3IPXA

X-ray structure of human deoxycytidine kinase in complex with adp and an inhibitor
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
241
structure length
229
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lead optimization and structure-based design of potent and bioavailable deoxycytidine kinase inhibitors.
pubmed doi rcsb
molecule tags Transferase/transferase inhibitor
molecule keywords Deoxycytidine kinase
total genus 85
structure length 229
sequence length 241
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2009-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ipxA00
3WYAA 2OFOA 1E32A 2D7CA 3QKRA 2FPLA 2HLDA 2HYDA 4HDQB 2G0NA 3WXMA 1OIVA 2WV9A 2BVNA 1JQLB 1U9IA 3RC3A 1LV7A 2VP6A 2OG2A 1ZM7A 3I61A 3OAAD 4IDQA 2K5UA 5JEEA 3R7WA 4BLSA 1E0JA 2FPMA 4ILEA 2GDJA 1ESNA 3ND8A 4FD2A 4JT2A 5JRZA 4QOSA 1TQ2A 2DWPA 2G3YA 1YZTA 4IOMA 4GRAA 1IXSB 3AEZA 4TMTA 1PUIA 4CEHA 4V0OA 4QGFA 2AFHE 1KAOA 1CEEA 4PHGA 4PQRA 5JHGB 3RRMA 3ZH9B 2GK6A 2YVUA 2F3TA 1SKQA 2IXEA 2WHXA 3GJ8A 3X2SA 1WA5A 3GEEA 4JLDA 2CHVA 3AH8A 1P9NA 1Z0AA 2ERYA 5C2JB 3QKSA 3IHWA 2GF9A 3HU1A 1MRNA 5C18A 4JL5A 4HSEA 3NEJA 1WBBA 1E2KA 4AYWA 3KKOA 1CJKC 4D6PA 2V8OA 1KI6B 4HAUA 1AS2A 5L3SB 5DISB 1U81A 2PEZA 3A1WA 3S1AB 4CVNA 2XSZD 1ZC3A 4QL3A 3VKHA 1RIFA 3MWKA 1T5IA 2R6FA 3SYLA 5KYKA 3WBKA 4KHZA 4Q9HA 3FGNA 4OI2A 3ZD6A 3TQFA 2OBNA 4LJYA 1LS1A 2BEJA 1NJGA 2QE7D 3UG7A 2DFNA 3K09C 1YQTA 4OBEA 5J4HA 2G83A 2FN4A 1VECA 3U3JA 1QBKC 1L4YA 1NN1A 3KKQA 1XP8A 1DBSA 3GQBA 4EQ6B 1ZNXA 3A36A 4A1FA 4C9BA 4CGZA 1QHHA 2IXGA 4MYUA 4R2HA 3Q85A 2GHIA 4A2QA 5ELXA 1OIXA 1ZD1A 2Z43A 3FDIA 4TQAA 4RD4A 4M22A 2EFEB 4A2PA 3PG5A 2VIIA 1BOFA 2QTVB 1DAIA 3LDAA 1NMXA 2BHRA 3VHXA 1I4DD 1ZM2A 1GZSA 1D2NA 1OXXK 4WBSA 2WWIA 1NBME 1YZLA 4AWXA 5EE0A 2PCJA 2QMEA 3CRRA 3UXMA 4WZAE 1RJ9B 2QU8A 4OQLA 1GTVA 2XZLA 4DSUA 1BMFD 5HZKA 3RNLA 5IRCD 3FMIA 4Q1FA 4D26A 2OESA 1P60A 4WOPA 3QBVA 3AKEA 5GADl 5B2ZA 1M74A 1MKYA 1HQYE 3SYKA 3VX3A 2WPDA 3C14C 4Q21A 1VCNA 4UNRA 4YXWA 2BM1A 3CH5A 3ZGXA 1R10A 2OT3B 3VQTA 2C2HA 3W6OA 4F38A 5AJYA 3FVQA 3KKPA 3EA0A 2O8FA 2O5VA 1XEXA 2XSZA 1KKLA 4Y0AA 1AZTA 1QG4A 1XXHE 4DJTA 1KY3A 2GJAA 2NZJA 1N6PA 4X8OA 2HYIC 1E2NA 2WZQA 3PUYA 4OHXA 1MR3F 2JASA 4QM7A 3AQ4A 3U60B 3SEAA 2QBYA 4MH0R 1R0XA 4OKSA 3CONA 4MITA 4JLJA 1BO6A 4BUJA 4OJQA 3C16C 4P32A 2AFIE 2FFQA 3BRWD 4IXNA 2ZANA 3U7GA 3IPXA 3VR4A 2B92A 3RABA 1G17A 1KSGA 5LPNA 2F1JA 4RVCA 3MWLA 2GJ8A 1R7RA 2AK3A 2UVQA 2A78A 2WIBA 2CCJA 3B1YA 3EAQA 4RJLA 2QORA 3WYFA 4U7DA 1ZNYA 1JJVA 3FE2A 2ZI7A 3VR5A 4ZDJA 2QT0A 5EP1A 5JEDA 3VFDA 3U7FB 2R8RA 1J2JA 1FL9A 4CZ2A 3DMNA 2V1XA 2PJRA 3SYNA 2ZPTX 3K0AB 1FX0A 3X1ZA 5F9FA 1J8MF 4PZYA 3M1IA 1W0JA 2C95A 1UKYA 5LB2A 2VL7A 3GJ6A 2V3CC 2RGAA 3A4MA 2JATA 4URUR 3I4LA 3KUCA 4RFSA 3L0OA 3SBEA 3W3ZB 4JS0A 5DN6D 2GCOB 4IDPA 2YINC 2WJJA 1NLFA 3QOFA 4AURA 4YMTA 4TL9A 4IOJA 2A5FA 2P5TB 2IYWA 4TL7A 1KHTA 4EFMA 4US1R 5GJWC 4UJ5A 4F93B 2BBTA 5F98A 3AF2A 4U00A 1E2IA 3BAFA 4M1KA 4DCTA 3ZJYA 1JR3E 4JLKA 4MYCA 2GRJA 2MMCA 5HCIA 2ZI6A 1YJ5A 4M8NE 1ANKA 2O8BA 2FA9A 1WF3A 2FOLA 1J70A 3I5YA 1T9HA 4XH9B 4A0RA 3A4LA 5BYKA 5FOSA 1YZGA 4LJAA 3SFVA 2BBWA 1Z0IA 4HDCA 4KI0A 4FMCF 2PLRA 4P33A 2GXQA 3LX8A 2QQEA 5EP2A 3MSXA 2WM9B 3CPJB 3ZZUA 3THXB 4TSFA 4B3GA 5JZVA 2CCKA 1FZQA 4C0QC 2X19A 2GZAA 1I4TD 4OHWA 4WXRA 5CYOA 2QQ0A 3UATA 3GPLA 3THYA 2XX3A 4XIGS 5LD2C 2LKDA 5KPDA 3KUDA 5H1YA 3GEHA 3T61A 1X86B 4L9WA 4QBHA 3TUZC 1GNQA 1ZRHA 2JLRA 2ZU0C 1CRPA 2WWGA 1P72A 4PAOA 2D7DA 3C8UA 1E2HA 1FMLA 5J4VA 4ZDKA 2H17A 2YWEA 4Q1AA 3Q7PA 1W2GA 2DR3A 1P3JA 3W5JA 1FPMA 4DLWA 4EPVA 3P20A 4CEJB 3ECCA 4QM6A 1EX7A 5DN6A 5SZJA 3H0KA 1KK0A 2OBMA 4A6PA 2ORIA 1YU9A 5DYIA 2WWFA 2VSXA 1J90A 1E2GA 2BJVA 5TXGA 2QI9C 2R6GA 3EC2A 1NLYA 1DAMA 1XMVA 1AIPA 4PHFA 2FX3A 2ZREA 1YZUA 3QG5A 4HUQB 2B7CA 2IC5A 4PC1A 4PC6A 5FBVB 4YMUA 1KJWA 2J7PA 2XJ4A 3QKTA 4C2UA 2PT7A 4FCTA 3V9PA 5KSPA 2HF9A 1G3UA 2WJGA 4PO8A 1W47A 4JLPA 4K8OA 1N2CE 5IF9A 2DB3A 1XD9A 2VP2A 2IUUA 4DKXA 3RS4A 1KO4A 5K8LA 1ZUIA 3R20A 2QAGA 1R5NA 5E3HA 5L8VA 3LBHA 1GRNA 5D3MB 1GAJA 4AD8A 1OV4A 4OQFA 4KVAA 3R7WB 1CLUA 5L3QB 5GJCA 4MYTA 4V02A 2JIZD 3K0CC 1ZNZA 3GLGA 2ONJA 1ZNWA 4JLNA 2CHQA 5HZHA 1DELA 4W5HA 2DPXA 4DEXA 1E9AA 4JMPA 1IJFA 1BKDR 3CBQA 1VHTA 3I62A 1KI1A 3VX4A 2IWHA 2HJGA 4BLOA 1M7GA 5HE8A 3PFIA 2GXUA 1GNPA 1P62B 3C15C 2O0KA 1V5WA 4HAVA 2JLWA 1RKBA 2B8WA 4Q01A 1FQJA 5EXXA 2IW3A 2W6JD 2GNOA 4M53A 1OH5A 2RHMA 1S9HA 2PT5A 1DS6A 1E0AA 1J7KA 1N0VC 4KO8A 2XXAA 4D0GA 4DLZA 4HI0E 3MAAC 3QY0A 4BFXA 2Y8EA 3CNOA 4OI0A 4TQUS 5JJKA 2G1JA 2C96A 3RRZA 1T8TA 4RFVA 2IHBA 2ZRNA 3HYTA 2B21A 3VR3A 4A4DA 2IYQA 2IYSA 2O8EA 3ZQJA 5BW8A 4Q1BA 5M04A 4UQOA 4HB0A 3SZRA 3RRNA 3K70B 5HE9A 3DZ8A 3A6PC 5E7MA 1LW7A 4PANA 3HJNA 5DI3A 4IEIA 1DTSA 1AM4D 1TF2A 2MSDB 2KWIA 1DEKA 3WMFA 3N2EA 2IF0A 2KE5A 4PFSA 1IBRA 2JDID 4GT1A 3TBKA 4DZZA 3QVUA 4PQFA 2KJQA 1SKYE 1TU3A 3DDCA 1KMQA 5F2EA 4D4KA 2CJWA 4C7OA 4RZUA 1P4SA 3KJHA 4XTCS 3KB1A 4WA7A 4NYIQ 2RGDA 1TEVA 2HEIA 3LA6A 1NBMD 2XITA 5FPSA 3KQUA 4XSHA 4HAYA 2Q3MA 1CU1A 1S3SA 3GJXC 2XTNA 2NPFA 2WKRA 1F2TA 1IQPA 1A2KC 2VP0A 3LY5A 2V54A 1JPJA 3K1JA 5AUQA 8OHMA 3ZVMA 2QP4A 5HCNA 5CJ2A 4P0TA 1N6RA 2AKYA 4NTZA 4IOLA 3UWOA 2ZYWX 4CEIB 4D4MA 4MRSA 1ZCBA 4ZIRA 4F7WA 5FBQB 3A1VA 1GDDA 2KSQA 1Q20A 4MRRA 2IYXA 2ANCA 3FMPB 4B76A 1MO6A 1JECA 2BMJA 2Q6TA 3QXSA 2IF2A 3KQKA 4LDJA 3N5CA 4HDOB 4A8JC 4HLUC 4LJ9A 5A5GA 1ZU5A 1JPNA 1BH2A 1YR6A 3CPEA 3KDSE 1WB9A 1QDEA 4RD6A 3AKYA 2NOAA 3RAPR 2IYZA 1XMIA 1GM5A 5FTKA 1DAKA 1VG8A 3QPUA 3E2IA 1S1CA 4MGYR 1NRJB 4O0MA 5FL7D 2QAJA 5FTJA 4KBGA 1CP2A 2DBYA 2OM2A 1SXJC 3GJ5A 1VCIA 2QTFA 4PC3A 3NIBA 3HWSA 4LUCA 1JAIA 2QBYB 3UMSA 1RZ3A 3B60A 5AJVB 2XB4A 5DYGA 4Q00A 1QZXA 4V0MA 5KSYA 5JI3E 4M9ZA 1OXUA 1NF3A 1X8JA 2WSSD 3MD0A 2P6NA 2KBEA 3VNUA 3OEED 4V03A 3LLUA 4F4CA 5JSZA 1FMJA 1UDWA 1FX0B 4PHHA 2ORWA 4HYYA 1UBCA 5J47A 4IVRA 1Z5ZA 2CVHA 3TAHA 4EJSA 1E94E 4YONB 5FUVA 2E1RA 6Q21A 3KJEA 1E96A 3MG9A 4M1SA 5DLQC 1WQ1R 1SXJE 2HCJB 3K09A 4JBWA 2GA8A 2GZHA 1VIAA 3LW8A 4NP6A 1XD8A 4MKHA 3EWAA 2PMDA 3U6BA 4S2EA 2Z6VA 1D9ZA 1NSFA 4LBVA 1W4CA 4NBSA 4PZZA 5FBRB 4AKIA 5L3VA 4GDFA 1KZGB 1RYFA 2CHGA 5IT5A 4YMWA 4ZCIA 4QJ4A 3LWNA 3OEHA 3SI7A 1W49A 1E98A 1D6JA 3U6KA 2ZI3A 4DSOA 2OZEA 3TAUA 3VTKA 1E2QA 1TEXA 3IUYA 4MKIA 3U44B 2YWFA 1K6MA 3IO3A 2HXSA 4ZIRB 5F9HA 2J45A 1E1RA 2P3SA 2CVFA 2R2AA 3I72A 5EUQB 1E4VA 5KTYA 4PAQA 1AZSC 3MRSA 1TTTA 5HKKA 3V00A 4PZLA 2YWGA 5AR1A 1TQ6A 2G6BA 2GJKA 2ZS7A 3TSZA 4B44A 2AXNA 5GVSA 1E2JA 4B73A 3IKJA 1A82A 1E9EA 1NIPA 4M9SA 3RDPA 4LX0A 4PSVA 2O8DB 1OT3A 1OE0A 4IRUB 4TYQA 1X3SA 3LNCA 1SQ5A 1ZM9A 5JI2E 1FOEB 3ICQB 5HTKA 1KO5A 4Z54A 5BYJA 4X8LA 2YZ2A 1AGRA 2ZUCA 1RC8A 3EW9A 1VPLA 1XZPA 4I1VA 2QENA 2C77A 1L2TA 2ZTSA 3AVPA 3HR8A 2A9KA 3I1FA 4LWZA 5FBLB 4CIDA 4F4JA 1O3YA 3MCAA 4WXPA 2GBLC 2QM8A 4DDWA 3W8NA 3DM9B 4W9MC 4Q1CA 1ZAKA 3MUFA 1YZQA 2ZRGA 1M1YE 5CB8A 1H8HD 2CBZA 2IWRA 1ETUA 1W5SA 1Z2CA 3VHLB 3IDQA 5TDHA 1LF0A 4O25A 3PUWA 5J4LA 4KU4A 3BFVA 1XPOA 2GK7A 1UF9A 2QEQA 4M9QA 2J0UB 4IKEA 1VG0B 1GITA 4M1WA 5FUXA 4YC7A 2WSMA 3KTAA 2UKDA 5JWHA 3KJIA 2A30A 4NCJA 1E4YA 4ACBA 2W6IA 4G01B 1TUIA 3VR1A 2QN6A 1S96A 5AJZA 4QGGA 4FINA 1M7HA 1XMJA 4C0LA 2GWHA 1XTSA 1Z6YA 2QE7A 1TF5A 3ZS9A 4MUBA 3O8DA 4TL8A 2QTHA 4MGZR 2WTUA 2P6RA 3BE4A 1S4QA 3BH6A 2QPOA 4OK6A 3J81k 5EZ5A 5J40A 2J59A 2ZROA 3IILA 4KLZA 2W2VA 3QENA 4BRWA 5D3MA 1XU4A 1P75A 2ZRLA 1G291 3IIJA 3AB3A 1G8FA 4I1SA 2VHQA 3F3YA 2HXYA 3I3SR 3AM1A 3VNVA 3H86A 1W36B 3MGCA 4YQFA 5CIWA 1Z22A 4LYJA 4URWR 2OAQ1 4Q9JA 5B64A 2VSFA 3WNBA 2OILA 1VYVA 3WP0A 4LJ8A 1M34E 1VHLA 1DAEA 2PX3A 1W44A 3CH4B 1G9XA 3K70C 4RCZA 4XWAA 2FWRA 2ZM5A 2ZE7A 3DO6A 4B6FA 5KDDA 2BJWA 4MGIR 3REGA 3WRYC 3NHBA 5FTLA 3VAAA 4KCGA 4G5SA 4JVMA 3RYTC 3CO5A 5D3QA 4F92B 2BMEA 3SR0A 2AWOA 4D4LA 4LOAA 4PXAA 1GKIA 1PLJA 4C4PA 4LBYA 3ADKA 4A15A 2GEDA 3FFAA 4LHWA 1AQUA 4MGKR 5C46F 2DCUA 2P6UA 3HU2A 5CDFA 3LD9A 3A1SA 4FIDA 3JVVA 1JAHA 4PR0A 3U5ZB 4B35A 2Z4RA 1OXVA 4HZUA 2H7VA 3K9NA 2J0UA 1G7RA 5E7JA 4DWJA 3CZPA 3T35A 3EZ7A 5DI3B 4TZ6A 1CTQA 1FFHA 1MRSA 4DLSA 4DSNA 5CIQA 2RMKA 4Y0VA 4TZ0A 1EFRD 3T06B 1R5BA 3UANA 1H8ED 4RZ2A 1Z83A 2CXXA 3TR0A 4QJ5A 4OQMA 4JVLA 4BGDA 5B30A 1GKYA 1G18A 1ZP6A 3EASA 2BKEA 1XEWX 3TVTA 4OQXA 4LHVA 5G40A 3WYGA 1OJLA 5DGXA 1ONBA 4QC2A 2ZJBA 3K8YA 5J4KA 1KDTA 4EPTA 3A8TA 2E87A 3A1TA 2FFHA 2EVWX 1XBTA 4OL0A 4BFTA 3TRFA 5EXSA 2ATVA 4IW3B 4GSYA 4B48A 1ZUNB 4OJKA 4Q7MB 3UG6A 2P65A 3MWJA 5FOUA 5JWOA 3SJBA 2VRWA 1I2MA 1P9WA 1W4RA 3CX6A 2A5GA 1E6CA 3BERA 3ZVLA 1G1MA 1ZD8A 4JZKA 1Q21A 5K8IA 4DT1A 3SQWA 1UJ2A 3IIKA 4JJZA 2I3BA 3LRPA 2YOHA 5TV2A 4CT5A 2GAAA 1T6NA 1U2RA 4TMKA 2D2FA 3K0CA 5L3RA 2AHOA 3AF0A 3PXGA 1TUEA 1W0KA 2OXCA 4ABYA 4HATA 4NL4H 1GKUB 4TYYA 1FW6A 3QBTA 4E22A 1FUKA 4NCHA 1E9RA 1KIMA 4HB4A 3ASYA 3BK7A 3TKLA 1MO5A 3TW4A 1XEFA 1R8SA 2VO1A 4URZR 1ZYUA 4A8JB 2V55B 2DFLA 4TT3A 1Z2AA 4NYMR 2PBRA 3KFVA 4ZPXA 3AVTA 1EFRA 4B34A 5J4YA 1Z08A 5HKKD 1AS3A 1DO2A 3BJIC 4NONA 3KQLA 5EZ6B 1XEWY 4KODA 3QXCA 1I4LD 4MA4A 3NC0C 1T4GA 1W36D 4CW7A 2VHJA 1T91A 4QNRA 4B2PA 2VHUA 1KAGA 3QKSB 4V0NA 2J41A 3JZAA 3U7HB 3I8XA 1N5LA 4ARZA 4B6EA 2ANBA 5FPHA 1NKTA 1RRPA 1UFQA 1SXJD 5L3SA 3THWB 3H2YA 4LJ4A 4J0QA 4N1AA 1N6OA 2GXSA 2FG5A 3QI2A 4JJKA 1YR9A 4BFSA 3FOZA 4DB4A 4TLCA 5FUYA 1TMKA 2X2EA 1G3RA 3GLHE 5C4MA 3H1TA 4CDGA 5DHAA 2ZJ2A 2CLDX 1UBEA 4JIMA 3RLFA 4DEYA 1E9SA 5EXTA 1OHHD 2CL7X 4DBLC 4E5UA 3UKDA 4CT4B 3LXRA 4KAXA 2OFWA 2RCNA 2NO6A 3KB2A 4EKDA 4YMVA 2EFCB 5JSZB 1RRGA 4G5QA 1G7SA 3RS3A 1OW3B 4UNNA 5BWMA 3EPHA 3GLIB 3K0EA 2O0HA 2YKGA 4EPXA 3C7KA 2REBA 1QHHB 1G5PA 3ZS8A 4URYR 2W6ID 2X8AA 2VQSA 3Q8XB 1E1QA 2GJ9A 2IS6A 1OYYA 4YDSA 2ZUBA 1FQKA 4V0ME 1KNXA 1Z0KA 3GD7A 2H57A 4IJMA 1U8YA 2IUTA 3WY9A 4DLVA 2CCGA 1ZCAA 4E03A 3BWDD 2R65A 1SVIA 2ZR0A 4FCWA 4TTQA 2Q21A 2XB2A 3RSOA 1C1YA 2WJVA 4WAUA 1T8UA 1E0KA 1VMAA 4PAMA 4Q4JA 5FBWB 2ZRIA 2VSOA 3FFBA 1N3BA 4A8JA 3B6EA 1IN4A 1KKMA 4DC9A 3R8FA 1N5IA 1UKEA 1XTKA 1BIFA 1XWIA 4URVR 5AJWA 3F5FA 1ZU4A 1N5JA 1E2FA 1YE8A 1YR8A 3CM0A 3QIAA 5FOTA 2J5XA 4GMXA 3ZYCA 4OQNA 2O0JA 4M0LA 4PQYA 4L9SA 4Q4HB 2O8FB 2FE4A 1DAFA 1NKSA 3LVQE 3OIVA 1G64A 2D2EA 3OIYA 3CRW1 1S0UA 2VEDA 1EXMA 2RHDA 1U94A 1KI3A 4D0NA 4UJ3A 2WJHA 1R8QA 3NTUA 4HB3A 1COWA 1M7BA 4JLVA 4QHSA 1NJFA 5JJLA 1EGAA 2ZRDA 1AGPA 1Z0FA 5EJEA 2NGRA 3OAAA 4A82A 4EJSC 3HPQA 3W90A 5DHFA 5GJBA 2XOKA 3NBZC 1NSTA 2VA8A 2FZ4A 3PENA 4JSTA 4NH0A 4C0JA 5AWFC 3TR5A 3BD9A 1VCMA 2B8TA 4RZ3A 2JLXA 3NDPA 4IHQA 3K9LA 1IN8A 4LI0A 1W5TA 3BOSA 3B7GA 3LBNA 1D9XA 2YV5A 4WZ6A 1RW4A 1UKVY 1CJTC 2OBLA 3CZQA 2GVDC 1DG3A 1T3LA 4B3CA 1II9A 2GKSA 4XD7A 1KSHA 1DVRA 2ZSEA 5KPJA 3ICEA 4Z8YA 2GETA 3I92A 1M8PA 1W1WA 4H1VA 4UXIA 3M0EA 2C03A 3AP3A 2FV8A 2Q3HA 1E9DA 1KTVA 3RS5A 1SHKA 5CITA 3BB1A 4QXAA 2WJIA 4XSGA 1RFLA 3W3AA 1EG7A 2CDNA 1Z8FA 2PCLA 3Q7QA 3C5HA 4B71A 1LNZA 1YZNA 4AC9A 2ZI5A 3LX5A 1BS1A 1E9CA 1HQCA 2IS4A 5KDOA 4I1UA 2V9PA 5SZKB 3OZXA 2C9OA 3B78A 1N6LA 3D31A 4BPBA 3THOA 2FJUA 3B9QA 4M1OA 1NN0A 4Q47A 1QHIA 4OK3A 3NBFA 3I32A 4EIWA 3CRQA 2DFKB 2FSHA 5EUMA 1HTWA 4UXJA 1NP6A 2EWVA 3AUYA 4Q4HA 2QNRA 2E9SA 2VP9A 4I4LA 4QKQA 1XFAA 1G3MA 1KI2A 1OFHA 1IY0A 2FGKA 2JIZA 3M4YA 2VF7A 3NVAA 5FTNA 4RCYA 4HUQA 2GBLA 1CRQA 3VR2A 1E2LA 2L0XA 1GSIA 2NO7A 3QF7A 4IDHA 2WPDD 4IFEA 2YC2C 5B58C 4QRHA 3BFKA 1OYWA 4RD2A 4KVGA 3PV0A 1D2MA 3LW7A 4OHVA 3QQ5A 2NG1A 2GCNA 3AF1A 3RS2A 1NLZA 2CE7A 4WZBE 5DH9A 3HPRA 3MWYW 1AKYA 3OEEA 3AV0B 4DUGD 1CIPA 4XOIA 2V6JA 1LTQA 1NN3A 3AGPA 3L43A 4EPWA 5L3QA 3HU3A 2BMFA 3PITA 1KSFX 2H92A 3X1YA 3EA5A 4BASA 3N2IA 1UBFA 4EFNA 2ECKA 2C99A 3FMFA 2NIPA 1DAGA 4A0HA 3CWZA 1FP7A 4NPHA 2BDTA 2H18A 3LH5A 2BEKA 5CLQA 5AUOB 1JB1A 1VDZA 2J0QA 3BGWA 1OFTA 2ZVPX 5LB4A 3PEUA 3K9GA 1A7JA 4TMVA 2B6HA 4WVFA 5JMTA 4LPSA 2HUPA 1DG1G 1MT0A 2R9VA 2UZ3A 1XJCA 3FHCB 3EARA 3LBIA 3LV8A 4RZXA 4XWKA 3HP1A 3I8SA 2WWYA 1IHUA 4B2IA 4A36A 3BFXA 3GFPA 1GOTA 4L15A 4XWOA 3WP1B 4JLOA 1XJ0A 4M4SA 3NH9A 2R6CA 1AJEA 3QXJA 2AWNA 2RKOA 5FL7A 1E2DA 2GILA 3CIOA 4P4SA 4W5WA 1IN7A 1KJZA 2QAGB 1E3MA 3O8RA 4GZMA 3DVLA 3NXSA 4R9UC 4LGMA 4BECA 4KFUA 4PSKA 4TYNA 1E79D 2Q0HA 4HLUA 4IVQA 3GP8A 3LQRA 1KI4A 1WBDA 2AK2A 4DVGA 4TL6A 2ODWA 1U0LA 4LYFA 1TADA 1FTSA 3K9HA 5GJVC 2GXAA 1ZUHA 4B3DA 2ZE8A 2VYFA 4B47A 1SXJA 1TAGA 3B5JA 1VYTA 5BN5A 2ZRMA 5IK2A 3GLFA 3VKGA 1T0JB 3ADBA 1Z06A 2J3EA 4POAA 4DIEA 1IM2A 4X8MA 3AVVA 1FP6A 3RS0A 4IDOA 4ZO4A 5CM9C 1WP9A 4TYWA 1G19A 1D8TA 2LCFA 4G3XA 4HLCA 2D4HA 3KZ1E 1DPFA 2ODEA 3C41J 5G3YA 2BIFA 4FWTA 2R6DA 4ASUA 4L16A 4ARZB 5JECA 4LK2A 1HURA 2ZRAA 3OIUA 1SGWA 4BLTA 4DUGA 3THWA 1U8AA 3LFUA 2VPPA 2CNWA 3A37A 3UMFA 2QL6A 4FI3C 4A2WA 1CR2A 521PA 1S8FA 3ETLA 3PUXA 1JEEA 1SVSA 1UEIA 1G4UR 1H8HA 4DCSA 4B32A 1A5TA 2JJ2A 1QRAA 4LJ5A 2CLSA 3CR7A 3RVBA 1XNJA 1NG9A 3GLGE 1X8LA 5EP3A 2ORVA 4B3XA 1F6BA 1YRAA 3GEIA 3FHTA 4Q4LA 3K0AA 3W8RA 2EU8A 3U2QA 2CK3D 2JJ1D 1GRRA 3QPVA 5FTMA 3NH6A 3TH5A 4C0SA 2YJTD 3TUIC 3UK6A 1COWD 3I5XA 4ESVA 3GLHB 4BLRA 4B3BA 4IOKA 5DE3A 4AI6A 1YRBA 4C7OB 1W48A 1F2TB 3IO5A 1B23P 3SJAA 4FN5A 2Z83A 4UKDA 1Q1ZA 3MMPA 4ZI3A 1Z6AA 2ZR9A 1G21E 3TUJC 1G8HA 2QM7A 4LJ6A 3KJGA 2DWQA 1QHGA 1G41A 4Q4JB 2JLSA 3U4QB 3FTQA 2F6RA 1DOAA 2VP5A 5E7IA 2DY1A 4NCNA 1GVNB 1Q1BA 4DXAA 3B13B 1IY2A 2BMDA 5ANRB 4ZCMA 1Q1EA 1G7CA 3M6AA 4XTRA 5LD2B 2NPIA 3AVXA 5BXQC 2WICA 3B9PA 3P1JA 5GVRA 1TPZA 1ELOA 1Z3IX 2O8CB 4I99A 4NYMQ 3CNNA 4QGHA 1EFHA 3CF0A 3EZ6A 4OHZA 4GP7A 4P4UA 3FHOA 1TQDA 5EE3A 2FMXA 3O8CA 1Q12A 3VMFA 2WWWA 1R6BX 5P21A 2LWIA 3D3QA 3IHLA 4ITRC 1YKSA 2AD1A 3DPUA 4RD0A 1OIWA 1E1RD 4BFYA 1S1MA 4PPGA 3TMKA 1P9RA 1T3HA 2DHRA 4EUNA 5IK2D 2QG6A 1FNNA 2WAYA 2JJ2D 4LBWA 4FCVA 2FGJA 3CB4A 1F60A 1SVOA 4Q19A 3SDZA 3D8BA 3PJRA 4U5XA 1EFUA 2WOJA 421PA 2BOVA 2BKUA 3U61B 4OI1A 3W9YA 1L8QA 4ASUD 2VBCA 2W00A 4XVQA 3WHLA 3AUXA 4HZIA 3SOPA 4Q5IA 1V43A 3SBDA 5H8WA 3L8YA 1SVLA 2RGCA 3OHMA 3EIQA 4EDHA 3OIWA 1NY5A 1E69A 2P0EA 3BC1A 1P7CA 3ADDA 2QA5A 1DADA 4L4UA 1HE1C 5FI1B 1LVGA 3QSYA 4LHYA 1SVKA 3RANA 3ZDQA 4C2TA 4PPFA 1KDOA 1HEIA 3OFNA 1RJ9A 2BC9A 2IEZA 4RY2A 3TGPA 1N5KA 2WOOA 1KK2A 4L8GA 1GFIA 3EC1A 1U98A 2X77A 1E99A 2QPTA 2ZYVX 4CYMA 1E9FA 1OXTA 1X1SA 3AKDA 3T1TA 3GJ3A 2WWXA 3GLIE 1RRCA 1XXHA 5DI9A 721PA 2O8CA 5AK0A 2ZJZA 2G9NA 3SHWA 3CWQA 3CW2A 4TLBA 4BRUA 1Z63A 1XMSA 2QP9X 2O8DA 4M9XA 1XEXB 3CLVA 3TW8B 4Q4AA 2RB4A 3GFOA 3BORA 4KYIB 1G16A 1ESMA 2VH5R 3K0SA 4EPRA 2ERXA 1R0YA 3A4NA 2JDIA 2NO9A 3P27A 1G4AE 2PZEA 2ZR7A 4BEJA 2ZSDA 1S2MA 2WBLC 4LYHA 1VIYA 1E79A 5KNDA 4NE2A 1HH4A 2WKQA 3UMRA 4AKEA 4GNKA 3WHKA 2YHSA 4BZPA 4JYCA 2ZS8A 3UPUA 1XD2A 5B57C 4RSGA 2RGNC 1Q57A 1LY1A 4I81A 1S9DA 2VLIA 4M2LA 5EE5B 1K5GA 2J0SA 3AF4A 4ZKEA 4F91B 3IGFA 3ASZA 2QY9A 3P4XA 2C78A 2XNDA 5CM8B 2W2XA 4QBGB 5F3WB 1OFUX 2C9CA 3NC1C 1N6IA 3SJCA 1US8A 4OHYA 2NQ2C 3QKRB 4F4IA 1JR3D 1BMFA 3P32A 1W2HA 2H8KA 1CJVC 1EFCA 1ZVQA 2J0VA 3O8BA 4QFMA 4Z1MA 1W4BA 2JA1A 4KV9A 3DM5A 3V4FA 2CJWB 4PO9A 3T12A 1QG2A 3C4JA 3T1VA 4TMXA 1WMSA 5E95A 4BLQA 2EYQA 4BQSA 2JLZA 1N6KA 4JVNA 4QNMA 3CX7A 5JS7A 3NG1A 3RS7A 4YXWD 3TQCA 3L82B 1IN6A 2ZRHA 5JBQA 2O52A 4P4SB 1SVMA 2FFAA 4TN1A 1EFTA 4PPNA 3RWMB 2REXB 4GBMA 3SNHA 3TE6A 4R98A 1CR1A 1R0WA 2OUKA 4QHYA 5J5CA 2V6IA 2H16A 4CEIA 3OEHD 3VKWA 4DLXA 2IYUA 3OF5A 5A0FA 3IQWA 3CNLA 5DNYB 1GWNA 2FSGA 3PVSA 2ZRPA 4PHTA 4Q4AB 3WBJA 3Q3JB 5DO9A 4NU0A 5LDDC 5H68A 4DCUA 4ESHA 2A5JA 4MDFA 2PJZA 3MJRA 4AKHA 2LKCA 2PZFA 4GP6A 1UAAA 2QSYA 3PUZA 1QHNA 1TNDA 4KSCA 5KNCA 2H1LA 3TSOA 4BFVA 1CR4A 4KITB 1Z0JA 4A9AA 3SC3A 4A0FA 2Q9AA 4C0KA 2N42A 3X1DA 1KI6A 3G82C 1KK1A 4G5RA 1OKKA 3EIHA 1KNQA 4Q1EA 4PC7A 5CB6A 1GP2A 1QHXA 2IEYA 4GL2A 5FOWA 3SFZA 2JJ1A 3MFYA 3EPKA 3AP2A 5KO2A 4RKFA 1Q3HA 4AYXA 1NMZA 4AG6A 3KFXA 1TQ4A 4C0AC 2FEMA 3GLFB 1J8YF 2V7QA 1NMYA 2MMGA 2GESA 2W0MA 4HAXA 4MKGA 1US8B 4EJSB 3ZVNA 1D5CA 3BH7A 4QBIA 2J7KA 3H4MA 1PZNA 4HEJA 4PO1A 5FI0B 1E0SA 2V4ZA 2ZQ5A 2GJSA 1CKEA 1AQYA 3CRMA 1II0A 2PL3A 1XTRA 1E1QD 4ZV4A 2F3RA 121PA 1NIJA 2GTPA 821PA 3DEFA 5KUTA 3NDBB 2ZVQX 5KSOA 1NN5A 3QF4A 2HDNB 1WDTA 2IYVA 3KXKA 5JCPA 3IBGA 2CE2X 3GLHA 4C0BA 4CRWB 1UBGA 4JLBA 4YDHB 3AKCA 3NEYA 1SVWA 4O2LA 3N70A 1OB2A 1G8YA 1LF5A 2BWJA 4K81B 2P2LA 3GLGB 2ODNA 2FSFA 2IYYA 4TQ9A 1R0ZA 2FZLA 2MSCB 3ZD7A 5C4GB 4Q9KA 1N6HA 2ZIAA 1CXZA 1WE2A 2IYRA 2OHFA 2RGGA 1XDBA 5JLJA 5CK5A 2VTKA 5JS8A 2PLFA 1KI8A 3X1WA 3QEJA 4BFWA 1T3SA 4LHXA 1NVXQ 1T5LA 2GEVA 5AUPB 2I1VB 2C98A 3DMDA 3SS8A 2G0TA 3FKSA 4LCBA 2QRNA 3E5HA 1EX6A 3B85A 4Q02A 4B43A 4NDZA 2EFHB 2PEYA 1N0UA 4JL8A 4BLPA 4JBYA 4LC0A 1R4AA 2QT1A 3TVDA 4B2LA 1Z47A 4I1OA 3PIRA 1DAHA 1CBUA 3QXHA 3GCGA 4EFLA 4RD3A 2QGZA 4K46A 3T34A 4KFRA 4IVPA 1XRJA 2ZJ8A 2O8EB 1SULA 1Y3AA 2XEXA 2P5SA 4CF7A 4JSYA 2FNAA 4TMZA 1JXMA 1UPTA 1TU4A 1MO4A 2QGNA 1ZW6A 4AY2A 3T1OA 2IS1A 1LFDB 1TL7C 2TMKA 4DRZA 5IHPA 1Z6GA 221PA 2ZAMA 2JAQA 4OK5A 4UNQA 5A4JA 2UZIR 1Q22A 1Y63A 3DHWC 1XX6A 1XCPA 1SKYB 3L0IB 3X1XA 3A58B 4MQBA 1P2TA 1YVDA 4W7SA 1NVVQ 2FDCA 2NO0A 1SZPA 1XTQA 2IYTA 1WXQA 3ZQ6A 2IYLD 4D82A 4D81A 2ZE6A 1W4AA 2FEOA 2BM0A 2KB0A 4DCVA 2FF7A 2DYKA 3KL4A 4V0KA 3AVQA 3ZZ0A 2I4IA 1II8A 3SQXA 1DO0A 1IAQA 2GCOA 1ZIPA 3I73A 4LJ7A 1XPRA 4WW0A 5EXPA 1W36C 3OESA 2ZRCA 5KDLA 5K8TA 2YC4C 3E70C 1ZJ6A 3QJYA 3AVUA 5BN4A 4ZCLA 4BE7B 2SHKA 4DLTA 2NZ8A 2CL6X 4MDEA 4U02A 4LV5B 2RAPA 3KXLA 5LBIA 4O3MA 1XB2A 1VG1A 3Q9LA 2WIAA 1OLOA 5KU1A 2YOFA 1Z0DA 4P31A 3DL0A 2CMKA 1KO7A 2Z4SA 5AUNB 1QVAA 3PR1A 3A1UA 2JLYA 3HDTA 1U8ZA 1EESA 2VF8A 3PCRB 4JYBA 4X8HA 1JR6A 1XXHB 1PUJA 3EIEA 4R7ZA 4O2RA 4G5OA 3T5DA 1P6XA 3PQCA 2X2FA 4FMCB 3RHFA 1MO3A 2AL7A 2OFXA 2WMOB 1CS4C 1U99A 3T1QA 3VU9B 4M1MA 4RFSB 1G5TA 3GFTA 2XZOA 1KO1A 4RD1A 2EYUA 2XJ9A 3THYB 2JLVA 3Q5DA 5CYPA 4DLYA 1G8GA 3SN6A 3U3RA 2JLQA 3WNDA 3KQHA 2BBOA 2GZDA 2QMHA 5JHHB 1H8EA 5EE9A 3V4RA 1PV4A 2YOGA 3BB3A 2OCBA 4AK9A 5TY0A 1A1VA 2EQBA 2J1LA 1Q3TA 4NHOA 2ZSAA 3B82A 1R5OA 3D6TB 4AKGA 4CEJA 3GLFE 2O8BB 4Q7LA 5KHOC 4P3YA 2YNMA 4ACAA 1KOFA 4M1YA 1HT1E 2NO1A 2GCPA 4Q1DA 3T15A 4KSBA 2ZJYA 3P4YA 3DOFA 4XVRA 3MJHA 3QEOA 1JXOA 1F2UA 1J99A 4N0DA 3ZIAD 2ZSFA 5JFGA 2F43A 3REFA 2VP4A 1PVOA 3HR7A 1G6OA 3GJ7A 4JLMA 1HY3A 1Z6TA 2VHTA 3IPYA 3SJZA 1CJMA 4Q9IA 2PH1A 3NKVA 1IXZA 1X1RA 4HLDA 5KOYA 1IOZA 2FPKA 2BBSA 4D80A 4R2IA 3QNUA 3CKLA 1RYHA 2N46A 5FR1A 1II8B 2EFDB 1HYQA 3L0PA 4NYIR 1Q1QA 1K5DA 1JI0A 5UKDA 4XVUA 5EE1A 5HPYB 1ZC4A 1G7TA 2WMNB 2A2ZA 3GJ4A 2F1IA 2OE2A 4W5JA 3R8CA 1HUQA 3G0HA 4UXHA 1W7AA 2WSSA 1A2BA 1UKZA 2D06A 5JRJA 3RC8A 1TX4B 2GAOA 3U44A 1KDRA 4TMWA 1X6VA 2W0SA 5FOVA 1GIAA 1U9IC 3D7MA 2V7QD 2QRZA 2QMUA 4IEEA 4BWYA 1OH8A 3SHFA 1OH6A 1AKEA 4FWIB 1K8RA 3GJ0A 2AKAB 2IL1A 1Z28A 4KLNA 5DSZA 4Q9LA 3U3OA 5TVKA 2HT1A 2WJYA 4GPTA 2Q3FA 1OHHA 1E2MA 1XF9A 1KO8A 3EPLA 2F55A 5CJPA 1MV5A 1LB1B 3AVYA 4QG7A 3TNFA 1GUAA 4BFZA 2IS2A 1ZM3A 2XNSA 4EPYA 4GOJA 1G6HA 3KXIA 4MYHA 3FB4A 2B7BA 3U3KA 2YWHA 5FR2A 3QG1A 4ERNA 3EPJA 2C04A 3TLXA 1XCGB 4G5GA 621PA 4TWZA 3CX8A 1P2VA 4DCNA 1ZINA 4TLAA 3TSWA 3IIMA 5JWRA 1ODFA 1IONA 2ZRJA 3B2EA 4GOKA 2ZS9A 2XXAB 3BIFA 1BYUA 2QUZA 2WAXA 2ZYTX 2XZPA 3K53A 1G20E 2HJVA 2R6AA 2CL0X 4JL6A 1G3IA 2OV2A 4LPKA 4LZZA 4D2IA 4US2R 2ZEJA 3K0FA 3F0TA 4URXR 2PZGA 1AN0A 3DOEA 3MLEA 2ODBA 5TB5A 1OH7A 1RPZA 1EWRA 2F9MA 1CF4A 1YZKA 3HYRA 4GFDA 4MKFA 2JGNA 1JJ7A 1FNMA 1CULC 1D2EA 4KYUA 1JEDA 5FPKA 1NNEA 1N25A 1W0JD 1Z29A 1H65A 1KI9A 1P73A 2PMKA 4JT4A 1WCV1 1F3OA 2EWWA 3QF4B 5EQTA 3EWSA 2HT6A 2YYZA 2EW1A 4HB2A 2C5LA 3IEUA 5CDFE 3PEYA 4ZDWA 4Q18A 1NY6A 2J46A 1A4RA 1VG9B 2F1HA 2ZJOA 3F8TA 4QHTA 2Z5FA 1AA9A 2OLJA 1RRFA 1KK3A 2OLKA 2XNDD 4GMDA 1G3QA 5SZIA 4HAZA 3B1ZA 4HAWA 4LV6A 1DE0A 1HV8A 4JBXA 1E9BA 1KY2A 2BCJQ 2QMOA 3QPWA 3TIFA 1CR0A 3UIEA 4CEHB 2ZE5A 4L5BA 1KI7A 2W6JA 1M6NA 2XTMA 1OSNA 2JCSA 3K70D 1JALA 2A7QA 1RVDA 2XOKD 3EZFA 4PTLA 5EP4A 2CLCX 4NZYA 2A3RA 3CUEF 4ZKDA 3GLIA 2ZSBA 3AVOA 2JJ8A 1MOZA 4B75A 3H84A 4Z1MD 2IHYA 2REOA 1N6NA 1U90A 2G77B 2J7PD 4Z8XA 4BEBA 1EWQA 4Q48A 1QHSA 1ZD9A 3P26A 2C8VA 3ZVRA 1AK2A 1W46A 3U3MA 4DB2A 2HV8A 1VCOA 1NVVR 3NWJA 2IK8A 3DKPA 1KDPA 1QF9A 4TYPA 4DDUA 4AIIA 2ONKA 4AG5A 1GL7A 4XD7D 1NL3A 2WVJA 2ZJ5A 2XAUA 4JVSB 4WIAA 4D25A 3FMOB 2IT1A 2OSBA 2CNWD 1PJRA 3LQQA 4D0LB 1KGDA 3CRVA 1E2EA 1OF1A 4E09A 2ZI9A 1VKJA 1PLKA 3B1WA 5DIFA 1GRQA 4DDTA 4D4JA 3G5UA 1LS6A 3TJZA 1T0HB 3FYHA 4FW9A 5FPYA 2D74A 1BYIA 2BCGY 5BN3A 1SXJB 2IUSA 4PC2A 4S35A 2Q9BA 2X1VA 1GILA 2OCYC 3S1AA 3WRXC 4KFSA 4MRPA 2HF8A 5TARA 1CJUC 1G8PA 2QP3A 1XJQA 2IBMA 4LY6A 3QE0A 4PX9A 3KQNA 2CK3A 4NYJR 2JLUA 1HA3A 3R9IA 4C0HA 1OXSC 3LXXA 4IFBA 3W5IA 2MSEB 4II7A 5G3ZA 4DDVA 3OFND 4Q7JB 5HR5A 1UDXA 2OAP1 3AGQA 1XPUA 1JBKA 2VHCA 2GVZC 1XTJA 3BS4A 3QVVA 4DLUA 4B74A 2OEPA 5CK4A 4BZXA 1Z6XA 1P2UA 3ZLJA 3KX2A 3LO5A 4TLDA 2D62A 3Q5EA 2F7SA 4DLRA 4JLAA 3NBYC 1OPXA 2ASEA 2ZETA 4EAQA 2QROA 4B3FX 1PLLA 2W2TA 4GI7A 4OI4A 2RGBA 4EQ6A 1FTNA 3CF6R 1F48A 4G1UC 4DT1B 3IBYA 2ZYUX 2JEOA 2QSZA 3SU8A 3LLMA 2F9LA 5E4FA 4V0LA 2RGEA 4NMMA 1VTKA 4HLQB 2W58A 3W34A 2AX4A 3VU9A 1P2SA 1NBMA 2KI5A 1HE8B 2ZI4A 3IEVA 4P4TA 4TTPA 3CF2A 2IX3A 1F5NA 2AXPA 2R44A 1P5ZB 2GEUA 4FMDB 4AYTA 5AJXA 5CLLA 3BXZA 3ONWA 4C30A 4ZI2A 4Q03A 3ZIAA 2HCBA 3ADCA 1UADA 4FMDF 3KKNA 3L8ZA 4H1UA 3U4QA 1XTIA 2AR7A 2DFTA 4JKYA 3KKMA 3BH0A 2WKPA 3FPAA 3PEVA 3AF3A 1JNYA 1GL9B 1EK0A 4NKRA 2OO7A 2ZRBA 2G1KA 4BFUA 1ZMXA 1IN5A 3ND9A 3TK1A 5FUWA 2Q9CA 1JQJC 1UEJA 1NVWQ 1MABB 3FKSD 3B1VA 3E1SA 4TSFD 5JJIA 3GMTA 2I1QA 4PSAA 1F2UB 4LV8B 1S3GA 1KZ7B 5FPTA 2G88A 2RGNA 3RRYA 2F43B 2ZUDA 3CR8A 1YR7A 2ZITA 2ZRKA 4US0R 5FOXA 1G5RA 2ZRFA 4MRNA 1L7VC 2D3WA 1YHNA 4QGAA 3R9WA 1O87A 1U0JA 2GF0A 4KFTA 4LRWA 2FU5C 3KTAB 3C5CA 4BZQA 1KMHA 2CEAA 2WWHA 4DIDA 2R62A 1KJYA 3EZ2A 3OE7D 5KSZA 4PPQA 3U7EB 3R9XA 1ZM4A 4JKIA 2ZXUA 3DZDA 3EG5A 4XJXA 4LSGA 3WNCA 1RE0A 2QZ4A 2NTYC 2ATXA 3EX7C 2BV3A 2NMVA 2PX0A 1OFIA 4MUAA 4M21A 3QKUA 4C3ZA 2ZAOA 1W0KD 2QAGC 1P61B 2QPAA 2J87A 3LVRE 3FWYA 4NYJQ 5SZHB 5IDVA 2IA5A 4YLGA 1N0WA 1KSJA 3WMGA 4KXFB 4A92A 1U0HC 5H70A 2AN9A 3SE0A 3B1XA 4UNSA 3RWOA 4N3NA 3AVWA 2A5YB 2DWOA 2OXRA 1KYIA 3QUSA 3W6NA 2A5DA 1IXRC 4FXPA 1R2QA 4TT3D 4A0GA 4ZDIA 1UM8A 3NHAA 1QVRA 1GL6A 1B0UA 2F1RA 4GZLA 2IXFA 1GG2A 1IJEA 1I2DA 2C9YA 4Q66C 2HLDD 2OCPA 3W6PA 3JZMA 1OKKD 1VYUA 4IXMA 2EFGA 1Q44A 2P67A 4NCIA 3FKQA 1GNRA 4Q7KA 1XZQA 2FFBA 4DSTA 4FMBB 3EXAA 2XTZA 3L0SA 2RH5A 4H9GA 2OCAA 3ZZTA 4LBZA 1IY1A 1FUUA 4NCKA 5G53C 4QJ3A 1MABA 1NVUQ 1WRBA 3LAWA 3T5GA 4RKEA 1E2PA 3IQXA 4TLEA 3PUVA 1M2OB 1NI3A 1C9KA 1QHYA 3K0FB 1OB5A 3AP1A 2J9RA 5K8UA 4YMSA 2ZU6A 3OE7A 4HZUB 3DKVA 2Z0MA 3BB4A 1Q0UA 1SHZA 3L2OB 2FSIA 4IDNA 3RSLA 3THXA 3VR6A 1C4OA 4OYHA 2V1UA 4M1TA 4DHEA 3B8HA 1MH1A 4HUTA 5JCZA 5FFMA 2XGJA 1JR3A 1ZIOA 1KMHB 4TTRA 3Q72A 4LHZA 2AD5A 4E07A 5BQ5A 3EZ9A 4R71A 4Z51A 3UWKA 2FH5B 1NG1A 1HT2E 3JVUA 3NBXX 4LYAA 1AS0A 4N0EA 2N1BA 1TF7A 4G0NA 5FH9A 5G41A 5TMPA 3PEWA 4KBFA 1XD2B 3O47A 4ON9A 1DARA 3WMEA 1ZBDA 3QXXA 4GOXA 5KNBA 5C1BA 1Z07A 1X8KA 2W83A 4KJZA 4LC1A 4QBFA 4A6XA 3CPHA 1XCMA 5FL3A 2RGXA 1L4UA 4MRVA 3BBPA 2KBFA 2H5EA 2ZJAA 4B33A 4UNPA
chains in the Genus database with same CATH superfamily
2C4KA 3WYAA 4J3JA 3O31A 4TV8A 4X1YA 1E32A 1GEGA 3K1ZA 2CDCA 1JX6A 4HDQB 3UWPA 2ZTHA 1LVUA 4WQMA 1JBQA 2WJ3A 1GT6A 4CM7A 5EEGA 3RC3A 2BAGA 1LV7A 4H4DA 4HQ0A 4QARA 4FX2A 1ZM7A 3HHEA 2B5VA 3AETA 3OAAD 4TKUA 2K5UA 4L3WA 3O8LA 4P54A 3R7WA 4BLSA 3F47A 3GAFA 2UZAA 5JRZA 1ESNA 4FD2A 3T3DA 1S8OA 1EK2A 1TQ2A 3SQOA 1W94A 2DWPA 2G3YA 5F4BA 4CEHA 2BZSA 1PUIA 1LH0A 2MINA 2A58A 1NJ8A 3TB6A 5JT1A 4RMNA 5DVZA 1JG2A 2D1FA 1WZEA 3RRMA 3JS5A 3QV1A 3UUWA 5DSXA 5KX5F 1Q6ZA 1DCMA 1RHQA 2AW3A 2PA3A 2YVUA 1SKQA 3C85A 1IZ9A 4RBNA 5J5VA 2JLCA 5FNVA 4BWFB 4XGRA 5DNWA 3C3AA 3GEEA 4FB5A 3R23A 1P9NA 3Q0EA 3KE8A 2GF9A 4DMUB 2P2YA 5DJ5A 5C18A 2YVQA 4HSEA 1WBBA 3KKOA 1UM9B 4D6PA 1IE3A 1VA5A 3PHIA 4CM4B 4G0UA 4NIMA 4MS1A 1U81A 2HMUA 2Z57A 3A1WA 4PQGA 3TZCA 2XMPA 4EG8A 4QQNA 5FWAA 1OU4A 4JQCA 4ZN6A 1OTHA 3G1TA 3LLSA 4ABTA 4OX9B 2H1SA 4CKZA 1WTAA 1ZSNA 3VKHA 1RIFA 2EW2A 2R6FA 5KYKA 2CNBA 2MSNA 4OI2A 3RGWS 3IEIA 3ZD6A 4X3OA 1FNBA 3BICA 1OZAA 3CSSA 2EHJA 4C4AA 4JQOA 1NJGA 4URHA 3ETCA 3UG7A 2G9QA 5AVUA 5IARA 3NT2A 2DFNA 3K09C 4D4IA 3FVTA 2FN4A 2F67A 1ZK2A 4BQIA 5IDYA 3U3JA 1GU1A 1H3NA 3FCOA 3EC7A 5K3DA 4KQ2A 4EGFA 3GQBA 3JR7A 1NVBA 3WZLA 1AO0A 2VAPA 4BO8A 1LRKA 3AHCA 1A5AB 2P9FA 5B4VA 3GI1A 5IUKC 1UWVA 3HY3A 4KNWA 4OGWA 3UW1A 5I8PA 3Q85A 4A2QA 4BGVA 2XMZA 1OIXA 5THQA 4RD4A 4M22A 5KNBD 1A8HA 2EFEB 2FSVC 1GZDA 3QYPA 3JD0A 1Q0ZA 4EMSA 2QTVB 1PWXA 1W4ZA 5E6UB 1T2FA 4DVJA 3CX4A 1I4DD 5J63A 5CCDA 1OXXK 3ITKA 2WWIA 1NOIA 3QMWA 3GLSA 5EE0A 2QMEA 3UXMA 3UC5A 5AIBA 1RJ9B 1AHIA 2OK8A 2QU8A 1GTVA 4OBBA 4EKNB 1NUTA 1B7GO 2H2WA 3PXDA 3K5PA 1SIUA 4Q1FA 1RCTE 4KV7A 4QU0A 3I2KA 3M33A 3QBVA 1QKJA 1BEEA 3LDFA 5B6IA 3AKEA 5FV4A 3ZDZB 1MO2A 1J1ZA 5GADl 1M74A 3I0MA 1MKYA 1YBVA 3UBTA 1Z5UA 1HQYE 1E4OA 2IIPA 3ODGA 1BGXT 1P2DA 2J6BA 2WPDA 3FGOA 4JBLA 1VCNA 3AR6A 2FCRA 3GFSA 3UKOA 1PG2A 5K01A 5FKJA 10MHA 2G7MC 5KTNA 5L53A 4FPXA 4D3ZA 4CM3A 1LPNA 1P31A 3BEDA 3TLJA 1N3LA 3LCJA 3MIZA 3A3KA 2XWQA 4K9DA 1UM9A 1QG4A 1A27A 3JQBC 4DJTA 3OE1A 3BL6A 4HX9A 1E2NA 2WZQA 1WY7A 3PUYA 4H4EA 2BUCA 2M1ZA 4B6JA 4D97A 4F86A 4ITVA 3AQ4A 4IDDA 3FAKA 2QBYA 1XU9A 4IMRA 2HRZA 3SQNA 4MH0R 3JD3A 3PGKA 2ZTVA 3ZWVA 2WQZA 3R9XB 5IN4A 3VC2A 1NATA 3MOSA 3C16C 3CZ4A 1YTUA 2NU6A 1AE1A 4FFBA 1XDUA 2ZANA 1NTRA 4GO1A 1ADBA 3IPXA 4NU6A 3UMVA 4YT2A 1XAIA 2QTNA 3FXAA 4ICIA 4JKOA 2YIMA 4L22A 5TEVA 5I7WA 1CY1A 2F1JA 1QO9A 3HR4A 1GGMA 2GFQA 1JKFA 2RBEA 4BN4A 1HM5A 2Q4OA 3VU1A 1D04A 5IJ9A 2QORA 1BDJA 4AQDA 3B6MA 3H4VA 4MP8A 2ZWPA 4WUVA 1ZSVA 2FPGA 3W9UA 5JEDA 1UXHA 2R8RA 1IL0A 4UEJA 3SYNA 1AZWA 2NXJA 4YUXA 5KYYB 5F9FA 1HG1A 2C95A 2A6PA 1UKYA 1BX1A 2VWHA 3QK7A 4AUKA 3PDHA 5KHAA 3ED5A 3VOBA 1W8DA 3SS9X 2PL5A 3GNTA 3KUCA 1SY7A 3W2FA 2VUSA 2DPHA 3L0OA 2IZ1A 2Q2QA 1V8BA 3PUHA 4RFSA 1QKIA 1MOSA 1J25A 1YS7A 2GCOB 2WJJA 2YW9A 4RPJA 4DPKA 3IUNA 1MW9X 4OQZA 1PFQA 4H35A 4YMTA 1KYVA 1M10A 3ROPA 1C81A 1SUWA 3D8TA 2A5FA 4PS1A 1C0EA 5BQOA 2GAJA 4DUPA 1JYSA 2P5TB 2QSJA 3DA8A 1AT1A 1T5BA 1CUIA 4US1R 4LECA 2UAGA 1VE1A 2GZ3A 4H1HA 2GLUA 3AF2A 4M0CA 3AR3A 2O06A 1ZK0A 1E2IA 2H31A 2M32A 4J0KA 3QUBA 4EYQA 1JR3E 4JLKA 4K28A 3K6JA 2GRJA 1HLGA 4YRNA 1GUBA 4M8NE 5H02A 1SPBS 2O3UA 1WF3A 1PJBA 2FOLA 3BGSA 1P4HA 1XLVA 4PZEA 3GMIA 2CLMB 1E3DA 4XH9B 2QRVA 3ZE6A 3ILYA 3A4LA 5BYKA 2XF2A 1QQ5A 3GCWA 3LQKA 1EAYA 4LOKA 5FOSA 1Z0IA 1G21A 1LUAA 1M3SA 2Y6VA 3BFJA 3DZIA 3IJEB 1X77A 3LQ4A 4BXOA 3LX8A 4PLTA 5F77A 3NDRA 5EKUA 3RQSA 2G6TA 3NYIA 2F1OA 3ZZUA 3ONFA 1Z18A 4BKUA 3D6HA 3FPBA 3Q9UA 3THXB 4OB6A 4MNTA 5E1MA 4EO9A 1I4TD 3DQQA 3TEFA 3OQJA 1GA1A 2IHKA 5G0SA 2P4HX 2W5UA 4AZ3B 2C2OA 4DWVA 1O4WA 2LKDA 3EULA 5DTJA 1XC7A 5I7RA 1PP4A 3Q9NA 1QZTA 2XUIA 2G04A 1X15A 2ZYRA 1ONPA 1RKVA 2HBRA 2HB6A 3GEHA 3HADA 3IP3A 1JYFA 1AC5A 4L9WA 5ELMA 4YAUA 4R51A 5C8ZA 4PAOA 2LGJA 2D7DA 4FYIA 1WEHA 1UT6A 4PN7A 1PT5A 1WV0A 2VYVA 2JIDA 3GZNA 2J08A 1FBNA 4N49A 1P5HA 3HDYA 3VGPA 1K3FA 2B83A 4WK2B 5T57A 5SYNA 5YASA 1A8PA 1QE0A 3VVCA 3P52A 4ESEA 4JY7A 3ECCA 4K6GA 4QM6A 4F3CA 4IICA 4WX2B 2RB5A 1O9HA 5DN6A 1KK0A 4PLWA 5D7NA 3I45A 1PFUA 4EWLA 4E31A 1W6UA 1YU9A 2ACEA 4KRGA 4LXTA 2WWFA 5DYIA 4BS9A 1J90A 5JD4A 1EX1A 2R6GA 3OZ7A 1ACJA 3PXCX 4YI3A 2QUHA 1C3LA 4L85A 1NLYA 3HRKA 2DQSA 2M9MA 4E32A 1SK9A 3D0RA 2GEFA 1DLIA 3V2HA 4PHFA 2FX3A 2P77A 1YZUA 2ZREA 3DLTA 3FDZA 3OCYA 3QG5A 5DTEA 1KQGA 1KJWA 2P5YA 2WDPA 2XJ4A 3QKTA 3QOWA 1ZITA 4EMUA 3H13A 4FCTA 3V9PA 4CKCA 3COJA 3C48A 3OLXA 2HF9A 1G3UA 2WJGA 4AICA 4K8OA 3BD7A 2XQVA 3ZJVA 1KO4A 4JOQA 3M6WA 1TB4A 1R9GA 5E3HA 4RE5A 5CFRA 2C7PA 2IBSA 3V8PA 3DT9A 3KEFA 5GPBA 1I33A 2WYIA 1TI7A 3EVAA 1T6BY 5AKLA 1JHOA 2DTEA 4LDZA 1GAJA 4OKNA 5IC6A 4EB0A 4RWZA 1WQ3A 2FW6A 4LKRA 2JIBA 4QO7A 2AVNA 4MYTA 4V02A 2JIZD 2ON6A 4H1WA 3ZDXB 5I7SA 2CHQA 3OMLA 4X6LA 1PNRA 1IQUA 4C0WA 2VDRB 4DEXA 3B38A 3JWJA 5JCOC 1BKDR 1U2EA 4MEAA 1UXJA 2A57A 2X0RA 1KI1A 4UVIA 3RU2A 3WSWA 1GLGA 4I5FA 3SXJA 4DARA 1Y6FA 2ORYA 4LQCA 4D9NA 4DAEA 1XTPA 3JZFA 3I6YA 1Y4ZA 5FFFA 2IIVA 3IBSA 5HK8A 2JLWA 2IOYA 3OSZA 3FYTA 4P3PA 2UZ1B 2B8WA 2X4IA 4Q01A 2JH9A 1GCOA 5ITSA 3HCCA 4ZQIA 1VC2A 2W6JD 3NP7A 3UT0A 1UDRA 1YH3A 1JHYA 5LQMA 3SBXA 3SMQA 3HKDA 5EIBC 4ARVA 4H7DA 4RGYA 5K05A 1N0VC 1HNNA 4BU0A 1X80B 3SICE 4N0PA 4BFXA 2X42A 3QY0A 5ER9A 5IBRA 5TQVA 3SYMA 4JGIA 2JG3A 3JXEA 5EGNA 2H2DA 3HI4A 2XDYA 1DJOA 2VJYA 2C96A 4RLSA 4PV7A 3SDBA 4F4DA 5HRCA 1GZ3A 2IHBA 2YBDA 2ZRNA 3U9LA 2PZAA 5K6AC 1XQWA 1KYWA 1NYTA 6GPBA 1P0IA 2HRRA 1RI4A 4XGIA 1N8KA 4TXJA 4LG1A 2O8EA 3ZQJA 3F9IA 4G23A 3ME5A 4UQOA 5ECYA 2RGYA 3RRNA 3RT9A 3SHQA 4UHEA 3SZRA 4BNWA 5JDCA 5JNTA 2HW8A 1Z8NA 3L5KA 3F3SA 4JI3B 2NYAA 5DI3A 2I2DA 4BO9A 1BA2A 4BEWA 1TF2A 2MSDB 2CFOA 3HYSA 5K0FA 1FFXA 4XEUA 4ARSA 2OPBA 2VDMB 3ELBA 3JWPA 3N2EA 3VO9A 2IF0A 2Z8YM 4PBTA 3GOQA 4KPEC 2JDID 4GT1A 4IDCA 3TLZA 1MJ5A 4PQFA 4NAUA 4WASA 3U31A 1PGOA 1EM8A 1KMQA 1B1CA 1TU3A 2GN4A 3PFCA 4RZUA 5F2EA 3IUMA 2FZEA 3KB1A 3AQIA 2FQQA 2HEIA 3HRIA 4O4HA 1I2CA 1EE9A 1P2FA 4OM7A 4Q3AA 1ORIA 2HCTA 1S3SA 3P4UA 5GM2A 1F2TA 1PZXA 1USVA 2FSSA 3CZ5A 3BKWA 3EPRA 4BNVA 1L4BA 3INTA 3TLEA 1DJQA 1XTBA 3GCXA 3D3WB 3GZJA 4WY2A 4HD8A 3PS9A 1OI7A 4P0TA 4HH4A 1OLUB 5ULLA 1GQQA 5LXTB 1N6RA 2RIPA 4XE5A 3FFTA 2BMVA 3EOZA 3PHJA 4WN9A 2ZYWX 1EHYA 4I7EA 1X7XB 2HDOA 4OOFA 4OXKA 1IJKA 4LAFA 4S1VA 3WIBA 1QJ4A 4ZIRA 4TTVA 3IVAA 4S1NA 4NATA 5FBQB 1HEYA 2KSQA 1Q20A 3NI2A 2P0AA 3G8AA 4OIMA 3JARA 4PSUA 2BMJA 2CNDA 1JFRA 4PFJA 4LDJA 2X6TA 3KYCB 2PUAA 4J0CA 4PM4A 3F7NA 3VKFA 4HAIA 1ZU5A 2PZ8A 1W5AA 2W8BA 1BH2A 2FCAA 2I76A 3EGVA 1L9XA 2ZB7A 4O4JB 5AHOA 3LC7O 3AKYA 3MOIA 3RAPR 3P0RA 3MHPA 5COAA 4BMCA 4K3VA 1XE3A 4A5OA 2BEVB 3OQIA 5DHPA 1TDJA 1HDZA 3QPUA 1RVV1 5FTJA 1IU9A 3SJUA 4I46A 1Z35A 4PC3A 3UXHA 2R00A 2QTFA 4AJNA 4DR4B 2M6SA 3H1GA 4ZVKA 4LUCA 2QBYB 3UMSA 1RZ3A 4R2JA 4MMYB 5DYGA 5IJ0A 2XE4A 2V0CA 2ZBQA 4QOEA 4RPCA 1NJ1A 4Y6SA 4B4WA 1JWBB 5JI3E 3W5AA 3O4JA 2IODA 1NM5A 3MLBA 4A16A 1OXUA 3K5IA 2D5AA 1GZ7A 5DM1A 3E2MA 4IGAA 2VH1A 4AAYA 1N4AA 3OPMA 3WAGA 1O7JA 1DFGA 3KKEA 2ZIGA 4N54A 3RSGA 5DW0A 5JSZA 1FMJA 1NLMA 1YV9A 4BBAA 3ROQA 2O07A 4R3NA 1MFPA 3FVWA 1Z5ZA 4IVRA 2OHHA 5TF4A 4YR7A 2QMYA 3S2YA 2BSAA 4KI7A 1DHTA 1D0SA 1L5YA 3KJEA 3W9BA 1WQ1R 3JD2A 3QUQA 4JBWA 3UJ8A 4RJTA 3DC7A 5C81A 2DHQA 5ALSA 5I7UA 4W1PA 2QD3A 4WNAB 3P9PA 3ZR4B 5CDYA 1WSBA 1QYXA 2H0RA 2BLNA 5JYCA 3WJ7A 4NBSA 1NSFA 2AF3C 4BMSA 3MHTA 3FRJA 3QU5A 5FBRB 3OE4A 4RYDA 3BHIA 1KZGB 1RYFA 2CHGA 4UUOA 5IT5A 3K9FC 3LWNA 3KT8A 2GO1A 3OEHA 1C0LA 1QYWA 4RK1A 1REQB 1WP4A 3U6KA 1IBCA 3HJAA 4DL9A 3GA7A 4OGKA 4G2NA 4KC0A 2BRUA 3U44B 4J76A 1M0EA 1ZN8A 2YWFA 3CVVA 1YQEA 3EEQA 2HXSA 5DK6A 4ZIRB 2J45A 5F9HA 1KYQA 1J0DA 1U4NA 2HM7A 2P3SA 3M5PA 3RIMA 4MV5A 1KZ1A 2G06A 1FU7A 1IAVA 4PG8A 4P83A 4CLRB 5HKKA 4K6FA 4Y6OA 3V00A 4CXMA 1ZMRA 3IUQA 5ESDA 4GDMA 3P0FA 4PZLA 5JASA 1YCDA 2G6BA 2GJKA 1IBKB 1JLLB 2AXNA 1J8QA 3ISJA 2AFHA 2IHVA 3IKJA 3D8HA 3H9BA 3LBFA 4LX0A 3PNYA 4PSVA 5TJHA 1OT3A 1N9GB 3O95A 3UMBA 5K2OA 4FYXA 2ZXEA 3EZNA 2GBFA 2JHFA 4IIXA 4TYQA 2YHBA 3W2TA 2D0PB 1AKWA 2GM3A 4XVCA 4KN5A 3FVRA 7REQA 5JY6A 1RC8A 1FTGA 2Y4OA 2AX3A 1PSDA 1VPLA 2JGKA 2OZPA 5DLPA 3WL8A 1L2TA 2Y05A 1VE5A 2HMWA 6REQA 3HR8A 3M8KA 3FOAA 3RT1A 4AO6A 1VFPA 4F5ZA 1HZJA 3D3NA 3FPJA 4V3CA 2QM8A 2OYRA 1NR5A 5HRAA 1KQFA 3ZX5A 4W9MC 3I2HA 1VMKA 1NONA 4XQGA 3DDUA 3VYWA 1FDUA 2C2MA 2XGOA 1YOVA 1CUCA 2YRFA 1FSPA 2WE8A 5CB8A 2IWRA 2CBZA 2PMCA 4ALMA 4CIXA 3D3EA 1ETUA 1W5SA 3EVFA 2NUPB 1Q84A 2CFIA 2OV8A 2PUJA 3A7DA 5AVKA 2JIQA 3EXEA 3U1TA 2XNCA 4LYEA 1J5PA 5K03A 3DNMA 5J4LA 5KC9A 4W5RA 1CUHA 3BFVA 1OZ0A 3EH2A 1PJ8A 1JQ5A 5K8VA 2PSFA 4C22A 2QEQA 3C5WP 1EVIA 4YACA 4RW0A 2DUJA 4IKEA 4PRKA 3AJAA 4QWMA 1GITA 3ZTTA 3U7GA 5FUXA 2RAUA 3F5QA 4YC7A 5IVHA 4NJMA 2UKDA 1WSDA 1O08A 2H0AA 2C58A 3DPSA 1Y34E 1CW2B 3TIVA 4ACBA 4RCVA 1E1CB 4MJ7A 1ECPA 2GQ0A 2CMFA 2B36A 4R84A 3G2KA 2AS0A 2CXRA 4JB3A 4FINA 1M7HA 1JE1A 1ZA2A 2WJAA 3RFTA 4Y6GB 5L7WA 1KPGA 1Z6YA 1TF5A 2QE7A 2IEGA 1JAYA 4MUBA 3O8DA 4MIYA 4P36A 2CB0A 4TL8A 2WTUA 2MYPA 1A69A 3BH6A 2C0PA 4Y6LA 4LYDA 1FXWF 4OK6A 4RHFA 2I4MA 3J81k 1F06A 5J40A 4NE7A 5TR9A 3JYPA 3PK0A 4BRWA 5KVSA 1WXFA 1XU4A 3O03A 4OQYA 1P75A 2ZRLA 1G291 2HBZA 3IIJA 3I52A 3E7FA 4I1SA 4G67A 3M7IA 3GFQA 4X24A 4RSMA 3UAGA 4BY9E 1Z0SA 3VNVA 2WIJA 1A1SA 4CV3A 1LV8A 3CBGA 4EHAA 1SKMA 1M2OA 2BFDA 3IUPA 5CIWA 1IRIA 4FDMA 4URWR 1J7JA 1QH1B 2X3FA 4D1YA 2OILA 1GTSA 3BT7A 3WISA 4WA8A 4Y1FA 4ZYTA 5E3JA 1GU0A 2GH1A 3H75A 3IHKA 3KJQA 3DXYA 1DAEA 4KQFA 4ODIA 4UAUA 3VV2A 1RXCA 5KJ6A 1I3CA 1P8JA 1W44A 2GNPA 2JFGA 3CH4B 5LZ5A 4X20A 2FWRA 5I9LA 1MOQA 2FUG6 3W04A 4PG5A 3G13A 4MUKA 3CEHA 2BM9A 3I1IA 5BSTA 4NECA 3NHBA 2YZNA 1R50A 2AZMA 1EWYA 4N3CA 5IJWA 4O2BA 3HM9A 1HTBA 3T3EA 5JNUA 4LYGA 3N1UA 2W2MA 1TRHA 2IJGX 2YTZA 5D3QA 1JL3A 1ZH8A 1Y82A 2R7AA 2XGGA 2BMEA 4F92B 2AWOA 2PY6A 2VR1A 4PXAA 1OXKB 1QS0A 4RKRA 3MINB 4A15A 3FFAA 1ITZA 3OM9A 1EJ0A 5EINA 3D6NB 5TQ0B 1YA6A 4K3UA 4IHJA 2XRZA 3ZE2B 4I1PA 2H1IA 2P6UA 3M4ZA 4RTMA 2Z2ZA 3LD9A 4KR3A 5KYNA 1JDBB 3V9AA 1ORTA 3R0QA 4HQFA 3GELA 2Z4RA 3U5ZB 2Z6UA 4HZUA 4KZPA 2NSJA 2OFFA 2OOKA 1THMA 1RWPA 1U0EA 3EXG1 5E7JA 5EJ4A 4DWJA 2E5LB 2VLBA 4R0VA 2ZZMA 3C45A 4KQHA 5DI3B 1TKBA 3T35A 1CTQA 4G56A 1QTIA 4F46A 2VP3A 4Z7JA 3FKJA 1RBMA 3AK4A 4FNMA 2RMKA 1PSZA 4LA4A 2AUNA 2RK6A 4LY3A 4RJKA 3CE6A 4Y0VA 1APBA 4TZ0A 2OCKA 5CTAA 4QUIA 1MAVA 4L75A 3TBHA 3K9CA 3TR0A 1WBJB 1JVSA 1GAQA 1WIWA 2PQMA 4QJ5A 5JAQA 4LEIA 4BGDA 4GMGA 4D3SA 2E1PA 3ZWQA 1Z5VA 5B30A 1QRDA 1ZP6A 3DBVO 4X1KB 1H42A 5ALJA 3TVTA 4BKPA 5F2NA 3GN1A 4EUEA 1ONBA 4LOHA 2FSVA 4QC2A 1O03A 5JTUA 1ZOOA 1KDTA 1M2EA 1OX6A 4EPTA 1JTVA 5J4KA 1YASA 1ZGBA 3A8TA 4DYVA 2ZLBA 2X6RA 3WDLA 3TLKA 1XBTA 4OL0A 2P9HA 3E18A 2QX9A 5EERA 3TRFA 4IW3B 2D5CA 1ZUNB 3K3PA 3QNMA 3BXFA 2R8YA 1KDYA 2Y76A 3UG6A 3SJBA 1CY6A 3OOEA 3L8CA 1VGVA 1C2YA 1W4RA 2A5GA 2YBEA 2C84A 1XJWA 4KREA 3ZVLA 1JUDA 4YFVA 5FNVB 5AQ1A 1J24A 4OH7A 1UDBA 1Q21A 4IIEA 5K8IA 1QH1A 2R66A 2I3BA 4D9MA 5L6LB 4KQ1A 1R0CA 2FWBA 2G4LA 5DV9A 5A9SA 5FEUA 3ANXA 3ETNA 4ZAFA 2V9ZA 2D2FA 4ONEA 3T7RA 1PT8A 3OQIB 3AF0A 2QYSA 1GA6A 3BGOS 5FO0A 1TM1E 4OHBA 4LOJA 5PGMA 1TOAA 1I3KA 3DEIA 4HATA 4E5KA 3MJCA 4AJ4A 5GOTA 3ZGOA 3PEEA 3QBTA 2NXCA 4NCHA 3JQAB 1E9RA 2PRIA 4HB4A 4EFKA 4CCAA 3B3FA 5T4BA 3JQBA 3ZXIA 1MO5A 2PUTA 1OLUA 1XEFA 1QIKA 1ODSA 1HZZA 1C2TA 2PKXA 4Q7QA 1MXHA 3SEFA 1QPZA 2DFLA 1L5LA 4TT3A 3GJTA 3WE7A 2PBRA 3GT7A 3KFVA 1NF8A 2DQZA 3AVTA 2WQ6A 1Z08A 5AICA 5DGIA 2HH9A 3BJIC 3UAVA 3JQ9C 4D8YA 1NV9A 4UAVA 3FZQA 1U7PA 5ARCA 2B25A 3I5UA 2IQ5A 1ECGA 1ZLXA 1T4GA 3NC0C 1LBEA 4OB8A 1GTRA 2HN9A 3CRNA 3KYCA 3EZXA 3LDHA 4BQOA 4B79A 5K45A 4NZ9A 2Q4EA 5K0EA 5KINB 3JZAA 2ZULA 3U7HB 1J6UA 2VJAA 1W581 3BRCA 3L4EA 1OX5A 1GEEA 1YDEA 2HNAA 1YCGA 2ANBA 2WZBA 4BQQA 3TECE 2Z95A 5L3SA 1UFQA 1QV9A 1H1LB 3TKYA 2BTOA 4J0QA 4OFWA 3JSXA 4N1AA 1QO0A 1S3FA 1VSTA 2XKAA 1ZH0A 1WOMA 3LE8A 4C05A 3C6MA 4IMJB 3O94A 1TMKA 4IGIA 4P84A 4JNCA 5KWVA 1N7JA 3HK2A 1PR6A 3C3XA 1UK8A 2N1MA 2ZJ2A 3LP5A 2UYGA 4PWYA 1YQQA 2IXTA 5AKXA 3Q11A 2WWVD 3J7AC 1B1AA 1RLJA 1RWQA 1GLNA 2CL7X 2R7NA 1NR1A 4HGNA 4B3CA 5BVGA 5DCLA 3UKDA 4CT4B 4CEJA 2JGMA 2I4OA 3UOWA 2A9PA 4TUYF 1Y1KE 4JFAA 3H9JA 1N3YA 1XQ1A 2NO6A 5HQ3B 2PIDA 1EVJA 2EFCB 3A6EA 1REQA 5JSZB 5DFAA 1NPDA 5IZ4A 1OW3B 2Y93A 3O8CA 3DV9A 1I3OA 2FN8A 4WZBB 1AMOA 3EPHA 1X9IA 3K0EA 4C6SA 3BD8A 2ETXA 3EIWA 1Y81A 3G88A 2HNBA 2R68A 1QHHB 2AFHB 1JG7A 2HQRA 3FUUA 3O4IA 5E6UA 3ZS8A 3WGVA 5KCMA 3TTTA 3BIXA 2R0QC 3PQ3A 4XDGA 3VOTA 4BCBA 5LP6F 1OYYA 1PGQA 4L8VA 3V4OA 2IS6A 2GYWA 1KNXA 2AG5A 4DGQA 3AHFA 3HYCA 2XUHA 2WF8A 1PJCA 2IUTA 3E23A 1AQIA 1N9GA 3GFBA 4MB6A 4DLVA 3FIJA 3VKUA 4AP6A 1ZCAA 1U8XX 3KNZA 4ZQGA 2A67A 4UUNA 1SVIA 4TTQA 1W87A 4O63O 2R4UA 5J5AA 3RSOA 4CKWB 1C1YA 2WJVA 3MBIA 1VMAA 1U8UA 1HDYA 2PDAA 3PDIB 4BAUA 2IP2A 4JP3A 3H65A 1J49A 3C6ZA 3T4EA 3SSOA 3B6EA 3ZKWB 1KKMA 3BHMA 3W4IA 1E6KA 4YT5A 1SKAA 4DC9A 4JEUA 4Z9XA 3NRBA 4Y0NA 2XBMA 2OO5A 3I2GA 3NHZA 5I9TA 4CM1A 5EJIA 4LF9B 1D1QA 3ZLBA 1PR0A 2CNOA 1VRCA 5AJWA 4QPZA 4X6XA 3SC2A 3K2QA 4EX6A 4JBHA 3MMXA 1N5JA 1VMEA 1MIOB 3OCVA 1Y0BA 2J5XA 4GMXA 4WPGA 3WHPA 4ZOQI 5FLEX 1WEKA 2IHUA 2XIQA 1QH9A 4RQBA 2RBKA 3KRTA 1OILA 3FWPA 2D2EA 2QTZA 4TRNA 4ZHQF 2D0DA 4N0QA 3ZDYB 3DWGA 1U94A 2O2XA 2BLLA 4JDPA 4P3NA 4UDYX 4D0NA 3ZHRA 1PL8A 5A06A 2OMKA 5KWJA 1JIKA 1QK4A 3R75A 4HB3A 3G0GA 1COWA 4JLVA 1H3EA 1PQPA 4K03A 1KY5A 5EJEA 1Z0FA 3R5FA 4OD0A 4F5WA 1IPEA 1E5TA 3U1BA 3JAMA 4G63A 2JAOA 3OAAA 4KYVA 4EJSC 3NTRA 2Y66A 2EKBA 5DHFA 1U5CA 2CHUA 2ZTMA 3GRRA 3NBZC 1NSTA 4DJAA 3MJVA 5AWFC 1ABFA 3RKUA 4O29A 3WVNA 5T6BA 3GB9A 2B8TA 2JLXA 4TWAA 4YMGA 3K9LA 1IN8A 1E1DA 4LI0A 4MEJA 3B7GA 1JHRA 1QZ3A 5GOZA 3TPFA 1F2VA 3V6LA 4AMBA 1RW4A 5GZ1A 5JALA 2O8NA 3OZBA 1T9KA 2PUHA 3OG9A 4G09A 1EBBA 3CZQA 3PX3A 2GVDC 2YYAA 1T3LA 3TLYA 1IULA 2GKSA 4LE2A 3NEAA 1YDWA 4KJXA 1SBQA 4P3KA 3JD1A 3KV3O 3DBLA 2PZJA 5KPJA 3ICEA 4Z8YA 2BGIA 2ZJ0A 1DUVG 4H1VA 2P2SA 2W37A 2FPSA 4AVYA 2I8CA 4TV8B 4RKQA 2HSWA 4X1YB 5F5NA 3AP3A 4LJSA 2Y1FA 1KTVA 1J8VA 3RS5A 4E7OA 3K8OE 4AZ3A 4CL2A 4XSGA 4B2YA 3W3AA 1VI2A 1T6YA 2LCIA 4BC0A 2WYHA 1A4UA 2JVKA 4M89A 1LNZA 1WVIA 2PRJA 4AC9A 1CUYA 1A9ZA 2ZI5A 3BJZA 1OXMA 5TEWA 1JFTA 5SZKB 3JQRA 2EF1A 1L7RA 4DXHA 3P9CA 4BPBA 1G21B 4IWXA 4MS4B 2RI0A 3B9QA 4GMFA 1RM4A 3W8FA 3WQRA 3E9NA 2C29D 1G2QA 1MB2A 2YASA 4GLLA 4S1PA 4Y1RA 3GEDA 3I32A 2HMYB 3JV7A 5CW1A 4DNPA 4UM5A 3BSYA 3WLQA 3FFXA 1H6BA 2JAPA 4DGSA 2EWVA 1M2WA 3AUYA 4GPZA 2P1ZA 2ZUUA 4L0QA 2VP9A 1KE1A 3K4QA 2IXAA 2YQ4A 4JYAB 1K7XB 1KI2A 1OFHA 2JIZA 3M4YA 3NVAA 4IINA 5FTNA 4RCYA 1JSCA 3NYWA 1EPUA 2GRAA 3VR2A 4L3OA 4ZCPA 4IDHA 1HL3A 3AUJB 4U9HS 2YC2C 5FB3A 2EERA 1X2EA 5E0KB 4ZT4A 2QTTA 1ISHA 1J39A 5KVAA 5SYAA 3L7LA 2B4RO 5KYVA 1NJ6A 4KVGA 1DLJA 3PV0A 3LW7A 4MWSA 4X5OA 2ISCA 4C1NA 3QQ5A 4R1QA 5BVHB 2B5WA 3KK0A 4H17A 3V7NA 1AUXA 3NYRA 1MX9A 3IQZA 2CE7A 2H48A 5AK6A 5HFJA 5IKPA 1UXGA 4A6DA 3FPCA 1CIPA 1LTQA 3A9SA 4ZRDA 5H3LA 4D8VA 4IHJB 3HU3A 4QUAA 3QU2A 5KWSA 4PEVA 3CC8A 2Y71A 1I32A 5JNVA 4MHOA 4KN9S 4UFNA 3WWOA 3LNTA 1TK9A 2PX8A 4CG0A 2IZ0A 2NQTA 5HUHA 2C99A 3WK7A 4KMMA 4NPHA 3T5PA 4PS0A 1Z45A 2BDTA 2GUGA 3QX8A 1AQJA 3DFFA 5CLQA 3L1HA 3WI7A 1UL1X 5KMGB 4OQ4A 2J0QA 1NNSA 3M82A 1DT3A 5LB4A 1U5AA 2H4YA 2B6HA 4I3FA 4WVFA 5A9SB 2HUPA 1U02A 3DBOB 5ALWA 3C1AA 3H2HA 1WULS 5BV8A 4QLBA 2QLBA 2P9ZA 2YRXA 3M1YA 3G5LA 5DBOA 2MJLA 3GFPA 4QAQA 5L7YA 3Q2IA 1FE8A 4TLMB 4JLOA 2FUEA 1BE1A 3W5CA 1JG3A 1R15A 5FL7A 3PQDA 3F71A 2GILA 3CIOA 4IRMA 3MQ2A 4W5WA 2BGJA 4GZMA 5GGXA 5GZ6A 2I3DA 1P0FA 1VHJA 5IX8A 4BECA 4F5DA 5CCXA 4LGMA 2W2PA 3COPA 1E79D 2Q0HA 1IJBA 2XAAA 4YQYA 3GP8A 3LTNC 1Z3CA 1KI4A 2R2GA 4XCQA 2AK2A 3L8HA 4FFLA 4DVGA 1XTTA 4H0NA 4TL6A 3MN1A 1ZO8A 5LU8A 3AB7A 1GPAA 3KOMA 3UJ3X 1Y9AA 5JISA 3K9HA 3UB2A 1VPDA 4UFOA 4B3DA 2ZE8A 2VYFA 4B47A 2A0WA 1SXJA 1TAGA 3B5JA 2O59A 3FWKA 3WLHA 5AKGA 2ZRMA 3GGPA 4JOCA 2ZFUA 4PYNA 1HE2A 4U7TB 3MCZA 4C4OA 3ADBA 1U28A 2J3EA 4POAA 4KHPB 1IM2A 3UFXB 3ZWDA 5JD6A 1M2FA 1Q7GA 1R9NA 1XYGA 5ARBA 2BSQA 1NNI1 2I65A 3CMMA 3UT6A 1KJNA 1G19A 4JR0A 3ESCA 3EEYA 4I08A 3D7NA 3V3KA 1XA3A 1CEYA 4E0BA 1DPFA 5AHKA 3FMGA 2X41A 5EJMA 3D02A 5AW1A 1ADJA 5ICMA 4JUFA 1M8KA 1T5DX 3OIUA 3KBOA 1SGWA 1UWLA 3BXHA 4Q9NA 4BN0A 4F0JA 4O4HB 1G8KA 2R7MA 2VPPA 2CNWA 3SY8A 4B7XA 1BE6A 2CLIB 3L8GA 521PA 1O57A 2YFQA 5LC1A 1R0BA 3CKKA 1ODKA 3G2IA 4J4TA 2VN8A 4PRYA 4DA0A 1ZK3A 1SVSA 3USZA 3VI3B 3F73A 3A2KA 3NKLA 1H8HA 3AI2A 4EARA 3I0NA 1A5TA 2HIAA 1QRAA 3A06A 2WUDA 2CLSA 1FFXB 1WSWA 5A0VA 4GHWA 2AI3A 2JARA 2FRDA 1KEPA 2LNDA 1UPFA 3CLRC 4YRPA 1CSEE 4B3XA 4RK4A 1NW5A 1YRAA 3GEIA 2OQVA 1BXGA 1R4NB 3K9WA 4ZAGA 1PG5A 3U2QA 4DLKA 5KAPA 2CDAA 1QU3A 2VYQA 4UUAA 2IPNA 4FM9A 4TWRA 2XTAA 2JEYA 4N6NA 4EJMA 1JIVA 1M6EX 2J0EA 7AT1A 1EUYA 3TLGB 2OCXA 1JMYA 2V3VA 4ESVA 4XYMA 4IOKA 4B3BA 4YLEA 3IT3A 4YRGA 4C7OB 3SF8B 3A4VA 2DPLA 1A9XB 1NXOA 3BWBA 3PFGA 3G8CA 3SJAA 3CLKA 2FEWB 2Z83A 4UKDA 3MMPA 1G21E 2QM7A 3GLVA 1A96A 1ODTC 2JCYA 2DWQA 3KJGA 1G41A 1K66A 1OC4A 4GI1A 2JD0A 3FTQA 4L6IA 1X7ZB 3ZLTA 2IP4A 2Q6VA 3SKXA 4JD5A 2D4AA 2IUFA 4PLHA 5I3CA 3LDUA 4LNUA 5TQ2B 1IY2A 2BMDA 3JPWA 4GM4A 5ANRB 1Y9DA 3RJTA 4EJFA 3DMGA 4TS4A 5F1KA 4TKZA 1I6KA 3U4HA 1FS4A 4II2A 3ZEIA 4ZWNA 1X74A 4I99A 1E63A 2NVWA 3CNNA 3CF0A 2I6FA 2C4MA 4ZZ1A 2UXCB 1F9EA 1ZWKA 4D3DA 1Q91A 2W8BB 1J09A 4DCOA 4PYJA 5EE3A 1WOYA 2FMXA 2AXEA 1HX7A 1Q12A 2Y2VA 4UMDA 1R6BX 1IG0A 1B6GA 1VL0A 2LWIA 2AD1A 3D2LA 4IJWA 3SZLA 3TSYA 1N1EA 3BZUA 2QF7A 1U9ZA 4BFYA 1NE7A 3WX0A 1IIBA 1PR2A 3TMKA 3EXIA 3G0IA 2OQIA 1RKXA 2Y99A 2YXPX 4R68A 2NUAA 1KS9A 1B0ZA 3DZCA 5CYFA 4GPAA 3BF7A 1CIJA 4RF2A 4EAAA 1Z38A 1KOGA 3IP7A 5B7GA 1F60A 1QCYA 4C4YA 4QQKA 4B0PA 1D6MA 1F8GA 2CLFB 3L7DA 1KRWA 2AR9A 5CVTA 3U61B 4OY3A 4LW8A 4O08A 4HDRB 5K4AA 4JGGA 4OI1A 3HCNA 4ASUD 1PJ2A 4J0IA 4BNFA 3D1JA 2VBCA 4HZIA 5DYWA 1M2VB 3SOPA 2YWJA 1TPYA 1C7QA 1XLTA 1XZGA 3EIFA 4NQZA 4QT4A 2Q9UA 4YUZA 2IH4A 1H69A 3BE5A 1YFLA 3D43A 4Z99A