3IPXA

X-ray structure of human deoxycytidine kinase in complex with adp and an inhibitor
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
241
structure length
229
Chain Sequence
b'RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxycytidine kinase
molecule tags Transferase/transferase inhibitor
publication title Lead optimization and structure-based design of potent and bioavailable deoxycytidine kinase inhibitors.
pubmed doi rcsb
total genus 85
structure length 229
sequence length 241
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2009-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ipxA00
2JJ1D 4IDPA 1IN6A 5EE1A 3OIVA 2JATA 1EFRA 1F2TA 4GI7A 2PZGA 2F1JA 4HLUA 3VU9B 2B7BA 3OIUA 4P4SA 5EXXA 3QXXA 2PT7A 4X8MA 4ZDWA 2XXAA 2WIBA 1YHNA 3H2YA 5H1YA 1NY6A 1JAHA 3Q5DA 4YXWA 4I1VA 2GK6A 4O0MA 4DSOA 4WZAE 4IFEA 1E2MA 5H8WA 1XMIA 4QNMA 1NBMA 3C15C 1BOFA 4ASUA 1XD2B 4V0KA 4OHVA 4AD8A 1MO6A 1OLOA 2FWRA 3KXIA 5FL3A 3X1YA 2R44A 4KFRA 3R7WA 2FFAA 1F5NA 1SKYB 1NMXA 3P1JA 4M1WA 4R9UC 2G83A 1I4LD 2JJ2A 2ZUBA 3LQRA 2GRJA 3AKYA 2PT5A 4FD2A 3NDBB 1W48A 4Q7MB 3FE2A 1KO5A 5K8IA 5DI9A 1E2HA 1PLJA 4RD1A 5JECA 1N0WA 2CHQA 2YC4C 4IOLA 4BFXA 2G9NA 2QMHA 2XJ9A 1GITA 4LZZA 4EJSA 1BYIA 1T9HA 4PC3A 4ZI3A 1AZTA 2NPFA 3IO5A 1J99A 3RRYA 4Q4JA 1DOAA 2P67A 2W2TA 2OBMA 4EPVA 2Q9BA 1TNDA 4Q18A 5BWMA 1NF3A 3HPRA 4NCKA 4BFTA 4GOKA 1TQ2A 3T15A 1N6IA 1X8KA 1LTQA 3QG1A 4HAVA 1RFLA 1VG8A 4V0MA 2BBWA 2H1LA 2PLRA 1P9NA 2AK2A 1G6HA 2JLXA 1TQ4A 5AJWA 5JBQA 3QI2A 4DEXA 3RS2A 3EIEA 1LS1A 1Y63A 3QVUA 3AVVA 2PMDA 3TW8B 1E0SA 4IEIA 4NMMA 1BH2A 4WW0A 1E9BA 1WP9A 1OT3A 2AFIE 2C2HA 2JLQA 4KV9A 2XZOA 2HUPA 2BEKA 3ND8A 4HB2A 2WKPA 4M2LA 1ZBDA 3LFUA 1K5DA 3BBPA 5HZHA 1ZVQA 2NG1A 3TAUA 3QEJA 4O3MA 2W6ID 4OHYA 4FIDA 2O8FB 2AK3A 3QG5A 3U7GA 2J0VA 4RKFA 2FOLA 1EFTA 1YRBA 4QJ4A 4V02A 1DBSA 4BRUA 5F98A 2ANBA 4EIWA 3OZXA 4MYUA 1P60A 2Z83A 5KNDA 1NBME 3DZ8A 3K09C 2JJ8A 1CTQA 2IT1A 2PLFA 3AVOA 5KNCA 3UPUA 4WIAA 2R9VA 2EWVA 2MSCB 3O8RA 3THXA 1MABB 4M1OA 4FMCB 3K0CA 2GVZC 4HZUB 4LV8B 2YWEA 5HTKA 2FV8A 2VSOA 3TSZA 2FNAA 2IHBA 5KYKA 1O3YA 4MDFA 3RNLA 4Q48A 2G77B 3QBVA 4LC0A 2RB4A 3L8YA 2IYZA 3GJ3A 4BFVA 4WZBE 4TN1A 2OZEA 3IQXA 4JLJA 3CRQA 5FPSA 1GAJA 4BQSA 2GZAA 2D2FA 3AP2A 1BO6A 1IN5A 3NDPA 5IK2A 1E32A 1X3SA 1SXJD 3T1TA 2XTNA 2YJTD 5BXQC 2XNSA 1E1QA 3CNNA 221PA 4M9SA 4Q4AA 4GL2A 1ZM9A 1PUIA 2KBFA 4IJMA 1FZQA 2DYKA 3GJ8A 4NCNA 4P0TA 4RZXA 2H18A 2OBNA 2DWPA 4DT1B 1VIAA 3S1AA 3V9PA 4DIEA 4ZKDA 1MRNA 5HCNA 4RZ3A 3C5HA 1DE0A 3TK1A 3Q7PA 4FCTA 5IDVA 2YWHA 2KWIA 2H17A 3JVVA 1W4AA 4GZLA 4HSEA 1NBMD 4UJ3A 1S0UA 4FI3C 2FN4A 1AJEA 3CRRA 1HV8A 1UJ2A 1YZQA 3ZLJA 5FUVA 5FUWA 2D2EA 2WSSA 4LC1A 2Q0HA 2OV2A 3BORA 3SQXA 2IYWA 1MT0A 1T4GA 2EFHB 1TF7A 1GNQA 5J4YA 3U6KA 4LPKA 1XZQA 3I4LA 1GTVA 2O0KA 2ZM5A 1EX7A 1XWIA 4L8GA 2DFKB 2GJ9A 1ZD8A 3IEVA 1E1RA 4HB0A 5EP1A 4P4TA 5FBWB 4OBEA 2VRWA 3W3ZB 3QKSA 2ZITA 3RS4A 1U0HC 1EK0A 1OFUX 1QHSA 2IYQA 4B3CA 5KOYA 3IEUA 3AM1A 2ZSDA 1NKSA 3GMTA 2WJIA 1TF5A 4I81A 1TAGA 1I4TD 4JVSB 2HT6A 3NBYC 4EFMA 3KQLA 3LQQA 3U2QA 1OXVA 2ZE6A 3T12A 2GJSA 5FI0B 3AQ4A 1IN4A 1DAFA 1KSGA 1A1VA 2VP0A 3MWJA 4Y0AA 5GJBA 4M0LA 1IM2A 1IN7A 4OL0A 2XJ4A 2R2AA 4JVLA 4DHEA 1VKJA 2Z4RA 3EPLA 1WE2A 2J41A 4JLNA 4KFTA 1LF5A 3A1UA 5DHAA 1RIFA 1NG1A 2EYUA 4JIMA 4TYPA 5EXTA 1TX4B 4DDVA 1N3BA 1U2RA 4PPQA 5D3MB 3W90A 1AK2A 5K8LA 5DI3A 1E69A 5C18A 3U44A 2QM7A 1SQ5A 1UM8A 1G64A 1NIJA 1UPTA 1W2HA 2QL6A 2ODEA 4DDWA 5B30A 1Q44A 3K9NA 3B60A 1KKMA 2WJYA 2RGCA 3THWA 1IHUA 2ZYWX 2AWOA 2ODNA 4RSGA 5JWRA 4AK9A 2HEIA 5SZJA 2FGJA 2V6IA 3EZFA 1COWA 1GRQA 2Z4SA 4PHHA 1BYUA 1HA3A 4DVGA 3ZS9A 2OCYC 2P6NA 1EGAA 1XEFA 3FVQA 4IXMA 5DI3B 1YR7A 2IW3A 3BFXA 4PAMA 4DLWA 2CL7X 5TY0A 5CIQA 1R4AA 5E7MA 3UG7A 1M2OB 2VP4A 2PMKA 5FH9A 1ESMA 2X77A 1UF9A 2OAP1 1A82A 4KSBA 1YJ5A 2Q21A 4JLBA 3RAPR 1YRAA 1MRSA 3SQWA 2VHTA 3L82B 3BAFA 1HURA 2W6JA 1MO5A 3IPXA 5SZIA 1G291 4JL5A 4PC7A 3ZVRA 3VX3A 4EFNA 1LF0A 4TT3D 1OIXA 3B1XA 4DBLC 2WOOA 1S8FA 4I99A 2PJRA 1KDTA 5FUXA 5J5CA 1GWNA 3BB3A 5HE8A 4HLQB 3FFBA 2CNWA 3CR8A 3ECCA 3FTQA 4LYJA 4OK6A 3SJBA 1R0XA 3SS8A 2YC2C 4U7DA 1RC8A 4B76A 2ORWA 2PZEA 4HUQA 1N5KA 3DZDA 4MUAA 4US1R 3K0AB 4B6EA 1T8UA 3BH0A 1Q3HA 5AR1A 5JEDA 4AKIA 3GLHA 1R5NA 1U8YA 1KMQA 3A4LA 4OQNA 2OCAA 1Z2CA 3TIFA 3ADBA 1SKYE 4GMXA 1LV7A 3G82C 2ZI3A 1H65A 1R2QA 2WV9A 1KNXA 1DTSA 1KZGB 2WHXA 3MWKA 4P3YA 2IUUA 3MRSA 3OHMA 1G41A 3GLHE 2VHQA 2F55A 4OHWA 4DLVA 1R8SA 3I8XA 3EARA 3PEUA 2HYDA 3SNHA 5CITA 2BHRA 2ONKA 3R20A 4JLVA 4CEIB 1HTWA 1XJCA 1PLKA 2IBMA 2N42A 3T5DA 2A30A 4A0HA 4B71A 1XCPA 3U7HB 4JLDA 2IXFA 1F60A 4QGFA 1E0KA 4LBZA 3O8CA 2BMFA 5EXPA 2ZRLA 2ANCA 3NG1A 4R2IA 3SC3A 3H86A 3PIRA 1HYQA 2QTFA 2LKCA 1FX0B 1NY5A 1VHLA 5E95A 4UXHA 4PC6A 4D81A 3NC0C 4M9XA 5AJVB 5EE3A 1GL7A 4NYIR 4CEJA 1G7TA 3BC1A 3C7KA 3AGQA 3RDPA 2VLIA 4U02A 1L4YA 4UNPA 4TMZA 1U9IC 2FSHA 5CM8B 5FUYA 5FI1B 4EQ6B 1U90A 3VR5A 3KJIA 2B8WA 1ZINA 4PSVA 5JJLA 4W9MC 2PEZA 3MG9A 2VA8A 2ZRJA 2W0MA 4FWIB 2ZRHA 2ZJZA 4FMDF 1Z0DA 1OE0A 4CEJB 1EXMA 1W5SA 1FMLA 2FEOA 2FSGA 5DN6D 4L9SA 4ESHA 2A78A 1UBCA 3TR5A 1UFQA 3VTKA 4F4CA 1XTJA 3FKSD 3DEFA 5DGXA 3U3RA 3M0EA 1ZUIA 5DLQC 2R6AA 3EPJA 4BLQA 3PITA 2GESA 1E2DA 2QENA 2GBLA 5DE3A 3N5CA 2OSBA 2ZJ5A 1W46A 2CJWA 2WWGA 3KX2A 3AF4A 4TQUS 4B35A 3K0FB 4PX9A 4B33A 1UEIA 2FPLA 5CK5A 5HKKA 5HKKD 1D2NA 4B3GA 1E9FA 3RRZA 2F3RA 3GEIA 5TXGA 1OYWA 3LD9A 4KSCA 4ABYA 1KKLA 2ZVPX 3C41J 2XOKD 1G3QA 3VKGA 3O8BA 1KSJA 2CK3A 4Q9LA 1KI6A 2C9CA 4R71A 621PA 4WXPA 1E98A 2DPXA 1PVOA 4QFMA 4AKGA 4M1YA 1IOZA 2J1LA 4BGDA 3KJEA 2IEZA 3SYNA 3CR7A 2R62A 5FTNA 3NHBA 4JJZA 2W58A 4IXNA 1HT1E 1Q1QA 2F3TA 2CLDX 4XH9B 4ZIRB 1SKQA 3FKSA 2OM2A 3WRXC 4A0RA 3RWMB 3TUJC 2WMNB 2IA5A 2RGXA 1MKYA 5FPYA 1VYTA 3VR2A 4Q4HB 4E07A 2VL7A 1U8AA 1VECA 2ZS7A 1JR6A 2REBA 4B44A 2ZRIA 4RD2A 4F4IA 2GETA 3KJGA 4XJXA 5C4GB 2BBSA 6Q21A 1E2QA 1G9XA 3G5UA 2W6IA 5KU1A 3I61A 2ZRPA 2PH1A 4WOPA 4JBYA 1KSHA 4H9GA 5TV2A 2G1JA 1WDTA 3CNLA 1DELA 4PANA 1U0LA 4XTRA 3DDCA 1K5GA 1U98A 5GVRA 2QRZA 3IHLA 2VSFA 2IYSA 4Q00A 2O8CA 4KYUA 2I1VB 1C1YA 2Q3MA 4JMPA 1UBGA 2QT1A 2HJVA 4MYTA 4C0LA 2N46A 1OB2A 3NVAA 1KO4A 2QY9A 1JALA 2FU5C 3LO5A 5EP4A 2C9YA 3QVVA 4A0GA 4HAUA 5C1BA 1CU1A 4QGHA 5CYPA 3IGFA 2R6DA 1DAMA 1KAOA 2ZETA 2NOAA 2ZYTX 3WNBA 4RZUA 2VYFA 3RLFA 4X8OA 3THOA 4NZYA 4TQ9A 4C30A 3R9IA 2FSIA 1NN0A 3MUFA 4XD7A 4A92A 1QG4A 1AKEA 5JI3E 5LB4A 2CEAA 2G3YA 1W4CA 2YOFA 3W34A 4JKIA 1E9SA 3FMIA 3IIJA 1W5TA 1XTRA 2AKYA 4Y0VA 2IEYA 1OH7A 1G8PA 3MLEA 1E6CA 1Z0AA 5FOVA 5ANRB 3LW7A 4TZ0A 2ZQ5A 3LV8A 4DUGA 3EWAA 3CZQA 4ARZA 1E2JA 3LA6A 1ONBA 4EUNA 4MRNA 2WJVA 4TSFA 1XEWX 2V1XA 3SU8A 4OK3A 1NLYA 5BW8A 1NP6A 1XCGB 3ZYCA 3K09A 3C8UA 4B3DA 2H57A 2ZSFA 3ZIAD 4X8HA 2XTMA 1NSTA 1M6NA 5B2ZA 5EE5B 3Q5EA 4KAXA 4RVCA 1NIPA 1N6NA 2F1HA 1G6OA 2P5TB 3B5JA 1CLUA 5HCIA 4IDHA 1GM5A 4BWYA 1AKYA 2BDTA 2NO6A 3EIQA 2JLWA 2ZE8A 2W2XA 3T34A 2V9PA 3RVBA 3SEAA 3CONA 4YMTA 2J45A 4DSNA 2AXPA 2VF7A 2A5FA 1HUQA 4LWZA 3MCAA 4LY6A 3B1YA 4BLRA 2JJ1A 4PO1A 1E99A 3U4QA 2GXQA 4QBHA 1OHHA 2F1IA 2C5LA 4IOJA 3B85A 4ZV4A 3TGPA 1E96A 3DM9B 4Q4JB 1UKZA 2ERYA 1OFHA 1CJKC 3L0SA 2VH5R 1XDBA 4Z1MD 3TVDA 4OQMA 3ASYA 1OYYA 2C77A 3SHWA 2WJHA 1Z6AA 4BUJA 2ZU6A 4TL8A 1NVVQ 4MQBA 3VU9A 3ZS8A 2QT0A 2EFEB 2J7PD 3CNOA 2EU8A 2XSZD 3FB4A 2JIZA 3R8FA 3AV0B 1P3JA 5DNYB 3QQ5A 4DCUA 1XPRA 2ZRBA 1YQTA 3VMFA 4EFLA 3GLIE 4Q19A 3H1TA 1IBRA 4HZIA 3SR0A 2PCJA 4URZR 3GEEA 5G3ZA 4W5WA 2EWWA 1EWQA 2E9SA 3HU1A 1FNNA 2NGRA 2RGNC 1P2TA 5IT5A 4HEJA 2QNRA 2QN6A 2J9RA 1IXRC 1SVSA 3WMFA 2ZRMA 1HQCA 4XOIA 2HV8A 5BYJA 2D4HA 2JLZA 4LUCA 1NVXQ 1XF9A 1XBTA 4US2R 3A1TA 3GFPA 5JSZB 2H5EA 4JLMA 1OJLA 2GA8A 3ND9A 3GLFE 2JJ2D 3K9GA 4ITRC 4RD4A 5F9FA 3IPYA 3BERA 3V4FA 4TQAA 1T3HA 3GJ0A 4GMDA 2VEDA 1ZC4A 4O25A 1WF3A 2O8DB 4Q1EA 4URXR 2RGEA 5DYIA 1YZNA 3NBXX 2ODBA 3EZ2A 1KMHB 1JPNA 2JDIA 4KJZA 1GOTA 3CM0A 5L3QA 1W1WA 3PQCA 2ZPTX 1KOFA 2Q9AA 1NJFA 2VIIA 3Q8XB 4KFUA 3RWOA 2JLUA 1XXHB 1E79A 4B3FX 3NXSA 3T61A 4IVQA 3REGA 4HLUC 4DC9A 4U00A 3IO3A 4XWOA 4NL4H 4J0QA 4QBGB 4H1VA 2CDNA 3CH4B 1DAKA 5KUTA 3Q72A 4B34A 2A5JA 1JR3D 2DFNA 1NN3A 1T5IA 3GLGB 1OH5A 1NN1A 1K8RA 2JASA 1U8ZA 2ZSAA 2ORIA 1FOEB 1VDZA 3GFOA 2J5XA 4BLTA 1EESA 1MH1A 3TH5A 2F9MA 2QSZA 5CB8A 1R10A 3OAAA 3ZVNA 4XIGS 3M6AA 4E22A 3ZH9B 2ZE5A 3I92A 4V03A 1XMVA 2IYVA 3OEED 1FUKA 2JGNA 3UWOA 1E2IA 2XNDA 4DB4A 2IYXA 4N3NA 3B1ZA 2JEOA 3NKVA 4PSKA 4RD0A 5JMTA 1P73A 3LLUA 1RRFA 3PEVA 5L3SA 2FX3A 4Q66C 3UMRA 2G6BA 4OJQA 2OEPA 1D2EA 4PQYA 4O2LA 3EG5A 1CBUA 1KTVA 2FEMA 5BN3A 1Q1BA 4KXFB 3TW4A 4C0BA 4ZCMA 3DOEA 3CRMA 4IOMA 4F7WA 4NYIQ 3O8DA 4HAYA 5KO2A 3FHTA 4PXAA 4LV6A 4IEEA 5KDLA 3KKNA 1OH6A 1NI3A 2H8KA 2GCOA 4NU0A 2YNMA 4IDOA 4MA4A 4UKDA 1SXJC 5B57C 5KTYA 4QJ3A 2IXEA 1FP7A 4LRWA 5CYOA 3WY9A 4XVQA 5IK2D 3RS3A 1Z6YA 4KCGA 4NBSA 1BIFA 1UKYA 1TUEA 1VMAA 3AVTA 1KI1A 3N2EA 4A2WA 2C99A 4TSFD 1YZLA 2GZDA 2QQ0A 4EPRA 2ASEA 3HR8A 3GLIB 3RS0A 4E5UA 1N6PA 2OILA 1NRJB 1VCNA 1S1CA 2QMUA 4RFVA 5CLLA 4F38A 3K70C 2ZEJA 2IHYA 2C98A 2GF9A 4L16A 1NVVR 3D8BA 4UXIA 3SI7A 1P2VA 1ZYUA 4B32A 2MSEB 3EZ9A 2G88A 1D9XA 1KI9A 3AH8A 3ADKA 2GCPA 4PPFA 4DZZA 821PA 4DT1A 4XVUA 3QPUA 2GNOA 2P2LA 4MKHA 2RAPA 5EZ6B 4DIDA 5EQTA 2R65A 1FX0A 2G0TA 4HZUA 4JLAA 5FBQB 1ZJ6A 3TBKA 4M9ZA 3SBEA 4BZPA 2GXUA 2OG2A 1LB1B 1Z29A 4YLGA 3ZDQA 2A5GA 4HDQB 1A5TA 2WM9B 1WXQA 1GKUB 1X1RA 4AY2A 4B2LA 2MMGA 4YMWA 2PX0A 2O8EA 1FUUA 3I3SR 1II8A 1UKEA 1XTKA 4Z8YA 2C9OA 4D0GA 3CPJB 3REFA 4Q7LA 2WPDA 1JQJC 5KHOC 4CF7A 4A8JC 1MR3F 3PV0A 1YZKA 1O87A 3CZPA 2PL3A 4FMBB 2BC9A 2HJGA 3WBJA 3TKLA 4YDHB 1QHHB 1AM4D 3IILA 3RYTC 2A2ZA 4XVRA 1YR8A 3FPAA 1OKKA 1SXJB 2AR7A 3DMDA 4I1UA 2VHUA 4GPTA 2YINC 1OB5A 1PUJA 4KLZA 4FN5A 4PHFA 5D3QA 1Q3TA 2W2VA 3EXAA 4A15A 1PV4A 1SVOA 4E03A 1DAHA 1ZAKA 4MRPA 3EPKA 2RGNA 3MWLA 4RCZA 3JZAA 3VR6A 3GLFB 1N0VC 4EPWA 2WAXA 3F5FA 4NHOA 4CRWB 3NHAA 2HLDD 4KO8A 4EAQA 4C7OA 5FTLA 4TTPA 3U7EB 4JKYA 3WBKA 2ZXUA 3EPHA 1DAGA 2GXSA 3K9HA 1QBKC 1FP6A 4B74A 2XTZA 3KB2A 1L8QA 5LBIA 4G3XA 3SYLA 3FGNA 3L8ZA 4Q9JA 3QXCA 4W5JA 2ZS8A 5HE9A 4TLBA 1GKYA 1KK3A 4TT3A 2EYQA 3B78A 1ZMXA 4M9QA 1VYVA 3LXXA 1WB9A 3X2SA 1KIMA 1CJMA 2B6HA 4PHTA 4C2TA 4Q4AB 2AHOA 1RE0A 3KXLA 4W5HA 4POAA 4PR0A 2OHFA 2ZRNA 3CRVA 1Z28A 2MMCA 1P72A 2QI9C 1DS6A 2FGKA 3HU2A 4UNNA 1A7JA 3F3YA 4GOXA 1K6MA 4D6PA 4CEIA 2IS6A 4B2PA 5EP3A 2O8BA 3X1ZA 2W6JD 3I62A 1E9EA 3UKDA 1UKVY 2RMKA 5L3VA 1KDRA 4C0HA 1KK0A 3BH6A 2REXB 2ZJAA 1QVRA 2QGZA 3QUSA 3Q85A 1HT2E 1UEJA 4BLSA 2NMVA 1G8FA 4JT4A 2C95A 4TMXA 2C78A 1JNYA 3UXMA 1P4SA 4A4DA 2P6UA 5KDDA 2BMJA 4RD6A 4ZPXA 1JPJA 3RSOA 3CB4A 3LNCA 3EC2A 4PSAA 3TJZA 5GJWC 1W0JD 2D06A 2YWGA 3MMPA 3RS5A 3OAAD 1JEDA 1G5PA 2WWYA 3CWZA 2ZJYA 4G5GA 4B48A 1GP2A 5AUPB 3K0SA 5EZ5A 2C04A 1XX6A 4D25A 4TMVA 2SHKA 4TZ6A 2PBRA 2D7CA 2QA5A 3EW9A 3PENA 2GXAA 3WXMA 1NG9A 1KI8A 3A6PC 1G18A 4JSYA 4LHWA 3R8CA 5K8TA 3DOFA 3KKPA 1UBFA 3PR1A 1JXOA 5FBVB 3BRWD 3WYGA 2YHSA 5TARA 1YVDA 3HDTA 3SJCA 4KODA 3OIYA 1W0KA 1Z0FA 4AWXA 1DEKA 5IHPA 3K9LA 3AVUA 4LBWA 3D6TB 1CR1A 3CWQA 4MGIR 4HYYA 1MO3A 4A8JA 3PUVA 1RYHA 3MGCA 2F9LA 1TQDA 1E2KA 2QZ4A 4GZMA 5FOTA 2KBEA 2AD5A 3C14C 1I2MA 1ZC3A 4HDCA 1E2LA 2HT1A 1W47A 2UVQA 1TTTA 4JBWA 1N5IA 1N5LA 3SHFA 1XP8A 1GILA 2BM0A 4NKRA 2AKAB 1KNQA 1N2CE 3BFKA 2XB4A 2CBZA 3PUZA 5FOWA 1C9KA 4G5RA 4QRHA 4M1KA 4K46A 1Q22A 2FJUA 3KQHA 3A58B 2O8FA 4UJ5A 3LDAA 3AVYA 2FSFA 4G5OA 1G3MA 4WXRA 2HCBA 4FMDB 3KQUA 3C5CA 3HYTA 4UQOA 1P6XA 2GZHA 2Z6VA 4IRUB 4BZQA 1N6LA 1FNMA 3D31A 5L3QB 5EUQB 4DEYA 2VTKA 2WIAA 3B7GA 4Q1AA 2OUKA 5J40A 2ZI4A 1GUAA 2DWQA 2FE4A 3TUZC 1GNRA 5LDDC 4FWTA 4TMKA 3CF6R 2ZROA 3KUDA 2A7QA 1WBDA 2J7PA 1E4VA 2FMXA 2I3BA 5FOUA 3U60B 4BFUA 4PPNA 3F0TA 3L0IB 2VHCA 1SXJE 2JLRA 3I72A 5BN4A 3OFNA 2XB2A 3PEYA 5GJCA 4Z1MA 4NE2A 1GSIA 4D0LB 3VHLB 4R2HA 3RS7A 5BN5A 3B82A 5IF9A 2D3WA 1P2UA 1KJYA 3UG6A 3B9QA 5TDHA 1XEWY 1UAAA 4GNKA 4IOKA 2BBTA 4NCHA 3B6EA 1Z08A 2ZR0A 2ZI7A 1E9DA 1SGWA 1XEXA 3CLVA 4P4UA 1CJUC 3U7FB 1S96A 4JT2A 2JDID 2QM8A 2OO7A 1SZPA 4PZYA 5DIFA 3VX4A 4D2IA 4AI6A 3PUXA 4Q1CA 721PA 1JJ7A 3GLHB 4G01B 4JSTA 1GRRA 1XTIA 4URWR 3BD9A 3M4YA 2G1KA 3C4JA 2CL6X 3HWSA 2IUSA 5A5GA 3UK6A 2R8RA 4JVNA 1G8GA 1E9RA 2DFTA 1D5CA 3FMFA 3CO5A 1J90A 3MAAC 2CVHA 2F7SA 4X8LA 1WCV1 2B21A 2CHGA 2EW1A 1KDOA 2Z5FA 5FBRB 1ZNXA 3QY0A 1EFHA 4NYMR 3ONWA 4BFWA 3EX7C 4BASA 2OLJA 1AGRA 4ILEA 1R0ZA 3DO6A 3I1FA 4UNRA 4PC2A 1OW3B 4IVPA 4AYWA 1D8TA 3AF3A 4LHZA 1W44A 2UKDA 4LGMA 5FBLB 4EJSB 3U3KA 3T1VA 3UMSA 1R5BA 3LLMA 4MYCA 1I4DD 1Z6XA 1P62B 1W2GA 1XPUA 3DKVA 1RPZA 1TQ6A 4XSGA 4IDNA 4W7SA 1FQJA 1KO8A 4Q9KA 3SJAA 3GLGA 3V4RA 5FR1A 4MYHA 1G21E 2O5VA 1JI0A 1WRBA 2CXXA 5G41A 1KAGA 4B47A 1ZCBA 1KY2A 3AKDA 3QJYA 3QKSB 4TLEA 4A2PA 4DDUA 1XFAA 3O47A 4S2EA 4AG6A 1QHYA 3GJ4A 3DM5A 3RANA 4AG5A 4A6PA 3KKOA 2QAJA 4C9BA 5JWHA 1Z5ZA 4D4KA 5GVSA 4A2QA 2IYYA 4B43A 4YMVA 3AVXA 1BMFA 1G1MA 2HCJB 2X2FA 2VP9A 3Q3JB 4QXAA 3VHXA 1Z0KA 1IXSB 2ZJBA 2BM1A 3DPUA 3P4YA 1XJQA 2A3RA 3GD7A 5A4JA 4KBFA 1KZ7B 5FOSA 1G7RA 1LVGA 3OEEA 3ZZ0A 2RGDA 4R7ZA 1JECA 3SBDA 3TVTA 3MFYA 1YR9A 1M74A 3Q9LA 4M53A 3ZD6A 3KB1A 3F8TA 5J4HA 1Z0IA 2R6FA 4L5BA 3UANA 4OJKA 4N1AA 1TPZA 4K81B 2TMKA 4P32A 2JLYA 5FFMA 1F48A 1QRAA 3CUEF 4QHTA 4DB2A 1Z3IX 1TEVA 4S35A 1N6KA 2ZAMA 4KFSA 1TADA 1CR2A 1DO0A 4TYWA 4C0QC 4ESVA 3KFXA 2AD1A 3OEHA 2IX3A 1CULC 1NKTA 3CF0A 2FF7A 5JRJA 4LJAA 4MGZR 4Q02A 4GBMA 1E0AA 2XEXA 1BS1A 1KGDA 2NO1A 3P20A 3D7MA 1Z8FA 2RHDA 5DH9A 3A1VA 5HR5A 5FTJA 3TMKA 3BB1A 1MO4A 1B23P 3L0PA 2O0JA 5FTMA 3RRNA 4B6FA 5JZVA 2FDCA 3AEZA 2X19A 3QIAA 3TE6A 1IY1A 2AL7A 3P27A 4OQFA 4QJ5A 1S3GA 1AGPA 1PJRA 4Q4LA 2CNWD 2K5UA 1GNPA 4LYFA 5LD2C 2OE2A 1FQKA 1ZM7A 2BJVA 2IYTA 3FKQA 1X1SA 1GL9B 4ON9A 4XTCS 4V0OA 3ZQ6A 2V54A 4JYCA 1XMSA 1EG7A 2LWIA 4NP6A 2ODWA 3KFVA 1SHZA 2ZU0C 2WVJA 4KU4A 3VR3A 3QENA 4A82A 1CEEA 5ELXA 2O8EB 3LAWA 2YYZA 4G1UC 2E1RA 3ZQJA 4NPHA 4PPGA 1N6RA 5EJEA 2XSZA 3LY5A 3GFTA 4CYMA 5AUOB 1Q57A 1ZNWA 4OKSA 3SFVA 2FH5B 1KI7A 3ETLA 2IK8A 2OCBA 1AQYA 1JQLB 4LCBA 2JAQA 4LX0A 4NYJQ 2AFHE 2WWXA 2OCPA 4DSUA 3A4NA 4JL6A 4TL7A 3ADDA 1Z6GA 1V5WA 4ZKEA 3W5IA 3TRFA 2BBOA 3PG5A 3EWSA 3EC1A 4JJKA 1PLLA 4OK5A 1OF1A 3GQBA 4QBFA 4Z51A 1T0HB 1YU9A 2ZUCA 4OYHA 4N0DA 3AVPA 1OXXK 3CBQA 1H8HD 1US8A 2R6CA 2J0UB 2XGJA 2QQEA 1NL3A 5DO9A 1NLZA 1QVAA 5FR2A 2CCJA 2NIPA 4RFSA 4WZ6A 3K0FA 1QZXA 1XD9A 1MOZA 5KPJA 3BJIC 4U5XA 1AA9A 2ZSEA 5HPYB 3E70C 4KLNA 1MABA 1T3LA 1UDWA 2AWNA 4TYQA 4A6XA 1W0JA 1F3OA 2QAGB 3PVSA 1US8B 1WMSA 2BIFA 2CHVA 2OFOA 4XWKA 4HAWA 1CRQA 1KK1A 3K8YA 3SFZA 1ZM3A 3AVWA 2QP9X 3GEHA 4DSTA 3PUWA 3RABA 4NCJA 2VQSA 4TLAA 1GIAA 1XXHA 4QM7A 4TWZA 4L15A 4WAUA 4KVGA 4HUTA 4EKDA 5J4KA 1IQPA 3GCGA 2BOVA 2ZS9A 3KDSE 2QU8A 4MKGA 2J0QA 3X1DA 1OKKD 3CRW1 1J70A 2GJ8A 3THXB 4Q4HA 3BGWA 2GWHA 4F91B 1R5OA 5JCZA 2EVWX 5EXSA 1IY0A 4QNRA 1D9ZA 4QGGA 2GVDC 4FCWA 4LHYA 4XWAA 4Q47A 5CLQA 4N0EA 3QXHA 3S1AB 3H0KA 2QPTA 1G17A 2QE7D 3GJ7A 1OXTA 3AUXA 2IWHA 2UZIR 1T91A 1KMHA 3Q7QA 421PA 2DB3A 3QEOA 3QNUA 2VF8A 5JLJA 3GLGE 1G8YA 1F2TB 2ERXA 2F1RA 4RY2A 3B13B 2ZI9A 1EFRD 1U9IA 2A9KA 2IYLD 5G3YA 2FZLA 2ZR7A 2WAYA 5E7IA 8OHMA 4LJYA 1G3UA 1T0JB 2IUTA 4QBIA 4DCVA 2ORVA 4RKEA 4E09A 1T3SA 5E4FA 1KO7A 4EDHA 1YKSA 5AJXA 4M21A 4DCNA 1KI3A 5FL7A 1Z63A 1EFCA 4ZDJA 3THYB 1S9HA 4AYXA 3DL0A 1CP2A 4DCTA 3NH9A 4LHVA 1FTSA 2B92A 3BXZA 2AX4A 2O8CB 1M7GA 4KI0A 2IWRA 3UWKA 3IDQA 2KSQA 4CT5A 2GILA 4LDJA 4AC9A 1ODFA 2RH5A 1W36D 2KJQA 2WMOB 3FFAA 1M8PA 5CB6A 4TYNA 2JLVA 4HB4A 4QGAA 1SXJA 5H70A 2BCJQ 4BECA 1TUIA 4TLCA 2QEQA 4P31A 1XTSA 5B64A 3KZ1E 1JAIA 2QPOA 1AS2A 1N5JA 2OXCA 2ONJA 1ZNZA 1W4BA 521PA 1OIVA 4I4LA 1ZP6A 1G19A 4BEBA 3ICQB 1TF2A 1R7RA 2BCGY 3N70A 3CPHA 4B3XA 3AP3A 1LY1A 1SVWA 4YDSA 4D80A 2C03A 1ANKA 2CL0X 2N1BA 4CEHB 1DAIA 1II0A 1W0KD 3TAHA 5CJ2A 4HLCA 5SZHB 1CJTC 2BKUA 1ZRHA 2X2EA 2ECKA 2Z0MA 3BE4A 3U6BA 1Z0JA 4BLPA 4NYJR 3VKHA 2ZAOA 4ARZB 1N6HA 1TU3A 2RHMA 4LK2A 3CIOA 1W36C 3KTAA 4G5SA 3FYHA 2AXNA 5TB5A 1W49A 4Q21A 5DN6A 2KI5A 4Q9HA 3D3QA 4ACAA 5JJKA 4RCYA 2GDJA 4JS0A 4DCSA 1IJFA 4PZZA 2B8TA 4CGZA 4OI0A 1SVKA 2EFDB 3EZ7A 5FPTA 1Z22A 4EJSC 3QKRA 1L4UA 3LXRA 1Q20A 1VG0B 1ZM2A 1QG2A 2CE7A 4Q7JB 4JLOA 2OXRA 2WSSD 3U44B 1A4RA 3FWYA 3BS4A 4DLUA 3U3OA 4BZXA 4ZDKA 3R9XA 2ZVQX 2V3CC 121PA 1E2FA 2P5SA 1NN5A 2IYRA 3B2EA 3THYA 4LPSA 1GKIA 4WBSA 1G5RA 1SVMA 2X1VA 3AF2A 3U3MA 5JHHB 1DG3A 2QMOA 2ZYVX 3HU3A 1U94A 3AB3A 2CLSA 5AJZA 2MSDB 4GSYA 4GOJA 2XITA 3GJXC 4B73A 5LD2B 4C0KA 1ESNA 2CE2X 1BMFD 1G5TA 1OV4A 2R6GA 5CDFE 3VNVA 1QHGA 2ZJ8A 3I32A 1YR6A 2CCKA 3E2IA 4HUQB 2FFHA 4QG7A 5HZKA 2DBYA 3K0AA 3T35A 3CF2A 4C7OB 1AN0A 1X8LA 4PHGA 5D3MA 2HLDA 1JBKA 2V7QD 3CKLA 2QSYA 2RKOA 1ZUNB 3KUCA 2A5YB 1E1RD 4M1MA 4PZLA 2IF2A 2VO1A 2J46A 1IONA 1RJ9A 4URUR 4ZO4A 5LPNA 4A36A 3QKTA 5FTKA 3OE7D 2P0EA 4UNSA 3N2IA 3KKQA 2OFWA 1M7BA 5TVKA 4YMUA 2YV5A 3LW8A 3W6PA 1G8HA 2WSMA 4ZIRA 2WTUA 3SYKA 5EE0A 3QF4B 1NLFA 1A2KC 1QHXA 3TNFA 4F4JA 4ZCIA 3WHKA 1R8QA 3A8TA 3BK7A 3L0OA 1VIYA 3B1VA 4BE7B 4HAZA 1BKDR 3IHWA 1KI4A 2QAGC 4QHSA 1TMKA 1W36B 2NO7A 3QSYA 2KE5A 2FA9A 2FG5A 4GP7A 3QKUA 4TLDA 4V0NA 4TL6A 4Q9IA 3A37A 3TQCA 1G4AE 3A36A 1GG2A 2WICA 5CIWA 2NPIA 1F2UB 2WJJA 1J8MF 1G4UR 3RSLA 2J59A 4DLSA 4QOSA 1P2SA 2VSXA 3DVLA 3HR7A 3THWB 2WBLC 3LBIA 1D6JA 3IIMA 4P4SB 1PZNA 1KJWA 2QE7A 2QP3A 4I1OA 2ZTSA 4MITA 1E94E 2FPMA 3T5GA 2F43B 1VCIA 4HDOB 1E79D 4HB3A 4C0JA 1ELOA 1ZIOA 3AF1A 1AS0A 1FL9A 2G0NA 3CPEA 1S1MA 1IY2A 1KDPA 4MKFA 3NEYA 2H16A 3CW2A 1F2UA 1F6BA 3NTUA 4HI0E 5BYKA 2V8OA 1UADA 2WPDD 3ZD7A 2WOJA 4KYIB 3W8NA 4MRVA 4GFDA 1MV5A 2J0UA 2KB0A 2PZFA 1G7CA 3RC8A 3WYFA 4D0NA 1VTKA 3WHLA 3CX7A 2BEJA 4D82A 1UBEA 2NZ8A 2UZ3A 4LJ4A 2E87A 4BEJA 5DISB 4ZDIA 3U5ZB 1JR3E 1ZM4A 5UKDA 1JB1A 1ZU4A 4B3BA 1QHIA 4MDEA 1YZTA 2IS2A 3NIBA 3FHOA 2EQBA 3L43A 4MKIA 2GCNA 4C0SA 3L2OB 1Z83A 1OHHD 1RRGA 4NONA 4ERNA 1R6BX 3IIKA 1CXZA 1X86B 3GLFA 3BWDD 5A0FA 5E3HA 1NVUQ 4DUGD 1WA5A 4WVFA 4JLKA 1S3SA 1N25A 1R0YA 1VG1A 2ZRAA 2RCNA 2VPPA 4Q03A 5JI2E 1H8HA 1B0UA 3PUYA 5GADl 4PQFA 1LW7A 3CH5A 4GRAA 3AUYA 5DYGA 1ZUHA 2QTHA 3RRMA 3E5HA 4CIDA 2XZPA 4CVNA 1EWRA 2CCGA 1P9RA 3OESA 4FMCF 2NTYC 2D7DA 4CT4B 3QE0A 2J7KA 4Q1DA 2VHJA 1AQUA 1E2NA 4R98A 3W5JA 3ZZUA 1Q1ZA 3EZ6A 4K8OA 4LYAA 3FMOB 1OFTA 3SOPA 4AKEA 1W4RA 1M34E 3MJHA 2WKQA 2CLCX 2GEUA 3DKPA 3EASA 1TU4A 4FW9A 3ADCA 1VCMA 2OFXA 2WWWA 3A1SA 4CZ2A 3I5XA 2F43A 3IQWA 5JS8A 2BV3A 1E3MA 4ZCLA 3P26A 2DWOA 2IYUA 4IHQA 3VR4A 3B8HA 1GRNA 4AIIA 2WKRA 2NO0A 5J4LA 5C46F 3TSOA 3LVQE 4KBGA 1D2MA 1GVNB 2YOGA 1HE1C 4LJ5A 3VQTA 3W6OA 4OI1A 2WWFA 3T06B 3VKWA 3GPLA 4QM6A 3LX8A 1E2EA 1W7AA 2O0HA 2BMDA 3ZIAA 1NVWQ 4AYTA 2WJGA 2IC5A 4V0ME 3UATA 2DFLA 2X8AA 5CK4A 4BRWA 2ZANA 5JS7A 4MRSA 3FDIA 5EUMA 4YC7A 3BH7A 1FW6A 2ZR9A 2Q3FA 1S4QA 1E4YA 3MJRA 1I2DA 4Q7KA 3OE7A 4Q5IA 1HEIA 2I4IA 3SZRA 3ZGXA 1FMJA 2F6RA 1SHKA 1E2GA 5LB2A 3V00A 2GF0A 3FHCB 3TQFA 1ZD1A 1XD2A 4RFSB 2ZUDA 2Q6TA 1RW4A 1KJZA 3K0CC 4YONB 3AKCA 2PX3A 1XMJA 1FTNA 2V55B 3U3JA 2Q9CA 1Z2AA 4RJLA 3W6NA 2V7QA 3OF5A 4PTLA 4HATA 5EP2A 5CDFA 3BB4A 5JSZA 2CMKA 2ZRKA 1N0UA 2H7VA 2JA1A 1KHTA 4L4UA 4MUBA 4RZ2A 4CEHA 1CKEA 2XOKA 2GBLC 2FZ4A 2ZREA 4KVAA 2CK3D 3GJ6A 3DHWC 1P75A 2QP4A 1G3IA 4A0FA 4A1FA 2V4ZA 4EPYA 1Q21A 2O8DA 4A9AA 2GEVA 1ZNYA 4B75A 1WQ1R 3T1OA 4D4JA 5L8VA 2ZJOA 5DSZA 4OHXA 4OQLA 3PJRA 1TL7C 2DY1A 4NTZA 4DKXA 3TLXA 2GEDA 2V1UA 3EA0A 4TTQA 1KO1A 1OSNA 2RGBA 3RHFA 4YMSA 4CDGA 3G0HA 2J87A 2ZI6A 2ZIAA 3K70D 3P4XA 1IAQA 3W9YA 3RC3A 3R9WA 1XU4A 1AS3A 1Z07A 4DXAA 1RRCA 2V6JA 1C4OA 1KSFX 1ZCAA 5E7JA 4QHYA 1LS6A 4OHZA 2XAUA 2IS1A 1NMYA 2GJKA 1G7SA 4M1SA 3KL4A 3ICEA 1RVDA 4II7A 1J7KA 4FINA 1IXZA 2XNDD 1E9CA 4PQRA 2Y8EA 4RD3A 2VBCA 2FPKA 3EIHA 2NO9A 4C4PA 4GP6A 3I8SA 4LSGA 5KSOA 3I73A 4TTRA 4M22A 3GP8A 1KK2A 3GJ5A 2RGGA 4JZKA 4TMTA 4LJ8A 4I1SA 5M04A 2QG6A 1XJ0A 4NDZA 1EFUA 5L3SB 3AVQA 4LV5B 2W83A 3WYAA 2XXAB 1RJ9B 2HF9A 4MRRA 5DHFA 3VFDA 2PEYA 1JR3A 3M1IA 4UNQA 4Z8XA 3ZJYA 3JZMA 1RRPA 5KNBA 3NC1C 4Q1BA 1LNZA 1OXSC 5KSZA 3IBGA 3SE0A 4BPBA 4JVMA 1NNEA 2BJWA 1XTQA 1X8JA 3SDZA 5JHGB 1KI6B 3IKJA 2J0SA 3ASZA 3AF0A 4BFZA 2LCFA 2IL1A 3UIEA 4WA7A 4DLXA 2BWJA 4ZI2A 2WWIA 5AK0A 4IW3B 1J8YF 4EQ6A 4L9WA 4AKHA 1VHTA 4PO9A 4LJ6A 2GAAA 2DHRA 4Q01A 3OIWA 3QBTA 2ZE7A 1OFIA 5FPKA 2QAGA 3NWJA 5KDOA 4QKQA 5CM9C 2ZSBA 3AGPA 1XCMA 2QUZA 1AZSC 4ASUD 1N6OA 2PCLA 4URYR 4DWJA 3AP1A 4P33A 5TMPA 1WBBA 2QBYB 1RZ3A 3E1SA 3WMGA 4DLYA 2BMEA 4C2UA 4GT1A 1SVIA 4A8JB 4M1TA 2QORA 5J47A 4ACBA 1II8B 5KPDA 4GDFA 2RGAA 3QOFA 4IVRA 1HQYE 4LHXA 3HP1A 2O52A 1DARA 2REOA 1G16A 2NZJA 2JCSA 2WZQA 4OQXA 4G5QA 3QKRB 5F3WB 4DDTA 4TYYA 2ZRCA 2YZ2A 2ZI5A 4LBVA 4TL9A 2QTVB 3A1WA 4YQFA 2GAOA 3B9PA 5KSYA 3ZVMA 1OH8A 1P5ZB 1KI2A 2QBYA 5F9HA 2VP2A 4NH0A 5J4VA 2BVNA 5AWFC 1L7VC 1J2JA 2XX3A 2GJAA 1S9DA 3NBZC 1ETUA 1XZPA 1XXHE 1FFHA 4HLDA 4JL8A 2IXGA 3LBHA 1H8EA 5L3RA 4IKEA 1HH4A 2C96A 1QDEA 4LBYA 4PO8A 4BLOA 3KKMA 1LFDB 1HY3A 4KHZA 3CX6A 4NCIA 2YVUA 3J81k 1T8TA 4FCVA 1OPXA 3VAAA 1XD8A 3K70B 5JRZA 2P6RA 1COWD 3PFIA 5BQ5A 1DPFA 1II9A 3PXGA 1DAEA 4DJTA 4Z54A 2OLKA 5P21A 2JLSA 3UMFA 4CW7A 1XPOA 3ZZTA 3WP0A 1CR4A 2Q3HA 3VR1A 2B7CA 1H8ED 4D26A 3KXKA 2W0SA 4G0NA 2EFCB 2VP5A 4QC2A 1XNJA 3TR0A 3TUIC 3LH5A 3FMPB 4XD7D 1JJVA 2QMEA 2LKDA 3H84A 4MGKR 3GLIA 2HXSA 3MSXA 1CJVC 3A4MA 1ZD9A 2QRNA 1M1YE 1XEXB 3OFND 1E0JA 2PJZA 3IUYA 4C0AC 2IF0A 4D4MA 1V43A 1Z6TA 2HF8A 4B2IA 4DLTA 1DO2A 2W00A 1ZW6A 1SULA 1OXUA 4IFBA 1VPLA 1GZSA 1P61B 1JEEA 1GFIA 4PC1A 5AUQA 4BFYA 2GCOB 4FXPA 3QXSA 5H68A 2O8BB 4JYBA 5G40A 4OI4A 2GTPA 3KQNA 3K1JA 4QL3A 3H4MA 1CF4A 1CR0A 3BOSA 3K53A 2D62A 2ATXA 2VP6A 1R0WA 2ZRFA 3OEHD 1OIWA 3K0EA 3NEJA 5JJIA 4PAQA 4Q1FA 3SJZA 4NYMQ 1GDDA 2L0XA 1DVRA 1G3RA 2I1QA 3C16C 3X1XA 3QXJA 2AN9A 3B1WA 2IS4A 3HPQA 4O2RA 1P9WA 5C2JB 2HDNB 4F92B 2D74A 5SZKB 2QROA 2P3SA 1CS4C 3NBFA 4LYHA 2ATVA 1E2PA 3CX8A 4EPXA 3EA5A 1RYFA 1KY3A 1U81A 4TMWA 3SN6A 1IJEA 2YWFA 4BFSA 2CJWB 5FOXA 3QPWA 3WNCA 2HXYA 2QGNA 3I5YA 1DADA 3JVUA 4F93B 4LJ9A 2ZRDA 1DG1G 3WMEA 1KYIA 5G53C 2YOHA 1NSFA 3WRYC 4XSHA 5GJVC 1ZU5A 4M8NE 5K8UA 5F2EA 3W8RA 3P32A 3KJHA 1G20E 5CJPA 5C4MA 4LI0A 4MGYR 5KSPA 2GK7A 2WWHA 3IBYA 3KQKA 3MD0A 1M7HA 4DRZA 1AIPA 1S2MA 2DCUA 4M4SA 4KITB 2BKEA 2ZJ2A 3MWYW 1EX6A 4DLZA 3LBNA 4HAXA 2FFBA 3WNDA 2P65A 2QPAA 1CIPA 2FFQA 1Q0UA 1YZUA 2GHIA 2GKSA 4AURA 3T1QA 1QHNA 3DMNA 3R7WB 3QF4A 2C8VA 3W3AA 3U4QB 1YE8A 1Z47A 1L2TA 1SVLA 1E1QD 2CVFA 4MH0R 1XB2A 3LX5A 4D4LA 3WP1B 1HE8B 3QF7A 5IRCD 3HYRA 4LOAA 4JLPA 4DLRA 2DR3A 1T5LA 5EE9A 2OESA 3TSWA 1UDXA 4LJ7A 1VG9B 3HJNA 5JCPA 3LRPA 1X6VA 3NH6A 4H1UA 4C3ZA 1Q1EA 4OI2A 4PAOA 1IN8A 3KTAB 3PCRB 4YXWD 1VCOA 4PFSA 2A5DA 3QPVA 1P7CA 2HYIC 1U0JA 1Q12A 1QF9A 3EAQA 4UXJA 3U61B 2H92A 1VYUA 1CRPA 2OAQ1 1YZGA 4EPTA 4US0R 2ZRGA 2JIZD 2NQ2C 3BFVA 2XZLA 5JFGA 3PEWA 3X1WA 1U99A 5JWOA 1GL6A 4IDQA 1FPMA 3AKEA 1NMZA 1QHHA 1NJGA 5FPHA 1XRJA 1TEXA 5AJYA 3FOZA 1E9AA 5B58C 1Z06A 3BIFA 3LVRE 4URVR 5FL7D 1Y3AA 5JEEA 4JBXA 3VNUA 2ZYUX 2OT3B 2EFGA 3LWNA 1JXMA 2J3EA 2Z43A 4V0LA 3ZVLA 2OBLA 1ZIPA 2YKGA 1A2BA 5AUNB 1T6NA 1RKBA
chains in the Genus database with same CATH superfamily
4IDPA 2ZGVA 1L5HB 3SHQA 4WN9B 1L5QA 3BEOA 4JYZA 1YB4A 3LTEA 5EC8A 5EKSA 2XTJA 3PIIA 1FNBA 2WJWA 1WIWA 1T0IA 1ZNQO 1YHNA 2XUHA 4L5CA 4AM8A 2O3TA 5GY7A 3ANTA 1JAHA 1HM5A 4EECA 4L51A 4O0MA 1E2MA 1R00A 1GPMA 1XMIA 3IT2A 4QNMA 4I9UA 3CEAA 3C15C 1BOFA 1E1DA 1E7QA 1XD2B 2F67A 6ADHA 4I1PA 4OHVA 3HYLA 3GYBA 1MO6A 1OLOA 2G25A 2WHYA 3MUOA 1EX1A 1VL5A 4MCHA 4TKVB 4ZI7B 3NVDA 1WCXA 2CLEB 3GG2A 2CUNA 4UREA 1DQSA 2ILVA 4ZAVA 2DR0A 3P1JA 4JBHA 1NMXA 3GPCA 3H6GA 5H59A 4M1WA 1ZKMA 4ZN6A 5JYEA 1H3FA 2APJA 2G83A 1E60A 3DFMA 2GN8A 4FQ5A 2YHIB 2EDCA 4Y9UA 2BFDA 2JJ2A 2W2PA 3DDUA 3LQRA 1U8XX 1ZOSA 2GRJA 3SYMA 1BMDA 2HHCA 3DWEX 3LHFA 2VDWA 1WX1A 3FE2A 1UH5A 5K8IA 3IMEA 2CXQA 5DI9A 1RBYA 2ENWA 2OA0A 1U1DA 2QX7A 3O4IA 2G9NA 2XJ9A 3H13A 3P7MA 4EJSA 5TPWB 4QEKA 4Y1RA 1LK0A 3NHRA 3N59A 4RPJA 3X0DA 1HNWB 1ZD2P 3C8ZA 3VOSA 1XXLA 2D7JA 4YHBA 2GRAA 1QGED 4K9MA 3KSMA 4MVJE 2H31A 4EPVA 1NR5A 3FBGA 5BWMA 3JAWB 2DCMA 1KAMA 3SEZA 1ITZA 2YXEA 4X94A 2Q4BA 1TQ2A 2P69A 3G2NA 3QE4A 3PNVA 3W6ZA 1TZJA 1PWXA 2PS0A 2PZKA 4LY3A 4NQRA 4EG7A 2UDPA 2VZ9A 2YZ7A 3X2EA 3ZU5A 3D3KA 3FRHA 4GE0A 5LQNA 1EGVB 1VKZA 2VDLB 3C1UA 2PLRA 3FLMA 3L1IA 2K2WA 4MLPA 4LVNA 1G6HA 4OJMX 5SYMA 1PR5A 1A27A 3W5DA 1XKLA 5KX5B 1LS1A 3AVVA 3QVUA 1C14A 1EFPA 2PMDA 2DT5A 3WX0A 1CVRA 3FVTA 3VOTA 2VRCD 1U3CA 4I55F 2ET6A 1CFZA 1NE2A 4N47A 1JJIA 3OE5A 2HJSA 2FPIB 2I6TA 2JLQA 4KV9A 4F96A 2GBPA 4H77A 4HB2A 4P3OA 2EJCA 3BBPA 2QN1A 4GWLA 4F7DA 1N78A 1H1DA 2DSNA 4ENSA 4KZPA 1WVIA 4HTAA 3U7GA 2B4AA 1C29B 5EMLA 4FEYA 3UOWA 2FPXA 1CY2A 4V02A 2CNOA 3IBTA 4YGYA 3TLKA 5I47A 3SYTA 5HRAA 2XE8A 3OZXA 3WRWA 5JARA 3EMKA 2Z83A 1ZR4A 5CLGA 5KNDA 1NP7A 1VBNA 2IKQA 1JSLA 2ECOA 4U2CA 4QSHA 1CTQA 1NVKA 2IT1A 3UPUA 3BXXA 2X2PA 2X15A 5DYTA 2CKMA 1TQ8A 4AJ9A 2MSCB 2IBSA 3IUSA 3WIDA 4IHAA 2P77A 3VKUA 4C4SA 4H17A 1QP0A 1QH9A 3QNMA 4HZUB 4FR5A 5ALWA 3G0CA 1AF7A 1WD5A 1D7OA 2YWEA 3KZCA 3R6LA 2C82A 5HTKA 2VSOA 3C7AA 2FNAA 2QTZA 5KYKA 1O3YA 2IPNA 3EGWA 1XJWA 2G77B 1A9SA 2GBGA 3NETA 4LC0A 2RB4A 3M3HA 4PZCA 3WGKA 1FMFA 3LYHA 4BFVA 4D9FA 4DMUB 4ZREA 1T6ZA 3QA9A 5E4JA 5F35A 2XT6A 1TCCA 3NVKI 3JQ7B 4ZHQA 5A1JA 3CZ4A 4MX8A 1BX1A 2D2FA 1VP3A 1ZJWA 2IZZA 1BO6A 5EJMA 1E32A 4OSPA 2Y0PA 1D7AA 1W581 1E6UA 3BZUA 1SXJD 5HGXA 2ONZA 3DTNA 2ZIGA 3QWHA 2UU9B 2XNSA 3VVBA 2ZQYA 5BRJA 3HHPA 5HUJA 3CNNA 3GL9A 3D4LA 3RG2A 1N2OA 2KBFA 2YV1A 2BGTA 1GN8A 1GY8A 1H2HA 2M1XA 4MTCA 1MENA 4NCNA 5DM2A 3DNMA 1Q6ZA 3QYAA 4PW0A 4W5QA 4EBBA 5BOVA 3S1AA 1DNPA 2NUTB 1TK9A 2D5LA 2UVDA 3WIVA 4ZKDA 4EUEA 2NU8B 1BHJA 1LI7A 5FA8A 3KYCB 1DE0A 2MJLA 5JFOA 4UPDA 1ZAYA 2J8ZA 1JNXX 3D4NA 4C6HA 5IDVA 1AMNA 1FSFA 4BNHA 2KWIA 1ODSA 1TLFA 3CJQA 4DR4B 2MSWA 3NYWA 4H3VA 3BUSA 1P17A 1EHIA 1NBMD 5CT4A 1Z5NA 1XVTA 1A77A 2DWCA 2H07A 3PFKA 1WXWA 4DIBA 4YIKA 4BRZA 1UJ2A 1YZQA 3ZDYB 5FP0A 5CT5A 4DGSA 2Z56A 4ND8A 4OQ4A 5KVCA 3QUAA 4E2FA 1OD6A 4QUDA 2IYWA 1I94B 1T4GA 4I36A 3NOQA 3OIGA 5CXUA 1TF7A 2ZWOA 1GNQA 3GHHA 5J4YA 5L6MB 3RFXA 3TL2A 4JX9A 3FYUB 3I4LA 4QBTA 2CGEA 2DUNA 5K6AA 4IVNA 4PFQA 4AO6A 4RDHA 3C6MA 4L8GA 4N48A 5ITWA 1E1RA 3JAKA 4HB0A 3SF0A 4CODB 4NBRA 4H4DA 3W3ZB 2AVNA 5IFLA 2P90A 1U0HC 1APBA 2WK1A 1OFUX 1FP1D 1VKHA 1WXGA 1V8FA 1JGTA 1SCDA 3A3NA 4JLWA 4KWHA 2VJYA 4HYTA 4X60A 5AW8A 2CZGA 3LFTA 2O2XA 2C5AA 4R41A 2OXIA 3CA8A 1TF5A 3MS4A 3QI7A 2VHYA 1TQHA 1TAGA 2NZXA 3C3XA 4J4BA 4LI3X 4DIUA 5BSWA 1A0OA 2CUZA 4EFMA 3KQLA 3R7SA 2C7BA 2GAIA 3VGPA 2ZE6A 3T12A 2OCIA 3HCRA 4UUAA 2LE0A 3QVSA 1YZHA 2GJSA 2PR7A 2PLWA 5JISA 1IN4A 1A1VA 1R12A 3OURA 3M82A 4P54A 1NW8A 1YJ8A 1TIBA 3MINA 2RAVA 1EK6A 5AKIA 4BKOA 2YNMC 1EP1B 1M1XB 4PYNA 3FN4A 4YAJA 2PXXA 4OL0A 2R2AA 1V9CA 4YN3A 1X1TA 1HMPA 1EGQA 4B3MB 1WE2A 3GROA 1RWWA 4X63A 3NYIA 5AHKA 1Z4LA 3I9OA 1RIFA 3E9CA 5EXTA 1P9OA 1TX4B 1NHWA 3A32A 4DDVA 4PPQA 3MT8A 4FFVA 4L0CA 3LT4A 3WOVA 1ULUA 4ND5A 4YPOA 4J91A 4GZ3A 1J9EA 2QM7A 2MR5A 4GP9A 4A6EA 3PLAE 1SQ5A 5DKFA 1G64A 1GUBA 1UPTA 4QU8A 3IIEA 4R2XA 5I9IA 5K01A 1UQRA 2GFQA 3BIXA 4C76A 4DDWA 3VPBA 4AECA 4N7BA 1KQFA 2AJBA 1SG6A 3OZAA 1U0GA 3THWA 1FFBA 1C4WA 4IXDA 1LEHA 4IQ8A 5KKAA 2X58A 3UC5A 2X40A 4AK9A 1JQ5A 2OZLA 1SBNE 2FGJA 3ZGOA 1BWSA 2FQXA 4DPKA 2UXDB 1COWA 3EYWA 4K9DA 4LEIA 1J2EA 1GRQA 2Z4SA 1WZNA 2BTQA 3GEPA 1ZCJA 3QVGB 4I9GA 4YQYA 4DCMA 2OCYC 3Q1LA 1KDYA 4G37A 1EGAA 1MC4A 1XEFA 3FVQA 4X1YB 3RKUA 4Y30A 1S4MA 2X0JA 2IW3A 5CFQA 4BQNA 1G98A 2GSWA 3GLRA 3U7QB 4KR3A 5TY0A 5K6RA 2XNCA 1R4AA 2Y0BA 5E7MA 3HJFA 1M2OB 1QFJA 3RVPA 2YJGA 2D1QA 2IXAA 3GAFA 3IUMA 4R31A 1ESMA 2Q5QA 4QOFA 3GAMA 4H1TA 2DJ5A 3FETA 2OAP1 3HKCA 3O38A 5NULA 3VKVA 1MX9A 5LP1A 4FB5A 1IL0A 1YRAA 3RAPR 3SQWA 3A9SA 1SXHA 3MD9A 5H82A 1QGUA 2F17A 3DOHA 4R01A 2W7TA 3E2PA 3ZH2A 1NOKA 3VX3A 3ZXXA 1NBAA 3FYDA 4EFNA 1LF0A 2E21A 1CYDA 1UM9A 3B1XA 5A4AA 2IP1A 1V8DA 2V7VA 3MLBA 1J39A 1IC6A 1CV2A 1JEOA 4FYPA 5J5CA 3PHJA 4D79A 2I9KA 1AKUA 5EY5B 1EMDA 1JHDA 5IAJA 3ECCA 3FTQA 2G08A 3KSAC 2HQOA 2EFJA 2E4AA 3KWLA 1N36B 2E6KA 3F4LA 1IUKA 2YC2C 2HXGA 4U7DA 1QH1A 2FPUA 4B76A 2A9FA 3Q3EA 3ENZA 2ZIUB 4JVOA 4B6EA 2I6GA 3BH0A 4MARA 4ZYXA 1MHTA 4TM7A 3I0ZA 1DCKA 1T29A 2V45A 1UFOA 3DBLA 4ARBA 2AN1A 1XZDA 1U65A 1PV1A 3K73O 1L7QA 1Z2CA 1U7XA 4EY6A 1SKYE 1XRSB 4XGNA 1H94A 1YRQA 4X92A 2B94A 4FT4A 2ZI3A 1T2DA 1R2QA 3V46A 2IIBA 5CUQA 4OB7A 1ZLXA 3GBVA 4Z9BA 4IV0A 4YR9A 5CIYA 1XZFA 1OFGA 3KD3A 4P3YA 1M33A 3MRSA 5J2UF 1KXJA 3FFTA 1QGZA 3GLHE 1KJIA 2F55A 2FPPA 4OHWA 4DLVA 1R8SA 1ZN2A 2MOKA 3AZOA 3I8XA 3LA8A 1AUXA 1YDMA 4B7XA 3HP7A 3N8GA 2BHRA 2ONKA 3DWFA 4G23A 4CEIB 3ETCA 1M1ZA 5BV0A 3J7AC 2B1RA 4YTEA 1N5DA 3R75A 3T5DA 4DRYA 1F2DA 4B71A 2J48A 4JLDA 3H1GA 1GUYA 3LQ1A 1E0KA 3O8CA 4ZMSA 2BMFA 4U7PB 3UTCA 2ZRLA 5MGBA 1MTZA 3H8JA 3NG1A 5KQSA 2P4UA 3E2MA 1EJBA 3PIRA 5JZOA 2NACA 1BD3A 1B26A 4E21A 2LKCA 1FX0B 5AKEA 1B3RA 1ZI9A 3FUUA 3QVLA 1L5NA 4G8BA 4XX1A 5D84A 4AT1A 1EM8B 1WHSA 2P6MA 1GL7A 5EE3A 5ESRA 1G7TA 1M6YA 3BC1A 5G1PA 3UFXA 4AJEA 4CM1A 4BE9A 4UHHA 3M5PA 2PKCA 2MIIA 5FWAA 4Q34A 2C2BA 1XDUA 1PDWA 2FPOA 5A9RA 1FJXA 3EEOA 3OQPA 1T6BY 1CRWG 1QIJA 1YI8A 2FSHA 2RI6A 4EW1A 1U90A 2AYYA 4R9VA 3PNOA 5AW3A 1TVKB 2JKZA 4HPJB 4URHA 3KR9A 3KU4A 7AT1A 2W0MA 2F3QA 1R0CA 2FRXA 4KDRA 4YUVA 5LWQA 1RI1A 5CPBA 4ZT4A 2EHDA 2Q0XA 2XZTA 1NFFA 1Z3CA 3B70A 3HN7A 1GTZA 1O94D 3D8RA 4BJ6A 4FYWA 2H2IA 1Z68A 4YJ3A 1Y9JA 2HO5A 5HGJA 3BMQB 3I8OA 3ASVA 5JCOA 5DYNA 4Z3DA 3E61A 3JPYA 3I9V1 4WKCA 5JG7A 3ITDA 3VTKA 3PJEA 1XTJA 4BB0A 4UCWA 2XLBA 5DGXA 5EZYA 4MWBA 3M0EA 4P7KA 5DLQC 4ER3A 3FSJX 3FPLA 3EPJA 3D8UA 2LV8A 4IO0A 5TPZD 4BQPA 1UPBA 1D4OA 2GEBA 2JD1A 3MWEA 3CF4G 4NC9A 1XALA 4EQZA 3E7FA 2BLLA 5EKXA 4LF9B 2ZJ5A 1JG1A 2BRUA 2WWGA 1PJ3A 1S6YA 1ZQ1A 3KX2A 3OKFA 4TQUS 5E9QA 1DBPA 2R8YA 4HADA 5KAPA 3KQYA 3K0FB 2WA2A 1PVDA 1JLLA 2WVGA 3V2UA 1M5UA 2JGRA 5HKKD 5ALDA 3PGXA 4TVSA 4RULA 4LYGA 4A0QA 1OBCA 4JUIA 5D00A 1D2HA 4JDPA 4MEBA 2J5QA 3BL8A 1OYWA 3DFIA 4Z7QB 1BCSA 1N5OX 1C9DB 5KB3A 4YACA 3UV7A 1DC7A 1XQVA 3E5NA 3IPRA 1GPLA 621PA 1KSJA 2BFOA 1OOEA 3OX3A 2C9CA 4EZBA 4D57A 4RH0A 3PRHA 2DPXA 3Q11A 3VC3A 4JBNA 4N82A 1I7SB 1W6RA 4BGEA 2XT9A 3MTEA 1BW9B 2IEZA 1L8XA 3SYNA 4W5RA 1HLGA 1V1MB 3LVBA 3V8RA 3NHBA 4JJZA 3Q5GA 1HT1E 4ZIRB 2FSUA 5E38A 4XM0A 3T9DA 4NNPA 3QUBA 1G8KA 1M2JA 3TW6A 2H51A 5JOQA 3TUJC 3ZNNA 1I3NA 1L7DA 4QRDA 2DBVO 1S3FA 2O3UA 1K8XB 3TTYA 1TU0A 1UDBA 2GTHA 3AFMA 1U8AA 3DXZA 4P2BA 3WWPA 5EJGA 3VPXA 4BV3A 3Q88A 3N3AC 1NNSA 2REBA 5EVJA 1TOAA 2PX2A 4U7GA 4XJXA 4CG0A 2P2GA 2W6IA 4L78A 2P4SA 1NUUA 3H1PA 8ADHA 5LP6A 2HIMA 2PH1A 2C0CA 1C3LA 4DV4B 1PFWA 3CG0A 4JBYA 1P4HA 4IJ6A 3CNLA 1C9EA 1DELA 2QI9F 2FMHA 1R4ZA 4Q3OA 4MTLA 3OP1A 3FUVA 1OU0A 2GHQA 4BC1A 4EHNA 4UVHA 3IHLA 2VSFA 1RHKA 4ANFA 4C14A 5E3IA 2PGOA 1S01A 1ZEMA 1NLUA 2V7XA 1QG6A 1UBGA 4MYTA 3TCNA 1AHPA 2R85A 3BXFA 4FZ3A 3EVAA 2GPTA 1JALA 2Z5VA 4ND6A 1GFZA 2KMLA 4LMRA 4YRPA 4BQIA 2C9YA 3VR5H 3R5SA 3AM3A 5JCOC 2A0FA 1GNSA 1NXSA 1NYQA 5CYPA 5K51A 2R6DA 4G25A 1A8PA 1TZKA 1WS6A 2CB0A 2NZUG 3P45A 4LWQA 3HKBA 3KYDB 4MULA 1FW8A 1WSWA 2O8NA 3AK4A 4L8VA 4LW8A 4L72A 4WADA 3THOA 4C4OA 4E32A 3PWSA 4KGVA 1T5HX 1WNFA 2WUEA 4NAHA 4C30A 1ZIYA 1BJRE 2R6JA 3EQ8A 4HDNB 2IPOA 1AKEA 1FYXA 2ZT8A 1LBEA 5G4KB 1DMRA 4UTZA 3ZBQA 1QMPA 2EIXA 3W34A 5K0TA 3DV0A 3RG8A 4B5KA 2IEYA 9ATCA 3V80A 3N5KA 1RS0A 4QTXA 1G8PA 5ENVA 3AOGA 1E6CA 5FOVA 3VO2A 1VJ0A 2XUAA 3E27A 5DBHX 4DUGA 1JDNA 3BMOB 2Q5EA 3EZYA 3E7XA 3LA6A 2WSLA 4J16C 4EUNA 4ZAYA 5A02A 1C7ZA 4RX1A 5JS1A 1AHNA 2QN8A 3PRKE 4TSFA 5ECGC 5LMUB 1Y8QB 1FU4A 3BE5A 1T4CA 5LXTF 3WR5A 3H1AA 2DLCX 1NM5A 1Q0LA 3ZIAD 5BMOA 1TZBA 2XTMA 4NFHA 2Q0QA 4H3KB 5JLAA 4LGVA 1E64A 2WUVA 5BV1A 2AC2A 1N6NA 4AROA 2YTZA 3PBKA 1G6OA 2P5TB 2GTIA 5HCIA 4M9CA 1GPKA 1AKYA 5KI6A 3VAZA 2HW8A 2W2XA 4IQGA 5F9MA 3WGHA 5ADWA 5AOAA 5FA5A 3EXEB 3ZHSA 2WSBA 2XE7A 1Y3BE 4BP3A 2AXPA 3OZEA 4LWZA 3TRDA 4P4GA 1TLLA 1EE2A 3MCAA 2QLBA 3DBVO 3B1YA 1BHQ1 3S28A 4BKMA 1IULA 3QU9A 2J3MA 3AR7A 1YL6A 5LCXA 4GI5A 4QBHA 1NGSA 2B82A 2ZBPA 3WDSA 1PV2A 4DWVA 3B85A 4OLBA 3TGPA 3FNRA 3NANA 1QS0A 1UKZA 2Z8XA 3LBAA 4RIEA 1O5IA 4OH7A 1MOSA 2VPIA 3TVDA 5EAIA 4UE3S 4ZICA 2JFPA 1F6WA 1UODA 2Q6OA 3RFVA 2JAHA 2C77A 3GGPA 4C3UA 3ME5A 3PF8A 4DBZA 5JY6A 1RJFA 1DZIA 1NVVQ 3ZS8A 2CVPA 2QT0A 3FB4A 2EU8A 2Y6UA 5LFAA 2JIZA 3R8FA 1P3JA 2I4OA 1XPRA 1MZPA 3VMFA 4EFLA 1L7NA 2EKPA 3PC3A 4UU0A 5JAOA 2YFKA 5TQ0B 3ZDDA 3FLAA 1MBZA 3SPXA 4HZIA 1YCGA 5IJZA 2K7ZA 4W8OA 1EWQA 2WYHA 1IJKA 5CA0B 2DZDA 3EE6A 2R1UA 2ZCJA 3CEHA 3S7ZA 3Q3GE 2I5PO 1JWBB 4XOIA 5CB4F 1XV5A 1U63A 5HVNA 2K7FA 5IS2A 1XQWA 4HJXA 2JLZA 1DFIA 4XX0A 3N8HA 3UA3A 2GF2A 3GFPA 1JHPA 2VJMA 4JLMA 1L3IA 2XUDA 1PF7E 2QE6A 5LBUA 3TQTA 5AQ1A 4MJXA 2XKAA 1DV2A 3ES9A 4JFAA 3G9UA 4RD4A 4G63A 4DG8A 3U0BA 2VQ6A 1GGHA 3KOMA 1I1NA 4LG1A 1Y4AE 1V5FA 3CURA 5BWNA 5JSKA 2AOVA 3GJ0A 2Q50A 1OMOA 3O92A 3TIVA 4F3YA 2VEDA 1H5UA 4NV1A 1I7LA 1MC5A 3UMCA 2RGEA 1J0XO 3QOXA 3WICA 1E5XA 2NU6B 4OQEA 4GI3A 4CL2A 2V3VA 3ROMA 1KMHB 2JDIA 1VFPA 1OWOA 2WM8A 1MG0A 1CUDA 2PO7A 3KNZA 5L3QA 3UBTA 1W1WA 1KOFA 1PI3A 2V65A 2VIIA 2SKEA 2Q62A 3NHWA 1M2GA 1XXHB 4ML3A 1AV7A 1H2AS 4PXSA 2JGAA 1RLTA 3RJ5A 3WGZA 3E7WA 5HCUA 2FEAA 2ZTHA 3X3HA 1LBSA 1QFSA 3PHIA 4NL4H 3RPEA 3WO0A 5CCEA 2P2NA 1NE7A 3GMDA 3R3HA 4C4YA 4LF7B 3CH4B 5KUTA 2SECE 1U6IA 2C61A 1S2OA 1JR3D 3JQQA 3T1YB 5KYWA 1NVEA 2VWQA 2HQRA 1H69A 3IQEA 4IPTA 1MZVA 3GLGB 4G0WA 3E15A 2ZSAA 3QX9A 3KPYA 3QM1A 2QQ5A 2DERA 1YI0A 2PUDA 2NP7A 2WE8A 4H0CA 4J3JA 5JXGA 5TVGA 2V98A 3AETA 3DVSX 3CT6A 3L1VA 4RKQA 3V42A 4OXXA 1EESA 1L7MA 3ND5A 2LW7A 4WNAA 1CNMA 2QSZA 2C0PA 3FNEA 3H17A 1FJHA 4ZQEA 4EB8A 3ZH9B 1NUAA 3ZEIA 2GS9A 4RIIA 2PL1A 3FTFA 3WJAA 4BNYA 1PQUA 2JGNA 4BTEA 1FDTA 4ISBA 3NKVA 4RD0A 3GRKA 2JLVA 5BSKA 4PU0A 3I1IA 4A27A 1BVRA 3KT6A 3LQ2A 1ZGAA 2G6BA 4OJQA 1Y9AA 2XWQA 5I4CA 3SMQA 1ISHA 4REMA 1D2EA 5JZBA 4PQYA 4O2LA 5AK3A 2B2CA 1CBUA 4RO0A 1YB7A 2D5AA 4NF2A 4EO7A 3TW4A 4ZCMA 1ENZA 3I42A 1ZG3A 3O8DA 4HAYA 4NYIQ 4YRLA 5E4TA 5GONB 5IC5A 5SY4A 3UJ6A 4E2WA 3FHTA 3DO8A 4KGZA 3PHLA 2A0UA 4IEEA 4ZQHA 2AVDA 2XB8A 3HXPA 4HP8A 5KDLA 4YJ2A 2C5GA 2UAGA 2EBWA 3KVVA 1MIOB 2GZ3A 5L45A 3CZ5A 5ALOA 2QMZA 4GM1A 1U1EA 4PSDA 4RSMA 1FP7A 3WY9A 1WXFA 3DHNA 4C7JA 1W36B 1Z6YA 1A5SB 1E20A 5BXYA 4MPTA 2I2WA 3T6KA 1YMVA 2RKWA 3AVTA 1AURA 1U7WA 2GK4A 5A62A 2EJWA 1JTEA 1K7FB 3I12A 1L0BA 2ASEA 1J42A 1HLFA 5H4HA 1Q1NA 2ZIVB 1G9TA 3LUHA 4RFVA 5F4ZA 3K70C 2Y1KA 1VKRA 2XRMA 2ZAIA 3H16A 2GF9A 4L16A 4PLPA 1Y6GA 2OKGA 4B32A 1P2VA 2BUAA 1Q0ZA 3QNWA 4G24A 2MSEB 3BQNB 1JFLA 4EHIA 3DVAA 3E7PA 1QFZA 3I6QA 1C7FA 1FTGA 1A9XB 3VSDA 4DZZA 821PA 4DT1A 2VT7A 1E6MA 1T8RA 4ESEA 5GOZA 4FIZA 4MKHA 1D2RA 1ST2A 4RA9B 4PG8A 2AFIA 1FX0A 4HZUA 1BS2A 4AXXA 3RTCA 4WLEA 4BZPA 4UZFA 4FFWA 2DFDA 2G9RA 1N7JA 1G66A 1WB5A 3GGDA 4FHCA 4YLGA 4X66B 1CZKA 2XYGA 4HH3C 4Y9TA 3B6JA 1RKUA 1ISJA 2IDZA 3H5NA 1J24A 2MMGA 3IAM1 4YMWA 3VSEA 4Z4CA 3PFCA 4YT2A 4CIXA 3CVWA 3A1FA 3JZFA 1Z18A 1SB8A 3I3SR 4MQ6A 3Q9UA 4MPDA 4F6RA 3SSNA 2IY7A 2QSJA 2QWXA 4B8WA 1Z2OX 5JZMA 2ZSKA 2A1TS 4Z8YA 3CPJB 4KAJA 1ODKA 3FOEC 2JS7A 1SUFA 2YDYA 4N40A 1QM5A 3ROPA 2JG3A 2HLNA 1E1YA 3PD7A 4W5NA 1YZKA 4KQJA 3CZPA 2LP4Y 3Q40A 2XHEA 3L9XA 1QRTA 3ZCSA 3TKLA 2ZBGA 2MT9A 3GVXA 4UFNA 4U9IS 1HEYA 2VPYA 3IILA 3M4ZA 2A2ZA 5C5DA 4JI5B 1NNUA 1Q7EA 2PWAA 4MWSA 4E6PA 1XQXA 3MSCA 1S2LA 3ESXA 4IF6A 1EINA 4UTNA 5ILGA 1YA4A 4I5FA 4KLZA 4ALKA 5JS6A 4B0PA 5EPEA 2R3SA 2W2VA 1J0EA 4RK1A 1QQAA 1PV4A 3MM4A 4E03A 2VOEA 1Y8RB 4M36A 1PZMA 3H3JA 2O1WA 5ED4A 2Z95A 2I91A 2RGNA 1X1BA 1TYEB 1G8SA 2JW5A 1N0VC 1AB5A 1VE5A 3RTGA 2WAXA 4UM5A 1I1HA 4H7PA 4CN8A 2EXXA 2P3LA 5BSRA 1QGDA 4E4RA 3DL4A 5I5GA 3T3NA 1RI4A 1O58A 4N9QA 4RHCA 4F04A 3RUIA 1USIA 1P1IA 1ZSNA 3HB0A 3PWKA 2PWZA 5L4LA 3RUCA 5CXSA 3UYKA 3FIJA 3FNBA 3HDVA 5AT1A 4CJXA 5K3AA 1YJXA 3FPBA 3PCTA 2IEDA 5LBIA 2A0WA 1C30A 2CSXA 4Q9JA 2B2XA 1U2EA 3QXCA 4BPRA 3FWPA 2ZS8A 4HNAB 5FJJA 2DSTA 1JBEA 2EYQA 1KBQA 1OAAA 2H9AA 2VTBB 1JA9A 2AOUA 1TT5A 2IOYA 2ZUTA 1QO7A 3HO6A 5LKRA 2C4HA 1Z4MA 3PR3A 4JI1B 4BWVA 1O6ZA 2BFDB 4OXKA 2BKVA 4C2TA 4ZAWA 3H5TA 2AHOA 3D7LA 5CNJA 5BOSA 2AUMA 2HMYB 1S2DA 5CXXA 4BFLA 2DETA 3OQIB 4DV1B 1FYWA 1RXWA 4HZGA 5I9BA 4PR0A 5IXJA 1Z28A 1JI3A 2MMCA 1P72A 1GTG1 2QI9C 1DS6A 2OHIA 4X95A 1OY1A 4ENTA 2IS6A 1TMYA 2WJ3A 2XTAA 1KHHA 1NW3A 1ORWA 3WMXA 2DPHA 1UL1X 1E9EA 1PS0A 1W88B 3CZ9A 3PEEA 4NNJA 1UKVY 4HGRA 4CM5A 4F4FA 4C5AA 2C7RA 1ULHA 3CU5A 1KK0A 3HKCB 2FN3A 3ONDA 2C2KA 3ABQB 3PZBA 1QVRA 2QGZA 3GT0A 4NBVA 3Q85A 1U4SA 2P4HX 2EZ8A 3OPYB 3FMGA 3AOEA 3N53A 4BXOA 2OCLA 1A9TA 1M0SA 2YWDA 1CEXA 1UK8A 2P6UA 4JOQA 3IA7A 4HDKB 4ZPXA 1JPJA 2C42A 4YUYA 1RFGE 3OMWA 3TJZA 5GJWC 3ZDAA 1MGPA 4TUYB 3UJBA 4YNBA 1LA2A 1ZBQA 2PKQO 3PHCA 5JSYA 4GNRA 2H4WA 3OAAD 3VHRA 1EU1A 3FSRA 3CWZA 3N2ZB 4WESB 3OSUA 4H6WA 4R81A 3RYIB 4CF3A 4D25A 4TMVA 1NXQA 1PDOA 5BW5A 3ORHA 5C53B 2PBRA 2D7CA 1LNQA 3TRJA 4ZK2A 1KI8A 4V2UA 1G18A 1VL2A 3ZV7A 2GYYA 5DT2A 5IH3A 3PR1A 1JXOA 4RIGA 5FBVB 2B98A 2YJ6A 4Q05A 3BK1A 3RJMA 1OR8A 4D6XA 4EY5A 4GSKA 3R0XA 2OBFA 2UZ1B 2P30A 4KODA 1DEKA 2PQ6A 5CRIA 1CNFA 2D1SA 2WJ6A 3UK7A 5J58A 3GFBA 3K9LA 5AI0A 4V39A 4K7JA 1AG9A 2J6CA 1BMQA 4WGGA 3HFSA 6REQA 2XBMA 4KJXA 3GQVA 1MO3A 1OLUA 5AXBA 8GPBA 4A8JA 1T8WA 2WTMA 1QUEA 1TC1A 1UPXA 1TQDA 1M2KA 2CJPA 4N5IX 4Q9NA 3GC6A 4KAAA 4M0DA 4BAUA 2QZ4A 1LLQA 3EXFB 1CZLA 3C8DA 2KBEA 2C9ZA 3PNYA 3OKAA 4O3FA 4WFQA 3C3YA 4EMUA 2AD5A 1EJ0A 2O48X 3C14C 3OJLA 1ISGA 4M8IA 4PG7A 4G5HA 4W8HA 1E2LA 2L17A 1W47A 3OKCA 5CW1A 3U56A 2HT1A 1TPYA 2VJAA 1IE3A 1KBZA 2TECE 3OTQA 4MQFA 4E6EA 3HWRA 1E3WB 3NWBA 3BFKA 4DUZB 2CBZA 2GN4A 4GRDA 3MZ0A 2VQDA 3L92A 1KFCB 3K1YA 3MK31 3KQHA 2P79A 5TMEA 4UJ5A 3LDAA 3AVYA 3QVXA 4G5OA 3UMBA 2ZXEA 3CGGA 3MOSA 5AI5A 3HYTA 3NAMA 5K0CA 4BZQA 2UVPA 3D31A 4RA9A 1JQDA 5EUQB 2C3UA 4EABA 2ZI4A 1J9GA 2JF0A 3LKDA 2UXCB 3TVYA 1QV6A 4BJ3A 3TUZC 4LZPA 4MUIA 3AJ8A 2JGIA 2Z2YA 2YFQA 3CF6R 2NQTA 3OQ6A 4YJHB 1V25A 3KUDA 4PYRA 4CKWA 1CF2O 1YQQA 2AI2A 2J7PA 2CZCA 1CF9A 4ND4A 4PYKA 3L0IB 1YUMA 1YB1A 1NURA 4KQ1A 3OFNA 4B4WA 4C43A 5GJCA 5MN5A 1B4DA 1U04A 3S8YA 5DX0A 3HN6A 4MQ5A 3KR1A 3KPVA 3TX6A 3VHLB 1X15A 5LUBA 5BNIA 3I5UA 2PWBA 2EATA 5BN5A 2ZBDA 2D3WA 1ZOLA 1KVQA 2JCXA 3L7NA 2JIRA 3SDBA 1MEJA 3T95A 3UG6A 1JDZA 5DNAA 1AK9A 5EMMA 5IYZF 1DQNA 2BBTA 3B6EA 1P1HA 1E9DA 1L7OA 4RVDA 1XEXA 4DOMA 5KTNA 3U7FB 4IKPA 1WJGA 2E3JA 3I9LA 5A06A 1BXRA 1PWZA 3QLVA 1Q92A 1XRLA 2VKTA 3QU5A 4EF6A 1F06A 3ZZMA 5KREA 4LF5B 4AI6A 2FN7A 4U0JA 4B46A 4B3JA 3OCYA 721PA 2FQ1A 4IMJB 3FNQA 1JJ7A 3OOWA 3AX6A 4X20A 4M7WA 4I3GA 5TR9A 1G9SA 4CCYB 5L7WA 1XTIA 2MYTA 2B20A 3BGVA 3DWGA 3GNSA 3I37X 4R84A 2G1KA 2Q28A 1X1EA 1LQUA 5LC1A 1V45E 2UZ4A 3QWAA 3HWSA 4N76A 4JVNA 1G8GA 2DFTA 2SCUA 3PC8A 3CO5A 5EQTA 1KDOA 3L5OA 4YJFA 3AY6A 3SR3A 2Z5FA 1QTQA 3QUTA 2ZWPA 3KQPA 1EFHA 4NV0A 4KC0A 3TQRA 3UH1A 3MOIA 5JJCA 5BSHA 1W8IA 4AZ0A 3PKIA 2BEWA 3DO6A 1DIBA 3QMPA 4FJ1A 4PC2A 1OW3B 4IVPA 2X0EA 4LHZA 5FT9A 2V6MA 1WCWA 3EISA 2VZEA 4C6RA 1I2AA 3L4EA 5LQCA 1RLIA 3U3KA 3BM5A 4MYCA 4PICA 2AQHA 4EUKA 4HDAA 3SEQA 2AEJA 2QYSA 4PVCA 2B7LA 1I30A 3WLIA 1Z0UA 1XPUA 4Q7QA 1O9GA 3DLPX 3EOAI 5ALSA 1H4QA 4LNUA 4RJIA 3D64A 3GLGA 1JTVA 4MYHA 1G21E 2O5VA 3HJRA 3FX2A 1QAQA 3MIZA 4OXRA 5G41A 1P7WA 1KAGA 2LDBA 5AKYA 5EIFA 5IW8A 1KY2A 3AKDA 4MMYB 4A2PA 4DDUA 3C85A 1IWPB 3O47A 5F2KA 4S2EA 4AG6A 5CDTA 3GJ4A 2C07A 2ES4A 3DM5A 1QRDA 5D85A 1RDFA 2LR0A 4QUAA 3RANA 4A6PA 1LI5A 3WGMA 4OBBA 2YXPX 3AHJA 1DINA 1XDWA 5EEGA 5K3FB 4F9EA 4NXNB 5KWVA 4J4TA 3ERCA 4GPBA 1F8GA 5HG0A 1MAWA 3AVXA 4JWKA 3HWX1 2CLMB 1G1MA 2HCJB 2VP9A 1C5KA 1DFGA 4CM8B 2HIAA 3UC9A 5KX5A 2A3RA 4PWZA 2OD2A 1JJAA 4KBFA 4LN1A 2ZKIA 5FOSA 1J25A 3N76A 4ZT7A 3ZZ0A 2RGDA 3OTOB 4I4NA 5HOEA 1S7GA 4RABA 1GVHA 1SXPA 2RHJA 5LDGA 1BXGA 3TZEA 1QC5B 1HRKA 2AGVA 1M74A 3ZD6A 4JELA 1XU7A 1FFSA 1V4VA 3AR4A 4R8SA 1Q17A 5J4HA 1QORA 1Z0IA 2HSZA 3DBRB 4NU6A 4OO3A 4OJKA 4OM8A 4S1PA 1F20A 3HEMA 3R2JA 1KEPA 3DQQA 4K81B 5DBFA 4QOGA 2F3SA 1LJUA 2G76A 2QU7A 1NT4A 1QRAA 1SC1A 3EXHA 4KIUA 4NBUA 4DB2A 3D8TA 4EEXA 1TEVA 5ECDA 4C01A 3DTYA 4KQ6A 4KFSA 3DE1X 1RJEA 2IIVA 1TADA 2J9FA 1DO0A 1GKLA 2GASA 3OEHA 1XUOA 1CULC 1XMPA 2FF7A 2ISSD 3DDWA 2WJPA 3LC1O 3O3NB 2XQGA 3Q8LA 1NW4A 4Z4FA 4GBMA 2H2HA 4UUQA 4YUXA 1FK8A 3KPJA 1WZEA 2JGMA 1UANA 4IZOA 1BS1A 4PQEA 2NO1A 5DH9A 4RGYA 4P2GA 3ROZA 5MDHA 1DTWB 1RJWA 4OF4A 3IOMA 1F1BA 2LTAA 3EXHB 4PX2A 3KU1A 2VYNA 4BYMA 1XZ8A 2A84A 4D3SA 3RRNA 1RYNA 3KB8A 4OG2A 3M49A 1RACA 4OQFA 4RF4A 4RESA 1UBKS 3GARA 1S3GA 3IXLA 3STUA 1DDIA 1GZ4A 3KJNA 3N8KA 3SKXA 3HY6A 3VZRA 4Y6SA 1OROA 4DYVA 3C24A 1PJRA 1ONPA 1L4LA 3BX1A 4NK5A 2CNWD 2ARKA 4X24A 4JEIA 5K05A 1PW7A 1Z0ZA 2QG9A 3DBIA 4LYFA 4UE2A 4DW8A 4P08A 2BJVA 2VJNA 3E53A 3K16A 5C34B 4LISA 4V0OA 3G8DA 4JYCA 1NAIA 1AN9A 3IOYA 3VM6A 2QTCA 3O2NA 4BO3A 2ODWA 1OLSA 1MJFA 3ZZNA 4C4RA 1SHZA 2H0RA 3WYNA 1CETA 1GGNA 4KU4A 4A82A 5A9SA 3VR3D 2O8EB 2F3PA 4O4JF 4BMXA 5E9JA 2NSDA 2WIKA 3OWOA 4PFKA 5JSFA 1I6WA 4HJRA 1CIJA 1R4NB 4G1UC