3IPXA

X-ray structure of human deoxycytidine kinase in complex with adp and an inhibitor
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
241
structure length
229
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Deoxycytidine kinase
publication title Lead optimization and structure-based design of potent and bioavailable deoxycytidine kinase inhibitors.
pubmed doi rcsb
total genus 85
structure length 229
sequence length 241
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2009-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ipxA00
3OEHA 3HWSA 3VX4A 2RB4A 3TE6A 2VP2A 1QRAA 3BB4A 5KPDA 3T5GA 2IUTA 1BS1A 1KO7A 4QBIA 3VNVA 1UKVY 4HLQB 1J99A 3BH0A 4EPXA 3GLFB 2G77B 1LV7A 1FNMA 1ZCAA 5ELXA 1JJVA 3QE0A 3QKSB 3ZVLA 1MO6A 3CR7A 4G3XA 5A5GA 3VR4A 3X1YA 2LCFA 1MO5A 2MSCB 3LRPA 3RDPA 5TMPA 1TADA 3GLIA 1TNDA 1RRGA 4Q7KA 4Q4JA 2GXQA 3M6AA 1G7TA 1FPMA 3Q85A 3MWJA 4KSCA 3VTKA 2O8BA 1BIFA 2A5YB 3A1WA 3GP8A 5EP4A 4D4LA 1S2MA 1C4OA 3QKUA 2QT0A 4KVAA 1AS0A 2ZREA 3IPXA 4V0NA 4V0ME 4HLUA 4MA4A 1T5LA 3WMFA 1KDOA 3JZAA 2CE7A 3G5UA 3FMOB 1JALA 4UNQA 4NYIR 1JBKA 3ZD7A 3HYRA 5J40A 1QHNA 1P2UA 3EWSA 3SEAA 3GJ3A 3IO5A 1KI2A 1XEFA 3KKPA 4FMDF 1XNJA 4DJTA 1EFHA 1L4YA 1VYUA 2ODNA 3EAQA 2WJIA 4BFTA 4ACBA 1WQ1R 3LLMA 1KI6A 3OIYA 4RD1A 5FPKA 1E9FA 1OYYA 1KMHA 2ZRLA 4B3BA 3A36A 5P21A 3X1WA 2WMNB 3VHLB 1RIFA 2WJJA 2ZSAA 2WV9A 5L3QA 1VIYA 4AY2A 3MD0A 1XB2A 1VG9B 1G17A 4ILEA 1IBRA 2W00A 2ZJYA 1WF3A 3RLFA 1J8YF 4XTCS 1E9BA 4RSGA 3NTUA 2HJGA 1E1RA 4PPNA 2ZEJA 5F98A 4TL7A 3QBVA 4DWJA 1DADA 2GK7A 2NMVA 3CUEF 3KKQA 2ZVQX 3EPJA 1T3HA 3BORA 1ZM2A 3GLGB 1CR2A 2ZRCA 2EYQA 4RFVA 3AVXA 1DO0A 1W49A 5KDDA 2IS2A 2QGZA 5FTKA 3IBYA 3TSOA 1G8GA 2D62A 2ZUDA 2IYZA 1GKYA 1CKEA 1P2TA 2RGXA 4P4SB 3VR3A 4YXWD 2W0MA 2GZAA 2PLFA 4FIDA 5JEDA 3UPUA 2W6ID 4PFSA 5CIWA 2PX0A 2GNOA 1PLJA 3AV0B 4G0NA 2J45A 4TYNA 1H65A 1GOTA 2EVWX 1PJRA 1WMSA 1ZNWA 3VQTA 1VMAA 1OKKD 1RYFA 1YQTA 2GXUA 4H1UA 2PZGA 2X2FA 3AQ4A 3BGWA 3GJ6A 4Q21A 1OLOA 2WVJA 4KITB 1Z3IX 2XNDD 2A2ZA 2FSGA 2VP9A 1OJLA 3NHBA 1OH6A 4M53A 5E7MA 3BFKA 1BYIA 1R8QA 1ZNZA 2ORWA 2W6JD 2JDIA 1J70A 5AJZA 1FTNA 3A1UA 2C98A 3TR5A 4BRUA 5JCZA 4LJ4A 4ERNA 2JLVA 4HAVA 4IW3B 1COWA 2OEPA 3GD7A 2GA8A 2I1QA 2OZEA 3QF4A 3O47A 1RYHA 5LB4A 1MR3F 4PO1A 4BECA 5EE0A 5KO2A 1XWIA 2QEQA 4JT4A 3I61A 5G3YA 3QKRB 2ZI7A 3K70C 4WZBE 1ZC3A 2WJYA 3HPQA 3SFVA 1Z08A 1F6BA 2PL3A 4MRRA 3BIFA 1IONA 3B82A 3ZLJA 3BE4A 1GNPA 2GXSA 2OCBA 3CF2A 3MCAA 4FN5A 4KHZA 4BEBA 4HAZA 4ASUD 2KE5A 5HR5A 4TL6A 1W2GA 2GEDA 3O8RA 3U3MA 4BASA 2DCUA 4XD7A 3SHWA 2ZE6A 2CCJA 1UEJA 3AVWA 4A8JA 3FMPB 2FNAA 4AYXA 1FMLA 2BJWA 2BM1A 1SKYB 3JVVA 1N5LA 3Q9LA 5KNDA 4JYCA 2I4IA 1HY3A 1W44A 2V7QD 4B35A 1SGWA 3AP3A 1E2GA 3ZIAA 3O8DA 3NH6A 1JEDA 2XOKD 4OK6A 2DR3A 3CPEA 4OYHA 4OKSA 1TF7A 2OAQ1 4GPTA 3WHKA 2O8BB 4D0NA 1NSFA 2F1HA 1DG1G 3EPLA 2FV8A 2WSSA 1KYIA 1G4AE 4ZKEA 4EPVA 2REXB 4PC2A 3K0AB 3CW2A 2OHFA 5IRCD 2WJVA 4A4DA 1BH2A 2HYDA 4E07A 1HUQA 1S9DA 1N6KA 3VKWA 4E5UA 4F91B 4URYR 1E2DA 1P61B 3L2OB 2PLRA 2VLIA 3R9WA 3I5YA 4CEIA 4DZZA 2ZI4A 4KLZA 4JKIA 3D7MA 3PFIA 1GKUB 4JLKA 3OAAA 5CK4A 4TMXA 4A2QA 4G5SA 4R9UC 5F9HA 1JR3E 1II8B 1KI6B 3DZ8A 5J4LA 1OFTA 4O2RA 4UNNA 2HCBA 4CT4B 2D2FA 1O3YA 4AYTA 1Q1ZA 4U5XA 1FUKA 2BCJQ 1TU3A 3IEUA 4P0TA 5DGXA 3K70D 3L43A 1LB1B 5K8IA 3PEWA 1L4UA 4DB2A 4YMWA 1NBMD 5L3QB 1P60A 2D3WA 3KJGA 3E5HA 3TAHA 1XXHE 5BXQC 4NCJA 2IYYA 4Z8XA 2J0VA 5JRZA 4LJ8A 4LK2A 5AWFC 5FTLA 1UFQA 4IVRA 3K9HA 3T12A 3LQRA 2ZRIA 4HUTA 2CNWA 2ZJZA 1G3MA 3PR1A 4EDHA 1NMXA 2B92A 1W36C 5TARA 3IGFA 4QFMA 1IQPA 2F9MA 1I4LD 1T8UA 4GFDA 1L2TA 1ZC4A 4PC7A 3W3ZB 2FU5C 1G8PA 3HP1A 3U7EB 1W7AA 3BD9A 3RAPR 3CNOA 3FGNA 1P2SA 4M9QA 3N70A 2OBNA 3OIVA 1Z5ZA 1G291 1JR3D 2ZI5A 2XITA 2PEZA 4FCTA 4LJ9A 1W4CA 1VG1A 2IXEA 2OESA 4XH9B 1OXSC 3CWZA 1AQYA 3SJZA 3UMRA 2VSOA 3PIRA 4PX9A 3LVRE 1E4VA 4DB4A 1FUUA 2OXCA 2CJWA 1DAMA 3OFNA 1DELA 2JA1A 3KQUA 1Q22A 5C18A 4BE7B 1XTRA 2OILA 1IN4A 4JIMA 3AVOA 4LJYA 3A6PC 2OXRA 3V4RA 2FE4A 2ECKA 3LY5A 2ZVPX 1DG3A 2CK3D 1G7SA 1Z47A 3QPUA 2Z5FA 3EA5A 4MGYR 3TMKA 4JVSB 4C2TA 2VHTA 5SZJA 5SZIA 3CRMA 1A1VA 2IBMA 4NCHA 3ZZUA 2ERYA 2RGDA 5J4KA 1TEVA 3QF4B 5JI3E 1UKZA 1E2IA 4PTLA 4DLYA 2VF7A 4N0DA 4DCTA 3SBEA 5DI3A 821PA 4DCNA 1UBGA 1ZJ6A 3THYB 4V03A 2H57A 2N46A 2IF0A 3UMFA 1NP6A 3P4XA 5FTJA 3THWB 2FPMA 4FW9A 2XB2A 1GITA 1GP2A 2YOGA 4KLNA 2FF7A 5K8LA 4OHWA 1EK0A 2P67A 5CJ2A 3PUYA 2H16A 5H68A 1YU9A 4B43A 2WOJA 3G0HA 2KBEA 1W5SA 2FGKA 4M0LA 1R0XA 4BZPA 2Z6VA 4JLVA 2PZFA 1W36D 4PPQA 2V54A 5GJVC 3L8YA 3CM0A 4G5QA 1NN3A 4TLEA 5C1BA 1P9WA 1G41A 2ZJBA 3U7FB 5CYOA 1R7RA 2R6CA 2GK6A 2R9VA 3LQQA 3REGA 1X8LA 3LX5A 2IT1A 3KTAA 2EFHB 4UXHA 1NLFA 4L5BA 3CONA 3ICEA 1W1WA 4K8OA 2ZQ5A 3ZQ6A 2ZUBA 1ETUA 2Y8EA 4I1SA 5LD2B 3QQ5A 1JXMA 1GWNA 1WRBA 2C9CA 4BRWA 4LBVA 4Z8YA 2QSZA 1Z6TA 1KO4A 2XJ4A 4QJ5A 3U60B 2NPFA 3UK6A 1ZD8A 1N6RA 2ZJ2A 3EZ9A 4UXJA 4YXWA 1TQDA 3CRQA 1D6JA 4KBFA 2G0NA 2W6IA 1MABB 1U0HC 3OIUA 4Q7JB 4P3YA 2ZSBA 2JIZD 1E2EA 2GTPA 3MLEA 4ZI2A 1UPTA 1RW4A 721PA 3I4LA 1E0KA 5DIFA 1OKKA 2BEJA 4DIDA 2VQSA 4CEJB 2ZM5A 2BHRA 5FBRB 4BFUA 3ASZA 4DDUA 3L82B 5IT5A 1GL9B 5EXXA 1XTIA 3LD9A 2XNDA 1WBBA 1EX6A 3FDIA 4TMKA 4EPRA 1U99A 1TAGA 2D4HA 2QBYA 4NL4H 2OM2A 2W6JA 5JCPA 1GFIA 4YMVA 4L15A 4HDCA 5JSZA 4IEIA 2GJSA 1HT2E 1KSJA 1R5OA 5TB5A 1W5TA 4DEYA 2EWWA 2GWHA 5M04A 2O8FA 1N25A 2PT7A 5JS8A 1SZPA 3KB1A 4ZDKA 5EXSA 4QBGB 4XWOA 1C1YA 1QHYA 4IVQA 1XEWX 5DISB 1WP9A 3RS7A 1TEXA 3KL4A 4JL5A 2FPLA 2ZRNA 4Q5IA 1IHUA 1T3SA 1OW3B 1E9CA 3OZXA 2H92A 2ODBA 2G1KA 2GDJA 1GM5A 4KBGA 2NZJA 3QVVA 1KK1A 1W0JA 5E4FA 4C0SA 1NKSA 4B2PA 1PUJA 4HUQA 3HU3A 3PV0A 5JS7A 1G20E 3ADKA 3CPJB 1YZTA 4JL8A 4W5JA 4ASUA 5D3MB 5LPNA 4O3MA 4CZ2A 5FI1B 3KXIA 1B23P 3I73A 2R6GA 4X8LA 3EPHA 1KK2A 4L9WA 2V1UA 1CXZA 1SHKA 1IM2A 2DHRA 4LC1A 4EFLA 1UJ2A 2DWPA 1KHTA 1RRFA 2CJWB 3K0EA 5J5CA 5IF9A 3VNUA 3MG9A 1AS3A 1M74A 1XD9A 2IYLD 1T91A 2W0SA 3QG5A 4DLUA 3QG1A 2V7QA 2GAOA 3GEIA 5A0FA 2W2XA 3VR5A 4D81A 1ZYUA 1U8AA 2XOKA 4MKIA 1WXQA 2YJTD 4LBYA 2BKEA 1S1MA 5FBWB 1W4RA 3GLFA 4JZKA 1NMZA 1U98A 2XTNA 4XVUA 3PITA 3N2EA 3NEJA 4IDPA 1CLUA 2FMXA 2DPXA 4PXAA 4TL9A 1IN6A 4DC9A 2QN6A 5DI3B 4BPBA 3DMNA 3GJ4A 2DYKA 1VCNA 3MRSA 4GI7A 2Q3MA 4OHVA 1KKMA 4I1VA 5DO9A 1X1RA 2C78A 3E2IA 1EWQA 1Z29A 3QPVA 1SULA 3GCGA 1UF9A 4LYHA 1CR1A 5F2EA 2YWEA 5JHHB 1J90A 1RFLA 3A58B 4NTZA 4FCVA 4IDQA 1WB9A 3PEYA 1Y63A 4Y0AA 2VEDA 1CJVC 4A6PA 1W4AA 3RRNA 3HR8A 5UKDA 4HAXA 4UKDA 2B6HA 3SJBA 4K81B 3NXSA 1NBMA 5SZHB 3CNLA 2OG2A 2WSMA 4GT1A 3T06B 5IDVA 5JBQA 4BLOA 3KTAB 2HDNB 4WBSA 2CDNA 4HZUB 1Z0DA 4IEEA 3TVDA 4Q47A 4U00A 3W8NA 2GVDC 1A7JA 5ANRB 4XSGA 3B85A 1N5KA 2LWIA 1N0UA 1YR9A 2VP6A 3FYHA 2D7DA 3CBQA 1LS1A 3NC1C 2R2AA 3PENA 1G64A 1N5IA 4QGHA 1KOFA 5KSPA 2ZRGA 1E32A 2HEIA 3LBHA 5LB2A 5CK5A 2VO1A 2LKCA 3U3OA 3W5JA 4LJ5A 3QY0A 4GMXA 2YOHA 1JR3A 2RGEA 4AC9A 3EXAA 4YONB 2BIFA 3T34A 2CCKA 2ZRMA 2J41A 1E6CA 4KXFB 3B2EA 1CJUC 2IK8A 5CLLA 1M8PA 3FMFA 5D3QA 4DSNA 3CX8A 4OK5A 4A92A 2SHKA 5BN3A 5FH9A 4M22A 4P33A 4RZUA 1G16A 3FE2A 3CRW1 4GP7A 1XXHA 2ZE5A 4QL3A 3FFBA 4QJ3A 2ZU6A 2IYQA 2ZJOA 2ZRPA 2ERXA 3A37A 4Q18A 2QBYB 2DWQA 4D6PA 3EIEA 4PO8A 4TYYA 2IYTA 1OH7A 3TRFA 1VYTA 3NHAA 4EFNA 4QHSA 4N1AA 3DKVA 1N6IA 2AD1A 4DDWA 5KYKA 2IW3A 2AWOA 3WRXC 4C0LA 3WNBA 2J87A 3HR7A 3PUWA 2BJVA 4B71A 4A15A 2JLSA 3PEUA 4U7DA 2RCNA 3W9YA 3FFAA 4MH0R 1IY2A 4V0OA 5GJBA 3NDBB 2VPPA 4FMCF 2V8OA 2W83A 4DDVA 4FCWA 4KCGA 2YOFA 4F4JA 2ZYUX 1NY6A 4DLWA 2YC4C 2GHIA 3QXXA 4RKFA 3CR8A 5EP1A 1OV4A 1QHIA 1U94A 4RZXA 2CNWD 2WJHA 3TBKA 1E0SA 4DLVA 4HUQB 1DBSA 4H9GA 3VR1A 2QE7D 3CKLA 3QKRA 2VA8A 5EE1A 4OQNA 1MKYA 2QY9A 2YWFA 4HI0E 5EQTA 2D06A 2ATXA 1XEXB 2C8VA 2WM9B 3AH8A 2W58A 3P32A 4TQUS 3DO6A 1JJ7A 1SVWA 5SZKB 2DB3A 5AJXA 2AXNA 5E3HA 4DLRA 1HH4A 1F5NA 1IAQA 2H8KA 3Q5EA 5DH9A 1NG9A 5C4MA 1A2KC 1FOEB 4LJAA 2XTZA 2FSHA 3WY9A 3FOZA 3KQLA 2CHVA 3X1ZA 5AUOB 1G7RA 3VR2A 2QSYA 2YZ2A 5LBIA 4AKGA 3W8RA 3T1OA 2QRZA 2VP5A 3CF0A 4C0HA 2BMFA 3OFND 4CW7A 1XX6A 2W2TA 4ZV4A 4K46A 4FXPA 2PT5A 4ON9A 3AKCA 4LX0A 1XMSA 3MUFA 1BOFA 1ESMA 4RZ2A 4B75A 5BQ5A 1R0WA 3UG6A 2G1JA 2WMOB 2JIZA 1G7CA 2Z43A 5CM9C 4Q66C 1OB5A 4PAMA 5FPSA 3KQNA 2AWNA 5EP2A 1EFUA 1GL6A 4B76A 1DTSA 2KJQA 2DY1A 4GSYA 1M34E 2FA9A 3LO5A 4I99A 4Q9KA 3K0AA 2ODWA 1SXJE 3TUJC 4DCSA 4O2LA 3LNCA 2EFGA 3TQCA 2RGNC 1KI1A 4M1MA 4AKEA 2Q6TA 2O8CB 4GP6A 4TLCA 5TDHA 1GG2A 1QHHB 4B3DA 1KKLA 4HATA 2XX3A 3K70B 1J7KA 3M0EA 4Z54A 5L3SA 4A0HA 2BBWA 1KMQA 3L0SA 1II8A 3AGPA 3W6NA 4LV8B 2BKUA 3T61A 5KNBA 2CLDX 3TSWA 2QMEA 2QAJA 3ICQB 2ZRAA 1VCMA 2QP3A 2FEMA 4GOXA 4D82A 1N6HA 5CITA 1U90A 2NIPA 1YE8A 2ZTSA 4Q4HA 5BN4A 521PA 8OHMA 5HZHA 3H2YA 4TMVA 4PZLA 3FKSD 2ZPTX 3SJAA 2NO6A 3UKDA 1YR7A 2BBTA 1FQKA 4N3NA 2EFEB 1Q21A 3OE7D 3AEZA 3ZD6A 2WKRA 4JLDA 1RKBA 3WP0A 3U6KA 3K09C 1IY1A 2QAGB 3FKQA 4RD3A 2JJ2D 3QNUA 3RNLA 4DLXA 2YINC 3B1XA 4M1YA 1GRRA 4HDQB 4LBZA 2QG6A 4BQSA 3AGQA 1AM4D 1XRJA 4TQAA 1X3SA 4XVRA 3AKEA 1VTKA 2GZHA 1G5RA 2GCPA 1FX0A 1QG2A 4KVGA 1AN0A 1YZKA 3IUYA 4WVFA 4D0LB 1KO1A 1TQ6A 1JQJC 4L9SA 3QBTA 3S1AA 1NVVR 3IQXA 4PHHA 1XXHB 2ZR9A 2C03A 3WNCA 3IKJA 3I5XA 4LHWA 1IJEA 1W47A 4JBYA 2RMKA 3H86A 5KU1A 4JVLA 5JECA 4PZYA 2DFLA 1T0JB 3UWKA 3LWNA 5IK2D 2P6UA 3WXMA 2QL6A 2Q3FA 2PX3A 4H1VA 3WRYC 4HYYA 3R8FA 4OK3A 3WYGA 2JLXA 1CJTC 3SDZA 4L8GA 1S3GA 2OFXA 1NVWQ 2AFIE 3OF5A 1Z6GA 2GF9A 2JATA 2FOLA 3EA0A 2RHMA 4Q7LA 1RE0A 5KSYA 1E2FA 1JXOA 3F0TA 3QIAA 3K0FB 5JEEA 3AVYA 1E2LA 3U5ZB 1NI3A 4PAQA 2WWFA 4TTPA 5F3WB 2HXSA 3AM1A 5EXPA 4M2LA 4B6FA 4NYJQ 4JLNA 4D4JA 2V6IA 2OAP1 4X8HA 4BEJA 3LXXA 5L3VA 2VHCA 5KPJA 4PC1A 4TMTA 1CBUA 1WCV1 2GKSA 1AZTA 2QTFA 4A82A 5AJYA 3DHWC 2J0QA 4D80A 3THYA 4LOAA 4JKYA 1CR4A 1OT3A 2QM8A 3LVQE 3BC1A 1D2NA 5EP3A 2QRNA 3THWA 3T15A 3QSYA 1Z0FA 1W36B 2F43B 4GBMA 5B30A 1Q1QA 3WNDA 1W0JD 1KSFX 6Q21A 1UEIA 1A2BA 2J5XA 3U3KA 4NCKA 3EZFA 1RPZA 4RZ3A 5IHPA 2YC2C 1RRPA 4AI6A 2FSFA 2BBSA 5GJWC 1JPJA 2IF2A 2YWGA 1NN5A 1XP8A 4F4IA 3BK7A 4IOKA 3UIEA 5B57C 3NG1A 3WMGA 2QGNA 4YLGA 1ODFA 2P5TB 2ZJAA 3L8ZA 4MQBA 4BFVA 3KQHA 3F5FA 1M2OB 4PHTA 1XD2B 2QAGC 3SC3A 3AVTA 3NVAA 4OBEA 2IS1A 2VRWA 4I1UA 4I4LA 3SR0A 1GVNB 4M1OA 4RD0A 4PHGA 5FL3A 1XCMA 4ZKDA 3CZPA 4V0LA 3QXJA 2JGNA 4HDOB 2G0TA 4S2EA 4W5WA 5KSOA 3KB2A 2CL6X 2A5GA 2WKQA 4ZCMA 4AK9A 1Z6XA 1KY3A 1ANKA 1KNQA 1NRJB 1MABA 1ZUNB 4MRPA 2ZYVX 1AA9A 2W2VA 2WBLC 5DI9A 1SQ5A 1KAGA 4Q1BA 2IYSA 1NSTA 1XJQA 4US0R 4CEJA 4DUGA 2HF9A 4QRHA 5KNCA 5L3SB 2G88A 1CF4A 4D0GA 3GJ7A 3ZVNA 1S4QA 2FWRA 5G3ZA 1T9HA 1YRBA 3QENA 1IY0A 1DAHA 1AJEA 2VHJA 3CRVA 2ZITA 3TNFA 5FI0B 4WOPA 3PEVA 4YMUA 2FGJA 1ZM4A 4QNMA 3M4YA 1LVGA 3TAUA 2HT6A 1KK0A 1NKTA 4AKHA 1TQ2A 5B2ZA 4Q4HB 3TSZA 4QKQA 4G5GA 2O52A 2ZS7A 3I8SA 1NVUQ 1EG7A 4ZCLA 1LF5A 1XEWY 1TUEA 2R44A 3AF1A 3AP2A 1CJKC 2CVHA 2ZJ8A 4G5OA 3BS4A 4FMBB 2CMKA 3SFZA 2QE7A 2Z4RA 4PC6A 4KI0A 4RCZA 4B44A 4W9MC 5CJPA 2ZAOA 3OHMA 2P3SA 2PBRA 1Z0JA 1FX0B 1TPZA 1D5CA 1Q12A 2B7CA 1N6LA 2QPOA 1FP7A 3M1IA 4HAUA 5EE9A 1P72A 5C4GB 4ARZA 1KI8A 1E9AA 1Z07A 2R65A 3B9QA 2BBOA 4Q4LA 3PG5A 5D3MA 3S1AB 2BVNA 4E03A 2IXFA 1LFDB 3C14C 2X77A 3PUXA 3U2QA 1Z8FA 1IN7A 4LV6A 4EPYA 4RFSB 4PAOA 1ZIOA 2XJ9A 3LW8A 4BFZA 4TLBA 1QVAA 4JVNA 1E0AA 3Q5DA 1AKYA 2ZAMA 3R9IA 1H8HD 3DOEA 3RHFA 1MO3A 3NC0C 1EFTA 4UJ3A 3ND8A 4IOJA 4JLMA 3TQFA 2G83A 4TYPA 4WAUA 4DCVA 4LHYA 4JLAA 4BUJA 1U8YA 3W5IA 2FH5B 1MRSA 1Z83A 4ZI3A 1ZD9A 2REOA 3KXLA 3RABA 4IHQA 4A36A 1E2MA 1ZW6A 4C3ZA 5CB8A 1U81A 3U4QA 1PVOA 2PEYA 4B2IA 2XSZD 4ZCIA 4RJLA 1AS2A 2VBCA 5JJLA 3I3SR 3RVBA 2VF8A 4Q1FA 3O8CA 1YVDA 3WYFA 3H0KA 3P26A 3RS4A 3X1XA 1EXMA 4IOLA 1XCPA 4EPWA 1L8QA 2O5VA 1AIPA 4MRNA 3K9GA 2A5FA 1HE1C 4Q9HA 1QF9A 3U44A 4FMCB 2B8TA 3FWYA 2RGGA 2Z4SA 1VIAA 4A2WA 3CIOA 3KKMA 4LC0A 2RKOA 2V4ZA 3T35A 1XJ0A 4G1UC 3QKTA 1ZNXA 3R20A 4OI4A 3RWMB 4YMSA 2XB4A 2AD5A 1U2RA 1NIJA 4Q00A 4TLDA 3X2SA 1JPNA 1DAEA 1KTVA 1NJGA 1EFRA 3A1TA 4B74A 1CRPA 2B7BA 1HT1E 1OIXA 5EXTA 4PC3A 3VFDA 5DSZA 3LX8A 5AK0A 3FKSA 3HJNA 3RSOA 3REFA 2FJUA 4IRUB 1QDEA 3QJYA 1WBDA 1Q44A 2I3BA 4HZUA 2ZSFA 1MH1A 4MRVA 4NBSA 3OE7A 3D3QA 3GLIE 2X2EA 1AQUA 4V0MA 2IX3A 1XTJA 1QHXA 1N6OA 2JJ2A 3SN6A 1XPRA 1Q1BA 4IDOA 5TVKA 3BH6A 4B33A 2GXAA 3DMDA 4R71A 4AG5A 4QG7A 4DHEA 5KHOC 4LHXA 1L7VC 2JCSA 2F9LA 1Q57A 1K5GA 3ECCA 2OT3B 1OSNA 4W5HA 3SQXA 3BOSA 1P6XA 5G40A 3PVSA 4US1R 4NONA 4XSHA 3ZJYA 3A1VA 3TGPA 4C0JA 2H1LA 3ZQJA 4WA7A 1OYWA 2H17A 1XCGB 5IK2A 1N0VC 1RJ9A 2NO7A 3ZZTA 3P1JA 1VECA 1IXZA 3ZGXA 4Q9LA 2C77A 1E9EA 4F92B 1Z06A 4HAYA 4NYMR 1N5JA 4NCNA 4BLRA 4JJKA 4YDHB 3VU9A 5FUXA 3N2IA 1M1YE 2RGNA 2X19A 3Q72A 4NDZA 1XZQA 3VHXA 5CDFE 5GADl 2VHQA 2A9KA 3D8BA 3D6TB 4MUBA 4TYQA 2OBLA 3IHWA 1H8EA 3EASA 1WE2A 1HV8A 2IC5A 3NDPA 2ZE8A 3I8XA 4IFEA 5FL7D 4WW0A 3HPRA 4FMDB 1XPOA 2J9RA 2J0UA 2NZ8A 4LYAA 3IIJA 4NPHA 1Z2AA 2JLZA 3DM9B 2OSBA 1FNNA 4M1KA 2IS6A 1W48A 2BMDA 4Z51A 3A4MA 3PUVA 1BYUA 4UNPA 1NNEA 4LYJA 1TMKA 3AF3A 2F55A 1G18A 3C16C 2F1IA 3A1SA 2GRJA 1ZP6A 2NPIA 3K53A 3PXGA 1PZNA 2VHUA 3TW8B 4LYFA 3IO3A 1OHHD 2VH5R 4ARZB 4DLZA 2WICA 3K09A 4I1OA 1TQ4A 1N0WA 2IHYA 4HB0A 4M9ZA 5DE3A 1T4GA 4P32A 3K9NA 2E1RA 1QHGA 4B2LA 4JLJA 1XEXA 1E9DA 1FP6A 5FTNA 4MITA 4KV9A 1GZSA 4BFYA 2GBLC 2IHBA 3G82C 1NJFA 2OFOA 2IS4A 5A4JA 3C41J 1VCIA 4M1WA 4Q1EA 3IILA 2WPDA 2V6JA 3VR6A 3MWYW 3TUZC 4KFTA 5HCNA 2QI9C 5DLQC 3KZ1E 1FTSA 2IEYA 5JMTA 2P6RA 4C4PA 5CM8B 3GLHE 3UG7A 2YWHA 4PANA 3U4QB 1RRCA 3Q7PA 121PA 4M21A 4XJXA 4KYUA 4W7SA 5FOVA 3N5CA 1K5DA 1ZVQA 3AF4A 3SU8A 3DDCA 4V02A 4PR0A 4C2UA 3EC2A 5J4VA 2OUKA 1A82A 1E2PA 4MKFA 4V0KA 4B3GA 4RY2A 3U44B 4AD8A 4BWYA 1BO6A 3BBPA 3R7WB 4IDHA 5DNYB 1DEKA 3CWQA 1ZM9A 4MKHA 3AF2A 1YR8A 1X8KA 4UQOA 2AK2A 4CDGA 4DSTA 2JAQA 4LDJA 621PA 4B32A 1SHZA 3PCRB 1E94E 3ND9A 2O8CA 1NMYA 4NHOA 2NGRA 5C46F 1ESNA 2J59A 2KSQA 3EZ2A 3OIWA 3C5CA 1QHHA 3BB3A 2I1VB 4NCIA 2RHDA 1KJZA 1B0UA 4MGIR 4A0FA 1FZQA 3NWJA 3WP1B 3NBYC 2UKDA 1Z0AA 2NO1A 2FEOA 4HAWA 4BZQA 4DRZA 5J47A 3GEHA 3RS5A 2QA5A 2KB0A 2FFQA 2IYVA 2QT1A 2OFWA 4AG6A 4GRAA 5HTKA 3B1WA 3GPLA 1X1SA 1SXJB 3MMPA 3SZRA 2QU8A 5G53C 1G1MA 4ACAA 5E7JA 5JJKA 1D9XA 3KJIA 2QM7A 3QF7A 5J4HA 1F60A 4PPGA 2AKAB 5JFGA 2NG1A 5JI2E 3ZZ0A 1JB1A 4Q7MB 2QMUA 1EGAA 3T1VA 2A5JA 1K6MA 1UDXA 4M8NE 2QAGA 3RYTC 1FFHA 3FHCB 3RRYA 4ZIRA 1CR0A 4KO8A 5GVRA 1R5BA 1E79A 3EARA 4TSFD 4BLPA 2BC9A 1NG1A 2P6NA 1G21E 2CE2X 5FUWA 3I62A 3A4LA 4TWZA 4EUNA 2F6RA 3TK1A 1RJ9B 4KFSA 1VHLA 2UZ3A 4IXMA 1LF0A 4ZDWA 1H8HA 3AUXA 3SBDA 4PSKA 4JLOA 3RS0A 1AKEA 1E1QD 3U7HB 4JJZA 2MSEB 4OQXA 4B48A 2C99A 3K8YA 3VU9B 1A5TA 2ORVA 1GDDA 1IXRC 1VHTA 4URWR 3RS2A 3THXB 4DUGD 2GESA 3K0CC 2AL7A 2AXPA 2BDTA 1CRQA 1OXXK 4NKRA 3ADBA 2XSZA 4Q9IA 4HSEA 3UWOA 4C9BA 4URXR 1GIAA 2J0UB 3K0FA 2ZRBA 3VX3A 4D26A 2HF8A 4LZZA 1RC8A 2QROA 1P9NA 1KNXA 1EWRA 3E70C 4MYUA 1F2UB 3HU2A 1O87A 4CEHA 1G6OA 1R10A 2A3RA 2VYFA 3BFXA 2C9YA 3HDTA 3SJCA 1OIWA 3IDQA 4B6EA 2YKGA 2O8EB 5EE5B 3RRZA 2ZETA 4EIWA 3NIBA 4PQYA 2LKDA 2MSDB 4HLCA 2WIBA 1P73A 2P65A 4QHTA 4TT3D 5BYJA 3CPHA 3B60A 4EPTA 4PO9A 2HYIC 3FPAA 4R2IA 2F43A 3SYKA 1VDZA 2O0KA 5EUMA 4MKGA 3BXZA 3FVQA 4J0QA 4RD4A 4Z1MD 2R8RA 4CRWB 2YYZA 5JJIA 1Q1EA 3LBNA 3AVPA 2JLUA 2ZRKA 1JR6A 3B8HA 2G9NA 2A7QA 1SXJC 1GAJA 1OXUA 3AB3A 3KFVA 4HB2A 5HKKD 2F7SA 1OE0A 1U9IC 3B78A 5E95A 1W0KD 4QBFA 3HYTA 3KXKA 1N6NA 1RVDA 2ZROA 4KFRA 1OF1A 1Z0IA 1T8TA 3LA6A 4O25A 1N2CE 1ZM3A 1KAOA 2QUZA 1DE0A 1I4DD 5KDLA 1XD8A 1XD2A 4DVGA 1G5TA 4A2PA 2GZDA 1FL9A 3C7KA 1G8HA 4Q4AA 4OHZA 2ZRHA 2DFKB 2WZQA 2VL7A 4C0KA 3U7GA 1S0UA 2HXYA 3Q7QA 5JWHA 4DT1A 2X8AA 2PJRA 2ZE7A 1LS6A 4URZR 2OBMA 2CEAA 4BFXA 4HLDA 2PMDA 1KI4A 2AFHE 4MRSA 1V5WA 3DZDA 1YHNA 3GJ0A 1NVXQ 2IUSA 1BMFD 1YZLA 1R2QA 1ZU4A 3GEEA 5CB6A 3IPYA 1SVLA 3SS8A 2ZRJA 4XTRA 2NQ2C 4C0QC 1XMVA 3QEOA 1UDWA 2R62A 5EZ5A 4ZDIA 3EZ7A 1UKYA 3QVUA 2YHSA 4MGZR 4EQ6B 3GJ5A 4JBWA 3MAAC 1TUIA 4MYHA 2GCOA 4HB4A 1GRQA 2IYWA 4DDTA 5HCIA 421PA 1S3SA 1ZCBA 2RAPA 1N6PA 5FL7A 1UBFA 2Q9BA 1DAFA 2HT1A 1YZNA 1KGDA 5H1YA 4B34A 3GJXC 4RKEA 4AWXA 1E9RA 1S96A 1DARA 1Z6AA 1EFRD 2WHXA 3T5DA 2QQEA 5FUVA 2JLWA 1DAKA 1R5NA 3FHTA 4HZIA 3U6BA 4PQRA 1NN1A 3KJHA 4X8MA 4EJSC 2FFAA 2MMCA 1KDPA 4M9SA 4B3CA 2OV2A 4IKEA 4N0EA 3FMIA 1SXJD 1HA3A 1P62B 1G3RA 1KI3A 3I72A 4ZIRB 1OHHA 4PPFA 5AUQA 4RD2A 3X1DA 4F93B 1NL3A 3CZQA 3EIHA 2CBZA 2JLYA 3JVUA 4WXPA 4E09A 2G3YA 3SQWA 2JEOA 2EW1A 3WBKA 4PHFA 3T1TA 5CDFA 2NOAA 1Y3AA 2ANCA 3B1ZA 1KO5A 1XBTA 2G6BA 1P5ZB 1XPUA 4UXIA 1XF9A 4POAA 1F3OA 4Y0VA 1P4SA 4MDEA 1R0ZA 4OI0A 1JI0A 4RFSA 1ZBDA 4TQ9A 4XWAA 3ZVRA 1R8SA 3CX6A 2NO9A 3DPUA 3ETLA 1M6NA 2GJKA 1GNRA 2V3CC 1OH8A 1NLZA 2PCJA 3FHOA 3CH5A 4OHYA 1E2JA 2QQ0A 3BB1A 3EG5A 3SHFA 1BKDR 4LJ6A 2QP4A 4JVMA 2TMKA 3RWOA 4A0RA 1YJ5A 2MMGA 2PCLA 1IN5A 1E9SA 5FPYA 3WMEA 1H8ED 4LY6A 1NLYA 2AKYA 1YZGA 4CEHB 3Q3JB 3L0PA 4OQMA 1CEEA 2GVZC 1MOZA 2O0HA 5HE8A 3E1SA 5FBVB 1NIPA 3UXMA 4FI3C 4DKXA 1G3UA 4NZYA 4P4UA 4WXRA 3JZMA 2FZLA 1NY5A 2UVQA 1XMJA 4C0AC 2AR7A 2EFCB 4M4SA 3J81k 1GUAA 3QOFA 2VSFA 1P9RA 2GJ9A 1X6VA 2OLKA 3QPWA 3RC3A 4EKDA 4QGAA 3I1FA 2Q21A 1KSGA 3IIMA 5AJWA 5EE3A 1IN8A 3GLHA 4BFSA 1PLLA 1ELOA 1SVMA 1VCOA 2JLQA 2ZANA 1KZGB 2BMEA 2V1XA 3QXSA 2GEVA 4GMDA 1ZD1A 3NBFA 3P27A 4XVQA 3A8TA 4BFWA 4GDFA 3B5JA 3L0OA 1M7GA 3LFUA 4MYTA 2D7CA 2EFDB 1UBCA 3Q8XB 4QGGA 5K8UA 5BN5A 1LW7A 3EZ6A 4P31A 1P75A 3GLFE 2XGJA 2P5SA 4JYBA 3PJRA 1LTQA 4F38A 5DHAA 1CULC 2GBLA 4L4UA 3ZVMA 2WWGA 4Q19A 1DOAA 4TN1A 4LI0A 2RGCA 1YR6A 4MDFA 3BFVA 3RRMA 2WPDD 4Q4AB 4YC7A 1E96A 4D25A 3IQWA 3P20A 1GNQA 4LJ7A 1XU4A 1ZM7A 3GMTA 4TSFA 1UBEA 2ODEA 1EFCA 2PZEA 3TUIC 4DT1B 2JJ1D 4KU4A 1V43A 2IWRA 5FOTA 3KX2A 4A6XA 1R6BX 2AX4A 4XIGS 5FOWA 2QTHA 2J46A 3NEYA 4S35A 1S1CA 1QZXA 4G5RA 1F2TA 1E2HA 2Q9AA 3KUCA 1E1QA 4GOKA 2Q3HA 4GL2A 4NYIQ 2B8WA 1VG0B 4IXNA 3RANA 3UMSA 2HJVA 3U61B 3ZS8A 1ZMXA 3GLIB 3MSXA 4Q4JB 3BERA 1W4BA 3SNHA 5H8WA 1NBME 2GCOB 4ZDJA 3GFTA 1E99A 1II9A 1YRAA 2BV3A 5HPYB 1TU4A 1Z0KA 4LBWA 1S9HA 3WYAA 5DN6A 2EQBA 2WKPA 1C9KA 3P4YA 1TX4B 1ZNYA 2R6DA 4PSVA 1G8YA 4C0BA 1T5IA 5B58C 2P2LA 4JL6A 3SYLA 4D4KA 1Z2CA 1MV5A 2DWOA 3VMFA 1HQYE 2FG5A 2H5EA 1P2VA 4BLSA 5JWOA 3GLGE 2DBYA 4TT3A 1UAAA 2P0EA 5FPTA 3GFOA 1T6NA 2XZLA 1T3LA 1KMHB 1GL7A 1D2MA 2BWJA 3LAWA 4QOSA 1ZUHA 2EYUA 1KDTA 2HLDD 3F8TA 1OPXA 3AVQA 2XZPA 3EC1A 1XFAA 3L0IB 4IVPA 1DAGA 2F3TA 4Z1MA 2R6FA 1E0JA 2ZI6A 2ZR7A 3I32A 3CB4A 4OI2A 1NVVQ 2QPAA 2J1LA 3NBXX 3MJRA 4JT2A 4LGMA 1E79D 2J7PD 1WA5A 3VAAA 1KK3A 4DBLC 3AKYA 2ONJA 5HKKA 3B7GA 4ABYA 3TJZA 1HEIA 2ZIAA 3PQCA 1I2MA 3B13B 2DFTA 4GZLA 1TL7C 1W0KA 2QP9X 5BW8A 3H84A 1OFIA 1NN0A 4F7WA 2VSXA 5DYGA 2WWYA 1U8ZA 2GETA 1M7HA 4B47A 4LV5B 1G6HA 2GILA 1IOZA 1VYVA 1ONBA 2IYRA 3W6OA 4RVCA 3NH9A 3CRRA 4QJ4A 1UM8A 2BM0A 1DPFA 3DKPA 4AIIA 1LY1A 4DEXA 1D9ZA 5TV2A 1JECA 2WJGA 2CHGA 1Q0UA 2WWWA 2FSIA 3ASYA 3DOFA 3BJIC 5EZ6B 4E22A 3EIQA 3K0CA 3LBIA 4ZPXA 1AGRA 4X8OA 4DCUA 2RGAA 4R2HA 1FW6A 1CJMA 1VKJA 3KQKA 3NBZC 2CL7X 1BMFA 3ONWA 2Q0HA 4LCBA 4OHXA 3MJHA 4YMTA 4LUCA 1GKIA 3CX7A 1NF3A 5FUYA 1ZINA 3FB4A 4EFMA 3SE0A 3TLXA 1CU1A 2L0XA 2ZJ5A 4AKIA 3C8UA 2R6AA 2CL0X 1E4YA 2XTMA 4MYCA 3R7WA 3THOA 2C95A 2WWHA 1QBKC 1GSIA 1G5PA 4UJ5A 3LLUA 4WZAE 1KY2A 4Q1CA 2ZS8A 2CHQA 3RC8A 4LHVA 1EX7A 4U02A 1SKQA 3GLHB 1HQCA 2HCJB 4HLUC 4MUAA 2FFHA 4O0MA 3ADDA 1AK2A 5DHFA 1Q20A 2HV8A 2AK3A 2KWIA 3A4NA 3V00A 4IOMA 5K8TA 2K5UA 3QXCA 4JSTA 4JS0A 3WBJA 2N1BA 1JAHA 4TL8A 2HUPA 4OQFA 2CLCX 1SKYE 5JRJA 1KSHA 3B1YA 4NE2A 3LH5A 1Z63A 4PQFA 4Q9JA 4LHZA 1SXJA 1I4TD 2PJZA 1N3BA 3EPKA 3C5HA 2BCGY 1OFHA 1U9IA 3K9LA 2V9PA 3C15C 2QMOA 5C2JB 3IBGA 3OEED 5BWMA 2C5LA 3BH7A 1E98A 4M9XA 4DSUA 4CIDA 2ZSDA 1R4AA 1US8A 3AVVA 4GOJA 3U3JA 1W2HA 2VP0A 3KJEA 3AVUA 3H1TA 4CGZA 2O8DA 4A8JB 3CNNA 2KI5A 2C96A 3FTQA 1F2TB 4R7ZA 3OEHD 1E3MA 2ZUCA 4Q03A 3ADCA 2IL1A 4BLQA 5CIQA 1ZU5A 3B1VA 4Q1DA 4TLAA 4JLBA 3ZDQA 4MGKR 1CIPA 4BLTA 4C7OA 2IUUA 1HTWA 1Z22A 2BMJA 1QHSA 1MT0A 2E9SA 4AYWA 3AKDA 4QNRA 5L3RA 1U0LA 1XZPA 4TMWA 1G19A 4NP6A 1XJCA 2FZ4A 2PH1A 3ZS9A 3PUZA 4WZ6A 4EAQA 3RSLA 1GRNA 2A78A 1SVIA 5DYIA 3TH5A 2EWVA 3THXA 4JSYA 1WDTA 3BRWD 1X86B 2BOVA 1IJFA 1A4RA 1R0YA 2WTUA 4RCYA 3F3YA 1P3JA 3TVTA 1U0JA 1GTVA 1SVOA 4TZ0A 4CEIB 5KOYA 2XEXA 4ESHA 4URVR 2CLSA 3K1JA 1GILA 5KUTA 1I2DA 2ZI3A 3R8CA 1RZ3A 3AF0A 1E2QA 1XDBA 1F2UA 5H70A 2ZXUA 2NO0A 2QNRA 5FBLB 2J0SA 1ZRHA 2O8EA 1VPLA 3B9PA 3IHLA 4URUR 5FBQB 4FWIB 3W90A 2EU8A 4B3XA 2GCNA 4ITRC 4EJSA 1G8FA 2KBFA 4XOIA 4OJKA 4M1TA 4KJZA 1G3IA 2OLJA 4OJQA 4DIEA 5L8VA 3GJ8A 1KI9A 2PMKA 2QZ4A 5EUQB 3ZH9B 1YZUA 2XXAA 2Z83A 3RS3A 3KKNA 3CLVA 2Z0MA 5FOUA 3WHLA 1FMJA 2NTYC 3GQBA 3W6PA 1SVKA 2A5DA 3SOPA 2WWXA 1MRNA 4XWKA 4FD2A 4D2IA 1YZQA 1E1RD 1X8JA 1ZUIA 2OCPA 3BAFA 4JMPA 2QORA 1JEEA 1XTSA 3QEJA 3BWDD 2WIAA 1E2NA 1P7CA 2IYXA 1PUIA 5JHGB 1Z28A 1M7BA 5FPHA 2VIIA 4KAXA 4HEJA 5AUNB 4NU0A 2FFBA 2Q9CA 4ZO4A 2IWHA 3U3RA 4CVNA 3TIFA 2JJ1A 1TF5A 1OB2A 1OFUX 2N42A 4A8JC 5KTYA 3AP1A 2F1RA 4G01B 4Q1AA 4WIAA 2FDCA 4DSOA 2RGBA 2YV5A 3MGCA 4LSGA 2WAXA 5AJVB 3I92A 3KUDA 3DVLA 5FR2A 4AURA 4RD6A 3B6EA 2X1VA 5LD2C 4GNKA 2UZIR 5GVSA 1AGPA 2ZRFA 1TF2A 3K0SA 1XTKA 3QKSA 1W46A 5CYPA 1HE8B 3QXHA 5FOXA 5TY0A 4OI1A 2XNSA 1KJYA 4LPSA 2JDID 1OIVA 4EQ6A 4JLPA 1J8MF 1K8RA 2CCGA 2VTKA 2ZS9A 5G41A 1G4UR 3KKOA 221PA 2XAUA 2FN4A 1KJWA 2ZR0A 1S8FA 1KI7A 1COWD 1D8TA 4A9AA 5B64A 2ONKA 4R98A 4LWZA 5GJCA 4D4MA 3UANA 1UKEA 2ZU0C 5E7IA 2D74A 2J3EA 2GF0A 2RH5A 3KDSE 2WWIA 2FPKA 4IJMA 4M1SA 4NMMA 2ZSEA 3SI7A 2BEKA 2OE2A 3EW9A 5JWRA 2J7KA 3R9XA 5AUPB 1CP2A 4UNSA 4HB3A 5CLQA 5KDOA 2AN9A 4KYIB 5J4YA 3VKGA 5KSZA 2ASEA 2HLDA 3OESA 2DFNA 1US8B 2E87A 3H4MA 3DM5A 4PSAA 4Q48A 2O8DB 1KZ7B 2YVUA 3DL0A 1AZSC 3W3AA 4QBHA 4Q02A 3QI2A 2CVFA 4KODA 2J7PA 1XMIA 1E69A 4IDNA 3O8BA 1QG4A 3VKHA 3W34A 4XD7D 4ESVA 1HYQA 4TYWA 4BGDA 2C2HA 3T1QA 4B3FX 1HURA 2H18A 1II0A 2OCAA 1Q3TA 4FINA 5EJEA 1D2EA 2YNMA 4C7OB 4TZ6A 2OCYC 3MWLA 4NYMQ 4PZZA 4L16A 1DVRA 5JZVA 3CH4B 2WOOA 3SYNA 5BYKA 2ZI9A 1MO4A 3MFYA 2CXXA 4II7A 3CO5A 3ZIAD 1OXVA 1ZIPA 3GLGA 4QM6A 4A0GA 4NH0A 2QMHA 2IYUA 3ZYCA 3MWKA 2ZRDA 1OXTA 2C04A 5JLJA 4US2R 2O0JA 1Z6YA 1DAIA 2JLRA 2WSSD 2GJ8A 5FFMA 5TXGA 4P4SA 5LDDC 4FWTA 2IXGA 1EESA 1KO8A 1XTQA 2GJAA 4P4TA 1T0HB 5DN6D 4QXAA 1UADA 1LNZA 3LXRA 4TMZA 5FR1A 5FTMA 3TKLA 3TR0A 1PLKA 3V4FA 1IXSB 3DEFA 2ANBA 2IEZA 5JSZB 4I81A 1PV4A 4F4CA 4CYMA 2IA5A 3C4JA 1JNYA 4OQLA 2CK3A 2GEUA 4QHYA 1F48A 4EJSB 3OAAD 2QENA 1OH5A 2ZYTX 1CS4C 1KDRA 3LDAA 2O8FB 2B21A 2JASA 1Q3HA 3HU1A 4UNRA 1DS6A 3CF6R 3QUSA 1G3QA 2ORIA 1E2KA 4DLTA 3AUYA 2JJ8A 4DLSA 2XXAB 1QVRA 2F3RA 1JAIA 3EWAA 1KIMA 1DO2A 2XZOA 3IEVA 3LW7A 4OL0A 3TW4A 1ZAKA 4C30A 4DXAA 2REBA 1G9XA 3KFXA 3UATA 4CT5A 1TTTA 3D31A 2V55B 4NYJR 4YQFA 1FQJA 2C9OA 4TTQA 4KSBA 2ATVA 3NKVA 1VG8A 2QTVB 5F9FA 3EX7C 4B73A 4BZXA 2VP4A 2QPTA 5HE9A 1J2JA 4GZMA 2OO7A 4QGFA 2WAYA 2H7VA 5FOSA 5AR1A 4A1FA 3GFPA 2AHOA 5HZKA 1CTQA 2D2EA 2A30A 2FX3A 4Q01A 4QM7A 2ZYWX 4LRWA 1YKSA 3OEEA 2F1JA 1JQLB 3V9PA 4LPKA 4IFBA 4YDSA 4JBXA 2GAAA 3IIKA 4QC2A 4TTRA 4KFUA 4CF7A 3LV8A 1SVSA
chains in the Genus database with same CATH superfamily
1CFJA 5FWYB 1U5AA 3HWSA 3JQPA 3TE6A 5LBUA 4YRJA 4HNAB 2TMYA 4G84A 1Y7PA 2E49A 4L2IB 4LF6B 1F14A 4IV5A 4HDAA 3N8GA 2YZ7A 3BH0A 2IOFK 2CZQA 4YP0A 4HYEA 2EKZA 3B3FA 4K8RB 3VV3A 5ELXA 1LV7A 1C4KA 1FNMA 2EF0A 1D6MA 2XT0A 7YASA 5KQMA 4LRQA 4C6RA 2O59A 1MO6A 2D3TA 3CR7A 3COJA 2YBDA 2H8GA 3TZEA 4X95A 3RDPA 3SZLA 5TMPA 1C50A 4FMPA 3DLTA 2CYBA 3DOIA 2EZ8A 3LSTA 3QIVA 3W78A 4BBJA 4FUQA 2GXQA 2IZ6A 1Z8HA 3I52A 2GSWA 3M6AA 1ZONA 3MVEA 1FPMA 3OEWA 4X94A 4KSCA 3DVSX 2RI6A 3NASA 1F6DA 5LQUA 5JDIC 4D44A 2Q0QA 3A1WA 4IUCS 1GADO 1S2MA 1C4OA 2QT0A 3E05A 1AS0A 4V0NA 4I55B 2QTLA 3GDOA 3MCZA 4MX8A 4MA4A 3GPBA 4P34A 3CKMA 1DBIA 5CT5A 2AE2A 4O4HA 3TM4A 5IANA 4NYIR 4Y2QA 3ZHSA 3R7AA 3RT1A 3ZI7A 1NNLA 4YT4A 3ZD7A 3R9XB 2BFNA 2BEUA 3NETA 3V3TA 4HDRA 1NBOA 1PZXA 3DV0B 4MEAA 4Z4EA 3ICOA 3HBLA 3HB9A 3DMHA 1DUVG 2DQ4A 2ZIUB 2FN7A 3KKPA 4FMDF 4EMSA 1JYEA 3F6BX 3PX7A 1QGDA 1VYUA 2J9FA 3INYA 5LQRA 1AKUA 3LLMA 1KI6A 1E5TA 3G85A 4RD1A 1Z2PX 1OYYA 1K6XA 5I7VA 1EXDA 2KS6A 1KMHA 3KU4A 1SZCA 2C84A 2Q1TA 4EG4A 5JO0A 3X1WA 5KTMA 5I5EA 3TX2A 2OCGA 3K4HA 4NY1A 3VHLB 1IZ9A 4DR5B 2FJPA 1BA2A 2X76A 1XB2A 5HIJA 3ET5A 4E5NA 4MNTA 3DZKA 3ORRA 4HTFA 2FLWA 2M2IA 4Z1OA 2WM8A 4AP9A 1UFVA 5FT9A 1K9VF 2A0UA 3PFFA 4UPDA 2PSEA 4J91A 2HJGA 4PSDA 4UM9B 3QVJA 4PPNA 1T43A 3EHDA 5HSGA 2IIQA 1L7PA 5CDUA 1RWQA 2GK7A 3N07A 3CUEF 2CLLB 3TD2A 1T3HA 1E3SA 1TJPB 3WQSB 2MHCA 1CR2A 3GLGB 2C00A 2FR8A 3G0GA 3VYWA 3JQAA 2FB9A 4GI3A 3GFGA 4RFVA 3CXRA 1JQ5A 2OHGA 1W49A 1V47A 2MSNA 4E4YA 2IS2A 2QGZA 2JLYA 3CTMA 2AQHA 4KOAA 1YR2A 1VJ0A 2VXOA 2ZUDA 1GNSA 2YRWA 2CLHB 1P2TA 4BMVA 4P4SB 3UAZA 5ECYA 2GZAA 2H1OA 3I01A 5JBNA 5CFLA 3GZTB 3GRAA 4W1SA 4ZZ3A 4LF4B 3PGVA 4R41A 3ILHA 3WTCA 3AB7A 2J45A 3DWEX 2ZIZA 5LM3A 4NXMB 1JB9A 1IU9A 1Q0ZA 1PJRA 1WMSA 3LPAA 3ER8A 1JA0A 3UGTA 2H4WA 1VMAA 1T2DA 3PTAA 1AY0A 2JGAA 2PZGA 4IIJB 3AQ4A 3BGWA 3GJ6A 2IHTA 1CUBA 4KITB 1YI0A 3M5PA 5F52A 3L04A 2JANA 3LTEA 4Y2SA 4AUEA 3O0DA 3P9YA 3BFKA 1ZNZA 4K88A 1OCEA 2Q6IA 5L51A 5FI3A 3VPAA 2P7HA 4FOPA 2ORYA 2VKTA 1Q19A 1FTNA 4PTZA 3OM0A 1QX3A 4G24A 4B81A 4D7AA 4DC0A 3KZOA 4TKZA 2B5WA 4NFHA 1V3VA 3R5KA 3H2JA 3OX1A 1KRWA 3GH1A 2EWMA 5JI2E 4I8IA 1GV0A 1XZHA 2XBLA 4LX8A 2HQOA 1WTCA 2OLEA 1R8JA 2YQ4A 3QF4A 4NH4A 1LZKA 1PP4A 4DNQA 4DWVA 3EUEA 1ADCA 1K4YA 2P2DA 4BNJA 5IZCA 1SZDA 1YHZA 4XB2A 5KO2A 2OXEA 3KLBA 3WADA 5K8CA 1D09A 1TM3E 4WASA 2C5HA 5BSGA 3K70C 5K0FA 3ACBA 2VJKA 4UHHA 3G5TA 4N7RA 1M8JA 3HPQA 2B1RA 1KQFA 1F6BA 2W22A 5LL6P 1IULA 4B09A 3B82A 3I4CA 3UB3A 4WZAB 3CF2A 4KHZA 1GTJ1 2HSZA 2PVPA 4H3VA 4HAZA 3EZLA 4I9UA 5LA6A 2C97A 2B4TO 2W9XA 4ASUD 5CFMA 5HR5A 1A9SA 2J85A 3BD6A 3MZ0A 4GOMD 4TL6A 1TYZA 4ND4A 4XR9A 1QE0A 2I91A 3U3MA 3V4LA 2Q3EA 1X0XA 4OJTA 4B3JA 4E21A 4BVGA 4BASA 2DCUA 3AILA 4XD7A 1HG1A 4FKMA 4YQYA 4Q3DA 3DTTA 3SHWA 1COZA 2CZGA 2ZE6A 1DKPA 3LCMA 4GYKA 5BSRA 1U04A 4GRIA 4UHJA 3HMKA 3BE5A 2XBMA 1THGA 2FNAA 1KQNA 5CDTA 3P0HA 1UBHS 2HTFA 3B6KA 1SKYB 2BAGA 3DOUA 4Q9AA 4B46A 1N7IA 1I01A 2HK9A 4JYCA 2O3QA 4KRXA 2JIPA 3ZGVA 4DUPA 4OLFA 2QL9A 2HBZA 2DR3A 1PZHA 1PNRA 3PXUA 4HNSA 2AVNA 4GMGA 3ZWXA 3QVSA 2ACEA 1NSFA 1V7ZA 5JSHA 2F1HA 3EPLA 2A4MA 4ZKEA 1I2CA 4LK3A 1T5TA 4IJVA 3RG2A 4PQEA 3KXDA 3VSDA 1G98A 2OHFA 3OJLA 1RXIA 2IPOA 1S9DA 3ETGA 1D2CA 2WDZA 3GIWA 4Y18A 4FZ3A 4O4HB 4F72A 3ELUA 4URYR 1P61B 5G0VA 2LIVA 2BEUB 2GO1A 4HDRB 3OM9A 4P80A 4DZZA 3I5YA 3WLNA 4O4JF 3F3KA 1SJ9A 2GTHA 3BMXA 3KSMA 4JKIA 3OFJA 3LS2A 1TYEB 3HA2A 4OY3A 4PSUA 2F2TA 2VPZA 2J9FB 4TMXA 1T4CA 3F67A 3IL2A 1DJOA 3D0QA 4IR7A 1II8B 1EM8A 1KI6B 1OFTA 2A1TR 4Q3OA 1RS0A 3L1JA 2D2FA 3NGLA 1EG2A 1NU6A 2I2XB 2X40A 5GM2A 3PLRA 3PEWA 3IXLA 3USES 1JJBA 3QLVA 2REQB 3F4KA 5KOHA 2VDPB 3KJGA 2IOHA 4HTFB 5LQNA 2J67A 4QUGA 5FLXA 1Y37A 1RRVA 2AR9A 5JRZA 1XRNA 3KU1A 5EC8A 1D2RA 2Q27A 1LQTA 3K72B 5FV7A 5EIBD 3RNOA 3WB9A 5EMKA 3ZTYA 1A5BB 1RQRA 4O5OA 1OC2A 5FIUA 4HUTA 2CNWA 3H8JA 1YB2A 1JN0A 3KTOA 1BDBA 2O7QA 3G8BA 2XF8A 3EOZA 3NALA 4GC5A 3K0KA 1SUAA 3FDXA 3R3UA 4N18A 2F9MA 3DGFC 1I4LD 1K7FB 1T8UA 1ZICA 1L2TA 1J25A 1RWWA 2BONA 2FX2A 1FBNA 2JHCA 2G8LA 1DDGA 2GRAA 3ILVA 4CQMD 1BEEA 1V6CA 1IPFA 2GYWA 1HE5A 4CUZA 5MN6A 5G0UA 5HJ5A 3NOXA 4G9GA 3DTVA 4M9QA 2OBNA 4W8OA 3U26A 1MXHA 3AIMA 4RABA 1FRZA 1CUIA 2JPDA 4KV7A 1JQEA 4D43A 2IXEA 2OESA 4GXRA 4HG2A 5AI6A 4OU4A 5CLJA 3CWZA 3TNDA 5EOVA 4N82A 4MAFA 1NFFA 3UMRA 2VSOA 5IAEA 3PIRA 4PX9A 5FYQA 4PLWA 2OXIA 3SQMA 4NE9A 4UASA 5T5QA 2FEPA 1T13A 1QONA 2QV0A 5LU9A 2HSEA 3WG9A 1FUUA 2OXCA 3IC5A 1MEJA 2CJWA 3GGGA 3N53A 2OK7A 3WGTA 5EZYF 2O1EA 4RETA 3ZHQA 3KQUA 4S3MA 5C18A 4E14A 1IN4A 5TS3A 1CY6A 1WUHS 2ZQZA 4U2BA 4I08A 1UZNA 1AOXA 3HB5X 2OXRA 1QNLA 1J09A 1PKXA 1R6AA 3CV3A 1MU0A 1E62A 1IH8A 1DG3A 2FG6C 4KO1S 2AJLI 2VK8A 1G7SA 3EAGA 5I7AA 3EA5A 1SHLA 1XZ8A 3PHHA 5GQSA 3SEQA 4G07A 2P30A 1IJBA 3USCS 1PWEA 2QZPA 1A1VA 2OKCA 1M2GA 2JBHA 2BEWA 4IBOA 1ONOA 2E3JA 3QF4B 5FLYA 2W48A 3I9JA 3L7IA 3DBRA 1FUEA 1U80A 4PTLA 4CGYA 5ITSA 1K6IA 3RYFA 1QQ7A 821PA 1UBGA 3S2FA 1DI0A 1UJNA 5ADUS 4O2BA 2IF0A 1V1MA 2XKJE 3LBFA 3P4XA 1PJSA 5FTJA 3VVMA 2FPMA 5AKXA 4X00A 1GP2A 5K8LA 2FX5A 1UR5A 1RYEA 3ND6A 4UUNA 2VPTA 3PUYA 2H16A 5H68A 4LRXA 4YJKA 3UJ7A 3T0IA 3D8RA 2VDLB 1W5SA 2PA3A 2BR5A 1VHDA 3DJFA 2IHKA 2Q49A 1RI5A 4RGYA 2JAXA 1SZJG 2EX1A 3LUPA 1KC3A 1R0XA 3K73O 4UUQA 5FNZA 4BZPA 5AM4A 2VQFB 2PZFA 1QQAA 3CVJA 1MVLA 3UV3A 3Q10A 2HDWA 4BMXA 3L8YA 3OO0A 3WLPA 3OVMA 4G5QA 2K87A 4K86A 4YP1A 3GLRA 1Y5NA 2M98A 1P9WA 5DXFA 3OTOB 4IJ5A 5B1EA 4TUYA 5FBHA 2R6CA 2R9VA 4F1KA 2TMGA 3LQQA 4JVOA 4UVEA 3REGA 4L8VA 3H2SA 1NTRA 2IT1A 4HYTA 4O3FA 3ZK9A 2R6JA 4ZYZA 3C3YA 2PT6A 4L5BA 2ZZMA 1Q6YA 1E64A 1W1WA 1BAPA 1UJCA 3OTHA 3HC7A 4K8OA 3ORFA 4DQXA 3T7KA 4HV4A 1ETUA 3VBEA 3ZU2A 1LLDA 3F98A 1C8KA 1VCHA 1BKYA 4HDSA 4HVAA 4DA0A 3QQ5A 4M54A 2BH2A 4F96A 3M82A 3U7RA 3VHRA 4GPD1 4Z8YA 2AMFA 2IH2A 2RBEA 5HMLA 3A4IA 3I5UA 4MPDA 4V2IA 2AZMA 4YXWA 1DG9A 3Q1LA 1CFZA 3BJZA 4AF7A 1MABB 1UBTS 3R3SA 3V4VB 1W87A 2OQIA 2PJDA 5JIBA 2ZZNA 1WZEA 4WKGA 2ATIA 3KYCA 4ZI2A 3ZG6A 3UPTA 4EY4A 3BXEA 3I4LA 5HMMA 1E0KA 1VJ5A 4JEUA 5DLDA 3N74A 3LPLA 3CUWA 3FX2A 4YRBA 2BEJA 4YJ3F 3GGCA 5G0TA 2P2CA 4PN3A 1G5HA 1ULHA 1AGNA 1M75A 3O8NA 3W2FA 2CY0A 2R60A 2ZM5A 1EUQA 1SHUX 1PFKA 4M1QA 1FFCA 1ZISA 3U16A 1T4CB 2W2QA 1Q0SA 3T7IA 1EM8B 1RWXA 4DR6B 4KACA 2W6JA 1GFIA 3Q3HA 5I4IA 1N5OX 4L15A 2MT9A 5DPMA 2HA2A 4ZV9A 4IEIA 1Q92A 4N41A 1NU8A 4M55A 1RQNA 2BGJA 4R9NA 5DYTA 5KOHB 2DETA 4PX2A 2PT7A 5CB4A 2CUTA 4X91A 1ZMTA 1SZPA 4RCVA 3T3PB 3VDRA 4MRAA 2QM3A 5EXSA 4UBLA 3VPFA 1ECBA 1C1YA 1DIHA 1QHYA 3ZWPA 1MC4A 3RI3A 3D8SA 2OB1A 5AK6A 4BE9A 3RU9A 3KL4A 3UH1A 3OMWA 4Q5IA 1R8XA 3AJRA 5ER6A 1T3SA 2PL9A 1E9CA 4HWPA 4U39A 5KWEA 2H92A 1LD3A 2XCRB 1GM5A 2HRQA 2HNAA 4ZP1A 1YONA 4H08A 1KAEA 3G2JA 1NKSA 1R0SA 1XZCA 4ARIA 1B41A 2XUDA 3RBXA 5JANA 1PR0A 3A6GA 4HMPA 2HHJA 3Q15C 1IBKB 1DP4A 4FSXA 3RSFA 4L02A 5LPNA 2QMYA 4O3MA 5LQDA 1T25A 1I0ZA 2V0NA 4CZ2A 2CEKA 3L4SO 3FNIA 1B23P 3FCEA 3CNHA 3I73A 4BV3A 2YWRA 1CEXA 4QPPA 4ARAA 5KYGA 3ELDA 4KXNA 5DNWA 3QLUA 1CXZA 2GUWA 2GBGA 1QYDA 4YFVA 1SHKA 2IH5A 5J1SB 1CWUA 4LC1A 3K94A 2DWPA 4RMJA 3KCNA 1RRFA 2CJWB 3K0EA 1PS9A 1EDBA 2J3JA 1M74A 3O21A 2I65A 1A76A 3QG5A 4YO7A 3T9FA 4MB2A 2FUG6 4DLUA 2HM7A 3MUOA 4TMFA 4TOIA 4YVFA 3TRIA 4CMAA 4G1BA 4MIEA 2VBIA 4P7GA 3R5XA 2C54A 1KDYA 4PBSA 5IDWA 2XOKA 5ALLA 2PMEA 3IVGA 3FCYA 1VE5A 2DJ5A 4WZBA 1W4RA 2QD3A 3AETA 4JZKA 5J2UF 1I32A 2Z5GA 3VAZA 4DXDA 4AZTA 4RVDA 5K0JA 2XTNA 1WTAA 1Q6ZA 5AM1A 3PITA 4TVKA 1NVMB 2B4AA 3U1BA 5EZYA 1CLUA 1EQAA 4V0RA 3WJ7A 4KIFA 4YJ2A 4QASA 2V4MA 2E2WA 3RYFB 5JJ5A 2FVXA 2JNWA 2DYKA 2HUNA 2QVYX 3FTCA 1CDOA 1O8CA 5JSUA 5DDIP 4O2BB 3IALA 3PE3A 1V1MB 1FLAA 2XE4A 2ZPAA 1X9HA 3EA4A 2JI7A 2P3OA 1EVQA 5A02A 2Y0EA 3QJ5A 2OCKA 2HSJA 2PKWA 3A0UA 5EQJB 5JDCA 4LXTA 1BD3A 2AUMA 1ODCA 4LYHA 4QPZA 2J6IA 1D2HA 2G17A 3ENZA 4ECAA 5IAKA 1ZIXA 1D4AA 4NTZA 4IDQA 1RLUA 1WB9A 2BGRA 2BZ1A 4M0PA 4Y0AA 3TLKA 1XWFA 4KXUA 3HR8A 1IRXA 1YJ8A 4UKDA 2QZJA 2Q2NA 2VA9A 2ZB7A 3NXSA 5BYAA 1NBMA 4X1IA 4ZYVA 5LVAA 4UEJA 1RPJA 1Y82A 2OG2A 3R5FA 2WVGA 5IDVA 1HEYA 3T9CA 4YPVA 4W63A 1SOMA 1T2CA 3M6LA 1P4GA 1NMQA 3PGLA 3R6WA 4WBSA 3W8NA 4HZUB 4IEEA 4OP1A 3T3DA 3U13A 3OUTA 1P8AA 4C4RA 5KSWB 4JI3B 3Q7IA 3LO8A 2GN2A 4B6GA 2E4WA 3B85A 1N5KA 1U3TA 2LWIA 3SZUA 1N0UA 2RI0A 2VP6A 1HSOA 4OOFA 3NC1C 3PENA 1N5IA 4HDSB 3ZD6A 4YWHA 4BKQA 3MNFA 3MM4A 3R6LA 2PYDA 3I58A 2XMQA 4ME6A 2HQ1A 3GLSA 1PV1A 4AG3A 1EDDA 3CF4G 4Z9XA 2RHTA 2VF4X 1YUMA 3DFZA 4OQDA 4BVFA 1OXMA 5K2OA 4RLQA 4Q3KA 3QY0A 4GMXA 2YOHA 5JROA 1FRQA 2G72A 2RGEA 2QYOA 2H0QA 4PRLA 3T7TA 5IU6A 1X7WA 1U11A 1SUEA 3KYIB 3W1VA 3B2EA 3GH3A 3IE0A 1H2RS 3HXTA 3ZWMA 3DC7A 3Q98A 4R81A 3I9KA 3IS3A 4E1VA 3OY2A 1FRFS 3CX8A 4JENA 4OHMA 4FGJA 4LGCA 4QLAA 5P8WA 3RSSA 3N6VA 3V55A 4M22A 2JRCA 1R0LA 4P33A 1Y4ZA 1VLZA 4NJEA 3ESXA 4NNJA 1PJ3A 1KVSA 4FOOA 4RHYA 2DH6A 3A37A 2XTJA 4JUDX 4Q18A 5LJIA 1DCMA 1JHUA 2IZZA 3BILA 3TQTA 4W9NC 4AB1A 3BIJA 3NHAA 4HXYA 3LT5A 4LA4A 2LBPA 2AD1A 1WMEA 1Y7HA 3BQMB 2IEDA 2H9YA 5G1OA 4RHTA 2YVLA 2FPSA 3AO0B 1JDPA 2J87A 2Z9BA 1KIFA 1AV7A 1FP2A 1YDGA 3HR7A 3KZVA 4O4JB 2AMVA 5ALJA 4KI7A 1UZLA 4BBPA 4ZEVA 5CB4B 4PGHA 4U7DA 5BMVA 3IQDB 4LF9B 2CFIA 3EVZA 1YA4A 4ZRDA 5L4SA 3I30X 1NTOA 3SC6A 1BHSA 4JITA 2VPPA 4N03A 5CXQA 2GPSA 1JR2A 4S1TA 2ZQYA 4MKRA 5F7ZA 5HK8A 3TLJA 1LDMA 2FPWA 3R24A 1A88A 4KEAA 1FK8A 1RHRA 3UUGA 2H6EA 2YOFA 3D81A 3PCXA 3ZJVA 3PR2B 1RHJA 1C9YA 1J6UA 2Z1MA 3E7WA 1TZMA 1NY6A 2G82A 3IP5A 3OPNA 1DBRA 5EESA 2BHNA 1VGVA 2JEYA 4KPGA 2IIPA 3QXXA 4L27A 4MVWA 2QZSA 1YVUA 1T8PA 1U94A 4PIVA 8ATCA 3FYDA 4G2TA 1HYBA 4H9GA 3WZ2A 1X7GA 5H7XA 5U9CA 1MB0A 2ZR8A 4JT9A 2QE7D 3CKLA 3QKRA 5LLSA 3WAJA 2YFYA 1MF7A 4CMCA 4Q3EA 2QY9A 3QRWA 5IEJA 5TIIA 1JHAA 4IQ0A 1ZJWA 3A3NA 1J0CA 1GZ4A 1M33A 2DR0A 1RJWA 3T3EA 2VYVA 5HQ3B 3ZY6A 3H7IA 4XX1A 1HNWB 1EP3B 1VZ2A 3DO6A 2X41A 3PWSA 4TQUS 1E18A 1JJ7A 2JH8A 1UJMA 3EEQA 2DB3A 3DCNA 1PW5A 3R7FA 3FTPA 2CF6A 3IQEA 2MSWA 1JLLA 3COPA 4NLLA 4ENWA 2VSYA 1Y8QA 1YRYE 1QO0D 2ECOA 1NJSA 4KE6A 2FPXA 1R6UA 1P1HA 2FSHA 4N3BA 1H05A 4WOKA 3K7EA 5H16A 4CU2A 2RCYA 3KQLA 3X1ZA 5AUOB 3VR2A 3AEQB 2QSYA 5LBIA 2ZJ1A 2A94A 3T1OA 3W8RA 2GZRA 3MMNA 4EGCB 5HILA 3GA5A 5EQDA 1P1JA 4WZBB 1O96A 2YIDA 3N3BC 4CW7A 1XX6A 1P4AA 4ZV4A 4A2CA 3SVTA 4K46A 1XVVA 2V45A 5D7NA 1W34A 5AOAA 5FPPA 1SCAA 4XVCA 1QZZA 4DVJA 2RG7A 3R6GA 1XMSA 2H29A 3L4BC 5EZYB 2V03A 1ESMA 3OUZA 2GPNA 4RZ2A 3E48A 4EMTA 4RHFA 3FGPA 4YJ2B 4B75A 3QHQA 5GM1A 4CM3A 2G9RA 3UG6A 4F3YA 5BWOA 2G1JA 2WMOB 3GW8A 2JIZA 2Z43A 1L7QA 4KNYA 4KRFA 4PAMA 5FPSA 2I33A 2D1FA 3C7TA 2AWNA 3V1TC 5C3MA 10MHA 2OCXA 2E6UX 1DTSA 2O2SA 5GV8A 4A8PA 3U09A 2QW8A 5J2UA 1KEUA 1RJDA 2DY1A 5DTRA 2VZEA 2FA9A 5FFFA 1TT5A 2B36A 3K0AA 4BQQA 1NBIA 2WIDA 3EGEA 1ZUNA 5BW5A 2DHCA 3HXPA 4N48A 4MYRA 2EFGA 3TW0A 4YAUA 3MMXA 3BM5A 3E3NA 5TF0A 2Q6TA 3V33A 3HRHA 4TLCA 3MQ4A 1L5QA 2VATA 4B3DA 1KKLA 4G8JA 1DOZA 3M0EA 3OQOA 2ID8A 3UMYA 1JWAB 1U4OA 5EWJA 3KOOA 4G65A 2DC1A 4Q37A 3ZE9A 4DNOA 2IZ5A 3GT0A 1MHPA 4FHFA 3RF6A 2R97A 4FPXA 1NLMA 1LA2A 2JLAA 2PFGA 3N7UA 5HJ2A 5ENVA 3ZGYA 5JRDS 2CLDX 2OMKA 2MINA 1DMRA 2HU8A 2Q5JA 2XNCA 2FPGA 1GZ6A 1YQEA 3KB6A 3M4ZA 4M60A 5I7FA 2BW0A 1WF6A 4GOXA 4UTPA 5J9FA 1B93A 5AHXA 2NIPA 1YE8A 1MX1A 8OHMA 2HO4A 3IQHX 3RAEC 3P0JA 3FKSD 2ZPTX 3AQIA 3SD7A 1FQKA 2H4JA 2QX8A 3I0ZA 5ALXA 4IIVA 3HYCA 4QYXA 5HUHA 1RKBA 1UOPA 2XT6A 4FDVA 3U6KA 3K09C 4BKUA 1YASA 1TMOA 3FKQA 1DIBA 2JJ2D 2QY6A 3QNUA 4G2NA 2YINC 4M0CA 3TOZA 2BELA 1GRRA 3S99A 4KR7A 2AH5A 2XHEA 1PL6A 1B43A 2G7MC 1SURA 1X3SA 3HKCA 4V1CB 2CDBA 1GPWB 3WIUA 2E7ZA 1A04A 1E6MA 1UT5A 1XNHA 4PN7A 1J97A 1FX0A 1QG2A 4KHPB 1O5IA 4WVFA 1VHWA 4FFLA 2ZWIA 3ICCA 4KQHA 3QBJA 2O0LA 4MUGA 4NJEB 4UMVA 3IKJA 1EZ1A 2FPUA 4GWGA 2HMWA 4PRKA 1D8AA 1OWOA 1IJEA 5JECA 4RTLA 4KZKA 1EVIA 3EXFA 6CHYA 1L5NA 1T1SA 3IMCA 1ADBA 2QL6A 3LUDA 5F3DA 3WYGA 3SMQA 1Q1GA 1CJTC 1Q3KA 4GU5A 4Y1RB 4D74A 1BWQA 3ISJA 2I8CA 4JP8A 1J9EA 1V11A 4W82A 3NCHA 3OF5A 3EA0A 4KRYA 4YJ3B 4XWWA 1M1NA 4QOGA 2F64A 1E2FA 3A11A 2JAHA 3G9UA 2YJGA 3C3PA 2WVHA 3DLCA 4Z9YA 5HQJA 1Z12A 3ZWOA 2QNBA 3AY6A 2FWAA 3DO8A 2H4HA 3M6IA 3N7AA 4IDEA 3VZCA 4NYJQ 1X7DA 4B6RA 4DQUA 4EGAA 4D4JA 1IWBB 1MT3A 3TXXA 2OAP1 3E9CA 1U0EA 2YYSA 4R8RA 4X8HA 4BEJA 2BI8A 3LXXA 3NPMA 5L3VA 3T3NA 3SEZA 3HUUA 4PC1A 1WCV1 2GKSA 2R5NA 2QTFA 4TMTA 1A5ZA 4JV5B 4YRCA 4K9DA 4D80A 4O33A 1CR4A 1GT6A 1KERA 3ZDFA 4GOLD 3BC1A 4DC1A 3GLVA 2CT8A 4RA6B 4TVOA 2RI1A 5IVIA 4RQUA 3QSYA 1Z0FA 3ZCTA 3SIPA 1WZ2A 2F43B 2O7RA 3VAAA 1JEYA 2IXTA 1J56A 2GPTA 3FZYA 1Y1KE 4J1SA 2H5IA 1V7CA 1W0JD 1KSFX 4HQLA 1NW8A 3QFRA 4V3CA 6Q21A 2J5XA 4GLLA 4NCKA 3SEFA 3H5IA 7REQB 1Q0TA 1RPZA 4BCCA 4Y2JA 1XVUA 3A9WA 3DF7A 4AI6A 3GDWA 1J0AA 2JH3A 1JDUA 1XKLA 1QP0A 1KMIY 1JPJA 1TKAA 2GM3A 1JLLB 3I2JA 4CM4B 1HFEL 1Y8QB 4BXOB 1Y5LA 4MQFA 1ZUWA 5T8KA 4G37A 5KYYA 1J42A 3BK7A 4DMUB 3UIEA 3KTDA 3EUAA 4CM6A 3NEPX 3LKDA 4RPKA 3ZIUA 1ODFA 2ZJAA 3RBVA 4JR2A 4DQLA 5AFSA 3KV3O 1RBMA 2I03A 2NYUA 3JQBC 1O5TA 1EVJA 3U7IA 3F5FA 3LE8A 1MTZA 1O96B 1B1AA 3KWLA 5TR9A 3TCNA 3A6FA 3G2OA 2BFWA 4E3ZA 5C53B 3D54D 4OBEA 4F0JA 2IS1A 2PSDA 1PWZA 3VR6D 3H18A 2ID4A 4I4LA 2BGWA 3H9GA 3LYUA 4YAEA 1BU5A 3C8ZA 3SAJA 2ZPUA 4ND8A 4PHGA 5GTDA 5IPFA 2VYND 1C7IA 1MBZA 2JGNA 4S2EA 1PG0A 2CL6X 3TPFA 2NZYA 1FEZA 1YCFA 4QYMA 2QQ5A 5J2UB 3M5CA 4AK9A 1KY3A 3C3WA 2NN3C 1TT5B 3A6JA 4LJLA 1NPTO 3H3FA 1ZUNB 2VAWA 5KCMA 3CVUA 1NQTA 4BJ6A 1U2TA 1I6MA 3RROA 3OETA 2FR1A 4WVLA 4ZVPA 1J1ZA 4WJZA 2CLMB 4Q1BA 2X7HA 4ZV7A 5BV1A 5CURA 1XJQA 2ABWA 4E5VA 5FEMA 2Q2WA 4ER3A 1UQRA 3TXYA 3DW1X 3EW7A 5CDYA 5EWJB 4K28A 4EVIA 4ZK2A 1EDZA 2C8LA 3PC6A 4JJ6A 2QDXA 2J3QA 4WGGA 5G3ZA 5BVGA 3QENA 4P86A 1IY0A 4LOJA 1KS9A 2WU0A 3IEKA 2FRDC 3HHPA 1GQSA 3FY4A 3CRVA 1J9GA 2M32A 3F7NA 3VBCA 2MINB 2IDKA 2R47A 1BCSB 1ES9A 2FGJA 2FPGB 4K26A 3CMCO 5K0TA 1Y9ZA 1V71A 3TAUA 9ABPA 1J5PA 5CHYA 3TTSA 1TQ2A 3OT4A 4IGEA 5B2ZA 4QKQA 1U9YA 1FY2A 4G5GA 2O52A 2WHPB 3RTEA 1XLTC 1FXWF 5FQOA 1Y6GA 3WL7A 4FDUA 1YE3A 1XEWY 1JKJA 2A0XA 1X42A 3JATA 5CBPA 3HI4A 1JFLA 2CVHA 4J29A 3BS4A 2X3UA 1VPEA 4L7VA 2JCBA 1THMA 4J90A 5SYMA 4R8LA 3RRFA 4Y6GB 4E4TA 4MEBA 1TEHA 4W9MC 4FYWA 1Y98A 2WUFA 4MQ6A 4M99A 5E3IA 4MKZA 2FLKA 1YFZA 3KQVA 3HKCB 2PBRA 2WUWE 5LZ5A 4MVJI 3U4AA 3WDMA 3KAJA 2AC2A 1FX0B 4KX5A 4FDAA 4TSRA 1D5CA 1Q12A 1KY4A 1J23A 3K1AA 1FP7A 1BCRB 4NZPA 4UAJA 4CHGA 1A3CA 5A4DA 1W75A 4EW1A 5JZ9A 4OP3A 2R65A 1JXAA 5D3MA 2BVNA 4HS4A 4E03A 2IXFA 1S7CA 2OOSA 3PUXA 3U2QA 4EPYA 1U3WA 4DR1B 1IN7A 4AF6A 1I0IA 4Z99A 4RFSB 3ZCRA 1A69A 2C0QA 2RJOA 2HIAA 2O48X 3ROKA 3R0QA 2A8YA 2D1TA 4ZREA 1AO3A 3QELA 1W85A 4X1KB 3WGMA 1QPGA 1B6GA 1EFTA 3ZNPA 4E94A 4LRUA 1JX6A 1V11B 1H42A 1C9NA 5IUNC 4QIHA 4DCVA 4WAUA 1M1NB 1TECE 4ITVA 1B6SA 1PFUA 4JLAA 4A1FA 1W93A 1RYBA 4YHBA 1Z15A 1MRSA 3L41A 5A03A 5IC5A 1VQ1A 4DG8A 1K97A 5B1IA 3RABA 3WRVA 3L0BA 1JVSA 1BE8A 2WZBA 1E2MA 3HJUA 4C3ZA 2YN2A 2H59A 1T9BA 2XSZD 2A1TS 3WRXA 1A9XB 1T24A 2CHEA 1KYWA 3DMTA 1W581 3PT9A 1XO1A 1UAYA 3RVBA 3S81A 4RADA 4Q1FA 3RQIA 1W0CA 2G06A 3WYFA 4H18A 5LQAA 1FP4A 4H60A 4WOBA 2E4VA 4DMRA 2F4NA 1AIPA 4MRNA 1BDHA 4Q9HA 1IPEA 3U44A 2F9FA 2UYGA 2P41A 1U3DA 5J63A 5FNVF 1JEYB 5EIOA 3FWYA 4C22A 3PSAA 1C9JA 5H80A 2FUNB 3CSSA 3LT1A 3S28A 4EUHA 5IJXA 2WINI 2V4ZA 1DC6A 4NATA 4E2ZA 3ONNA 2NZVG 1D4FA 4V3BA 1XJ0A 5E8JA 3T35A 4BL5A 1VA5A 4YHHB 3PXEA 3A1CA 4KQMA 2HHAA 3ZE1B 3RWMB 4KIGA 4YMSA 3UBTA 3WKEA 5I48A 1SPBS 1NIJA 1U2RA 2QMQA 4Q00A 5JAQA 3VDXA 5JD6A 1JPNA 2JIOA 4B7CA 3VJKA 4I4TA 2XADA 4P54A 4MQFB 5D8DA 3O82A 4A03A 4LQCA 4B74A 1CRPA 1LXCA 5BN5B 4LOHA 3VFDA 4R8VA 4Z86A 1XKXA 4MV4A 2GYVA 3LX8A 2APJA 1JZQA 4DNXA 4EZIA 2JKYA 3PWKA 2V6BA 3R3YA 1QDEA 4CMBA 4RULA 5A2QA 4QQRA 4MMZB 1RWOA 3E5RA 1KKUA 3OE7A 2ZWPA 1XIVA 5AHWA 3UUWA 2JL1A 3JQ8B 2IX3A 1XTJA 1T4DA 3N86A 1RAHA 4L57A 3X0DA 2XWQA 1Q1BA 1XI2A 4BC0A 1H94A 3KLPX 1H5UA 3W5VA 4ND8B 4AG5A 4PWYA 5T3YA 4C04A 4DHEA 5KHOC 4DV2B 1CE8A 4LHXA 2PYZA 4W6ZA 1Y1TA 2G5CA 2BGKA 1Y4UA 1DSSG 1UKBA 3QH4A 4HX5A 1JR4A 1UXJA 4Z5XA 5B3KA 3ECCA 2C0CA 2OT3B 2BE7A 2QS9A 1TZCA 3SQXA 3BOSA 5D84A 1P6XA 3PVSA 2HRBA 8AT1A 3SHOA 1WW2A 3OD5A 3TZBA 4US1R 2Q9UA 4BVJA 3IVMA 1EQUA 4HC4A 1VSVA 3H0CA 5B1DA 4ZQFA 5DB4A 4AULA 3T0GA 2IFTA 1VP9A 4X54A 3W2TA 4Q3AA 1GPNA 3SXUA 1FNBA 5IK2A 3VO8A 1E3WA 4KXXA 3MRVA 3BULA 3NLLA 1T1IA 1CCWA 6AT1A 2FAXA 3P1JA 1VECA 1Y3DE 1IXZA 2D5BA 1GFWA 4NULA 4ZT6A 1LX6A 5F4ZA 1SRRA 3COWA 1OA0A 4HAYA 2V58A 2OPBA 1N5JA 5BVGB 2OV1A 4BLRA 1BWSA 3S7ZA 3VU9A 5FUXA 4EJ6A 4W8GA 2CW5A 1L7XA 1HE3A 4NDZA 1UMBA 1XZQA 4WK4B 1UK9A 1RTKA 4R31A 1L3IA 1WR8A 3K30A 4MUBA 3V7FA 1ID1A 4HF7A 1YMUA 3IAFA 3IHWA 5F2NA 1WE2A 4TZKA 3RJMA 3BKXA 1V8FA 1S2IA 4UUPA 1KEZA 3D6UA 2G63A 1YUNA 4IFEA 5A3VA 3PX2A 3TE7A 4DGQA 4EY8A 4YXFA 1I3KA 3HPRA 2D8MA 1XPOA 3JWHA 5DLYA 1QAOA 3IIJA 1YQ9A 2XGSA 1W2WB 2XYGA 2XWBF 3A25A 3HKBB 4NPHA 4TM7A 4B1FA 5CCEA 5HIAA 2FP3A 5CBPB 1FNNA 1SBIA 3NHWA 4M1KA 2JLZA 4FYJA 2IS6A 3RRXA 2WIKA 3A4MA 3T3IA 2V7XA 2Q1YA 5JAHA 5KTTA 3TF5A 2PUEA 2FWBA 1D1QA 1ST3A 3C3EA 4LYJA 4TS3A 1TMKA 3PLAE 4C76A 1O4WA 3JALA 4OVKA 5TMEA 4PRZA 1BFKA 1G18A 5CEFA 1KYXA 2KPOA 3A1SA 3K53A 1N9ZA 1GAWA 1PZNA 1BGXT 3IO3A 1OHHD 3BDIA 1U7ZA 4W9RA 4DLZA 2WICA 4I1OA 1TQ4A 1TGYA 3FCUB 4HB0A 1UP6A 4Q82A 4AX4A 5IKMA 4L07A 3HK2A 1JIXA 3P9NA 2E1RA 1MAHA 1PT5A 1SK8A 1TJ4A 2VFAA 4O1MA 1RXEA 3DVRX 4MITA 5ARBA 3ANMA 8MHTA 4X44A 5AXAA 2IHBA 1JU4A 3QELB 3MLBA 1KH3A 1W85B 3TWOA 2OFOA 1EE9A 1ZCJA 3D2BA 1U3UA 4R9SA 3VUEA 3OIDA 2Q3BA 2CUZA 1HNNA 4M1WA 4PLPA 2WPDA 4WI1A 2G6TA 3RGWS 5K4HA 1D6NA 3H9QA 4DIUA 5HCNA 1IBLB 3KZ1E 5DP1A 4MQ4A 3HB1A 1U1DA 3UG7A 2YWHA 4PANA 1I9GA 3OLQA 1T2FA 3N2YA 3Q7PA 4EY7A 3CLSD 1QG0A 3LUHA 5AJUA 4XJXA 1FLVA 2DMRA 4N54A 5FOVA 3RIHA 2HKIA 3GL9A 4J3JA 4DCCA 1QWSA 3WFIA 3N8KA 4V02A 5FCDA 2H2AA 1Y89A 3ZWDA 4DQKA 1JP7A 2B5OA 4C2UA 1FP4B 4Y9DA 3REQB 9ATCA 5BOSB 1UK8A 4V0KA 4EM6A 4UHBA 1MB4A 1NRXA 4EG7A 5HNKA