3IPXA

X-ray structure of human deoxycytidine kinase in complex with adp and an inhibitor
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
241
structure length
229
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxycytidine kinase
publication title Lead optimization and structure-based design of potent and bioavailable deoxycytidine kinase inhibitors.
pubmed doi rcsb
molecule tags Transferase/transferase inhibitor
total genus 85
structure length 229
sequence length 241
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2009-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ipxA00
1GITA 4JVMA 4NYJR 3D7MA 4URYR 1DE0A 4MRPA 4YXWA 4A4DA 3GJ7A 4D0NA 2CXXA 1EFUA 2J7KA 2YINC 4LZZA 3HR7A 1EX6A 5DIFA 2D7DA 1Q21A 5E95A 5JZVA 4NKRA 4OHXA 1KI6B 1F60A 3QE0A 3QVUA 4GP6A 3QXXA 1E9RA 3MRSA 4HDOB 3HDTA 3EX7C 4UNNA 3OEHA 3LXXA 1K5GA 2O0JA 4V0MA 2PLRA 2JDIA 4U00A 1VCIA 1DAEA 3BD9A 3WRXC 5FTJA 1KI8A 2N46A 4LJ7A 2GZDA 3U60B 1KMHB 2B6HA 4US2R 4CEJA 2GNOA 1HT2E 2JLWA 1N5JA 4XVRA 4M4SA 2VSOA 1TAGA 3KUCA 4J0QA 4RVCA 2VP9A 2A9KA 3W6PA 1PLJA 4BQSA 1OIVA 1XTJA 3ND8A 3LBHA 1KAGA 2B8TA 2V6IA 1KO8A 3TUIC 4CIDA 1FP7A 2BBOA 2WM9B 3AF2A 4FCWA 4LC0A 3BB1A 4BASA 5C4MA 3G82C 4KODA 2OESA 1PUIA 1M7GA 1S4QA 3DZ8A 4Q1DA 4X8MA 3TAHA 2QAGC 2ZXUA 1I4TD 2EFGA 1Z8FA 3KKNA 1KO7A 4D2IA 2X8AA 2D2FA 2O8DB 4URVR 3TH5A 3EA0A 3PG5A 4MKGA 2CK3D 2N1BA 1QHHB 1E94E 2VA8A 3KUDA 2ZJBA 4DT1B 2RGNC 2CNWA 2J0VA 4D25A 2VO1A 2CL6X 3Q7QA 2WOJA 2JJ1A 3TUJC 5FTLA 3T61A 5BW8A 4FIDA 3TW4A 3CRMA 3M4YA 2HYDA 4MITA 4FWIB 2QQEA 3W34A 421PA 4FD2A 1Z47A 4DCNA 2F9MA 1XCGB 2WMOB 2CLSA 3GLHA 3UMSA 4TLCA 1N2CE 2NO0A 1FZQA 4KO8A 3GJ5A 2QAJA 4CRWB 4WXRA 4BFZA 4XWOA 5GVSA 4OQMA 4D6PA 5FBRB 1JPNA 1QVAA 5KU1A 1E4VA 1XBTA 2QU8A 4US1R 1F3OA 1IXZA 2WVJA 5FL7A 4QFMA 1JPJA 2X2FA 1WB9A 4O0MA 4NYMQ 2F7SA 3SHFA 1GIAA 3WYGA 2YV5A 1Z0FA 3AVYA 4HLUC 4ZKDA 3T15A 2B92A 4URUR 5TV2A 2WWGA 2NPIA 4BFWA 2NO1A 1I4LD 2V9PA 4ESVA 3UXMA 2QP3A 2V1XA 4P32A 5CM9C 3EZFA 3RYTC 3WNCA 4QBHA 3DL0A 1R6BX 1HQYE 4NYJQ 4M9QA 1KDTA 2PEYA 2ZI4A 2XX3A 3TIFA 4EFNA 1YZGA 4XWAA 4XJXA 1U94A 4RD1A 2J0QA 1AGPA 2FOLA 2W2VA 2ZSEA 2J87A 4HB3A 1CJVC 1S0UA 3H1TA 3CZQA 2OBNA 4JT2A 3TVTA 3LQQA 1W4BA 4KVAA 1QHIA 1A4RA 3TRFA 4TYYA 2QRZA 3EIEA 4QM7A 2QY9A 4KSBA 3NBZC 3NC0C 1GRNA 3OZXA 2WZQA 4M1YA 2GCOB 5TDHA 2RGDA 2AK2A 2ATVA 2GESA 1OHHD 2AFIE 4EQ6B 2AXPA 2JLXA 2ZU6A 3I73A 3SNHA 4TYQA 2QTFA 3VNVA 2YOHA 3U6KA 4OJKA 3FKSD 2ZSBA 1KNXA 1CRPA 4ZPXA 3EZ7A 2ZI5A 4I1VA 1U0HC 3WRYC 3X1DA 4IVQA 1C1YA 1OLOA 3OE7A 4LJYA 2ZI3A 1ZAKA 3PITA 3DPUA 2WICA 1K5DA 1OJLA 1GTVA 5DE3A 3A4MA 3K0SA 3OF5A 1EFRA 4NCKA 4RCZA 1Q3TA 2WJGA 3KTAA 2YWEA 2FSFA 1E2GA 1HV8A 3VQTA 4KYUA 5FI0B 3GFPA 4RCYA 1V43A 5F3WB 4IDNA 4DDTA 1NMYA 4P31A 3GLHB 1EESA 2RKOA 2GBLA 3NBYC 1SXJA 3CNNA 1QBKC 1VCNA 2EFEB 2WJJA 2C95A 4LHXA 4RD4A 1DAGA 3GQBA 4ZCLA 3HWSA 1JB1A 2I1QA 3KFXA 3BAFA 5EXPA 4II7A 1M34E 1VIAA 5G41A 1TQ2A 3F8TA 1OH5A 1MT0A 2IYQA 4I1UA 3I5YA 3NHAA 1YRBA 1LTQA 4KFTA 2RGCA 2OXCA 4MGYR 1AGRA 3LVRE 2ZYVX 2JJ2D 2NZ8A 1M7HA 1G21E 2XAUA 1JEEA 1GRQA 2XXAA 2QSYA 3P26A 2WPDD 3LLUA 5C2JB 1KSJA 2O8FB 3K09C 4RD6A 3LD9A 5JSZB 2NTYC 2P0EA 2GAOA 3QIAA 5KOYA 3L82B 1ZU4A 2KE5A 4LWZA 5AUOB 1OB2A 1T3HA 4WVFA 1T91A 3HP1A 3TLXA 2WWYA 2WKRA 3GJ8A 3Q3JB 2A5DA 2JEOA 3QBTA 3RANA 5LD2C 3Q7PA 2R65A 3U4QB 2ZUCA 4CEIA 3VKGA 1ZUIA 4DLUA 1W49A 4V0LA 1MO5A 2CVHA 2ZE5A 1ZNZA 3B5JA 4BLPA 2DWQA 2ZI9A 3DDCA 2BMEA 1COWD 4PZYA 4NCIA 2Q9CA 1KZGB 1IONA 1BMFD 2FFQA 5LB4A 4D82A 4A36A 4S35A 4AI6A 1D6JA 5DI3B 3WNBA 4FI3C 5CYPA 3AGQA 1ZUHA 4TMXA 2G6BA 4OQNA 3W8RA 4O3MA 2FA9A 3VHLB 1RC8A 4TMVA 4MUBA 1P2SA 2AD5A 1JQJC 3HJNA 1CJUC 5JFGA 4I99A 2GZHA 3V4RA 4D26A 3GLFE 4FN5A 3ZQJA 2V54A 3HYRA 1ZU5A 2D06A 1DAIA 4B6EA 4QXAA 2XTZA 2IF0A 1B0UA 4IEEA 3UATA 4DLVA 3TQFA 3T1TA 4GOJA 3Q72A 3BJIC 4MGZR 1HQCA 3FOZA 1FMLA 2KSQA 2HYIC 4Q21A 4L15A 3SFVA 1R5BA 1Z6TA 4BFUA 3L0PA 3WY9A 2BM1A 4AYTA 1MV5A 1CU1A 3NWJA 2VH5R 3U44A 4QGGA 3RS4A 4GMXA 4EIWA 1QHNA 2CHQA 4KJZA 2YJTD 4MYTA 1SVSA 4PXAA 4BLTA 3ZIAD 5J4KA 3QEOA 1MOZA 1D9XA 4JKIA 1W46A 4XSHA 1OXTA 1G7SA 1P4SA 5EE1A 4C0QC 2FZ4A 3EZ6A 1KI7A 5SZKB 3ADDA 1MO6A 2JLRA 3L0IB 2IWHA 2F55A 3MUFA 1X8LA 4EDHA 2BEJA 2Q3HA 1OKKA 4TTPA 2LKDA 1SVMA 4Q9JA 5A0FA 2CJWA 3A37A 2ZUBA 3BIFA 3LLMA 5K8TA 1FL9A 1G4AE 4LV5B 2BCJQ 4PANA 4B75A 2BMFA 1U2RA 1BYIA 3QI2A 2HF8A 4HDCA 4JLJA 3RVBA 2HXYA 2D7CA 2ZRAA 3U61B 3LW8A 1GWNA 2CCGA 4RKEA 1Z6GA 2ZI6A 1NIJA 1JR3E 2BMDA 2GJ8A 3DO6A 3H2YA 1XEXA 1OFHA 1YU9A 3QKSA 3QQ5A 4C7OA 4CEIB 3SBDA 3DHWC 1X8JA 2QBYA 2Q3FA 3T5GA 1G64A 3PR1A 1C9KA 1CJKC 2CE2X 3PXGA 4JLMA 1YZQA 5JRJA 5E7MA 3LNCA 1US8A 2YNMA 1XJCA 4C0JA 4ITRC 5KUTA 4DJTA 1WXQA 3U3KA 2IXFA 3IKJA 2IXGA 4EPVA 2VEDA 4AKIA 2OHFA 2OBMA 4P0TA 1ZNYA 2QENA 2QPTA 2ZYUX 4ARZB 3QEJA 4ZO4A 2H57A 1P2UA 3H84A 4EAQA 2ZJZA 4TZ6A 1UEJA 1ZP6A 3ICQB 3IEUA 4ZI2A 1NLYA 3IUYA 2IK8A 1SVIA 2QMUA 3O47A 4IXNA 4P4UA 3NVAA 3TJZA 4TSFA 3B78A 2F1RA 3CKLA 1P9RA 4IEIA 3PUXA 1NVVR 3PEWA 1VCMA 3NG1A 1MH1A 3B7GA 3LWNA 4XVUA 2GCNA 4QGFA 2O52A 4A8JC 2XZLA 2PZGA 1GKIA 2PMKA 4M1TA 4WZ6A 4IHQA 4A6PA 1NKSA 5JCPA 1UBCA 4F92B 2PCLA 1VYVA 3RS7A 1SVOA 2PLFA 5IHPA 3LFUA 1LF5A 4MRSA 3IIMA 4IDQA 1NG1A 3LDAA 2VYFA 4N3NA 1XTQA 4W5JA 2VSXA 3LY5A 2C03A 2RAPA 4TLBA 1Q0UA 2H92A 1Q1BA 1ZINA 1E0AA 1G7RA 3LQRA 4EJSB 3ADBA 2VIIA 3AP2A 1SHZA 4NONA 8OHMA 4B3FX 2W6JD 3E1SA 1C4OA 4PPQA 3R7WA 4BFSA 5JI3E 4R98A 3MWKA 1CP2A 4XD7D 1VCOA 1E2PA 2CJWB 3RC3A 4BWYA 2CL7X 5F9HA 1E9EA 4TWZA 1ZM7A 1NBMA 3VKWA 1G19A 2OZEA 3X1YA 4LDJA 4RSGA 2W0SA 2V4ZA 5EP3A 5LB2A 5AJXA 4KSCA 1W0KA 2ONKA 1XXHE 3RRMA 4C0AC 3SS8A 5IK2A 1EWRA 3QXCA 2FSIA 2O8CA 3KQLA 4L5BA 2JASA 4TQ9A 3I5XA 1LNZA 5LDDC 3MLEA 1VHLA 2AWOA 4LCBA 4MUAA 3N2IA 4DLXA 3QPWA 4FINA 3E70C 1VMAA 4OI0A 3WBJA 1P3JA 1IY2A 1N6LA 4Q4HB 3K0FA 1XMJA 4QRHA 1CR4A 1LY1A 3VR2A 2BKUA 4YMSA 1XDBA 3P20A 2XTMA 1GVNB 1W0JA 5CK4A 2ZRJA 1U0JA 1RRPA 1PVOA 1KJYA 4AKGA 3B85A 2GXAA 1HEIA 2C77A 5E4FA 4LBZA 1MRSA 4BE7B 2PBRA 4OHYA 3N70A 4M0LA 5JHHB 2G77B 2GVZC 5BN3A 1NY5A 3AM1A 4DSTA 2GXSA 3VNUA 4E07A 2XSZD 3CRRA 4A2PA 4UKDA 1F48A 1IN8A 1UEIA 3ZLJA 3OEED 4RY2A 3S1AB 5H68A 3M1IA 4Q66C 1AKYA 3NEYA 3KXKA 1OB5A 2QE7A 1Z6AA 3MD0A 4PHGA 2FH5B 3THYA 5EQTA 4CF7A 1S1MA 2GJSA 3JVVA 1KDRA 3R20A 4Q4JB 2ASEA 4DUGA 2VHTA 3EWAA 1U99A 1UPTA 5FTKA 4BRUA 4DDVA 2XOKA 3Q9LA 1W48A 4OQXA 3B6EA 1OXXK 5BQ5A 1IM2A 3IO3A 4L4UA 4B47A 4B6FA 2JCSA 5KNCA 1WF3A 1HA3A 1KKLA 4JLOA 4O2RA 4UQOA 1OPXA 2QQ0A 1NVVQ 2D2EA 1F2TA 3UWKA 4DRZA 4Z1MA 3BXZA 5G40A 1KJZA 1HE1C 1KMQA 1NP6A 1E9BA 2O0KA 2ZUDA 2QA5A 1KI2A 3KX2A 4NBSA 4Q1AA 3U7FB 4NMMA 2YVUA 3SR0A 3DKPA 1TUIA 4S2EA 4PX9A 1T8TA 1AS0A 3NDPA 2ZROA 1KI1A 1G41A 2FE4A 2WJIA 2XNDA 3THXB 4JBWA 2WIAA 1L4UA 3GLGE 2OCYC 2Q9BA 5FPKA 3EPJA 4GI7A 5F98A 4LHVA 2J46A 3CM0A 4ZIRA 4QBGB 3QG5A 2ZETA 4NDZA 2R6CA 2XB2A 3RRNA 3OAAD 2ZRPA 4I1OA 3RAPR 3K0CC 2WMNB 2IUTA 4HDQB 2GAAA 2EFHB 4WIAA 2NZJA 5D3MA 4D4JA 1O3YA 3BH0A 1N6HA 4GP7A 3UG7A 2QT1A 2H7VA 4MGIR 4TTQA 1E1RA 2XITA 2HLDD 3N2EA 4FMDB 1G7TA 3ETLA 4A0FA 1QZXA 2ZE6A 1AJEA 1ZC3A 2EWWA 2ORVA 2QZ4A 3ZVRA 2P6NA 1Q3HA 1YZLA 4ERNA 1RRGA 2ODNA 3PUWA 4LSGA 3V00A 1G9XA 2ZR9A 1U9IA 3X1XA 1WQ1R 2CVFA 2C9YA 3K0EA 3P4YA 4NP6A 4XVQA 4UNQA 4HAZA 4MYCA 2DCUA 4A15A 3P1JA 3IPXA 3EA5A 4LV8B 4JL5A 1G5TA 1KY3A 2R6AA 3CF0A 1FQKA 4F4CA 1B23P 4KCGA 5UKDA 2OCBA 4AYWA 2C04A 2IS2A 2EW1A 1Z83A 1WRBA 4IOJA 5KNBA 5L3SA 3QKTA 4R2HA 1RW4A 4PHTA 2NG1A 3T06B 2BBTA 2OFWA 3KL4A 1ODFA 3KB2A 4AK9A 1S96A 1TF2A 2J45A 2OG2A 3UWOA 1VG9B 2OM2A 4HAWA 2J59A 1DADA 2AFHE 3NEJA 4NTZA 3TR5A 1G5PA 4DHEA 3FFBA 4ABYA 2ZE7A 4PQFA 3F5FA 2I3BA 4JVSB 1TF7A 1VTKA 1J7KA 1P61B 2VHUA 3NH6A 4JS0A 1AS2A 2FWRA 3BORA 3AKEA 3MMPA 4D0GA 1XD8A 2GA8A 2O8EA 2D74A 1ZBDA 2REBA 1E2HA 4GOKA 4NE2A 4B73A 1G6HA 5HPYB 4Q01A 4TLEA 3P4XA 1E2QA 4XSGA 5CDFE 2IS1A 3PEYA 1NL3A 1ZRHA 3A6PC 2VP5A 4Q1FA 4JLVA 2CK3A 4U7DA 1XZQA 2AR7A 2OILA 2PT5A 3FGNA 5FOTA 3UMRA 3W6NA 2E87A 2FPKA 4BEJA 4ZIRB 4M9SA 3J81k 5JBQA 4JZKA 3M6AA 4G5RA 1QHYA 3EARA 3KXLA 4LJ9A 1FUUA 1NSFA 5P21A 3W8NA 1YQTA 1CJMA 4KLNA 1CXZA 3VAAA 5B30A 1W47A 3U3MA 1OE0A 2QTVB 4JLPA 3RSLA 4A2QA 1JQLB 4LYFA 2GZAA 1ZD8A 2PZFA 3C8UA 2F9LA 1VYTA 4MDFA 1Z3IX 2YC4C 3LH5A 2QI9C 1IJFA 4TYNA 3FHOA 5BN5A 1KYIA 3ZZTA 2ZI7A 4CGZA 2EFCB 1F2UA 1X3SA 2YC2C 1PJRA 2DFTA 3QKUA 1D2EA 1R2QA 1KO1A 1JALA 1SHKA 4PPFA 2FDCA 2OCPA 1XWIA 2ZR7A 4I4LA 3AGPA 1S1CA 1N6IA 3ZJYA 2F1JA 1NJGA 1H8EA 1KTVA 4XIGS 3N5CA 4AC9A 4JLDA 5CIWA 4JKYA 5G3YA 3PUZA 3WP0A 1II8A 2FF7A 5F2EA 4Q00A 4YMTA 5ELXA 5AJWA 4N0DA 3GJXC 2ODEA 3GMTA 3HYTA 4Q7MB 1E79D 1IXRC 1S3SA 3T1OA 1IN7A 1ZM3A 1TQ6A 4GFDA 1M7BA 5G53C 5HCIA 5DN6D 1T9HA 2BOVA 3AF3A 2FFAA 4JLNA 4BLQA 5IT5A 4HSEA 3TKLA 1M1YE 2ZJ2A 2Q21A 5BN4A 2H5EA 4KYIB 4PC6A 4QNRA 1HYQA 3R9XA 3AVVA 1D8TA 3NXSA 4A2WA 2ATXA 1X6VA 1VDZA 1SGWA 1UADA 2MSEB 3GLFA 3A1UA 3CRW1 2BM0A 1YZNA 2ZE8A 4R71A 5HR5A 1KI4A 3GLIE 4LOAA 4UNSA 2FFBA 2WWXA 5JJLA 2R8RA 1IJEA 1IHUA 2W6IA 2IYVA 1E32A 4IOMA 5DO9A 3U3JA 5J4YA 2UZ3A 4B2LA 1II0A 2J7PA 2V1UA 3ZVLA 5J4VA 3FKSA 3I4LA 1H8HA 4ZCIA 2RGBA 1QF9A 1QVRA 3BK7A 2CBZA 4KFUA 3VMFA 2F6RA 2ZRDA 2CEAA 4CW7A 3DM9B 2WIBA 3B9PA 2ZRCA 3OIWA 1GNPA 1GAJA 4EPYA 2G1JA 4QJ5A 2D3WA 2ZITA 1SQ5A 3ADKA 1DG1G 4V0NA 2FPLA 1II9A 1Z6XA 4YXWD 3X1ZA 3LRPA 2X19A 2B21A 5IF9A 3VR3A 1XTSA 2F3RA 3ICEA 1XU4A 4TMTA 1ZVQA 1CLUA 4ZDKA 3GEEA 4DCUA 2P67A 3TUZC 5EE9A 1XEWX 2GDJA 4LV6A 4BEBA 3V9PA 3BS4A 2XB4A 2VP0A 4FCTA 4RFSA 3B1WA 5FBVB 4CEJB 1KK0A 4UNPA 2H18A 1JR3A 2GF0A 2F1HA 2JJ2A 2QGNA 2QL6A 4GBMA 1RYHA 2JA1A 1KDOA 4LY6A 2WPDA 2VHCA 3IQXA 1NG9A 1WCV1 1EXMA 1R10A 1VECA 1JNYA 4P4TA 1FQJA 4PTLA 1X86B 4BLOA 2J3EA 1V5WA 4TTRA 1ZM9A 1KY2A 4DLWA 3U7EB 1SVKA 3PEVA 1IXSB 3WMFA 1OW3B 4B48A 3FB4A 1R7RA 5FOUA 1KKMA 4D81A 1W4AA 4RFVA 3QF4A 2DFLA 4LHZA 2MSDB 3CR7A 2VL7A 1RFLA 4LRWA 1JJ7A 2WKQA 2ORIA 5KPDA 4QHYA 3ZD6A 1BMFA 2IYZA 4B3DA 4DLZA 2GCPA 1FFHA 3CRVA 3FE2A 3GFTA 4M9ZA 1A7JA 5IRCD 2QEQA 1UM8A 1YR9A 2BEKA 5E7JA 3RS2A 3I62A 2WSSD 4FWTA 2WBLC 1XEWY 2ZR0A 2PT7A 1R0ZA 2VPPA 2W2TA 3K70C 4PSAA 4D0LB 4EJSC 4JLBA 3SBEA 1CR2A 2OFXA 5E7IA 2HT6A 3BFVA 3BH6A 4Q9KA 3BWDD 2CNWD 3U7HB 1F5NA 1OH7A 2KB0A 1NN5A 2WJYA 2OSBA 4D4KA 1AQYA 4IJMA 4BGDA 5J4HA 5KTYA 4C2TA 4CT5A 4EFMA 4HLCA 3TVDA 2BMJA 2IYLD 2R6DA 2OCAA 1GFIA 4EUNA 4URXR 1RRCA 1D9ZA 4LJ6A 4IKEA 3L8YA 2RMKA 2R2AA 2WV9A 3E2IA 4X8HA 3MJRA 1IOZA 4OHVA 4ZDWA 3LBNA 2C9CA 5IDVA 1Z6YA 1L7VC 1G8FA 1UBEA 2WJVA 2FG5A 4JBYA 4OJQA 3FDIA 2IC5A 4LJAA 4V0OA 4N0EA 3IIKA 3IEVA 4JJZA 1U90A 2BCGY 2Z0MA 4YC7A 3BOSA 4D4LA 2RH5A 1AN0A 2LKCA 3K9GA 4IOLA 5SZJA 3D31A 3B1YA 1N5IA 1P60A 4AY2A 1WE2A 2RGNA 2JIZA 4Z51A 3THWA 3Q85A 3GEHA 4XTCS 1N6OA 1W2HA 1XXHA 3KJEA 1DOAA 3MWYW 4QNMA 1X8KA 1CR1A 5B64A 1T0JB 1D2NA 1XTIA 2IS6A 2G0NA 4MKHA 1Q1EA 4MYHA 5D3QA 2PMDA 4B34A 5GADl 2N42A 5CIQA 1XJQA 3L0OA 3C16C 4P4SA 4Q48A 2ORWA 2B7CA 5L8VA 2HEIA 3NC1C 1A2BA 1Z2AA 1JBKA 3SYNA 3KQUA 2FMXA 3AKCA 3SJAA 1LS1A 2ZVPX 2JGNA 3RNLA 2D4HA 1SKQA 3GJ4A 4AG5A 1R0WA 3I92A 3NH9A 1U8YA 4HAYA 4TQUS 1N6NA 1NJFA 2OV2A 2ZSFA 3TMKA 4PQRA 1OH8A 4UJ3A 1UBFA 4DCVA 3ASYA 3AEZA 1Z08A 3QXHA 3I8SA 1E2NA 2QPAA 2J41A 4C0SA 2CL0X 2BBSA 4R7ZA 2O8BA 1K8RA 1MABA 1KK3A 2OFOA 4D80A 4Q4LA 1ZD1A 1IY0A 4PC2A 2H17A 1EFTA 4B3BA 4YMVA 4YMUA 3UPUA 3SN6A 3OE7D 4BECA 2P5TB 2G0TA 3KTAB 1J8YF 1TQ4A 4Z8XA 2VF7A 2X1VA 3QNUA 3SE0A 1DO2A 4A92A 2XNSA 1BO6A 4NL4H 3DMNA 1YZKA 3VTKA 2GK6A 2ZPTX 3EZ2A 4HI0E 5L3QA 3ONWA 4M1SA 1SXJB 1E0JA 1XMVA 4KFSA 3EIHA 4GNKA 4DIEA 3B60A 3U3RA 1O87A 2J0SA 2VRWA 5DYGA 4DBLC 2ZRGA 2CLDX 3Q5DA 3U2QA 2P2LA 1Z63A 2AKAB 3CB4A 4DB2A 4NYIR 1FNMA 4F7WA 4B3GA 1E3MA 1R5NA 4HB4A 2GETA 4V02A 1D2MA 1Q22A 3ND9A 4CZ2A 2C78A 4JL6A 2XXAB 4JYBA 3CH4B 1KI3A 3SC3A 4DZZA 1JXOA 2A5JA 2C98A 1E2FA 1GP2A 2W0MA 1J70A 1R5OA 3HR8A 4PZZA 3RHFA 3VU9A 4HB0A 3THWB 3W6OA 2V6JA 4LBVA 2IF2A 4V0KA 2VP4A 3GLGA 3K0AA 5AUNB 4B35A 4XD7A 3MCAA 4Q4AA 4O25A 4GZLA 1QHXA 3EASA 4NPHA 2FJUA 5JEDA 5DYIA 1U98A 4Q7JB 1ZIOA 221PA 5FOSA 4IDOA 3UIEA 1KGDA 3QG1A 4G3XA 2IYXA 4KI0A 1ESMA 2ODBA 1MO3A 3VR4A 4DSUA 3TNFA 5HTKA 2WJHA 4M21A 2FPMA 4ZDIA 3U3OA 2JLSA 2BDTA 3PENA 4NCNA 5CJ2A 3DVLA 4Z54A 1T5IA 2G3YA 3TW8B 3UMFA 3LVQE 2NMVA 4BFVA 3OIVA 3ZS8A 1NLFA 2RGGA 1N3BA 3BRWD 5J47A 1XD9A 4LC1A 1ZCAA 4C0LA 2GXQA 2AX4A 3CLVA 2JJ8A 4TL7A 4B33A 3MGCA 1RYFA 2X77A 1R8QA 5H8WA 3MJHA 5JEEA 4LI0A 1CS4C 1D5CA 1NIPA 1ZMXA 2W58A 1RRFA 3K09A 1VKJA 3TE6A 1OXVA 3BC1A 3LX5A 4Q1CA 3AKDA 3QJYA 2PEZA 3FMIA 2DHRA 2BC9A 5DISB 4L9SA 2JAQA 1OH6A 1SULA 2FU5C 3WBKA 1A5TA 1IN6A 2OT3B 3U44B 4OI4A 3AVWA 1W2GA 3C5CA 3DM5A 4LJ8A 3AVTA 1G4UR 5L3QB 2QUZA 3GCGA 1CJTC 4FXPA 2JLYA 2WTUA 3OEEA 4LBYA 5HKKA 4QM6A 4BUJA 4RD2A 1NMZA 4ZDJA 3K70B 1J90A 2J1LA 3ASZA 2OE2A 4TMZA 2ZTSA 3FVQA 4Q9LA 1HY3A 1E1QD 3P27A 3CH5A 3WXMA 3K70D 1OT3A 3C7KA 4OK6A 3I3SR 5FPYA 2ZS7A 3CF6R 1LS6A 2VP6A 3QF7A 4KBGA 3F0TA 4O2LA 4B71A 4Q5IA 1TU3A 5JCZA 4UXIA 3DOFA 4MH0R 3SFZA 1GZSA 5KO2A 1Z07A 5CDFA 1PLKA 3VFDA 4C30A 3L0SA 3LO5A 2IS4A 4B2PA 3PJRA 1BKDR 3TSZA 3IBGA 3B8HA 4HYYA 4C0HA 2NIPA 2HT1A 1P2VA 4Q4AB 1XEXB 1Q1ZA 2KI5A 3QKSB 521PA 1HH4A 4C7OB 4UXJA 1E2IA 2QBYB 2RGAA 1G20E 1S9HA 4Y0AA 4QC2A 4NYIQ 5CK5A 1KO4A 2QN6A 3IPYA 3G0HA 3PV0A 2QTHA 3CWZA 1RJ9A 4Q19A 1ZC4A 1US8B 3CNLA 1XTRA 2ZIAA 4MKIA 4OHZA 2ANCA 3QKRA 4OHWA 4LJ5A 4OKSA 4FMCB 4HATA 2C96A 3QPUA 1CULC 4JL8A 3LW7A 2QRNA 3OAAA 5H70A 3A36A 3EWSA 3TAUA 3KKOA 2ZM5A 2P6RA 1N25A 2IA5A 3LBIA 4TN1A 5EXXA 3WYAA 3SZRA 4I1SA 4M8NE 1UAAA 5KHOC 2A7QA 4YMWA 1KHTA 4L9WA 2ZRLA 2HLDA 3Q8XB 5L3VA 2IYRA 4W5HA 1FTSA 1E2KA 4DCSA 2VF8A 1E0KA 4BLRA 3RS3A 1YR8A 2C9OA 2MSCB 1ZCBA 4JSYA 5AR1A 3ZS9A 2NQ2C 4WXPA 2A78A 5JJIA 1WA5A 4GRAA 4EFLA 2XJ9A 1UBGA 4RD3A 1Q12A 4EKDA 1TEXA 2V7QD 3GJ3A 2WKPA 3PCRB 4L16A 4ACAA 2EWVA 1NNEA 3AV0B 4OQLA 1T5LA 1JR6A 4C2UA 4LYHA 3BBPA 2DY1A 1EFHA 3CW2A 1RKBA 4KAXA 4AURA 3H4MA 4G5QA 3EXAA 5CB6A 1TADA 1YRAA 1G5RA 2ECKA 2TMKA 4HZUA 1E96A 2NO6A 3I32A 1NRJB 2UVQA 4Q7LA 3ZVNA 2C2HA 1LW7A 3WP1B 1PZNA 1SZPA 1UDXA 1IN4A 1MR3F 3FMFA 4YONB 2LCFA 3R7WB 2ERYA 2BJVA 1XPOA 3A4NA 3GLIA 3W5JA 2QGZA 4WOPA 3C4JA 4WAUA 1DEKA 4U02A 1EFCA 2WHXA 2ZVQX 3GD7A 3MAAC 2AKYA 3PIRA 4BFXA 1W4CA 2LWIA 3E5HA 821PA 4IFEA 3RS0A 1SKYB 4DLSA 1MRNA 2O8CB 2ZRIA 4LHYA 3IDQA 2WWWA 3T35A 2JLVA 2AXNA 4MRRA 1S9DA 1ZM2A 2H16A 1UFQA 4HAVA 1XCPA 3CX7A 1RJ9B 5BYJA 1XX6A 1OIXA 1G8PA 3IHLA 3ZGXA 5EE0A 2WWFA 3QKRB 4PAOA 2UZIR 5JI2E 4R9UC 4AD8A 2WOOA 3EZ9A 3K0FB 1Z0KA 1LVGA 4LK2A 1CKEA 1VG0B 4AKHA 1DO0A 3H0KA 5FOVA 2YWHA 1G8GA 5DHFA 1WDTA 2O0HA 5FBLB 2I1VB 3SU8A 2DFNA 4LYJA 2KJQA 1Z28A 1E98A 3AVXA 4JLKA 2QSZA 4A6XA 1W0JD 1BIFA 4PQYA 2ZJOA 3OIYA 1LFDB 4YQFA 2FV8A 1XJ0A 3W5IA 1KI6A 1GG2A 4TL6A 1QG4A 1M6NA 4LPKA 5CB8A 5GJWC 3AF4A 3B9QA 2FGJA 3RRYA 1XPUA 3QVVA 1OFIA 4XWKA 4TLAA 1HUQA 4OBEA 1OSNA 4EPRA 1Z06A 4DLYA 4PO1A 4KXFB 1CR0A 1JAIA 2DPXA 2G88A 4GMDA 3THYB 3SQWA 1Y63A 2GXUA 4OL0A 3ZZUA 1W36C 4IDPA 2ZEJA 1YZUA 2R9VA 4DWJA 1E2LA 1KMHA 4KU4A 4TYPA 4EPTA 2FX3A 5TB5A 2E9SA 3O8CA 3WNDA 1L2TA 5KSYA 3K53A 4K81B 1T8UA 1QHSA 2CCKA 1E79A 1X1SA 2ZS9A 5ANRB 1Z22A 3EAQA 2EYUA 2XOKD 2BIFA 5DN6A 1R4AA 2VHQA 1TMKA 1F2TB 4H1VA 1ZM4A 1NLZA 4OI2A 1CRQA 1QDEA 1OXSC 1P7CA 3NKVA 3EG5A 2YKGA 4IVRA 2YYZA 4HB2A 3I1FA 1E2DA 2HDNB 1PLLA 1KIMA 1NMXA 3AVQA 1XEFA 2GTPA 2ANBA 4HLQB 1AKEA 5FL3A 3CBQA 1XRJA 3KXIA 5KDDA 2ZJ5A 2RGEA 2P3SA 5KDOA 2IYWA 5CLQA 4CDGA 2O8DA 5FR2A 1SVLA 3O8RA 2H8KA 3SEAA 4DT1A 4K46A 2C8VA 5AWFC 2IT1A 1GSIA 2Z6VA 5KNDA 3QUSA 3L8ZA 1TUEA 1ZNXA 3HU2A 5D3MB 5A4JA 4FMDF 3AVOA 4V03A 1JI0A 3Q5EA 5KSPA 1E2MA 5HCNA 1J99A 2H1LA 3REGA 3W3AA 2IXEA 3RWOA 4F38A 2QP4A 4IVPA 4KFRA 3QBVA 2Q6TA 5DNYB 3I8XA 3RDPA 1E1RD 1G7CA 1I2DA 2XZPA 2Y8EA 1IBRA 3BGWA 4TT3D 5FFMA 5FUWA 2NPFA 3C15C 1JXMA 3RWMB 2HXSA 4W9MC 4IW3B 2Q9AA 1QHGA 3B1ZA 1TU4A 2IHYA 3SHWA 2IW3A 2DB3A 1JECA 4W5WA 2ZJYA 1CIPA 4ZV4A 1X1RA 5M04A 4C0BA 1GOTA 1G17A 3CR8A 3A1WA 3AH8A 4KBFA 4HLDA 1BH2A 4M53A 2ERXA 4M1OA 2GEDA 1XZPA 1CEEA 1S8FA 3MWJA 1IQPA 2IL1A 2AK3A 5KDLA 1TTTA 4Q47A 4HAUA 3LV8A 2GEVA 5L3SB 5TXGA 4E22A 3IHWA 4GT1A 2I4IA 4WW0A 3K0CA 1WBDA 2QMHA 2VTKA 1LB1B 3IO5A 5AJZA 4LHWA 1ELOA 4B74A 4H1UA 1E69A 4XOIA 1KK2A 2GVDC 1W1WA 4C9BA 1ZNWA 2PX0A 4PC3A 4P33A 4QHSA 3OFND 2WWIA 4M1MA 3HPQA 1NI3A 3AP3A 3K9LA 1NVWQ 3O8BA 1DS6A 2XZOA 5JRZA 4DSNA 1BOFA 4BPBA 4ASUD 4DIDA 1NSTA 2GBLC 1SXJC 4G5OA 4QGHA 4M1KA 1OV4A 4QHTA 4B3CA 2O8EB 4PHFA 5TY0A 3B2EA 1OHHA 1U0LA 1YHNA 3CIOA 4DEXA 1YZTA 2GCOA 1M8PA 121PA 2VLIA 4H9GA 2Q0HA 3KJGA 5AK0A 4EQ6A 2G1KA 4F4IA 2GHIA 3DZDA 4PHHA 3U5ZB 2ZRMA 2F3TA 4C3ZA 2WSSA 1NN1A 2A5YB 1AZTA 1P5ZB 2HJVA 2QT0A 4BRWA 4DVGA 5HE9A 4DDWA 1NVUQ 1GKUB 4A0HA 1L4YA 2ZAMA 5FPSA 4DSOA 2R44A 2ZRKA 3REFA 4IFBA 3PVSA 4URZR 1UKEA 4B32A 2C5LA 4PPNA 1FTNA 2OLKA 3R8CA 4RZUA 1ANKA 5G3ZA 621PA 1F2UB 1KNQA 2BBWA 2ZAOA 4DC9A 4CEHA 5JS8A 5EXSA 6Q21A 5BXQC 1JEDA 1G3UA 1NKTA 2FSHA 3OEHD 1ESNA 2FSGA 1OYYA 2JDID 5AUPB 4RJLA 3VX3A 1AK2A 2MMGA 2ZU0C 3AQ4A 1II8B 2NOAA 3TQCA 1H8ED 4Q03A 4FW9A 4R2IA 5FPHA 1IN5A 2O8FA 5J5CA 3PQCA 1FW6A 1T3LA 5GJCA 5JSZA 1G6OA 2HJGA 3WMEA 4GOXA 4FCVA 2VP2A 3UK6A 1G8HA 3KKMA 3L2OB 4MDEA 3EC1A 3THOA 1Z5ZA 3VHXA 3GPLA 1QRAA 1DAMA 2RHDA 2G83A 3KJHA 4E5UA 2GEUA 4AG6A 1COWA 3TK1A 3U4QA 3B1VA 5CM8B 5FH9A 3PEUA 5DI9A 2OUKA 3GLFB 1P72A 3SDZA 5J40A 1ZW6A 2F1IA 3X2SA 5K8IA 3ZD7A 1VYUA 4JBXA 3NIBA 1P9WA 5GJVC 4IRUB 4Q1EA 2G9NA 1GL9B 3K9NA 2YZ2A 4QJ3A 1W36B 4X8LA 5DI3A 3LA6A 1GL7A 3FHTA 3SJBA 2WWHA 2ZRNA 1RZ3A 4JSTA 4DDUA 2GK7A 5CITA 4DLRA 2AWNA 3HPRA 4W7SA 4E03A 1W36D 2J5XA 1UKVY 3EW9A 3FMPB 1OXUA 4RZ2A 2EFDB 2JJ1D 2W6ID 3HU3A 4X8OA 1SVWA 3WMGA 4KLZA 4A0GA 1NVXQ 2J7PD 4PFSA 2F43A 1H8HD 2Z4SA 3AUYA 3CO5A 2MMCA 5KSOA 1DG3A 2EU8A 2VBCA 1S3GA 4AYXA 4GPTA 4EPWA 4WZAE 5LBIA 2QAGA 1AQUA 3HU1A 1ONBA 1Q44A 2BWJA 4TMKA 3ZIAA 4BLSA 1FOEB 4DCTA 5FL7D 1TNDA 3IBYA 4PC1A 2ONJA 5EJEA 4G0NA 3OIUA 2V3CC 2QG6A 3BB4A 3MFYA 1OYWA 3VR1A 1LV7A 3AF0A 4K8OA 2QMEA 4CEHB 1G3MA 5GJBA 3CPJB 4HUTA 1I2MA 4B43A 2K5UA 4FMBB 4QGAA 4RFSB 1WP9A 1VG8A 4DB4A 4Q02A 5JHGB 1J2JA 3NTUA 2FEOA 1UJ2A 1K6MA 2PH1A 1GNQA 4DKXA 2KBFA 1KAOA 1OFTA 4BZQA 3T5DA 3ZH9B 3CUEF 1E2EA 3TSOA 4A0RA 1JR3D 1E9AA 3G5UA 4RZXA 4KITB 1E9FA 1FMJA 1JJVA 2XEXA 3SYKA 1WMSA 1Z29A 4V0ME 1WBBA 3FWYA 2WAXA 1KJWA 2PCJA 3CZPA 2P5SA 3BFXA 4OK3A 3WHLA 3V4FA 3NBXX 1OFUX 2V55B 4WZBE 3QF4B 1YVDA 4IDHA 1Z0IA 4QKQA 5TVKA 1UKZA 1N0UA 3ZYCA 2D62A 5CLLA 1KSFX 4HLUA 3B82A 1G16A 3DOEA 1H65A 3CNOA 4ZCMA 1AA9A 3BERA 2DR3A 1XB2A 1N5LA 5JJKA 3B1XA 2HCBA 1GILA 3QXSA 2IYSA 1GKYA 1GL6A 2JLQA 4ARZA 2UKDA 1XMSA 1HE8B 1Y3AA 1ZJ6A 5JWHA 3KQHA 4Q9HA 1YR6A 5EP4A 3X1WA 5DHAA 2SHKA 1W5SA 3F3YA 1I4DD 5EZ6B 1EFRD 3TBKA 2P65A 1E9DA 2BJWA 4LPSA 3IQWA 1Z0JA 2F43B 3W90A 3U7GA 1E4YA 4GDFA 3AVUA 4PO9A 2CHVA 3SJZA 3QOFA 2NO7A 4RZ3A 5HZKA 1ETUA 2AD1A 2HCJB 4JYCA 2L0XA 4BZPA 3PUVA 4HAXA 1SXJD 1YJ5A 2IYYA 3NBFA 1IY1A 1XNJA 3KKPA 1XFAA 2QAGB 1YKSA 1HTWA 3U6BA 3FMOB 2OLJA 2ZSDA 2ZJAA 3SOPA 5B2ZA 2DYKA 5FBQB 1MKYA 3GLHE 3QXJA 4ESHA 2PZEA 1XD2A 1N6RA 3FHCB 4LYAA 4QBIA 2PJRA 5KPJA 2B7BA 4JLAA 5B58C 1VPLA 3AUXA 5K8LA 3K9HA 3TGPA 2Q3MA 1KK1A 5H1YA 2RCNA 3CRQA 3SJCA 1U8ZA 3T1QA 4OQFA 1E1QA 1NY6A 1GRRA 1Q57A 2ODWA 2W6JA 4A1FA 5EE5B 2EQBA 2IUSA 1XXHB 4B3XA 4JT4A 1G3QA 4EJSA 2QMOA 3TSWA 4QBFA 3GFOA 1FX0A 2IEYA 5FUVA 2JIZD 2PJZA 2CMKA 2QNRA 2OO7A 5EUQB 3CWQA 4JVLA 1N0WA 3GJ0A 2HV8A 1ZD9A 3CX6A 4P4SB 5C1BA 5DLQC 2FGKA 3RC8A 1E2JA 3A4LA 5C18A 1RIFA 3OESA 2IHBA 5JECA 4UXHA 5KSZA 5CJPA 2GILA 4LBWA 2IWRA 3KB1A 2W00A 2QM8A 3KJIA 2FNAA 4AKEA 2IX3A 1KDPA 4MQBA 2R6GA 3EPKA 4Q18A 2GJAA 2BKEA 2J0UA 1U81A 2JATA 3GJ6A 1DBSA 4NCJA 1PV4A 4DLTA 1NF3A 4B44A 4MKFA 2OBLA 5EE3A 4BFYA 5C4GB 3MWLA 3MSXA 1G8YA 2FFHA 2XJ4A 4PZLA 4XH9B 3NDBB 2O8BB 3BE4A 2JLZA 1MABB 3JVUA 4QJ4A 3TR0A 2RHMA 2CHGA 2VQSA 4Q4HA 1KI9A 2HF9A 4BZXA 3RRZA 1F6BA 2Z4RA 3UANA 3SYLA 4LX0A 4QG7A 1OIWA 5EUMA 1R0XA 3KDSE 1GNRA 1G18A 4Q9IA 4KVGA 5AJVB 1E6CA 5AUQA 3LAWA 2O5VA 1YR7A 3B13B 3CX8A 4Z8YA 3GEIA 1DARA 4IXMA 2XSZA 4JVNA 2ZS8A 4MRNA 3CF2A 4PC7A 1TF5A 1A82A 1FNNA 2YHSA 1G3RA 1UF9A 3AB3A 1MO4A 1RVDA 3PFIA 3VX4A 1XP8A 2GWHA 3R9IA 2A3RA 1T4GA 2BVNA 5FTNA 4ZI3A 2V7QA 3S1AA 4ON9A 1G291 4Y0VA 2P6UA 1XPRA 721PA 4WBSA 4NH0A 4PAMA 2VHJA 1P9NA 5E3HA 1RPZA 4MRVA 4Q7KA 1FP6A 1P62B 4AIIA 1XD2B 4Q4JA 1JAHA 1W4RA 1OKKD 4WA7A 1SXJE 2ZYWX 2QORA 3KZ1E 5FOWA 4KHZA 1CBUA 1Q1QA 3VU9B 4D4MA 5DH9A 3BH7A 4DXAA 3ECCA 2GJ9A 5SZHB 5JWRA 3GLGB 1G1MA 4LUCA 3K0AB 5EZ5A 3T34A 2W83A 1FX0B 4YLGA 3KFVA 4US0R 2PX3A 4I81A 1KSGA 1RE0A 1FUKA 3A1TA 1U9IC 3RLFA 4OK5A 1YE8A 2FN4A 3DEFA 3PUYA 1EX7A 4NZYA 5HZHA 2DBYA 5SZIA 2A30A 3THXA 4P3YA 4BFTA 3BB3A 3I72A 3A8TA 3M0EA 5JS7A 5TARA 4GL2A 1E0SA 2IEZA 1AZSC 2IYTA 2J0UB 3A1SA 3VR6A 4URWR 4E09A 2OEPA 3O8DA 2QPOA 1BYUA 5J4LA 2KBEA 2Z5FA 2EYQA 1M74A 4OI1A 3AVPA 4M1WA 5JMTA 5DGXA 4JJKA 3RABA 3QY0A 2W2XA 4PO8A 4TSFD 4PAQA 2ZREA 3JZMA 1P73A 2AHOA 4RKFA 1N5KA 2RGXA 2A2ZA 4DEYA 3ZQ6A 5LD2B 1A1VA 5BWMA 1DAFA 2QP9X 3CONA 2DWOA 2Z83A 2ZYTX 1Q20A 1N0VC 4B76A 5FI1B 4MGKR 3R8FA 3ZZ0A 3C5HA 4TL8A 3MG9A 2X2EA 1XCMA 1KOFA 1DVRA 4MA4A 2YOFA 3A1VA 2C99A 1DTSA 1KSHA 3SQXA 2NGRA 3L43A 1TPZA 3H86A 4G01B 2CE7A 1DPFA 5HKKD 4MYUA 1AM4D 5C46F 1A2KC 4HUQA 4F93B 2XTNA 4TLDA 1UKYA 3QPVA 2WAYA 3AF1A 5FUXA 3W3ZB 4G5SA 2OXRA 3T12A 2B8WA 3ADCA 2HUPA 2REXB 1P75A 3QENA 4OYHA 1GUAA 1N6KA 4CYMA 4YDSA 1T3SA 4U5XA 4EPXA 1IAQA 4UJ5A 3RSOA 3EPHA 2ZJ8A 4C0KA 3QSYA 1NBMD 4L8GA 4G1UC 4RD0A 1CTQA 1Z2CA 2PL3A 5TMPA 1OF1A 1FPMA 3LXRA 3DMDA 2R62A 4A8JA 2QROA 4C4PA 1TEVA 1W0KD 2V8OA 3AKYA 5AJYA 5GVRA 3KQKA 1P2TA 4F91B 2FZLA 5FTMA 5IK2D 4CT4B 3A58B 5F9FA 1HT1E 4FMCF 4PPGA 1TL7C 5CYOA 1E99A 5FBWB 4PSVA 3KKQA 4YDHB 1KZ7B 2RB4A 4PR0A 3OHMA 2REOA 2IYUA 5K8UA 3FKQA 1ZIPA 4QL3A 1ZUNB 3ZVMA 4LJ4A 3UG6A 3W9YA 1M2OB 3UKDA 4A9AA 3FPAA 1VG1A 3EIQA 2ZRBA 1LF0A 1EGAA 1EG7A 4LGMA 1W44A 3FYHA 4HEJA 4M22A 3FFAA 2A5GA 1XTKA 2J9RA 3IGFA 3CPHA 1ZYUA 3R9WA 4N1AA 1T0HB 4B2IA 1EWQA 1Z0AA 3EC2A 4GSYA 1NN0A 2OAQ1 3NHBA 4TT3A 2JLUA 1KO5A 3FTQA 2A5FA 2YOGA 4IOKA 1AIPA 4AWXA 2IUUA 3VR5A 4ACBA 2VSFA 1E9SA 3K1JA 2GRJA 3BFKA 3DKVA 1S2MA 2IBMA 5B57C 3SI7A 1R8SA 3WYFA 4A82A 5JWOA 2QE7D 1TQDA 5HE8A 2E1RA 1HURA 1VHTA 3RS5A 1W5TA 1QG2A 2ZANA 1EK0A 3WHKA 1J8MF 2EVWX 1DAHA 1P6XA 4HZUB 4DUGD 1PUJA 3K8YA 1N6PA 4NHOA 4QOSA 2ZSAA 3KQNA 2XGJA 2OAP1 4ILEA 4TYWA 3JZAA 2KWIA 2YWGA 2R6FA 3EPLA 4HUQB 4TZ0A 1T6NA 1DELA 2Z43A 3C41J 4POAA 1E9CA 4UNRA 1W7AA 1AS3A 3T1VA 1NN3A 1DAKA 3D6TB 3GLIB 2WSMA 4GZMA 5BYKA 4NCHA 4Q1BA 4Z1MD 1CF4A 2CDNA 4JMPA 2DFKB 4TL9A 3P32A 3OFNA 1BS1A 4TQAA 3D3QA 4PSKA 5EXTA 5L3RA 1R0YA 4CVNA 4ZKEA 3ZDQA 1GM5A 3GP8A 4ASUA 2GF9A 2GJKA 5KYKA 5FPTA 1XMIA 1U8AA 5EP1A 4A8JB 2XNDD 5DSZA 2DWPA 4NU0A 3CPEA 2GKSA 3IIJA 2ZRHA 3VKHA 1QHHA 3LX8A 2BHRA 2QM7A 3I61A 2CLCX 4JIMA 2ZQ5A 1NBME 5LPNA 2FEMA 4KV9A 2AN9A 1G3IA 4XTRA 1L8QA 4NYMR 2CCJA 3AP1A 5FUYA 1Z0DA 5FOXA 2YWFA 1VIYA 4M2LA 1GDDA 1UDWA 5EP2A 2AL7A 1XF9A 4M9XA 1SKYE 4TMWA 3C14C 5FR1A 2BV3A 4F4JA 2ZRFA 4HZIA 5A5GA 1TX4B 2NO9A 4G5GA 3IILA 3D8BA 5JLJA
chains in the Genus database with same CATH superfamily
1JSCA 2PK3A 4NYJR 1P74A 2OO5C 4URYR 4EO7A 3DDHA 4MRPA 2V7GA 3DSRA 3GJ7A 1U2GA 3GP3A 4QNNA 2ID9A 1TXGA 3R09A 1EX6A 4HLNA 5DIFA 3U37A 3GT4A 4DIOA 5L4LA 1Q21A 2ZTLA 4AC9A 3VZCA 3AFOA 1ZMRA 1E7RA 1KHHA 4ZQHA 1F60A 1Z7BA 4IHJF 4WOBA 4PHCA 5DOVA 1P1JA 1V16B 2Z9BA 1P80A 4EUFA 2P11A 3DQQA 4WNAA 3M70A 2WLSA 4F9EA 4UNNA 1G8MA 3OEHA 1W85B 3LXXA 1TYDE 1KOGA 3L6BA 4Z9XA 1UR5A 1N1GA 3LP8A 5F23A 3N8NA 1DUSA 3L6UA 4YJ2F 3UFXA 5C5EA 5JYCA 2BM8A 1DAEA 3D9QX 3LUPA 2ZVDA 4U7FA 5CTJA 4MR7B 1MAHA 2GZDA 1ZJZA 1PR6A 4DRXA 1RBMA 4I6EA 3ABIA 1HT2E 3X2FA 4QATA 1N5JA 4XVRA 4O4HB 3B38A 4M4SA 2BFDA 4BVBA 2CVOA 1TAGA 4IWXA 4Y2QA 4MK4A 2A9KA 1M3SA 2NPOA 3P9NA 4XPZA 4AJ2A 1OIVA 1JP7A 1XTJA 2QRGA 3LBHA 5KTPA 2V6IA 5FQOA 4YMHA 4FGUA 4X45A 3NOQA 9LDTA 4QOGA 3PDHA 4PFJA 2P3LA 3DHNA 2XLBA 3PR2B 3OT1A 2PSSA 1Z26A 3T3OA 3I76A 3KLMX 4X8MA 3HDVA 2X0DA 4YVFA 3AYZB 3L7DA 4JI3B 1TYCA 1ML4A 4GU5A 4J75A 3PNPA 5AK6A 4HR7A 1FJ2A 4RQBA 5M2QA 2X6TA 3KKNA 1FF9A 1KO7A 1IM8A 2I6UA 2M1ZA 3C6QA 4EW1A 4D2IA 3NLLA 1P0CA 2O8DB 3L7AA 3MS7A 1SUWA 3KEQA 4BQNA 2CK3D 2N1BA 3PQ6A 1QHHB 3BRCA 5IMBA 3KUDA 4KKXB 1A9OA 2PA3A 1ZK0A 4Z4CA 5IH7A 4PTZA 2J0VA 3CV3A 3O7MA 5L7TA 5HMMA 3UMYA 4M3NA 2WOJA 1XRNA 2O48X 1HDZA 2JJ1A 3AM5A 5FTLA 7ADHA 4JV5B 1ADBA 1JZSA 1H6AA 5BW8A 2PWAA 3PQEA 4LZJA 4H17A 2I8LA 1QH1B 2VQ6A 2IXDA 3WL6A 1A76A 1ECFA 1JFLA 1F5SA 2JC3A 4J0IA 4YAWA 5I3CA 1PEYA 4FWIB 4L8FA 2BFPA 4M88A 3E15A 4I2VA 3UMSA 5EWJA 2CLSA 4MVJH 4W7HA 1U2DA 2NO0A 4J9VA 3W3AD 2QZZA 3GJ5A 1KP9A 2A67A 2QAJA 4IDEA 3HKBB 4FOTA 5AMXA 3UJAA 4BFZA 4UOZA 5GVSA 1A4IA 3VI3B 1N34B 1R4MA 1JPNA 1QVAA 2DUMA 1E4VA 3LLVA 2K2WA 1BN6A 1F3OA 1P1FA 2BFEA 3OF2A 4WNCA 1Z9BA 3KR9A 5FL7A 2XDQB 2XYVA 4JD5A 2X2FA 4H4DA 1JAYA 2EQAA 4YDQA 1O9HA 3NAQA 5IXSA 5K0GA 5ALZA 5KYXA 3RBVA 3R6WA 1I1OA 3CU5A 3SHFA 3RWBA 4RTKA 1PVDA 1Z0FA 1YR2A 3MYYA 4WNAB 1P8JA 1Y89A 2HMYB 2COUA 3BX1A 2WWGA 3UJBA 4BFWA 1U1DA 3MBIA 1I4LD 1C1XA 4I1PA 3FLAA 2V9PA 1S8NA 2GYYA 2D1SA 2V9ZA 3I04A 3UT5A 1H9CA 3F78A 1P45A 1RMQA 4ZJPA 3EVBA 5DULA 4UFPA 1UQUA 5GIPE 2ORYA 4XLTA 3OCCA 3EGDB 3DUWA 4AJ4A 1BS9A 1L5MA 3KVNA 3O1IC 1B6SA 2ZI4A 4ZYZA 4KXYA 2QB5A 4Z1OA 4EFNA 2Q8NA 3ZIUA 4XWAA 1M2KA 1H66A 5HDBB 4XJXA 2GN1A 1PX0A 4GX0A 3CRZA 3NJ8A 1AGPA 1GN9A 2HLHA 2FOLA 3KV3O 3N7TA 2W2VA 1OBCA 1ZO8A 4ZO9A 4Z0HO 4HB3A 1CJVC 2RFLA 4HP8A 4M49A 1EWKA 3IPCA 2UVPB 3GG9A 3LQQA 4KVAA 1NX9A 1QHIA 4QRDA 1OWPA 3TRFA 2QRZA 2XB6A 3RO7A 4QM7A 4ZO8A 3QTLA 2HPVA 3FOCA 4UHBA 5TDHA 4DJFC 2WJPA 1J9ZA 3RYIB 4IUCS 4WLVA 1T4CA 2FK7A 4UPDA 2AK2A 1HYBA 3GEBA 1D0SA 4EQ6B 3IIIA 5AW6A 3I73A 3T9DA 4DMHA 1QGUA 5ES3A 1CDZA 3SNHA 3VNVA 5TQVA 5ALEA 4XB2A 4ALKA 3FVTA 3VDRA 1GUFA 1SU8A 2QZJA 1U04A 2ZBEA 5M3BA 1QIKA 3C39A 3QUCA 5ALLA 4ZPXA 3HCEA 1HL7A 1WO8A 4I1VA 4XRGA 3KBOA 2XUDA 3OE7A 3R0VA 1E6UA 1ZAKA 3DE6X 1P39A 2QN3A 2JIMA 4OSOA 5DYYA 3HQ4O 1JIKA 2GBFA 3VYUB 3A4MA 3Q40A 5LWHA 1GYPA 4GKAA 1EFRA 3PC7A 2SKEA 5KTOA 1Q3TA 4H3VA 1IBSA 3KAQA 4D43A 2FSPA 2DTXA 3C3JA 3ENWA 1WSWA 1E2GA 4TV9B 2PV0A 4KO2S 5FI0B 3GFPA 5F3WB 1KYZA 3IURA 4NJMA 4H7IA 4WERA 3O91A 4IHKA 5EWJB 3L79A 4MMZB 3VU3A 4OCZA 3DVAA 4FW8A 4URHA 2ID4A 1EM6A 4F4DA 3GQBA 3HWSA 3ICWA 2MYPA 2I1QA 4HX2A 4UZEA 2E18A 3BAFA 2DQ4A 4NABA 2ZTHA 1M34E 2WE7A 3GRFA 4W99A 3F8TA 1NPYA 4XFJA 3WI7A 3LMKA 4K05A 4EG0A 1CNMA 4E2FA 8ADHA 1HDGO 4P82A 4FOLA 1OH5A 1VP9A 5GONB 3JX9A 3KR2A 3OQIB 1N33B 4KWIA 1FIUA 1JGTA 4KFTA 2RGCA 3GOHA 1AGRA 2JGMA 5KYXB 5C80A 1WZ2A 4M1ZA 1A5SB 1JEEA 3MJEA 2QSYA 4YR9A 2C82A 2NV0A 3P26A 4GH5A 2FW9A 3GLTA 3MT9A 4MPTA 1A8UA 4XM1A 4MVWA 3RK0A 2G82A 3TSAA 4F56A 3KZVA 2O19A 3L82B 1KYTA 2KE5A 4JI7B 1JHRA 1OB2A 3MLAA 1FQOA 1T3HA 3VSCA 4PYMA 4WVFA 4KXXA 3LTNC 1Y5MA 3KQWA 3URKA 3IE2A 3KSUA 3NRCA 1W29A 3HBFA 5LD2C 3Q3JB 1QQBA 3GHHA 5BORA 4KB5A 3PXCX 4CEIA 3AF6A 4DLUA 3PNOA 1VKOA 1P4JA 2CVHA 3MRXA 3TTWA 1JYEA 2DWQA 1GHTA 3TRHA 5A0VA 3P5SA 4GVXA 1TI7A 5K4GA 2QQFA 2IHKA 1RCUA 2PZJA 3K9QO 1Y34E 2FFQA 4A36A 1RLUA 4S35A 2A9FA 1D6JA 3WNBA 4CKCB 3KSAC 3IMKA 3TW8A 1ZUHA 3G5LA 3RFUA 4OQNA 3W8RA 4X65B 2BTEA 3VHLB 1Q95A 4FS3A 3ZQUA 3MINA 5FQNA 1P2SA 1UZUA 5GQSA 7MHTA 3ZXSA 1EFDN 1ORWA 3RJTA 4R1OA 5JFGA 2VT3A 4D26A 2V54A 1N3IA 3OM8A 4EKGA 1ZU5A 1LRKA 4QGBA 2WA2A 4CMEC 3T4UA 2NUAB 2IF0A 9MHTA 3TQFA 5J23A 1DQYA 4FVTA 4K5QA 3OT4A 3E4DA 1O7JA 3C3CA 3B1FA 3NYIA 4CM9A 2JGIA 3M6MD 1XNGA 4FYXA 3O3CA 1NAIA 3C3YA 3RTBA 4BBPA 4UHCA 4B6QA 1SU4A 4AYTA 4MHSA 3RM3A 4R1NA 2K4MA 2DUUA 4FKZA 3WG9A 4P3OA 4EY8A 3R3HA 1C80A 3I9KA 1D4FA 2V6MA 3C45A 5CVVA 4NJMB 2MCFA 2A5LA 2CHQA 1O6FA 2GUGA 1NUTA 2UAGA 4BLTA 5J4KA 3ZIAD 3RREA 1QK5A 3WGGA 1D9XA 2C4HA 1EE1A 1FSGA 3K2BA 3NGLA 4LHEA 2FVXA 2PSDA 1OXTA 4J03A 1JF8A 3GQBB 1G7SA 4ZAXA 4F06A 3KYIB 5FV7A 1OA0A 3CKKA 4K6HA 4Q3NA 2BHTA 4AJEA 4HVLA 5AKJA 1UK8A 4V3BA 2F55A 3L7CA 4YO8A 3WO1A 3AFIA 3CHYA 3K6JA 4YV7A 4V2UA 2BEJA 3JVEA 1C9MA 1OKKA 1T9GS 1JEQB 2J3IA 2LKDA 4TTPA 3BDVA 5A0FA 3M6WA 5DM4A 5ALXA 5HJEA 3LPCA 4FLFA 2BCJQ 2C97A 3MCTA 2Z30A 4K2HA 4B75A 2BMFA 1CS0A 3QI2A 3JQFA 5EJGA 2F4NA 3PX3A 3VTAA 5BVHA 1YZ3A 1ZD2P 3U61B 1LX6A 2J31A 3OA2A 1GWNA 2AOTB 4E14A 1EGVB 4U5QA 4RVOA 3QUAA 4G9EA 1RJWA 1JR3E 4BUZA 5EUCA 4DG9A 3JQQA 4F84A 1L9XA 3H2YA 4EGCB 1M73E 1SCIA 1YU9A 3QKSA 2O2JA 3NDRA 4I50F 2OCIA 4X91A 5IAJA 1FK8A 3SBDA 4CEIB 2QBYA 4KXWA 4KQKA 2Q3FA 3GH1A 3T5GA 3U4AA 3WGLA 4HSGA 4YRJA 1FUYB 3HB5X 2PMCA 5C5IA 3RR2A 5JRJA 1OXBB 2OLEA 5ILGA 2GKGA 4HXGA 3UM9A 1FDWA 4AW9A 1ZN2A 2JVIA 3DZCA 3IKJA 1T9AA 3O82A 4HDSB 5AFSA 2QENA 2YN2A 3HA2A 3QEJA 4IH4A 3H84A 2D00A 2ZJZA 4HRAA 4UBOA 1ZP6A 5L51A 3FFWA 3MWGA 2PMFA 3IEUA 1JG6A 3IUYA 4ZI2A 4HNUA 5BVGA 1YAJA 2VF5X 4QUKA 2IK8A 1SVIA 2QMUA 1GV1A 1FXUA 1P0MA 2R8BA 2RBKA 3GEMA 4GQAA 2CFOA 5TC4A 2W48A 4OD0A 4KE9A 3TJZA 5KNBH 5DRYA 2W98A 2P2SA 1LX7A 2F1RA 3B78A 1FMFA 1LRLA 1QFXA 5IXYA 1URPA 1WMAA 1MB9A 1VCMA 2CNBA 3NG1A 3B7GA 5LQKA 3IQGX 4EL5A 5BR7A 2QRVB 2GCNA 1ZVVA 2EV9A 4ZRMA 4CN8A 2PZGA 1BCSA 1SURA 4I5GA 4NFLA 3F2IA 3VZRA 3LOPA 3NFRA 1AB6A 4UARA 1RR6A 1Q0ZA 2VNKA 3FCYA 4EPVA 2PCLA 1ZOIA 3LT2A 3PHHA 4HRXA 1ES9A 1TKCA 5A3JA 1XUOA 4CFSA 4W6QA 3IIMA 1TA9A 4IDQA 3RC9A 3OOYA 3LDAA 1UWKA 1VJRA 2VYFA 2VDPB 1RXVA 2Z08A 2L82A 4W5JA 2VSXA 2PX5A 4X6UA 2RAPA 3WLIA 4LI3X 4XB1A 2H2GA 1FSZA 5K51A 4C01A 1G7RA 2NTJA 4Z9BA 2IPMA 2BF7A 2XWSA 3GA0A 1SUAA 2VIIA 5JVDF 3ADBA 4JXXA 3TRKA 2H54A 2PANA 5KTKA 3E1SA 1C4OA 4H6WA 2PT6A 2ADFA 1CP2A 4I46A 4NCXA 3CB2A 4XGIA 5E2BA 5HOQA 3INGA 4Q7QA 3ZKWB 2HJRA 4BWYA 3TZ6A 2XUGA 1ZK1A 4ECEA 1NBMA 3LCMA 4B4WA 5J2UB 4RSGA 2W0SA 4EW2A 5LB2A 5AJXA 5BVHB 1J0CA 3MAJA 2DZDA 3D7RA 2NSJA 2YXPX 3DL4A 1P1BA 4C0AC 2JH3A 2COKA 3DE0X 2XQIA 3IVAA 1YJBA 2FSIA 2PGAA 2O8CA 3KQLA 2ZBVA 5DHTA 5JQGA 1H1TA 2ACKA 3R5HA 5HTOA 4IDFA 2A4KA 2AYXA 2HNAA 3BWVA 2JAOA 1D4ZA 1JLKA 4L4RA 4WOJA 4ZWNA 3VR6H 2I2FA 2CV1A 5CDTA 4AIRA 4D1YA 2Y67A 4LCBA 4MUAA 1WD5A 2MR6A 4ZV7A 2IYOA 3E70C 3RF7A 3H65A 4MAFA 5E6RB 3WBJA 3WJ2A 1IY2A 1C9YA 1CETA 4YGXB 4BMNA 3K0FA 1ZOLA 2KW5A 1C14A 2BKUA 4I9UA 4EA6A 4X20A 4YMSA 4G26A 4YCBA 1RPTA 3LSTA 1QWSA 1W0JA 2OYRA 3FDXA 2Z6UA 1RM4A 1RRPA 2QV0A 2NZUG 1YJCA 3R3XA 4ZALA 5CBPB 3V6LA 4KR9A 2IDZA 2VN8A 3FFTA 4DRYA 3B85A 3HUFA 3JR3A 1SUBA 2ZP1A 4WY8A 3L7IA 3TOCA 5CAEA 1X0VA 4I1YA 1TECE 2HA6A 5E4FA 3RG8A 4XD2A 4BE7B 3DEKA 2PBRA 3M33A 2YYYA 3FYCA 1Z34A 5IAGA 4CU5A 3MPOA 2GVZC 3OVMA 4G0QA 5BN3A 1UKAA 3TXXA 3VNUA 4HTAA 3IP9A 4RKQA 2AOUB 3EF1A 4FE7A 5I48A 1RYNA 3WBBA 4JB3A 3X1KA 1ORTA 1N5DA 3CRRA 3NHFA 4QOIA 4WBXC 1YQUA 2QD3A 1PI3A 3OEED 2YH2A 3QVJA 2EKQA 1DG9A 1J8FA 1F20A 1GVHA 2QE7A 5KKNB 3DAOA 1DEOA 3P9QA 5EQTA 3GLSA 1WB4A 1TJ3A 3E4CA 4E5SA 1UH5A 4LRTB 4XLLA 1KDRA 3AB7A 5C7IO 4N12A 3BILA 1OAKA 2A9RA 1NF2A 4QODA 5T4FA 5THKA 3T7AA 4KQ9A 4CL0A 5LM3A 4YP1A 5FTKA 2PM8A 3K92A 4DDVA 5CXXA 4UHEA 3Q9LA 1W48A 4B7CA 4OQXA 3S81A 1QHEA 4XEUA 1IM2A 1DBVO 5HUHA 2JCSA 3B51X 1KKLA 4O2RA 1OPXA 1NI5A 1NVVQ 1DBWA 3SQLA 3OZAA 3UWKA 1AKTA 3WRWA 2BGWA 5AM0A 4AMBA 2F8MA 4RE6A 4Z1MA 1KJZA 3P0JA 5HRUA 4YRBA 2NV6A 4Q1AA 5HUQA 2O0KA 2ZUDA 4R9RA 4QVKA 4BKRA 1DJLA 1U2GC 1WMBA 1TUIA 4ICIA 1J09A 1L9KA 3JSAA 4PX9A 5K0LA 9ABPA 2ZROA 1KI1A 2FHPA 4IJWA 1LDEA 3THXB 1HT3A 2I7XA 5I6DA 1HT0A 1L4UA 4G41A 1YL7A 3ZHRA 4CFYA 2OCYC 4TRNA 2BT4A 1XQVA 3LBYA 4JU9A 4QAJA 3RVDA 3EXEB 1JFVA 3AEYA 4QBGB 4S1TA 4YUZA 4J2OA 3VZBA 1SQ0A 1WW8A 2ZETA 2R6CA 4NJEA 2XB2A 3LLSA 2FZWA 1DPGA 4WINA 5JQGB 3GDGA 3KC2A 5DM70 5LU8A 2WMNB 1USVA 3COWA 3MWFA 2GAAA 3GXOA 3UV6A 1AURA 4O1MA 1WF6A 4QPDA 1U0FA 2PBFA 5D3MA 1JYSA 4OXNA 4D4JA 1N6HA 1ODJA 3IKMB 4GP7A 1MB3A 2QT1A 4HMOA 3TQOA 4BNDA 3V4RA 5CFLA 2QR3A 1ST3A 5ERXA 4KQFA 1H1DA 3MW8A 1N7GA 2R00A 3GT0A 3HGMA 4FMPA 4G8CA 1CUWA 2GPNA 3SLRA 1KAHA 1G6KA 1QZXA 3AI3A 1AJEA 4B1FA 3H5OA 4KQGA 4ZVQA 1YZLA 4ERNA 3OU6A 4L2IA 1RRGA 3DQPA 3GRVA 5ALRA 1TLFA 4B7AA 3EJWA 3ZWPA 1G9XA 5H3LA 1JQKA 1WQ1R 1D03A 5EKXA 1NUAA 2CVFA 2C9YA 4V2IA 4NP6A 1W0CA 4KOEC 4PLGA 4UNQA 5AHXA 5JSUA 4HAZA 4MYCA 2AFVA 3VPBA 1C4KA 4FHCA 4LY3A 5BN3B 5EJ7A 3IPXA 4F4CA 3CF0A 3S2EA 2IEBA 3TJMA 4YAJA 2ZIWB 3JRWA 2PNFA 4KCGA 4EITA 2VPYA 3PC3A 4PIPA 1M2VA 3OH8A 3HEMA 1XJ5A 4R2WA 4M0PA 1WRBA 2DT8A 3RC2A 5DVZA 3QKTA 2VH1A 1RW4A 3R3JA 4R2HA 5C1PA 1NV8A 2X4DA 4EK9A 1O58A 1VI5A 4B7ZA 4OA8A 2OFWA 3S55A 3IVCA 3OZEA 3FPKA 1QQ6A 1S96A 3O1JC 1TF2A 3ZGNA 1C0PA 2OG2A 4DMGA 4ZI7B 3A6KA 2CNLA 1NP7A 1G5PA 2DF8A 2LPMA 3D54D 5EUBA 3FFBA 4GWGA 2AFIA 3TR5A 3S8YA 3VJRA 1IM5A 2ZE7A 3LL7A 3F5FA 4MYRA 4KLRA 2M2IA 1BCRA 3PRJA 1P61B 1ADCA 3NH6A 4N3AA 5FPQA 3BORA 4MWSA 3PFCA 1SG9A 3ABSB 4UAVA 5FOSA 1XN4A 1YTUA 1SCUA 1ZBDA 1KC1A 2UZ1B 2ZDQA 2REBA 3EUEA 4B73A 5IZCC 2PGIA 3IUMA 4DCPA 5F2NA 1GG5A 2R8YA 3LECA 4IKOA 1V37A 3QLEA 4RS3A 3P7MA 1EBUA 1L7QA 1K4MA 2I67A 2XHEA 4CMIA 5CDFE 2UVDA 1DRKA 1NL3A 2Q7XA 2ZR8A 4I9NA 1ZCJA 3UUWA 3VGJA 4BEVA 3A6PC 2VP5A 2DPGA 1EUCB 3K9BA 4PG7A 5K99A 4U7DA 4FCCA 4I08A 1LZKA 2PT5A 5AK4A 3UMRA 2FWAA 3W6NA 1Y9DA 4LQLA 5I7VA 4FLMA 4FR0A 5JBQA 4MAMA 2ZKIA 5I8ZA 2C2YA 4JZKA 2RBGA 3H2HA 4YAFA 1RM0A 1GCGA 4RULA 4WLNA 5E0OA 3RU2A 3PVZA 5B30A 5D01A 3F4BA 1WB5A 2J3JA 3A27A 1P33A 4LYFA 3MBOA 2GZAA 2W6QA 5U4XA 4EF5A 2F9LA 1VYTA 4KAFA 2GEBA 1Z3IX 1CUGA 2G80A 3QVGA 2YC4C 4CLRA 2YUIA 2KLBA 4XWTA 1PKXA 1UC4B 1DIRA 3N2GA 2EFCB 2HRCA 1PNQA 4H7EA 3ZD9A 5I5EA 1D2EA 1K7FB 3EFOA 3PUKA 3LT0A 2I99A 4KN5A 1OZHA 3UJHA 2FDCA 2CXOA 3ILHA 4W4TA 1L5HB 2Y1OA 3QVSA 4RJTA 3AGPA 1WVIA 1X87A 5JNWA 1OBFO 1S1CA 2FG7C 1N6IA 3RTAA 4ENQA 3QHPA 1RRVA 3QFFA 2IKQA 2AMVA 2JCXA 2Q5JA 3FAKA 3N5CA 3Q7SA 4XQGA 5CIWA 1N2JA 4TROA 4X1IA 1Q6YA 4QYSA 2WKSA 5G3YA 1XYYA 2AG0A 4WXEA 1EXDA 5F2EA 3WMWA 4FKMA 3MXOA 2EW2A 2XQJA 4X90A 3I64A 5ELXA 4Q7MB 1RAHA 3R74A 3T1OA 3KRTA 5T41A 4DR3B 1DHRA 1N8SA 3NRJA 5C51B 4GFDA 4S1NA 1M7BA 4ZAVA 4ZMSA 2ECQA 3RODA 1RWXA 2BOVA 1V7CA 3TQIA 2R8XA 1KQNA 4D9HA 4L95C 2R4UA 4UTNA 3OTIA 3FF4A 1CNFA 3QVOA 2B4KA 2R7KA 1U7OA 3WLQA 3V1NA 2F9FA 1LD3A 1P19A 4QNRA 4PNZA 5JS1A 2Q6OA 5I7UA 1Z6PA 1IPFA 2ATXA 2BSXA 1SK8A 1Z12A 2RGUA 3G2JA 5CU7A 1NUPA 2XV1A 1NSYA 1O1YA 1PAUA 3AIIA 3CRW1 3GLFA 1C7JA 5JAOA 2CUNA 3O9MA 3EQZA 4ID9A 4KG7A 4L6AA 4RH3A 3USCS 4R71A 4FTWA 2CZQA 4JT8A 2BKAA 2D5LA 4L8WB 3GJZA 2WWXA 5JJLA 4MVJM 1YA8A 3UVEA 2GCIA 3P9IA 4HX5A 1JG2A 4ZOEA 3JVDA 4IOMA 3U3JA 1MPTA 5DO9A 4ENSA 4GZ3A 3FPJA 3E9NA 3LUCA 3MJDA 2UZ3A 2Z8XA 2Z58A 1E59A 5J4VA 1UMCB 4JUBA 1SPBS 3I4LA 1ILWA 2BGTA 3VJKA 3IOYA 1TVEA 4AF7A 1OA1A 3E81A 6NULA 1H85A 1KORA 3B9PA 3JU3A 4EVSA 4LOIA 4WZZA 2CFRA 3DTYA 1Q1NA 2G1JA 3DE2X 3T52A 3A4YA 2QLLA 5TEVA 1ULZA 3WXBA 5HP4A 3ADKA 3C4QA 4HVTA 4Y67A 3TOVA 3AX6A 1IVYA 2OCGA 4TYMA 3T7TA 1GQYA 5DT2A 3RLIA 2CHUA 2FUEA 4YK7A 1CLEA 1RKQA 3HKDA 4C20A 4YAEA 3LRPA 4U2BA 4O2AA 2B21A 4KACA 2NYUA 3I6YA 1RHKA 3VR3A 1P5JA 3QVGB 1A9PA 4TMTA 3HJHA 4BATA 2K7FA 4Z3KA 2RJNA 2PRYA 4DCUA 1NVEA 2R84A 1IQUA 2FWMX 1QGAA 1LI4A 4BDSA 5IAKA 4U63A 3V9PA 2POCA 4BEBA 4DIKA 1NFRA 1NRWA 1L4LA 1N77A 3CLKA 4O4HF 2VWPA 4F1KA 4FYHA 4ZAFA 3B1WA 3JD3A 3F7NA 4CEJB 2OZKA 3NT5A 3IS3A 3NBUA 1FMCA 2F1HA 2JJ2A 2XMPA 4XDYA 4BQQA 4GBMA 1JLLA 2PGLA 2R3SA 6ADHA 1IG0A 1KDOA 2GI4A 2WPDA 1YI0A 5DMXA 2VHCA 3SXUB 1Z5VA 4Z7JA 2WINI 4ND7A 1EXMA 4JLUA 3ZHQA 1QFSA 4ZCSA 1T9ZA 1LDNA 2AKEA 1BH6A 4BLOA 5IC4A 2J3EA 4Q3OA 1D6SA 1XZBA 2F59A 1KY2A 5JTTA 2EZTA 3U7EB 2ISQA 3A7DA 3G9UA 3M49A 2DY0A 3P97A 3CUSA 3GH3A 3R3SA 3U48A 2NO5A 1WVMA 1I2ZA 1ZI9A 1AKNA 1SBQA 3NDIA 5FOUA 4QJIA 4X6LA 2WNHA 4RFVA 3BE6A 3LDUA 1HRKA 2MSDB 2YHIA 3CR7A 5LMUB 1MEOA 1RFLA 3KVRA 4LRWA 5FBZA 1IJKA 2HAEA 3EGVA 2WKQA 4KO1S 5SV2A 3WLJA 3TM5A 3OHSX 1UPXA 2JFXA 1CQIA 4GMHA 3T5CA 1OTYA 4NX2A 4TKVB 5E7JA 5EHGA 3MTAA 5FWDA 1GCIA 1JQ3A 4LRSB 5IEJA 3LE8A 5AM2A 4HQKA 3K30A 5KHLB 1R0ZA 2HJ9A 2EGUA 2QTMA 4R1UA 3SBEA 3ZZ1A 1QLHA 4ZREA 1EU1A 4X66B 1YCHA 1M1NA 3EFEA 3BH6A 4Q9KA 1PFWA 4R7TA 5LCXA 1F5NA 1R9MA 5CHYA 3U7HB 4B81A 2ZB3A 3PC4A 2OSBA 1UP4A 1YRWA 3B3FA 3AYXB 4ZT7A 2EZ9A 1Y6RA 3QELA 4BO0A 4HWTA 4MVJD 4C2TA 4DQKA 1ZMTA 3JQFC 2IYLD 3O0TA 1GQSA 4AP9A 4PS1A 3NX4A 1RRCA 4EY3A 3EFHA 5TNXA 1OUMA 1U3GA 4FFNA 4EGJA 1SD1A 2R2AA 4N54A 2GCEA 1V9CA 4X8HA 4ZDWA 2ZFUA 2C9CA 3OZ7A 4KLAA 4XDZA 4GPIB 1PEDA 1BVUA 5I9BA 1L5ZA 4AECA 2B34A 3BGSA 3B9RA 3BJRA 3ITEA 5CYFA 1L5RA 4U6QA 4ZOBA 1H2FA 2R8ZA 1R1DA 5TPWA 4MAAA 4D46A 2CHEA 4N0EA 5DYTA 4F6RA 4QOHA 4YUAA 5CFNA 1U90A 3DV2A 2Z0MA 3QX9A 4FYKA 4K6CA 5BR8B 1AN0A 4IOLA 3TSCA 1WWKA 4O3FA 1P60A 2R86A 4DY6A 5K0CA 1WE2A 3L8HA 2OGWA 1C3VA 1O8BA 3EBOA 3Q85A 3M6LA 4XTCS 3DLAA 1NT4A 1XXHA 4QNMA 3IQHX 1DOAA 4UMVA 3YASA 5AXBA 3VO9A 1C30B 2EKDA 1NKVA 3VYTB 5B64A 1EP1B 1SXPA 4INAA 2EFYA 1V3TA 4RKWA 2WY2D 2IS6A 2Z95A 1BFDA 4ZVOA 3UK7A 5DLYA 1N78A 3TFOA 4OFWA 1J07A 3GUHA 1YRHA 2N42A 1NU6A 1XJQA 3TXAA 4BU1A 4P4SA 1XEAA 3PXXA 5L8VA 2YRFA 4HC4A 3NC1C 2M1XA 2FEPA 2BRUC 3SYNA 2FMXA 5HNKA 1B14A 4KR6A 1IOWA 1BQEA 2ZTMA 3U17A 4CDMA 3QLTA 5C37A 2SKDA 3MTEA 1N3LA 1Y7LA 2XMRA 4BDTA 5CXQA 3GJ4A 3N39C 2GPTA 1NJ5A 3OCZA 5HSGA 3G0OA 1VL6A 5KYVA 1U8YA 1WZNA 4TQUS 1EFVA 1N6NA 1NJFA 2OOKA 2YHIB 3HXLA 4TSRA 4ZN6A 4PNPA 3V8BA 5IN4A 3GLVA 5FO0A 1TRHA 5AICA 4OG2A 4OJNA 5DCYA 5CGQB 1Z08A 3I8SA 2AG5A 2QPAA 2W11A 3QP9A 2CL0X 2BBSA 2VJKA 3RIYA 3JALB 3GJRA 5ECDA 4WJZA 4CF4A 2RK4A 4HTFA 4D80A 4O4LB 1Z39A 3PXDA 4FOPA 1CYDA 1KE2A 1IY0A 2Q2OA 4P7JA 4PC2A 4BB9A 3RUCA 2ZGVA 2CFSA 3KJQA 4P5DA 1V25A 4MVJF 3M9XA 4B3BA 1UBTS 4TV9F 5ENZA 3IDFA 4CKWA 1FDTA 5KQRA 1QANA 3OE7D 4K0RA 2WM3A 4P80A 4MCAA 4Y1RA 4KMRA 4Z8XA 1UIRA 2Q9UA 2VG8A 2Y68A 4U8GA 2GK6A 4N49A 2ZPTX 3WLPA 2BE9A 2XGSA 3TAXA 1BDBA 3U39A 2JGFA 2Q4BA 4GWLA 1E0JA 3EIHA 4NMLA 3PHIA 3C6ZA 4F96A 2J0SA 5GONF 4P0TA 5DYGA 1GQOA 4LXYA 5JNSA 2ZW9A 3QFTA 4PEVA 3AU8A 3FYUA 1R4NA 4X64B 1D07A 4MVJE 4DB2A 4NYIR 3WS7A 2WTNA 1H2ZA 3FTNA 5TVGA 2XUJA 1E3MA 2RI0A 1AUQA 3PHLA 2C5BA 2ZSKA 3PSHA 1LNSA 4XGNA 3ZWDA 4JL6A 3L93A 1MVNA 1NW4A 2R47A 1YRQA 4DDKA 1B8OA 1TC2A 2P2NA 1JXOA 3FA2A 1ZK3A 3LUGA 2C98A 1E2FA 1GP2A 1FFSA 2NUPA 2P5YA 4PZZA 3WRYA 3IC5A 3ILVA 1NF8A 4X1YB 1Y9ZA 1G60A 4RHEA 1F0NA 4Z9YA 1UPAA 4LBVA 2IF2A 2I03A 2VP4A 5AVWA 3GLGA 2BDUA 3PFNA 3SOZA 4B35A 3SP1A 3HFSA 3G2IA 1HR0B 2RK6A 3SHTA 4NPHA 2FJUA 2WJAA 2CXRA 3FH0A 5H3HA 4BLWA 4XDHA 2R5WA 4RGYA 1VLHA 3UIEA 5F4BA 5DN9A 3V2UA 1HNNA 3I9V6 1U8CB 3R40A 4KI0A 1AA6A 1FX1A 1MO3A 4YYZA 4DSUA 5HTKA 2GS9A 2WJHA 3BRSA 3JWGA 4M21A 1SB8A 4L3VA 2JLSA 3PNKA 3H11B 3OUZA 3PENA 5BQOA 1T34A 2QX4A 2Y1KA 3FSJX 1JA9A 1TIPA 2CBXA 4GYWA 4L02A 5F12A 2XDAA 3UMFA 4B84A 1LQTA 3AJAA 4A3SA 2NMVA 4BFVA 3OIVA 4LRUA 4GDMA 3ZS8A 3ZWWA 1M1UA 3BRWD 3PC8C 1J33A 4M9RA 2OQIA 4PYJA 2D59A 5ESXA 3OM1A 2AX4A 3F3KA 2JJ8A 3H3FA 3PQDA 4G6ZA 4TL7A 4D79A 1F4VA 2XA2A 4IUYA 4LXQA 5HQTA 5T8KA 5T7BA 5H8WA 3OD1A 3MJHA 3LGXA 3GVIA 3ESYA 4QSHA 3RJZA 3K6KA 3BD7A 1KAMA 5FHQA 3QGMA 1D5CA 1NIPA 1B8VA 2W58A 1RRFA 1FDOA 3WV5A 3IAS1 2A9PA 1RI2A 1J21A 4Q15A 3AHEA 3LX5A 4E88A 5CLFA 2OCDA 1XZGA 4GKVA 3GK3A 2DHRA 1Z74A 4PIMA 3LCJA 4N6OA 1JHOA 1VSUA 2JFQA 3V8VA 2IPXA 5ECWA 3FI9A 4D4IA 2PA0A 1CUFA 4CM9D 4AJLA 1TKBA 1IN6A 5JAQA 1JDBC 3T0GA 3NUGA 4UVGA 4QPZA 2C7PA 1XVVA 3F8WA 5CEFA 1XU9A 4KXNA 3AVWA 3NV7A 1W2GA 1NOIA 4YCNA 4LJ8A 1G4UR 3LZ6A 3RIMA 1CQZA 2Q3JA 3GCGA 2WTUA 1RBZA 3K71B 3ERCA 4IYJA 1P5RA 1AMUA 4BUJA 2PKQP 3HJBA 4MUYA 3VPHA 1XVIA 4FGZA 1FLDA 5I5GA 4JFRA 4IJVA 5BXYA 2VATA 3K70B 2G17A 2AC4A 2EC5A 2J3LA 2OE2A 1R4NB 2DWCA 2Q5CA 2WJWA 3FVQA 3K1AB 4HXEB 4KQEA 4JX9A 3CH5A 1YB1A 2BKVA 2BCEA 5EIBC 3UMVA 4C7XA 4OK6A 4RVHA 1KTIA 3D8TA 1GA4A 4YRZA 5EIWA 2D2IA 1U5BA 4PSDA 1SM4A 3F0TA 5MFPA 2UUCB 2XE7A 4Q5IA 1LBQA 1FYWA 1G42A 1TU3A 4E2WA 5JCZA 1ZSVA 3PUJA 4G0UA 2FPIA 5K3SA 1RRMA 1JJIA 5FLYA 3SFZA 2X5KO 1H1LB 2FX2A 2IP1A 2NNLD 4MI6A 2Q0XA 3VFDA 1X3LA 5KO2A 4PGAA 5B6IA 4Q7EA 3T38A 3OQ6A 4HYYA 2ZIVB 3TCNA 3TSZA 3TDMA 3T3IA 4HXYA 1H5NA 1XHEA 3Q0EA 4UBLA 4DFDA 4RTLA 1KEEA 1D7OA 3GF4A 4TTIA 5EPEA 4D97A 2B4TO 3PL1A 4B5KA 1EX1A 1LDYA 1SUPA 4LKRA 1GQQA 1HH4A 2RHJA 4LK3A 2Z3WA 2AMYA 5CK5A 1S9HA 2YJGA 4YJ3A 3IR5A 1L5QA 4PINA 5DX1A 4MHTA 3PV0A 1F8XA 2ZT6A 4D3YA 3ANSA 1I1QB 1ZC4A 4DSNA 1US8B 3EVEA 4CUJA 2XCTB 3CNLA 5I7OA 1LBSA 2GEJA 2IZ1A 4X60A 4OHWA 3S2YA 1F0KA 1CULC 3DMFA 5ENVA 3LW7A 2QRNA 4OSEA 3T1VA 2BJHA 3OAAA 3ILSA 1ZUNA 3BGDA 4ENRA 1HFWA 3EWSA 5KQGA 4DADA 5A5DA 3KM0A 1N25A 4FGWA 5EYPB 2AE2A 5EXXA 2DFVA 2P6RA 4OHRA 2NVWA 1FJHA 4I1SA 5LU9A 1SEVA 3A6FA 1QWOA 3DEYX 4MS3B 4CLHA 5KHOC 3CO0S 1HLDA 1M33A 1SUEA 3DDSA 3HV0A 4WKBA 4YMWA 4AJ9A 2JVJA 4L9WA 4S1WA 2FDRA 5L3VA 2VAPA 3TN7A 3H5IA 2Q28A 4OF4A 1N57A 4DCSA 1NV9A 4M0MA 1HETA 3MHTA 2ZYGA 5J2TB 5JMPA 3RS3A 3ZEAA 1E8NA 2R1TA 2B20A 1ZCBA 3BREA 3VC7A 4WXPA 3PX7A 4E2XA 4Q3BA 4PRZA 4M9UA 1RWMA 4EFLA 2XJ9A 3FJOA 3EPRA 5KAPA 1Q12A 4CV0A 1TEXA 1Z5UA 5K6TA 4L16A 4ACAA 3HDGA 1NNEA 3PJRA 3KPVA 1JR6A 2V3VA 3BBPA 3GIDA 2DY1A 3NOVA 1DKMA 1RKBA 4G9GA 4I5FA 3SIWA 1KZYC 3H4MA 5CB6A 5DHSA 4NV3A 3G17A 2OKCA 1N5MA 1YRAA 2XNKA 1FTGA 1Z7WA 4ZOCA 5B1HA 2YL2A 1NYLA 2GPAA 3I58A 3T3EA 1JR2A 1NQVA 1PZNA 2IDKA 3FPEA 3MC1A 4GGOA