4FONA

High energy remote sad structure solution of proteinase k from the 37.8 kev tellurium k edge
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
publication title Macromolecular Crystallography at High(er) Energy
rcsb
molecule tags Hydrolase
total genus 103
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 4fonA00
3H42B 1LW6E 5JXGA 1AH2A 3PRKE 3VHQA 1SIBE 3OSZA 4JP8A 2PWAA 1OT5A 3EIFA 3D43A 4OMCA 4B5LA 3BGOS 4KPGA 4H6VA 1BH6A 3GCXA 2ZRQA 1SCAA 1UBNA 3VSBA 4CFYA 3I2YX 2ST1A 3LXUX 1MEEA 3HJRA 1R6VA 2ID4A 1SUBA 4CG0A 2HPZA 1C9MA 3ZXXA 3SQOA 5FAXA 3A3PA 1GA6A 3DE2X 1SIOA 4FONA 5JXJA 2IXTA 1EA7A 3TI7A 3VTAA 1S02A 1SCBA 1YJAA 3A3OA 1Y48E 1KDVA 1GTG1 5AVJA 4WOBA 4C3VA 1XF1A 4NE7A 3GT4A 1YJCA 1C9NA 4DJ5X 1WVMA 2P4EA 3QMPA 1NLUA 1ZVKA 1GNSA 2V8BA 3GCWA 1AU9A 1SCNE 1WMFA 2Z56A 4YN3A 3DW1X 1SUEA 3AFGA 1AQNA 3I30X 1SBCA 4NMXB 1TECE 2ID8A 3A3NA 3DVSX 3CO0S 3I34X 1SUCA 3DE1X 3PTLA 1CSEE 1DUIA 2IY9A 3TECE 1CNMA 2DP4E 1TO1E 2PKCA 3TI9A 3AJ9A 1SBIA 1P7WA 1GCIA 1PFGA 3CNQS 1BE8A 3AJ8A 1ST2A 2ZWOA 3LPAA 3ZXYA 2PYZA 5B1DA 4LVOA 3VV2A 5ARDA 4WOCA 2Z2YA 1GTJ1 1OYVA 1Q5PA 5FBZA 3DYBA 1TM3E 4I0WB 2WUWE 2PQ2A 1MPTA 1TM7E 2Z2XA 1SH7A 5B1EA 2TECE 2PWBA 1P7VA 4AKTA 3DDZX 1SVNA 4GI3A 3DE3X 2HD4A 1TMGE 2WV7A 1YU6A 2SBTA 1GT91 5CW1A 4ZARA 3BX1A 1AVTA 2ZWPA 3DE6X 1AV7A 1THMA 2Z30A 5ARBA 1C9JA 3Q5GA 5K7SA 1NDUA 4C3UA 1C3LA 1Y3CE 1SIUA 1OYOA 4NE9A 2XRMA 1A2QA 3F7OA 5AQEA 3D9QX 1BE6A 2Z2ZA 3EE6A 1VSBA 1Y33E 4M1ZA 3VYVA 5I9SA 1TM1E 1V6CA 3SICE 1T1GA 2DQKA 4K8RB 1NDQA 3DWEX 1KE1A 3VV3A 3F7MA 2Z58A 3Q40A 5SICE 1SUPA 5JXHA 2SNIE 1V5IA 1SUAA 1GA1A 1Y3FE 1PTKA 3DE0X 1PJ8A 3DE5X 1BFKA 1SCJA 2QTWB 1SBTA 3DVQX 3BPSA 1Y9ZA 4OMDA 1GA4A 1Y4AE 1HT3A 1R64A 3LPCA 4LVNA 1Y4DE 1IC6A 2B6NA 2WUVA 3DE4X 1KDZA 3L1KA 1SCDA 5AMXA 3WIVA 1SUDA 2E1PA 1WSDA 1IAVA 2W2PA 5JXIA 3LPDA 1AK9A 3DVRX 4BWGA 2G4VA 2W2MA 3WQBA 1WMDA 2WWTA 3UNXA 1TM4E 4AKSA 3WIUA 1WMEA 2SICE 4HX2A 1KE2A 1P8JA 1DBIA 2W2OA 1T1EA 3I37X 3WHIA 1JEAA 3P5BA 1Y1KE 1TO2E 1ST3A 1AF4A 1T1IA 4RYDA 3QTLA 1BJRE 2PRKA 4DZTA 4H6WA 1BFUA 3EDYA 1S01A 1R0RE 2PMWB 4OV6B 2SECE 4ZOQI 4KG7A 3QFHA 3T41A 2XTJA 1Y3BE 1TK2A 1YJBA 5FFNA 4Z2AA 3DE7X 2W2QA 2W2NA 3F49S 4HVLA 1PEKE 1S2NA 1EGQA 4MZDA 2Z57A 1Y3DE 1KDYA 5ARCA 1GTL1 3DW3X 2DUJA 5JMOA 4H6XA 4CFZA 1SPBS 4KB5A 1Y34E 4DWWA 2X8JA 4J94A 3GT3A 1SELA 1SBNE 1GNVA 2GKOA 1SN7A 1ZVJA 1TM5E 2X8JB 1SBHA 5AVKA
chains in the Genus database with same CATH superfamily
1G60A 1JPNA 2H00A 2ZJ7A 3EXEB 3V7YA 4K88A 1HYGA 3I9JA 1ZY2A 1NASA 1ZMBA 4BMPB 1U8AA 2YS7A 3PHBE 4KE7A 4BNDB 4H0FA 4MMYB 5AW5A 3TFQA 3MN1A 4FFMA 4CMBA 4MB0A 4CXMA 4ONEA 5HIAA 1KEVA 4DMFA 1T6NA 4UBNA 4BO1A 5K3OA 1A96A 3WDLA 4TYWA 1STOA 1PR0A 1XYVA 5IH7A 4DTCA 1AKRA 1R9GA 1NJGA 1QB7A 3O4RA 2BGKA 1D3AA 1ULSA 2E21A 2X7HA 3EF0A 3O83A 4I50B 4GKKB 1KPIA 1T0PA 1UPBA 2FSUA 4NOMA 2QTGA 4GPIB 2QE6A 1MABA 4PYQA 2BFOA 4UTVA 4MINA 1CDEA 4G56A 1M1ZA 4IR7A 4UUAA 5ALOA 1DPFA 4BXOA 3WB2A 1NBHA 3HN7A 3L0OA 3MGBA 4LQDA 4ZCPA 3U4MA 5TC4A 2W71A 3NVKI 2R65A 4LNAA 2IOFA 1QKKA 2CXRA 5EJGA 2CK3D 5H3CA 2WHXA 3W8RA 1BX3A 5L3ZA 3LT2A 4RTJA 1V8PA 1QZUA 3NHZA 3P94A 4QXRA 3IAFA 4F7WA 5AUQA 2O19A 2RAUA 1WR8A 3L06A 1Z3CA 4ZCIA 2C2OA 2Q28A 3JYQA 4J91A 3DPSA 1VPWA 3BSWA 3SP1A 2CXPA 4JLWA 4MA0A 1FFGA 4UHEA 5FAXA 2GILA 1SY7A 4CBVA 2QJRA 4I8IA 3N0WA 2AHRA 2B21A 1A2KC 2QJTA 3HV2A 4JMPA 1KYXA 1WQ4A 1J5EB 1UBRS 2MR6A 2OBXA 4FONA 4K87A 1V37A 4M8LA 3D2AA 4GBJA 5BNFA 4CMGA 1WZCA 4FFBB 3VI4B 4QUDA 2BRUC 4AWBA 1IHDA 4TXLA 2V97A 2WP8J 3C6YA 3T5CA 2WSSA 2P0YA 1S02A 1W8DA 1ZU4A 3C3BA 3HKDB 4ZZ2A 3CLRC 3BL6A 1R0ZA 4RKQA 2QK4A 1I2ZA 5KCZA 2MSKA 1Z62A 5AXDA 3AMVA 4UPVA 3RC9A 3W2HA 3PR3A 2ZIGA 1GVHA 2BZ0A 5A3VA 1VKZA 4AJHA 3NT2A 5L4NA 1AGXA 1RKVA 2AFVA 4JC4A 5JCXA 1JWBB 4DUZB 4OHOA 4JZYA 1XLTA 2F9LA 3MELA 3KJIA 3EISA 4WXHA 2ON6A 4ZANA 4ISCA 4N40A 2YH2A 2AWNA 1VL2A 2RHDA 4OUDA 3BD8A 4X3OA 3JALB 4P84A 1OR8A 2FPGB 4HNTA 3R09A 1Z2CA 4NS1A 4ZZ3A 2Z8YM 1R50A 1VHTA 2OXEA 3D8NA 3KS9A 3QXXA 1ECJA 5D51S 5GONB 2IBTA 4W1SA 4C4YA 1WVMA 4W5QA 4NZMA 2YY6A 2QNRA 2ZJFA 4R6XA 4W63A 4M8SA 4YNBA 4M22A 5DXAA 3TQRA 3U80A 1ZVKA 4D45A 3K9HA 3SG0A 2YV1A 4TXHA 5BSEA 2ZJZA 2FQQA 1SCNE 1OX4A 1WNTA 1XRRA 1IQRA 5CFMA 3VR6D 4KQJA 5C3MA 3I1FA 3QU2A 5K3SA 1FSFA 4ROTA 4BOYA 4EHLA 3DMRA 1Z06A 3GNLA 1CY8A 2XNJA 3DEHA 3LO5A 4NMMA 4ARSA 5AP9A 4DT1B 3QSGA 4MH0R 1MVOA 4R2IA 3KV1A 3PXXA 4W6ZA 2QROA 2P2YA 1PT5A 1CG6A 1KS2A 2ZXFA 1JEQB 2WMNB 4G0UA 1E1QD 3B2EA 4X8HA 4O2AF 2H31A 1GL9B 3Q9LA 3WB1A 4A6DA 4F21A 4MNTA 4MWOA 5EP3A 4ZV9A 3NM4A 3DO6A 4H2DA 4Y0VA 3TI9A 2Q6TA 3R3SA 4BECA 4TV8F 1RC0A 4F2HA 2JCGA 4ZJYA 1T1JA 3L93A 1GY8A 4B7XA 2GXQA 5F4BA 3DFFA 4HL6A 3CBQA 3N1UA 1OYWA 5CRIA 1VM6A 1KP9A 3H1PA 3ERCA 3C3WA 3C3AA 3C6QA 5DGHA 4IFIA 2K6GA 1I8TA 2Q1TA 4WECA 5A02A 4N0MA 3Q7QA 4IH1A 4PHHA 3HU3A 3ABQB 4LZNA 3TB4A 1ZWKA 3HXKA 4ODIA 1Y3HA 4LMPA 1VA4A 1B8VA 2EKPA 2RGNA 2V74B 2TMDA 3LDFA 4UUBA 4C07A 2WHQA 5KNDD 1U02A 1JBQA 1YZUA 2XMQA 3PHIA 3JRXA 3K5PA 4AO8A 2HUPA 1L3IA 3M33A 1W4BA 2XZLA 4ZOAA 3RIHA 2AK2A 3DEZA 2NV2B 3OOSA 3S7TA 2WU1A 3ZI4A 3RVPA 2VDWB 4XVHA 2BEUA 3BICA 4X7PA 3CVJA 3I28A 4DJAA 5H4HA 1WCWA 2Q9UA 3TUZC 1J0EA 3LBYA 2XQGA 1X3LA 2WKRA 1V8BA 3ZDZB 3G6KA 1U3FA 3M6FA 1EK5A 1VI5A 2W4MA 4JK3A 4L22A 4XM2A 4BVJA 2EWWA 4LYJA 1UANA 4M6WA 2OC9A 2W37A 3T7JA 4L5BA 3DNPA 3GC6A 3U39A 1WULS 4LC1A 4WW0A 3H2SA 3UYLA 5AUNB 2WLTA 3JR3A 1CJCA 3EVBA 3AESB 3MLEA 5F12A 1JEYB 4E5YA 1QP0A 3KOXA 4XPIA 1G9TA 3AILA 4WZAB 1QVAA 3Q5EA 4QDOA 3NBYC 3H0KA 3HRKA 1FQJA 4QAJA 5D6NA 3NHRA 2W6ZA 1M74A 3PXAA 5JNRA 4KAAA 5CDTA 3HBFA 3LGSA 4HVTA 4OQZA 1HE1C 3KAPA 1SOAA 3QXSA 1PLKA 1RC1A 1X1CA 5JS2A 4UOEA 1MGOA 3AGQA 1OZGA 5C9ZA 2WKWA 4MUFA 4U5QA 3FM9A 5AHRA 4ZARA 2JIRA 5EVCA 5L45A 3TEMA 3BJRA 2YFHA 5K0ZA 3MVEA 4RY0A 3LZDA 3L7AA 4LK2A 5JZSA 1E9SA 3RUCA 4XJSA 4CN9A 3KTAB 1TO6A 4ZZIA 1B8OA 4LXYA 4C2UA 2DT5A 1L3BA 3BMQB 4DIDA 1Y81A 3OU2A 1WA5A 1SZCA 2EF0A 2HHJA 4CKCA 4D3XA 3C3YA 4NABA 3QXCA 3MLBA 3QOFA 4DBZA 2TSYB 1MX5A 4IZIA 1MQAA 5AXBA 2NZXA 1PTJC 4BNHA 3N87A 3ZWQA 1WP9A 5DN6A 4ARZB 5BR4A 4HXYA 2C42A 5EXEA 1BDJA 1FFEA 2CHFA 4OHRA 4QUAA 1GYQA 4G5FA 2I76A 4TTIA 1CNEA 2QQEA 1N3IA 1RVV1 4GM0A 1X0VA 3ZVRA 3EBPA 1PVVA 1M10A 1MH9A 3NLLA 3B8HA 4O8CA 2WK1A 1GG2A 4IEEA 4KFSA 3ICOA 3AHCA 4Q0MA 3VU9B 3N28A 4C7MA 4EKGA 3NMUF 3L0PA 4A03A 1XRPA 4RY8A 3CEHA 4E33A 2OKCA 4PTZA 3SVZA 1FDVA 1N0HA 2RC6A 4CQLB 2QW1A 3BQNB 2CVOA 3CONA 2X77A 3L3BA 1MW8X 2JCBA 5TS3A 3DWGA 3E8XA 3FXAA 3DBIA 4K9SA 3R75A 4C4OA 3TLGA 1TM1E 1JXOA 3CB2A 3K5IA 2QP9X 1V9LA 3K2BA 1MPXA 2IU4A 2GD2A 3H2YA 4TUYB 3RSSA 3ZOZA 4L76A 1NW3A 1PT7A 2P0EA 1CQJB 2NXEA 3C70A 5AI4A 1N25A 1P4HA 4K1LA 3UOWA 3VZPA 2HOQA 5P21A 2O8FB 2O59A 3ZHSA 3U3RA 1FJHA 3G0BA 1LNQA 3Q40A 4LHSA 3ADDA 2GUWA 3OEEA 1QFSA 4AY3A 2JKVA 1E5VA 2EGHA 3I9MA 1ZJ6A 5EESA 4GC9A 3T5MA 3NKVA 4KR0A 2HDOA 3DPUA 4NOKA 3TDMA 2WVAA 3IVCA 1MR3F 3LVFO 2OSVA 3V8EA 4A10A 2B3DA 1SBTA 1R4MA 4RCYA 1CV2A 1D09A 2WZQA 3OCWA 4L3OA 5EC8A 2Q7XA 3ST7A 4RHEA 3ZK8A 1W93A 3K73O 4ZJPA 4UQLA 1ZEJA 3ITDA 1ZN8A 1RXIA 2I55A 1WUHS 5DEOA 5TF0A 5JD6A 4DIFA 4FGWA 1L5ZA 3O21A 3P9XA 3VR1A 2NUBA 3V4LA 4EIWA 1Y4AE 1JH8A 1M1YE 1VMAA 1ZA2A 3O5AA 4H18A 3ESRA 1KZ9A 3TVDA 3LPCA 1Y5MA 3EDRA 4LVNA 2HQOA 3UXYA 1L4MA 1CR0A 4FKMA 3OIDA 3I2JA 3EFHA 3LUCA 4R84A 4ZVKA 3QA3E 4XH9B 3TW6A 4BPRA 1HDGO 4DJFC 1SXQA 4C03A 1T4GA 1QGYA 1NF8A 1ZN2A 3KB2A 4LRWA 3BREA 3LZ6A 1KOFA 3SE0A 2HQRA 2OHHA 2VC2B 3CRW1 3K1ZA 5DN9A 3OZSA 3JVEA 1ODKA 1SEPA 2PA3A 3M6XA 2QN6A 3DA8A 2P3LA 3T9FA 2YWHA 3WLFA 2XCSB 2GBPA 3SC6A 1D1PA 3AP2A 3CRRA 2JNWA 2SKCA 2I65A 3D7KA 4IUYA 2Z2IA 4QBGB 2ACKA 1ZMTA 2PGXA 4RPJA 4ZOBA 3O8RA 5HK9A 2ZBUA 1N1EA 4H4EA 3TB6A 1AUOA 1CQIB 4PZPA 4R7ZA 1SK8A 3L84A 4O8ZA 4MUMA 4EW6A 5H3LA 1DQNA 1SXJC 1R0BA 5IBCA 1U7TA 4NQZA 1UAGA 2WM9B 4NZOA 1Z0AA 3QKIA 3C6MA 2A0WA 2NP7A 4TX1A 4P81A 1U8EA 3BBPA 2HLPA 3BEDA 4UTXA 1E6KA 3T3NA 4XLZA 1G6KA 3RASA 1OJ7A 4OAOA 2ZRPA 5HF9A 3KLOA 4QRIA 4KUEA 1EVEA 1DFIA 4S1TA 3HEMA 3GARA 5KYYA 2W9XA 4BFVA 2G8LA 4GM4A 5IKXA 3OQOA 1AKTA 3K1TA 1GPMA 3AVWA 2YJZA 2X14A 3U7GA 2ZSEA 2PZFA 4AMZA 4GGMX 3BIJA 4YIHA 1CUBA 3TM4A 1L5KA 3IP7A 2RGRA 4Y18A 2EATA 1T1EA 3H5WA 2O07A 4MWCA 5JAIA 3C97A 3IDFA 2HI0A 1W0JD 4KPYA 5LZ2A 2XYVA 3RWBA 4AJPA 5FUYA 1TLLA 5ALIA 1RXSA 4MW5A 1HRKA 3F6CA 4MVJF 4RETA 2BGGA 1P77A 1JDUA 4NKRA 5DRYA 1C1HA 3UUWA 1S8NA 2QG9A 3KBBA 3LBFA 4KLRA 4ARIA 1XYGA 2ZPUA 1PNQA 1S8AA 2ZYGA 2C83A 4X60A 4LRTB 1CUWA 1PJCA 4HFRA 3D6FA 4AKEA 1G5HA 4FIDA 2GEUA 3VC3A 1U7HA 5IAAA 4C3ZA 3PWSA 1LNZA 3Q3CA 3BQMB 4NK5A 1TT7A 1ENYA 4MX8A 2E3JA 5AM1A 1D2EA 1KEWA 1KI2A 2PANA 2RHHA 2VZLA 3HL0A 4MUKA 4C0KA 1L4LA 3RFCA 5BV2P 2YC4C 1A7AA 4PIVA 2ZE8A 4XWOA 1ZVVA 1T8RA 1JALA 4TPKA 1DAFA 5TMDA 3ZWDA 1WD5A 2PMWB 1SKMA 2FW0A 3IAS6 3B6MA 3ESXA 4EY8A 3SBOA 5DNCA 3R0JA 4LYGA 5JJLA 1G4HA 1Z5OA 3KR9A 3H11B 2A1TS 3GH3A 2WYUA 1V4BA 2B2CA 4FP9A 4CM7A 4AMYA 1WB6A 2P6OA 3JQRA 4BMSA 4F56A 4WJLA 4CZ2A 1U0BB 5LWHA 3S1AA 4RKYA 3L8FA 4UNPA 4B40A 4BJ5A 3WKDA 5JT1A 3NDJA 2C07A 3R8FA 2CJWB 1BDBA 5AKZA 4UM7A 2AH5A 2AL7A 4QU5A 1Z3IX 2WTEA 4KWHA 4IMRA 1R4NA 4G0MA 2C4WA 2ECOA 3MT7A 4BNIA 2DWCA 1NF2A 2O0JA 3ZVMA 2O8DB 4QGSA 5FFNA 3ZLJA 1DIBA 4IIHA 2RAVA 3A9TA 2YDXA 2GO1A 3HSKA 4E2XA 4IAOA 5KOHA 1CW2B 3GGPA 1G42A 1TEHA 2XADA 3PJDA 4BTLA 4ZZ1A 3AM1A 3FOAA 4AM8A 2JIZD 2Y2UA 3JASB 2ZJYA 3UMCA 1OI2A 1W4RA 4B87A 5BVGA 4JSYA 3EAGA 1H0RA 3PEUA 5T8KA 5DK6A 3T4EA 1T0IA 3ESQA 4Z5XA 1CR6A 2VJMA 1KVRA 4QTZA 3KZOA 2FR8C 2CYCA 4DS3A 5E4FA 4KO8A 3U60B 4OB6A 1COWA 1V11A 1VGVA 1PFYA 1XJQA 5HFNA 3VUEA 3KJNA 3R0IA 3EUAA 4M99A 1T3GA 2R6ZA 4BVKA 4WD3A 2A30A 4D96A 1URPA 2C0QA 1JIIA 4H6XA 2GA8A 1NXQA 3ZWOA 3IP6A 1U0EA 5HUHA 4REQA 4JI5B 1X2BA 3I42A 3FDJA 3EPPA 2VZ9A 1U2DC 3MRVA 4RESA 4C21A 4NXNB 3FX2A 3H1EA 1IOZA 1SELA 3GT3A 3IUYA 4K2HA 2CJPA 3I9V1 1M6HA 1PAUA 1YZVA 1U3TA 3K8OE 3L8CA 4Z86A 4R51A 1H22A 4CMJA 1TM5E 4O2AB 3WNQA 1A1SA 3RARA 4DSAA 2X6TA 3H05A 3WGQA 4PX2A 1Q7BA 2VS1A 3UFBA 3WHPA 2OO5A 3A58B 4TV8B 3H42B 4CDRA 5FL3A 3SKVA 1WWKA 3G9UA 1R5NA 2X5KO 3NHMA 4KW7A 1IXKA 3FY4A 4RL4A 2IOQA 4B75A 5C8ZA 5FUMA 4A1FA 4D0SA 5LLTA 1N8SA 3C7DB 5BT9A 1GQOA 3UGTA 2PWAA 2V6MA 5SZHB 5GINE 4IJKA 3O1JC 4OMCA 2CNKA 3TXYA 3QMMA 3R7BA 4CM4A 3N0RA 5E6RA 3QEMA 4IJ5A 2ZVJA 1ZP6A 1ESDA 4P2BA 4HN2A 1P31A 2ZIFA 1DJLA 1TA4A 2GEJA 3E3MA 3N59A 1XQYA 4J6EA 1G5QA 4JVNA 3D2LA 3AHDA 3JZIA 1K92A 1EX9A 3I5MA 4MP8A 3RTCA 3T95A 4NCBA 1LK7A 1GPWB 2QVLA 3CUWA 3V1TC 4D4IA 1ZVQA 1K7FB 1PK7A 2ZIEA 4CFYA 4EH1A 2V1UA 2OZPA 4ZCRA 1TTQB 5F76A 1GUDA 4HLUC 4DDKA 3G2JA 4DA7A 4V0QA 4R41A 1N9KA 1PN3A 2H4XA 1MEEA 3B2QA 1JAIA 5AXCA 1DJOA 1ETHA 5MHTA 4R2KA 1O54A 5A5DA 3OFND 2F55A 4S05A 2PTGA 4F8JA 1F4LA 1KZYC 3EQ8A 4QGAA 5BRNA 2RAPA 2JGDA 2QD2A 3B1JA 3ZGZA 4GXTA 1TD1A 5BYBA 3QXJA 4UZEA 1EFUA 5D3MA 2LZ0A 4E5UA 1UMDB 5DWVA 3BXOA 3B48A 2F4VB 2J3HA 1QPZA 3LO8A 1ZK2A 2R6FA 3T1VA 2WM3A 4QOEA 1I10A 1QXSA 4CKWB 1G8SA 1D7AA 3IEXA 2RONA 1IEQA 1N1MA 2QLLA 3KRTA 2XDYA 5B4UA 3FSEA 2QOEA 4OATA 5LZ9A 4TRRA 3DDOA 1C0PA 2XJ9A 1YQEA 4WADA 2P9QA 5JFTA 3AKEA 2YNMA 1Z36A 3F5DA 4FE4A 3GBSA 3HKBA 1J07A 2HAEA 4MGKR 1OBCA 2J5RA 2PD6A 2QTNA 3O6VA 3TK1A 3IT2A 4RD4A 1EH5A 4D6XA 2XUQA 4FN4A 5ERGB 4JHLA 4DB2A 3GZJA 1BU8A 4ENSA 3OWXA 2J08A 3UHFA 3LXMA 4DLNA 3PEYA 3VJLA 3Q5DA 1FFAA 1XU7A 3A6KA 4ZMBA 3ZW7A 5LZ5A 2HMVA 4LWQA 4CU2A 5FI1B 2A1IA 4YRSA 3JZMA 4RIIA 2CJYA 3BSSA 2WU0A 4MYHA 4DHEA 1LVUA 4MDHA 4NEGA 1QDLB 3CGGA 4TLAA 1UT5A 2F00A 2HLDA 4GBED 4TWAA 4UHCA 4XYGA 4KAJA 4RYLA 4QWWA 1GLGA 2EKDA 2Z8ZA 2J3MA 2PZJA 3GUHA 3V1KA 1ULBA 4RA6A 3T52A 4CF5A 1SR8A 3ND7A 2FFQA 3PFGA 1ZCZA 4OUDB 2XAAA 1MQSA 1GUBA 3NQ41 3B1XA 4G1CA 5JZBA 1AE1A 4BB5A 3KX2A 1WCYA 3K70D 4NBKA 5EI5A 1TPZA 3LU1A 3DS8A 5ILGA 4D6YA 2GLXA 2XWPA 2W6JD 3USZA 1JLLA 2FH5B 4CDNA 5H8WA 2LV8A 4RTMA 3TLAA 1C7EA 3CO0S 1OX4B 1K6EA 2IHZA 3M4ZA 5C7IO 3OIYA 2QF7A 1Q2XA 4JVOA 4X1OA 4ZVVA 2JJ1A 8OHMA 3U9LA 3STYA 1FUYB 4OXNA 3L0IB 3VKWA 5LNK1 2ZPTX 1TADA 2OK7A 3WK9A 2XBUA 3CRZA 5IJAA 4CM6A 4RKWA 2G08A 3TECE 1YQGA 4OU5A 4WLEA 1EHCA 3FFWA 3A10A 4TV9A 3GIWA 3WMGA 2WZDA 2Z1MA 2IIPA 5B37A 3IXMA 1LH0A 4DG5A 1Z83A 3RSGA 4FNOA 4YP7A 4FGJA 5A4KA 1R9MA 1AHPA 1RRGA 2ZZMA 2R1VA 2PLRA 1I24A 3LUHA 1JWLA 2ZRFA 1IQPA 2VCEA 5KOJA 1MO5A 1SC4A 4J4TA 1K7CA 3IBTA 3KZ1E 4UPEA 3HDTA 2ZI6A 3GLIE 4IKOA 3NS7A 3CNQS 3IKJA 2GASA 3JQ9A 2NTNA 1SU8A 4GUAA 2XE4A 1UZLA 4MI9A 4X95A 4DL9A 2JLUA 1XGKA 4PLGA 3GJZA 3IE2A 3Q7PA 1R0WA 4N18A 4O2BA 2C5HA 2VPQA 3D7RA 2QN3A 4JBIA 3C3MA 2ONZA 4JELA 4QGGA 1TFRA 3G2MA 3LPAA 4AUMA 3IEUA 4R98A 4FILA 2MINA 4QEDA 1DFHA 3H5IA 2BEWA 3PBKA 1HBJA 4Y1FA 4KXLA 1BS2A 1QFXA 1WTCA 3LECA 5EXDA 5ARDA 5G1OA 2YJNA 5HJ7A 4RVUA 4L8FA 3F98A 1JLMA 1JDBC 1RWQA 3GEMA 4BNJA 4UNIA 3SX0A 1NA5A 2IYFA 1IB6A 4BZXA 2XUAA 4RSRA 2XTZA 4UUQA 4AX8A 1N2XA 1N5DA 3UA3A 4Z4HA 1OYVA 2JI4A 4JYBA 4TS1A 1N77A 2YXDA 3DMTC 2BEUB 4BNMA 4LY0A 4JY7A 2F6RA 1OXKB 1JDNA 2EP8A 4PAMA 1B8NA 2O6LA 4UATA 5B4TA 1Q57A 1OUMA 2VDQB 2ZUVA 3EBLA 4TZTA 3ZY6A 4CG2A 4G89A 3ZHBA 3IJPA 4LYAA 1V7PC 2G88A 2I33A 3NXKA 3SS7X 2GZRA 4V3BA 3RVJA 3AHHA 1FFYA 4ZRMA 2CBZA 3I73A 4I81A 1DPGA 3F4BA 1G291 1ZONA 2FK8A 5E9JA 1UEIA 5FT9A 2Z08A 2EFJA 5C81A 3RO7A 1IBMB 4PC7A 1A8PA 4BDSA 4IIYA 2O7RA 4XPIB 5AKIA 3U3MA 4HUQA 3NBXX 3OFVA 1TYDE 3W8DA 2QTVA 1VG0B 3GLHA 1TAQA 1UADA 2QSJA 3OLXA 4RNCA 3SQXA 5ALWA 4RHUA 1JXQA 1OFHA 2PE5A 1INLA 1JXMA 3JQ8A 4WFKA 3SPXA 1FDUA 1SOMA 1XCJA 1U99A 1CCWA 3IULA 4KQKA 1ZIXA 1NP7A 3L8MA 2PUCA 1YZYA 3TVYA 3HH8A 1RDFA 3HDJA 3QWHA 1ML4A 4ZCLA 3ZGNA 5LIRA 2FW6A 4RV5A 1CS0A 2IPNA 1TAHA 5JZVA 1TUGA 3IOEA 3ADCA 4XB1A 4JASB 3K1YA 1O94A 4D46A 1CJTC 3KEFA 4CKCB 4MR9A 1NOJA 3FSGD 1XL1A 3S55A 1Z07A 1E2KA 5CDYA 1IJFA 1LSJA 1Q1AA 3FZGA 2ZVDA 3ROXA 4F1WA 3FPJA 2Y1CA 4M0PA 1GV1A 2I8CA 3C98A 3L5OA 5JDIA 4AKGA 5E7IA 4B6EA 3X44A 2WG2A 4OPMA 3USCS 3G0HA 5E6UA 5IDQA 3U4HA 4ZO8A 3G9TA 3FBWA 4J0HA 4X3PA 3RPEA 3RYHA 2XQVA 3SDZA 1BZYA 4LYFA 4O2RA 1XTJA 4J0EA 4N5LA 1TJPB 3DAGA 4XIIA 2BGTA 3MUEA 4CM5A 1U4NA 4IWNA 5E3JA 2IPMA 1VE7A 1VZ2A 3ZGLA 3GLGA 2PDAA 2PJZA 1SZPA 4KUHA 1LF0A 5KQMA 4Z7JA 5FPTA 4OA5A 2C2HA 1KWGA 3DOOA 1E9VA 1TF5A 3WZMA 4RTLA 1EM6A 1P1KA 1ORWA 1JHXA 4YA6A 1GZVA 3SICE 3O90A 4E0BA 4M83A 2WIFA 3C6BA 1PW7A 3DSRA 4EGSA 1JE0A 4MUHA 2OOSA 4R8RA 2WP0A 3G88A 3TLGB 2QWXA 3OEHA 2WYWA 3T4UA 1YI0A 3V7NA 4HNRA 5C7YA 3ZWKA 3F1KA 3A6LA 3HPQA 3GLFA 1XMIA 1SUPA 2JAHA 1N2EA 2BE9A 2QG6A 3QUTA 1NW9B 4HWGA 3DTYA 3WLJA 5FWXB 1OILA 3EPKA 1M2GA 3CLTD 3HJHA 4ZJZA 2HU2A 2R84A 3IHLA 2F8TA 1E98A 1DT3A 1PTKA 3KU4A 5AKYA 2OHVA 1UBHS 2ZCJA 2IH2A 3ROEA 2HF9A 2Q4BA 3R3ZA 2XW6A 3U0VA 3MCZA 2P91A 3ZWXA 2VPTA 4B3HA 5LIPA 3NKFA 1HR0B 1FLVA 3OZBA 2X4IA 4HNAA 5ENZA 5IJ0A 4Y2RA 3M34A 4BB9A 1NG9A 1R4MB 3BWXA 3PSAA 2P9JA 3ZY4A 4YT4A 4K6KA 2P7IA 4IBOA 3REFA 4O2BF 3V42A 2HJSA 4PZZA 4TSFA 4TQAA 3I58A 5EIHA 3WK8A 2AX3A 1V7CA 3BE5A 1CY7A 3I64A 4GBGA 2XB9A 4HH4A 4BDTA 1ZQ9A 2YV5A 4ZI7A 2H7YA 4BV2A 3FDXA 3MUOA 3DDWA 1ADGA 5A7FA 3N75A 3ZWMA 3QY0A 2AW5A 3IAM1 3EY4A 3UMGA 1IY1A 1QKJA 2GN2A 1PEYA 4E03A 1IMOA 3W9YA 3KZXA 3X1WA 4EPRA 3DOEA 2ZLBA 2IGBA 4N0EA 3UKJA 5FWNA 1PL0A 1G5TA 2V3WA 4LMRA 4RSGA 3AB7A 4S0ZA 3FI0A 1GPJA 3QZUA 3LPDA 4S1NA 3WA6A 4HTAA 3N8DA 3EVEA 4NZ9A 3BGWA 1X38A 2P1ZA 3AIMA 3HHEA 3R44A 4UXIA 5G40A 4DANA 4E4YA 1O95C 3S44A 3AFOA 5JBNA 3R7WB 1XZJA 4MRPA 2QUHA 2FR1A 1K7XB 4I36A 4ARUA 6GPBA 1GTZA 3MUNA 1OWLA 1NQUA 3IQHX 3KTFA 4Z7QB 1B73A 5EJ6A 1NY6A 1PSWA 1XRJA 3ROGA 1ZR4A 2CUNA 2H2AA 4AKSA 4E2WA 3GLSA 1KVQA 1MW9X 4RDXA 4BMYA 2JZCA 4E46A 2R1ZA 3AV3A 3COYA 2VWHA 3H6HA 1NVKA 4BMOB 2Z1DA 3FTFA 4JLVA 1Q12A 4CHGA 2GK7A 5KYYB 5B7GA 2EFDB 3T5BA 5F3DA 3I37X 2H2DA 5CBPA 1DJNA 1PNTA 1QE0A 2RHMA 2PHZA 4QFDA 5J9FA 1Y1KE 5FI0B 5FKJA 4NK4A 1KOGA 4FBLA 5IMBA 4IDBA 2VNIA 3OZUA 4WGGA 4KGXA 4ACBA 4YMTA 2VSQA 3L1UA 2R62A 2OWDA 2NSYA 2RD2A 2IELA 5D3QA 3LQRA 3T9CA 1I2DA 5ERYA 4EHKA 5KZMB 1IZYA 1Y5RA 4L9SA 2FK7A 3CUYA 3V80A 3LNCA 2YINC 1Y6QA 3IIIA 4O4JF 3VFDA 1RRCA 2ZJ8A 4NNPA 4B34A 2ODAA 2QLBA 5BMVF 1H94A 3SYNA 4AECA 1KEEA 5FFMA 1K06A 2QM0A 1W19A 2I71A 2VF4X 2ZROA 2SKDA 1J09A 3BG5A 4U63A 1X7DA 2VHTA 5DN6D 3EIXA 5I9LA 1RI5A 3WNDA 3QHQA 3IR6A 4CEIB 3HCEA 3AI7A 4JDUA 5AO9A 1R2QA 2VYCA 4G09A 4PZCA 4YV0A 2VP0A 4CUJA 4QICA 4GLOA 3CFYA 3EHEA 4N5IX 2XCIA 4DA4A 3FPSA 1OZFA 3A3KA 2JAQA 4G5GA 2IPAB 1MAAA 3KB1A 5DULA 4D26A 1OIXA 4MULA 5DHQA 2WM2A 2GJKA 3QPWA 1LS6A 3B6IA 3ONVA 3NX4A 2EFHB 1Z6TA 2Q99A 3IV6A 4IGFA 4RE6A 3S1AB 2OFFA 2C03A 2IUSA 2PX5A 1NWCA 5FDFA 1EU1A 4JBYA 2Y05A 3UCXA 2D2EA 2IEAA 1ABFA 4HZIA 1U5AA 2NTEA 4H1UA 4NDAA 4HDCA 5CAEA 1GR1A 2ZM6B 1NZFA 3DOIA 4ZQGA 1R4NB 3OIVA 1KRXA 1JR3A 3KSBC 4IGKA 2FEPA 2GCOA 2J31A 4G1EB 1TTPB 1J8DA 2IS2A 5KOHB 3ICEA 4M1OA 1YJ8A 4CTKA 4FZJA 1CVIA 1P2SA 3CEMA 3E82A 3ZWWA 3TEFA 4YDQA 2JGNA 4LN1A 4MZDA 1XMOB 1F0NA 3OEED 1RI1A 1XK7A 3QBDA 3I39X 3VPDA 5DTQA 4D5GA 4JAVC 2IC5A 5BVGB 1ND5A 1SA0B 1YKFA 3U7QA 3RBXA 4I4NA 5ERXA 1QORA 2C7RA 1OF1A 2DCMA 2VJMB 3LDGA 4OL9A 3TE6A 5IHXA 2IYLD 4BQOA 2QM8A 3V1UA 4KOAA 1EBBA 3ZHXA 1V11B 4C78A 1V7ZA 2PGJA 2VP4A 4HWPA 3BM5A 3IVMA 3DUFB 2F3TA 4ILKA 5SV2A 3GPDG 4ON9A 5LLSA 4BN0A 3S81A 3T5PA 1ZD9A 2C5FA 3CPJB 1DKLA 2YDYA 1WBDA 2X8JA 1YCHA 1BHJA 2ZQYA 4YCMA 1H9AA 3DVAA 4F12A 3A4IA 1HK7A 4P2GA 4REQB 4AMGA 4GPTA 4PEVA 3QBEA 3HVIA 3IPCA 1GAJA 1JQEA 2G25A 4HFNA 4W1RA 5DHSA 4F3YA 1KI8A 2IYXA 3EZ7A 1XKXA 3W7BA 1PGOA 5E3IA 4ZMSA 3BS4A 4HGRA 4GYJA 3CNNA 1NQAO 1C3XA 1A9ZA 1T3TA 3G2IA 2EU8A 1BRTA 3ORSA 2ORWA 1QCCA 3IURA 1QTNA 4J75A 4WAUA 4JLUA 4AYWA 4BAZA 4YJKA 3SIXA 4G9EA 1M33A 1QWOA 1M66A 2VSXA 4FQ7A 4TWJA 1CRQA 3UQZA 3VHQA 4EI9A 1YACA 3KKOA 1XZMA 4R9VA 1KMQA 3EG5A 1AXGA 5DLDA 2VWPA 5KEIA 5GMOA 3HLYA 3ZVNA 1GSAA 2R5NA 4B5LA 4J4BA 2A0UA 1C30A 4D3SA 4NZPA 4KPGA 2GHIA 4UTNA 5JPCA 1JA1A 5KPJA 4MVJG 2OCBA 1KJQA 1T3ZA 1VCHA 2Y1GA 5K0EA 1Q0TA 1Q0RA 1SG9A 3IOBA 1E7YA 4NL4H 4CM4B 5E6RB 2MHCA 3QEMB 1S2MA 4D74A 4D81A 3EQ6A 1JR4A 5GGXA 4V3CA 2R7AA 2OQVA 5J5VA 3K3PA 1ENPA 4M0EA 5D3ZA 2ZT8A 3WGVA 1F7UA 4EL0A 4JUAA 5B3KA 5LMUB 3PF9A 4FGKA 1ZXBA 1K6IA 1SMKA 3C3KA 3I05A 4JC5A 1KDTA 1H5UA 3DZJA 2D59A 1WO8A 4V2IA 4IVRA 3PNOA 4IVPA 1B41A 4MPPA 3AM5A 3DLTA 1VLJA 1QIHA 1U3GA 4CG0A 3UK2A 2FJUA 2AS0A 1SKBA 1UJBA 3URKA 1E9BA 1DADA 4MIYA 5AK4A 4QHSA 3GQVA 3SLRA 2IYVA 4HDAA 1SBZA 3E1SA 1EFLA 4TYMA 2R96A 4XDGA 1VYHA 4FZ3A 4BVLA 2JGDB 2A7XA 3EVTA 4EDHA 2PMKA 1USWA 2IE0A 4ZCMA 2XUDA 1T6ZA 3GYBA 2ZTVA 5D3MB 4X62B 5SY4A 4Y2PA 3T5TA 3GD7A 3V1YA 3CVXA 4LK3A 4DM7A 2OC4A 1ZM4A 1FVHA 3Q7EA 1U2RA 4FFSA 1R6TA 2IXTA 4N5DA 2JIOA 3LX5A 2ZSKA 2VWQA 3CUUA 2E5FA 1EA7A 2LDBA 1ZH4A 1Z2DA 2CXTA 1X1EA 3LZCA 3N7UA 4HAIA 4ND1A 4WZZA 4ARAA 5DTIA 3WL3A 5J1SB 4YAEA 5K1ZA 4NMLA 4IQFA 1WSBA 4R6WA 1TCBA 1KMIY 2RGGA 4IF4A 4BQQA 1MORA 5JNSA 2UUBB 3JWPA 4EAQA 1XU9A 2HNAA 3HKBB 4JEIA 3ZU2A 3NBMA 2BBSA 5BQ3A 3OQVA 4Z4FA 5JBQA 1MAVA 3VSEA 3EWIA 3EDMA 2FMHA 4TLLB 1LS1A 2CXNA 4L3WA 1MKYA 1NVBA 1YA8A 3AF2A 4FKZA 3IPXA 5K0JA 4LAFA 2KBEA 3W5CA 4ZOLF 5EXSA 1JHZA 2L0XA 3DKKA 2NADA 2R7MA 2QUZA 2X7JA 2O2EA 3RSOA 8ATCA 1I4WA 4F5YA 5BWMA 2FZEA 1Q14A 1ZGCA 4R83A 3SNKA 4O08A 4ENQA 5K09A 4INPA 3QLUC 2FLVA 4YO7A 4Y2VA 3U7RA 5CEFA 4RA6B 1QF7A 3A9VA 4HNSA 3QVXA 1L5MA 4PWZA 1F9AA 4JUIA 2Z56A 3ELYA 4XQ9A 3TNJA 5K4GA 3HUDA 2PV0A 1MC5A 2Q8QA 4RDHA 3WLTA 1YJXA 3F6RA 2ONCA 1DBSA 4HO1X 3ZZUA 4EW1A 2E85A 3U19A 1PZMA 1S2OA 1HYBA 1I1NA 4EHHA 5CA0F 4ZO9A 4PNEA 1JLLB 5JAHA 3MZ0A 1EXNA 4J6FA 2HHHB 1CVRA 1F9EA 2AJCA 5C34B 2JFNA 3ZZNA 4CR7A 4KXUA 5IDXA 4R71A 1G3UA 1AM4D 1COWD 2HADA 2ZP1A 4HRAA 3A6JA 4Q1VA 5L51A 1YFLA 2FN3A 2R6CA 2PR7A 3G49A 3KEMA 4TMWA 3FYTA 1ATIA 4K40A 3PG5A 2C0PA 1JIUA 1UUFA 1Z6GA 2AUNA 4B83A 2MMGA 3AUKA 3ZJ4A 1TVEA 2QYTA 1LDNA 4PN3A 2QL7A 1L7EA 3KVRA 4TV9B 3A9CA 1SBIA 5BN1A 1UOPA 4NULA 1LJLA 3EVNA 4I1VA 4C1BA 4DR1B 2L82A 4IGIA 1PFGA 4EABA 1KORA 4NV0A 3A1DA 5IKMA 3GZNA 4LXQA 2R1VB 5J2UA 5DBEX 1JQ3A 2FFRA 5KOJB 3IB6A 1DCKA 1P73A 4Z99A 1VP9A 1Q16A 3VDNB 1JAHA 2ZWOA 4GOKA 4ARCA 2DE0X 4PRZA 3DAYA 3VUFA 3JX9A 2ZZNA 3DZDA 4O2BB 1I6MA 2Q5OA 1J9GA 1JIQA 1IL0A 3ZCXA 4FYYA 2XCLA 1QQ5A 3ELBA 2ZIXA 3GT0A 3K53A 3R6TA 1KFCB 3GP3A 3B5IA 3FNIA 2MINB 4OAQA 3IR7A 5HMLA 2BEWB 2HCBA 4LC9A 5E1DA 4TL9A 4ZA2A 1OZHA 2X2OA 3SHTA 4KFUA 1E2FA 3QWFA 1DL5A 1FU4A 4PZ9A 3UEOA 3TQTA 3HXQA 4Q9HA 3QG1A 1HV8A 2VT7A 3HA5A 5HFAA 3FKSA 3RUHA 3EWSA 4JJ8A 1KQ3A 2GYVA 3IXQA 1VSTA 1BVUA 1GRQA 1Q1BA 1SH7A 5CEJA 3HKCA 4C3OB 5AVXA 2PWBA 2V54A 1FTWA 1D7OA 5BQ5A 2W6CX 3DDZX 4PW0A 1BE1A 1BN7A 1E5XA 1R1DA 2CCGA 3QX7A 3NAGA 1EUCA 2JI7A 1LTHR 1MFZA 3B70A 4IV0A 4L75A 1LQUA 2JH9A 3OOHA 2NXNA 1TMGE 3TZBA 3ROMA 4HZGA 3NUZA 1E63A 1YU6A 4G4GA 1Z5ZA 4QPZA 4XTCS 3SEAA 3WLSA 1RMYA 3FYSA 2E5WA 2Q0QA 4LTDA 3T9EA 2JASA 2DC1A 4Y1EA 3BD6A 5CW1A 4EY4A 3K0SA 1B0UA 1NPYA 2VSOA 3AV0B 3DOUA 3G5UA 1DEKA 3K0FA 1XEWX 3LOUA 4HUQB 5JWOA 3TUIC 3P2YA 2H8KA 3D4OA 1U1DA 3LI2A 4J16A 2A3RA 1ITZA 2AZMA 2QTVB 3GLHB 4IEFB 4C88A 5MDHA 1T5TA 3NC0C 3AB3A 3N70A 3AIIA 1C2TA 3WKEA 1XTBA 2RBGA 1M2WA 2JAXA 2HU8A 3TLBA 5JCJD 5K8CA 3MAJA 2DYKA 4CUKA 4ID9A 3SJ7A 2HJWA 4EWLA 4OL0A 3M89A 3QM1A 1U1IA 2YNMD 4ZAXA 4GKBA 3EHDA 3VR6H 4IDAA 1VHQA 2D1SA 3QP9A 3H0CA 3PJGA 1Z6AA 1CS0B 4KQ1A 2VSYA 1LKZA 2FWPA 3I9LA 1XJ5A 1ZCJA 1UBGA 1M6VA 1F12A 2KI5A 1PUXA 1V1MA 4MQ6A 4D0LB 2D5LA 2M1ZA 2QRLA 1IN4A 2R7LA 4UFOA 3C48A 4D8WA 2W2TA 1CEYA 3V7FA 1N2ZA 4NP6A 3SR0A 1GZUA 3HUFA 4D98A 5KSOA 2ZAYA 2QXTA 5HKLA 2V03A 2Z2ZA 3L02A 4QGHA 3ODPA 1FCJA 1FDIA 5J4VA 3EULA 5IARA 1NTRA 5E6UB 3DT8A 1EDDA 4D2IA 2A0YA 3RYHB 2G17A 2BKUA 4H08A 5EP4A 3UH0A 5LDHA 1HE4A 3HXPA 2PZAA 1JHYA 1L3CA 4W7HA 3DHYA 3GLGB 1XXHB 4KV7A 3TSCA 1MX9A 4PYRA 5IDVA 1UDAA 1UBFA 1P3DA 2BHLA 3B8EA 1QKIA 1BSVA 3O7WA 2NZJA 2Z58A 3O93A 2RGBA 3VOBA 2P2CA 4GYYA 1LGYA 4GIBA 2Y0CA 1N4AA 2VHVA 2AF4C 1FYVA 4YMIA 2CNLA 2WSYB 3D3NA 1ULTA 5LMCA 1QYIA 4X61A 4FGZA 1RD4A 3SKXA 4EHBA 1EQAA 5KNDH 4HDNB 3GLFB 3PGVA 2JJ1D 1Z5NA 3GEBA 3PVSA 4GS5A 4OQFA 1X1DA 2QRNA 5AI5A 3WXMA 2BUAA 3JQCA 3MFQA 2NGRA 1F0KA 3O2NA 3TSYA 4K26A 3RSFA 4E5NA 3KQWA 3JS5A 5AESA 5M5BA 1SHZA 2XXBA 1LPPA 3MWEA 4B3IA 2NT4A 1NRIA 4JIMA 4A0GA 4BYMA 4NATA 4BL5A 1XPRA 3PDJA 5MFPA 5T6BA 1RFLA 4LNHA 1UQUA 5EHZA 1WXXA 3O75A 5I9BA 5J2UF 3VPXA 1C1XA 2ZW9A 2ZGVA 1PBNA 4OMDA 1BS9A 3MINA 2R11A 3WGUA 1SQ5A 2A9JA 1ZMRA 2FWAA 2H9YA 4HNAB 5IJ0B 1Z22A 2R44A 4HDRA 3U40A 2O7VA 4JYMA 3NO4A 1AQYA 1JT9A 5HZGA 1PX2A 1WETA 1AB5A 2JKZA 4NDZA 1WS6A 3OTWA 2VJBA 5JYBA 2BTEA 3ZUGA 2D1YA 1FP4A 3M0EA 2QL6A 3FMPB 2ZB8A 3Q98A 3I8SA 4P53A 1KDZA 5KO2A 3DL2A 4YRAA 1GZ4A 5F77A 1YBVA 2QL9A 3GYGA 3EPHA 1PS9A 2AN4A 5TV2A 5DP1A 4WOPA 3LLCA 4GR5A 5JNWA 3ND9A 1YS2X 2WYIA 5D85A 2VNAA 4PINA 4CQMD 5INTA 1E2NA 2QPOA 4S1OA 1X87A 3ORFA 2BGWA 2ENUA 3KO8A 2XMPA 4LMBA 3PE6A 4B09A 4NZYA 1T6BY 4RDCA 5DHRA 5A1JA 2C61A 4Y2HA 4ZAGA 4BQSA 5BXQC 4V38A 3UBTA 1YQXA 3Q7SA 2DAPA 2O3UA 4ZHQA 2C3MA 4B7ZA 4Z8XA 5HW0A 2GEBA 4KQEA 4X1YA 1BU5A 4CIWA 3NWOA 1NBMA 3B38A 1RCTE 2E4UA 3EUEA 3O38A 1BEUB 1CF2O 1Q21A 4KQ9A 1VBKA 3UFXA 1E2IA 1ONBA 1XJWA 1CNFA 2H7VA 2WD7B 3PUVA 1PZHA 2UZ1A 4B9AA 3OKAA 3FTNA 3SJCA 1VCMA 5ICMA 4PGFA 4R69A 3LCCA 4LDAA 4LY9A 3K92A 4YDRA 4JB0A 4GLJA 5AVOA 2CVHA 4LPSA 5DCLA 3RF6A 5IEBA 4ZT7A 4YRKA 3GFQA 5BWBA 4INAA 5AM4A 3HYLA 1M2OA 2HWWA 2ACWA 1W59A 3NTXA 1ZC4A 2GXUA 2C2KA 3INTA 4MQLA 1PJTA 3CZ4A 3A9WA 5G3YA 2CWDA 1BMDA 3STTA 3W8FA 5CBPB 2XRZA 3PPYA 4XM0A 1F38A 1HRDA 1A3CA 3F3YA 1CZNA 3IJ5A 3JQQA 4W5JA 3L8YA 3VPHA 2Z95A 2OV8A 4BWVA 2JG3A 1PJ3A 4KLZA 3CY6A 3DLAA 4IMJB 3U62A 3P27A 3B36A 4NTZA 3M83A 4LRUA 1WZIA 1U7OA 2X9QA 2I6UA 5DGTA 4C08A 3DKIA 2WWVD 1LPSA 1E3JA 5CDFE 2C7VA 4H0NA 1J9ZA 1ZOIA 3BCRA 3LL7A 4FGUA 2RKWA 1W35A 3HCFA 4WKOA 3DEYX 4U4AA 3AYXB 1CP2A 4UMFA 4Y7CA 4OHMA 4DSZA 3G7NA 1O94D 4OFXA 3WRYA 1P9WA 3WYFA 4DR4B 3NHKA 3QNMA 5H02A 4F85A 3KK0A 3KZNA 2QLNA 4M0DA 1KEEB 1WABA 3AWDA 2X9NA 4ND3A 1LJUA 4F5WA 3LJKA 4DABA 3HR8A 3IEVA 2XDQA 4NEQA 3HNOA 4RUKA 4ZDIA 3JRWA 5G2OA 1NVVR 2REXB 3HO6A 3GGDA 3LY5A 1EM8A 4UBMA 4B80A 1X9HA 2EBWA 1IZ0A 3N2KB 4LRQA 3D54D 1E66A 1U0NA 2BGUA 1RAAA 2ZBDA 3E5RA 3GFVA 1E2BA 3FROA 3F74A 3BDAA 3KQYA 1LJ8A 2XHEA 2P40A 2CD9A 2CKDA 2DH6A 2FY8A 1EFVA 3ZBTA 4IDEA 4RV9A 4WPGA 1VL5A 1KO8A 1KZ4A 3H9JA 1J2JA 1F20A 2ZAMA 1B3BA 1VCIA 3DE7X 4DWVA 3S40A 1Z4MA 3SZUA 1PGQA 2GB4A 4YRFA 1AKVA 3L8ZA 3FWNA 4R9RA 3GPLA 1S9HA 2V7UA 3C6XA 4TKZA 3WWPA 4RHYA 5LUAA 4ZOLB 2D0IA 1P2VA 5CAEB 3CF0A 4MI3A 3OEHD 3LQFA 4Y6LA 4QBHA 1HDZA 3TBKA 3FVWA 4DCMA 2O2CA 2XMBA 3QOWA 2VJNA 1XELA 2GCOB 1D07A 5EHGA 4CTMA 3V8NA 2ZTLA 4ZVUA 1N78A 4BGDA 1N6NA 2QD1A 1LRKA 4DC1A 1KGDA 1UMBA 2CXSA 3O2QB 2QDKA 4PRYA 1LC3A 4R5MA 3MJSA 4D80A 2DSNA 5G41A 3SHFA 4CKEB 2BTOA 3C1AA 5C5CA 2J5KA 3DW3X 3R24A 3RQIA 5JMOA 2VTBA 3ZHUA 1V8DA 1YK0A 1YQTA 3IT3A 3B6JA 2RHRA 5B53A 3ZDRA 1E1CA 3U7QB 3RIGA 1YCGA 2Q3HA 4A4DA 3IPLA 3IELA 4U02A 1HWYA 3UG7A 3GOHA 2Y1OA 3DMPA 5KOIA 2AFIA 4QELA 3H84A 2XQIA 1PHRA 2X41A 2JCSA 4ERNA 4CE6A 2FZGA 2AQIA 4Z54A 3LBAA 3NATA 1KI6A 4DJJA 1I01A 2YVKA 1K89A 2GKOA 1KRWA 2W98A 1ZVJA 1A77A 2X8JB 3Q72A 3FNFA 2OSBA 3DVAB 2BM8A 2FW7A 4JEUA 1CX9B 3EXIB 4N3BA 4XGIA 2CLCX 2IF2A 3VR4D 5F7XA 5HGJA 3OF2A 5BUZA 5K45A 4JL8A 5CA1A 5FBQB 3SC4A 4UDNA 1QVRA 4QIHA 2WG1A 3MCWA 3PYXA 1QZ3A 3AF6A 4FOLA 3DBHA 4JP8A 1ZW1A 2IP1A 2G7MC 1AS3A 1SZJG 4OGLA 1S7GA 1TQ2A 4I2NA 3S2YA 1NM5C 1E62A 1NMQA 2ZG6A 2NXWA 5BV1A 2XBLA 1KEUA 2WAYA 2ZDHA 3L0ZA 1UC4B 5CVJA 3SFVA 2QAGC 3EEBA 1OPRA 1K5PA 1BH6A 4FJ2A 4A0RA 5FCDA 2QNIA 2N47A 1WXDA 2O0HA 2WIKA 3BRQA 4CM3A 2AC7A 1E9CA 3EVAA 2M9MA 4PLPA 1B74A 1TUEA 3NV7A 4G1VA 1E79A 4YCJA 3UWMA 2UZ4A 1XWWA 2QMUA 2VP3A 1ISHA 4GOJA 3IEKA 4N76A 1JIKA 1DDOA 4KIUA 3K9QO 5CUQA 2J41A 1QQ7A 2PX0A 1YR2A 1R66A 4LWZA 3U7HB 4FYVA 3I2YX 3D3EA 3RV3A 4IFBA 3K30A 4H35A 1MZPA 4P93A 3OCZA 5H59A 5EQTA 4D9FA 3BWBA 2OLEA 3BJEA 4NAHA 3ZQ4A 5KSYA 3ZE6A 2D5CA 2GPJA 4YAUA 1E96A 2FKAA 4D0RA 3FZEA 5DW3A 4H60A 1WG8A 3SQOA 1M3SA 4IICA 4YFYA 2B5OA 3DNFA 2IQIA 2YVLA 1QJ4A 2QY9A 1CZRA 4UM8B 4YRCA 5CLJA 3R5HA 3OQBA 2YWGA 2EERA 1VFNA 1NQOA 2WE7A 4XVUA 1Y0BA 3ZJ5A 1GUZA 1AKMA 3MIIA 2H57A 5TQ2A 5HIKA 1XP5A 2YIDA 1XRLA 1IG0A 1QIIA 4Q93A 4PSAA 2XVYA 3LCVB 4NFHA 4WY8A 4HSEA 1Y8QB 4RO0A 3L92A 3ND6A 4DLSA 3HJFA 4MCAA 4ND2A 1MRSA 2H54A 4L8GA 4N9WA 3AETB 4DIOA 1IIBA 4BB6A 4BX3A 3A3OA 2II6A 2FFBA 1M1NA 4OLAA 4LTNA 4F72A 1Z13A 4DCTA 1G6HA 1WHSA 3VJKA 5ESWA 1MO3A 2WMYA 1TEZA 1C0KA 1U0JA 4OQEA 1R16A 1SKQA 3FLBA 4GR4A 3TRIA 5L6MB 5C5EA 4RQAA 4I99A 3IV7A 4ZVLA 4NE7A 4ZQIA 1YVPA 4D44A 1XKQA 3B53X 1HT1E 3A9RA 4ZYUA 1GVNB 1PFQA 2VJLA 3MHPA 2QE7A 1OC2A 4IQGA 1HC7A 3HUTA 3P0EA 4QM6A 4YRBA 5BN3A 3DONA 4B8ZA 4BMCA 1A8UA 1DBWA 1KMHA 4BFXA 3OURA 5LP6A 2FAXA 1SHTX 2YJ3A 3GQBA 5FUQA 4Q7MB 4KPFC 1I4DD 4EI2A 4KITB 4C4AA 5J4YA 1RXCA 4X94A 1IUKA 1GNSA 2XUGA 1V16A 1JR3D 1QV6A 2HTFA 2QRGA 4YN3A 4JNCA 1AQNA 1YSCA 1GZ6A 2ID8A 3GJTA 1H6AA 2C2GA 3I6QA 2DLCX 4G0PA 3ZNQA 1UBUS 3AFHA 3B78A 3H83A 4KZKA 1KAQA 1Q1EA 3CRMA 3QVTA 4XGKA 2ZSHA 4FT2A 5L9AA 1JJIA 1QTRA 2PUDA 2FDXA 3MOSA 1AT1A 2PU7A 3GP5A 5CX1A 4GPAA 2XGGA 3DE1X 1UDXA 5DTMA 2VDOB 4AYXA 4WHMA 4BGVA 1HPLA 1VOTA 2PKXA 3O3OB 5KVSA 5IT9A 1A9QA 3D64A 3KT6A 1GYRA 3LQ4A 3N58A 5LOVA 4UU7A 3OIWA 3SXPA 5AI8A 4QOSA 4RU1A 3D4BA 4IHAA 3LKBA 2PKCA 3NYRA 4XRGA 3AJ9A 3WGYA 4NY1A 4NCNA 4ZYTA 4V0SA 1P1FA 1P7WA 4WKBA 3T15A 1FNMA 5A4IS 1YBMA 2MT9A 1MU0A 3I04A 3DQZA 3NAQA 4IG9A 4D9MA 4M86A 2KHZA 2P4HX 4JEMA 1DJMA 5ECYA 5CA1F 2XDAA 3PFWO 4MLCA 4R9NA 4FB4A 1FDWA 4FEGA 4WY5A 4QXMA 3B13B 1UQRA 2NZ2A 2Q29A 1JVNA 1C4WA 3KOUA 1B2LA 4NCXA 4P4UA 4RVGA 1GTVA 3VSCA 3GZNB 1HZZC 3KSRA 3O26A 3EVGA 2HT6A 3LSTA 2D3TA 2IDMA 2VLIA 5J2UB 5BVHA 2OAEA 2ZJOA 1XJ0A 4FGLA 5FA6A 3L6BA 5WRFA 4ENTA 1Q0UA 4XA8A 3ETDA 1WPRA 3K2EA 1D1SA 1CHDA 4LVOA 4PR3A 2VRCA 4TL6A 3S4YA 3U5ZB 2AZDA 2VYQA 4E5DA 3IILA 3E3LA 2W6PA 3KZCA 3TAHA 5DEIA 5BXYA 3SF0A 3VKHA 2E6KA 2WT4A 4QU9A 4EYKA 1JAYA 4DV5B 4WOCA 1KAHA 1PT6A 2C4MA 2Y27A 2CNWD 3ACDA 2Z2YA 3PDHA 3P9SA 5FP0A 1PWXA 3RANA 1V5FA 5CPBA 1MQ8B 2ZIXB 3CE9A 3GFBA 3QITA 5HE9A 5IKOA 5CCEA 1YR8A 2QP4A 1JMYA 2P65A 5FBZA 1W5AA 3GN1A 4MHOA 4EA6A 1LX6A 4ZWNA 4YAGA 2Z2XA 1E1NA 3CG0A 4Z49A 4F1JA 2DQYA 4BP1A 2AV6A 2VHCA 3KUUA 3OZTA 4IHKA 4IQ0A 4CIBA 3IKVA 4V0MA 4FQ5A 3FPAA 3C85A 3ZQKA 5KDDA 1IPEA 5KWEA 3QYPA 1JHQA 4G07A 3B3QA 3EGEA 3EFOA 4OLHA 3TM5A 3LY7A 1U2SA 1E3WA 4Z4IA 4RM2A 1R37A 2BKVA 3K70C 1PDOA 4ALNA 1JU3A 3ZHVA 1EUCB 4LBVA 2DBYA 1WXWA 1T9BA 4N65A 3OX2A 5U4XA 1JZSA 3JWIA 2O3RA 3O31A 4CEHA 3Q0IA 4HT3B 3D59A 1RPAA 3AR7A 4BX0A 4CLRB 3KL2A 1DC4A 1JXAA 3PWTA 4C4SA 2XTMA 4EG7A 5C18A 2YJ6A 2H1RA 5AKEA 1Y8ZA 3STWA 4OJYA 1V35A 3W04A 4OLJA 3VR5D 4G8BA 2YW9A 3ZTYA 4BP3A 4W9MC 3H5OA 2I62A 1J0AA 2PWYA 1V1JA 1QIFA 2UYQA 3FSRA 3K0FB 3LP6A 3NCHA 4NCIA 3CTPA 3L8EA 2PH7A 5F1YA 4Q9NA 1XZDA 2P9FA 1JR6A 1E3QA 2MYTA 2QMQA 5FV7A 1R10A 4Q4JA 4DNQA 3NWEA 4M4SA 3WYGA 2O7QA 4EPVA 5KQGA 2AEEA 1T29A 1E2GA 1ZRNA 2ODEA 4ITRC 3AQIA 3RYFA 4TKMA 3WKAA 3KL4A 1N8NA 3D8RA 4NC9A 4ZU6X 1YBAA 1Q50A 3HTXA 1TOAA 1Q0LA 4GDMA 4HQFA 1NR1A 2MYUA 1SU7A 2P78A 5C80A 2IOHA 2X3FA 1OXTA 5BSHA 1J9EA 1FFXB 3GRVA 3KKNA 1FUUA 1W4LA 3D6JA 5KREA 1T8PA 1H42A 4YJGB 1M6VB 2H5IA 2BISA 3P2OA 4NFLA 5EEGA 3WK4A 4R8MA 2GZMA 4EUFA 1S1MA 3CW8X 3A4NA 3G0GA 2NIPA 4J07A 4MVJE 3S2EA 5AVVA 1EXDA 1E2EA 2Y0DA 4BBJA 1P33A 1Y9DA 1H69A 2NTVA 4GL4A 4JUBA 3KVOA 5EMJA 2O06A 2RGXA 3FOEC 4RD2A 2NUAA 1FW6A 4OQDA 2FSSA 3GVIA 4GM1A 4DLYA 5ALJA 2IV3A 2D7CA 4K6FA 4FK8A 3NONA 1TQ8A 1RYNA 4BNXA 4KVGA 4F4JA 4AF8A 3ZDFA 4K9NA 1NJ6A 1ENZA 1OREA 2YW2A 1YS4A 2RHWA 3O3MB 1GRNA 1IFXA 4BZQA 3QE9Y 2G28A 4P31A 1RYMA 3R0QA 4LYEA 1J8QA 2FFJA 4OB8A 4A16A 4B17A 4ZU1X 5JC1A 3PKIA 1NY5A 4IO0A 2V3VA 1P4AA 3OJXA 5LOVF 1YGPA 2MOKA 2XGMA 1DTEA 4ZVMA 2HPAA 2OFOA 3U49A 2I9KA 4RENA 4IIDA 1L8LA 4ZHSA 3DE0X 4W9NC 3X1DA 1EDOA 2GDJA 1UKCA 3PJFA 1CDOA 1MJ5A 4LJ5A 4Q9KA 2LCQA 2FQYA 4G24A 2X1MA 3NJ8A 3C0KA 4QFBA 4RJKA 1ZSYA 3G8BA 5FF9A 3ROPA 3GBVA 2WF7A 4F4HA 1PTJA 4A8PA 2PX6A 3MWEB 1LC0A 2GM5A 3KYCB 1JLRA 1GA4A 1NMYA 3F0TA 4MZXA 4QARA 2UUCB 1OI3A 4GWKA 3VQTA 5FLXA 2HSZA 1IG3A 2R00A 1SVWA 2HBZA 1FS5A 2I6FA 2XR1A 1C1XB 3E2MA 4M7OA 3PUIA 4L4UA 3ZGXA 4F6LA 5KYNA 1XV5A 4HVAA 1QPBA 5HG0A 4A36A 2VF8A 1I94B 1F8FA 3C15C 2FCAA 4I6EA 8LDHA 2JI8A 4O33A 1E77A 1J42A 5B55A 2AJBA 5CG1A 4UEOA 1TJ3A 3KQHA 1DB3A 3P97A 3AKCA 2CDAA 4C0LA 3L1KA 3U09A 1Q0SA 2FSVC 2QVGA 4LI0A 4JD5A 3I0NA 1KSFX 1FP4B 4NI5A 4AN0A 3ENWA 1WY5A 3CSSA 3IUQA 3OPMA 5DNUA 6CHYA 1K8RA 3U3KA 2COEA 3EIEA 4Q3CA 2NNLD 5DM2A 3RE1A 2K5UA 3GG9A 1DTWA 4QO7A 3WP0A 4HDKA 5DX0A 1X92A 2W2MA 3KLBA 4G65A 3KPWA 5LBIA 3RM3A 4HLDA 3A8TA 5CVEA 1ADJA 1E69A 2WMDA 2BHSA 1ECLA 2DCUA 4DJEC 3MXTA 4W9RA 2A78A 2X3YA 3FKSD 3K1JA 1DG1G 4QTUB 4DLKA 3NTQA 2I78A 2ZSUA 3K8YA 4RABA 3NALA 3M4NA 4AJIA 1K3UB 4MXDA 1D04A 6REQA 3GZ4A 1KK1A 4OYRA 4K1XA 1OWPA 1YE3A 4X1YB 1M1UA 4PTLA 1D2CA 4FYWA 1YNSA 5ES3A 3DEAA 3O4IA 1AO3A 3QPAA 4NU6A 3UFXB 3WOVA 2RIRA 5IVDA 2UZ1B 4HJXA 4MEJA 4A2PA 3DT9A 2B94A 4MIOA 3FOFC 1GR0A 1ZL2A 4WZBE 1SVMA 4DLAA 2CDNA 2IQ5A 3PHJA 4NIMA 3RK4A 4N7MA 3WE7A 1A9PA 2V7PA 4U9HS 4ZJUA 1UAYA 3C45A 4K2AA 4DCGA 4EBBA 4WN3A 3FUWA 5EJ8A 4JR2A 3L2OB 1UJ4A 4WESA 2IYPA 3OQJA 4UDXX 3CLTC 4CW7A 3H17A 1O58A 3QU9A 1E4EA 1W25A 4MS3A 3OHSX 2XEXA 4DREA 4M0UA 5A06A 5BW5A 2JH3A 1DO2A 2VG8A 3SJAA 2LCFA 3HM9A 1PFVA 1RYDA 3LXXA 3GUZA 4JU9A 3RK1A 4N3GA 4ZT5A 1JHRA 1KKLA 5KNCD 1HX7A 3L49A 4N01A 3NI2A 2CY0A 5JMWA 2HWYA 1Q7CA 4A73A 1ESCA 2DF8A 1L5GB 3BH6A 1GPUA 3A25A 2JGMA 5DPMA 4JROA 4XKJA 3TQIA 2OBBA 2XB2A 1LLCA 4WT7A 4EOGA 4YRGA 4RVSA 1RLTA 3DL7A 3KU1A 4YAIA 3UWKA 4TVKA 4ZOQI 1U0OC 1HEIA 2QYOA 2W7TA 3KR0A 1NI3A 3F9RA 3HDQA 2KLBA 3GAAA 4GMDA 1QOQB 4NU0A 4ZAZA 2VPIA 3NPAA 3WOHA 4NBTA 3D4LA 3C3PA 3WVNA 2IFTA 4YQFA 1WXFA 5SZIA 1SXJA 4GGOA 4ML3A 3Q8MA 2XDQB 1DFGA 3KOMA 4J2TA 3V6MA 3KQOA 4QJ4A 1GZDA 3FMVA 3ZH9B 1KAMA 1EM8B 2WT9A 4F4UA 4F84A 3HXMA 2W6OA 1NZJA 5FTKA 2G1PA 4CUZA 1KSGA 4N6GA 4PG7A 2W93A 2PLFA 3ADPA 3H5VA 4MVJM 4OI0A 1R9NA 1RQ2A 4HEJA 2VK2A 1EFVB 3HMQA 3JZFA 4OA8A 1KPGA 4PLHA 4Y2TA 2P2DA 3SVTA 5MGBA 1LUAA 1R0XA 3LX8A 3WFZA 4M9QA 3KOWA 3HYTA 4V24A 3EXFB 4I9GA 4ZT2A 3ZWVA 4CIYA 2X6RA 3I2KA 2PT5A 4RGBA 4ABYA 5F2NA 1TKCA 3W5JA 2A3NA 2Y0PA 3H8VA 3HHPA 3L43A 1V71A 3EFBA 3QJYA 5U9CA 5F5LA 4MEAA 1MLDA 2IHJA 2VN8A 3EEFA 3LUKA 3ZWBA 4ALMA 1ADYA 2C96A 2YHAA 1LPBB 3C1UA 3PX3A 1G38A 1MHTA 5GJBA 1C1DA 2GJ4A 3F9IA 4JWTA 1NI4A 2CCKA 1KDOA 2XX3A 1A0OA 1UMBB 1WPGA 4RSHA 1FTYA 3HB5X 5THQA 4BBPA 4ER5A 5A4FS 3OKFA 3OKCA 1V7QA 3PRYA 1JJAA 1W52X 4P7BA 1VE3A 2GZDA 4Y1RA 4TKLA 1AX9A 1N8TA 1WOMA 1E1CB 1C4OA 1QGDA 1TVCA 3EXHC 4KI7A 3CH7A 3E2IA 3OPVA 1BS1A 4L8VA 4UNQA 4YRIA 4UVEA 2Q1SA 3SC2A 5C1OA 1W36B 3IKMB 2P6MA 4LX8A 4V02A 2ZRLA 3OAAD 2AFIB 5CCDA 1M76A 1VGQA 2NU7B 3TRJA 2XE8A 3OG9A 1CEQA 1KAOA 1BQEA 3VNRA 4YAKA 4YJFA 5JRJA 1KI6B 1MIOA 4RS4A 1AUPA 4J7XA 4HMOA 1IDOA 4Q02A 1N3YA 1PJQA 2HZBA 2IYUA 3R5FA 1QR6A 1GPYA 2ANBA 3NEPX 2WAAA 4IJQA 4L6IA 4R2HA 4H31A 3T3HA 1RTKA 4C6TA 3E15A 1TYCA 1WMAA 4DV0B 5FV4A 2Q49A 4X5OA 5JYCA 5ITWA 1Q3KA 5CA1B 1SQFA 4EG1A 5HA5A 3N7TA 5EHNA 2GJSA 4AIRA 1US8B 1V8ZA 3DBHB 3CLVA 4IIUA 3EW7A 3OVMA 2DHCA 4QBKA 5CVDA 3SZOA 4CVNA 3FRHA 2C7BA 4O4HA 3H3FA 1AKYA 4OSPA 2BHRA 5EIEA 3Q0EA 2PUVA 4OKNA 4QNRA 1CUIA 4DBLE 1M6YA 3GDGA 3SJZA 1P0PA 5FHRA 4KC0A 3V33A 3F6BX 3B20A 1S1CA 1KARA 3MK31 5FRDA 3AI1A 5LXTF 2F3PA 2I66A 1RMQA 3CNLA 1FUKA 1NBMD 2JFVA 1V3TA 5EG5A 2C7GA 3I9NA 2RK3A 2WSIA 4NZZA 4HQ6A 3LXUX 5H5JA 4LMAA 3VYSB 4NDNE 2ID4A 3A37A 1QVZA 3PK0A 3PE3A 1SUBA 3WL6A 2I03A 5BSWA 4A6PA 4DR3B 2GR9A 1D5CA 3FNQA 1VIVA 5F9HA 1UPCA 1XTSA 4HXFB 2F1RA 5K6AC 1YFKA 4DW8A 5L40A 4A0FA 1CVLA 1ZJZA 2NO1A 2YHBA 2V0GA 4ZXPA 1CFZA 1QS0A 2BD0A 1XROA 3A3PA 3DR5A 4OIMA 3W77A 2WUGA 2BJWA 1L7DA 3DE2X 2GK6A 3C4QA 3RSHA 2X5JO 2D3WA 4UEKA 1EDEA 1D03A 1FMCA 5BN5A 4OH1A 2BF4A 3HS3A 1P75A 3G2KA 4MRAA 3PNYA 4DV6B 4I55A 1JEJA 2IXBA 2Y68A 2IYZA 2ZUWA 1OD6A 4PS1A 3ONDA 3TI7A 4EHJA 1NUAA 1ECCA 4WBNA 4LZAA 3ZDQA 2BGRA 1Y4ZA 5I7WA 5TQ2B 3A32A 1YRHA 3WMEA 4GQIA 1T10A 5E7QA 2DFDA 2HZ7A 1U3UA 3KQNA 3ZGYA 1F2UA 4R8VA 1DARA 1UBOS 1TC1A 3ZJYA 1X13A 2CVQA 1Y9JA 2ZS9A 4US2R 1XG5A 3HM2A 5JXGA 3CVWA 3LW8A 1XZHA 2ZRCA 1VXRA 3AG5A 3H6KA 4NJMA 2FPRA 2AXEA 5FEUA 1M1NB 1RRKA 1W87A 4ZMRA 2VUSA 4KYVA 2D6FA 1VSQA 1WHSB 3MTIA 1PUJA 3PYLA 3REGA 5K5EA 1MH1A 2GTHA 2ZRKA 4KDEA 5AKJA 4KVFA 3VKUA 3D4NA 3ZX4A 1JDJA 3O8CA 1JIJA 3OI7A 1MT3A 4TS3A 3TSOA 2FW1A 3R5XA 3UT5B 2O4CA 1KOLA 1NUSA 2C2MA 4FNMA 4BRZA 4DIKA 2JFWA 1HOTA 1U0FA 1XVAA 5DISB 3FN4A 2EQ5A 4V0LA 2EJTA 1N6HA 3CLSD 3QMPA 1GWNA 3R2JA 4MYUA 1KXZA 1PEAA 4AZVA 3TTTA 5BN3B 1KMHB 2C2ZA 2YY5A 3CN9A 5LP6B 4YRJA 2I6SA 5LQAA 1JLHA 3GQBB 1L8XA 4I4TA 4PG5A 1L5QA 3S2FA 3AFGA 1T9DA 1VL8A 5LYJA 4KX3A 1VCNA 2ZXUA 1V16B 2A9PA 2OCDA 3KUCA 5THXA 2ZQ5A 5HQTA 4GMKA 1E9AA 1RXEA 3D6VA 2BGJA 3LHIA 2HRZA 3I34X 1XVUA 4HK4A 3AJEA 2IVZA 5P8WA 3HXLA 1J7JA 1JG2A 2FSFA 2GSDA 3W34A 2BM9A 2IY9A 4Y8VA 3K9BA 2D7DA 2XTAA 3Q2KA 1KQNA 2ZUBA 5HTOA 4PXAA 5CX1B 3RREA 4FMBB 4U7FA 4XB2A 4DCVA 1I1OA 2PAFA 5CB8A 3DMNA 3DM9B 3I6ZA 3JSAA 4J0FA 3A4TA 4ENWA 4AQ7A 5LOVB 4IDQA 3HV0A 1XKLA 3OP1A 3UHOA 4M89A 4QHYA 2YOFA 1AXEA 4PS0A 3D1VA 5JLAA 4AWXA 1K3TA 3BIOA 1M2HA 2A9OA 3VPSA 3ZEAA 4C76A 3FVTA 3LLVA 2QBYB 1JN0A 3R6WA 4B48A 4U7GA 4B5KA 3HP7A 3CZPA 3F1LA 3H6GA 5TB5A 2R66A 3PNBA 2EYUA 2RB4A 4XQ0A 1N7HA 3DP9A 4XQGA 1DO0A 1LVGA 4FYIA 1SD5A 4OEHA 4O4HF 1GGKA 1NJ5A 3H0EA 3U4CA 5B7NA 3R0ZA 4XGRA 2JAPA 4LOHA 4KSYA 2FRDA 3CH6A 2JCXA 1CY0A 3UGQA 4G81A 1FYEA 2E7ZA 5KNBA 4NR0A 2X19A 1JB1A 3M9LA 1Z7YA 3FCCA 4Q34A 2LVBA 2NUTB 4YACA 2FUG1 4MLZA 3SZGA 5KIAA 3WLPA 3C1TA 1HGXA 1MOSA 1YVDA 2ACEA 1BVRA 2F9MA 2O8NA 5JW6A 4O5AA 5EJIA 5B1EA 1CDDA 3KQLA 4GKJB 3JWGA 1ATZA 3N39C 4OXKA 5I4IA 1P17A 2FRXA 4H1TA 4XRRA 1EJ2A 4RACA 1VDZA 5HDQA 1U65A 5ALNA 4EFLA 4RTOA 2BI4A 1ZO8A 3G8DA 5A05A 1LZKA 5DIFA 3ENNA 1R18A 1Z15A 2WV7A 4G4SO 2P9TA 4NYJR 4O59O 4B81A 5LL6P 3FTPA 1LA2A 5CJ2A 2QTRA 4W8OA 1JEDA 4E6PA 1AK2A 1UC5B 3EFOB 5FUBA 2C1ZA 3E18A 4MV7A 121PA 2F67A 3L7MA 4TLBA 2NWQA 1E3WB 1VRVA 5AM5A 1Z18A 4EJ6A 4FFNA 4MCJA 2OD7A 1AVTA 3NC1C 1PYGA 1QRAA 3CIFA 4MUJA 3BRCA 4CEHB 2Z5GA 4TN1A 1HFEL 3GGCA 4K6OA 4NBVA 5JO9A 1X74A 2P35A 3IMFA 5T8KC 4AX4A 2J9FA 2ONYA 1S96A 2Z4TA 3MTAA 1M34E 1KK2A 1RE1A 3KP1A 3Q5GA 1NDUA 2D5AA 4I55F 2OILA 4MSUA 2JGKA 4LSZA 5EJAA 2BBOA 5A0FA 3VPGA 3HZZA 4NPHA 2Q1UA 5CU7A 1BMFD 2QTHA 2ZBQA 4FUTA 3X43A 1CIVA 1DC3A 4YAFA 1OKKD 1QHXA 4OXQA 3PYMA 3Q41A 1P2FA 5DTRA 4GU5A 3VVLA 4FZVA 3KLMX 1XFDA 2XT6A 2O5RA 2F3SA 3FWPA 1J90A 2YFKA 4LDZA 3RYFB 5DNVA 4D4LA 3GLHE 4H4CA 3WRXA 1BXZA 2ISQA 4GLLA 5AJUA 3SIWA 1TD9A 2HK9A 5AQEA 3ZCUA 4JT8A 3D9QX 1CETA 2PKQO 4ER0A 3G8CA 3NDIA 4BNNA 2C3YA 3PL5A 5ELXA 1NL3A 5YASA 4BHTA 3DMTA 3PC6A 3CLKA 1ZM9A 1W2HA 1Z0JA 1B76A 3ILYA 4U1RA 4DGSA 5GIPE 3TKYA 1GEGA 2DUMA 4KXNA 3AONB 2QE7D 1DXOA 1VKRA 1W6RA 2ZYRA 4MARA 3TIVA 5KC9A 4U2CA 2W0MA 3HU1A 4QUIA 1YO6A 4I4TF 3TW4A 4DWJA 3GMTA 2JFOA 2K87A 3PXCX 1I7LA 4L3VA 4JGBA 3U48A 4HEA1 1BMQA 3IYLW 5LYJF 3P20A 1KFEB 1A5AB 2VDKB 4HXGA 4UFNA 1QPGA 1O96B 4ZT4A 4JH0A 2NUAB 3JAWA 2H11A 4YS6A 1GV0A 2EFCB 1IJBA 1XC7A 2PZKA 1IPFA 1F3LA 1R4AA 1T2NA 3ICQB 2QLFA 1XP8A 4QYMA 1IBKB 2P4SA 3BE6A 1JEOA 1PWYE 4J2HA 2AQKA 1BXGA 3SNHA 4B4UA 1B42A 5JXHA 2BONA 3IP5A 1GA1A 4FSDA 3RD5A 3ICWA 2HK7A 1KIFA 3A26A 3ZW9A 4GZ6A 3C3JA 3IA7A 4M38A 4OHKA 1GYPA 1XXHE 1XWFA 3NRBA 2ZUCA 4LE1A 1FDOA 2B8NA 4K81B 2XT9A 1FTGA 4BZWA 1IM2A 1L8OA 1JSRA 2V7WA 3PQ7A 2LTAA 4PX5A 3ICPA 2J87A 3BTVA 2VHJA 3L6RA 5SY6A 4PLCA 3UJBA 3RVQA 1WOYA 2WZBA 4J03A 1H0SA 4DSNA 1SVOA 1EB9A 1UMKA 4PX9A 1L6RA 3BCSA 3TRDA 2JIBA 4RLSA 2OBLA 2PNFA 2BJVA 3R20A 2Q07A 4JBHA 1RM4A 4H7EA 4CR6A 1APBA 2P5YA 4BFUA 1P2UA 1T5SA 1EWKA 4ZYXA 2ZYSA 4UJ5A 3JVIA 5KCMA 3VSAA 1EVLA 4HRXA 1UJ5A 4MUIA 1NRXA 4QDZA 2WWHA 2SKEA 1H85A 3QUAA 3HJUA 1ZXXA 5F52A 2R85A 3KOOA 1BHQ1 3PUKA 2GLTA 1KAGA 1FB5A 1IC6A 3A0UA 5EZSA 5GGYA 4GEGA 4A8TA 4YBZA 2FDRA 2WUVA 1CP3A 3R3WA 2VAVA 4M88A 4TXJA 2QN2A 5I9IA 2J9XB 3WLRA 1T1RA 3BIWA 1V25A 1QH0A 1WW8A 1J0DA 4NCHA 5CK5A 3RJZA 4FZ5A 2YNMC 3WYCA 2VSFA 2JBAA 1SUDA 2OCKA 1XEXA 2ZB4A 4TMYA 1WSDA 2CLDX 2G82A 3A6GA 3RSLA 2WHPA 3G85A 3P9ZA 4K86A 4QL3A 2YOHA 3IUMA 5JXIA 1R8SA 3W4IA 4GZLA 5LD2C 4BWGA 1G8FA 1RYFA 4AYTA 4DLZA 2QG4A 1LEHA 1XDGA 4FI3C 4MWBA 5TQVA 4QKQA 4B4KA 3KKLA 3E3OA 2HYDA 3SD7A 4DILA 2VUHB 4JJKA 4IO1A 4Q7QA 1DTWB 4K3UA 1PYDA 4HDKB 3T7IA 4E4TA 1ISSA 4H3KB 4AS3A 3FR7A 4OG2A 5HRAA 5KVVA 4REMA 4G0WA 4MDFA 5JSFA 4URWR 3WIUA 5JQGA 1OASA 2OV4A 2P90A 1FVXA 1Z0KA 2FN7A 2C29D 4DCPA 5B2ZA 3F5QA 4LS3A 1QF9A 4Z1MA 2D2XA 2ORYA 1Y89A 3ND8A 4YGXB 3ZWPA 4BIMA 3ZDBA 4F86A 2LR0A 3KJHA 1XLWA 3FDZA 2BKXA 3RRFA 6REQB 1QAMA 2PBLA 3QE4A 3P5BA 5C2JB 5MF6A 3E0XA 4BB0A 1RWPA 2IL1A 3B9RA 4IXWA 4CDGA 3FETA 2R4UA 1EA5A 2OGUA 3W3ZB 3F4KA 1FYFA 2TMKA 3ZHZA 1XDBA 4ND8A 4EHAA 2Z5VA 4C05A 2WNHA 1L4EA 3FNEA 1H9CA 4QXQA 2QLMA 5DM0A 3VDRA 1WU7A 3QBTA 1GPH1 1FJ2A 1QHYA 4LOLA 5CNKA 1QCDA 3CCFA 1YC2A 2LGJA 2PRKA 3NIBA 2JAOA 4TYYA 2PA0A 4PPFA 1IN1A 2GD0A 2IZ1A 4S1WA 2AJLI 2RG1A 4WESB 2UVQA 2PH1A 1UXIA 3F2IA 3DOFA 5FIUA 2IK8A 3V32A 3VAZA 4ZFNA 3CGWA 1E4EB 3ENQA 4MS3B 5ALGA 5K6RA 3ADBA 3ENZA 2BLLA 4HADA 1AGYA 1YOVA 2FF5A 4ZEOA 1KR5A 2YHIA 3MQ2A 2F48A 4ZV4A 4L2IA 2IIBA 4LCBA 4HG2A 3VZCA 3PHLA 3DG9A 3S3TA 3QVJA 2Z83A 5AHOA 1W8IA 4BUZA 5KTYA 1ICIA 3U9TA 4DA9A 3JYPA 4DLWA 3ZCRA 3T41A 3CB4A 2XTJA 3VO1A 1O95A 1T15A 3CF6R 3ZHOA 1OSNA 4QXOA 4YQZA 3LYAA 1ACJA 1II9A 1K9VF 2NV6A 3WR5A 3WQQA 1UPXA 2XCTB 4YMGA 1L4HA 1S6YA 2J0VA 2Y1LA 5REQA 1N0VC 4II7A 1SXJB 3EZ6A 4FD3A 1ONNA 1RAEA 3SEZA 4QDJA 2HSDA 1SB8A 2R8PA 2ZE5A 3TTSA 3ORYA 4HS4A 3DOCA 2W2QA 5AJTA 3UB3A 2XEDA 1Q7TA 4F60A 3WADA 1C14A 3CO5A 3IHKA 2YMQA 4FX5A 2DERA 4UU0A 2WTAA 2HDHA 3KVNA 3OLYA 4RD3A 2X42A 1F3OA 2HPHA 2ZAGA 4X1KA 4EGCB 3JW8A 2WJJA 4TL7A 2AFHE 1JG6A 1RRFA 1VCOA 2A6PA 2ZSBA 3GJRA 1EG7A 1K8QA 1AA6A 1PBTA 2QR3A 2XZPA 5ICSA 5B3AA 3RTEA 1T8SA 3ANXA 5THKA 4MWSA 1MO4A 3PGKA 2XWBF 1JMVA 1MB3A 3CR8A 3E7PA 5K03A 4PZ0A 2GOYA 2PCLA 5EE0A 4EGQA 3MLAA 5D5HA 1GLVA 3ZS9A 3V48A 1QG6A 5B57C 4DR2B 4C0BA 3JYNA 3RQSA 4BBAA 5SZJA 7REQA 1AIPA 2HM7A 1C1DB 4DLBA 1NI4B 1MFPA 4HNVA 1J06A 5GZ6A 3FPFA 1DBPA 4XD7A 1NR5A 4D0GA 2DQSA 1I7QB 3Q88A 4MYCA 2QSUA 3CKLA 1IAQA 4LOJA 1KYTA 4WXRA 4X71A 1S2LA 5AH0A 1LW7A 2FU5C 3SYRA 1TA0A 3UMVA 2IUFA 5A5VA 4JI4B 1H1LB 4JB2A 1IN5A 3SC2B 1GG8A 4Y2JA 5BO5A 2B1QA 1ZNZA 2ZR7A 3LCUA 4HWSA 5K6TA 4RJLA 1I51A 3DCJA 1PE0A 521PA 1YVEI 2GN6A 2NZYA 3QOYA 4E31A 1PJBA 1DJQA 1ZH8A 3W1VA 1H23A 1ILEA 2ECQA 2D54A 3ZZTA 4YJFB 1H2XA 1MIOB 2V5VA 4YLGA 1W47A 2PM8A 3FSJX 3INRA 4DCSA 4BQIA 4LGVA 1K8ZB 2SHKA 4LJ7A 5F1KA 4BO3A 1O94C 4PNZA 2OGTA 5G1PA 5M7EA 4D1YA 4N6NA 4CRWB 1G21B 3OM9A 4C22A 4G9GA 2O7NA 1FFHA 3Q15C 4K3VA 4E5PA 2OQIA 3E81A