4FONA

High energy remote sad structure solution of proteinase k from the 37.8 kev tellurium k edge
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
279
structure length
279
Chain Sequence
b'AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Macromolecular Crystallography at High(er) Energy
rcsb
molecule keywords Proteinase K
molecule tags Hydrolase
total genus 103
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 4fonA00
2PRKA 4H6VA 4DJ5X 3BPSA 5K7SA 2G4VA 3DW3X 1Y3DE 1AK9A 1DBIA 4LVOA 1NDQA 1OYVA 4LVNA 1PJ8A 3AFGA 3WQBA 4OMDA 1PFGA 1ST2A 2WUWE 1SN7A 1KE1A 2ST1A 3DVSX 2B6NA 3DE6X 2W2NA 3I2YX 3TI9A 3VYVA 1SBIA 1CSEE 4MZDA 3GCWA 1T1GA 1Y3CE 1UBNA 2HPZA 5JXJA 4J94A 5ARCA 3GT4A 4CG0A 1Y3FE 1MPTA 3ZXXA 1TMGE 2QTWB 3WIUA 1TM3E 1BFKA 5FBZA 1Y4DE 1YU6A 2GKOA 4RYDA 1SCNE 1TO1E 3QFHA 1IAVA 3F7OA 3DE4X 3VV2A 1SCAA 4YN3A 1P7VA 3BX1A 3AJ9A 3Q40A 1SUBA 1Y9ZA 2Z30A 1Y1KE 2SBTA 1CNMA 2E1PA 1WMEA 3DE3X 1YJCA 1KDYA 1SUDA 1SELA 4C3UA 1AH2A 4JP8A 2HD4A 2Z2YA 1Q5PA 2XRMA 3F49S 4OMCA 1BE6A 3LPAA 3VTAA 5ARDA 3DE1X 1ST3A 2WWTA 3A3PA 1TM4E 2SICE 1SCDA 2DQKA 1XF1A 1AU9A 4ZARA 4CFZA 2IXTA 1R6VA 1DUIA 1AVTA 1BH6A 4KB5A 4AKTA 1GNSA 1GT91 3A3OA 3EE6A 1MEEA 3GT3A 2Z57A 2Z56A 1KE2A 3SICE 1TM1E 3DE0X 4Z2AA 4KG7A 2PMWB 1PEKE 1YJBA 3Q5GA 3TECE 3WHIA 1SUCA 1SBTA 4C3VA 1SUAA 1P7WA 1GCIA 5AVJA 1SPBS 2W2QA 2WUVA 5AVKA 3BGOS 1C3LA 2P4EA 1S2NA 4FONA 4WOBA 1EA7A 1TECE 1Y4AE 2PQ2A 3LPCA 3CNQS 1SCJA 1Y34E 2DP4E 1IC6A 1C9NA 3I30X 3DVRX 4WOCA 2Z2ZA 2ZWOA 1TK2A 1SH7A 5JXIA 3VHQA 1R0RE 1VSBA 3ZXYA 4OV6B 1Y3BE 3I34X 1R64A 3HJRA 1SVNA 1EGQA 1T1EA 3TI7A 1THMA 1GNVA 2WV7A 1SIUA 1AV7A 1C9JA 1Y33E 1C9MA 3VSBA 1SIBE 3VV3A 2PWAA 2ID4A 3GCXA 1SCBA 2Z58A 5SICE 5B1EA 1SUEA 3DE2X 1WMDA 1GTG1 4BWGA 3DW1X 1V5IA 4HVLA 1KDVA 5CW1A 1SUPA 3WIVA 3DYBA 3AJ8A 3EIFA 4ZOQI 1YJAA 1OT5A 3F7MA 3DE5X 2X8JB 1A2QA 3P5BA 3D9QX 2SNIE 4DZTA 3UNXA 4H6XA 4GI3A 4NE9A 2W2OA 4AKSA 3EDYA 1TM7E 2X8JA 1ZVJA 1WSDA 1TO2E 3QTLA 2DUJA 4NE7A 2PYZA 1GTJ1 3DVQX 4HX2A 4H6WA 1Y48E 2ZWPA 1P8JA 1AQNA 3DE7X 1S02A 1JEAA 1OYOA 3OSZA 3PTLA 3D43A 5JXGA 3A3NA 2PKCA 3I37X 2PWBA 5FAXA 1WMFA 4CFYA 1V6CA 3SQOA 5FFNA 5ARBA 1KDZA 5JMOA 1SBHA 1SIOA 1BJRE 2ZRQA 3DDZX 1GA1A 1NLUA 2ID8A 4NMXB 3CO0S 2W2MA 1HT3A 1NDUA 4B5LA 5B1DA 1AF4A 3LPDA 1BE8A 1TM5E 4KPGA 5JXHA 3PRKE 5AQEA 1GA4A 3LXUX 2TECE 2XTJA 1BFUA 3QMPA 4I0WB 2W2PA 1GA6A 1WVMA 3L1KA 1SBCA 3DWEX 1GTL1 5AMXA 1ZVKA 4DWWA 3T41A 1SBNE 4M1ZA 1PTKA 2IY9A 5I9SA 1S01A 2Z2XA 3H42B 2SECE 1T1IA 2V8BA 1LW6E 4K8RB
chains in the Genus database with same CATH superfamily
2ILTA 3KVRA 2C2OA 3H2IA 2NTEA 1ADCA 5AKIA 4ZV7A 3TZBA 4NENA 1W85A 3HWX1 2E6UX 3VZQA 3GGOA 4JL8A 1WO8A 2NSYA 3O8BA 1UBGA 2GZRA 4QYIB 4B3IA 3DFKA 5JD5A 2PGLA 1Q95A 4KE8A 1XRRA 3PICA 2CXRA 1IHYA 4LISA 4NAVA 2CCJA 1B41A 1EFPA 4O1IA 1JMKC 4GMDA 1EFVA 2QX9A 2Y67A 1L5QA 4W1SA 4X93A 4YAIA 4F3RA 4TT3D 1RQ7A 2IU6A 2VC2B 1W2WB 4Y6GB 1V8FA 2HSZA 1LRKA 3CTMA 3N2KA 3UMVA 1FLAA 3G5AA 3S8EA 1QO9A 4GMXA 3IDAA 4NOJA 3BKXA 3ZK7A 4QUKA 4TPKA 2O2HA 4GOJA 2XE8A 4HXFB 1NXQA 3AR8A 1C14A 2EW8A 2GTPA 3KUKA 3MQFA 1IMJA 2WJJA 1WA5A 1GGMA 2AFIB 4UBOA 4K1XA 1GV0A 2GZHA 5JXWA 4EZIA 3ZGVA 1UM9A 1BWPA 3ND9A 1NBOA 2I33A 3SZLA 4A6XA 2MCFA 1LI4A 3O26A 1R0XA 2UYGA 3PJDA 5ALOA 4MPPA 3AB8A 1SZJG 3C48A 4MZDA 1EJ2A 4IINA 5KJ6A 4UREA 4H2DA 4M1TA 5CB8A 2OHJA 1DTEA 1TGYA 1QVWA 1J06A 1X9HA 4MO9A 1RHMA 1UT5A 1VL8A 3A6ZA 5IVDA 4ER0A 2XUKA 4ZZ1A 1WB4A 3FN4A 4UMVA 5I4KA 5LDDC 3N74A 5EP4A 3DBOB 3LQ2A 1WKCA 4FGUA 3OEED 4MRSA 4BNGA 2VDQB 5JJIA 2I2XB 3MXTA 2VQ3A 2XMCA 3ZR4B 3ADPA 3L0OA 1EA5A 3ICPA 1CUXA 4EW1A 4YRIA 2R4QA 3SGLA 5IWCA 2IHKA 1CQPA 2QK4A 4IUYA 5FI5A 4TTJA 4FCTA 3E53A 3H1AA 2CXPA 5C52B 2VA8A 3BIOA 2BHTA 4DIUA 4YRPA 4E5KA 4JP5A 2F3PA 1B0PA 4Y1EA 1Z45A 1C30A 1JALA 4GOMD 1COZA 5P21A 3T3IA 4UNRA 5GZ1A 4OAQA 3B3JA 1HMYA 4GC9A 1V2GA 4QDTA 2ASEA 4MQBA 3WKAA 4XRGA 4Q1VA 5CLIA 1DRVA 4JY7A 3JYQA 1KRXA 1NPYA 3U4QB 1T4MA 5IJAA 3PBKA 2UZAA 3IV6A 1KZ1A 3QKUA 1FDWA 5IT0A 3U3OA 3PXCX 4L9SA 3BX1A 1NY5A 4YLGA 1E3DA 1FPQA 4ON9A 5A03A 4M9CA 1J0XO 1JQ5A 1GITA 5E3HA 5B58C 2IBSA 2IPNA 3EMDA 3PC3A 2R5FA 2HJVA 3WISA 3RVNA 3KYBA 1U2RA 2PT6A 4X61A 1R12A 4UTPA 1MIHA 1PJCA 4L5JA 5JADA 2PSEA 3V4PB 4GNRA 1JFFB 5EUMA 3C2QA 2ZJOA 1YHNA 2OXRA 3G82C 1CZUA 1WCYA 3W6OA 3CLHA 2H5IA 2FGJA 3G85A 4YCNA 2JEYA 3U13A 3TGPA 2OCXA 3WMFA 5JNRA 3IEXA 4AO6A 1W4RA 2QA5A 1JI0A 4O4IB 4YROA 2XA1A 3QTBA 3MS2A 1F48A 1RHJA 2QRJA 2V55B 3JWGA 4MR7A 1RLMA 1X8KA 1LI5A 2ZRKA 3LQ4A 4UM5A 4CM1A 3DXXA 2D62A 3GJTA 4M0MA 3SR0A 3L0SA 1OHHA 2C4VA 3R3YA 5AM5A 3U49A 4PIMA 4DM7A 4ZV4A 4TV9B 2VCYA 3EC2A 1SPXA 3T54A 2BMAA 3BH7A 1QK3A 4PF1A 2D1SA 2AC7A 2PKWA 3GAFA 1I8TA 3PWZA 4RY2A 1F14A 3PQ8A 4MW2A 1FB5A 3SU8A 1GLVA 2NLOA 3W1VA 3PWSA 3NHRA 1JJBA 2O8EA 1QHGA 1M5UA 1UWLA 5IK2D 4QOGA 4X71A 4AUKA 4KR6A 3HL4A 2WA1A 1XZHA 2I8AA 2QUJA 1KY2A 2IXTA 4UQOA 3T3MB 1FVXA 1C7RA 2QZJA 5AI0A 3U31A 2J48A 4PNHA 1MQ8B 2QUAA 3GUUA 4YJFB 2ZANA 1I4OA 3VNBA 4IFBA 1K7YA 1VSUA 1Q0LA 1DFIA 3TRDA 1T24A 3FBTA 3ZZ0A 4RPGA 4TQAA 3SC6A 2GK3A 1D6MA 1TA4A 2AFRA 4L95C 4Z3KA 2WJGA 4HEA6 1DQPA 4JV5B 2RAFA 2GPAA 2PJUA 3EQ8A 4HZUA 4LF7B 3HY4A 4B7UA 2FW9A 2NGRA 3C1TA 1QHYA 3DEKA 4HDSB 1B8OA 3A1CA 1T3HA 4C4XA 1XNGA 1UAGA 5KYWB 3RGGA 2H4JA 3GDFA 3HBJA 4NOLA 4GPZA 3NPAA 4YPFA 3TZKA 2N46A 4H9GA 4IQ4A 4NLLA 2CSUA 4N5LA 3INTA 3SF8A 4KK4A 2VPIA 1LLUA 3WHIA 3MTAA 1R4MB 5E4TA 3I32A 1SBTA 3ZPXA 3O93A 1Z4JA 4QDKA 2RJ3A 1JFSA 2P79A 4R1LA 5DMXA 2WAMA 2NT3A 5C8YB 1QJ4A 4Q9LA 5D3QA 1FNSA 4OFWA 4KBFA 2G9NA 3ZTTA 4DV4B 4RV5A 3I2KA 4MVXA 4RQAA 2RCYA 1DRKA 1DJNA 3JALA 1DINA 2YMPA 4DHWA 4QM7A 1JR3D 4G0OA 4XYGA 3QOYA 4GOND 3LP5A 4L8FA 2YHAA 4QTUB 1DX6A 4Z9FA 1QFSA 3WADA 1M2KA 3WGNA 3KETA 1X70A 3I64A 4LRYA 3CNEA 2B0JA 3LUHA 4EG1A 1BMTA 3I9V1 3JQAB 1BXRA 4OGKA 3LW8A 4P7FA 4Y9UA 3WG9A 3BL5A 1GL6A 2JFPA 2NU7A 1RHUA 2GHRA 1RJEA 5LQKA 1ECJA 4XVRA 4YP1A 4DMHA 3HCRA 2M6LA 1GU7A 2H3HA 3DL2A 1G17A 2W98A 5ALNA 4B7ZA 4G4JA 5FH9A 3KHUA 1MX1A 2PXAA 2X1MA 4U3JA 1NVUQ 1PEYA 1D6NA 1VRWA 5JQGB 4X6LA 4ZQGA 2B7CA 1M34A 4TLCA 1GL9B 5HE9A 1UKVY 5IXYA 4XDGA 2PUEA 2JDID 2NVBA 3DG9A 3FI9A 2QV0A 1G7RA 1AE1A 1RADA 1GCUA 3FWPA 4CT4B 4Z2YA 3JZDA 3U9TA 1R15A 1ICEA 3GFBA 4IMIB 5F78A 2ZDGA 1KHTA 2QPTA 4CF3A 3ZHRA 1CUGA 4M86A 1ORIA 3H99A 2AMJA 2Q07A 1BYUA 3L92A 4B3CA 2DECA 3MJ4A 1FUEA 2VXCA 4CQLA 4U2FA 3PNLA 1NMZA 3CT6A 5FOXA 3PS9A 2FP4B 4TROA 3AI2A 5CU7A 3WYFA 1Z4IA 3ZG6A 1E77A 1N2CB 2BD0A 2ICAA 4AF6A 4D5GA 4JC0A 1E8DA 1ORRA 3HBAA 4PGHA 4G1EB 1HDIA 2C2GA 5TY0A 4AS1A 5KWVA 3JYNA 3NASA 2VSOA 4G5SA 5JSFA 4CV1A 1AV7A 4MARA 2XCLA 3RYFA 4LF9B 1OV4A 2JLBA 2X7XA 4NH0A 1N4DA 4WCVA 1ICIA 3QVXA 5M3BA 3VSBA 4MWEA 3ZNPA 2O8NA 3C3AA 3KXIA 2MINA 3M1LA 2C7BA 3WJ7A 4B33A 1DAHA 1I7SB 1CEXA 4JT4A 4QPPA 1SXJB 3CVXA 4O1HA 4AZ0A 3BRWD 3PI7A 4FGJA 4ZAVA 5BPHA 3HLTA 5JG7A 4NCIA 4EEZA 1GL7A 2Y68A 3UHFA 4EVRA 5KREA 1PJQA 1P18A 1P1HA 4FE7A 2GZDA 3WLTA 1NV8A 2XMRA 3QEKA 5D8DA 1F3OA 3TIFA 3HV2A 1VC2A 1Y3IA 1L5HB 1JG4A 4JUIA 1YVPA 4JODA 3I2FA 2C61A 3RDPA 1G21B 1DCMA 2DYKA 4JR2A 1TKCA 3M9XA 2GZ3A 3EMKA 4QUDA 3RC8A 1UH5A 3NMUF 3M6LA 5E9JA 1SXHA 2D06A 2I7TA 4DXAA 5JCXA 4TTPA 3EBPA 5CFLA 1XQ9A 2V7BA 2VSFA 2HYDA 5A0VA 3UXYA 4N5HX 3JTMA 1IY1A 1VJCA 2CMKA 3DYBA 4MLDA 1CF9A 4QICA 2W6CX 3RHZA 3WWPA 1CQIB 4UCWA 1EX9A 3L6BA 2HY7A 3H9BA 3QEMA 2XCSB 3V2GA 1E2KA 2O20A 221PA 1L8OA 5SYMA 4CKCB 3V8PA 2I5PO 4YT2A 3W5CA 4N5MA 1NUHA 3JX9A 4WKPA 3W1WA 4WXRA 5BUCA 1LQ2A 3JPYA 2X3UA 3KAQA 1GTRA 5A6VA 4B8WA 3Q85A 4LV8B 4MQFA 4OVKA 2OHFA 4D74A 4ZFNA 2WHYA 4L4RA 2I2AA 1MZVA 2X8AA 2BTQA 1QC5B 1OF1A 3UWDA 1GUFA 5T4HA 4QC2A 5J2TB 1G8FA 4FSDA 2PX4A 1Y4SA 2QGNA 3BWVA 4R2HA 4BMPB 5IYZB 3Q2IA 4JLMA 2VK2A 4IV8A 4AY4A 4BU0A 4AKGA 3F6YA 2VKQA 4D3ZA 3LTEA 4JB0A 2BKLA 1KI2A 3CIOA 3T9AA 4ZI7B 1WSDA 2Z2JA 3H5OA 3ICCA 1K0FA 1RYEA 4JJZA 1VSVA 4BP9A 1W30A 1ODJA 1PVDA 1WW3A 2AN5A 3SYTA 1TLTA 4EGSA 1PQ4A 1AQJA 3UXMA 3DD5A 2ZAGA 2Z1MA 2WFLA 2IOYA 2WJYA 2YWJA 4H35A 2GPYA 3W8FA 4H6WA 3MB8A 4XYEA 3L4SO 4QNNA 9GPBA 1KXZA 1NW4A 4IDHA 5T64A 2FPPB 2AH5A 5BXQC 3NT4A 3WWDA 1YZFA 4Q3NA 5BSKA 3QK7A 3QVLA 2VF7A 1L4KA 4MW0A 1QIKA 1QGDA 1YQEA 3CH6A 3CX6A 1GKYA 1PFWA 1H1TA 1G8KA 1T36A 1SZPA 3MBOA 3FX2A 1DBPA 2XOKA 3X2FA 4BNDA 1ISJA 1N7HA 4C29A 4DRXA 4U7FA 4FINA 3ZWXA 3SK0A 1UZMA 2CXHA 2XODA 1Q0UA 1IJKA 4BC0A 3O90A 3IDQA 3EGDB 5JCPA 1OYOA 3VZBA 3RJMA 4LCBA 1P9OA 2I0FA 3OHSX 2R68A 1V41E 3ESYA 3OQVA 2YNMC 4BZWA 1EK6A 1TEXA 2N47A 4ZOLF 4PRZA 5L4SA 5ILGA 5FI0B 1MAUA 4JJ6A 4Q4JA 5KX5A 1K5PA 3K2QA 3HO6A 1V6CA 3L0DA 5ARBA 3MWKA 4ZOEA 3HCFA 3JZIA 1HKHA 2ZP1A 4QHSA 5U4QA 5JJBA 4ZVKA 2R4UA 4M46A 1C8BA 4MS1B 2EQ5A 1KJQA 3DKVA 3ESDA 1PT7A 2VPXA 2WWRA 4LOKA 4YO8A 5CX1B 3X44A 5ECGC 1BNCA 3P2JA 2AFIE 2OAGA 2ZJAA 1L5WA 1NLUA 2AA3A 2ID8A 2TYSB 3I09A 1U2GA 3I2JA 4HSEA 4IDFA 4I3GA 3GDGA 4I5FA 4RKEA 3CPHA 1MO5A 5DXFA 5I8ZA 3WL4A 4EMUA 1SVSA 1ZA2A 4ENTA 3PQ2A 2VPPA 3HA7A 5HCNA 3NANA 2W2MA 4JYMA 4ZVPA 1U3TA 5KU7A 4G5GA 1JSCA 3RFUA 5B1DA 4EYSA 3B1FA 3VGJA 2HSJA 2VVTA 5I5EA 1GGJA 1UXGA 3TZQA 3ZHYA 5KUTA 3ANSA 3FCSB 1DVRA 4GE0A 5IJ9A 2XCIA 2AYYA 2QQGA 3PHLA 2QW8A 1OFHA 2FF7A 3OIWA 5H7XA 1HL3A 3HXKA 2G1JA 4JWTA 3KZNA 3PQ4A 5JY1A 5KU1A 3R0QA 2IYRA 2CWWA 2HWUA 3KEMA 3PRKE 4IV0A 4DMCA 4X00A 1GAEO 2J30A 4DW8A 4K0KB 1ZK0A 4B3GA 2F8LA 4HMQA 4KXXA 4QUEA 4GI7A 2BLLA 4RD3A 3RS9A 1WNTA 3ZE6A 3COJA 2I1VB 1IUOA 1ZNXA 2R6JA 2DPLA 3Q2OA 2WFZA 5IHXA 5FRDA 1PNQA 1QP8A 2Q62A 1BVRA 2FJPA 1N9KA 2BBWA 2RHCA 3K09C 3KU1A 4MZXA 2REBA 4BQNA 3GL9A 5HQ3A 4D6YA 2N1BA 2JCSA 2VXYA 3CKYA 1GD1O 1JTVA 2HU5A 4R40A 4MROA 4R3NA 5B7QA 2PR2A 3KLMX 4D44A 1Y9JA 4DJAA 3HK2A 2QVGA 2BCEA 1KIFA 4MWTA 2O2JA 1XKTA 4AJIA 4NENB 1W85B 1TCCA 3GA0A 4AF7A 1X1QA 4FYMA 1ZR2A 1UK8A 1DHRA 1T0JB 4H3VA 3T41A 1HLPA 2HMWA 1EI9A 1QB8A 2R751 3FFTA 3SZRA 4Y0VA 3HYRA 1H2FA 2JS7A 3CEHA 3PGKA 1XPUA 2YW9A 3JYOA 1EFPB 4KUGA 5FPPA 3V7WA 1EFVB 3U3KA 4MDEA 2XCUA 1RJ9A 1T1IA 2AK2A 3PFWO 5J63A 4EATA 3UT5A 2GI4A 4L8YA 1BU8A 3N2KB 1QV6A 5JBQA 1MFZA 2HMSA 4L8WB 1KYYA 1YB1A 1RLUA 4Q9AA 3KK0A 1DCTA 2BN4A 3PPWA 3IMCA 1O8BA 1G19A 3PZBA 4LC0A 4N18A 4RDIA 3UMMA 2IYLD 3PQDA 4J6EA 2J5RA 3DLCA 4G5FA 5C8ZA 1XP5A 1E0JA 2GZAA 2ZR8A 3IC5A 4GPAA 4XWGA 3SEAA 3WSTA 1ZX1A 4OO3A 4YJKA 1RYDA 1KZGB 1UM9B 2F3QA 2NXEA 2VQ6A 1LPMA 3Q3JB 3LG2A 5JS2A 1P5HA 4A8PA 1CRPA 3T5CA 2XWPA 3FA2A 8AT1A 1TJNA 1DBIA 4LVOA 2W42A 2JGRA 3V6LA 1OXMA 3H5LA 5BT9A 2WI8A 1J21A 4GECA 1P0QA 2YY5A 1QWSA 4TSFD 4LJ5A 1N5LA 3GN2A 1N6LA 5AI9A 3SZUA 3UK6A 4QVGA 1GPBA 1GTSA 2W2VA 2YVUA 1TFRA 4EFNA 2C4HA 1BHQ1 3OKFA 2J1LA 4BMVA 1JMYA 3T7SA 3QUCA 1VL0A 4EKIA 4ZZ3A 1U7HA 2WJHA 3R5XA 5HG0A 5BW5A 1ZD2P 2OUKA 3D02A 2MYPA 4CETA 2FWJA 4MW1A 1KJWA 1ZCBA 4NCHA 4W6QA 1AZTA 4YXWA 3VPFA 4MYDA 4QGSA 1DO0A 4MR8A 3AR6A 4I66A 5I7SA 1XIVA 3VU8A 1ENOA 5HKOA 1HE2A 4J16C 5L3SA 1SG9A 1JDJA 1TU4A 4YV0A 1CDDA 2JZCA 4PIVA 1T1GA 3Q3GE 3SR4A 2ZBQA 2HT6A 1CUAA 3V1NA 2AN4A 4L5IA 1C30B 5ALJA 3UO8B 3VPDA 3WDLA 1JQKA 5HEKA 1NQXA 1YA6A 2QLFA 4MV0A 3WK9A 4RW0A 3OPQA 7ADHA 3PE4A 4WTOA 2GR9A 3VVCA 4QFDA 1EWTA 2G5GX 3OQ1A 1NP3A 2XMQA 3MGBA 4L0DA 3UGQA 2ZR9A 1MQ9A 3SQMA 4C5CA 3IAXA 1DJMA 2QAGA 2CC2A 3UICA 3OEYA 4PYJA 1DXOA 2GJ8A 1C7EA 1E2MA 3VTFA 5JZBA 3VC3A 3ICQB 3C14C 4AECA 4YMTA 1JB9A 1UWVA 1L7BA 4PE5B 1E66A 5EZYF 3R7DA 3K70C 2XOXA 1H5QA 2O2DA 3QX7A 1I6WA 2HOQA 1OYWA 2B5WA 1KAHA 4IH4A 3JQCA 5F23A 5FBZA 5IARA 2PZJA 3M1YA 5KI6A 2IOFK 3L0ZA 3DEYX 3U80A 1PHRA 4WZBE 5ENZA 2XNCA 5K51A 4D3DA 4LS3A 1U4NA 2IDMA 1XAHA 2QPLA 2GLUA 4J76A 3NU1A 3AHEA 3O8QB 4X63A 5JAZA 4D9NA 3VR2D 3HJFA 4QUHA 1JEYA 2AN9A 3H2BA 1T9BA 2BHRA 1J1ZA 2F43A 2CJXA 4HNQA 4OXXA 4BDSA 1P0IA 1Z12A 2ILVA 4MR7B 4S2UA 4XKJA 1I33A 4XUGB 2OHXA 4RMGA 1HORA 2GXQA 4EGJA 4PLYA 1RYMA 5F2OA 5HJ7A 1WBBA 2PYDA 2RHMA 4L4UA 1QIJA 2XUDA 4UHHA 2B8JA 3RUPA 3RHFA 2XE7A 1G9SA 1SHUX 1YS4A 2R86A 2UYOA 521PA 1TO6A 4I4TF 2MMGA 3RT1A 5C1IA 2G28A 2C2WA 1QCZA 1U0GA 1XRNA 2EOAA 2YBEA 4TQ9A 4XUDA 5DW3A 4AJOA 4DEVA 4DFDA 1ZM3A 1G8AA 4D9MA 1SELA 1YVDA 3TLMA 3X1XA 2O8EB 3K0CA 4Z54A 1HQCA 3SXJA 4BHTA 1AH2A 3C41J 3L7CA 3RIHA 4Q1EA 2OM2A 1SVWA 1CUFA 2OE2A 1LX7A 3E2MA 5TPZA 2Z2YA 3KKPA 2DKNA 3OMWA 2X0DA 4D2IA 4ZYWA 4I5DA 3CZ9A 3JD0A 4GWGA 3A1VA 3KQVA 1GV1A 4LCEA 4XOUA 1XXHA 1U98A 4D92A 3A58B 4BWYA 3DEJA 4V38A 4XZ3A 4YP5A 5BMVA 5TMBA 1OOEA 2WIKA 3PXDA 4RVFA 1PK7A 5JNLA 3T94A 4EX6A 1NMXA 3RI3A 4AULA 1Z0AA 1L7VC 2WWTA 4U8GA 4US2R 2WU3A 4EO7A 1UJNA 1LPOA 1U0HC 1HDEA 1O57A 1RXEA 1ZDMA 2I2FA 1FSSA 4HZUB 4XPZA 1R5BA 4YCAA 3VH3A 4ZTZB 2DQKA 2QD2A 5COAA 1TKBA 1BJTA 4ZT3A 4UBIA 4X92A 2HL6A 4S3MA 1G60A 2BFNA 2FPSA 3Q7RA 1P0PA 3DZ8A 4GH5A 5GM2A 2G77B 1DOAA 5FOUA 1U65A 5LLTA 1BTOA 1SWVA 1YDFA 1V4VA 1AZLA 2FSIA 4XX1A 1E3EA 1RWXA 5EWJB 2Z5FA 1Y42X 1EVQA 2P35A 3L8DA 3LQKA 4ZAYA 1GUZA 3SF8B 3KD3A 5AVTA 1DBVO 3ADDA 2WE8A 2JJ2A 4YCJA 3DJYA 1EYZA 1CNFA 3RNOA 1NUSA 1A5ZA 5MHTA 2YASA 2O8CB 5EQFA 3TIGA 4YASA 4HPWA 4EG7A 4EFKA 3ANMA 1A69A 4FUTA 5ALEA 3V48A 1KI6A 3IIKA 1XDZA 1GAQA 1TCAA 4ITUA 1G64A 3LUKA 4C30A 5C51B 2R7AA 2E21A 4ZMBA 1PRYA 1LX6A 4FCVA 1NMQA 1YQ9A 3A4VA 3EWSA 2W6ID 3JALB 4PM4A 4TLBA 3ZDFA 3SICE 1ZJWA 3ZU6A 3R41A 1EWYA 1PVVA 4MAMA 5JSHA 3T35A 3P2OA 3TTWA 3PGXA 4FHDA 3VX3A 4RZ3A 3I76A 2PL3A 1YZTA 2VKTA 2ZRLA 4PHFA 3JD3A 3B1JA 4UZEA 1BMQA 1BXRB 3A6PC 1SOMA 1SB8A 2NU7B 1PV1A 2AG8A 1HSOA 3QHQA 4BOYA 3T7AA 2JRCA 2ODEA 4LOHA 4NZ9A 5FL7D 5J4VA 1DADA 2B69A 5ESRA 9LDTA 1EG7A 3COYA 1G21E 3N0TA 4WAUA 5HGXA 1EFLA 3VDMA 1DTWA 2ZSEA 2ZTLA 4KV9A 1JG2A 3H11A 5H68A 3LRTA 2O7VA 4ZO8A 4U3JB 2FNAA 5F73A 4QRIA 2F4VB 2WTEA 4QPCA 5EKSA 4M8IA 3U4DA 5AM3A 2XGMA 4DMLA 1M34B 4UUOA 3BE8A 4NL4H 4P4TA 2VBIA 2O1SA 4V0LA 1QIEA 2XYGA 3WMGA 1NF8A 2H7XA 1INLA 5EHQA 2GWHA 2WNIA 4FFWA 5LU8A 1Z6GA 4RTSA 4LXUA 2P6MA 5L40A 1E9EA 5AVRA 2ECFA 2YRXA 2OOKA 3IBSA 3IKVA 2J3MA 1YI8A 3LNTA 3DEZA 2XMDA 2W6NA 1DUSA 3BE4A 3NWEA 4ZHQF 5AVXA 4BKPA 4BO3A 1UAYA 2GBLC 4UUPA 3CRQA 3UGJA 1N8NA 2C5GA 3WLIA 4UD6A 1OJ7A 2A58A 3UJAA 1SCJA 3WK7A 4OYLA 4G37A 1YZYA 4FMCB 2FEWB 3LGXA 3OLXA 3W2HA 1QGAA 4CQLB 5JANA 3GAZA 2Q0XA 4NXNB 4BPRA 1HWYA 1C2YA 3DYIA 5ADHA 2P2GA 3A25A 4YRLA 4B3HA 4AY5A 5DP2A 1A96A 1TD1A 5EOVA 3S1SA 4LZNA 4GR9A 2F67A 2YJNA 4IOJA 2H5EA 2IYVA 1EX1A 3BRCA 2Z2ZA 1DC4A 1PWHA 3AF4A 2XWJI 3WKBA 3MAJA 4N40A 2FN4A 2P3OA 4QYSA 3RYFB 3QGMA 1FP1D 2CLSA 4GXQA 1G7CA 1ZK4A 2GK4A 1FTNA 5AKGA 1DRJA 1K6IA 4DVGA 3VR3D 2MINB 5F7XA 4KFCA 4MO2A 3LWZA 3SVZA 4JU9A 4OJTA 3KPUA 1CR6A 3ESBA 5HF8A 3ZXUB 4AZ0B 5F77A 4URXR 4MPRA 1ZO8A 4R8LA 2SKCA 4LYFA 4DPLA 2OL4A 4F2DA 2RDMA 3KFLA 3Q72A 2WHXA 3AXSA 3CX4A 5K4AA 3LZCA 3ZHOA 5M5BA 4DR5B 3BREA 3L43A 2OQRA 3BGDA 3CQ9A 1R50A 3PVCA 4BNTA 4FMDB 2G06A 3C7CB 1E1YA 4C7JA 1ZKDA 2FSVC 4KSCA 4QTXA 2ID7A 3WYNA 4BTLA 4X64B 1DQSA 2PWAA 2C9OA 1A9XA 3DAOA 4AJJA 3DZBA 3SQNA 4I1PA 1WOMA 2N3ZA 4E21A 3G0HA 2MWMA 4UHKA 4DABA 4E7PA 1QIGA 1SKMA 4UTZA 2ZYSA 2GHTA 5ICFA 2GNPA 2Y27A 4WERA 1B43A 4M9RA 2K87A 1OH7A 4FE3A 5KINB 4RDCA 2ZBRA 3EYAA 4OHCA 3SHFA 4TQUS 3NHMA 3H5TA 4WD3A 1TVCA 1GG9A 1TVEA 1DUVG 3LYUA 3RRJA 4P0PB 4FT4A 3V42A 3EEOA 1EK2A 3UWPA 3W2FA 1T6ZA 2H0QA 2Q3FA 3H83A 3A31A 3AV0B 3ZQ4A 1VIYA 3NTLA 3ROZA 1PKXA 4QKQA 2GVNA 1JL3A 5G4LA 4CTNA 4GDFA 1A27A 1V5FA 2I6XA 3PXAA 3RC1A 4MQFB 4CEIA 4PCVA 4R8RA 1RSZA 2MR5A 4HVLA 4HB0A 3ZWOA 1KDVA 4MINA 2BTQB 1YCFA 3FLBA 2D2XA 1G5TA 3IUEA 3HJTA 4YMHA 4A36A 2WTNA 2R6FA 3GPIA 3LPMA 1CF4A 4L9AA 4X1YA 5I7AA 4GDMA 4W99A 1J00A 1GPNA 5BP7A 3KB6A 5AJHA 3PIIA 4UEQA 2IZ6A 1EFHA 1M6VA 2UVDA 2J0VA 3KXDA 5DBFA 3RVMA 3V9PA 4C4TA 5JRJA 1HDGO 3TX6A 2VDUE 1X19A 1T9HA 1SY7A 4PSVA 2QN2A 3BXPA 1WULS 5G0UA 4ZJYA 2IS6A 1WEHA 2GZSA 4B71A 1EK1A 3G7SA 5K05A 2WHRA 4BO6A 4FYYA 3CUYA 2ZUWA 3WC4A 3CW2A 1WETA 2WFLB 3FZEA 1W49A 4H16A 1T8PA 2BDTA 3W6NA 1YVUA 4M1MA 3R76A 4MUYA 1GPDG 1P19A 3PUYA 4HQOA 4JJKA 4YP7A 3DB1A 1X42A 3WLFA 1JDSA 4UJ3A 1UDAA 2AUTA 3D0RA 4MVYA 3Q8XB 4JOCA 5AVWA 4H6XA 4OBXA 3V6MA 1T36B 2R8PA 4PYMA 4AURA 4ER5A 4BNDB 4DRXB 2PJDA 1V2HE 1C8LA 1FDUA 2J5XA 2OORC 4KUEA 1XDGA 1R8QA 2QYTA 1DLIA 4RSRA 3L1IA 4F97A 3WXBA 1W0CA 3MBIA 1L8QA 5JECA 4CODB 1DEHA 2I4LA 4JZKA 3OZRA 3GLUA 4KXQA 3K5HA 2GSDA 4F5ZA 4TYQA 2YXBA 4J0GA 6NULA 3PQ7A 2RKWA 1UXJA 3C3JA 3FSGA 2X86A 2BMJA 4LDQA 3V46A 1IPEA 4DLSA 3DH0A 4Q4JB 1K2VN 3GB9A 4DLUA 1T91A 1XZJA 5KX5B 1LB1B 2HF8A 1YFLA 4J1TA 2WUDA 2H2FA 4H7JA 1BEZA 1GRQA 1TT7A 4OPMA 5EVCA 4DDKA 2IZ7A 1WE2A 3BB1A 4ILKA 3ET4A 3PCRB 3QJ5A 4DMGA 3IVAA 4LECA 2NXCA 2OYSA 2VPTA 2YZNA 2F9FA 3FOZA 1EUZA 2VSQA 3ESAA 2ZUFA 3MPOA 4LFAB 4LSWA 3LKDA 4D3YA 4UUAA 5H9VA 3UK0A 4CIWA 2DETA 1PBTA 1S6YA 3ZKWA 2ZIVB 2PH5A 1E6WA 5LMCA 1O9GA 1G3UA 1K2WA 1QMGA 5IJ9B 1W75A 3OE1A 5B37A 5TQ2A 3QNWA 4WDRA 4D8UA 1G8MA 2YFYA 4KH1A 4Q05A 4KYVA 1FFSA 1G9TA 1JQEA 3I4CA 4JUAA 4QOJA 3R5FA 1WUJS 4C22A 5A4JA 5C7YA 5J58A 3RG8A 5BNFA 4GPEA 3E8XA 3PX3A 1G63A 1QIDA 3TLCA 1ULZA 2CLDX 2NN3C 3ORFA 1SHLA 3GEIA 4H7DA 2NUTA 1S2IA 5CG1A 2H2IA 1VHTA 2GK6A 5DDIP 1DFHA 5DYNA 2WYUA 1L7QA 1UZLA 3RO7A 5HQ3B 1M7BA 4HQRA 1UUFA 1KYQA 3IQEA 3ZN2A 1M6WA 3QLTA 4A8JB 4FKZA 4DZZA 4KEAA 5CVJA 4F7WA 1T6BY 4Q7KA 4HEA1 1PR9A 4YWJA 1JYFA 1L5ZA 3W3AD 4X54A 3KSAC 2H16A 4P31A 5KDLA 2NUAA 4JT8A 3T06B 4MRPA 1Q0ZA 4ZEXA 1N25A 1AA9A 3AFNA 4M1QA 1ZNZA 5D51S 2RGBA 3R8CA 2P65A 1R18A 1XK6A 3LI2A 3MN1A 1XAIA 4G0PA 4E5NA 3E5RA 1FL9A 3Q5EA 4P58A 2VZ0A 5AJZA 2ADOA 4F6LA 1OVMA 2TECE 4UU8A 2VJMA 2H3EA 4H27A 3EDMA 1MDBA 4ARBA 4JJIA 1M76A 3ROEA 3UT5B 2C9ZA 3FPFA 1L8AA 1P17A 2IPAB 5FNVA 2Q4DA 5GMOA 3UXEA 5AQ1A 1ZBDA 4B6OA 3B48A 4OI1A 4YPOA 3JQGA 5EXSA 1XTVA 4DG9A 1HE3A 3F9CA 1GTL1 2G5TA 4MW9A 3UJDA 1GUDA 3PF9A 1NF3A 3IMGA 3IT3A 1SBNE 3AC0A 3FOCA 3PR3A 4FW8A 4BNHA 2GN6A 2PIDA 4PSKA 1PL0A 3GRRA 3PRYA 1XYGA 3EOBI 3LUPA 4C5AA 1OJLA 1WB6A 3I9NA 4QOSA 2V8BA 3OESA 3VZSA 3U6KA 1AK1A 2DY1A 5IXSA 3KQHA 2ZITA 4PZYA 3IHWA 1GHTA 3K53A 2YW2A 3F7NA 2AZMA 1AB5A 3GP3A 3L46A 3WAJA 2R6CA 3E3AA 4NV3A 2ZS7A 2P2YA 4X97A 1XXLA 2CE2X 5CYPA 4CDGA 4H6VA 1SC4A 1XRPA 1FDTA 3MILA 4UCXA 2BMDA 1ZIOA 2PZKA 4TTAA 5CW2A 2PUFA 3DR3A 2WJWA 3FF1A 3UMFA 4M38A 2BEKA 3X0DA 2PE5A 2H1HA 4KWHA 1POXA 5AJWA 4D9JA 4D26A 3KELA 2UYCA 2PZAA 1MO2A 2PVPA 2XT0A 3E5MA 5FOSA 4BO1A 3ELYA 3ZBPA 1SQ6A 2Q7OE 2ENUA 4BCDA 1G5QA 2Y92A 4JB3A 5KYGA 1IOZA 4IQGA 3ZW8A 1JWBB 2YRFA 4CCSA 4G0XA 5F5XA 4M0FA 5T5QA 3DUFA 4JUBA 1PR6A 3LO8A 2GFQA 3ZCTA 6AT1A 2DAPA 1K6MA 1KWGA 2W4QA 2H1IA 1ZSVA 3AM3A 3RTDA 3WL8A 5FWXA 4WBNF 1SKYB 3CY6A 4JDPA 2QAGB 3G5TA 6PFKA 4BPBA 1RWBA 3ZE1B 1EJ0A 2PANA 2PL5A 4L9WA 1BOFA 4R0NA 1XVLA 4BP3A 4FNOA 5HTOA 4YONB 1H8ED 3CTPA 5JWOA 4Z4FA 2JKYA 3IB6A 1KWKA 1B14A 1SIWA 2QE7D 3ROXA 4IVNA 4EY7A 4EL5A 4WLFA 3NS7A 3E9YA 1IIBA 3WLAA 2FG5A 4FOLA 1KOLA 1S8NA 2Z9CA 4BWVA 1FJ2A 4EF6A 3W5HA 3DHVA 1JDBC 1DV1A 2A35A 4RHXA 1DC8A 4RQUA 5ARCA 5BV1A 4RJKA 4OI2A 3CT4A 1CJKC 1WQ4A 3OE7A 1XNQB 2F43B 1NBHA 1W5AA 1ZUHA 3VNSA 4NEHB 2GXUA 4HRYA 1TC2A 3E9EA 3ER9A 4FHEA 4EVQA 1EGHA 3C6ZA 1WPXA 1XZLA 3PGVA 4H1HA 5CJJA 4C4ZA 2EFHB 1IZ9A 2BUCA 1M83A 5EJGA 4OYYA 3UY4A 4CM5A 1KTIA 2A59A 2C7QA 2W0SA 2HRDA 2PKYX 3FUXA 2B61A 3AY0A 4J0IA 4ONEA 1KZ9A 5LP6A 4QO8A 1T0HB 1U3FA 4YVFA 3R6TA 3TF5A 2LP4Y 2IBTA 1ZXXA 1GRVA 2ZPAA 1CW2B 2IQIA 5E38A 4NMWA 5L6LB 1C7JA 1GR1A 2VRNA 4KXVA 3KLBA 5AW2A 3WA6A 2WB2A 3KQKA 1BRMA 1U7TA 2ASVA 4KFUA 1GN9A 1IDOA 4WL0A 1CYEA 4YNBA 3IB3A 2BEJA 2Q9UA 3F5FA 1L7OA 2B37A 2ZGVA 2CZQA 1XXHB 4IJWA 5JQWA 4YUZA 2AFVA 1L4EA 4AVYA 4B45A 5BMVB 2HQSA 2CKDA 1EG2A 1PS9A 3FSJX 1HE1C 4PFQA 4DXHA 1ZRSA 1IH8A 5EIXA 5IULC 1T6YA 3DHWC 5BWOA 1Y3HA 3H2SA 3KEFA 1WU7A 3L4EA 4II2A 3DNPA 4K1LA 3HCDA 5IASA 5T57A 2OCGA 3CJQA 1PN3A 3Q8KA 4QOEA 4ZGGA 5NULA 1L5KA 3ZS8A 3H18A 4KFSA 2Q2QA 1QM5A 3OC6A 5AI5A 1NW5A 4BO4A 3LU1A 4WRRA 5DMHA 4ZT7A 1QZ3A 3NOQA 3L7DA 1Z5VA 3HWRA 3J7TA 4MW4A 3T1HB 1I3CA 2HH9A 5E0KB 4PC2A 5CFRA 1EWQA 2BFBA 3RR2A 1NI4A 4IGEA 4DOMA 3PJRA 1RI2A 3MNFA 4DLBA 2W83A 3CEJA 1YE5A 2GM9A 1J8FA 2C1ZA 3DXYA 2ZJ2A 1KVQA 4JQYA 1IXKA 1E0KA 1E3LA 2GN8A 2CDCA 2NYUA 4KQXA 2GQ0A 4RL6A 2JL1A 4EARA 2G9RA 3GJ4A 3LP6A 4IMJB 4DG8A 5J59A 1EFCA 3F73A 4KPUA 3ZXIA 3TLGA 1KQFA 3C5CA 1JDTA 1QIMA 4EVSA 2OBLA 3V8VA 1S2DA 1L7NA 1WKBA 3FHLA 3HDHA 3TG8A 2Q3DA 1MH9A 1BH6A 4RIGA 2A94A 2OENG 6Q21A 1JNYA 4K26A 1EQUA 1SRQA 1VMDA 2MYTA 4CMEA 4EJSA 4OMFG 3F6SA 1MAHA 2K2QB 3K9QO 2VJOA 5DX1A 3RIYA 1T1JA 4CF6A 2P6PA 5GOTA 4Q7QA 5EMNA 3EIEA 1KTVA 1IUNA 4YQYA 2CNBA 4KXUA 2H4HA 1N34B 1E8NA 2UKDA 2WPNA 5FEMA 1PVOA 2Z57A 5JS7A 1DTWB 1OWMA 1Z7BA 2Q1YA 2WMOB 3QTTA 3H11B 1Z22A 4P33A 3D0OA 2CK3A 1BWSA 2PG3A 1E18A 1WDLA 3HXTA 1W581 3CVUA 1KMQA 3JVEA 1L7XA 4CU5A 2FPMA 1ZUNA 4N3NA 1PR0A 2WVJA 4A0HA 3V1TC 2JLXA 2IIBA 3AHJA 1UPCA 2QRVA 3F98A 3O21A 4KQJA 1SQ0A 2BRUC 2WKQA 4R41A 4RK6A 5DHSA 1BS9A 5HQJA 1Q20A 1TYAE 1NUPA 3EWIA 3K9GA 1RDFA 4GBED 4K6MA 3KUCA 4ARZA 1DTSA 3ZHQA 1DS6A 4EFLA 2DQSA 3LMKA 2F55A 3LX6A 4I1OA 1T35A 5LOVF 4DEXA 3GRKA 4F3TA 4P5PA 1H05A 5TV2A 1DZ3A 2PJZA 1PK9A 5IDYA 4ZCTA 4C87A 1NY6A 2H11A 4QDJA 2IVZA 3STUA 3T1YB 2IW1A 3EEBA 1HI9A 4K6HA 1HNXB 1A4IA 4Z4QA 2IYXA 2J5KA 3VAZA 2VLIA 1KYWA 4N6OA 2QL6A 1C0EA 1VPWA 2FW7A 4ZYXA 1HFWA 4LEIA 1CEYA 4E88A 1EA7A 1TECE 1TUBA 3CUTA 3HSYA 3I6YA 4YJ2B 4C7VA 1AC5A 5ITZA 1BN7A 1RWPA 4FYJA 5F7ZA 1T2AA 2VJYA 2HDNB 2FR8C 4PC1A 3WGZA 1VIAA 5K0ZA 4PBTA 5ILOA 1NXTA 2GAOA 2JK1A 1T25A 1TMYA 2IODA 4D46A 5D6OA 2EATA 3CISA 2FW8A 4IQFA 2BGMA 3E2PA 5F2KA 4E2YA 4PG6A 4DTCA 5FWNA 5HKKD 3AR3A 3H5VA 1RI5A 5EHZA 3IJEB 4D57A 1WD7A 2J9ZB 3ER6A 3AVTA 2HQ1A 4QT4A 4A4DA 2R8YA 4A2PA 2BV3A 4XWKA 1TJPB 2HHCA 2Q2VA 3KB2A 1BJKA 2GD1O 1LS1A 3F97A 2I6TA 2XQGA 3MCWA 1K75A 1BX0A 3WLLA 2EYQA 2NTYC 3KKKA 3VHLB 4EYQA 4ZEVA 1MW8X 3I01M 1NBIA 1YDEA 3WKCA 1MO3A 4DDWA 2ACKA 4HGPA 1TRKA 3A70A 4WNYA 3CEPB 1C3OA 2C99A 3G2NA 4F5DA 3WWEA 3ADCA 1E9DA 5FOVA 3TTVA 4C0KA 3E1KA 3S5UA 1WXWA 1YHZA 2YN4A 4O4LF 3VGPA 5EAIA 1C81A 2AJLI 3PI6A 3N2GA 5EJ4A 1R6TA 4ND6A 1V6SA 1T8TA 3P2IA 5TLSA 2BH2A 2FZCA 2QQ5A 5TQJA 3K0HA 3ENZA 2ZM6B 2FW6A 2AV6A 2QLJA 3A11A 1XBTA 4B3JA 1D2RA 2FX2A 3M0EA 2CZGA 1Y6ZA 3D59A 3KOYA 3ZI7A 4MWOA 5JBNA 1YBMA 4IO1A 5FYQA 3AF3A 4CLEA 4EHFA 2E89A 2IUYA 3B36A 1GNVA 4JYAB 2CVHA 1H1LA 1L4BA 3K4PA 5DEIA 1GVNB 3RFTA 1J7JA 1T29A 2WSSD 2AXEA 1WVGA 1GZ5A 1LK7A 3IKJA 3PP8A 3MMXA 3G13A 4JOBA 4K9RA 5CJPA 3AU8A 2J08A 3MJEA 2XADA 3GVPA 2RHHA 3R3JA 4KO8A 5CLLA 1UJ4A 5BR8B 1KEEA 1Y9EA 4CEIB 2PY6A 2FI1A 4E11A 4KN5A 4LF8B 4XJXA 2PJRA 2VYVA 1JVSA 1ULSA 2KJQA 1B8PA 3BMCA 3GRUA 4X1YB 1BDHA 5EJIA 1B6TA 1E4OA 4WT7A 2GCOA 4G56A 5ETJA 3RRBA 1WCWA 2P2DA 4QDOA 2M6RA 1M6VB 4H7EA 4IHJF 3UB3A 4F2GA 2WQ7A 4WXHA 3AVXA 2XI4A 4JYBA 1BG6A 5CA1A 2I29A 3KQLA 1YK0A 3TJRA 5KNCD 1H42A 2QV7A 1XN4A 2QF7A 4UUMA 1C1DA 4ZQFA 1PX0A 5FKJA 4U9HS 2CB0A 3TPCA 1A7KA 2ON6A 1P4AA 1V5IA 3AP2A 3IPRA 4WEOA 2G6TA 5HJ5A 1XWWA 1HFEL 4XQ9A 3U61B 1RZ3A 3EIFA 1PYDA 3LHFA 4JOSA 3MRVA 2YOFA 4BXOA 4J49A 3THYA 3VSAA 4OBWA 1Z82A 4KZKA 1D0VA 5DM1A 2JIBA 3UJPA 3ZLVA 1EVEA 1V5EA 1Q12A 5AHXA 3W8EA 4D25A 4TXMA 1GSAA 1SU8A 2BFFA 4MWBA 2XLCA 4HFMA 1KK1A 4QPJC 5I7VA 2CVOA 4MUKA 1CJSA 4XW2A 2B7LA 3DZDA 2QRZA 3NONA 1KAQA 4PQGA 3W3AH 3EVNA 4AMZA 3DCYA 3NH9A 3ZE0B 1MC1A 4IWYA 1R0YA 1ZGJA 1KDOA 1BGWA 3FLAA 1Y80A 3N75A 3TSYA 4M3NA 3PKZA 1OYYA 1QSGA 2HF2A 2JFUA 3B6IA 4JVMA 4MVJD 2ECKA 3OO1A 3GELA 3FZNA 4AKSA 4H08A 3EDYA 1KVRA 4GLFA 8ABPA 4JI7B 4KPEC 1MP0A 2D3WA 1U8YA 1TO2E 5ALHA 4IJKA 2BGNA 4P7KA 1JPNA 2VCHA 4RSGA 2ZUBA 1NE7A 3ZLUA 4DG5A 5FFNA 3ZCSA 2R60A 1AGRA 4N3BA 1D4OA 3ZKWB 3B3QA 4J2OA 3TO5A 2R6HA 3L6CA 2HSGA 2C54A 3GJSA 3OPYI 5TQ2B 3N8HA 1UDRA 5A3QA 3SHVA 4JXKA 4F4IA 4E4RA 5HR5A 5THQA 2HA5A 3W9SA 4EQ6A 1FTSA 3DEAA 4QL3A 5DASA 3R7SA 4CEJB 3ZIUA 3AY6A 3OLQA 1E7SA 1GG5A 1U2DA 3TLBA 1PSDA 3KQOA 1C3JA 2ZYAA 3HJGA 1J2UA 5EE0A 1U28A 5AFSA 2RGWA 2WJ3A 1JQLB 4NV0A 3V4VB 2HADA 2NUTB 3GJYA 4TYPA 5DOZA 5B4VA 1G3RA 4WY8A 1XDWA 3E9ZA 4GM4A 3W5BA 5HS6A 3OJFA 1MJFA 1RI1A 1TXGA 2YCBA 3NTVA 4LV5B 1ETHA 5DRYA 5K0LA 2VJAA 2HPAA 4JBWA 4XASA 2PWBA 2YQZA 1WQ1R 1DIHA 2NUAB 2XCOA 1ZSNA 1E1RA 2P4QA 4MQMA 4NULA 4J3FA 4O63O 3EBLA 2PH3A 3GIWA 4N1AA 3M6FA 5JTTA 2IRWA 3P0JA 4J1QA 2CFCA 1JHYA 4U39A 4C6SA 1SBHA 2XR1A 4DBLE 5DWVA 1YA8A 3Q0IA 4N0MA 1PWXA 5DIFA 2BCGY 3RFCA 2YINC 4E51A 1RC0A 5FHRA 1HURA 1ESCA 4QRHA 3WJ2A 3X3HA 1XP8A 3GJ7A 4JVSB 3QUQA 4MHTA 4TKVA 4YO7A 2NM0A 1CUJA 4TLEA 1W36B 2VJMB 4JAVC 3NTOA 4JI6B 4EB6A 2C98A 2NUPA 5EJEA 1DBQA 2JKVA 1JQDA 1UJ5A 4OH7A 3ZHSA 4XDYA 5ALMA 4UXIA 3JQGB 1D0SA 3RJTA 4BFCA 1R8SA 5CCEA 2KX7A 2P3QA 2FFQA 2YV3A 1L5NA 1C7ZA 2ODNA 3FDXA 3IULA 2H85A 1V37A 2N9UA 3NC0C 3P97A 1E79D 1R00A 4KDFA 4NFHA 2PS3A 1KIMA 4QAJA 1U6KA 3FSRA 4XB1A 3K0KA 4B80A 5ESDA 5CBPA 2A4MA 1KI1A 3G68A 1ZNYA 2WD8A 4NRDA 5CYOA 1IM2A 2J9XB 1H0SA 4RADA 4U0KA 4DLPA 4XWOA 5BV0A 1AGPA 2GWRA 2WW8A 3GMDA 2AMVA 5INTA 1CUHA 1ZLXA 4Z4HA 2W6QA 1E1CA 3C70A 1XCPA 4A7PA 3RSFA 3AK4A 3QMVA 5C3UA 2FK7A 5ICGA 3FCYA 2GD0A 3WGJA 4WLVA 3EG9A 1MBZA 2BGLA 3L1KA 2QRHA 2J09A 1DFGA 1JEJA 1J2EA 3DONA 3VSEA 5HRAA 5DLQC 2XYHA 2ZI6A 3KAKA 3L1JA 3MLAA 1RJWA 4ZCRA 2OLKA 4G84A 4BJ3A 5CT8A 1MABA 1X7ZA 3O4JA 3RVOA 3NHLA 5L53A 3SDSA 4J0EA 1YRLA 4JBXA 2EHDA 4CLRA 5T8KA 2PSJA 1FMLA 2C83A 3H1TA 4ZO7A 2IX9A 4R6WA 4AJ4A 5AXBA 5A4KA 1IXYA 3PGA1 3S5JA 5AIBA 4PR0A 4IIYA 4LQCA 1UXOA 4AX8A 5AUNB 1NWHA 2K2WA 1T6XA 2G5CA 1KJNA 3R3ZA 1JLSA 5LMNB 2DU8A 2YC2C 3DUFB 5KVCA 3PT5A 1VJTA 2OA0A 1Y1SA 3UVEA 3QVSA 2ZVJA 3ZUGA 3RSHA 4K9MA 1TW2A 4UVDA 5HM8A 4RJLA 3W8NA 3M49A 5FWXB 5LXTF 3LSYA 3ZXSA 3URMA 1LV8A 4TQGA 3HCAA 3FRHA 3X43A 4BEBA 1T3LA 5EHGA 1WF6A 1OZFA 5EPOA 5KKCA 3SSOA 2PKQO 1OLSB 3MUOA 2RC5A 4FNMA 4YJ3B 1DKRA 3AGPA 4MYCA 3SD7A 1ODFA 1E5QA 3D8HA 3VUFA 3LCJA 3TD6A 3U9SA 1XMPA 3ZVKA 5DTQA 2J9FA 4KJXA 5EZQA 3IFSA 3ILHA 4FSXA 1B8NA 1TZJA 3NIGB 3RYIA 3FCEA 3K0EA 1FCJA 3QUTA 4G2TA 3ZD9A 3L1HA 4EI9A 4R9SA 5HVNA 1QG0A 1RC1A 3OICA 4JSYA 1DARA 4JWKA 3RSQA 4CIXA 1TT5A 1KO1A 2RH5A 2C2ZA 4L1KA 2P5TB 3SKYA 1PFGA 5LD2B 2QBYA 4UZFA 1UIMA 1UKZA 4HWTA 2EWVA 2VDVE 2F1IA 4Y1RA 3TB6A 3VJLA 1SXPA 2R84A 2ZWIA 3HCEA 5IJXA 1ZG3A 3NX4A 5DLPA 1E64A 2FPWA 3PC6A 5AW4A 2WICA 2ACEA 4M6WA 1IJFA 2BZSA 2PHZA 4RV9A 1AQUA 1GADO 1IB6A 4PNPA 1G2OA 3MUNA 3FETA 4J90A 5AD1A 3DAPA 5C5IA 5FLXA 4B4KA 1EP9A 1IRXA 1NW3A 3K4QA 4BNUA 1IAQA 2BGTA 2GF9A 3VSCA 5IDQA 1H4SA 4DANA 1AUQA 2FMUA 3SJ7A 1QCYA 5KDDA 2JVIA 4MWSA 3CGGA 3WNVA 5LP6B 2WTUA 2WSMA 1P72A 4RPIA 1TRHA 2ERYA 2PA3A 2FEKA 3P9YA 1NLZA 3FPGA 4OY3A 4RXMA 2C2MA 4WZAA 4DV1B 3Q8MA 1OH8A 3EA5A 4G1MB 2HJGA 4GR4A 4DQ0A 1H5NA 3CZCA 3B5EA 2BELA 3THSA 4FGKA 1LBEA 3IQFA 3UA3A 4DR6B 1Y3FE 5EZ6B 5HSGA 4RLQA 3FW1A 5F21A 1QTIA 3FIJA 3IE0A 3ILVA 2BFOA 1HDZA 1V7PC 4ND1A 5CDSA 1U0FA 5G41A 1YV9A 2HLHA 3CCFA 1ENPA 16PKA 4U9UA 1GGVA 1VBNA 3DBRA 3GAMA 4PLTA 2G70A 1O4VA 1WBJB 2WK1A 1U2TA 1PG5A 2UZ0A 2FZVA 4J91A 2B3TA 4LYYA 3W5IA 2FVXA 1XRQA 3MINA 1KNXA 4HYTA 3PNQA 4NHEA 3WJ1A 3OQIA 4K9KA 1FBTA 4E6EA 5JWHA 4EMBA 1VI5A 5G53C 1XD2A 3UTDA 4ZK6A 1YB4A 1O03A 2BKUA 2Y1KA 1E0SA 2D2VA 2R8XA 5SY6A 4WK6A 1IZ8A 2V3CC 1E0DA 1PR4A 2VPWA 4X7RA 4ETWA 3IO3A 4A8TA 5LYJA 1SQ5A 1CUEA 3UJ8A 4B85A 2JIMA 3MAAC 4DNFA 4RZ2A 3FKJA 3QKSA 4AZVA 3MT8A 3UQZA 2D1FA 3IUJA 4GVLA 4B82A 2R65A 1XQWA 1LV7A 2WFMA 1ZWKA 3CO5A 4DLWA 2BFBB 1NI4B 1QNLA 4TSRA 5AWFC 3L0CA 2YHIA 1GUYA 3TTUA 3W5DA 3B1WA 3BCHA 4M89A 1DRWA 4LE1A 4Q1FA 3SCZA 2G4LA 3TRJA 4AJPA 1FZTA 1EFDN 4RBNA 1XMSA 1VYHA 5JT1A 4BB5A 2O8BB 2Q1XA 3KQTA 1ZGHA 1SUDA 4WKOA 2GESA 2OVFA 5HZKA 2UXCB 5EJ2A 1UP4A 2DSNA 1NQOA 1Z5NA 4KPUB 4UATA 3UWKA 3TLGB 4F5WA 2IEDA 1KZYC 2VHUA 2C7OA 3SWWA 1RWVA 1RWNA 1VGQA 3AXTA 3CLVA 4L7VA 1RWWA 3UH0A 3TAUA 1WCXA 3WB0A 4LWQA 3VUEA 2Z5LA 2F8SA 1TA9A 4R1UA 3IVMA 5AUPB 3Q3CA 1XTBA 4IG4A 3PHGA 3ZTWA 4BZQA 1MX5A 2D59A 5DO9A 3FPKA 1LC0A 3EQ9A 4C3ZA 5EIBD 4ZO9A 1NUQA 3R23A 3HZZA 3ADBA 3MERA 1LGYA 4L28A 1SR8A 3C3XA 2BH9A 2J6BA 5ES3A 1P4SA 3UT6A 4AUMA 1GGKA 4GIBA 2VHQA 3U26A 1J7KA 1O08A 2OZEA 3OIGA 4INJA 5H4GA 4A27A 5GIPE 1AU9A 1ZUNB 4F84A 1J90A 4ENUA 1SVLA 3JQFA 4CFZA 2E4AA 1I9GA 3O47A 4TKLA 3R74A 2FZKA 3FPHA 1RABA 1NW6A 1VTKA 2P9ZA 3S44A 4E46A 3EGOA 3LDFA 4FKMA 4EFMA 1AQ6A 1AVTA 2EG5A 4HGOA 5EESA 3PLAE 1ZNQO 4ARZB 3LK6A 3EZGA 2E85A 3SPXA 4GZMA 5KTNA 4XIGS 2PX8A 1TA0A 2OV2A 2Y4NA 3PFGA 4FBLA 1GNSA 2YXNA 3CNHA 3FUTA 4CXMA 1P1JA 2YXPX 1QLWA 3ASVA 4LHXA 1A98A 2J46A 3A1DA 3H9CA 3B9BA 3L0IB 1YUBA 4PEVA 3KG2A 4PX5A 4G9EA 2P62A 1S96A 2REXB 1ZVQA 2IXEA 2JIDA 4Y2RA 2B2NA 2R7KA 4RQBA 4TV8A 3FHJA 4N03A 1NN5A 3U7HB 1NASA 2G17A 3C97A 2NP7A 5JEDA 2G83A 3R3UA 5EIAA 4KG7A 2WNSA 4PWZA 1U3UA 2J45A 2RKBA 5EJMA 2FOIA 4G8JA 1OVGA 3P9NA 3B6JA 2NYRA 3IDSA 3NFYA 3LSTA 1TUBB 1PR3A 4ZCPA 5B30A 1N3IA 3B3AA 2CNWD 5ITZB 1OH5A 4YGXB 3SKVA 3DNFA 2R0QC 5DNAA 3OY2A 1WG8A 3FIUA 3O83A 4QGBA 5LA6A 4L73A 4WVLA 4Q15A 1JFVA 1KMMA 2JLUA 13PKA 3QI7A 2YJZA 4OQDA 1S3GA 3BTSA 2B3DA 3OUUA 5LQAA 5J2UF 3NQ41 3G7NA 4E2XA 1K63A 2VJKA 2WUVA 1YL6A 3UAXA 1N3LA 2PUCA 1ZJZA 5HTKA 2MSEB 1Z34A 3D5QA 1E2QA 3KALA 4HB2A 4E94A 3D4IA 2AXPA 3RFFA 2HA0A 5IFLA 5HZHA 1GXSA 5E1DA 2P40A 1Y4AE 2E5WA 1JQAA 3PQ6A 1O0CA 4DQLA 4S0XA 4LF5B 1NJ5A 5IPFA 5KNCH 4R51A 5JQGF 3LPCA 3ZY2A 1C3OB 3OEHA 5JFTA 1MHPA 2PZMA 4JB2A 2CLHB 2YBDA 3KM0A 3QLJA 2Z4SA 4NYMR 4DWJA 3GNTA 4E5SA 1ISSA 3WA7A 2XT9A 3SNHA 3N2GB 1ZOOA 2DP4E 4F1KA 2ZSAA 3O3MB 4MWZA 3MWGA 4LKOA 3T7CA 1HRKA 3T7IA 2D00A 4QGFA 1PZGA 2PS0A 4PQYA 3EVCA 4R7ZA 1AZWA 3WSWA 1QHIA 2J7KA 2Z1DA 2I6QA 1W6UA 1F60A 3V3TA 3IVXA 2IVFA 2AKAB 1DT3A 2C4KA 2Z95A 3OZXA 5EPEA 3RV4A 2G9ZA 1W19A 2OR3A 2QZ4A 2VQFB 2QW1A 1NVEA 3QQ5A 4U63A 2DF8A 3GROA 4FI3C 4ISCA 5EXTA 3E9DA 3G49A 1ZU4A 2OO5A 1QFMA 2NV6A 4G97A 4UQPA 4G4IA 2JEOA 4PGMA 1V9CA 3Q9LA 3GLVA 5CLFA 1KSHA 1KEEB 2I6SA 4F6RA 5DNUA 1CY1A 1KAOA 3MMSA 1EBBA 4WE3A 5BQXA 5ADVA 1CIJA 4B0OA 1WHTA 4BTEA 4C5BA 1AO0A 1ZWLA 3BMCB 6REQA 5IABA 4X60A 2YJ3A 2V7WA 1L4NA 3AL3A 3UK2A 4I9UA 3D5EA 3GGDA 5HWSA 2D0IA 2JIZD 2I1QA 1F6BA 4MVJH 5AVOA 3SJZA 3ENQA 3KWMA 1I0ZA 1FNNA 2C5FA 4D8YA 2OKCA 5HIAA 3N8DA 5DF1A 1P9WA 1IK4A 2PBFA 5CA1B 2DLDA 5KKNB 1W52X 3NIWA 1MJHA 2FFHA 3N05A 5C5CA 4L8LA 3JASB 3NDIA 1NJFA 1SQSA 1CEQA 1C1DB 2L42A 4IFTA 2XXBA 5KWIA 4ZC1A 1EFRD 3OOYA 3KJNA 4YAOA 5A3SA 3GCXA 2CV1A 1EVKA 2PFSA 2WF5A 3HCCA 3H6KA 2WV9A 3FB1A 2GZ1A 4G81A 5JR3A 2G72A 5BW8A 4WY5A 4REOA 4I1VA 4XM0A 1KYVA 2J5QA 2PD4A 5JMPA 2H5LA 1SRRA 4GBMA 2CBGA 3K9HA 3CX8A 4JJ8A 2PEZA 4KAFA 4BXOB 3THYB 2GHQA 2PIAA 2WKPA 3WGQA 1IY2A 3AP1A 3FNRA 4Q9HA 3UW3A 5JOQA 4G23A 4OEHA 1IBKB 2B4QA 2BFFB 3VSDA 2X9NA 2AFHA 2IP2A 2L69A 4MLCA 3TPFA 2VHVA 4HFNA 4YCBA 3VR6A 3U19A 3SHQA 1USKA 1DGQA 4GXRA 1S0UA 3I8XA 1A71A 1YZLA 1RQ2A 1T15A 2QP3A 3ML1A 2OT3B 4PG5A 5CW1A 2R7MA 5AM0A 5IX8A 4EY3A 1FMJA 2HX1A 3DTVD 1DLJA 1KVUA 2YV4A 2C2BA 4KR9A 5DBIA 3I52A 4B2PA 4DCOA 4BUJA 5LBUA 1TF5A 4N7JA 5BPFA 5FTJA 5LDHA 4X65B 3QVKA 4CFSA 2PCJA 1W29A 3EDCA 4Z7NB 2X76A 3QW4B 1L1FA 1A2QA 4RDXA 2XNHA 1E1KA 1IXSB 2UDPA 2W2KA 1N92A 3C16C 3PC7A 1RU3A 1MLDA 1YQGA 2W4IA 2ZUVA 4K7JA 1MVNA 4OAOA 2SNIE 4KODA 1AXGA 4Q3OA 3LOPA 1QOZA 4LW8A 3GFGA 1PYOA 2QGFA 3SYNA 4PCAA 1FUUA 1UFKA 2HPVA 4HB4A 1WS6A 4OQYA 2G1UA 4Y2GA 4Z0NA 5IM4F 1ULBA 1U6IA 3EVGA 3UGTA 2H2WA 4IRUB 2PU7A 4Q37A 1SUWA 2ZBPA 3VDRA 1ZZEA 1TM7E 2BSQA 3ZWYA 4RTJA 1Y6RA 1FF9A 3QTLA 1VXOA 2VO1A 3VHRA 2I91A 1A5SB 3H4TA 3FKSA 1A8QA 3ZEIA 1PZEA 4HX9A 1A50B 5A7FA 1LD3A 2YWXA 3NCHA 1I10A 2XVYA 2QYOA 3GD5A 4MYTA 4BGDA 3KTOA 2H8GA 3U3XA 5A3VA 2X5KO 4YRNA 1QRSA 3AL2A 1SG0A 1W48A 3M8KA 1QHFA 3OKCA 4FNAA 2GJ9A 3C8MA 4BP8A 3QITA 5G02A 5CD1A 3I6ZA 4YJDA 3B38A 1QQBA 1B74A 2C42A 3PDHA 2LDBA 4IEFB 1VLQA 5K5EA 3DMNA 1JDZA 4MVJI 4B46A 3GLFA 1XRJA 3BCSA 1U1EA 2NO6A 4TKVB 3CA8A 2CFIA 2P9YA 4HO1X 2PKRA 1X1RA 2WTAA 4CG1A 2P9EA 4QU9A 4EB6B 3BIWA 5JXGA 5HRUA 4EGFA 2J3HA 3G2PA 1Q0SA 1PEAA 4LZZA 5K6RA 4LPSA 4K6OA 1I2ZA 3U7GA 1LA2A 1KERA 2XDWA 4CFYA 1WB9A 2ZQ5A 3LL4A 4GMFA 5EVJA 1YL5A 1E9BA 1BXKA 4KN9S 4YWHA 4C6HA 1VMEA 1NC1A 3GJRA 1BQ3A 1CDOA 2VDKB 1HMPA 1N4AA 1IK6A 5EQJB 4B7AA 1I1QB 3EEQA 4JLUA 5J9FA 1NBME 4IS2A 4MYUA 2P2ZA 2WJVA 3HHPA 4PAQA 1PJZA 4Y1GA 5JAUA 2Q3EA 1FVFA 1TQDA 2QU8A 3O4IA 4KU4A 4KWCA 4NPAA 3RC3A 1CFZA 5F33A 1UBEA 3J7AC 4YY3B 1E1CB 3JR3A 1XMJA 1ZUIA 1J5XA 4PGGA 1JIIA 1UBKS 2ZIAA 3EG9B 4L5CA 4MS3B 1Z2CA 3IBFA 2QLLA 2V96A 3PDJA 3MOGA 4HQLA 5ALWA 3AONB 2WF7A 2YWEA 2UUAB 1WTAA 3RRMA 1MABB 1X7ZB 3MYYA 4C43A 4MQUA 1DDOA 1A9ZA 4PQEA 1ZD9A 4TL9A 3ZIAA 3FRIA 5F4BA 2DHQA 4N8EA 1USVA 1HYBA 2HU7A 1YD7A 2VK1A 3HBMA 1O0SA 1ZISA 3UOAB 1CJMA 5DNEA 5KCZA 1U2PA 1QK4A 4NWIA 4OQLA 4RD6A 4BQOA 1T43A 2CDBA 5AHRA 1Q11A 3VYSB 4Q7MB 4LY9A 4UUQA 4BC1A 4C0AC 1E1QD 4QLAA 4B81A 1MJGA 1NHWA 4PYNA 2O3RA 1DNPA 2QR2A 3MGCA 3EGXA 1N2BA 3RHTA 3KJGA 1HETA 3L7MA 5EJFA 1PW5A 3CLSD 1EUDA 4Q16A 1I2BA 3CYFA 1QDEA 1OKKD 4CRWB 1HDOA 1YBAA 4G8CA 3QEJA 2OD2A 5CFMA 4HWGA 4DWWA 1EUYA 2ZB8A 1T34A 1AHNA 1PTKA 3B9PA 1I4LD 2IY9A 4KN6A 4BV8A 4DV0B 3CZMA 1ZD4A 2DPHA 5KSYA 2GF0A 2JGFA 3S3TA 3RBXA 2OZKA 2WIFA 4W6ZA 1O4WA 2EW2A 3KVOA 1VCNA 3W34A 3N9IA 1U7ZA 2J9FB 4DJEC 4JL5A 3RYIB 1I4EB 3P9QA 3GVCA 2FZ5A 4IUCS 3HKDA 2BLNA 4ZOAA 4C06A 1S2OA 3WZMA 1YTLA 1M2GA 2EVWX 3TYXA 3J81A 4QASA 3KBBA 5DLYA 3CZ5A 1TT5B 4C0BA 2QBYB 2ECOA 2P0YA 5A4MS 4Y1RB 2FAXA 1PGNA 2AZ4A 2RGYA 4P4UA 3WP1B 5DNYB 4I6JA 4EDHA 3ESRA 3Q9SA 4PYLA 1FFHA 3ABIA 4Y1FA 4NYJR 3IQDB 4BMOB 3PV0A 2VYCA 3CLRD 2R1TA 4U4AA 3GA7A 3GUYA 3H13A 1EJ6A 1YHYA 3DBVO 2HXYA 2H1RA 3HJAA 4PZCA 3F5SA 4AZSA 2ZJFA 3SX4A 3E3OA 2XKAA 4AG3A 1DDIA 3MB5A 4XWTA 1X77A 2J4DA 4MTCA 1Y5MA 4OXYA 4YC7A 3U40A 4BASA 5IVPA 3FPAA 3PRJA 3P4XA 1VSQA 4GX5A 3O3OB 1PJ8A 1V7ZA 3AFGA 5JYCA 1RW4A 4FNGA 3L04A 5JJKA 1JDPA 1L6IA 2NWQA 4HGNA 4B40A 3MELA 2IYNA 1CRQA 1OTXA 1ZKMA 4WZAB 4DSUA 4RD1A 2O8VA 1RLOA 4IZ6A 2EKZA 4MV3A 5DN6A 4UM9B 2UZ1A 1AKVA 2ORED 3TNYA 3ZWAA 2ST1A 1Z06A 1Q83A 4M22A 1UDXA 1VMAA 3QIAA 4C3OB 1KEWA 2XBLA 3E61A 3FHCB 3QY9A 2H1LA 3Q6NA 4WNAA 4II3A 5CA0A 3VYVA 3FGOA 4ROTA 4KBYA 1L0BA 1CSEE 1DBWA 2VUHB 3S2FA 4YI3A 2C31A 1E4VA 3DBRB 5IN4A 3UPTA 3G0BA 3ZZNA 4LJRA 2QTVA 5IBPA 1NR5A 1C0PA 2XUFA 3Q5DA 2CWDA 2OGZA 4UPVA 3EUWA 3BD7A 1OREA 3D2LA 5JXJA 1NYRA 1HV8A 1X9IA 4ND3A 4NSNA 2WJ4A 5TXGA 4EQZA 1N75A 1IONA 2EGGA 2WWXA 3OQIB 2NSJA 4DUGD 5LIPA 4FFOA 4NV1A 4FOOA 1FYDA 3BWEA 1IRIA 1E7QA 1XD2B 2WF9A 3AR5A 1YASA 2WU8A 3C4VA 4IKEA 4J4HA 4LYHA 4DF3A 2E5LB 1A72A 1PUIA 1J9EA 3HU5A 3KZCA 4N7MA 1OBFO 2A0XA 4JR0A 3NALA 1XCBA 4M37A 8GPBA 2GPWA 4J3NA 3SFZA 4WXPA 4XRRA 1ZGAA 4Q9IA 4LJAA 3KB8A 3QKSB 4YDSA 3R8FA 1CDZA 1R0SA 2VCEA 3LF1A 1IBLB 2E87A 2QR5A 3FR8A 4LZLA 4J0HA 1R10A 4RYDA 1D2GA 3TM5A 4TMXA 4ARCA 1RVDA 1CD5A 1J0DA 1H6AA 2DBZA 2YHIB 2IT1A 3BFJA 3CNBA 1EVLA 4HAVA 5A7HA 4K28A 2GOYA 1BAPA 1R0ZA 2N75A 3A3KA 1P5RA 1G55A 4NCNA 3IVRA 4X8OA 2AYXA 4S2EA 1ZD5A 2HRCA 3OIDA 4KX3A 3E3NA 1N2GA 4LHVA 5F3WB 1ZRNA 5JRZA 1Z0IA 1QDUA 1Y4UA 1EIWA 3DZKA 3GCGA 3H8VA 3Q40A 2ATVA 4POAA 1A2KC 2G8NA 1P2FA 1QQ7A 3QVOA 3QJGA 2AS0A 4UBMA 4OLJA 4NNPA 1Y9ZA 5JDIC 3TJZA 1M2VA 4I36A 2PO5A 1CNMA 2M2IA 1SQFA 3UMRA 1QP4A 1PHPA 1WMEA 5DNWA 3SVTA 3ISJA 1YJCA 2F1OA 1WAMA 2ONZA 2CHFA 2X1LA 1NXXA 2R3SA 3UHOA 1IN8A 1S4QA 4Q4HA 5EEGA 3ZLBA 1FTGA 1R66A 1XG5A 2XSZA 3KKEA 3KZMA 4MK4A 1DAOA 3KR1A 4PZLA 1M8KA 1V95A 1YBFA 2C5LA 4OLFA 2XMPA 4CIYA 4FQ8A 1RHQA 1FPMA 3D0KA 5F98A 2OQIA 2Q2NA 3RS7A 3N0WA 1CS0A 4GEKA 5GVRA 1F8FA 1RWQA 1YZVA 2J41A 1YRQA 3H8WA 2D5LA 4V24A 1NI3A 2NZJA 1V8BA 1Y82A 1RPJA 1DIRA 5EJAA 2ZT7A 5DM2A 4ZOBA 1BGVA 2QORA 5FUQA 3QXCA 3UFXA 1E4EB 4O0MA 1M7HA 3FD8A 5IAKA 1SULA 1BCSA 1CY8A 3N7AA 3HPQA 3MTJA 1BE1A 3V2HA 1J09A 1WLYA 3OT1A 3VO2A 3F6BX 3WB2A 5B53A 4RVUA 4IGAA 4IILA 4OUDB 2CJWA 2UVQA 3OE5A 3VZDA 4TV8B 1LBQA 3N87A 2HA4A 1LDYA 1JDNA 2MOKA 3UUWA 3KKNA 1Z63A 1V5GA 4RMJA 4AT1A 1IEWA 4RK1A 5C31A 1M73E 3FFXA 2VSYA 3OHMA 4F86A 3ODPA 5IS2A 4LXYA 5DGHA 4CQMD 4AB1A 1OBOA 4TM8A 3IALA 5DIZA 1NVBA 3FCCA 3DGFC 4QXMA 1HR0B 2J4FA 5CM2Z 3BD8A 5JS8A 3OZCA 2XVXA 4BECA 3ED1A 5LA6B 1JHDA 1QGZA 3AEXA 3CJTA 3SZMA 3NG1A 2GCEA 3WOVA 3WXMA 4UASA 1H8HA 1P62B 1ZONA 2R47A 1MHTA 4FQ7A 4GYWA 4PRKA 5JWRA 4MLPA 4NJEA 1UKCA 1GGEA 5DXAA 5HIIA 3R9WA 5FORA 1AKRA 1E2FA 4B7XA 4WW0A 1TM1E 2KQUA 3KZVA 1NC3A 4Y7DA 3LX5A 4YV2A 4OYRA 2VEDA 3ZIDA 4AU1A 1ZQ9A 1LPBB 2JFZA 2ZYVX 1BE0A 3ONFA 3K2BA 4IDEA 1GXSB 1N78A 1PEKE 3N8IA 3OBBA 2XWSA 1A8HA 3T3DA 4M55A 4K05A 1F8YA 2E18A 3T4EA 4N39A 5IKOA 3V8QA 2FDCA 4J2TA 4LSZA 1OXTA 2QAIA 4QBIA 4DPMA 4E07A 4G67A 5B58T 5IG2A 4Q4DA 3ZD6A 2J9RA 4BNZA 1OW3B 3E7FA 5J3JA 2O52A 3LM8A 5FWAA 1ODLA 3F2IA 1Q44A 4X8MA 4KQIA 2ZS9A 3KPYA 2NZWA 1P1IA 4CMCA 1BD4A 2I6UA 1JECA 2RB4A 3T5AA 1PDVA 2V65A 5DGDA 2OCDA 2Q41A 2C4TA 3DLIA 4JLAA 4ZRDA 4XA8A 3UMGA 1I7DA 3RU3A 8MHTA 2FLWA 1BS2A 1Z4NA 4FMCF 1GZSA 1W0KD 3K8OE 2Q5QA 1K9SA 4Y7CA 4ZU6X 4FDUA 4HDMA 1NMEA 2D1TA 3FUWA 3TSZA 3NYIA 5BQPA 3K20A 2IC5A 1B6RA 1Z5GA 3ZWWA 2WIGA 3ZWCA 1KI4A 1JAZA 4C78A 1DEAA 1Z75A 4KNWA 4M7RA 1C4XA 1C9NA 1WHTB 5EA2A 5FDFA 3U0BA 6REQB 3NZEA 1NURA 3RS3A 1UCFA 3ABSB 4Y6LA 4HFRA 3MC1A 4TTRA 4P81A 4LOLA 1LF0A 3PA6A 2BFEA 3DVRX 3PVSA 4D3XA 4AYWA 2V7EA 2WUGA 1Z8FA 4LZAA 1FY2A 3G79A 1OI7A 1V3VA 1W9HA 4LV6A 4QBKA 1RLIA 4ZMSA 5JXIA 3FYCA 3VHQA 5KWEA 1FXWA 1R0RE 2AOTA 1MAVA 2YWBA 1L6RA 1NT2A 3DPUA 4HADA 4BQSA 5LQRA 1IHDA 5T4BA 5CDFA 4L5YA 4AUNA 2NV0A 2FX3A 4AG6A 3EDQA 4PO1A 2GJAA 3OQOA 1ZQ1A 1CY0A 2J9YB 4BNKA 3TUZC 2O5RA 5CT5A 4YFYA 1PFUA 4DR2B 3EYWA 2J31A 3C6MA 1OZ0A 3OX2A 1ZUD1 4GQBA 1FX0A 4CV3A 1T1EA 5LR6A 1U0BB 3QELA 2B1QA 1NHGA 4X66B 2VS1A 2JAQA 3ABQB 4D79A 3CUSA 2JGEA 2JCVA 1M1YE 5FI3A 4DCVA 1EGAA 5KHOC 2C57A 3M9WA 1WR8A 5GGXA 3SEQA 3TXXA 1JXMA 2VNIA 4F4FA 1X6VA 4RY8A 2LKCA 2AFHB 1WPRA 3IOEA 1M6NA 3GRYA 3LC0A 2VR1A 1VRCA 4GOLD 4JDUA 2R5NA 4F5YA 3VX4A 3QFCA 4WVFA 1XZPA 1M6HA 3TNDA 1SUFA 3LBNA 4EF4A 5LYYA 2VQDA 4W4TA 1YA4A 3NNNA 2HU2A 2Y0CA 2A9OA 3G8DA 3IOYA 3G1TA 2UUPA 1P61B 2VF2A 4XEHA 4F9FA 5B1EA 3I62A 1ZCAA 2NQ8A 4ENPA 2CD9A 3EPKA 3Q9NA 1JHAA 2GASA 3HEBA 1MB4A 3OY7A 4F2WA 5IF9A 5KWSA 3IEUA 4EIWA 5A4AA 5JVDA 1MTOA 2W2KB 1MW9X 1MX3A 4LQDA 1WP4A 2V6FA 4YV7A 3NBUA 2QN8A 4UM8B 4F11A 2VP5A 1K4KA 3WLEA 3AKEA 3DO6A 5L3VA 2FETA 3T99A 4ZYVA 3C7AA 1O5TA 1YZUA 3AJ8A 2YY7A 2XUHA 1RHRA 1R5JA 1QANA 2OCAA 3OFKA 1QTNA 2BSAA 2OMKA 3PR1A 3BM5A 1GFIA 4KCGA 2ES4A 3FI0A 3TIXB 4G8BA 3L8YA 3T0FA 1K6XA 2A9VA 5F1PA 3EWAA 4F60A 5CLJA 4BUCA 1F17A 2JIQA 2PZLA 3VFDA 1P91A 2BP7A 2PUHA 3GPBA 3RB8A 2D3TA 4HNGA 5IVHA 2FEPA 3D5TA 3D9QX 1RC8A 2W58A 1MB0A 3L8ZA 4GKAA 1RYBA 4AY2A 2E48A 4Y18A 2RH9B 4FDTA 2HSEA 3I3SR 1RHKA 2K7ZA 1W4BA 4NPHA 4R3UC 4WV3A 1NNLA 2H1VA 2P9CA 2XGOA 3FMFA 5JYBA 1Z6AA 4NFSA 5T67A 5BWMA 2RHDA 1G20E 2IP4A 3GLFB 4JGIA 5DBHX 3GAAA 3AY3A 5AKKA 4MULA 3WY9A 5BURA 5K8JB 1W4ZA 2EKLA 3E7DA 4PPGA 4EM6A 4F8EA 1QVVA 2DUJA 3EWNA 3UHPA 4NEQA 5B55A 5KC8A 5EE3A 1Q50A 1EIZA 2GTIA 2W6JA 4L4XA 1VP9A 1U2EA 5ALLA 4EY5A 3BWYA 3BK1A 5KNBA 2VT6A 3DKRA 1QTQA 3FTEA 5AKXA 2B99A 4TZTA 2F3TA 1Q2XA 5A62A 4B3BA 3D64A 4CW7A 1RYHA 2ONJA 1LK5A 1GDTA 4Z5XA 3EAFA 3BERA 3EB9A 4EUFA 2LDXA 2Z6UA 2I4OA 5CNJA 2GVZC 4B47A 3ADKA 4TWAA 4BL5A 1ZIYA 5CG2A 5ELXA 1XQ6A 1OWPA 5DHUA 5HDQA 4BIMA 4ZI2A 4R69A 4ZRNA 1ZM7A 5AI6A 2OCPA 2IIQA 3PTLA 1R2QA 1PUJA 4KH0A 4PX9A 3GFOA 2XITA 4ITRC 1XCJA 2BT4A 3T3NA 5TC4A 2RHTA 1Z29A 1CLEA 2H57A 2EJWA 2EL9A 4NJOA 5ECWA 5AR1A 3TLAA 1Z8NA 4RMIA 3OJXA 3DMFA 2FFAA 1CUUA 1IWBB 3SHOA 4D4MA 5FOTA 1CRLA 3UWOA 3QPCA 4MB6A 1WW2A 3T4PA 3SQOA 3WHLA 1AQIA 4AZTA 4D3SA 1Q1QA 1X7HA 4DY6A 4WZAE 4CQNA 1HDYA 1NW8A 1WXFA 3KCQA 3OKPA 4H31A 3U6BA 4NIMA 2ZRQA 1G2QA 3MSXA 2H4YA 4TMVA 1QTRA 1ZCZA 4BVEA 1P6QA 3W6UA 1EEHA 1L3BA 1OFUX 4NMLA 4GLBA 1Z7GA 3BL6A 4FBMA 3RIXA 3B5IA 1XU7A 1YRWA 4FEAA 1G8JA 3ZK9A 1FDVA 4PYQA 2FCAA 2FWIA 3EGXB 3RVRA 1J4AA 3U17A 3ROGA 4N8SA 1IEQA 5IMSA 4TUYA 4LTMA 1V43A 1EUDB 5EIFA 1EFTA 2YNMA 3I53A 1BKSB 4FDVA 3TBFA 5LQMA 2CLCX 3SMQA 2VEOA 1L7MA 5AHKA 2XGGA 2AG6A 1EKXA 2PLAA 1XX6A 4RK0A 4W1PA 2EZTA 3MWYW 3BZWA 5I7OA 4IICA 4DLVA 5GINE 3DOCA 4BFXA 4Z4GA 1L5RA 3NDBB 5M34A 1AY0A 3HKDB 4ZZ2A 1H65A 3AB3A 4RHCA 4Y6QA 4P3OA 3M81A 2FEOA 3G17A 1P4GA 1VIMA 3TMAA 5JNVA 3SC4A 2JJYA 1WXQA 4LY3A 3QVMA 2ZCVA 1BIFA 3B5JA 1P6XA 4A9AA 4O08A 2R1TB 5J40A 4FEYA 4GKVA 5JSYA 3H97A 3ZU2A 1WCV1 2Q46A 5F76A 2R6DA 1Z37A 3A4TA 2BZ0A 3KYJB 3U4IA 4IL5A 4LNHA 5F35A 5FPHA 3WWCA 5DBEX 4QJ3A 2BOVA 1X0XA 3IILA 4HRXA 3DKIA 5MFPA 2G76A 3H86A 1YRHA 3VPSA 2YZ7A 4IXTA 1ZXLA 3H0EA 3IQGX 3DDUA 5I9IA 1II0A 4B4VA 5E3IA 1I5OA 4EPYA 4KITB 3IL2A 3PD1A 3C4QA 4COKA 1E3QA 4DR4B 2AMFA 5HMMA 4HVTA 3K09A 1NX6A 2IHTA 4G5QA 4Q82A 1JJIA 4XGQA 1D5WA 3BHMA 3GVHA 3KUXA 1QXSA 4HN4B 5SY4A 3U7EB 4M88A 2UZ1B 4YAWA 2HXSA 4CEHB 3I61A 3UBTA 3LHDA 1ZC3A 5DZSA 1QYRA 2AF4C 3FNGA 1MT0A 5ALVA 5C7IO 2YXEA 4WNAB 5CA0B 3T5DA 1QRDA 3MTEA 3O84A 5KDOA 1XVVA 1YOBA 4ETIA 2IGBA 4HXGA 2ISCA 2ZYDA 5SYAA 3OZGA 2QTVB 2QRKA 3OMXA 4HPJB 1ECFA 1Z2EA 1WDKA 3HNRA 4HDCA 1N9GA 1KU6A 4GL4A 2R7NA 5KJEA 3UCXA 1O6GA 3C8HA 4OMDA 2PT7A 2JFYA 4TLLB 1TPYA 1EVJA 3DULA 1D3AA 2IHUA 3JWHA 5C8XA 1IY9A 3KAJA 1CG6A 2FG6C 2EJTA