4FONA

High energy remote sad structure solution of proteinase k from the 37.8 kev tellurium k edge
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
279
structure length
279
Chain Sequence
b'AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
publication title Macromolecular Crystallography at High(er) Energy
rcsb
molecule tags Hydrolase
total genus 103
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 4fonA00
5FFNA 3F7MA 1JEAA 3SICE 3WIVA 4LVNA 3DE0X 3DW3X 1AV7A 4MZDA 1KE1A 1TM7E 3LPDA 1THMA 4CFZA 3DE5X 3Q40A 1SCNE 2DUJA 5B1EA 1R0RE 4FONA 1VSBA 2PQ2A 1Y3DE 1Y33E 1BH6A 3HJRA 3GT3A 4WOCA 4H6WA 1PTKA 4DZTA 1TM1E 3VTAA 3A3OA 3DWEX 1SIOA 1GCIA 4C3VA 3TECE 5AVJA 3VYVA 1WMFA 2PWBA 4OMDA 1SELA 2WWTA 3DE3X 1TM4E 2ST1A 2Z2ZA 4LVOA 1ZVJA 3BGOS 1C9MA 2Z57A 4BWGA 4H6VA 2DQKA 4HVLA 1NDQA 2SECE 3DVSX 2GKOA 2SBTA 3L1KA 3DE7X 1GTG1 1PEKE 1NDUA 1Q5PA 1P8JA 2Z2YA 3LPCA 5K7SA 1TO1E 1EGQA 3DE4X 3VV3A 1CSEE 1P7WA 1XF1A 1SUEA 3QFHA 4ZARA 3EDYA 3CO0S 3AJ9A 3PTLA 1KE2A 2P4EA 5AQEA 1TMGE 1YU6A 2IXTA 1ZVKA 4AKSA 1GNSA 1S02A 1Y4DE 1HT3A 1YJBA 1SN7A 1Y9ZA 1P7VA 2PRKA 2V8BA 3LPAA 3Q5GA 2Z56A 1SCDA 2HPZA 4KPGA 2PKCA 1WVMA 5AMXA 3TI9A 5ARBA 2Z58A 3GT4A 1WMEA 1GTJ1 2Z2XA 1C3LA 1Y3BE 3P5BA 1SVNA 2PYZA 2G4VA 3TI7A 1WMDA 2Z30A 3I37X 1R64A 2W2OA 1T1IA 2XRMA 4ZOQI 3GCWA 5AVKA 1WSDA 2X8JA 3OSZA 4WOBA 1SBNE 3QMPA 1S2NA 2QTWB 2ZRQA 1OT5A 1SUCA 1UBNA 4OMCA 3F49S 5JXIA 3EE6A 1GT91 3AFGA 3BPSA 3A3NA 4H6XA 3GCXA 2XTJA 1TK2A 1AVTA 1SUDA 1V6CA 3SQOA 1MEEA 1SUPA 1Y3CE 1Y3FE 1SBIA 2ID4A 3VV2A 1SBTA 2WUVA 4KB5A 1V5IA 1TM5E 1TO2E 4DWWA 1AQNA 1AU9A 3DW1X 3DVQX 2WUWE 2ZWOA 2IY9A 1SPBS 3VHQA 1A2QA 3LXUX 1GA4A 4B5LA 4Z2AA 1LW6E 3T41A 2W2QA 1NLUA 1SCJA 1CNMA 2DP4E 3A3PA 1PJ8A 5I9SA 1GA6A 3UNXA 5FAXA 2W2PA 2SNIE 1R6VA 1AF4A 3CNQS 4HX2A 3DVRX 1AH2A 1EA7A 1KDVA 1GNVA 1YJAA 3DDZX 3ZXYA 2PWAA 3D9QX 1S01A 4C3UA 1SCAA 1T1EA 2W2NA 1SBCA 3I2YX 3WHIA 4NE9A 3I30X 3DE1X 5ARCA 5B1DA 3H42B 3ZXXA 3BX1A 3EIFA 1BFKA 3I34X 4GI3A 1Y4AE 4JP8A 3PRKE 3D43A 5FBZA 1KDYA 1SBHA 4DJ5X 2ZWPA 2SICE 3F7OA 1SH7A 4NE7A 1IC6A 1Y34E 3VSBA 2PMWB 4K8RB 5ARDA 2TECE 1TECE 4YN3A 1TM3E 3DE6X 1SCBA 4NMXB 5JXJA 1C9JA 1DBIA 1Y1KE 3QTLA 1ST2A 1BFUA 1OYVA 4I0WB 4OV6B 4CFYA 1C9NA 4KG7A 3WQBA 1BE6A 1YJCA 3DYBA 5SICE 5CW1A 1PFGA 5JXHA 2X8JB 1GTL1 1T1GA 1BJRE 4CG0A 3WIUA 1BE8A 2B6NA 2W2MA 2E1PA 1SUBA 5JXGA 2ID8A 4J94A 1OYOA 3AJ8A 1MPTA 1IAVA 2WV7A 5JMOA 4AKTA 1AK9A 1Y48E 1SIBE 2HD4A 1GA1A 4M1ZA 1DUIA 4RYDA 1SUAA 3DE2X 1ST3A 1SIUA 1KDZA
chains in the Genus database with same CATH superfamily
5KYYA 5EIXA 1FRNA 5FFNA 3ZLUA 4QDTA 1EFVA 2FY8A 3FNRA 1PE0A 4G5HA 5A3RA 5HX7A 4MI3A 2FX5A 5FV4A 4ZQBA 4II2A 4YDRA 4ARBA 1L5FA 4HXYA 3BYZA 4J0CA 4BNFA 5EJ7A 5A6SB 4YO7A 4NH4A 1EVKA 3AJAA 4G0QA 2YC2C 1M75A 4G23A 2BGLA 2XDAA 2G0NA 1AV7A 2QIPA 3T4UA 3VOAA 1NVEA 3A28A 3FNQA 2XXAA 4EQ6B 4CKWA 1PJ2A 5BN4B 2ZREA 1HRDA 3EGCA 5FWAA 1FRZA 4UZEA 1N33B 4MCJA 1RYBA 4ETWA 3ORHA 1XTUA 3R1IA 3U4DA 3NIWA 4ZJZA 3BXFA 5KTNA 2ZJZA 5LIPA 1FUYB 2YHUA 3LDFA 1E1QD 2P4QA 4TMWA 5EFZA 2GYWA 2AVDA 4FZRA 1N0IA 4MB0A 2JFZA 3DZHA 4EMTA 2JGEA 1E1KA 1YO6A 3NIFB 2GCGA 1H2AS 1A50B 4L0QA 3SAJA 1KZGB 1I7SB 2GJ4A 4DPKA 4JUIA 4Q48A 2YICA 1VIAA 5FF9A 5KYGA 1LJUA 4FNMA 5BXQC 4XYGA 2EP5A 4IJMA 3K1TA 4L2IA 5A6VA 1ZI6A 5M34A 2A78A 3MGGA 1LNSA 1Z2NX 3RJMA 1AQ6A 2YYYA 2GFQA 1DHRA 1Z8FA 4A0SA 3LLSA 1AUOA 3HL4A 3E8XA 4I36A 2R84A 1Z26A 1NMXA 3JYQA 1TADA 4LI0A 4J1SA 3GT3A 4MI6A 1KY3A 2GM9A 4IMJB 5DBOA 3GD5A 2FUNB 3OEEA 4MEBA 4JYAB 2QE6A 4H31A 2QV7A 3C1AA 4QFCA 4BLUA 2OHVA 2R6HA 3ONDA 3GOQA 3DO5A 2RK3A 1U0HC 2JJ8A 2H18A 2P7HA 4KODA 4TWZA 4TMTA 3Q7SA 1M8JA 3UJ3X 1XAJA 1NLZA 5AJUA 1Q1NA 2XQIA 3IE0A 3S1LA 5ALYA 2QP3A 4IG9A 3EBOA 1DXHA 1MH9A 3OSUA 1EXWA 4G5FA 4R7TA 3H2ZA 2PEYA 4HDKA 2X9QA 1HQKA 4WLNA 4OMDA 5AVOA 4G8CA 1QOZA 1JKJA 3DOOA 1DMSA 3RD5A 3DBLB 1P61B 2P27A 1P9RA 1Q2UA 2YC4C 1FVFA 1HE1C 2XIJA 3P9PA 2GJSA 5L9AA 4RELA 3DMFA 3U7HB 2XKBA 4DLXA 1I2BA 1W7AA 3AHEA 5G4KA 5JZMA 4QO7A 4DEVA 1JKMA 3R2JA 1QGAA 1CQWA 1VRWA 4XDGA 4HWGA 2Q3LA 3AILA 1HDXA 2PKQP 3SBXA 2HJVA 7REQA 4HZGA 4XVUA 2R8ZA 1L5YA 1T2VA 1II9A 5AKIA 1Y5IA 1J6UA 4G5XA 3UWKA 2IWRA 4YRIA 4DV0B 3DQPA 3K15A 1IG0A 1W4CA 3IP8A 5C7IO 2A67A 1Z4OA 1EBFA 3IMGA 4RVFA 3PGMA 3H3FA 1PTJC 3NAQA 4PVCA 2BEVA 4KLZA 4QWMA 3K6SA 1O6GA 1Z8HA 3O5AA 4G0UA 2OFWA 4MCAA 5EJFA 2VHYA 1D5WA 1Z0ZA 4PF1A 3S4YA 3BE4A 1BA3A 2DR2A 2WUFA 1E1RD 2FQQA 5IAJA 3TRJA 2HC9A 2J9XB 2QPLA 3GIWA 3OZDA 2ZSEA 4CI0B 3CR3C 3AVVA 4TMXA 4JJKA 4LXIA 1Z3IX 5LB4A 1ZX1A 3QVTA 1JT9A 4UUPA 1DC4A 2AZ4A 2HA4A 5HS4A 5JAZA 4B79A 5K45A 2YVUA 4GMHA 3T3HA 1XZMA 4DJFC 2B8WA 4B3CA 2GWRA 3OAAD 1JAIA 1EMDA 3BOSA 3LZCA 5FBWB 4EUNA 4MINA 3UJ7A 2PR2A 1P7WA 4I3FA 1XF1A 5C8DA 2DT5A 3OUTA 1VPDA 3QFHA 4FYKA 1UOOA 4H3VA 2D1TA 1VQ1A 5CA0A 2D13A 3L0BA 3RE1A 3R44A 1IPHA 4PTYA 1T8SA 2ZBDA 1SD1A 3IVAA 1X19A 2E48A 2P65A 4QRDA 4QU9A 3T3IA 4B75A 4EHDA 4DAEA 4TRRA 3K9HA 5KYKA 3OU6A 5MFPA 1RRMA 2DLNA 3JQ9A 5FUXA 5IM4A 1YU6A 3KD3A 1UMBA 1A8UA 2XE4A 1USIA 2VT2A 4XPZA 4HY3A 2H5LA 4Q03A 1UZNA 4RSGA 1PT8A 4R0VA 1U3GA 3ESYA 4N40A 5D1HA 1KMCA 5DN9A 5L7YA 4EO9A 5CB4B 1GNSA 1S02A 1RYNA 5CDGA 3QBVA 2O48X 5JLJA 4HYYA 4GYKA 2HV9A 3AQ4A 2XE8A 2IV7A 2BD0A 4KYUA 3PUHA 3N07A 3P9QA 1IMJA 4KO1S 2R60A 4QU5A 3OIVA 3KB1A 4NCKA 3FB1A 4G4IA 2IXAA 4TM7A 5H16A 4Q18A 2AYYA 1YDMA 3A1UA 3M1LA 4WCFB 1GG8A 5K5EA 10MHA 2B4QA 2HPZA 5K0TA 4QBFA 2YIMA 3V4SA 3PQDA 4P2GA 1NF3A 3M81A 1LDEA 1QAQA 2BBWA 2CUZA 1RAHA 1YHZA 2VP2A 3EBPA 4O63O 5FQNA 4ZEXA 5JD3A 4D3ZA 4EF4A 3R3HA 1RYYA 4C1BA 1T5DX 2O2GA 1IPFA 4P9NA 1T1SA 3RIYA 4ENWA 3T3OA 3LT5A 1NAHA 4N3CA 4TL6A 4RJTA 2RE8A 4F72A 1A97A 1QLJA 2NQ2C 2W2LD 4F9TA 3HDTA 1I6MA 1K6XA 3L7CA 1OD6A 5IK2A 4FE7A 1TQ8A 3OCUA 4MUEA 1IY8A 4RZQA 5EE1A 5IFKA 5IJZA 1Z38A 3GVIA 5FUVA 3ZJUA 2XODA 3B13B 3OECA 4XVHA 4BV9A 2YWXA 4GH5A 1K0UA 1V25A 1SHZA 3LSTA 4MGIR 3QWIA 4L4XA 1JFVA 4PSAA 5E3IA 4D25A 2P0YA 5JSHA 1HYGA 1JJVA 1WWKA 1ZK3A 5FUWA 1WU7A 1ILEA 4JELA 1QMPA 4DGSA 2ERXA 4RS3A 3DO8A 2EEZA 1YOVA 5DTEA 2Q2QA 1Z5ZA 3V8MA 3N8DA 4M6WA 4F9FA 2VVTA 5MGNA 4F9EA 1X0VA 1Y7LA 5SZHB 3K4PA 1U5BA 1CRLA 2CLKB 2BF4A 4QTXA 4PHFA 3N0TA 4Q4AB 3GUCA 2VP3A 4RK4A 5JSYA 4JUDX 1CUXA 1TJ4A 1EUCB 2C99A 4DG5A 1U0GA 4UOZA 1U63A 5JUWA 3JYOA 1TVMA 4TKVB 5EFOA 3RSOA 4R4JA 1SXPA 2MSCB 1L1RA 2EW1A 3EYWA 3MT8A 3OE4A 4G9BA 4X3PA 1YRYE 5ALWA 4D3YA 2ZIZA 2ONKA 3ZPXA 5BYKA 2F8SA 4LXHA 3RIMA 1COWD 1PWHA 1H4QA 2PXAA 3CUUA 4W5QA 1BCSA 3M7IA 2JI7A 3NALA 1YFJA 3JTEA 1PNRA 4OUKX 3M5CA 2OG2A 4WK4B 3RBVA 3TOZA 4D9FA 4MIYA 1XV5A 3QELA 1EUQA 1IU9A 4HLUC 1TMYA 4Q01A 2O4CA 2IDJA 3IAM1 4B4OA 2HF8A 3BXGA 3DTVB 1FRFS 1H4TA 1RFGE 4WOPA 4RVSA 4Y9DA 4CKBA 2NUTB 2CGEA 4F8JA 3NBMA 2H29A 1XDDA 1CJCA 2CYCA 2X76A 1KYTA 4R98A 2VDWA 2ZJ4A 1D7OA 2C2YA 3NPMA 4QFDA 1JDJA 3QE9Y 2NU9B 1HDZA 4W6ZA 1YFKA 3K71B 2VOJA 1TO2E 2FU5C 3T7JA 3ENZA 3B1VA 4OATA 2GQ0A 2V1UA 5EJIA 1XGKA 2KBEA 1CB7A 1XEXB 2Q45A 3NBZC 2IS1A 1UL1X 5K51A 2ZRKA 3WBKA 1TYZA 1VDMA 3VJMA 5JS6A 3UJPA 2CUNA 2J5XA 3FSEA 3ZDQA 2A0KA 3BMXA 2D3WA 1JSRA 3TAHA 5BNWA 1ENOA 4TTTS 4XTCS 3RAJA 3RJ5A 3SS9X 3IE1A 3LHDA 3C6ZA 2WVGA 5DEOA 3FKSD 1ZIOA 1QWSA 2PT5A 2BHTA 3LP6A 3LS2A 4QA9A 1ZNWA 4UDXX 4D92A 4PZCA 2IE8A 4XOUA 1D1QA 1X3LA 3NBUA 4YP7A 1V11A 4ZK6A 3L4JA 1T3ZA 2MSLA 1CFJA 1XCGB 4X9XA 3VVMA 2OB2A 3DZCA 2J9FB 2QX8A 2OWEA 3CZAA 3QBTA 1CKEA 2AN4A 4D81A 1XU4A 1F4VA 1QCYA 3G9TA 5U9CA 1F51E 4I3GA 5FWXA 3C87A 3R5JA 1P1BA 2HZBA 4OA8A 4R3NA 4AN0A 1EESA 4HH0A 1ZM3A 2ZI4A 3IHKA 3QKIA 4RD4A 4X91A 1AH2A 4Q7KA 3BKWA 4BQIA 3LVBA 3BL8A 1XDBA 4P81A 3VDRA 1LK7A 2GX6A 1NR1A 1GNVA 1WXGA 2FWBA 2IZOA 4R8SA 5LQJA 2W70A 4CL8A 1G2OA 1P1RA 1YV9A 4DRXB 1KU0A 5BSGA 9GPBA 3ZD7A 2D7JA 2LVBA 2FDCA 3EGDA 1W47A 5CVTA 4EO4A 1S01A 2HMSA 1GUAA 4N8DA 1BXGB 3PQ6A 5DNDA 5FTNA 4C0BA 3SQNA 3HNPA 4MW7A 4MIKA 1F12A 3TE7A 1SBCA 3AL3A 4FGJA 3C15C 4AJ1A 3AI7A 3ZBQA 4JI2B 2TMKA 1V41E 2I78A 4LYDA 4DNOA 2BE9A 3IQFA 3DFUA 3O7MA 3AF1A 1W29A 3L3BA 4M8LA 4YGYA 2ADMA 4O2BB 4HT3B 1ID1A 1IDN1 4KR2A 2AR7A 3ETEA 1YCDA 2GPJA 2W48A 4C6RA 1YR7A 3DD5A 4OJTA 3L7MA 3AP3A 3C1OA 3RGGA 1GWNA 3LC2O 2ASVA 2JH8A 3GLQA 3JARA 3D1VA 1U11A 3RSZA 3WDLA 3SCZA 5JD5A 5KNCA 5DGHA 3MWDB 5REQA 4AS1A 1V7CA 3E53A 4DCUA 2XYPA 4XVQA 1Q44A 5GIOE 5JZSA 3WOHA 2Z4RA 2GRJA 1KDYA 3M6LA 1NNUA 1PN3A 4E4RA 2NVUA 3BHIA 5HDQA 3AV3A 1JQJC 1VG0B 3IR7A 5B3JA 4B6GA 2OV3A 3OHSX 3OEHA 1YZ3A 5TRTA 4GBGA 4M0FA 4MKFA 4IICA 3UWDA 1U2GC 4NAHA 5LQKA 2XWQA 1Q7CA 1LFAA 3K0BA 4TS4A 3UGQA 4B2YA 2HRDA 1AKRA 5JU6A 4N76A 3P0IA 5J47A 3IP1A 1R4MB 4XI9A 4YB8A 3KYCB 3MT9A 3GG9A 1CUSA 4PX5A 1BD3A 1OC4A 2GD6A 3KR2A 4MV0A 3GJ4A 2IWHA 3VZSA 3EF1A 5JRJA 2XOEA 4YACA 4JMPA 3RUIA 1BXRA 1DX6A 2O1WA 3N0WA 4PSKA 2SCUB 1ST2A 3ONVA 4B35A 2VJCA 4O2AA 3T3DA 3WL3A 2EHJA 3SEZA 4E2YA 4EGQA 5IZ4A 5K8CA 2ZZMA 4UNSA 4BO0A 1CFZA 2B8EA 3GLFE 4GPD1 2COEA 3RO7A 3PQ8A 3TQCA 3QVSA 4J29A 4NJMA 4ZI7A 3ETNA 3KLOA 4AO6A 3N0XA 3ZJYA 3OLZA 1GV0A 1DLJA 3PQCA 3BS4A 4E07A 5AW6A 2ZROA 5JJ5A 3BQMB 1Z13A 3OF3A 3OZBA 4KPUA 3ULKA 3UMVA 2DWOA 4GGOA 5ES3A 1K4MA 1T26A 2JD1A 2NZ8A 3I01A 4HAOA 4HEQA 4MV6A 3U3JA 1NJ6A 3PBKA 1NZFA 3EZ6A 1UR5A 3GRCA 4IIYA 5KNCH 3WSTA 3A8TA 5HJ7A 1H2WA 3C14C 2AW3A 4P7GA 4X1OA 3U3XA 3CH4B 3OEWA 3WMRA 2Z09A 4ZVUA 2JIOA 2D0DA 1XZJA 2MIIA 4FZJA 3FZGA 4WERA 1FW8A 3IIIA 4DMRA 2BC9A 5AKJA 1FRVA 1RPNA 3AJ8A 3C7AA 4O4JF 4PLTA 3VXKA 4MW1A 3WLQA 4A92A 5DBIA 2PUCA 5ECWA 3IBYA 2P5TB 4MR7A 4LX8A 1N4DA 2D8AA 2WKSA 4MYDA 1I5EA 4BKQA 1D0IA 1S4QA 3PHGA 3TXYA 4ZHSA 1MXFA 1DQSA 4G5GA 5EXDA 4BASA 3PEFA 4AIRA 1W19A 1XTKA 4DLUA 1VIYA 2AK3A 2LXNA 3EZGA 5BY2A 1Y48E 2WLSA 4RQBA 2OBNA 3KB6A 3K9CA 4KJXA 2WMNB 2ZT7A 1DJLA 3FHOA 1KK0A 2YV4A 3H16A 3O0DA 3K7EA 5I7EA 1EE1A 1MOSA 2XHEA 8ATCA 4EH1A 4ZYUA 3KL4A 3DDWA 1J2YA 3VTZA 1I7NA 3G2PA 1M1NA 3K9GA 4TV9F 2ZT6A 4ML3A 4YCDA 4R2KA 3WK9A 4OHFA 1LXCA 3FPFA 1PL8A 3HJTA 2TMGA 4FTWA 5AKZA 4BXOA 3AUAA 1M67A 3V7NA 1BU8A 4IVRA 1DKQA 4N8SA 1CUHA 1I80A 3I9KA 4J6FA 4E1VA 1PYDA 3KTOA 4IAOA 1YL6A 1WO8A 5T41A 2OV1A 5IAGA 1BYIA 3A6GA 4G5OA 4GI7A 1JWBB 1L4BA 3G1TA 2JAPA 1M6EX 2BHSA 3MSCA 1RZRA 2DQSA 4EMSA 2F9FA 1O95C 2GASA 2O2XA 5ADVA 4TWJA 4W4TA 2QSUA 3OI7A 4E5PA 3ZCTA 5SZJA 2GT1A 1WXDA 2QJRA 1B8VA 2VG8A 4ODIA 2ECOA 3A2LA 1HGXA 1XVAA 1XWFA 2ZCVA 3HV0A 4JJ8A 1I2MA 1HQDA 1FFAA 3C6YA 5D85A 3MS2A 5K9ZA 1TTQB 2YV3A 2ZSKA 4OI4A 4JOBA 3WGHA 3ET5A 3Q40A 2IYXA 1B2LA 5C7YA 1Z7BA 3PXCX 4EG1A 5TC4A 3BD8A 2C3YA 1APBA 2JBWA 3I2GA 4CI9A 1BMFD 1RAFA 1TPZA 2ECPA 2HTFA 3C70A 3U1VA 1YQUA 3VU9B 1L0BA 5BOSB 3OU7A 1J5EB 4LZPA 1THTA 1EJBA 3R3SA 5CVVA 4BVFA 5CFOA 4YDHB 1C30B 1ZUIA 1THZA 3GJ5A 1N2IA 1QHSA 3KFLA 4BMXA 2BL4A 3B51X 3R7AA 2JI8A 4CT5A 5EXSA 4N6OA 2IZ6A 5TGTA 1C1DA 1RJ9B 3DMNA 5AXCA 4B32A 1E20A 5JAMA 4EX7A 2WJIA 3IEPA 1K7FB 5DTMA 1FZQA 2X3UA 2I54A 2WSBA 3O90A 2Y0DA 3SM3A 5K0FA 4J8PA 4GR5A 1OGJA 3NETA 4BVKA 3ZIDA 1MW8X 3CEHA 4L74A 4H6WA 3TSYA 4BZQA 1NZDA 1X2BA 3UFXA 4U9HS 5LQUA 5ITZB 1KQ3A 1PTKA 1ZVQA 3CRQA 4LC9A 3EQ7A 4P4TA 4QGBA 3SX4A 3IRVA 5EY5B 3IERA 4FEYA 1WB5A 2PZGA 1VJGA 2EZ8A 3IQHX 3HG7A 2IBSA 2QTFA 3W5AA 2EIHA 3VKVA 1NDHA 1UM9A 5GONA 3L7BA 4E22A 1NIPA 2UZ1A 3ZE6A 2A14A 1KZ6A 2XI4A 2AJBA 3OM8A 2Z2IA 3PPIA 4I19A 4UW9A 3ED5A 4LBZA 3UUGA 2R86A 1IBMB 3RJZA 4JITA 1RKUA 2A84A 3GFBA 5BR4A 3PWSA 3KQMA 1NW8A 1MGOA 2VNJA 3I9V1 3DBVO 4D9KA 1N0VC 2JI4A 3EF3A 5TQVA 4M1OA 1C14A 2W8ZA 3A1NA 2GCOB 3WS7A 1EWYA 3I1JA 1FYEA 1IWBB 2LBPA 3HFRA 4B5KA 4FMBB 5DM60 4YDQA 3CNLA 1ML4A 2M98A 3QVGA 3MJSA 5B1SA 4DLSA 1TPYA 1QM5A 3V1TC 2POCA 2CBGA 2OORA 1HDRA 3ICPA 4EDFA 3ES9A 4YJ3A 4G65A 1UWKA 1WDWB 3ONEA 4YHHB 1U3WA 1QFJA 2C4WA 1TZCA 3DAPA 3THYA 1ZVVA 1JEOA 5JNRA 1FVHA 2NV2B 2XYHA 4Q66C 2Q0SA 1A27A 1SVUA 3CNHA 4J3JA 3IJRA 1EFRD 4AX4A 5MHTA 2K2WA 2IBTA 1BJKA 2C77A 1J0CA 2BCGY 3K09A 3T61A 1O94A 3DBRB 4JU9A 3VPAA 2X9LA 1Y3AA 3PCTA 2FI1A 4OHOA 3KAJA 3R7WA 3CKMA 3WJ1A 2B9VA 2D2IA 3K0FB 4R7GA 4Z53A 1E2BA 3ACCA 3LQQA 1CULC 1AO3A 2VJPA 1VMDA 4NCXA 2UVDA 3VZCA 1A7KA 3THSA 1T13A 3O73A 1A4IA 3OZVA 1G9TA 4JOCA 4C4PA 2YW9A 4NBTA 4UMEA 3BBLA 4XGKA 3IALA 4XRGA 4ZZ1A 4M8SA 2C31A 3N2GA 3TS1A 2BM0A 1R74A 4ZYWA 3WJ2A 1DT3A 4KKXB 1MRNA 4LQDA 2G1AA 2GAJA 2RGXA 4I50A 1K06A 4UVDA 5CGQB 5EE5B 5JSKA 4KTTE 1WA5A 1TO1E 3VR5D 1JU4A 2GMWA 4LYEA 1V96A 3G82C 5T4FA 3P94A 1VHWA 5KINB 1I2ZA 3NHJA 1ZH4A 2PUBA 3D6UA 2XMZA 3HCEA 4MQ5A 3GELA 1ZWLA 4FNAA 4HFMA 3WLFA 2P1DA 5CXUA 1RPTA 1VFPA 3ZDDA 2EFJA 3RT9A 1UBSB 3KZKA 3HABA 2OYCA 3RC9A 5BNIA 3SYTA 1HTBA 2ZB7A 3QF4B 4MARA 2P0AA 4IR7A 2GVNA 1YGPA 3GMDA 1CR4A 1YS1X 1PWXA 3HPQA 5JYEA 1DX4A 1QBKC 1WDMA 1DUVG 1GPWB 3L93A 2JFYA 4R9VA 3M6VA 3GLHB 4XLTA 1ZK1A 1XZIA 5IM4F 1TUBA 3ELYA 4M8NE 2HXYA 1EAYA 4FIDA 1E4VA 3NHUA 2Q1YA 1GQRA 1IBSA 1MAVA 1PZEA 4Q9AA 1VHDA 1NW9B 5DJ5A 5FUYA 4CMEC 2AC7A 3HKEB 5K05A 4RAOA 4GYYA 2VF4X 4WEOA 3KVYA 2G80A 2YNMD 4IS2A 5K4GA 2IQ5A 3FTNA 3HCPA 3PKJA 4IDNA 4L4UA 4MNTA 5D51S 5D01A 2R7MA 2Z04A 1Q7BA 4YC7A 4MDHA 1JFRA 4ZJPA 1GNTA 3HQ4O 4FFBA 1E7YA 2ATXA 1EX7A 1JR3D 2YXEA 3O8QB 1L5QA 3AVQA 3RS3A 5K3EA 2WABA 3OUZA 5EYPB 1Q7GA 3BILA 5U1PA 3S2ZA 2FGKA 3S5UA 4B85A 3BJMA 3ZDCA 2HSJA 3HVIA 4P08A 3L8ZA 2ZI3A 2ZBQA 1NPTO 4ZPXA 4KBYA 3H5RA 3KSMA 3NTUA 4JQSA 3A9UA 1AM4D 2P6PA 2CMFA 2ETXA 2PKCA 3VKUA 3GVPA 4N5MA 4AYWA 3W06A 4EF6A 4J0DA 7ADHA 3GNTA 4ENVA 5HUQA 1QQBA 4TYYA 1ATZA 4X8OA 5E7MA 1GQ2A 2IE0A 3NHWA 5ARBA 1XTSA 2Z58A 4Y6LA 3LKVA 2YJ4A 3ZWNA 4AFNA 4CF4A 1KSFX 4XEHA 4WZBA 4DL9A 2IX9A 5H4GA 2GBPA 4BRWA 1NVUQ 3BCUA 3MFQA 1Y3BE 4QPDA 4X7BA 4JI3B 4YAOA 5I9MA 3EFOB 4OI1A 3Q0TA 4GICA 3TFQA 5IC4A 4PU0A 3MJ4A 3BRWA 2GFHA 4HRVA 4B3BA 1L7DA 2VH5R 5AK5A 1HDIA 1ICIA 3BXXA 2WFZA 3ITKA 4X6YA 3V97A 1Z6ZA 4LXTA 3CH6A 2G9VA 4NV3A 4RE6A 4ZRNA 2XLCA 2Y99A 3NGLA 5EJAA 5DNVA 3QH4A 3UBMA 3RV4A 1G5RA 1LDBA 3EEYA 3IHWA 4AZ3B 1RQ2A 2WILA 1RWPA 4X63A 5F7JA 1KMHA 4F4FA 4ZWNA 3JCZA 2DR3A 3NDRA 2BGTA 2BTQA 2FEOA 1DCKA 3IEKA 4ZVRA 3CUKA 4CKCA 3DL7A 4XWTA 4N5HX 5CDUA 3WA7A 4B4VA 3FTPA 3NMUF 3D3KA 1P73A 1U2RA 1M74A 4KXQA 1OT5A 2C29D 2Q0XA 5CDFA 2Y76A 4AX8A 4BAZA 2O2EA 4YV0A 4M9XA 2C88A 5J40A 1H22A 2AG8A 2OLEA 3JQ7B 4GPTA 2H1WA 4K8OA 4OQLA 4BAGA 5HJ2A 3L0IB 1ODJA 3H65A 2WKWA 1UK7A 3ZHBA 1A9XB 3ZK7A 3VR6D 4TLBA 1LBQA 1AHPA 1JKXA 1FNSA 1XLWA 2WYVA 3AFOA 3GPDG 2XCUA 2PZMA 4DOMA 2X2OA 3KYDB 1Y42X 4JL8A 2GTPA 1M2NA 4QFMA 3G0DA 2BFPA 4RM3A 4C04A 4L9RA 5DYTA 4EYOA 1KVSA 4JBXA 3KKKA 2C5BA 1UANA 1KI9A 2G06A 3C74A 3GLKA 1Y37A 1B2RA 4PEVA 1DG3A 3OQPA 3U7IA 3EQZA 4H3SA 2P6UA 2F3TA 4DY6A 4CV2A 3G88A 2H9AA 1MX5A 2ZTLA 2FX3A 3L7KA 5LA6A 4I4LA 3GV0A 4O1HA 4YFVA 4ZQEA 3WBFA 4J75A 5K7SA 1GPKA 3GEMA 5JNVA 3KHUA 1REQA 3GFFA 4BTLA 2MMGA 1MEOA 2I8AA 3P9NA 2HLDD 3M83A 3WMXA 3WYAA 4BLOA 5AVZA 4BU0A 2FWPA 2HPVA 4WQMA 3QLUC 2F48A 1V0JA 1XKLA 4BE9A 2XX3A 1BYUA 1MCZA 4UHDA 2CMGA 3TNYA 3L1IA 5BSKA 3VC2A 3CF6R 3OMWA 4C4SA 1N25A 2V7VA 1YQQA 4NE2A 4A03A 4RAQA 3Q85A 5A6SA 1ZJ5A 2QD2A 1IN8A 3AB3A 4IH9A 1N3IA 1C7RA 1T9KA 1ZSYA 1W0KA 2BJWA 5HOQA 5HZGA 5BUZA 5JMPA 4AG6A 1OVGA 3D7SA 3DXFA 5DXAA 3BQ9A 2HMTA 3DAGA 3OLQA 5D7NA 4EQ6A 5JNWA 5D87A 3ZY5A 1V16B 2YXLA 4JI5B 3FF4A 3E70C 5BN4A 3WWYA 5JC1A 1YB4A 4M98A 2J1LA 3O3NB 3A6DA 1MDFA 3DQZA 3P5SA 4FJ1A 4R1UA 2AX3A 2CJWB 3Q0IA 5C1PA 4YPFA 4HFJA 2VYCA 1YD7A 2GNAA 1NLUA 1TQHA 2YY7A 2G25A 4OAPA 4ZQHA 2X5KO 2XF2A 4WXMA 1T36B 3ZX5A 2J7PD 3TQTA 2VWHA 4RNCA 2WYWA 4JBWA 4NATA 1FXSA 4NLLA 2G4LA 2OVBA 3ZHYA 2Y1FA 1M2HA 2AI3A 5CT6A 3UWSA 1L6RA 1MC5A 1GL7A 1CY8A 4KVFA 3ROXA 4HX2A 1W76A 3EEQA 1ZGGA 2XYGA 4HDSB 3BDVA 4UBOA 1AXGA 1EFUA 5HG0A 4QTTB 4XCXA 5SYNA 4YRKA 4JFRA 1CCWA 1WDLA 3DDHA 4L16A 3RSLA 4CIYA 1KFJB 3ZXYA 1HG1A 1V45E 2EKDA 1PO7A 1W96A 3DEZA 3EGOA 2C0CA 3H84A 2E55A 1YS7A 1KEEB 3D9QX 2UVQA 4PZAA 3YASA 1CDEA 1V8FA 4LDZA 4NWIA 2HWWA 4TSFD 3AY7A 1RLUA 5EEHA 2ZXUA 2NZ2A 2JGRA 3H75A 5LP6C 2WWXA 1YHNA 4AS2A 4EEKA 3MGBA 2GHQA 2R2GA 2I1VB 3IRUA 4RCVA 5C8XA 2XUIA 3G7UA 3HB7A 4XR4A 3QU7A 1ZEMA 1KI2A 3UMBA 1A5SB 1C4XA 4L57A 1L5LA 1BXZA 2VEOA 3ZD9A 3WR5A 2QU8A 2EOAA 3TJZA 1MHTA 2GEKA 4UU8A 2GEFA 3DBLA 4UM7A 4LYFA 2LCFA 3ASVA 5HRCA 3ESXA 3TQHA 3OF2A 4ER5A 4O2RA 2ZRAA 3UMJA 4Q3BA 1K9SA 4HNRA 1A0OA 1PS0A 2JIMA 4DAOA 4DA0A 4DXHA 2Z08A 5IF9A 3D43A 3PFKA 3OX2A 4OB6A 2V3VA 3PFGA 4HAVA 5BSHA 5HVNA 3F4BA 4FP9A 3OQMA 4NENB 1P1CA 1CR0A 3K35A 3PQ2A 3ZIUA 2FJ0A 2GHIA 3CX8A 3FFTA 3I58A 1NZJA 4MQMA 2ZM6B 8MHTA 3MQFA 4KVZA 1A5AB 5ARDA 3KWJA 3H9GA 1PUJA 5DP1A 2YRXA 4I81A 1UBUS 4HJRA 4PGMA 4XDZA 3VTKA 4ENSA 2YBEA 5KTKA 3F74A 4MRMB 2KLHA 4EI8A 1DEKA 5TY0A 1FS4A 4DZRA 4IWYA 2ZJ0A 3HJUA 4BGDA 2PV7A 3SC4A 5HZHA 3UWMA 1UDXA 2XVYA 1WLSA 3OUUA 4RPIA 4QGGA 1KY5A 4ZJYA 2XBMA 4R16A 1FTNA 3D6TB 3HH8A 2GZMA 2R5FA 3CWZA 3OIDA 5F33A 3WGIA 3K4QA 1X2EA 4IKPA 1WXQA 3FXAA 4JWKA 4OV6B 5I7WA 2FXVA 1M3SA 4UMFA 1KH2A 3AY3A 5EHIA 1N0WA 1G5TA 1V47A 2NQ8A 2Z43A 4NIMA 2VNAA 4R1OA 4O4LB 3BT7A 1BFDA 4A27A 3JQ8B 1JDZA 2AMJA 3T3GA 2CBXA 4MLZA 3ZI0A 1EFTA 2VNKA 4I1UA 4NS1A 5DP2A 2ZTMA 1LBSA 4XQGA 1ZK0A 3ZYCA 5SICE 5JYDA 4JR2A 4OY3A 2GAOA 4IHAA 1HKHA 2H48A 3EIWA 1P60A 1Z34A 1JVBA 2XMCA 5HS6A 1ISSA 3VO8A 4C0QC 2G4CA 5DYWA 1JBEA 1ZRMA 3KKMA 2ECKA 4LJRA 4YRGA 2QUIA 1JXOA 3VJRA 1J23A 3M4NA 4QUJA 3BIWA 1NNSA 3TQQA 5JAPA 4AN4A 2QQFA 1IAQA 1PT5A 5KOIA 2HMWA 2DFVA 1DX9A 1XVUA 4LSGA 4QQNA 5DDIP 5JCJD 3I6ZA 2H2HA 4R1PA 4QDJA 2C7PA 1MDBA 2H1SA 2WV7A 1FDOA 2YIVX 2VUSA 2J0VA 2YZ7A 2ZT5A 4DMGA 2BBSA 1EVJA 1D6MA 4CCAA 3ZJ4A 3DO6A 3GNSA 2FR8C 3SLRA 2DUWA 1UBGA 4KQ1A 5CB4A 2AE2A 3ZDYB 4L85A 2NQTA 2FW6A 2FETA 3AF3A 5DZSA 5F7ZA 3P27A 3ZWVA 1YE5A 2VQEB 4A1FA 3KQHA 2A3NA 4DV4B 2JJYA 1XRQA 1JHXA 2K4MA 1H0HA 3KUDA 3O2SB 3H1GA 4OOFA 1ACMA 4GMFA 1KK3A 3L9WA 4M9RA 1M1YE 3AVYA 4EJSB 4ZP1A 1D09A 1MC4A 4WCFA 4ZK2A 3U9SA 1XA3A 2HLNA 3QY0A 1L5KA 5HM6A 2P9HA 3I23A 3B2NA 1NVVQ 2BM1A 2PUFA 2ACKA 1L5GB 1ZIXA 2WPDD 1URPA 2Z3ZA 3QMWA 1JFFB 3MCTA 1ZUD1 4RH3A 4UZFA 5I9IA 4EHAA 4MMZB 3F7MA 3M3DA 4P92A 2AQHA 2OYRA 1WCIB 2J9RA 1DOZA 4LZZA 4WXEA 4J91A 1BC5A 1G8PA 1L7VC 2EW8A 3HWSA 3Q5EA 4DT1B 3CX4A 5AKEA 3G7NA 4R0NA 4Q1EA 4KFCA 2AG0A 5AI9A 2HI0A 3CF4A 2KE5A 3TOVA 3WIVA 5TPZA 1Y1TA 4OX9B 1XZBA 2DT8A 1H1LB 2HWUA 3TW6A 4X6XA 1AZLA 1P31A 4H0NA 4NG4A 4NRDA 4D3DA 4D46A 3H5WA 3IMEA 4MVYA 1J56A 4OSOA 3P9ZA 1XZLA 1M5TA 2JLCA 1JDPA 2PU5A 3G3EA 3SSNA 1HYQA 1IIRA 5DM70 2FSIA 1ZUNB 1OFHA 2OCXA 4UTOA 3CHYA 4CM9D 4TXHA 1CQPA 1XXLA 4PR3A 3TZHA 1DC7A 1J33A 4O8CA 5ERXA 1NG1A 1KIMA 2PAFA 1GRVA 4RACA 1MVLA 2D74A 4QREA 2RK6A 1PGNA 1LPAB 3EVEA 4MEAA 1SK8A 4YGXB 3ICCA 1JT2A 5LDHA 1EP3B 4P0QB 1GZSA 2AXPA 2C5EA 2V58A 2GXQA 3O38A 1ISHA 2AI1A 4LRWA 1U0JA 4WE3A 2JFBA 4Q4AA 3UOGA 1RHMA 4EBFA 1I0LA 3WSVA 2J87A 2JDID 3IV9A 1EUCA 4LZNA 3A58B 5I6DA 4IOJA 4GOKA 4TKVA 2ZM5A 1TAGA 4EGJA 3Q5DA 1U2DA 2Y93A 2H2WA 3DAOA 3OZGA 1B14A 1DKLA 4JLSA 3L01A 4B80A 1Z2OX 1QANA 5JZ9A 5AJVB 5ESWA 2IH5A 2JNWA 4H7JA 4O3FA 3U7QB 1QX4A 1TJPB 1CS4C 3HKDB 1OU0A 2Y66A 5TQJA 3VDNB 2JVJA 2DMRA 3GG2A 1KMMA 2X0FA 4URUR 3VC3A 2O23A 4JBYA 4U7GA 4Y6RA 2C1ZA 1TMOA 3A3OA 1U5AA 3KZXA 4GUDA 4JEHA 1O89A 3DOIA 3EK2A 1LV7A 2AE1A 1PZGA 3I73A 3LRXA 5JNLA 1PDOA 1PV4A 5GIPE 1BD4A 3DM9B 3DTVA 4HWSA 3PIRA 3KJIA 2OXFA 2D2FA 3GO4A 1YCFA 3M6WA 1Z8NA 1WMFA 5K8VA 3QLJA 1M2KA 1IBRA 2NUTA 1XVIA 2DQYA 5AHWA 3LDAA 2VS1A 2DY1A 4RCYA 3VVBA 2Z5GA 621PA 2FEAA 2LKDA 3GBSA 1OFUX 1U28A 4QELA 4LIPD 2NU9A 3AETB 1KYVA 2Z0MA 3T3MB 1ES9A 1YWGO 2PKRA 4EUKA 4RTJA 2G67A 2VTEA 1ISGA 4HGRA 4NDNE 2Q99A 4ZYXA 1OXMA 2R1VB 4DR2B 3W3AA 1XEXA 3UHPA 4HLQB 4M1TA 2H07A 3G49A 5DEIA 1RJDA 3FNBA 5LQCA 4BAUA 1WXEA 1WHTB 4YCSA 1M5RA 5AJYA 4F2WA 1Y4UA 2XQFA 3SWWA 2XVXA 5C8YB 5JANA 4LYJA 4HUQB 4IVQA 4BFXA 3TMAA 1EP2B 2JF0A 4JXJA 4DGQA 3WLNA 2ORED 4PX9A 3G85A 1VLVA 3ANYB 1P7CA 2AZMA 1MAAA 4ZXPA 1HT0A 3TTUA 3QUBA 1BWSA 3RANA 4LJ4A 3PC7A 2FPIB 4B3IA 5KNDA 2IHNA 2OO5C 2NOAA 1F0KA 3E9MA 2WAXA 1AE1A 4F7WA 5HP4A 1FFHA 5A0TA 1S8AA 1W5BA 2J9FA 2D5LA 1QIEA 4AZ0B 1R8SA 2WSYB 2NO0A 1NJGA 4NH0A 4F85A 1L5OA 1K98A 2RBEA 3RSSA 2QLLA 2RKWA 3E4DA 4G5RA 5A3JA 3NNNA 1JA1A 4BWVA 2FZCA 3EAGA 2NUBA 3EASA 1E8NA 5BN1A 5J4HA 1E7RA 5CYOA 4EPVA 5A1JA 1JR3E 2V6GA 1RKBA 3VV3A 4B3DA 5IWCA 1K63A 1NKTA 5A1TA 1ZH6A 3TW8B 3ECSA 4DRXA 3PRYA 2NO7A 2WKRA 4Q9NA 3ABSB 4UUBA 1K8XB 2GR9A 3L1JA 2W11A 3N8GA 4YA6A 3S27A 3SX0A 3VX4A 6NULA 5G3YA 4XTRA 4ME6A 2G9NA 4LPKA 5CLIA 4PZEA 4LF7B 3OMLA 3QEBZ 4LYHA 1AS0A 1BXGA 2DTDA 2GEDA 1VG8A 1W6RA 3M6UA 3W5SA 3ZR4B 2V55B 1OY1A 4EGFA 5DGTA 3W3AH 2OSVA 4HUTA 4LRXA 5FPYA 4K28A 2BGWA 3LM8A 3KJFA 1W5EA 5KVCA 2IYEA 1J0XO 4R8RA 2ZZKA 2QJTA 1A2KC 4O2BA 3ERCA 4NFYA 3OCCA 2AXQA 1GG9A 2BF7A 3TG2A 2HBQA 2RHMA 1CJSA 1I8TA 2VYQA 2WJZB 3HA3A 4L9WA 4KUEA 4MV1A 3I0ZA 3MIIA 4N39A 4Q3LA 2W22A 1YDGA 1JAXA 3C5VA 5EMLA 4BNVA 5I8PA 3ZW8A 1RJEA 4KCGA 3W4IA 3BIJA 1FYVA 1ORRA 2P3LA 4KAXA 3MWDA 3GLTA 5CYPA 1Z7EA 4I8IA 4GR9A 3B1FA 1QGZA 4L7QA 3CQ9A 3EVNA 1EH5A 1O5IA 1J90A 1D4FA 1QHHB 3C8MA 4WK2B 4YX9A 4P4GA 1W85B 1EIZA 2H17A 4HNVA 5KNDH 3SZLA 1F8UA 3MZ0A 1Q7TA 3W79A 1EP1B 1KFEB 5GGYA 5CNKA 1XVLA 2JA2A 5IKXA 2O06A 3TOXA 4NU5A 4DSTA 4BS9A 4NSNA 3CZPA 3R3JA 3IO5A 4F60A 3DZFA 1VTKA 2FSFA 1L5SA 1OPXA 1R4MA 1JRLA 2DTXA 2EGUA 1Z5PA 3B6JA 5HHTA 5IK2D 3FTEA 3QENA 3UWPA 3KYCA 4DRYA 3RK4A 2GVZC 3GT4A 4JDPA 4FEEA 3KOXA 3L46A 2OK7A 2I6SA 2X3YA 4BX3A 4QSMA 2PYIA 4BZXA 3BJRA 1RI5A 3D0RA 3DFKA 1SD5A 4YJ2B 2SCUA 3P5BA 1L5WA 1QH9A 5DNAA 2C4NA 2FDRA 3MCAA 3GJSA 4M38A 4J4TA 5C4IA 5ICMA 4RSRA 1RPAA 2Q9CA 3KAPA 4Z49A 5KHAA 5KTYA 4BN5A 5CX4A 2XA1A 2I4NA 4UCFA 5EJMA 3WXBA 4DQLA 2INGX 4Z7OB 5DLEA 3RVPA 4H7IA 2O59A 4OK5A 5LKAA 1QIIA 3IHLA 2M6KA 5BQ3A 4XJXA 1W48A 4NZNA 3AM1A 1AIPA 3GJ8A 4O59O 2I7TA 2X9NA 1FJXA 1ESDA 4KO4S 3UB2A 2IP2A 4MW2A 4B71A 5T4HA 3ZWAA 2V4MA 3BWEA 3EH2A 4H7FA 2RARA 5BV0A 2ZVQX 1S2NA 3AUTA 1SGWA 3IJPA 3M49A 1I7PA 2YFQA 2ZRQA 3QMPA 4P83A 1XPJA 5PGMA 1XMIA 2D5AA 3O8BA 3AHFA 2R0QC 3ZJTA 2EU8A 2XSZD 1RKVA 3BD7A 3HL0A 1YVPA 4J2OA 3LA6A 2PPVA 4R0MA 3ZHSA 4NC9A 3H4MA 3K2BA 4ARSA 2LW7A 4NXNB 2Q5LA 4ZPJA 1GPNA 1YC5A 2EAUA 4IW3B 3EE6A 1BEZA 4MGZR 1FY2A 3VKWA 3WJ7A 1P0FA 2HHCA 1D6SA 3HPRA 1DAKA 3TCNA 4BO9A 2GWHA 1DXYA 5H3LA 2OV4A 3JV7A 1E3DA 3AGPA 1C7EA 1CYDA 2FFAA 2O2CA 4UVHA 4TT3D 5BV7A 5A03A 4HX5A 4PYLA 5AKLA 5A04A 5IDYA 4BY9E 3SQOA 4H6PA 3H83A 1ZHHA 1Y3CE 2PKQO 1WZNA 3B9QA 3QE4A 4AVYA 1P0IA 3NTRA 5LA6F 4CIAA 5I4IA 1JLKA 2YW2A 4B6PA 2OCIA 4M54A 5H82A 4GNRA 3RVKA 4A82A 4CEHB 5H4HA 1H8HA 1YRBA 4CDMA 2CJFA 2BY4A 3U6BA 2ZUUA 4JVMA 3A37A 3DCIA 2X5NA 2WUVA 3G0IA 1UKZA 2VYNA 3BF7A 3CZQA 2A1UB 5CK4A 5KSYA 2JB9A 2YJ5A 2P2LA 2HQBA 3P4XA 2I76A 3B8HA 1N6HA 4Q4HB 1RC8A 2V7TA 4OLBA 1X38A 1DAPA 5H70A 2VXBA 2QZPA 3UC5A 1RFLA 1RLOA 3AJDA 4AP9A 3LXUX 5KUTA 1UDCA 1CUJA 1GTVA 3QXSA 3WLLA 2FGJA 1MAHA 3A70A 4OMUA 4OK6A 4H7KA 1VGQA 4LZAA 2CL6X 3E7DA 3WGUA 3AUSA 1QK5A 2HRCA 4L8YA 1LPMA 2AOVA 4HGYA 3RRNA 3NVDA 1Y6FA 3DB2A 3OC6A 4XLLA 2H16A 3DDNA 1QOQB 3DXYA 1WKBA 4S1TA 5HFAA 1LW6E 3U81A 4AG5A 2YHAA 3L7LA 1GFSA 4BGEA 3WFJA 4M1QA 3ZBPA 4MVJM 4PY2A 3T7IA 4AJOA 1NMYA 1ESCA 2J5QA 1GLGA 1S2DA 4IHJF 3VU9A 1HE2A 1R6DA 4L3OA 1YB1A 5BOSA 4UTNA 1GSAA 1L8LA 3EVBA 3ZW7A 2R68A 4D4JA 3GZNB 1C30A 4C7VA 5AI6A 2CV1A 3QLVA 4XDHA 4H0CA 3BRCA 1NHGA 4HB4A 2VR1A 3MBOA 1NUSA 2ZTHA 3FFAA 3GAZA 3H9CA 1M2JA 1RJ9A 1S1CA 1SKUA 4Q1AA 5IAEA 3NJ4A 4NMLA 4MVCA 2KJQA 3HI6A 3I0MA 1VKOA 1KDVA 2QMUA 3EEOA 2PZAA 1XKQA 1Z83A 1PR2A 2GRAA 1F3OA 3MJVA 2P9FA 4N3AA 3WKAA 4B44A 4CW7A 1M6VB 4R3WA 4OREX 4ALIA 3HZHA 5CLQA 1RIIA 4BHTA 1M8FA 3PUKA 4MRSA 4H35A 3JSXA 5DXFA 1KXJA 2HO4A 5ALXA 5HUJA 4PHCA 4JI0B 4MUNA 4MAFA 4KPFC 3T99A 3V48A 2FUCA 2OZPA 1SJ9A 3EVDA 3HLTA 3HBLA 2XB9A 3OQJA 5HQJA 1S2LA 4LYYA 4B3GA 2R00A 1PNTA 2HWXA 3UAVA 2PUDA 5ARCA 1O7JA 3LOPA 4DREA 4C7OB 2Y6VA 1DQRA 2R9VA 4JLBA 4MS1B 1Y1LA 2YWJA 5D7BA 1IJFA 4CHTA 2PH3A 2QW1A 3CUSA 4H7EA 3O95A 4L4ZA 4X66B 2GCOA 3WLSA 4BEVA 2BOVA 3NNSA 3Q41A 4IQFA 4CLXA 3CFYA 3D8RA 2IUUA 4ND2A 4OFXA 5FULA 2QN1A 2V5UA 2X58A 4B6JA 2BEWB 1R18A 2O7NA 3HCFA 2W4MA 3VZRA 3X2FA 4ARUA 3LVRE 1DKUA 1VRVA 1SH7A 1RAEA 4BNWA 4GOXA 4TOIA 2RMKA 1ZWKA 3FRJA 4EJ6A 5ADHA 3DZJA 5CM8B 2FMUA 1LV8A 3AY0A 1WNTA 1FFYA 1RWVA 1DWOA 1SG6A 3OPXA 5IF3A 4X90A 2QAJA 3ZQ6A 4MUJA 3QPDA 2QWXA 4WLVA 2G9UA 4LGMA 5DYIA 4CU5A 2EVWX 3K2QA 1TM3E 3DBRA 5DM4A 3CZRA 2VJAA 1IN7A 3N2KB 3LU1A 1XJWA 2HF9A 3K0FA 3RUEA 4RD0A 3FCXA 4JASB 4LN1A 3RC8A 1PU2A 2DCUA 4GEKA 3ZTTA 1DAFA 1DAEA 2OG1A 4WSOA 2OD7A 1CU1A 3DZGA 4Q7EA 3F8WA 3TZEA 2XWPA 1QP4A 3PTZA 3WWDA 1L3IA 2Z9CA 5H68A 5BMVF 1AO0A 1H2BA 2HSGA 1X87A 1HYEA 2OK8A 2HBRA 3RVMA 3VR2D 4W5TA 4NMMA 1EGAA 4JLPA 2VQFB 1DNPA 2EFGA 3PF9A 1OU4A 2J6IA 1WM1A 3C5CA 1R6XA 3PD1A 4JHLA 4OKNA 4UFOA 5TMBA 4MA4A 2TRSB 4FMCB 4F5EA 2NO5A 4LOJA 4OK3A 1O9HA 2QENA 1CDDA 3ZVNA 2XUFA 4LS3A 3I28A 4JC4A 4MWGA 3O4IA 1HFKA 1G8KA 1V4BA 1ZMOA 1R4ZA 3QF4A 3CR7A 3QIVA 1QO0A 3K4HA 3SP1A 1YMVA 4ND8B 3DEKA 4MEJA 4QBTA 1XNQB 2A7XA 5DTRA 3C4QA 3GRFA 1L4MA 4Z9XA 4A8JC 1QTIA 3ROQA 2VNHA 3GLHA 4C01A 2F1KA 1TUIA 3RS4A 5DRYA 4N0QA 4TKUB 4AK9A 4L15A 1IAVA 5H02A 2I9KA 1IOZA 5F7XA 3MLEA 3ADPA 3HKEA 4KQJA 5FOUA 3KPJA 1NQVA 3FOZA 4DR3B 1RXEA 1T2FA 1EFCA 3OLXA 1ORHA 3FPCA 1G8AA 1OA1A 1RSZA 1RXUA 2NAPA 2MYUA 1U4SA 4KZKA 3BMNB 4Z5XA 1P72A 1R6BX 1M1ZA 3O8QA 1JEEA 1TEVA 3GGSA 4H1WA 2Q5HA 1MGPA 3Q6NA 5FKJA 2Y1LA 1XRPA 3QXHA 5EYPA 4AJ4A 1EKXA 3AL2A 5TE9A 3S2UA 3ZCXA 4POAA 3LZ6A 3A36A 1LNZA 4UTRA 1V8BA 1CB0A 1E1MA 3TEJA 2VCHA 1IZ7A 4RV4A 5CYFA 1W4ZA 1UIRA 1ZH2A 4IGEA 5J5AA 5HQ3B 3OT5A 4RJIA 5LR6A 2Q4BA 4MR9B 4ZN6A 4ZOLF 3KJQA 5D3MB 3N7TA 2YCLA 4OFWA 1LH0A 1U0OC 3B38A 3C3WA 3LWDA 1LCIA 1QCDA 1JJ7A 2FW1A 4EY5A 1Z6AA 9MHTA 4O0LA 4JENA 4OXRA 1A72A 3ANNA 1ONOA 3P9YA 4C43A 4I6EA 3EG5A 5EXXA 4Q00A 1K0FA 2J6BA 1X9GA 2ZVJA 4CN9A 3HUTA 1QIMA 4NBUA 2QEQA 4IFIA 4HDCA 4L5BA 1B6RA 1SR8A 3I04A 1Z36A 4M99A 1NUHA 4MZDA 2Z6AA 1PT6A 1U9IC 4IFEA 3EFOA 1VC2A 1SK9A 2B61A 2WZCA 2X5OA 4UTZA 1ZIYA 2DPGA 4BB0A 2YIDA 5G0TA 3K05A 5EIHA 2NV0A 5CCXA 1W52X 2OAGA 4FBGA 2D1RA 3DOHA 3G17A 1P4RA 4JJ4A 4RLQA 5EJ5A 1U8FO 3B1YA 4R2LA 3KE8A 5EWJB 1F38A 1N75A 2KX7A 5BRNA 4AZ3A 1GUFA 5CA1F 1NLFA 5H9WA 1YH3A 3RSQA 2QBYB 1BDIA 1CUFA 1MQAA 2DH6A 2PO5A 1AUPA 2ET6A 3EFEA 1UT8A 1MAWA 4OYLA 5FPSA 4OHCA 4YMIA 2O2SA 3COYA 4GX1A 1YZQA 3Q3JB 3Q1LA 4KBFA 1FFWA 1KPHA 1S4MA 2HQOA 3ZWOA 1JSXA 3B7WA 3CW9A 4G2NA 4PIPA 5E9JA 1E6LA 5HF6A 1GILA 4XD7A 4B82A 4E70A 5ES4B 3JQ7A 4UHFA 2VPZA 5ERGB 2R2AA 4NNPA 1RQ7A 1YQDA 2PH5A 3EULA 1NC3A 3KVNA 1A9XA 2RKBA 1WKVA 4X60A 1MBZA 1W0JA 1KBQA 2Y1CA 1G7CA 3W3ZB 1FTWA 3ZDXB 2FG5A 4R2HA 1ZMBA 4HATA 3KYDA 1Z7YA 2GAFA 3NTXA 5CXXA 3SDZA 2JFNA 3EUEA 2ZOSA 4BLPA 3AP2A 3VTAA 3VNUA 4Z9YA 5FHQA 2WRZA 2VHQA 3F47A 4RJLA 5K3CA 4PC3A 4G0OA 2X8WA 1LGYA 4WPGA 1XTQA 4O0MA 1YKSA 4ZMRA 3PUXA 4GE0A 3KVOA 4DV6B 4NFSA 5DCLA 4EI7A 4YV2A 4CTOA 4Z7NB 4FZ5A 5F3WB 5KQLA 3VPSA 2RGGA 4FE3A 3L40A 1FUUA 1YE3A 2XMRA 4IDGA 5F76A 2QG6A 1T34A 3KSDO 4O4HB 3TLZA 3FOEC 1DGQA 3TR5A 5TDHA 1PEDA 1MR3F 2XWSA 1YS4A 1QFYA 2QRPA 4NBSA 2IDKA 5L7TA 3IKJA 2XDQB 3KZNA 3QE0A 1DCTA 1GKUB 2JFXA 3ZH9B 4Q3NA 3CINA 2NG1A 4MKHA 1UK8A 3I2HA 3SHOA 4PO9A 2GBFA 5B36A 1UWLA 2N0SA 3IOEA 4OBBA 5DF1A 1CC1S 1Q12A 3AIKA 3I5UA 1PJQA 2ZIVB 3Q8XB 5GAJA 4C4OA 4EFMA 3F67A 1J39A 2IYNA 1Q0LA 4YRFA 1KQPA 2LCIA 2ZJBA 2RGEA 5ALKA 4ROTA 3L0CA 3C8ZA 3NYWA 1J1ZA 2PL1A 1NW3A 1PR9A 1V16A 4RGYA 1HE3A 1QYCA 3WMGA 2UV8A 1E2HA 4YPOA 3WGNA 4J0EA 4FHEA 5TXGA 4B8WA 3LRTA 1NT4A 1OR8A 1SBZA 2CJWA 2VXYA 2QSZA 4JEMA 3TL2A 5FL7D 3VNVA 3C3KA 2N42A 1Z73A 4RD3A 1H3NA 1Y82A 3PR3A 1V3QE 1W581 1N7HA 2H57A 3SNHA 3AIOA 3EDOA 3V4LA 1T36A 1OFUA 2R4QA 5FT9A 1ESMA 2VLIA 4RTQA 2C2HA 3OCZA 1MTOA 3N7AA 4S12A 4BZWA 2G1PA 5K6AA 4AP6A 4LA4A 2PL3A 1FSGA 4MGHA 4ZT3A 3BTSA 1HDCA 2LIVA 2BTOA 4XIFA 5KNBD 1C8VB 1U2SA 3N2NA 4HDSA 3FCUB 1E99A 3LQYA 3C24A 4IGAA 3ER8A 1CSEE 1J2UA 4M87A 3BFPA 5E38A 4S05A 1PG0A 2FMXA 4CUKA 3GVCA 4IEFB 1Z7WA 1SOVA 4FINA 4IH4A 2IXFA 2GRUA 2I1LA 4F11A 4LCJA 1SBYA 3OQ6A 3RKUA 1KEEA 4GI5A 3D2CA 3QPWA 4LHYA 4DEYA 1B7GO 1D3AA 3NVMB 2ZB2A 1MHPA 4CF3A 2ZULA 3HGMA 1S2IA 3Q9UA 3UJ9A 5LJIA 3OX4A 2F7SA 1TT7A 3HYSA 5LDDC 2RGRA 4V0LA 3EWIA 1FFXB 3KXKA 3PS9A 1Q0PA 4GC9A 4JL5A 5IPFA 4O2BF 5MF6A 2W4QA 4IO0A 3NVAA 4YAKA 1UF9A 3AFMA 1YZUA 1A96A 3C6BA 3G7SA 3NEJA 2AUTA 4NESA 4QNNA 3WV5A 1KQFA 1TW2A 1KYZA 2I4OA 3T5CA 2C83A 2IYLD 5YASA 4CTMA 4BWYA 4EKIA 1TT5B 1E1CB 3R6GA 3VYTB 1KKLA 3R5TA 1IM5A 4OG2A 1T91A 3ISJA 3HVKA 4IUCS 4MP6A 4CLRB 1D1PA 4U7JA 4L6CA 4V1CI 4ETIA 2HCRA 1CJMA 1U3TA 3R8XA 3BH7A 4LKOA 2RHRA 1TLFA 5ALSA 2B37A 3FVRA 4U7DA 3E9QA 1W8IA 2DCMA 2YWGA 3GJQA 3M2TA 3W2HA 4L4RA 2PBFA 1SCDA 4K05A 4KH1A 4NENA 3GHYA 3CCCA 2QT0A 3BK7A 4WEQA 1K68A 1SHKA 4I2VA 3UHOA 4A23A 1M76A 1JEDA 3CVWA 4K9KA 1T6ZA 3QXGA 3ZCUA 5DX1A 1WOYA 4PRLA 1T0IA 3SD7A 4W82A 1MO3A 4MRMA 3BHNA 1A77A 4FLMA 1RQLA 1IXSB 1L7MA 3D4OA 4WVFA 3EZXA 2VOEA 4KXXA 1H5NA 3DAYA 3COSA 1WMEA 2P9BA 2CHGA 5JAUA 4OAOA 4X65B 1JNYA 2RBKA 4X1YB 4U2FA 1XVTA 1OZGA 4YLGA 4UM5A 1BDHA 1Q77A 2C04A 1Q50A 5EQTA 1ZBDA 1OI4A 1OT3A 1PW5A 2V59A 4CTNA 1S5PA 1VKNA 3IKMB 5I5GA 3FPSA 4AJLA 1SUWA 3VM6A 3NP7A 5JS1A 2IOQA 1MX3A 1M83A 1N5MA 1UWVA 1QS0B 4O4LA 5ER6A 1EZ4A 2QX9A 4UNPA 3V1UA 3JQ8A 5B55A 2EDCA 3I37X 3OPNA 3Q88A 2MWMA 2FQ1A 1AOXA 4TZ0A 1ISIA 1EK1A 1P7YA 1UFKA 1UOEA 1VBFA 1VZ3A 2XRMA 3GX1A 3GMIA 3IVCA 2AOTB 2QI9C 2VYVA 4MLPA 3U9TA 3ZEIA 3PIDA 4X8MA 1F0YA 4BTEA 3JWEA 1SBNE 3A3YA 1NTOA 2A94A 3I9FA 3JR3A 5DISB 2L18A 2ODQA 2VUHB 3CSSA 5ELXA 2PFKA 4JQZA 5FUMA 1CRQA 1QP8A 3RC2A 1Y8QB 1YFZA 4K9NA 3D31A 4EFNA 4XUGB 2AJ8A 2A59A 3BWCA 3RIEA 4FN5A 4YV1A 3H9UA 1JBKA 3V8EA 4KMSA 4C14A 3H5TA 5IC5A 1TD1A 3GVXA 3PNMA 1WE2A 2QTVB 1ZAKA 2VHVA 3KBBA 1A95A 1B41A 2HXGA 5KKNB 1OXUA 1R9NA 3HE3A 4ZAYA 1LPNA 3HDYA 3P1JA 3ASYA 5IVIA 5TIIA 4F06A 1O54A 5DGCA 2AZTA 5EQDA 6REQB 1DQYA 5IJWA 3AKZA 2G07A 4B7AA 2VZLA 2CMKA 3AEKB 5HE9A 4Z2YA 3EYAA 4QT4A 3BB3A 1XSEA 5EP3A 5D2CA 4EJSA 1ECLA 1C2TA 1FOEB 3IAEA 2BGGA 1SBIA 1PYOA 4OXKA 4H18A 5K0BA 5DNYB 3I1FA 2I6TA 3D0KA 1OWNA 2ZG6A 1XP8A 3JD2A 5KYUB 2QKYA 2OCBA 2AD5A 1IB0A 1L4UA 1SKQA 3CXRA 2J5BA 1GD1O 2VH2A 2PX3A 4NMHA 2PJZA 4YMTA 1JFFA 3GLGB 2QS9A 3Q98A 1M7GA 2VJLA 3GT0A 1V5IA 1W0KD 1WCIA 4RA9B 4K9PA 2C82A 2WSIA 4DT1A 4L5CA 5GZ6A 1KC1A 4DLYA 4OUDB 3UT6A 5JG7A 5J4KA 1T0HB 3BMOB 2YFYA 4ADSG 2ZWOA 2OB1A 2WHEA 1H1LA 4LTDA 2YYSA 3HACA 5K2MA 1A71A 4Q3DA 3ZNOA 3J81A 4CUZA 1PDWA 4CMKA 4JN6B 3KETA 4E5SA 3DGFC 1ADYA 4MV4A 3RNOA 3O6VA 2A92A 1P4AA 3KPYA 3QHAA 1Z4KA 3UCEA 4DHEA 1Z16A 3MOGA 1SB8A 1EQUA 1ZUNA 3BHJA 3T5BA 3T9FA 3IJ5A 4ZAXA 2J3QA 3ILYA 1PT7A 2AGVA 2OQIA 4NBRA 5AM3A 2OLKA 3LC1O 4FR0A 4ZO4A 1X1DA 3CSUA 3FOFC 3WQSB 3A1DA 3H1FA 2EQ5A 3EQ8A 2X2FA 2XTZA 2VNIA 1XZ8A 5KSZA 4BATA 5JD4A 3E9EA 3P2JA 5C5DA 2BRUA 4BJ6A 1EM6A 4FW8A 3QU9A 5GM1A 2BFEB 3NG1A 1XX6A 2FVXA 1LWNA 1OXVA 5C8ZA 1GR0A 4M49A 3WWEA 2ZYVX 3W1WA 2JJ2D 6GPBA 4BX2A 4IJQA 2GSDA 2QTLA 3RUFA 2C07A 4YRTA 4B6OA 2GYUA 2TMDA 1JYSA 3BXOA 3VRHA 1CEYA 3IKLA 4Q34A 3HKDA 4WFKA 3IEVA 3ZK8A 2NZYA 2O8FB 1ORWA 2IF0A 4JC5A 4FDTA 4GPIB 5LQDA 3AFHA 4MLCA 3DLCA 2H0QA 2AOWA 3ZWPA 1XQ1A 4I1VA 1KVRA 1VLLA 3W4JA 4W9NA 3PJRA 4JR1A 5IG2A 3WG9A 1GGVA 4UPDA 4UZSA 4C5AA 1VI6A 3MMPA 5LPNA 3STHA 1FQWA 2A9PA 4G37A 4HQOA 2DF8A 5SZIA 3WHLA 1YL7A 4RL6A 1AMOA 4L8GA 1ODCA 3BWMA 3AHGA 5AHXA 3ND7A 1G8SA 5AM5A 3F1LA 3MF4A 1CS0B 3KWMA 3AETA 3Q9SA 1KIAA 3IQWA 4W7HA 5EPOA 4Z1OA 2ZJ3A 1WY7A 3OJFA 1UZAA 4BP9A 1K7EB 4JP8A 3I61A 3BIOA 3SKYA 1L4EA 2MSWA 3A9WA 1RYMA 1VECA 4LKRA 2YWBA 2R1VA 3DT6A 1GXSB 4OGGA 2ZETA 3SK0A 3AI2A 2Z4TA 3UN1A 3F7OA 3FETA 1WHTA 1O9BA 3KOUA 1JPJA 4NE7A 1HURA 2WSSD 5IP5A 4DPLA 3D3JA 1A1SA 4WN9B 3MGCA 4O6VA 2W9XA 4DSNA 4KLRA 2YXBA 5C8YA 3UWOA 1AQJA 5JH7F 4UREA 4HUQA 5ALFA 3OWOA 4Z9AA 5DM2A 1VB5A 1FXWA 1CY7A 3KUUA 3LY9A 2C3UA 1K86A 2ORVA 4IEIA 4XWWA 3NHRA 1JGTA 1V95A 3UJ8A 1CJKC 4FGWA 4LCEA 4H3HB 1M0WA 1RYEA 3DHYA 1T6BY 2J07A 3QQPA 4RVUA 4UUNA 4A2QA 2FE4A 5K6RA 2YMLA 2Z6VA 4KI0A 4Z51A 2J4DA 2FPIA 4R2JA 3S0JA 4BFYA 4G1FA 3SX2A 1G4UR 1OYVA 3IKTA 5IT9A 1ZGCA 3CY6A 4TRNA 5LQNA 4G1MB 1SXHA 4KI7A 4AZ0A 3NDPA 3IAS6 3TJRA 1QF6A 3PUIA 1XRLA 4QYMA 3KOMA 2J3DA 4RGBA 4LV8B 1AS3A 5KSPA 4BP3A 2CB9A 5CB6A 3UMGA 4H2DA 1LLDA 1KA9H 3HN6A 4IOKA 3D4LA 1MABB 4P5DA 1BE6A 4CM3A 4EUFA 4M1EA 3HUFA 5A4AA 2YWHA 3BXEA 3II6X 3QKUA 1DO0A 1M2FA 2CNLA 1LDGA 5A9RA 2R5WA 2ICAA 4RW0A 3TW8A 2C4VA 4D3XA 2BGIA 2YFKA 1FSSA 1CY1A 2HGSA 2J09A 1USWA 2X6RA 3PI7A 1JHOA 2XYQA 5EG5A 2BFCB 5M3BA 4AO8A 4N5IX 1EHCA 2OGUA 1V5WA 3KG2A 1P18A 4QUKA 2PVPA 2IU4A 4H08A 4IDAA 2W2MA 1YR8A 2XUDA 2FMTA 4U9IS 4OH1A 3O7WA 1PJRA 2GNOA 1V9SA 1XCPA 4PYOA 1JA9A 1TUEA 4JIMA 2E1RA 4LDPA 4LOHA 1RZ3A 1V3TA 3L8CA 1EB9A 1NFFA 1VJ0A 4GMDA 1SC3A 4NCNA 5GJWC 4F3CA 1YR6A 5HCIA 2FZGA 4JUFA 1N2BA 4MJ3A 2FZ4A 2IT1A 3TOSA 2GNPA 4DIUA 2E85A 3MUFA 3S8YA 2QAGA 1YDWA 3A06A 3AEQB 2VA9A 5KOYA 5BRJA 1GA1A 1GY8A 3SF8B 1TF2A 1QHXA 4FUTA 3ZE0B 3WK7A 1QHHA 3RVNA 1I10A 4M0UA 4MKZA 1WETA 1SUAA 1W85A 5A2GA 4K7JA 2XCRB 1US8B 3FYTA 1VJRA 3DMYA 2AEEA 3DE2X 2MR5A 1W2WB 3E05A 2AN5A 3UOAB 4KMOA 4FN4A 5BNZA 1RJFA 1Z4PX 3HHPA 3OT1B 2OP0A 1KBOA 1XNRB 4LHWA 2HNBA 2B1QA 2RI6A 4GL2A 2IOFK 4HNUA 1AD2A 2DQ4A 3D3EA 4DY4A 1PLKA 3KYIB 4LY9A 1RQPA 4WLFA 1NU8A 3VYSB 1O03A 1ZCZA 1S3GA 5FOQA 3QFCA 5C37A 2PL5A 2POQX 3VBCA 1KYWA 1MJFA 1RRVA 2AHRA 2H4HA 4ICIA 4YAWA 1J9ZA 4I3HA 3D54D 1BX3A 2OKGA 1G2QA 3M33A 3FYCA 4G1VA 4K9MA 1OWLA 4YJ2A 3W90A 4F45A 4IDQA 4QBHA 4MWEA 3HRIA 1E7QA 1VYHA 2PGNA 2PZJA 3MBIA 2ZFUA 4ZOCA 4JJGA 2ZYUX 3H1EA 3ENQA 3LPDA 1B26A 1YR2A 3ACBA 3OZCA 4RPGA 1E79A 5EKTA 3R7BA 3R8CA 4DTIA 2CNBA 5ETJA 3TF5A 3BE5A 2H7XA 1N5IA 1E89A 1JTVA 2CDAA 2ZVPX 3FPAA 4EJMA 1GPMA 1R3UA 2IXGA 1HETA 1DKRA 3SJBA 4E5UA 3O2NA 2FAXA 3OZ7A 4X6UA 7MHTA 2QP9X 3I5MA 1QV6A 3DF7A 3GGCA 1NRXA 4YS6A 1SVOA 4FWTA 3H9EO 3EVTA 2PQ2A 2GA9A 3R6LA 4JJ6A 4QPZA 3GRKA 1Y33E 4KDEA 2IUFA 4D80A 2XCIA 3ZY2A 1BH6A 2CD7A 3FH0A 5AVXA 1HL7A 3U80A 4RKFA 2XRZA 2ARKA 3SJ7A 1ESNA 1L8XA 1TC1A 1YA4A 2AW5A 2C5AA 4XIJA 4LJ6A 2VT3A 1BNCA 3CVUA 5HMMA 3ZBTA 1JEYB 4MUYA 1KJZA 1ZUHA 5KTOA 4ND5A 1LPPA 2NTVA 3H1TA 2VDNB 1ZL2A 4MVJG 2NIPA 1IZ9A 3WYFA 3HJRA 1GGFA 4EHKA 3DFFA 1E60A 1T1JA 2PRJA 1IWPB 3I42A 4L07A 3BTVA 4OQZA 5NULA 1LLQA 4B1FA 1HNXB 2PRIA 3L5KA 3MAGA 3P0RA 1TM1E 3URMA 2N9UA 2QZ4A 5CU7A 1BEEA 2IGBA 4JLNA 1U1IA 1UDRA 1XALA 4Q02A 1OZAA 3DUWA 1U04A 5CFMA 3ZIAA 1TRHA 1P77A 2R6CA 3WRWA 4L9AA 5IBCA 4C3VA 4Q1DA 3TVTA 3HEBA 2I1QA 3FWZA 4ZKEA 1P4JA 1Y63A 4FYWA 3RS0A 4A8HA 4PO3X 4WA7A 1TXGA 4CEHA 1JHZA 1SELA 1N36B 5L3RA 3QKSB 3QPBA 4B9AA 4DLZA 1ZINA 1XCJA 3U6KA 1KDTA 2VDLB 2R8OA 2O8CB 4Z3KA 1A4RA 3WQQA 3E03A 3BGWA 2EJTA 3RRBA 3H4TA 2ZJFA 2I66A 2A1UA 1JZQA 4X7PA 1XN1A 5CLFA 4WJLA 2QY6A 5BW4A 1X42A 1H2EA 2GF0A 5C3MA 4KRYA 4Q4HA 4C6TB 2WOOA 5BPFA 4GXQA 4FD2A 1MZPA 3F97A 2F1HA 4NXMB 1GHTA 4FCCA 4MVJF 2BONA 2F90A 3BWDD 5C1DA 2WT8A 2M6RA 4IGIA 1P6UA 4M36A 3CE6A 4K46A 4KOAA 1TE2A 5D00A 3ITDA 3CB4A 3INYA 1M33A 1QWOA 1NBHA 2PFGA 1CVRA 2GOYA 2PIAA 1V26A 1HWYA 4G81A 4IXMA 4L8VA 4NCIA 5IX8A 2PR7A 1PEKE 1XN4A 1W46A 2A0YA 1V5EA 4R68A 4X93A 1TLTA 1PZHA 1NDUA 3KQTA 1NXQA 3A4LA 1DBQA 3KR9A 3LBYA 1KR2A 3GZNA 4KXNA 4PE5B 5C1BA 3IUQA 4S1WA 3LMKA 2CWDA 2XAAA 1YT5A 3HWX1 1PL6A 5EMNA 3WWCA 1BN7A 1MPXA 2JIDA 2NVWA 3WMFA 1UXIA 3N1UA 3QTBA 2RGNC 3BSFA 3EPHA 1O0SA 3ROTA 3RADC 2VSQA 2JGDB 4MWTA 2D1YA 2EF0A 1GAQA 4K88A 3LGAA 4UQOA 5FR1A 2GZAA 1IHOA 1BMTA 4IIEA 1M6VA 2QMEA 3GFGA 3EDYA 3K1ZA 5CFPA 4DLLA 3CO0S 3GYGA 3OTHA 4HGQA 3ILXA 2ON6A 2PNJA 4IJVA 5KI6A 1W36C 4C1NA 2PQMA 1NW6A 2QTRA 4ZAZA 3P19A 1M2OB 1VCNA 2FRDA 1ZOPA 3BL5A 3QYAA 4FMDF 4JODA 1VJDA 1TIPA 5DHTA 4FW9A 4YAIA 5LIRA 4D8XA 4RHXA 1HYHA 4MW6A 1WG8A 1SZDA 4DCCA 3OQVA 4YAGA 3DEHA 2CFCA 5BSRA 2JLQA 3DNFA 4C7OA 4B09A 3RBXA 4MS1A 4PG5A 3HP7A 1K08A 1RWKA 1Z4IA 3B1JA 3D4NA 5DLYA 3AOGA 4CBVA 1NVFA 5JYBA 4MLDA 1OV4A 1EFDN 2XEDA 4U7TB 4FCVA 4JR0A 2J6CA 4JQOA 3C7TA 4EK9A 4XUDA 4RZHA 1W0CA 4PIMA 4INZA 2JBAB 2R6GA 4PBRA 1ZGBA 4QT0A 3QOYA 4U3JB 3VFDA 2D5IA 2NW6A 2OXEA 3SBEA 2BEWA 2DFLA 2B20A 3LP8A 4V3BA 4TLCA 3WLTA 5AW8A 1B42A 1Y8ZA 1ABFA 2V3WA 5AHKA 3ZHOA 3CF0A 4AKHA 2OC4A 2EERA 3NDIA 3PYMA 4X85A 3LW8A 2CY0A 5DI3B 1JIUA 5T3UA 4YY3B 4EABA 2IHZA 2F17A 4LNAA 3H9BA 4KWCA 3P0JA 4IZOA 3IPYA 3UA4A 2C95A 4GZMA 4Z54A 2QHXA 3IQEA 1FPQA 2IXDA 1U4OA 1O08A 8LDHA 4LRSB 3LL4A 1CWUA 2H5JA 2ZKLA 3N2KA 4KN5A 1Z8DA 3PC8A 1IZYA 3AGQA 1O4WA 4U5QA 2XB2A 2IS4A 4HXEB 2ZWVA 1YUMA 1P0PA 4NECA 1EJ2A 3C3AA 3WGMA 4UOEA 3AMVA 4Y9TA 4E11A 4LXYA 1MJ5A 2BFOA 1LSUA 4DWVA 2VT6A 3TDMA 4L50A 5JDCC 3RWBA 5KQMA 4NOMA 4DLWA 1E63A 3FI9A 5IT4A 3S8MA 4WTOA 4BRUA 4GKVA 1XL1A 1Q16A 3AHIA 1GZDA 1WABA 3D2BA 1HOTA 3HYTA 2ZRMA 1Z6YA 2AWOA 3BIXA 4D26A 1ZXLA 4DUPA 3U5ZB 3GEEA 2BH2A 3EA0A 4GE3A 4C7KA 1TYBE 2EG9A 3KE9A 1MQ9A 1BKSB 2BEUB 4LX0A 2Z1DA 1U1FA 1K9VF 2E6UX 2GZDA 2HJHA 2WWRA 1LQTA 2CJXA 3FLBA 3CLTC 1UBJS 3AM3A 3ICWA 5EIFA 1NVGA 5DN6D 2YH2A 3JQAB 3NC4A 5DULA 3RDPA 1H1TA 3HHEA 4B4WA 4PQEA 4ND8A 4G07A 4WXHA 4BMNA 5EHXA 2PKWA 3JVEA 2GYVA 1EUYA 2O20A 3ANSA 2N1MA 3L05A 3KWFA 3F2IA 2AOUB 4Z0HO 3E61A 4L76A 4TKUA 3K70C 1RI3A 5DBGA 1DQPA 4A5SA 1SC6A 4BFVA 2GBCA 2P2NA 3PGVA 4FFRA 3A3NA 2P9QA 2YDXA 4RTOA 4C4ZA 1ODFA 4TKLA 1I4WA 5LVAA 3NZEA 1W4LA 4PRZA 5IBPA 3FVWA 4NK5A 4UNIA 3QA9A 4HOYA 4EQZA 1FBTA 2TSYB 3UATA 1ND5A 2BISA 1LS1A 2WJYA 3V6LA 1V6CA 1JDVA 4BFWA 3BMNA 4B73A 5HFNA 4WXRA 2CD9A 2EBWA 4BNHA 1ZR4A 3MB8A 1CTQA 1NSTA 1A7JA 1NN0A 1VMKA 1BX1A 1E9VA 1O8BA 2PH7A 3B85A 2GKSA 5EE0A 5K0JA 5DM0A 1QAOA 1F2DA 5BPHA 2IPAB 4OBWA 4AZVA 3VKHA 2OV6A 1G60A 2EZ4A 3GJRA 1MG5A 2ID4A 4ZVKA 5HQ3A 1NX9A 3W34A 2QI9F 1FDRA 1A5BB 1UC8A 3FPBA 4J2TA 1YK1A 4MR9A 3ZS8A 1XPOA 5GOTA 4BMCA 4Q15A 2XMDA 5D3MA 5LUAA 1Q3KA 4RZIA 3KB2A 4GFDA 5DHQA 2B98A 5EHNA 4CV1A 2M9MA 2HF2A 2R1TB 1J0BA 1PG2A 4L8FA 4W1PA 2G7MC 4BGUA 1YBVA 2HDOA 3JW8A 3KKEA 4FLEA 3NTOA 4DG8A 1OFTA 1XQ6A 4N5DA 5LZ5A 3VHQA 2CJYA 3SEAA 3PGXA 2EP8A 5EIEA 4JVSB 3ED1A 2ZUWA 4M22A 1HX7A 2UYGA 3DMTC 5IEJA 3O8DA 4AI6A 3TN7A 1N6NA 2WINI 3CVXA 3HU3A 3ZE7A 4U2GA 4Q37A 3QY9A 4X84A 4XSHA 5CNMA 1JPUA 4MS3B 1JE0A 1H23A 2W2QA 1YRAA 5DHFA 1SCJA 5EWJA 3TLXA 2ZBGA 1TGVA 4J07A 5DYNA 4Y2UA 3A3PA 3SC6A 4PXYA 3FOAA 4NG5A 2QBYA 2NP7A 2ZVDA 5FTJA 4EGCB 3E5MA 4D6XA 2EJBA 3I9NA 1BMDA 1XCLA 4NU8X 2O3RA 4LE2A 1KNXA 4G67A 5F1YA 4EW6A 4JXKA 4QJ4A 2C4TA 1KVTA 3STUA 2EKQA 2ZSFA 2IXBA 1KJIA 2FUG6 1I0ZA 1IG3A 3L84A 4YJGB 2ZJ5A 1U28C 1IBLB 4N49A 4Q6WA 3M1YA 4C0HA 2P9TA 4I4TF 1SXJC 5MN4A 4B3TB 3RRZA 3SS8A 2R79A 1BHJA 2VDRB 3TKAA 3IVXA 4MPDA 4FC6A 4G5SA 1G64A 1G2PA 5KNLA 3L1VA 1ZSNA 5I8ZA 4DQUA 3FZEA 3O4GA 3UJ6A 4FHCA 3L7OA 1F5NA 3DCJA 4F7DA 1IL0A 5SY6A 5I4BA 1ZISA 1FTYA 2PMCA 2PTHA 1R5JA 3HM9A 1TTHA 5C7LO 1QIDA 2BKUA 4LOIA 3NDJA 2WAYA 3ZDEA 3EX7C 3M1IA 2QGFA 3NTVA 1I2AA 1FDIA 2CLHB 3E7WA 4S1VA 1G38A 1LS6A 4O4HA 1S2OA 4CQLB 2E4VA 2ADFA 2F43B 2IOHA 3E15A 3L7YA 1DRUA 4FNGA 5F77A 3ZNQA 5ED4A 2YKGA 4GPBA 2QR2A 1E1QA 1K3TA 2Y1EA 2XDQA 4I08A 2HT6A 3KDAA 1V3VA 3JRXA 4PN3A 3F9IA 5EWLB 2ZRPA 3ZWWA 2CE7A 2X1VA 3EGIA 1ZA2A 2IYVA 2GCNA 4KXLA 2KS6A 4QYXA 1UP6A 1JR4A 4FGLA 5AXAA 4GG1A 1SBHA 3DYVA 2HRBA 1YC2A 5A4KA 4CL0A 4Y6OA 2BE7A 3A1WA 1AGNA 3EXHC 2GILA 2PPLA 4IVNA 4JGGA 4CZ2A 3M4ZA 3H05A 2LPMA 3HU2A 1KL7A 3LYAA 2BSAA 3TVYA 4UVEA 4BPRA 4B7CA 1RXVA 1ZJ6A 3BFJA 3T06B 4YN3A 1IHPA 3HZRA 4TSRA 3TUJC 2V7BA 4FFMA 5E3JA 2O8NA 5ALIA 4ZCSA 2WM2A 3LG2A 3RUCA 5DTQA 3V00A 4FYYA 2DE0X 2D00A 1YZNA 4E5KA 2YJNA 2L69A 1X1EA 1B74A 3NC0C 5AVYA 2XMSA 3EUAA 1QCZA 1H5QA 2FMIA 3VSCA 3R3XA 4B3XA 4HEJA 1OLXB 3KRTA 1NBWB 3NASA 1E3LA 1EWTA 3EZ7A 4J0JA 5IEBA 3RVDA 3DPIA 1GYQA 4CFYA 3JTMA 1XDZA 3V46A 1KZ1A 4YCLA 2QPOA 4TS3A 2QNBA 1G7TA 2PIDA 3SYNA 3WQBA 4ZGWA 2XQKA 1DADA 1VLZA 2PSDA 3H5OA 1QFZA 5GVSA 3ACDA 4LQ4A 5L51A 5JBQA 1KRWA 1JQBA 3HA5A 4HGZA 1HMPA 3FYUB 3FOCA 4IX9A 3UGKA 1AGPA 1C0PA 4KR9A 4HB2A 2N3ZA 4EIWA 3RTDA 3FWNA 1BKDR 3M4XA 5EOVA 7YASA 4GKKB 4ZVQA 3HNRA 4ZTZB 3EBLA 2OZLB 1T2AA 3LFTA 2RB5A 5A7GA 1QE3A 3SFVA 1PQYA 1LI5A 2HUNA 1AKWA 2QX6A 4FS3A 4K9RA 4QOJA 4Y2YA 4XXHA 1QK3A 1FFXA 4JNKA 2W8BB 1D6JA 1KHHA 1MPTA 2PX4A 3Q7RA 2QRZA 3BWVA 3BZUA 3W8FA 3WZ2A 1QQAA 1W5SA 3LQ4A 1YS9A 3VR0A 3GJZA 5JY6A 2WKQA 2GEBA 1TT5A 1E1CA 1N6RA 2V5AA 1E1RA 1E1DA 1NP7A 1XNHA 2R8XA 1Z63A 1Z47A 1E3MA 3KX2A 4CLRA 2ID7A 1KAEA 3DFMA 1PJLA 2IHTA 1NASA 3EIHA 1AJEA 2IDMA 3NANA 1X80B 4Y2HA 1FRQA 3KQWA 3LZDA 2H2DA 2HU8A 2BFNA 4O2LA 1ORIA 1S3FA 4MWZA 4YBZA 1ST3A 4R7ZA 2AMLA 4FI3F 3DONA 2WDZA 1E7SA 1K7XB 2J5RA 4MWOA 1KDZA 3WIEA 4EPYA 4MQLA 3FCAA 4EY3A 1PIWA 1E2IA 1Z75A 3EGWA 3MD0A 4AKIA 2C94A 1G6HA 5KC8A 2PS9A 3MN1A 1B15A 2O7VA 3WLAA 1HH4A 5AVUA 2RAUA 1ZGAA 4KPEC 1VYTA 3ZEAA 4MSUA 2QTGA 4C9BA 4PLVA 1GU0A 4OJYA 2SHKA 3CGGA 1XZPA 4LY0A 3GROA 4X1YA 4YJ2F 5DTIA 3F73A 2FG6C 5IARA 1FX0B 1XWIA 3IMCA 4RS4A 4UBJA 4LTNA 2QSJA 1RLMA 2O3SA 1U3CA 4TXLA 2GF2A 1Y5NA 3OPVA 4DNPA 5EA2A 1BG6A 1S8FA 4DANA 3ODPA 1N1DA 3U4MA 4JU8A 3AU9A 1QS0A 4KLCA 4BKRA 4WAUA 5KIAA 1U3VA 3DVLA 1HMYA 1PD0A 4PG4A