4FONA

High energy remote sad structure solution of proteinase k from the 37.8 kev tellurium k edge
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
publication title Macromolecular Crystallography at High(er) Energy
rcsb
molecule tags Hydrolase
total genus 103
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 4fonA00
1KDZA 3CO0S 2Z57A 2IXTA 3L1KA 1LW6E 5ARDA 3EIFA 1R64A 1Y9ZA 4B5LA 1BE8A 4OMDA 1TM3E 1SUCA 2Z58A 1KE2A 5FFNA 2DUJA 2ZWOA 5AVJA 2X8JB 3WHIA 2ID4A 5CW1A 1GTG1 2SBTA 4BWGA 3DVSX 4KPGA 3TI7A 5I9SA 1A2QA 1SBIA 4H6WA 1WMFA 1OYOA 1Y48E 3UNXA 2PQ2A 5SICE 1ZVJA 2W2NA 5JMOA 4MZDA 1SUDA 5AQEA 3OSZA 1XF1A 3DE5X 1WVMA 4ZOQI 2SNIE 2Z2XA 3TECE 1MEEA 1BE6A 2IY9A 1GTJ1 4Z2AA 3WIVA 2Z56A 5B1DA 2X8JA 3Q5GA 3Q40A 1P7VA 3VV3A 3F49S 1OYVA 1SBCA 1S02A 2WUVA 1V6CA 3I2YX 1T1EA 3F7MA 1Y4AE 1Y34E 2PYZA 3A3OA 4LVOA 1AU9A 4C3UA 1GA4A 3I37X 4J94A 1WSDA 1TM4E 3DDZX 1C9MA 1YJAA 3AJ8A 1Y33E 3DW1X 1BFKA 1Q5PA 3BGOS 1GNVA 2P4EA 1THMA 2XTJA 1VSBA 3EE6A 1GA1A 1SN7A 1EGQA 5B1EA 2W2MA 2WWTA 1HT3A 1TK2A 3DE1X 4YN3A 4AKTA 1SIOA 3LPAA 3EDYA 1OT5A 1YU6A 1Y3CE 2ID8A 3VV2A 4CFZA 1Y3BE 1ST2A 4LVNA 1BJRE 4DWWA 1S2NA 1PTKA 2Z2ZA 3DYBA 5K7SA 4WOBA 1PEKE 1MPTA 1EA7A 1C3LA 1SUPA 1V5IA 3DE7X 5JXJA 3SICE 1AVTA 2XRMA 3GCXA 3VTAA 1Y4DE 2G4VA 4OMCA 3F7OA 5AMXA 1SCDA 1PJ8A 1R6VA 2WV7A 3DVQX 5FBZA 4HVLA 1YJCA 1SBNE 1AK9A 2W2OA 3DE6X 4CFYA 2B6NA 3PTLA 3HJRA 3WQBA 1DBIA 1SPBS 4NE9A 1R0RE 1CNMA 3P5BA 3QTLA 3LPCA 1TMGE 3PRKE 2ZRQA 3DE2X 4CG0A 3VYVA 1SBHA 4HX2A 1SUEA 2Z2YA 3DWEX 3GCWA 4DZTA 2HPZA 1C9JA 2ST1A 1YJBA 4OV6B 1SCJA 4C3VA 1TECE 3DW3X 3VHQA 1JEAA 2PMWB 1TM5E 1SCBA 2E1PA 4KB5A 4WOCA 3ZXXA 1SBTA 1T1IA 4JP8A 4RYDA 1GTL1 1Y3DE 2PRKA 3I30X 1UBNA 1KE1A 1WMEA 3GT3A 1PFGA 1S01A 5FAXA 1BFUA 3WIUA 1IC6A 1GA6A 3T41A 3TI9A 4NMXB 5ARBA 1Y3FE 5JXIA 5AVKA 3DVRX 1NDUA 1GCIA 3DE0X 1TO1E 4M1ZA 1SCNE 1GNSA 2TECE 3LXUX 1AH2A 4FONA 2Z30A 1SVNA 2SECE 1T1GA 3QMPA 2HD4A 3SQOA 3A3NA 1AV7A 2ZWPA 3D9QX 1NDQA 1C9NA 2PKCA 1WMDA 4DJ5X 3D43A 1NLUA 1ST3A 1TM1E 1AQNA 5ARCA 1Y1KE 3AFGA 1ZVKA 1SELA 1KDYA 2DP4E 1P8JA 1GT91 4AKSA 1IAVA 1AF4A 5JXGA 2W2QA 1DUIA 3I34X 4KG7A 1BH6A 3DE3X 4ZARA 1CSEE 1SCAA 2DQKA 2PWAA 3H42B 1SH7A 4H6VA 3BPSA 3A3PA 4NE7A 1KDVA 3DE4X 2W2PA 3CNQS 2QTWB 3ZXYA 2PWBA 3VSBA 1TM7E 4GI3A 3BX1A 3AJ9A 1SIBE 3GT4A 4K8RB 1P7WA 2WUWE 4I0WB 2GKOA 3LPDA 1SUAA 3QFHA 1SIUA 2SICE 5JXHA 1SUBA 1TO2E 4H6XA 2V8BA
chains in the Genus database with same CATH superfamily
1B8VA 3PHCA 4YWHA 4GXQA 5I9NA 4L8VA 2VTBA 4MGYR 3F2VA 3SHQA 3TKYA 3Q3HA 4J29A 2IYVA 3G8AA 5D6NA 4A3SA 1U4SA 2I76A 2YFKA 1WLSA 3ZLTA 4AN1A 4ON9A 1JIQA 2NT3A 4ZMSA 1A82A 4WCDA 4A91A 2EC5A 2IYTA 1XJQA 2JCYA 3RF7A 4OOFA 3QZUA 4YAEA 1H9BA 4TKUB 4S1PA 2UYCA 3EIFA 2EZ8A 5EA2A 2EBUA 2ZT7A 2PT9A 3THSA 4JI0B 2GETA 1VE6A 4N5IX 4RE6A 4B48A 4JENA 1PWYE 3NNNA 2OZEA 4BWYA 2OUKA 1WXGA 3KYDA 4O8CA 4Y6SA 1C7IA 4KVZA 1SWVA 2PL9A 4KKXB 2B9EA 3ACCA 2WF6A 2CJWA 3BCSA 2FN8A 3L0BA 3UUGA 4ARSA 1WW3A 3OOHA 3ONFA 5FFNA 2FMKA 3KWLA 2HF9A 3G9XA 2ZUWA 5A7GA 1RYNA 2NPOA 4BVEA 1JW9B 1Q91A 3AKEA 1X7XA 2BKVA 1KF0A 4EK9A 2NG1A 1CR6A 4HLUA 2DQ4A 2VQ6A 5KO2A 3NU1A 4HB0A 4MJ3A 4BWGA 1PEAA 5M3BA 1E4EB 3V2IA 1T43A 1CIPA 1M3SA 1H85A 1NE2A 2Z6VA 5KOHA 4G97A 4JUIA 1RQPA 2ZWMA 1POXA 1YB4A 1I36A 3DXZA 4LBZA 3DFMA 1LNZA 3K35A 4UPVA 1C3OB 2VQFB 4MVJG 2QTNA 3O6VA 5EP2A 5A5DA 3BC1A 5BT9A 3OJOA 5IZ4A 5C81A 3RNOA 5AUOB 4GIBA 1H9AA 1WZEA 3N70A 4H60A 4UUOA 5FA5A 1QQTA 5AQEA 4HGNA 4KCGA 5K3SA 2A58A 3EFEA 4FHCA 3SS8A 1L7QA 1T3HA 3K05A 2UXBB 1IUKA 1SY7A 1I24A 2XGOA 4N03A 4EKYA 1Z35A 1YB1A 3THWB 1FFXB 3EG9B 3TSOA 1N2BA 1Q7CA 3IFSA 3OPXA 4IFTA 5DCYA 4YHHB 1PQYA 4PG6A 3CPSA 1FFDA 1NYLA 3GJ0A 3LRXA 1RAEA 1YRWA 4E1BA 1C7ZA 5JJBA 2M9MA 1MDFA 2R5WA 2VXCA 2AT1A 2HRDA 3D4BA 1BJTA 3IMEA 1H3FA 1JQ3A 4RVHA 1B8OA 1BEZA 4G5QA 2V5VA 1ZIYA 1IBSA 2DPLA 3HL4A 3RAJA 3TZCA 1UKEA 5L8VA 4QDXA 1KP3A 1U3GA 4XDYA 1KEKA 1JDJA 1EA5A 2NUAB 2Q8NA 3VV3A 5SYMA 2ZIGA 1GTRA 3PXGA 1MD9A 1T91A 4FMBB 2DG2A 2FF5A 3DP7A 3ABIA 2A5DA 4BWVA 1U3VA 2H63A 2ZXEA 4K6MA 4P81A 4P84A 3W06A 1AMOA 1H2FA 5IH3A 3LXRA 2O3TA 3Q9NA 2K2QB 3CUTA 1B93A 1FMCA 1LI7A 2JIOA 2FPLA 3RM3A 3KAPA 4LF6B 4K6CA 3I3OA 3JS5A 4UVDA 2IV3A 1AU9A 1TRKA 5AKXA 3TZQA 3ZWYA 2XZLA 2O23A 5IMBA 1FVOA 4Z2YA 4L4RA 2UZIR 3QVKA 3LKVA 4FB5A 1NVGA 3ABRB 1TOAA 5EVCA 5JY1A 2YRXA 1Z5NA 1ZUD1 3K32A 5GM2A 1XTSA 3NYIA 3NETA 4B17A 5IASA 3M49A 2JLVA 1HNWB 1GDHA 3CZ9A 3DMDA 4UZSA 2BI8A 2Y68A 1JIKA 3TNLA 2GWHA 1U28A 1DAFA 2J4CA 2R00C 1IHDA 1KGSA 2CLSA 2IXBA 2JVIA 5KNDH 5AM0A 3D3WA 2FI1A 4OLFA 1KI3A 3H7IA 1RCUA 2G9NA 1NR5A 3L4BC 4A0SA 1LI4A 5I8ZA 4BO0A 3U4AA 4S1NA 1W1UA 4DTCA 3E05A 4TT8A 3CGGA 4UHHA 5LXTB 3K53A 1TVKA 1RC0A 1W9MA 5E4TA 2NVUB 2HW8A 4PYQA 1ULTA 3RHSA 3NTUA 1U9CA 2ODBA 2YWHA 5FLKA 3M9XA 1AS0A 3WOVA 1GOTA 1NAHA 1XD2B 5KWJA 3C97A 2E4ZA 2O2GA 4R8SA 1GAEO 4TLLB 3T5PA 2L17A 4QXQA 4GGPA 2RK6A 4BQRA 3K6JA 4A8TA 3T1OA 4ZO6A 2YV2A 2NNWB 3GRVA 1KARA 3KZVA 3CJTA 4PLPA 2BGWA 3IIMA 4MIEA 1ABFA 2EFDB 4M36A 4X7RA 2QSYA 4CRWB 4IDOA 1Y3BE 1L4MA 4DCPA 1BJRE 3UYLA 1S2NA 4B3TB 4XFJA 4PGGA 5KSZA 1HRDA 4RL4A 3ZZ0A 2JKZA 1SIWA 3CZCA 5EMLA 3SIWA 2FSVA 2NU6B 4TRRA 1I1OA 5HE8A 3PWKA 5M5BA 1GSOA 1VKOA 3ZD7A 4CN8A 2ZTLA 2J0QA 2XD9A 1JKJB 1BW9B 1WCIA 2PR7A 4HVAA 5AVQA 5J2UA 3T7DA 1WSAA 3A6HA 2XZOA 3GROA 4L5IA 2ORYA 1F14A 4HMOA 4UBJA 3K6RA 1CUEA 3DUFB 1TKCA 3N0VA 3AR8A 4OXRA 1JAZA 3CLTC 4WGFA 4KQHA 4R16A 3TAUA 5JC1A 2HIHA 3ZDEA 4A2QA 1E2EA 3E3OA 1U7OA 1QC5A 4Q4DA 3IAFA 1UXHA 3SPXA 1FLNA 3OBBA 5A2GA 1AVTA 1GGNA 2QENA 3GFOA 4Z0HO 5JDCA 4P1ZA 4QUHA 2EERA 4X6LA 4QPNA 3N7AA 4YJ3B 1CQXA 2AH5A 4UPDA 3W77A 4IG4A 4OJYA 4EHDA 5F3WB 5BRNA 2VF5X 4QYSA 3VR5A 1ESDA 1G4UR 3U0VA 1CC1S 3IAEA 4DPMA 4ZYYA 3R6DA 2VSOA 4TT3A 5CCBA 1VJTA 1P44A 2JCXA 1MJ5A 3PFBA 2H6EA 4H35A 4KVGA 3UFBA 4YMTA 2GNPA 2WV7A 2YVQA 1RS0A 4IDFA 2UUCB 4GRAA 3M3HA 3MUOA 1FSZA 3VU9B 1QFZA 1DP4A 1N0WA 2ZG6A 2I8LA 3DP9A 3EVBA 2YJ5A 3H1FA 1V5EA 4DLUA 4LGVA 1W49A 3ZCPA 2GTHA 3R24A 4QT0A 5C9ZA 1Q1NA 1R9JA 4TSRA 1CULC 4MVJI 3JYNA 2GHTA 2DCUA 2WRZA 1RHMA 2FW8A 3WWPA 4LF4B 2BHLA 3L0YA 4KH0A 3UK2A 3OZEA 1M76A 2JDIA 2QIPA 5JE8A 2Z1MA 3RGWS 3S7ZA 1PLJA 4X00A 1YQTA 4NF2A 2PUEA 3G0DA 4DUYB 3OSUA 5AW7A 4B4WA 5EZ5A 1WPQA 2PGLA 2E9SA 3JR3A 2IIQA 5BY2A 2RGEA 4MJ7A 1SZPA 2I3DA 5DP1A 1WB6A 3IHTA 4UAJA 4DM3A 3DM5A 2PS3A 1J1IA 2RI6A 3K0AA 2IPOA 5P21A 3IUJA 2PUBA 4BMXA 4C01A 2PKEA 1DAGA 2BM9A 5B1HA 5AOBA 3PJRA 4EARA 4QVGA 1MMFB 1JPJA 1OE0A 2IYAA 1TT7A 4B35A 4PAMA 3PXXA 2VOEA 4TMWA 2FSFA 2ZUFA 5JS2A 4N8EA 2AR0A 5DGXA 2KQUA 3JYLA 4RIFA 2VJPA 2GXQA 1YR3A 5C4GB 2XQFA 5AVOA 3VMFA 4M1QA 4URYR 3CRZA 3VAYA 3THXB 1XZBA 1ZOPA 4RSGA 2FG5A 2PZMA 1DNPA 5AM3A 2GQ0A 1S1MA 4DTIA 5CFLA 4EGSA 3NM6B 1E0DA 4E2YA 2HPZA 3PNQA 2IOQA 1JV2B 3RT9A 1NE7A 4IR7A 5AKGA 1YFLA 1NURA 1V3UA 3LQ2A 1IXKA 1G16A 1YR6A 1DQZA 1B0AA 2QW1A 3KZXA 3QKRA 3SFZA 3ZHYA 4AYWA 3GLUA 4CODB 1D1TA 1QHYA 1RLUA 1Z7GA 2GPJA 3A6LA 3AEZA 3I9V1 4UMEA 1SXJE 4TYMA 4QU8A 3RQSA 4C7JA 1VB5A 1H42A 3PS9A 3B70A 1A97A 3QLEA 1QZ3A 5H9WA 1KI6A 5B5SA 2R0QC 2V6BA 2VJMB 4KE9A 2ZI6A 3TQTA 1UM8A 1K7SN 1ISMA 2OBBA 3BWEA 3EXFB 2WTXA 3CF0A 1J0XO 1O6BA 3CVUA 1JZTA 2XUIA 2K87A 2NADA 1LPSA 1T2UA 2XWQA 3KFVA 1X7HA 2CFCA 3T7EA 2DERA 3W2GA 3GFGA 4QTUB 2NNLD 3A32A 2QP4A 2QSJA 2NUTB 2WG2A 2XB8A 3EAQA 3I30X 1BS9A 3W3AA 4TMVA 2VI5A 1OTHA 3VKVA 3TGPA 3HYTA 4RM3A 4R3NA 3V4OA 4ZOAA 3AJRA 1R88A 2XMRA 2JI9A 5IHXA 3QU9A 1UF9A 1CRZA 2ACWA 1CZHA 2RGCA 3HWWA 4H27A 1SVWA 1COZA 4WA7A 3MTJA 4A5SA 1KFCB 1R0ZA 5C8VA 2N0SA 5LQMA 3CUSA 1A71A 3OOJA 3C39A 2C0PA 2C9MA 3PQ4A 2IZ1A 5EQFA 2Q1TA 1RYEA 2QN6A 2V4MA 3RD5A 4D92A 4X91A 5JPIA 4XVCA 5CDYA 1M5RA 2IYRA 5HRUA 4RZUA 4B9EA 2OXEA 2LCIA 4RIHA 4XYBA 5F78A 1L5KA 2GWRA 2FG7C 1YSCA 3K7EA 1E2MA 1T4CB 4MV0A 2Y99A 4ZAVA 1APBA 3VPXA 1JA9A 1I7DA 3WGUA 1ZA1A 1R6DA 2P90A 2NU7A 3LLMA 5JXIA 5AVKA 3GRKA 2R6CA 5KJCA 3DVRX 3UCXA 3JW8A 3K9CA 4ISCA 5AKLA 1G2PA 3A7EA 3D8BA 4KWTA 1PRYA 3K9GA 5AHXA 4JJZA 1GNSA 2WBLC 1U0GA 3AU8A 3OOYA 4MRSA 4X64B 4U7GA 3D8UA 5LDGA 2Y92A 2GKGA 3T5CA 4AZSA 1CUUA 1CVRA 4DMUB 2HQRA 4LDNA 3BJZA 1TB4A 3TTYA 4HX5A 3G0BA 3LBHA 3QF7A 1UMBA 5EQTA 3VNSA 4EG4A 2Q1XA 4BIIA 3R0IA 1P7PA 1R0SA 4IUBS 4OKIA 2HB6A 2J9GA 4EY4A 3OCCA 2XQVA 3PWSA 4FBLA 3FLEA 4JI6B 2VP2A 3Q10A 4NATA 1PF7E 3FUXA 4PRYA 3EMBA 1X2EA 4N5DA 4JDUA 3DHYA 3ZE1B 3F4BA 1ZLXA 3SBOA 4N9QA 3C15C 4RH3A 1Q0RA 3KZNA 3ORQA 1OAAA 1PLKA 2EP8A 2O4UX 2NO6A 2ZVPX 3EISA 3G8YA 4ZZ0A 1AV6A 1LX6A 3RNLA 3HKCB 4CMHA 1CLUA 1AV7A 4CDNA 2J8ZA 4CU2A 3S2FA 3QVWA 5DW3A 4R1TA 3M9LA 2AD5A 5B37A 1JSZA 5MN6A 2Y66A 4BS9A 3CX4A 5EPOA 4M1OA 3SS9X 4ESOA 1RP7A 3SZMA 4IVQA 1DIAA 1EBFA 3SFTA 4RH1A 1MX9A 3REOA 1V8OA 4J7XA 5D5QA 1JEQA 3TYXA 4JODA 3OHMA 5CB4B 2C82A 1XIVA 4JBXA 1WD7A 2GFIA 4X5OA 3AF1A 3TW8A 4P4NA 4IFIA 2SKDA 1Q77A 4PZZA 4TROA 3TKLA 2FF7A 3C4QA 1P77A 5CHYA 4MQLA 3K4PA 1R1DA 2C92A 2QIOA 1FTQA 2WSMA 3MWJA 2C8KA 3GH3A 3OCXA 4IKEA 3U4CA 5BUSA 3S99A 3PYXA 1K9SA 1GFWA 2G5PA 2I3BA 3E3AA 1GT91 2HMYB 4BMNA 2I4LA 1PJTA 3TGLA 3OQPA 3GAZA 2QN1A 16PKA 3WYNA 4MMZB 3EEOA 3MUFA 3A9RA 3ET4A 3FLBA 1H2ZA 5DEIA 1PS9A 3VR5D 5DDIP 4B2LA 2AEMA 3V2GA 2W6IA 2GN9A 3AERB 5E8JA 4DIOA 4AKEA 3E8XA 2KYRA 1ABBA 2H4FA 1DO8A 1Z17A 2DQKA 3EVAA 3HUTA 2VKTA 3PHLA 4YUVA 1PGNA 4B6QA 1T24A 4C21A 4CLOA 4J4TA 4GSKA 4LSGA 1WUTA 2JHFA 3RQIA 3ECAA 2UUBB 3PGVA 2NYAA 4EJFA 1T4MA 4G37A 5BNIA 1JIJA 1ZP6A 3ZY6A 4F4CA 1UFKA 4OQQA 2V1XA 2HUPA 3I9MA 3L41A 3RFTA 1FY2A 5JNLA 2Z95A 2EEZA 4HWPA 4PR0A 5K0SA 1IBKB 2IH4A 4WHMA 2GM5A 2OCAA 1PP4A 2PGOA 4KDRA 4MROA 4RMJA 3GXBA 2FEPA 5LB2A 2OV8A 5HQ3A 4JP3A 1RKXA 5AR1A 2WKWA 3VPDA 4DMKA 8AT1A 3GZNB 3WYCA 3NCHA 4YP0A 2JGDA 2EEPA 5HCUA 4V1CA 3SIRA 3AR7A 1LLFA 5THKA 3JAMA 2BHTA 3HV2A 1UPBA 3HLKA 3TWOA 3W8NA 1T34A 2EFEB 4DV6B 1XD9A 4UUMA 1RYYA 3REQB 5B7QA 3O4FA 3FLAA 3FHCB 4N3AA 3VMMA 2V1UA 1QYDA 1KY3A 3F6YA 3HCDA 4PTLA 1I13A 1T9KA 1X7WB 1Z4NA 2GUGA 4J16A 3REGA 3NIBA 4DV1B 1DKUA 1VLLA 1P0QA 1U1DA 3ZWMA 2XCRB 1XZEA 3CZ4A 4URWR 1JMKC 5I5GA 4R2KA 1U5AA 4FZ5A 2VCEA 3F74A 3A27A 4IIJA 3S81A 1P2GA 3H4MA 4FGKA 2W4QA 4I6EA 4R1LA 1BHSA 2WD7A 5DNEA 1Z8DA 4WXMA 3IP3A 2GNAA 3EXHC 1NMYA 2P2ZA 3BWYA 1RLMA 3DDUA 3L9WA 1K1EA 4IWYA 4JLMA 5FUVA 3UJ7A 1EE9A 1KMHA 1AIPA 4PBTA 2ZSEA 3SU8A 5EQJB 2X7XA 4KFUA 4OQNA 2ZUEA 1MEJA 2JVKA 1SUBA 1YZNA 1FSGA 2BFMA 3KALA 1A50B 2WIKA 3COZA 3C6KA 1N2OA 4H6XA 1BVYF 1LCIA 1LK5A 1T0UA 2CZCA 2Q5IA 4GXNA 2PANA 4TMZA 2WYUA 1J07A 3GLIA 1T3SA 1CEQA 3VYRB 3T3NA 1FS4A 3HH8A 5FT9A 4DJEC 4P7GA 4RJTA 1RP1A 2YY7A 4QFBA 4G9EA 4Y1FA 4RWZA 2VPYA 1MOSA 2JJ2D 3SQLA 3DLIA 3SYMA 5LNK6 3CUWA 3TDKA 1AQYA 1KY5A 1T5IA 3CY6A 4AZWA 1D09A 4ZHQA 3AL2A 4DPKA 2JGMA 5L53A 1ORVA 4MI9A 1J39A 1J9ZA 1R7RA 4ZYUA 5A3RA 5B2ZA 3P2EA 4DIKA 1B0UA 2IDMA 4MVXA 1BE8A 1LLUA 3KQSA 1MOQA 2BLLA 1YDWA 4JK3A 2X19A 4P83A 4BRSA 3M6XA 2OBMA 4K9RA 1UEJA 3EC2A 4C22A 4JXJA 2AWNA 4NV3A 3V48A 2Q0QA 4ZO4A 1VE7A 4ISBA 2VUTA 2DUJA 3JALA 3W2TA 5GY7A 3ZK7A 3ROXA 5A1TA 1AB5A 3GT7A 4R7ZA 3U3MA 2HU7A 1JEOA 1S3SA 5ECYA 1Z6AA 5G0VA 5I51A 3BCRA 4ALKA 3R3ZA 3RUIA 2FUG1 4W5NA 2CD7A 2GYYA 1LRLA 4QTTB 4WQMA 1JHVA 1ESZA 3NKLA 2FPUA 3S1AB 3S2UA 1TTPB 1SKMA 3CX6A 3OLXA 5L4SA 4U0JA 2X1VA 4S1WA 3D8HA 2QGNA 3BA6A 4H59A 4DRZA 4E7OA 1E2QA 5GONF 3K5PA 1AGPA 4E2ZA 1CE8A 3VQTA 2VHZA 2LDXA 3ZOZA 4Y1RB 3OLCX 4WFJA 5KTTA 4FR0A 5DBHX 1KO8A 5JMOA 3AR6A 1FYEA 1D5WA 2ZJ0A 3M6IA 4MSUA 4P54A 3OTHA 4J8PA 3STWA 2EJTA 4YFVA 3SM3A 1ONNA 2IP1A 2JS7A 2VT3A 3EFOA 4E30A 1QR6A 1TA4A 1M0TA 4FDMA 1USGA 1OI4A 2WPNA 1ONBA 4NQZA 1KVRA 2VK4A 3X2EA 3NWEA 4I55A 3C5CA 3ZBTA 4Z3KA 1DKPA 2IZ7A 3OX1A 3K92A 4PNZA 4XI9A 2OO3A 3QEMB 5KYNA 3FZQA 1IZZA 1QO0A 1U2DC 1NXPA 3GBVA 1DIHA 521PA 4EHIA 3HZRA 1D1QA 2VDQB 3KKZA 1ND5A 3L1IA 4Q3BA 4PZAA 3B2QA 3X0DA 5BWLA 2CMGA 1JXAA 3D64A 2D2IA 5AXDA 4E31A 4X8MA 4ECAA 5J4KA 5M29A 1RVDA 3BXGA 1U3UA 3AWIA 5CVCA 2B4TO 4GQAA 1JR2A 2VNIA 1DHRA 1F5SA 2P9FA 2C7RA 4HXYA 1PTJC 2CUZA 2PTGA 2ZPAA 3KQOA 2D5AA 3OLWA 3K15A 1QOZA 4G8BA 3NEPX 4X45A 3N6VA 1A5SB 2C7VA 3FH0A 4EW1A 5EWLA 5IJWA 3HB1A 2IYXA 3N86A 1FJXA 1UDRA 2IEYA 4PHGA 3ENWA 4K6HA 5HMLA 5K8IA 4CQMB 2GRUA 5AW5A 1Y4AE 1ZVQA 2FRDA 3FCYA 1L8XA 2QK4A 4IGAA 4NRDA 3C6ZA 4FINA 3HMKA 1T9GR 2C95A 4V0ME 3T34A 2WAXA 3CKKA 3TCXB 1NN5A 3B6MA 4JLKA 4L8WB 4TSKA 3SM9A 3R3WA 4ER6A 4HNTA 5L3SA 1AGXA 1EKXA 3AQIA 5HILA 1N0VC 1MLDA 1N2CB 1VBMA 2JJ1A 2LCFA 2P9EA 1J0DA 3TJMA 3WKBA 3GA0A 4ZCSA 4ND4A 4BB9A 2FGKA 3KWMA 3M6MD 4IUDS 2X3FA 3CSSA 1JALA 1L1EA 1KSFX 2CLCX 3MS2A 4Q1VA 2Y2UA 2YJTD 4PYKA 3BJRA 3KYBA 3MCAA 3AUTA 3TUIC 5IULC 1FCJA 1TXGA 4XVRA 3RBXA 1P4JA 2FPIA 1A5TA 4GICA 2W6ID 5KNCA 1FXSA 5LYJA 3PSHA 1OU0A 3INGA 4MV9A 1EYZA 4FYWA 3LU1A 3UCEA 2BFCA 1GA1A 5CB8A 3A2LA 3RE1A 4ALNA 1UAYA 1DIOB 1RPAA 2KM1A 1C4OA 3T3PB 2WWRA 4D96A 3IBGA 1FPQA 2OC4A 4HG2A 1R6BX 1QCYA 1T2DA 3SVLA 1W96A 2BSAA 3AUUA 1X7DA 4YCAA 5JSFA 5IRCD 2REQA 4B1FA 1FW6A 3L6UA 1LBTA 1XL1A 2D1FA 2FSIA 3ZE2B 5LIRA 1GAJA 3C43A 1LC0A 4P53A 2QZJA 5ICMA 2IWHA 1BOFA 3B5EA 1U0FA 3DHNA 4NFSA 3PQFA 4G1MB 5JZVA 2DPXA 3GJTA 1VI2A 1OB5A 1AUXA 1P8AA 2Q7OE 3R0JA 1E5QA 1L7BA 3NYQA 3VR4D 3K3PA 3WAJA 4PG5A 4A36A 3UA3A 1RU3A 3SSMA 1RQNA 1T2CA 1YDGA 2JHGA 1XP5A 2LP4Y 4DREA 1PDVA 2IYUA 3ELUA 5L3VA 4AP6A 3G2NA 2C2KA 1Z5PA 4R5HA 3ODPA 1D4AA 3G1UA 1GRRA 4HX9A 4V2UA 2JFXA 3TL6A 4OKSA 3TPZA 3ZZUA 4BVHA 4NYMQ 3WKEA 4ZK2A 4AY6A 4MGKR 2WMDA 3MRXA 4UJ3A 4YQFA 1ECLA 4NARA 3RVMA 3TO5A 1U3TA 2WQ7A 4IF4A 2Z2KA 1YVDA 3O9MA 3HADA 4EF5A 3BDIA 1XZNA 4KAXA 1SXHA 4C5BA 5BQOA 3HG7A 5EWMB 3FGZA 2QTHA 4M0LA 5KTNA 4Z8XA 1KJNA 4YRQA 1W76A 1KMCA 1NQUA 1Y37A 3FUCA 1XKLA 3LHDA 3SVZA 1V48A 5CYPA 4DDWA 1F8XA 3BXEA 3JYPA 4EY7A 4NONA 1I2ZA 4CLXA 2UV8A 1UXKA 2CNKA 2RGWA 4ZXFA 4MCAA 1CQWA 4B8ZA 1JSCA 2Z5VA 3MELA 5KUTA 2O8FA 4LHZA 1P31A 1QLJA 4NYIR 4FWTA 5FEUA 1RM0A 2VKQA 2ZYDA 2QVBA 4R1UA 4CHGA 4NBLA 4OMCA 5HZGA 1GXSB 1CY6A 4OB6A 1Z5VA 3GHHA 4BJ3A 8ATCA 1YDEA 5K8UA 1I80A 2B35A 2OAGA 4XTCS 3G7NA 2O0HA 2UVPB 2VYNA 2IYFA 2NV0A 4QO8A 5IN4A 4OHRA 1ADCA 1WU8A 2D54A 3GRPA 1XPJA 3SJUA 1L5FA 4QDJA 4RTJA 5AI6A 2VPIA 1AK9A 1YAHA 2I3GA 3EMDA 3JAWA 3MGAA 4FOPA 4REQB 4YRMA 3MSCA 1H4QA 1H93A 3P9QA 1EVIA 4F97A 2OCKA 3T7AA 1X14A 2G07A 1G2OA 2WKSA 3L77A 1Z38A 1RJEA 1SU7A 2IYLD 4B81A 1G21E 3AU9A 2VUUA 5ELLA 3B38A 1EXMA 2CLOB 2DAPA 2H7CA 3EEQA 4UEJA 5CVDA 1IRXA 3NTRA 3FTNA 2ZSBA 3ZU5A 2OBNA 3BGVA 3D8RA 1UWVA 3L93A 3BWBA 4TLBA 3RW9A 3UMSA 1DT5A 1KJIA 2XVAA 4RY8A 4RK6A 3CR7A 3VC3A 4AM8A 2ZUBA 2CZQA 3CCBA 4DMLA 4EJ2A 2RBEA 2NXJA 2Y1GA 2WSSD 4I50A 3G6WA 4HLDA 1WP9A 4KO4S 1Z4JA 3AW8A 4HAVA 4IIEA 4Q4JB 3OEED 4C7BA 4H31A 3GVPA 5K3BA 2JEZA 2ZRQA 3PFFA 3C5WP 1NXVA 1LTHR 2J0UB 2MINB 2ZLBA 1LKZA 2WV9A 4ND7A 1NXTA 1YCGA 1XDZA 3ESRA 3O83A 4PFKA 4Q9LA 4YQZA 2C8LA 4O29A 1XZHA 3K0EA 4A27A 1L7RA 1MGOA 3L1HA 4MIYA 5IBPA 4RXTA 1ZUWA 2CYAA 3ZVNA 1ZH8A 2POCA 3CONA 1U1IA 3O9ZA 3QI7A 1UP7A 1QO0D 2GVZC 2WLSA 4AX4A 3CUKA 4LBWA 1QXSA 4GOND 4JYAB 4UW9A 1SCJA 2C98A 4H3KB 4UFNA 3SZGA 4BLOA 4WKOA 4MR7B 1WG8A 4OQDA 4BDTA 1KI7A 3KXKA 3QLVA 1Z9BA 1A27A 1OX6A 2C1ZA 2I33A 2PMKA 1SQGA 3G2PA 4H7FA 3SBDA 5CFPA 2YXDA 1NG9A 3BERA 1NSTA 1ARZA 3UJAA 4UVGA 3UJDA 3T35A 3FGNA 3STYA 3RVLA 3HEMA 1HT0A 1OGIA 3ED5A 3G88A 3K2QA 3OZGA 1WV1A 2WILA 2XKJE 4HWKA 4KIWA 1ZINA 5BSFA 5CGZA 2POQX 4YNBA 1N3YA 3EGWA 4I4CA 4RKQA 4UDXX 2R9VA 5KOJB 1M34B 4JL5A 2PV0A 1UBNA 3VJLA 3FNGA 1RXYA 2C04A 1EUZA 2H3HA 2WTAA 3FVVA 2F3UA 3GGDA 2EWVA 2C4NA 3UJ9A 3CH4B 1RC8A 3E2MA 4RFLA 1EUQA 4IQGA 3P0HA 4O1HA 1M2VA 2XXBA 1NOKA 2CD9A 2R2GA 2ZITA 1VL6A 3OWOA 4ACAA 4AMYA 4D3SA 4AICA 1S01A 4Y6GB 1HGXA 1Q20A 1LX7A 4BB6A 1BFUA 3GJZA 4C4YA 3CRW1 5ALFA 5J23A 3X44A 2JK1A 3WIUA 1UPAA 2K4MA 4OX9B 2WIGA 4X3OA 3D1LA 1H1LA 4FLEA 5LJLA 1BEUB 2DC1A 1P17A 2VTVA 4IZOA 2QM3A 2H11A 3H5IA 3ASVA 4XQEA 1NI4B 2AYXA 1VZ2A 2H0RA 3O8OA 4M9CA 1Y3FE 3RBZA 4FEGA 1B1AA 1M2FA 1Q7GA 1XA4A 2AQIA 2N46A 3QYPA 3TG2A 2WP0A 3FDZA 5J4YA 4DV2B 2RGRA 3QXJA 3JWJA 2X5JO 2B61A 3FZGA 4XUGB 4BNWA 1N2JA 3T5BA 5LSAA 4Q3OA 1R12A 2QTRA 1VCNA 1H0KA 3AFHA 3JQAA 1RNLA 2XGMA 1UPCA 5JMWA 1MO2A 3HP4A 3K96A 5F3DA 4R3UC 3SNKA 1R8QA 4RPGA 3DAPA 3TL3A 1NY5A 4QICA 4HEQA 3CF4G 3ZI7A 1N77A 4Y0NA 1IUNA 2FPWA 4OQMA 2KB0A 1DDGA 1Z3CA 5ANRB 4LSZA 5BORA 2I4RA 3H86A 4W8HA 2CL5A 2UVQA 3ORSA 4DXAA 4CEIB 1UBHS 4WDRA 3DLBA 4MTCA 1XQVA 1OI3A 1PAUA 1V4NA 1RI5A 2Q46A 4CUJA 3QX3A 3BICA 4L1KA 3F7NA 1MJGA 1A2BA 3OMWA 1U65A 2GCEA 2PZ8A 3MRTA 3UMBA 2HWUA 4CTOA 4OB8A 4BMYA 4PCLA 4E2WA 3ASYA 3QJYA 2HSWA 5TQJA 1X1SA 1NBEA 4NFHA 1AXEA 2BRUA 1GZUA 1F51E 1XXHB 3QVVA 4CIYA 2HRZA 3DHVA 4FXOA 1U2SA 1WDKA 1A9XB 1ZM4A 4GHWA 1WMDA 3KSRA 3F3MA 2FR8A 2R97A 4M8LA 3UICA 1NLUA 1VJGA 3AL3A 2HT6A 3RK0A 5FF9A 1V37A 4FIZA 4KN6A 2JANA 3NV9A 1VSQA 1FRNA 2BBWA 2H7XA 3KJHA 3WWZA 4BMOB 5HP4A 1SVUA 2J0EA 2NSJA 2AMJA 3LY5A 4RIEA 3V00A 8GPBA 3N2EA 1Y7TA 1HDOA 3ASUA 3GQBB 5CJJA 1E3WB 4FK8A 4FN4A 2ZSHA 3EXEB 1I51A 4JN6B 4TMKA 5BSTA 1MJGM 3KAJA 4O4JF 4S04A 2WB4A 5C52B 2GDJA 2YRFA 5TMPA 4MS3B 5IBQA 3HDHA 2GHIA 2RBGA 3CLTD 5K9ZA 1IJEA 1PWXA 1XXLA 1XJ0A 2NSYA 2ZBPA 4V0OA 1ETUA 5EJEA 3L7LA 3VSDA 1DIGA 2FZVA 4DZZA 1X8LA 1QZXA 4CQLA 5F9FA 1HE2A 1MDBA 3G2OA 1I7NA 2IUYA 4MX8A 2HA2A 5CH8A 1TYEB 1JE0A 5KYUB 1DEXA 1ODIA 2OVFA 4OQPA 3OU2A 3WICA 1JDNA 4MITA 5K99A 2QN7A 5EFOA 3HY3A 4YWJA 1KDTA 4DBZA 4P98A 3U26A 2XUJA 1P7YA 4ZGGA 5CA0F 2B34A 3VR0A 2RGNC 3FPLA 4JZYA 1KEVA 1V11A 1QYXA 1T4GA 2AD1A 1G4HA 3FNRA 4KVAA 5C7LO 3M6AA 2BFDB 1XX6A 4H0CA 3R0QA 2AG8A 3ZG6A 2H06A 5DHSA 4FEEA 2RC5A 1BXRB 1ZUIA 3ZW9A 3NIDB 1Z82A 1JTEA 1YE3A 3BTOA 4KX5A 2EQBA 1BCRB 1EJ2A 3DTYA 4F4JA 1CK4A 3FFTA 5LC1A 5JQGA 1AGYA 1NVVR 2O3QA 2FSHA 1UJBA 5I9LA 3OHPA 1M6HA 4Z53A 2P27A 1ESCA 2Q9AA 4BMPB 4C6HA 2VJNA 1UPXA 5AM4A 1Q84A 3WLEA 3TIGA 1BMFD 1OWOA 1XCMA 3FZEA 1ACLA 1CFZA 3PHJA 5E9QA 1LF0A 5IANA 1OXSC 4EMBA 4IJKA 5F73A 1A4RA 2B30A 2CDNA 4YP7A 5JAUA 1IWOA 4AY3A 1KS2A 2ATXA 1S2DA 2EGUA 4HPJB 4RS3A 1W94A 3U60B 4S12A 1AKEA 2HA5A 4TL9A 4UXJA 1YC5A 1T0JB 5AW2A 1YTLA 3EPJA 4LDQA 2QLNA 4MB0A 1DFGA 2OOSA 3UVEA 1SUAA 3GCZA 1N9GB 1OTXA 1UM9A 3OAAA 2H5EA 5EPEA 1EFVA 1QDEA 2LD4A 2YHIB 4TTVA 1WHTA 3ZNQA 4CMJA 3R09A 2H0AA 4PXAA 4RMHA 5HW0A 3BDAA 1YD7A 4IV8A 3ZV5A 5LZ4A 2DSNA 1IY9A 2JL1A 1DJQA 2HZ7A 3S4YA 1K86A 1SMKA 1FL9A 1IWPB 2JFUA 4FYJA 5E6RA 4AMBA 1JAIA 3DA8A 1A9OA 3EXHA 1Z2CA 2M1ZA 4OFBA 2C5GA 2W6JA 2YS6A 3AZOA 3DOOA 4JU8A 3S29A 3H0KA 2P9TA 3A6ZA 4ZN6A 4BMSA 3AJDA 4DSAA 1ZR2A 2H08A 1Z4LA 1ONPA 5EE5B 3DVLA 3AKDA 1E60A 4G0QA 2Q5QA 2II6A 5BWMA 1T8YA 3ADBA 3C3JA 4BU1A 2OV6A 4A1FA 3NVKI 4JQCA 3EVGA 3QBEA 1I14A 4RELA 4I4IA 5FD8A 2P9YA 4HWOA 1J5EB 3LRPA 4FFBB 2Q0XA 4L8LA 3C3BA 5ALWA 4ZV9A 1R16A 3PPIA 4LNUA 4C1BA 1Z6ZA 1EHCA 2O0LA 4NMHA 1TO6A 4EVQA 4KUHA 2IKSA 3NATA 9MHTA 2XTNA 2A9JA 1GG8A 1V6AA 2W2TA 2JLZA 3NWOA 4WZAE 4R9SA 1KJJA 3QUBA 1Z33A 1BMQA 4WBNF 3BZUA 2Q8QA 4P33A 3RYHA 4DQVA 2I80A 3BMQA 4MUAA 1SHKA 2P78A 4QULA 4FCTA 3ICEA 3RJZA 2PMBA 3D8SA 3IEMA 2X8JB 2BKEA 3GGJA 5JNTA 2V9ZA 4DMFA 4QC2A 1NUSA 3TDMA 2FJ0A 2J30A 4KQXA 1GTG1 2SBTA 3I9FA 4W9RA 1H5QA 1HBJA 3WKCA 3WZ2A 1U9YA 1H8HA 1GILA 1G42A 2ZYUX 4X62B 2WWFA 1PVOA 1ZU5A 1SKQA 2LE0A 2PL3A 3OPYB 4Z1MD 3TZEA 2BH2A 4ROTA 3MAGA 1RPTA 2PXHA 5K3FB 4YDQA 1ZCZA 2H1OA 3M4XA 1ZD5A 1Y4UA 4IF6A 5BVGA 4CUZA 2Q2OA 5FTKA 2QP3A 1O9GA 4FHGA 3KD3A 3U3OA 2CLEB 4PAWA 2JH8A 3TZKA 4G5YA 3DZIA 2PG3A 5T3YA 3BF8A 1K88A 1U2TA 1J56A 1ZGHA 3Q87B 4L7QA 2SNIE 2NUPB 5LOVB 1A7KA 3FB1A 1FMLA 1XFDA 1CJCA 3EA5A 1RXCA 1XAJA 3EULA 3R7DA 1O5IA 1EFCA 3AXSA 2EX4A 1JDBC 2WYVA 5F1PA 3Q41A 4HBZA 5FRDA 1E1CB 2Y1FA 2L2QA 3UFXB 1O77A 1NUUA 1P2FA 3DV2A 3UPTA 1B74A 3RTAA 4IKOA 3PITA 4KFRA 4HYEA 1U2DA 1UZMA 3PRYA 3GDWA 3UJBA 1TU3A 4RV5A 2Z56A 1UFRA 5A0FA 4OTZA 3R9IA 1J2UA 3O3NB 3Q7PA 3UWSA 5IT9A 1T8UA 1S2IA 4X84A 1AHNA 3Q1LA 4PSAA 4EA7A 2WWXA 1EGHA 5CTAA 2WUVA 3H11A 4WT7A 2XODA 4JV5B 4WY5A 2V58A 2H1FA 2PMCA 3DUWA 2IRWA 4ILKA 2K7ZA 3T9FA 1PQWA 4ENWA 1JIIA 3DDOA 4IIHA 1AT1A 1L4EA 4FBGA 2FPPB 3TB6A 4PPFA 3T4EA 3T1TA 5JR3A 1RHQA 1EHIA 4CIBA 1WS6A 1ZN9A 1YAJA 1RBQA 1HE1C 4G1EB 3IS3A 3FYUB 4W1PA 3WK4A 2O1EA 4HMQA 4HZIA 2PV7A 1CUDA 3LT1A 5IC6A 3WWCA 4CR7A 5BXQC 2VBFA 1O3YA 1DIRA 2BTQA 3BHNA 4PTYA 4MWEA 1H4SA 4O4HF 3W9BA 3ADKA 1XWWA 2V7EA 1ND6A 1P5HA 1V8DA 3KEOA 4YP6A 3QXXA 5LBUA 2Q4RA 3PFKA 5TF4A 3GLGE 4EI8A 4MLDA 2O8BB 3G23A 1YQDA 1IWBB 3MJRA 4YBZA 3WK7A 1GNVA 2X86A 6ADHA 4M37A 1PV4A 3U3DA 1RRVA 2OGSA 2GTPA 3OX2A 2YW2A 3P2IA 4KJZA 5D1NA 1X15A 3LF1A 2RH9B 4RVGA 1PR0A 3RVBA 1YUNA 2OZKA 1EVJA 4MEBA 5FOTA 2R4QA 5H3HA 4EVSA 1SUFA 1GITA 1TUIA 3OY2A 1S1CA 1WXFA 4CTKA 1Q3HA 2XLBA 2YW9A 1K9VF 3JZFA 4P32A 3V7UA 3L2OB 2BH9A 2VSYA 1SIOA 3AEUA 2ZRJA 3AJEA 1Q6ZA 2FMIA 4JB3A 3G2HA 1OI7A 2GD2A 4RADA 2AR9A 2OV2A 3MHPA 1UK9A 2OE2A 3WSWA 2O2JA 2V0NA 3KLMX 4PM4A 4MHTA 2Z2IA 4YAUA 4QODA 1VHJA 1UWKA 2JBWA 2QUBA 4WXHA 4H17A 1OFUA 3OURA 3KE9A 3GN2A 4MVJD 3Q2IA 5TSDA 2QLFA 2DSTA 1UXIA 3DYBA 1IQ0A 4C0BA 1ECJA 1DS6A 1J20A 2OG2A 2HXSA 2ZI4A 3HO6A 1D03A 1MG0A 1O9HA 3RH0A 5E9WA 4QU5A 1ZLYA 5GGYA 1CUWA 3LHFA 1N6HA 4DILA 2AVDA 4RLSA 3L4EA 3JD2A 3D8TA 4OBWA 3ABQB 4F85A 3TLYA 2ASEA 2YHBA 1RRCA 1IHUA 2FFJA 3H1BA 3V8VA 1MFZA 4M6WA 4QD3A 3F4LA 1G4AE 1QG6A 3KPUA 4N82A 1U4OA 4YMIA 4ER7A 1P2VA 1ECBA 3ISVA 5I6DA 1LBHA 3QIAA 2WIJA 4FLMA 5LZ7A 4EOGA 3MWEA 2Q7XA 2IE0A 4RMNA 5HQJA 3ZS9A 3RTBA 3A1CA 4CM7A 1WJGA 4EUNA 1VG9B 4HL6A 4MRNA 3TD2A 3O4VA 4FJ2A 3WNBA 2O3SA 2XRMA 5HE9A 2R60A 5CYFA 3VI4B 2RHTA 4KRGA 4TV9A 3ZNOA 3OPNA 5AO9A 2JFZA 1WVGA 3U31A 1JSLA 2FSPA 1INLA 1I7PA 3OD1A 4C2AA 3S68A 2JKVA 3WGIA 1KFBB 2E37A 3OPYI 4OAQA 1L5LA 3JRWA 3FSGD 1GLGA 3S2ZA 4CMGA 1OOEA 2AFHB 3PQ3A 5FTJA 3PD1A 2A94A 2OQIA 3F6EX 1SBZA 4JT4A 1M2KA 2PRIA 4OXKA 4XCQA 3SBXA 2ORVA 5CFMA 2CJFA 1GU0A 3BXZA 1L5WA 4X3CA 3D6VA 3KCNA 1CQJA 3ABSB 4F8EA 3OMLA 2B6NA 4E5VA 4MWSA 3VH2A 1Z4KA 5IW8A 4AJNA 1FU4A 1QGUA 1RFGE 3DBHB 3GDOA 4NICA 1JHOA 3MWFA 4DDUA 4PSCA 2JIMA 4K9NA 4DCSA 2OMKA 1PO7A 1Y9JA 3TRHA 5J4HA 1FB5A 2E4YA 3ND6A 5DOZA 1M7GA 3H1GA 2Z09A 4TXJA 4B3XA 3DBRB 1NVEA 2O2IA 4N01A 4JI7B 4FYVA 4ICIA 5NLLA 2AUMA 1CVIA 1YQEA 4EMSA 4CR8A 3IH5A 3LPCA 1SU8A 4KBYA 3EQ6A 4JSYA 3WO0A 1Q3TA 4D57A 5FTLA 4OGGA 5JV5A 3BHMA 4GP9A 1GV0A 1NBIA 3UC9A 4FQ5A 3ZKWA 4DLPA 3WK8A 2RHJA 4NZYA 1Y6GA 4MGHA 1HNXB 3D6HA 2A9RA 5DLDA 1GM5A 3EGCA 4YCLA 5LA6B 1SUEA 3BRQA 4CKZA 2RIRA 2DBQA 3IIIA 1IYZA 2HAEA 3HO8A 3ZE8A 1Z18A 4L6CA 1DUSA 2HQOA 4MYUA 4QE3A 3CLHA 3DNMA 5D1HA 1YE5A 3TGWA 3T7CA 3NAQA 4C29A 2WICA 3E18A 3PGA1 4UXIA 2QXTA 1SHUX 4OHFA 3NHYA 3ZNNA 1Z7WA 3P2JA 2GJ9A 1A9QA 1SVIA 1X0XA 1NQAO 1NPTO 4XLTA 3DHEA 5G4KB 1YMQA 1MIOA 2ZTHA 2ZJAA 1E9AA 4INZA 1MO5A 1Z36A 1L7PA 1CJVC 1NX6A 4E08A 1U8ZA 3QELA 1GN9A 1BXZA 3FCOA 2VDNB 4GC5A 4I8XA 4L16A 2CMFA 2R6GA 2YR0A 3VHQA 2WWYA 5AUPB 2JEOA 3FJYA 4NMWA 3G59A 4ZOCA 1JJ7A 4IQ0A 2CWDA 4J4HA 4EI7A 2A1UA 2IYNA 5BSKA 3Q9LA 1DCKA 1ZQ1A 3NAMA 2VVTA 2W4IA 5FL7D 4RHUA 4D9GA 4RY0A 2PX0A 3GZTB 1GIAA 5EJ4A 1GTL1 1NTRA 1JNYA 4F6CA 1ZOSA 2PHZA 4ZQIA 5KOIA 3V8RA 4DSUA 1XTKA 2CHEA 1N6IA 3ES9A 1Z8HA 2B1RA 3UM9A 3A2NA 3V8BA 3EZGA 2WTUA 4GT1A 5E6SA 1JB1A 3QJGA 4GBMA 2JFWA 5CFNA 1G66A 1DDOA 4PC7A 2NTEA 1IVYA 3FETA 3MOSA 4TXLA 3I1IA 5TEVA 3T7IA 4DDKA 3TNFA 1TZKA 2IS1A 4LHWA 2GM4A 4GOXA 1XXHE 1Z34A 3EH1A 4ZT2A 3ETNA 4CIDA 2XYQA 1PWHA 3BB4A 1IZ9A 4FNOA 1QH1A 2OLEA 4K1LA 1Y6QA 2YCLA 4TYNA 1F5NA 2YQ4A 2ZCJA 1SJ9A 1E2IA 3MILA 4TPKA 2ZRDA 3N2KA 4KPUA 5I8PA 2HPAA 2NU8A 1E3IA 4EZEA 2YHAA 3DV9A 1HEIA 1P3Y1 1XZMA 3DHWC 3ZH2A 4LF7B 3GUUA 3WB9A 1CRPA 1YHYA 1JHMA 5BWCA 3FWNA 4RZ2A 1N9KA 2O7QA 3UATA 1GYPA 2J7KA 3V7NA 3U7GA 2OQ2A 3IDZA 4P7JA 2RJ3A 5ERYA 2BFFB 2OM2A 3STUA 1Q2XA 1RQGA 3SNHA 4KVFA 5SY9A 1RVV1 2QLJA 4BQOA 3WLJA 3QOXA 2JHAA 5AKJA 5ELXA 4INPA 5ADVA 4JEMA 4ND5A 3WXBA 4F3YA 3FR8A 5AOAA 3HVIA 1XCGB 3TVDA 1WQ1R 2NXCA 1STOA 1IEQA 3ONWA 3EVFA 1OC4A 3RIMA 1RQXA 1JFFA 1OIVA 2RGGA 1PIWA 2FR0A 2XWBF 3QRWA 4MUKA 4NBTA 4QDTA 4IM7A 4TMXA 3SFVA 3TTWA 1WUHS 4R0VA 1AK2A 3I0NA 4X8HA 4JY7A 4IINA 2UU9B 5FOUA 4EYOA 5KREA 1OILA 1LXCA 4AD8A 3CG4A 3RADC 4JYMA 4AF6A 2IHYA 3IUSA 1YDHA 2A9OA 3FM9A 2GN8A 2NXEA 3AI1A 3IEUA 3NT5A 2XT9A 5FTWA 4K05A 1ZOOA 2J31A 4II7A 4XARA 5C34B 2W2KA 4G24A 2BR3A 1Q95A 3CRNA 4NFYA 2W0SA 4YDRA 4P34A 3LPLA 5CGQB 2VAXA 5CT6A 1U2RA 3VSEA 4E5KA 3LP6A 2YOGA 3IPXA 1IHOA 2NSDA 3GFBA 3BMNA 4DC0A 2NTJA 3F8WA 2PJUA 2OWDA 1U5BB 2BFAA 2FPSA 5T57A 1W1IA 3ROGA 4CTNA 1V5FA 2C9DA 3KK0A 1OASA 2FFBA 2HZBA 4TWRA 3V4FA 1ZM2A 4CTMA 1OIWA 2P67A 4JWTA 4QVIA 3GJ3A 2QPTA 2AR7A 3ZZ1A 1X8KA 3ETJA 3I12A 1K5GA 2CFSA 2F4VB 5E38A 4QQNA 3WADA 5ALPA 1OZHA 5LD2C 2O3RA 2I03A 5DNUA 2D06A 3O8CA 2JHCA 2BMVA 4OQLA 1VYTA 3DR3A 2NO4A 4GR5A 4QSMA 1J5XA 1YVEI 4ND6A 5JXGA 1ZAYA 1JFVA 3LCJA 3TFWA 5CA1B 4P7KA 1CT9A 1O96B 1YQXA 1TYBE 2PX3A 1E3JA 2ZCVA 3R23A 1XDDA 4XX0A 1GTSA 5THQA 3RAPR 2XNCA 2V7TA 1K68A 4LBYA 5GONA 2CHGA 2QJFA 2Z83A 3GJSA 2MIIA 1XWFA 4JFRA 1BS2A 3T95A 1IPEA 4F5WA 5JLJA 5BNTA 3VU1A 4R1OA 3UJPA 1SH7A 4WW0A 1TVEA 4BUZA 1MXHA 4BNZA 2PKRA 3C70A 3SX2A 3PD0A 1GU1A 2A30A 1TU4A 4CMAA 4YTEA 2R751 3EF0A 1G41A 1ZMBA 3RRNA 4N48A 3KT8A 4ZU6X 4UVHA 3AV0B 3MJTA 1A5BB 2ADOA 4S0ZA 4UM5A 1FNMA 3LCRA 3QKUA 2Q3JA 5FLXA 3QSYA 4GLOA 3GLFB 1RWNA 2XYGA 1SG6A 4KK3A 2PQ6A 4QWMA 3LQ4A 4ZT3A 4B3BA 3AOGA 3KOOA 4Y6LA 1UL1X 1N5LA 1FDRA 1MVOA 4G4IA 3RSFA 1IXYA 1SD2A 2VAPA 2QYSA 4BFLA 3IYLW 3OFKA 4RMIA 2M6KA 4DA7A 3NEAA 3KD2A 3I9V6 1K98A 2B2XA 2J9FB 4EITA 3G0CA 3VPBA 3OQMA 2V7XA 3JATA 2GK4A 5I7AA 5IN5A 5TS3A 4XQGA 2H1WA 4XUDA 5HCIA 4RD4A 3FBWA 5DLEA 3DC7A 3IA7A 4K6FA 3A70A 1UAGA 1HEUA 4YCSA 4PZLA 1Z7YA 4TMTA 1XYGA 4DZRA 4ECEA 4CEJA 2H52A 4EP1A 4H1UA 3D81A 1EWRA 3IMGA 1L5OA 1A9YA 1XPUA 3U49A 2CVQA 2PRSA 1CIJA 4QBIA 2XMDA 4BE9A 3HO1A 4E5UA 4RXUA 4C4PA 2J45A 2ET6A 2AFIA 2Z3VA 3NJ8A 3K9NA 4FOOA 1F9AA 4DAOA 1EUDA 3EPPA 1T5SA 2DWQA 3NORA 1C2YA 1GO2A 1QNFA 1R8SA 4P3NA 1T9CA 3W7BA 1FJGB 1FYVA 1JR3A 3FYUC 2OFPA 5TQ2A 2ZSIA 4UUPA 1U6KA 1IH8A 1QUFA 1XDWA 1DRKA 3URMA 4B7XA 3DQZA 1NBHA 2JJQA 3L92A 4KQ2A 5THXA 5DX0A 3RYIA 5F7XA 1GRNA 4GI1A 4R2WA 5I48A 1BIFA 2EJWA 3TXAA 3ZCRA 3TFOA 3I3SR 2D1QA 3V6LA 2X40A 1KSHA 4J1TA 5B57C 2Q1YA 3GFSA 1XLTC 2AN4A 1W36C 2DR2A 4TL6A 2FN7A 1QRTA 5DM1A 4AFNA 3HCAA 1E2NA 4RETA 3RUEA 1OTYA 1ZRNA 3H97A 2EKLA 4OP2A 1JZSA 4YA6A 4I3FA 4A23A 1LY1A 2WVGA 4FHFA 4CM4A 1FQWA 1R18A 1VI6A 2PT7A 1N32B 4ND8B 2PH7A 3LNCA 5K0GA 4KNYA 1QQ6A 4C87A 2B25A 5KKAA 2LZ0A 1CD5A 3JQBC 3TLZA 4U2FA 1E98A 3SSOA 3X2SA 1T1SA 3TI7A 5I9SA 1EX6A 4HNUA 2FUEA 3NC1C 4MW6A 4UHEA 2C5HA 1OYOA 5A2QA 5H16A 4MW1A 4XVUA 3EX7C 4Z7JA 4C0SA 4BP9A 2B1JA 3SEZA 1W4ZA 4Q19A 5SICE 3C24A 4MWCA 4QAQA 3AC0A 2G70A 4R68A 1F7VA 1JG1A 4LTNA 5IVKA 3K30A 4CCYB 1SXJC 1BFDA 2AFRA 2B4RO 4EPXA 3I9KA 3IKTA 4YQYA 3BTSA 5ECGC 4XGIA 1ZIDA 3MTAA 4NZZA 3KQUA 4DSOA 1R74A 2H51A 3HLTA 4IX9A 4PLVA 4OHBA 1D2EA 4R4JA 1X7ZB 1EDBA 2EL7A 4EM6A 2Z5LA 1HKUA 2X9LA 3QLTA 4U00A 1IZ8A 1E4VA 121PA 1K2VN 2AIRA 3I8SA 3OVMA 1XGKA 1G1AA 2JFVA 4MP3A 5C3UA 4C88A 2Z6AA 2IY9A 1C8VB 3DAOA 3PXCX 1Z63A 3UJHA 3RG2A 4A2WA 1IK4A 2HJSA 4MQEB 2OB1A 3WDLA 4EO4A 3EBLA 4YFYA 3ZGYA 2DFKB 2AXPA 2B92A 4EYQA 2VYCA 2Z4SA 2VP5A 5CNMA 3JQ6A 1T6NA 1KPIA 1XQYA 1TUBB 1DLJA 5EOVA 1IATA 3H2SA 5ER6A 5MFPA 4QBGB 3ZDFA 1RAIA 2PX5A 3SLGA 4AS1A 4O4IB 2O3UA 3M4JA 1J99A 4KMRA 3N8KA 1GCUA 1VYHA 3EZLA 4I2VA 4JA2A 4MOWA 5FI0B 3PNVA 5BUQA 2VXYA 2FWRA 4LY9A 4L5BA 5ADUS 2VS1A 1K75A 3EGEA 2VA8A 3HA7A 3I2YX 2HYDA 2E4AA 1YCFA 3U7QA 2QAJA 3FBTA 3CNEA 3H19A 4ZPJA 3ZGNA 4ZDIA 1OLSA 1W6UA 4KZKA 3DGFC 4WASA 4KI0A 2O59A 2F9MA 1CV2A 4J2TA 4M0MA 2HLHA 1F3OA 2AC4A 3V34A 3X1JA 1P74A 4BBZA 2XRZA 3ESBA 1I1NA 3DDZX 3TSAA 1UBUS 3CU5A 2A3RA 2JGAA 3RSCA 5HJEA 2G6BA 1THZA 1DWUA 5DGCA 1P5RA 4ZVKA 2QQGA 3FDJA 2BZ1A 3OE7D 3DOEA 3F2IA 4IDHA 3NEYA 2X1MA 1NVBA 4UHKA 3S2YA 1QV7A 4MLZA 1M1ZA 1AHPA 1P4SA 2QE7A 3VHRA 2OCDA 1T8RA 2L42A 5L3RA 3BVPA 3AR3A 3O73A 2G71A 4A8JC 2PCJA 2R4TA 4KQCA 4W1QA 5ISMA 3PEUA 3EE6A 3ICWA 5HX7A 4OH1A 1KJ8A 1R6TA 1SHJA 1PW7A 3TUZC 3TNYA 4Q01A 4XUCA 3L49A 5G53C 2C9CA 2QRVA 1G20E 1NATA 2VNKA 3HCFA 1J00A 3CZQA 3AGPA 2J48A 3VX3A 4UFPA 2WKRA 2GCGA 1U7WA 4NSNA 5COBA 2R79A 1NMSA 1XHFA 3F9CA 3ZUPA 1O5OA 2YVLA 4OM8A 4YMWA 2YBDA 2QOEA 2DKFA 1W25A 1COWA 2IZ5A 2IYYA 3P26A 4LXTA 4MARA 4RM2A 3T4PA 4EGAA 2IYWA 2QX4A 1JVNA 1OBFO 2G40A 1NVWQ 2ATCA 2EXXA 1ZHOA 2Q07A 4W5TA 1E1MA 4B0OA 1SUWA 3EH2A 2EDCA 1FBTA 2JGNA 1HY3A 4YK7A 5SYNA 3VTFA 1R8YA 1ST2A 1VP9A 1PTKA 2P5TB 4JROA 4Q12A 3WC4A 4F91B 1GR0A 1US8B 1K08A 2NZYA 1BGWA 3AO0B 5E7JA 2VT6A 3A10A 1G9TA 2R85A 5LUAA 4DB2A 1Y82A 3N2NA 1R4ZA 4PO9A 1E2HA 4WLNA 4TOIA 3B1JA 4RVNA 1AUOA 4ZKEA 2RHGB 1I9CA 4K3UA 3ZE9A 4EY5A 3LY8A 4YDSA 3K9FC 1L1QA 1YA8A 3B2NA 3LBIA 3OLVA 4H7HA 4RPLA 4TTSA 3SJBA 2FRVA 3DNPA 3L6EA 4FT4A 3LUDA 2ONZA 2YWFA 3UKOA 3E2PA 1IOZA 4OB7A 1CYDA 2BKLA 3LBNA 3ZEIA 4ARZB 4DG5A 1L8QA 4L9RA 1DMSA 2WMYA 3SC2B 2J3LA 4GYJA 3ORRA 3VPHA 2BV3A 1QVAA 4CKBB 4F8JA 1FS6A 2J3EA 2KE5A 1RACA 4XDHA 3SY8A 4E4YA 2YIJA 1XU4A 2BZGA 1ZPDA 4RZIA 1Z74A 4YJKA 1D0VA 2J7PD 4CQMD 3B9PA 3PI7A 4XOUA 3ZTWA 4N7BA 1LPBB 4ND1A 3TD6A 3FB4A 3JWHA 2Z6UA 1JLRA 1QHHA 2V6IA 4Q3EA 2UZ1B 1Q50A 1CZRA 1XJ5A 1V6SA 4J4BA 4MKXA 2FUG6 4L5JA 3CLSC 3FHOA 1BDMA 3MM4A 4UC0A 4YDHB 5CVTA 3ADCA 1ZUNA 4JC5A 5AI8A 4TRNA 4JOSA 4CM6A 2QD2A 1DTSA 1QIGA 1E32A 3AVPA 5L95A 4AZ3B 2GPNA 3DZGA 4IHQA 2ZRPA 4JJKA 1U0OC 1X1AA 2W2OA 2TMGA 2HL6A 2R5FA 1KEUA 4IRUB 5KNDD 3ZDAA 3VR6H 5FWYA 1ZCBA 3A1EA 3RTDA 4IMPA 2PVCA 1UBSB 4FILA 1AZWA 5JY6A 3UGJA 2O8EB 1F0KA 4Q7MB 2B8TA 2QGFA 3HBJA 3DKKA 3WQBA 3QVOA 1VC2A 4NCBA 2OC9A 1DXQA 3HI6A 2UKDA 1DV2A 1JIVA 2PZFA 2ZETA 1W75A 3BSSA 2M6LA 1J70A 2D4AA 5DNWA 4B8YA 1F7UA 5HIKA 2QN9A 1A4XA 1TZCA 1WULS 1U2EA 4O2AB 4WNAA 4Z9XA 3T9EA 3ZQJA 2QZZA 2GZMA 1U0SY 3D4IA 3VH3A 2GF2A 1R5OA 1D6NA 1V9CA 2W48A 4UZFA 2HK8A 3LECA 4JKYA 3FW1A 4LRWA 4HC4A 2Y1OA 5IP5A 5HKKA 4KV9A 4PR3A 4EZIA 1BHO1 3TQCA 1F0NA 3SC6A 1UDAA 1YONA 2GYUA 2MSCB 3QGMA 1XCOA 4NNPA 4A03A 1JU3A 2FP4B 2NZVG 2OBLA 3PDIA 3LBFA 4GLLA 3TINA 4IIXA 2PO5A 4Q15A 3VYVA 2C57A 3N0WA 2J3IA 5IPFA 2H2AA 4B3FX 2WNHA 4JI8B 4NQRA 1TCAA 2CLKB 2VYVD 3GA5A 3TZLA 3UMFA 2ENWA 1K3UB 3HU5A 1YVUA 2X5OA 3LFHA 1OH6A 4US1R 4LEIA 5AKZA 2G63A 3LC7O 4FCVA 1CQIA 1GRCA 2AI2A 3JD1A 3HJBA 4NDZA 5DMHA 2R1TA 2XNJA 3GO4A 3STTA 1C9JA 2YMMA 1PGQA 2EP5A 5KKNB 2FV8A 1S8AA 2W0MA 5EMNA 1VPWA 2JB9A 2LW7A 4LAFA 2IH5A 1K8RA 4I5EA 1G5TA 2Z9DA 4E11A 1ENPA 2LKDA 1E69A 4WLOA 1BE0A 1ZGJA 4YI5A 3STHA 2HTFA 1L5MA 4O4JA 3UGQA 1ACJA 1KBQA 1KY4A 3EOAI 4QHSA 1FFWA 1ZM3A 1CS0A 5A4AA 2CV0A 3DW3X 3ZD6A 3VKUA 2MT9A 3MWDA 4UM7A 4Y2TA 1H66A 2O6LA 6PFKA 1XRLA 3Q7EA 3AI3A 5AIAA 5K0FA 2Y0BA 2W8BB 3MCZA 1SCBA 1P9LA 4W7IA 4PXSA 4B6EA 1WF6A 3L7OA 3RGGA 4E6EA 4ESVA 5EJ6A 1H23A 4H2DA 1WF3A 4IIFA 3C6YA 1QIHA 4JI2B 3LUJA 1AC5A 1LBEA 2IZZA 4UHBA 4U9HS 3ST7A 4LZAA 4RFSB 5CA0A 4BMVA 5BN3B 5K8VA 3OKAA 3GJ5A 3PL1A 4FTWA 5KPJA 3D7KA 4QFDA 4BO4A 2IOHA 1FBNA 3ILVA 5JYBA 3GN1A 1CKEA 4R98A 4EFKA 4C4OA 5C8YF 1DAEA 3LM8A 1FNBA 1UKVY 2I2XB 1V2HE 4YLYA 6YASA 3AL0C 3E9RA 2PZJA 2HDHA 3KELA 4XYGA 2GN0A 3RSOA 2BBSA 1V71A 5EY5B 1SG9A 2WI8A 1DOZA 1OPRA 4EFMA 3QHPA 2Y71A 4QPZA 4I1VA 3SKXA 1XEFA 1D4ZA 4PQRA 3N5CA 3W05A 3JQGA 3CTPA 2NPFA 3OWHA 1R0KA 3FPSA 2W2LD 4DCMA 1L9XA 2RAFA 4RKFA 1CUCA 5IDXA 4EFLA 2ZE5A 2IBTA 2E87A 1Z13A 4WE3A 4OSEA 1HL7A 4QJ3A 3SF8B 1XD8A 2FWNA 4OM7A 5AVTA 5ILOA 5CK5A 3AF0A 3BHJA 4AP9A 3KJIA 5BN4A 1H1TA 1AF7A 1V7QA 3PUYA 3U37A 1GKUB 4PRKA 4EH1A 4E3ZA 2O2EA 3HDVA 4R84A 4D9KA 5C1DA 2TECE 5K6AA 3JWIA 2GM3A 3HNRA 3OQIB 2EHJA 5DXJA 2J4FA 1ONOA 3GFTA 3V4VB 2HT1A 2C31A 1LV7A 5DNCA 1OKKA 1Y5RA 2HO4A 1DBWA 3KSDO 1SKBA 2P8JA 4Q37A 4R8VA 3TLEA 4MAFA 5C1OA 4U63A 4DV7B 4RTOA 5HKBA 3QV1A 4HUQA 3W9SA 1QPZA 4D25A 2BHSA 2WABA 1DOHA 3W5AA 4E15A 5JG7A 2ZBVA 3DWGA 2ETXA 4MS4B 2VAMA 4QELA 1XSEA 1ETHA 3BN3A 4QFMA 1YRYE 1YHZA 3PF9A 4JVMA 1YA4A 4LDPA 3KTAB 4N3GA 4RA6A 4XIFA 3ZWNA 4J2OA 4YPVA 1Y1PA 3IPCA 1JBEA 3IJ5A 2HN9A 2WZDA 1D8TA 3U4QB 2CL6X 1DVRA 5LWQA 2FPGA 1AUQA 2NZ2A 3C8ZA 4P0PB 1CUXA 4RPCA 4H1TA 4K3VA 4Y67A 4BBJA 4XXHA 5I7HA 3IQXA 3UMCA 1GYRA 3JYHA 4WL0A 3D9QX 3UJ6A 1NDQA 3B6ZA 1W8IA 1T8PA 4Q5IA 1Z8FA 1KNXA 2P9QA 4Y30A 2VH5R 3FPFA 2PZLA 3KRTA 3D43A 4E4RA 3OF5A 4OXIA 1EINA 4LFCB 5JSZA 3O1HB 5JJCA 2OGZA 4X0EA 5ALTA 4D6XA 2HQSA 2QRZA 2VJAA 4LCEA 4LOAA 4LZWA 4ZMBA 1G8GA 2CVZA 4EJSB 1O6FA 3NJRA 4EPYA 2PQMA 2ZP1A 3RUCA 3CA8A 4HDNA 1IQPA 1RLOA 2CL0X 3I2FA 3KQYA 5JCOC 4WBNA 4XYLA 4Z51A 2B20A 1R9NA 1V2GA 2CHQA 4FNGA 4FYMA 3KZOA 3PKJA 1OYYA 1RRGA 4MKHA 4FDLA 2R6ZA 1DT3A 3WK9A 1NQ5A 1U80A 4G4JA 4EA9A 3UUWA 1ZXXA 3BGDA 4EG6A 1KAGA 4FWBA 3C7AA 1FX0A 3EGOA 3GMIA 4F6RA 1VYVA 2O57A 1NVFA 4QGAA 4QOHA 2CFTA 2HV9A 4RULA 2PR2A 1NW8A 1CUIA 3CS3A 1HDYA 2ZULA 3UBTA 2C9BA 2P9CA 1YB2A 3U4MA 3BCUA 3ZIDA 1QTRA 4UAUA 2XUFA 4QU0A 1U3FA 5REQA 4DCVA 1Q15A 3BRSA 3PQ2A 4BB0A 4FBMA 5FPTA 4D41A 3P9RA 1XCLA 5CDHA 4L3WA 3Q1KA 1ELOA 2QPAA 2R7AA 5EJGA 3SIPA 3LYHA 4BGVA 4YUYA 3SSAA 5JDIC 4DL9A 1T8SA 4QXPA 5JCJD 4FYKA 1II8A 1ZKDA 1IY0A 1RBYA 4A10A 1NASA 4AJ1A 4AF8A 1IPHA 2O7VA 5SY4A 1LZKA 5CB6A 1CF9A 4HRAA 3V8PA 4MGZR 4EX6A 2D2FA 1FDUA 2QVCA 4ZMRA 2R3SA 3DL2A 4F45A 5GZ6A 3PR1A 3WHPA 4BNLA 3TNJA 4UTPA 1FP7A 4WUTA 4TUYA 4ZTBA 2A57A 3JWEA 1UT5A 4NENA 4EKIA 2W43A 5IC4A 4J90A 1CY4A 1NF2A 1HDRA 1IY2A 3AHIA 2BUBA 3N76A 4ZFNA 2AX3A 2RHWA 5FFMA 1VCOA 1DUVG 3T6KA 4ARIA 2HWYA 3GBPA 3WNDA 3FGOA 4D3DA 3ZZNA 1XB2A 3IJRA 2CT8A 5IAJA 2WHPB 4BQFA 4CETA 2J09A 5CLQA 3NVAA 4K0RA 5HG0A 5KYWB 2FOIA 4GSYA 2F3SA 4JLPA 5TPWB 5INTA 3ID6C 4RZ3A 2VHXA 4HGZA 1L5HA 3D3QA 4CM8B 1P6XA 1UR5A 2CDRA 1D2MA 4G4SP 3R9KA 4YLGA 2A92A 2WHQA 1KQPA 4A2PA 1J42A 2IEBA 1TYZA 2W6NA 3Q2OA 3TUJC 1X39A 4DANA 4A73A 3SR0A 1JJBA 2IELA 3W5IA 1K7FB 5CCEA 2C3MA 5TX7A 4JVOA 2GN6A 3EVTA 4O4HA 2CJYA 4TKVB 2PQ0A 5JBNA 2ZM6B 3KL4A 2IVZA 5EIOA 5JASA 3H5VA 2JLRA 4DUGA 1GPYA 1OXKB 1PNVA 3IT2A 4ZVSA 4WV3A 5BMVF 4DMMA 4BN4A 1ZD1A 1W2HA 2O1WA 3DDHA 3M4NA 3SBEA 3PJEA 2A33A 4QBTA 3E7WA 1DPGA 3ZHUA 7MDHA 2ZE8A 3OJLA 3T3MB 1ISFA 4DQDA 3I4CA 2ERXA 3OLZA 1ZRMA 3H1TA 5FPPA 2EG9A 2Z9CA 3OZSA 4TYPA 2XH8A 3TOXA 3IKJA 3VH1A 4ER5A 1XDSA 1RIIA 2R96A 1E5TA 4LMRA 2FKNA 3FNHA 4JX8A 4G1VA 1I2DA 1XLTA 5IBCA 3WK6A 5AKKA 4RA9A 2YN0A 4DT1B 2ZWOA 1RKUA 1WX1A 3C6MA 1HYGA 1JFRA 4UBKA 3GF4A 4H9GA 2WIDA 1AE1A 2H1CA 4J76A 4U5XA 4IXTA 1GUAA 4CMEA 3DVSX 3KP1A 4ZAYA 3RUAA 2J6BA 4H15A 3ZWDA 4H1VA 1SBIA 5A9SA 5BQXA 1EEXB 1KU0A 1M0SA 5D3QA 5J5VA 2P9BA 1YF3A 2P0AA 3RRYA 4LISA 1JQKA 2X0EA 2BPOA 2FR1A 3IERA 3QVSA 4L72A 1OXUA 4PLTA 3ZW8A 1RW4A 1JSRA 3HKEB 2XOXA 4YRAA 4EYEA 2QHXA 4DBLE 1SZJG 1T5OA 3TVYA 4YR9A 3GLIE 2JBAB 1LVUA 1W46A 1RLJA 4JITA 4Q9JA 5B2EA 2OLKA 3KSAC 2M6RA 3S44A 3UBMA 2ZXUA 2D8MA 1Y6FA 1XAGA 3CEPB 1I5RA 4EVIA 3FD8A 1M1UA 5SZHB 4EW2A 4S0XA 4KSCA 1Q7EA 4QASA 1KZ6A 4NDAA 2ZIXA 2EBFX 3ZWBA 2KMLA 4RIGA 1A96A 1RTTA 2VBIA 4AYXA 3L4KA 2HRRA 1FMFA 2PJDA 5FPYA 1QKKA 3DBLB 2FQXA 5FR2A 2KLBA 2Q41A 4PLWA 5LQSA 3T61A 4BXOB 5CBPA 4RTPA 1X9HA 2DQZA 1LJUA 4OHOA 3ZWOA 1A0OA 1E3SA 4UNIA 3OHSX 3KB8A 2I7CA 1F06A 4U39A 1AKQA 1H69A 2IZOA 4WESB 3AFNA 1FDOA 4KXXA 1M74A 1SC4A 1SKYB 3Q8WA 1KVQA 4NCXA 4NABA 5L6LB 2XSZA 3R3YA 4YP5A 4LOHA 4YP1A 3K9WA 4RGQA 3VTZA 4C30A 3ILXA 2QAGA 4FLFA 4JB2A 4QNMA 4QTYA 1Q16A 4MIKA 1H3NA 4Q3CA 4CWAA 1NBMD 5DBIA 3Q98A 5B6IA 3JSAA 3EYAA 2X0JA 1SVLA 1U9IC 4IJVA 3NT2A 4RVUA 3OZFA 3SZ3A 4RQTA 1R8XA 5AJHA 1RT9A 3FWHA 1O6CA 5CJ2A 3OEYA 1AO0A 5C37A 3V5NA 3QITA 3UTCA 4U3JA 4MVJP 4NJMB 1CBUA 3K0BA 1IDOA 2QYHA 1UAAA 4MJLA 4YRZA 4C2BA 2JASA 5SZJA 3A3YA 4UTXA 3I61A 4YAGA 3BK2A 4FUTA 9LDTA 1SQ5A 3B1VA 1RM4A 1Y6JA 3H3FA 3W1WA 5FOQA 1LQ2A 4NCJA 3QG1A 2QY9A 2QRUA 1M2JA 1P1IA 1ZI8A 4OBBA 1OFHA 4XM0A 1VL5A 2EP7A 2JAHA 4NC9A 3L6CA 4W1SA 3GMTA 3X1KA 5ABPA 4ZOEA 1SU6A 1F4LA 4X9XA 3UQZA 3RYCA 1QBGA 2YYSA 2HR1A 1E7WA 1Y8RA 2BE7A 2G5GX 3AYZB 3NBAA 2FVYA 4JJIA 2G77B 3BFPA 4W9NC 3WGOA 2EJUA 1AS2A 1HT3A 2GB4A 1YZUA 5AUNB 1OBOA 3T7KA 1VXRA 1MIHA 3QUCA 1P19A 1W4LA 1DO0A 1KORA 2Q50A 3A58B 4JUDX 4RPIA 3VNBA 5BXYA 1YB6A 4QUJA 3I6ZA 3HQ4O 4ITRC 5G41A 4TL7A 4AKTA 5D3KA 5GWXA 2FMXA 2PFKA 1FSFA 2WPDA 3LPAA 3MMXA 3OA2A 1VLMA 4LV5B 1AKYA 1IBMB 1W7AA 3RKRA 1SXQA 2ZUTA 5K3OA 1IMOA 4GX1A 3U48A 5E0OA 1TT5A 3EQ2A 4LXGA 1TIBA 2Z8YA 5ICEA 3VR5H 3IKMB 3A14A 4KWEA 4WTOA 1Y8QB 4NCKA 1M2NA 5L7WA 1CX9B 2Q6OA 1BKDR 2CYBA 3KU4A 3F5FA 2O48X 3UG7A 1BSVA 5K7SA 3QLUC 4LECA 2Q1SA 1WKCA 1QQ7A 3FJOA 4GOLD 1Q1QA 1MH9A 3HBLA 4KC0A 4N3NA 3AZPA 4IEEA 1NFRA 1A9TA 1TZBA 1V1RB 3VGJA 1RJWA 4CM3A 1MPTA 1VE1A 2GARA 2WUFA 1G64A 4UCFA 5AHWA 2XTZA 2OD9A 5E6UB 3K09C 3K70B 2X2FA 3I52A 3NBZC 3DMPA 4W8GA 5JC8A 3PDCA 4MP6A 5KC9A 5AVXA 3M9WA 3NIFB 2DYKA 1I32A 3RU7A 5AVZA 2BVNA 2BFNA 3LCUA 4Q3KA 3HBMA 4UHCA 2MDTA 2BMWA 2QTGA 1U0BB 1L4YA 3QXGA 3ZHCA 4WKNA 4FQ8A 3K1TA 821PA 2WLTA 3AUJB 1AQUA 5I9MA 3SR4A 1N5KA 5EZYF 4KXNA 4LNHA 4JXZA 4IOKA 1CR1A 1YZVA 1ZM9A 1A8PA 4ZEXA 5JOQA 2NX2A 1H65A 4ZVPA 3O2NA 5BWBA 2JFOA 1QG0A 4E5NA 1MABB 3EIQA 3NGXA 2HWXA 4PVDA 3F7OA 4RVSA 4YECA 2HKIA 1F9EA 4I19A 3X1MA 3ZLBA 1QSGA 4L08A 4RVFA 2X0DA 1Z39A 3BUSA 1IULA 2LIVA 1AQ6A 1LSSA 1RJGA 2WYIA 3NC4A 3OCWA 1VJ1A 1EE2A 1EFHA 3D6TB 3QNWA 5DFAA 1KQOA 4GDMA 1JLMA 3OEWA 1WIWA 1D0SA 3PQCA 2ZIVB 3NTQA 4D42A 4DYHA 1HKHA 1UPTA 5DYGA 4DV4B 2O06A 4BZWA 2L82A 4BVAA 1SUIA 1P60A 2B5VA 5JSKA 1FE8A 4ASUD 2ECFA 2VRNA 1QM5A 4DLRA 4G63A 2QNRA 4F2HA 2H9YA 4K6GA 2I71A 5AK5A 1L4NA 1QIJA 3D02A 4M1MA 3T3DA 3TRDA 1GDDA 1PQPA 2H5JA 3W5DA 2BM0A 3PT9A 2WP8J 2PX2A 4M9ZA 4OBEA 2DFPA 1VTKA 4QXMA 3F5QA 2W22A 3CFYA 1Q0PA 3HKDA 4NE9A 2A84A 4UUBA 2ZUVA 3UCFA 3WIEA 1J2YA 1WW8A 4RSRA 4CMIB 2DTEA 2FWPA 1ESNA 4B3GA 2AF3C 1QFXA 3ZXIA 5FPHA 4LF5B 5NULA 4CKEB 3V7FA 5KMGA 2HRBA 3EWIA 1H05A 1P39A 1GCAA 4JR0A 4UTNA 2HJWA 4QRDA 2ZQZA 4U6NA 3L8EA 2R7NA 1IM5A 3W3AH 2R5NA 2ZR7A 3K0FA 4HDSB 1OBCA 5TMEA 1XNQB 1H2AS 1K0UA 4EATA 4WJLA 3BZWA 3CXRA 3V7YA 3LX5A 1X1DA 2WJYA 4BFVA 1SVKA 3K1YA 4FZRA 3DWEX 2AZMA 4MYDA 3IA2A 1H6CA 2FWJA 2H1LA 2ZTMA 1SXJD 2F43A 4INJA 4WZZA 1U3WA 4COOA 2AJTA 3PLAE 1XRRA 1OHHD 1YS7A 1Z5OA 3LS2A 2J32A 3B1XA 4H18A 4JXKA 2E21A 3EG9A 2XITA 4K2HA 3THWA 2B21A 3II6X 4EJSC 2AJ8A 5EMMA 4B2YA 1R5NA 4F3CA 2CB0A 2GEKA 3MLBA 4HEA6 3L43A 1N57A 4HK4A 2F9LA 2B5OA 3UOAB 5G3ZA 2H9AA 4O8ZA 3VA7A 5MGNA 2JGEA 1TGYA 4Q9IA 3LDGA 4J0EA 1OFTA 4U7JA 5FHRA 5TPZD 4FX2A 4PLFA 1UKZA 4O6VA 3GJ8A 4XIYA 4UFOA 2FU5C 1Y98A 4ER3A 4EUFA 3NHAA 4JP8A 5EXSA 2ZYRA 3T1HB 1O6ZA 1Y3DE 5ALMA 4GR4A 2VPQA 3D6MA 2E85A 3L8YA 4OF4A 1VL8A 4BRUA 2G7MC 4MVJM 3KJNA 3WLAA 4CVNA 3RAFC 4FGJA 2IBSA 2RI1A 1KE1A 2Q28A 3BMCA 1H8ED 4K9KA 4XIJA 2B4QA 3RSLA 1HRKA 1E5DA 4R69A 3KHUA 5F5XA 1XZCA 5M04A 1DJMA 2C8JA 3ZJTA 3RJ5A 1F0YA 5IZCC 2QKYA 5FNZA 1V7PC 4KOAA 5HDBB 4BVLA 3BAFA 5B58C 2HMTA 5DCLA 3VX4A 4XD7D 4E21A 5F33A 3MXOA 4YGYA 4X65B 1KSJA 3OJ0A 3EW9A 1PX2A 4G01B 4DIFA 2QU8A 1QGZA 4R9VA 3SSNA 4AS3A 5AW0A 4LC9A 4PNHA 3U6KA 1QO7A 5AVWA 1YRLA 3INRA 5FTNA 5J2TB 1SOMA 3PP8A 3O3OB 1IVSA 2RG7A 5A3VA 4KLAA 1N2GA 3DWFA 1JJVA 4MB6A 1P1RA 3LQFA 3JZMA 5EZSA 3B6IA 2RAUA 3H0CA 4GGOA 4M22A 4OQEA 3WHLA 3R40A 4YV1A 4FR2A 1QOPB 1K66A 1XLWA 2B1QA 1YGYA 1O2DA 2DR0A 2ZWAA 2XZDA 1PLLA 1MA3A 3GLHE 4GWKA 4K2AA 4ZU3A 4YAJA 4L4UA 3RRJA 5L3QB 2NVUA 3ONNA 3IURA 3WLKX 2OHGA 3ETCA 3H2KA 4KLZA 2OYCA 3BWXA 1UZNA 2WPDD 2HGSA 2DBYA 1XTIA 2IYPA 2OO5C 3IQDB 1YS4A 1PHRA 3WMRA 4AZVA 2FPXA 5K0LA 1J8MF 1UJ6A 1NVTA 1MO3A 2D7CA 3C98A 3DLAA 4O4LB 4D99A 2O0KA 2OLJA 3AEQB 4KI7A 1SOUA 2VPPA 3N2LA 3DKPA 2FXIA 3P7MA 4PFJA 4PSVA 1Z47A 1XZJA 2XTAA 4RK5A 5ADHA 5KYYB 2ZWPA 2GZ1A 3JASA 3CNLA 4Q4AA 4YO8A 3D5EA 1FJ2A 2C2GA 4MEJA 4Q05A 4TTAA 4EHHA 3WBFA 2C1XA 4V0MA 4C0JA 3KVNA 5JCZA 1Z6GA 1ZC3A 1QYRA 4I2NA 4HKTA 2OXIA 4DLBA 4JBYA 1L5QA 4L0QA 1PK9A 3RREA 2YN2A 2C7QA 3BT7A 5LQUA 1GQOA 2XAAA 3L8HA 4MVCA 1GGEA 1YQGA 2WFZA 3A9VA 4KR0A 2IEZA 5B2FA 1C0KA 3E0XA 2V03A 1H2XA 3ANYB 4FYIA 4KN8A 2J6CA 3UAGA 2WZQA 3G2KA 2R66A 2XT6A 4WEQA 3LQYA 4DADA 2DCMA 1UFQA 2AW3A 3DEIA 3IVMA 4MQFA 4R2JA 4YCJA 3EGDB 4IIGA 1KMMA 2W2QA 3I34X 4S2EA 4TV8F 3KYJB 3ZYCA 2XCSB 4KBGA 1YR7A 3H1AA 1UQTA 3GPBA 3ZYZA 1WBBA 4BFZA 3MB5A 1MV5A 3PC4A 3R7LA 3SQWA 4M21A 4GM1A 2NO9A 1BWPA 2QJOA 3HN6A 4F84A 1PSDA 2ZATA 2UZ4A 2DXIA 1M9NA 4AY2A 1I3CA 4EJ0A 2PPVA 1VSVA 2I4NA 4CKYA 2AVNA 4B71A 5K2OA 3WVNA 1G8AA 3ICVA 4XUEA 4MIOA 1BRTA 1YL5A 5FBQB 3SHOA 3CLSD 2F8SA 4POAA 5IFKA 1XK7A 2RKOA 3D3NA 1A9XA 2PBFA 3BPSA 1CUZA 3FE2A 3M1IA 3M6VA 3MT7A 4O2BB 5D01A 4XWOA 1W35A 1IEWA 2VTBB 1Q11A 3NRJA 2PS1A 3AEKB 5LMNB 3UAZA 1X7GA 2QTVA 3H17A 3OZRA 2D2VA 3DMGA 6AT1A 2GBPA 3C1OA 1G6KA 3CURA 4GPBA 3IOBA 3PFCA 4WFQA 4J0HA 4XEHA 5CLIA 4FGZA 3MBIA 2I2BA 3O8RA 3EVDA 4PG7A 1PJ4A 3H84A 3ZXSA 2ABWA 1Z6YA 4WD3A 1PT7A 1JILA 4PC1A 2VATA 1E9FA 3LFUA 1I2BA 3DNFA 1L7AA 3ND5A 4ZRDA 1X7YA 1YZTA 3BX1A 2Z5GA 3KYDB 3IKLA 3IBFA 2QA5A 3NHZA 1R6UA 5B1YA 2QMZA 3N8DA