4PTZA

Crystal structure of the escherichia coli alkanesulfonate fmn reductase ssue in fmn-bound form
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
173
structure length
173
Chain Sequence
b'MRVITLAGSPRFPSRSSSLLEYAREKLNGLDVEVYHWNLQNFAPEDLLYARFDSPALKTFTEQLQQADGLIVATPVYKAAYSGALKTLLDLLPERALQGKVVLPLATGGTVAHLLAVDYALKPVLSALKAQEILHGVFADDSQVIDYHHRPQFTPNLQTRLDTALETFWQALH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FMN reductase SsuE
publication title Crystal Structure of Escherichia coli SsuE: Defining a General Catalytic Cycle for FMN Reductases of the Flavodoxin-like Superfamily.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 57
structure length 173
sequence length 173
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.38: FMN reductase (NADPH).
pdb deposition date 2014-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ptzA00
3OWXA 1AHNA 2Z9CA 3D7NA 4H6PA 3NHFA 3F90A 3NFRA 4J8PA 4GR9A 3B6MA 2WC1A 3OWHA 5BUCA 1FLDA 3FW1A 4YAFA 1C7FA 3OX2A 1AG9A 2KLBA 2V5UA 3QE2A 1D4AA 3UXHA 2BPOA 3FX2A 1AKUA 1C7EA 3NHPA 4FGLA 2HNBA 4LA4A 5ULLA 4YAOA 3HA2A 1SG0A 4DIKA 1D03A 3KEGA 1XI2A 2ARKA 2N1MA 3OVMA 1XYYA 1CZLA 4QOHA 2QX8A 3NLLA 2QR2A 1YRHA 3HLYA 4Y9UA 4PU0A 5NLLA 2Q62A 4Y7CA 4HEQA 1X77A 4QOFA 1SQSA 4YAWA 2MT9A 3NHLA 3ZHOA 4S24A 1DXQA 4C14A 3QFRA 3FVWA 3W79A 3KAPA 1B1CA 4QOGA 1AKWA 5FUQA 3NHWA 3O2NA 3GFSA 3NHSA 4CF6A 4ZVNA 5F51A 2Z9DA 5LJIA 2D5IA 1I1OA 2Z9BA 4R81A 3SVLA 4NLLA 3GAMA 2A5LA 3ESXA 5EMNA 1AKRA 3O73A 1RTTA 3JSXA 4U7GA 4Y9RA 3RPEA 5A4KA 2QX9A 1OBVA 4GI5A 4PTYA 1JA0A 4QODA 2BN4A 1YDGA 2F1OA 3K1YA 3ESYA 2RG1A 3TE7A 4BMPB 4D02A 4H2DA 4U7FA 1YCHA 2FDXA 4ZVLA 2KQUA 1XT6A 3U7IA 1RCFA 1KBOA 1QHEA 5LLDA 4ZVMA 3OX1A 1T5BA 3FNIA 3GFQA 3R6WA 5LJLA 1YCFA 3OX3A 2MTBA 1FVXA 5TGZA 2OHJA 4XDHA 3N39C 3NHRA 4N65A 3L9WA 2V5VA 2OHIA 5FA6A 4YAUA 4LAFA 4XDGA 2Z98A 1ZWKA 4C0WA 3B6JA 2HPVA 2QX4A 3W77A 1JA1A 4U7HA 3OJXA 4C0XA 1RLIA 2BF4A 4ICIA 4OXXA 4QOIA 3UXEA 5LMCA 1D04A 1DXOA 3HR4A 1FUEA 5B3LA 1AZLA 3N3BC 3ES9A 4N82A 4QOJA 2XODA 2QWXA 1F4PA 4QOEA 3EDOA 1QR2A 1YCGA 2FOXA 2XOEA 3B6KA 4LTMA 1FLAA 5LBTA 1ZX1A 1CZKA 1WSWA 3L9XA 1H66A 3G5MA 1AKTA 2FZ5A 2BMVA 2FX2A 2OHHA 5NULA 1CZRA 4NULA 3LT5A 2ZKIA 5F4BA 3W7AA 3TEMA 2X2PA 3N3AC 1BU5A 2MWMA 1RLJA 1TIKA 1YKGA 5FX2A 4N9QA 5JROA 2M6SA 4ZVKA 2OYSA 3KLBA 3NHYA 2Q9UA 1FX1A 3TZBA 3K20A 2MOKA 2R97A 4PTZA 3QFCA 1BVYF 1CZNA 3EYWA 1TLLA 6NULA 3NHJA 3LCMA 2FZVA 1QBGA 5F12A 2W5UA 4LTNA 1KBQA 1QRDA 4DILA 2BZSA 5B3KA 1E5DA 5EAIA 1DX9A 1AKVA 4FGJA 1WSBA 3OJWA 3U7RA 3P0RA 1FLNA 3W78A 3KAQA 1J9ZA 1J9GA 4ESEA 2R96A 4YQEA 1ZWLA 1OBOA 1AMOA 4LTDA 1T0IA 2V9CA 4DY4A 2FLVA 5LBUA 2FCRA 1J8QA 1H69A 1FLVA 4YALA 2FAXA 1GG5A 3GFRA 2QX6A 3FJOA 2HNAA 2M6RA 4F8YA 4HS4A 1OFVA 1V4BA 1NNI1 1CZUA 2QMZA 1YOBA 2B3DA 4FGKA 1FTGA 3S2YA 3F6SA 2AMJA 1AKQA 4CETA 1CZHA 4BMOB 1J9EA 3NHKA 4FX2A 3B6IA 1CZOA 4C76A 5EA2A 3F6RA 2GSWA 3NHUA 3ESZA 2FVXA 2QMYA 3F2VA 4M0CA 1XYVA 4GQIA 5LVAA 2X2OA 1VMEA
chains in the Genus database with same CATH superfamily
2IDJA 3GZNA 3KPUA 2ZUWA 4KWTA 1KDOA 1PG5A 3K72B 1IY0A 3P2EA 1K8XB 3RR2A 1CUYA 2JIOA 2LXNA 2NSLA 4JWTA 2KW5A 3IAEA 2ZJ0A 2CXNA 1DBRA 3KL4A 4ZAFA 3WYCA 2HSEA 4DLLA 2Q6VA 3HFJA 3KUCA 1G21E 2VN8A 3RROA 4X41A 1BVRA 2GCEA 2VSQA 3BMCA 1UF9A 1V3UA 2W6MA 3B89A 3EUEA 4N8DA 4XTRA 1T26A 3F47A 3OQNA 2W42A 4FXOA 4QVGA 3W9YA 3SLGA 2YUTA 3GQVA 2C2WA 2C5HA 2VUTA 3IP6A 3K15A 4N6OA 4TKLA 3BXHA 5AKEA 2AXEA 2N46A 5JFGA 3L6DA 1YS2X 1M6YA 3KWFA 3NU1A 4LHXA 5SYMA 1SKBA 1RWMA 4B75A 1DTEA 1K88A 2O1SA 5GTDA 1EMDA 1UFOA 1ZFNA 1ZH2A 4G9BA 4IOLA 3FCCA 1OW3B 2HA5A 2XE6A 3EXHB 4KO2S 3SQLA 3N7AA 5BWBA 2Z1MA 3QPDA 3FHTA 3AR8A 4O29A 1YZKA 4HDAA 3UK1A 4QHSA 1PYOA 2A9JA 3ZV7A 5M29A 1CYDA 4XWYA 4MVWA 3WGNA 5A1JA 3R41A 4PO3X 3ER9A 4TTTS 5BN5A 4WACA 4DJ5X 4JEUA 4J1TC 4B6SA 1J2TA 2G04A 1PWHA 1KZ6A 4ZT6A 3ADKA 1DOZA 1LKZA 1NVUQ 2FPKA 2IEGA 2YRFA 1WUTA 1AGYA 2N1MA 2WAAA 1NKSA 1XLWA 3KPYA 1KS9A 3M34A 4L16A 2FW1A 4M4SA 1R4MA 3V3TA 3QV1A 3G1WA 1A77A 1WB4A 4UEOA 3SEQA 3AC0A 3PDUA 2CWWA 1FFXB 4FFRA 4RL6A 1CETA 2AF3C 1EVYA 2C1ZA 2QY9A 2Z57A 3FHJA 4EITA 4Z3OA 2HLPA 1PFQA 3DYIA 2IZOA 2AZDA 3V34A 3N8KA 4MA4A 1CUDA 5COQA 2GD2A 2RHMA 1CG6A 1ZH8A 1LJUA 1NW5A 3A6LA 1KMCA 3DTVA 4HLQB 5ALRA 5FA5A 3LPMA 3ZXXA 4FB4A 1N7IA 1C3LA 1W35A 1ZVKA 3EQ2A 3FOCA 4PWZA 3DTNA 3F9IA 3STUA 4XLZA 1QPBA 4D99A 2XCUA 1L8OA 5TS3A 4L8LA 1WDWB 3LG2A 2IU6A 3O93A 3CN9A 4WFKA 4XIFA 2QM3A 5I7FA 3FZNA 2V5AA 1D3AA 4CF3A 2OCPA 2Y2VA 2ZI6A 3KKZA 3QTTA 1U3CA 4YWJA 3RUEA 1FP4A 3H4IA 5B2FA 2BLNA 1RADA 4G23A 1RM3A 4DC9A 2IH5A 2CXTA 5L95A 1K06A 3BILA 1PT6A 1VSBA 2HV9A 2XUIA 4JCOA 4LRQA 1N25A 3OP4A 5L4SA 5A4JA 4TMFA 5IZCA 3EY4A 4GXQA 1OSNA 3H5NA 3QKTA 4V0OA 2VPXA 1YR9A 5KTOA 4GM0A 5HKBA 1CQWA 5KPDA 3K96A 4HZUB 4UTPA 3IVAA 4D98A 4ECEA 7MHTA 3LQ1A 2C5BA 3K1ZA 1WSDA 3WGUA 2VYNA 2OLEA 3GEEA 3EVTA 3GAAA 4YJGB 3VGPA 1QIMA 2O7RA 3FZQA 3NH6A 2BFMA 4DT1B 2CBZA 4I4CA 5D00A 5IM4A 1VLJA 1H22A 2BFDA 1CR0A 3M82A 5B1IA 4L8WB 2B20A 1ABEA 2X5XA 2O23A 1C4OA 2DYKA 2I0FA 1G0OA 5AW3A 3UK0A 1MHPA 4CUZA 4F21A 2BGLA 2DTDA 1RXSA 3H2GA 3IR7A 5KWIA 1UZMA 5F2NA 6GPBA 2I6GA 2NVOA 1RP7A 3NO4A 2BM0A 2X4GA 1GRRA 1UMDB 1CULC 2Z43A 2QRGA 3JYLA 3FPSA 3QPVA 1NQTA 4RK7A 2Y66A 3RT9A 1NUTA 2CUTA 3SFTA 4RPHA 4QXOA 4DB4A 1ZGCA 2X76A 1FDRA 1HL3A 4BIMA 1MFPA 3NVKI 5T57A 3CKMA 3L4JA 4UUBA 2G83A 3WWYA 1W36C 2WHYA 3ZWAA 1GZSA 3F73A 4ZQCB 5CYFA 3GU3A 5DNWA 1YBVA 3JATB 3PRKE 4R1MA 2E4AA 2WHQA 1M1YB 4ZYZA 3D8UA 4WDRA 5K6AC 3A1FA 2P2NA 3BHMA 1DEAA 1QFZA 2HJGA 3HEBA 2Q1SA 4Q48A 5CDFA 3UG6A 2R6R1 3OU2A 2GPTA 4PN3A 1ZXLA 5DDIP 3NH9A 1WCIB 1D1QA 3F8WA 3HBAA 4ZOBA 4WI1A 4HNTA 3NORA 4OO3A 1TZMA 3K09C 4PPGA 4Z3KA 4XH9B 4Y2TA 1QHNA 5ARDA 1JIXA 2GF2A 3ZKWA 4QQNA 3U7HB 4CLDA 2GPBA 4IIJA 4CM9D 1TQ6A 1MENA 4H7IA 4BNKA 3W5VA 4BWGA 1ZGBA 1S8AA 1YCHA 4HQ0A 2JZCA 2VSOA 4BOYA 3OOWA 1EAYA 2J3HA 4GICA 2Z08A 5DNEA 3R6TA 5DJ5A 4ZV9A 2ZM5A 2SKDA 3O94A 2JIQA 1JKJB 1C3OA 1KC3A 1M6WA 4KQHA 1J49A 4M9CA 2XMDA 4JLAA 4BBZA 3BMNA 4R9RA 1VZ2A 2GPYA 2J31A 4CL3A 3ILHA 1SBZA 4HFMA 5AUNB 5LM3A 2B25A 2EIXA 3WB2A 4UDOA 5FPTA 4Q3AA 4HQKA 3ET5A 1O58A 2O1XA 5FNVA 4EPXA 1CB7A 1Q1AA 4M83A 4MKIA 3RNLA 1WM1A 3IMKA 3EIEA 4AY5A 4X95A 4DWWA 5BV1A 4UMDA 3VO2A 1LV8A 1SK8A 1X1EA 3UY4A 1GGJA 4LI3X 4Z0HO 5KNCH 4DUZB 1QMPA 2HQ1A 3AM3A 1GEEA 2NV6A 4E5MA 1BX0A 4BNLA 2FFHA 5CHEA 1YA8A 4G0OA 1G64A 1E1QA 1O94D 3NJ8A 4AG3A 5HZMA 2BDEA 3A4VA 1V4NA 1XQXA 3RS0A 3SHFA 2OFOA 2RHRA 2PUGA 1GXSB 4WKCA 3B6JA 4D4GA 1D1TA 4TVKA 3QPCA 5EHQA 1DJMA 4E2XA 1XRMA 3IULA 2GBGA 2II6A 2JAWA 5ICEA 2IZ6A 4OBEA 1KZHA 1S2IA 1CUXA 1H3FA 4K1XA 1Z47A 3BAFA 3PXEA 4MWDA 2FPIB 5F9FA 2PUTA 2FDRA 4E30A 5I7UA 5BYKA 4DR2B 2W2QA 4LC9A 3HZHA 5DHQA 3ZX4A 1EHIA 3ZTWA 1A2BA 1GVNB 1VHLA 3W05A 2X22A 4BX2A 2ZZNA 3TPZA 2FHSA 1ISMA 1RYDA 2O14A 2BHLA 3BD8A 2C94A 4BRSA 5CA1B 4DIEA 4NMXB 1RHUA 1D04A 3M83A 5KKAA 2IU0A 3D6NB 2FLWA 2PDAA 4MGHA 1LQUA 4Q7EA 4AY2A 1LPNA 2FHPA 3OZFA 4K9KA 4QREA 1RYBA 1Y3AA 4H1HA 1KSJA 2X19A 3VFDA 3W4JA 5DV9A 5CRIA 3SR4A 3WYBA 2JCSA 2Q6LA 2X8WA 3ESBA 3IAM1 4G8BA 2WG1A 4YDHB 4CWAA 4F6RA 3UUFA 1KEEB 3E58A 1QUEA 1TYZA 3BEOA 4ERNA 4NZOA 3F5FA 2RAFA 4ZI7F 3WKBA 1XV5A 4GPAA 1UFVA 2I1VB 3TL6A 1L4NA 1QV6A 4LZNA 3LGSA 3CB4A 1W85B 1EVQA 4C1BA 4FE4A 4MRRA 4NCHA 1I32A 2JGNA 3TCXB 1Q1EA 1RHMA 3D59A 4O2AF 1PVVA 1Q74A 1RQPA 3KU1A 3QYJA 4FZVA 4J49A 3RC2A 5DTMA 4BNXA 3FIJA 3X1MA 3WQBA 3DV0B 3U1BA 4Z3DA 5BR1A 2OB2A 2SCUB 4NAUA 5F9MA 3OQMA 3A6EA 1A8IA 2FSPA 1ZQ9A 1YD7A 3LDFA 1PQWA 3DDWA 4GVPA 2KI5A 3SZGA 3LHDA 1VE3A 3IO5A 3P9XA 1OWOA 3AU8A 5KB3A 1M8FA 1C1XB 2J3KA 2LIPA 4QU8A 5JS2A 2D74A 2IHUA 1RR6A 3ET4A 4JHXA 2VNSA 1FBNA 1IZ9A 3KWLA 3HYTA 1Z8HA 5BYBA 4UHCA 2P7HA 1P0IA 3ABSB 3EA4A 3EUWA 3D3NA 3KJXA 1ZN2A 3H18A 3I9LA 2QVCA 1EDEA 3G59A 3MT0A 2KSQA 4N39A 4R7ZA 3BE8A 5AOBA 1BRTA 3DE7X 1JHOA 1ZIXA 1OGIA 1J33A 1FYWA 3KR1A 1HDEA 3N2NA 4ALMA 4G36A 1CP3A 4BDTA 3KB8A 3F9CA 1FZTA 1S2OA 3T0FA 2QYSA 3ZWNA 3MBOA 4LXIA 4QRHA 3WI7A 4AYXA 1FYXA 3N2EA 4MLCA 1K7XB 1O6ZA 3OM1A 3VBEA 2GJSA 2IVZA 5JD4A 1N0IA 1VJGA 1YKGA 3I1IA 3K9NA 2RK4A 3FWZA 4KQFA 4RV4A 4XQEA 2PGIA 5EWJB 5K6RA 1CUWA 3LIIA 1JDJA 2IHTA 5JSKA 3HKCA 1WW3A 3E48A 4DV6B 2QSUA 3LUDA 2I4MA 1HETA 1CRZA 1EBFA 1T91A 1W96A 1XWFA 3PB3A 4QASA 2AZ4A 5ALHA 3Q5GA 3NDIA 3AFIA 1U3DA 3M1LA 1V8OA 3SK0A 4OKSA 1JPUA 3ND6A 5K9ZA 3GLFB 3KQUA 3T9CA 4LJRA 1NBHA 3FPEA 1HLFA 3GRKA 5DOVA 1VIAA 2BE9A 3TSWA 4ROTA 1NLMA 3SEAA 4CHTA 1BVYF 4RSGA 5ITWA 2BMEA 3DFFA 2X86A 2XB2A 1L9KA 3E9RA 5H68A 4G24A 4ZT5A 1P33A 1VKHA 4BIIA 3U56A 2BSQA 2QP9X 2AWOA 3MOGA 2OHXA 4JX8A 4RACA 3UCXA 2NYVA 4LUCA 2HZBA 1S8OA 2AVDA 4X20A 1VIYA 5AM5A 1I4LD 3JQ7B 3MHTA 1JYFA 3LP8A 2G3YA 1JEJA 3PHBE 2DKOA 1CUJA 2FKNA 2YQZA 3D0KA 3A9UA 2HHJA 4ZV7A 3TW6A 3ZTYA 1RU3A 1Q14A 4PC6A 4A0RA 3N07A 2GYWA 2W2XA 2R3SA 3AHHA 4KIJA 2XE7A 1NR7A 1H2WA 2BZSA 1UJBA 1RKXA 3C7CB 3FGZA 3SZUA 1GDHA 2C7OA 1Q0UA 3KHKA 4FUQA 1Z68A 4W7SA 4F71A 4MUYA 4B7XA 3H8SA 4JT2A 4HBZA 1TNDA 3IQIX 5T4EA 4DANA 1E66A 4LCEA 4P83A 1VBKA 4EHAA 4CEJA 3ZD9A 1PQ4A 4BZQA 2O3QA 3PZBA 5JNTA 3VU8A 2DLNA 2Q0SA 4PHTA 4OLBA 2X8JA 3DBLB 3U7RA 4M9RA 5JU6A 3OQHA 4MGKR 1Z12A 1BSVA 3CLHA 2XT9A 3SM3A 1J9ZA 1HKUA 5BPFA 2EZ8A 1P3Y1 1XX6A 2QLBA 4I5FA 4WKPA 3L18A 5AKIA 3L06A 5JAMA 1BYUA 3IL2A 5A2GA 2HADA 2R00A 4RFSA 4UTRA 1HL7A 4MV3A 2V03A 1H9BA 4GLJA 1ONBA 1KJWA 4LJLA 3OZSA 3V7WA 1LK5A 5CLQA 4OHRA 4KQCA 3KYDA 3WLSA 1N36B 3R3VA 2BZ1A 2FW6A 3QUAA 4F4DA 3SCZA 2OGTA 4FBGA 4CIYA 1B76A 3K4PA 5K03A 2HEGA 2R5NA 1ZJYA 4K9QA 4PINA 3DLHA 2ZAOA 2WUFA 5JAQA 5DLQC 2QVZX 3O5AA 1LC3A 3QKSB 9ATCA 4X91A 2VT2A 4YJDA 3D7KA 1IM2A 1AS3A 3OETA 1OH7A 1XTIA 3ZDBA 3MMPA 1XNJA 1BJRE 1N32B 3HCBA 2HSWA 3I8OA 1GTG1 2CJFA 3LQYA 4RKRA 4EJMA 1BN7A 5TPWB 4W99A 2X5OA 3L46A 4FNOA 2YHIB 4PAWA 5A06A 4L27A 5KHAA 3TTSA 3ZXUB 1FTYA 3QMVA 1T0JB 1PKEA 3HNOA 4B9AA 1T0BA 4ZCMA 4B85A 4Z7JA 7GPBA 3NBXX 3S2YA 2AMJA 3AIMA 4XVQA 3VPHA 1AKQA 2FK7A 1W49A 2I78A 3KXIA 1C3XA 4G0NA 2ZUUA 3O26A 4I7EA 1YI8A 2FWMX 4R3UC 5DPMA 4C7XA 4ZGBA 2ZDGA 3WLTA 2VSYA 5AHXA 2Q3BA 2H1FA 1FDWA 1KO1A 4F2DA 4W1QA 1R9NA 1RP1A 4FX2A 3WWDA 2FWRA 2XHEA 5IWCA 2FW8A 2NGRA 3MJEA 4C76A 1GZVA 5JYEA 2XCSB 5LXTF 2C4NA 3GEBA 1UMBB 1IOWA 1O8CA 2BGNA 2W2LD 4G4SO 3VUEA 2D4HA 1OZ0A 1V35A 1TZKA 1OIWA 1T6BY 2PSEA 1EDBA 4AJKA 2XVMA 3AY3A 2FEWB 2ORYA 2B3TA 4OQLA 1J8DA 4LW8A 1N9GA 2QQ0A 2QYHA 2H5IA 1DE0A 4M1MA 5EIWA 4G0YA 3P8ZA 2XKAA 4JOSA 3CKYA 5E0OA 3RVLA 5EE0A 3LQKA 3AQIA 1Q2XA 4EG5A 4RDXA 4KHPB 3PFCA 4M54A 1VJDA 2XVAA 2FUKA 4IGIA 3UMJA 5DK4A 2AJLI 2WRZA 2Y1DA 4JUCA 4RHYA 4XE5A 2A3NA 3O3MB 3VTAA 5DSTA 1NBWB 3DYBA 3BH6A 1YB5A 4XWTA 4DVJA 2HU7A 2EU8A 1DADA 3VYTB 2Y6UA 4Q9IA 2QJOA 5AQ1A 2Z9CA 4V0RA 1VLZA 4RLHA 1K5GA 2C3OA 2IZ1A 2XTJA 5KI6A 1MBZA 1L5LA 1Z37A 2YNMC 1XEXB 4RDIA 1A4UA 3S68A 3PJFA 2RB4A 3U31A 4BL5A 5HEKA 4I4IA 2CVZA 4IZIA 4HGQA 1Y8QB 4L8GA 3RFTA 3LBNA 4DIMA 1I6WA 1S9HA 1YQGA 4Z1MD 4CLRB 2DPHA 3KQNA 1Y5MA 2HDNB 2AOVA 2W90A 1EZ4A 4MW5A 1ESNA 3LK7A 4NV0A 4W8HA 4INOA 2XZTA 4XGKA 3BRSA 1QGAA 2ZDQA 4CDMA 2ZYVX 1YJXA 3QEMB 3R8CA 2V5UA 3V8NA 3NV7A 4L3WA 3MGCA 2XPCA 4ZT7A 1L2TA 3L79A 4CIVA 4YH1A 5BVHA 1NIPA 1HDYA 4Q7KA 1E3IA 1NT4A 3ND7A 3NGMA 3PJEA 1KH1A 1JQLB 2JAUA 5WRFA 4PZDA 5C8DA 4DDVA 4NX2A 4NJOA 5CH5A 2PKQO 2IUUA 5LDHA 4GBMA 4YIHA 1EVEA 4EKYA 3UAYA 3ZQKA 4KWIA 1TU3A 2GPWA 4OP3A 3FMIA 3ITDA 3RK0A 5F98A 4N0DA 5KKCA 3HFGA 1GKIA 1RRVA 4TL9A 5EMMA 1Z8DA 1MVNA 1P8JA 4CKCA 3M9LA 2ZGVA 4E3ZA 1A98A 1KR2A 3A6KA 3P0HA 3LFHA 5HILA 1QYIA 3BGOS 3JQ8A 2K6GA 2QW1A 2AF4C 4OEHA 4Q1BA 4EY6A 5L3SB 2I65A 2OFWA 2I7DA 1AV7A 3TI7A 4BEJA 4K6CA 2ZI4A 2HMVA 4WT7A 4IICA 2WIFA 4MJXA 2Q2WA 4YRMA 5FRDA 4BEVA 4HDMB 1E3LA 3AEYA 1RXVA 4F4CA 4REQB 3RSLA 2B30A 2PBFA 4HZGA 2QMHA 4YCNA 3DGEC 1KH3A 1NW9B 2PZ8A 1QR6A 4HQFA 2X2FA 2YV4A 4M0PA 4ZZ1A 1HSZA 3MTQA 5EZYF 3RAGA 3AIOA 3WOVA 5ALTA 4WCFB 4EJ2A 2PKRA 3CLTC 3IIEA 3S99A 5DI9A 2JF0A 2JLBA 4DV0B 1K5PA 3ML1A 2RE8A 3FCYA 2YHAA 2H1CA 3W8FA 2HA4A 3EF3A 5TEWA 4PYLA 5FFMA 3WLLA 1UBNA 2C0PA 2DZDA 1QZZA 1VPLA 2VHQA 4F1JA 3WK5A 2ESRA 4GT1A 2WFAA 5LOVF 2DWCA 3TN7A 1QXSA 1MQ9A 1W88B 3PHCA 4DIOA 3FB4A 1A2OA 3PFIA 4A0HA 1CWUA 3D7SA 2VLBA 1SM4A 3SJCA 2XRZA 2QTZA 1KFBB 3B52X 2NXEA 1RWQA 4HDCA 4NARA 4ND2A 1P9RA 2HSDA 4M1TA 1C3EA 2E4WA 1KJ8A 3AINA 5GGXA 1ZW1A 2KHZA 4QG7A 3F6YA 3WP1B 4X71A 1AQJA 3CY6A 1AKWA 3WZMA 5KSZA 2IZ5A 3PEEA 4NMHA 1O03A 2FUEA 1UDAA 4E5SA 3UGKA 3MELA 1E5LA 4PRYA 5ALQA 3WGQA 5HFAA 3DZJA 2IWRA 2DPYA 2RAUA 4CIXA 3JZAA 4AC9A 4YRNA 2PX5A 3IDSA 1UWKA 3L07A 3VO1A 1Z5PA 3DO8A 1J97A 4QPDA 2VNHA 3WC4A 4ND6A 1RZ3A 5D3MB 2ZZMA 1BA2A 2OECA 3SOZA 1RT9A 3FSGA 3UHPA 3WNDA 3WA6A 4YRIA 4OJYA 2A5DA 2JZNA 3T4UA 2NXJA 2YVUA 4NLLA 5JO0A 4FCCA 2OGSA 4UNSA 2ZTHA 1YC2A 2J6HA 4HH3C 2BMAA 4YRLA 4CCAA 2ZWVA 4EW3A 3G1UA 4P82A 5L45A 3OA0A 1USKA 5BSGA 4OVKA 2O06A 4NAVA 2RC5A 3HGMA 4NG5A 3KQLA 4DF3A 4MGYR 1PR3A 1OLXB 2WSYB 1EGVB 1NDHA 4OQMA 4AF7A 1DQNA 3TFOA 1G8YA 2WOOA 4N4AA 1G21B 4CIBA 3PUXA 2JCYA 1GU0A 1SU7A 2ZG6A 3HXTA 3JYQA 5A7FA 5D3KA 5I7HA 4EPTA 3U44A 3EIHA 5K0ZA 4IGFA 1ZKMA 3OQIA 3VVLA 3OLYA 1PV4A 1M33A 2CFSA 3SFZA 1YJAA 4R4JA 2JK0A 1B6TA 3BL5A 1G63A 3B8HA 1JDNA 3PC4A 4E94A 5JTUA 4U7JA 3A2LA 2FPWA 4NOLA 4CR8A 4URUR 2LUOA 5BR8B 1S3FA 1NL3A 4JT9A 4EKIA 1O96B 3A3YA 4DL9A 1CDOA 2X7XA 3IHWA 1K8ZB 2XMSA 1U1GA 2EL7A 3DEAA 3OMWA 4IIUA 4MGIR 3TQFA 5KWSA 1R0CA 2QI9F 3KNZA 2G8LA 4MRSA 5CJPA 2NXCA 3G2PA 5JH7B 3CT4A 1I3LA 1GPDG 1EXNA 4ARIA 3OZ7A 1NRXA 1KAMA 2JAQA 2WHXA 2V7UA 5DW3A 2GN2A 2P5SA 3O6VA 4BNYA 3WDKA 3DLCA 4KQ9A 5I4KA 1MHTA 1A9OA 4MWOA 3DO5A 4RQUA 4RNDB 1FNDA 1PS0A 1X1CA 1NJFA 1OTYA 2FQQA 2JHCA 3E7FA 1EWKA 2XZPA 5HR5A 4O4HF 2O20A 3ED1A 3R3UA 4MMYB 1DC3A 1XKLA 1X13A 5FDFA 2DGDA 2XB4A 3S7ZA 3LO5A 3FDJA 3CVUA 3GZNB 4J0GA 4LN1A 1ND5A 4LY6A 1IBKB 2BBOA 4Q15A 4MQ4A 2WUWE 1UJ2A 4IJ5A 5FXMA 1L8AA 1ZRSA 2J3JA 2AOWA 4KE7A 1E1RD 3BMCB 3NXKA 1AQIA 1Q0RA 4KN9S 5CVUA 4EY7A 5DHAA 5CB4B 4GVXA 4BFUA 5IAOA 3IVXA 4WRRA 4Q3CA 1Y1LA 3GELA 3VYWA 4DUPA 2C2YA 2GF0A 2NWQA 4MUAA 2OY0A 5BW8A 1X87A 2PZBA 2ZRDA 4KAJA 3KXKA 1MX5A 1E77A 1SQFA 2AUTA 5FUBA 4MUHA 2PKCA 3FMOB 2IV3A 3X1DA 4WBNA 1ATZA 2D7JA 1DSSG 5TB5A 3K0CC 3T1HB 1R6XA 5B2ZA 1ZH4A 1PZXA 2P9GA 3RIGA 3VAAA 3VM6A 4F4HA 3OM0A 2WJ6A 2PJUA 3CX4A 4A7PA 4D9KA 3OE5A 2GCIA 1YNOA 2V96A 3VISA 1YL7A 5TQJA 4GE3A 1LVHA 1IZZA 1PUXA 1N1DA 4I4TF 2JG3A 2H4YA 2ZDHA 4IIVA 2FSSA 4G5OA 1ZOSA 2OFFA 3HR4A 1FUEA 1A72A 3C3XA 3IRVA 4MWGA 4MVJF 5I3ZA 4BP9A 1XRSB 1QWOA 3DQZA 4IQGA 3N0WA 4UXHA 5LP6A 1JAXA 4D9MA 2EEPA 4PAQA 4UBMA 1UQUA 4BXOA 1KJQA 1KTVA 2BCEA 4BQEA 1GZ3A 4M9XA 3DDHA 5EKSA 3PIDA 4EA7A 4LNUA 3ZC3A 2FPGB 3I2KA 2JLWA 4YRSA 2C96A 1QR2A 2PSJA 3BIOA 3RYFB 4BGEA 4MQFA 1EBBA 4X9XA 3VR6H 2FOXA 2IUEA 3DTVB 3B6KA 5BSRA 4IFIA 5IN4A 2OO3A 3KZVA 4TV8A 2IY7A 3ZVMA 4TS3A 4YACA 1C1YA 1VLQA 5AJHA 1OYYA 1UZLA 1H8HD 2QUKA 4KDRA 4WOCA 2O59A 4A1FA 4MIOA 4HX5A 2C4UA 2PRJA 3GDHA 3BZUA 4FMCB 1VL5A 5JJKA 1JYEA 3NASA 5DCYA 9GPBA 3WIVA 1IHYA 1YB6A 4RVOA 2ZT5A 5BP7A 5I7WA 4AY3A 1FP4B 5TPZA 4XGRA 4G1VA 5EFOA 4I3HA 5K4HA 1XAGA 1G8SA 4EELA 1C5KA 3TFQA 3DBHA 1NATA 1XCPA 2IDKA 1XNRB 3MJRA 4X6LA 3ZZUA 5F5LA 4IS3A 7AT1A 1V7QA 3FFAA 1V1MA 3GFPA 3HJNA 4HH4A 2I4NA 3UCEA 5MDHA 3TRKA 3PC6A 5LYJF 1XB2A 1GNVA 4QUGA 1LSSA 1RAGA 3RC7A 3ZBQA 4G09A 1X3SA 4RETA 3ZK9A 1NYRA 4RHTA 1WZEA 1IE3A 2O7NA 5LIRA 3WGYA 3EXG2 4V0LA 4ZJUA 1NWHA 2GUWA 3L7LA 4BVHA 5MN4A 2EBFX 1TYDE 4RM2A 1L3IA 2JA2A 2BFDB 4MI3A 1F2TB 2IXBA 3IILA 1P0CA 2Q5QA 1MW9X 4LNAA 1GA4A 1T1RA 1ECBA 2ZP1A 1E0JA 4S1TA 2E4ZA 4V3BA 4A1OA 3A4YA 4L9AA 4OP1A 3FUWA 1NP7A 4MUIA 1NVVQ 4QC2A 2VJOA 3WFJA 4LF9B 3TIFA 2PL9A 1G3UA 1XJ0A 2P1RA 3GN2A 4IEIA 1XCOA 1WV1A 1NN0A 1ONSA 2ZETA 5CLIA 5DWVA 1C8VB 2H5EA 5EPOA 1XZJA 5ENVA 1P60A 1WNFA 3EPPA 3HCRA 3W2FA 3ZIDA 4EG0A 4L6IA 1DHTA 2W7TA 1XZBA 4C05A 3ZJVA 1JHMA 5FD8A 4B8ZA 4XWAA 1T6NA 4KPYA 3JVVA 2PGOA 1CCWA 1RRPA 4QOSA 5HNKA 3DDSA 2BLLA 3S1SA 2BTQA 1Z16A 3EDYA 5LWQA 5F3WB 1Z18A 4RLSA 2JKZA 3WV5A 3UT6A 3Q8MA 5L7WA 1T8SA 1CJUC 3UO8B 1E20A 2BFPA 2C9ZA 5F12A 2QTNA 5TX7A 3TFWA 2W5UA 4DCGA 2WFLA 1TUBB 2GPSA 4H60A 3DUFA 4JL6A 2EDCA 3DEKA 3VHQA 1L7AA 3U4HA 1J1UA 2VTVA 1KBQA 3K0FB 3WICA 4CI0B 2GJAA 2X1VA 3ONDA 4M21A 4NK5A 2RHDA 4XZ3A 1Z88A 2CNLA 4F7WA 3S1AA 3GLGA 1LNQA 2ZVJA 4FILA 4JBNA 3UJNA 3ZKWB 2QL7A 1PL6A 3CNQS 3I52A 1F8FA 3A4MA 1QH9A 4TLLB 4AMVA 4C7KA 1YFJA 3M5DA 1EEXB 3RTGA 4L02A 3ACDA 4FGJA 5B6PA 2UKDA 2YW9A 4PX3A 1MUUA 4II3A 3KWMA 4M1SA 5KWEA 2F9MA 4B6RA 4Y2SA 4LKOA 1T8YA 1N5IA 2FR1A 2WT9A 4DCUA 3CLRD 2ZJ8A 1VRWA 3AZOA 5CX1B 4P3YA 4AZ0A 2RMKA 1KIAA 3O3CA 1U98A 5KYKA 3CH6A 2WTMA 4TM7A 1IDN1 1PX0A 3DFZA 4AJOA 4F11A 1ADYA 4Z1OA 4QU9A 3R5FA 4IJ6A 4QXAA 2IITA 2VTKA 4PSCA 1ZCJA 3AUKA 1M7HA 4IV5A 3BMNB 4IJUA 4NEQA 4RMJA 4DM4A 1KHTA 2O7QA 3IJRA 1XTBA 3EGDB 3KR0A 2EW2A 2OA0A 4WTOA 4CG0A 1YAHA 3H16A 4JB2A 5FNVB 1X8KA 3V8VA 2FE1A 2JGAA 4HRYA 3EVGA 1Y48E 1O87A 1Q15A 1RPNA 3DCJA 3FNRA 3WSVA 1LVUA 2IBTA 2CEKA 2PN1A 3AGPA 3AWIA 3SHWA 3QPUA 4ALKA 3NPMA 4X1IB 4XUEA 3BIWA 4LY0A 2C58A 2AFHA 4ZVRA 2X3YA 4JASB 5EJGA 5FPQA 1X7GA 2Q8QA 3U80A 1DL5A 2AMVA 5TGDA 4AF6A 1FS5A 4U7TB 3L0PA 1DOAA 4JR1A 2DF8A 2D8AA 1L5YA 2RIRA 5BSFA 4QPJC 2R65A 5HPYB 4ZYTA 1D07A 3BTSA 4H15A 3KQWA 3VKGA 1LF5A 1SOAA 1MA3A 1HMPA 3N70A 3JAMA 1QC5B 4RF3A 1YFLA 1BE8A 2Q5HA 2ID8A 4YMLA 1XK7A 3BRWA 4ZYWA 2R7NA 3U19A 1G19A 5B36A 1IH8A 2JIMA 3CZ4A 3IXMA 1C1DA 1NW3A 2H1VA 2D3WA 5KU7A 5IANA 5JVDF 2XUHA 3B9BA 1BDJA 2CSUA 3DL2A 5FPHA 5CDSA 2A1TR 4I9NA 4R2LA 4FOPA 1BS2A 2QORA 4C08A 3KD3A 4MYHA 3DDUA 4NXNB 3PUYA 2EFYA 3JQAB 1EDDA 4MQEB 4Z5XA 3ZHQA 2G67A 5KVQA 2HJRA 5TF0A 4A2CA 3O31A 5IKXA 2C5FA 1YZ3A 1M34A 1CBUA 2IBMA 2A0YA 1KFEB 1G2QA 3QKWA 4AYTA 5C35A 2VDMB 4F6RB 2E0IA 4BGVA 3BG5A 3OOJA 1VI2A 1K1EA 3X1JA 3I5MA 4GNRA 3KOUA 4GOXA 1PS8A 4BWYA 4DGSA 1AGNA 3D4OA 1AO0A 4TKVA 5G4KA 3MQ2A 3AHDA 2BISA 3L6BA 3E8SA 3UW1A 3N2LA 1V1RA 3F2VA 3H13A 3HCCA 2EZ9A 1AUPA 3VOBA 5JIBA 1QIFA 3FOEC 1V3QE 1PBTA 5BUZA 2Q6KA 4AG6A 2BEUA 3BFVA 4BO3A 3I6BA 5TV2A 2XT0A 3L6CA 5ANRB 3D9QX 2I29A 2WE7A 1DFHA 4IEEA 3U1VA 3WIOA 3TRIA 3JQPA 4AJ2A 3SVTA 4MQMA 2MR5A 3A10A 3QUBA 4EFMA 3LWDA 1J7KA 3A1NA 4MUEA 1VHQA 2XYVA 2FK8A 3FB1A 3UB2A 4J1TA 3C7KA 3TNDA 3FTDA 2C7RA 3L41A 4UHJA 3ANYB 3PL5A 2O8VA 4RH1A 4HG2A 5B1HA 3HM2A 1WE2A 2QTLA 4LYHA 1VKRA 4OXIA 2R7MA 5J2UF 1MH1A 1EP1B 3ANNA 3ONNA 4LJ6A 1N0HA 1XPOA 4RK0A 3D3KA 3T3IA 3SKYA 5B37A 3FGOA 2YWRA 3UJPA 4C29A 1I3NA 1U0RA 3DTVD 3V2GA 4KQ1A 4F12A 4QD3A 1P81A 1RQXA 1V2HE 1X0VA 2ZQZA 1OAAA 5EL0A 2UXDB 5EMJA 1V48A 1N6NA 4FYXA 2VDJA 1VB5A 4R8LA 3VZSA 1B15A 2QRLA 1C29B 3QE2A 1XJ5A 4RVCA 4CUJA 4KCGA 1FUYB 3KK0A 5JZVA 3S81A 1RRGA 4IM7A 2NYRA 4KRFA 1DAKA 2X9VA 4LECA 1L8LA 2J7KA 2ZRHA 1E59A 2I22A 1P5JA 1Z4IA 1Z06A 1G2IA 1J23A 1W6UA 2KS6A 4YAOA 4XYMA 1Z9BA 1GGKA 3D43A 3DVQX 3HKCB 1JMKC 3PYXA 1B3BA 1PGJA 2HDHA 2VTEA 1F2DA 1JSRA 2GK4A 4N9WA 4UTXA 5GPBA 5AWFC 3TIXB 4F91B 4FMDB 4M9QA 1PYGA 2BM8A 3GRYA 3O1LA 1RHRA 2UVPA 4D41A 2O8FA 3QW4B 5DM4A 2UZ0A 3BJRA 3TQHA 5BMVB 3ICQB 1EG2A 2DPXA 1JG3A 1TYCA 2W00A 2BP7B 3A6PC 2B94A 1O8BA 4GF5A 1ZDMA 5TQVA 5LQMA 1F3OA 2W37A 1VBMA 4MULA 2VYND 2KLHA 4DA9A 2QX8A 5HUHA 3TOCA 2IS1A 2VUUA 5K3OA 4MA5A 1P5FA 4CKBB 4GWLA 2C4MA 2OL4A 2Q6IA 3TD6A 4QBKA 4D9FA 2SNIE 3AG6A 4JJAA 1F6BA 1J0XO 3OEYA 4KYVA 3JD4A 2Q62A 3REGA 4BEBA 3BMQB 2VF5X 4RV5A 3GBPA 4B73A 4ENVA 4MUMA 2J3EA 4XWOA 3B6EA 3KDAA 3QKIA 4TTRA 3H3JA 1YGYA 1HDZA 1NA5A 1ZC3A 3MZ0A 1X7XA 4X20B 4X66B 1FF9A 1I2AA 1ZOOA 1NXWA 3ZWPA 2WPNA 4PSVA 5EHNA 3TX6A 1JF8A 2CD9A 3PQ7A 1SZDA 1ISJA 3LLMA 5IXJA 4KXUA 1U1DA 3NEAA 2QJTA 5C8YA 5CEEA 5KJ1A 4N0PA 5CW1A 4KR2A 3FM9A 4PG5A 2JS7A 1RE1A 4G37A 1UK8A 3BGWA 5B57C 1N2IA 1SCDA 4BVEA 2JGKA 5JBQA 3AHJA 4M87A 3LXRA 4HB0A 3ZLUA 5JEEA 4CEJB 5EIBC 2VC2B 4OATA 2Q4OA 2I4OA 1X1SA 3G2LA 4RJLA 4EFKA 1OGYA 2WMDA 3GFFA 1H2FA 3K8QA 2XGSA 1KI8A 3L5OA 3CCBA 3OZRA 4BMZA 4BRZA 3H5WA 1Q17A 3FYUC 4KKVA 2HSGA 2XEXA 3ZIUA 3BGSA 3DKVA 5J4KA 3BFKA 5LQRA 3UAXA 4ZO4A 3NT2A 1QHIA 5IRCD 1NT2A 1JR3D 3AVTA 5A5FA 1T2NA 2NZJA 2WJYA 3PWZA 2PXCA 1S8FA 4L1KA 3PA8A 1OHHA 4F96A 1R0SA 1N3IA 2YXEA 5B3AA 4GGMX 4L4RA 3PFHA 3K09A 1SGWA 3DP7A 3WKAA 4CMEC 2A5LA 1SWWA 3AM4A 4RE5A 4EP1A 2NSDA 4C2BA 1L7OA 3U49A 3DE5X 1C0PA 1QH1A 1YB7A 1YQDA 3RAJA 2AZMA 1FX0B 4RTLA 1WUIS 1CHNA 1YZGA 4PNHA 2JGRA 2N1BA 1POXA 2OGZA 1CUBA 3LX5A 5U4XA 2ZTLA 1XUOA 3WYGA 4B4WA 4B7ZA 1V9LA 3FKSD 3G82C 1XD8A 3T38A 4QXPA 5CD1A 1P44A 5HQ3A 1QYXA 2PGNA 2PIDA 1XJQA 1KVTA 4OHKA 4YT5A 5G02A 4PPQA 2JHPA 2VTDA 4RPCA 2WWIA 1LDBA 2QDXA 1PLLA 2BN4A 2GPNA 5FOVA 3RSQA 3WGJA 4A8PA 1UEIA 3EY9A 5DIZA 1GPKA 2P0EA 2OAEA 1GZUA 1KYXA 2XUGA 3E0XA 3NBZC 4HEJA 3G49A 4XYGA 1T9GR 2QPAA 1NLYA 4B74A 5HF6A 2GA8A 3ESYA 2RG1A 3UJ9A 5ALXA 3L3BA 3OIUA 1E1QD 3SXUB 4NOKA 4EQZA 3C1UA 3N0TA 3U17A 2N75A 4R3WA 4E13A 4PANA 1I6LA 1F9AA 1VIMA 1ZD1A 4WA7A 1J09A 5I01A 1V71A 2JL1A 1JG7A 3ANLA 4IMPA 1RCFA 1SQ6A 2ZYAA 4KR9A 4NCIA 1RJWA 4IUDS 3N8GA 2F3PA 1ESCA 3LYLA 1DVRA 2AI1A 2J4DA 3RUIA 5BQOA 2C78A 3IUYA 3R9XA 1Y80A 3QEKA 1HYEA 1N9GB 2E4XA 1HT2E 3O8OA 3PQDA 4Q4AB 4QELA 4DSUA 3KQTA 3BSYA 2LD4A 1WMBA 4FQ7A 1THZA 1ZM4A 3NBQA 4IG9A 1Q0ZA 1OWMA 1GYPA 2EHJA 2PKEA 1LPBB 2WDZA 2WIAA 2X4DA 3OX3A 1XLVA 4GMXA 1Q0HA 1ZOLA 2ZVPX 3WP0A 3LCCA 2UVQA 3ZWCA 4XDHA 1DIHA 1M73E 2WV9A 3UMYA 2QQFA 3LGXA 3VJLA 5HCUA 4EUHA 4X92A 4FGUA 1C4KA 3WMEA 1UQRA 5HKLA 1OIXA 4AU1A 4IDEA 1T3HA 4N7RA 4NBTA 3DTTA 3ORSA 1SXJC 3WGLA 3WADA 1US8A 5JY6A 2XEDA 4MPPA 2BOVA 2V5VA 1QKIA 4HDRA 2OEPA 4JLMA 4Q3KA 4HPJB 1FTQA 4AKGA 3CTPA 1J0BA 3CRW1 5EUBA 1Q95A 4GKKB 4U2EA 3SQXA 1X86B 3PXCX 2XUPA 5SZKB 5I3CA 3PWKA 1OV6A 4IYRA 4UPDA 3ZYZA 3R5XA 2MSLA 1P2GA 2IGBA 3W77A 4D9CA 3OI7A 5I9LA 3HY4A 4DA0A 1K86A 1I1HA 1ZSNA 4I1PA 2H1WA 3KOMA 5BV2P 3FLBA 5JV5A 2DQ4A 2TYSB 1KU0A 1SMKA 2FG7C 2WILA 2FMIA 3C6KA 4QT0A 1ECGA 2YR0A 2Q7DA 4C0XA 2GASA 3I73A 4B79A 5BVHB 1C2YA 4ZCTA 2WJ3A 3E6AA 1OLSB 2GEDA 2ZYHA 3CS3A 2JFZA 1RD4A 2PMFA 4B46A 4DLXA 3GJ6A 5AIAA 1J39A 3R77A 3PCTA 2PY6A 4P80A 3GJ5A 1ZCFA 3PGMA 5AKJA 4Q01A 1DXOA 2LCIA 3LF2A 4DLWA 1HF3A 2I9KA 3UQYS 2C7GA 4CT5A 1AZLA 4CKCB 4B6JA 4UNNA 4BQRA 4EO4A 4XVUA 4DLVA 2HF9A 5AI9A 3HACA 4Z54A 1BS9A 4BFLA 2YIJA 4R7TA 4Y1FA 3AGQA 3K31A 5JFTA 1V26A 1BXGB 1E1MA 1I1NA 4KGZA 3HV0A 5AW8A 1DC4A 1NX9A 1DAFA 2VFAA 4RD3A 4ZRNA 2QAGC 1I7NA 5EGNA 4RO0A 5LUAA 1KP2A 1RPAA 3R3YA 5CYOA 3KBBA 3ZV6A 1EIWA 4YJ3A 3U7FB 3QMPA 3INYA 3MINA 3DXFA 5EEHA 1HRDA 3FWHA 2JH8A 3D2BA 2IU3A 1ZJ4A 2IHBA 1XAJA 1V7PC 4NI5A 2WVGA 2YN4A 4UMEA 3AVWA 3ORQA 4LSMA 4OB8A 4Q7MB 4QDUA 4RSHA 3TEJA 5BPHA 3SZLA 1E2JA 2LP4Y 5EC8A 1B41A 1RI1A 2FZ5A 2HCRA 3L7YA 4FR2A 3WLIA 2XSZA 4YHHB 1HEIA 2JK1A 2D5LA 2YOGA 4FT4A 3KJEA 1ZM7A 3NOXA 2G7ZA 3LT5A 2PX3A 4GUAA 4L3OA 2GS9A 3UAWA 5KYUB 4TMVA 1LUAA 4E5KA 3UMMA 4PX5A 1JIJA 3PG5A 2PLRA 3E9CA 4WJKB 3R5HA 2EJUA 1I2MA 1YZUA 1SVLA 3GMSA 2X2PA 1N7HA 1HC7A 3LZ6A 5AKGA 3C41J 5FLKA 1XWWA 5KNCD 4BNUA 3KCNA 4UVDA 1R37A 3DT6A 3EGIA 3HDTA 3OZEA 2AMLA 1N7GA 3ZQJA 4CMKA 2OYCA 3W6OA 4AF8A 4CEHB 1Y1SA 3V42A 4N3CA 4RJKA 2XLCA 3CNNA 4UREA 5A05A 5BMOA 1DEXA 5JADA 5AXCA 1EA7A 1MZVA 4OB7A 3WNVA 4CQNA 2BKUA 4KDCA 4NHOA 2WWWA 3SXPA 1UWLA 4ZEOA 1NBMD 3AEQA 1GUYA 3WYNA 4OBBA 1WF3A 4OHCA 1OR8A 2FSUA 4I9HA 4M49A 3GPLA 1G9SA 2BI7A 2PL3A 1H2BA 5F7XA 5KYYA 1Q0SA 5KX5B 1OWPA 4JC8A 3TTXA 2EBHX 4BX8A 2JFQA 4WADA 2B9EA 1O1YA 3G0DA 1M2HA 3KQMA 4OV6B 5AM1A 1XQ6A 5EVJA 4CEIA 2QD2A 1GGFA 4FM9A 2OZLA 2PKWA 4DTIA 4O4IB 4RTRA 2JJYA 2CB0A 1W87A 3G0HA 5CFLA 5LMNB 1QVRA 1TJNA 3E1GA 1HTWA 3EYWA 5DXAA 4R40A 4B0OA 4E6PA 5M2QA 4KH0A 2W11A 4UNPA 4OX9B 1YCDA 4UUQA 1GHTA 4JJEA 1RHKA 3W04A 1GM5A 1POWA 2HPAA 5EUQB 3VU1A 3IDAA 4G1CA 1MO5A 2NU7A 3W8EA 4H0NA 2Z3ZA 5FI0B 3IALA 5FPKA 3CZQA 2ECOA 2HJVA 3MWEA 3T3PB 1Q1GA 2HHHB 5CXQA 2EKLA 1ZAYA 3IA7A 5TE9A 4EHHA 3S2IA 1JPVA 5KVAA 3OQIB 3BK1A 5EHIA 4Q3OA 3SG0A 1Q7CA 5LZ4A 4UC0A 1Q3KA 2AS0A 1B43A 1UBUS 2PLAA 1LJLA 3B1VA 3N8HA 3TSAA 4CFSA 3HC7A 2AHRA 5B3KA 1NOKA 1L5HA 4X45A 2UUOA 5K6TA 1H0RA 2R8OA 5IAKA 2OBBA 3KKNA 1EJ2A 4RTSA 1HDXA 4HEA6 5EIXA 1ARZA 1XPJA 1SXQA 1NF9A 5FO0A 1CSEE 5TDHA 3VX3A 1FC0A 1W47A 4N5NA 4P81A 2JEZA 1ZKDA 3GNTA 1QVAA 3QTBA 5MFPA 2NO5A 4PZAA 4GR4A 3NX4A 5CT5A 4P08A 4MZXA 3DZHA 5DX8A 1Z63A 4HDKA 2FV8A 2OCIA 2R86A 2WTAA 4K88A 5ITVA 1W52X 2V0GA 1SUSA 2MJLA 4EPYA 3SBEA 1I3MA 1CQZA 4ESEA 5JBIA 1Q92A 4O02B 2QUIA 4N5LA 4BNNA 3OLQA 4K9NA 1YK0A 5L7YA 3RSHA 2R8ZA 4NU6A 1F4LA 3C4VA 3ENVA 4K6FA 4XM0A 1RBMA 1WP9A 5B1SA 4OYRA 1K27A 3ILSA 2Y27A 2D2EA 3BXEA 4OQZA 5CB6A 4I1OA 4J4BA 1YBFA 4OSOA 4CIDA 3ECCA 2C04A 3IV6A 3OPNA 3EQ6A 3PXBA 1K7FB 3EAQA 1V4VA 4LV5B 4YASA 4B4DA 1GG5A 1ODCA 4F1KA 1SIOA 1YZHA 2AG5A 3ELBA 4YNBA 4EY8A 5K0TA 2OT3B 2R6FA 1N6HA 4CT4B 2M6RA 1HFEL 1GUAA 4K2AA 3SS7X 4C89A 5KIAA 1V9SA 1FDVA 1L7NA 3ZWVA 4HS4A 1DUIA 2BR4A 1XCGB 2OLKA 1XXHE 2WOJA 3HBFA 3RANA 4F92B 3S2ZA 2WYWA 3PNQA 1IBLB 4WBNB 3TVTA 2IQIA 1B00A 1YOBA 1WXDA 2H2AA 5ISMA 1KEUA 2JFPA 4RHXA 1J0EA 5IUJC 2IYZA 5C2JB 1CY2A 5IYZF 4C7JA 1EXDA 2KBFA 1D9XA 5HKKD 3G2HA 2P30A 2ZUVA 2JLAA 5FORA 2FQWA 1EWQA 2ZIAA 1QP0A 1G6Q1 4YP6A 4J4HA 2B1QA 1VB3A 4IGAA 1HKHA 1XLTC 1CZOA 1KYZA 3V7UA 2YNMA 1SPXA 1MPXA 3CT6A 3MSXA 5C37A 2D7CA 3QIVA 4GSYA 2AXNA 2JFHA 4GLOA 1GG9A 5CVTA 4ABTA 1HG1A 3L1IA 4K8RB 4Q16A 1CVIA 1MJHA 4UCQA 4CFYA 3ADBA 4ZJPA 4RELA 5FYDA 5KJCA 1DIGA 3WXMA 1LFAA 3H3XA 3ABIA 4LNUB 1DBQA 5EJFA 2X5JO 4PM4A 2GHRA 4DJJA 4CG1A 5LLSA 3L8MA 2JCGA 3U3MA 1VGRA 4IL5A 4GM4A 1PEYA 1MF7A 1PJZA 3PD0A 5F64A 5SYNA 4C78A 5LVAA 3QFHA 1WXEA 1KPIA 1VE9A 3A1EA 3CZMA 1EB9A 3ZH9B 3M33A 1ZI8A 4I8IA 3O1IC 4NYJR 3ZUPA 5B7QA 3HKBB 4OBXA 3Q0IA 4TVSA 5KREA 3TZHA 4EGQA 1P2BA 2VI5A 1R0YA 4XB1A 3LO8A 4ECAA 3GW8A 5IC4A 2H59A 1M3SA 3I23A 1FJGB 4FSXA 1DEHA 1YU9A 4GP9A 5BRAA 5C8ZA 4AMGA 5DBOA 1E2KA 3D1VA 3DBHB 4L4ZA 1NONA 1GPLA 4M1EA 5B1EA 3LNCA 4JUDX 4G5FA 1VPDA 2Q9BA 4WPGA 1ST2A 4YRCA 5JY1A 3U4DA 1EE2A 2OSBA 2A92A 2W6NA 2YZKA 1AQYA 4RKQA 4DPKA 2Q4DA 2DQYA 1U94A 1NZJA 1RXCA 3KRTA 3M1AA 3SHQA 4LF8B 2VAWA 1OIVA 4H7PA 3S27A 3Q72A 1VXOA 2BKEA 2Q46A 2NQ8A 1DBWA 2ZTSA 3FPGA 1SG0A 3D6HA 3GIWA 5I8WA 3A05A 4L2IA 2H8KA 4OYHA 2JFUA 3ETLA 5F52A 4P3OA 4GP6A 4JLOA 5CDFE 2JJQA 1YSCA 5JS6A 1U2SA 4RD4A 2HYIC 4NV3A 3K5WA 4X8OA 2RH8A 2JAXA 3FCOA 2AFIE 2VOJA 4Z8YA 5HTKA 5TQ0B 1WZUA 3CKKA 1JR3E 3OQVA 5F1OA 1SXIA 3P2MA 2MSNA 1Y42X 2VG8A 2YXPX 1FVOA 5DI3A 4GX0A 1YNSA 4JDPA 3S7TA 2ERXA 4JXZA 1BG6A 3SLRA 4BNGA 4BNTA 3FHOA 3DHEA 4BP1A 1KTIA 2R1VA 3AXSA 3INGA 2UYOA 1YJQA 3EGWA 1I3CA 3LUBA 1XJCA 1YV9A 4IUBS 4KBGA 4PCUA 4ZXFA 4DW8A 2WJ4A 3MXTA 3SJAA 2V7GA 3L8CA 3TDNA 3HCOA 1SC1A 3OEHA 1ZCZA 1LWOA 4MVJH 5MN6A 2Q5IA 4JYMA 2QTCA 3DD5A 2YJTD 2HWWA 2QVBA 1SU6A 4YAWA 2DB3A 3DUFB 4BN5A 2Q9CA 3PF8A 1IBMB 2CLEB 1E64A 3SDSA 5CNKA 3VR1A 3GXBA 3GLGB 2ETXA 2BHRA 3FHLA 4G85A 3ZHOA 3TD2A 3CVXA 2BAGA 1TJPB 2NUTB 2ZBEA 4NNJA 2IKSA 4DEVA 1MX9A 1B6RA 3B78A 3R0XA 4NFSA 2IW3A 4X1YA 4BU0A 3GLIA 3EH2A 3ACCA 4EABA 3ZKAA 1M7BA 2VDVE 4IIDA 2M2IA 2ZRQA 1ZM2A 4ND7A 4BC1A 4AAYA 1UOEA 2XR1A 4EAAA 3STWA 4WOJA 1TYBE 3FPLA 2WABA 4GECA 4TTSA 1I2CA 1RYZA 1UMCA 5LMUB 5K3FA 1P1RA 2Q4RA 1MJ5A 4G3XA 4AZ0B 4J7UA 5H5JA 4RZSA 2A0XA 2Q45A 3FROA 1NW4A 4PXYA 3WK9A 1QTQA 1EESA 3DQPA 4B35A 1NBEA 5J5CA 1A8SA 4IHJB 4D3ZA 5F51A 1H1TA 2ODBA 1R6BX 1WX1A 4LMAA 4P3NA 4K6KA 3Q8WA 2P65A 3OCVA 4R69A 1C4WA 5DYIA 3EBOA 4HT3B 4DNXA 2YIVX 4RH0A 2ZI7A 3SVLA 3BFPA 2ZBQA 3HKDA 4CR6A 4GKAA 3CKLA 5B4UA 1TRKA 4EG6A 3KT8A 5KTYA 3JV7A 5JJLA 3NETA 1J4AA 2D62A 4J0EA 4WE3A 5CFQA 4K9OA 2AXQA 1W0KD 2YWFA 4U7GA 1JVNA 4R1SA 5E95A 3UG7A 5KS2A 2X1HA 1UK6A 1DJQA 5SV2A 2OCKA 2V7QA 3C5CA 4Y9RA 4NCNA 4JR0A 4BVKA 3D2AA 4BS9A 4Q9DA 4TYPA 4Z4FA 2IX3A 2JEOA 5UKDA 3IT2A 4Z7QB 1BC5A 4F8EA 1UPBA 3SAJA 1FMCA 4BQIA 2YVQA 2EFDB 3FAZA 4D3DA 2WBLC 3KM0A 4KB5A 3IEPA 1CR2A 5GY7A 4P58A 5DNDA 4LYEA 4S0ZA 4DLSA 1H9CA 5T6BA 4PYJA 1QDUA 1F51E 2QRNA 1C1DB 3DMTC 3DPIA 2VQEB 4BFWA 2WD9A 4WZAB 4OHPA 1GKUB 4C2UA 1GGEA 1TQ2A 5ECWA 1YR1A 3OC0A 3EDMA 4JKOA 4R1PA 4MR8A 1RC8A 3JQGA 1QG0A 3R0QA 5EJ4A 3BRQA 3WK8A 1XU4A 2GHQA 3CEMA 3H1TA 4NP6A 5ADWA 4DV7B 1NI5A 4DIDA 1M34B 4Q18A 1JDVA 3PHLA 3OQPA 4K2HA 1R74A 1OCEA 1SVOA 5IK2A 4EH1A 1ILEA 3EVBA 1KBOA 1QHEA 3B1YA 3PS9A 4HGZA 1TGVA 3W34A 4PHGA 5DBIA 5JZSA 3F4KA 2IUSA 2GBPA 5CXSA 3ZWXA 4TKVB 1LB1B 5E3JA 5G40A 1EWRA 2OQ2A 3MWDB 4OKNA 1K7SN 1UXJA 1V1RB 1ZEMA 4EEXA 2QNIA 2J9RA 1X8JA 4Z4HA 1REQB 2VAPA 4J94A 3KVVA 1BVHA 1FTNA 2CHQA 2V7VA 3K0CA 3EODA 4H7EA 4PGGA 1YCFA 2QBYA 1C7JA 1AM4D 1INLA 4ACBA 2MTBA 4U7WA 3ADDA 5TGZA 2CJWA 1CIVA 2PA3A 4JLPA 1MGPA 1U8UA 1XCMA 2QP4A 2VZ9A 3CRRA 4QNMA 3ZWDA 2XUFA 3PGA1 2I6UA 3GRRA 3NHRA 3W3AH 4YYZA 2Z8XA 3D3QA 1DJOA 3D3WA 5LLTA 4GOND 1P2VA 2AZTA 3K8ZA 3OUUA 3DT9A 2EQAA 5BNTA 1LPPA 7ABPA 2QIPA 3ZY3A 4JFRA 3VAYA 1WB9A 1T9AA 4PCLA 4JLVA 3GUUA 3LVBA 3WLJA 1DBIA 2X0DA 1Y8RB 1T9HA 4E3WA 4BGDA 3DE6X 4TROA 1OE0A 2YZ2A 2PZMA 4FKBA 4KSYA 1Q83A 1RWXA 2I66A 1FYEA 2Q50A 4Q7JB 2HKIA 3LOPA 1KSHA 2EVWX 3BWCA 3DE1X 4I5IA 4AT1A 4YAKA 4WD3A 1JHAA 4QO7A 3RVMA 1AU9A 2GR9A 1Q11A 1KE1A 1XMIA 5BYJA 4UEWA 2YYZA 4F5ZA 2REOA 2BEVA 1JVBA 2I80A 1QK3A 3ZHSA 3G9TA 4YN3A 4BQQA 2GXAA 1KH2A 3SF8B 1MTOA 2HUNA 3W7BA 2FEOA 1M6VA 2P8JA 4F2HA 1MEOA 4ZV4A 2I7VA 4W9NC 3BVPA 3R9WA 2UVPB 4GX1A 3CCFA 2O8FB 2CGEA 3CUSA 2XJ9A 1YQ9A 1ZM3A 2C00A 1NBME 2CVQA 2W8ZA 1KYIA 3TM5A 4D42A 5CTJA 1RTKA 2GD6A 2MSCB 4HUTA 1QS0A 1GKLA 2TRSB 1AF4A 5KCZA 1GTRA 4DR7B 1XDGA 3PNBA 4MIEA 2VSXA 1TYEB 4DCPA 2IUTA 3HN2A 3PP8A 1YOVB 2QL5A 4G2NA 1EE1A 2I7XA 2WT4A 3T7JA 1JAIA 3PFNA 5LBTA 4K03A 3WGZA 1ORHA 3R4CA 2J85A 5ED4A 2FQXA 3D64A 4D5EA 2H08A 3P0JA 2OCLA 4DQKA 3Q1KA 3P2IA 3I1JA 3Q3HA 1EFKA 1X7XB 3A06A 4J91A 1AKTA 1KY3A 1L7XA 3QJGA 3PE3A 2HF2A 4EARA 3VOSA 1AA6A 3U60B 1Z56C 1E9EA 4GOJA 3UA4A 1H1LB 2RK6A 4BYMA 2HXYA 2ZANA 3PUHA 3TL2A 3PFKA 4XGIA 1KI9A 5C8YB 2ZRFA 3DE0X 4LEIA 3RADC 5J23A 5BVGA 3IUSA 3NP7A 3L7DA 4TM8A 5FOXA 3VPFA 4K1LA 5M3BA 3EJ6A 3VVCA 1FXSA 4OL0A 3MA0A 1LBHA 9LDTA 2N3ZA 2MSEB 4KWCA 1MOPA 1DUVG 4I1SA 4O4LA 4JK3A 2QT9A 3RRBA 4BNVA 1CFJA 2B5VA 2CXSA 1OBFO 4QUBA 4BATA 1N3LA 1RLJA 4PGMA 3IH5A 5TMBA 1U0BB 3I37X 3ESCA 1W36B 4FFNA 2BGMA 4RSMA 3G7UA 3QEAZ 5L4NA 1ADBA 5FX2A 1ZD9A 3REQA 4MH0R 4PBRA 2DWPA 1GCGA 1U5BA 2YQ4A 3PC7A 5FL3A 3RC9A 4QICA 2ZB7A 4LOIA 5IDQA 4W5NA 4NC9A 3ZVLA 2M98A 5FB3A 3WNZA 1L5SA 3ZR4B 2VH5R 1N75A 4GYKA 3VRHA 4FS3A 4K3VA 1AZWA 2MR6A 2EEZA 2ZFUA 2FUG6 2CFTA 1T8UA 1NBOA 1U9CA 5T8KC 5IJ9A 2YOFA 3GOHA 5CT4A 3VU0A 1WPQA 1J8VA 5H9VA 5JXIA 3TNFA 2C7PA 2AC7A 3GPDG 5HIAA 2WUDA 4MJ3A 1QH1B 2A9PA 4CIWA 4QBIA 4Q4CA 4OHXA 2VDUE 4RVHA 1J21A 1IZ8A 1J6UA 1XIVA 3GJSA 4G81A 4LY3A 4MR9A 4DG5A 2KPOA 3D4IA 4INPA 1W73A 3GG9A 4LYAA 5U1PA 2CXQA 1FPQA 4MMZB 5E4FA 3ZW7A 4B3MB 1PNVA 5HQ3B 1DKUA 3GF4A 2TMKA 4IDNA 3STHA 3WGVA 1XG5A 3HP1A 1JDTA 4QIHA 1XDZA 5EIAA 2XUDA 3MGGA 5FBHA 1QKJA 1ZIPA 1U2DC 3JARB 4BMNA 4CU2A 5K51A 4OUDB 1FQOA 2XQJA 3IPAA 2H00A 5FUVA 5K05A 5K99A 1N5LA 1RI4A 5JT1A 2QRJA 2W2VA 2JLRA 3ENQA 4DILA 3KDPA 1LZKA 4OK3A 2VJPA 3GT0A 5I45A 3PGVA 4URVR 1VMDA 1T5TA 2CKMA 3I5UA 5EZ6B 1SRQA 1SZCA 4N3BA 3HJGA 2ZQYA 3KC2A 4IXTA 2XYQA 3I2IA 2IJGX 3EVNA 4FGZA 1D2CA 2FEPA 3OPYB 1NVAA 5A7GA 3RNOA 3DONA 3WGIA 1E0KA 3EEIA 1RDFA 2PGLA 4NONA 4PWYA 4MDEA 1EVJA 3K2QA 2PX2A 3FVQA 1JDSA 5AUOB 1FXUA 2XTZA 1QJ4A 3UBTA 4JI1B 2Q3EA 2NQ2C 2VSFA 3W2EA 4MV8A 2GEKA 1J9GA 4MDYA 3T5TA 5AW2A 4NYIQ 5FBRB 3O8OB 1D5CA 3IAAA 5IJAA 2P6OA 2VPTA 1JEYA 2IVFA 4LBVA 5CA1F 2H51A 1OU4A 3LPLA 3PUKA 4YVFA 2ZQ5A 2ZRLA 4AJJA 1XQVA 2PBZA 4FDAA 1T0IA 3HO6A 2FR8C 1PW5A 4G1MB 2YMQA 3M81A 4HAXA 5DP2A 3L7BA 3QENA 2G07A 4GAEA 4RYLA 5BQXA 5AUQA 1Y6ZA 3HXMA 4LDZA 1FLVA 2CDAA 4TRRA 2PL1A 1KEKA 3ZDAA 3V8RA 3ZZ1A 3BM5A 2OHGA 3FH0A 1US8B 1PLJA 1Y5IA 5HOEA 5KMGA 3K70D 1SU8A 3FJOA 4WKGA 4CDRA 2H9YA 3WAJA 3V00A 1T5OA 3VYUB 1VIDA 1FFGA 1SU4A 4P7BA 4P36A 4Q34A 4RQTA 1O9HA 1GO2A 3I5XA 2X4IA 2WKSA 1OJ7A 3BWYA 1GGHA 4JLUA 1F3LA 5CT9A 3A6DA 3QHAA 1SC3A 1SOVA 3AX6A 2RCNA 4PZ9A 1TM5E 2QRZA 2NTYC 5JMWA 5IZ4A 4UHDA 4BHTA 3W5AA 1A9RA 2OMEA 1G6OA 4LKRA 3UJCA 1EQAA 1DT3A 1L7BA 1JA9A 1QIEA 5FKJA 1G66A 1DIBA 2QK4A 2O5CA 1MAVA 2XNDA 3CXRA 5KQRA 3PFWO 4ZO9A 1LPOA 3BE4A 1JJFA 5E6RA 4GZMA 1DAIA 3IT3A 5BXYA 2BIFA 1IWBB 5C1BA 2H4XA 1MV5A 3DZDA 3GUVA 5CTAA 3VHXB 4ASUD 1C4XA 1ZK2A 5HBRA 4KU4A 2OXCA 4NV1A 3UEOA 1K8RA 1PG2A 5F35A 1WCXA 1IULA 2FPSA 4BN0A 4LOJA 4PFJA 4KREA 4A91A 4PV7A 2BUBA 1HNXB 4B5LA 2MSDB 2IE0A 3A1SA 1SUIA 5JZMA 1IUNA 3PQ2A 1E60A 1WUJS 3LKZA 2FFAA 3I2YX 4KDFA 4MW9A 2RGGA 4NVRA 4ENQA 4N6NA 2VS1A 4EPWA 1E2EA 4LF5B 3CZCA 2B6HA 1ISGA 1R15A 3W1WA 1I5EA 2A88A 3DA8A 3MTBA 1U9ZA 3PQCA 1G38A 1HR0B 3A0UA 4FR5A 1R64A 2H0QA 1HE4A 2UYYA 2ZYDA 2D0IA 3E7XA 5DVZA 2UXCB 1UDCA 2WZCA 4UVIA 3NOOA 4C7OA 2DTEA 3NRBA 4Q9NA 4YJ3B 3V8BA 3DF7A 2XAUA 3MINB 1DQPA 3VDXA 3X2SA 3QXGA 2ZJ3A 1ZXBA 1I4TD 2RGCA 3D0QA 3BFXA 3FGPA 4ID9A 4RZ3A 4DMRA 4YMGA 2MINB 3IV9A 3N2KA 1E4VA 2MHCA 4WZBE 3OKFA 1YVRA 3BX1A 2D7DA 1JG1A 4IH9A 1RVV1 4F5EA 2ZPTX 2B8JA 3IGFA 3L7JA 4X6YA 1NBAA 1BJTA 5ALWA 4CQJA 4BKOA 3GGDA 3NRJA 2PMBA 3SS9X 2VQDA 4OLAA 4YCAA 4B2LA 1CQXA 1W34A 2BMWA 3DBVO 3K6RA 4YV1A 1SXPA 1N77A 2Q1WA 3CZAA 4WGFA 1G7RA 3VZBA 3RTBA 2XYPA 3Q5EA 1L0BA 4YDSA 4TYNA 1PDWA 3OWHA 2B36A 3IEXA 1KDZA 1DPFA 1WV0A 5HCIA 3E82A 3LA8A 4KGDA 4D3XA 3UN1A 4K81B 4FLEA 2M6KA 4HWRA 1BO6A 4YPFA 3AL2A 3ZGVA 1I1QB 1BGXT 1JDBC 2YBEA 3FLAA 3H1GA 5AKHA 1JE1A 3AV0B 1M1UA 2GEUA 2IXAA 2C83A 3S5JA 3WGKA 1CDDA 1APBA 2JIZD 3UXHA 1N1GA 3KEMA 2OZEA 3FX2A 4Y2HA 1SZPA 2V0NA 4AUKA 4MI9A 1IWPB 1Y98A 2XRYA 2VT3A 1TA9A 2ZTVA 1DRWA 1HTTA 3GAZA 4D79A 1E9DA 1OREA 3AEQB 4ZZ2A 2P11A 5K45A 5I9MA 3LUJA 2YYAA 4Y1EA 3VYSB 4AO7A 5FTMA 3JASA 1EZZA 3KEGA 3CNOA 4XWKA 1GTMA 2CN1A 2YMLA 1WUHS 3GXOA 3TZCA 1WMFA 4BVFA 3V7FA 4Z7OB 4UD6A 5KYYB 1O9BA 3EFOA 3VV3A 2PUEA 2ZI3A 3QOFA 2Q2OA 3COPA 2FPOA 2O52A 3HB5X 3UM9A 2JGFA 2DKNA 3GA5A 3DMHA 4QFBA 3UMFA 3UVEA 1AUVA 1G6HA 2IIVA 3E81A 3PR3A 1KDTA 4MVYA 4QUHA 4U2DA 3AY7A 4EPRA 3HYRA 2MYPA 4IDQA 3HVJA 1YZNA 3E3AA 1A0OA 2HJSA 4WAUA 4MV4A 3IAHA 3OEED 2CNNA 2WJPA 1YRHA 3E7PA 4K0RA 4D0GA 5ELLA 4Q12A 5ECYA 4KFSA 5ALOA 1UPCA 1JFLA 2FP4A 1M2WA 3WL4A 1LS1A 4Z4GA 4E08A 4JIMA 3P5SA 3S44A 5ITZA 1ECLA 2PMWB 3ZW9A 3FYUA 1SJ9A 1V37A 3OZVA 4KVFA 5FO1A 1WOYA 3M5PA 1OHHD 2Q99A 3LIPA 4KZPA 5AOCA 3MWEB 1I80A 3TEFA 4JI0B 4Q3BA 3CX7A 3FI0A 2VBGA 2ZIUB 4FOTA 3R76A 4IDFA 2FUG1 2FX3A 4F38A 1BHSA 3LF1A 3HXPA 1DMRA 1NXTA 2CFRA 3IIMA 4IRMA 5DWQA 1XDDA 2YV5A 3SJBA 4BE9A 5CD9A 4GOMD 2W6CX 1C7IA 1D6NA 1L5HB 2WM8A 4Y2UA 1MB0A 2WF9A 2X9NA 3E9NA 4UCFA 3ZU4A 1JIIA 1FU8A 3U7JA 3WGHA 4CMEA 2ZITA 4C14A 3PHGA 1HG0A 2GN6A 2ZJ2A 3QWAA 1JI3A 4N49A 3FOWA 1EX1A 3VGJA 1JFSA 3QFRA 2P3QA 4JX9A 3R8XA 3DCYA 3G2NA 2BFBA 3QU4A 3JD2A 3MUEA 3GRUA 4G4JA 2E6KA 3L0YA 5B55A 2VHCA 3RYHB 4P0PB 3EXEB 4R2KA 5AMXA 4CLHA 2W43A 3O2NA 2BKXA 2QDKA 4WNAA 4O1HA 3NHSA 4JU9A 1QGDA 2HRQA 4LQDA 1QH8B 1CUSA 1FQKA 4IPTA 4DR5B 3SICE 3FVRA 3AEXA 2J9YB 4GRAA 2NXWA 1T3ZA 2IYUA 4IF6A 4FB5A 2Q3HA 5CNJA 4A73A 3ZJTA 1MB2A 2QN2A 3CLSD 3NWBA 4WUTA 2HWYA 4I81A 5GJWC 3WL5A 4B76A 3DV9A 1CHDA 2B69A 1U3FA 2H92A 2HWXA 4IRXA 4HD8A 2Y4NA 3LYAA 2HCJB 2RGEA 2TMYA 4G8DA 2AZXA 1GU1A 3GAMA 1M2JA 1NQVA 3ESXA 3UHOA 3FNBA 1CB0A 1TZCA 3P32A 4M7RA 3ZIAA 2DLCX 3Q3EA 1CR4A 4I3GA 1CPYA 1LW6E 5C0OE 4V2IA 1XVIA 3UB3A 1B8UA 1XZPA 2J0SA 4YA6A 1GCOA 4M9UA 4EENA 1ZIDA 2PZJA 3RHZA 4B32A 4QFDA 1LX6A 3DJFA 1S3IA 4YAGA 1WDLA 3GLUA 4S1NA 1YIOA 2DR0A 5C4GB 3R7NA 4D26A 4P92A 1WF6A 3M6XA 4YBZA 4RGBA 3DOJA 3WB9A 1I3KA 4RY9A 3W3ZB 1SBCA 5H3HA 4X5OA 2CVOA 4QEDA 5B64A 4FMPA 1H85A 4MHOA 2DUJA 1D8AA 4UQPA 2PS0A 3BFJA 1MDFA 4U63A 2GNOA 1CY0A 2J0EA 2A4KA 5BWMA 5IH3A 4PSDA 2ZJYA 2F1OA 3TUJC 1PJAA 1IM8A 2GXUA 1P9WA 4Y18A 5D87A 3ORRA 3H5VA 4BB5A 4F3NA 1MNAA 4K87A 4LYYA 1ORWA 3TVYA 3TE7A 3FG9A 1F5NA 2WG0A 3A2MA 2PH7A 2PZKA 4NBSA 3W9BA 4CMIA 1EGAA 2ATEA 3OMLA 4H9GA 1Z4KA 3USES 4D6PA 3Q10A 1SXJA 3KAJA 2VYFA 3EMDA 3PQFA 4HX9A 4F5YA 1T24A 4KR6A 2F8TA 5C1DA 5DGHA 2WJZB 1TX4B 1XZCA 2KX7A 2P2GA 3OD5A 3OTHA 4RZQA 3ZY5A 2NO1A 1M8KA 3GLKA 3TDMA 2BT4A 1DLJA 2F8LA 4ZVMA 1COWA 1M8PA 2BI8A 3FYHA 3GGPA 4CKEB 5JJBA 2AFIB 2A2ZA 3RE1A 4FDLA 3HPQA 1GQQA 2QAIA 5IUNC 2GAIA 2ZIXA 4YRZA 4WESA 3KVRA 4RFVA 4RENA 2NVUA 2IPOA 4R9SA 1URPA 5IAAA 3CWZA 3LBFA 4QUEA 5AKKA 4KBFA 1T1JA 1FSGA 5E4JA 4BFYA 5DNUA 5KWVA 1MO4A 3ZWYA 1UMKA 3CRNA 1AGXA 2P4HX 5KNDH 4BMYA 3HMQA 3C87A 4M9SA 1A9QA 3D81A 1SCUB 1TT5A 4MHSA 4ER0A 3NCHA 2OM2A 2VR1A 3L7MA 3PXGA 3OE1A 2HCFA 2PS3A 3F0TA 4E09A 2Q2QA 4HXFB 2ON6A 5IABA 3U7GA 4JCCA 4YAUA 3ROEA 1PQPA 1XMOB 3CF2A 2Q5EA 2QAJA 4F72A 4XDGA 3VNSA 2Z98A 3ZTTA 4RHFA 1FUKA 1Y9ZA 4E32A 3UV7A 4B4UA 5K8UA 2B2NA 3CJTA 1P61B 1ORRA 5KYXB 1FS6A 3H4MA 1M1NA 1F14A 4XPIA 4DWJA 3RAFC 3BDIA 2EJBA 4ZRMA 3MGKA 1P4AA 1S2LA 1VSUA 2DXIA 4U7HA 2QAGA 3N6RA 4P1ZA 2BGJA 5TGTA 1K63A 4MDFA 1WLSA 3HCNA 3Q3CA 5AI4A 3TUZC 2YXBA 3DXZA 3W5JA 3RI3A 2W9XA 2RC6A 3CR8A 2HXSA 4WCFC 1Y37A 2R60A 3N5KA 4S12A 2B9VA 3S3TA 4AKIA 4QTTB 3PLAE 2DFDA 2WICA 5AVOA 1VE7A 1R0KA 3HB0A 4F6LA 2HGSA 4B3XA 2OR3A 2NO4A 2QJRA 2BHSA 4D81A 4F9TA 2PUAA 4L2IB 2MSWA 2ES4A 1WS6A 1JDUA 1ZUWA 3AI3A 4W1RA 3K0EA 2GYVA 4IOMA 4K46A 5TVKA 3DAYA 1GITA 4S2EA 1NDUA 3X2FA 5BYAA 4HTFA 1LJ8A 1NZDA 5DMXA 4AWXA 1XD2A 3E18A 4XASA 4KI7A 3G17A 4YRTA 3EC2A 3K8OE 2WJHA 3B12A 5KDLA 3CE6A 1OU0A 1Z74A 4O63O 1W30A 3L0CA 4AS1A 3OQ6A 4TMKA 1ZSVA 2XTMA 1EFLA 5DI3B 4BYGA 3L8DA 2PV7A 1UBHS 4MLZA 2ZYGA 2GA9A 2FSHA 4LCJA 3IPYA 3ROZA 3ZS8A 5MFZA 6ABPA 2GPAA 2PL5A 4LTMA 4QYIA 5K7SA 1EUCB 3P1JA 5CK5A 5IVPA 5CLHA 2YWDA 5D7NA 4D4KA 1UBFA 4NR0A 1OI7A 1OFIA 2V9PA 4DCSA 1MD9A 3L9XA 1KYYA 1T2UA 4XB6B 2ZWOA 2QN1A 4F9GA 4D4JA 2HIAA 4UE3S 3ZE9A 5FV4A 4XUDA 3MRSA 3TWOA 4B8YA 3L4KA 1NI4A 2QLMA 4KN5A 5MGNA 2DPLA 4HH1A 2FI1A 5FH9A 3BDAA 3NWJA 2LNDA 2NYUA 3F98A 2BMVA 3ABRB 5KOJA 2IUFA 2P9BA 1CF4A 4B47A 1SUCA 4JH0A 2GN1A 4E5YA 2XX3A 1CZRA 3JVUA 3QMMA 4M6WB 4C4YA 2QTRA 4E03A 3UV6A 4ON9A 4OK6A 1Z08A 4PE5B 5TXGA 2COEA 1BMDA 2G9UA 1NQAO 3DO6A 1E4YA 4FHGA 4J29A 4MVCA 5D01A 4ARZA 4WA8A 1MXHA 1XTQA 1VBNA 2FSIA 1ZIOA 1RQGA 2WF6A 3QVSA 4MROA 1IEQA 1YL5A 3B38A 2K5UA 2WU1A 2AFHE 4L5AA 1U2EA 3EZFA 4RSRA 1GQOA 1UMCB 1JLKA 3HY6A 1UOPA 1P2FA 4J76A 1T4CA 3L0DA 2IE8A 1KO4A 1DKQA 1R5BA 4JLDA 4X44A 3J80A 1TQHA 1AUXA 2OWEA 3PUZA 1YS7A 2P1ZA 1IQUA 3IBGA 4RU1A 5ALJA 5JSYA 2BGUA 4A2QA 4CYMA 3KKPA 3FOZA 2CL0X 4LF6B 2VNKA 3OJLA 2J0UB 1XTUA 1ISIA 2ZUFA 1XZGA 1QRAA 3COWA 4R68A 3RVRA 1FJ2A 3L7AA 1MQ8B 4ZCSA 3H99A 2JCBA 3R09A 2PBLA 4JNKA 4ZYXA 2B78A 2NAFA 2JJ8A 1I33A 4ENRA 2RGWA 1NXQA 1SB8A 3HKDB 4JJKA 4NBNA 5ADVA 2HEIA 1USGA 1OD6A 2P9YA 3H9CA 4GFDA 4PNZA 1WIWA 1R4NB 5CGQB 3UF0A 4AWAA 1Z13A 4L57A 5CM8B 3GDOA 3U9TA 1EJ6A 1YS9A 5CR9A 1PWXA 2C8JA 4MYCA 1EVZA 2B1GA 3NHZA 3EIXA 1CZNA 4ED9A 1FRNA 4XJXA 1E2BA 2EG5A 3C3JA 2GVZC 1FFAA 5H7XA 4TV9F 1H6CA 1B0AA 1WDKA 3D6UA 3NTXA 3ZLTA 2EERA 1Y7IA 4N1AA 3GT7A 1O77A 1XZAA 4M0MA 3W6ZA 5AW5A 4G5QA 4EHNA 5EIHA 4IO1A 4OM8A 4UFNA 4DOMA 1ZVJA 4AO8A 1R6TA 1PKXA 3FD8A 4EB8A 2ZWIA 4NCBA 1KETA 1N92A 4IQ0A 1LS6A 2DCUA 2ZB3A 4U5XA 3T5DA 5JPCA 3E5RA 1YXMA 2CNKA 3UV3A 3QE9Y 5TJ9A 1E8NA 1A8PA 2W93A 5EAIA 1PR2A 2GSDA 1PJ8A 1ZUHA 2BGTA 2XW6A 3ICOA 1YONA 4MR8B 2XBMA 3OCYA 2QL9A 3G89A 3QKUA 4X3OA 4DC0A 3LOQA 4LRXA 2VDOB 3AV3A 2WM9B 3PCXA 3QU2A 5IM5A 1XMQB 1XL1A 3V1LA 2VP6A 4W9MC 1DCTA 4EMUA 3EGCA 2O8EA 4DQDA 1OILA 1WQ3A 4C6HA 2I3BA 2PU7A 1NPTO 1NVEA 2CZCA 3GGJA 4IINA 4ZDJA 4ZZIA 1X7ZA 2VRBA 3Q6IA 1WHTA 3WR5A 1IBCA 1NXXA 5EQJB 3MRTA 3HWSA 4LDPA 1GP2A 4MYSA 4WY5A 4Y1RB 5CPBA 3LVQE 4EQ6A 3HFRA 3OJCA 3UTCA 5AI8A 5GV7A 4E46A 5CH3A 3K9LA 2YXDA 5EXDA 1XNGA 2AI3A 4AN0A 1C0EA 2VT6A 2G08A 2FGJA 2QX7A 2QBYB 3PDHA 4OGWA 4AL4A 3UGJA 1NHGA 1UJ4A 2WF5A 3RUHA 5IT4A 4TTQA 1QU3A 2YWHA 3PE6A 3HB7A 1MRZA 1HZJA 2YNMD 3GI1A 4D44A 3RU2A 1G0NA 3NWEA 1P17A 2Y9MB 3ON5A 4GBJA 5BSTA 1YUNA 1CJMA 2OG1A 3D3WB 4DLRA 1JLLA 4FQ8A 5G53C 1JQBA 3GFRA 2WF7A 2RHHA 4KI0A 4FEAA 5CPFA 3CZRA 4DMHA 2CVHA 5E7MA 3M1IA 1HK7A 5K0NA 1RM0A 4JNCA 3VYRB 4UJ5A 5IDYA 3GDWA 3EXG1 3I3OA 4AJIA 1G16A 2Q5OA 3K53A 4N54A 4PVDA 1IZYA 1V6CA 1U4OA 3NV9A 3BEDA 5KC9A 1KK1A 1ZD2P 2BVNA 1G3RA 2IOFA 3OPXA 2BBSA 3ZDRA 4MCJA 1KYQA 2Q1YA 1ADJA 1ECPA 3QVVA 2WTXA 3MTGA 2I3ZA 4CETA 3EB9A 3G7NA 5TR9A 2BEVB 1CZHA 1PNQA 1QYCA 1P77A 5LCXA 4DSNA 1G2PA 2B4KA 1A9PA 2D5AA 3VNUA 3E4DA 3CUWA 4HWSA 1BWSA 1FYDA 3V4RA 3ICWA 3RYIB 4EZEA 3EUFA 3PDIA 3VMMA 3ZLBA 4BLPA 4YPOA 3ITEA 5ARCA 3HVIA 4DARA 4ZOLB 3LAWA 4NE7A 4X7PA 3MBKA 1N3BA 1VKOA 3B6ZA 3EARA 2ZIGA 3RTAA 2J59A 1A4IA 4K9SA 2J3DA 1QWSA 3FVVA 1QS0B 3MTDA 3HYSA 3IPRA 3H1AA 2EFEB 4Z9XA 1Z07A 2JNWA 5FV7A 1UBSB 1U9YA 4M1KA 4PGFA 1ONOA 4CE6A 4M0CA 4G0VA 2JI7A 1XALA 2A5YB 2PKQP 4Q3EA 4A15A 1FY2A 1UDXA 3TJZA 2ZT7A 3EFEA 1QHXA 2FEAA 2POCA 4XUGB 3CLTD 3SQDA 2X2OA 4H4EA 1HDGO 2R2AA 3E9MA 4PIPA 1QO9A 3V97A 5K0JA 2DUUA 1TVCA 3JALA 1RZUA 2C4TA 2F9FA 3FNGA 3HBMA 2XRFA 4X7RA 3U7EB 1CY8A 3CUTA 3NIBA 4AZTA 3DOCA 2CF5A 3NDRA 3R0ZA 4IQFA 1LTQA 2BONA 3BQ9A 1OB5A 2AQHA 2PPLA 3AF3A 2KYRA 4JAVC 1JG2A 4HR7A 1VYTA 3BBLA 3QX3A 2P4EA 4M38A 4CU5A 2ODNA 4R6XA 3VA7A 4BZWA 5BV7A 5H02A 3VMFA 4Q9JA 4MHTA 3W2IA 3PPWA 2XA1A 1K6MA 1W5BA 1OZGA 4JJGA 2P40A 4G84A 5K4AA 1ODIA 2P0YA 3HGQA 1V0JA 1UZAA 4NEGA 5BVGB 2OV2A 3DZIA 4FW9A 5D86A 3K9GA 3RTEA 3A11A 1XRQA 9ABPA 4LJ5A 2ID7A 2FDCA