5F2EA

Crystal structure of small molecule ars-853 covalently bound to k-ras g12c
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
168
structure length
168
Chain Sequence
GMTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETSLLDILDTAGQEEYSAMRDQYMRTGEGFLLVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase KRas
publication title Selective Inhibition of Oncogenic KRAS Output with Small Molecules Targeting the Inactive State.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 62
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5f2eA00
2PH1A 2GHIA 4S2EA 4XTRA 1S3GA 4JYBA 5EP2A 4B33A 3SJBA 1GP2A 1VIAA 1VYVA 3UIEA 4AKIA 2XXAA 1P7CA 1U9IA 4LHYA 3RRYA 3VNUA 4HZUB 3KL4A 3Q3JB 1O3YA 1WDTA 4L9WA 2HCBA 2J7KA 1CR1A 1QVAA 2ZYWX 3GJ8A 3DOEA 3FHOA 4UXHA 1UFQA 1XZQA 3VR1A 4ZO4A 3UWOA 1Z3IX 2OAQ1 2H17A 1OHHD 1RC8A 1HTWA 5E7JA 2ANCA 5JFGA 1ZRHA 3FTQA 1U9IC 2W58A 3B85A 1HURA 2FFAA 2RHDA 4KU4A 4PO9A 4ABYA 1X8KA 4MUAA 1EFUA 2GZDA 2JEOA 1II9A 1P62B 3MJRA 2WWIA 1ESNA 3EXAA 1KO1A 3SE0A 4Q48A 2ZJ5A 2B21A 2ZRLA 3IDQA 4V02A 2JGNA 4ZPXA 4MITA 4OK6A 2IYVA 4LPSA 4B47A 4GSYA 2P5SA 3MWKA 1J2JA 5EXTA 3EIQA 1XTKA 1T3SA 2O8FA 2EWVA 1KSJA 5EE9A 2P6RA 4L4UA 2XSZA 3RS7A 3KQHA 3B1XA 1P6XA 1W4CA 4C4PA 3KJEA 3PUYA 2O8EB 4C0BA 2FZLA 5FPTA 4PSKA 3NBFA 1N6PA 3C5HA 1Q21A 1HV8A 3F3YA 1CIPA 2DPXA 3AVTA 1E3MA 4N0DA 1H65A 1D9XA 3QXXA 4PAQA 3BH6A 3CRW1 5AJWA 5G53C 4GP7A 2CHVA 4TWZA 4KFSA 3SJAA 2WVJA 2A5YB 3MRSA 3KTAB 3EC2A 3MLEA 4BFUA 3IHWA 1R7RA 3VR6A 1MOZA 3CO5A 5JI2E 1HUQA 1CJKC 1CJMA 1LVGA 3V00A 4QRHA 1ONBA 4PHTA 4NZYA 2IUSA 1E9AA 2X77A 2ZRGA 4MRNA 3AV0B 3ZYCA 4G01B 2EFGA 4I1SA 3THXB 2BV3A 3QNUA 1P2UA 2B7BA 2XOKA 4CGZA 4XWAA 5GJVC 1O87A 3GEEA 2JLSA 3KUCA 3L2OB 2OAP1 4PC2A 1CXZA 4AG6A 4RD2A 3X1DA 3BERA 1Z07A 2EYQA 4EFLA 2ODEA 3C8UA 3UMFA 4ZCMA 2OCPA 4P4TA 5FPSA 3SOPA 1TEXA 5EE3A 1N0WA 5KNCA 2Q9BA 2XGJA 3I1FA 4LYJA 2ZJYA 1DE0A 1AK2A 5HZHA 1ZUHA 3TSOA 2NTYC 2ZS9A 1XMSA 2QMHA 2IYZA 2P67A 2WKPA 3T5GA 1N6NA 2H18A 5CB6A 4JT2A 4KVAA 3A1UA 5FOWA 4DIDA 2V6IA 2RHMA 2NZJA 3N2EA 2NPIA 2ZROA 2ZYTX 3CWQA 1II0A 2CK3D 1GOTA 4R71A 1Z6GA 1BYUA 3BE4A 2NG1A 1NG9A 2ZRAA 3NH6A 2G9NA 1R5NA 1D5CA 2A30A 3ZVMA 3B60A 3CZPA 1LS6A 4Q9IA 2QBYA 4C2TA 3K70C 4AIIA 1RFLA 3LAWA 2OFOA 3WHLA 2Z0MA 4EFNA 4XD7D 2V1UA 1KMHA 2OG2A 5FI1B 3HU2A 4F92B 1PUIA 2BEKA 1WBBA 3A1SA 4G5QA 3L8YA 1HH4A 3PVSA 4PZLA 4WBSA 5CM9C 2V4ZA 1GNQA 3CF2A 1OB2A 1NSTA 1ZVQA 1IHUA 3UPUA 2IUTA 4KLZA 3ND8A 1GL6A 3QEOA 2RH5A 1OKKA 5C46F 3FE2A 2X2EA 5L3QA 1P60A 3FMFA 1IXRC 4JBYA 1DBSA 2AKYA 2ZEJA 3GP8A 5KHOC 2V7QD 2QQ0A 3QBTA 2IA5A 4FI3C 1X1SA 4YQFA 2YC4C 3UMRA 4B3BA 2O8BB 2EU8A 3JVUA 1VYTA 1FQKA 3QKSA 2FPMA 2J0UB 1FQJA 3KKPA 4FCWA 2JJ2A 1XCPA 1QRAA 2I1QA 5G3YA 4DUGA 3U6KA 3NHBA 2UVQA 4EPXA 3CW2A 4LI0A 1R6BX 1F3OA 3GLIB 2DYKA 4KJZA 4BLRA 5JI3E 3OEHA 4Q4AB 1S9DA 5JECA 5F3WB 1G5PA 1UDXA 3THYB 2J9RA 4DVGA 1W36B 4D6PA 1E0KA 4HZUA 3GJ5A 5GJWC 2P0EA 4X8OA 1T4GA 3M1IA 3TAUA 3QY0A 4DLWA 1VMAA 1JI0A 4G3XA 3LV8A 3PV0A 4NYJQ 4A9AA 2C5LA 1VPLA 1LV7A 1Z0KA 1YQTA 4IXMA 5LB4A 4KYUA 1JPJA 1NLZA 2AK3A 2YWHA 3PUWA 2LWIA 2XZLA 2D2FA 1E2MA 4NYMR 2OE2A 2NGRA 4ACBA 5L3SB 2PCJA 4RZUA 4I1VA 1PVOA 5F9HA 2PX3A 3FB4A 3H4MA 4DLSA 2AR7A 5J4KA 1K6MA 2ZREA 3LNCA 2CEAA 2WKQA 2ZSFA 4V0KA 4DCVA 3QUSA 4I99A 1E2PA 3SI7A 2QMEA 4OHWA 1JR6A 1V5WA 1Z08A 1ZIPA 2CHGA 3AKCA 3KFVA 1GDDA 2IYWA 3DM9B 2P65A 1B0UA 2A7QA 2TMKA 4EDHA 5H70A 3T35A 1TNDA 1G4UR 2O8EA 4WW0A 2FWRA 2ODWA 2EFEB 4GBMA 2ZE7A 4DZZA 1KK0A 1AQUA 3CRMA 3GJ3A 2RGDA 2RMKA 2ZRFA 1XXHE 2NIPA 3RANA 4HUQB 1KYIA 1NVVQ 3KJGA 3DHWC 3RYTC 4G1UC 5FTJA 1JEEA 1CLUA 2DR3A 4BE7B 3AVWA 2QGZA 4V0LA 3ICQB 3CPEA 1SVOA 2R6GA 2A5JA 3K53A 5E4FA 3A8TA 4EFMA 5H8WA 1ZINA 5ANRB 4O2LA 3CPJB 3KXLA 1BYIA 2ZRKA 3KTAA 4US0R 3NH9A 2GK7A 4MUBA 1RZ3A 3QF7A 3EW9A 2GAOA 5JWRA 2FZ4A 1XB2A 1JJVA 4TN1A 3AVVA 4A36A 1XMJA 1Q1EA 2JIZD 5J4LA 1A4RA 3P20A 1JR3D 2FPKA 1NI3A 3OEEA 3QPUA 4RJLA 3RDPA 3SYKA 3ZIAA 3AKYA 2W2XA 4B48A 2EQBA 3RS3A 3U7EB 3U3JA 3HJNA 4FCTA 2RGNA 2ZI6A 5BYKA 4IOMA 4BLPA 1OT3A 1TTTA 2HDNB 1DEKA 1DOAA 1E2NA 1RRPA 4B74A 1WRBA 2O0JA 2P3SA 5B30A 3E70C 4CF7A 4OYHA 3ASYA 1EFTA 4L16A 4G5GA 2W0SA 1RYFA 1P61B 3IPYA 5AUPB 2ZE5A 1RPZA 5CYPA 4JL8A 1IJEA 1KDTA 4E22A 3VFDA 4TSFD 3B1VA 1M7GA 4Q7MB 4LRWA 2RGNC 4UNSA 2PT5A 4IHQA 2FDCA 4I4LA 4PC1A 4JZKA 1QHHB 4A0HA 1GRNA 4Q01A 3TUJC 2ZAMA 1KNQA 1TAGA 4LV5B 2PJRA 4HB3A 4ZKEA 3U7HB 5EP4A 4ESVA 2GAAA 2OEPA 3SBDA 2ASEA 2GJSA 1E9DA 3WXMA 2KSQA 4HSEA 3WMFA 3KB2A 1KJZA 4M1SA 5KPDA 1G8HA 1SVLA 1UBCA 2Q3MA 5CK4A 1CBUA 2J0VA 1SKYB 4M53A 2YV5A 3U3MA 2AWOA 3WMGA 4AYWA 1ZJ6A 2YJTD 1S3SA 2OESA 2HEIA 3QKRB 2CNWD 1MO6A 4HAWA 1CKEA 3X2SA 5FUXA 5HKKA 4LGMA 3AVQA 3AM1A 4D82A 4IDQA 4PAOA 1TPZA 3E5HA 5K8LA 4K46A 3ZLJA 3B1WA 2BKUA 1F6BA 1KI9A 1FFHA 1OV4A 3M0EA 2VYFA 1E2KA 3FKSA 5DHFA 3C7KA 1G6OA 5EE0A 4GI7A 4E09A 2YZ2A 3L43A 5IHPA 3CKLA 2MMGA 1XCGB 4LHXA 4PAMA 4PTLA 4LC0A 3W8RA 4HATA 4TYNA 3M6AA 4BLQA 1NLFA 3DDCA 4D4KA 1P2TA 3SS8A 5TMPA 3CF0A 4AG5A 2ZSEA 2YWFA 3CIOA 4B35A 3VR4A 5FL3A 2ZR9A 2OXRA 3L8ZA 4C3ZA 1A7JA 1TEVA 2VSXA 5CB8A 4BGDA 1Z22A 4NONA 3IGFA 4AK9A 2QUZA 3EZ2A 3EWAA 2O8BA 2ORIA 2XX3A 4TTPA 4Q9HA 2BWJA 2J0UA 1CU1A 2QSZA 2WZQA 2OILA 3LA6A 4C30A 5KSZA 4TQUS 4V0OA 4KITB 3GLIA 1SXJD 2RKOA 3VHXA 1E9SA 1Q0UA 4Q4AA 3THYA 2IS1A 4LJAA 5TV2A 3ADKA 2OSBA 3K9HA 2A2ZA 1TF5A 1FMLA 1VCNA 4IW3B 4LY6A 2QTHA 5KSYA 4KFUA 1AJEA 1E0AA 2V55B 1GFIA 1CJUC 4EPYA 1M7BA 5JS8A 2MSEB 2QY9A 2ODBA 1E6CA 2H7VA 1JAIA 1VTKA 4FWTA 1KJYA 4PO1A 4FMBB 3C15C 1W36C 1W0JA 3AP3A 5BW8A 2MMCA 3VNVA 1JEDA 3TRFA 5L3SA 3ZVRA 5CIWA 1KGDA 4JMPA 2RGBA 1SVIA 3QXJA 3TE6A 3VHLB 2C2HA 4OQLA 2IYXA 3P4YA 2IYRA 3B5JA 3ZZ0A 4OK5A 2GEUA 4Z1MA 4YMVA 5D3MB 1UKZA 4DEXA 2IYSA 1S9HA 3QJYA 4ZDJA 4R2HA 2IYQA 3OIWA 4RD3A 2LCFA 1II8B 2ZI7A 4NL4H 1YVDA 1X8LA 1SHZA 3DL0A 4XOIA 2W6ID 3B8HA 2QQEA 3RC8A 3O8CA 3CH5A 1QG4A 3ZZTA 2ZRPA 1R0YA 4Q1DA 1VHLA 1E1QA 4OKSA 4M9XA 3NEYA 3K0AB 4AYTA 1KI1A 4HUQA 2R9VA 4JLMA 4CIDA 4A15A 4CEIB 5AJZA 3ADCA 1U81A 2CE7A 1OXVA 2JLRA 2ONKA 4DT1B 1SVSA 2G83A 1U0HC 1BO6A 4DEYA 1ZU5A 5CLQA 1DELA 2ZSBA 3AKEA 3C14C 3QI2A 4HDQB 4R98A 4KFTA 2F9LA 1W44A 3OAAD 1W4AA 1BOFA 4LYHA 1CF4A 4HEJA 3RRNA 1JXOA 1FUUA 1E1RA 4KLNA 3PEUA 1LW7A 4F4JA 4LC1A 4JLBA 1X6VA 2WM9B 3MFYA 2VPPA 4JJKA 3MWYW 1CS4C 1SULA 2YKGA 1D9ZA 4TZ0A 1Q22A 1F2UB 3QKUA 4HB4A 3GJ7A 3IPXA 2XJ4A 3PG5A 1ZC3A 2K5UA 3KZ1E 1E9CA 4PSVA 1AQYA 4C2UA 4ILEA 1Q3TA 1E99A 1NBMD 1SZPA 1XXHB 2D74A 2ZI5A 3LLUA 4FMCF 5JS7A 4GFDA 2ZUCA 1E2EA 2VP9A 4OHYA 2FSIA 2Q3HA 2QL6A 3B6EA 5HCNA 3ND9A 3RS5A 1NJGA 4D2IA 4PPQA 3AVPA 2N1BA 4Q1EA 5ELXA 1OH5A 1OFHA 5LBIA 2O0HA 1P9WA 1QHHA 3IIJA 3W3ZB 3V9PA 4A1FA 3I72A 3VAAA 5AUQA 3U44B 2ZRIA 4D0GA 1KO5A 1Q3HA 2R6AA 1NKSA 3S1AA 5E3HA 3DM5A 4TTQA 4R9UC 2QTFA 1G21E 2IYTA 4YLGA 4XSGA 4TL6A 2WAYA 4LBVA 3EZ7A 2Z6VA 3QKRA 3OIVA 5F2EA 4P4SB 5BYJA 1BKDR 1SVWA 1DPFA 2OCAA 4PHFA 3UANA 1CP2A 2ZJ2A 3BIFA 3LRPA 4LV8B 5DN6A 4O0MA 821PA 3EPLA 2HXSA 3REGA 1NVVR 1YR8A 1DG3A 4TZ6A 5DH9A 1LTQA 4A8JB 5JLJA 3BOSA 5G41A 3VR3A 4A0GA 3IILA 3UATA 4L15A 4UKDA 1OFTA 2H8KA 2PMDA 4G0NA 1XX6A 4IVPA 2V1XA 3T1QA 4OI4A 4JBXA 1GITA 5HPYB 1S1CA 4NYMQ 3B9QA 1OHHA 1OE0A 4DRZA 3CZQA 2PCLA 4JKIA 3LBHA 4GNKA 1UF9A 2VH5R 5EZ5A 1JB1A 1Z06A 4QNMA 4BASA 2VSOA 4LJ6A 4DSTA 2OLJA 1OXSC 2NO9A 1YZQA 4LHVA 2J46A 2O0KA 4DDUA 3A1TA 2GTPA 3M4YA 1T0HB 3QIAA 2VHJA 1VG9B 2DHRA 1KDOA 3B1ZA 4Q1CA 4PPGA 2FN4A 3B78A 3HR7A 3IIMA 3DEFA 1Q1QA 4MKFA 4BFZA 1CJTC 2F9MA 5DGXA 1WBDA 3QENA 1E9EA 4Q7LA 221PA 4JLKA 4DLRA 4ACAA 1N6HA 2YOGA 5FFMA 1KK2A 1OIVA 1L2TA 2GJKA 2EFCB 1J8YF 4A82A 2Z43A 3D7MA 5C4GB 5A0FA 1W4RA 1WF3A 2W2VA 1J7KA 1NRJB 1TUEA 4NMMA 2EW1A 5AUOB 5J4YA 2WWYA 1NBME 4B71A 5FTLA 4IFBA 1TMKA 3R8CA 1U99A 3LX5A 5TY0A 2IXGA 1KI2A 1P9RA 3GLHE 1D8TA 3WY9A 2GCNA 4YMWA 1Y63A 4B32A 3CR7A 1PLKA 1QG2A 1I4LD 4B44A 1IXSB 4TYYA 4QHSA 2IWHA 1LB1B 4JVLA 3EC1A 2QPAA 3VTKA 1FNNA 3AF3A 1ZUNB 3LFUA 1Z29A 4FW9A 4W5HA 5B58C 1Q1BA 1RKBA 2J3EA 1UADA 5D3MA 4D4JA 2A5GA 2R6CA 4QC2A 4UNQA 4A2PA 2CVFA 1II8A 2GXAA 1OXUA 1Z47A 1PV4A 5AR1A 5JJIA 621PA 1YJ5A 2AKAB 2F6RA 1OLOA 1XD2B 2F1HA 3R7WA 2UZIR 1W4BA 2IYLD 4XH9B 3SJZA 1NVWQ 3RAPR 5KU1A 5JEEA 2G3YA 5BN5A 3T5DA 3FFBA 3K0AA 3LW8A 4RVCA 4CDGA 1YZLA 2QTVB 4L5BA 4B75A 4CEIA 2R2AA 2AFHE 4TMVA 4Y0AA 2WSMA 3W34A 3CWZA 3SNHA 1W0KA 4P31A 4JIMA 4D26A 2DWQA 2R6FA 4Q66C 3B7GA 4DT1A 5A4JA 3ZVNA 3DPUA 2WOJA 1IY1A 1E79D 1A1VA 3PEYA 1L4YA 2FEOA 4QGAA 2GXUA 4LWZA 1M8PA 1HYQA 2C03A 3TVTA 1RIFA 4G5OA 3QXCA 3WHKA 4W7SA 3A4LA 2FSFA 1MO5A 1E4YA 2OXCA 2GETA 1M1YE 2XNSA 5SZHB 5DYGA 2CK3A 1LF0A 1KK3A 8OHMA 5B57C 3CLVA 2IF2A 2Q9AA 1TUIA 2BVNA 1QHGA 4HAXA 2C99A 2VHQA 2F55A 4HLUA 5FR2A 1F2UA 4MRRA 2QAJA 4AYXA 2GVDC 3GJ6A 3IKJA 4IXNA 4RSGA 1E2IA 4OQMA 2R6DA 2KBEA 2ZSDA 4KBGA 5CJ2A 4C0LA 1QHXA 4PPFA 4QBIA 3F0TA 4UQOA 3BBPA 1XXHA 1XD9A 2RGCA 3IBGA 3AVUA 2VHUA 4ARZA 2ZIAA 1TQ6A 1L7VC 2IEYA 3PENA 4II7A 3RSOA 3X1XA 2QEQA 1W1WA 3NG1A 1XTSA 4Q1AA 3MG9A 2V8OA 1D2EA 2ATVA 3DOFA 4HLUC 1KNXA 2FV8A 4U5XA 3EX7C 2FF7A 2VHTA 1YR7A 5EXPA 1UKVY 2YC2C 3ZS9A 3U44A 2VBCA 5FL7D 4DB2A 3EARA 1SKYE 3MUFA 3THWB 4GP6A 1EWQA 1DO0A 5UKDA 2ORWA 1AKYA 3KQLA 3SQWA 4BECA 1HY3A 4JLOA 2V7QA 5B64A 4I1UA 1NMZA 5FBLB 1N0VC 2WTUA 4FMDB 3ZDQA 3QE0A 4A2WA 4P4SA 3KB1A 2R8RA 1E9FA 4OK3A 4TYWA 4Q1FA 1JECA 4WXRA 3R9WA 2B8TA 1SXJB 1WB9A 1W5TA 1U0JA 4A8JA 2WWWA 1F60A 3RHFA 5JHGB 3BH0A 3OZXA 1N6KA 2JAQA 4UNNA 4TQ9A 2RGGA 3AB3A 3AP1A 5EUMA 1ZM2A 2JJ1D 2HT1A 1GKIA 2IUUA 3UMSA 4M9SA 5KDOA 4TYQA 5DI3B 2F43B 4RCYA 1ZM4A 4JLPA 5IRCD 2N42A 4NBSA 2AX4A 2GNOA 2WSSD 1G3UA 3QEJA 3V4FA 1NF3A 4LK2A 4WVFA 1I4DD 1KSHA 1VYUA 3Q5EA 4A4DA 1ZM9A 5AK0A 4NU0A 2W00A 4PX9A 1YRBA 2JASA 4IVQA 3GCGA 2A78A 4XTCS 4A6PA 3DZ8A 4A8JC 5KUTA 3AP2A 1T91A 1E2LA 4B6FA 1U2RA 1MO3A 2FEMA 3F5FA 5FR1A 1GL9B 3TQCA 5FOTA 4TL7A 2OZEA 2WJYA 2YOHA 2NPFA 121PA 4GZLA 2C9CA 5J4HA 1GAJA 4XVQA 1YZGA 2B7CA 2E87A 4MYHA 4YONB 2VHCA 2QP3A 2GJAA 3QOFA 2FMXA 3C41J 2J59A 1M2OB 2GDJA 1E94E 1N5JA 3T61A 3IHLA 2JLXA 4ITRC 2OLKA 4K8OA 1NN1A 4MYUA 1G17A 4NCIA 3L0SA 3UKDA 1FL9A 4XIGS 4D0NA 3SR0A 1G6HA 4YC7A 1EX6A 1JXMA 2ZI9A 1WP9A 2HUPA 5FBVB 1T6NA 4DCNA 2ZE6A 3W6NA 5EE5B 3ADBA 4Q4HB 5FOSA 3NDBB 3DKVA 1NIPA 2WJIA 2BBSA 3WBJA 3G5UA 3O8RA 2AL7A 1OPXA 1KSFX 2FSHA 2VP2A 3BD9A 4HLDA 3K9NA 4LJ8A 4PHHA 1UJ2A 5TVKA 1YE8A 1KSGA 4GMXA 4CVNA 3Q9LA 3BFKA 1FPMA 1K8RA 4DWJA 2VF8A 4F38A 4ZDIA 2JIZA 4QXAA 4LJ5A 1TQ4A 1XBTA 1DAGA 2RGXA 4OHVA 1ZCBA 3QQ5A 3CX7A 1UKYA 3LXRA 4PHGA 2D2EA 3KKOA 5KOYA 2R65A 1XD2A 2H57A 2FU5C 2QE7D 1DADA 1G7TA 3K1JA 2W6JD 1VDZA 1A5TA 2QM7A 3KKNA 2PBRA 1P2VA 1IN5A 3GLHB 1OSNA 3NC0C 1FX0B 4OQFA 1TU4A 4WOPA 4IJMA 1GUAA 1KKLA 1NVXQ 3NBZC 4C0KA 3I3SR 1KJWA 1OW3B 3U5ZB 1RJ9B 1UAAA 3A4NA 2ZYUX 3B9PA 4HAUA 4ERNA 4C7OB 2XTMA 1N6OA 3CB4A 4HAZA 1DTSA 1Y3AA 6Q21A 5BN3A 5CITA 2DBYA 5J5CA 2NO6A 3WNCA 3HR8A 2ZI4A 4BZPA 2ZRMA 4QBFA 2IBMA 4AWXA 3WP0A 1R0ZA 2F1IA 2FJUA 3FMOB 5M04A 2CLCX 2CNWA 1D6JA 3U61B 1BS1A 2FX3A 1UDWA 1KZ7B 3EZ6A 2WIAA 4MYTA 4KFRA 3ZZUA 2QROA 721PA 1SGWA 4QOSA 5J47A 3T34A 4YDHB 4DKXA 4LJ9A 3NKVA 4QBHA 2GBLA 1Z28A 3NVAA 1R8SA 1WXQA 4JLNA 5H68A 5A5GA 3TQFA 4OI1A 3QXSA 3OHMA 4MKGA 2F1RA 2IXEA 2CLSA 4Q47A 1ANKA 3THWA 5JRZA 4BPBA 4BLSA 1B23P 5E7MA 3FVQA 4HLCA 4KBFA 1HEIA 4O3MA 2UKDA 2FE4A 5JBQA 1N5LA 1NIJA 1P5ZB 1XJQA 3WP1B 3P26A 2GBLC 2E1RA 1MRSA 1XNJA 3EG5A 4BRWA 1N5KA 1NN5A 1SVKA 1COWD 4DB4A 4TLAA 4P32A 3RWOA 1NMYA 1Z5ZA 3BS4A 1ZMXA 2ZRNA 3NBYC 2F3RA 2GKSA 5GVSA 2BM1A 3IIKA 1SXJA 1G41A 1CRPA 4IDPA 2CCGA 2WWGA 1E2GA 4Z54A 4L8GA 3BFVA 3H1TA 4Q1BA 1W49A 4URYR 1Z6YA 5K8TA 3W6PA 2WKRA 3BGWA 5EZ6B 2C98A 2QORA 1G19A 3NIBA 1JQLB 1NSFA 4FINA 4NCNA 4JJZA 1IM2A 5DI3A 1TF7A 3SU8A 3F8TA 1KY3A 1Q57A 4P0TA 5FBRB 5SZIA 3DKPA 1P72A 1SXJC 1I4TD 1N2CE 2BJVA 2CCJA 4AC9A 1N0UA 1GKUB 4JKYA 3RSLA 4URXR 4BFSA 2Z5FA 3MWLA 4HB2A 3SYNA 4ESHA 5DSZA 1FP7A 1ZNZA 3QKTA 3AH8A 4C0SA 2X19A 5AUNB 4Q9JA 5FBWB 1KDPA 1T8UA 4EKDA 3X1WA 4U02A 2J41A 4DSUA 4EJSB 4TLDA 1E98A 2QRNA 2NQ2C 4PO8A 1N6RA 1VIYA 4EUNA 1XMIA 2AD1A 4M22A 2JLYA 1ZD1A 2GA8A 4KCGA 4IEIA 3ZGXA 4DIEA 1ZIOA 2W6IA 1OF1A 1GG2A 3DMDA 2Q21A 2HXYA 5GJCA 2VF7A 3CF6R 1OH6A 3DMNA 2Q9CA 2F3TA 1XCMA 4G5SA 3EA0A 3MMPA 4DLTA 1VKJA 2AFIE 3BXZA 3BB1A 5FI0B 2AN9A 3DO6A 1HE8B 4WZAE 3BWDD 2I4IA 3TBKA 3FKQA 1JJ7A 2ATXA 3SC3A 3WRXC 4BQSA 2J87A 3GFOA 2B6HA 4QM6A 1EWRA 4TT3A 1XF9A 2FA9A 1L4UA 1JR3E 3IO5A 1ZD8A 3OEED 1D2MA 2QPOA 3HYTA 3VX3A 3ZIAD 4LHWA 2Q0HA 4EQ6B 3ZH9B 4JVNA 2CL6X 4XJXA 4CT4B 4MYCA 1XPRA 5IK2D 2IHBA 3AF4A 4ZIRB 4R7ZA 1W2GA 2ZRDA 4H1UA 2OCBA 3B82A 4B6EA 2ZAOA 5IF9A 2PEZA 4X8LA 1G20E 1U98A 2J5XA 2JDID 4B76A 2QU8A 4LJ4A 2IF0A 1GKYA 5LD2B 3AGQA 4Q4LA 1LF5A 4BFWA 1A82A 1XWIA 2Q6TA 5JSZB 1KO4A 2PLFA 4QFMA 3THXA 3BAFA 3EAQA 4PXAA 4F7WA 2BEJA 5IT5A 3EWSA 3K0FB 3TR5A 1NBMA 3VX4A 2WMNB 3BFXA 4BFYA 2C04A 1KI6B 3VMFA 3GPLA 1G7RA 3GLHA 2VA8A 4B3GA 2IL1A 3MWJA 1RE0A 2X1VA 1FX0A 1SKQA 2IT1A 3QG5A 4Q00A 4HZIA 3W6OA 4RFSB 1NN0A 3LX8A 4QGFA 3H86A 4TMWA 5EUQB 3LQRA 3FMIA 2VO1A 3K9LA 1A2KC 2ZS8A 3TMKA 3WYFA 2Q3FA 4F91B 5GADl 3LLMA 3U7GA 1RJ9A 3TSWA 3EPKA 2GCPA 1FMJA 4C7OA 3PIRA 5BXQC 1DAKA 1W47A 3KDSE 2ZS7A 5JJLA 1NNEA 1IAQA 1ZBDA 3TGPA 3BC1A 1E0SA 4N0EA 1XPOA 4RD0A 1W7AA 2OT3B 1T0JB 1XDBA 4Q03A 4DBLC 1CEEA 1QHIA 1UM8A 3PUZA 1G291 2D4HA 5L8VA 2ZI3A 4MH0R 1H8HA 2FFQA 3DZDA 1WE2A 1S4QA 4OHZA 2ZRBA 1XZPA 4KV9A 1U94A 1G9XA 2RB4A 1E0JA 3PQCA 1TU3A 2VLIA 1J8MF 3FPAA 1XU4A 2A3RA 2OUKA 3H0KA 5FPKA 1H8ED 3PFIA 2CL0X 2ZANA 2IC5A 3EPHA 4P3YA 5JRJA 5DHAA 4UXJA 3GFTA 1DAMA 1E2JA 1P4SA 1FUKA 2CHQA 1IXZA 1CR2A 4OI2A 4UJ3A 1S2MA 2GESA 3CR8A 3GFPA 2YHSA 4RY2A 2EFDB 4W5JA 1E2FA 2R44A 3HP1A 4OBEA 3MD0A 4DHEA 5TB5A 3U2QA 1AZSC 1HT2E 3NHAA 3CNLA 3HDTA 5FOUA 5K8IA 1FOEB 2BJWA 4X8HA 1QHYA 3WYGA 4CEHB 1KI7A 1SXJE 4B3CA 4ZKDA 3D8BA 4URVR 4Q7JB 4F4IA 2AD5A 1ZP6A 2PT7A 2KB0A 1S96A 1DAHA 4Z51A 4AKHA 1CR0A 5C4MA 3TW8B 4Q9LA 2G1JA 1XJCA 4OQNA 1VCOA 1MKYA 2BBWA 1F48A 1IBRA 4HYYA 1AGRA 1AZTA 4Z8XA 3AF1A 3B1YA 4LUCA 3ICEA 1F2TB 1Z2CA 2XTNA 3QF4B 4M1WA 1JALA 2G88A 4C0AC 3KX2A 4V0NA 3EZFA 3IQWA 4XSHA 1RRFA 4LOAA 3THOA 2OFWA 2JA1A 5FPYA 2PZGA 2VEDA 4NDZA 2XZOA 4LCBA 2YNMA 2C9OA 1DAIA 1TQDA 1T3LA 5DE3A 1WCV1 3MAAC 1Q20A 2GEVA 4DLUA 1V43A 4LJYA 2XB4A 4Q19A 3T1VA 3CX8A 1YZTA 1XEWY 4JL6A 3N2IA 4Z1MD 2G1KA 4KSCA 2IS2A 2HYDA 2D62A 1BMFD 3AQ4A 4KODA 1XRJA 4M8NE 1XTQA 1XPUA 3TLXA 4TL9A 4LJ7A 4EJSA 1N25A 4URWR 4MKIA 1KO7A 4WXPA 2YYZA 4X8MA 3KKQA 4ASUD 4F93B 3SYLA 4GDFA 1YRAA 3E1SA 4C9BA 5KDDA 4OL0A 1S1MA 4EPRA 4JYCA 2ZJOA 4XWKA 1LNZA 3AVOA 3U4QB 1EXMA 4YMSA 4LBWA 3KKMA 1MH1A 4D4LA 3O8BA 4PC3A 1CJVC 4QM7A 2GF9A 3IBYA 4O25A 5L3VA 3U6BA 1UEJA 5TARA 4EJSC 3GLGB 2ZETA 1GNPA 1ZM7A 2IW3A 2P6UA 3ZD7A 3GQBA 4TMXA 1XTRA 2AWNA 3KQKA 3L0PA 3FFAA 2WWXA 3RS2A 4BEBA 1G18A 4DJTA 4GT1A 1ETUA 2VSFA 2WJGA 3CRQA 4Y0VA 4YXWD 3C4JA 2GJ8A 1GSIA 3AUXA 3TUZC 1E79A 3V4RA 2NZ8A 2CBZA 2ZVQX 3U60B 1EX7A 3K9GA 3OESA 4PQRA 1DAFA 3QPWA 2REOA 1ZM3A 2PJZA 4PANA 1FP6A 4NYIR 4MDEA 2BM0A 1G8YA 5JCZA 3JVVA 1XTJA 1IOZA 3OE7D 3P27A 4ZIRA 4MDFA 1OFUX 5CDFA 3W9YA 4A6XA 1ZC4A 3IUYA 2DFTA 4Q7KA 1UKEA 5KNBA 3KQUA 2QMUA 1DVRA 2O8FB 4GMDA 4YMUA 1MT0A 1ZCAA 5BWMA 1OH7A 4HDOB 1KMHB 1D2NA 2GZAA 4QGGA 4A92A 2J0QA 3OFND 4NKRA 2J45A 2A5DA 4KHZA 5JSZA 4URZR 2IWRA 1EFRD 2WICA 3TH5A 4TMTA 3CPHA 3GLFB 3K0FA 2MSDB 4G5RA 3TIFA 2YWGA 1CULC 2VP0A 5LB2A 2BIFA 1KI6A 2GEDA 1G5RA 1KTVA 2QENA 4Z8YA 2DFKB 3W3AA 4Q21A 4M4SA 4RFSA 3K0CA 2FGJA 2HLDD 2XZPA 4LZZA 2SHKA 3AKDA 5LD2C 2W2TA 1IJFA 1P75A 1E9BA 1G1MA 5FL7A 3EIHA 1VG8A 1MABB 1ZNWA 4DCUA 1ZNYA 2J0SA 3ZVLA 1Z83A 4IRUB 1KIMA 3P4XA 2HYIC 3SHFA 1OJLA 4B43A 4NTZA 2QAGB 2CDNA 3IO3A 5DN6D 2O8CB 2J1LA 2C9YA 2RCNA 3X1YA 3A58B 2G77B 2OCYC 2PX0A 3K0CC 2IYUA 2A5FA 4MRVA 5FTNA 3LW7A 4MGKR 5EP1A 2DFLA 2QGNA 5BQ5A 5E95A 1HT1E 3TW4A 2GWHA 1XMVA 1OFIA 2BKEA 1SQ5A 3MSXA 3A36A 2JATA 2PZEA 3AVYA 1X8JA 3LD9A 4CRWB 2WIBA 3GJXC 3AEZA 5TDHA 1F5NA 4C0HA 4OQXA 4UXIA 2JJ1A 4W5WA 3TNFA 1R5OA 1K5GA 3IQXA 4MGYR 5HCIA 1US8B 4I81A 4CW7A 4RKFA 1HQCA 2WSSA 4LHZA 2ZU0C 2HT6A 3IEVA 4DSNA 1QHNA 5HR5A 3EA5A 4H1VA 3X1ZA 3I8XA 1DARA 5IDVA 1VG0B 3I5XA 4PZYA 2I1VB 2GF0A 2WPDD 4MA4A 4CEJB 1VCMA 1KI3A 2ANBA 4UNPA 4CEHA 4QJ4A 1U90A 4XD7A 1DAEA 4Q4JB 3A1VA 4JSTA 3SFVA 1N6IA 5C1BA 1G8PA 2OM2A 1KAGA 1G3MA 4FMDF 2QNRA 3H2YA 3R8FA 4BWYA 4ZI3A 3FDIA 4D0LB 1AS3A 4UNRA 4EPWA 3LVQE 4NP6A 1T8TA 4NHOA 2GXSA 2J7PD 1F2TA 3QF4A 1KO8A 1QHSA 3SHWA 1UPTA 2W83A 4HLQB 4P33A 2ZYVX 3R9XA 1OB5A 1EG7A 2PZFA 4M1YA 1G16A 1Z6AA 5EQTA 2XNDD 2WWHA 2HJGA 1K5DA 2OBNA 1ZYUA 4URUR 5DI9A 5FTMA 4IOLA 3TKLA 2VQSA 4DLVA 3AGPA 1XP8A 2B8WA 4NE2A 5CM8B 3A4MA 4BEJA 3AUYA 4MRSA 3OIYA 1M74A 2QG6A 5P21A 3HU3A 4GPTA 3CX6A 1NG1A 3UWKA 3SQXA 4JLJA 3BK7A 2RGEA 4LV6A 4QHYA 3O8DA 2BC9A 3I73A 3T15A 1J70A 2CL7X 4QJ3A 3BRWD 1MV5A 2N46A 1KOFA 3VU9B 3TK1A 2NOAA 3U4QA 1W48A 5KSOA 2VP5A 5GJBA 3TAHA 3CM0A 1ZNXA 1Z0JA 3QVVA 1ZD9A 1R4AA 5TXGA 3LH5A 3ECCA 2V3CC 2QE7A 1BIFA 2GZHA 4RD6A 3SFZA 1W0KD 1PUJA 3OIUA 3GLGA 2KI5A 1ELOA 1G3QA 2BHRA 1KKMA 2W6JA 5DYIA 4EPTA 5HTKA 4ZV4A 4M2LA 4TLCA 3QSYA 1GRQA 4AKGA 2ODNA 1OYYA 1G64A 4AKEA 4I1OA 2BMDA 1KAOA 3BORA 3Q5DA 4HAVA 2H16A 3KFXA 3FYHA 1QBKC 1WQ1R 3Q85A 4D80A 4GOXA 2YWEA 1NMXA 5AJYA 4BFXA 5DNYB 4PQFA 1RVDA 1XJ0A 2XSZD 4MGIR 1YHNA 2W0MA 4DCTA 5CDFE 2WWFA 1W5SA 2C77A 4JS0A 3REFA 2BOVA 3D31A 4JBWA 3PXGA 2BDTA 4WZ6A 4ZDWA 1JPNA 4XVUA 4F4CA 2EYUA 2JCSA 4NCJA 4QHTA 3RC3A 2HJVA 3NBXX 2ZM5A 3ZQJA 1R0XA 1ZUIA 2IYYA 4FIDA 1NJFA 1YZNA 2ZUBA 2LKCA 2VRWA 4P4UA 4HUTA 4OI0A 1XFAA 4BRUA 4DSOA 2BMFA 2FFHA 5JMTA 2VL7A 3FWYA 2UZ3A 4QNRA 1IN4A 1SVMA 3GLFA 3BB4A 4B3XA 5AWFC 2VP4A 5LPNA 1PLJA 2ZJBA 2FGKA 1FW6A 2G6BA 2FG5A 2ERYA 4EPVA 2FH5B 3QXHA 2OV2A 3B13B 2XEXA 4TL8A 1T5LA 1LFDB 1SHKA 4NPHA 2XOKD 2BCGY 2GRJA 2D7DA 2F1JA 3QVUA 2JLQA 1JR3A 2XTZA 1MABA 4R2IA 3U3KA 3PR1A 2IK8A 1FTNA 3HU1A 1GVNB 4JSYA 3L82B 1VG1A 1VHTA 4C0JA 3PITA 2WMOB 2QAGA 2PEYA 2O8CA 1E2HA 3I92A 4E03A 4V0MA 4QJ5A 4IDHA 2C96A 2ECKA 5JWHA 1COWA 5KO2A 3BH7A 2V54A 2XJ9A 2C78A 4N1AA 4M9ZA 4M1MA 4JL5A 3I61A 4CT5A 3K70D 4NCKA 4CZ2A 1JAHA 2IXFA 1N6LA 2YVUA 4TSFA 3Q8XB 1MO4A 2QSYA 3NC1C 2ZRJA 1MR3F 1T3HA 2GK6A 1R0WA 4XVRA 3W5IA 2DFNA 5LDDC 3KXKA 3PUVA 3CRRA 1JNYA 1XEXB 2QAGC 3CNNA 3NTUA 5FH9A 2QA5A 1M34E 3CONA 2G0NA 5J40A 2GILA 1P73A 4RD4A 1US8A 3TJZA 3FOZA 3GD7A 1OXXK 4MQBA 2QZ4A 1NP6A 2OFXA 2QRZA 3HPRA 3PUXA 4U00A 3T1TA 3I62A 3T1OA 3RABA 1YR6A 4US2R 3D6TB 4FXPA 4PC7A 4E07A 1E32A 4H9GA 4M0LA 3RS0A 2C8VA 3SDZA 1E96A 2CMKA 2QM8A 3N70A 4QBGB 2JLVA 1JBKA 4CEJA 4A0FA 3QPVA 5DO9A 521PA 4IVRA 1RRCA 4LBZA 4JLVA 1AS2A 2WOOA 3CH4B 3VR2A 4Q4JA 4BLOA 1EGAA 1HA3A 1YZKA 3L0OA 3B2EA 4J0QA 3UG6A 1QDEA 2NO0A 3EPJA 1OKKD 1TX4B 2ZJ8A 4IFEA 3I32A 3ASZA 2REXB 1BH2A 3LDAA 1L8QA 1G7CA 1Z0AA 2ZSAA 2QT0A 5EXSA 4O2RA 2D3WA 4B73A 3FHTA 1U0LA 1NLYA 4M9QA 3RVBA 4W9MC 1GZSA 5CJPA 2O8DB 2CE2X 2ERXA 4ZI2A 4PPNA 4XWOA 1WA5A 4TTRA 4FWIB 1IY2A 4EAQA 1NKTA 3ADDA 3VKGA 4DUGD 2JJ2D 4UJ5A 2HV8A 2PL3A 1ODFA 4M1TA 1J99A 3CNOA 4U7DA 1OIXA 2CJWB 1UBEA 2ZU6A 4GL2A 1JQJC 3OEHD 2XB2A 3K8YA 2GCOB 4IDNA 4HI0E 5FOVA 4QKQA 1GWNA 4NYIQ 3WNBA 1ZU4A 2QI9C 4BLTA 4POAA 1T5IA 4PQYA 4ZCLA 2JLUA 3FHCB 1VCIA 1C1YA 1IY0A 3AF2A 1NN3A 2P6NA 4RFVA 5IK2A 2OBLA 3A1WA 3SJCA 2H92A 3VU9A 5KNDA 2IHYA 2DCUA 3RRZA 1IQPA 2C95A 2EWWA 1DG1G 2F43A 1ZAKA 4KVGA 3GLGE 3G0HA 2JDIA 4D25A 1Z6TA 1Z0IA 1E9RA 4KO8A 5JEDA 1TADA 5KDLA 3BJIC 1CTQA 1R2QA 1J90A 3I4LA 3K09A 5EJEA 1W2HA 3R9IA 1PJRA 3RWMB 1G3IA 2WJHA 1AA9A 2GJ9A 3KJIA 5JWOA 4AURA 1FNMA 3DVLA 4HB0A 4Q5IA 5FUYA 1Z63A 2D7CA 2DY1A 1AS0A 3R20A 3IEUA 4PC6A 5C2JB 3S1AB 2OHFA 2ZXUA 1W46A 2CCKA 4QL3A 2OBMA 4TMKA 3C16C 3I8SA 2DWOA 4QGHA 4HAYA 4IOJA 1U8AA 4MRPA 1RW4A 1RRGA 2DWPA 3K09C 3ZJYA 2IS6A 2OO7A 2V6JA 2EFHB 3RNLA 1NY5A 1OYWA 4ZDKA 1NL3A 1YZUA 3G82C 1HQYE 1IN8A 1XTIA 3GLFE 2HCJB 2ZVPX 4FCVA 3RS4A 3HYRA 1KDRA 4B2PA 4LBYA 4AD8A 2Z4SA 4B3DA 4Q4HA 4TLEA 5FTKA 5EXXA 3U3RA 1G4AE 3SN6A 5CYOA 1OXTA 2IEZA 1I2DA 5BN4A 2ZRCA 1E4VA 2XITA 3AF0A 1G3RA 2H1LA 5KYKA 1H8EA 1EFCA 3J81k 1U8ZA 1GRRA 1M6NA 2F7SA 4DDVA 3OAAA 4JT4A 4K81B 1N3BA 1KY2A 3GJ0A 4PZZA 4TYPA 3VKHA 4BFVA 2H5EA 4DCSA 2WV9A 1NVUQ 4V0ME 1XD8A 4B2LA 5L3RA 2CLDX 4TQAA 4NH0A 5AJVB 4JLDA 1KHTA 1EK0A 4FD2A 2PMKA 4RKEA 3W8NA 3JZMA 4KXFB 3BB3A 3D3QA 1P2SA 1P3JA 3LY5A 4B34A 2AXNA 4QG7A 3K0EA 4LYFA 5CK5A 4D81A 2FOLA 1GILA 4WZBE 5CIQA 5KTYA 5SZJA 4OHXA 2O52A 1UBGA 5HE9A 2REBA 2WJVA 4DLXA 2L0XA 4BZXA 3L0IB 2VIIA 4IDOA 2VP6A 4Q02A 2IX3A 1IONA 1E2QA 5E7IA 2JJ8A 1XEXA 2ZE8A 2XAUA 5DISB 4Q18A 3SBEA 3TVDA 3HPQA 4GOJA 3JZAA 5FPHA 2HF9A 2ZJAA 3FMPB 1Z0FA 3O47A 5HE8A 3AVXA 1GL7A 5DIFA 4RZ3A 4YDSA 4E5UA 4ON9A 1QZXA 5HKKD 4RZ2A 1PLLA 2Y8EA 2GVZC 1AM4D 2P2LA 5EP3A 3CRVA 3P32A 4JLAA 1XEFA 2XXAB 3Q72A 1X1RA 1X86B 3ZQ6A 3KUDA 1C4OA 3UG7A 1BMFA 3FKSD 4IKEA 3HWSA 3WRYC 2QPTA 3Q7QA 1KI4A 2CXXA 2V9PA 3LXXA 3T12A 2NO1A 4ASUA 3P1JA 5J4VA 5JCPA 2YINC 3A37A 3RLFA 3RRMA 3U3OA 3R7WB 1QF9A 4BUJA 1S8FA 2E9SA 3U7FB 3QG1A 4PFSA 4TMZA 1AGPA 5H1YA 1A2BA 1KI8A 3PCRB 2ZUDA 2O5VA 4OJKA 1YKSA 2NO7A 4JVSB 4NCHA 2AK2A 1AKEA 4Q9KA 4C0QC 2O8DA 3KJHA 5G40A 5DLQC 2QMOA 1Z2AA 1RYHA 1UBFA 3ETLA 5CLLA 2QN6A 4A2QA 4TT3D 2ONJA 5F98A 3PEVA 1HE1C 1TL7C 3GJ4A 3SEAA 3CUEF 1N5IA 1XEWX 4N3NA 2CJWA 3PEWA 4IEEA 1OIWA 2BMJA 3W90A 4YXWA 3EZ9A 3ZS8A 1W36D 1I2MA 2GCOA 2WHXA 1NY6A 1G5TA 1G8FA 2ZRHA 3EIEA 3LBNA 3LVRE 3TUIC 3VQTA 3FGNA 2X8AA 4DC9A 1YU9A 1Q12A 4FN5A 2KE5A 4V03A 3ZD6A 3LBIA 1AIPA 4DLYA 2KWIA 4DLZA 4LX0A 1EESA 1ZW6A 5K8UA 3OE7A 2ZR7A 3ONWA 4RD1A 4LYAA 3SZRA 2I3BA 3H84A 1W0JD 2ZTSA 4NYJR 4M1KA 5AJXA 3T06B 2QP9X 3A6PC 3OFNA 1G7SA 3VR5A 4CYMA 4ARZB 2FPLA 3TR0A 4EIWA 1EFRA 2EVWX 2Z83A 4LDJA 2X2FA 2FNAA 2R62A 2KJQA 5B2ZA 4S35A 4A0RA 1ESMA 1FTSA 1IN7A 2A9KA 2ZJZA 4WIAA 2WAXA 1E69A 1OH8A 1GIAA 4WA7A 3N5CA 5SZKB 4AI6A 3VKWA 1LS1A 5GVRA 2AXPA 4HDCA 3PJRA 4BFTA 1KK1A 1GNRA 2HLDA 4M1OA 4LSGA 3MJHA 1DS6A 4BZQA 1KZGB 2PLRA 4PR0A 4FMCB 2YOFA 2WBLC 1E1QD 1Z6XA 3UXMA 1TF2A 4OJQA 2IS4A 4KI0A 1IN6A 3LO5A 4TLBA 3WYAA 2VTKA 5D3QA 1H8HD 4DXAA 5FBQB 3NWJA 5KPJA 3TSZA 4B3FX 4MKHA 3MCAA 3NEJA 5G3ZA 4PSAA 1TQ2A 5F9FA 1R8QA 2ORVA 4US1R 1G8GA 5FOXA 3WMEA 2B92A 3E2IA 4KAXA 1E2DA 3K70B 4RZXA 3WNDA 1Q1ZA 4LPKA 1CR4A 1R5BA 3Q7PA 1Z0DA 5C18A 2MSCB 3NDPA 2Z4RA 4RCZA 1E1RD 4JVMA 4DDTA 3QBVA 4DDWA 3KQNA 1LY1A 3LQQA 2BCJQ 2JLZA 3GMTA 4EQ6A 3OF5A 2FSGA 1DO2A 2LKDA 1P9NA 3NXSA 3CBQA 2QBYB 2WJJA 3GEHA 2NMVA 5JZVA 2DB3A 4KYIB 3KXIA 5JHHB 2FFBA 5HZKA 1UEIA 3GLIE 1M7HA 5JJKA 5EE1A 2BMEA 2G0TA 2JLWA 4KSBA 2WPDA 1C9KA 1KMQA 2ZPTX 1CRQA 1VECA 4B2IA 2D06A 3C5CA 3K0SA 2QP4A 1WMSA 2GXQA 4WAUA 3W5JA 2KBFA 1X3SA 4ZCIA 1MRNA 2P5TB 5FUWA 1QVRA 1GTVA 1AN0A 1Z8FA 5L3QB 1R10A 3LWNA 2BBTA 1U8YA 3MGCA 4MGZR 5KSPA 3I5YA 2RAPA 4GRAA 1YR9A 2QT1A 1FZQA 2RGAA 1PZNA 2BBOA 2J7PA 4GOKA 4IOKA 4GZMA 1T9HA 1S0UA 1GM5A 2ZITA 2CVHA 5FUVA 2ZQ5A 4L9SA 4YMTA 2HF8A 4M21A 3GEIA 3WBKA 2AHOA 2XNDA 3QKSB 1EFHA 421PA 4AY2A 2ZR0A 1Q44A 4D4MA 3UK6A 3EASA
chains in the Genus database with same CATH superfamily
1T13A 4OF4A 4WACA 4WFIA 4CETA 4R1NA 1EP1B 3FWNA 1PR0A 2C57A 2ID8A 3K16A 2JGAA 3C8DA 1U9IA 5CG1A 8ABPA 3W5CA 3VNUA 1SB8A 1A77A 2XECA 4HZUB 3FLAA 5ERXA 2M6LA 2ODPA 4PW0A 1LLQA 4ALKA 3GJ8A 4LOLA 2W93A 2ZJ7A 5IWCA 4ZYXA 3FHOA 4QYWA 3UQYS 2O7QA 3T38A 1JE0A 1Z3IX 2H17A 1IG0A 1OHHD 1HTWA 1SBYA 2A9RA 4F0JA 5EZQA 4ZMSA 4KXQA 3L5KA 1QKJA 2NYVA 4RM3A 5EXEA 5MN4A 3Q10A 3ANTA 1HNWB 4FBMA 1PGJA 1RAFA 1E61A 2FFAA 1TYZA 2HRZA 4H35A 4W7HA 4R2JA 5FQNA 4Y2QA 1M34A 2JEOA 1P62B 2ORYA 5T4HA 4JKOA 1ESNA 2X9VA 2JIPA 2NU7A 4Q48A 3UMMA 2FJPA 3U1TA 3VPFA 2I6SA 2HQ1A 3IVXA 4B47A 5LWQA 3FBTA 3HWX1 4BVKA 1F2DA 2Z9BA 4MEAA 1J2JA 1YRWA 3V34A 4JLWA 4KNYA 1ZK0A 3RHTA 4G0QA 2NV2B 4BCDA 2OHJA 1WUIS 4KDEA 2B5OA 1P6XA 1K8ZB 1SBNE 2COUA 2IEDA 3TW8A 4RLSA 2O8EB 4M38A 5JD5A 2OQ2A 3C6BA 1QE3A 4C0BA 4CLRA 1L4MA 3C4VA 2VATA 3NBFA 1YJCA 4ZODA 4BXOA 3NGMA 3ZGVA 1XYVA 2QN1A 5KBYA 1ABEA 5CH8A 3DDOA 3Q8LA 1L4HA 4M89A 1P4AA 4HVAA 4ZTUB 3BH6A 3GNLA 3PC6A 5AJWA 2FPIB 2CHVA 4NENB 2XXBA 3PC8C 2WVJA 5TX7A 3FDFA 4IIBA 3MRSA 3GGJA 1V8FA 3OBBA 3LZDA 2CB9A 1Q84A 3IHWA 4KPUA 4WRRA 1MOZA 1Z0SA 3CO5A 3H1FA 4HQNA 1CJKC 4YGYA 5E1MA 5DZSA 3R5TA 5HIMA 1NFRA 2I2FA 3LRXA 4NZYA 5DKFA 3VDXA 2CLLB 1R5JA 1E9AA 1T0UA 3O4RA 4JQSA 3SR3A 2ZRGA 3I1YA 5L95A 1KZYC 4DV6B 3MWDA 4F1JA 4RY0A 1CHNA 3DR5A 3QNUA 2B7BA 5KC9A 4IP0A 1U7XA 5C7OO 4RTQA 1DB3A 1XQ9A 1G6Q1 1KJJA 3HGTA 3SHOA 1O87A 1Z2PX 1PJTA 2OO5C 4BUZA 2OAP1 1ST3A 1CLEA 3KJFA 2WZDA 3O94A 3EB9A 3OZGA 3TDMA 4ZJPA 3E22B 3ND6A 3V2IA 3W2TA 2ZDGA 4CMIB 2JA2A 2EYQA 2HFKA 3UMFA 4L8FA 4P2GA 5FPSA 1H93A 3T9EA 4BX3A 1MP0A 1PGPA 1L8AA 3GLQA 1PU2A 4R83A 4U6QA 1S2DA 1C4XA 5KNCA 3DNPA 1MN6A 4YJGB 1XRMA 3I1FA 2PMCA 3LCUA 3OIFA 1ACMA 4BWVA 3HCFA 1ZUHA 3I6IA 3VO9A 2ZS9A 1CQJB 3A25A 3ZLBA 1XMSA 2QMHA 2IYZA 4NJEB 5I7VA 4AJ2A 3LCMA 3OH8A 2QQ5A 4MP8A 4WI1A 1Z5OA 4YGXB 5EWJB 2E5LB 4OMDA 4DEXA 2PO7A 1WCXA 5BVHA 1CZKA 4FOLA 4OAQA 1ZGAA 4Y1RA 1ISPA 2C0PA 5FOWA 3CT4A 3MGKA 2NZJA 4MW6A 1PO7A 3HDJA 3DE4X 4P92A 1GOTA 2X7HA 3C4QA 3VKVA 4EW6A 3HQ4O 1MQ9A 3FUWA 5DOVA 5TQ2A 4B6PA 4E1BA 4YPVA 4B85A 1C8KA 1FQWA 2G9NA 5JNUA 3GG9A 3M6IA 3GRYA 4L1KA 1H2BA 3CEHA 1R5NA 3OZFA 4LYDA 3URMA 3WVNA 1E3WB 1M75A 2JBWA 3CZPA 1VI2A 4Q9IA 4K2HA 2QBYA 1A88A 1H4SA 4AIIA 5FYDA 1GPNA 1RFLA 1WW3A 2ETVA 3NV7A 3LAWA 2OFOA 3LX6A 4LXHA 4IQGA 2W37A 1KMHA 2OG2A 4POOA 3F6BX 5AHXA 5A1JA 4F92B 1O57A 2R85A 3LPDA 3A1SA 1PI3A 4G5QA 3QOXA 1WXHA 3AR3A 4LG1A 1EZ4A 1HH4A 1L5NA 4Y2PA 2C2YA 4PRYA 4WBSA 5CM9C 3UV7A 1GY8A 5CGZA 4J0GA 1LI4A 4F5DA 5HKBA 3CF2A 1NSTA 1ZVQA 1IHUA 4HPXB 5DJ5A 3UPUA 2IUTA 4KLZA 3K5WA 4EHHA 5TJ9A 1UBUS 3QEOA 3JQDA 3BA6A 1KEVA 1MRZA 1RWWA 4QDZA 4D9GA 5CB4F 2NU6A 4X24A 2OLEA 3U80A 1YCFA 4QQNA 1IXRC 1L1EA 4R1OA 4BBJA 1SCUA 4ZAXA 2HMTA 3B36A 3GP8A 1KP3A 1NBIA 4RL4A 2B3TA 2DCMA 3LT0A 4H7IA 4G1VA 3QBTA 4KWEA 5CEFA 4I4TB 3NHFA 1SBHA 3LYAA 3UMRA 4B3BA 2O8BB 3JVUA 4JGGA 1VYTA 4F56A 1QUFA 4DUGA 4IR7A 3PHGA 1XCPA 2HIMA 4OHKA 1OFGA 4GUAA 4O29A 3RYFA 3IOYA 3WGLA 6LDHA 1R6BX 4KN5A 5FBZA 3A2KA 4BLRA 5JI3E 1PWEA 4MVJD 4DLLA 1PFGA 1KJ8A 2JJYA 3WV4A 3TECE 5F3WB 3Q0TA 4D6PA 2QW0X 1FIUA 4ZU1X 1IHPA 2LCIA 2YIJA 1E0KA 1YT5A 4JDUA 1LGYA 3FNBA 3ZNNA 8LDHA 4IFIA 1XFDA 3HXKA 2XVZA 4QSHA 4X8OA 4BBPA 1USVA 1FXWA 3H2GA 1JSZA 3HL0A 3GHHA 4MHOA 3JATB 3M1IA 4QASA 4E33A 3ANNA 4WZBA 3QY0A 5KVQA 3UJBA 3E4DA 2D5BA 5IMBA 3PV0A 5KOHB 4BZWA 2B25A 1U8EA 1VPLA 1Z0KA 2X4GA 1RBMA 1YQTA 3H4TA 4GXRA 2A86A 3NT5A 1JHRA 1KETA 1MNAA 4CJXA 3MCTA 4I8DA 4X1KB 5REQA 3B6ZA 1J9GA 3L8CA 1SCNE 1FEZA 2OE2A 2NGRA 2Z1DA 3GZ4A 3B6MA 2PCJA 5CXQA 2QS9A 3H75A 3J7TA 3PLNA 4TM7A 1GARA 4C4SA 3OKFA 3UMJA 4K0RA 3KXDA 3H4MA 1QZUA 5KJ1A 1KERA 1E1CB 2ZREA 3NRCA 2VYNA 2CEAA 1XA4A 2H2GA 3BD7A 4JI8B 4TLMB 4KQJA 3DVAA 3SI7A 2J09A 1JNXX 4GZ3A 1V5WA 3VJRA 2GFHA 1Z08A 4Q3NA 1N32B 1ZIPA 2CHGA 5IS2A 5IH7A 4FDLA 2QG4A 2IYWA 1YB7A 1GSAA 2P65A 2A7QA 2QDKA 3ZU2A 1TGVA 3EOAI 1G4UR 4AN1A 2WHPB 2FWRA 2ODWA 4O4HA 2ZATA 4DZZA 2R6HA 3CRMA 4JB3A 4EHNA 2DGDA 2ZRFA 2NIPA 4NU8X 4HUQB 2GAJA 4L95C 3ONDA 4DZRA 5JXWA 3TX6A 4JUAA 5FTJA 3LBFA 3ZI4A 4MWTA 4RMHA 1IY8A 2TMDA 4WA8A 3A1CA 4UHDA 4RVHA 5E9JA 3ICQB 1SUSA 2AE2A 1KZ9A 4LQ4A 3U3ZA 3NM6B 5AKJA 1M10A 3KXLA 1BYIA 3G1TA 4I1PA 2YIVX 4RVFA 4US0R 5DDIP 2GK7A 4MUBA 1WMBA 1FP1D 3QF7A 4RHUA 2RCYA 2NSLA 3PRHA 3A9VA 4MRMB 1PD0A 1XB2A 2XWBF 2FF5A 3LECA 4MV3A 4TKVA 3OCJA 3A3NA 1Q1EA 1V5EA 4YPOA 1X1AA 3P20A 4TZKA 4RQAA 1T6YA 9ATCA 1RJFA 2TMYA 2EJTA 1QNFA 2Z5VA 3ZIAA 4YT4A 3B6IA 4KR7A 1GFWA 2W2XA 3DAHA 1ORHA 2AN1A 3U3JA 1LC3A 4B48A 4FCTA 5EJMA 5IN5A 3WISA 2RGNA 1DGQA 4D4GA 4IAOA 4EG1A 4BLPA 1K6XA 4ZK6A 4TVBA 4C01A 2V3WA 1HE3A 1QANA 2XOXA 3R7NA 1RJEA 4YB8A 4YASA 3WADA 3ZW8A 1JDNA 4C0WA 1WRBA 2GAFA 1I6WA 2P3SA 3E70C 2C7RA 5E9AA 1LPNA 3L7YA 2ZQYA 3LXUX 4OBBA 3G7NA 1NBWB 2CMGA 1NQOA 2ZCVA 4G5GA 2W0SA 4L16A 3RANA 1C1HA 3E9CA 4UHHA 2AG5A 2WMDA 3NATA 3WLLA 5I9BA 4EZIA 3IPYA 5AUPB 4BMOB 4YY3B 1O03A 5LCXA 2ZE5A 3FRJA 3BD8A 4TXJA 1EAMA 1W581 1YUMA 3EHDA 3EZGA 1I5OA 2FW6A 4WE3A 1KDTA 5JD4A 1IC6A 3ZEAA 5B6PA 3B1VA 2IP2A 1Y0BA 3CUUA 4Q7MB 3WQRA 2OKGA 4IHQA 1FYXA 3KT8A 1IFXA 1WB5A 1IG3A 2ZIFA 2WDPA 1DIAA 1QHHB 3IVAA 4RGBA 1I51A 4KR0A 4Q3AA 1TAGA 5C31A 4LQLA 3W77A 4Z3OA 2B61A 1L5RA 4KFCA 1Z33A 4LJSA 4P0QB 1RZRD 3FFTA 4JBLA 4MI3A 4YAIA 3BAZA 1YUNA 2KSQA 3DBLB 3LY8A 4MJLA 1KJZA 4MPTA 4UATA 2OA0A 1G8HA 2BHLA 3KS9A 1ZK1A 1AV6A 1U8XX 4JROA 2Q3MA 4LCJA 1CBUA 1K63A 3ILSA 2IPAB 2RG7A 1OA0A 2ZUWA 3OTIA 3DTVB 3ETGA 1ZPDA 1ISJA 1PT8A 4KSYA 3QA9A 4AYWA 1QG0A 2HEIA 4NLLA 1DEAA 1NF9A 4F60A 2Q2VA 1Y6GA 4ZEMA 1G21A 2W8BB 4HAWA 3X2SA 4NPCA 5FUXA 4CG2A 2FCRA 2QX6A 3IB3A 3AVQA 4B4OA 4C22A 4D82A 4ALLA 5LQKA 1NOIA 2AOTB 2VDVE 3EZYA 1DIHA 4Z4GA 4K46A 1L3BA 3B1WA 4NBLA 1EAYA 1AMUA 3ROXA 3M0EA 2VYFA 1E2KA 3FKSA 2YXLA 3A6KA 3LC1O 3NRJA 4PNHA 4DREA 3D4OA 3MUEA 5IHPA 1TUBB 4QLAA 1XCGB 5J58A 3PX7A 1J2EA 4LC0A 3W8RA 4NE9A 3SMQA 4HUJA 4NRDA 4ZTZB 4JITA 4CLEA 3HCOA 1EWKA 3DDCA 2EXXA 3LBAA 3V1YA 3SS8A 1AKNA 3A2MA 4AG5A 3ZG6A 4LOHA 1QGAA 3H0CA 4QX6A 1IM8A 4PGHA 5E6UA 3BQ9A 4X92A 3Q9UA 3GC6A 2P9ZA 1TEVA 2VSXA 3U40A 4EY4A 1H4QA 1Z22A 3VHQA 4DEVA 2DUMA 1NLMA 1XMQB 4Y7DA 3IKMB 1B74A 4PYMA 3I83A 3TE7A 4HG2A 5A02A 1IE3A 3E8XA 1CU1A 5LKAA 1VL0A 4C30A 3KKEA 3DOJA 4UVGA 5EKSA 2NU8A 3LLVA 5GINE 5ES4B 4R1SA 1SXJD 2RKOA 1E9SA 1D1SA 1Q0UA 2NAFA 4QUEA 3OETA 1QLWA 4EJFA 3EC7A 3ICPA 2IZ5A 4ND1A 1D09A 2HUNA 4MMYB 3DAFA 3IR7A 4QUJA 4F5EA 1VIMA 1SCAA 4BGEA 2OSBA 1F14A 1DJOA 1FTWA 3FLMA 3K9HA 4LY6A 4KWTA 4LSZA 3RUIA 2QTHA 4D92A 4KFUA 4J1TA 3U4MA 5FT9A 3O8QA 3BCRA 1XROA 1M7BA 2P2YA 2XCTB 4PGAA 5TE9A 4JJ6A 4ECAA 3BSWA 4OQDA 1E6CA 3N2GA 5JPIA 2XY4A 1CRLA 2I99A 2Q28A 4MCAA 1QYCA 1KJYA 1H1TA 4PIPA 5DGIA 3QU7A 3L92A 2BW0A 1N2XA 1JEDA 3TRFA 1V2HE 2I3GA 1XLVA 1EUCB 3QXJA 4LJKA 5CURA 3NPAA 4I50A 4OQLA 2VT6A 1CNFA 5ALMA 3ZZ0A 1FMTA 3B5JA 4Q3BA 4Q6BA 16PKA 4MV0A 3SVLA 5HF6A 3EZNA 2PLNA 1I30A 1Z68A 3PXAA 5EHXA 2HBQA 5IVHA 3FSEA 1RQPA 1LSOA 5JATA 5D3MB 4JEMA 3QJYA 3NANA 2RIRA 1RS0A 2G4LA 1SEPA 4UHBA 1DAOA 4RD3A 3NONA 1RXSA 4HGRA 1M0EA 1YVDA 3HUDA 1X8LA 1SHZA 1ZVJA 4JUDX 4U2DA 2CSXA 3COSA 3DEYX 1V8OA 4OX9Y 2NZUG 1MA3A 2XEDA 3O8CA 3RVSA 1Y9DA 1L3IA 2D0OB 2Q5LA 3G0BA 4FMPA 4XUGB 3OE1A 4OKSA 5F2OA 4KQGA 2VJPA 4JX8A 1FW8A 6REQB 3FCUB 2V0CA 1SIUA 3ANLA 1BDIA 3CCFA 1J4AA 3PGLA 5AJZA 5HK8A 1D7AA 2RI6A 3I2JA 3EXHA 2VUSA 1AK1A 1ADJA 1U81A 1HNNA 2PAFA 2WT4A 2AW5A 3AM4A 2BFDB 5ENVA 2JBHA 1VLZA 1BEEA 2G83A 4RO0A 4GECA 2BGTA 3EAGA 3NOQA 4PYLA 3SF0A 1ZU5A 1JF8A 2OZLA 4TGLA 4P9NA 4FFBA 2ID9A 4G0PA 4M49A 3IQHX 4HDQB 2JHPA 3ZWOA 4KFTA 4EGFA 4WT7A 5BP7A 1W44A 3CR3C 3D8TA 3LT1A 3OAAD 4DMFA 5A4AA 1BOFA 1L5SA 2Z3WA 4HH3C 4LYHA 5DYWA 1PQWA 3W2GA 1K5HA 3PJFA 4CPDA 3CVOA 1S89A 1BZYA 4UMDA 5AK4A 3VZDA 4EAAA 1U1IA 4EYSA 2WM9B 4MIYA 4JJKA 3MWYW 1M1YA 2P69A 3GPIA 5CR9A 1D9ZA 2V74B 3FA2A 2CD9A 1SCKA 1F2UB 3RBAA 3T3DA 1WEKA 3WIEA 4TZ0A 3IPXA 5AFSA 1ZI6A 2C97A 3GGDA 3KWFA 1ZC3A 2MINA 3NDRA 6NULA 1QP4A 4K8RB 4PSVA 3DBHA 2CDCA 1Q3TA 1NBMD 3F2IA 3W9SA 1NVMB 1VPDA 5EQFA 3WBBA 4OHYA 3ZV4A 5IZCA 2Q3HA 3VTFA 2W2PA 3MC1A 3WWEA 3I34X 3MJCA 4PPQA 3TL6A 3PA6A 3ZE6A 5DM70 4MW1A 4AUKA 3KSZO 5L40A 3HXMA 1HFJA 1Q0TA 4LF6B 2HQOA 1QZZA 1C0KA 5E2AA 3PXCX 2J6CA 2WFMA 1R88A 4CHGA 1XKLA 3BWBA 1YDFA 3I72A 4HH1A 5AUQA 3VAAA 5ARBA 1NV8A 2PZBA 3BE6A 1SMKA 1O7JA 1UFRA 1YB5A 3ES9A 1XQ6A 3QVJA 4RKWA 4Y2YA 3IEIA 5G0UA 3WLAA 3WSTA 1ZGBA 4M99A 3AIMA 4LRTB 3ZIUA 1U0RA 4WCDA 1YA6A 4K9QA 1EJBA 5DNAA 3Q3EA 2HXGA 4R01A 3LUPA 1K92A 1NC1A 1I6KA 4LBVA 4C06A 4I8IA 2Z6VA 4MWOA 4LVOA 5F2EA 1SVWA 2DH6A 1DPFA 2VJKA 2Y99A 3UANA 3WWDA 3GRZA 2ZJ2A 3BIFA 1IWOA 3K15A 4P1ZA 1J1IA 4R9NA 2XH8A 4O0MA 3J81A 2ZZKA 7REQB 4YMLA 1G0OA 2GPWA 2AC2A 3HSKA 5DH9A 1TMYA 1YOVB 4FGZA 3MMXA 4C6SA 5JLJA 3BOSA 2WP0A 3KV1A 5G41A 3VR3A 4ZJYA 1Z56C 1GT91 3UATA 3EEQA 1RE1A 3LC2O 4NEQA 1DKRA 1JZTA 1KMNA 1UPAA 2FMFA 1OFTA 4RXUA 4UKDA 3BK1A 1WXIA 1BHSA 1Z62A 1XX6A 4PYOA 4NCAA 3H1EA 1CFZA 4OI4A 4JBXA 3U7IA 5LYJB 1GITA 4FGUA 1CY2A 4DRZA 4NEGA 2VT2A 3AEXA 4ZYYA 1GV0A 1UF9A 2H1FA 2BEUB 5LB4A 2HCTA 3AWIA 3V7NA 5EZ5A 3WB9A 1VSQA 1Y7LA 4PZPA 3TM4A 2HU7A 1KARA 3G3EA 3V55A 1C3VA 4EHKA 2NO9A 4CKWA 4RKYA 4ZEXA 2J46A 4BGIA 4DKJA 2VA9A 2GTPA 4EHIA 3D43A 3M4YA 4I6JA 3A9SA 2DHRA 1KDOA 5JC8A 4DTIA 4HQOA 2FN4A 1VJ5A 3IIMA 5EPOA 3UJHA 1N8SA 3EJWA 4NU5A 4CF6A 3PDIB 9GPBA 4ETIA 4F6CA 3P9IA 5CTAA 5DGXA 3CLHA 2VJNA 2PKEA 3PPIA 4LE0A 1PSWA 1QFMA 3QOWA 2AJBA 4H60A 4BNGA 3TLJA 1TD1A 1N6HA 3REQB 5EVJA 3FYUA 2JK0A 1IATA 1OLUA 2EFCB 1J8YF 1RAHA 2Z43A 3G0GA 5TF0A 3U39A 4A82A 5J4YA 3L4BC 3V8PA 1KS9A 1NRJB 1UJ6A 2ROQA 3OM0A 3BGIA 2F62A 4JASB 4JJ4A 3MRVA 3LC0A 5FTLA 1WVGA 4IFBA 4XEHA 4OSOA 2PG3A 1IBMB 4YRGA 1EMDA 2C94A 3LX5A 4WECA 1JIQA 4LDRA 4WZZA 1PW7A 3DMHA 3TL3A 1UH5A 3WY9A 2ORED 2GCNA 4DQLA 5DEOA 2D8AA 3OICA 1Y63A 3DOIA 3CR7A 1PLKA 1WCWA 3EQZA 1IXSB 5A7FA 5IHXA 4EG7A 4S1PA 2QPAA 2C1ZA 4LOKA 1QX4A 4EUEA 3JQ9C 1DUSA 3T6KA 3AF3A 1ESZA 1ZEMA 2B8JA 2QZPA 3DAGA 3A26A 4XGQA 3QA3E 1RKBA 4NARA 5NULA 4ENWA 3E35A 5A7GA 2HU8A 3THRA 4EGAA 3JQBC 3N76A 4K9PA 4L4RA 3RC2A 4QC2A 2I9KA 1M6YA 1W34A 1YC5A 5TC4A 2CVFA 2GXAA 1OXUA 3GCZA 5HK9A 4C3VA 2ZIZA 5AR1A 1WLYA 1B76A 1JPVA 1RM4A 1VFPA 2XI4A 1R74A 3HY6A 4PTZA 4X95A 1I01A 1WW2A 3DAYA 3WL6A 2J6HA 2Y0DA 2C61A 2G3YA 2NACA 4P5DA 4QGBA 1NVBA 2GCIA 4CEIA 2R2AA 4Y0AA 1RABA 3WLEA 1K7YA 2OCDA 3KP1A 3W34A 2Q45A 3AB7A 4RTNA 1W0KA 3GEBA 5EPEA 4RMIA 4MI1A 4IINA 4EITA 5EJ9A 4D26A 4EJMA 5BSWA 1EBFA 2VF4X 3OBIA 4Q66C 5L7TA 1DT5A 2WYVA 2HA4A 3CUTA 2Y0CA 2H65A 4HYTA 3NIFB 2BP7B 4X44A 5DBEX 1A1VA 1H23A 4AZSA 1TO2E 1H69A 2F1KA 4LWZA 4QGAA 3QNMA 1HYQA 4R2XA 4E12A 4HDRB 4XFDA 4Y6OA 1V5IA 1FFWA 3ILHA 2IEIA 2QMZA 3QXCA 4RY8A 1E4YA 2OXCA 2GETA 2H0RA 4ZYUA 2XT0A 5SZHB 1DKLA 2CK3A 3EG9B 1KK3A 1WZCA 3FYTA 5B57C 1QV6A 2P9CA 3EYAA 2IF2A 4QOIA 1MAUA 1DU4A 3L1IA 4B3HA 4P5EA 2BVNA 1QHGA 4YALA 4HAXA 3DCJA 4YUXA 2Q1SA 2ZZMA 5DK4A 2HK7A 2DHDA 3ASUA 3GROA 4MRRA 3NW9A 1JG4A 1TIKA 4IXNA 2O2GA 4OX9B 4OQMA 4C0LA 5I8WA 1H1DA 4Q3DA 3F0TA 3WZ2A 4PVDA 3A9WA 4EECA 4OM7A 3UHPA 1C7FA 1W88A 1Y7TA 2NUTB 2X58A 2ZIAA 1MIHA 4II7A 3X1XA 3MTAA 1DXQA 4NV3A 5K4HA 3W3AD 1W1WA 2D1RA 1AGYA 4UAUA 4Y2XA 1S2NA 4MINA 5BSGA 2ZYHA 3PXBA 1YR7A 1OFVA 1UKVY 2YC2C 5JCJD 4URFA 1BHO1 2BMAA 4H31A 1R4ZA 3GA0A 1ZXXA 3DKKA 3U13A 2SKDA 4KO3S 3H2BA 1EWQA 4IY1A 1N8KA 4UZEA 4KVZA 3KQLA 1MJNA 2L2QA 2W4MA 5A6VA 1NR7A 5B64A 3AOGA 4IJUA 1MUUA 1P17A 1Q11A 4KAAA 4TVKA 2HSEA 5IASA 1Y80A 3VC1A 4FMDB 2WTUA 3KNZA 1GN8A 5AW4A 5ALSA 1C0IA 5ED4A 1JIXA 3RT7A 4RTJA 1H42A 4R05A 4TYWA 2V98A 1JECA 2FMIA 4WXRA 2HRQA 1PDWA 3MUNA 2C5SA 4K9DA 5F4BA 4Z0HO 2O19A 3X2EA 1K1EA 1LWNA 4HR7A 3V1NA 3S1SA 4RVOA 4Z9AA 3BH0A 3I6BA 1S7CA 3OZXA 1I24A 4TTSA 4UNNA 3FBGA 2RGGA 3AP1A 3I9V6 2VHXA 3KQKA 4A8TA 2FW9A 4IHAA 5DI3B 3L8FA 1ZM4A 2AR9A 4RJ2A 4ZGWA 4JLPA 5DHSA 2RBGA 3I5AA 4V1CB 1L4BA 1P0PA 1YAHA 2GNOA 1G3UA 4L5YA 4KTTE 1NF3A 4LK2A 4WVFA 5T5QA 1I4DD 4GP9A 5HNKA 1KSHA 1AUXA 2OL4A 2Z5GA 3ORRA 1AHHA 4PX9A 1ATIA 2JASA 5FLXA 4A6PA 3ED1A 1T2CA 5D3ZA 1E2LA 5JQGB 4NJMA 5ICGA 2FEMA 2Q5EA 1NE2A 4K40A 1IUOA 3FZYA 3TQCA 5FOTA 3K1TA 3DEKA 2YOHA 2GI4A 4D9IA 4GZLA 5J4HA 1K6EA 1M66A 4XVQA 2I78A 1JEQA 2JAHA 1WAMA 2VHCA 2KMLA 2BY4A 5DHPA 2V4MA 2PS0A 3WLQA 2CXNA 2VLBA 1S8NA 5J3JA 3S2YA 3C41J 3HNOA 2E5FA 2J59A 3LCJA 1E94E 4GWLA 2FQQA 3MTDA 1N5JA 3E03A 2K7FA 2J3JA 4ITRC 4DDMA 1NN1A 5K8JB 2X8BA 1FLNA 4DCCA 3QUQA 4OXNA 5ALEA 4CM9A 3HKEA 2C5EA 1DQNA 3ELYA 3OPYI 1SCQA 1G6HA 1U1FA 2D5IA 2OGZA 2V7GA 2Z57A 3N8GA 4RC9A 1NJSA 2E4VA 3CPSA 5G4KB 4B31A 1WP9A 1RKUA 4BX2A 4JYMA 2YMMA 3OZVA 3PHLA 5EE5B 5AI9A 1XKXA 3ADBA 2AG1A 2PGLA 2VPQA 4LYYA 1JKJB 1Y9ZA 2A9FA 1N5OX 3HFRA 4UHFA 3G5TA 3WBJA 3G5UA 4OSEA 4RJJA 2AL7A 3KYCA 4A6DA 3T5AA 1KSFX 2FSHA 3IQIX 3O8RA 1KTIA 3INNA 4FBGA 4HLDA 4HVCA 1UJ2A 1A2QA 1U11A 2VDQB 3CRNA 4WOBA 2ECPA 5JBIA 3DP7A 3HEAA 4DN6A 2BUCA 4TTTS 1K8RA 1Z45A 2FCAA 3S70A 3TG8A 3L02A 4MVJG 1IXYA 4Z4IA 1AUQA 2VTDA 4PICA 1I7QB 4E1AA 5L6LB 1V16B 1O94A 2RGXA 4YI5A 4J76A 4OHVA 4I1YA 1THZA 3H9QA 4AIRA 4F5ZA 5FORA 3GK3A 3OX2A 1KVUA 1XD2A 2D5CA 2D13A 1K0UA 4JHXA 4QBTA 4X1IA 1SQ6A 3U0VA 1BXKA 5KNCD 2DPLA 1U02A 4V24A 4ZC1A 3LKVA 1AZLA 1C7RA 1V1MA 2H08A 2Q62A 3CZ5A 3D2CA 3R3ZA 2AZXA 1BX3A 2PUVA 1R4NB 1XN1A 2GBIA 2QVBA 5LC1A 4C7BA 1WXGA 2QTVA 1H5QA 3KKNA 3TD6A 4IV0A 1MJ5A 2EGGA 5EERA 1E4EB 2GM9A 5BQXA 2EP8A 1Z35A 3UKJA 3NC0C 5A4FS 1V9LA 1YCGA 5B2EA 1IH8A 2DUNA 1XDDA 1MAAA 4OQFA 1TU4A 4WOPA 4WNAA 2OV1A 3ONEA 1NVXQ 4C0KA 3IMFA 3K2EA 4IQ0A 4HOYA 3I3SR 4QXPA 3U5ZB 4GGMX 1W6RA 3QEKA 2OHXA 3A9UA 3JAKB 4WK0B 1K6IA 5B1EA 2FXVA 2VQ3A 4B6QA 5BR1A 4TUYB 5GTDA 4ERNA 3ZU6A 4X5OA 1Y3AA 1E6WA 2D0PB 4ZCSA 2XQKA 3DDHA 2LDXA 2KHZA 4R9RA 1XDZA 4CM8B 1GG5A 3QSGA 2L69A 1QGYA 1R9GA 2DTEA 4L6AA 4MR8B 5AM1A 3SK0A 4Z7NB 2GZMA 4Y0NA 2F1IA 4C07A 5CBPB 1QV7A 3BILA 3OF3A 4HGYA 4R1LA 2OV8A 2R7LA 4G5XA 1YACA 2CLCX 4EG0A 5IJ0B 3ZC3A 4ZV7A 3WAJA 1D6JA 4GLJA 2G28A 4O4LA 1O5OA 4EG6A 4FUTA 2FX3A 3LU1A 5HUHA 3WR5A 1N7IA 1RR6A 1L7PA 4KFRA 5ESDA 4RIIA 1X13A 2QROA 3D7KA 3OHSX 2CBXA 1RJDA 1SGWA 2BGNA 1T3ZA 4RSRA 5F76A 3RU2A 3ETHA 3UHFA 4DKXA 4HQRA 1UBKS 2Y1OA 1E7WA 4M7OA 4H4EA 3VH4A 3OKCA 2GBLA 1B0ZA 5HMMA 3NVAA 1GFZA 1R8SA 5EIBC 1CEQA 3MERA 2IHUA 5LQRA 1MQAA 4EVSA 1ZA1A 3OHMA 3AIOA 3KKZA 2F1RA 4P7FA 4CE6A 1KQ3A 3CZRA 3UXEA 2GZ2A 5IF3A 4CM4A 3CY6A 3L7KA 2E7ZA 3ZHCA 4U7PB 1Y8QA 2QN9A 3F5SA 4CBVA 4TV9B 4BPBA 3KLMX 3P71T 5E7MA 4D9NA 1YFLA 3FVQA 1ZH8A 4FYXA 4HLCA 1R50A 1YR3A 1ZEJA 4EA8A 5BR7A 1NIJA 2FRXA 2V8BA 3N2NA 4D8VA 3QTLA 4RY9A 4BX9A 2E1RA 3KEOA 2AQKA 2J6BA 1MRSA 3DV0A 2IV3A 1ENYA 4BRWA 5I48A 3BN3A 1SVKA 1V8BA 2C4NA 2G5GX 1FK8A 3ZDEA 4D9BA 4K28A 4P32A 2OR3A 3JYOA 3KB6A 3PQ5A 4WOJA 1Z5ZA 1XRRA 1FNCA 4JQYA 4L6IA 5DNWA 2ZRNA 2X0RA 1OWPA 2F3RA 3NBYC 5BYBA 3RJ5A 1O0SA 3V5NA 4M7WA 2BM1A 1V1RA 3ACBA 3GD5A 3IIKA 4BQIA 2CCGA 3TOCA 2C9BA 3PQ4A 4GI1A 1E2GA 3SBXA 4AECA 4L8GA 3H1TA 7MDHA 3QYJA 3U7QB 1DEHA 2OFFA 1V95A 4URYR 1Z6YA 5FOQA 3GBVA 1SOAA 5K8TA 1QK4A 2NWQA 2QRQA 3C3CA 1CDOA 1KRHA 2WSIA 3C7TA 3OFSA 4K6OA 3GRRA 4P22A 5JISA 4R1TA 4C4AA 3DZCA 3L6RA 2D1YA 1KY3A 3N0XA 1EHCA 3KUUA 2WTNA 3F7NA 3ROFA 3IFSA 2EERA 1LSJA 1P72A 2CCJA 4AC9A 2I3ZA 2RAUA 3H6KA 4JKYA 3RSLA 3VR6H 3K9FC 3OWXA 1L5OA 1PJ2A 1RHRA 3WLOA 4Q7EA 5JXHA 3SYNA 3COJA 3LOUA 2YWXA 1FP7A 3QKTA 1UOEA 3S2FA 3AH8A 4C0SA 1GLVA 1U7DA 4HQLA 4DSZA 5A0VA 2CKDA 1R64A 4Q9JA 1V6CA 4GD3Q 4JJAA 4EKDA 3KC2A 4DSUA 1OU4A 4EJSB 1VPTA 4TLDA 2YN2A 1XIVA 4F2HA 1IHYA 2XQIA 1N6RA 3OPXA 5KS2A 2H2HA 4CV3A 3B38A 3S5JA 4HN2A 3QVGB 4M22A 1ZD1A 1G2PA 2MYNA 3H11B 3WRXA 4WKPA 5CDYA 2BMVA 1M2OA 2VCYA 4KGZA 2O23A 5CT8A 4NZNA 4DIEA 3CS3A 1X7XA 1OAAA 2Q21A 2PKXA 3IEXA 4UTNA 1O6BA 2F3TA 3AZOA 4G5SA 4HTFB 1FZTA 1NPDA 2G7MC 1EEHA 1JHYA 3TCKA 4JODA 3ET4A 5TS2A 3BB1A 5FI0B 1KE2A 4W1SA 4EK9A 3GAFA 3BWDD 1JG2A 3UK7A 2O59A 2I4IA 3DL7A 3EXG2 3MOIA 3EGEA 1JJ7A 4HD8A 3SC3A 2J87A 2WUFA 4D3SA 1DI0A 2DEUA 4F3CA 4X3CA 3NVKI 4QM6A 1XF9A 2PJDA 4ZRNA 3CEJA 5FUQA 4L74A 1TO6A 4S3MA 1L4UA 3MWGA 4UFOA 2BKLA 1D2MA 1YNOA 3HYTA 3DW1X 2FEKA 3ZIAD 3K2BA 3G2PA 4TWAA 2VQEB 1TYDE 1XL0A 3ZH9B 4JVNA 4EBFA 4D9JA 3O4IA 1HE4A 4YPFA 5LXTB 4PX5A 4YYEA 3A70A 4H1UA 2B83A 2HWKA 2OCBA 4B6EA 1Y42X 4U7WA 3DNFA 3NUGA 1TAQA 3F5DA 2J5XA 3PHJA 5IN4A 2QU8A 1ZISA 2INGX 1VQ1A 4BFWA 4Q15A 1A82A 5JSZB 3Q6MA 2EBFX 5IDWA 3S7TA 3D8UA 5IT5A 3HLKA 4D0SA 1CYEA 1KBOA 4BNFA 2XA9A 5I8PA 1VKNA 5IKPA 3BFXA 5U4QA 4G6ZA 3MCWA 3K94A 2XRFA 2ZWPA 4DA8A 4BV8A 5SYAA 1BFDA 1RE0A 5F78A 5ED0A 2QVGA 1V4NA 4DWWA 4XGKA 2JJQA 5EUQB 1S7GA 2PRKA 2CXRA 3LQRA 3T7DA 2VO1A 2H1OA 2WNHA 4AY5A 2Q3FA 1XF1A 5E4JA 1RJ9A 1EFPB 1NXSA 1GKLA 3SIXA 1ZW1A 3TSWA 1Y37A 4LZPA 1BRMA 3CMCO 3L7MA 5BXQC 1DAKA 1WTCA 1NLUA 3L6UA 1NNEA 2YL2A 1M6HA 1QWSA 3TGPA 2WHPA 2A35A 1KEEA 1SZCA 4H6WA 3OMWA 1T8WA 3GA5A 2O8VA 3AHEA 5JAOA 2JKVA 1NJ1A 3F6SA 1T0JB 3DPIA 1XDBA 3CLRD 4Q03A 4XCXA 5EEHA 4F6RA 1UM8A 2AEMA 3DH0A 1A72A 1ZCJA 2EQAA 1FRNA 1EIWA 3GH1A 4ODIA 1NP7A 3DKIA 4UHCA 4OHZA 3MMZA 1OZHA 2RDMA 4RVSA 1E0JA 2VLIA 3CN7A 3PF9A 4IH1A 4EEZA 1JILA 2A3RA 4ZZ1A 2HDWA 5BR8B 2CL0X 2QUJA 1WKVA 2IXTA 2DKNA 5JRJA 5DHAA 1HKUA 3CZAA 3PE6A 2QSUA 1K97A 1P4SA 4LXTA 3GY0A 5E7QA 4BMPB 2YV2A 4ZT6A 2CHQA 1IXZA 1CR2A 2WF7A 3B2NA 3CMMA 3BQMB 1QOZA 3EH1A 1FFCA 3BCHA 4P83A 5CVUA 3P2EA 2DFPA 1H1LB 4R7TA 4Y3UA 4OHFA 1PTJA 1UMKA 4XZ3A 2K7ZA 1YB1A 4DHEA 3G9QA 3QVSA 3DDZX 4P3KA 3GDHA 5K3AA 5FXMA 4LIPD 4DR5B 5FOUA 5K8IA 1XZFA 1QHYA 1GA6A 3IJ5A 4CEHB 5DHUA 3D8SA 1RSZA 2PQ0A 1Z37A 2X8LA 3MQ2A 4TYMA 1UXOA 3IAS6 4B9EA 4H7KA 4ZKDA 1CYDA 4TKLA 3BTSA 5F7XA 2AD5A 2BYTA 2QTZA 1ZH4A 2DXIA 1KJQA 1TYBE 2Y0EA 1QORA 4AP6A 4NZMA 2GDZA 3RADC 3HA2A 3EVTA 3NKLA 4Q9LA 1L9XA 4CCYB 3MQFA 3UV3A 2PH5A 3UV6A 1EFVA 4UM9B 4D3XA 3MILA 4HYYA 4UUPA 2BLNA 2JCYA 3QE3A 4Z8XA 3HJHA 3JWJA 1M1NB 4HX9A 3HBMA 1F2TB 3VH2A 1Z2CA 3WXBA 2HADA 2XNCA 4M1WA 4E5PA 5GONF 2G88A 1UPUA 3KX2A 4V0NA 1J22A 1DOZA