5F2EA

Crystal structure of small molecule ars-853 covalently bound to k-ras g12c
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
168
structure length
168
Chain Sequence
b'GMTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETSLLDILDTAGQEEYSAMRDQYMRTGEGFLLVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase KRas
molecule tags Hydrolase
source organism Homo sapiens
publication title Selective Inhibition of Oncogenic KRAS Output with Small Molecules Targeting the Inactive State.
pubmed doi rcsb
total genus 62
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5f2eA00
2EFEB 4I4LA 2IYLD 3U60B 1KKMA 1W0JA 1NKTA 4JS0A 1N6LA 4B3FX 1XNJA 3DVLA 4PPNA 4BEJA 1EFCA 1NKSA 3IBYA 4ACBA 4HB2A 3ADDA 3NBXX 1PVOA 2DFLA 1CR4A 1ZIOA 3SQWA 1SVOA 3P4XA 2GXAA 3ADKA 4PZYA 4C4PA 2KB0A 3U2QA 2RGBA 5FI0B 1ELOA 3WNCA 1R8SA 1TNDA 2TMKA 3KL4A 1CJMA 4OL0A 1A2BA 4LBWA 2ZSFA 1YKSA 5HKKD 1GG2A 2F7SA 5BYJA 4DB2A 4KSCA 5JI3E 1KO5A 4KXFB 3L0SA 3OZXA 1OXVA 4Z51A 2PBRA 4JT2A 1EX6A 2LCFA 1M7GA 4KYUA 4LHXA 5AUQA 4YMVA 1F3OA 1Z08A 2QROA 2XOKD 2J0UA 3HDTA 3U44B 2YYZA 3OAAA 2F3TA 5EP1A 2JAQA 3TH5A 1F60A 3KQLA 5LB4A 1G5TA 1Z0AA 2WWHA 1TF2A 2WZQA 3ZIAD 2BJVA 1ZUNB 1P2TA 4M1TA 3WP0A 1KMQA 5KHOC 2YJTD 5E4FA 3U7GA 1CIPA 4L15A 2CBZA 3GFPA 3K0AA 4MKFA 121PA 1H8HA 1RFLA 2RKOA 2FMXA 4PANA 4LC1A 1NL3A 1E1RD 1MT0A 4IVQA 4HAYA 3ASYA 1K6MA 3SYKA 1UEIA 2J7PD 3VU9B 4A8JB 2W83A 1XD2B 1QHYA 1HUQA 4LJYA 2R8RA 2V1XA 5JWOA 5K8IA 2IK8A 3CF2A 5SZHB 1Q12A 3QKUA 3SFZA 2VHTA 5TV2A 4GRAA 2NO9A 5GJWC 2GEVA 3MWJA 2BV3A 4QL3A 4Z1MD 3O8DA 4EQ6B 5DI3A 1J90A 1EWRA 2D3WA 1G5RA 1JXOA 1E2HA 2OBMA 5TXGA 2A9KA 4IRUB 1D9XA 2CVHA 4US2R 1GKIA 4U7DA 1CBUA 1GRQA 3P32A 1K5GA 4BZQA 1Z8FA 1I2MA 2I3BA 3GJ3A 4URVR 3CR7A 1D2EA 4A8JC 1IHUA 4ITRC 2J41A 5K8UA 3RS0A 3FKQA 2CLDX 3SNHA 1NNEA 5LD2B 1OFTA 3K0FB 2X1VA 4F91B 2P65A 1M8PA 4BGDA 2HJGA 1F2TB 1TEXA 3U7EB 3CH4B 4ZI2A 5CITA 4Q1DA 4F92B 2HLDD 1W5SA 3DO6A 4XSGA 3GP8A 3E70C 5G3YA 1JPNA 1RRCA 3ZVNA 3CKLA 1Z47A 2FPKA 1E3MA 4ZKEA 2OFOA 1NVXQ 2IYWA 3WBKA 1Z6XA 2GCPA 4BPBA 2GXSA 3EXAA 1G16A 3U61B 5E7JA 4DT1A 2P67A 2ZI3A 1AKYA 1Z6YA 4QHYA 1US8A 2VLIA 5J5CA 2QP3A 2QSYA 1CP2A 2ZR0A 3FKSD 4NYMQ 4TSFA 2JCSA 5JWRA 1VPLA 3GLGB 4M1SA 2P6RA 4URZR 1F2UA 1MABA 1S4QA 2YC4C 4OJQA 1J7KA 1MV5A 1G17A 2XB2A 1Z0FA 1U8YA 1WE2A 1JNYA 4NCJA 1XJQA 3IQWA 4L9SA 5B30A 3FMOB 5JMTA 1S1MA 5AJWA 4LSGA 3JZMA 5AUPB 2GF0A 2Q3HA 2VIIA 4A92A 2XSZA 4C30A 1E2MA 4AWXA 2FGKA 2W58A 2REOA 4O25A 5TY0A 2W6IA 3BH7A 1YRBA 4DVGA 1ETUA 4HEJA 3ZZ0A 4C0JA 1HV8A 1P9NA 4HAZA 5KSYA 1J99A 3OIWA 2IT1A 2GETA 4GMXA 2A7QA 2OE2A 5F3WB 4C0HA 2ORIA 4WXRA 4Q21A 2CVFA 2VP4A 3X1YA 2QN6A 1N6OA 1FNMA 3T61A 1OH8A 4ZIRB 1L7VC 2C04A 4V0MA 4QBHA 4KBFA 4XOIA 1L4UA 4R2IA 3KQHA 3IO5A 2BVNA 3DHWC 4MYHA 2GTPA 4B34A 1W4CA 3LRPA 2WIBA 1G5PA 3BGWA 4MDEA 4ESVA 5F9HA 4A0RA 5AJXA 1MO3A 4BFVA 1P75A 2OBLA 3KKNA 1T0HB 2JLRA 3C15C 3RHFA 1LF5A 2CCJA 1UADA 3SC3A 4DZZA 2ZYWX 2W2TA 1PLJA 1XTIA 4MRPA 1XD9A 2ZSEA 1F2TA 3LD9A 1IY2A 2VHJA 5HPYB 2DWQA 1UKVY 4PFSA 4RD4A 4TMXA 1XCMA 2QORA 5CJ2A 3RLFA 5KPJA 1Z29A 3E5HA 4TZ6A 2BOVA 4G5GA 1QVAA 2WJYA 4RFSA 1W46A 2ODBA 2ZXUA 4HB4A 4Z8YA 4A0HA 5FTJA 1MABB 1U0LA 1FL9A 2FU5C 3SZRA 3PXGA 5KNCA 1JR6A 2IYTA 3ZIAA 3CF6R 4M1KA 1V5WA 4MH0R 1P9WA 3LWNA 4HSEA 4XTCS 4PHFA 2D06A 2IC5A 5FL7D 5SZIA 4FCVA 1R0XA 4EQ6A 3R9WA 3SE0A 3NBZC 4HATA 1G7SA 2WKPA 4DT1B 4B3BA 3K8YA 2ZR9A 1CS4C 4Q9LA 3AVXA 4M9QA 1S0UA 1VHTA 1KDOA 2OLJA 2ZRIA 4PZLA 1N0WA 1S1CA 1E2DA 4AY2A 1SVLA 2BCGY 3DMDA 4PO9A 1XD2A 4GPTA 4Y0VA 2ZE7A 4JLJA 3RS5A 4C0LA 2NZ8A 2FFAA 3OIVA 2V6JA 5P21A 2V54A 3AUYA 1D2NA 3ND9A 4CEIA 2IF2A 3MRSA 4BECA 3K0AB 1HTWA 2ZYTX 2AFIE 4CEJB 2EWWA 3I3SR 5FOTA 3KTAA 3EIQA 3CRMA 4UXJA 1G6HA 2VYFA 1SKQA 3VKGA 4G5SA 1RW4A 3OIYA 2GEDA 5KDLA 2J0UB 2F43A 3JVVA 4JLAA 5EE0A 3WRYC 2IUSA 4Q02A 3L43A 3NIBA 1Q3HA 4ZI3A 4ZV4A 4QJ3A 3NKVA 1KI3A 1KSHA 4C2UA 2VTKA 4NONA 4GP7A 1W1WA 1EESA 1OH7A 4Q18A 1PV4A 1GRRA 4OHXA 5GADl 2V7QA 3GPLA 3W9YA 4HZUB 2JASA 4PAQA 1G3QA 3VU9A 3BFKA 1WB9A 3ZGXA 1M1YE 1G4AE 1EGAA 3CRVA 4UNPA 1G1MA 4FINA 2Q21A 2QQ0A 3LVRE 5HZHA 5IF9A 3T1TA 3K70C 3CNLA 4GP6A 1TPZA 2PZFA 4TLEA 3DZ8A 2WOJA 2G3YA 3S1AB 1IQPA 4A2PA 3HU3A 1SKYB 3VTKA 4F4JA 5CM8B 4DJTA 1NVVQ 1GKUB 1X6VA 3DOFA 2R9VA 4FMDB 4L4UA 1CULC 4KCGA 4OI1A 2P2LA 4Q19A 3T5GA 4Q7JB 2DY1A 4Z8XA 5FBLB 3TW8B 2RGXA 1QHGA 5EZ5A 3D8BA 4CRWB 1MR3F 3ZQ6A 1M6NA 3FHOA 1JECA 2ZUCA 3H0KA 2G1KA 4DB4A 4Q7MB 2O0HA 1BYIA 2B7CA 5GJBA 2GEUA 2W0SA 2OG2A 4BFTA 4BFYA 3T35A 2QRZA 4RKEA 1MO5A 1W2GA 1VHLA 5JLJA 2QTHA 1P62B 5TARA 1GZSA 2NIPA 3GJ5A 1XTQA 5HTKA 3GLGE 2K5UA 2RGGA 1FUKA 1DO0A 1JPJA 1MO6A 5G3ZA 1NVWQ 3T12A 1PUJA 4DDTA 2MSCB 2QTFA 2H92A 2WVJA 3NEYA 1CJTC 3CBQA 5EXPA 4U02A 1MO4A 4LBYA 2EFCB 5JEDA 4J0QA 1Q1QA 4OHVA 2QZ4A 3MJHA 3T15A 2G9NA 1ZU5A 4TMVA 3MUFA 3AVQA 1P9RA 4AYTA 3ZQJA 4Q1BA 3WNBA 5DSZA 4TL9A 3B2EA 4TYQA 5L3SA 1YZKA 2X2FA 3RRNA 3GEIA 2RH5A 2VHQA 3THYA 1G4UR 1Z0DA 2Q9AA 2O8BA 3SEAA 4B3DA 2DCUA 2YOGA 4EPRA 2IWRA 3ZS8A 2ONKA 4F4IA 2NZJA 2DBYA 3RC8A 4Q9KA 1XBTA 4Q00A 3RYTC 1G6OA 3D3QA 3TUZC 4M0LA 2D62A 1P2UA 1TEVA 1YJ5A 1G7TA 2UVQA 3W3ZB 1MKYA 1XEXA 5JRZA 4X8MA 4B2PA 1HH4A 4Q47A 4RFVA 2HYDA 4RY2A 3W8NA 3ZD6A 2RGEA 1S9HA 4TTQA 3LDAA 4JYBA 1OE0A 3VNVA 4LUCA 4B43A 4X8HA 1T0JB 5AUOB 5FBRB 2WOOA 3CRRA 1XPOA 1OB5A 3B8HA 1S3GA 3FYHA 2CL6X 1NMYA 1XJ0A 4MUAA 5FBVB 5E3HA 4C9BA 3V4RA 1ZM3A 4HAVA 1D6JA 1P2SA 4C0SA 4EUNA 1COWA 3R7WA 5DIFA 2XZOA 1YHNA 4BFSA 5TB5A 1Y3AA 4RZXA 5DGXA 3Q3JB 3HPQA 4LJ8A 2A3RA 4QGFA 4ZCMA 2IW3A 4TL8A 3FFBA 4P3YA 1W36D 1G19A 3QXCA 2O8BB 1TF5A 4LJ6A 4GMDA 5KNBA 3PUXA 1GSIA 3B1YA 2AHOA 4MKIA 2Q6TA 3OF5A 4YMTA 3LA6A 4QM6A 4LY6A 2FSGA 1FFHA 2IWHA 2Z6VA 3PITA 4I1OA 3ZZTA 3IIJA 2ZI9A 3EZ9A 4F7WA 4N1AA 4WZ6A 4D82A 3FE2A 3THWB 1TQDA 1VCOA 2WIAA 3PENA 4NL4H 4O2RA 4V0LA 1O3YA 2RGNC 4FCTA 4CZ2A 1YR7A 4PC2A 1TTTA 4BUJA 4I99A 1KY3A 4B2IA 2QMHA 1WF3A 4AG6A 1FQKA 4B3XA 4GDFA 1UKEA 4B6EA 3IEVA 1XTJA 4RD6A 1VYUA 2PEZA 4NYJQ 3T34A 1NBME 1WCV1 1QRAA 3REFA 1DAMA 2F55A 1GUAA 1QHXA 3PR1A 2ZU0C 1WRBA 2DFKB 3QBTA 4N0DA 5DNYB 4NYMR 1VDZA 2H8KA 3AGQA 2GZAA 3I8SA 3ND8A 1Z07A 3NHAA 1Z83A 3Q5DA 1JEDA 1LTQA 4BZPA 5HCIA 3AKCA 3BB3A 3TLXA 4KYIB 1II8B 1U9IA 5JFGA 2OAQ1 3ECCA 4JZKA 1E2PA 1KHTA 1QG4A 3NWJA 3ZVMA 1P73A 4NBSA 1U9IC 4Q66C 3A58B 4WOPA 3S1AA 3DKVA 4UXIA 1SULA 1KZGB 1II9A 4JKYA 2J0SA 5L8VA 2OCYC 1ZVQA 1E79D 4LJ5A 3VKWA 3QKTA 3I8XA 1R0YA 2H16A 4I81A 3QY0A 4D4MA 5FOUA 3O8CA 2JLSA 4TTRA 4JBYA 4TYNA 2KE5A 2HCBA 1E1RA 2JATA 4WA7A 3VKHA 3I72A 4M21A 2XZLA 2OFWA 5CK4A 4LYAA 1W4RA 4DIDA 2AXPA 2HUPA 2BBTA 2WTUA 5JJIA 4LJ7A 3AGPA 1X1SA 4Q1EA 5FPTA 4Q4HB 1SZPA 2IF0A 3SU8A 3L8YA 2C77A 3LFUA 1XRJA 1IONA 1ZNXA 2F43B 1IJFA 1Z0IA 3CIOA 3IHWA 1SXJE 2BMEA 4TL6A 3CPJB 3QPVA 3QKSA 1K5DA 5DISB 2OLKA 1TU3A 3IO3A 3AF1A 3B1ZA 1GILA 2ZUDA 1OF1A 2FZ4A 2CL7X 3KTAB 3HU2A 1AK2A 4AG5A 4BQSA 4CEJA 1M74A 3SQXA 3CF0A 3RRMA 4O0MA 1RKBA 1COWD 4TZ0A 3AF0A 2D7CA 2QM7A 1A5TA 2AWOA 4H1UA 2O8DA 2DHRA 2QBYB 1FX0A 3P27A 1RPZA 2OXCA 5LPNA 3P1JA 5J40A 3KX2A 5TDHA 4NZYA 2ZRMA 1IJEA 4OQNA 1E6CA 1HT1E 4W5HA 5EXTA 1KGDA 1NBMD 4BLOA 4DWJA 2UZIR 2XB4A 4R71A 1JJ7A 2GBLA 2FG5A 2J0QA 2B8TA 1Q0UA 4XH9B 3EPHA 4ZCIA 1W0JD 2P5SA 1SXJA 3GLHE 4QHTA 4KO8A 3HU1A 2VH5R 4FD2A 3VMFA 1GL9B 5B64A 3QEOA 4US1R 2B92A 3TUJC 2ZREA 3D7MA 4DLUA 3K70D 3MSXA 2QUZA 2GZHA 1ZUHA 2QG6A 1G8HA 1W2HA 3EPKA 2GK7A 3EG5A 2IXGA 2ODEA 2OT3B 2IXEA 3A1SA 4M8NE 2ZE6A 1SHKA 3AH8A 4RFSB 4H9GA 5EE3A 3B9QA 2H17A 4PX9A 2QGNA 4BFZA 4W5JA 2O8FA 3QUSA 1VG1A 4EPWA 3C5HA 1W44A 3BORA 3KXLA 3CZQA 3B7GA 1ZC4A 3ZVRA 2F1HA 4LHZA 3LO5A 3TAUA 4LYHA 4MGZR 1T3SA 4KVAA 1XTKA 4TMWA 1N25A 4A82A 2WWGA 4IOJA 1UBGA 2J3EA 5DH9A 3MFYA 4B48A 4GNKA 1IAQA 4B74A 2ECKA 1AQUA 4DEXA 5C2JB 5EXXA 1TAGA 1S3SA 4NDZA 1R0WA 1KOFA 1G7CA 2EU8A 2PZEA 3DEFA 5JSZB 4FXPA 4ZIRA 1BMFD 2FFQA 1N6IA 2ZJBA 2W6JA 4KFTA 4AKGA 2ZM5A 1Z0JA 5BWMA 2XXAB 1JAHA 3SBEA 1IY0A 3UMSA 1SVMA 2JJ1A 2ZI7A 4QFMA 4C2TA 1XXHB 4IOLA 4NHOA 1CRQA 4QJ5A 3UWKA 1UFQA 4GI7A 2BMFA 2ZR7A 5EE5B 1I4TD 1XMVA 4DSOA 5L3VA 2DFNA 1S8FA 4UNNA 2FSHA 3BOSA 4JT4A 3B1VA 5BYKA 1VYVA 4P4SB 5FL3A 3L2OB 2GNOA 2PLFA 2GVZC 2JJ8A 4YC7A 3W8RA 3KFVA 2F1IA 2OM2A 4NYJR 2ZS9A 5G41A 3WHKA 2N42A 2G88A 1F2UB 2JIZA 4QOSA 5JJLA 2R6FA 4IVRA 3GLGA 2W2XA 3ZD7A 4A36A 4WZBE 4ZPXA 3SI7A 2CHGA 1TX4B 3QI2A 1AS3A 4IVPA 1GIAA 1US8B 3R20A 2NO1A 1OIVA 1EG7A 3IGFA 3PCRB 2EWVA 2NMVA 1KI2A 3K70B 4UJ5A 1DE0A 1K8RA 2EYQA 1RYHA 4TYYA 2QMEA 3A8TA 1R7RA 4P4TA 4V0NA 1XMSA 3BE4A 3H1TA 4Z1MA 4GL2A 2PMKA 4KU4A 1KSFX 4V0ME 1N0VC 2GDJA 2ZSDA 2EYUA 1D2MA 3GD7A 3W6PA 4M1WA 1OW3B 1XD8A 1FMJA 3NXSA 3K0FA 2O8EB 1T4GA 1UKZA 4EPTA 1CEEA 4ZO4A 1RJ9B 2XNDD 4PC1A 2A2ZA 5C1BA 4KODA 4V0OA 1KO4A 2WKQA 1DAKA 4DC9A 3UPUA 1KO1A 3LVQE 3RS2A 5IHPA 1DAHA 4DSUA 1XWIA 1MOZA 2PJZA 2R6GA 5FOVA 1BS1A 3AV0B 3GFTA 1ZC3A 4A0GA 3PEUA 4TLDA 2CE2X 4GSYA 5DI3B 1ZYUA 4Q9JA 1ZIPA 1ZU4A 3TSWA 4Q4AA 4ASUD 4IKEA 1KYIA 4TMKA 4TWZA 1OHHD 1VG8A 1VG0B 3B6EA 1YQTA 2WV9A 1JQLB 4HB3A 3GLFA 3BIFA 4DDWA 4D0NA 1BKDR 3GFOA 4M9SA 3ONWA 3TQCA 1XPUA 2NO7A 5E7MA 3IUYA 3RRYA 1CR1A 2QE7D 4HUTA 2GF9A 5ANRB 4Q01A 4QGAA 1RRFA 4PHHA 1W5TA 1U8AA 3U6BA 2ZJOA 3O47A 3T06B 4CT4B 2MSDB 2HDNB 3VFDA 1GNRA 4IDOA 1EXMA 4URWR 2C8VA 3SJZA 1ZD9A 2JLXA 4IFBA 1P6XA 3GLHB 3UXMA 1CRPA 5G40A 2DWOA 1WP9A 2FPLA 721PA 5J4LA 1X8LA 2GAOA 2GJAA 2Q3FA 3F3YA 3FHCB 3M6AA 5EE1A 1YR9A 1XF9A 5AWFC 2IYSA 1P5ZB 3VHXA 2CE7A 4RD0A 1W49A 4HUQB 2UZ3A 4FWIB 2J59A 5FOXA 2VHCA 3DL0A 4EPXA 3KFXA 2AN9A 1X8KA 3ZH9B 1R5OA 1KDTA 1M7HA 1G3RA 4PTLA 2IL1A 5DN6D 1Q1BA 1FPMA 3HYRA 1HE1C 4HLDA 3WRXC 3B78A 4K81B 2C96A 4UQOA 1L4YA 2XAUA 4LHWA 1DS6A 2DR3A 1E9EA 2FH5B 3W90A 1HE8B 4ZDWA 1NN3A 1YZQA 2JLUA 1NVVR 3TK1A 1DVRA 1FMLA 1KNXA 2YZ2A 2P3SA 4M9ZA 4PHGA 4V02A 2WAXA 3SHFA 2J46A 3QBVA 4B75A 2N46A 1T8UA 3OEHD 4OHZA 1JEEA 3OFND 2OSBA 4JLOA 4HAUA 1E9FA 3QOFA 5FR1A 1KI6B 2BEKA 4JIMA 1AQYA 4D0LB 1BOFA 4YMSA 4OI0A 1E4VA 3M1IA 4DLSA 5FTMA 5CYOA 3K0CA 4K8OA 2H18A 3SOPA 1DG1G 2HV8A 2XJ4A 3KXIA 3KQNA 4TYPA 1NI3A 4FCWA 3RRZA 3V00A 3QVUA 1ESNA 2GK6A 2F1JA 1ZMXA 4OI2A 1GNQA 1P2VA 2FOLA 3PG5A 4QXAA 3TRFA 2HT1A 1SKYE 2IYZA 5CLLA 1TU4A 1YZTA 3NTUA 3LY5A 4YXWD 5L3RA 1JAIA 3CX8A 3EASA 3TKLA 4AYXA 2IEZA 1OIWA 2G0TA 2ZJ8A 1G8GA 2VQSA 2FWRA 2RHMA 1QDEA 2GESA 3GJ4A 2VP0A 5JEEA 1M34E 4LCBA 5KTYA 4BASA 4Q4LA 1PZNA 3AVYA 1CLUA 3K9NA 1XMJA 1OYYA 1F5NA 1ONBA 4E22A 5TVKA 3R8FA 4WXPA 2YKGA 4Q9HA 3UMFA 2J0VA 2VBCA 1E2QA 2ZE5A 4DLZA 2QMOA 3KJGA 4LGMA 3LXXA 4IEEA 3NC0C 2FFHA 1GVNB 2QSZA 5FOWA 4CGZA 2CLSA 1EFRD 2OHFA 4QC2A 3EC1A 1PJRA 2GCOA 3FMIA 3ZZUA 5KSOA 3GCGA 4E5UA 4B35A 2PLRA 1KK0A 2VO1A 1ANKA 1BIFA 4DCVA 1PLLA 2XSZD 1KZ7B 3CNOA 1DBSA 5M04A 4EJSB 1DARA 4XD7A 1IN5A 1G41A 1P3JA 4JJZA 2ZRLA 3KUDA 1N0UA 4ZKDA 2ATXA 1ZJ6A 3VR1A 3RSLA 4MUBA 4R98A 5JWHA 3RS3A 3QXJA 4DDUA 1U94A 2ZJAA 3DOEA 2HJVA 4Q9IA 4YLGA 1KKLA 5CIWA 3TW4A 2IYXA 3NDPA 2ZUBA 3X1DA 4BLRA 621PA 5HCNA 1D8TA 1TADA 2ZU6A 2IUUA 2AD1A 1XU4A 2A5YB 1X86B 3GQBA 1DAIA 4LHYA 2WMNB 2GJSA 4JL5A 5ELXA 2BKEA 1OV4A 3V4FA 1OB2A 2IXFA 4LZZA 2J9RA 3NH9A 1SVKA 2D2FA 4D80A 4R9UC 1GOTA 1R0ZA 1OXTA 1W4AA 3C7KA 3TNFA 3L0OA 4AD8A 3FOZA 2AX4A 2YWFA 2YINC 2FPMA 4RCYA 5DE3A 2G0NA 4I1UA 4WVFA 3KB2A 4HAXA 4AKIA 3RDPA 5E95A 4M1OA 3KJIA 4TLCA 3WXMA 3CNNA 4F93B 2G77B 2VP9A 1E2KA 3CB4A 4TL7A 2QTVB 4HI0E 1TF7A 3A1VA 2YOHA 3C41J 4GBMA 2WSSA 3B1XA 4PAMA 1E0AA 4FMDF 4MRVA 4UNSA 3RS7A 1GWNA 3CWZA 4G0NA 1TL7C 4B47A 2A5FA 3BB4A 4KLNA 1F6BA 2X8AA 4JLMA 1D5CA 4OJKA 5EZ6B 5FUWA 3AP1A 4BWYA 2HEIA 2NPFA 2I1VB 3TJZA 5BN3A 2ANBA 3AF3A 4DSTA 3Q9LA 3BFXA 5H68A 4B3GA 2ZQ5A 4PHTA 1OFIA 5JRJA 1EFHA 4P4UA 4QNMA 3LXRA 3UK6A 4D81A 4IJMA 1BO6A 4HZIA 4EJSA 1OXSC 2WPDD 1FP6A 4NCNA 4XWKA 1J2JA 2QA5A 1BYUA 1E1QA 3CWQA 1FQJA 2OILA 2ZI6A 3T5DA 1S2MA 1T3LA 2FDCA 1NIJA 1TQ4A 1NP6A 2G83A 2ZRKA 2RB4A 4NYIQ 1MRSA 3PV0A 2IX3A 4S35A 4DHEA 3K09A 3RSOA 1KJWA 2CJWB 2ZJ2A 4ACAA 3EIEA 1P72A 1IN8A 3IQXA 1VMAA 4WZAE 3J81k 2QPOA 4URYR 5CJPA 4PPQA 3HJNA 3WMEA 2WPDA 3HPRA 1NIPA 3K1JA 2OO7A 4M1YA 3SBDA 5FPHA 2OESA 2ZS7A 3U4QB 4W9MC 1R10A 2XEXA 5KOYA 1ZW6A 1G8YA 1CR0A 4EFMA 2B21A 3BJIC 3T1VA 2WWWA 1KSGA 1UBEA 4PSKA 2WWYA 2BMJA 1E69A 1XEFA 2GILA 2QAGC 4FWTA 2X77A 5EUMA 1DPFA 3EA0A 1C9KA 4G1UC 2AD5A 5AR1A 3L82B 3LX5A 1NF3A 3FMFA 4DLVA 4WBSA 1JR3A 4JLBA 3SJAA 4JMPA 4NCKA 4DLTA 3A4NA 1GRNA 5CIQA 1GITA 1OFHA 3TE6A 4BZXA 2BBOA 4DBLC 4OKSA 1N6PA 1Q44A 5SZJA 2V8OA 2W00A 4EFNA 5FTKA 2WHXA 4BFUA 1YZLA 1OIXA 5AJVB 4IOKA 3EPJA 1XEWY 3THXB 1M2OB 4CF7A 4OHYA 1TUIA 4JSYA 4N3NA 5GJCA 1N5LA 1KK1A 5DYIA 1IN4A 4A2QA 2VA8A 1Q3TA 2BDTA 4QBFA 1G18A 1SXJD 2AFHE 3CH5A 1P61B 4P32A 3QXXA 4Q4JB 4NTZA 4A4DA 1HT2E 2GXQA 4NKRA 2VF7A 2ZROA 3DPUA 4DIEA 2RGAA 1ZUIA 3QF4A 3PEYA 1F48A 1U8ZA 2A5JA 3AF2A 1C4OA 3M0EA 1WBDA 3EAQA 1Q22A 4JLDA 5EXSA 3HR7A 3CO5A 1ZAKA 4IDQA 3EZ2A 3H84A 5IK2D 2CHQA 3TVTA 1ZNWA 3MD0A 4IXMA 3ZLJA 2ZEJA 1JB1A 1VCIA 1QHHA 3RANA 2CEAA 4KFSA 2J1LA 2ZRGA 4XD7D 1DEKA 2XITA 1Q1ZA 2Z0MA 4ERNA 4IDNA 4YDHB 4PO8A 5CB6A 1WXQA 5JS7A 1OPXA 4KI0A 1T3HA 3LBNA 2XTMA 5CM9C 2V1UA 3B5JA 3KKOA 1H65A 4HDQB 2OAP1 4EAQA 4UJ3A 1CF4A 4MGKR 4N0EA 3U3MA 5JCZA 4DXAA 1T91A 4JJKA 3G5UA 3UATA 3BAFA 3SR0A 5E7IA 2JLZA 3QENA 4M2LA 2ZETA 5FOSA 4B33A 4Q03A 4DCTA 4TMZA 1XMIA 2ORWA 1SVSA 2FZLA 4XJXA 5HZKA 1LFDB 3R9XA 1NMXA 2PL3A 2GXUA 4CEHB 3RNLA 3T1QA 1V43A 1NLFA 5H1YA 4YXWA 4C0KA 5DHFA 2PT5A 4QNRA 3SFVA 1YVDA 5J4YA 1E2GA 4JLPA 3FGNA 2GJ9A 3X2SA 3WY9A 3ZJYA 2CK3A 1G21E 3KJHA 4ZCLA 3L0IB 3N5CA 2V4ZA 3C14C 3PUYA 4PPFA 1FW6A 3QKRB 3I32A 3VAAA 3SYLA 1P60A 1KDRA 1A82A 3DM5A 4JSTA 3LW8A 3WYFA 1Z63A 2OCPA 2N1BA 2H7VA 2BBWA 4UKDA 2IYQA 2QM8A 1JR3E 2IEYA 4M4SA 1T5IA 1ZM4A 1AZSC 3I1FA 4I1VA 3K9HA 3LQQA 4LV8B 2WJJA 1GL7A 5KUTA 2C2HA 3Q7PA 4FMCB 5FR2A 5FL7A 1XZQA 3GLIB 1PLKA 2NO0A 3W6OA 3WYAA 4D25A 3EX7C 1AA9A 2CHVA 5C46F 4MYCA 2QP4A 3QSYA 3H4MA 5D3MB 2BJWA 4GFDA 3UG6A 1H8EA 5CB8A 1OKKD 1JQJC 3A4LA 1DADA 4L8GA 2D2EA 4M1MA 3AM1A 2HLDA 2QY9A 3QKRA 2LKCA 3OEEA 3MWLA 2JLVA 1Q57A 4LPSA 3AKEA 4D4LA 1O87A 4URXR 3OEHA 4TN1A 2QNRA 2VSFA 2YHSA 2CL0X 3TGPA 1LF0A 3L0PA 4TT3D 2W6ID 2EFGA 5EQTA 4EPYA 1IN7A 2IA5A 2QENA 5C4GB 2IS4A 2WWXA 4PZZA 1W7AA 4CEHA 4MKGA 1AS2A 4L9WA 4OYHA 2EVWX 4HLUC 2P0EA 4Q1FA 3GLIA 1NG1A 3N2IA 4WAUA 3MJRA 3Q85A 3NC1C 3RWOA 1RRPA 3QG1A 3LW7A 5JHGB 4X8LA 4B6FA 1XP8A 3D31A 2FSIA 4RD2A 2VF8A 3EA5A 3OHMA 3E1SA 2C9YA 4PSVA 1CTQA 1IBRA 3VQTA 4D6PA 1G291 3AKYA 1E2IA 4TTPA 4DKXA 5GVSA 2UKDA 1SVWA 4LV5B 1LB1B 1D9ZA 1EK0A 2ZAOA 1AIPA 4LYFA 4NCHA 3PQCA 2G1JA 5AUNB 3WMGA 3AVOA 2REXB 1X3SA 3HR8A 1KI4A 3AF4A 4D26A 2MMGA 2DB3A 3NBFA 3VR2A 3WYGA 3NEJA 3CRQA 1P7CA 5C18A 1QHHB 2YVUA 4KVGA 3FVQA 6Q21A 2IS6A 1QBKC 1W36B 3QG5A 4IFEA 1LNZA 1AKEA 2DFTA 2R2AA 4P33A 1E9AA 1XCPA 1AS0A 4BFWA 3I92A 3PJRA 4AKHA 1GAJA 3I5YA 1QHSA 5H70A 2O8FB 5A5GA 2V6IA 2JIZD 2NQ2C 2XTZA 2F1RA 3HWSA 3UIEA 4BLSA 2BM0A 2NOAA 2ZRBA 3VR5A 3KKQA 1GL6A 1H8HD 1CJVC 3LBIA 1AZTA 3SHWA 5K8TA 3IPYA 4FI3C 3A4MA 4TLBA 1OH6A 1CKEA 4YMUA 4TYWA 1XX6A 1KJYA 1Z6AA 1Z6TA 3THXA 2Z4SA 1R5NA 2QP9X 4ARZA 4D4JA 3FHTA 4ESHA 2GVDC 2ZS8A 5FBWB 1J70A 1E98A 1SXJB 4GOJA 1OXXK 2L0XA 3K09C 3ETLA 3L8ZA 5DHAA 2F9LA 3A6PC 2FEOA 3MGCA 1CJKC 4YDSA 5JBQA 5KPDA 1Q20A 2GJKA 3C4JA 5KSPA 1II0A 5BQ5A 1G64A 4PO1A 3U3RA 1E1QD 4HB0A 1KMHA 1SVIA 2BWJA 2FX3A 3EZ7A 4DDVA 5F9FA 2A78A 1NSTA 4M9XA 4MITA 2LWIA 4Q4JA 4G3XA 2YC2C 1X1RA 5L3QB 1IM2A 2HXSA 3TAHA 2WSMA 4HAWA 3BERA 4AC9A 2O0JA 2AL7A 1RC8A 2C03A 5GJVC 3OAAD 3CPHA 3OESA 5KNDA 1W47A 5FPKA 3U4QA 5DYGA 2QT1A 2QL6A 3O8BA 3REGA 5EJEA 4IHQA 3O8RA 3GJ8A 4TT3A 1KNQA 3KQKA 3DMNA 4Q4HA 2WSSD 4NE2A 4URUR 4LDJA 1ZP6A 2AKYA 4QG7A 4EKDA 3W6NA 3PVSA 5IT5A 4C0QC 3ADCA 3RABA 1R8QA 4OQMA 3B13B 1OKKA 3IIMA 1XB2A 2CNWD 3OIUA 2CCKA 3K9LA 3WP1B 4QGGA 3KZ1E 4PC3A 3IKJA 3OFNA 2O8CB 2WICA 4MRRA 2Y8EA 4PQFA 1XZPA 3F5FA 2OEPA 2X2EA 1B23P 3CM0A 1LV7A 3TSOA 2ODNA 3NG1A 3CONA 1G3UA 1GTVA 1SHZA 2RGNA 4MDFA 1VYTA 2ZANA 5C4MA 2OCBA 2GCNA 1G7RA 3C5CA 4PXAA 4L5BA 1U90A 1BMFA 1XTRA 2V7QD 4D4KA 4RD1A 1KAOA 4MRSA 3LV8A 5DN6A 2ZJ5A 1C1YA 1E96A 1GDDA 2I4IA 4CDGA 4DUGA 5FTLA 2W0MA 1LS1A 2P6UA 2QT0A 4RVCA 1A2KC 2RMKA 3KJEA 1Z2AA 1OH5A 3MAAC 2R6DA 1JJVA 3AVTA 4I1SA 5FPSA 4NMMA 3SS8A 4UNRA 1ZM7A 3FDIA 2PMDA 5B2ZA 1JXMA 1UDXA 3SJBA 5FUXA 3PUVA 3BS4A 3TR0A 2GJ8A 4A15A 3THOA 5TMPA 3MWKA 1G8FA 3TSZA 3VR4A 3WHLA 4DCUA 3KXKA 1ZD8A 2ERXA 4OBEA 2BEJA 2JEOA 4OK5A 5UKDA 1E2EA 4LK2A 1T8TA 1I2DA 1FTNA 1HEIA 1YZNA 1W36C 4BLQA 2QRNA 1QZXA 3I5XA 2VL7A 4OI4A 1EWQA 1TQ6A 5LD2C 4LJAA 1WDTA 4F4CA 1HYQA 4JL6A 1G3MA 1N5KA 4KHZA 2IYYA 2C9OA 4CW7A 2ZYUX 4EDHA 4RZUA 3V9PA 1GNPA 1OJLA 4G01B 3T1OA 4XWAA 1Q21A 1ZCAA 4MYUA 5FUYA 2F3RA 4XTRA 1ZM2A 3WNDA 3ZYCA 1AN0A 4Q7KA 5B57C 3EARA 2R65A 4ON9A 4KSBA 5J4HA 2VRWA 3GLFE 2I1QA 1E4YA 3GMTA 5F98A 2OBNA 4RSGA 2EFDB 1NLZA 3K53A 1E0KA 1KI9A 3LNCA 3RAPR 2CK3D 3SN6A 2ZAMA 1DTSA 2ZITA 1GKYA 4IDPA 4LYJA 1Z6GA 4P31A 3F0TA 4RZ3A 1QHIA 4BEBA 1CU1A 2WM9B 2KJQA 3FMPB 1XEXB 5A0FA 4D2IA 4QGHA 1OHHA 3BD9A 4MRNA 1Z0KA 3IIKA 4HDCA 4KBGA 4HDOB 2O8CA 1GFIA 3C16C 5BN5A 2ERYA 1CJUC 3CZPA 1E9RA 3PUWA 3QIAA 4MQBA 4AURA 2V55B 2VHUA 4C0BA 3W5IA 3A37A 4KFRA 2Q3MA 5B58C 2FJUA 3KQUA 5IDVA 1SQ5A 4KLZA 2B8WA 4YMWA 5FFMA 2QPAA 3MMPA 4JL8A 3TUIC 3X1XA 1UEJA 4OQFA 3OE7D 5LB2A 4PR0A 1QF9A 3AB3A 5EP4A 1E2NA 3AKDA 4BLPA 1Z2CA 2NTYC 2QU8A 4D0GA 1VIYA 3BXZA 4B32A 3FFAA 3P4YA 4HLUA 3BK7A 1ESMA 2HF9A 5EE9A 3KKMA 4LHVA 4MYTA 5L3QA 1NRJB 3CLVA 5KYKA 1KI1A 2JDIA 3BRWD 1M7BA 2AXNA 3KKPA 4DLWA 1RIFA 1OFUX 2YNMA 2C9CA 2ATVA 3QXHA 1KMHB 4BRUA 4CYMA 4JVMA 4KAXA 1UDWA 3QPWA 1YRAA 1XFAA 4O2LA 2IS1A 3BH6A 1XXHE 4AYWA 2VSXA 1QHNA 2GRJA 3K0EA 1IOZA 5KSZA 1LW7A 3A1UA 4HUQA 4OQXA 5FTNA 4XVUA 4RKFA 5CYPA 4ARZB 3C8UA 1OT3A 1KI6A 3X1WA 1PUIA 3PEVA 5EP2A 2AK2A 1UBFA 3U6KA 1J8MF 1XCGB 2FEMA 1IXZA 2D7DA 1E9BA 4Z54A 4MGIR 2IYVA 1KIMA 3P26A 3Q72A 2RGCA 3A1WA 4TQAA 2DYKA 3PUZA 1AM4D 5JHHB 3I73A 4MGYR 3OE7A 1GM5A 1ODFA 4FIDA 3W3AA 3SYNA 3TQFA 2IHYA 3QVVA 2RHDA 4HZUA 1G3IA 3PIRA 4C3ZA 4PQRA 5JZVA 5H8WA 1ZNYA 2GKSA 2ZRFA 3JVUA 1KSJA 4YQFA 5FBQB 4NPHA 3FWYA 1MH1A 2AK3A 1W48A 2ASEA 1RZ3A 1N6NA 2EQBA 5HE8A 3TBKA 2QPTA 2FV8A 4EJSC 4Q4AB 2BIFA 3B9PA 3KDSE 4B44A 1KI7A 4DSNA 1L8QA 5DO9A 1YZGA 4Q1AA 4JLKA 5SZKB 3VX3A 3R8CA 1TUEA 5BN4A 1A7JA 4DLYA 2VP2A 2BCJQ 1AGRA 1CXZA 3BC1A 5IRCD 3GLHA 3GLIE 421PA 1U2RA 2XNDA 2Z43A 4OK3A 1N2CE 4LC0A 4LOAA 1LY1A 1P4SA 3BB1A 3N2EA 2O8EA 5G53C 3VX4A 3W5JA 3ZDQA 4CEIB 5IK2A 1KDPA 2ZI4A 1WQ1R 3UANA 2FGJA 2BHRA 4S2EA 2BM1A 1A4RA 1VECA 1Z3IX 2JJ2A 2WJVA 3EWSA 4FN5A 4U5XA 4ZDJA 2YWEA 4BFXA 2QE7A 2IYUA 3EZFA 2XGJA 1DAFA 2X19A 3GLFB 1RRGA 3QF7A 5KU1A 1E9SA 2PX0A 4C0AC 1NN1A 1T6NA 1U0HC 1YZUA 4WW0A 3WMFA 4ABYA 1QVRA 1KO8A 3IILA 4RD3A 3TR5A 1NY6A 4Q7LA 3CUEF 2MSEB 1RVDA 4A2WA 4G5OA 5EP3A 1A1VA 3UMRA 3ICQB 1VG9B 2J7PA 2Z83A 2J7KA 1NBMA 2JLWA 2PT7A 4P0TA 5KO2A 4Q48A 4ZDIA 2FFBA 3M4YA 4II7A 4DUGD 3VNUA 2B6HA 2C5LA 1IY1A 1KAGA 5D3MA 3ZVLA 1RJ9A 4JVSB 4NYIR 2BBSA 1NLYA 3U5ZB 4LBZA 2WJHA 1XDBA 5FUVA 2RGDA 1Z06A 3B82A 1E9DA 2QI9C 2XOKA 3GJ0A 4GZMA 4HYYA 2ORVA 3R9IA 2ZIAA 1U0JA 1XXHA 2VEDA 1UM8A 2J45A 3CX7A 3P20A 4LI0A 1S96A 4HLQB 4PAOA 4DLXA 2ZRJA 4ASUA 2XJ9A 4GZLA 2XXAA 1R5BA 4Y0AA 3AQ4A 4YONB 3QEJA 4KJZA 5DI9A 2BC9A 2ZI5A 1FNNA 4XWOA 2E9SA 1EFTA 4F38A 4M53A 2CNWA 1UBCA 3H2YA 4BRWA 1YR6A 1HY3A 3MG9A 1Y63A 5J4VA 1DOAA 3W34A 2P6NA 3EC2A 1G9XA 1RE0A 2ZRDA 1DAEA 1Z28A 4PQYA 5LDDC 2GWHA 1VCNA 1AJEA 1TQ2A 1IN6A 1QG2A 3BWDD 1KK3A 1LVGA 2FN4A 4OQLA 4JYCA 3G0HA 1E79A 1G8PA 1W0KD 2JGNA 3UKDA 4P4SA 3DKPA 3JZAA 3BFVA 3AP2A 3VR6A 4Q5IA 2ANCA 2IUTA 3AP3A 2IYRA 5EUQB 2G6BA 8OHMA 3CRW1 3IDQA 1G20E 2QMUA 1KO7A 1T5LA 3OEED 5JS8A 5BW8A 5AJZA 3I61A 4POAA 2KI5A 3H86A 3ICEA 3GEHA 2NGRA 2GAAA 2A5GA 2FE4A 1DAGA 2WAYA 3IEUA 2WKRA 4LJ4A 2PJRA 3N70A 2OXRA 2O5VA 5FI1B 2Z4RA 2C78A 2C99A 2V3CC 2OZEA 2LKDA 3U3KA 1OYWA 1ZINA 1SGWA 3WBJA 5JSZA 1KK2A 4UNQA 4PC6A 2EW1A 1FUUA 221PA 1VCMA 4QM7A 1NY5A 1E99A 2HXYA 4US0R 3AEZA 3ZS9A 4DRZA 3GEEA 1ZNZA 1X8JA 1NN0A 4BLTA 1RYFA 1KJZA 3HYTA 4A9AA 2CMKA 4IW3B 1E32A 2B7BA 3CW2A 4EPVA 1T9HA 4IEIA 4X8OA 2Z5FA 4GOXA 1IXSB 3E2IA 3EPLA 3VR3A 2Q9BA 1FX0B 1JR3D 1NJFA 3CR8A 3QF4B 2QBYA 2O8DB 2XNSA 4LX0A 3AUXA 2O0KA 3QNUA 5J4KA 1E9CA 5K8LA 3AVUA 2PX3A 1AGPA 1E0JA 2W6JD 1DELA 1HQCA 1HA3A 2ODWA 2WWFA 2ZRCA 3FKSA 2ZE8A 3FB4A 2ZTSA 2R6AA 4B2LA 4EIWA 4O3MA 3X1ZA 5HE9A 1NSFA 2FA9A 3GJXC 4LRWA 4JBXA 3IBGA 4TQUS 1N5IA 2DWPA 2GBLC 2JJ2D 4V03A 5BXQC 4PPGA 2H1LA 1CR2A 2PH1A 2P5TB 2ZSBA 3ASZA 5A4JA 1HQYE 2VSOA 4GT1A 3EIHA 3FTQA 4V0KA 4QHSA 3Q8XB 2FSFA 3U7FB 3PFIA 4EFLA 4OHWA 1E0SA 2VP6A 4JLVA 3NBYC 2KWIA 4NP6A 2H57A 1N6HA 5D3QA 4A6XA 4A1FA 3B60A 5AK0A 2R62A 1UPTA 2F6RA 4A8JA 2HYIC 2JLYA 5J47A 3DM9B 5KDOA 4TSFD 4XSHA 4B73A 2H5EA 4ZDKA 4GOKA 2IHBA 4H1VA 4B76A 1H8ED 4LBVA 4W5WA 2OFXA 2HT6A 2OV2A 1R2QA 4LWZA 2XX3A 4DLRA 2ZPTX 2MMCA 2W2VA 4AIIA 2BKUA 3HP1A 1I4LD 3QKSB 4RJLA 4XIGS 2RAPA 4DCSA 3QPUA 1XTSA 2R44A 1YR8A 4QBGB 5FH9A 3U44A 2HF8A 4IDHA 2J5XA 1YE8A 4R7ZA 4XVQA 1R6BX 3DDCA 3ADBA 2CJWA 4LJ9A 3SJCA 4R2HA 5CDFE 2ZRNA 1E2FA 1XJCA 3A1TA 2KBFA 3SDZA 2CXXA 4CIDA 3K9GA 2GZDA 4WIAA 2EFHB 5FPYA 3LQRA 2JLQA 3AVWA 3LLUA 2Q0HA 1E2JA 2C98A 2CDNA 2JDID 3MWYW 2QEQA 3RS4A 3FPAA 2YWGA 2YV5A 4JKIA 3TVDA 3TMKA 1FOEB 1OXUA 1Q1EA 1N5JA 2ONJA 2AR7A 4JBWA 2E87A 2ZJYA 3LBHA 1NJGA 1E94E 4RZ2A 5JI2E 2REBA 2PZGA 2ZJZA 3NDBB 3K0SA 3RC3A 2FNAA 2ZVPX 4CT5A 1UF9A 2WWIA 1Z5ZA 1N6RA 2AWNA 2Q9CA 2E1RA 3KB1A 1U99A 2J87A 4PC7A 1II8A 3U3OA 2F9MA 4KV9A 1FP7A 4DCNA 2YOFA 2V9PA 4CVNA 4E07A 1DG3A 1BH2A 1B0UA 3NH6A 4NU0A 3CX6A 1IXRC 1ZD1A 2QAJA 2QGZA 3LH5A 1S9DA 3GJ7A 3GJ6A 4A6PA 2PCJA 1ZRHA 4KFUA 4DEYA 1E2LA 3Q7QA 2KSQA 3MLEA 4QBIA 3I4LA 4UXHA 3R7WB 1YU9A 3AVVA 4L16A 4C7OB 5JJKA 1NG9A 1U81A 1UKYA 2XZPA 4IXNA 4JLNA 4G5RA 4OK6A 4TQ9A 1EX7A 3CPEA 2GHIA 3EWAA 3RVBA 1DO2A 1EFRA 1R4AA 2HCJB 2WMOB 4U00A 3LLMA 3U3JA 3D6TB 4TLAA 3BH0A 5JECA 1JALA 1WMSA 1WBBA 4E03A 3THWA 2SHKA 2ZVQX 3MCAA 4G5QA 3NHBA 1NVUQ 2A5DA 2QAGA 2PEYA 2WJIA 1L2TA 2PCLA 4IOMA 5HR5A 3QQ5A 2D4HA 3PEWA 1KTVA 3F8TA 2AKAB 1ZM9A 3B1WA 3K0CC 1UAAA 4BE7B 1HURA 4B3CA 3KUCA 4AI6A 4KITB 1NN5A 2ZRPA 4W7SA 3A36A 4JVLA 2CLCX 2JJ1D 4Q1CA 521PA 2VP5A 1GP2A 3LAWA 1EFUA 1OLOA 4E09A 3TIFA 4AK9A 2ZRHA 2GCOB 2OCAA 4RCZA 5CLQA 1JBKA 3BBPA 3B85A 1Z22A 2QQEA 3LX8A 1KY2A 4PSAA 1W4BA 2ZRAA 3UG7A 2CCGA 2R6CA 1WA5A 5HKKA 2IS2A 4HLCA 2GA8A 3VHLB 3AVPA 3G82C 2WJGA 3DZDA 3UWOA 1FTSA 2C95A 2OUKA 2ZSAA 1U98A 4FMCF 4B71A 2QAGB 3IHLA 2JA1A 4LPKA 2NG1A 3NVAA 5JCPA 821PA 3U7HB 1FZQA 1MRNA 1I4DD 3QJYA 4FMBB 1KI8A 1XEWX 1ZCBA 2VPPA 1XPRA 1W0KA 1J8YF 5CDFA 1VTKA 3IPXA 2DPXA 2IBMA 4QRHA 4C7OA 1SXJC 4M22A 4ILEA 2RCNA 1ZBDA 4NCIA 3RWMB 2BMDA 1LS6A 4A0FA 2A30A 4FW9A 1JI0A 3QE0A 3QXSA 3EW9A 4MKHA 2NO6A 4MA4A 5GVRA 3I62A 4NH0A 3THYB 4LV6A 2YWHA 4XVRA 1VIAA 1NMZA 2XTNA 5KDDA 5DLQC 5F2EA 4AKEA 5L3SB 4JVNA 1OSNA 2FF7A 5AJYA 1N6KA 4QKQA 2D74A 2ZYVX 3EZ6A 4K46A 2NPIA 2O52A 4QJ4A 4TMTA 2WBLC 1TMKA 1N3BA 1VKJA 2KBEA 1UJ2A 3Q5EA 5CK5A 5LBIA
chains in the Genus database with same CATH superfamily
2EFEB 2GB4A 5GV7A 3BFJA 3U60B 4LWPA 3WRXA 4HYQA 2BRUC 3ZD9A 2ZB8A 1DBIA 4JS0A 4YH1A 3DD5A 1XNJA 1UFKA 1PI3A 2NAFA 3DVLA 1SQFA 4YVFA 4B3FX 4ACBA 3QLJA 4NRDA 1PVOA 3ZHYA 3L02A 3AEXA 3BQMB 1MD9A 4U39A 1AB6A 2FE1A 4B40A 3SQWA 1ADBA 3ADKA 3TBFA 1BJKA 2E1PA 1QZUA 4ONEA 3FOWA 2M32A 1PT6A 2GCEA 3FPSA 4LXGA 1SU8A 3U2QA 2RGBA 3BMOA 2RDMA 1TNDA 2G09A 3BIOA 3IRVA 3QPCA 1Z82A 4R3NA 1CJMA 4OL0A 4XUDA 4EW2A 2G40A 5KNCH 2EIHA 2ORED 4PAWA 1DC4A 4KSCA 3SLGA 4PZDA 5JI3E 2BR4A 1NF8A 2W6QA 3G2PA 2HTEA 4IRXA 4KYUA 3EODA 3TMYA 2IUYA 4RF3A 4F5ZA 1U4NA 5K3BA 3RLIA 5HS6A 4RKWA 5HZGA 3HDTA 1FYFA 2VJOA 3NM5A 2YYZA 3FDZB 2Q7XA 1RHMA 3PC7A 4NBTA 5CCBA 3TH5A 1UBSB 2VDKB 2VK8A 1SWWA 1Q7GA 3EC7A 1UOQA 2AT1A 5DX1A 5F5LA 1AG9A 1P2TA 3H11B 1MG5A 1WXDA 5KZMB 4X5OA 3UH0A 4FGJA 1CIPA 4JYPA 4FZ3A 2P9EA 1AZLA 121PA 1H8HA 1RFLA 3LYHA 4W7HA 3H5WA 3L40A 2G67A 4HQRA 1NL3A 3G0GA 1IDN1 5HF8A 5K3DA 4F5WA 5HNKA 4IVQA 1KBQA 4FKMA 3ASYA 4N5DA 1DCKA 5MGNA 5EKUA 4ZARA 3SYKA 4A8JB 5J58A 4CTMA 1WZCA 3A6GA 1JYSA 3F78A 2QN7A 1HDIA 1QHYA 2PX8A 4D4HA 2V1XA 4FEGA 4B7AA 3V1UA 1UPAA 3CG0A 3I09A 4KE7A 5JWOA 3LL4A 3CF2A 4AWAA 1EUQA 1L4EA 2ZFUA 4AX4A 5FQOA 2JHAA 2R1VB 3AFOA 2C7QA 3QHQA 2N9UA 3UN1A 4IGIA 5HFAA 5GJWC 2YXLA 1G63A 4U7JA 4EQ6B 1EWRA 4GW3A 2JFFA 1PDOA 4BIMA 1JXOA 1XQXA 4ZYTA 5TXGA 4J1TC 3TQHA 2A9KA 4IRUB 3I12A 2YXEA 1QHFA 1D9XA 2CVHA 4OXXA 5HQ3A 1DDGA 1JLSA 1GKIA 1SKBA 1L4KA 1HM5A 1UXIA 1U7HA 3DLAA 3P32A 1K5GA 4J1TA 3RIYA 4AJOA 4DR5B 3GJ3A 1Q7CA 4URVR 3UOWA 4BNTA 3LTNC 1DQRA 6YASA 2G25A 3PZBA 4JV5B 1KDYA 1T5HX 2IZZA 1IHUA 3SMVA 2ZB3A 3NBQA 1NNEA 3E61A 4TKVA 3DLTA 5LD2B 2X1VA 1B76A 4OSOA 5EN4A 4BGDA 3ZJ5A 2WU3A 4F1KA 3F6SA 1IRIA 3NHPA 1N3LA 3DO6A 3MWDA 3DEIA 3GP8A 4FZVA 2E48A 2FP3A 1JPNA 4KP7A 3A6FA 3IQZA 1L9KA 1A8IA 3CKLA 2ZWMA 1Z47A 2B34A 2IP1A 2VHEA 3AFNA 1SVNA 4KNVA 2OZLA 3ICCA 4FFWA 1TM5E 1YFJA 1MTOA 3WBKA 2GCPA 3U13A 4DEVA 4DJDC 1H4VB 2ZI3A 5AW7A 5JQWA 3HY6A 4YRPA 5DX0A 5KINB 3GHYA 4DANA 4YDRA 3GGPA 4EA9A 3KYDB 2OQVA 3TCNA 1KQNA 1RM4A 2OENG 2PUVA 1JA1A 3CLHA 2VYND 3O31A 5CVDA 3FKSD 4YBZA 3N0RA 4I0WB 2Y4OA 3B7WA 4TSFA 4E14A 2Z2YA 5JWRA 1A4XA 3CUTA 5D1NA 4G4GA 3GLGB 1CUUA 2W2LA 1ML3A 1TVCA 3IEIA 3R7NA 4NEGA 1KYYA 2YC4C 4BJ1A 2Q62A 4D99A 1D1SA 4YCSA 5TF4A 3R2JA 4UBOA 3SZGA 3OOJA 4Q3CA 5DTMA 3UJNA 1IZ8A 1JKJA 1PWYE 1WE2A 2B5OA 2V0NA 2ZT8A 3CURA 5FQNA 5IEJA 1T9CA 1N4DA 5KJFA 5HFNA 1ZFNA 2R5NA 3GRUA 3IQWA 3OJCA 4MJXA 4HSGA 4K6GA 4ENQA 5GV8A 4W9NA 1KY4A 3GLKA 4LSGA 2JCXA 4HDKA 2Q3HA 1W8DA 4J7AA 1E2MA 1YDWA 2FGKA 5A9SB 2W58A 5IXYA 1H4TA 3NBUA 2PN1A 3CZ5A 4F46A 3WSTA 1YRBA 2VOEA 3C1AA 3O5AA 4HEJA 1PR0A 5KSYA 1HV8A 4HAZA 4H60A 4XGQA 4EH1A 1GHTA 1JG4A 2ZT5A 1J56A 1ILEA 4DAEA 2ORIA 2Z2XA 1VMIA 1PHPA 3HBJA 2QN6A 1QRTA 3K5HA 3T61A 4E5DA 1OH8A 4ZIRB 4XX1A 1PWEA 4HMPA 3PQ2A 2JGDA 4QBHA 4XOIA 1AK9A 3D4NA 4BATA 1U1IA 1R88A 4DMUB 1SUWA 2AJCA 1SVUA 2CJYA 2DPMA 2GK3A 1CP3A 1UZLA 3EXIA 3GGOA 3IO5A 5DYNA 5IF3A 4MYHA 4ZQEA 3AR4A 2IH5A 3S8EA 5JBIA 1W4CA 4N9WA 2WWRA 4P80A 5IC6A 4MDEA 1BSVA 4KGDA 4RANA 1L8LA 4I55F 4C20A 4Y2VA 4I9NA 1IJKA 1JL3A 2OBLA 5THXA 3A4YA 1RWVA 2AEEA 1EEHA 3PNSA 4R2KA 1PE0A 3RHFA 1V7ZA 1G1AA 4IAOA 3IOMA 2PU5A 2J85A 2O23A 4NFYA 2BDUA 3B2NA 3TIIA 1XTIA 4MRPA 1G0OA 1XD9A 3TZLA 1YR3A 1W85B 1NV9A 4H1WA 2XT9A 4TVBA 3HE3A 3VPSA 3RLFA 5KPJA 1KTIA 2WB2A 1EJ2A 4J1SA 1USVA 2W6ZA 3DFKA 3E5HA 1PSZA 4AT1A 4BO9A 2IUEA 4G5GA 4H08A 5T6BA 4RFSA 4EARA 2ZXUA 1XG5A 3GDWA 4Z8YA 5E4TA 1VL5A 3E8SA 4BP9A 1Y33E 2UYYA 1Z13A 2CFRA 1MB9A 3ICOA 3KJXA 3SZRA 1JR6A 5LNK1 2Z8XA 4Z2YA 1ZRSA 1U3TA 2EKZA 3KZKA 4H4CA 3NHMA 2PGAA 3KSUA 1MX3A 3PPVA 1WR8A 4HSEA 3SSMA 4DQDA 1RQNA 4P4LA 4FCVA 4TTAA 1MUUA 3Q2OA 3SE0A 3NBZC 2YMLA 3BL5A 3OEYA 4PO3X 4ZJYA 2Q5HA 3W4KA 2WHEA 4B3BA 1XV5A 3AUFA 3RUDA 1YB2A 3GC6A 1W34A 1S0UA 2OZLB 4AY2A 3FGOA 1KQOA 1SVLA 4PRKA 2NUAA 5K4HA 3OCXA 1U8XX 1XD2A 3KVRA 1NVMB 1RQPA 3D1VA 1K3FA 4JLJA 5AHKA 4WOBA 5ALVA 5KOIA 3D0QA 2ZIFA 4HOYA 4LVCA 3GIDA 3OIVA 4PYMA 4BMSA 2PG3A 1D2NA 3F4LA 1Q11A 1Z45A 1XJWA 3MRSA 3C8DA 2IZ5A 3R7LA 1HTWA 1NNSA 1W29A 4WZBB 3ZDXB 2AFIE 2EWWA 2DWUA 1YNOA 3OETA 4KQWA 4E2XA 3BHJA 1OZHA 4ZRMA 3IELA 2GN8A 2OG1A 2VYFA 3VR6D 3AJ8A 4G5SA 3VKGA 2I7CA 1QQ5A 1QGDA 3J81A 4GPD1 1GDHA 4EFDA 3JVVA 1M2KA 4FT2A 2O50A 5HGJA 3SZMA 2HF2A 1QTRA 3WRYC 2HMYB 4FTWA 4WPGA 2P2SA 2OFFA 1DZ3A 3SVZA 3AT1A 1PHRA 1PR1A 4KTTE 1NJ8A 4XYMA 1FJXA 2H1OA 1Q3HA 4ZI3A 5KQPA 2EEPA 1E5LA 4QJ3A 3A9WA 1KRXA 2O2EA 4JJ8A 4JOCA 3LWBA 2WB4A 4NONA 4P38A 4JJ6A 3O3NB 4E7PA 5I8PA 1EESA 3ZU4A 1P5JA 2UZ1A 1OH7A 4QOHA 1GRRA 5GADl 1DO8A 3GPLA 1LW6E 1Y4ZA 4HZUB 3RIXA 3VU9A 1G3QA 4E46A 4MUIA 5JCOC 3O4GA 3ZGYA 3GUZA 2IYAA 2CXTA 3ZHOA 2FKNA 1EFDN 1R0CA 1SUFA 2Q21A 2ZIXA 4FINA 4H6XA 3F67A 3CNLA 4GP6A 1W8IA 2EF1A 4TLEA 4M0DA 1VJCA 2BZGA 3E5MA 3EB9A 2WOJA 4JJIA 1BW9B 3BPSA 3S1AB 5JDIC 3RAFC 1LD3A 4A2PA 2VRNA 1ZUNA 3D1LA 3HU3A 1SKYB 4GMGA 3PF8A 4HX9A 4MS1B 4AMVA 4BBAA 4I1PA 3P2EA 4FMDB 2HK6A 4KCGA 4DW8A 2BGUA 4MW2A 4XR9A 4F3TA 4Z8XA 1AGYA 5ALDA 4B87A 3KG2A 2E85A 1QHGA 4FNOA 1PFGA 4RVFA 4CV3A 3K1AB 4NFHA 3UUFA 3FPJA 3KAJA 2G1KA 4EBFA 4DB4A 4K9QA 1ZIYA 1BYIA 1YVUA 2B7CA 4MWEA 5A4DA 2CY0A 3AVXA 4ZO7A 1GD1O 3P9PA 2PSSA 2HMWA 2EIXA 1QRDA 2Z9DA 1GJRA 1XAIA 4OM8A 4YT2A 4RA6B 5L53A 3BXEA 3GLVA 2ZLBA 2BGNA 2HRCA 2QTHA 4MJ3A 3OQIB 2IITA 1GZSA 3VR4H 3GJ5A 3GLGE 1EIWA 5JY6A 2K5UA 2RGGA 3RFCA 4MVWA 5G3ZA 1J0EA 1NVWQ 1PUJA 2OSVA 3PE4A 4BQRA 4CLHA 5I7FA 2FR1A 2PX5A 4DA7A 2Q27A 3WB0A 2QTFA 2YZKA 3PS9A 1YE5A 3NEYA 5JR3A 4LXHA 1H3NA 3CBQA 1ZK0A 2B4KA 4IYJA 3VPAA 5KNCD 1ZJZA 3ZYZA 5F73A 4EG3A 4QEKA 4LBYA 2YFHA 3EUWA 1MQ9A 2VWQA 3FCSB 3JQBC 3MJHA 1I80A 2ID8A 1GG8A 1ZU5A 3M6UA 4YEDA 4CM8B 2QE6A 3F6BX 5LZ8A 2CDRA 4KO4S 4GSKA 3HWWA 3WV5A 4F9TA 2ROQA 4KN9S 5DSZA 3WK6A 1TT5A 2VDWB 2X2FA 2G6TA 3ESAA 1GLNA 3VI3B 5C1OA 4OA8A 4NJMA 3DDUA 4ZGBA 5KQMA 4J16A 2Q9AA 4GKAA 3B48A 1QK4A 4X1IA 1TZCA 3T5BA 1BDHA 4IIFA 4RIGA 4TS4A 3F46A 2FOXA 3ROTA 2OP0A 5IM4F 1Q84A 4UPVA 3T5TA 2D2IA 3D2CA 2QVBA 4LZAA 3KQMA 3TUZC 1KA9H 2XBLA 2D62A 3GBPA 1UT6A 2DQ4A 2P7HA 3UCFA 4J7XA 3A9RA 4X97A 3W3ZB 3KOMA 1MKYA 1BEUB 1QOQB 3BIWA 3ETNA 3MOGA 3RCBA 3VJMA 3HA5A 1XZHA 4S2UA 5EIOA 3W8NA 2QXTA 2RGEA 3L06A 5AVUA 3Q41A 1Z38A 2DPYA 1X7YB 2W98A 3GUCA 4LUCA 4X8HA 1T0JB 5FBRB 2WOOA 4G4IA 3N0WA 4ZQCB 1V71A 3N2ZB 3WIEA 2JF0A 3C3AA 4RETA 2WVHA 3ZCQA 2CL6X 1BD3A 1WEHA 2QAIA 3FTDA 3QU7A 4MINA 4MUAA 3RI3A 3FRIA 1FFCA 1KYQA 1NVTA 3V4RA 1NXOA 5WRFA 3LGSA 1HWYA 1YACA 3R7WA 3BGOS 3INGA 2VK4A 2ST1A 3SIXA 5AKLA 5AW1A 3RPEA 3DNFA 5LXTF 1N7JA 4UM9B 3HZRA 4ZCMA 4JP1A 3OJOA 2X42A 4B8YA 1E62A 4P3YA 2R7MA 2XB9A 4W63A 2O8BB 3IAFA 3GV0A 3GT3A 1AX9A 1L5HB 2D1YA 5IBQA 5LDDC 3PUXA 1GSIA 1G8MA 1F8UA 1NU6A 2QF7A 4FYXA 3HXQA 1L5QA 1TAHA 2Q6TA 3BREA 2HO5A 4M3NA 1Z5GA 2YY5A 4C04A 3SF8A 4BEVA 1FFHA 2EX1A 2Z6VA 3WJ2A 1JIKA 1YUMA 3PITA 1GNVA 1HE2A 2GMWA 3SHQA 3ZZTA 5KOHB 3EZ9A 1Z2EA 9LDTA 4LG1A 3ER9A 3DEKA 3BCSA 3U1BA 4MLCA 2HQSA 1ZD2P 1TQDA 5IEBA 2MSKA 2W70A 1U04A 4BFCA 3LT5A 4WKNA 1JEJA 4JYMA 1WXXA 2WIAA 1JHZA 4N6NA 1O3YA 4FCTA 2RHCA 1AUVA 3CCBA 4IV8A 4U7FA 3EVFA 4IZHA 3SJUA 2QOEA 1G8AA 2XA9A 5T41A 4BUJA 4C7MA 4GKBA 4B2IA 3NVKI 2DMRA 3L07A 4ZXPA 2IY8A 4NZPA 1O7JA 2CYAA 2FPPB 3NCTA 3EFOA 1S2DA 4NAUA 3WK5A 3C5WP 3RTAA 1ZVKA 3GPDG 3W5CA 3AHIA 5DIZA 4B6EA 1DCTA 2PZLA 4FYYA 3EEYA 4BB9A 4X44A 3IEVA 2NAPA 5EZYF 3VOTA 3T1HB 5A02A 4WXYB 4ZTUB 2KS6A 2KPOA 3BWVA 2FEPA 3S99A 5EXEA 5EPEA 3I04A 3LKBA 2XIQA 1WCV1 1J0CA 1QRAA 2VBIA 4EVIA 3GZNA 1E1MA 1GUAA 3QJ5A 4XGKA 1D4FA 5H0IA 2ZU0C 1VDZA 3A3OA 3DF7A 1RAGA 3I8SA 3BMCA 3NHAA 3ND8A 3OE5A 2G82A 4CLOB 1B42A 3MCTA 4BZPA 1ORIA 3BB3A 1D6SA 3K15A 3KSMA 3UMYA 2BH2A 1FE8A 4KYIB 1II8B 1U9IA 4WNCA 3MEQA 3CUUA 3GRCA 1GUZA 4BVHA 1H2YA 3TRJA 1XSEA 4JZKA 2FRDC 4GDMA 3ZIUA 5ITWA 3NWJA 3C6BA 3NKFA 4NBSA 1QH8B 1U9IC 3M81A 3ZJVA 4Q66C 4CCYB 3AW8A 3QE2A 1OZFA 3D81A 3OI7A 1PGPA 2OCXA 1A4UA 3OLQA 3W2TA 1ZITA 2Q0SA 3UTCA 3DLIA 1EBFA 2WUDA 3J7AC 4DV7B 1Z34A 2EXXA 5CHEA 1FS4A 1MA3A 1YT5A 2Z3ZA 1X2EA 3PEFA 3M70A 3QVSA 3VKWA 3VO1A 5L45A 2HIHA 3T41A 4BFSA 3QY0A 5HW0A 4ESOA 2HLHA 4D4MA 2OORC 4BKOA 3O8CA 2JLSA 3IOYA 2G28A 2Q3CA 3GAMA 4IQFA 1E1RA 2Y05A 3PDWA 2QTRA 4WA7A 3NBKA 4PIVA 3ZDFA 2QRUA 3PHJA 2OFWA 5CK4A 4LYAA 4BJ5A 1N2GA 2AXPA 1PK9A 3IR7A 3V4LA 1UIMA 1NR7A 1RPAA 3ONNA 4LJ7A 5EL0A 4LF7B 1BS2A 5FPTA 5HQJA 3SU8A 2EGUA 4YMGA 3LFUA 2C77A 2ZJ4A 1XRJA 3PTAA 1ZNXA 3H19A 1X14A 5DMXA 2B4RO 3W2GA 1JSCA 1Y3FE 3ACCA 1JHUA 2HQ1A 1EM8A 1SD2A 2XOXA 3IV9A 3QXGA 1U8FO 3G02A 3V8VA 3WL6A 4MVJD 1ZISA 1BQEA 3FUWA 4GE0A 1F8XA 4N8SA 4BTVA 3FFWA 3B1ZA 3N5KA 5JAUA 4E0BA 1R6DA 4J4TA 1KARA 5F9MA 4FYPA 4AG5A 1SELA 2BMVA 1Q0ZA 1VLZA 5FO1A 3K71B 1JE1A 1WLSA 3CF0A 1V95A 1HG1A 4OSEA 4TZ0A 3AF0A 1J00A 1HNXB 4OMDA 3SJ7A 2O8DA 4J0CA 2A0FA 1ZK2A 3E3MA 2BF7A 3MTEA 1Z5NA 3HCEA 5D5HA 1FFEA 4JBGA 4PXYA 5HJEA 3LOUA 4GI5A 2DR2A 1XDSA 3RU7A 4M86A 1KEVA 2HFJA 4UE6A 2ZRMA 4W5HA 1E6CA 3DLCA 3KDPA 4NX2A 4EL0A 2UZIR 1M0TA 1USKA 5A1TA 3MN1A 4Z0NA 5F51A 1EWYA 1ECBA 1M1NA 4ZCQA 5AYVA 2HWWA 4MKZA 2AKEA 2EKQA 1B3BA 5EHIA 5HJ5A 1HDOA 1B26A 2ZCJA 2VH5R 5B64A 1U28C 3GY0A 2XDAA 2XR1A 2JZOA 1WMBA 4W8OA 3SLKA 3D7MA 4DLUA 1UDCA 3MSXA 2QUZA 4I6EA 4U2GA 5AW8A 3RVOA 3TPFA 1Z88A 3WMRA 2IXGA 2JJYA 4CQMA 3CVYA 3HYSA 5BR4A 4JB8A 5DM60 1HOXA 2ZTHA 1SHKA 2PKQO 3GEBA 3NYQA 4QEZA 3AH8A 3MSCA 4AP9A 4POOA 1TEHA 3B9QA 5JCOA 3E4CA 2BPOA 3O92A 5KX5F 2QN1A 2QGNA 4BFZA 2O8FA 2FWBA 5GWXA 3R8XA 1EM6A 3TGWA 1VG1A 5K0GA 5FEUA 5DGHA 2VJDA 3OFKA 5HCUA 3PNPA 5HKOA 2C59A 4L02A 4MQ6A 1PSWA 1Y8RA 2B20A 4F06A 3Q3CA 1W44A 5JYCA 4PZEA 1EVIA 1LLCA 3BORA 5G0UA 4D8XA 4D9BA 4TV9F 5AD1A 1WXEA 2YJ3A 3B7GA 5KNDH 5EIAA 2LGJA 2V9ZA 2PPLA 1QC5B 4FE7A 3LO5A 4Z4CA 3TAUA 4MGZR 1ZN2A 5KYGA 1QQTA 4KVAA 3CPSA 3H9QA 3SHOA 1LDGA 1WXGA 1WD5A 3CHYA 1DCFA 3MFYA 5AHRA 5AW3A 2I22A 4CM4B 4ICIA 5AM3A 1AQUA 2CMDA 2YJNA 3I5AA 5CLHA 1JLLB 2B7LA 2XRMA 3BWBA 4V0SA 4NDZA 1R0WA 1QPGA 4JMLA 3DEFA 4M1EA 2VDLB 3BE5A 1JH8A 4I5FA 2QK4A 4R31A 4ZIRA 4H7DA 2VUIB 3ZLTA 2ZJBA 2W6JA 3FVWA 4AZ0B 2ZM5A 1RXEA 5DK6A 4JUFA 5B55A 5ILQA 4KZPA 2FJPA 3H5OA 1QIHA 1IY0A 3RUHA 4I19A 3SDSA 4PGFA 1LLQA 4XEHA 3ZDCA 1OZGA 1TJYA 3K3PA 2QXUA 4R7GA 4C2TA 1CRQA 1AXEA 2JCVA 4F2DA 2FLKA 4BXOA 4XE5A 1ZHOA 2PD4A 1JQEA 3Q2KA 4O5AA 3OMLA 3FZEA 3RRBA 1S8FA 3P2IA 3AM4A 4BX2A 4E12A 4EKIA 1N8KA 3B1VA 1Q16A 4P35A 4P4SB 4M0EA 4YMHA 1JAXA 3COJA 2JJ8A 3EBLA 1UM9A 4L1KA 2F8MA 2F1IA 1TVEA 1WDKA 1AOXA 5G41A 1W19A 1NQXA 4NNJA 4ZP1A 3VBEA 3WHKA 1NFFA 1NX6A 2GR9A 2CBGA 4YECA 3VR0A 2JIZA 4D9KA 1R6XA 2R6FA 5JJLA 4OYRA 1WV1A 4F5YA 4ZTZB 5TPZA 1RXWA 1E1DA 1LZLA 1N5MA 3O1IC 1TX4B 4W6ZA 3QMMA 3R20A 1US8B 4EFKA 1H0KA 3G49A 4YJFB 1GU7A 4TTSA 4NBUA 1MRZA 5A71A 1KI2A 4LE0A 1Z17A 3HN6A 4TROA 1RYHA 3LFTA 1OXKB 4YRBA 2WJWA 1SBTA 3DB2A 5E6RB 3V7WA 1UBMS 4B45A 2PFGA 1WW2A 3BE4A 2WUGA 1U3GA 1XFDA 1J0AA 2B61A 2HU5A 2GVNA 3ER6A 4KE9A 4PYQA 4KU4A 3V80A 4GL2A 5JCJA 3GF4A 3L92A 2GDJA 3TB6A 2JPDA 5ARCA 2EV9A 3PLNA 2ZT7A 4WN3A 3KVOA 1Z7GA 3W6PA 2IH4A 1XD8A 2JFZA 2ZTVA 4BN0A 3KUXA 2SCUB 4Q7QA 4X41A 4EPTA 3AEUB 3QX8A 3LL7A 3ZNQA 2A2ZA 1BVHA 1EUZA 1EFPB 2QB5A 4BVFA 4CM1A 2GFQA 1PZEA 4K5QA 4ZEOA 1T4CB 4DC9A 1UDRA 1DAKA 1XPJA 1D03A 4HDSB 4L85A 4LMRA 3IQDB 5IHPA 1JUDA 4FE3A 2JRLA 3F6PA 5AM0A 1XWIA 4GAEA 2PJZA 2R6GA 3G13A 3LTEA 1UQUA 3AV0B 1ZBQA 3FPEA 4YIKA 5DNUA 3VVBA 3GFTA 4IKOA 1VBFA 4MV8A 2DUNA 3VUEA 1I2ZA 4KO3S 2WABA 1NQTA 1ZYUA 3ENWA 1ZIPA 3EUFA 4FFVA 2HEGA 3VZDA 1EVLA 5C1DA 1J9ZA 3C3DA 2XWJI 3LUKA 4G09A 3TD2A 1LSUA 3B6EA 2WV9A 1JQLB 3WLRA 3BIFA 1KOGA 1BKDR 4JI0B 1I01A 4D0RA 1V7PC 3ONWA 2Y1LA 1IWPB 3QRWA 3UAGA 3HNRA 2OK8A 1VBNA 3GNLA 1CR1A 1NRWA 4KG7A 1GPUA 4PVDA 3SC6A 4QOJA 4A5SA 4HUTA 2BE7A 1U8AA 5TRTA 3A3KA 4EELA 1ADGA 1RYMA 2HSEA 5FP0A 4PPYA 4UULA 2FPGA 2IU3A 3G8CA 2GI4A 3O47A 4G5XA 1XQVA 2PGOA 5IN5A 2LCQA 4CT4B 5LDHA 2OBXA 3WLFA 3GPIA 4ENPA 4IDOA 1WPRA 3ZWOA 1UKBA 3A2KA 4BO7A 1RAEA 3HTXA 1W4LA 2P9JA 3LRXA 4CIAA 1YDMA 1FNBA 1PJLA 1OREA 2FPLA 3DHVA 3KLPX 4DPLA 721PA 5ARDA 4I8XA 2BGTA 4X60A 4Y2RA 5EE1A 4O0LA 2YJ6A 2UZAA 3PUHA 2CE7A 4KQHA 1BCRB 2C2XA 1W49A 4FIZA 4Q3LA 3OQHA 1H6BA 1DC8A 4Q12A 6ABPA 2UZ3A 2WHPA 3OTHA 4GKVA 3PRJA 4OHOA 2J59A 1DRJA 1IEVA 3M9WA 4IH4A 5BOSB 5FFNA 1JDTA 1ECJA 1F20A 1QYDA 1UT5A 1TT7A 1ZO8A 2HJSA 2IYEA 1X8KA 3D2LA 3F9RA 3KFXA 2R4UA 4LWOA 4URFA 3STUA 3DDHA 1G3RA 1HXHA 2HNBA 1YBAA 2IL1A 1M10A 1R74A 1Q1BA 2OO5C 3GA5A 3R3JA 4NWIA 5H83A 3LCUA 3LLVA 4K81B 2C96A 4ZAVA 4QLOA 2DCMA 1I3MA 1GV0A 2Y1FA 3T9CA 4UEJA 1EKXA 1E9EA 3MF4A 4B09A 1U80A 3IMKA 3TOXA 2C7OA 3OECA 3D3KA 2JLUA 1TYAE 5CPFA 3TK1A 5KTMA 1C0IA 1FMLA 4K1LA 3D64A 1CNFA 2YZ2A 2H06A 2CUNA 3HL0A 1QR2A 1ENZA 4JK3A 3OEHD 3WZLA 3EQ9A 2OSBA 3OFND 1T5TA 1M2OA 1HPLA 4E5MA 2ZXEA 2ZUUA 4NG5A 4YMSA 1E4VA 2R68A 1IK4A 3M1IA 4Q16A 1KS9A 4K8OA 2PRJA 3SOPA 4E1AA 4EKYA 5ADHA 4CDNA 1VIMA 2HV8A 2WA2A 3KE8A 4MWGA 3BD8A 4XW2A 3SXPA 3VH4A 3FBGA 3A14A 1FJGB 4EF5A 2OD2A 5AICA 1VL1A 2F1JA 5JNTA 1GNQA 2FOLA 4OMCA 2HT1A 2VTEA 4G8JA 5CLLA 4WLOA 2UU9B 2GUGA 4YXWD 5L3RA 2SECE 2A9PA 4P5DA 1XKLA 1SCKA 2KM1A 3SC2A 1R6UA 1RWNA 1J1UA 2FWRA 3FBTA 4K40A 4LOIA 2GESA 4UU8A 5EYPB 5T8KC 4DBLE 4H1HA 2AW5A 1LZKA 4DV4B 2WHYA 2ZKIA 4TVKA 3R74A 2IRWA 1ZXBA 1ONBA 2HDWA 1DOHA 1GFWA 3OZAA 5U9CA 4N5IX 2VBCA 1ZKMA 1E2QA 2Z8ZA 4HEA1 3E4DA 1ZESA 4GM1A 2OGTA 2QMOA 4K87A 2LXNA 5BQFA 3AKZA 1ODTC 1Y8QB 2J9XB 1H42A 2I66A 4TKUA 5A0VA 3OE4A 2QSZA 1YZHA 5T6MA 3X2FA 4CGZA 5L7YA 2E5LB 2CLSA 4R9SA 4B31A 1FFXA 3RVQA 1YJCA 1MJFA 3WIUA 1PJRA 2BTQA 5F21A 2X0EA 5KSOA 3GCGA 1FTQA 2NNWB 2VDJA 5CNKA 3RJ5A 1QX3A 1KK0A 4AY5A 5EJ5A 2VO1A 5I7AA 4QDUA 1V16B 1KZ7B 3RT1A 1MC1A 4XUCA 2H00A 3HNOA 3Q5GA 4DBZA 5GTDA 2AFIB 1SUCA 4JJZA 1R4NB 4YUXA 4DWOA 4ZKDA 3ZW7A 3FW1A 3VR1A 3I6IA 4J07A 4CPDA 2JHCA 1CQJB 1C0PA 2AYXA 2BH9A 3H3JA 4HRAA 3RSLA 1QU2A 2GZ3A 4L74A 1CY0A 1RWWA 4LIPD 4Q9IA 2BHSA 3OCJA 4R6WA 4QJIA 1RNLA 1KKLA 1FNDA 1JSRA 2EBHX 4H0FA 3X1DA 3H1BA 1Y5RA 4BLRA 1D8TA 1LLFA 1H5NA 3PDCA 2BAGA 5REQA 2IUUA 1F6DA 2GYUA 5B1SA 1H2EA 4QXRA 1IZ9A 4LHYA 4YCMA 2J5QA 2BKEA 4CL0A 4O2AA 1YZFA 3N9IA 4AJKA 4XYLA 4R41A 3JQ8B 1UDBA 1V96A 3NH9A 4LZZA 4XX0A 5J43A 4DFDA 2D2FA 1U2SA 1GOTA 1P4JA 1W4AA 1WHTB 3C7KA 3F5MA 3HQ4O 3TNFA 3VNBA 4AD8A 5MF6A 2E55A 2X5KO 2YINC 1NVEA 3ND5A 4GZ5A 2VDMB 4TTTS 5LIPA 1QK5A 2EKBA 1KQ3A 1PRYA 4FUQA 3KB2A 3F9CA 3FTEA 2X1LA 1Q0RA 2RH8A 1RABA 4RM2A 4M1OA 4FLMA 1NXSA 3KJIA 7REQB 4JROA 3PGVA 1RU3A 5IKEA 1S7CA 3W4IA 2I4OA 2YMMA 2GBIA 5CT6A 2QTVB 3GT0A 4E4RA 1MNAA 2W6PA 3B1XA 3UWDA 1E0AA 1UWLA 2AG1A 2X4IA 2H48A 3EHDA 5CW1A 4B8ZA 2YIDA 1TL7C 1V7QA 4NHEA 4B47A 3ZXUB 3C6XA 3BA1A 4JBHA 1HOTA 4KLNA 5FBHA 1XTVA 2NXEA 2O3UA 1D5CA 2PS9A 5EZ6B 3AP1A 3QHPA 3TSCA 5IPFA 4K9NA 3E9YA 1BNCA 3EZGA 4X91A 3L77A 1NYRA 3ADOA 3EF0A 3GAFA 4DTIA 1XIVA 3E22A 4U9UA 2B99A 4MCHA 2B82A 4R0VA 3BDVA 3FBWA 5JRJA 3CC8A 2VJMA 3KAQA 3LXRA 5K2OA 4QDTA 4IJMA 1BO6A 4HZIA 3D8TA 3MUOA 4YRZA 4R8MA 4C88A 2QA5A 2WYHA 4GSLA 3RYHB 1ZVVA 1FQJA 2OILA 1LVHA 1YWGO 4ISBA 5K3SA 2K7ZA 2FDCA 1TQ4A 3EH2A 3VYTB 1K6EA 1HLFA 2B3TA 3ZR4B 1E6EA 2PL1A 4NYIQ 1LVUA 1OLXA 4ZODA 4ZT7A 2YHIA 2PT6A 3LPLA 4JC8A 4L3OA 4YIHA 1H2HA 3WA7A 3AJDA 3A27A 3EIEA 4N03A 2Z5GA 4RKQA 1GTRA 2I2FA 3IV6A 3NC4A 4URYR 5CJPA 4A03A 3HJNA 4G24A 3WMEA 1K7XB 5FPHA 2ZZMA 1SOAA 2OESA 5F76A 1MJGA 2WUEA 5KOYA 1HLGA 2A94A 3C70A 4BL5A 1G8YA 3DHEA 3QK7A 4P86A 4YCAA 5A6SB 5CBPA 5KX5A 2VTBB 3HCWA 2G17A 3NDRA 1YTUA 4LFCB 4COOA 3IT2A 5JV5A 4PSKA 1ISHA 1XEFA 1RBMA 2GILA 1UP6A 2QAGC 3OZ7A 1DPFA 2DGDA 5TS3A 3LDUA 2UXDB 1V2HE 3H75A 1G98A 4MUJA 3EZXA 4REOA 3T52A 1GLVA 1D6NA 3RFVA 1JE0A 1NF3A 3FMFA 3RJ9A 3WDKA 1ZH6A 4BWVA 5GZ1A 4YJKA 3QX3A 1O9HA 1NXPA 5EFOA 1GRNA 3CNEA 1OFHA 2DPGA 2YH2A 3NWOA 1IWOA 4OKSA 4QTXA 4YUZA 1AA6A 3EEFA 2V8OA 3RSQA 1MB4A 2OK7A 3IESA 4B7UA 1FPQA 2VN8A 4EHIA 4E2WA 4IOKA 2PVSA 1XEWY 4G1FA 4DXDA 4WXHA 3THXB 3HG7A 2WJ4A 1AVTA 3T7CA 4CF7A 2XQKA 1QGOA 3O8OB 3LBYA 4X6LA 3DO8A 3RK0A 3PJDA 1D09A 3WMWA 4B9EA 4ZYYA 1P1KA 5C32A 4N3NA 5KWJA 3KLOA 3MS4A 3ILHA 4O4HF 1T13A 2GBPA 5CIYA 1OA0A 3WGYA 2EJTA 4A2QA 2VA8A 4C1NA 3PQ4A 4E88A 5IT4A 1G18A 1SXJD 3LMKA 1T5SA 1GARA 3QXXA 4Q4JB 3O4FA 5FIUA 4A4DA 1R9JA 3H1FA 1HT2E 2IEBA 4BVAA 3DPUA 2Y68A 3FI0A 5EKSA 3GGGA 4JELA 1U8ZA 2AE2A 3HKDA 3ZNPA 3ITKA 3I9MA 3HR7A 4EO9A 3CO5A 2X9LA 1J24A 3EZ2A 3H84A 3DLHA 3TVTA 1ZNWA 3MD0A 1YFKA 4CHGA 4BV2A 4F2PA 2P3QA 1VHDA 2GLUA 3LQKA 2X0DA 1OWLA 2BP7B 2CWWA 1QHHA 1RHQA 2J1LA 1S2GA 1B8PA 4FONA 1QZ3A 3VJLA 5JMOA 2C3OA 3SYMA 4IDNA 4EQZA 4OREX 4BMXA 4PO8A 1YJBA 4MLZA 5HIMA 2PUGA 3QWIA 1WXQA 1OPXA 4KI0A 4C5CA 1T3HA 4Z4FA 3QH4A 4YLEA 1KJIA 1TMOA 3B5JA 3KKOA 1H65A 1WCIB 3F6YA 2JH9A 3P9CA 4IUDS 4Y3UA 3RUEA 2CSXA 4OQZA 1NXWA 1ORWA 1Q74A 4UJ3A 5COAA 5EPOA 1SCNE 4MGKR 4BDSA 4DLKA 1VE3A 2QZZA 3ABSB 4G0ZA 3VZPA 1YS2X 3EGDB 1G60A 4XGIA 2F67A 3QENA 1PQPA 3LPMA 4OHCA 1XZCA 2PNJA 4M6WA 2A9JA 3M6VA 5I7EA 2A14A 1XMIA 2ORWA 5AK4A 3SWWA 3P9KA 1B3RA 1OCEA 3IAM1 4XJXA 5D84A 2IHNA 5F5XA 5ERXA 2ES4A 4INPA 4DCJA 3HVUA 2CLLB 3QEMB 4MGHA 5H1YA 5AKZA 5FA8A 3TM4A 4C0KA 4CMAA 4D3DA 5AM2A 2CXNA 1E2GA 3LOPA 4J0JA 2NVBA 1QH9A 3FGNA 4JLPA 2GRUA 1FZTA 3VJRA 3WY9A 3ZJYA 2QD3A 2XCLA 5FWNA 3KJHA 2PX2A 3L0IB 3N5CA 2P8JA 2BDEA 4EY8A 2V98A 3AB7A 4RESA 1EFVB 3VAAA 3KCQA 1KDRA 2GBGA 4YJ2A 5A1JA 5HF6A 3DM5A 2Z1DA 2C57A 4XXHA 5IX8A 1M0EA 1Z63A 2OCPA 2OVFA 3IPRA 3IP5A 1KP2A 2NU9A 1Q0HA 2W2OA 3P9NA 3RGWS 1BXZA 2G9VA 3CLSD 3OURA 5KMGA 2IYQA 2QM8A 1NC1A 3PXCX 4M4SA 3KETA 4CLRB 1QS0B 4MGEA 1H3EA 3FA2A 2R5FA 1IMJA 1T4DA 3S28A 1AO3A 1I3KA 4FKZA 4KQ1A 5J63A 1GZ6A 2VBGA 2Y0DA 2YFYA 4LV8B 2WJJA 4R1TA 4TZTA 3WGHA 2C2HA 3Q7PA 4FMCB 1QIDA 5FL7A 4BB6A 3GLIB 2NO0A 2ZYRA 3KD3A 4MR9A 1F7UA 2GKGA 1H05A 4DDKA 3EX7C 4BS9A 3ZDEA 2C31A 4E2YA 3LZ6A 2CF6A 5P8WA 4BZWA 1U8CB 2I0FA 3DF9A 4QYMA 1EP3B 3B1FA 4F6LA 1GPJA 3QSYA 1QTQA 1W2WB 3RC9A 3LUPA 3UG6A 3U56A 4EMTA 1IHPA 1RWQA 1T3ZA 2VRCD 5AIAA 1OKKD 1FDVA 5I01A 4M1MA