5F2EA

Crystal structure of small molecule ars-853 covalently bound to k-ras g12c
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
168
structure length
168
Chain Sequence
GMTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETSLLDILDTAGQEEYSAMRDQYMRTGEGFLLVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective Inhibition of Oncogenic KRAS Output with Small Molecules Targeting the Inactive State.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords GTPase KRas
total genus 62
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5f2eA00
2LCFA 5AJZA 3DPUA 4P31A 1PUIA 1N6HA 1U8ZA 4Q47A 1E9BA 3B1XA 1Z47A 2RGCA 2WSSD 4Q4AB 4A82A 3TGPA 1CBUA 3ZLJA 2IYTA 5DYGA 2QROA 2YC4C 3L8YA 3U60B 2WIAA 4QJ4A 1R0WA 3C4JA 1N5KA 3QPVA 5JCZA 1XBTA 2QE7D 3PG5A 4HDQB 2FFBA 3FDIA 2ZYVX 3VR5A 3QVUA 1NMZA 1RJ9B 2JASA 5FBQB 4OK3A 2W2XA 3AF2A 2GNOA 3B9PA 2WKQA 3CONA 4F92B 4WAUA 4DLXA 2QEQA 1KGDA 1XMJA 3REFA 3ASZA 1Q57A 4PPNA 3VFDA 1FP6A 2OXRA 4A8JB 4WIAA 1W2GA 4IXMA 3KL4A 3LBNA 4F4CA 4CZ2A 3SYLA 3NBXX 3MSXA 2QENA 4YONB 3Q5DA 4TQAA 1DARA 4JLVA 3TR5A 5JCPA 1CP2A 3IEUA 4JJZA 3DKPA 3IDQA 3TUIC 3ZS9A 2IUUA 2J59A 4AYXA 2XZLA 1BIFA 2KE5A 4Q7MB 1E9FA 4DZZA 3V00A 4CEJA 1OXUA 2AKAB 5KSPA 1J8YF 1KDOA 2REBA 4L8GA 1R0ZA 4YLGA 4DEYA 2G6BA 4I1VA 2QTHA 1HH4A 1NP6A 1MKYA 5HZKA 1W46A 3BAFA 2WBLC 1KMHB 1YKSA 3GJ3A 4XVQA 3A36A 2ZM5A 4JJKA 4F4JA 1GKUB 1G18A 2ANCA 4BRUA 2J1LA 2YINC 3PVSA 3M0EA 3FE2A 5EUQB 4B2IA 1HYQA 1N25A 1WE2A 4UXJA 5EP1A 3X1WA 1W49A 3OIUA 3UIEA 5EE5B 2QNRA 5CLQA 4IOMA 1F48A 1W44A 3AVYA 2IHYA 1XCGB 2LKCA 3L0PA 2PZEA 3QSYA 2BHRA 4UXHA 4JBXA 3F3YA 5UKDA 1TU3A 2WVJA 3QQ5A 3TW4A 2IYWA 4TL9A 4TTQA 3KUCA 5FOWA 1E9DA 1LFDB 2O8DB 4U7DA 4JZKA 3CRW1 1F2UB 1LY1A 4DLSA 3KFVA 1TADA 1OE0A 2OAQ1 4D82A 1D2NA 1W4CA 4MRNA 4ZO4A 3RRMA 4W5JA 4TYQA 3BGWA 3W34A 1JEDA 1Q1BA 1ANKA 3ZVMA 4Q19A 4QGAA 1FZQA 4GI7A 1JALA 4R71A 2D3WA 3GPLA 1DAEA 2OG2A 3T12A 4DT1A 1R2QA 3BBPA 3FMPB 4HUQB 4JSYA 5AUPB 2YWEA 1ZNYA 3DVLA 3P1JA 4JLKA 1KTVA 2V1XA 2H16A 2OAP1 5FOSA 2QZ4A 3FFBA 4EPWA 1LF0A 4XOIA 1GRNA 3M4YA 2WV9A 3VX4A 4I99A 4DCSA 3D8BA 4N0DA 2ZRFA 3PENA 1P62B 1BYIA 3QXCA 5TARA 3LVQE 2XNSA 3K09A 5JWRA 1BOFA 4N3NA 1Q20A 1CJMA 1VHTA 3B8HA 2ZS8A 2Z83A 2O8BA 3BE4A 1OFTA 4RSGA 3EC2A 1E0KA 3DM9B 3SR0A 4M21A 3EXAA 1P5ZB 3HU1A 1XMSA 2O8FB 4JMPA 3EZ2A 5J4KA 5TXGA 4IVQA 1WBBA 1T5LA 1FMJA 1MO5A 4R7ZA 1FUUA 4R2HA 2F3RA 1MRNA 2YJTD 4PR0A 1G9XA 5DE3A 5TB5A 5EE1A 3IHWA 3PJRA 4P4SB 1EFHA 1Y3AA 4B32A 2QMOA 2QSZA 4LY6A 5CLLA 2ZRDA 4EJSC 4Z8XA 2R65A 3FGNA 4MKGA 3UKDA 2GA8A 4TL7A 2ODNA 4EPXA 1FFHA 2HLDD 1RRCA 5FPTA 3X1ZA 1OFIA 2A3RA 2ZITA 3KQHA 1OV4A 2VHCA 3R8FA 4B33A 1G4AE 3QG1A 4M53A 3QBTA 4FMCB 1II9A 1YU9A 2FOLA 1QHNA 1Z5ZA 3LQQA 3EZ9A 4LI0A 2QAGB 4L4UA 1QHIA 3GLFE 3LLUA 4GP6A 4XWKA 1E9RA 1Q22A 4RY2A 4X8LA 1BO6A 1QHGA 4BE7B 2AN9A 3Q9LA 3WRXC 1Q1EA 3PV0A 3B1YA 2BBSA 3RWMB 1H8HD 2GEUA 4JLOA 5GJCA 2XAUA 1UFQA 3TVTA 1JQJC 4D81A 4PQRA 4D4LA 4KVGA 5B58C 2W00A 3KQLA 1XXHA 1YR7A 2WWYA 2NO6A 1JR3E 2PEZA 3LXXA 2WMOB 4AKHA 1GOTA 3LRPA 4XSGA 1U8YA 3UK6A 5H8WA 2PZFA 4FIDA 1Y63A 1JNYA 4JKIA 2Z43A 1Z0JA 2X8AA 3ZQJA 5C2JB 2ATVA 3LH5A 5KSZA 4TT3D 621PA 3NDBB 3I73A 4URWR 5C18A 1XDBA 3BK7A 3OF5A 3WNDA 2EWVA 4NP6A 1W4AA 3B1ZA 2O8FA 2E87A 2N42A 1Z0KA 1KAGA 3A58B 3ZD7A 1J7KA 2WWWA 4PSKA 4D4MA 3K9LA 4PX9A 1KJWA 1N0UA 2NOAA 4Q00A 3BB4A 5EE3A 5C4MA 5C1BA 3I61A 3ONWA 4LDJA 5J5CA 3DZDA 5EP3A 3UXMA 4TMTA 2V8OA 3I5YA 5FL7D 2FZLA 3A4MA 1FQKA 4G3XA 2EFDB 4CRWB 1PV4A 1ZM7A 4W5WA 3OAAD 4IDOA 2CMKA 4A0GA 2OZEA 2ZPTX 2AK2A 2ONJA 3I3SR 1NRJB 2XOKA 4LGMA 4POAA 1VECA 4V0KA 1OHHA 3QNUA 1VCNA 1FQJA 2FGJA 2CE7A 2X2FA 2ZI4A 3SS8A 4OQFA 1QVAA 2QM7A 2ERYA 2WWHA 5G3YA 2QMUA 3TUJC 4P33A 2FFAA 3C5CA 2AHOA 2OCYC 4URZR 1PLLA 1S2MA 4PSVA 4TLEA 4AKEA 2FSHA 4URUR 4YXWA 4PHHA 2A5YB 1QF9A 5JEDA 4CT4B 3P26A 4PC3A 1EWQA 1NG9A 2QPAA 3A1SA 1KAOA 3UMFA 1KI4A 4KCGA 2VP9A 4Q7LA 4GOKA 4Q21A 1OXTA 5HCNA 4TN1A 5L3VA 4MKHA 3G0HA 3W3AA 4KV9A 3TE6A 4D6PA 4LJ4A 4P4UA 3K9NA 521PA 2XEXA 3WBJA 4RCYA 1W5TA 2CVHA 3DEFA 3CKLA 4UNSA 3TSZA 3OESA 1ZCAA 4IVPA 5FUWA 3ZYCA 2O8DA 2BBTA 2XTZA 2Q21A 1KIMA 4WXRA 1F6BA 3QF4B 3VHXA 1ZYUA 2ZS9A 4ZV4A 2ZRHA 5D3MA 4TYWA 2PT5A 1PJRA 4YMVA 1G3RA 4BLRA 2VIIA 4KSCA 2RHMA 3UG7A 4BFVA 4QG7A 2CL0X 4RZXA 4EUNA 4I1SA 3RS7A 1IJEA 1OXVA 2BMDA 2W6ID 2J46A 1V5WA 5FR1A 1SXJC 4AURA 4LYAA 3CX7A 5EP2A 3U3MA 4YC7A 1P72A 1VKJA 2ZE7A 1KI3A 3E70C 4ZKDA 3IILA 1G16A 4NL4H 5IHPA 4NE2A 2GDJA 1U9IA 1XD8A 1ZBDA 2C9CA 2FG5A 1LW7A 1RFLA 1S1CA 3LO5A 4DLYA 2H17A 1MO3A 2J9RA 3RS0A 1AGRA 4MYHA 4ON9A 2ZJOA 2V7QA 2XSZD 4DDUA 1DBSA 1ZM9A 1G3MA 5JEEA 4DIDA 3C5HA 4Q1AA 3X1XA 2C98A 2VEDA 4V0OA 5E4FA 4PFSA 4D25A 2P2LA 1CR4A 3U44A 1ZUHA 2XGJA 3AVTA 1PZNA 3MJRA 2I3BA 4TMKA 1EESA 5J4HA 2VF7A 2ZIAA 1ZW6A 3I72A 4LYHA 2H8KA 4RD4A 2AWNA 3X1DA 4KU4A 4DJTA 1UKYA 4GPTA 5KNBA 3FKSA 1QHYA 1FP7A 1NN1A 1SHKA 1WRBA 3B60A 3GJXC 2ZJZA 1UKVY 2OEPA 3MD0A 4E09A 2B21A 4GSYA 1XMIA 4B48A 3GMTA 1OHHD 4Z1MA 1GNQA 5EZ6B 3QENA 3BH0A 4B76A 3L0IB 2OM2A 1XEXB 1VYTA 2RH5A 2IYXA 2OCBA 3UMRA 2XSZA 3VNVA 1U94A 4TYPA 3KKPA 2HYIC 5JRJA 4TLAA 5HTKA 1OH6A 4A8JC 3K9GA 2AD1A 1E0AA 3AKDA 3ZQ6A 5E3HA 1CJUC 2CCJA 2TMKA 3QEJA 3HJNA 3OE7A 4ZDJA 4QL3A 3IQXA 1R5NA 2OBLA 2GF0A 1Z06A 2CDNA 4L5BA 4UNQA 4E07A 2DYKA 1GSIA 3DZ8A 1VIYA 5KOYA 5H70A 4PZLA 4FI3C 4PAOA 4M9QA 3EPKA 1NMYA 4LBWA 3HPRA 4F7WA 2QAGC 2ZANA 4EDHA 4DC9A 5GJBA 4B3FX 2J7PA 4MGIR 2PZGA 3THXB 1ZM4A 4ABYA 3KJGA 4YMTA 5LDDC 1P2VA 1YZTA 2FF7A 4MYTA 4JLDA 2ODEA 5AJXA 1COWD 1K6MA 4OJKA 1O87A 4Q03A 2E9SA 4DDTA 2GHIA 3IKJA 4TWZA 4BGDA 5GVSA 4MRVA 1VHLA 1ZUIA 3ZS8A 1F3OA 4DCUA 1YR9A 3JZMA 2EW1A 2YHSA 3OEHA 4GP7A 3DKVA 3KFXA 2BJWA 1ZRHA 1YRAA 4P0TA 1DAGA 2YVUA 1EFRA 4HYYA 3AP2A 3TJZA 4HAZA 3THOA 1EFTA 2QMHA 3T1VA 1UDXA 3BB1A 2QTVB 3TW8B 4EPYA 4NKRA 4NU0A 1G7CA 3A37A 4B71A 3IUYA 1EK0A 1KSGA 2IXFA 4LWZA 2JLWA 2PLFA 3B82A 4GL2A 1A7JA 3KUDA 4Q5IA 1OW3B 3AVXA 4C7OA 3R20A 4BASA 5HR5A 1Z6XA 5K8UA 1EXMA 3AF1A 2IYUA 2Q6TA 3BRWD 1Z63A 5E7MA 3LV8A 2IYLD 2W6IA 4O0MA 3A1VA 3A4NA 4US0R 1XMVA 2IYRA 1FOEB 1C1YA 1KMQA 4C0SA 5K8LA 5FBLB 3TNFA 2NO9A 3U7EB 4DRZA 1G17A 1TEVA 1OLOA 4FMDF 1HV8A 4H1VA 3VX3A 2VHJA 1NI3A 5EXPA 1MOZA 5FTNA 4YDHB 4C0KA 2G0TA 1RC8A 1T6NA 4URXR 2DBYA 4XWOA 1QRAA 2DFTA 4EQ6A 1KZ7B 3LD9A 2H92A 4KVAA 1TUIA 1T0JB 3WNCA 3MAAC 2ZRCA 2GXQA 1W1WA 2JATA 2K5UA 2QQEA 4FMBB 3GLIA 1TL7C 3THXA 4QHSA 4B34A 4QKQA 1BKDR 1N6LA 3PR1A 4YMUA 3MWKA 2OXCA 4H1UA 4ILEA 1NG1A 1AN0A 1NL3A 5J4VA 2C78A 3FOZA 4LHZA 1TU4A 4RZ3A 2ERXA 1ESNA 5D3MB 4JT2A 4DBLC 5BWMA 2F9LA 3K70D 2C04A 4MQBA 4AYWA 3KB2A 4LBYA 1GZSA 3SYNA 4M9ZA 2OLJA 2ZRNA 2C03A 3SZRA 1RPZA 1SXJB 2ZJ8A 1C9KA 1OYYA 4PAMA 1IM2A 4Q4JB 3K70B 3GFTA 5IT5A 1YZGA 3B78A 1GILA 1HQCA 2YOGA 3CWQA 2EQBA 2RGNC 3N2IA 1GL6A 2F1HA 2GESA 4KSBA 2ZRPA 4HAUA 1OT3A 3NDPA 2YOFA 2ZI5A 1XTSA 4B47A 2FH5B 3UMSA 1G3UA 2XX3A 3SDZA 3RS3A 1KY2A 1YZKA 3FYHA 4M9XA 2WHXA 5FPSA 4Q02A 3U3RA 3WXMA 1R4AA 4OI0A 4LHXA 1U98A 3BXZA 3TSOA 4CDGA 3SJAA 5HZHA 2W83A 2Q9AA 1J8MF 5DHFA 1TTTA 2J0SA 1W0KA 5CK5A 3TAUA 4AI6A 3PEVA 4KFUA 1NVVR 2H57A 3DHWC 2V3CC 2Z5FA 4G0NA 1M7GA 3EWAA 4HB2A 4D0LB 4ZDIA 2GAAA 3RANA 2P3SA 4PC6A 4IDHA 3K1JA 1EGAA 2BMJA 2R6AA 3CRVA 1S1MA 4BFSA 1WBDA 1NBME 2JGNA 4OHWA 4TLCA 3AH8A 4YDSA 3AVWA 2KJQA 1I4TD 4Q7KA 1XCMA 3W5JA 1J99A 4XWAA 2QT1A 1QHSA 5D3QA 1G5RA 1UBEA 4PHGA 3RABA 1J90A 1S4QA 2DWOA 3EWSA 2O8CB 1CKEA 2ZREA 1E32A 2C5LA 1CJVC 4M2LA 3PUWA 2E1RA 3D3QA 1HEIA 2ZR0A 4I4LA 3BH6A 2F43A 1IXZA 2IT1A 5LD2B 4OQLA 2EYUA 3RSOA 2IK8A 2QGZA 1KKMA 2REOA 4QJ3A 1G291 3CPHA 3GEEA 3BD9A 1HUQA 4HAYA 3DO6A 2CJWA 5BYKA 4MRRA 1NNEA 5CM8B 1A5TA 2PJZA 4TSFD 2YKGA 2VP0A 1HURA 4AKIA 1NVWQ 1AM4D 1SXJA 2AWOA 2XJ4A 4Q4JA 3FB4A 2F1JA 1D5CA 1KO1A 1SULA 2JLUA 1TF2A 4IHQA 1WF3A 3AKEA 1YQTA 4RFVA 2HDNB 3VHLB 3EX7C 2KBFA 1TPZA 2P5TB 4AG6A 1DPFA 1WXQA 2H18A 2O0HA 4KFTA 3N70A 2Q0HA 2ZSEA 3OAAA 1G8HA 4QGHA 3WHKA 1XWIA 3GLGA 4AY2A 4KHZA 1N5JA 2FE4A 1KK3A 1M8PA 4BWYA 2IWHA 3SNHA 4AC9A 1XJCA 3QJYA 2AXNA 3MWYW 3HU3A 2QGNA 2X1VA 4WA7A 1MV5A 4MGYR 2JLRA 2NMVA 2GZDA 3ZIAD 3NWJA 4LJ5A 2PJRA 5AR1A 3ADBA 5JHHB 4YQFA 2C2HA 4XSHA 5AUQA 1JR3D 1ZC4A 4LBZA 4Y0VA 4HATA 1KOFA 2ZRBA 1NBMA 5TMPA 2G1KA 3SBDA 2D62A 2Z4RA 3K53A 3QKRA 5FOTA 4D0GA 2VO1A 2J41A 1JECA 3ADKA 2WM9B 1SZPA 5FTJA 3R7WA 3VAAA 1FMLA 1NF3A 2B92A 5FH9A 1JJVA 1W4RA 1G5PA 3ZZTA 3Q7QA 2IW3A 1N5IA 3ZZUA 1GDDA 2O8EB 3TUZC 1L8QA 2N46A 3BB3A 3AVOA 4PSAA 3RWOA 2G83A 4OQXA 5G3ZA 4TTPA 3D6TB 5SZKB 1JXMA 5JLJA 5FL3A 5IK2A 4NYMQ 2EVWX 2WICA 2G77B 5BYJA 4PXAA 2WIBA 1MO6A 4JSTA 2ZYUX 3EW9A 4WZBE 2JLYA 1FPMA 2ZYWX 1J2JA 2ATXA 3VQTA 2NGRA 2YOHA 4DUGD 4EFNA 3VTKA 1N5LA 4L15A 2OESA 3CM0A 4JLMA 5AUNB 4V0LA 1BMFD 1E2PA 5JS7A 2ZVQX 3LVRE 4JIMA 5F2EA 3PIRA 2HLDA 1DS6A 2V54A 2WAYA 2IBMA 4HUTA 3GLGE 2D2EA 2QMEA 5K8TA 1UEIA 3QOFA 2ZUBA 1IJFA 4RFSB 3W8RA 3QKUA 5CIWA 1DAHA 1HQYE 3OEED 5DI3A 2P65A 1XTQA 2EFEB 4JKYA 4URVR 1KDRA 4PHTA 4NCKA 4CIDA 3NBYC 4DKXA 1XFAA 1KI6A 4ZCIA 3LDAA 3X2SA 1KDTA 3KB1A 4N1AA 4MUBA 4B3DA 2W0MA 2OCPA 1XTIA 1KI1A 1TF5A 2MMGA 5JI2E 1QHHB 1ZD8A 3T5DA 4BZQA 2YZ2A 2QP3A 4W7SA 3IEVA 5M04A 1W4BA 3GP8A 3KQUA 2J45A 2FPKA 2GVZC 4K8OA 2KSQA 3IPYA 5LB2A 3MG9A 2HJGA 2GCPA 1ZJ6A 4LX0A 4LV6A 1E3MA 1FX0A 3FHOA 2J7KA 221PA 2NTYC 3ZVRA 1IBRA 3IBYA 1NSFA 2R6CA 4DCTA 4QM7A 4FCVA 1MT0A 1NN3A 4R2IA 5FUVA 5TDHA 1R6BX 1T3LA 1UJ2A 4IDNA 1KO4A 1XPRA 4BLSA 1E9EA 2AK3A 1NN5A 4A6PA 4U5XA 2C8VA 1G5TA 3ZGXA 3B2EA 3WP1B 4KO8A 4KJZA 3IIMA 4Q9KA 4XJXA 4BLPA 2F55A 4QHYA 2VP5A 1F2TB 5BW8A 4ZCLA 4RZ2A 4B2LA 1NMXA 1DTSA 1TX4B 4LHWA 1Z6AA 2WSSA 4ACBA 2MSEB 2Q3FA 4Z51A 2FGKA 3TBKA 2L0XA 4K81B 2GZHA 2IS2A 1R5BA 2A2ZA 1NJFA 2OFWA 3SI7A 4D0NA 3ICQB 2KB0A 3W90A 1KNQA 2G88A 4QJ5A 5FUYA 2NO1A 1Z6GA 1G19A 1M74A 3KX2A 1RE0A 1MH1A 1CJKC 2ZUCA 4F93B 1ELOA 1SKQA 2R44A 1OB2A 121PA 2GRJA 5GJVC 5HKKA 5KO2A 2FMXA 1M7HA 4LHVA 3K8YA 3D7MA 3W8NA 2F7SA 1XB2A 3GJ4A 1CF4A 2FEMA 3AP3A 4JBWA 3GLHB 1DE0A 3MWLA 3OIYA 5KSOA 2HT1A 1FTNA 2GXSA 4BLTA 4LZZA 1SVKA 2JLSA 4NONA 4R9UC 2PBRA 5KYKA 4NYJQ 4LYFA 3V4RA 2FU5C 5FFMA 1G8GA 3ZJYA 1RZ3A 3PUVA 4HLQB 5SZHB 1SVLA 3CH4B 4NH0A 1Z6TA 2IS6A 2I4IA 1FX0B 5IK2D 2RGEA 1NVUQ 1GL7A 3L82B 3S1AA 5DNYB 3RC8A 4AG5A 1L4UA 2VBCA 3GJ5A 3GLIE 2WOOA 2Z4SA 3R8CA 5F3WB 2V55B 4GZMA 1G7SA 2HCJB 2KI5A 4WBSA 4AWXA 821PA 1CIPA 2JIZA 2GCOA 2GJ8A 2IEYA 5FOUA 4B35A 3HU2A 2XZOA 1G3QA 4DLRA 2CEAA 2IL1A 4OYHA 3BIFA 4A2QA 1LTQA 4IOKA 4EKDA 1LS1A 4LJAA 2ASEA 3WYFA 1VIAA 4WZ6A 1D9XA 4KXFB 1E9AA 3HDTA 1U99A 4XTCS 1FW6A 3AF4A 5EUMA 5KHOC 4G5SA 1SVIA 1OH8A 1G7RA 4CT5A 2J0QA 3OIWA 4TZ6A 1KKLA 4Q4HB 1E2QA 1E2GA 1E4YA 2O0JA 1QZXA 1OH7A 3E5HA 3B1WA 1T9HA 2GZAA 1SQ5A 1S0UA 2GF9A 2RHDA 1L2TA 1PLKA 1XXHB 2A5JA 1G6OA 2CVFA 3CO5A 5AK0A 3D31A 3PXGA 2ZI3A 1A82A 1R5OA 3FWYA 2PMDA 5IRCD 1AZTA 5A4JA 4OK6A 2AL7A 4DB4A 4PZZA 3TH5A 4DVGA 3NG1A 5JJKA 1KI8A 3WBKA 721PA 4QBGB 2VSOA 4TZ0A 3GLHA 2P0EA 3KXKA 1XJQA 2VLIA 2LKDA 2VP6A 1NVXQ 2CHVA 1I2DA 1ZUNB 4MKFA 2XNDA 5DHAA 5FOXA 1N6NA 5F98A 3L2OB 2JDID 2AX4A 4KLZA 4U00A 1NIJA 3ECCA 4HLCA 4MRSA 1R0XA 1ETUA 4IW3B 1U2RA 4WZAE 2IYZA 2RGBA 4G1UC 4C9BA 1DG1G 1DO2A 1RRGA 2A78A 3IPXA 4YMSA 2GKSA 2WJHA 1IN5A 3EA5A 4LJ8A 4ARZB 3QIAA 4NCHA 2AKYA 4HAVA 3UWOA 4E5UA 2DY1A 2P6RA 1E4VA 1G1MA 1GNPA 5FPKA 1MRSA 4NTZA 4BZPA 2RGGA 1DAFA 1AJEA 2B8WA 1M1YE 2IUTA 2ZJAA 1P9RA 4LSGA 2A5DA 3EZFA 2P6UA 4NYMR 3ICEA 3LW7A 1JBKA 2N1BA 5KPJA 3U7HB 3O8RA 4HB3A 4TQUS 2C96A 1D8TA 4GOJA 1AQUA 4Q01A 5CJ2A 4BFXA 3WHLA 4Q9IA 5GVRA 1T8TA 4HSEA 3R9WA 2ZJ5A 4RKEA 3V4FA 3CR7A 3T35A 3FKQA 5AJVB 4C0AC 1W0JD 2GETA 3N2EA 2CK3A 2GJSA 5GADl 1XNJA 4WOPA 4EIWA 4IJMA 4JLNA 2ZRAA 3FVQA 3RS2A 5CB6A 1P6XA 4PANA 4DLTA 5L8VA 2VPPA 3FMFA 2BEKA 4DCVA 3B9QA 1JI0A 1CXZA 2DWQA 4I1OA 4UKDA 1TQ2A 4JVMA 3SHWA 3ZIAA 2WZQA 1XD2B 2VHTA 3GLHE 2GTPA 3DMDA 4CVNA 3M1IA 1T3SA 3WMFA 3FHTA 4B44A 3ZH9B 5JZVA 4B3GA 3QKTA 3AVQA 1S3SA 2GWHA 5KDOA 1JXOA 5JJIA 2BCJQ 3SFVA 1L4YA 2OCAA 2UVQA 3UPUA 4GZLA 4E22A 3SJCA 4GMDA 2QL6A 4R98A 3HPQA 5FTMA 3OEEA 1N0VC 2NG1A 4M1KA 3V9PA 3TMKA 3BERA 5IDVA 1GITA 1ZMXA 3MWJA 4XD7D 3C14C 1TMKA 2XJ9A 2XTNA 4IEEA 5J4YA 4ZIRA 3BWDD 3Q3JB 1YVDA 4DHEA 3VMFA 2ZE8A 5LB4A 4PQYA 1RJ9A 4EJSA 3ADCA 5FPYA 1YZUA 1ZNXA 2ZI9A 5JECA 3PEWA 4WW0A 3EPLA 2FWRA 1T0HB 3JVVA 2DHRA 1UM8A 3DOEA 2H5EA 4ASUA 2MMCA 3CZPA 5H68A 2BEJA 3KKQA 1Z08A 5EZ5A 1Z0DA 2ODWA 5A5GA 4L9SA 2Q3HA 4Q9LA 1JR6A 3H84A 3CWZA 3T5GA 1QHXA 2IHBA 4LC1A 1XU4A 1N2CE 3U44B 1KNXA 1WQ1R 3OZXA 3P4YA 4OJQA 4P32A 1I2MA 1UDWA 3L0SA 1X8KA 2ZJYA 1JB1A 2R6FA 3UANA 2ZEJA 2IYVA 3Q8XB 1AS2A 2BKEA 3KKMA 2JAQA 2OFXA 1DAKA 2WMNB 4CEIB 1LV7A 1H65A 4B6FA 2CCGA 5BXQC 1E0SA 1Z0FA 2EFHB 2WJYA 1GG2A 3IIKA 4PO9A 1RYFA 3QKSB 4LUCA 3O47A 2V1UA 1CULC 4M9SA 2JDIA 5BN5A 4LOAA 2XNDD 1RVDA 4PZYA 5DO9A 1OKKD 4KYIB 1D6JA 3LXRA 5EE0A 1NKSA 2ORWA 1WB9A 1S9DA 5FTLA 1XEXA 2A7QA 3BOSA 3MGCA 5BN3A 1A2KC 4LV5B 1E96A 3VR2A 4OQMA 2QU8A 2A30A 3NC1C 4Q1FA 1Q3HA 4K46A 3W6OA 2IF0A 4HDOB 1SVMA 5FPHA 4DB2A 2WKPA 1JPNA 4AIIA 4DDWA 5P21A 1W36C 1F2UA 2FA9A 4KITB 3TSWA 4HB4A 4HUQA 1YZNA 1KSFX 1G41A 2FPLA 2QPTA 2ANBA 2GJ9A 2WWIA 1ZINA 3KTAA 2FPMA 4PPQA 4FD2A 1KO5A 1IN7A 4EJSB 4EPRA 2GEDA 3NHAA 1CR1A 3TIFA 2ZE6A 1Z2AA 2C99A 3U6KA 3BS4A 3UG6A 3KQKA 4J0QA 4DT1B 1GKYA 1ZNWA 1CJTC 3BC1A 3QEOA 4HI0E 1PLJA 5JJLA 2QP4A 3DM5A 1W7AA 5CYOA 2UZ3A 3JZAA 4MGZR 2GCNA 4AYTA 2IS1A 2J7PD 1E2EA 2FFHA 4ZCMA 4KI0A 4B75A 2PCLA 1FNNA 1H8ED 3KKNA 4F4IA 4KLNA 3THWB 2JJ2A 1NBMD 3WMGA 1AS0A 5GJWC 5DN6D 4PPGA 2NQ2C 3ZZ0A 3FPAA 2BV3A 1DAMA 1ZAKA 1KI2A 1G4UR 2BOVA 4A92A 4FWIB 2GBLC 3F8TA 3PUXA 1UKEA 5LD2C 3THYA 2WJGA 2O8BB 4JLBA 1ZM3A 4MKIA 4BFZA 4BLQA 1G3IA 1BYUA 4PHFA 3RRZA 2QY9A 1E98A 3K0SA 4CEIA 3IIJA 4UXIA 2VSFA 2OT3B 2P5SA 2RCNA 3QKSA 2NIPA 2GXAA 3O8CA 2WJIA 3VKHA 4M1YA 2ZRGA 3SE0A 1G64A 2X77A 2W2VA 1IXRC 4A0HA 4DSNA 4IVRA 5C4GB 2PCJA 3NXSA 4BFTA 1NLZA 5JHGB 1JR3A 3F5FA 2X2EA 1E79A 5HKKD 5JI3E 2F6RA 2BMFA 2W58A 3RVBA 1S9HA 2PX3A 4M0LA 1SKYB 1ZD1A 4PO1A 1E2IA 3NBFA 3PUZA 4G01B 1BMFA 2QAJA 3RAPR 3BFXA 1KK1A 5FBWB 3Q72A 1E1QA 1HA3A 2KWIA 3FKSD 1NN0A 2QAGA 2FNAA 2ZU6A 3EA0A 4QFMA 2HF8A 4UQOA 3RNLA 2JLZA 4DUGA 2O0KA 4GFDA 4NZYA 4A36A 1VCMA 2FSFA 2G3YA 1QDEA 3W5IA 2ZI6A 3ZVLA 5JWHA 3BJIC 1IHUA 3I4LA 1MABB 4DSOA 1NIPA 1NLFA 3SFZA 4EQ6B 2EFGA 4M1WA 4OQNA 4Q1DA 1FL9A 1SVOA 5G41A 4JL6A 2YNMA 4LPSA 2IX3A 1E9CA 2JLXA 5KPDA 1XD2A 5FBRB 5SZJA 4RKFA 4D4KA 4OKSA 1L7VC 2IXEA 1NVVQ 4MA4A 5BQ5A 4NYJR 2GILA 1NJGA 2ZS7A 4PQFA 4QM6A 4NMMA 1M2OB 1G21E 3HWSA 3K0FA 4PC1A 3ND9A 2CE2X 2D74A 1ZVQA 3MMPA 1D2MA 2VHUA 2LWIA 3CRMA 2OILA 2DFLA 3U2QA 3C15C 5G53C 3IHLA 1G6HA 5CDFA 4IDQA 4MH0R 3I5XA 4ERNA 3U4QA 3CNNA 1GRRA 2HF9A 4HZUB 4HAXA 2G1JA 4FCTA 5J40A 1E2KA 1KHTA 5HE9A 4M4SA 2DFNA 3B13B 2NZ8A 5F9FA 3B85A 1XP8A 4GT1A 3CPEA 3QE0A 4MITA 5KDDA 2EU8A 1VMAA 2ZI7A 3NVAA 2J0UB 3L0OA 4DWJA 4MGKR 5KTYA 3KDSE 4M1TA 1VG0B 2VYFA 1W0KD 3CRRA 4FINA 3R9XA 3WYGA 1OXXK 1SXJD 4FMDB 3RDPA 4C30A 3H0KA 3WP0A 2BC9A 2ZRMA 4NDZA 4JYCA 4B3BA 4GDFA 1SXJE 4JYBA 3J81k 3TR0A 3A6PC 2F9MA 1W2HA 1OYWA 3TRFA 1CS4C 2Q9BA 2OO7A 1LF5A 3PITA 3NIBA 3KXIA 3QXSA 3IQWA 2WAXA 4XIGS 1D2EA 4FW9A 2YYZA 4TLBA 1TQ4A 1IN4A 3VKGA 1G8PA 2O8CA 2HYDA 1EFRD 3K0EA 3U7GA 1P3JA 3EIHA 4NCNA 2D4HA 2F43B 1A2BA 1Z29A 3A4LA 4O3MA 1ZC3A 4IOLA 2B7BA 2CNWA 3OFNA 1GVNB 3MRSA 3EIEA 3NKVA 3RC3A 3LLMA 2JJ8A 4LJYA 1OFHA 4QNRA 4M8NE 3QY0A 4KODA 3PUYA 3U3KA 5JWOA 3H86A 3QF4A 5EP4A 3U6BA 1Q44A 3I8XA 1JEEA 1IQPA 5AJYA 1UAAA 5AUOB 1DOAA 2VL7A 2IA5A 2WTUA 4AKGA 4A9AA 2J3EA 2JLVA 3KTAB 5FUXA 1HT1E 1OIXA 2HT6A 3U4QB 1LS6A 3R9IA 1BH2A 3AV0B 2ZSBA 1JAIA 1C4OA 3REGA 1NY5A 2QT0A 3OE7D 4Q48A 2ZRIA 3VU9A 3GLGB 4ESVA 4IFEA 5IF9A 2QTFA 4N0EA 5JSZB 3HP1A 4C3ZA 2ZR9A 4TL8A 2VP2A 3BH7A 3LBIA 3I92A 4ESHA 5KUTA 1RW4A 1AKYA 4LJ6A 2OHFA 5EE9A 1IN6A 1OSNA 1ZIPA 2B8TA 1SHZA 3A1UA 3LFUA 3QXXA 3U5ZB 3IO3A 4RZUA 3OIVA 3LA6A 4BRWA 2FN4A 1VCOA 3MJHA 2GJAA 5KDLA 4S35A 2XB2A 3OHMA 3QG5A 1ESMA 1E2JA 3IO5A 1G7TA 5DLQC 2XITA 4DDVA 3I8SA 1US8B 2YWGA 1KMHA 4ZPXA 2CHQA 3SQXA 2UZIR 2ZRLA 4PO8A 1OJLA 1W47A 1XTRA 2PX0A 3O8BA 3GFPA 3EAQA 3X1YA 5DGXA 1A1VA 2W2TA 1EG7A 2PMKA 2ZSFA 1J70A 3E2IA 5E7IA 1N6RA 5KSYA 2HXYA 1WCV1 1TF7A 1VTKA 3FHCB 4LCBA 1CLUA 4X8HA 3T15A 2ZVPX 4DLWA 2J5XA 3NC0C 3KXLA 5B64A 1GAJA 3H1TA 1ZNZA 2ZQ5A 4JVSB 1COWA 4FWTA 1W48A 2DPXA 2RGXA 3IGFA 3HYRA 1SKYE 2YV5A 1UBFA 5AJWA 3RRYA 5JS8A 2FDCA 5J47A 1T3HA 1T5IA 3P27A 1P2TA 1FNMA 4TQ9A 4KYUA 3O8DA 4HLUC 2F1IA 3EZ7A 4A1FA 4AK9A 3FMIA 4D4JA 2B6HA 2R6DA 4QC2A 4A0FA 1MABA 4L16A 5BN4A 1RYHA 2BDTA 3RHFA 2BBWA 1KK2A 2FSIA 2ZSDA 1VYVA 3VU9B 3T61A 4RFSA 4UNRA 1P2UA 3GJ8A 4B73A 1GM5A 4TT3A 3P32A 1XRJA 1UBGA 4OHXA 2D2FA 3QI2A 5DI9A 4RD1A 1KY3A 1VDZA 3WY9A 4LPKA 1Z2CA 4GOXA 2ZTSA 1X8LA 4LV8B 1OFUX 2OE2A 4IFBA 4II7A 2X19A 3K0FB 4LRWA 3LWNA 4F91B 2VSXA 4LHYA 3CNLA 3FFAA 3W6PA 3HR7A 1YR8A 1AK2A 1RRPA 2Q9CA 2RKOA 3EG5A 4GRAA 4S2EA 3AM1A 1Z28A 1JPJA 2ZU0C 3WRYC 2ORIA 3RSLA 4B3XA 3I32A 4ZDWA 3LW8A 2WJJA 4MDEA 1EFCA 2A9KA 2VH5R 3T1TA 1US8A 3B5JA 1JQLB 2MSCB 4O2RA 4TMZA 6Q21A 3PCRB 2FSGA 5LPNA 3EZ6A 3G82C 1GP2A 1E2NA 1NKTA 2IS4A 4Q9JA 3CUEF 5CYPA 1QBKC 8OHMA 3VKWA 2CHGA 3MFYA 1X1RA 3W9YA 3MUFA 4C7OB 2ZE5A 4JT4A 1NSTA 4ITRC 1DVRA 2OBMA 2P6NA 1V43A 4BLOA 2BIFA 1DADA 5FI1B 2J0UA 2NPFA 1U81A 2GXUA 1E9SA 3AKCA 4Q18A 1FTSA 4CEHA 3SJBA 2ZAOA 1F2TA 2JJ1D 4P4TA 4OI2A 4LK2A 4A2WA 4JLJA 1E2MA 2P67A 3ASYA 2W6JD 4C2UA 2WWFA 1K8RA 2IEZA 3L43A 4V0ME 5FOVA 2CXXA 4EPTA 1TNDA 5F9HA 1S96A 4OL0A 2JEOA 5HE8A 3M6AA 2ZSAA 2AFHE 1X1SA 1X6VA 3P4XA 2ODBA 2EWWA 2QRZA 4JS0A 1CR2A 1VG9B 4IKEA 4UNNA 5DISB 1LVGA 3QVVA 2QBYB 4Z54A 3F0TA 4I1UA 3H4MA 4MDFA 5JRZA 3ZD6A 1W5SA 2QUZA 2VHQA 4TMVA 4DCNA 1GTVA 1OIVA 4KBFA 4X8MA 1E2LA 2ZYTX 3AGPA 2C9YA 3CW2A 4H9GA 3W6NA 3GLIB 4Z1MD 3CZQA 2FZ4A 3GD7A 3T1QA 4AD8A 2IXGA 3N5CA 4D2IA 4B43A 3RYTC 3EPJA 3CF2A 4P3YA 3PFIA 1MO4A 2HEIA 4JL5A 2C77A 1KSJA 4URYR 1RRFA 2QSYA 1Z8FA 1UKZA 2Q3MA 4M1MA 4OBEA 3VR6A 3QPWA 3SJZA 2CBZA 4DEXA 4XH9B 5L3QB 1XTJA 1IY2A 3AB3A 5TY0A 4C2TA 1WP9A 2VRWA 3QUSA 1SGWA 4G5GA 2CNWD 1YHNA 2VP4A 2BMEA 1HE8B 3VR1A 3SU8A 1TUEA 1SVSA 1Z22A 3QF7A 1ZM2A 5FI0B 1KJYA 4MRPA 1PVOA 4UNPA 4OI4A 1GNRA 4V02A 3DOFA 4QGFA 4EFLA 1II8B 5E7JA 4ACAA 4BUJA 1ZU5A 2V7QD 3DMNA 4M1SA 4NCIA 5DYIA 1VG1A 2GCOB 5JSZA 4QHTA 5FL7A 4B6EA 2BJVA 3TAHA 1AQYA 5B30A 3K9HA 4CW7A 4XVUA 2BM1A 4Q1CA 4CEHB 4US1R 4V0MA 1DG3A 1N3BA 4U02A 1E99A 3GJ7A 1IY0A 2V6JA 2ZAMA 3QXHA 4FXPA 4LBVA 2ZRJA 2V9PA 4OHVA 1Q1ZA 5FR2A 3LX5A 2WKRA 3MLEA 2I1QA 4IOJA 5KNCA 5KNDA 1R8SA 2GJKA 3B7GA 2XXAA 2NZJA 1Z07A 4RVCA 3KJIA 3PEYA 2R6GA 2QRNA 4O25A 1E2HA 4O2LA 1M34E 1Z83A 2WSMA 1OPXA 1I4LD 4PAQA 1GWNA 1VYUA 3C8UA 4XTRA 4Y0AA 5DH9A 4TYNA 2RB4A 2BVNA 2ZXUA 1W36B 2W6JA 3G5UA 3TK1A 1H8HA 1TAGA 2JJ1A 2FEOA 1P60A 2QI9C 1DELA 1RIFA 1IONA 1U90A 2CLSA 4BZXA 5G40A 2EFCB 2OUKA 1VCIA 1XF9A 4FCWA 1N6IA 3A1TA 2O5VA 1Q12A 1Q1QA 3CR8A 5EXTA 2CJWB 5L3QA 1K5GA 4Q66C 1KZGB 1CRPA 2GK7A 1GKIA 2WOJA 1T4GA 3EPHA 1N6KA 1YE8A 1YZLA 2OFOA 4JL8A 3AF0A 4ARZA 1QG2A 1P2SA 1X8JA 4BQSA 2ZJBA 4KFRA 2VA8A 2AD5A 1AGPA 3Q5EA 1ZIOA 1TEXA 1Z3IX 1VG8A 1N0WA 1ONBA 1P75A 2OV2A 4GBMA 1XPUA 3B1VA 5ELXA 3UWKA 2XOKD 1CR0A 1GL9B 2C95A 3OEHD 3K0CC 2WPDA 1GRQA 4BFUA 5CITA 5AWFC 2XB4A 1Q0UA 2WWGA 4HB0A 2QA5A 3I1FA 1KYIA 3GJ6A 4G5OA 1P7CA 3SQWA 2RGNA 3T06B 3IBGA 5TV2A 3AVUA 3Q85A 4X8OA 3WYAA 3LY5A 3SOPA 3KKOA 3GLFA 2VF8A 3A1WA 3TLXA 4QBHA 2HUPA 1XXHE 4TTRA 4NHOA 1CU1A 2RGAA 3TQFA 2IYQA 3A8TA 2DR3A 1B0UA 2ZUDA 3AQ4A 4L9WA 4QRHA 2ONKA 4JLAA 1KI7A 1UADA 3P20A 5EXXA 1E2FA 4HLDA 2FX3A 2H7VA 2Z6VA 2W0SA 4C0JA 1EX7A 2PEYA 1M7BA 2BCGY 4NPHA 2QN6A 2OSBA 3BFKA 3T1OA 1U0HC 3E1SA 1AKEA 1P4SA 3QKRB 2O8EA 4PC7A 1R10A 2UKDA 2RMKA 1Q21A 2HCBA 1F60A 3AP1A 1N6OA 3OFND 3K0AA 4B3CA 3R7WB 4US2R 3CX8A 3KJHA 4DIEA 1ZP6A 4GMXA 1N6PA 1E69A 1GIAA 4EFMA 4DLUA 3RS5A 5DN6A 2XTMA 1OB5A 4ZIRB 4HDCA 1CTQA 3L8ZA 1IAQA 2YC2C 4Q4LA 2PH1A 5DSZA 1UF9A 3UATA 1KJZA 4YXWD 4I81A 4NYIQ 1GFIA 1OIWA 5CK4A 1E1QD 2HV8A 4G5RA 2QBYA 2WJVA 4BECA 4W5HA 2HJVA 1RKBA 4HAWA 4BEJA 4RD6A 2YWHA 4RJLA 4EPVA 3TKLA 1F5NA 1ODFA 1OKKA 3FTQA 2QE7A 4QBIA 3ND8A 2H1LA 3TQCA 3VR3A 3RRNA 5CB8A 1EWRA 1KI6B 1S8FA 2CLCX 3EASA 4GNKA 4D26A 4KAXA 3SBEA 1E94E 2FJUA 4G5QA 4OHZA 1Z0IA 5DI3B 1QHHA 2GAOA 1E1RA 1U8AA 3BFVA 3ETLA 4NBSA 4A2PA 1XZQA 2REXB 2Y8EA 3CX6A 5TVKA 3AVPA 2WWXA 4B74A 3ZVNA 4A0RA 3C41J 2RGDA 3SEAA 1DO0A 3HR8A 4TL6A 2OLKA 3QBVA 3QPUA 3AUYA 2KBEA 4F38A 1E2DA 1HY3A 4CYMA 1II8A 1R8QA 4OI1A 5FBVB 5CIQA 2PL3A 3W3ZB 3HYTA 4BFWA 1W0JA 1KK0A 5B2ZA 1M6NA 2QM8A 1XJ0A 2ZROA 2D7CA 1P73A 2R2AA 1CEEA 1P9WA 3MCAA 1OF1A 3AEZA 3CH5A 2XZPA 1WA5A 4Q4AA 1OH5A 2G0NA 1JJ7A 1P61B 4IRUB 1XD9A 3GFOA 3Q7PA 3PEUA 1CRQA 1KDPA 1VPLA 2J87A 1ZD9A 5SZIA 4A4DA 3DDCA 4Q1EA 4JVNA 1KO8A 4D80A 2OBNA 4MUAA 4OK5A 2FFQA 4UJ3A 5HPYB 4KBGA 4DXAA 1KI9A 4A6XA 2XXAB 4ASUD 4A8JA 2AFIE 3RLFA 1U0JA 3K09C 1QVRA 4ZDKA 5EXSA 2JCSA 1YRBA 3GQBA 2ZETA 1S3GA 1K5DA 1NLYA 3CNOA 3LX8A 2ORVA 3THWA 1T8UA 2IUSA 5L3RA 1G20E 3EARA 2DB3A 2IC5A 3GEIA 2QPOA 1E79D 4DSUA 2CCKA 1EFUA 1KO7A 2HXSA 5B57C 1O3YA 3CPJB 4CEJB 3THYB 1MR3F 1AA9A 3CIOA 2B7CA 4IXNA 3TVDA 4TMWA 4TMXA 1T91A 3LAWA 1A4RA 2DCUA 4EAQA 4YMWA 3U7FB 2ZJ2A 4C4PA 5EQTA 4QNMA 3SC3A 1SVWA 1Z6YA 2J0VA 3NEYA 4FN5A 4BFYA 2V6IA 2QG6A 2DFKB 1FUKA 1QG4A 1XCPA 1XEWX 2AXPA 5JFGA 2BKUA 3NEJA 2IF2A 4ZI3A 3GCGA 5JMTA 4TYYA 5CJPA 1U9IC 1I4DD 2RAPA 2O52A 1JAHA 3S1AB 4M22A 4KFSA 4BEBA 2JA1A 1E0JA 2A5GA 4JBYA 1ZCBA 2EYQA 4ZKEA 3CRQA 4Q9HA 2JJ2D 2NO0A 3LBHA 3NH9A 2I1VB 3AUXA 1H8EA 2CK3D 1LB1B 3ZDQA 1ZU4A 5LBIA 3VNUA 2PT7A 2IYYA 2R9VA 4DLZA 3NBZC 1AS3A 1YJ5A 1G8FA 2MSDB 2QORA 4ZI2A 4WXPA 5H1YA 4IDPA 4WVFA 1G8YA 5CDFE 3VR4A 1U0LA 4JLPA 4QXAA 1XX6A 4C0BA 2CL6X 1YR6A 2GVDC 2QQ0A 4PPFA 2AR7A 3GLFB 3AGQA 3SHFA 2G9NA 4HZIA 1EX6A 5ANRB 2SHKA 1R7RA 3FMOB 2IYSA 4MYUA 4Q7JB 3GJ0A 1HTWA 4Q4HA 3RS4A 4CGZA 4V0NA 2BWJA 4M1OA 5L3SA 1IN8A 2CLDX 4RD2A 1E1RD 5EJEA 1R0YA 3I62A 5DIFA 5A0FA 5JBQA 4E03A 3KZ1E 4LJ7A 3AVVA 3K0AB 3CF6R 3U3JA 3PQCA 5C46F 4QBFA 3NH6A 3H2YA 1D9ZA 1X3SA 2WPDD 1TQ6A 4Q1BA 3KQNA 3KJEA 2Z0MA 1UBCA 1XZPA 2IWRA 2R8RA 4RD0A 1XEFA 2JLQA 4C0LA 3DL0A 5J4LA 1NY6A 4UJ5A 4HZUA 4QOSA 1LNZA 1XPOA 2F3TA 3BORA 4TSFA 4CF7A 3EIQA 5CM9C 4DLVA 1UPTA 1XEWY 2V4ZA 4JVLA 2BBOA 4XVRA 4LYJA 2PLRA 1GUAA 1Q3TA 4Z8YA 2GK6A 4P4SA 2JIZD 3NTUA 4DSTA 2ZR7A 3QXJA 1B23P 2D7DA 3WNBA 3SYKA 5E95A 2VQSA 4TLDA 1IY1A 5K8IA 4HLUA 421PA 1WDTA 5KU1A 1AZSC 1P9NA 2ZRKA 2NO7A 3NHBA 4BPBA 1IXSB 1II0A 4OHYA 4QGGA 4B2PA 4HEJA 4W9MC 1AIPA 1E6CA 1YZQA 2A5FA 3C16C 2NPIA 3GEHA 5HCIA 3WMEA 3JVUA 4NYIR 1W36D 1KSHA 3LQRA 3C7KA 1OXSC 1Z0AA 3CBQA 4RCZA 4C0HA 3U61B 2DWPA 4LJ9A 4IEIA 2F1RA 4RD3A 2D06A 3T34A 2GBLA 3K0CA 1DEKA 4PC2A 2FV8A 4C0QC 1UEJA 3AF3A 2QP9X 2GEVA 2R62A 3LNCA 1X86B 3ADDA 4PTLA 2CL7X 4MYCA 1WMSA 2YWFA 4V03A 1TQDA 3B6EA 4XD7A 3K70C 2BM0A 3CB4A 2C9OA 2VTKA 3EC1A 3AKYA 5L3SB 1DAIA 1PUJA 3SN6A 1IOZA 4NCJA 3CLVA 4FMCF 3U3OA 4A15A 1HT2E 1BS1A 4LC0A 2ECKA 1HE1C 3CF0A 1XTKA 5FTKA
chains in the Genus database with same CATH superfamily
1G20B 4TWRA 2O7NA 3AL2A 2UUAB 2QLTA 3DPUA 5DHPA 1PUIA 1UMCB 4FFMA 1N6HA 1U8ZA 2R8YA 4Q47A 4R8LA 1Z47A 1PZEA 3IHTA 4E1VA 5U9CA 3KUXA 3DAPA 4GAEA 4IILA 1YBFA 3TGPA 3FZYA 5DWQA 2IYTA 4TV8F 4BNFA 4ARCA 1XAIA 2QQ5A 3L8YA 4B3HA 1C7IA 3HRIA 3ZGLA 3U60B 1R0WA 1HM5A 2QE7D 3GJRA 1OU0A 3WWDA 3IB3A 5T41A 1B42A 4OK3A 2W2XA 1GUFA 1RTTA 3AF2A 3B9PA 3BK1A 2CXPA 3HADA 5CR9A 3WG9A 4ZCSA 4DLXA 2QEQA 2IBTA 1KGDA 1RYZA 1BCRB 1JBEA 3ASZA 1UBMS 3JZDA 4CM5A 3JQ9A 4F3CA 1TM3E 1GQ2A 4CTNA 2BTQA 2XMRA 3KL4A 4KYVA 4I36A 4RVFA 4ALMA 4AN4A 4D4IA 4F7DA 1GRCA 4XIJA 2J31A 1JG4A 1T6ZA 3LVFO 2JF0A 2P62A 1GFWA 4G8CA 4XWGA 3V8NA 3JASB 1QUFA 2FEPA 3W6ZA 2V97A 2QENA 4R1QA 3WK4A 4TQAA 1XCBA 3H04A 1UCFA 3VRHA 4GBGA 1B1AA 4JLVA 2R0QC 1FXWF 1M8FA 1ZXLA 3DKPA 3IAHA 3IDQA 4FYIA 5DNEA 3JQGB 1FXWA 5BNZA 2WY2D 3HYSA 4PTZA 2R6ZA 4UHFA 1G6Q1 1F20A 1R0ZA 1T9AA 3BPSA 5AI8A 4DEYA 1ZJWA 1M1ZA 2QTHA 1E6WA 1K68A 3D3NA 3DE3X 3MQ4A 3RD5A 1I9GA 1MKYA 4B9AA 2J3HA 4ZTZB 4WOJA 3BAFA 2FMIA 5ILGA 3VZBA 5LQAA 1P1JA 1V5GA 1UXJA 4L8WB 2BP7B 3H8WA 5HMLA 5B3LA 4JFAA 4U7HA 4JJKA 4J7UA 5CURA 4FYKA 3AUTA 4E6EA 3INGA 2A0XA 4HVCA 2AC7A 1HYQA 1N25A 2H2AA 5EMKA 3ZZMA 5C5EA 2FPGB 3A4TA 1VZ3A 2X14A 2K6GA 1W44A 1GNTA 5TJ9A 4UTNA 3AVYA 1NURA 3OE1A 3I1YA 4NULA 3PQ5A 1E7MA 1X7ZB 4UXHA 1J2UA 4JBXA 4R05A 4EHFA 1SIUA 2M6KA 3GDGA 3LDHA 2CW5A 2J4FA 2LIVA 1TCVA 1OLXA 4AMVA 3JQQA 2ZZMA 2IJGX 4B7ZA 3QY9A 1WXDA 1E7WA 1JPUA 4U7DA 3O03A 3L6EA 4JZKA 1EGQA 3FPHA 4WPGA 4YRCA 3CT4A 3KFVA 1KP2A 3UCXA 4BO6A 1MOSA 3PE6A 3DKRA 1XPJA 2G76A 2JFWA 3KHSA 4W5JA 4Y2TA 1RDFA 2CXSA 2IZ5A 2NXWA 1Q1BA 4NR0A 3W34A 3AI1A 2W6ZA 1XRNA 4CCSA 4Q19A 4D5GA 4CF3A 1SUPA 3U48A 1IULA 1UZMA 3KYCA 1YUBA 1DAEA 2EBHX 5HKAA 3T12A 4DT1A 5AUPB 4HUQB 5T8KC 2GD1O 2IKSA 3AR9A 3V4ZA 4OF4A 1EXNA 5C3MA 1JP7A 1KTVA 4R3NA 2P2ZA 1X7XB 1ORWA 2XQIA 1F38A 1VFPA 1XQYA 3B48A 1QMGA 2FLWA 3N8KA 3V8MA 1SQGA 2QZ4A 4BFCA 3FFBA 2YXEA 3O26A 4XOIA 3QU4A 3TSAA 2QTLA 2GBPA 4FDAA 2YQ4A 3NT2A 1ST3A 4DCSA 1IXYA 2ZRFA 5JU6A 5HHTA 2MYNA 2OK7A 5JS2A 3GNLA 3PENA 2I2WA 2CKMA 1M8KA 4HH4A 1WF6A 4KZPA 1RABA 3FD8A 1HGXA 4RWEA 3PQ3A 5TARA 5CX4A 4FE4A 5HVNA 2PLAA 2ENWA 2PU7A 3K35A 3TOSA 3B8HA 5BT9A 3BDAA 3GVXA 3ONEA 2IPNA 3BE4A 4KXMA 4RSGA 2B4KA 3OLCX 3LIPA 4N41A 4F46A 3G5LA 3GEMA 2C3PA 1K86A 1U7UA 1XMSA 1N8KA 3MBKA 1H5NA 4RSRA 4XXHA 2HZ7A 1WBBA 3MW8A 3EDRA 3UJ6A 3W7BA 2E55A 4Q3EA 4D6YA 1GPKA 3TKAA 2F3RA 3RS9A 3I9NA 3I01M 3CFYA 3ZWMA 1M0TA 5DE3A 4C4XA 5AJHA 3EB9A 1Y1SA 5TB5A 3QX3A 5FJJA 4QOGA 1X14A 3G6WA 1ICIA 4YIHA 1XZKA 2A86A 2JAXA 2XGOA 2WK1A 2W4IA 3LTEA 4RKQA 4B32A 1DHRA 1SU4A 2JGEA 5DTJA 3G7NA 3G0GA 4LY6A 5EESA 1WVGA 5A3QA 3EA4A 3OM8A 4OBXA 3KOOA 4Z8XA 1CD5A 1PEAA 1UC4B 3HCRA 3K1YA 3O4FA 4YGYA 4O4LB 4EPXA 1TIPA 3H1AA 3NMUF 1YCFA 1U9ZA 1K75A 2Q6KA 2W43A 1QGAA 2C2KA 3KQSA 1OV4A 3KQHA 3QMWA 3MWEA 4I2NA 5IYZF 4F4UA 1EQAA 2R00C 3QBTA 4L5CA 1HORA 4J76A 5F35A 5HWSA 2AEJA 4EK9A 4B3RB 1USKA 1QCYA 1DC6A 1QHIA 4C03A 2QMYA 4GP6A 5B2EA 2I03A 1Q22A 3IIIA 4OJNA 4BE7B 3I04M 3DD1A 2AN9A 4HYQA 5I9MA 1I33A 3ZGYA 1Q1EA 3D0RA 3PV0A 2BYTA 3WKDA 3GPCA 5IFLA 4LHEA 3CSUA 4AROA 4X6UA 3FPGA 2N3ZA 1PDWA 3JALA 5CLFA 4UUQA 3UO8B 2UUBB 5E9JA 3INRA 1OI2A 1RHJA 4NBTA 4NV3A 4AU1A 1SR8A 4HD8A 4MRAA 4XSGA 1ZK0A 1U8YA 3UK6A 1L1QA 3IPAA 2A58A 4FIDA 5CLGA 4G63A 3ZW9A 1Z0JA 2X8AA 3EY9A 3ZQJA 1MEEA 3LCUA 3Q3VA 1RPNA 3BZUA 3C6XA 621PA 4W5RA 3EFOB 3K8ZA 1T6YA 3I73A 1K2VN 2BSAA 1W5BA 4TM8A 4S1WA 3VO1A 5K20A 4DA8A 1XDBA 3QTBA 4RPLA 3OFSA 4NP6A 1D0IA 3B1ZA 4N3CA 1EZ1A 1ZQ9A 3A9SA 1FSPA 4ZT4A 2HQRA 2ZB8A 2XQJA 3F4KA 1ZR2A 1SK8A 2D3TA 4YR9A 2VNAA 1BS9A 3FETA 1XZJA 5C4MA 3EXFA 2GEFA 5HW0A 4LGCA 2XE8A 3ZDBA 2WQZA 1NM5C 2Y66A 3PXUA 3FGZA 4TMTA 2V8OA 5L4SA 1P17A 1NRXA 1FRVA 4G3XA 4KXXA 4M46A 3UQYS 3K5HA 4OMCA 3ZDRA 1JPVA 2SKCA 4CRWB 1PV4A 1P39A 3I6IA 4CKZA 3OAAD 1GGFA 3U19A 3N2YA 4XGIA 1RHQA 4YBRA 5F9FA 3CMCO 4D3YA 4A0GA 3QKWA 2ZPTX 3LSTA 1QR6A 1WLSA 2XWPA 1QLHA 1VECA 3G8CA 3IPRA 2C00A 4N9WA 4PS0A 3G8BA 1OHHA 5CA0F 1EG2A 1FQJA 2ZI4A 2ZB2A 4WADA 1SU6A 2QV7A 3OPXA 5DM60 4BWGA 4OHKA 4IXTA 1M1UA 2WWHA 3GLUA 2QMUA 5G3YA 3E3LA 1IXKA 2R8OA 3TUJC 4P33A 3H2GA 4UBNA 3C5CA 2IPXA 4IGEA 4TXNA 1PLLA 2Q8NA 2E4ZA 2R48A 5LJLA 5MFZA 4B3IA 5G1NA 4OAOA 4MW2A 4PHHA 2BLNA 2ZAGA 2ESRA 1K06A 2F8SA 4L4SA 3S2IA 1SCUA 5EJIA 3VNAA 2QPAA 5GGYA 1I3MA 1X94A 3PXEA 5IW8A 1Y8ZA 3UMFA 1GRVA 4KCGA 2VP9A 4EY3A 3ZJUA 1JEJA 1DQPA 4GOKA 4URHA 3FLBA 2OD2A 2V0NA 4TN1A 3VR6H 3RU2A 3BIJA 1EVJA 4FYJA 1ZK1A 3M4XA 5EEGA 3RSSA 2B1JA 1UZAA 5K0NA 4OFBA 3O3CA 5BN1A 4FYVA 4MWDA 3PDWA 3QVOA 4GI5A 4O8CA 4P4UA 4PGMA 3RQSA 3WBJA 4CJXA 5LLTA 3OZEA 2VXOA 3TSZA 3CUSA 1OBCA 4UNSA 4E2ZA 4Z7QB 1N1EA 2O8DA 4YCJA 1C7EA 2VYVD 3AB8A 3OE5A 2IEIA 1VIDA 2R25B 1F0YA 1F6BA 3P8ZA 2BMVA 3QF4B 4RMJA 2OBXA 3VHXA 4F5YA 1N7IA 5BVGA 7MDHA 1NI4A 4MLPA 2Q5FA 1G5FA 1U2DA 4CXMA 2JD0A 4C4YA 4TYWA 1PJRA 4CUJA 4DPMA 1U9CA 4KSCA 1E1KA 2WUDA 3JAMA 1G8AA 2CL0X 1D0VA 1ZI8A 4KWIA 4RZXA 3RS7A 5MN5A 4GRDA 2DR2A 4UU7A 5F51A 1OXVA 2W6ID 1OZGA 5HF9A 1NVMB 4F2PA 3CLRC 5FR1A 3CX7A 4P7KA 3B3AA 4NU6A 3GZJA 2Z08A 1IB6A 2FW6A 4FJ2A 5T7BA 4BDSA 4QUBA 5IHPA 4NE2A 2JFFA 3OU6A 5ED4A 4XGRA 1B6RA 4IG4A 5TMDA 1F17A 4BO4A 1APBA 2C9CA 2FG5A 1NQAO 1LW7A 4I8DA 4BMXA 3LO5A 2UZ1B 4RX1A 4MYHA 1E8MA 2FWJA 4C5CA 1FZTA 3IUJA 1U8CB 4BNMA 1ZM9A 5EKXA 1TU0A 2DULA 2H1IA 5JISA 3ORRA 2BT4A 3JVIA 2QIOA 4IMIB 1FLAA 5ULLA 2XGJA 5LZ9A 3M1YA 2X8LA 1C9YA 2ZCVA 3MJRA 3Q12A 3CT6A 5K6AA 3I72A 4HQNA 4JWTA 1MJGA 2H8KA 5JXJA 1KYTA 4D9EA 3F8WA 2AWNA 3GROA 2XYVA 4IAOA 4CUKA 4L6AA 1M73E 1CDZA 4Q9DA 4DJTA 1UKYA 1QXSA 1Q11A 2QUIA 4QUAA 4CL3A 5KEIA 5KNBA 1NN1A 1WRBA 5CB4A 2HMSA 3CLHA 3V7WA 4RZHA 3G1WA 1NXQA 2B1QA 5I4CA 1AGXA 2YUTA 2I65A 3CE6A 1OHHD 4EY5A 2BR4A 3BJMA 5CPFA 4Z1MA 4R0MA 1U8UA 4JENA 2HRDA 3QENA 4HVTA 2ZXFA 4IX1A 4K3VA 4RK1A 1KOLA 3V48A 1XEXB 5JS1A 3ZXXA 3EGOA 1U2ZA 2XSZA 3R3HA 4HOYA 3VNVA 1U94A 1T4DA 2CHEA 1RI1A 3KKPA 3ULKA 3GIDA 2YIMA 3PLNA 1MQ9A 4TLAA 5FWYB 5HTKA 2HM7A 3CLTC 4A8JC 3K9GA 5KYTA 3SOZA 3ST7A 1E0AA 1A9QA 1S3FA 2ZYSA 4BATA 1HDXA 1T2UA 1WVMA 1C0IA 3EQZA 4Y9RA 2UYYA 4NU8X 2ZIVB 5E3HA 3ENWA 5JAQA 1OOEA 3DAOA 3OMWA 3OE7A 5AQEA 1L5KA 1J20A 4UC0A 3EIXA 2GF0A 1Z06A 2CDNA 2NUAB 1WABA 3ZLTA 1GSIA 2IIVA 3EQ6A 4LTNA 4DXHA 1MB9A 2YXBA 3OSZA 1JJBA 3NXKA 2XNHA 1NMYA 5KBYA 3K9CA 3R2JA 2ZRQA 2HR1A 4XPZA 4PZ9A 3F6CA 5GJBA 1OUMA 3RFTA 3CHYA 3WGOA 5CFLA 1P8JA 3UB3A 4JQYA 2E4AA 5DTIA 1DKUA 1ZM4A 3NNSA 3KJGA 2H08A 3DYVA 3ZZ1A 1P2VA 1YZTA 2Q5IA 1C9DB 1FYVA 1W1UA 1WUHS 3PPXA 4W9RA 4OJKA 5FF9A 5FI5A 3R7AA 2E9SA 4DDTA 1THMA 4NC9A 1W94A 2GHIA 3AXSA 3IDSA 2YYYA 3P97A 4R1SA 1QZ3A 4TWZA 3BUSA 2P6PA 5DPMA 1YUMA 3PC7A 1ZUIA 3ZS8A 4DJ5X 1PR5A 2YHSA 2JGAA 3QIVA 1QR2A 3ICPA 3HDQA 4HYYA 2AYYA 5ERXA 2R3SA 4DIOA 1YK1A 3T1VA 4BVHA 2IP1A 4JLWA 1JIKA 4BNIA 1DRJA 3JQ6A 1ZFNA 2H2IA 4NNPA 4N7MA 4H08A 3SJUA 3HJGA 1E2UA 4IHKA 1R66A 2R47A 5EKTA 3AESA 1P4AA 1T43A 2XNJA 3VPSA 4NU0A 1GYRA 1RVV1 3CKKA 2H9AA 2XMQA 3GNQA 1B74A 1IZ9A 3IUYA 5E4YA 3ZHUA 1GEGA 1H2RS 1KBOA 2G06A 4H15A 2A9OA 4LWZA 3EGDB 2JLWA 1AUOA 4LF4B 1B8VA 1EVLA 3I8OA 1C7RA 3NGMA 1PT5A 3NW9A 3RBZA 3UWDA 4MR7A 3WL3A 3AVXA 2CXOA 4BASA 4A2CA 1QFYA 4EVIA 1TI7A 1OLUB 2AJTA 2TRSB 1Z63A 2HCTA 3MN1A 3UYLA 3ZCPA 4JVOA 1XA0A 2IYRA 4FOSA 3V1TC 3N8IA 7MHTA 2PA0A 1ZJYA 2XQKA 3QLJA 2FX2A 1J2TA 2FWPA 2I0FA 4EO4A 3EQ8A 3K6SA 1FCJA 2NO9A 4AJKA 3LLSA 3FOWA 3JVDA 5EMJA 3U7EB 4WK4B 1TEVA 1XDGA 2N75A 1P0QA 4Y9SA 2WVGA 3MCWA 4Q3DA 1OLOA 2ZCUA 3OPQA 4CCAA 3BTSA 3OCYA 3FF4A 1NXTA 5CTJA 4G9BA 2BFBB 4IQGA 4YDHB 4C0KA 3NTQA 3DLAA 1C81A 2E1PA 4TKUA 3C8HA 2OCDA 2DBYA 4XWOA 2H92A 1ZRSA 3W4KA 5JZ9A 4OHCA 1C3OA 1R8JA 2XB9A 5E9QA 5IKXA 3GPBA 3MAAC 5K51A 1GFZA 2GO1A 1MRZA 3T9CA 1HWYA 1W1WA 2CV1A 4X6XA 1JYFA 4FMBB 5FIUA 3IMGA 3GLIA 2OR3A 1KAMA 4G5XA 3TI9A 2V7WA 2A9VA 2RHTA 2D4AA 3NP9A 5HA5A 3DUFB 3PR1A 4E33A 2YV4A 1NJ2A 3G79A 3LZDA 3MWKA 4UREA 4YMUA 1QO7A 4MQLA 1HG0A 4LHZA 2O5EA 2DSTA 1TU4A 1PL0A 2HKIA 1CUZA 3K5WA 3O6VA 1HE2A 2GYUA 5ITVA 3WIVA 1DBVO 4YLEA 1ZNQO 3JTMA 5D3MB 3RRJA 5HKOA 5BWMA 5K9ZA 4LSMA 5B6IA 1MX3A 2OD7A 3EVGA 1BOOA 3KB2A 1Z45A 4KX5A 3SYNA 4M9ZA 2R7LA 3ER6A 1EUCB 2C03A 1ORHA 1W93A 1SXJB 3GP3A 4QIHA 1BU8A 1C9KA 4PAMA 1IM2A 2PGXA 3N5KA 1SUIA 1CR6A 4I50B 1Q0SA 1YZGA 3ZE7A 1GILA 1HQCA 3CWQA 1NASA 4DGSA 2F1HA 2VZLA 4B5KA 2P2GA 2R66A 2VHVA 4B81A 5IAAA 3ZCXA 3CURA 4ZYZA 1OT3A 2YOFA 4YV0A 1XTSA 2H2DA 2FH5B 4HRXA 2Y4NA 1SUCA 2H3EA 5DFAA 1XAGA 3VPXA 4ECAA 3DW3X 2ZR8A 4IXDA 3H4TA 3F3SA 3LQ2A 4JEMA 4L0MA 2W2MA 3C4VA 4EGFA 4QEDA 4Q02A 3KZCA 4OI0A 2GRUA 1UXKA 4E2XA 1JQBA 4FBMA 5F76A 1Q0QA 2W83A 2Q9AA 3UJ8A 3KDPA 3BEOA 4YCNA 5C1IA 5JALA 4QDJA 4PLGA 4HNUA 4KFUA 2Q99A 3ILXA 2VWPA 4HQOA 2ZBQA 1O89A 2PSSA 3DHWC 3L8HA 4HMOA 1UC9A 4NMHA 1X7WA 4QFBA 1ZGJA 4EKNB 3TTWA 2CYCA 3HFGA 2Z5FA 1TVCA 3A6HA 2DC1A 4KWEA 3WZMA 3NIWA 3L79A 3ZPXA 3MRVA 4C0XA 3FNFA 1EGAA 1R37A 5JOQA 4X3OA 1WBDA 5I01A 2JGNA 1NJ6A 1Q6ZA 2NNWB 3AH8A 5JD5A 2B8JA 2P9BA 1W1IA 4MMZB 2OZKA 1V6SA 3WDKA 4Q7KA 1GQOA 4BAGA 2XD9A 3PHHA 1J99A 2CDRA 2NYUA 4PIPA 4M6WB 3T5CA 3W5JA 5F77A 4AULA 5JDCA 2DG2A 5AW3A 1J90A 3FBGA 2FEAA 3EWSA 4P4GA 3A7DA 1DXYA 1E32A 1FU4A 1TT5A 3RIEA 4M2LA 1MPXA 4MWZA 2XVZA 2G72A 2Q3CA 1UIRA 1HEIA 3TLZA 5HQTA 4FNMA 4AMUA 5LD2B 4MYRA 1M10A 1ODKA 2QGZA 5F7JA 1RI4A 1TQ8A 3G0BA 5H83A 4GI2A 2I6UA 5K3EA 1TFRA 1CK4A 1QIGA 3UXHA 1A71A 2ZUUA 3LKVA 1IDN1 1JLLA 1RXUA 2A0FA 2CJWA 3DO6A 1JE1A 1P0MA 4MRRA 1NNEA 1ZK3A 3L7OA 1JUDA 2PJZA 4ME6A 4F2DA 2YKGA 2BN4A 5DWVA 3G2QA 1G5HA 2YWRA 3RKSA 1SXJA 1XMQB 3KWFA 2XJ4A 2MSLA 4JROA 3TFQA 1WS6A 3VJMA 2Y1EA 3O74A 1HBJA 2F1JA 1E6EA 4ZTBA 4IZ6A 1B41A 1KO1A 3I5UA 4QNNA 1NUHA 4YP0A 2XGMA 2GPSA 3O8OA 4AP5A 4J0CA 4LXUA 4NENB 4J16C 2CVQA 5IUKC 3SJ7A 2PN1A 3G1TA 3DPIA 1HNXB 2IU4A 4LDAA 1U2DC 1RAFA 4UMDA 2D2IA 3FMGA 3I01A 2ZSEA 2B3TA 3NIGB 4QGHA 3PR2B 4DM3A 3Q8KA 3GLGA 1VSBA 1E7RA 3JATB 4MVJD 4AY2A 1YH3A 2FE4A 1VE6A 2GLTA 4BWYA 1BWPA 3P0JA 2NZ2A 1VL8A 5KKCA 2G9UA 3DP7A 3RV4A 4FDMA 5MDHA 4TKMA 1PQPA 1U3CA 2AXNA 3C3MA 1I51A 2GD2A 2QPLA 1RWBA 2X1VA 3FNGA 4W9NA 4WA7A 2NMVA 3R7SA 2XA1A 5LOVA 2J5RA 2NVOA 3FHJA 5H59A 3UK2A 4NJEB 3NHWA 5DNDA 1ZC4A 5AUQA 4RDXA 1I2CA 4AWBA 3W79A 3BQMB 2XXJA 1P5FA 2AUMA 2G1KA 3W2GA 1L5OA 2R1UA 3FYSA 1OY1A 3QKRA 4FZ5A 3IQGX 4HDSB 5JQGA 2UYGA 2ZIUB 2V4UA 2J41A 3AF5A 3NM6B 3S68A 2O7RA 3NHZA 3R7WA 4QVKA 3RVOA 4J3FA 4J91A 4M6WA 4JUIA 4BMYA 1NF3A 2ROQA 2B92A 4O08A 1VE3A 2P30A 1AHIA 1JJVA 3Q5GA 4AUKA 1CERA 4TKLA 3CMMA 2LR0A 5D01A 3ZZUA 1GDDA 1YGPA 3GLTA 2EGGA 2P27A 3AHJA 3IA7A 3PSHA 4L9RA 3I6MA 4UBKA 2HTEA 5EPEA 4PSAA 1JF8A 1L8OA 3RUIA 4DJFC 1U1FA 4OQXA 1TK2A 3PR3A 1E3IA 2IZZA 3BZWA 2IPAB 4Y18A 1ECJA 1OI4A 3IYLW 4ZCPA 3NZEA 4F9FA 5FL3A 1T0PA 3MTQA 1QO0A 4JNCA 2G77B 5BYJA 1VJ0A 1CZLA 3EPPA 1JLLB 3I6BA 3O4VA 3LYUA 4JQZA 4JSTA 1T4MA 3VYVA 4C7XA 1RU3A 1KETA 1T4CB 3EW9A 2ZYWX 1K8YB 2QW0X 3CN7A 3GAAA 4MS3A 2WMYA 6NULA 1B14A 1N5LA 5BMVA 1K92A 4MJXA 4ZK6A 4BMPB 2O2YA 4JLMA 4KWHA 1GPBA 3NYIA 3OWXA 4E5KA 4EYSA 1X7DA 1A5BB 4KO1S 3ZY6A 3O8OB 1CFZA 4Y2XA 1TM5E 1ZVMA 2FMHA 5F2EA 1K0UA 2PMEA 1DS6A 4CQNA 4FOOA 1JIXA 4K2HA 3SFTA 4LF8B 1G1AA 3CZAA 3Q3EA 1JHYA 3PQ7A 2Y1WA 3GLGE 1Z17A 2D2EA 2QMEA 3OJOA 3PCXA 3R6TA 2G7MC 1UEIA 2XE4A 3UQZA 5K8TA 5FTKA 1XCLA 4RFSB 2DBVO 2Y0PA 1YRLA 2YWCA 2ZYRA 2HA0A 2NZUG 3F3KA 3HGMA 2TMGA 3T4XA 1KDRA 4DKXA 4G86A 3H2SA 4HS4A 4ZCIA 3C7CB 3DEJA 4MUBA 4N0MA 2P6MA 5CPBA 3BF7A 1NVAA 1TF5A 2H59A 1FUIA 2MMGA 3GOHA 1I1OA 5JI2E 3Q6MA 5CHYA 3T5DA 4NJEA 4TLMB 4BNUA 2CLHB 2YZ2A 2QP3A 1GCUA 1TEHA 3E15A 4EVSA 1OD6A 3MJ4A 1BWQA 2HDHA 2FPKA 4K8OA 3QKIA 1H9BA 1I4EB 4D99A 4DYHA 5LB2A 3MG9A 3IAEA 3PVCA 4LX0A 1E3MA 3QITA 1FX0A 3QX8A 4O2AA 221PA 3X44A 3ZVRA 5D84A 1KMCA 9GPBA 3T7CA 2OB1A 2J3QA 4RA6A 1WD7A 1XRMA 3BYZA 3QSGA 4LFAB 1NN3A 1HT3A 3OUUA 4R2IA 3HBLA 1R6BX 3LCMA 3LVBA 1O5TA 4LY9A 3X0DA 5LJIA 4OLAA 2TMYA 1MAVA 2PA3A 3IVGA 4YP9A 2JNWA 4L0DA 4A6PA 2C8VA 1ECFA 4G09A 5CDGA 4UTXA 2CD9A 3B2EA 1GNSA 2JIBA 2SCUB 4PR3A 3D9QX 1TCUA 2J4CA 2QYHA 3LGSA 3IIMA 4KO8A 4O8ZA 4TUYA 5T3UA 2VQFB 3GJSA 1FYFA 2XLCA 3RU3A 2PKXA 3LFHA 3PD1A 5CT9A 4AO6A 3ESZA 3P2OA 2RARA 3HUUA 3ZWXA 1VPWA 4R6WA 5BW8A 3F67A 4ZCLA 2JBWA 5IJXA 5LYYA 1DTSA 3H87A 2DZDA 3GLSA 4YRZA 2WE7A 5GMOA 5LMCA 2QV0A 4KOAA 1C30B 1NVGA 4Z51A 2VQDA 4Z9XA 2PFKA 2L0XA 2NAPA 3AFHA 4RABA 3ROQA 2GZHA 3BGVA 4H60A 3S3TA 3C6ZA 3P2JA 3WDMA 4D0NA 3B36A 3SI7A 3ICQB 4HNHA 4KAAA 4LNAA 1KNQA 2VJQA 5EPUA 4N0QA 1LI7A 1Z6GA 1G19A 3MWDA 5EHGA 1GG5A 1M74A 2BGKA 3KX2A 4YDQA 4K8RB 4CMKA 1ELOA 2R44A 3VXKA 4RFLA 1NDQA 2B4AA 1DJLA 1IHDA 2JIPA 3GN2A 3ZJTA 1QE0A 5CA1A 1F0PA 4KIGA 4LHVA 3WBFA 2HU7A 3C85A 3L41A 2F7SA 1PTJA 2HA6A 1LUAA 4KRFA 3MWLA 4CNQA 2L19A 3I45A 5KSOA 1GG9A 3FTCA 5DX0A 1TE2A 2PUHA 4RV5A 1UT5A 4LZZA 3ZQKA 1OT5A 1SVKA 2JLSA 4HJXA 3ROGA 5BWLA 2DPGA 2PH5A 5IM4F 1J42A 1QJCA 4YT8A 5TS3A 2CB9A 1XQ6A 1V41E 4YT5A 5CBKA 2PBRA 3LHFA 5KYKA 5FORA 1RM0A 2VWHA 5FFMA 2BONA 3L1UA 3PUVA 2TMDA 3EK2A 5SZHB 1CY2A 2BEWB 3HFSA 4E88A 2Z2JA 4ZK2A 5JNLA 4YUZA 1P29A 2I4IA 2F8TA 1UBNA 4X84A 1SD1A 2VUIB 4AG5A 4EI2A 2FOXA 4QU5A 3GJ5A 3GLIE 2XNKA 4WLVA 3HFRA 3O1HB 1SA0A 2FWAA 5DK4A 2I1WA 3U39A 3VZCA 1D1PA 2V55B 3M6MD 1TZBA 1G7SA 4BMOB 4WBSA 1OWMA 1FDTA 1TT7A 3VSDA 2IZOA 3C6KA 4RWZA 5KOJA 1G3QA 4D79A 4DLRA 2CEAA 1XDDA 2WUEA 3FWNA 4LJAA 2HMTA 3WYFA 4KG7A 4MJ3A 2PQ2A 1E9AA 1SEVA 4ODIA 3HDTA 3N0XA 4TUYB 3TNDA 3V3KA 3P5SA 5EUMA 2B5OA 2HA4A 3B5IA 3OHPA 1SVIA 1OH8A 2VJDA 4XPIA 1Z12A 4FLMA 4CT5A 2WFLA 1R6AA 5EWLA 5FKJA 4Q4HB 1E2QA 2NT4A 3IPLA 1H4SA 1K66A 4TOIA 2ID9A 3QU5A 1NXPA 1QZXA 5I9SA 2CYAA 4DDKA 3I5YA 2H7YA 3HEBA 5B6JA 1ZH8A 3SZGA 4BJ5A 2OQIA 1SQ5A 1RZUA 3GO4A 3KQOA 5JLAA 3LQ4A 2VDRB 1XXHB 1JTVA 1O6CA 2Q2NA 3KVYA 4DDHA 1G6OA 2CVFA 2XCUA 1E6MA 1MDBA 3D31A 2Q5QA 3PXGA 3FWYA 1X87A 3AB7A 3KLNA 4BGIA 5BPFA 4RTSA 2HW8A 5IRCD 2IX9A 4AF8A 3EGXA 1ZSYA 1PJBA 1OFVA 4BVFA 4KQJA 1AGYA 2ZBGA 3KZVA 5A4JA 4KR6A 2RD2A 2FEXA 3OZGA 3WBKA 4NJMB 2NW6A 3FTFA 4RV4A 3FXAA 4YIKA 3KBOA 3TW6A 1T5DX 3KXKA 2I7TA 2VLIA 1XC7A 1Y81A 5T64A 5IZ4A 2CHVA 2PNJA 1UM9B 4MKFA 5DHAA 3RAJA 1C3XA 2EFYA 3L2OB 4WN3A 2AX4A 1EEXB 2XTAA 3VNRA 3E1KA 1V71A 1R0XA 2DFDA 3CEMA 3LUJA 4MRSA 1LGYA 3WO0A 1U2RA 3IAUA 4KMRA 2RGBA 4B45A 1DO2A 1RRGA 3DOJA 2WNSA 3MSCA 2PKQP 2WJPA 3BWXA 1O77A 3K1TA 2A78A 4WINA 3IPXA 3O83A 3G13A 2WF9A 4LEIA 3DFUA 3PDJA 4NCHA 1MJGM 1P31A 4GD3Q 4TTAA 2P6RA 1GNPA 5KVAA 3TKYA 4EJFA 1MRSA 1V8PA 4QGSA 1SKAA 4BZPA 2A8YA 1M1YE 2VDQB 3AEQA 4YAIA 2PUDA 1QU3A 3IUBA 2A5DA 1MAHA 3I1IA 3LUFA 1JMVA 2R1TB 3OBBA 1V1MB 1KQOA 4DSAA 3LLCA 3U7HB 4X97A 4TKZA 4GOMD 2HC9A 2AFIA 1F06A 1V4NA 2DR0A 2V9ZA 1EGMB 3ELWA 3HVUA 4I6JA 3ZU2A 1PEKE 3DCJA 1DIRA 2JFXA 4Q01A 3TFWA 1TKAA 1AF4A 1NOKA 2ZB3A 2ZTUA 3DL7A 4E2FA 3EXHC 2O2IA 4RKEA 5D6OA 4PNZA 3Q15C 1LV8A 2QDXA 3V4FA 2C94A 3FKQA 3SR4A 4C0AC 1WMBA 3KYIB 2GETA 3NS7A 3AWDA 5H4GA 5IU6A 2D5LA 1C3LA 3IQZA 3S28A 1B4DA 1I7LA 1RYMA 2WSLA 3RS2A 1TLTA 1P6XA 1PUXA 2JAPA 3MCUA 4PANA 4Z7NB 4WD3A 3GVIA 2V7VA 4UBOA 1RQGA 1JVBA 1EVKA 2CN1A 3NKFA 4X1OA 1T6BY 3SLKA 3FOEC 3ZIAA 3EXG2 3JR3A 4JVMA 2WZQA 4ZMBA 4ZOLA 4HGYA 2GTPA 3E61A 4MVWA 3L04A 1KMNA 2HHLA 2QD4A 1D1TA 4AO7A 1WZEA 4D56A 1XZAA 3PDIB 4S04A 3FHTA 3ZH9B 2B20A 3EJWA 2NU7B 5JSQA 3SX2A 2GWHA 5KDOA 1T2EA 2Y9MB 3SZUA 4CTJA 3KOXA 1ND5A 5JJIA 4G4JA 2OCAA 4PWYA 1A04A 1QH8B 2PSEA 3I6ZA 3HWWA 3AEXA 1N0VC 4NHEA 4DUPA 5AI0A 3ISTA 3BERA 5IDXA 2C4NA 3P2MA 1NBIA 2H48A 5FTWA 2XQGA 1AZLA 4QAQA 5HCUA 2DKOA 4DLPA 4JR0A 1U7HA 4ZAZA 4ENRA 5HILA 2P2SA 2AYXA 4CIYA 4DHEA 5IBQA 4EJSA 2RHLA 4AN0A 1YZUA 1HOXA 1GPH1 1Z38A 1ZNXA 2C2MA 2ZIXB 3M3DA 3V8PA 3C8DA 4PGAA 2Z58A 5JECA 1JWAB 1J9ZA 2RAVA 1IEWA 2Y0DA 3UJ9A 4DA6A 2FJ0A 3ESBA 2DHRA 4OKIA 4MWEA 1K7YA 1UM8A 2H0RA 3W77A 1XTVA 2QXTA 4ASUA 1Z7EA 2BEJA 3F5QA 4JELA 5CEJA 3KKQA 3KPVA 5JYDA 1QDLB 5DN9A 2BCEA 2P9FA 3JARA 5EZ5A 4JD5A 3OCUA 2QMZA 4ETWA 3B6JA 2Q3HA 3H84A 4ZVKA 1M8JA 3CWZA 1ZDMA 1ISRA 3JW8A 3T5GA 2DUMA 3GOQA 4A16A 1AUPA 3P4YA 3OPYI 3UAXA 5KWVA 2VT6A 4Q34A 4LZPA 5FEUA 2CZQA 2ZUEA 4E21A 1JB1A 1JG1A 2YV1A 3EXEA 2IYVA 5ESWA 2X9GA 1CUAA 1FYWA 2BKEA 3NBUA 3V46A 4GX0A 2QR2A 4EITA 2JHGA 4CEIB 1ULUA 1H65A 2XRMA 3L49A 3VVMA 1L1RA 1V11A 4WV3A 2EFHB 2G09A 3JWHA 1LBQA 4YPFA 1GG2A 2BZGA 2X8BA 1RYFA 2GNAA 1J97A 2Y27A 3O47A 4BU1A 2V1UA 1IPHA 1JAZA 4M9SA 2JDIA 1AO3A 3SPXA 4PZYA 1EWVA 4QA9A 4M0PA 3LXRA 3U7QB 1MIHA 5IKPA 4WEOA 5FTLA 3EZLA 2A7QA 3OICA 8ATCA 3RTAA 3MGCA 4IDAA 3WMXA 5JD6A 4LV5B 3QE4A 2HJRA 3M8KA 4EOGA 1IQUA 5AIBA 1E96A 1J4AA 2CBGA 2XPCA 5IKEA 2A30A 3G8AA 2I8LA 3SGLA 5KWIA 1T13A 2WYIA 1GAQA 1DUSA 1I80A 2IF0A 4HDOB 3ZD8A 5FQOA 1SVMA 3IH5A 5FPHA 3HDJA 2P9QA 2WKPA 1WSDA 2XDQA 4F96A 4D8WA 2QVCA 3CZCA 4TV9A 4DDWA 1F2UA 2EKDA 3E7DA 1NW5A 2DPMA 3DEHA 1V96A 3COPA 3DL4A 4GGMX 3S2YA 1TKBA 3TDMA 3HJHA 1D6SA 3D6MA 2E3JA 4UTRA 2QPTA 2PL9A 5AVTA 2FPMA 2G63A 4IUBS 4EJSB 4X95A 3PS9A 2WG2A 1V0JA 2HSJA 4JR2A 2CFSA 2X5JO 3TIFA 1BDJA 1FLNA 2Q6OA 1WPGA 4JI6B 4B31A 4JCCA 1A88A 1R6VA 5CYOA 2VYCA 1GZ5A 5CNKA 1GZ3A 2CLOB 3D4LA 4Z0HO 3VAYA 5A02A 3JZAA 1BEEA 2DXIA 4FC7A 2VAWA 4F97A 4B75A 1MB3A 2GYYA 4OXXA 3IX7A 4L2IA 3CJTA 4WN9B 4F4IA 3NJ4A 1NBMD 3FIUA 5FULA 3ZNNA 1OR8A 3M33A 4PPGA 1UDAA 3V2HA 5DW3A 1BRTA 2AZDA 1C29B 1IDOA 2JS7A 5K0GA 1ZAKA 2Z1MA 1KI2A 1SB9A 5CXSA 4B6QA 1R4NA 4KREA 1RP7A 1UKEA 3I9FA 3PUXA 3THYA 1EHYA 3HLKA 5MN4A 1P18A 1ZM3A 1Z25A 4V0QA 5HJ2A 2O8BB 4CL2A 3SC6A 5REQB 4OX9B 2QY9A 1DP4A 3K0SA 5CP8A 4CEIA 5BSKA 1K6EA 3IIJA 5FLKA 5LQRA 3S2ZA 3D1VA 1RXEA 1QK3A 2QLMA 3WZLA 1G21B 3O8CA 2GSDA 3JQRA 4ZWNA 5CDYA 1NRIA 3KU1A 1JI3A 1SMKA 1WXIA 1G64A 2M1ZA 3LC7O 5E6RB 1HL7A 5B7NA 1Y33E 3D5EA 3T5BA 4D96A 1TO2E 5EVJA 4PBSA 5ABPA 2R86A 5DTQA 3KYDA 2BEUA 3E2PA 4B3JA 4B4DA 4I9FA 1KWKA 2RHWA 1Y7LA 4H4CA 4QELA 5KAPA 3T7JA 4LF6B 2NU8A 4RPIA 2F6RA 2WHRA 1K7CA 5KYYA 1NUSA 2PX3A 1ZD1A 3QA3E 1ODIA 3NBFA 3D2BA 3RM3A 1N3LA 2QIPA 4M7WA 1B8NA 2C2OA 1VLVA 3BFXA 1XQ1A 2AJCA