5F2EA

Crystal structure of small molecule ars-853 covalently bound to k-ras g12c
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
168
structure length
168
Chain Sequence
GMTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETSLLDILDTAGQEEYSAMRDQYMRTGEGFLLVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GTPase KRas
publication title Selective Inhibition of Oncogenic KRAS Output with Small Molecules Targeting the Inactive State.
pubmed doi rcsb
source organism Homo sapiens
total genus 62
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5f2eA00
5IRCD 1WB9A 2NG1A 3SQWA 2GETA 1U0HC 2JLRA 3HWSA 1PZNA 5J4HA 2ZRKA 5IF9A 1AS3A 4BRUA 3PUZA 2Q3FA 3PEUA 4D0NA 3CIOA 3MD0A 3EW9A 5A0FA 3DZDA 4HDOB 1VHLA 2A30A 3TNFA 1Q3HA 1KO8A 3IDQA 4PSAA 2DBYA 2V55B 2A5YB 5KSPA 2QP9X 4LV6A 4AKIA 4A6PA 5D3MB 3BS4A 5SZKB 1ZYUA 2J46A 2F9LA 5FUWA 5HR5A 4LV5B 3TE6A 1DEKA 4P4UA 1VMAA 1GKYA 4ESHA 3WHLA 4D6PA 2W6ID 1Z28A 1D2MA 1PLLA 2V6JA 1JR6A 1QDEA 1JB1A 1S0UA 1WF3A 1ZNYA 4KSBA 5DISB 1WP9A 2HJGA 3Q7QA 3UG7A 3G0HA 3QXXA 4TMZA 2ZRBA 3WMEA 1F60A 1X8LA 3FOZA 4Q4HA 3RS2A 3LBNA 2ODNA 4IOMA 4QM7A 4F4IA 3IIMA 3AVPA 2YKGA 4G5QA 4M9XA 3ZZTA 5JI3E 2ECKA 1I4DD 3TVTA 4O3MA 4BLTA 2RB4A 4OI0A 1Q1BA 2C78A 221PA 2GCOA 1HQCA 5TARA 2AX4A 2FOLA 4W9MC 4NBSA 1YZUA 4DRZA 2JGNA 2Q3HA 4JT2A 5AJVB 4RFVA 4DCUA 5J40A 2WJIA 3JVUA 1ZNWA 3P4YA 1OH8A 3SYKA 3QQ5A 5BYJA 1H65A 2C9YA 2QA5A 3TQFA 1E2JA 1TNDA 3L0SA 1TU3A 3X1YA 4M22A 4URUR 4TZ6A 3C5HA 2VHUA 3RC8A 1OV4A 1J8MF 1A82A 3ADKA 1AS2A 5K8TA 4X8OA 1Y63A 1XMVA 4C4PA 1Z08A 3EWAA 3B8HA 4ASUA 3GLIB 3SYLA 4TWZA 4GZMA 5AK0A 1CKEA 1SKYE 6Q21A 1AQYA 3WBKA 3OEED 4MRNA 5D3MA 3WYAA 1XD8A 4IOJA 5C18A 4QJ3A 2C8VA 2QBYB 1IBRA 4B43A 1E9SA 3MAAC 2L0XA 4V0MA 4D0LB 1OSNA 3EIHA 5G53C 1UM8A 2XZLA 5KNBA 4A8JC 4TMXA 3KQKA 1XNJA 1H8EA 2BVNA 1RYHA 5FL7A 4IDOA 1P2SA 2PT5A 2B7CA 4TMWA 4WBSA 1TTTA 5FOUA 2FGJA 1E9AA 5DYIA 3QEJA 5KSYA 1E96A 1E2IA 1Q22A 3OIWA 1UFQA 4UQOA 2J3EA 5FUYA 5FTKA 3M0EA 4LHXA 4PPQA 5FBRB 3MWJA 4JS0A 2YWGA 1II9A 3BXZA 1FUKA 1R7RA 3RABA 5E7JA 2J0SA 1KJYA 2PJZA 3E2IA 4RZ2A 1G8PA 4L9SA 3ZVNA 2KJQA 4ZO4A 4IW3B 1JPJA 2PBRA 2QMOA 2QTHA 4V0ME 2EWWA 1A7JA 4TT3A 2JASA 1EFRA 2WHXA 3AP2A 3ZLJA 2WV9A 3Q3JB 3CPJB 2WWHA 4HZIA 1P9WA 3LVQE 4LYHA 2H17A 5BN3A 4MKIA 3H2YA 5EZ6B 4CIDA 4A0HA 1JI0A 4D0GA 2D4HA 3DVLA 1G18A 1SXJB 3R8CA 2QNRA 2BM1A 5DI9A 3GLIA 3MSXA 1ZD8A 2ZU6A 3UIEA 1UKZA 3RLFA 2PMKA 2H8KA 5FL7D 3VNVA 5JWHA 2BBOA 3R9XA 3U4QB 4US0R 1RFLA 3GCGA 5GJBA 1M7BA 5KPDA 1U81A 2QBYA 3RWOA 1F2TB 4BLPA 4BASA 4D25A 1QZXA 4KCGA 2ZSFA 2I1QA 1PLJA 2A5DA 3SZRA 2IYYA 2V6IA 4DLYA 1MR3F 3VTKA 3K53A 1M74A 4B6FA 2GVDC 4HB3A 3L2OB 1TMKA 2WMOB 1DAEA 3ZH9B 2YOHA 2OBNA 1X86B 1TQ4A 4PXAA 1ELOA 4ZKDA 2P6UA 3AQ4A 1VIAA 3K0FB 3KL4A 5AJYA 4LHVA 3CRVA 1NVWQ 5FPHA 1AGPA 2BJWA 2R2AA 3AB3A 3K9LA 3SBDA 4JBWA 4B2PA 1EWRA 2HXSA 3GLIE 4IDNA 2OO7A 1OW3B 2ZSBA 1EFRD 2BMJA 4S2EA 1N6OA 5CB8A 1I2MA 3VQTA 2ZYVX 5H70A 2XTZA 3BOSA 1DS6A 4QGFA 2GJSA 3HU2A 5D3QA 3FKSA 3TUJC 1KMHB 1D6JA 4DKXA 2YWHA 1W44A 4M53A 1E6CA 2JJ8A 1NSTA 2FF7A 3RS4A 2IYLD 3B78A 4KI0A 4QHTA 1G64A 1X3SA 2LWIA 2H7VA 4C0JA 3UMRA 1KO4A 1NJGA 1NMXA 2CHQA 4E07A 1S2MA 3QOFA 2NO0A 3GFOA 2GK6A 2ZM5A 1YR6A 121PA 2PEYA 3QIAA 1CP2A 1SXJA 2QT1A 3PFIA 4EPTA 2XXAB 4H9GA 1UAAA 4WZ6A 3OFND 1KI1A 3K0CA 4DEXA 3U3OA 2YC4C 3U5ZB 1TUEA 1XPRA 1NNEA 2WMNB 1QHGA 4C2TA 3WMGA 4XWKA 5L8VA 4HAWA 3AVVA 3CM0A 1IXZA 2OFOA 3OIUA 1KK0A 3U4QA 4Q9HA 1OIWA 3K9GA 1F2TA 4Q7MB 4G01B 3P20A 721PA 2QQ0A 4LI0A 1MO6A 1E9FA 2V54A 5HCIA 4URXR 3PENA 2Z83A 2GEDA 3CRW1 4YMSA 1S9HA 5TVKA 4B2IA 3TGPA 1RYFA 1XWIA 1XMIA 1KO7A 4MYTA 4JL6A 5EZ5A 4YQFA 2RGXA 4NZYA 4URZR 4Q4LA 2AFIE 1X1RA 2ZRIA 4US1R 3ZQ6A 4IFEA 2RKOA 1Z6YA 3CZQA 3FKSD 3K0FA 4LSGA 3SS8A 5E3HA 2IL1A 4AI6A 1NIJA 2G0NA 3RHFA 1ZM7A 1SXJE 2H16A 2YC2C 1II0A 1M7HA 4BEJA 3D8BA 5G40A 3FHOA 4KLZA 1W36B 2G83A 3IO5A 1Z8FA 2CL0X 2IUUA 2VF7A 2VP5A 1TF2A 1ZC3A 1KMHA 3FHTA 1SXJD 4AYXA 4QGAA 3M6AA 4ON9A 5GVSA 3NEYA 2HLDA 1XF9A 3V9PA 3OIYA 2G1JA 2E1RA 4MKGA 2ZRHA 1SHZA 4OK5A 2ZTSA 3RS0A 3FMIA 4PPFA 1VDZA 1WQ1R 5JJLA 1G7SA 2IX3A 1KJWA 4PPNA 3KQUA 1KKMA 3MMPA 2CHVA 2Q21A 4IJMA 5KUTA 1EG7A 1O87A 1Q1ZA 3BAFA 3QXHA 2A5JA 2XXAA 2GXQA 4JLDA 3H1TA 1GNQA 1U99A 1QG4A 2KWIA 2G0TA 2A2ZA 2Q6TA 2VPPA 2XB4A 2DFLA 3O8BA 4ILEA 1E1RA 4GOJA 2G6BA 2RGEA 1KTVA 1E2NA 4W5WA 4BQSA 4EUNA 3QVVA 4TTPA 3MFYA 3QG5A 5CIWA 2CVHA 1N3BA 4MGZR 4ZDJA 4NYIQ 4L4UA 4Q4AB 2GXUA 4TYYA 4IXMA 5JS8A 1TF5A 2KI5A 3QBVA 1FP7A 1KZ7B 4JLAA 2JLSA 1VG0B 1KMQA 4PO1A 4UNNA 4LY6A 4X8MA 1K5GA 4M9QA 3NBZC 2ANCA 2F1HA 3RYTC 1OH5A 2FN4A 4FCVA 2BMEA 1LB1B 2SHKA 4JKYA 1N25A 4ZDWA 5IT5A 2HLDD 3RRYA 2F1JA 2IS4A 1GILA 1KDOA 4Q9LA 4ZI3A 3V4RA 4AWXA 4B2LA 3GFPA 2VSFA 1XZQA 1OIVA 3PIRA 4BLQA 4NPHA 1ZMXA 4IEIA 2WWIA 4RD3A 4AG5A 1I4TD 2CJWB 5DNYB 4D80A 2XITA 1NLZA 2B6HA 3B1ZA 2BBSA 4ZPXA 3LD9A 2WVJA 1Z06A 2BOVA 3S1AB 4LHYA 4M1SA 4XH9B 3I8XA 3UG6A 2ZI4A 1NKTA 1DG1G 4TLDA 4U00A 3TLXA 3TSOA 2FGKA 3TAHA 3K70C 1Z0IA 5F98A 4BFWA 1NN0A 2F6RA 3VAAA 1H8HD 1MO5A 2UZ3A 1XFAA 1E4VA 1U9IC 1O3YA 2GA8A 1UKEA 1N5KA 3BB3A 4B6EA 4E09A 4I1OA 1ZINA 4NCNA 2NIPA 4OKSA 3ZDQA 4G5SA 4HAUA 4LCBA 4UJ5A 5E7MA 1W0JD 2ZPTX 4DIDA 4OQLA 3FHCB 2GJAA 2HJVA 2RGNA 1XMSA 5AWFC 2ZYTX 2KBFA 2WJYA 3AH8A 4GZLA 3I5XA 4K8OA 3CR7A 4PANA 4DDUA 3NC1C 2X2EA 5FPYA 5SZHB 5BW8A 2C5LA 2HCJB 3W34A 4B76A 2X2FA 2VSOA 4HLCA 3M1IA 4E5UA 5DN6A 2FPLA 4A82A 4QKQA 1ZU5A 4EJSB 3ADBA 4Q4AA 1NVUQ 2EYUA 3DMDA 2Q9CA 2ZJ8A 2RGGA 3A36A 3CRMA 2DR3A 4KFTA 1W36D 2NMVA 4MRPA 4KVAA 1NLFA 3B5JA 4A36A 1TX4B 2NQ2C 1YZNA 2CLCX 1Z29A 1E2PA 4D2IA 1E1QA 2VBCA 3EPLA 1P7CA 1UBFA 1L7VC 1R5OA 3QVUA 1EK0A 1GDDA 3EIEA 3L0OA 3CNOA 3GEEA 4BZQA 2VHQA 5K8LA 3TUZC 3CR8A 1OJLA 4QXAA 3PVSA 2B8WA 4AK9A 2CJWA 1KO5A 1OXTA 2QRZA 1KI8A 1FQKA 1N6IA 1T5IA 2PEZA 4DSTA 4B3BA 1TUIA 1DAHA 1G4AE 3S1AA 4U02A 2XGJA 1GNRA 1L4YA 1KY2A 2QM8A 2ORVA 1XTSA 1BKDR 2ODEA 3CX7A 1OXSC 1JQLB 4X8LA 5EUMA 3IEUA 2ZS9A 5GVRA 4O2RA 2BKEA 4LPSA 3AUYA 1JNYA 4NMMA 3THYB 2WJGA 1KIMA 2AD5A 2IYWA 4Q1CA 1SVOA 3UXMA 2VP4A 2YWEA 1G5PA 2FV8A 4PFSA 2OFWA 4HDCA 4TQUS 3ZVRA 5JCPA 3ZD7A 1JXOA 4GL2A 4MRVA 2O8CB 1G6OA 1D2NA 4DLUA 5DN6D 5EE0A 4G0NA 4KVGA 1W46A 5FH9A 1SVSA 5CB6A 4GFDA 1D8TA 3B6EA 1YU9A 1G7CA 4OL0A 2OILA 2IYZA 4B75A 1XJ0A 3GQBA 2JCSA 4HAZA 1E32A 1VYUA 2XZOA 3KTAB 4XJXA 3LX5A 1Q1EA 5EP1A 1HURA 2BDTA 2VHJA 4JL8A 2GZDA 4BLOA 3A1UA 2ZRMA 4H1UA 3VR6A 2R44A 4EJSA 2IYQA 1E0JA 3LH5A 1XTJA 1QVAA 4JLMA 4KITB 1OKKA 4BFVA 3FYHA 1U8ZA 4B3XA 3N2IA 4ARZB 2AR7A 1NIPA 1TU4A 2FNAA 4P3YA 1T3HA 2WOJA 3GP8A 4IVQA 1P5ZB 2ZJ2A 2MMGA 4C30A 2QG6A 3TW4A 5L3VA 4C2UA 4TTRA 4B48A 3IIKA 3EZ7A 2EW1A 2I4IA 2ZJ5A 4EQ6B 3U7FB 4LJ8A 4Q48A 4WXPA 5GJVC 4ESVA 2XSZD 4Q1DA 3EPHA 4DLSA 1FX0B 2P6RA 3CPEA 4HAVA 4RJLA 1E2FA 4AURA 1YVDA 3O8CA 3ZQJA 4G5OA 1N6NA 1NLYA 5FPSA 3W90A 4DWJA 4E22A 3W3ZB 4PTLA 2GJ8A 2IYSA 4OI2A 2DHRA 3CLVA 1G21E 2J59A 5KNCA 2DWQA 4KLNA 2JIZA 4FCTA 4YONB 1AZSC 3B9PA 3T1QA 3VX3A 3LX8A 3KXLA 1IAQA 2YVUA 1E3MA 5TMPA 3KKMA 5DE3A 3THYA 4F93B 2J0VA 2FSFA 4R2IA 1D2EA 1KDRA 4CVNA 4LRWA 2C03A 2QRNA 2O8DB 3DPUA 5EE1A 2O8CA 2AWOA 2O8BB 1UJ2A 1I2DA 3WY9A 2R6FA 4HUTA 1E2KA 1W47A 1OKKD 4Q4JA 3T34A 2IWRA 1E9EA 3CX8A 5EE3A 3UK6A 3I73A 4LDJA 2N46A 4FWIB 5F2EA 3NIBA 2PZGA 3KTAA 1UBCA 2OBMA 2CL6X 1OLOA 3I62A 5SZIA 3EC2A 3C5CA 2OXRA 2WWGA 2ZIAA 1QHSA 1KYIA 1Z22A 1ZNXA 4PAOA 4AC9A 4B32A 3OESA 2UVQA 2JLYA 2GEVA 3DKVA 2ASEA 4EPRA 4ARZA 3UMFA 3PCRB 4LJ7A 1RPZA 1W0KD 3I4LA 5JWRA 3VKHA 1W4CA 1OHHA 1XEFA 2RCNA 2X77A 2XX3A 4U5XA 1FNMA 4MRSA 4TYPA 2WSSA 3HP1A 4PO8A 1W4RA 4EQ6A 1XJCA 2O8EA 2I3BA 4PZZA 1UBGA 2NTYC 1HT1E 1FX0A 4LHZA 3PR1A 4IVRA 421PA 3BK7A 5BWMA 2FU5C 1IHUA 5AUNB 3E1SA 4I1VA 1MT0A 4CEJB 1CJMA 2HT6A 3GLHB 1KKLA 2F43B 3EC1A 3D3QA 1BYIA 2OLJA 4QHSA 3D31A 2ZRPA 3KZ1E 3ZS8A 2QUZA 2O5VA 3NXSA 2O52A 2QU8A 2EVWX 4DCVA 1FTNA 1QVRA 5FUVA 1U8AA 2PCJA 4PZLA 2JAQA 2OCPA 5FTLA 1E2MA 2QQEA 3KJHA 2EFEB 3GD7A 2ATXA 4Q9KA 2O8DA 4F38A 2O8BA 3PJRA 5F9HA 3QXJA 3AP1A 3ETLA 1SQ5A 1YRBA 3KJGA 4Q02A 4LK2A 4QC2A 2IYRA 4R98A 1DBSA 3AF2A 1SGWA 2LKCA 2QGNA 4KFUA 1E2HA 1OHHD 3VR5A 3AKYA 4RY2A 2WSSD 4FCWA 1LVGA 5CLLA 2FJUA 2CEAA 2JEOA 3GPLA 1XU4A 2ZR9A 3TH5A 4JLVA 4RD1A 5C4MA 4JLKA 3PUWA 2IWHA 5EE9A 5HKKA 4PR0A 1Q44A 1QRAA 1KOFA 3BH6A 5B64A 1FTSA 4PC1A 3PEVA 5C2JB 2REBA 3RRNA 1AIPA 2IUTA 3TBKA 1X1SA 5HTKA 1F2UB 2V1XA 1GRNA 4A0RA 1W2GA 1ZW6A 2WIBA 4D26A 1LF5A 2GZHA 4GP7A 2ZAMA 4OQMA 5F9FA 3T15A 2OXCA 2J7PA 4PC7A 4HLQB 4XWAA 3WHKA 3OEEA 4Q01A 3KKQA 4MGKR 4LZZA 1X8JA 3ND8A 3FB4A 4HDQB 1QF9A 2QN6A 4OI1A 3CH4B 4CEJA 3GLHA 4GOXA 3PG5A 2ZYUX 2OFXA 1II8B 2F43A 4Q19A 2C04A 1TL7C 3QE0A 1LY1A 4C0KA 5JEEA 2VH5R 1GIAA 1R0WA 2QMHA 3PITA 1YR9A 2TMKA 3WBJA 1Z0DA 4D4MA 4KU4A 3GEIA 4UNRA 3EPKA 3KQLA 3GJ5A 3PEYA 4C0HA 1KGDA 1UDXA 3DDCA 4LC1A 4DCSA 1EESA 1SXJC 1GKIA 1WA5A 2EFGA 2OG2A 4EPVA 4A92A 2NO1A 1WE2A 2WM9B 3BJIC 3H84A 3ZJYA 3K0CC 1XJQA 1RRCA 1W48A 3WXMA 1IM2A 4RD2A 5EP3A 1DARA 3BFXA 4NCJA 3BIFA 5HKKD 2H18A 1OB2A 3VHXA 2ERYA 2C77A 4FD2A 4V03A 3B85A 3NEJA 4H1VA 2NO7A 1Z5ZA 1ZC4A 2F7SA 5ANRB 3R7WB 3REGA 3GLHE 1Q12A 3AM1A 1M8PA 1HY3A 1N6HA 4NYJQ 2ZAOA 4LYJA 2FFAA 2Z5FA 4JSTA 1RC8A 1ZNZA 2J7PD 4LUCA 4MKFA 1PUJA 3TIFA 4D81A 2FMXA 3RANA 3WNBA 5KU1A 2YV5A 3C14C 1NF3A 1SULA 1RVDA 1GTVA 5TY0A 4LBVA 2B7BA 4XSGA 1AZTA 2O0HA 1G8GA 3PUYA 1X6VA 2WKRA 1P9NA 3IGFA 1F2UA 3C15C 4KJZA 3KQNA 1WDTA 4KXFB 3KFXA 1CEEA 4HB4A 1PVOA 2PZFA 5CDFA 4A15A 1CU1A 2OV2A 4B47A 1DAKA 3C8UA 5C46F 1J70A 4JLPA 3MGCA 1GL9B 2OE2A 4IDPA 4B44A 3DM5A 2X8AA 1E99A 3KX2A 5HZKA 1P73A 4FMDB 5JLJA 2H92A 1T0JB 3OF5A 1XXHB 3Q72A 3AVWA 1G19A 1UDWA 1II8A 2ODWA 5HCNA 4P4SB 5DHFA 3B7GA 1A1VA 1J90A 2ZEJA 3KKNA 4WA7A 4P4TA 1VG8A 3FMFA 2A5FA 4Q00A 2PL3A 3B60A 2ZVQX 2V4ZA 1LF0A 2Z6VA 2HT1A 5HE9A 4OHVA 1M2OB 2HV8A 1U2RA 1FL9A 4JKIA 4RZUA 3V4FA 5DIFA 2DFNA 3UWOA 2EU8A 2ZI3A 3QKUA 3O8DA 3I32A 2J0UB 4MH0R 1OF1A 5AUPB 2AWNA 2G3YA 4JIMA 4S35A 1R6BX 2CLDX 3MWLA 4HLUA 3LW8A 5FOSA 5CDFE 3LA6A 2ZSEA 1R4AA 3ADDA 2OSBA 1Q0UA 2VP9A 2ZRAA 3KKPA 4LX0A 1VCIA 1CBUA 2R6DA 4L5BA 4M1KA 5J4VA 2V1UA 1T3SA 3EXAA 3R7WA 2IYVA 2E87A 2E9SA 5CM9C 1KZGB 2FPKA 3BERA 2IS6A 1ZD1A 5E7IA 1Z63A 1RKBA 4BFTA 3GMTA 1VYVA 4GBMA 1HH4A 3LY5A 2IYTA 3A4MA 5JHHB 1SVMA 4M9SA 3ASZA 3U6KA 1SVLA 2IEZA 3Q5DA 3AVYA 1NN1A 1VCNA 5FPKA 4N3NA 3F0TA 4TL6A 2WAYA 3OFNA 521PA 3R20A 2IBMA 1XP8A 4Q18A 1BO6A 5AUQA 3U2QA 1W36C 2F1RA 1BH2A 2GVZC 2UZIR 2VTKA 4OI4A 1A2BA 1V5WA 1NG9A 2RHDA 3NBXX 4BFYA 3T1TA 2PCLA 1NSFA 4A6XA 3VR4A 3QI2A 2BEKA 1YR7A 1Q21A 1G20E 1SKQA 3BH7A 1XXHA 3U3RA 1P61B 1R8SA 4P4SA 1G4UR 1HEIA 2QMUA 2W2XA 4DC9A 1X8KA 1MOZA 1YRAA 3MJHA 4HSEA 1LV7A 4LYAA 1EFCA 2OAQ1 3U7EB 3ZZUA 3GLFB 3QY0A 5FBQB 4W5JA 1NN5A 2QE7A 1NY6A 4MKHA 4RKFA 1PLKA 3G82C 4A0GA 3SE0A 1CXZA 2GRJA 4Q7KA 3NDPA 2J0UA 3GJXC 1G5TA 2RGNC 4PHFA 1G8HA 4BECA 1J99A 3UMSA 3OEHA 1HA3A 1R10A 1Z2AA 1WBDA 2IEYA 1ZUNB 2CVFA 5DHAA 4DZZA 4NCHA 4Z8XA 5FTMA 4US2R 2Q9AA 3UWKA 4JLOA 1UKYA 1XXHE 4PSVA 3FMPB 4FN5A 1OH7A 2IHYA 1TQDA 4L16A 4KBGA 5IK2D 4C3ZA 5LDDC 3GLGB 3E70C 4DBLC 4AKHA 1JAIA 1K6MA 1WXQA 2QPAA 1FFHA 3BGWA 3Q7PA 4A1FA 1CULC 4BLSA 4R2HA 4F92B 1GWNA 1GP2A 1T4GA 2AL7A 3MJRA 5CM8B 2JLWA 2HYDA 3AF1A 4OHWA 1GFIA 1KY3A 2VIIA 5FI0B 2PT7A 4IFBA 2C9CA 1IN7A 1QHYA 4OHYA 1PJRA 2JJ2A 4OQFA 1RZ3A 4Q66C 4V0OA 2H57A 2WBLC 4DIEA 2QE7D 2R6AA 1N6LA 1YZTA 1VECA 2IYUA 2ZRCA 1AM4D 1BYUA 4DDWA 3IEVA 4B3GA 4LWZA 2FEMA 4Q1AA 1EFHA 1G291 1Z6GA 1W5SA 1DADA 4BUJA 4MUAA 3P32A 4WVFA 3UATA 1AGRA 2GTPA 2XNSA 4TN1A 4XTRA 1U0LA 2ZUBA 2DYKA 3OEHD 4ZCMA 2GXAA 5JZVA 5BYKA 2QTFA 3GLFA 2WWYA 1BMFD 2J41A 2VP0A 1ANKA 3BD9A 4OQXA 3T61A 3DL0A 1ZCAA 3A1WA 2P6NA 1EXMA 2D74A 5L3RA 1NBMA 3LV8A 2BMDA 1Q20A 4F7WA 2VRWA 1AS0A 1N0WA 5SZJA 1S3GA 4NYMQ 3W5JA 2WKPA 4TMTA 5A4JA 1OE0A 3SEAA 4DJTA 1DE0A 4IXNA 1CRQA 2NO9A 5TDHA 1NL3A 5KHOC 1RE0A 2A3RA 4URYR 3RS7A 4KYIB 4CEHB 1NVVQ 4ACAA 4F4CA 4P32A 4EJSC 3N2EA 3C41J 2G77B 2JJ2D 5HPYB 5UKDA 5JMTA 2BMFA 1P2UA 2WSMA 1E0AA 3D7MA 1ZIPA 1H8HA 3GLGA 1S1MA 1FMLA 1COWA 1BIFA 4MYHA 3GLFE 3B13B 2FE4A 1NJFA 1KK1A 2HDNB 3DMNA 3EARA 5JSZB 4XVUA 1NKSA 3MCAA 3ICEA 4Q9JA 1W0JA 1NBME 3O47A 2W6JD 2RGDA 1KI7A 2KB0A 3V00A 5LB4A 3WP0A 2P67A 1HT2E 4CW7A 3AVQA 3BWDD 1G8YA 2GCPA 1CJKC 2QPOA 1CIPA 4PO9A 3BB1A 1R5NA 2IF0A 2HCBA 4PQYA 4NYJR 1NBMD 3CB4A 621PA 4M1WA 3W5IA 4K46A 1Z47A 1VHTA 2QAGB 2WJVA 4IDHA 3GLGE 1GVNB 1RRPA 1E98A 1G7TA 5DO9A 3A58B 4RFSB 5GADl 3W6PA 1AKYA 2QORA 1VPLA 2OUKA 3LLUA 1L8QA 1KNQA 3MWKA 5FTNA 2OHFA 1SVWA 4BRWA 4LJ6A 1G17A 1XCMA 1Z6AA 2B92A 2OEPA 2D3WA 3HR8A 4GT1A 1DELA 2R62A 2ZRFA 2FEOA 5CJ2A 1E0KA 1T91A 3MLEA 5DSZA 2ZROA 1COWD 1S3SA 2CNWA 3HPQA 5CITA 3QBTA 1MRNA 5JFGA 1G1MA 2A5GA 1ESMA 4UXIA 4II7A 4CEHA 3K0EA 5FOXA 1ZIOA 3HPRA 4CZ2A 4GMDA 1NY5A 2Y8EA 5B58C 3DOFA 3U60B 3AVTA 4RZXA 3T06B 2Z4RA 2YOFA 1JPNA 2ZJZA 2Q9BA 2ZE5A 1SVIA 2FH5B 4ZIRB 1ZU4A 3PV0A 2XJ9A 2ORWA 2ODBA 1IN6A 1XTRA 5JSZA 1Z0KA 5L3SB 4D82A 2LCFA 2NZ8A 4J0QA 3CX6A 4GSYA 1MO3A 4KFSA 1NI3A 3VKWA 3NBFA 3K9HA 4TYQA 5HZHA 1JALA 4UKDA 3U3JA 5L3QB 1CR4A 2YWFA 1OXVA 1B0UA 4UJ3A 2ZVPX 3CF0A 1R5BA 4FMCB 1SZPA 2HEIA 3W3AA 2FFQA 1G41A 5G41A 3WRYC 3K0SA 3ICQB 4DLXA 4PQFA 2EQBA 3P1JA 5KDDA 3MRSA 2AFHE 4DLVA 4RD0A 5E4FA 3JZMA 3T12A 2QAGA 3LNCA 3H0KA 3TKLA 5KOYA 2CNWD 4QGHA 4FW9A 2PLRA 4DSNA 3EWSA 2WICA 3N5CA 4Q21A 3U3KA 4BLRA 3CKLA 4RFSA 4IOLA 4URWR 4RSGA 3DHWC 2JDID 1CJTC 5G3ZA 4DCNA 2ONKA 1IY2A 4JVNA 1JECA 1HYQA 2VSXA 2Z43A 1Q57A 2XSZA 4LJ9A 3AKEA 3P4XA 5KDOA 1Z07A 4CGZA 2OAP1 3CH5A 2ZR0A 1E0SA 3IPXA 4DSUA 4P0TA 4C0AC 1UEIA 1IN5A 1DVRA 4NP6A 1CR1A 4PQRA 1OFTA 5DYGA 4XD7A 5HE8A 3K1JA 4TMKA 4OHXA 3RDPA 2ZS7A 3J81k 3TR0A 1G3UA 4P33A 1ZP6A 2ZRNA 4C0SA 1P2VA 4R9UC 2EFHB 2ERXA 3GJ7A 4NONA 1WMSA 2EFCB 1M6NA 3GJ8A 4JVMA 4ZIRA 2WWXA 3NBYC 3PUVA 3SC3A 3GJ0A 4MUBA 1YR8A 1WBBA 1KK3A 3JZAA 4BZPA 5L3SA 2ZS8A 1L4UA 3OHMA 5L3QA 3LRPA 1UEJA 3D6TB 4BFSA 3ZGXA 1P72A 1YKSA 2IHBA 2IK8A 2WJHA 3QPUA 2D2EA 2ZREA 2JLXA 1KNXA 4PC6A 4NDZA 1A4RA 3FFAA 2D62A 3R9WA 5TB5A 1XD2B 3NVAA 1NMYA 1NN3A 1XPOA 1WRBA 3FPAA 1XCGB 2H5EA 1QG2A 2PZEA 4NCKA 3ZZ0A 3I3SR 1OYYA 2B21A 4Q1BA 3X1ZA 1XTQA 2I1VB 1DO2A 3QENA 2YYZA 1F6BA 4WZBE 1KAGA 1W0KA 1YHNA 3CWZA 2K5UA 1ZM2A 2HXYA 3BORA 3B9QA 3OAAD 4XD7D 4Z8YA 4EFNA 4YC7A 5JECA 3CO5A 3NH9A 3L8ZA 5FBLB 5AJWA 1A2KC 2ATVA 4PZYA 4AD8A 2GK7A 1NVXQ 4QBIA 4CEIB 3AGQA 1CJUC 1P9RA 2P65A 3LLMA 1XX6A 4IVPA 1E2QA 5FR1A 3HYRA 1IQPA 2YHSA 2GHIA 1P60A 1RRFA 1HUQA 2BEJA 2IF2A 3K0AB 2VLIA 4QNRA 5CYPA 3X1WA 4DCTA 5DH9A 2ORIA 3NTUA 4URVR 4RCZA 4WXRA 2CK3D 4XVRA 4MGIR 5FOWA 5DLQC 1E2GA 1XEWX 1OH6A 2X19A 1QHXA 2ZI9A 3AP3A 4OYHA 4DDTA 1T9HA 2P2LA 5BN4A 5EP2A 1ZUIA 2OZEA 2ZSDA 1E79D 2AK3A 4PAMA 1GRRA 4ERNA 3KDSE 3SYNA 3LW7A 4DB4A 1U98A 3K09A 4P31A 4MDFA 3G5UA 4ZKEA 3T5GA 3AVXA 2AXPA 3EX7C 3QEOA 1VG9B 3CRRA 2GDJA 5KNDA 3LDAA 1GL6A 4XOIA 3BE4A 4IEEA 4B73A 4PHGA 4RZ3A 2BKUA 2DPXA 2IC5A 5KYKA 1XD2A 1M1YE 4B71A 1BOFA 2IW3A 1P3JA 3FVQA 3UPUA 3QJYA 2J9RA 3SI7A 3NDBB 3RRMA 4TYWA 5AUOB 4O25A 2W2VA 3U3MA 1MV5A 2PLFA 3BFVA 3EA5A 3I61A 2AN9A 1OFHA 2ANBA 3QKRB 3U61B 1KHTA 1Q3TA 3HU1A 4NHOA 4OJQA 3X1XA 1T5LA 5KPJA 5H1YA 2ZRLA 2ZE6A 1YZGA 3CPHA 4TTQA 3ZS9A 1AA9A 4NYIR 4HLUC 1C1YA 1C4OA 4N0DA 821PA 3L43A 4CEIA 4ITRC 3CBQA 4JSYA 1Z6XA 4C0BA 3SNHA 3BB4A 2OCYC 5FOTA 4QBGB 1EX7A 3A37A 1KSGA 3K0AA 5TXGA 4DUGA 3GEHA 4Q5IA 4RCYA 1N6RA 3TVDA 2OLKA 5FR2A 5LD2B 4CDGA 3WRXC 4NE2A 1IXRC 4PX9A 4GNKA 2JLQA 3K70D 3DM9B 1Z0AA 2W58A 3LQQA 1W1WA 4LHWA 4V0NA 2BHRA 3F8TA 1TF7A 5JCZA 1KSHA 5CIQA 1XCPA 4QBHA 3U7GA 3NHBA 5GJCA 2HYIC 4LBYA 3L0PA 3IBYA 4ZCLA 2W83A 4LOAA 4ZCIA 3QKSB 2GZAA 2N42A 2PMDA 2QP3A 4OK6A 3UKDA 3A4LA 1B23P 1E9BA 3ZIAA 4N1AA 2V7QA 2RGAA 3UANA 2XJ4A 1DPFA 1E4YA 2OM2A 2ZI6A 1W4AA 3Q8XB 4PC3A 3PQCA 2GESA 4JLNA 4GP6A 4FIDA 4JJKA 4Q03A 3RS5A 2GXSA 3QPVA 3SJAA 4EKDA 2DWOA 4I99A 3IQWA 4EPYA 5A5GA 4YMUA 3SJBA 2N1BA 3GJ6A 1SHKA 4IKEA 3Q5EA 3RRZA 5JWOA 2EYQA 3ECCA 4CYMA 3TUIC 2A78A 2J45A 3F3YA 1XZPA 3NHAA 3QKRA 4DUGD 3KKOA 2ZE7A 1JEEA 1JBKA 3QG1A 4TSFD 4LC0A 4Y0AA 2J7KA 5FPTA 4NTZA 4MGYR 4KAXA 4JL5A 4OBEA 4B3FX 1OIXA 2O0KA 4M1YA 1HE1C 3B1WA 3IQXA 5AR1A 2NPFA 4B74A 1HTWA 5DGXA 1VTKA 1QHNA 4Q1EA 5J4KA 1GM5A 2RH5A 2QP4A 2VHCA 2FSIA 2P0EA 3TR5A 1EX6A 3H4MA 5FFMA 5B30A 5FI1B 2LKDA 2BBWA 1Z0JA 2FFHA 3B1XA 4NKRA 3TQCA 1W4BA 1K5DA 2OCBA 5FBVB 2OCAA 3EIQA 4QG7A 2KE5A 1G8FA 3RNLA 3ZIAD 4G1UC 2JJ1A 3EA0A 2V7QD 2RGCA 3HYTA 5KSZA 3CNNA 1HV8A 3DEFA 3IUYA 1HQYE 4IDQA 4KSCA 3EG5A 1VYTA 4I1UA 4FI3C 2ZSAA 3R9IA 1F5NA 2ZUDA 4IOKA 3KUDA 4TQAA 4UXJA 4TL7A 4AG6A 1T8UA 1RW4A 2VA8A 4FINA 5BN5A 4CT5A 2ZR7A 3QKSA 4ZDIA 5EXSA 4M8NE 1CTQA 3LVRE 4RD4A 2O0JA 4FMDF 2BBTA 2JLVA 4HZUB 5IHPA 4QM6A 5BQ5A 2P5TB 2ZJOA 3FWYA 4G5GA 2J5XA 4KODA 4A9AA 3VU9B 4Z54A 1E69A 1NG1A 2C95A 1CRPA 1ZM3A 3DKPA 1MABB 4CF7A 1E2DA 1V43A 4B33A 4BEBA 1N0UA 3RAPR 2ZU0C 4NL4H 2IS2A 1JJ7A 5H68A 5FTJA 1BS1A 1E9CA 2GBLA 5JRJA 2R9VA 4WOPA 3EZ2A 1AK2A 4G5RA 4V0KA 4LJYA 2WWWA 2XOKA 4LYFA 4KO8A 4K81B 1N6KA 2JJ1D 4OHZA 2V3CC 1IJFA 1NP6A 2REOA 5JEDA 2RMKA 2CE7A 4PSKA 5JJKA 3B2EA 3JVVA 3KXKA 5GJWC 1T8TA 2VHTA 3M4YA 1R8QA 4L8GA 2ZJBA 1GSIA 3SHWA 1HE8B 2CLSA 2KSQA 1GNPA 3A8TA 5KSOA 2XAUA 1JJVA 1JQJC 1VCMA 3OE7A 4KBFA 4CRWB 2NZJA 3IBGA 3T1OA 5JHGB 2JLUA 2XTNA 4TLAA 3W6OA 1KJZA 2CMKA 3ONWA 3IPYA 3VMFA 2QROA 3IHWA 3SBEA 2JA1A 4QOSA 4MITA 4ASUD 3HJNA 3I1FA 2GILA 4ZDKA 1ETUA 1KI3A 1GOTA 1XEXB 1ZRHA 2W2TA 1AJEA 4JYCA 4QHYA 5CYOA 3P26A 3SU8A 4JVLA 2MMCA 1N6PA 1XB2A 3RS3A 1ZAKA 4HZUA 3BFKA 4M2LA 3IHLA 4GPTA 3SDZA 1G9XA 1PUIA 3E5HA 4V0LA 1KDPA 2XOKD 1IXSB 3VU9A 2Z4SA 3DO6A 5IK2A 2ZRGA 3B82A 1CLUA 1GKUB 5AJXA 5FOVA 3W8NA 4KV9A 4AKGA 1H8ED 1MABA 4HAYA 4EFMA 1CF4A 4Z1MA 3CF2A 4HUQB 5KO2A 3LWNA 3QF4B 1K8RA 1UKVY 1N5LA 3SFVA 4YMTA 4N0EA 4LJ5A 4LJ4A 5CJPA 3OE7D 4FMBB 3LAWA 4MYCA 3W8RA 3NC0C 4F4JA 1ZUHA 2VP2A 4DT1B 2Z0MA 3TK1A 2WIAA 1U94A 2GF0A 1P6XA 2Q0HA 2QMEA 4PHTA 3TJZA 1J8YF 1MKYA 3AF3A 4QJ5A 1IY1A 1UADA 3CWQA 1QHHB 4XIGS 3QKTA 2FFBA 3QNUA 4M4SA 3Q85A 4JMPA 1XPUA 4TT3D 3KUCA 1LW7A 2FX3A 5EJEA 3RC3A 1ZM9A 2D2FA 3W9YA 2W00A 1J2JA 3RSLA 3ZVLA 4A8JB 4Q7LA 4HI0E 1P4SA 1R0XA 1BMFA 3VHLB 3DZ8A 3AUXA 1KDTA 4A0FA 3EPJA 2QEQA 2C2HA 4A2QA 4PPGA 1VCOA 3VNUA 1N5IA 3WYGA 4BGDA 4QBFA 1FNNA 2RAPA 1VKJA 5C4GB 2DCUA 3SJZA 3LXXA 2FSGA 4Q47A 4PAQA 2IYXA 1SVKA 1XEXA 4TL9A 1I4LD 1R2QA 5AJZA 1LTQA 1W49A 2R8RA 4B3CA 2W0MA 3ADCA 1LFDB 4D4LA 4D4JA 5H8WA 1YZLA 3N70A 2GCNA 2G9NA 4MQBA 5FUXA 4Z1MD 1P62B 2XTMA 3IKJA 2X1VA 4L9WA 4NH0A 4OQNA 2HF9A 3KQHA 2XB2A 4LPKA 4C0LA 2IXGA 2FZ4A 3AV0B 1G3RA 4R71A 2ZJYA 5E95A 4JLBA 3QSYA 4I81A 2DB3A 2QAGC 4AIIA 1FZQA 3IILA 3TAUA 3U6BA 2F55A 1UF9A 1G5RA 1DAMA 4BFXA 4DVGA 2IS1A 3KJEA 1ZJ6A 4XVQA 2ZXUA 3WP1B 3AEZA 4TMVA 2G88A 2GJKA 2QGZA 4HUQA 1FOEB 2ZJAA 3QF4A 2WKQA 4OJKA 3CF6R 4C9BA 2XNDA 4POAA 2CCJA 4EDHA 1NRJB 4QRHA 1YZKA 1E2LA 1ONBA 2GJ9A 2W6JA 3NH6A 5EQTA 3I92A 4MRRA 2ZITA 5JBQA 4DT1A 2BWJA 4X8HA 4YDSA 5FBWB 4TLBA 2FZLA 5CLQA 2WPDA 4WIAA 1L2TA 1TEVA 1QHHA 4MDEA 3A1SA 4HATA 2UKDA 1U90A 5EP4A 2NO6A 3KJIA 3HDTA 4GMXA 1PV4A 3GFTA 1YE8A 3Q9LA 3SFZA 4A8JA 4LGMA 2AK2A 4BWYA 4HLDA 4DLRA 4RVCA 3SOPA 3IO3A 1G6HA 4WW0A 1Y3AA 2QAJA 2CCKA 4DEYA 2P5SA 2MSCB 3X1DA 4ABYA 4DLZA 3KXIA 1Z6TA 1N2CE 2HUPA 1KI6B 2YOGA 3WNDA 3RSOA 1IN4A 3GJ3A 4XWOA 3NKVA 1DOAA 4I1SA 4YLGA 1D9ZA 1S1CA 2PH1A 1FPMA 4TYNA 2ONJA 3VKGA 2CHGA 4LBWA 3W6NA 1J7KA 3X2SA 2BV3A 2F1IA 1ZD9A 2XNDD 1N0VC 2V9PA 3SR0A 1LS1A 3AKDA 2IXFA 3L8YA 5G3YA 3VR2A 5JS7A 1XD9A 1W7AA 1CR2A 3WMFA 1W2HA 3BBPA 2WWFA 2D7DA 1EFTA 1FUUA 1U8YA 4JBYA 4I4LA 1F3OA 1IJEA 2WAXA 3RVBA 2FG5A 2WPDD 1N5JA 2ZI7A 1E94E 2VP6A 3TSWA 1GL7A 2GAAA 5K8UA 4IHQA 3VX4A 1YZQA 1M34E 1FQJA 4R7ZA 4HB2A 4CT4B 1F48A 1VIYA 3OZXA 2QZ4A 1E9DA 4E03A 1US8B 3K9NA 4Z51A 2CCGA 3HU3A 2WOOA 4O0MA 1VG1A 5ELXA 5BXQC 4NU0A 5LB2A 1IONA 2P3SA 1JXMA 2QENA 1CJVC 2VQSA 2GWHA 2RGBA 1JEDA 2HF8A 4M9ZA 2FSHA 4EPWA 2PJRA 1KI2A 2GKSA 4LBZA 5EUQB 1XTIA 4JLJA 3FTQA 4AYWA 3BH0A 2BCJQ 4DHEA 3O8RA 2VL7A 5CK4A 1TADA 2YJTD 1GZSA 2D06A 3K09C 2VYFA 1FMJA 2JDIA 3KB1A 4Q1FA 1IN8A 1JAHA 2QPTA 1DAIA 1KI6A 3CW2A 3FGNA 3AVOA 1S4QA 4UXHA 3VFDA 1ZM4A 4IRUB 2GNOA 5EXTA 4ACBA 5B57C 4FMCF 1R0YA 3P27A 4G3XA 4NCIA 3THWB 2AKAB 3K8YA 2QT0A 2R6CA 5FL3A 1D5CA 1E1RD 2EWVA 2XZPA 4M1TA 3EASA 1DO0A 5LPNA 2BIFA 2ZE8A 5EE5B 4DLWA 2ZUCA 3MWYW 3PUXA 3LFUA 1OT3A 2F9MA 2ZQ5A 3A1VA 4M1MA 3QXCA 3L0IB 1KSJA 4GOKA 3FDIA 1UPTA 4KHZA 4Q7JB 2AHOA 2H1LA 3NG1A 2NPIA 1EFUA 2DWPA 1DTSA 2FPMA 4TZ0A 2WZQA 4GRAA 2CBZA 3ASYA 2J0QA 2BC9A 2R65A 1W5TA 2NGRA 3ZVMA 2VO1A 3NWJA 4OK3A 4PC2A 2ZYWX 1KI4A 3TSZA 1T6NA 1MH1A 3QUSA 3EZFA 4FXPA 3PEWA 1US8A 2OT3B 2ZANA 1CR0A 4A2PA 2C98A 1G3IA 5M04A 5KDLA 3BRWD 2IXEA 2JATA 3LBHA 4O2LA 4YMVA 3PXGA 1NMZA 3SJCA 3KB2A 4V02A 3A6PC 4KFRA 4UNSA 1Z2CA 2CL7X 2QY9A 3OIVA 4B34A 3CZPA 5J4YA 1XBTA 1A5TA 3U7HB 3ZD6A 5DI3B 3FMOB 3SQXA 4M0LA 2GAOA 3GJ4A 1Z83A 3OAAA 4JZKA 4Y0VA 4BPBA 3C4JA 2QI9C 2C99A 2CDNA 2A9KA 2AKYA 2IUSA 4YXWA 2WTUA 2IA5A 3I8SA 4TL8A 2OESA 3R8FA 5J47A 4Q9IA 1OFIA 1ZCBA 1TQ6A 1ZVQA 2GEUA 3B1VA 4A4DA 3EZ6A 4HYYA 3THOA 5C1BA 3THWA 3BC1A 1TPZA 1TEXA 5JJIA 1OFUX 4WZAE 1P75A 3LO5A 5LBIA 2ZRJA 4DB2A 1UBEA 1Z3IX 3VR3A 1T0HB 4BZXA 3THXB 4W7SA 2CK3A 2R6GA 4GI7A 3DOEA 3KFVA 3FKQA 2DFTA 4C7OB 4QGGA 3VR1A 3U44B 4HAXA 1ODFA 3AF4A 4UNPA 4ZI2A 5JI2E 1GG2A 4PHHA 1DG3A 4C0QC 1KAOA 4Q4JB 4DDVA 3K70B 1IOZA 1QHIA 4HB0A 5J4LA 4FWTA 1E79A 3LQRA 2KBEA 2JLZA 2PX0A 4QJ4A 1XEWY 1RJ9B 4UNQA 5CK5A 1E1QD 1E2EA 1WCV1 1QBKC 3ZYCA 4M21A 4DSOA 1CS4C 2A7QA 4A2WA 2QSYA 4YDHB 3A1TA 5F3WB 4JJZA 2F3RA 1OB5A 1C9KA 1ZBDA 1OXUA 4EIWA 3CONA 4MYUA 1R0ZA 4U7DA 5B2ZA 1YQTA 2QL6A 4L15A 1RRGA 1MRSA 2XEXA 1KK2A 2VEDA 4QL3A 2CXXA 5LD2C 4YXWD 1GUAA 1KO1A 2AXNA 2BCGY 5EXPA 3B1YA 2O8FB 2O8EB 3SN6A 4BE7B 1IY0A 1EWQA 3RWMB 4EAQA 1Q1QA 2YZ2A 3AGPA 5IDVA 3WNCA 2B8TA 1OPXA 3MUFA 5DI3A 3IIJA 4ZV4A 2IT1A 2DFKB 2ZETA 3CNLA 4RD6A 1JR3A 4JT4A 2D7CA 1TQ2A 4AYTA 3REFA 3AKCA 2FWRA 2C9OA 1XDBA 3TMKA 2MSEB 3EAQA 3WYFA 5K8IA 1U0JA 4GDFA 2FA9A 1E9RA 1G3MA 2BM0A 1D9XA 3QXSA 2AD1A 3F5FA 4TLEA 5P21A 3LXRA 3THXA 4AY2A 2QTVB 4C7OA 2Q3MA 4XTCS 3AF0A 1OYWA 4B3DA 3U44A 1MO4A 1KI9A 3LBIA 1G3QA 3SHFA 4EPXA 1FP6A 1T3LA 2MSDB 3T1VA 3C16C 4DXAA 4W5HA 1FW6A 4NYMR 1S96A 1OXXK 1LNZA 5TV2A 3MG9A 1RIFA 4KYUA 3CUEF 3A4NA 2GBLC 1G7RA 4M1OA 4QNMA 1RJ9A 2WJJA 1U9IA 4BFZA 4B35A 5EXXA 1AKEA 1M7GA 1NVVR 2DY1A 4QFMA 4F91B 2BJVA 1JR3E 4LV8B 2F3TA 1TAGA 3T5DA 2REXB 4JVSB 3EZ9A 2YNMA 2J1LA 4TQ9A 2QM7A 4BFUA 2C96A 4JYBA 2FDCA 3FFBA 3QPWA 4AKEA 5JRZA 2W0SA 5KTYA 4LJAA 3FE2A 1EGAA 3TW8B 1GRQA 1S9DA 4RKEA 1G16A 1JR3D 4MA4A 3T35A 1XRJA 2QSZA 2O8FA 3I72A 3H86A 3L82B 2VF8A 1GITA 2JIZD 3QF7A 5J5CA 4Q4HB 4DLTA 1AQUA 2RHMA 4YMWA 3C7KA 1ESNA 1S8FA 2ZI5A 2PX3A 4TSFA 2J87A 3HR7A 4EFLA 3ND9A 2CE2X 2NOAA 8OHMA 3I5YA 2YINC 1KSFX 1LS6A 1P2TA 2G1KA 2W6IA 1SKYB 4JBXA 4WAUA 3CRQA 1YJ5A 2EFDB 2GCOB 4XSHA 4HEJA 1Z0FA 4D4KA 1AN0A 2GF9A 1XMJA 4TLCA 3TRFA 1DAFA 1GAJA 1XTKA 1DAGA 2OBLA 2ZRDA 3AVUA 2V8OA
chains in the Genus database with same CATH superfamily
5JSYA 4J4HA 1K97A 2CNNA 2I76A 2L69A 3FOWA 3SQWA 4TVOA 1WB9A 5IYZB 1A9PA 2JLRA 1EK2A 4MJ7A 4P35A 4PYQA 3TN7A 4ARAA 4C07A 2PN1A 2YNMD 5IF9A 1GQQA 1BTOA 1ES9A 1K3FA 4JJ6A 4UAGA 5PNTA 1M5RA 3IKLA 3PKJA 1QB7A 1C9DB 1RQLA 3MD0A 5A0FA 3AFNA 3DZDA 4G4SO 4HDOB 3OQMA 4QSHA 3EXHC 4MVJD 2A30A 1Q3HA 3P19A 1KO8A 5KYXA 1V41E 2DG2A 4IDBA 3ZDBA 2V55B 5EESA 5KSPA 1BXGB 2JFGA 5BSTA 5T41A 4DILA 3E03A 4NABA 2F8SA 3DTYA 3TKAA 4A6PA 1IVNA 4TWRA 5JAQA 1ILWA 1N9GA 4FYPA 5SZKB 2JAUA 3WO0A 1ZYUA 4C4ZA 4E1AA 3KRTA 5FUWA 1PHRA 2CJFA 5HR5A 5EZSA 2ALJA 3MHPA 2H6EA 1CE8B 4ESHA 1XL1A 4X1YB 3WHLA 2NAFA 4FQ7A 2W6ID 3U49A 4GKBA 1JR6A 4GOND 4D9HA 5DISB 1MB4A 1N1GA 4N5HX 4MLCA 4MYSA 3F7TA 4WN9A 3ZXXA 5LVAA 1TVCA 3WMEA 1F60A 4PNPA 1HDGO 3EZGA 1V9CA 3UH1A 3EAFA 3LBNA 5FA8A 1E58A 5F4ZA 2XRFA 4RNDB 5KWVA 1EU1A 4H3VA 2L82A 4XB2A 1U02A 3OEYA 3IKVA 2HO5A 2I29A 4HEA1 3L6BA 4PO3X 1NVEA 3ZZTA 1EDEA 5BSEA 2PYIA 3GFBA 5ILGA 3KYCB 1WPXA 3KCQA 4O3MA 5B7GA 4BLTA 1K92A 4Q34A 1XCBA 1Q1BA 3W5HA 5K3DA 4RDCA 1VDMA 1E6LA 4D98A 4D9GA 4F5ZA 2GBFA 3EJWA 3PLRA 3Q10A 4G63A 4W9MC 2B4QA 1FP1D 1J8VA 3BHJA 2JGNA 4JT2A 5AJVB 2JHPA 3I09A 4Y9RA 3MOIA 2Q0QA 1E3QA 1EFPA 3WL8A 1RLJA 4LDAA 3MERA 1B8NA 4ZYTA 4DREA 5IYZA 1IXKA 1V7CA 5H5JA 3GPCA 2X4DA 4TZ6A 1K4YA 3C5HA 4F46A 5F5LA 2VHUA 3R6TA 4IIBA 1RHKA 1J8MF 1RSZA 5BPFA 2AG6A 4MV0A 1AUPA 2FSSA 1SMKA 3NBQA 4RVNA 1GYRA 1NW3A 1VSBA 4MO9A 5KAMA 4B4WA 2QRUA 3GLIB 4ASUA 4YPFA 1MD9A 3S99A 1M2WA 2FWBA 1BXGA 1EVJA 1SKYE 4XI9A 1X7WB 3VU0A 3ENQA 3EULA 2FP4B 5DX1A 5AFSA 1AQYA 3OPNA 3WBKA 5BW4A 2V8BA 1U7DA 3GRUA 1LBSA 4MRNA 4CUZA 5L45A 4QDXA 3UA4A 2WAMA 3A11A 2QBYB 5I8WA 3O84A 3F49S 1E9SA 4M1QA 3R7BA 4I0WB 5J3JA 2H2HA 3LY9A 3M82A 4CXMA 1CE8A 4D0LB 1OSNA 3HN6A 4RVOA 1UM8A 5G53C 4X1YA 4LHEA 4BJ5A 1IAVA 2OB1A 5GZ6A 5DHUA 6YASA 5D1HA 2YR0A 2QKYA 1XNJA 3KQOA 2BVNA 3SPXA 2PMFA 1ZOIA 2NXCA 3H1GA 3FTCA 4BMVA 3HJTA 1K7YA 3RFUA 4BX2A 2YIJA 2LCIA 3FPEA 3A6JA 1QTRA 3MJVA 4M89A 2FGJA 2XVXA 3FGPA 3PA8A 2I7TA 4ATNA 1E9AA 3QEJA 3CLTD 1N2ZA 3CZMA 3HKCB 4WFKA 4ALLA 3WGKA 3KYCA 3C7CB 2BUCA 3K0HA 4KQEA 1VJ0A 2J3EA 4MR9B 3CZ4A 2R8ZA 4QULA 5FUYA 3M0EA 4RLQA 1XMPA 2G76A 2XECA 2AH5A 1Y5LA 3HJAA 1IOLA 3O7WA 3QGMA 4KUGA 2WMDA 4RY0A 4O4LF 5I4BA 1FUKA 1R7RA 2O4UX 3FNFA 5K0JA 2EKQA 1TAUA 4RSMA 1ZBQA 2J0SA 3ZDYB 3L05A 2RG7A 4ZYYA 4V0ME 1JPJA 3LT4A 2GPAA 1SXGA 1A7JA 4N65A 3BWBA 1UK7A 2Y05A 2JASA 4FKBA 4MTLA 4S1TA 1F5SA 1VLQA 2WHXA 3VUFA 3AP2A 3ZLJA 3QBEA 2J3QA 3CPJB 3PNSA 4AZ0B 2CNDA 3EPPA 4MAMA 3A32A 3O74A 5CG1A 2OMKA 2R2GA 2X0EA 4Y2JA 3RTDA 3KB8A 3V1TC 2HHLA 4A0HA 1XQ9A 4ENTA 4ZCRA 1G18A 2Y6VA 1N8TA 3EZNA 3IERA 4WESB 5TT0A 1U3FA 1KRWA 3QVTA 4EMTA 3GLIA 1YONA 1JU9A 3HFJA 4MQLA 4XIJA 5ECDA 1UKZA 3CV3A 4AZWA 3RLFA 5EIAA 3IEPA 1J5XA 4DADA 4DBZA 1P1RA 1APBA 2YMPA 4JX9A 3JASB 5IZ4A 3CHYA 1N78A 3QVOA 2FP4A 4R3WA 1L4MA 2VLBA 5COBA 1WKCA 4C5CA 3R9XA 1M2FA 1RFLA 4US0R 1M7BA 1JIXA 4LQLA 5YASA 1YO6A 4WY2A 1U81A 5KPDA 3KUUA 2QBYA 3IUSA 1AQ6A 1GGFA 1QZXA 1RAIA 2HI0A 2IOHA 2ZSFA 3WJ2A 1U7ZA 2A5DA 4TKMA 3X44A 1IK4A 1XVVA 2OV6A 2V6IA 2HBQA 3TDNA 3UCXA 3S8EA 3H6GA 2Y71A 3K53A 4RPLA 3WIUA 4B6FA 4H17A 2JK0A 4EABA 4HB3A 1YRLA 4JOSA 4RJTA 4UQLA 3ZH9B 1DAEA 2OENG 2Y0BA 2V3VA 1A9SA 2YOHA 1YZFA 1I4EB 2OBNA 4AVYA 5I48A 1M72A 1H22A 3Q4GA 2Q28A 3UMGA 2FEPA 4DR3B 1VRVA 1FBTA 1XDGA 5AJYA 1RAEA 1P0CA 2AFRA 4LHVA 2NU7B 1RLUA 1AGPA 1MGPA 5HOEA 1CFJA 1DQNA 1O6FA 1C0PA 2P8JA 3BICA 3LQKA 4M36A 4B2PA 3HKCA 2IBSA 4JC4A 3KU4A 5DP2A 2BMJA 3DTVD 1N6OA 4S2EA 2HA7A 1L7QA 4MR9A 3BGDA 4RGVA 4UPDA 3VQTA 5EI5A 4YRAA 5H70A 2BFAA 4FHEA 3S3TA 2ODTX 4A6DA 3D8NA 2VDKB 1DS6A 5H0IA 2C2OA 4QGFA 2I66A 3UXHA 3F7MA 1CVLA 3JWGA 3ZJVA 4DV6B 2PFGA 5JZ9A 1F8GA 4B82A 4M53A 5HKLA 5D84A 2I7VA 3B2NA 3T99A 2VCYA 3RS4A 3D6UA 2IYLD 3ND5A 2AFVA 3HJCA 3PGKA 1D4ZA 3SSMA 5BQPA 4AZ0A 2BHTA 2W22A 3DXZA 3VI3B 1M3SA 1HDOA 2I1WA 3AFGA 1YR6A 1EP2B 1RABA 121PA 1I94B 2KLHA 3QIAA 1HX7A 4WESA 3PFIA 4M87A 5IKOA 3ROGA 3TVYA 3USCS 4OXXA 5JADA 1DHTA 1F4PA 2YJ3A 3FYCA 3T7RA 4CG1A 1VI6A 4S1WA 2YC4C 4YRDA 4NICA 1E5VA 1GTZA 3JASA 1M6YA 3N3AC 1JSLA 1W76A 2BF7A 1Y89A 3BWVA 1IC6A 3VSDA 1CS0B 2NXWA 4Q9DA 3GR6A 5MFZA 4H1TA 2CJYA 2A1TS 3WVNA 1DX4A 2IPMA 5CVEA 4Q7MB 5JIBA 721PA 4CJXA 1MO6A 4MGHA 3QVGB 4URXR 3LPMA 1PWXA 5CDGA 3SHQA 3CRW1 1Y5RA 1GAXA 1QOZA 3RJMA 3KJQA 2WWVD 3S44A 1XWIA 1ZNQO 4R2WA 4EZIA 5HEKA 4JXZA 3RADC 2RGXA 4URZR 4C4YA 3FVTA 4Q4LA 3JAMA 2AUNA 2YVLA 3CZQA 1MNQA 1Z35A 1IDN1 3SYMA 5CLFA 2KM1A 2P8SA 2NU7A 4AI6A 1EA5A 1LXCA 1NIJA 2G0NA 2R0QC 2AS0A 1Q74A 1YFLA 4V2IA 2GERA 3ITEA 4W5OA 4DPLA 2P4HX 2J4CA 4JCOA 1KYZA 1SB8A 3I01A 4KLZA 1Z56C 2G83A 3QX8A 3VPBA 3JPWA 3CTMA 2E2WA 3ET4A 3A3YA 2CL0X 3STHA 2IUUA 4F2WA 1XZGA 1E5QA 3NZEA 2Y0EA 4E94A 3OH8A 1RHRA 1YDMA 1B8PA 3M6AA 4ZZ3A 3ANLA 4J7CA 3SD7A 1B8OA 1XF9A 4U9UA 3A2NA 1K6IA 2ZRHA 3GVCA 3DC2A 1L7MA 1Q0SA 2Y68A 4YCNA 4PPFA 1VDZA 3ISJA 4RIFA 5F3DA 3KEGA 3LLVA 3PX7A 4RQUA 3GV0A 5BPHA 2Z2YA 5HRCA 3HBAA 5FV7A 5EIHA 1SN7A 1D2GA 2A5JA 3MJCA 1JKJB 2IZZA 2VDPB 4CIXA 2C7QA 3RLIA 1TJ3A 3IMGA 1KGSA 3S68A 3C7AA 3ITDA 2ZWPA 1ISJA 1GNQA 3DZIA 4J0IA 4KGVA 3UGQA 4KAFA 1BVRA 4RL4A 4TUYB 2MWMA 5K6RA 5AVOA 1U7OA 1PGQA 4LIPD 4N4AA 2PGNA 3ZWCA 3BCRA 1SXIA 2DFLA 1CS0A 3EVBA 2BR3A 3GCWA 4Y2GA 2RGEA 5D7NA 2P9JA 1KTVA 1E2NA 4ROTA 2HNKA 4NDNE 2D5CA 4TTPA 5C8VA 3MFYA 2OGZA 3ZJTA 1LRLA 3DQZA 2DKOA 3QVGA 4Z99A 3KBOA 1N3BA 3JVDA 1S6YA 4CLRB 1F0NA 4JUDX 5TF0A 1U2DA 2X3YA 3JQFA 1M8KA 3IP1A 3QBVA 4HP8A 1SIUA 4IICA 1C1XB 4YLYA 2WTBA 2EBWA 4PO1A 4LY6A 4UNNA 3EK2A 5DYTA 1EDDA 2B69A 3E48A 1HNZB 1H6AA 2GN0A 5F7JA 2F1HA 2ENUA 1H4QA 3ELYA 3ITNA 3KPUA 5KSYA 3IIEA 4JKYA 4LE1A 2IS4A 3RQIA 3CW9A 1K63A 5E8JA 2Y0CA 4FSXA 3Q0IA 1Q6ZA 3HACA 4B2LA 3E3AA 1XZFA 1MQ9A 1OIVA 3PIRA 4FQ5A 2BGKA 3RUIA 3UOWA 2VKQA 2IE8A 2QX8A 5JSHA 5GM2A 2ZBQA 4BNDB 1P31A 1ZITA 1I1HA 1UL1X 2CJWB 3A26A 2RCYA 5DNYB 4ENRA 4X7RA 1NLZA 3GAFA 4G0VA 3COYA 4ZPXA 1XRPA 4BVJA 1NX9A 1T8RA 1ZIXA 4EI8A 1Y7PA 3IB6A 4FX2A 1TW3A 4BXOB 3UG6A 1UJBA 1NKTA 2ZI4A 3BQMB 4U00A 3TLXA 5CUQA 1DDOA 1LLDA 1Y34E 4ZGWA 4NZPA 1GUFA 1NN0A 2YJ4A 4KXWA 2LGJA 3UICA 1H8HD 2AE2A 4ZVRA 5AW5A 1RNLA 2R97A 1BMTA 1Z68A 3EAGA 3V33A 3RTGA 1O3YA 3HDVA 3V6LA 4X66B 1J7JA 1UKEA 4F06A 3LQ4A 1E7WA 4LYGA 5JMWA 4E09A 3J80A 3CVVA 2FDXA 3AL0C 3KZOA 1UUFA 3ZDQA 2NIPA 5AVYA 3DE6X 3L7BA 4XFJA 5HXAA 1PZMA 1FLVA 1IZZA 1W0JD 2ZPTX 4R40A 5IMSA 2YIMA 2AVDA 4TUYA 4BNFA 1XMSA 4EHLA 4ZVVA 5NLLA 2WJYA 3UWMA 2GH1A 5B12A 2PLAA 4RJKA 3SEZA 1GZ6A 4GZLA 4C4OA 1AMUA 3I5XA 4PANA 4WWHA 1H3EA 3EGOA 5A5VA 4B76A 5KC8A 4LXTA 2X2FA 1KEZA 3HY6A 3BZBA 3F98A 2VSOA 2C00A 4HLCA 5DHTA 4XSVA 2P35A 3AM4A 1VA5A 4EYQA 1EB8A 5KTSA 2FPLA 4A82A 3CJRA 4CLRA 1A71A 5C53B 4UEKA 2IITA 1NMEA 3IULA 3T5CA 4DTCA 1XA0A 4HXFB 2X5KO 4WKCA 1C1XA 3E27A 1S4MA 4PXYA 3QELB 4B1FA 1U3CA 1U65A 2K2WA 4KVAA 3D6AA 3B5JA 2GN1A 4OM7A 4OOFA 2AR0A 5LBUA 1P19A 3OQPA 1VYHA 1Z29A 4HXYA 2PU7A 1E2PA 4OY3A 1O89A 1P7CA 1UBFA 5TE9A 4D96A 5DTMA 5A04A 3L0OA 1GDDA 3EIEA 2R8XA 4WNIA 1I4OA 5K5EA 2VHQA 2FEXA 2XV1A 3PHBE 4BNDA 5K8LA 4BRSA 1OJLA 3KELA 2Z5LA 2B8WA 3PVSA 2CJWA 4PS0A 1XAJA 3WQQA 4AK9A 3TLMA 2BGUA 4BE4A 1TCBA 2PQ2A 4BNMA 4G23A 4MV4A 4ETNA 1N6IA 5C32A 4QUDA 1VHWA 3MEQA 1OZGA 1DIHA 5EWMB 3JQ9C 5IH3A 1KWGA 4BXOA 1Z2PX 3LYLA 5I9MA 4X8LA 3PPYA 4CDNA 1OXSC 4YJ3B 3CZ9A 5ALVA 4AO6A 3GRPA 1XUOA 5GVRA 3DE1X 1V25A 4S0ZA 3AUYA 4DV7B 2OCKA 1L8LA 1JNYA 2DP4E 4DZRA 1H0HA 5G1PA 2RDMA 2WJGA 1PTKA 4Q4CA 4Q1CA 2IYWA 1SVOA 3KLNA 3UXMA 4Z86A 1AURA 1KIFA 1WB4A 2YWEA 3ENZA 3V5NA 3BYZA 1JXOA 2FPPB 1SQGA 1SD2A 4MRVA 1JIUA 5AW6A 5LU8A 1CNEA 3F71A 3UTDA 4ZJYA 4KVGA 1HLFA 3VNRA 3WLQA 3SXUB 3RIGA 1C1HA 2BLLA 2MR6A 2YXEA 4GFDA 4WK0B 1T5DX 4BVGA 1U31A 1YOVB 2AW3A 2D1YA 5F1OA 2IYZA 4WY5A 2WTAA 1TKAA 5TC4A 4B75A 4YT8A 4ZMBA 2JCSA 1VYUA 4L27A 2EW2A 2Q6IA 3W3AD 1NU6A 3O95A 1A5ZA 3KTAB 3TAXA 1MOSA 1Q1EA 5EP1A 3NM6B 3GN1A 2FX5A 1XCJA 4RBNA 1PZFA 4J0GA 3NHPA 4G5HA 2WABA 2ZRMA 4H1UA 3FAZA 1Q11A 2R44A 1JDZA 2IYQA 1E0JA 5IBPA 1TKRA 1QVAA 3C48A 3RBAA 4JLMA 2IH4A 1OKKA 3FYHA 1U8ZA 3ZD8A 1NASA 3QELA 3N2IA 2G8LA 2AR7A 1QH9A 1IL0A 2RHLA 4YDRA 3WKBA 1GA6A 1F1BA 1BHQ1 5BNTA 5TGTA 3B1JA 4FPXA 3GP8A 3VSEA 1J9ZA 1BGWA 1FA9A 3HVIA 2B4KA 4TTRA 3TW4A 4B48A 5L3VA 1O6CA 3EUFA 3EZ7A 2LUOA 2CWDA 2I4IA 4FDUA 3HCEA 1I0ZA 4EQ6B 3U7FB 4LJRA 4I9FA 5GJVC 4ESVA 2XSZD 3OUZA 4Q1DA 1NC3A 5ECGC 3BGOS 4RJLA 2VJMB 3NRBA 5AVRA 2QRQA 2AIRA 1YVDA 2FK7A 4AZVA 5HQ3B 2E82A 4IX1A 3R7DA 4RABA 2VKTA 5IC6A 1V5IA 4M8IA 4TRMA 2FSUA 4E22A 5EWMA 1RI1A 4R9VA 2IH2A 1GZ3A 1K8XB 3CN7A 1FDUA 1G21E 3ZN2A 1A95A 2O3TA 4KZPA 4DMHA 1V4BA 2FUEA 3IBCA 3MVEA 4RS3A 4OB8A 5ER6A 3T1QA 3VX3A 5JC1A 3DBOB 3KXLA 4MWDA 3RU9A 3W5SA 5TQ0B 4HRYA 2HXGA 5AOVA 3UWDA 1QFXA 2J0VA 1EZ1A 2FSFA 2O3UA 3DOHA 2JEYA 4ZQEA 1GVHA 3G2IA 2HPHA 5EMKA 4CVNA 2FPPA 2QRNA 2WVAA 4A8PA 5EE1A 5COAA 2AWOA 1UJ2A 4RHFA 2VXCA 1OZFA 3WY9A 4IUBS 3SXUA 3ANXA 4EDFA 1W47A 1OKKD 4I5GA 1BXKA 3K8ZA 1SG9A 1YOVA 3GPBA 3HO6A 2XMSA 5EQJB 5ES3A 4BB5A 3PFKA 1DBQA 2I33A 1Q91A 3KTAA 2W93A 2W70A 5SICE 3UOGA 3ZQKA 2LR0A 2IKSA 4PN7A 1NP7A 1RXIA 1GL3A 5E0OA 3TXAA 4L57A 4GR4A 2PXXA 1QMPA 3GHHA 4QRIA 3R1IA 3MGAA 5CCXA 2VATA 4AC9A 3OESA 3QNWA 1ZCJA 4CTMA 1Z17A 4XR9A 1LD3A 1OILA 2ASEA 5BW6B 2H9AA 1QIHA 4A3SA 1QIMA 3GI1A 3U16A 3ONFA 4B4KA 1RPZA 4JP3A 2A0YA 3ZWQA 2YJGA 1W4CA 1OHHA 1XEFA 2JI9A 2PY6A 3FJ1A 3MJ4A 3NWPA 1QZZA 4J0KA 1FNMA 1EHYA 5A7GA 5BV8A 4AXXA 4W4TA 1R9MA 4JYMA 3B3AA 1QAMA 5CT6A 1W4RA 2QTCA 1JX6A 4EQ6A 1BEZA 2OGSA 4P9NA 5DNWA 3WYNA 2XMZA 4WK4B 3NLLA 5CURA 5G0WA 5SY9A 1HT1E 3ZNOA 5L40A 3PC8C 5HS6A 1JEYB 1OFUA 2A67A 2VJMA 4OH7A 3MRXA 3IAEA 4JY7A 2FU5C 4MIEA 5EJ9A 3RVJA 1OWOA 1MT0A 3LKDA 3NW9A 3P97A 4IUDS 4XX1A 3TQSA 3RUFA 5KTNA 5B1EA 1KKLA 2ZIGA 2AUTA 2F43B 3KC2A 1GYPA 4FQ8A 1WR8A 1X7DA 3D3QA 1BRMA 1XMQB 1QV9A 3W1EA 1SUDA 3PPIA 4BYGA 4REOA 1IZ0A 2QUZA 2R7AA 3ZBTA 2IIVA 1KVTA 5F64A 4HNTA 5I4KA 2OK7A 4X1KB 5C8DA 2JANA 2EVWX 2QX9A 5IC4A 2YUTA 4DCVA 3TL2A 3TOXA 2QN1A 5TQ0A 5HM6A 3WGIA 2JAQA 2G06A 4H2DA 2F9FA 5EMMA 2HZ7A 4B7ZA 4RTOA 1GPLA 2B61A 4Z7OB 1UPFA 3QXJA 1SQ5A 3ER9A 1NVMB 1M8GA 4DJJA 3LTNC 3AZQA 2OD2A 4R98A 1J4AA 3SKXA 3NYIA 3K72B 3N6RA 3VHXB 5BNWA 1ZEMA 4WPGA 3LSYA 2WNIA 1I5OA 2RK6A 3HRKA 2DE0X 1OHHD 4RDHA 4XAQA 4ZVUA 4LOHA 2CYAA 2XWPA 1LQUA 2ZUUA 2OVBA 4LYEA 1QWOA 2XW6A 2XVYA 1TO6A 1XTBA 1RBZA 2Z2JA 5CLLA 4C43A 2HKIA 1GT6A 1R16A 1MCZA 3GPLA 1AA6A 1NWCA 3UAZA 5KQMA 2WM8A 1GGMA 4Y2QA 4D0GA 2OAGA 4UOEA 3FYSA 5EE9A 1BWPA 1QRAA 4IDGA 1KOFA 5CR9A 1A8QA 3WB0A 3TZKA 1KXJA 2EJBA 3HA7A 5JCOA 3RRNA 1YOBA 3VTAA 5AW7A 4P3PA 5FFNA 4WLEA 2C88A 3QMVA 2E89A 4IQ4A 1UFVA 1YJQA 2C2WA 2WIBA 2R96A 4RHEA 4D26A 2ZIFA 3IR7A 2ZSHA 3W4JA 2J3MA 5F9FA 2WF5A 2OXCA 4XWAA 4F97A 4HLQB 3K2BA 3P9RA 3OX2A 4Y6RA 4H7PA 4MCAA 3OEEA 4Q01A 1JEYA 2VZ9A 4HDQB 3EF1A 3SJ7A 2H52A 3GN2A 4MV7A 1SM4A 2G5PA 3CH4B 1DQRA 2YFQA 1J00A 2ZKLA 2H06A 4MDHA 2ZYUX 4Q19A 2F43A 1WXFA 3C70A 1TL7C 1JWAB 2A7XA 2A58A 4ND8B 3V8MA 3CSUA 4FYWA 4C0KA 2VH5R 4DMMA 4EJFA 2Z56A 1E6WA 5I9TA 3X0DA 3IDSA 3WLLA 2D13A 3GEIA 3MT0A 3VZQA 3ZDFA 3UF0A 4X1KA 1T29A 1EEXB 2QRMA 1QQAA 5K99A 2XD4A 1WA5A 3FPHA 5JD3A 3FNRA 1WE2A 3H84A 1HGXA 3I6BA 4KV7A 4L4SA 5I7WA 1BCRB 5C34B 3WXMA 2MSLA 3PXDA 4MVJM 1YDWA 5K6AA 4BFCA 5EP3A 3CKKA 4RLFA 1GEGA 2M2IA 3MTEA 4WCDA 2FMUA 1OB2A 2V7WA 1N8KA 3NYWA 3VHXA 3EOAI 1KXZA 4V03A 1I6LA 1O6GA 2IVZA 1ZC4A 5ANRB 5LQSA 5EIXA 1ZXLA 3G7NA 3ZXIA 1Q12A 2VNKA 3FYTA 1M8PA 3AM1A 4PAWA 4OQQA 1SU4A 2JGFA 3FRIA 2FFAA 5JJBA 4HXGA 2V0CA 1Z38A 4LOLA 1XZ8A 1ADFA 1LK0A 4MKFA 4NC9A 4IXWA 5LUBA 3TIFA 4RUKA 4Q7EA 1EG2A 4D81A 2QL7A 2HAEA 3LPCA 2UYCA 3GZTB 2D2VA 4K03A 1YZVA 2YV5A 1SULA 4AJNA 3ORSA 2Q3DA 3NXKA 1VJGA 5ECYA 4D7AA 5AOBA 3QV2A 1XYGA 2O0HA 4EMBA 3DFKA 3GDHA 1VPTA 3MW8A 3M1LA 1O97D 1P9NA 2W9XA 3IGFA 3LKVA 4QODA 4KJZA 5H59A 3RRJA 4UCQA 1CY4A 4WT7A 5H4GA 3N0RA 4Y2SA 5DCYA 3UKOA 3KFXA 5KTPA 1X9HA 1TMYA 4A2CA 1L3IA 5F2OA 2OBBA 1B3BA 2CUTA 4XYMA 5A0VA 1QVZA 1O94C 1PP4A 1DAKA 1JIIA 1CF2O 1X1CA 4L8LA 3O4RA 1J70A 4JLPA 2EKPA 5KNBH 2JIMA 2GAIA 1E99A 3EHDA 1RWPA 1VL1A 2NTVA 3ED5A 3INYA 1L7RA 4QYTA 2AG8A 2H92A 2P68A 2R84A 3Q72A 4KAJA 2CVOA 5CDSA 5DHFA 4L76A 4ND8A 3D3JA 2AUMA 4OHMA 3EEFA 1E3TA 2OQ2A 4C05A 1DJQA 1Z2OX 3CN9A 3TI9A 4IHJF 1ZLYA 4RJJA 3FFXA 4U2GA 2WSYB 5I9SA 2FW8A 2XB9A 2ES4A 1ABEA 1L7OA 2YMQA 3B60A 2V4ZA 3VKUA 2Q3EA 3LYAA 4RF4A 5SY4A 5HE9A 4OHVA 3ZHZA 1M2OB 4RZUA 5IT9A 1FL9A 3KVVA 1CERA 4QRDA 5JO0A 2DFNA 4AY3A 4LF8B 3VC7A 2ZI3A 3H19A 3PGMA 2JFWA 5BORA 3H11B 2VAMA 3HGTA 4KTVE 1BCRA 2G3YA 3UHJA 4S35A 3MMZA 5FQOA 2P9FA 4LF4B 3MWLA 2ZTVA 2ROQA 5FOSA 3LA6A 3IVXA 1VPEA 4HBGA 2PT6A 3DB2A 1YHZA 5FBHA 1HNWB 1NBOA 2R8EA 1Y3HA 3HVUA 4HNVA 1G9TA 2FFJA 2BUBA 1VZ2A 1YQGA 1T9DA 4R1TA 2PX4A 3DZKA 1ECJA 4RY8A 1RCTE 2GN8A 3EGVA 2BHSA 2E87A 3HRHA 3GCXA 3OCYA 3KYBA 2PUEA 4CR7A 2OM6A 1ZHFA 2A4MA 1ZD1A 4XLZA 5JXHA 3T4UA 2NTNA 3CVJA 1JA9A 1QH0A 4LAFA 2OC4A 1T36B 4K87A 1VYVA 1HH4A 3E9MA 1LUAA 2IYTA 3UT5B 1SVMA 1T1IA 2PNFA 4M9SA 1EXVA 3U6KA 3DJFA 1UJ4A 4BVFA 2IBTA 4GOLD 3E9QA 5SYNA 3K4QA 3UPDA 4C2BA 1JLSA 3AHGA 4XYEA 4RPHA 4FR2A 4N3NA 3RU3A 2CJPA 2O7VA 1EQUA 5AKXA 5HG0A 3WWDA 1IFXA 2WAYA 3OFNA 1W6UA 1LA2A 5J43A 1M0WA 1GD1O 3NOQA 2H85A 3CGGA 3U2QA 2VTKA 1Z33A 1NG9A 1A2BA 3Q5GA 3C1OA 4BIMA 3G9XA 2RHDA 1L0BA 2P41A 2CMDA 3S70A 1C8BA 4EY7A 1WETA 3RUHA 2D2XA 1HFJA 1CSEE 3OZ7A 5E6UB 4RTNA 3ZTTA 1ZAYA 4ZT3A 2M98A 2DC1A 2Z3ZA 4JIGA 3ORYA 2VBIA 3DR3A 1P61B 3KQYA 3HK2A 2W2XA 3W0LB 1G0OA 4LI3X 4B2YA 1Y81A 2NUAB 1MOZA 2ZTMA 3O1HB 3WX0A 4CLXA 4W5NA 3V8QA 3VR4H 1U1DA 2OAQ1 1YS9A 3JRWA 3PYXA 4DMCA 3GLFB 5FBQB 4W5JA 2V59A 2YS6A 2M6LA 5LNK1 4RKFA 3TNDA 1P0QA 5CRIA 4H1WA 4Y2YA 2N1MA 1CLEA 1M2OA 1GPBA 1CHDA 3KXDA 5FWDA 3SE0A 4P1ZA 5AK6A 5A3RA 1JTVA 4TWBA 4MW6A 3GJXC 3H11A 2RGNC 4GPEA 5FD8A 4YFYA 4NAVA 4LVOA 3UMSA 4G09A 1L5GB 1YS1X 1HA3A 3OEHA 1ZMOA 3O4GA 1KJ9A 1WXXA 1Z2AA 2GFQA 2XOEA 1WBDA 1ZUNB 1L1FA 1FXWA 4NCHA 1L7EA 4Z8XA 5C8XA 4RK7A 3P2MA 4HVAA 4LSWA 2Q9AA 4RF3A 4JLOA 1UKYA 5D3ZA 1U2SA 3FMPB 1ZWLA 2PU5A 5LFAA 3BKWA 3A4VA 2JKVA 4KBGA 4XDZA 4B40A 3BVPA 5LDDC 2ZULA 1O95A 3FCSB 2WYOA 3DE3X 3HUDA 1OZ0A 3E70C 2HY7A 1RAAA 1T36A 4N76A 1JAIA 3F96A 4FZJA 3PNMA 3UT5A 1CULC 2IELA 1UFRA 1YZ3A 3BTUA 1GWNA 1GTL1 2E37A 2JLWA 1KHHA 5HK8A 4OHWA 1LSUA 1Y5IA 2VIIA 5FI0B 1RQ2A 4YT4A 2EG9A 3KJXA 1PJRA 3BM5A 3I6YA 1Y9JA 5KZMB 2Q5CA 3TBFA 2Z6UA 3RIXA 3VTZA 1GZ7A 1FSZA 3PFHA 2QVGA 5K3FB 4BCBA 4B79A 2X6TA 4KXMA 4PSCA 1VECA 1BYUA 3A1DA 2ZWOA 3IEVA 4B3GA 4DM4A 3FCCA 5E6UA 5F3RA 1AKTA 4AXBA 1G291 3PXBA 1W5SA 5DKFA 3NTOA 1UK8A 2IODA 2GDZA 3P32A 4KBYA 1RDFA 4TKLA 2UZ0A 4WVFA 4ALJA 2NUAA 2XNSA 3AUKA 1FRNA 2FPUA 2DYKA 2M6SA 3GJYA 3I30X 3OEHD 5EPOA 5JZVA 1T35A 2QTFA 6ABPA 3GLFA 3QQPA 1L7DA 4X6YA 3L8EA 5AK5A 5FJIA 2MYPA 3KWLA 1C2TA 1KEVA 1ZA1A 1ZI8A 2VUUA 1W9MA 4MB0A 2GYVA 4FT4A 1WZCA 3DL0A 3T61A 3EDCA 3HXQA 1KOJA 1JIVA 3A1WA 3EEIA 4LNUB 1EXMA 2VJCA 3WTBA 1OD6A 3OX4A 2DUMA 1F8XA 3MT7A 5FAKA 1MHPA 1NBMA 2OPBA 3O38A 4R1SA 1HFKA 1CEQA 4YJ2B 1TO2E 5T6BA 5KU7A 1G55A 4KQ6A 4R6WA 5LOVB 5BP7A 2OP0A 5CW1A 1AS0A 1N0WA 5SZJA 3DD5A 4NYMQ 2WKPA 4Q6BA 5C7YA 1ZUNA 2VA9A 5CDHA 2IIPA 1F6DA 4W5RA 3U13A 5DNCA 5TDHA 1CRQA 4YUZA 1KZ1A 1XVAA 1JQAA 3WIOA 1RE0A 3FX2A 5KHOC 2A3RA 1CIJA 1HG0A 2CSXA 2QJOA 1NVVQ 3D4NA 4OFXA 5DXJA 1K9VF 2HGSA 4WOKA 1XU7A 1QGED 2B0JA 4AJIA 4EJSC 3AOEA 5C51B 1XROA 4RHUA 1O4VA 2BMFA 2WSMA 1PGJA 2XDQB 3D7MA 4RKQA 1XDZA 1PV2A 1KAHA 1QONA 1FSSA 1OZHA 4J29A 2Z3WA 2IYNA 3B13B 3CRNA 4J2OA 2YVQA 4RFLA 1NJFA 1PJTA 3L0CA 1K8ZB 4PYKA 3QK7A 1KK1A 1TCCA 3QX7A 3MOGA 1NKSA 4YRTA 4IXTA 4LRSB 4Q9JA 4WSOA 1JVSA 1KEUA 4QJIA 4LE2A 3G2KA 3WL5A 2WPNA 2OORA 2XUKA 3JY6A 4H15A 2KB0A 3AIOA 1XZCA 2B8JA 3OIDA 5LB4A 3V00A 4GX2A 4R41A 1SBTA 2GTIA 4K7JA 5EKUA 4ZMSA 2C07A 2P67A 3GAZA 4NS1A 1RU3A 5K3FA 1HT2E 3AINA 3ZU5A 2YN4A 3Q7TA 2I67A 3GAMA 1G8YA 3DVSX 2WI8A 3M6IA 1CIPA 4MV8A 3BB1A 5K01A 2ZATA 1NBMD 4NYJR 2CXTA 2X42A 4M1WA 3W5IA 3WIVA 4K46A 1VHTA 4CM6A 1JUDA 1R6DA 3FIJA 1U4OA 3G0IA 3GLGE 3BL8A 1RRPA 2CUNA 2ECPA 3GJRA 1VCHA 5CGQB 4C7JA 4B7AA 4AJJA 4R8RA 2NVBA 2ONYA 2GA9A 4RFSB 1SUSA 1QIEA 4INAA 4X90A 4XGKA 4RQAA 3W6PA 1KWKA 3MHTA 1VPLA 5DHSA 5EUCA 5FTNA 3L7NA 1C3EA 1Z9BA 4LNUA 4FUTA 2JH3A 4LJ6A 4ND5A 4HVLA 2PWAA 1XCMA 2Z1NA 3HU5A 3QUCA 1LRKA 2OEPA 4YJ2A 4GYKA 5EVJA 3Q6IA 1DELA 2R62A 4MHTA 2Q4DA 2XHZA 5CJ2A 3NT4A 2HIGA 1G2PA 3LHKA 1S2DA 2FKAA 2CNWA 4JK3A 1FRZA 4WOJA 1IIRA 5B37A 2NXJA 1ECGA 2R1VB 1L4BA 4B8YA 4EB3A 3NMUF 5IJZA 4WGFA 3SQDA 1Z4MA 3DC7A 3BSYA 1PE0A 2H4JA 2NYUA 4GXTA 4J0HA 4TT8A 4EWLA 5FOXA 2IU3A 4P54A 6NULA 4CZ2A 3W7BA 1AUQA 1NY5A 4X97A 1ZQ1A 2YZKA 4YDQA 2XDQA 5AVWA 1GARA 1ZH6A 4BDTA 3PQEA 1CJCA 4HEHA 5T67A 3B20A 1NM5A 1GCAA 4RJ2A 3SG0A 3ESRA 5LP1A 1SVIA 2FH5B 1ZU4A 4RVSA 1EDBA 3I01M 4ARUA 3OPVA 3L0BA 3UK0A 4JUAA 2CV0A 2N47A 5JNLA 2ODBA 3BRSA 4KNVA 4X84A 4F3RA 2RIRA 2LCFA 2NZ8A 4ZALA 3WG9A 2I2DA 3PDWA 5IBQA 3SLGA 3VKWA 4TYQA 2AJDA 2O1WA 1WBBA 3K6RA 4UKDA 3U3JA 2DUUA 3UA3A 4CMBA 4JNCA 2VDWB 4XLLA 3TLYA 3OJOA 1DKQA 1R5BA 1E60A 3R3WA 2HEIA 4UU0A 1JAZA 1DQZA 1D0SA 1ECFA 4LS3A 3WRYC 5TNXA 3WI7A 5ARCA 5C35A 3K0SA 5IWCA 5KDDA 4POOA 3EFOB 3K9CA 4RD0A 4KQCA 4IQFA 3NIFB 3K16A 4FIZA 4EYSA 2R6HA 4MEBA 3QWFA 3DDUA 5B5SA 1Q16A 1JMVA 2C7PA 2I9PA 1J24A 4QOEA 4O4HB 4DRXB 1Q19A 4RCVA 2CNWD 3SHTA 1L8OA 1N5DA 2AZMA 2WICA 2WJ4A 3N5CA 2IP2A 3IFSA 4RFSA 1K4MA 4IOLA 4DN6A 3AR5A 5AKKA 1QO7A 4RSGA 3EGCA 4DNOA 2OZKA 1KS9A 1IY2A 4TZKA 3BXOA 2BZ0A 3BTVA 2AVNA 1RYMA 2OZPA 3H6KA 1J1UA 3DYVA 4YUVA 1VL6A 3AHEA 4JROA 1PDOA 3ZGLA 2OAP1 3CH5A 4P0TA 2R1VA 4AY4A 4IR7A 2FCRA 4H31A 1DVRA 4NP6A 5HIIA 4PQRA 1M1YB 3V4OA 2ZZMA 4XD7A 5HE8A 3K1JA 4HFJA 3AT1A 4I4NA 4Y67A 2ZS7A 3RDPA 4RS4A 3TR0A 2NAPA 1WDWB 3ITKA 4D9BA 4L3OA 2G72A 2RSLA 5FLYA 4C0SA 1P3DA 1B6TA 1UXJA 1NF2A 2EFHB 3C4VA 5A7FA 1CNFA 3T4EA 2ERXA 3D6JA 3BHMA 2JI7A 5BN4B 1NVKA 2EFCB 1QFJA 3ZXYA 3IQIX 1BWSA 2DQYA 3NBYC 2V7TA