5F2EA

Crystal structure of small molecule ars-853 covalently bound to k-ras g12c
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
168
structure length
168
Chain Sequence
GMTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETSLLDILDTAGQEEYSAMRDQYMRTGEGFLLVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase KRas
publication title Selective Inhibition of Oncogenic KRAS Output with Small Molecules Targeting the Inactive State.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 62
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5f2eA00
2WWYA 3CWQA 1PV4A 4DT1B 1Q0UA 4C0LA 1PLKA 2W0SA 2FE4A 4UNPA 4OI0A 3C5CA 3QXSA 1P2SA 2OCPA 3RRZA 2ZXUA 1XZQA 3Q9LA 2D2EA 2FF7A 2ZS8A 3TQFA 1OIXA 5KNDA 1XB2A 4MH0R 3RC8A 3QXXA 2ZM5A 4GRAA 4B33A 3B1XA 1KI1A 1DS6A 2BHRA 4NYMR 2NIPA 1VYUA 3CNOA 4GSYA 5TV2A 3OEHD 3T1QA 2PJRA 4NCJA 2XB2A 2W2VA 1N6PA 4PTLA 1CXZA 1NSTA 2F1HA 2WKQA 1T0HB 3QKRA 1IXZA 1CS4C 3H86A 1SXJD 4L9WA 4BZXA 3LNCA 2FA9A 3LW8A 2V6IA 1QDEA 2IEZA 5K8TA 1UBGA 2C98A 5D3MB 1ZNWA 1KGDA 2ODNA 4JYBA 4LWZA 5DN6D 4CEIA 1VYVA 4O0MA 1HA3A 5G3ZA 1Z6YA 3K0AA 1ZNYA 2W83A 4LJ4A 4GDFA 2OHFA 3DEFA 1ZRHA 4H1VA 5DYGA 3S1AA 2A78A 1VCIA 2EFEB 1J90A 1SVOA 4KJZA 4JBYA 4JLJA 1D8TA 5JI2E 2YWHA 2QL6A 3TGPA 2O8DA 1GIAA 1Z29A 2QN6A 2W2XA 5CDFA 1OJLA 5JWHA 2WIBA 2EWVA 3JVVA 2ZI4A 2ZRHA 4HLDA 2BBWA 1VG1A 2IL1A 3IGFA 5FL3A 2BVNA 5J40A 3W90A 3OIWA 1MO3A 4HDQB 3SDZA 2QBYA 1CJKC 4NCIA 2JA1A 1COWD 4PHGA 5KTYA 1KNXA 4E03A 4UQOA 4UXIA 1M34E 1E1RD 1KK2A 1FUUA 2DFTA 3CPHA 1BMFD 1JPJA 1Z6TA 3RSOA 1ZUHA 3ZVLA 5A0FA 2Q0HA 2R65A 4EJSC 2JLYA 4US0R 1FP6A 4DHEA 3V4RA 4F4JA 3P20A 4G5OA 1E9RA 2OSBA 3PQCA 1VPLA 3QF4A 4KFUA 4Q1AA 1G3UA 3OFND 4F92B 4A92A 2XXAB 3BIFA 1AGPA 4KHZA 3AKEA 2AWNA 3H2YA 3D8BA 1NBME 3OEHA 4TL9A 1DAFA 5FPKA 5L3SB 2O8CB 5TXGA 4JIMA 4FWTA 5KSOA 2GF9A 2O5VA 2WOJA 4FMCB 3U60B 3PENA 4GI7A 4MUAA 4RD0A 3TH5A 2YINC 1E2FA 3HP1A 1KK0A 1SXJA 3CKLA 4IDHA 3I92A 2C99A 4LJ8A 1KI8A 5DN6A 3FMPB 2NGRA 5BYJA 1U8YA 3Q5EA 5JLJA 2VBCA 4ZDJA 2CEAA 1W36C 2F7SA 3PG5A 2ZAMA 4Q4AB 1OB5A 2ECKA 2A3RA 4DIDA 2J0VA 2NPIA 2CBZA 2BCGY 3EARA 2RMKA 2ZVPX 3C8UA 2GCNA 2PLRA 1L2TA 3CH5A 4FIDA 4RZUA 4DSTA 1E2EA 3NKVA 4NKRA 3LH5A 1SVIA 2HJGA 1QHNA 1E2IA 4URXR 1D2NA 2CNWD 4TZ6A 2QT0A 2CHGA 4NH0A 4BZQA 1GFIA 5CYOA 1X8KA 2XJ9A 5EQTA 3ZD6A 1COWA 3AKCA 2BV3A 3B1ZA 3CW2A 2FNAA 4A0RA 1E1RA 1K6MA 1VIYA 3IHWA 3TNFA 4AK9A 4B43A 1RJ9B 5EZ6B 2ZS7A 4B2LA 4GL2A 4TYNA 1VYTA 1XDBA 3NC1C 4TL8A 3HJNA 3EZFA 5EP1A 4PC3A 3GLIB 1DAIA 5BXQC 5EXPA 4AKHA 4LJ9A 2CK3D 1E2LA 4PHHA 3CM0A 5C46F 1Q57A 4Q9JA 4B48A 5EE3A 2Q9BA 1GITA 2DR3A 2B7BA 4LHWA 4L8GA 3OFNA 1HURA 2QMEA 3AH8A 3WBKA 3LLUA 4HUQB 4C3ZA 2KSQA 3EPLA 2ZYVX 1P4SA 2EYQA 4M21A 1YVDA 2FZ4A 3LVQE 1A5TA 3DZ8A 4IDNA 4A8JC 1OXTA 2XNSA 3TBKA 2FPKA 2Q3MA 3AVWA 4JBXA 4PFSA 5JSZA 5UKDA 4GOXA 2XJ4A 3BB4A 3AGQA 3RC3A 3BRWD 1DOAA 1HV8A 4F7WA 4JVLA 2ZR0A 4MQBA 5DSZA 1HEIA 2GDJA 1E79D 4M1OA 4XVUA 521PA 1Z6AA 1GSIA 2J87A 3SJAA 2DWQA 2GCOA 1SZPA 3QKRB 1XF9A 2AR7A 1ZUIA 1E9EA 5FUXA 1OT3A 3UANA 4IEIA 5TDHA 4JKIA 3T5GA 4CEIB 3ADDA 2GJKA 4TLDA 1XCPA 4O2RA 3MSXA 5F2EA 4EPTA 3K0AB 4A6PA 3KQLA 3OIVA 1R0WA 3LQQA 5DO9A 2GZHA 2CNWA 5E4FA 1P9NA 1WP9A 4M1KA 3W5JA 2DFNA 4F38A 1AZSC 3S1AB 3PXGA 4Q47A 3LVRE 3ONWA 1R4AA 4DCTA 3L0PA 5CB8A 1U9IA 2O8DB 4M9QA 2F43A 2VHJA 2CMKA 1FL9A 1N3BA 3K09A 2IYLD 1P3JA 3ADKA 3U3MA 2PBRA 3GJ8A 3C14C 1TAGA 1E3MA 2CHVA 2V4ZA 4GP7A 4GZMA 1TQ6A 4JJKA 1FMLA 3ZVRA 2HXSA 5KU1A 3QPVA 1OFHA 3TVTA 4JVSB 2IUSA 4DDUA 3ECCA 1OH5A 2FMXA 2JLZA 2C04A 1VHTA 3WXMA 2FPMA 1U99A 2N42A 5AUQA 4LI0A 1ZM2A 1LVGA 1ZCAA 4B71A 4WXRA 3TSOA 3GLGE 4MYUA 1TADA 5CLLA 4LUCA 1E4VA 2GXQA 1EFUA 3THWB 1G6OA 1XTIA 3T06B 4D26A 3W6NA 3JZAA 2D7CA 4FCVA 3B78A 4HDOB 4TSFA 3KUCA 1XD2A 2GEVA 2J41A 3GFTA 5EE1A 3A4NA 4MRNA 4OHZA 3REFA 3VHLB 4OK6A 1E69A 1SHZA 4Q4HB 4DDTA 3A37A 1ZYUA 1U90A 5C4MA 3G5UA 1G18A 2UVQA 4D0LB 4YMWA 2JCSA 3DOEA 3DMDA 3IKJA 4B73A 2JLQA 3EC2A 2IF0A 3VX4A 4Z1MD 2F1IA 3L0OA 4MYHA 3G0HA 2QORA 2PZFA 2HT6A 2ZE6A 3SHFA 4Z51A 4CGZA 4OI2A 1WE2A 1XFAA 2YYZA 1FZQA 1RPZA 2MSEB 2JJ2D 3P4XA 4ZDIA 3UG7A 3QKTA 1AJEA 5EXXA 1T8TA 5LBIA 1UDWA 4I1SA 3W8RA 2ANBA 4RD2A 1M7BA 2PCJA 2RKOA 2QTVB 3WNBA 1E2DA 1VG8A 4OK5A 1OH8A 2HLDD 3THOA 8OHMA 1T4GA 3BH0A 1ZM7A 3A6PC 3ZQJA 4DLYA 1LF5A 3LO5A 1R5NA 4TYYA 4Q21A 1WMSA 4GOJA 5HCIA 2F6RA 3G82C 3QUSA 1KJYA 1W44A 3FWYA 5DISB 3CF6R 2O8FB 4PPGA 4B44A 2WKRA 3I73A 1NLYA 1US8A 2AD1A 1UEIA 2H5EA 1AK2A 4BPBA 4JT4A 1W4RA 3E2IA 4PO9A 2DBYA 1F48A 3PUXA 1DE0A 2WWWA 3GJ0A 2YZ2A 2WSMA 4IEEA 5BYKA 3HR8A 5JZVA 1VG9B 1Z0JA 1XD9A 4W7SA 3ICEA 1D5CA 3RLFA 3SE0A 5JMTA 2GCPA 3THYA 3T1OA 5DIFA 2QMOA 2RGDA 2Z4RA 1E6CA 4I1VA 4Q03A 1CJTC 4RZXA 1Z3IX 3RHFA 1TQ4A 2C03A 4A2WA 2RAPA 3K70C 2HF8A 4HAZA 3TUIC 1OB2A 2QTHA 4Q4LA 5DE3A 3KXLA 1Y63A 3B5JA 3UPUA 4L16A 3LY5A 4Z1MA 3HWSA 4C30A 5JS8A 4QM6A 5LD2B 3QBTA 1RRPA 2QE7A 2AK2A 2GCOB 3U2QA 1M6NA 2OXRA 5DI9A 5C1BA 1UPTA 2JJ2A 4D0GA 4NCNA 2CHQA 2QAGC 1KDOA 3MUFA 1TF7A 2W58A 4KYIB 1XMJA 3A4MA 4JMPA 3RRMA 2AWOA 3EASA 2CVHA 3EZ7A 3L8ZA 4NHOA 4Q02A 1G64A 3F3YA 4NYJR 1CKEA 5F3WB 2HLDA 2EVWX 4QGFA 3ASYA 4JSYA 3NWJA 4TMTA 3FOZA 4BRUA 5KDOA 5ELXA 5FUYA 2HEIA 3KL4A 4O25A 1IN4A 4BLTA 1NG1A 4HAXA 1RFLA 1CIPA 1MH1A 1SXJE 3FTQA 2RGXA 3TSZA 3AVTA 1C1YA 4FMCF 1XD8A 2OBNA 2R6DA 2O52A 4K81B 2R6FA 4PPFA 4RVCA 4TQAA 2NOAA 1XTRA 5F98A 5FBQB 1DO2A 3CNNA 2ZPTX 4WVFA 3FFAA 3VR6A 4QRHA 5FR1A 1QHYA 3FMOB 1UBFA 3LDAA 3T34A 1HQYE 2ZSAA 4Q5IA 4H9GA 3ZGXA 1HTWA 2ZUBA 1ZM9A 2R2AA 2ZI9A 5L3QA 3MFYA 1ZMXA 2NG1A 2FFHA 3M4YA 3OE7A 5J4KA 1KY2A 4JL5A 1G7CA 1GVNB 2CCKA 3U4QA 3A36A 1FQKA 3AVPA 3DOFA 2ZJ2A 1GDDA 2E9SA 2QUZA 4OQXA 3WYFA 4GP6A 3X1ZA 1XD2B 2QM7A 2W2TA 1WQ1R 2ATXA 5JS7A 5D3QA 1O3YA 4DLTA 4Q18A 3ND9A 4V0LA 5CIWA 2CL0X 3U44A 1JBKA 2FGJA 4BLPA 3B60A 4F93B 3CF0A 1Z2AA 2AFIE 1RIFA 2GILA 1LY1A 3SYNA 3QQ5A 4DB2A 2IUTA 1AS3A 1W2HA 1NIJA 1VECA 4DC9A 4QGHA 1P2VA 1VG0B 3VU9A 1F60A 1ZBDA 2QP4A 2P65A 3QPUA 4OBEA 3GJ6A 2IWRA 1R5BA 2JASA 4US1R 3EZ2A 3K1JA 2FX3A 3SYLA 3HU3A 1LTQA 3BBPA 1Q1BA 4C0QC 4TMXA 5CM9C 2NZJA 4PPQA 4EDHA 1YRBA 3QKUA 1EWQA 2QMHA 5GVRA 2OEPA 2C9YA 1E9AA 1VTKA 1NJGA 2ZIAA 4G1UC 1Z28A 4OJKA 1G5RA 2QT1A 2WJYA 4HB4A 4D80A 4JJZA 5JJLA 1GNRA 4XTCS 1DVRA 2QM8A 1MO5A 3NH9A 4RSGA 2JGNA 1W0JD 4QFMA 1US8B 3B7GA 2DFLA 2QQ0A 2ZANA 4YLGA 1OXXK 1T8UA 2YWEA 4Q1CA 3K0CA 4B3BA 3LLMA 1OH7A 5L8VA 1G20E 1NY6A 1XMSA 1LF0A 1ELOA 2PEYA 5G40A 2VL7A 3PR1A 1KI9A 3I3SR 5EZ5A 3IIKA 4G5RA 3THYB 2P3SA 1EX6A 2JLSA 4WZ6A 4DLSA 3BXZA 3UMSA 3ZZTA 2FEOA 3N2IA 4S35A 5HE8A 2YKGA 1N5KA 3X1XA 5EJEA 4Q19A 4Z54A 2D4HA 5TY0A 3UIEA 4F4IA 2ZRGA 3MWKA 2ZJBA 1ZUNB 1SVKA 2JLVA 1FQJA 1OXSC 1F2TA 1KZGB 1WF3A 4PO8A 4TTQA 4ACBA 4HAWA 2CLSA 2GZDA 2D06A 1NVVQ 4JBWA 1DO0A 1KK1A 5B57C 1I2DA 1DARA 3WP0A 3CPJB 5GJVC 2QGZA 4EFLA 1CRQA 4KV9A 4DLZA 4C0SA 5K8UA 4US2R 3Q85A 2B21A 4JLDA 4EQ6A 1GOTA 1JXMA 1WCV1 1A2KC 4DJTA 1XEXA 1H8ED 2WZQA 2WMOB 3B85A 3CRVA 4ZCLA 4CEJA 2XX3A 1G8HA 1XXHA 1KTVA 1G291 5IT5A 4P33A 2RGGA 3OIYA 1Q12A 4LBZA 4WIAA 1S1MA 2GXSA 3QOFA 1XNJA 2E1RA 4OYHA 3H1TA 5HE9A 2AHOA 3X1YA 2WTUA 4QBGB 5JEEA 5EXTA 2DFKB 1T3SA 1JR3D 4HSEA 3IILA 2J1LA 2ZSFA 4KFRA 2VP9A 4F91B 4MRPA 1G3IA 3CRMA 4BLOA 5L3QB 3GLFA 1WB9A 1OFUX 3SJZA 2J59A 1XPRA 5TB5A 1CR1A 2BM0A 1MO6A 2BKUA 4KSCA 3OEED 4BLQA 2V9PA 1X3SA 3TLXA 2H16A 2BMJA 1EWRA 3MJHA 5FBRB 2KWIA 4AIIA 1J8MF 4HEJA 1TF2A 3QI2A 3T12A 4V0NA 1RYHA 4KU4A 1YR8A 4E09A 2GTPA 3TAHA 1N6LA 2H7VA 3BH7A 1G8GA 1SGWA 1TX4B 3C15C 2HCBA 2RGCA 3U44B 4Q4AA 2I1VB 4V0OA 3UMFA 1W46A 4AWXA 1CP2A 1L7VC 3GLHA 2A5FA 2QA5A 1CEEA 4NP6A 1KKMA 2GZAA 2LKCA 2IW3A 2OFOA 4L5BA 2L0XA 4G0NA 5G3YA 2XGJA 3C7KA 2IYVA 1DAHA 1CULC 4DBLC 4JLBA 4TWZA 2D3WA 3VU9B 1KSHA 721PA 1CJUC 5TMPA 3Q3JB 2VSFA 3LXRA 3RWOA 2HYDA 2Q6TA 5FI0B 1UEJA 1H8EA 2XTNA 3FFBA 3VFDA 1IN6A 2IS6A 2CLCX 2ZI3A 4QGGA 4C0BA 2R6AA 1NMXA 4D6PA 1U0LA 3MJRA 5L3RA 3VTKA 3GEEA 5GJBA 5HPYB 3GLIA 5AUPB 1IXRC 2ZE5A 4W5HA 1KO5A 4AC9A 1QVAA 4YC7A 3B9QA 1W4CA 3NIBA 1S3GA 1E99A 1Z0KA 621PA 1P60A 4ESVA 1Q44A 2R6CA 4URYR 4LV8B 1JR3A 1PUJA 2YV5A 4OI1A 4AKIA 5EP3A 3A4LA 2VEDA 2I3BA 4HUQA 4YMUA 2BEKA 3QIAA 1E94E 5SZHB 3FMIA 4QC2A 5FFMA 2ZRLA 4Q4JA 3AVUA 2GESA 5E95A 2IA5A 1R2QA 3IUYA 4A2PA 3OEEA 4M1TA 3ZVNA 2WSSD 4B34A 4P4UA 3NBFA 2OFWA 2YOHA 1HUQA 1SVLA 4TYQA 5JJIA 1ZC3A 4V03A 4D82A 1NVUQ 1N6KA 4Q7LA 5EXSA 3UWOA 1GZSA 2ZJZA 2IBMA 5GJWC 1JEEA 3UK6A 3SN6A 3ZH9B 3AF0A 4YMTA 2OCAA 3A58B 1FFHA 4PZLA 3TRFA 4JKYA 2FSHA 1EFTA 2GJ8A 3R7WA 2C95A 1CR2A 2XZLA 4IOLA 1F2TB 2G77B 4KITB 3M6AA 1XRJA 3CRRA 3HYTA 3P26A 4TZ0A 3I62A 4BFSA 1YZUA 4ZDWA 1LNZA 2BOVA 3QJYA 1W0KD 2GA8A 1NNEA 2F1JA 3AVQA 1CBUA 3KDSE 1E96A 2RGNA 5CB6A 2G83A 2IS1A 4M8NE 2X77A 4R71A 4EQ6B 3NC0C 2HDNB 4X8HA 4URWR 1T5LA 1IBRA 3VR4A 1XEXB 3SS8A 2QGNA 4AYTA 4RZ2A 3DPUA 2GXAA 4CEJB 2IK8A 1XXHB 2QENA 4YQFA 1S9HA 4LPKA 3KQNA 1NJFA 5KPJA 4PXAA 4P32A 2RHMA 3PUWA 1FOEB 1SVSA 2ZR9A 4P3YA 4TL6A 4QBFA 4YDSA 1T9HA 1QHHA 2B8WA 1U81A 4X8MA 4BEJA 4DLXA 4IXNA 4UXJA 3WMFA 1UFQA 2DWOA 1DADA 3THWA 2ZYTX 1T6NA 2WSSA 4FW9A 2BM1A 2WAXA 2NQ2C 5HKKD 3RRNA 3FE2A 2WIAA 3U6BA 3GLFB 1DAGA 5CIQA 4TTPA 1CR0A 3NG1A 4C7OA 2ZRCA 4R9UC 4HAVA 4Q4HA 2WWGA 1NKTA 1OYWA 2IWHA 3U61B 1G9XA 4HZUA 1FUKA 1ZU4A 4Z8YA 3U7EB 5TVKA 3IIJA 4N0EA 3MWJA 2GJ9A 2ZRFA 1R0XA 4LGMA 4XSGA 1XCMA 5A5GA 2AKYA 2XZPA 3DDCA 1SQ5A 2ONKA 3RWMB 1KAOA 2VO1A 2ZR7A 2GJAA 1AS2A 1UJ2A 2PX3A 4UXHA 3GLHB 4XIGS 5H8WA 1QHGA 2JLWA 1W0KA 3A1WA 4PQYA 3K9LA 3PITA 3VMFA 4O3MA 2UKDA 2J5XA 2Q3FA 2J7KA 4EFMA 4QHSA 3MCAA 4DVGA 3IQWA 1NN0A 2CE7A 3KUDA 4NTZA 2ZRAA 3QY0A 2X2FA 2C9CA 4KCGA 1FP7A 5CLQA 3TJZA 4QNRA 1UM8A 421PA 3RS4A 1A2BA 1GL7A 2OLKA 4NDZA 1G8PA 3I32A 1IONA 3QEJA 2VH5R 2GBLA 4U5XA 4PSVA 2G1JA 2ZJ8A 3KQHA 4PANA 4NCHA 2O8FA 1BMFA 3PEYA 2XB4A 1YZQA 1X8JA 2V1XA 1I2MA 2EFGA 3RVBA 4B3FX 1KY3A 1UBEA 3KKPA 2ODEA 2A7QA 4KVGA 3E70C 3OIUA 2EFDB 5FPYA 4XTRA 1OYYA 3DKPA 3NHBA 3L43A 4PC6A 3ADCA 3ZVMA 1R0ZA 3MG9A 3NXSA 2IYYA 1BOFA 2UZIR 1Q1QA 3NBZC 1P61B 2K5UA 5HKKA 4C2TA 2H8KA 3HR7A 2GAAA 1S96A 3AP1A 3HDTA 4UNSA 4E5UA 4M53A 4Q4JB 5SZJA 1VCMA 2F3RA 4V0MA 3U7GA 1XEFA 2KB0A 3CONA 1Z06A 1JJ7A 3BB1A 5FBVB 1PZNA 4LDJA 5CK4A 3K53A 2VA8A 1N2CE 1C4OA 1XP8A 2G0TA 2QMUA 4LV6A 4LBVA 2LWIA 1YZKA 2ZE8A 2ZRJA 5HZKA 4N0DA 3SZRA 1ETUA 1G1MA 3AKYA 2VLIA 1N0WA 5HCNA 1NKSA 4W9MC 1Y3AA 5JRZA 3B82A 1S2MA 2P5TB 1E9BA 4DLWA 3QSYA 1E2NA 1RVDA 3OF5A 2ASEA 4RCYA 3R7WB 5AJYA 1II8A 2FFBA 4DLRA 4YXWD 1BKDR 3QNUA 4HAYA 4R2HA 3BC1A 5K8IA 1ESMA 4IOMA 3ND8A 1UAAA 4JL8A 2ZRMA 4LJ7A 3GQBA 4W5WA 3K9HA 1OHHD 1FPMA 3WP1B 4G5GA 2ZEJA 2ZITA 4ARZA 2I4IA 5E7JA 1BH2A 1X1SA 4LHZA 4Q9LA 1CJMA 3QBVA 2ZE7A 4DKXA 1NMZA 2CK3A 4Q48A 3KQUA 5EP4A 3EG5A 2C2HA 2RGEA 1DG3A 2WWFA 2ZQ5A 3I5XA 2ZREA 2IYTA 1ZCBA 1V43A 1GILA 1MRNA 4D81A 1XZPA 3AF3A 2GVZC 3EA5A 3AUXA 5E7MA 1HQCA 4BQSA 1E2JA 2KJQA 2FGKA 3P1JA 5GJCA 2OLJA 3JVUA 2BBOA 4V02A 2FDCA 1QHHB 4OQLA 1V5WA 2QP9X 4GOKA 3L2OB 3ZZUA 3FKQA 2NO0A 4LBWA 3T61A 3V9PA 3EPKA 2BMFA 3KFXA 2F1RA 4AY2A 4L4UA 3T5DA 3QG1A 4PAQA 1NSFA 1KSJA 5DHFA 2RCNA 5E3HA 3B6EA 3DO6A 4LHVA 3U3KA 2WJHA 4C7OB 2QU8A 3GLIE 1E79A 3RABA 5P21A 5SZKB 1ZJ6A 3W6PA 2JAQA 4LYJA 3EAQA 2LKDA 4EAQA 1W49A 4HZUB 1SHKA 4CF7A 4JZKA 4D4JA 4H1UA 1KKLA 5KHOC 2H57A 3BD9A 1G16A 2BKEA 3K0FA 2GETA 2VHQA 3VR1A 2BCJQ 4HB3A 1TMKA 4UNQA 1JXOA 5JRJA 4M1YA 2QPTA 2ONJA 2X19A 5TARA 5GVSA 5J4YA 1ZIPA 1Z5ZA 3DVLA 3U3JA 1JI0A 4IOJA 4OHYA 4C2UA 4G01B 4URZR 4Q1DA 3RS3A 4XOIA 2P6RA 1VMAA 4J0QA 1OLOA 1OHHA 2KBFA 3PFIA 1IM2A 4LY6A 1QHSA 4B35A 4EPVA 2QY9A 4M9ZA 4HLUC 3L0IB 3DHWC 1JB1A 3IQXA 3SJBA 3CH4B 5L3VA 2VP2A 4WBSA 3RANA 2GK7A 4W5JA 1C9KA 4URVR 4DB4A 2PZGA 4HDCA 3ZZ0A 4LCBA 4NU0A 1AQYA 3SQXA 4IRUB 1U0HC 4Q1EA 1YKSA 4EPRA 1CTQA 4HZIA 5FTKA 2IYXA 3OZXA 4IFEA 1HYQA 3EZ6A 2H18A 2B92A 3NBXX 2X2EA 4FINA 4MGKR 3W5IA 4NYIR 1MO4A 4QHYA 4MUBA 4FMDF 1HE8B 3WRXC 3BE4A 1L4YA 2VYFA 3IPYA 1N5LA 4TN1A 3LAWA 2FU5C 2ODWA 5EE5B 3SU8A 5AJZA 1PUIA 4GFDA 4XVRA 2R9VA 2VHCA 5CDFE 3T35A 4NPHA 2QTFA 3TK1A 4Q1BA 1E98A 4L15A 1RW4A 5E7IA 1QHIA 3A8TA 1XTSA 1AIPA 2I1QA 4EJSA 2BC9A 2P5SA 3QPWA 4LJ5A 2IXGA 1G3QA 2CXXA 3LBIA 4YMVA 1A1VA 1KDTA 1Q3HA 3O47A 4AD8A 4A36A 1EK0A 1LS6A 3F8TA 1ZM3A 1R8QA 3U7FB 3B9PA 4ZCIA 2FFAA 3B1VA 3V4FA 5KO2A 1KNQA 1OXUA 2AKAB 1NF3A 5G53C 1IY2A 4TT3D 3SHWA 4B6FA 1N25A 3J81k 1M8PA 4LYFA 2IYRA 1NY5A 2G1KA 3CPEA 3I1FA 4XVQA 3VAAA 1AA9A 5C18A 1N6HA 4HLQB 2GF0A 5FPTA 1II8B 2YOGA 1N5JA 1UKEA 3DM5A 4ASUD 4BFVA 1R5OA 3TVDA 4ZI2A 1JALA 1YR7A 1TPZA 2IXEA 1BO6A 3AQ4A 5GADl 1ZM4A 4WOPA 2C8VA 3ICQB 5EE0A 4X8OA 1MRSA 1NVXQ 3QF7A 4ARZB 3MD0A 1J2JA 4IVRA 1IHUA 4IXMA 2VF7A 1JECA 2Q3HA 2OBLA 4OQNA 1RRCA 2V1UA 2OCYC 1TU3A 1NMYA 2XITA 4G5SA 4QL3A 3AF1A 2D74A 4D4LA 4B6EA 4GMXA 4FMBB 3NDPA 1YRAA 2Z43A 4OL0A 3TR5A 3RAPR 5JHGB 3CR8A 4MA4A 4Q1FA 1W4BA 4B3GA 1NBMD 1EG7A 1JJVA 2QSZA 4BFYA 2IUUA 3EC1A 3MMPA 4TLCA 5FUVA 3C4JA 1Z07A 4DSNA 1G7RA 1S4QA 1ZINA 2N1BA 3KJIA 1Z47A 2G3YA 1VHLA 2VRWA 1LV7A 1DAMA 1WA5A 1AZTA 1IAQA 1CR4A 4MRVA 2O8BB 3LQRA 3MLEA 2HT1A 2J0QA 4KFSA 4A8JA 4KSBA 3AVOA 2AXPA 5FTMA 4TT3A 4DSOA 1II0A 2KE5A 2OV2A 3I4LA 2ZI7A 2B6HA 3IO5A 3PUVA 4Q7KA 2Q9CA 3KKQA 3K0FB 3UWKA 2CCJA 2OESA 1G7TA 2VHTA 4ASUA 1CJVC 3SR0A 3SC3A 4B47A 1Z22A 1W47A 2OXCA 2WM9B 1P73A 5FTLA 3IO3A 5JJKA 4A1FA 1CU1A 3MWLA 1RRFA 4DLUA 4PQRA 4V0ME 1W5SA 1TQ2A 1HT1E 4ZO4A 5A4JA 1E9DA 1TF5A 1P6XA 2BWJA 3IEVA 4DRZA 2J46A 1M74A 3KB2A 4TL7A 3CUEF 1WXQA 2WAYA 4X8LA 1NN3A 4XSHA 5CJPA 3NHAA 2IYUA 4OQFA 2P6NA 3M1IA 1DAEA 1KOFA 3A1UA 1SKQA 4EIWA 4BGDA 3HU2A 1TUEA 3W3AA 4U02A 5B64A 3VNUA 4AG6A 1Q21A 4YDHB 5AUOB 5DH9A 5KSPA 5AJWA 1G4AE 2G0NA 4TMWA 1OXVA 1X8LA 3EIEA 4TMZA 4QKQA 1NVVR 3P27A 1ESNA 1NBMA 2A5YB 2NO6A 2H1LA 1LS1A 2VP4A 3BAFA 4XH9B 2A30A 2VSXA 5DGXA 4AKEA 3AEZA 2B7CA 3X1WA 3DMNA 2LCFA 1OFTA 2FN4A 1E9CA 2A2ZA 4Q9KA 1OE0A 2OAQ1 4ABYA 4QBHA 3W3ZB 1KI6B 1CF4A 2OZEA 2P67A 4TLEA 1Q1ZA 4EJSB 1VIAA 2XAUA 1B23P 1XEWY 2MMCA 3EWAA 5EUQB 2OFXA 4MKGA 4AKGA 1B0UA 1SXJC 3TR0A 5G41A 2JLUA 2VP0A 2IX3A 1I4DD 1PJRA 4RKEA 1AKEA 1MKYA 2A9KA 2V6JA 5JCZA 1DBSA 1E2GA 5JI3E 1NRJB 3Q72A 3BB3A 4QNMA 5H70A 2C96A 4R2IA 3WNCA 1H65A 1EESA 3EIQA 1XJCA 1G8FA 3AP3A 3WYAA 5J4VA 1SKYB 4LC0A 3SNHA 3PUYA 2FH5B 1W36B 1A82A 4DCUA 3L82B 2ZRPA 2ZSDA 3VR2A 1NVWQ 3W8NA 3I61A 2WJGA 5FBLB 3JZMA 4E07A 2G88A 3KTAA 2MSCB 4GZLA 1VDZA 1DELA 2CJWB 1M1YE 2PEZA 5EP2A 5B30A 1W0JA 1S3SA 3KKMA 2FJUA 2O0JA 2PCLA 1AS0A 2C77A 4GBMA 4FXPA 1Z8FA 2FG5A 4WXPA 4FN5A 4IJMA 1WDTA 4LPSA 3QG5A 2J7PD 2ZETA 3GJXC 1JEDA 2ZRKA 2BBSA 3LA6A 5AWFC 1MV5A 2KBEA 2GWHA 1YU9A 2YHSA 3AP2A 3ADBA 5BN3A 3ZS9A 3RS5A 5FPSA 4DEYA 2XSZD 1UKVY 3GJ7A 4LHXA 1JR6A 1G5PA 2ORIA 3A1SA 4V0KA 1JQJC 4PAMA 4PZYA 3CLVA 4QGAA 3N5CA 4N3NA 1Z63A 4QXAA 1GL6A 1GRRA 4BFTA 1T3LA 2J3EA 3UKDA 2TMKA 2P2LA 4Q00A 4OI4A 4A8JB 3FHCB 5LD2C 5ANRB 1R0YA 4AURA 2EFHB 4LJYA 4CT4B 1SVMA 1BYIA 2UZ3A 3R8CA 4M22A 4C0AC 2CE2X 2ODBA 3ASZA 1NLFA 3CNLA 3CO5A 1NG9A 1G5TA 4M9XA 1J99A 2DHRA 4IDOA 1FW6A 2OG2A 1D6JA 4ZKEA 1U9IC 4C0KA 3WHKA 2O8EA 4ESHA 3EX7C 2CDNA 2QRNA 1AQUA 4F4CA 1E32A 1T3HA 3K09C 4YONB 1IJEA 4K46A 5B58C 3T15A 3O8RA 1XCGB 1DG1G 4DXAA 1Q22A 1P72A 2Z0MA 2FV8A 2WWHA 4A9AA 2W00A 4PC2A 1QF9A 2J7PA 1UBCA 1WBBA 3VR5A 3GJ3A 1UKZA 2WVJA 3TKLA 3KFVA 3VQTA 2F55A 1SVWA 3KJEA 1CLUA 2BDTA 3WRYC 2IYWA 1L4UA 2XSZA 4BUJA 4TMKA 1KSGA 4CVNA 3TUZC 1E0KA 2BJVA 3K0EA 3PV0A 1NN5A 3GFOA 5FOTA 4U7DA 1GP2A 2BEJA 4GPTA 2OCBA 2ERXA 3IPXA 5JBQA 1OIWA 4PHFA 2GK6A 4RJLA 1AN0A 1E2PA 1F2UA 4Q66C 1FNNA 3I72A 4NMMA 3TIFA 2CCGA 5KOYA 2WWXA 3FVQA 2PL3A 2ORWA 3PUZA 4BE7B 2E87A 2D7DA 3ETLA 4L9SA 3QVVA 1TL7C 5FBWB 3AUYA 4RD6A 1E2KA 3NBYC 2R44A 4MRSA 1RC8A 4FMDB 1Z83A 2ZI5A 4QBIA 1IOZA 3LBHA 1OKKD 5IDVA 1GM5A 1TNDA 1XPOA 4DCVA 1EGAA 1KI3A 2OM2A 4IVPA 1FTNA 3HYRA 4G3XA 3B1YA 2JDID 3SBDA 3CRW1 4C0HA 2REBA 5AK0A 2XNDD 1JNYA 2O0KA 1MABA 4JT2A 3KX2A 4TLBA 6Q21A 2KI5A 4E22A 3IDQA 3PEVA 4URUR 4ZV4A 2XTMA 1FTSA 4IW3B 4R98A 4ITRC 4BLSA 3Q7PA 1S1CA 4A4DA 1GKIA 1QZXA 2MMGA 3KXKA 1AGRA 4JLPA 4WW0A 4I99A 3KQKA 1JAHA 2P6UA 2VP6A 3O8CA 3LRPA 2G9NA 4P0TA 1P9RA 1ZC4A 4LV5B 3AF4A 4OHVA 1SULA 4DLVA 3QXCA 3CBQA 4RFVA 2P0EA 4AI6A 3DM9B 3D31A 3KTAB 4BEBA 4BFWA 1KDRA 2DB3A 5KPDA 5K8LA 5FOWA 3K0SA 1ZD9A 1XX6A 2FSIA 4NONA 3UG6A 1K5DA 3GP8A 4PC7A 2RH5A 2WJJA 2ZRDA 2EFCB 4DUGD 5DI3B 2J9RA 1WBDA 2PH1A 3P32A 4M1SA 4UNNA 4NYMQ 4PSKA 4BASA 4CT5A 1G6HA 3KJHA 1E4YA 2EWWA 2SHKA 4QJ3A 1QBKC 3FYHA 4ZPXA 1LB1B 4WZBE 1E1QD 1LW7A 2JJ8A 4B32A 1P5ZB 1TTTA 4HUTA 1HT2E 3KKNA 1WRBA 5JFGA 1XJ0A 2JLRA 2Z6VA 1P7CA 3KB1A 2GVDC 3SFVA 4GMDA 4CEHA 2GJSA 1E0SA 1OKKA 1ZU5A 4JLKA 3AF2A 1EFCA 3QEOA 2F9MA 3CB4A 1Z08A 4HB2A 5BN4A 1IN7A 2JDIA 1D2MA 3EIHA 2YVUA 3WHLA 4D25A 3KKOA 1EFRD 1II9A 2ZSEA 2XNDA 4HI0E 4ILEA 4RCZA 3K70B 5H68A 3PIRA 1QVRA 4TYPA 1E2QA 4RFSA 3LX8A 3RDPA 3OHMA 821PA 1U8ZA 1ZNXA 1OPXA 2QG6A 5J5CA 2NZ8A 3PJRA 1N0VC 1MR3F 4IFBA 4Q7MB 4QM7A 4G5QA 4LHYA 5H1YA 1KK3A 3CR7A 1KMHA 1XMIA 1GKUB 4IOKA 4TLAA 1D9XA 2QAGB 1W48A 1HY3A 4UJ3A 2O8EB 1UADA 1N6NA 1X6VA 5FOXA 221PA 1AM4D 1TUIA 5JWOA 1NN1A 2RHDA 3F5FA 2XOKD 4D4KA 2VIIA 3ZD7A 1P2UA 4KODA 1XPUA 3X1DA 4D4MA 5KDDA 4UJ5A 1G21E 4DUGA 2O0HA 1G8YA 4ZIRA 4HATA 3PEWA 4LZZA 3GLGB 1YJ5A 1N5IA 2ORVA 1G3RA 3WYGA 4JL6A 3ZIAD 2OAP1 4MGZR 1G17A 1Z0FA 2IYZA 1GL9B 1YR9A 3RS2A 4MKIA 3AV0B 5FOUA 1QRAA 4OJQA 2JJ1D 4BFUA 1E1QA 4B3CA 3LV8A 1U0JA 4MDEA 3CX8A 5EE9A 1QHXA 5FL7D 3WNDA 4EKDA 2QP3A 2PJZA 1QG2A 3UATA 1GWNA 2OBMA 4D0NA 2V3CC 3N2EA 4A15A 1MT0A 4C0JA 1YQTA 1XXHE 2NO1A 2NTYC 1L8QA 1IY1A 4Y0AA 1F2UB 3RSLA 3MAAC 3BWDD 4FCTA 1ZIOA 4P4SA 4KI0A 4A0GA 4GNKA 1KO7A 4B75A 1EFRA 2ANCA 1DAKA 1IN5A 2RGBA 4DCNA 1F6BA 1NL3A 3ZYCA 121PA 3B13B 2OO7A 4RZ3A 2RGAA 3C41J 1UDXA 4TMVA 1D2EA 3WY9A 3QXHA 4LSGA 2IHBA 2ZJYA 2PT5A 4B2PA 3GLFE 3U7HB 2EYUA 4RKFA 4TSFD 3PCRB 1P62B 1K8RA 2VHUA 4ZDKA 5DNYB 1UF9A 5J4HA 1MABB 1U94A 2VF8A 3CIOA 4IVQA 1FX0A 2DPXA 3EXAA 3ZLJA 4PC1A 3C16C 1NI3A 1U8AA 5HZHA 3AGPA 2HV8A 4JLVA 4WA7A 3MRSA 3O8DA 4POAA 4B76A 2AN9A 3MGCA 4PQFA 1JQLB 1T91A 2XOKA 4XJXA 5KSZA 5KYKA 3AVXA 4A0HA 5B2ZA 1IJFA 4LJ6A 4A82A 1RZ3A 1KO4A 3GLHE 2Z5FA 4LBYA 3IIMA 3ZIAA 3VKWA 1S8FA 4JVMA 4TQUS 2AD5A 2QQEA 4M1MA 2QSYA 2WICA 2Z83A 3EWSA 2JJ1A 1OF1A 1K5GA 4PO1A 2YC4C 2R6GA 2ZJ5A 1J7KA 5FL7A 2QBYB 2Q9AA 2IS2A 3SYKA 3K0CC 1OIVA 2WBLC 3BFKA 4CIDA 1GAJA 3NH6A 1MOZA 4BZPA 4Q7JB 3BGWA 3NEJA 4NL4H 3TE6A 3TQCA 3KXIA 4B2IA 2HF9A 3FKSD 2O8BA 2JATA 2YWGA 5AUNB 4FCWA 1GTVA 2AXNA 3TMKA 1KHTA 4ACAA 1KMQA 2R62A 3A1VA 1JR3E 2N46A 2V55B 1Z2CA 2BBTA 4CEHB 5IRCD 4Q9IA 4LYAA 2R8RA 3QF4B 4JSTA 3W9YA 4QOSA 5CM8B 2BIFA 4YXWA 2J0SA 3GCGA 1ZW6A 3VKGA 4M9SA 4PSAA 2DY1A 1M7HA 2IC5A 4OHXA 3GPLA 1IN8A 3LBNA 4BECA 4KYUA 4RY2A 3P4YA 5CK5A 2B8TA 4JLAA 3ZJYA 3BS4A 1F3OA 4DIEA 1VCNA 4RFSB 5F9FA 2J0UA 1SXJB 1CRPA 1YZLA 3NEYA 5AJXA 1JAIA 2F9LA 1P9WA 1GNPA 2HXYA 2W0MA 3DKVA 1W36D 3NDBB 2BJWA 1XEWX 5CYPA 2WV9A 1YE8A 1D9ZA 3E1SA 3VX3A 5FPHA 2ZTSA 5FTNA 3Q8XB 2QE7D 3Q5DA 4B74A 3T1TA 1KMHB 2JIZD 3K8YA 2V54A 2H92A 4CRWB 2CLDX 5M04A 1GRQA 4MGIR 4AYXA 1BIFA 3B8HA 2GHIA 3SFZA 2IF2A 3HU1A 5CITA 2NO9A 3FHOA 4KFTA 3EPJA 2NPFA 3CX7A 1E2MA 2QZ4A 1VCOA 5KDLA 3WMEA 2VP5A 4ZIRB 2BMDA 1HE1C 2GEUA 4ZCMA 4AYWA 4WZAE 4A2QA 4R7ZA 2W6ID 3AKDA 5DHAA 2X1VA 4BFZA 3K9GA 1KO1A 4HLCA 5F9HA 2PT7A 2WKPA 4DSUA 1KI6A 4ZI3A 4IDQA 3T1VA 1G3MA 5KSYA 1W1WA 2GXUA 2ZI6A 3R8FA 1PLJA 3FKSA 2ZYWX 3A1TA 4JVNA 3KJGA 4Q01A 5LDDC 1W5TA 4I1OA 4LC1A 4JS0A 2FWRA 2JEOA 2VSOA 3EW9A 2QAJA 2ZUDA 1KSFX 2ZU0C 3EZ9A 4MKFA 3FB4A 1G4UR 3W6OA 3R9WA 1ZNZA 1R6BX 2ZU6A 3W34A 1A4RA 1EFHA 2IXFA 3BFXA 4P4SB 1P2TA 3CWZA 4PR0A 3AB3A 1J8YF 3RYTC 4M0LA 4OQMA 1PVOA 2ERYA 3OE7D 5LB4A 3IBYA 3HPQA 4C9BA 4JYCA 3GJ5A 4LRWA 1S9DA 3Q7QA 2HUPA 1DTSA 4O2LA 4PZZA 2PMKA 1XMVA 1FNMA 5JSZB 2OILA 2GEDA 3THXA 4RD4A 1XWIA 3GFPA 3I5YA 1H8HD 2WWIA 3REGA 4DWJA 3RNLA 4IDPA 4QJ4A 3LXXA 1NLZA 1FX0B 1I4TD 3CZQA 3R20A 1G41A 1Q20A 1KIMA 2JIZA 4KBFA 4A6XA 4B3XA 1N0UA 4Y0VA 4M2LA 2CJWA 4NYIQ 1O87A 1E2HA 5IHPA 1Z0IA 1G19A 1Z6XA 3QENA 2EU8A 4BFXA 1ODFA 1KJZA 4LX0A 5CJ2A 2FSFA 3CF2A 1R8SA 1IXSB 5BQ5A 3L8YA 4TQ9A 4EFNA 3BORA 1XBTA 4DZZA 4EPWA 1GUAA 2W6IA 1GKYA 5DLQC 1HH4A 3BJIC 3RRYA 3H4MA 4CYMA 2F43B 1XU4A 1YZNA 3VKHA 4KLZA 2A5JA 2QRZA 2ZUCA 2CL7X 4B3DA 2GAOA 1N6IA 4XD7D 2EW1A 2IHYA 3GJ4A 3LWNA 1YR6A 1PLLA 3U6KA 1FMJA 2ZROA 5BWMA 2HYIC 1ANKA 4D2IA 5DYIA 5AR1A 1X86B 3BOSA 3R9XA 1GG2A 3QKSA 4AG5A 4XWAA 1F5NA 4LOAA 2FPLA 2ZVQX 1X1RA 2MSDB 3AVVA 3SI7A 4FD2A 4HYYA 1OH6A 1ZD1A 4OKSA 3DL0A 4KBGA 4A0FA 2YWFA 2IS4A 2OT3B 1OV4A 4NCKA 1OSNA 2C78A 3BFVA 4PHTA 5JHHB 4NYJQ 4DDWA 1JPNA 5J4LA 1QG4A 3IBGA 1KYIA 3U3OA 3MWYW 1H8HA 1KO8A 1OW3B 2ZAOA 3LW7A 4JLMA 5FH9A 1BYUA 2WMNB 4NBSA 1E0AA 2CVFA 2J0UB 2REXB 3BH6A 3QXJA 4PX9A 1RRGA 2RGNC 4HB0A 5JECA 4EPXA 1KI2A 2QNRA 2YC2C 2ZJAA 4IHQA 4EPYA 1M7GA 2DYKA 4OHWA 1ZD8A 3SQWA 1XJQA 4I4LA 4S2EA 3D7MA 3I8SA 3F0TA 3PVSA 3UXMA 1RE0A 3C5HA 3R9IA 1AKYA 1T5IA 2Q21A 1RKBA 3WMGA 4RD3A 1VKJA 3UMRA 1U2RA 5IF9A 5JWRA 4KLNA 2AX4A 2XZOA 4MYCA 2QROA 4P31A 4GT1A 2C5LA 1GNQA 1Q3TA 3GEIA 3LX5A 4ZKDA 4XD7A 4YMSA 3K9NA 1S0UA 3NVAA 2YJTD 1R10A 2XEXA 4U00A 4QHTA 2ZS9A 2FSGA 3SOPA 4DT1A 5EUMA 1IY0A 3OAAD 2HCJB 3GEHA 1IQPA 4PAOA 1E0JA 3O8BA 1G7SA 1UKYA 3CRQA 2AL7A 3DZDA 3ZQ6A 3EA0A 5IK2D 4CW7A 4QJ5A 2NMVA 1W7AA 2JLXA 2IT1A 4WAUA 1NP6A 2YOFA 1YZTA 2QPOA 1GRNA 1ZP6A 3B1WA 1M2OB 4KXFB 4Q9HA 5C2JB 1DEKA 1W2GA 2W6JD 1ONBA 1T0JB 2C9OA 5C4GB 4KAXA 3L0SA 1A7JA 3ZS8A 2D62A 3FHTA 2REOA 1KI7A 2GKSA 3K70D 3IEUA 3RS7A 2WPDD 1XTQA 2QPAA 3V00A 3U5ZB 3CX6A 4NZYA 1TU4A 4MITA 1XTJA 5LPNA 2V7QD 2FOLA 3AM1A 2ZRBA 5D3MA 3THXB 2ZRNA 5HTKA 4DEXA 1E9FA 3FDIA 2ZRIA 4PPNA 3TAUA 5FOSA 4M1WA 3U3RA 3TUJC 2QEQA 2VQSA 3HPRA 2QI9C 1KDPA 5J47A 2OE2A 2DCUA 3H84A 2PMDA 1I4LD 2AK3A 2V8OA 1ZVQA 2GBLC 3B2EA 2D2FA 3LD9A 3QE0A 2ATVA 5HR5A 1KAGA 4HLUA 3D3QA 4MKHA 5DI3A 4KVAA 2PLFA 2WJVA 3SJCA 2A5DA 3BK7A 4ERNA 2WHXA 2IYQA 2WOOA 1W4AA 2HJVA 5FR2A 4M4SA 4FWIB 1DPFA 4DDVA 5FTJA 1N6RA 2IEYA 1EX7A 2OUKA 3OAAA 1KI4A 2GNOA 2X8AA 1ZAKA 4ON9A 4MGYR 3GD7A 2G6BA 4N1AA 3QVUA 4BWYA 5IK2A 2F3TA 4CZ2A 2WJIA 5KUTA 3M0EA 1Z0DA 3FMFA 3TSWA 3X2SA 1RYFA 1YZGA 5KNCA 4LYHA 2XXAA 3AVYA 2A5GA 4FI3C 3ZDQA 2W6JA 4OK3A 4IKEA 4RD1A 2XTZA 3QKSB 3BERA 1Q1EA 5L3SA 3TW4A 4XWKA 1N6OA 2O8CA 4MYTA 3VR3A 2RB4A 2FEMA 2WPDA 2PX0A 3GMTA 5JCPA 2Z4SA 4UNRA 3U4QB 3N70A 3RS0A 1Z6GA 4TYWA 3VNVA 2NO7A 4C4PA 2V7QA 1NIPA 2ZYUX 3OESA 2H17A 4XWOA 5AJVB 1E9SA 3CZPA 4BRWA 3TW8B 3VHXA 5FI1B 3WBJA 5FUWA 3I8XA 2VTKA 5FOVA 4MRRA 4JLNA 1LFDB 4TTRA 3D6TB 1BS1A 1KJWA 4HAUA 5SZIA 2QAGA 4MDFA 4DCSA 1XTKA 2CL6X 3NTUA 4LK2A 2YNMA 2ZSBA 1J70A 2AFHE 4JLOA 3SBEA 3FPAA 2J45A 2GRJA 3FGNA 4UKDA 1YHNA 3H0KA 2FFQA 3LFUA 1EXMA 5LB2A 2VPPA 5BN5A 4CDGA 2PZEA 3E5HA 4EUNA 2IYSA 3GLGA 1KZ7B 1TEXA 3KZ1E 4LJAA 3IHLA 5JEDA 1R7RA 4I1UA 4II7A 1U98A 4BLRA 1RJ9A 3SEAA 1SKYE 2ZJOA 4K8OA 1OFIA 1P75A 2EQBA 3EPHA 1TEVA 2BMEA 4P4TA 4QG7A 2Y8EA 4NE2A 1TQDA 2FZLA 4I81A 3PEUA 1Z0AA 5BW8A 4KO8A 4Z8XA 5KNBA 2DWPA
chains in the Genus database with same CATH superfamily
4ZJUA 5IEJA 3BRQA 3NC4A 1M3SA 1KMIY 3OVMA 5SY9A 1Y33E 4RU1A 1RLUA 5DGTA 4UNPA 3F6EX 1T4CB 3NHWA 4OQQA 4P8RA 3RRZA 2VDWB 4X3PA 2O5CA 1GYRA 1FYEA 2OSVA 1IDN1 4L3VA 4RK7A 2ZS8A 1EM8B 4ZT6A 2W42A 2HA2A 2PWYA 4LXYA 1MDBA 2JGIA 4JP8A 1XB2A 5A05A 3RC8A 2GM4A 3EXHB 4E2XA 3WG9A 4C03A 1DS6A 3CUUA 1KJJA 3PUJA 1RABA 1VYUA 1YHZA 2HX1A 2J9FB 3ER6A 3A25A 4AICA 2I91A 1L9KA 4RBNA 3JPYA 1H2AS 5E2BA 3T1QA 3WK8A 3V4LA 2O1SA 3GVPA 3OOSA 1EU1A 3GMSA 3LKVA 2F3QA 3KJZA 3N87A 4XARA 2BGNA 4FYHA 4GNRA 5K0NA 2Z2JA 2Z95A 3RFXA 1IXZA 4UBLA 1CS4C 1PS9A 1W9MA 3LW8A 4DYVA 1O58A 3GUCA 1I2ZA 4ZCSA 4J1TA 1P7WA 1ZNWA 1KGDA 1M2VA 1UK9A 1V45E 2ODNA 5F33A 1IUKA 1VYVA 3O0DA 3PD7A 4FLMA 4OLJA 2AC4A 3FSGA 3K0AA 2AOVA 4JBHA 3QEMA 2D1RA 3DEFA 1H4VB 3S1AA 1CR6A 1P5RA 5H59A 2A78A 4U7FA 5K0ZA 1RXVA 1J90A 1SVOA 4KJZA 1NNI1 3TKAA 4JLJA 1D8TA 2POCA 2G72A 4LJLA 2NUTA 4YP7A 4K3VA 1GPYA 5L53A 1K6EA 4WA8A 2ZDQA 2JD2A 3KD3A 1UXJA 2IIQA 5CDFA 3ZGYA 4H0NA 4BVKA 4ZQCB 2ZI4A 1TVMA 2ZRHA 4O5OA 2IL1A 2P2CA 3IGFA 5AHKA 2BVNA 5DTEA 3J7AC 4DIOA 2VVTA 3SDZA 2B8JA 2QBYA 3D4LA 1CJKC 3PB3A 4NCIA 4C6HA 4DAOA 1COWD 2JBWA 1Z38A 1PO7A 2B2CA 2VUTA 3EGIA 3BFJA 4RY0A 5F3DA 1KNXA 3HB5X 4AY5A 5EUBA 1XZDA 2X58A 4UXIA 4G84A 1FUUA 2BMAA 1AHHA 1GU7A 2RHJA 1OLUA 2ADOA 3N2NA 3VMMA 4MW0A 2HBQA 2GJ4A 7ABPA 1ZUHA 3PXUA 3K9WA 3TLGA 1H2HA 4F04A 5FWXB 3IJRA 4HEHA 2JLYA 1I14A 2GVNA 4C87A 3B20A 1FXUA 2PWBA 4PF1A 1PT5A 4S1WA 4US0R 5I8PA 4KN9S 4FEAA 4YRZA 3O94A 2JCXA 5LKAA 3QF4A 3RHTA 4F92B 3OFND 4KAJA 4OO3A 2C31A 1AGPA 2AYXA 4BX0A 3D8BA 1UMBA 4ZMSA 3GIDA 4RTLA 1AD2A 5FPKA 1OPRA 3D5QA 1JJAA 3EMKA 4P7FA 3EB9A 2I80A 4DYDA 1P1BA 1ISIA 1IEVA 3B5EA 3OZ7A 3PQ3A 2GF9A 4OHOA 1J00A 1QFMA 4FMCB 5ICFA 4ZXPA 3PENA 4GI7A 4WJZA 3FPGA 4RD0A 2GPBA 2XKAA 2YINC 4B7CA 4EECA 1H9CA 1BAPA 1QHFA 2JGAA 3TTXA 1I7LA 3IBTA 3I30X 2J3LA 4NESA 5LZ7A 2WJWA 1AHNA 3VOAA 3G89A 5JISA 3R7NA 1DSSG 4BO3A 1VLJA 2CEAA 3LF1A 4UUQA 3Q0EA 4G67A 5C8XA 1WUYA 4KZKA 3ZXYA 3JY6A 4B4VA 2A35A 2JLBA 1O95A 2BCGY 2NPIA 2RMKA 2QDKA 4RZUA 4CZ2A 4QVIA 2BJHA 3N05A 4AO6A 1YA4A 3I2JA 3W2FA 4NKRA 1VJCA 4EVQA 3E5NA 5KOJA 2MHCA 3EBOA 2CFSA 3UHFA 2Q5IA 4BCCA 2P2SA 4XFJA 3PS9A 4R1MA 1P2FA 2ONZA 2PA0A 4OHMA 2NO4A 3KJXA 2VKTA 5BN5B 4FFPA 2O5RA 4N5LA 3RUCA 1RI5A 4GE3A 5CYOA 1X8KA 3O1LA 4M55A 3DAFA 5EQTA 3GMDA 1HT3A 4G89A 4B45A 4Z49A 3F8WA 3DFKA 1I30A 4ERXA 3CW2A 2X2OA 2F8LA 1ODTC 1K6MA 1Q50A 1ECBA 1RJEA 2GYYA 3UQYS 1RJ9B 2ZS7A 4MHSA 4B3MB 1N2SA 1BXGA 3MCZA 3OCWA 5DDIP 4PLVA 4B2LA 1JG1A 1Y4ZA 3IOMA 3LBFA 2GKOA 3IOEA 3HJNA 1Z45A 3LK7A 2C20A 3AK4A 2GA9A 1DAIA 4J16C 3FOBA 4MJ7A 5EP1A 4D45A 5EXPA 3KT0A 4KN5A 1LX7A 1TJPB 4PHHA 2Y93A 2QNIA 2UDPA 1CJBA 3DMTC 4Q9JA 1AT1A 1EX9A 1JU9A 4ZRMA 4DA9A 1GITA 4DXHA 5GIOE 4DNPA 1Z5VA 4LHWA 3UAWA 4EENA 3M6UA 3PDUA 3QWHA 2LD4A 5G4KA 2E85A 3G9UA 3BXEA 5LLSA 4R8RA 2YY7A 2JCGA 3JW8A 1E3WB 1HM5A 3CLKA 3N0TA 4FC6A 4ONEA 2Y99A 3VAZA 1VLZA 2RHCA 4HQRA 1KORA 3KDPA 1BGWA 1JAXA 3NEAA 3AG6A 1A5TA 5JYBA 5CIYA 4QIHA 2DEUA 4ZV7A 3QKIA 4CKBA 4JBXA 5EAIA 1F1JA 3KPJA 5JSZA 1LQ2A 2FJPA 3H5VA 2QD5A 2XJ4A 4TS1A 4JR0A 1FS6A 1PG5A 3LQ2A 3OOHA 3S99A 3L46A 2ZR0A 2WI8A 3H9EO 3MTJA 2PVPA 2J87A 521PA 4RAQA 2GCOA 3FUUA 1MAAA 1XF9A 5FAXA 1MD9A 3OP1A 4FOSA 3V4OA 2Q6KA 3O2JA 3OPXA 3O8QA 4QEZA 1XMXA 4IEIA 4QQKA 3ADDA 4IHJF 2C5BA 3WQSB 2GJKA 5E3IA 1IG3A 1XCPA 1A98A 3KSMA 1VCHA 2V6GA 2YW9A 3K0AB 3OWHA 4R1OA 5ALRA 4YP9A 4D79A 2GZHA 2CNWA 3ED5A 1P9NA 1WP9A 3QEMB 3R3UA 3TZHA 3W5JA 1RE1A 3S1AB 3V8NA 3PXGA 3LVRE 3FLEA 3VDRA 4V3BA 4BX3A 1R8YA 3L0PA 1CUFA 3JYHA 4WZAB 2CDCA 4FR5A 5JDCC 3SQLA 3ZWAA 1C30B 1U9IA 2Y1FA 3DHYA 4JU8A 4HS9A 2NUTB 4XGIA 1YVEI 1JUDA 1GV0A 3L5KA 4L51A 3R3SA 4HTFB 3FF1A 4UM7A 2WG1A 1FL9A 4Z86A 1WX1A 4YAIA 3L8MA 1XP5A 3DDUA 1N7GA 3HEBA 2E2WA 2H59A 3H2ZA 4XWTA 1N2GA 2TMYA 3OMLA 1TAGA 3K72B 2VJMA 3BWEA 4BS9A 1FMLA 4C89A 2HXSA 3AUFA 1V37A 3OQHA 4Z2YA 4DWWA 3CWCA 1KH2A 4OGWA 5DRYA 1OLUB 1BWPA 5IH3A 3REOA 2H9AA 3NM6B 1NJSA 3IXQA 4EMSA 4IJUA 1YS4A 1KY5A 2JLZA 3WRYA 2GBPA 1VHTA 2QUHA 3RVDA 3ZWQA 3TLGB 1AURA 5DBFA 2KLHA 3WK6A 4XWWA 1PF7E 4WXRA 3JR3A 3GLGE 3WLPA 4Z7OB 2HW8A 3V8MA 4LGCA 4TWAA 3ANNA 2VTBA 1WXFA 2Z56A 3FRJA 4LUCA 1J9GA 2XVXA 2YWDA 4BBJA 1O4WA 1YO6A 4B4OA 5HW0A 4AO8A 4NZZA 1PSWA 1ZRNA 1PYGA 4BNIA 1KEEB 2GHRA 1UMBB 3D2AA 1L0BA 3GNQA 3QV2A 3AERA 1SC6A 1SBCA 3E18A 4RE5A 3A4NA 5IVIA 3V7NA 1LLFA 1SBZA 1S3FA 3K2QA 3R5JA 3REFA 3B89A 5BSKA 2BFCA 2FUCA 1T5HX 1YGYA 5DXFA 2ZPAA 1UAYA 1V11A 1ZYUA 1YVUA 1M2FA 1JEAA 4IEFB 3G5UA 4I4TA 5H9VA 5IBRA 5BO5A 2JCSA 3G0OA 2ODTX 4QOIA 4WLVA 2JLQA 3G2PA 2EG5A 1SBHA 2YFHA 3GGGA 3QMPA 2EJTA 3BMOA 4YTEA 1E2UA 1W5FA 5FA8A 4QJIA 1OGIA 5A1JA 4R9NA 4KIWA 4Z51A 1AXEA 4OI2A 1WE2A 2H1SA 3BWMA 1FZQA 2IE0A 2ZYIA 4RPLA 1GPAA 2F17A 3HP4A 5A3JA 3P0EA 1HOTA 3LDGA 3LJKA 5HDBB 3TI7A 5J23A 3UG7A 2WMDA 4DJEC 3O4JA 3ZBQA 3QVLA 5KOJB 1J39A 1T8TA 4I1SA 5K03A 2XLCA 4YS6A 2PFKA 1M7BA 1JQEA 2PMFA 5DM2A 4ZVUA 5THKA 3T7DA 3LF2A 1OX5A 2QTTA 2AQ8A 2QQGA 2W5UA 2XHZA 1VC2A 1D2GA 2AG0A 4QPJC 2HLDD 4DQXA 3PFHA 2QAIA 2ID8A 5LA6A 3GRZA 3PHJA 4EW3A 3I5MA 3OECA 3ZQJA 3VTFA 4B3JA 4F0JA 1ZK0A 3PP8A 4Q21A 4LOIA 2YYSA 2F6RA 3DWIA 1RFGE 4NBRA 2Q1WA 3KLOA 1KJYA 3FWYA 4AJ9A 1LJLA 4WTOA 1R0CA 2B34A 4HFJA 1BXGB 4HRYA 5DISB 2D2XA 3ZV5A 1H3EA 3CLRC 3WK4A 2O8FB 4E5VA 1ZCFA 3EAFA 4K9DA 1EHCA 1US8A 4H0FA 4NWIA 3FTEA 1VKOA 4OG2A 5ARBA 2QZ9A 1IK4A 1AK2A 4JT4A 5JADA 3R5XA 3E2IA 4XX1A 4R1UA 3PUXA 3MRTA 1Z4NA 5ERXA 2ACKA 1DKLA 3B9BA 5BYKA 2WSMA 1L5RA 2ZWAA 1KMCA 3HR8A 3LC2O 4LVOA 1D5CA 3RLFA 4F72A 5DIFA 5FYQA 2HMSA 2DUMA 2RGDA 3BXFA 3OF2A 4FYXA 4KKVA 3SGLA 1JMKC 3GYGA 1E6CA 4F9GA 1USUA 1Z3IX 3P9QA 4N0MA 4PCLA 3VSEA 1ZQ1A 1ZK1A 1ODLA 3V1NA 1AKRA 2YTZA 4XDYA 3TUIC 2QTHA 1X1BA 2NTEA 4MWGA 1R00A 4NNOA 5DE3A 5AM3A 3R75A 3V1KA 1XNRB 1RC1A 1L7XA 3DEAA 3UPUA 3KM0A 2CXPA 4S1TA 1FK8A 5JS8A 4QM6A 4CLOA 3PCXA 1JF8A 1KL7A 1RMYA 2GCOB 3DAYA 2HH9A 3NOQA 5JV5A 3CEHA 3GCXA 4DHWA 1UPTA 2HO4A 2JJ2A 3D3JA 3LY7A 3MILA 3O8QB 4D0GA 2I03A 2CHQA 4C7BA 3MUFA 4MAMA 1DDGA 2W58A 5AFSA 4V24A 1X9GA 1O1YA 3D8UA 4UOQA 4K0RA 2MTBA 4Q02A 1G64A 1LC3A 4TLLB 2HPVA 1H22A 5AH0A 2EVWX 2B9VA 4QGFA 5M34A 3NWJA 1EK1A 4JJGA 4E0BA 2FI1A 2HEIA 2ZRQA 4YV7A 1K68A 2YV1A 1PL6A 1R4NA 1ZSVA 3LI2A 2RGXA 4YB8A 4ZXFA 4QT4A 4FMCF 1FZTA 2PKWA 3IPAA 3OCVA 3BN3A 4UC0A 3BIWA 3DE6X 4K81B 2R6FA 4WOKA 4KN8A 4POOA 3V5NA 3OUTA 3TX6A 2VHVA 3IV9A 1R37A 4RVCA 1C9YA 2NOAA 3UA4A 2VJMB 4O2BB 3M82A 2JG3A 3K1AA 2RG7A 2RKWA 3M6VA 4ROTA 4MV4A 3F7TA 1UBFA 3SDSA 1Z0ZA 4Z9XA 1HQYE 3B5IA 1PJQA 5EZYF 2OK7A 4ZHSA 2GM5A 3I12A 4O8ZA 5ALDA 3IJEB 2QRGA 1YD7A 1NLUA 4QXQA 1H4SA 2R2AA 4NABA 2PQ6A 3M83A 2YBEA 3R6DA 1Y6RA 4IKOA 1XAIA 2H51A 5KYUB 5ILOA 2P7HA 2I8AA 1U6KA 3HN2A 3U4QA 2QV0A 3AVPA 3KAKA 4C7VA 2PKRA 3IJPA 4OYRA 4AL4A 1PFUA 4IGAA 1P80A 3JR7A 1RQNA 2E9SA 4PRLA 5EL0A 2CJXA 1P0CA 2JK1A 1E8DA 1WQ1R 2ODPA 2WF5A 5JJ5A 5JS7A 4JV5B 5ESRA 2A92A 1B42A 2VFAA 1QIKA 2BFCB 1O3YA 4H6WA 3HGQA 1V16B 1V9CA 2BHNA 2Q1XA 3K92A 4WXHA 4I4TB 2K87A 4MP8A 2FGJA 1E66A 2Q4RA 3JASA 4ZO7A 2FTKE 1RD4A 2O3TA 5LN1A 1NV8A 4HNAB 2GILA 1LY1A 3SYNA 1M1YB 3JQRA 1DXYA 5FLEX 1R0LA 4N3BA 3SP1A 2IUTA 4DB2A 3G5AA 2IPNA 4X1YA 1F60A 1XHEA 2IWRA 2BH9A 1FFXA 2H7CA 2Q1YA 1R5BA 3GJ6A 1SCAA 4MV0A 2Q8QA 3SYLA 3HU3A 2JC3A 3BBPA 4CM9D 3EQZA 1Q1BA 1SZJG 2MU1A 4AP5A 2NZJA 3FWPA 4PPQA 2JKYA 3DE5X 5EJ2A 3T7EA 4WZBA 3WZ2A 3F98A 4HN9A 5J1SB 10MHA 5GVRA 4IJVA 2OEPA 5LA6B 4EAAA 2C9YA 1M2WA 2R79A 2OO3A 4OJKA 4YROA 2WJYA 4A0SA 2GTHA 2G9ZA 4HB4A 5ECGC 2I55A 3AL2A 4JJZA 2JAUA 4B7AA 3TSAA 1O5TA 4XCXA 2R6JA 3DBIA 1PD0A 1XR3A 5TQ0A 4DYHA 1ZK2A 2VDLB 5DOZA 1CUAA 4ARAA 1US8B 3O1HB 4B6JA 1LVUA 3TF5A 1VPVA 4INJA 4OVKA 1Z4LA 3NOVA 1SG6A 3IJ5A 4MHOA 3HE3A 1MOPA 3LKZA 2XYVA 2YWEA 1T9GR 4NE7A 4Q1CA 4X44A 1ESDA 2CFTA 3A3YA 3WB0A 2PWPA 1LF0A 1ZEJA 4BAZA 3WHPA 4UQPA 3A3OA 3PR1A 1EK5A 4KQJA 4MOWA 5C8YB 1QF7A 5IUNC 1ZPDA 3N74A 4K6MA 2AYZA 1EX6A 2W6OA 1RT9A 4WZ6A 1XNQB 3BXZA 3Q3CA 4KV7A 3NT5A 3EXG1 3GLSA 3M9XA 3IUMA 1DAOA 3OP4A 4HDMB 4X3CA 4Z54A 1ZD4A 2DSNA 3AXTA 1KS2A 1U7XA 5TY0A 4BO2A 4JP5A 3GHYA 2Q41A 3I1IA 1DJLA 5AYVA 1TJ4A 5I4KA 4RMJA 4CLOB 1SVKA 1YVPA 2JLVA 1F2TA 1KZGB 1WF3A 4YUYA 2YJGA 3LTEA 3DE4X 5K3FA 1PGJA 2P77A 1Y0BA 5TE9A 1I2DA 4V3CA 4C7KA 5GJVC 1CRQA 1KBZA 2ZT6A 4DLZA 2PGOA 4B83A 1DBVO 2PUVA 4LMAA 7AT1A 5KB3A 1BHSA 1CLEA 3JQDA 4EQ6A 1B8OA 4WGFA 3ZX5A 2PXCA 2YMQA 5ADHA 4GXTA 4LHEA 3CZCA 3HDGA 3L49A 3MOIA 1G55A 4DG9A 4EL0A 4GQBA 4R68A 1PNOA 2WMOB 1R4NB 1YIOA 1YMVA 3B85A 3K9CA 4MDYA 5CMLA 1G8HA 4ZCLA 3W5VA 4EY3A 1KTVA 1X42A 4XXHA 5IT5A 4V1CI 1J2TA 3WA7A 1CS0A 1Q12A 1UPCA 2VTEA 2GXSA 3QOFA 3A6GA 3OQVA 3H2JA 1MC5A 5CBPB 1XNJA 2E1RA 1JHAA 2AT1A 3PHBE 1V1MA 3IEKA 4QQNA 5HE9A 3ZHQA 3K1AB 4F85A 5C5IA 5EXTA 2HHCA 3AZPA 1JR3D 4AXBA 4HSEA 1F3LA 3MMZA 4KFRA 2ZGVA 1Z2PX 2VP9A 4FGJA 3CCFA 1L4HA 1F9AA 4FW8A 5K6TA 4MRPA 4KREA 1LLQA 3CRMA 1NOIA 4BLOA 4HV4A 1E1YA 1WB9A 5KYVA 1OFUX 3RTBA 3SJZA 2CZGA 1XPRA 2WAMA 4I4NA 5TB5A 1HTBA 2R751 1QTNA 4I50F 5LIPA 3G6WA 2BKUA 4EGCB 3HKBA 3C7AA 1ETHA 1C7EA 1Q6YA 2V9PA 4ZICA 1X3SA 2JLCA 2Y27A 1NXWA 4FPXA 1EWRA 1E0DA 2C5FA 5FBRB 2KWIA 4AIIA 2FR1A 6PFKA 1TM4E 5DMXA 1TF2A 2F8MA 2YYAA 2VQEB 1RYHA 3FFXA 4LSZA 3UK1A 4PNPA 3WMXA 1OBOA 2X40A 1SGWA 3GUUA 1TX4B 2H2WA 5T4EA 3C15C 5BSEA 1YFJA 4ZCQA 4O4LF 1KVRA 4Q4AA 1LSSA 4V0OA 3UMFA 3D2CA 4JI5B 3JASB 1CP2A 4GKKB 5EN4A 1X1AA 3R24A 1A72A 5ILQA 1C80A 1PQYA 4PYRA 1M0SA 1KKMA 1U3WA 4JP3A 3AF6A 4L5BA 3BAZA 2W7TA 2ZCJA 1X0VA 3ANLA 3EZGA 1V2HE 1JVNA 3JD1A 2XGJA 2IYVA 3BMCA 1DAHA 4DBLC 1W8DA 4X1YB 4TWZA 5K4GA 3LUGA 2IPOA 2C57A 1CJUC 3PQ7A 3Q3JB 2VSFA 1XL1A 3GC6A 5A3RA 1BG6A 5TS3A 4D9IA 2Y4OA 5FI0B 1PEYA 3Q7IA 1HQDA 2EG9A 3JVIA 3W2HA 1H8EA 2PGXA 3LZ6A 2JNWA 3M81A 4AS1A 2VHEA 1SCKA 1E4OA 3ELDA 4ZYTA 2CLFB 2I29A 2XRMA 2CLCX 4QGGA 4UUAA 1XVVA 2R6AA 1GD1O 4PM4A 1EVIA 1GN9A 3MJRA 4WZBB 3C3AA 5GJBA 3LHSA 3GLIA 3MC1A 2KQUA 1IXRC 5K0GA 2UUBB 3EQ8A 1Y6JA 3QMVA 3TOXA 2XIQA 3FPCA 3GL9A 3NIBA 1E99A 1LBEA 3CY6A 3EPRA 4URYR 4HMOA 4HHEA 1WXGA 3BIXA 5TQ0B 2O2ZA 5EP3A 1QIJA 1U1CA 3KCNA 3PIIA 5BR1A 3A4LA 4G36A 2EIXA 2VHXA 4HDSB 5EHXA 1EZ4A 2YFKA 2BEKA 4X3OA 2AI2A 3RJZA 5A0TA 1MTOA 5IJWA 2AZDA 2ZRLA 4Q4JA 3RSZA 1FC0A 1U7WA 1DHTA 1AB6A 1GU0A 1R2QA 3IUYA 2O7QA 2R97A 2WA2A 3OEEA 1A7AA 1V9LA 3WJAA 3ICPA 1IAVA 2IU6A 2SCUA 3OLXA 3SCZA 5IWCA 3WYDA 4CL2A 3MTEA 3EGWA 5I9TA 4WL0A 5IBQA 4J0EA 4LCEA 5T6BA 5AJTA 1NDQA 3NBFA 1W8IA 1HUQA 1EB9A 1YACA 4K9QA 5JJIA 1ZC3A 4D82A 1NVUQ 1FPQA 4DCTA 2H0QA 5CHYA 4HGYA 3UKJA 4Q7LA 3EDOA 4RS4A 4YT5A 4TS3A 1DXOA 2QTGA 5GJWC 3SSOA 3SN6A 3ZH9B 3UJ6A 5JT1A 1HDEA 2DOKA 2OCAA 2QG4A 3A58B 1FRZA 3K1ZA 4D3DA 5ITVA 4O2BF 1CIVA 1N8NA 1U2GA 1EFTA 2WF6A 3HFRA 1WEHA 1P8JA 3BIJA 1UPFA 4LY9A 3E4DA 1F2TB 4KITB 1G21B 5C9ZA 1BXRA 2I4RA 4TZ0A 4MI1A 2R11A 2IHUA 4FDVA 1YZUA 1YR1A 2H5IA 1LNZA 2OK8A 3KYIB 3RU2A 3VPBA 4MUGA 2RG1A 1NNEA 4MWEA 4NDNE 3D7RA 3ZHRA 1U6JA 3AVQA 1CBUA 1MB4A 3M1LA 4M49A 4XDHA 1TTQB 1JG7A 1GDHA 1MQ9A 2G83A 5CT8A 4DG8A 1YDFA 4QUDA 2X77A 4EI7A 3RC1A 4R71A 4KE9A 5BV7A 1JILA 4QDKA 4EQ6B 4GLFA 4X8HA 2HDNB 5JG7A 5AVOA 4C4AA 1STOA 2HB6A 4EZIA 3CLUD 4J6EA 4O4JF 4EYEA 2GXAA 1D4OA 1K6XA 1U9CA 4N12A 4NS4A 3R0ZA 1F8XA 4EVRA 1EVYA 1ZL0A 2QENA 3NVMB 1S9HA 2YZGA 4LPKA 3PGMA 3KQNA 4KTTE 1NJFA 1IIRA 4PYQA 1WW3A 4W1PA 3T7KA 4JHXA 2YQ4A 4P32A 1XTBA 2UYHA 1SVSA 1L5VA 1V1MB 4TL6A 4ZJZA 2B61A 1T9HA 5LU9A 2B8WA 4M1ZA 2XVMA 3TB4A 2BLNA 4M76B 2CYAA 1UFQA 4CFYA 1Y34E 3THWA 1T6NA 2WM2A 2BM1A 4C4XA 2RARA 1G9SA 4EJ0A 1TVEA 1P2BA 1ZXBA 2WAXA 4FLFA 4GWKA 3KDAA 4WQMA 5F3RA 5FD8A 3WLHA 5LR6A 1A9ZA 1DAGA 1T6BY 3L6UA 1CR0A 4JWTA 3TIGA 5BUQA 4W5OA 2JI4A 3ORQA 3DCIA 1XTZA 2AYYA 3OU6A 3TLYA 2WWGA 3NIGB 5TNXA 2PD6A 2IWHA 1OXMA 3ZU2A 3U61B 1ZH8A 3OKPA 4M37A 4TKZA 3B3AA 4IRXA 4WBXC 5IC6A 3IIJA 1P1JA 2QR2A 1U9JA 5D2CA 2EDAA 2ZRFA 3H1PA 3MWJA 2I2FA 1R0XA 2HQ1A 3RBAA 4DMHA 3DDCA 1SQ5A 3ML1A 1CETA 4B40A 2ZTHA 4EM6A 1KAOA 1NWCA 2VO1A 2GJAA 1NGSA 2PX3A 5HYVA 4W4TA 1TGVA 4OA8A 1KZ1A 1QHGA 3VZBA 4PQYA 3A1WA 4BP9A 3KYBA 3H5AA 1IUOA 2X9QA 3DVSX 3IQFA 2Q3FA 4KDEA 1QXSA 2C88A 3FCCA 4YRKA 2XVYA 1QE0A 3MCAA 2HJHA 4MVWA 2O4UX 1V3UA 4BVLA 3BMCB 1L4BA 1NN0A 2CE7A 2GBCA 1PAUA 1RPNA 1Y1KE 1UXOA 3PDHA 2ZRAA 4D8TA 5C8YF 3T5MA 1QM5A 4KCGA 1FP7A 3F3KA 4DMRA 4IH9A 4IJWA 3HMQA 2IOFK 1XRRA 1G8PA 2Z8YA 4HRXA 3V7FA 5AIBA 3QEJA 2VH5R 3UVEA 2VOEA 4D3ZA 2ZJ8A 4WNYA 1FLVA 5B53A 4Q3KA 3WWPA 3KQHA 3QMMA 2XB4A 1LLDA 1X8JA 2V1XA 3BSFA 3RVBA 3TIIA 2WFZA 3KKPA 3MB5A 1FUIA 1DBPA 1OI2A 1J2EA 1Z5WA 3F6BX 3IAM6 3PTZA 5ALFA 5TMDA 1SXQA 2G5GX 2KHZA 4KVGA 4B6PA 2EBFX 5HK9A 2C4WA 3OIUA 5FPYA 3CZ5A 2CFCA 2P4QA 3DKPA 2AMVA 4HKTA 1ARZA 4LJRA 3NS7A 1GQOA 4B85A 4ZANA 4MWSA 4G24A 2JAXA 3H8VA 5KKNB 2FZVA 3WAKA 5EMLA 2CUKA 5L4LA 3BMQB 2V7PA 1XLTA 2GAAA 1YQXA 4F1WA 3DFFA 3GFFA 2YMPA 3RARA 1CZNA 2VQ3A 4M53A 4Q4JB 1VCMA 3R41A 3OX2A 2IZZA 3ITNA 2V98A 1Z06A 3ENZA 3BB1A 4HMQA 4OYLA 5G2OA 2C7VA 1A8PA 4OUDB 2P27A 4TWJA 5CK4A 5M5BA 5ALWA 1N2CE 1C4OA 1XP8A 1ND6A 2G0TA 3CUSA 3N8GA 1U4NA 1DBRA 3SZRA 3U3XA 1ETUA 1BHO1 2QUIA 4JGIA 3OT1A 3ETDA 4G0WA 2Q62A 1SQ0A 1N0WA 4WUVA 2YRWA 5HCNA 2I7XA 3KZXA 3G7SA 1CZKA 3QNWA 5I47A 3RWBA 2XKJE 4W9MC 3PDIA 5BWNA 3OBBA 1WPGA 4PLCA 3D2BA 2D54A 2ASEA 4C20A 1CDOA 3C7DB 2HU7A 2XT9A 5AJYA 1VKRA 1XA4A 1LPNA 1I33A 4BO8A 4YXWD 3I5UA 1HDIA 2PFSA 4DM3A 1BXRB 1YL6A 1J0CA 3STTA 1OVMA 1ESMA 2A0UA 3OQNA 4IOMA 2VWHA 3L4KA 1UAAA 4JL8A 2ZRMA 2XH8A 1F14A 1X15A 3E8MA 4YQYA 4BTLA 1HDOA 2CFIA 3KZOA 3TVYA 1FPMA 1IHYA 4CIYA 5JXWA 2ZUEA 4IMIB 5CFOA 4ARZA 1TAHA 3S2UA 5KQGA 3AEKA 3ZV4A 3IS3A 3S2EA 4TUYA 4MUKA 1CJMA 3FX2A 2R86A 2Z8ZA 3NAMA 3FYUC 4LYEA 4R1NA 2C5SA 3M6FA 3MCTA 4I46A 2XEDA 3O75A 3SDBA 1XL0A 2QKYA 4FGZA 3R5SA 4ZWNA 2QOEA 1V43A 1GILA 1MRNA 1YE3A 4IJ6A 1R27A 5LWHA 3BTVA 3I39X 3EA5A 4UULA 1IBKB 4JNKA 5E7MA 1HQCA 3OOWA 1AU9A 1LW6E 4BQSA 2KJQA 3P1JA 2FGKA 1QO0A 1VIDA 2OLJA 3L7OA 3DE2X 3K3PA 4V02A 4CCYB 3Q6MA 2QJTA 1EFAA 2UZ1B 2Q2VA 1UBJS 4LBWA 4LRSB 4OCZA 4CKWA 4ZMRA 1PX0A 2BMFA 2KMLA 2WD7A 1VJ5A 2WTBA 3KFXA 4L4UA 3RREA 3EPKA 3C1UA 3EXHC 2OXTA 2VAWA 3O3OB 4QVKA 3LWBA 2RCNA 4NJMA 2BE9A 4IIGA 5E3HA 4BMVA 3U3KA 3V6LA 2PNJA 1ZIDA 1DT5A 3ITEA 3NGMA 2O59A 3P9NA 3DF9A 1DLIA 4WY8A 5SZKB 2BISA 1F7UA 3STWA 1Z12A 2OZKA 5C4IA 4FGKA 1QR2A 1UEXC 4H1HA 5EPOA 5HQ3A 2EP5A 4MW4A 1G0OA 4DIKA 1F1BA 1ISPA 1KKLA 4H1UA 4LXUA 3TL6A 3LP8A 4R6XA 1G16A 1LXCA 5BW5A 3K0FA 3D2LA 3EYWA 3NALA 1QHEA 3VR1A 1V9SA 1YSCA 4UNQA 1SMKA 2ALJA 4L0QA 4EGFA 5JRJA 1GPMA 1I2AA 2BL4A 2R4UA 3AESA 4YCBA 5TARA 3VH1A 5J4YA 1Z5ZA 3DB1A 4L4XA 1ZA2A 5BOSB 4OHYA 1N5DA 4G01B 1YS1X 4URZR 4Q1DA 4CMEA 3RS3A 5C1PA 4XOIA 3ZD9A 1OLOA 1JDJA 3AEUA 2QV7A 4DABA 3HMKA 3NGXA 1JHMA 4B35A 2P91A 4EPVA 2QY9A 1PIWA 2LTAA 3H16A 4H3VA 4F7DA 3DHWC 4QUJA 2PUTA 2XD9A 1U0TA 3F1KA 3SJBA 5E38A 1W35A 4WBSA 5E6RA 2WHPA 5JYEA 1PQPA 2PIAA 1LTHR 2PZGA 5ICEA 2Y1LA 4KKXB 3ETJA 2B4AA 4IRUB 1RHJA 4NU0A 1U0HC 5CCDA 1K4MA 1V8DA 3M34A 4MWBA 3ZQ4A 5F9MA 1ZJ4A 3KCQA 1M66A 5A71A 5B7NA 1C0LA 1BJKA 3EZ6A 2H18A 2R8XA 1L5NA 2IOHA 2Y71A 1J97A 4QTTB 4PYLA 2B1IA 5BWBA 5LKRA 5ISMA 3KKEA 3WRXC 4Y18A 5CCXA 1RLMA 1HT0A 4RM2A 4N4AA 3IPYA 3Q4GA 5G0SA 1VPDA 3D6HA 5C8VA 4TLMB 3N6RA 2FU5C 2XCQA 5HKBA 1EUDA 1JMVA 5IM4F 1KMNA 2ZWMA 3HQ4O 4UEWA 4C3OB 5A9RA 5BMVB 1ZJYA 5KNCD 5DX0A 1ZD3A 3QHAA 1E98A 2GCIA 3FOWA 1U8EA 2GRAA 4L15A 4AUEA 2I2WA 3LK6A 3ZY3A 4EJSA 3UBMA 4PZCA 2WJ4A 5AICA 2IXGA 3PC3A 2XR1A 1KDTA 3LECA 3GK3A 3O47A 4AD8A 2F3PA 3L5OA 1ULHA 1LS6A 4Y30A 2XB8A 2D59A 1Q1NA 2PSEA 1R8QA 3U7FB 3H04A 4ZCIA 1ZUNA 3OU7A 4MGHA 5BVHB 3OT1B 3B1VA 3QW2A 1RZRA 1KNQA 3AI2A 1JIUA 3WLQA 3ITKA 4QOJA 5MFZA 2IV2X 5G53C 1IY2A 4TT3D 4A8PA 1OZ0A 1ZD5A 3TZBA 2PM8A 3PDIB 3LRTA 1KDYA 1GNLA 3TIVA 5HXAA 2O2JA 3Q6NA 3JQCA 4BGVA 2ZJFA 2WAAA 3LQ1A 3OUZA 3ZWYA 5C18A 1Y6GA 1QP7A 1QSGA 3E84A 2R5NA 1N5JA 4ASUD 3F5QA 2H2GA 3LGXA 1FVFA 3K7EA 3I2GA 4NMXB 3K4HA 4S0XA 2C2BA 2AG1A 3FTFA 1NUTA 1V7QA 2VZEA 4L6AA 4WOPA 1E89A 3ICQB 1HDCA 4R0NA 4X8OA 5EE0A 2JFQA 1GRVA 1XRPA 1NVXQ 2WTMA 1NQ5A 4ARZB 4EI8A 5AW1A 3AEKB 3MD0A 3MFQA 1J2JA 4ZVNA 3K4QA 2ZBVA 3GPCA 3GJTA 5JDIA 1GPUA 2PH5A 1TAQA 1Y7TA 4OQNA 1RRCA 2V1UA 2OCYC 3JQ8B 3J81A 2XQVA 3GBVA 3TL3A 3HRHA 3W3AD 3FDFA 3OO0A 5A2QA 3DLHA 1MEOA 1VL2A 3AR9A 3M2PA 4X5OA 1L3CA 1K8ZB 4KWCA 4F1KA 4D4LA 4B6EA 3NDPA 1YRAA 4OL0A 3RAPR 3CR8A 1XCLA 1XQYA 4HGQA 3CISA 4UOEA 4LQLA 2PRJA 1JJVA 2QSZA 1NP3A 1EUZA 1N92A 3GDOA 5K51A 3QE3A 4JFRA 1P5HA 5FUVA 4PIPA 4U8HA 2IODA 3VU8A 3SSNA 4CKWB 4RK4A 3A9SA 4DSNA 2WD7B 2C2XA 1TGYA 1S4QA 2N1BA 2CBXA 1SQFA 4KBYA 1IN1A 1U4OA 1VHLA 5E6UB 1ZUWA 1LV7A 2B3DA 3IP8A 1UP4A 2G0AA 4N7JA 5CNIA 5A7HA 3C2QA 2JZOA 4NF2A 2IU3A 2Z5VA 1YCGA 5IT0A 2HT1A 1PR6A 1QO7A 3GRYA 4RUKA 3U37A 3UAVA 3S4YA 4A8JA 4KSBA 4R4JA 1P77A 2AXPA 2KE5A 5HQ3B 5JSKA 3QX8A 3HB7A 2Q9CA 2XT6A 4MPRA 4QYIA 1BROA 3EFHA 3HWWA 5BYBA 4J1TC 3KKQA 1P31A 3K0FB 2CCJA 2VHTA 2G25A 1TYZA 1CJVC 1QU2A 1XROA 1NJ8A 3GB9A 4FFNA 1XO1A 3QI7A 2WM9B 3SSAA 5FTLA 3AESB 3IO3A 4DV6B 5JJKA 4A1FA 4DLUA 2WFMA 4V0ME 3U4HA 1YI1A 3WS7A 2I4NA 2CHUA 4ZO4A 2M6SA 1ZHHA 1P4AA 4YFYA 1FJ2A 4F8EA 2BWJA 2QX6A 4GLLA 4NENA 4PZUA 3N6VA 3N86A 3G0GA 4PG6A 2VYVA 5PGMA 2PU5A 4MZXA 3CUEF 5E2IA 4E30A 1NN3A 3SZOA 1K6JA 3INYA 4OSEA 4CV1A 1JE1A 2P6NA 1V41E 2V59A 3A1UA 5E6RB 1YV9A 2WHPB 1FTYA 1TUEA 4XPZA 5ALYA 3VNUA 1H23A 4AG6A 4FLEA 5J3JA 2EX1A 2XODA 1EJ6A 3B8EA 1E8MA 5JO0A 5KSPA 2J32A 1VXOA 3EBLA 4TMWA 3JQ7B 1YK0A 2AVDA 5I7OA 4MGEA 5IJ9A 3PNBA 3WDMA 1WG8A 4CQNA 2O19A 1YUMA 2C8JA 4GI3A 1GUBA 3RUFA 2ILTA 2CNKA 5ADUS 3AL0C 2RHRA 2VSXA 4F60A 3W8DA 1JHUA 2JLAA 3BL5A 4AKEA 2DM6A 1NBAA 3V1MA 4JIGA 3DMNA 1C8BA 1E9CA 1EUDB 4E7OA 3G5LA 4O8CA 4EA6A 4ABYA 4QBHA 1WUTA 1D4ZA 1CF4A 2FQWA 1Q1ZA 1XZKA 4CL0A 5FCDA 4EJSB 1WCYA 4LA4A 2V6BA 1Z2NX 3RJ9A 8ABPA 2CD7A 4ZVLA 1W87A 4OF4A 2D5IA 4EUFA 2FHPA 4MWDA 3O73A 3FAKA 3LS2A 4AKGA 3ITDA 4B82A 4DV0B 1SXIA 1Z6ZA 3FMVA 5BRJA 4JI7B 1B7GO 1I4DD 2Q2WA 2V6JA