4HTFA

Crystal structure of s-adenosylmethionine-dependent methyltransferase from escherichia coli in complex with s-adenosylmethionine.
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
249
structure length
243
Chain Sequence
DIAEKFSRNIYGTTKGQLRQAILWQDLDRVLAEMGPQKLRVLDAGGGEGQTAIKMAERGHQVILCDLSAQMIDRAKQAAEAGVSDNMQFIHCAAQDVASHLETPVDLILFHAVLEWVADPRSVLQTLWSVLRPGGVLSLMFYNAHGLLMHNMVAGNFDYVQAGMPKKLSPDYPRDPTQVYLWLEEAGWQIMGKTGVRVFHDYLREKHQQRDYEALLELETRYCRQEPYITLGRYIHVTARKPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords S-adenosylmethionine-dependent methyltransferase
publication title Crystal structure of S-adenosylmethionine-dependent methyltransferase from Escherichia coli in complex with S-adenosylmethionine.
rcsb
source organism Escherichia coli
total genus 82
structure length 243
sequence length 249
ec nomenclature
pdb deposition date 2012-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13847 Methyltransf_31 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4htfA00
4E2XA 5GM1A 2IDJA 3A7DA 1SQGA 1XDUA 3P2IA 5T67A 3P71T 3HVHA 5B1SA 3UJDA 1JQEA 4M37A 1X1BA 3BWMA 5C9ZA 2Z6UA 4BY9E 2XYQA 4KDRA 3A27A 3BUSA 2IBTA 4RTPA 3NWBA 3TM5A 1KYZA 4E2WA 1QAOA 2DPMA 5K01A 3PT9A 3AXTA 3BZBA 4DMGA 5LQAA 2O05A 3GU3A 2PLWA 1R00A 1KHHA 2JH8A 2PX2A 3MTIA 2NXJA 1X1DA 5DT2A 3FRHA 4QTUB 1M6YA 3RIEA 4XUDA 1D2HA 3OPNA 3EMBA 1AV6A 4A6DA 4AX8A 4AZVA 1N7JA 3GRVA 3M6VA 2CL5A 2ZTHA 3P2KA 3HVKA 4MIKA 3ID6C 5IH3A 1YB2A 2P1DA 1AF7A 3LBFA 3NVMB 4QPNA 4LG1A 5E1BA 2NYUA 3PX2A 2YVLA 5DX1A 3SSNA 1EIZA 5K8VA 5P8WA 3SSMA 3LL7A 2QM3A 1R74A 2CMHA 2ZZMA 2GH1A 2PX5A 4O29A 1N7IA 1RJEA 5EVJA 3KQVA 3JWIA 3EEYA 5DRTA 5ICEA 5EEHA 4P7FA 5FWDA 3TR6A 1X1AA 4PGHA 2P3OA 3FTCA 1VL5A 3EMDA 3PX3A 4C04A 1NW7A 4E70A 3O4FA 5KYGA 2H1RA 1OR8A 4E32A 5K09A 2C7PA 3V97A 5LR6A 3FPGA 2GA9A 2IH5A 5K0EA 3KQTA 4GQBA 4BP1A 3GXOA 5FQOA 1WS6A 4F84A 4PYLA 4QQKA 3EVFA 4ER5A 3UWPA 3GCZA 3FUUA 3P2EA 4EMSA 2XBMA 4E33A 3FYCA 5KQSA 5EHGA 3KR2A 1YFJA 1IY9A 2G71A 2G70A 3BGVA 5JUWA 4C07A 2ZZKA 3EVBA 5CCBA 9MHTA 3GRZA 3T7TA 1QZZA 4GC9A 1G8AA 3MB5A 1L3CA 3OU6A 4Y2HA 4WVLA 3DH0A 3R9XB 5K03A 3CC8A 3HCBA 3ORHA 5K0BA 3OZTA 1NBHA 4QVGA 3SGLA 1FJXA 3PVCA 4YUYA 2PXXA 3I58A 1NW8A 5LQCA 1KR5A 2I62A 3M6XA 3QOXA 4HGZA 1RJDA 4RTMA 5EPEA 3DR5A 2O0LA 1MJFA 3LDGA 3MGGA 2PT9A 1EAMA 1G60A 3G2PA 3I9FA 1XCLA 1YUBA 3C0KA 4OA8A 4RVGA 3TQSA 5D1HA 2HMYB 4EVIA 3EGEA 1HNNA 3P9IA 5D1NA 2GB4A 3DXYA 3ELYA 2PT6A 3C3PA 4AZTA 3LDUA 2ERCA 3HTXA 1D2GA 3CVOA 4FS8A 4KDCA 2H00A 3CJRA 4Z2YA 4DCGA 1T43A 3TM4A 5GIPE 4HSGA 3MQ2A 3LBYA 4C06A 2QRVB 2OY0A 2VS1A 3MAGA 1TPYA 4X1OA 3LCUA 1YZHA 2JHAA 4B17A 1YFLA 2OXTA 3PS9A 1IXKA 4ATNA 2YR0A 5DM0A 3PB3A 1WXWA 4IV8A 2IP2A 3UJBA 1XCJA 2AZTA 4M38A 1YF3A 3MCTA 4PIMA 1TW2A 2FK8A 5FCDA 3S68A 3BWYA 2G8NA 3AY0A 4PGGA 3GIWA 3T0IA 3FPJA 3CJQA 2R3SA 1AQJA 3G8BA 2BH2A 2AR0A 3LX6A 4DM3A 5CVJA 4E31A 3GDHA 2EJTA 3IYLW 4FR0A 4AUKA 5EOVA 2VDWA 5K05A 1V39A 1JR4A 4GEKA 3DUWA 5E2BA 2BR3A 5FWAA 5DSXA 3G7UA 4DQ0A 3SR4A 1VPTA 5LQJA 5E8JA 1JQDA 4P7GA 1O54A 5EZQA 2P35A 1EQAA 4PCLA 1UFKA 1SG9A 4C05A 3Q7EA 4PIPA 1FPQA 2CKDA 5DRYA 4GOLD 3I5UA 3LCVB 2ZBQA 3K6RA 3MTEA 3NW9A 4BLVA 4C4AA 4GOND 5KQRA 4OBXA 4PYQA 1PRYA 3P97A 1FBNA 1SKMA 3PFGA 3HA7A 5GIOE 3R0QA 2P7HA 2NP6A 1WG8A 3TOSA 1Q0SA 4QPPA 4FSXA 3BWBA 4CTJA 1H1DA 2ZBPA 3KPVA 1ZGAA 1EG2A 2IDKA 4NECA 3K0BA 2OB1A 1R18A 4LWOA 4X41A 2XYRA 4KWCA 3PFHA 3FUTA 4E30A 1QYRA 2N47A 3OU7A 1P1CA 3G2OA 3OFJA 5HILA 5LQUA 3KPYA 3ANXA 1NW6A 2HV9A 5FADA 2PSSA 2PX8A 2P41A 2WA1A 4HG2A 3AJDA 4OBWA 1XDZA 4FSDA 4PYOA 4QDKA 4R8SA 5EIWA 4E2ZA 4GOOD 1VBFA 5LQRA 5GP1A 5IKMA 3BKXA 4OQEA 3UA3A 3M70A 5DWQA 1RI4A 2HWKA 3B5IA 5EC8A 2ZIFA 2NXNA 2ZLBA 3HVIA 5EMMA 1X19A 5EMKA 4RX1A 3FPEA 3KQOA 3DTNA 4QQNA 3DXXA 4RTKA 3CJTA 2FHPA 1BKYA 1SVUA 4KW7A 1M0EA 2QRVA 2Y1WA 3IHTA 2JHCA 3G8AA 2VP3A 3DMHA 5ERGB 1JG3A 3UFBA 3VYWA 5GINE 2AOVA 1EJ6A 2EFJA 1VQ1A 3BGIA 4IKPA 2FPOA 3NVKI 2AN3A 4AZWA 1L3IA 4CTKA 3OCJA 4YV1A 4QVKA 4DKJA 4E2YA 3GRRA 3KPJA 4MHTA 3GNLA 3SMQA 4PONA 2NP7A 1O9HA 1ZQ9A 2QE6A 3HEMA 3KQYA 1QANA 5DTQA 3ER8A 3R6TA 1Q0TA 3EGVA 3FYDA 2VDUE 3I53A 1I9GA 3VSEA 2ADMA 5EKUA 5FUBA 5DM1A 4RVFA 5C0OE 5CIYA 3ME5A 3A7EA 3OE5A 1KXZA 4L7VA 4JXJA 4RTQA 4PWYA 3LCCA 4M36A 4X63A 5DM4A 2Z6AA 1QAMA 5DPMA 3U81A 4R6WA 5DXAA 3DOUA 2UYCA 1VP9A 2V74B 1D2CA 2P40A 3KR1A 3SX0A 2AOUB 5CUQA 1VLMA 3UA4A 3VC2A 1NV8A 2WA2A 3LDFA 3M4XA 4RTNA 3SXJA 4GUAA 4FGZA 5E9JA 4R8RA 3A26A 3B3JA 3ELWA 3NMUF 4YMGA 1JG4A 3KQQA 1Z3CA 4MTLA 2NXCA 5C1IA 1KYWA 2P7IA 2PY6A 2ZW9A 3UJ8A 1F38A 3ER9A 1FP2A 2PV0A 3P9NA 4P7JA 5FULA 4CKCA 5HIKA 2PXAA 4UOEA 4OQDA 2XVAA 4HTFB 2Z6QA 3H2BA 2HTEA 4HGYA 2O07A 3M6UA 4RTOA 3E23A 4PYIA 1SQFA 1ZKDA 4RTSA 3KHKA 3TMAA 4DZRA 2BZGA 5DTRA 3UJCA 5LQKA 3P9CA 5K0CA 4POOA 5CVDA 3R24A 3E7PA 3FUXA 2AN5A 1SUIA 4HC4A 3ERCA 5ICFA 3X0DA 2KW5A 2P3QA 3FUWA 3DULA 4EQZA 2ESRA 3HA3A 2NNWB 4F86A 1WXXA 4ER0A 5HOQA 3OFKA 4PINA 2AS0A 2WK1A 1BHJA 2GPYA 2YXLA 3F4KA 4KVZA 3HM2A 4FP9A 1BC5A 1VIDA 4RWZA 1JQ3A 4V0RA 3DLIA 2B2CA 3HCEA 5F2OA 4PNEA 2ZIEA 1NV9A 4HRAA 4KIFA 4ER3A 4MQ4A 5DXJA 2AOWA 4RSRA 3ELDA 3IEIA 2G1PA 2AN4A 2PBFA 5F2KA 3GRUA 2ZIGA 5EGSA 1XVAA 3WSTA 3B3FA 4DF3A 5HIMA 5JR3A 4LECA 4FT2A 2PJDA 4HH4A 3CBGA 4X61A 5HEKA 1RI5A 3LPMA 4M7RA 2UYQA 2DULA 3AWIA 1XJ5A 3HVJA 2EG5A 3HP7A 2AVNA 1YZ3A 3LKDA 4R05A 4GOMD 3V8VA 1QAQA 5EMLA 5LSAA 1KP9A 4PCAA 3SSOA 3UBTA 4IV0A 2A14A 5CVEA 2QYOA 2PWPA 2FRXA 2OPBA 3VC1A 2ZVJA 3A4TA 3E8SA 4K6MA 2AOUA 2EJUA 1VE3A 3KQMA 4RV9A 4YV0A 3DMFA 5HIIA 5FA5A 1KPHA 4DCMA 3BT7A 2IGTA 3T7SA 4RYLA 2YUIA 4FZVA 3MERA 2FCAA 5EEGA 3KPWA 2XVMA 3FPFA 5E2AA 5G02A 4MWZA 4KIGA 3KU1A 1ZHFA 2YTZA 4HTFA 2NXEA 2ORED 1X1CA 3BKWA 4U7TB 5EG5A 2R6ZA 1NE2A 3G5LA 5EKXA 3HNRA 5HIJA 2QY6A 1R8XA 2B9EA 2ZULA 5EZSA 3TPZA 5CCXA 2ZBRA 4PYKA 4ISCA 2IH2A 3GRYA 1KPGA 1PJZA 2YQZA 3LSTA 5H02A 4C03A 4PYJA 2IFTA 10MHA 2ONYA 4RVHA 2YXEA 4A6EA 3C6MA 1XDSA 3MHTA 2ZZNA 3I64A 1P39A 3ELUA 3OZRA 4PYMA 1I4WA 3GO4A 3DMGA 2OZVA 3B89A 3G2QA 4EKIA 5FA8A 1KPIA 2B78A 2YXDA 3KQSA 4V0QA 5K0NA 3CKKA 2V7EA 5CD1A 3THSA 1UIRA 1B42A 1SUSA 2CWWA 5ICGA 3TFWA 1R8YA 1M6EX 1MHTA 4P58A 4YMHA 3FUVA 3QOWA 4FT4A 4P7KA 2BM8A 2OKCA 1IM8A 4X60A 5BP7A 4ER7A 3O7WA 2ZFUA 1DCTA 3HCAA 8MHTA 1EJ0A 3C3YA 3C6KA 3G89A 3EEOA 5E9QA 2OYRA 1P91A 3QV2A 3NJRA 3M6WA 4EKGA 4OX9Y 3FZGA 2GLUA 1JTFA 1U2ZA 1INLA 5U4XA 2GS9A 1L1EA 5CM2Z 3EVDA 5EHIA 4DA4A 5GOZA 5EQJB 3UJ9A 1G8SA 3KQWA 3HCDA 4CKEA 2JG3A 4U7PB 3KKZA 2P3LA 3JWGA 3KR0A 3MCZA 4GF5A 1JG1A 1NBIA 2P8JA 4PYNA 2C7QA 4C08A 5E1DA 3DXZA 2BR5A 3BGDA 3O31A 5F2NA 1ORIA 2F8LA 3B7PA 3BXOA 4GBED 2UYHA 1R6AA 2VZ9A 3NDIA 4QTTB 5DM2A 2HR1A 3L8DA 4WXHA 3GJYA 1DUSA 1RI3A 5BXYA 3SM3A 4BLWA 1XTPA 2CMGA 4IWNA 1HMYA 5HZMA 3LECA 1JSXA 1N2XA 2BR4A 3AXSA 1NKVA 2FYTA 2BM9A 3B3GA 3EVEA 3FPHA 5MHTA 1ZGJA 3P9KA 3FTFA 5GM2A 5FHRA 2FK7A 2O06A 2OO3A 4RVDA 4YUXA 2LD4A 3CCFA 1RI1A 2EX4A 2PVCA 4CXMA 1UWVA 1G38A 2PXCA 3JWJA 5E1OA 1BOOA 4YV2A 3T7RA 3FTEA 2ZSUA 2Y1XA 3E05A 3EGIA 4LWPA 2IBSA 1NW3A 2PX4A 3LHDA 2JHPA 1KIAA 2AOTB 4KRGA 4ZTBA 3G2MA 3RW9A 5DSTA 3CGGA 3UJ6A 2PKWA 2PGXA 2Q41A 3PLAE 5E8RA 2PWYA 2K4MA 5EMJA 1FP1D 3OU2A 2OB2A 1NT2A 3DLCA 3EVCA 4RTJA 2C7RA 5K0GA 2G72A 2E5WA 1JG2A 2I7CA 2I6GA 3LKZA 4CKBA 4F85A 1ORHA 3KQPA 2YX1A 5ICCA 3GGDA 5GWXA 5FHQA 1I1NA 5E9WA 5DX8A 2JJQA 3A25A 1ZG3A 1RJGA 2XYVA 4OA5A 3EVAA 3PTAA 2ONZA 3OZSA 3SVZA 4YUZA 4H0NA 3REOA 5T64A 3Q87B 3GWZA 4AZSA 4RTLA 1G6Q1 1TW3A 2H11A 1DL5A 3HCFA 4EK9A 4ER6A 5KVAA 4BLUA 1XXLA 3HCCA 3EVZA 4R6XA 3LGAA 5CVUA 4BP3A 1WY7A 3EPPA 2O57A 3OE4A 3R3HA 3P8ZA 2IIPA 5K0JA 5FQNA 4QDJA 3FTDA 3KPUA 3M33A 5K0FA 1P1BA 4XUEA 5HFJA 3THRA 2C7OA 5KS2A 2IH4A 2UYOA 2ZWVA 2B25A 3FRIA 1Y8CA 3NTVA 3BWCA 1WZNA 5CVVA 1G55A 3TLJA 1L3BA 1F3LA 1O9GA 2UZ4A 2HNKA 5BW4A 5T6BA 5DLYA 1RJFA 2GAFA 3DP7A 1RI2A 2JH9A 2OBFA 4G56A 2VDVE 5K0LA 5LQNA 5DTMA 2ZCJA 3EVGA 3TRKA 2ZWAA 4XCXA 3JWHA 3IV6A 3NWEA 4YUVA 5DX0A 1JTEA 1VP3A 3UJAA 3UJ7A 2I9KA 4XUCA 3G88A 5M5BA 2IPXA 5BW5A 5E1MA 2AOTA 4GC5A 3KR9A 5EIFA 5FTWA 3RODA 3TKYA 2AOXA 2AVDA 4Y30A 3HA5A 2B3TA 3UZUA 3TKAA 4YUWA 3G5TA 4RTRA 1AQIA 3D2LA 1L9KA 7MHTA 3NDJA 4CWAA 1NW5A 1JSZA
chains in the Genus database with same CATH superfamily
1TJPB 5AW6A 1I5OA 3E84A 1PNTA 1QSGA 2MTBA 4KTTE 4EJ2A 3A7DA 3K09A 5T67A 1E2IA 4MB6A 3EX7C 4HS9A 5BW6B 1JR2A 3VSBA 1C3EA 2DY1A 3U7HB 2ZWPA 4H3KB 1QUFA 3PQ2A 4B2PA 3HFJA 2MCFA 3V8EA 5I01A 3TRIA 4Q7KA 1RU3A 3Q9LA 4DVGA 2I22A 4U02A 1U7XA 4K7JA 4FEYA 3LRTA 3RSCA 5JJ5A 3FTPA 2G36A 3D6HA 5EMHA 1ZL2A 1WCWA 2ZBVA 3SD7A 2K5UA 1GA4A 1N2CA 1DMRA 1L9XA 3P9ZA 4KPUA 4M6WA 4L9SA 4TUYF 2D2EA 4Z7JA 5KNLA 3AR5A 1AV6A 2GEJA 5DHTA 1RYEA 1DGQA 4MI3A 2BN4A 2V1UA 2I4NA 5AKLA 5E6SB 1YB2A 3SEFA 4JBLA 2GZ2A 3S5JA 1PJ3A 2DUNA 1U8UA 4KBYA 3QKIA 3A28A 2QA5A 4RE6A 2FV8A 3HN7A 4O29A 1L5KA 1BWSA 1ZC3A 1E99A 2F1HA 3KQVA 2GZHA 4ZOEA 3EEIA 1DRWA 4R1QA 3ADKA 4GI1A 4CN9A 1V7CA 4A8TA 4DS3A 4ZN6A 1ZI8A 1N7HA 3GGCA 4ASUA 3MAJA 2HO4A 3VDQA 4EHNA 2QS9A 5JHGB 5JAUA 1UXGA 2IZ5A 2RFLA 1T4DA 2H1RA 2PZAA 3CX8A 3OICA 4E32A 2HDNB 3V97A 2HL6A 3B2NA 3BIJA 3FNFA 1D0VA 2Q3EA 2OAQ1 5K20A 2DXIA 2XKBA 4RHYA 3GLHE 4I1YA 3UWPA 2YOGA 1Z83A 3GPDG 3OQIB 3ZV6A 4F2DA 5SY4A 5ESWA 5BV0A 1A0OA 2EBFX 3CEHA 2IODA 4BWGA 2DFVA 2RBGA 4UNNA 1WJGA 2HMTA 4ZVQA 1TQDA 1Z7WA 3U1TA 3MB5A 1C9KA 2QDXA 3A1FA 3C7AA 3DVAB 3GJSA 2D7JA 1KFJB 1EMDA 1FRVA 2R6JA 1KSFX 3ADDA 1HV8A 4PSDA 2QVBA 1S2OA 3D8UA 3E4DA 2DCUA 2QF7A 3C6XA 2WZDA 3ZWXA 2H1OA 5EGNA 5H83A 3K6SA 1CZHA 2H4XA 2APJA 4QHTA 2W2LA 1TEXA 3LU1A 3ZKAA 1RJDA 1FNMA 2GERA 4NV0A 2VJAA 1P60A 3B51X 4OMCA 4M0FA 1SOMA 3CE9A 4Y18A 3TEJA 1O97D 5JDIC 1B6RA 1TPZA 1UUFA 4J49A 1QF6A 1YVDA 1U31A 2XRZA 3DWFA 4OGLA 4DOMA 2WLTA 3Q3HA 3SY8A 2DVMA 5E6UB 1CVRA 3E1SA 3CZ9A 4X8LA 4Y0AA 3CXRA 1A2OA 3D4OA 4ZCSA 2BFNA 2QUIA 2QRKA 4B17A 3T15A 2HZ7A 4ZQCB 4DCTA 2Z2KA 3EXG2 5BVGA 2ZRJA 4RF3A 2YR0A 4B9AA 1ZX1A 2R5FA 3PB3A 3PXAA 4MGEA 4ND8A 1ZH6A 3NH6A 3UPDA 5A5FA 4XPIA 4DR7B 1TM7E 3KYCA 3UANA 4CDMA 2GKSA 1BN7A 3VR3A 2ZRLA 1VKNA 3IDZA 4NAVA 4HMOA 2LCIA 4W6ZA 4DLBA 4B33A 4RIGA 3OZWA 4M0KA 4BDTA 4AUKA 5EOVA 1NX6A 2REBA 1TOAA 3FB1A 2AD5A 4Q9HA 1ORDA 4HH3C 2P6OA 2DFNA 5AD1A 3PEYA 2REXB 5KHOC 2WSMA 3ADOA 1LQ2A 3FDZA 4HTAA 1Z2CA 2VDRB 4IGKA 5EZQA 4EWLA 1ESCA 1T0IA 2C8KA 3NALA 2CKDA 5JW6A 4X93A 5TS2A 1CQIB 3CCCA 3MMSA 4LNUA 3GVHA 4OHZA 5JO9A 2BGWA 5DTJA 4EZIA 2WHQA 2RGNC 1NYRA 1Q50A 2CVZA 2QQ5A 1OH8A 5DCLA 4TL9A 4UVGA 4U0KA 3TNDA 3KPVA 5BWNA 1Y7LA 2G9VA 4PLYA 5EY5B 1JZTA 3MILA 4DL9A 3R9XA 4KWCA 1BE6A 2ZRFA 4HDNB 2P5TB 2CXHA 2TYSB 2XB6A 4LXQA 5ARCA 1FSSA 1IHOA 1NJFA 1P1CA 5I5GA 4DPKA 3ODGA 4GR4A 3KNZA 4MQ6A 3KLOA 4E03A 1PFWA 3NEJA 1K9VF 3UHPA 4DRZA 2WA1A 3IP1A 1GQYA 1HFWA 2IHKA 4R8SA 1SUPA 4V0LA 4WW0A 5A6SB 3ZQJA 4AMUA 4E2ZA 4LC1A 2QI9F 3NS7A 4M83A 3BXZA 2G07A 3H6HA 1JA1A 1H6DA 4IOLA 5F52A 4ZDJA 5AW0A 2WUWE 1UEXC 2GF0A 3ZWBA 2QJRA 3N2KB 4G4JA 4LCEA 2KSQA 5AW8A 4BMNA 4DM4A 3HPQA 3H1FA 3K0AA 4DDTA 2AGVA 1VLLA 3PFIA 1UMCA 4MO9A 4CQMA 1PIWA 2B2NA 4PWZA 4X97A 3CVVA 1UWCA 4ARAA 2EFYA 1RQLA 3ZHBA 4ZTUB 3O84A 1WPRA 2OGWA 2ZRGA 4MCHA 3EASA 3NHZA 4IOKA 1U8XX 4U7HA 4N49A 1RAFA 4TUYB 4LX0A 4D80A 3SS8A 4O4HF 3S81A 3HK2A 1O9HA 1QANA 2WIAA 3A10A 4XIJA 4NOMA 2UXBB 4GI2A 4Z4IA 4KXFB 1HTBA 4UAUA 5T41A 3OPMA 3GJQA 3TB6A 3WOHA 1AQUA 1NPDA 2LIPA 3V3TA 4A0RA 3VISA 1ZXLA 2D0DA 1PW5A 2Q50A 1BGVA 4L0CA 4ZQFA 3L0PA 3NOQA 3U7EB 1V41E 5LYJF 3DAPA 4R7TA 4R9VA 1XPJA 5ALGA 1Q0UA 1ZOLA 3M1IA 1VP9A 5CGZA 4D45A 1CKEA 3KR1A 3QVSA 5BWMA 1NI5A 4IRUB 1BMFA 4IGIA 4RTNA 2HCFA 1P6XA 4FGZA 1ECGA 4W63A 4F3NA 1TLLA 1A8SA 3NMUF 4AJ4A 5U9CA 4LS3A 4XM1A 2C88A 4QUKA 1RM0A 4GPD1 1MTZA 3AEYA 5K0TA 4GPBA 4FDUA 1AQLA 4Z4FA 2EKBA 2AK3A 2FSVC 4YREA 4N8SA 1CRPA 3MJVA 3WVNA 3WGGA 3PXBA 2Z6QA 4C6RA 1UR5A 4HGYA 5CK4A 4I4TB 1OPRA 3UAWA 2ZM6B 1DEOA 2Q4BA 3ICCA 2BEUB 3T4UA 3IQXA 4K6HA 3P2JA 2PRSA 3GFQA 3JQQA 1V35A 4IZHA 4XIYA 1J24A 1OIWA 5KWIA 4ZAZA 1DJNA 5AXAA 3IR5A 4NU6A 1ULSA 3FUWA 4POAA 3QG1A 5CGQB 3A1VA 2WDZA 3UT5B 3IXLA 2O8BA 1J0DA 4HAZA 2BRUA 2H0AA 1BC5A 1QTNA 3WYEA 3QFHA 3AR6A 3DBIA 1DLJA 3DKIA 5KSPA 2FA9A 3M5WA 2BDUA 4QOHA 4HNVA 2CZQA 4BHTA 4Y2QA 4G5SA 4IQ4A 3V48A 4OQYA 1BU5A 1K7EB 1HBJA 4RNCA 5F2EA 4FT2A 1NXXA 3KXKA 2OECA 2WTAA 4KAJA 1BDMA 1P1IA 1QIFA 4EEXA 1XIVA 2VBGA 3FVWA 3AWIA 3QBDA 4EG4A 4DCVA 1UFOA 2C2YA 3NCHA 3O90A 3SEAA 4AWXA 2ZIVB 3VPHA 1I6MA 1UDRA 3G0OA 4IIXA 1OFVA 3RROA 1K3FA 4RLQA 3T3NA 1MW8X 1UXOA 2LBPA 3L49A 2QIOA 3QLVA 3SPXA 4Z3DA 2R0QC 1SK8A 4LRUA 1MA0A 3C3WA 4DLWA 3UBTA 4CFYA 1FDRA 1PT6A 3EZ7A 3OEEA 4FMDF 4ARCA 3SICE 1MC4A 3C5EA 4R01A 5EAIA 2FW8A 1WU8A 1Y9DA 4UCXA 5HIIA 4RJJA 2CVQA 3N87A 1DC7A 2NTYC 4Q4DA 5FA5A 4UHCA 1HMPA 2IYAA 1JR3D 1RZ3A 2Q5EA 4R31A 4N41A 3NYQA 4UHDA 3BVPA 1B93A 3N2GB 1AKTA 4DSNA 4YJ3A 2Q3BA 2I2CA 2P9QA 4XJVA 5J4KA 1GPMA 2A33A 1MOQA 4X24A 4H3VA 2ZROA 4Q7QA 3ZWKA 1OSNA 2X13A 5HGXA 4FJ2A 4ZVUA 3CM0A 1ESEA 4GW3A 3GLTA 1Q21A 1GZSA 2ZULA 2XNJA 2AIRA 1L5QA 4JGIA 4PYKA 4L4YA 4I36A 4UUAA 3RRNA 4B71A 4DMRA 3QFRA 2AQHA 4YQFA 1RC8A 2XUZA 3VU3A 2X58A 4XVUA 4UQOA 4XDZA 1ULZA 4WKOA 1J9ZA 3IO3A 3I64A 3LXUX 2C4NA 3ZWDA 5BWOA 1XMPA 2OZVA 6YASA 3LLUA 2ZQYA 2GZSA 3F96A 4NEHB 4PLGA 1GPH1 2ES4A 5CH3A 4C1NA 3BHNA 3BORA 4AIIA 5BY2A 3AEZA 2QZJA 1LCIA 1UIRA 1FRZA 3GFRA 3AKCA 3OX2A 4EJ0A 3KTFA 2VCEA 1A4RA 1YRYE 4YRKA 4D42A 1FTSA 1MHPA 4FT4A 1DC8A 4V24A 3BF7A 3KZNA 5BP7A 5HJ2A 2CVFA 3COSA 5AM1A 3BTUA 5EJEA 1EFTA 1YRHA 2A1IA 2QT9A 2UZ1B 3N2LA 2OCDA 3NTRA 4JQZA 3VNAA 1JILA 1P31A 2AN9A 3EBLA 2H0RA 4IXMA 5TVGA 3G89A 2FQWA 4AMBA 3URMA 3ZDAA 1L7NA 1TVCA 3EQ8A 3HFRA 1ZR2A 1K7XB 2VP9A 1UBKS 1VLVA 4BNXA 2X9GA 4JR2A 4KO3S 3WQRA 4RPKA 1CY1A 3TIVA 2QU7A 3TRHA 4O4HB 1AMOA 3HM9A 3H2YA 1ODKA 3JZFA 2XNHA 3PTZA 3QWHA 5BSWA 4PC7A 2RHDA 4RGYA 5EVCA 3W3AH 3V8QA 3BX1A 3TD6A 5KJ6A 4BEWA 3SBOA 2PLFA 4BNNA 3JQ6A 5E1DA 1PWXA 1TEHA 3B2QA 3K3PA 4LFAB 4M4SA 1BFUA 4NULA 1E1YA 2ZIUB 1Q3TA 1EESA 1J5PA 3PLRA 1IZZA 2FW6A 4FMCF 4ZDWA 3TZLA 5LYJB 5KTRA 2R8YA 3LUGA 4KQIA 1AY0A 4B74A 3HHPA 4WADA 3D54D 5A0FA 5KPJA 3V8BA 1AGPA 5LBIA 1FYEA 1WW2A 1XEAA 2G76A 1I0ZA 2BMJA 4MYDA 1AKMA 1WXGA 1AUVA 4IYJA 1ZGJA 4PANA 2WU4A 3HYCA 2I66A 5GM2A 4QICA 1JDPA 3I2FA 2QZ4A 2LD4A 4GKVA 1LNQA 2I1QA 2PVCA 4FDVA 3TLGB 5F5LA 3WA6A 4BGEA 1R2QA 4F2PA 2XBLA 2GFHA 3O2SB 4PPQA 2VF4X 4J91A 4HLNA 4DXHA 3OT4A 3UIEA 3JASB 4FYJA 4TYPA 1GQOA 3RW9A 3LY8A 1GG8A 1HLGA 1NLUA 2PKWA 2X2PA 2ZRDA 4NU5A 4ZO6A 1FFXA 2JAPA 1ECPA 1KEZA 1T6BY 4WEQA 4DR6B 4EARA 5CDYA 4R8KA 2XCQA 2E5WA 1JG2A 2FFJA 3BXFA 3IPXA 3JRNA 3KQPA 3MHPA 4LCJA 4NAUA 3M89A 4Q3DA 3WO1A 4ZCRA 4FGJA 1POXA 5IWAB 1JEEA 4BNJA 1XWWA 3PU6A 5B6IA 4M2LA 2B83A 1P80A 2ZVPX 3E35A 2F8SA 4IO0A 3SVZA 1KEPA 4CG1A 2EGGA 3K5HA 2IXTA 1ZIPA 1P2VA 2FPPB 1Z15A 2FJPA 2ZBEA 1NMSA 2C82A 2NG1A 3GVIA 3K31A 2O6HA 5KQLA 2EW8A 1JQJC 4PZ9A 4LAFA 4PM4A 1KEEB 1YVUA 4ARZA 4LF6B 1TQHA 3QJGA 2D59A 2H7VA 4OMDA 1EWKA 1QFYA 3WK4A 4BC1A 1XALA 3CRW1 4OHMA 1EA5A 5CMLA 2DM6A 4D74A 1LVUA 1AM4D 2E82A 4EB6A 2H1HA 1HQDA 2OXEA 4E5KA 3THRA 3L9XA 1DDOA 2Q5JA 3B8EA 3IOYA 4WV3A 5F4BA 5JTUA 3OZVA 1MD9A 1Q7CA 2FPIA 2M6SA 5CVVA 1Q0LA 1Y1LA 1YDHA 4FMDB 4IFIA 3RRFA 1WKVA 1XF1A 2XZPA 2ZB7A 4YP5A 4RZSA 4NYIQ 2I6QA 2HIHA 5CLGA 1VGVA 3DUFA 1DBQA 4O4IA 4QOSA 4W7HA 4LMBA 2R1TA 4N03A 2HA4A 4YMUA 5A4DA 3BXHA 2HGZA 3VSAA 3KQLA 1FTNA 1WMBA 4QQFA 4QFCA 3VU9B 2MYNA 3SXPA 1DSSG 3SS7X 4TWRA 4CN8A 5BVHA 2HWYA 5AVTA 1R66A 4CYMA 1DV1A 1YZGA 2I9KA 4BU0A 5BMVF 3EGWA 3PQ8A 2E1RA 4J9VA 5E1MA 5BW5A 1P9WA 2DBZA 3RODA 1IMJA 2PVPA 3QEMB 2OXIA 4D9KA 4JBYA 4LSMA 1C3OA 4PC2A 4PV7A 4H1VA 4QAQA 4E5VA 3DEFA 2D54A 2G4LA 3W3AA 5A3JA 1W6UA 1SY7A 2WUDA 4FOLA 4GYWA 3EPRA 1QCYA 5HK9A 4E2XA 5CDUA 4EB3A 3LP6A 2BDTA 2IDJA 1XHFA 2H2IA 3E15A 4QFMA 3PIDA 4ZPJA 4KFCA 1VJCA 1HZZC 1X1BA 2Y9MB 3BWMA 4PLWA 1JAIA 1O96B 1Q3KA 1YL7A 5ELXA 3W7AA 2WQZA 5ESXA 2YINC 4RJKA 5IVKA 2YVUA 1T35A 1FJ2A 4TV8F 4D7AA 2PZFA 3AXTA 3H9GA 1CD5A 1D1SA 4MPJA 5AP9A 1Z2AA 2QTFA 3VPCA 3ZW7A 3AHHA 2EJWA 2JH8A 5KYKA 5LD2B 4A6PA 2H6EA 2QUZA 3NM6B 1UEIA 4GM1A 5G3YA 5TVKA 3RS0A 4BE9A 1P0PA 3HVKA 4MI1A 3UXMA 1L7DA 3NYWA 5FEMA 2WJIA 3QE0A 3PX2A 3IBGA 2IPLA 5DSZA 2QM3A 1JKJA 3WTCA 3H19A 1YSCA 2VDLB 4KXYA 4PLFA 4BFYA 3L9WA 4Y9SA 3NI2A 2OCKA 1JIIA 3SYLA 3EEYA 1P4JA 1QGZA 3I34X 1QR2A 5EEHA 5AKHA 4S12A 5I51A 3TR6A 2NVUA 1THTA 2W2OA 4QATA 1NBWB 3LO8A 5JD3A 3U37A 2ODEA 3BIFA 4MRVA 2H54A 3DQZA 4OIMA 4U2KA 4E70A 1OR8A 3PQ3A 1EDBA 3W1WA 4FNOA 1Y6QA 2NX2A 2XYGA 3QPAA 3R41A 4EF4A 3FYHA 3PD1A 5K6AC 4LRTB 4P82A 1A5ZA 2Q2NA 4MQMA 1EM8B 4W5OA 3FUUA 2ICAA 2J5KA 2O3QA 3GPCA 3BRQA 1UKAA 2PKEA 2ZI3A 3AHIA 1SXJC 1JHDA 4U39A 1WVIA 3AKZA 2QVLA 3JQBA 5JXWA 1QRDA 1E5XA 4ZRMA 1Y9EA 2NUPB 3FSGA 3GD5A 1DKUA 1NFFA 3EAQA 3RSHA 3MOSA 3HV0A 4BO4A 4CT0A 4OSPA 3SFZA 3NDBB 2ANCA 1PBNA 1S3GA 3I6QA 4KTVE 4KGVA 4Y9UA 1U8AA 2H06A 3QVUA 1PS8A 3PZRA 3RIHA 3W4KA 4DFDA 5IC4A 5DHQA 2GAJA 4GE0A 2GXAA 4IEEA 3AHEA 1J70A 3RRMA 2XNSA 3NFYA 2C78A 2FDXA 1U0LA 4RD2A 3PUVA 1KZGB 1U1DA 1ZSNA 2R1VB 1ZHHA 1ZK4A 2BZSA 4KQKA 3EPHA 4Q48A 4KKXB 4LE0A 4OJMX 5CB8A 3EGEA 3M5DA 1X7XA 2I3DA 5KOHB 3N2NA 1MAHA 2XA9A 1RKQA 2VEOA 3HCWA 4AJHA 4DGSA 3D4LA 3CX7A 3DOHA 2BEJA 3OEWA 4FR5A 4TKUA 1JA9A 1XMVA 3DBOB 4WCFA 4Z1MA 4DRXB 5AXCA 3LUAA 1BH2A 1RNLA 5AUNB 2I7DA 4BVFA 3WRXA 2BGRA 2Q2WA 1ZUIA 4WXPA 3FNEA 2LXNA 5FEUA 4QQ8A 2HB6A 3AY0A 2Z9CA 3VPFA 2TMYA 1TD1A 3CJQA 4MARA 1Y8AA 2VXYA 3JQFC 3K70C 3TZQA 3GDHA 4ODIA 3IYLW 1RWBA 2QMQA 3K9CA 3GR6A 2OENG 4GOJA 4PLCA 1Y82A 3L93A 5FL7A 5GMOA 2J41A 3WL6A 4AG5A 4FEEA 2VF2A 4M8NE 3G7UA 4E5UA 4BQPA 3UHAA 4ZMBA 5CFRA 2BJWA 2ZYHA 4KRXA 4C05A 4FX2A 3O2JA 2UVPB 2RJOA 4K1LA 4AROA 1QOZA 1L5NA 2OTCA 1NRJB 3K96A 5IDQA 4A23A 3PFGA 2JATA 3TOZA 3SMVA 2W6PA 4C4YA 4RSGA 3DEKA 2PGIA 5A7HA 2XUOA 3VMMA 1F06A 4OQLA 4UTXA 3BWBA 1FFAA 4CIWA 2X76A 2X7JA 5TIIA 1CDOA 2NU9A 4JLMA 3GHHA 4U63A 3K0BA 1E7RA 5BMVB 1CR0A 5TXGA 5FIUA 2OCLA 3AX6A 3NHMA 1M2EA 2OXFA 4NH0A 3FDJA 1AXEA 1YZLA 1ZIXA 2XEXA 1O03A 3KVOA 2GYWA 3DE4X 1QK3A 1KAQA 3KLMX 4DSUA 4Q24A 4OBWA 2C9ZA 4PFSA 1H3FA 1PYGA 1RLJA 2H2FA 2GEKA 2X1LA 2Z56A 3FAKA 3FSEA 4UD6A 5FXMA 2I2DA 3W2IA 4OQEA 4S1VA 1QHXA 4JYBA 1QKIA 5JCJA 2HWKA 4OYLA 4XWWA 2G88A 1YE8A 3GZNA 1U6KA 1DE0A 2IZ7A 2GYUA 2XMQA 2TECE 4QQNA 5GVRA 2CYAA 1LX6A 5AKKA 5F51A 2QLMA 1CS4C 3EEBA 3BWVA 4KQ2A 1VC2A 5BR1A 2F4VB 4O08A 1E3EA 1J07A 1GDHA 1GUDA 4RU1A 3ZJ4A 1GM5A 3QVMA 2FI1A 4TRRA 1R37A 4FEAA 4RM3A 1PR9A 1H5QA 3VH1A 3WNQA 1M2JA 4D9IA 4E2YA 1FZTA 5D3KA 4MHTA 3SQDA 3HKBB 4LY6A 2OWEA 1SMKA 1A88A 4IIYA 5I4KA 3T41A 2XGJA 4E12A 3R76A 1Q0TA 4D4MA 1AO0A 4N3BA 4B4OA 4ILEA 1EB8A 2CXNA 3AUKA 5FUBA 4EF6A 3QMPA 1RDFA 5C0OE 3AMVA 3Q7QA 4F3YA 3NATA 4WK0B 5DM4A 5A05A 3ZH2A 2I4LA 4ZCIA 1E1MA 1IHYA 4Q18A 1UJ6A 4X3CA 3U81A 3ND8A 4O4LB 5IAOA 3KV1A 1GL6A 4BV8A 2J4DA 2Q5FA 2OBYA 5JRZA 3BF8A 1XTVA 4IDPA 2ZSIA 2XMDA 3WADA 2OK8A 2HRQA 5TNXA 4BQOA 2JZOA 3N6XA 3N5CA 5T3YA 1Z3CA 4EH1A 821PA 2Q0XA 2PN1A 2P1RA 1ZJYA 4PTZA 3UMRA 2OLEA 4BQNA 1GZ7A 4C4SA 4ZK6A 2WUEA 5BPHA 4A03A 5JXGA 4IX9A 3I5YA 3NM4A 2AUNA 5BV2P 2WTNA 4DGQA 1Z4JA 4G84A 4LYDA 4UDXX 3D0RA 3DWIA 1AHPA 2H4FA 3KHKA 4TSFD 2J5QA 4XYBA 4FGUA 3TMAA 4FCVA 5HWSA 3P9CA 2J48A 1ICEA 5CA1F 3L4BC 3HDQA 3QX8A 1PD0A 4HC4A 4ALIA 3AJ9A 1XL0A 4LOIA 4Q7LA 2AT1A 3B52X 1NVWQ 1CNFA 1M1NA 1X92A 3DWGA 3G2NA 4Q1CA 1ZYUA 2F59A 4LCBA 2AS0A 4C03A 3CLSD 3LVFO 3RM3A 4TMXA 4B2IA 1Z12A 1YT5A 1FYVA 2ZT7A 4OHPA 4RPCA 3RSZA 4ER3A 4JFRA 3VR5D 1ZL0A 4P4LA 1M5RA 1K27A 2QOEA 1RS0A 1O7JA 4KFUA 2DERA 4ZU1X 3FMOB 1GA1A 1H6CA 3AERA 2RI6A 1F0PA 2Q4TA 4AI6A 1WKBA 5HEKA 2XYPA 3TOVA 1KU0A 2IE0A 5I7UA 4WN9B 2VWPA 1GZ3A 3O8BA 3HSYA 3ENWA 5KNBH 4XGNA 5TGDA 4TX1A 1Y3IA 3LKDA 3M4YA 4MVCA 4B35A 1U7TA 5KSYA 1Q16A 5BUZA 3DVQX 3UH0A 1SD5A 1LI4A 1SOWA 2F1RA 3FNRA 2HT1A 1NWCA 2X0NA 1UM9B 4JS0A 2OO7A 4XZ3A 1M33A 1Z4PX 3ZS9A 5J2UA 1JIKA 2PX6A 4RV9A 4ZEMA 2SKCA 3REQB 5C52B 1C3LA 1KVSA 1MRNA 2ZYSA 2FPKA 3Q3EA 4WXEA 4FX5A 3IKLA 3NORA 3R7FA 1CUAA 2FCAA 2RGBA 3EVNA 3ET4A 1FUUA 2ZCUA 3PNQA 4V0SA 1XHEA 5ALQA 5EHQA 2DKOA 5CIQA 5IN5A 3RWMB 3GEIA 2BM0A 4DLKA 3ZR4B 5LWHA 3K0HA 1NQUA 2ECKA 1CJBA 1T36A 3M6IA 4MAAA 3TW4A 1DWUA 1E3MA 4F4CA 1J2RA 1R8XA 1VYHA 3LC7O 1MEOA 4UE3S 2GDZA 1YMQA 2XH8A 3KT6A 3AVTA 1KPGA 1PJZA 4HP8A 1XZFA 3FOFC 1N2BA 1XYVA 2YXEA 1BW9B 2YH2A 3IKJA 2FWPA 3S8YA 1U28A 1UKYA 2WMYA 4PYMA 4IDAA 4D0SA 3ROQA 2XNDD 4AXXA 4C2TA 2GNOA 3B89A 3IUMA 3LHIA 2HSEA 1XVUA 2MR6A 2ZI4A 1TC1A 4XRRA 1NE7A 1QE5A 1W46A 2RJ3A 4CG3A 2QUKA 4N5DA 3HFGA 2DLNA 2X3YA 4QNRA 4GQIA 4URUR 1B41A 3NM5A 4P58A 4JR0A 1XTZA 4UBOA 4QWWA 4K9SA 1JG6A 1I3CA 1ODTC 2DKFA 3S70A 2QSJA 3NQ41 3ZK8A 4AG6A 1QQAA 3L5OA 4ECAA 2ZUUA 5K3EA 4A73A 1D8AA 1GAJA 4IDGA 4B46A 1Z9BA 1PTJC 1DQRA 2VKTA 3JQRA 1C1DB 3KTDA 4TMKA 3ORRA 4B5KA 4DJFC 3PR3A 2WI8A 1W85A 3PWTA 4KYVA 4LKRA 3F6BX 3LDAA 5CX1B 3FZGA 2GKOA 2ADFA 3PGMA 4FK8A 4QBTA 4FQ5A 3SYMA 3GP8A 2WMOB 3BBPA 2HBYA 3I2KA 2EXXA 4GGOA 1RJ9B 4MUBA 2JZCA 1Y8QB 5EQJB 5CB6A 2P9FA 3L6CA 3KT0A 4MQLA 2QTBA 4YJHB 4HQNA 1BGXT 4GF5A 1MXFA 4C7BA 1RYYA 4D9MA 4JV5B 1C3VA 1P62B 1VJRA 1W4ZA 2PNFA 3MUFA 3O31A 3WDKA 1I7QB 3B7PA 3LQ4A 1TIKA 4X1KB 1R6AA 2VZ9A 3EWIA 3Q2IA 4LDJA 1SHUX 3MMPA 3N76A 4WNIA 3WB0A 4W5NA 2IEAA 1L5HA 4DIMA 4EW1A 1J21A 2I4RA 2GR9A 1LW6E 4UMDA 3VVCA 4C20A 3EG9A 3CX4A 2P8SA 1PR4A 1PJ4A 2OLJA 1TYDE 2WG2A 2ZJ1A 3G0DA 2WAXA 2DECA 1ZN8A 2FYTA 2XOKD 1JL3A 3NC4A 4HEJA 4NJMA 5CH8A 1SEVA 1YQDA 3M2TA 2C5EA 5F78A 1JSRA 1PNQA 2XXJA 1SBYA 4QOEA 5E0OA 4IV5A 4D6PA 4EW6A 2ZBDA 2I6FA 5JCOC 1LSOA 4IHQA 4RFVA 1NZFA 3K71B 1LPAB 1OX4A 3IAFA 2J33A 3K6JA 4RZQA 1T5SA 4B3JA 4C0WA 1KBQA 5TT0A 3VC2A 3ADBA 2AOTB 4DPMA 2X5NA 4FMPA 5DSTA 4EATA 3AINA 3X44A 2ZTVA 4MB2A 2GJSA 3TLEA 1GYQA 4DR1B 4RPJA 5CW1A 4OJNA 5K0GA 4CTMA 3KOZA 4ZVSA 4UVEA 4MKZA 1BVUA 5G1OA 4NNOA 4KSCA 3U17A 4CMHA 3VR2D 4DWVA 2C3MA 1Z45A 2UKDA 4KHPB 3F8TA 1XUOA 4M89A 3RARA 1OU4A 1N1DA 1U3FA 4KO4S 5CU7A 5TJHA 1ZNWA 2Q0SA 5K5EA 3K0FB 3GDGA 2RC5A 4XLZA 4YUZA 1A9XA 3ANYB 3WQHA 1PR3A 3SX2A 3ASVA 1CJMA 2GXQA 2Q1XA 3ICWA 3C7DB 4HB0A 4BNTA 2HMSA 1ZNXA 1PF7E 1RWNA 3EF3A 4YO8A 4EA9A 4BL5A 1Z06A 2H11A 2HFKA 3JQAB 3LUKA 3H5OA 1DKLA 1V25A 1KYTA 3LGAA 4UM9B 3TECE 4G1BA 2FPRA 1WY7A 4XJXA 2O57A 3R3HA 3JR7A 5FP0A 3T1OA 4CMJA 2ZPUA 4I1OA 2IC5A 3OP4A 1F7VA 3A3NA 1QS0B 1QHYA 2R1UA 2AZDA 2WWIA 2AZXA 4EFMA 1Z6TA 1DXQA 2G5PA 2NQ8A 3CT4A 2IH4A 1CWUA 2KMLA 4DIFA 4LGYA 5BORA 2CJPA 5LLTA 5AYVA 3AH8A 2FUG6 1E62A 2G1KA 5FNVF 5G3ZA 1CLUA 1KGDA 1TU3A 1HQYE 2AFIE 2Y66A 4GRDA 4AMGA 2I71A 3QEBZ 2R751 3A2KA 2BKAA 1A50B 1CRZA 3B60A 1R64A 4DMMA 1YCGA 3I2YX 4P0TA 3AEKA 1D8TA 1ZIDA 4WY8A 2W2TA 5LQMA 4PX5A 4GPAA 4HYYA 3NWEA 1T0UA 1TKRA 5IEJA 5HP4A 3F6RA 3IBSA 4Q3CA 4Q9DA 4O5OA 5HF8A 3JYPA 3V1TC 3BRWA 4MAMA 4D8YA 4MVWA 2IPXA 2FMKA 4A8JB 1DAMA 1V16B 4FU0A 3NT2A 2A9QA 1A8IA 2BUAA 4FYYA 1AQIA 4RDIA 2E48A 1VRCA 1CJKC 5FOTA 1QZUA 1FNCA 3OIGA 1UANA 5CDSA 1ZH0A 3F3SA 1BKSB 3I76A 4V02A 5BOSB 3GLFB 1G7CA 4IMRA 4B6GA 3DLAA 4IXWA 4JT4A 2VQ6A 2HRBA 2O4UX 4II7A 4YJGB 5A9SA 4CQNA 4PZEA 1ORRA 4P9NA 4OLAA 1NW4A 4I50F 4JUCA 1NVDA 2QPOA 5BN3B 3TM5A 3UPTA 3RS8A 1BCSA 1QWSA 3LCMA 4OSOA 1NJ1A 2M6LA 4KAFA 2Z95A 3DBRA 5GV7A 2BHLA 4H4EA 4Y2YA 1KMHB 4OU4A 5DULA 3T9EA 4LK3A 4WCVA 5HRAA 3CNHA 5CB4F 1R8JA 2R68A 4QJIA 2EYUA 1CPYA 4XM0A 3DZKA 1E98A 3BL8A 1GTL1 1GUAA 1TL7C 3FYUA 3MTAA 4RCZA 4AY3A 5IMSA 2ONCA 4OHOA 2V7UA 2ZTHA 4YACA 5DCWA 5ILOA 1WM1A 2EG9A 4DJEC 1RZRA 1AF7A 1P0IA 3OE7A 1OH5A 4EM6A 1YS9A 4AJ2A 4TV9F 4RWEA 3ENVA 4Y7CA 4YCNA 4KZKA 3F5QA 5CITA 1JLMA 4PBSA 4HDOB 2BY4A 4IUYA 1DG1G 3W5JA 1YTUA 1TT5A 4Z7OB 4RMJA 4DIKA 2VJMB 4MXDA 2CDCA 5DRTA 1T0BA 4F11A 1LZLA 1WU7A 1X1QA 3DLPX 5LP1A 5FLKA 1QQ6A 1ZLXA 4AUEA 2VPIA 3BJEA 3V4ZA 3WL4A 3R9KA 1Z6QA 1AUQA 3G7NA 4RJ2A 4PQEA 5KX5A 2CUZA 1XP5A 5KIAA 2V8BA 1HURA 2I80A 1ZVKA 3ESCA 3GXOA 4NAHA 1KKLA 2ZSBA 5LIPA 4QT4A 1XKQA 1XDWA 1F4VA 1WLSA 1N3LA 1PP4A 1C9JA 1FFDA 3JVEA 1U0GA 3L79A 3M6FA 5JSUA 2LGJA 4YAOA 5CYPA 3EODA 1WZ2A 4YLGA 3SF8A 3EGXB 4HH0A 3VGPA 3X2FA 1N5RA 1E4VA 4COOA 2BEKA 1MABA 2Z0MA 2A67A 3AEUA 4IGEA 5EINA 1ZCJA 5EYPA 5K3AA 3DYIA 5EZYF 3BGSA 3EC7A 4G4SP 3JQCA 3HCBA 2C8LA 5I5EA 4NTZA 1GT91 3E9DA 5E6RB 6CHYA 2H48A 2PXXA 3R5FA 4JUFA 3ZXXA 5IHXA 4A5SA 4G0NA 2HPZA 1B43A 4M60A 3CVUA 1GZVA 1ZH8A 4NJEA 2OHHA 5A5EA 4JKOA 1U0BB 1UEJA 2PRKA 4FYMA 1GEEA 4WT7A 4D2IA 4O6VA 1FQKA 1MJFA 5KNCD 3GT7A 2Z2XA 3TSYA 1VLQA 3G2PA 4BNIA 4C0JA 4HB2A 121PA 1ZXBA 1N8TA 1ULHA 4UM9D 1XDGA 3ELYA 2PT6A 4B81A 3O38A 3O0DA 2Q3FA 3IP6A 5AJZA 4B82A 4G9EA 4GSLA 2PGDA 4A4DA 1P3Y1 2FZ4A 2Q0QA 1YZFA 1B00A 4L0DA 4YT8A 1V43A 3QBTA 5JFTA 3U16A 2B98A 4HXGA 3PK0A 3OWOA 5DM0A 3UAYA 5DI3B 3ZVLA 3D8BA 1KVRA 2AI1A 3A1WA 3OCXA 3EDYA 5DGXA 4U0JA 4QJ3A 5KVSA 3U60B 4MUJA 4YFVA 4ZQIA 4IPTA 1CVIA 4EGJA 4R1NA 1A76A 3ZGXA 4B84A 4E31A 1CCWA 1QH1B 1QO0D 3VQTA 1T2EA 2H9IA 3L7AA 1XKXA 2WSYB 4HLUA 2R87A 3B82A 1P17A 1N9GB 2BR3A 1RLTA 5FNVB 3WA7A 3NUZA 4JHXA 4JX9A 4KRYA 1EFRD 4ZV9A 3MJHA 1CNMA 2O3RA 2XJ9A 3KKNA 1XK6A 3D3EA 3I9OA 4AICA 5C7YA 2Y3IA 3K1ZA 1DKNA 1BXGB 4J2TA 3V1YA 4GKBA 2BRUC 4LGMA 2P7HA 1PWEA 4W5HA 2CUNA 5JZ9A 5JXIA 1HL7A 1E9BA 3BCSA 1D2EA 2C5FA 3IESA 4FSXA 4N6OA 4BAZA 3E48A 1KI7A 1GY8A 4WE3A 4ZREA 2EP7A 1SHLA 3L4EA 4DC1A 1ZK3A 2MU1A 4BTEA 1DAGA 2C5SA 3JQEA 2NU6B 4Y2RA 3UBMA 3PL1A 3L40A 5DBHX 1F0NA 1NNEA 3I1FA 5FTKA 5JWHA 4BNMA 5JSQA 1HE4A 3RRZA 1DG9A 1WF6A 5AHRA 3IIJA 5AHKA 3IXQA 2YWXA 1AB5A 3DMDA 1J06A 1HKHA 3PTLA 3IKTA 4JI2B 5EWLA 2J4CA 2C2GA 1SZJG 3NHJA 1ISPA 2F6RA 1YU6A 3OPYI 3QLVC 4I1SA 3O1JC 2BTQB 4RD4A 1SVIA 2WVAA 5CNIA 4S05A 4HJRA 1PR6A 4MEBA 3OM8A 1NF2A 1BKYA 3P26A 4GO1A 5KI6A 2YDYA 4EHJA 3KKPA 4Q16A 5ALNA 1EJ6A 2EFJA 3B9QA 2I3ZA 3BGIA 4IKPA 4Q4LA 1UMKA 4XWOA 5L3VA 4B48A 1RHKA 5JAZA 2XUFA 1UPXA 3OG9A 3OTHA 3DC2A 3W8EA 5B3JC 1Y80A 5CB4B 5EJ8A 3G1UA 4MGZR 4ZC8A 1MKYA 2NP7A 1MORA 5DTQA 3A6HA 5CVCA 3KQUA 2PBRA 1DWQA 3I53A 2VDUE 4PFJA 4Q39A 1FFEA 3ANMA 1C3JA 1EVIA 4GP7A 4OB8A 4UHEA 5K45A 4BXOA 4TV9B 1Y37A 2YICA 1I13A 3BB4A 3IVGA 4G8DA 4CM9D 5JS7A 3ZVRA 2L2QA 1GSAA 1P33A 3LCCA 2BP7B 2BZ0A 2RSLA 4GICA 4M36A 3E03A 4U1RA 4X8OA 2RIPA 1R4MB 2Z6AA 3DV0B 1X7YA 3ZI4A 4BWYA 3EWNA 3ETDA 3FD8A 4RUKA 2Q9UA 2UYCA 2V74B 2ODQA 4X20A 5TJ9A 1N7GA 4RZUA 4XI9A 2ZRHA 2B35A 4YRFA 5JG7A 4WZBA 4J6EA 2GJAA 3UV3A 1WNTA 4PG4A 3QI2A 5CT6A 4YMGA 3KQQA 4RFSB 1PGOA 3Q8LA 2IJGX 1Y7TA 5E4TA 3ZTWA 2QD3A 1FP2A 2DSNA 4RQBA 2BTOA 5FULA 5FPKA 1U0RA 1JWLA 5ICMA 4KWHA 3F8SA 1BTOA 1PVDA 3VM6A 2PL3A 4ZHSA 1CF4A 3ZIUA 4NBKA 2X0EA 3TZ6A 2L42A 3M6UA 2JD1A 1JEQB 4DLUA 5ESDA 1XTJA 4IQ0A 4NESA 2WFMA 4DMCA 4E6PA 3OMXA 4OEHA 1SXQA 5EZYB 5FV4A 1SBNE 2JKZA 5DIZA 2A4MA 3EHDA 3IPAA 5GOTA 5H7XA 3W1EA 2DETA 1MFZA 3EFBA 3FUXA 2JARA 3S3TA 2NSHA 2R4QA 1CFZA 4ON9A 2OXCA 3E7DA 4X3OA 3TTSA 3NGLA 4CTNA 4MWEA 4MEJA 2IKSA 2NIPA 4ZRDA 3UG6A 4OQZA 1WXXA 4L8LA 3PDHA 4QHYA 3THSA 1KZ1A 3WYNA 5IXJA 3A9TA 2O5CA 3LQ1A 1MJHA 4R7GA 4JVOA 5F2OA 3A9CA 4DAOA 2CHGA 1CE8B 2IPMA 4K9MA 3R77A 1M72A 1ZRMA 2C3UA 1C7ZA 3IEIA 3C8MA 3JQDA 3NTOA 4ZDIA 5JD6A 5HNKA 3RAJA 3ZDCA 1RT9A 2PL9A 2ZETA 4Z0PA 3Q0TA 4D3DA 5KQPA 2P9YA 4IJ5A 1XVIA 3M1AA 4PZ0A 4CU5A 5MN5A 1N0VC 5K2OA 1GGHA 2D1FA 5EESA 1GR1A 1G20E 1Q1QA 1MUUA 5HZHA 4UBLA 1SOUA 1J23A 2FUKA 1BEZA 3WK8A 2EOAA 4UREA 5IU6A 1QCCA 1I4OA 2VR1A 4GG1A 2WABA 5IDYA 3NYRA 2V6IA 2ZSDA 3VC1A 3E9QA 1TZCA 4OPMA 3AUAA 4JVLA 3O2NA 1AN9A 2X15A 3DAOA 3HLTA 4N7JA 4XEHA 5HCUA 3WGUA 4DDMA 1WBDA 1IXYA 3BMQB 4QOGA 4DCMA 3UCFA 3VZQA 1AIPA 3CLHA 2VP2A 1P5HA 5EZ5A 5A03A 5JJIA 3HU5A 2QMZA 4K03A 4ED9A 4TMZA 1FNNA 4RBNA 5HQJA 3GLIE 2X8JA 1R0WA 4OF4A 3ZDYB 1YC5A 4ZK2A 1OLUA 2P9HA 4QARA 4UPVA 4MS1A 4LI3X 2M9MA 3A0UA 4L9RA 2AWNA 2RH5A 3ENQA 4F5ZA 3P2YA 2AFHA 2QV0A 3I23A 3L02A 3WZLA 1G4AE 4M9XA 3VA7A 1NBEA 1UK6A 3H9CA 5EE9A 1FSPA 1A71A 4IMIB 3VBCA 4P4SA 10MHA 1OBOA 3LDHA 5DYTA 1WBBA 2BC9A 3M9LA 1A8QA 4RANA 4ZVMA 4MZXA 2ZI5A 4WX2B 1F20A 4PR0A 3SIXA 1CP2A 1A5SB 5CNKA 3RC7A 1BNCA 2AUMA 4W5RA 5TSDA 3U2QA 3IGFA 2G06A 3KTOA 1H22A 1MF7A 1IULA 3O21A 2YXDA 2B78A 2QD5A 4M1KA 5EE5B 4J29A 5K3FA 1DAFA 1SBCA 1UP4A 1SUSA 5JAPA 3RRYA 4KBGA 1KKMA 1USGA 4IEIA 4M8IA 1B0UA 2P6MA 5CH5A 2DUUA 3VOSA 1MHTA 4CMEA 3GDOA 3HB5X 4D9EA 1K68A 1MB4A 1VBMA 1VL1A 5A0VA 5IW8A 4P7KA 2BM8A 4Q9KA 4B8WA 1TVKB 4ENQA 2I33A 5HSGA 1Z13A 2CXTA 3ASYA 3HCAA 2ID7A 4QC2A 3AKDA 3OJFA 3B7GA 2WW8A 4BLRA 1BWPA 2PZEA 4UM7A 5LBUA 4G0UA 5FPQA 1BHQ1 1CZNA 5KJEA 5BNIA 3IJPA 2HU8A 2BFOA 3BB3A 2QPAA 4R0VA 1H2HA 1GO2A 3HSSA 4P0QB 2OWDA 2GS9A 3CEMA 3OZXA 4XFJA 1KYQA 1RBMA 4AVYA 3IUNA 1CDDA 4MUHA 1CUJA 1YXMA 3VOBA 1RQXA 3GA5A 2ZRPA 2ZDGA 3FETA 3FWZA 3ZWYA 4EA8A 1J99A 1BMQA 4URVR 3RS9A 1Y3FE 1Z8DA 3N1UA 1ORIA 4U3JB 2Y1DA 4LZWA 4CQJA 2WT8A 4GXTA 5C8DA 4EY6A 2OHXA 1DUSA 2AEJA 3SM3A 4IOJA 2F7SA 1E2HA 1G7TA 2VPWA 3TPCA 2HSZA 1HMYA 3QLUC 2C3PA 3BZWA 3MYYA 4F8YA 1TTPB 4GX5A 1E3WB 1A7AA 1Z16A 4CEJA 3E8MA 4E09A 4MWGA 4PZAA 1YRAA 3F0TA 3MGBA 4M0LA 3DL4A 4WPGA 1ZJJA 1GNQA 2A9FA 5D3MA 4I5FA 2AJLI 2K7ZA 4P3KA 5BYBA 3I83A 2PXCA 1HA3A 2PH5A 2VJNA 1QFZA 4XOIA 5C4GB 2CLCX 4L51A 1JIUA 1R5OA 2YHIB 4DZZA 2OFPA 2VPTA 1FZQA 4HH1A 5AUOB 4Q3NA 1YS6A 1ZAYA 5IXYA 2LCQA 1AX9A 1JBEA 1G7SA 3CX6A 4GPTA 4AF7A 1K66A 1OLXB 3MYRA 3ITEA 4NNPA 3SQNA 4L16A 1B6GA 5T6MA 4QKQA 1LF5A 1JNYA 1NT2A 2WTMA 3EVCA 5DNAA 5G4LA 3W05A 4OKNA 1DDIA 3ZU5A 5JH7A 1QFMA 2FMTA 2FQXA 3TW8A 1ORHA 2PR2A 4HY3A 1XTSA 1OCEA 1II9A 5JDCA 3BHMA 3HGMA 3FZYA 4G9BA 1HYBA 2NU7A 2PO7A 3CNEA 2Q5IA 2ZYIA 1IIBA 3EXIB 1NKSA 1V1RA 5DTIA 4OLBA 4E3ZA 2BV3A 2AXNA 4LGVA 2MSLA 3CZRA 4FDTA 4MVYA 3NASA 4WFIA 5FTMA 2F4NA 3W90A 4CI9A 4F1WA 3F67A 1SKYB 4G1VA 3TQQA 2PRYA 3SLKA 4KBFA 1NXOA 4CUKA 5KVAA 1SAYA 2P65A 2J31A 1WDTA 4QRDA 3U62A 5I6DA 2OAGA 1WRBA 2P9JA 3DOFA 5HRUA 4YRZA 4UAVA 3ZK9A 3KLBA 4DBVO 5H9WA 4ZYXA 4MKFA 4M9QA 1SC9A 1MOZA 1PD1A 3IVAA 3P4XA 3KPUA 3JYNA 3U3DA 4XUEA 4EJSC 1QH8B 2JIBA 4X44A 4XYLA 1H8EA 3AVQA 4MDYA 3QBEA 3UWOA 1B8UA 5KKNB 1OXXK 2JGIA 1TF2A 5BQFA 5JD4A 4MJLA 3KAJA 3DT6A 2H2WA 2W6OA 3ONWA 4L3OA 4C30A 1MT0A 2J3MA 4IIUA 3BHIA 3WLLA 4AN0A 1L7BA 2ON6A 4I4NA 4CL2A 2P2YA 2QN8A 4R68A 2EZ4A 3FGZA 3AG6A 4KAAA 2VDVE 1O8CA 5TB5A 4FWTA 2Y76A 4JJ6A 1YR1A 3G8DA 2WE8A 1EFHA 3PICA 1LY1A 5A04A 2B92A 3WHKA 5C8XA 1V7PC 2G9NA 1CUVA 3W6OA 4BFVA 3PHJA 4YUVA 2PRZA 1NJSA 3NHRA 3C3EA 4TQUS 3IUBA 1J49A 3PXXA 4QBFA 1TYAE 3KKEA 1YDGA 1JHVA 4HDSB 5DT9A 3R7DA 3DL2A 3RYCA 2QRZA 3FHCB 1QIDA 5J2TA 4PNPA 1U0SY 1E0AA 7REQB 5KMGB 5F12A 3QFFA 3NIFB 7GPBA 3D6FA 2AOXA 2GCPA 4S04A 3LOQA 1BA3A 2SHKA 1EFDN 1JHYA 2QRNA 2YV1A 4WCFC 4FBGA 3A4MA 1WV1A 4D41A 1NXVA 4LWQA 4F8EA 3SZ3A 3NGMA 4L5CA 4BO3A 2VBCA 1KO1A 1A5TA 2MIIA 5JXHA 3EGDA 1I1OA 2VSNA 3NV7A 3N0XA 2X4IA 1S8FA 3HVHA 3M2PA 3S2YA 3GGOA 5IT9A 3RHZA 5AKIA 1NVXQ 4EX7A 2NUTB 3J81A 3I9KA 2AR7A 3W9UA 2PPVA 1CU1A 3AFOA 1KDOA 1GU0A 1E89A 4O2AA 1VJDA 4DR4B 1VKZA 3PA8A 2GETA 4N3GA 3ZIAA 3H1PA 2PLWA 1TZJA 1Z28A 3S1AB 1E3IA 1VYUA 2B0JA 1DPFA 1QH9A 1UJCA 5INTA 3A1TA 5LXTA 1X1DA 2YY7A 3CKLA 4C6TA 4ZI2A 1I0LA 4EMUA 3OPNA 1FFYA 1KJZA 1DTWA 4KR3A 3U3ZA 2QMUA 2JHGA 3LX5A 1N7JA 3K53A 4CBVA 4FJ1A 2YW9A 2XXAB 3FAZA 3GLGE 2WG0A 3DF7A 4QDOA 3LUJA 4URZR 2FZEA 5CM9C 4PHCA 3LL7A 3IDAA 3CPEA 2D3TA 4Q47A 1UZMA 4D4IA 1Y4ZA 3L8GA 2PX5A 1S1MA 2VK8A 2WZQA 3GQBA 5IH7A 4QGBA 3EXHC 3QRWA 3L7JA 4L50A 4PN3A 3OQJA 3PR1A 5J3JA 1A9TA 2Z2JA 1EUDB 3AHJA 5B1IA 2WYIA 1TM4E 5IYZF 1F2UB 3AM5A 1PVVA 3CZQA 2JFGA 3HBNA 2VI5A 4CIBA 3QEJA 4FFBA 3ZCSA 1DIGA 4A16A 1QGAA 1QFJA 3GCXA 3KBBA 2VUIB 3E9RA 4FOOA 4HXYA 2Y71A 2I4MA 5JS2A 4GP9A 4MKXA 5D2CA 1SD1A 2QXUA 4P5PA 1M7HA 4QQKA 2W0SA 3SX4A 3WZ2A 1GTRA 2NO6A 4OKSA 4BVAA 1KEWA 1JXAA 3IBYA 5EKTA 5EHGA 3X1MA 1L7EA 3WIOA 4YS6A 3ECCA 4REQB 3V8RA 3ZX4A 2MINA 3DMTC 2EF0A 2WNSA 3PXUA 1WA5A 3Q8WA 3HFSA 2H3HA 4KQFA 1QC5B 2Y2UA 3BMNB 3IXMA 4CDGA 2B20A 4MUAA 2Q21A 4L4SA 3K4QA 4B6SA 5K0BA 4LX8A 1N8SA 3R0XA 4ZAFA 5B7NA 3X2EA 3I58A 3A9SA 1W7AA 2Q1WA 4J4TA 3QYPA 5D5QA 1NONA 2CFCA 4FHDA 4ZO4A 4LRXA 3RIYA 4GMGA 4FNMA 4PR3A 4NABA 3ACDA 3LBNA 1XA4A 4ZOAA 3MGAA 4NBNA 3B36A 1EAMA 3R7WA 5I47A 2QGNA 4OA8A 3BCHA 1CULC 1PR5A 2D0OB 3O8QA 3HBFA 1IY0A 2CZGA 3Q12A 4IDHA 4N5NA 3UV6A 4A92A 1HEUA 1YDEA 2GB4A 2OA0A 4PPNA 1OWPA 1IZ8A 3FNBA 2ODNA 1C1XB 1DEXA 4PG8A 2WFLB 4JU9A 1V48A 2Z1NA 4NZ9A 3RIXA 3V4VB 5GIPE 4TQ9A 1Y6GA 3UUEA 1A04A 4YP6A 3DP9A 2JFVA 2OY0A 3H0KA 3CZMA 4CEIA 3G9XA 3HDHA 3MK31 1MQ9A 1UOQA 1G19A 2JFPA 3MWJA 3PUZA 2QW1A 3EF0A 7MDHA 3D3WA 3UK0A 4NMMA 4YQYA 1AS3A 3LCRA 3I8SA 3I3SR 5ADHA 1I4EB 1V1JA 3CXUA 4PIMA 2FK8A 4V0MA 4J03A 1X77A 5H81A 3G8BA 2VCYA 1VCMA 3MZ0A 3KSMA 2C2OA 3ND9A 4P81A 3WICA 4DM3A 3MWDA 2PO5A 5CYFA 4PQYA 1E9FA 3DBLB 1HKUA 3DQPA 2FEPA 1EQAA 1TO2E 1TQ4A 2BKXA 4IMPA 1SG9A 3JZDA 3Q7EA 2XDAA 4WKBA 1IUOA 3LWDA 2YFQA 1C30A 4LY9A 1CIPA 1BX0A 2H17A 3CKYA 4CR8A 2VQ3A 3WR5A 5KUTA 4D9JA 1RAIA 1UQRA 3HA7A 2TS1A 3DD1A 4Q93A 5TMEA 4EPTA 3F6SA 3RSGA 1AUOA 16PKA 1SVLA 2D0IA 2P0EA 1I2MA 13PKA 2YN2A 2WWRA 2ASEA 2OD9A 1ZR4A 2XYRA 1OTXA 2YN4A 4Y2XA 4AAYA 1IM2A 1S4MA 2CLDX 2ZR8A 5EMKA 2W2NA 1WMEA 1LFDB 3BJMA 3AZPA 1PWZA 1P4GA 4MKGA 5COAA 1TU4A 4B34A 5B2FA 5T3UA 2PSSA 3AJDA 4Q05A 4ND3A 3SZRA 1YAHA 2WYWA 2F8MA 3CGWA 4H2DA 5LDGA 1QLHA 3AIMA 4AB1A 2G0AA 1W52X 5IKMA 4AX4A 4CVNA 1B16A 3RC8A 3M70A 1P73A 1W88A 2HRCA 2H9AA 3L7IA 4IILA 2JAHA 4WZAA 2HN9A 4X7RA 1N5KA 4EEZA 1E96A 3ICOA 2C57A 2PJUA 1JLLB 2BBOA 2FHPA 1SVUA 4OGKA 5AXDA 5GZ3A 2QRVA 3A4IA 4WOPA 4UUNA 3HR7A 3KYIB 3QVKA 4HFNA 1A8PA 2JCXA 4FHGA 4KWEA 5GPBA 1JDUA 1LBQA 2OBXA 3GY0A 1L3IA 4K9NA 3ZCPA 3RJ9A 4NNJA 5K8IA 3IAM1 4PSUA 5AJHA 2A5FA 2QPTA 2AR9A 1ADBA 2E6UX 4HMPA 1OHHA 1Q7RA 4P3YA 2JGDA 4UFOA 5B1YA 5K8TA 1XYYA 4JDUA 2ZRKA 4N76A 3AM3A 1NIPA 2ACVA 2Z4RA 3CF0A 2FOIA 3TAUA 2FW1A 1Y9ZA 4CM4B 5KYYB 3CONA 3TQOA 1WUYA 1DIOB 1GAQA 1RRKA 3N75A 1GPKA 4L3VA 1WD7A 3WLSA 2BONA 4YDRA 4KN6A 4ZV4A 1KFEB 4YMIA 3TSWA 2AXQA 2WB2A 1MEEA 5GTDA 2YWGA 1IZ9A 1JT2A 2N46A 1S4QA 2BMVA 2JC3A 1VLMA 1RQPA 2JGKA 2OMEA 3AGPA 3MWLA 2BHRA 3LDFA 2Q3MA 3OUUA 5FAXA 5FR1A 2J0UB 3LQFA 3UC9A 4D96A 2DY0A 3ZWAA 4IDFA 1FNBA 5HDQA 3UJ8A 3VZPA 3TL2A 4XD7A 5JE8A 1F38A 3K1AB 2ZCVA 2PUCA 1R1DA 2WIKA 2LP4Y 1XEXB 2ZUSA 4XWYA 1EFPB 3Q3VA 2UUOA 3AI1A 4AUNA 1ODJA 2FZKA 3OZIA 4GLFA 4J0FA 4OQDA 2JFNA 4R9NA 2HPAA 2HTEA 2QTRA 5JATA 2TMKA 1JJIA 1R3DA 4WA7A 1H2YA 4IGAA 1AMNA 3WLIA 2XCRB 1IXZA 3TUJC 4MYUA 1SBZA 3UJCA 2F1JA 1E5QA 4RO0A 2EQ5A 1U7UA 2GBPA 1T4MA 3E7PA 1UODA 5K8CA 5TC4A 4A3SA 3Q7RA 2P3QA 1CR2A 4OBBA 1ZCAA 4EQZA 1LUAA 2IOQA 1FW6A 4WLNA 1Z7YA 2JAXA 1Z6ZA 2XI4A 5CDGA 1SXJD 3T4XA 3GJZA 1IY8A 3OZCA 5YASA 5A3QA 2PKQP 1QRSA 1T5BA 1JBQA 2GEFA 4NP6A 2PGOA 2B2CA 4UBIA 4M1EA 2J7PD 4MWTA 1KF0A 3T7AA 3C43A 4UOQA 2G1PA 4QE3A 4AQ7A 2G9RA 3I9LA 2ZB2A 4MLZA 5F2KA 4WXYB 4BYGA 2IS1A 1ZMXA 1UPFA 2GK7A 2Q45A 2BDEA 3ZEIA 4ARVA 4AKHA 2HREA 3IMCA 3P19A 1A9SA 2OM2A 1BDIA 1GCUA 4HH4A 3CBGA 3CRRA 4ZEOA 4M7RA 2FEWB 3KJGA 4L6CA 2YOHA 3TLCA 2JGNA 3WHPA 4BKQA 4KPYA 1KI1A 3PNYA 4RPLA 3O9MA 4HQ0A 4OHWA 3PE4A 5TEWA 3DLBA 1EZ1A 1SU8A 4TM8A 1FNSA 1LK5A 1QH0A 4FWBA 1BHSA 1RMQA 4IO1A 3TNLA 1QAQA 5L7TA 3QQ5A 4OI4A 4F9FA 4ZPXA 1XNJA 4MRMB 5TARA 1BE8A 2C5HA 2UUCB 3E22A 1JYEA 4IEFB 2P30A 1D04A 1E2JA 4NCKA 4TTPA 1B2LA 4TS4A 4BCCA 1UBMS 3DMFA 1R7RA 3VDNB 2HBZA 4H7KA 3M5CA 1MH9A 1OX5A 2DYKA 2WSSA 2FN3A 3L1JA 2I87A 4J75A 4Q01A 4RA6B 5NLLA 4EPXA 3LYLA 1P4SA 1AA6A 2BFCA 2QMEA 1PE0A 1QCDA 4WAUA 1ZLYA 2WIGA 1PDVA 1KH2A 1NI4A 4WIAA 1RKXA 1FDIA 3MLBA 3ZLJA 2D1TA 5IZCA 3IDOA 3TSCA 4A36A 1OFIA 3WWDA 5CFZA 4QYXA 4RH1A 3T0FA 3VHQA 5EL0A 3OUZA 4ZO7A 1TCBA 5HIJA 1KXJA 5EZSA 2IBSA 3BSWA 4HAVA 4DC9A 1D3AA 3QWIA 2GCEA 3EUEA 3ZE8A 1ES9A 4R7ZA 1J9GA 3QE9Y 4RKRA 2HSGA 1Z33A 4AZ3B 3C6MA 3EG5A 4OQNA 2RKWA 5HFAA 3WMRA 2R6GA 4AYWA 2ENUA 4C5BA 2FKAA 1GQQA 1L8LA 3RLIA 1I4WA 1NNUA 4IBOA 4KL8S 3H5NA 5BRAA 2X2FA 3MT8A 3H83A 1E1CB 3VYSB 1AU9A 2GCIA 2ECQA 2V6JA 2ZYTX 4XM2A 2N1BA 2X9QA 4KIJA 4EKIA 2MT9A 5LB4A 4U9UA 4PO3X 1N2JA 5AJYA 3V9AA 4F9TA 721PA 2IGBA 4UPDA 5IKPA 2OO5C 3GZ4A 5GZ1A 1R9MA 4HCJA 5ALJA 3GUYA 3THXA 4C0KA 1BS1A 3EQZA 4M9UA 5DBOA 4Z1OA 5DI9A 2WDPA 3CUEF 3G9QA 1SVSA 2H2AA 1C0IA 3EUFA 1ZOOA 3QY0A 3ZD6A 3IFSA 3OT1B 1MJNA 3D7SA 3TWOA 3KTAB 1EA7A 4LBVA 1TUGA 3ANNA 3LY7A 4HVTA 1YZQA 4XGRA 5E9QA 2QRMA 4I1UA 1P91A 1TD9A 1U2EA 3QV2A 4OM7A 2WD7A 4BBZA 4GPEA 3V00A 4NY1A 1U1CA 4TYWA 1MH1A 2F1KA 1K2WA 3PEFA 2DFPA 1ESMA 5BQ5A 3UHFA 3PD0A 1G8SA 4YI3A 1H5UA 1ULAA 2V7GA 1XRPA 5BO5A 3GJXC 3RGWS 5JQGF 2IX3A 1XZBA 2OVFA 3CFYA 1CEQA 1NBIA 2P8JA 3EULA 3JYQA 1PVOA 5CBPB 1YHNA 2WHPA 2PKQO 2Q07A 3EJWA 4QJ5A 1VLHA 2FSSA 1N0UA 3U5ZB 2F00A 3W5VA 4RK0A 1XKTA 2G1AA 3GJYA 3CUUA 1K92A 1J00A 1UK7A 4OVKA 2ZR0A 4XGQA 1PJTA 1G4HA 3RHFA 1B8PA 2P75A 4EI7A 4Z99A 4DCCA 1TCUA 5I3CA 2ZWOA 3LC0A 1EWVA 4Y6GB 2Q1UA 3O82A 4ZCPA 1JR3E 2XQGA 4Z3OA 2KJQA 4H0CA 1ZD5A 1Q20A 2JLYA 1NXQA 3FCEA 5ULLA 3RT1A 1FMJA 2HMVA 4C21A 5FHRA 1BEEA 4CT5A 2O06A 4HZGA 4JBHA 5JMWA 1YVEI 4OUDB 3TFOA 1Q1AA 2LDXA 3TIFA 4HB3A 4BNLA 4OX9B 5LPNA 3OCZA 3VHRA 1I3LA 3OLYA 1VG0B 4ABYA 2PM8A 1NW3A 2FFHA 1PDWA 1ADFA 1WDWB 1RQ7A 1HFEL 3HXPA 3MBKA 4LI0A 3T7KA 5I7OA 3FYUC 1DOAA 3MT0A 4RAOA 1WVGA 3W5DA 1QKJA 1C50A 3ZNPA 1UCFA 2X4DA 2NZJA 2OUIA 3DLCA 2IU6A 1NF9A 1JXOA 1MO2A 1X74A 1J0XO 4I1PA 5LU8A 2QK4A 5EP4A 5JS1A 3MD0A 1VE5A 2IQIA 3GGDA 5ICCA 3HCNA 1RXCA 2C7VA 2CY0A 2EATA 3LXXA 4IVQA 4O1HA 5E9WA 5FHQA 3T7DA 4RIFA 1HE8B 4XWTA 3MRVA 1QYXA 3UT6A 5AI9A 1ODCA 3ILXA 4H4DA 1C9MA 3EQ7A 3ZWMA 2DWQA 3OZSA 5C8ZA 1Y1QA 5F5NA 4EW3A 4BNYA 1E0KA 1NWHA 3PQFA 3RGGA 4L9AA 3SZLA 3T9BA 2HK9A 2O0KA 4AZSA 1Z37A 4RTLA 2NLOA 2GBFA 1TFRA 3VKVA 2PH3A 2Z5FA 3OTIA 4DLTA 2KYRA 1N2CB 4HI0E 3RFCA 2PZMA 1NZDA 2NTNA 1ST2A 4GZLA 4KPUB 1FBTA 1AUXA 1MO4A 1OD6A 1B8NA 2QWXA 4L74A 4QA9A 4GX2A 1G6HA 1ZA1A 1GV1A 1TAQA 2C1XA 3P8ZA 1Z8FA 4EYGA 3WFJA 3QELA 3ZYZA 1AKWA 3D8NA 2XMRA 4NOKA 5KYVA 5AKJA 1FEZA 4S2UA 4IIDA 1XMIA 3OPQA 3LG2A 2W37A 4E5YA 4LNHA 4EVRA 2MR5A 2D1QA 3HLYA 4E5DA 1Q2XA 4M55A 1SPXA 5BSGA 1SVWA 3Q1LA 1PSZA 4CL0A 1DIAA 4ZZ1A 2VZLA 3F49S 3L06A 1B7GO 5F1OA 3TDMA 4QBGB 4DDUA 1AK9A 1K63A 1TVMA 2GPSA 4R8LA 4YBRA 2WILA 2EFCB 2CFIA 5AM5A 1MPTA 4GPIB 3RVPA 3LZ6A 2JDID 2BKLA 1NVFA 4MVJH 3QMWA 3IMKA 5H70A 1HNXB 1ML3A 3KKMA 2OFOA 1Y6RA 2R4TA 3GH1A 3WI7A 5CBKA 5I45A 4ND7A 2YN0A 3PUKA 1RABA 5EIFA 4C3UA 2IPOA 2ZJFA 3OJ0A 5JS8A 1VLJA 2P4SA 2VFAA 4G5YA 2PJRA 2B3TA 4BRWA 3VNVA 1H69A 3TKAA 3WNVA 3ZE0B 1YVRA 1AO3A 2AZ4A 3HY4A 1K86A 1ZUWA 1GQSA 1XZQA 3ZHVA 1Z5OA 3D5TA 2P5UA 4UEQA 5JNVA 4LTMA 5B1SA 1TA4A 3CUKA 3I8XA 4O5AA 3GBVA 4QUGA 4EUEA 1JMKC 2GTHA 5JC8A 1IEXA 2XYQA 2GM4A 4L4UA 2ERXA 2F1OA 2Y67A 5C8YF 1SU4A 4B8YA 4HLUC 1H8HD 5T4HA 5JD5A 1MVLA 4DMHA 3CURA 4LJRA 1NTOA 2O05A 3PX7A 3TGLA 2XUQA 1JDNA 1KHHA 1L5OA 4BX8A 1CUXA 4UU0A 2HMAA 3LI2A 4QYSA 1E8MA 1R6TA 2V7QD 3R74A 1BMDA 4COKA 1NBMD 4F21A 3UAOA 1OAKA 3IALA 3IO5A 3IT1A 1WWKA 3H4VA 4AX8A 1O94D 2HA5A 3GRVA 2CL5A 2ZVDA 2P1DA 2JLQA 4K8RB 3VPSA 3R3JA 4LG1A 1PV4A 2YVLA 2ZREA 4NCXA 4ND8B 1E1LA 1E5LA 3EISA 4XPIB 3KD3A 1KSJA 3TZHA 4RH0A 3KYCB 5JQGB 1RJEA 5B64A 2YZ7A 2PFGA 4MYTA 4ZO9A 1EINA 5JY1A 3HJBA 1O08A 5TQJA 3CF4A 4YRMA 2OD7A 4WKPA 4LPKA 2OAEA 1KRHA 4UNIA 1VL0A 3UQYS 4IMJB 2GPNA 6LDHA 4UEKA 2EJVA 3M34A 4TKVA 3WKEA 3FDZB 3PWKA 1N9ZA 4XVRA 2QAGA 3F7MA 4I8DA 5ED0A 2GBLA 3UWSA 4JVSB 3L8FA 2XYHA 4MCJA 4F84A 2EBUA 4LNUB 4UDYX 4YJ3F 5T8KA 3C48A 4KJXA 1J2JA 5LMZA 3KOUA 3L1KA 2OV2A 2WWYA 1MDBA 2IEIA 2NVOA 2R8ZA 2WJVA 4RVUA 4HMQA 4ML3A 1CERA 4CF5A 2QUBA 4CMIB 1SB8A 3BGVA 5COQA 2BSXA 1YR6A 1P2BA 4FFWA 4P5DA 3RK4A 3T7TA 1P1KA 3U31A 1XLUA 3ND7A 2GGSA 2WU3A 4Y6OA 4N47A 1M75A 5JCOA 4C4TA 3COYA 1NG9A 1I7DA 3R9XB 4KREA 5C5EA 3CC8A 4QGAA 5DO9A 1GQFA 1NVEA 1JECA 1U02A 3EZGA 3SIWA 4GWLA 2XUHA 2WF6A 4OHCA 3VKWA 4R83A 4R40A 3PDCA 4ZKDA 5FUQA 5JECA 1L8XA 4IYRA 1JLKA 3C1OA 3ZQUA 1B8OA 4MINA 1BMTA 2QJOA 4RTMA 4QTXA 3CZ5A 3QWAA 1JJAA 3Q7TA 2IHTA 2WP8J 5KNDH 4X1YA 2DC1A 3AL3A 1MB9A 1VJ0A 2CXPA 3MCWA 3GA0A 2XNDA 3A2NA 1D07A 1K97A 2G5GX 1Y1SA 2CYCA 4J3JA 4DRYA 2O8FA 3LDUA 1GGMA 4LTNA 4TV8A 3K0AB 1T5HX 3T7JA 4DCGA 4MVJA 2H08A 1UMCB 3PXEA 3TE6A 3TM4A 4CQMB 2XADA 2Y99A 5J1SB 2ZYRA 1DAEA 4FKZA 3PDWA 3DYVA 2KE5A 3HUEA 4FI3F 3ZX5A 3UMSA 1E9SA 4OU5A 1ILEA 4BO1A 3TLXA 2JFFA 2XW6A 1WXWA 4P84A 4ZYUA 4CHTA 1N0IA 2HF2A 4B32A 1K8QA 1KI6A 3P96A 4BEVA 1II8A 1SWWA 2IYTA 3FPJA 1LRJA 3MT7A 3T0IA 5C1OA 3AVYA 2X8LA 3OY7A 2OMKA 3OQ6A 3M82A 1FQWA 2P62A 4FR0A 2VDWA 4BQFA 4LYFA 1JR4A 3DFUA 3L6DA 4JUIA 5E8JA 2FQ1A 4ND2A 1O58A 2FPUA 2WKRA 2PKXA 3AI2A 5SZJA 1KK3A 2HU7A 4H60A 2RK3A 5IC5A 3P97A 4EUFA 3O4VA 5FBQB 1SKMA 2QJTA 2UZ0A 2ZIZA 3R0QA 1I3NA 3G2KA 1KVUA 2B1IA 2QMYA 2ADOA 4GU5A 4L72A 4O8ZA 3WKBA 5B4VA 5JV5A 2XBUA 4JUBA 2M32A 4OTZA 4M1QA 3TG8A 4Y2PA 3W8RA 3IDFA 3AETA 4JOBA 1A7JA 4MSUA 3BQMB 5KYUA 3D6NB 1L1FA 3HWRA 1Q11A 4HPWA 5AWFC 5HZKA 5KYYA 1QYRA 2GCOA 1GWNA 3HYLA 3Q7PA 2TSYB 4GKAA 5D8DA 1YI8A 4LVOA 4WK2B 5LJIA 4HQFA 1S7GA 1NW6A 2W2LD 3K9BA 1PI3A 1GVHA 1TAGA 3GXBA 1NBAA 4LZOA 4ENUA 1P4RA 1ZINA 3MJFA 2QRJA 3KQHA 2PQ0A 1PGNA 3BPSA 3ROFA 3MAAC 1EGHA 1GKYA 3F9RA 3GGJA 3KVYA 3D64A 3DZGA 1EX1A 3CWZA 3NIDB 2UV8A 2ENWA 5LQDA 4EY7A 1M2NA 4HRYA 5JJCA 4W4TA 1Q0HA 4IIFA 2BGLA 3AHDA 5JZSA 1JHZA 4EHFA 3P1JA 1GKKA 3N53A 4FXOA 2JW5A 1TMOA 1JPUA 3VPDA 2EARA 1VIYA 2B8JA 3H13A 4O63O 3K9HA 4UAGA 3MD9A 2XE4A 4HSEA 4EZEA 2HNAA 1ATIA 5KYWA 1L4BA 2XMZA 3DZFA 5KDDA 4DKJA 1OJLA 2R8XA 4DM7A 4PONA 5JNSA 2I3BA 2QE6A 3A4YA 4XWKA 4JYZA 1I6KA 3Q72A 4X95A 5IJZA 2Y0CA 3FTQA 2Q5LA 1YCHA 4KE8A 3VSEA 1W9HA 3LV8A 4KG7A 3AHGA 3D1LA 5A5VA 2I9PA