4HTFA

Crystal structure of s-adenosylmethionine-dependent methyltransferase from escherichia coli in complex with s-adenosylmethionine.
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
249
structure length
243
Chain Sequence
DIAEKFSRNIYGTTKGQLRQAILWQDLDRVLAEMGPQKLRVLDAGGGEGQTAIKMAERGHQVILCDLSAQMIDRAKQAAEAGVSDNMQFIHCAAQDVASHLETPVDLILFHAVLEWVADPRSVLQTLWSVLRPGGVLSLMFYNAHGLLMHNMVAGNFDYVQAGMPKKLSPDYPRDPTQVYLWLEEAGWQIMGKTGVRVFHDYLREKHQQRDYEALLELETRYCRQEPYITLGRYIHVTARKPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of S-adenosylmethionine-dependent methyltransferase from Escherichia coli in complex with S-adenosylmethionine.
rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords S-adenosylmethionine-dependent methyltransferase
total genus 82
structure length 243
sequence length 249
ec nomenclature
pdb deposition date 2012-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13847 Methyltransf_31 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4htfA00
3M6XA 2ZSUA 1WS6A 2IH5A 2G70A 2WA2A 2YTZA 2BR3A 2CMGA 3BGIA 3CCFA 3NDJA 4R8SA 4YUYA 5LQNA 4MHTA 1F38A 4EQZA 2OY0A 1ZG3A 2P41A 3KPYA 3OZTA 5K03A 3PTAA 4FP9A 2GA9A 4AX8A 3MGGA 5FHRA 3LECA 1YFLA 4R05A 4E2XA 4GEKA 5CIYA 1JQ3A 4RTSA 1ZGJA 4QPPA 1U2ZA 5K8VA 3HVJA 4RTNA 2IBSA 3GRVA 2OXTA 4GUAA 4ATNA 2NNWB 4C05A 3BT7A 4OA8A 3P71T 3FRIA 1BC5A 3KU1A 3CJRA 2DPMA 5BXYA 4C03A 1DCTA 1DUSA 3FUXA 4LWOA 3GJYA 4KDRA 4M37A 3ELYA 5DXJA 2FRXA 3CC8A 1G6Q1 3HM2A 4HGYA 3LBFA 3F4KA 4L7VA 4BLVA 2OYRA 2BM8A 2PX2A 4RTPA 4RVHA 4PYNA 5F2NA 5GIOE 1G8SA 2NYUA 2PBFA 3CVOA 3FZGA 4PYOA 4PYQA 4X61A 5E9JA 1RJDA 1PRYA 1P39A 2ONYA 3AJDA 1YUBA 5FUBA 2AOXA 4RVFA 3PFHA 5DXAA 3KR9A 4KRGA 5K0LA 1FJXA 3ELWA 3P9CA 2C7QA 3K6RA 3HEMA 3I5UA 1G60A 2PWPA 3NTVA 4QQNA 4MWZA 2PX8A 2G72A 5E9QA 5IKMA 1R8YA 1NV8A 3FUTA 3HVIA 4RVDA 3SVZA 2PGXA 1AQIA 3UA4A 5K01A 3GIWA 1MJFA 5FHQA 3TOSA 2OPBA 4QPNA 1NE2A 3B3FA 2PLWA 3IV6A 5DTMA 5MHTA 1V39A 3K0BA 1PJZA 2OBFA 2AOWA 2ZBRA 2AOTA 3ERCA 4RTMA 3TMAA 1G38A 1B42A 3A26A 4GC9A 3GNLA 1VIDA 4P7KA 3RODA 3BWYA 1JG3A 3TPZA 3Q87B 1YF3A 5KQSA 5DM0A 2BM9A 5HIIA 1QANA 2K4MA 3THSA 5HIJA 2OZVA 3FUVA 1RI3A 4E2WA 3MQ2A 1O9HA 4P7FA 5EMMA 5ICEA 5D1HA 1RJEA 2ZZNA 4E2YA 2XYRA 3DLCA 3M33A 4XUDA 1JG4A 9MHTA 3M6VA 3C6KA 5HILA 3G88A 3QV2A 5CUQA 3HCFA 5HZMA 3X0DA 2PX5A 1VP9A 4HTFA 2OB2A 1VE3A 2AOVA 2PT9A 3D2LA 5GP1A 4PYJA 5H02A 3KQMA 4CKEA 3SGLA 4PYIA 5ICCA 5K0EA 1FP1D 4CKCA 4YV2A 4C06A 4DCMA 3LHDA 4PYLA 5FQOA 1JR4A 2UYOA 2UYCA 2HWKA 2YVLA 1YFJA 3R0QA 3PFGA 2P35A 5ICFA 4E30A 3HVKA 4RSRA 4DM3A 3VSEA 3FTFA 3C3YA 2ZWVA 5EEGA 3KPVA 2PXXA 3HCAA 5EMKA 1VQ1A 3OZRA 4ISCA 5FWAA 1KYZA 2AOTB 5HFJA 4C04A 4RTLA 2B78A 5CM2Z 1EQAA 4R8RA 2KW5A 3P97A 4FZVA 1JTFA 4GOOD 2BH2A 2F8LA 2PJDA 5EIFA 2CWWA 5K09A 1NW8A 3TQSA 1Q0TA 2JG3A 2BR4A 1M6EX 5E2BA 3CBGA 4OQEA 3O31A 5CCXA 2HTEA 1G8AA 3A4TA 4HH4A 2A14A 3OU7A 2VDUE 5DM1A 3UJCA 2I9KA 4IKPA 1WXWA 4GC5A 1H1DA 2FPOA 3AWIA 3UZUA 4X1OA 4DA4A 4FGZA 1MHTA 3BGDA 1VLMA 2H1RA 3KR1A 3R9XB 3UJ7A 1VBFA 3EGEA 5DSTA 1NW5A 3KR2A 3JWHA 5DX1A 2ZBQA 5DRTA 5LQUA 1EAMA 5EPEA 4UOEA 2G1PA 1ZQ9A 3NMUF 5E2AA 3PT9A 3LL7A 5LQJA 4EVIA 1EJ6A 2P8JA 2B9EA 3I9FA 5HEKA 2IH4A 2XVAA 2G8NA 3IYLW 1XDZA 3BKXA 3FPEA 3R6TA 1NW7A 4YMHA 3EVZA 1QAMA 3KQSA 3P2KA 1XCLA 1NW3A 2AVNA 4CKBA 2PXCA 3R3HA 4EMSA 4RTOA 2GH1A 5K0BA 5FA8A 2VDVE 5GM2A 1M6YA 3DOUA 3KQQA 4DZRA 1P1CA 2OB1A 3P2EA 2YXLA 4RTRA 2IPXA 4YUVA 3GRUA 3ID6C 3TKAA 3HCCA 2QRVB 3PLAE 1YZ3A 4HRAA 1KIAA 4Y30A 3DTNA 3HCBA 4WXHA 3DMGA 5FA5A 3FYCA 4H0NA 2HR1A 5C0OE 2R6ZA 1L9KA 1ORHA 3I53A 1RJFA 3DXXA 1T43A 1N7JA 3ANXA 3UWPA 3RW9A 3JWJA 4EKIA 3LCCA 3PX3A 2UYHA 1SQGA 1Y8CA 2IDKA 1XCJA 5KVAA 2YR0A 4PYKA 3KQTA 4PONA 4X63A 5P8WA 3FRHA 5T64A 4DF3A 5T6BA 5JR3A 2C7RA 2XYQA 2B25A 4FT2A 5GM1A 4B17A 5LR6A 3BZBA 5D1NA 4PINA 3EVFA 3LGAA 1KXZA 5F2OA 3UJBA 3EVCA 1XDSA 2NXCA 1UIRA 4PYMA 4QQKA 1VPTA 2JHCA 4IWNA 1N2XA 2UZ4A 1NW6A 2FK8A 3NWEA 4FT4A 2VS1A 4DCGA 2GAFA 3TFWA 2PVCA 3TM4A 3VC1A 2V7EA 3DH0A 1JSZA 3DR5A 5CVDA 5EMJA 1HMYA 4X41A 5EOVA 1XVAA 1R8XA 1WG8A 2G71A 2LD4A 2YXEA 2PSSA 3MTIA 1R74A 3MTEA 4OA5A 1NBIA 3B3GA 4GBED 1FP2A 1IY9A 1JTEA 2Y1WA 5E9WA 3MCTA 3CKKA 4WVLA 3KHKA 2ZW9A 3C3PA 4IV0A 5CCBA 1M0EA 3ELUA 3M6UA 5JUWA 3TR6A 5DPMA 3B3JA 2FHPA 3O7WA 1R18A 1L1EA 1NT2A 4XUEA 2JJQA 4GOLD 5FULA 5GOZA 2AVDA 2AOUB 2ESRA 2B3TA 4XUCA 3VC2A 3LBYA 3OE5A 1SG9A 1EJ0A 5EIWA 2P7IA 3C0KA 3ER9A 3NDIA 4FS8A 1EIZA 2C7PA 3EGVA 3EVDA 1TPYA 4Z2YA 2NXNA 4IV8A 2Z6AA 2JHPA 2VZ9A 4KVZA 4E33A 1QAQA 3EVGA 4ER7A 3SM3A 3NVMB 3MB5A 3OFKA 2PY6A 3A7EA 1HNNA 3LPMA 3HA7A 3WSTA 1KR5A 5HIMA 4C4AA 2PXAA 4QTUB 3G8AA 2JH8A 4ER5A 5K0CA 2PWYA 3SXJA 1SUIA 4BLWA 1BOOA 1D2CA 3FUWA 4GF5A 2ADMA 3OE4A 4C08A 2IBTA 4U7PB 5E1MA 3LKDA 3BKWA 3BUSA 4PNEA 4KW7A 4P58A 4RTJA 1FBNA 2DULA 3EMDA 2YUIA 5EZQA 3FTDA 2O57A 3LDFA 2CKDA 1I4WA 4P7JA 4MIKA 5EMLA 4RWZA 1RI4A 1KPGA 2BR5A 4ER0A 4PIPA 3SSNA 2ZCJA 2PV0A 3ORHA 3SX0A 4LWPA 3CJQA 3GXOA 3KPJA 3HVHA 3IEIA 2XYVA 5K0NA 3SSOA 1VP3A 3GRRA 1BKYA 1D2GA 5FCDA 3KKZA 3L8DA 1WZNA 4GQBA 4LECA 3SR4A 2ZIGA 1SUSA 4PCAA 1IXKA 3QOWA 1N7IA 2PT6A 2PX4A 3MCZA 1KPHA 5T67A 4AZWA 2WA1A 2EX4A 2O05A 4HTFB 3TLJA 1G55A 3OCJA 3B7PA 2VP3A 1QAOA 1KPIA 3IHTA 1KP9A 1RJGA 3THRA 2O06A 1UWVA 2XVMA 4PGHA 3EVEA 2QYOA 5E1OA 4A6DA 2HNKA 5KQRA 5E8RA 4KIGA 4GOMD 5LQCA 4DMGA 2GS9A 5FWDA 2I62A 1WXXA 4GOND 3S68A 3HCEA 5DTQA 3EEOA 2IH2A 3CJTA 3DXYA 3OU2A 7MHTA 3AXTA 1X1CA 3FPFA 3OU6A 4QTTB 5EKXA 3DLIA 1KHHA 2P3LA 4BLUA 2P3OA 1X1AA 3C6MA 1AF7A 2QM3A 3TM5A 2H11A 3FTEA 3AY0A 3FPHA 1ZKDA 3T7RA 2AN4A 3P9IA 4RV9A 3EGIA 3KQOA 4DQ0A 3OFJA 3FUUA 2Z6QA 3DULA 3ELDA 2GPYA 5DM4A 3FPGA 3UA3A 3ME5A 3UJ9A 5BW4A 4CTKA 3DMFA 3G7UA 2YQZA 1I1NA 3EPPA 4RX1A 2NXEA 1YB2A 5FQNA 4RTKA 2Z6UA 3NJRA 3KR0A 4OBXA 4AZVA 3E7PA 3JWIA 2AN3A 2O0LA 3PS9A 2NXJA 5KYGA 3BXOA 3G2PA 4KIFA 4EKGA 3KQWA 3FPJA 3V8VA 4YV1A 5EVJA 4QDJA 2PKWA 3LDGA 1IM8A 1BHJA 4ZTBA 4ER3A 3EVAA 3LDUA 5HIKA 2GB4A 1KYWA 1ZHFA 4BY9E 3QOXA 10MHA 1R6AA 2I7CA 2R3SA 3JWGA 4Y2HA 4O29A 2IIPA 3OZSA 3T0IA 5K0GA 3G89A 5EG5A 3TRKA 2FYTA 5CD1A 5E8JA 4M7RA 5BP7A 2ERCA 4R6XA 4F85A 5C9ZA 5EGSA 3MHTA 2QRVA 5C1IA 1L3IA 5LSAA 4V0QA 3G5TA 1JG2A 4QVGA 2IGTA 2AR0A 2I6GA 3RIEA 5EQJB 2ZLBA 3HA3A 4F86A 4YUZA 1NKVA 3DUWA 3P8ZA 2QY6A 2ONZA 2ZTHA 4K6MA 1JQDA 2AN5A 4CTJA 3G5LA 3CGGA 2FCAA 1VL5A 3KPWA 1P91A 5EEHA 8MHTA 2YXDA 1NV9A 5EHGA 4V0RA 4HGZA 1Q0SA 1RI1A 5U4XA 3M70A 2E5WA 4M36A 4CXMA 3HP7A 4X60A 5K0JA 3A25A 4E70A 5E1BA 4FR0A 4YUXA 3GU3A 1XJ5A 4HC4A 3P9NA 3HNRA 4OQDA 3R24A 1L3CA 3VYWA 2ZBPA 2P7HA 5EHIA 3UJ6A 3LKZA 2OKCA 1XTPA 4G56A 4JXJA 3E05A 3UJDA 2EJTA 1UFKA 2IP2A 3DP7A 3GRYA 2ZWAA 3I64A 3PB3A 4PGGA 5LQRA 4BP1A 1OR8A 2CMHA 1AQJA 4QDKA 2EG5A 3LCVB 4AZSA 2ZIEA 3SSMA 3GO4A 2BZGA 3BGVA 4OBWA 4LG1A 5CVEA 5DX0A 5F2KA 4BP3A 5GINE 2CL5A 4NECA 1SVUA 2FK7A 5FTWA 4C07A 1AV6A 2ZZKA 3HTXA 5M5BA 3GCZA 1ORIA 4POOA 1INLA 2AOUA 3BWBA 4E32A 4YMGA 2N47A 4KWCA 2HV9A 3G2MA 3HA5A 3G2OA 5FADA 3E8SA 2ZZMA 3AXSA 2O07A 3LX6A 2NP6A 3FTCA 2ORED 5DX8A 3EMBA 5CVUA 5LQAA 3HCDA 3SMQA 5CVVA 2EJUA 3G8BA 2ZVJA 3TKYA 3V97A 3UJ8A 4A6EA 4U7TB 3G2QA 1P1BA 2AS0A 3A7DA 3LSTA 3M4XA 4RVGA 4YV0A 5K0FA 4CWAA 1WY7A 3DXZA 1O54A 3GRZA 4RYLA 3UBTA 1R00A 2YX1A 3KPUA 4OX9Y 2ZULA 4M38A 3PX2A 5EKUA 3P2IA 1RI2A 1SQFA 4FSXA 1O9GA 1RI5A 3P9KA 4PCLA 4QVKA 3UFBA 3EVBA 2AZTA 3KQPA 3ER8A 1QYRA 2Q41A 3EEYA 3H2BA 2P40A 4R6WA 5G02A 2ZIFA 3FYDA 3PVCA 2IDJA 3GGDA 5E1DA 4E31A 4XCXA 4HSGA 1JSXA 2VDWA 5DT2A 2UYQA 5KS2A 3NVKI 5DSXA 2OO3A 4MQ4A 5DRYA 4EK9A 4HG2A 2EFJA 1JG1A 4P7GA 2Y1XA 1X1DA 3B89A 3E23A 1EG2A 3KQYA 3A27A 5IH3A 4RTQA 3M6WA 2GLUA 3LCUA 5BW5A 1YZHA 4AUKA 2JH9A 2WK1A 5ERGB 4KDCA 1F3LA 1XXLA 4F84A 5DWQA 2JHAA 1D2HA 2ZFUA 3O4FA 3UJAA 5CVJA 5DLYA 5DM2A 3NWBA 4DKJA 2QE6A 5ICGA 4FSDA 4PWYA 3KQVA 3U81A 2XBMA 3DMHA 1I9GA 5K05A 4YUWA 3REOA 3I58A 5LQKA 4AZTA 1JQEA 4MTLA 2P1DA 3GDHA 4E2ZA 1X19A 3BWCA 5GIPE 3T7SA 2IFTA 1TW3A 2NP7A 1QZZA 1XDUA 3MAGA 5DTRA 5B1SA 2H00A 3MERA 1TW2A 5EC8A 2B2CA 1DL5A 2C7OA 1ZGAA 1SKMA 1L3BA 4ER6A 1NBHA 3B5IA 3BWMA 2V74B 3GWZA 3T7TA 1X1BA 3OPNA 2P3QA 3NW9A 3Q7EA 4PIMA 1FPQA 5HOQA 5EZSA 2HMYB 1Z3CA 5GWXA
chains in the Genus database with same CATH superfamily
3KJQA 3VMMA 3LRTA 2Z3WA 1TXGA 1XXHB 2EF0A 3DT9A 3LC2O 3NDJA 5DIFA 3SQLA 2VEDA 2YZKA 1XE3A 4EHAA 4NRDA 5BNZA 4BCDA 4QLAA 3WOHA 1G7RA 1JECA 4X8OA 5JAZA 3UM9A 1I7LA 3CF4A 3LECA 1XT6A 3T9AA 3UHAA 2B5OA 5FDFA 3HJGA 2E3JA 3AUSA 4URZR 3UH0A 1JQ3A 3RJ5A 1L6RA 4J4TA 3D81A 4F7WA 2I67A 1QWOA 5H59A 3SBOA 5K0SA 1NVUQ 4B4UA 4E7OA 4X90A 1EVQA 3AEQB 4L0DA 3BL8A 5C1BA 4R54A 2ZG6A 1IRXA 4MI6A 4GDFA 3ELBA 3L84A 1X0XA 4BPBA 4O2AB 2JVJA 4RLQA 2ZREA 4YCSA 1NVMB 1Q1NA 2H2GA 4QELA 9GPBA 5CAEB 4A0HA 3B53X 1X3SA 2A0YA 1E3JA 4KPGA 4LGYA 3WFIA 4AJEA 2AG0A 2VPYA 1F14A 3DBIA 3T3PB 5H1YA 4D3DA 2AG8A 2M6RA 4X1YA 4PYOA 1L5VA 3I04A 1PRYA 3R0IA 1YUBA 2Q3HA 1CTQA 4OI1A 1L4YA 2XWJI 4GT1A 4ZHQA 1K06A 3PEVA 1PR3A 3BDVA 3HP4A 2BFEB 4RQUA 3THXB 1OIWA 1E6MA 1M33A 2QN8A 4R7TA 2G72A 3JQGA 4QU0A 4H16A 3AESB 1X38A 2ZDQA 1NE2A 4RV5A 3T4PA 1FFYA 5DTMA 2PRSA 2P65A 2WBLC 2IP4A 5MHTA 2JAOA 4D56A 4X3OA 5KWJA 4WFJA 3KK0A 3VPHA 1G5IA 1Y6QA 1BWQA 2VAMA 1X14A 3TGLA 3AJAA 1U1IA 3F5DA 3CRNA 2J9YB 4HX2A 4UMEA 2OD7A 5JAUA 1CU1A 3ESAA 3AO0B 1M2HA 1PLJA 4XQEA 4W5HA 4CF6A 3VU9A 2XZLA 1X7XB 3LO5A 3FR8A 3SNHA 2VH5R 5TGTA 4K9KA 2ZKIA 3IFSA 4F11A 4GZLA 4DEVA 4WLVA 4EY6A 3DF7A 5IM4F 4JV5B 2GPSA 2SCUA 1M6HA 2WF6A 2QAJA 3OECA 1ZCFA 3ANSA 4FFSA 5AJHA 1OROA 2EC5A 1N6PA 3EXFB 2LCFA 1UFOA 3GBVA 4HDAA 3CCCA 2O19A 2PDAA 1DIHA 1FJ2A 2TYSB 4LJ9A 2CXTA 3QVOA 2X41A 1V95A 1VE3A 2W2TA 4QIHA 4G01B 5EXDA 3A9WA 4PO1A 2B3DA 2C57A 2CMKA 2OCBA 3U4GA 1NNEA 1U8YA 3TSZA 5D7NA 3FFWA 3OFVA 2DXIA 4RKEA 1YC5A 1H2RS 2VDJA 3IAM1 2KE5A 3V4FA 3ZKWA 3QH4A 3BAFA 3C3DA 4NBUA 1MIOB 1JYFA 1I94B 3TEMA 3UWSA 1F48A 4MVJH 2OGZA 5E95A 1I7SB 3FTFA 2R8EA 2ZWVA 4FFOA 1PNOA 1C9MA 4DWVA 3C3EA 2JIOA 4R16A 1UZLA 3OZGA 2ZXEA 5ELLA 3C16C 3KZ1E 4NOKA 1RZVA 4PZAA 3A2MA 1RRCA 4LPSA 1J23A 1VB3A 2WNIA 3DBLA 4V2IA 1TL7C 1IHXA 3G0BA 2X8AA 1J0XO 4JXZA 2A5DA 1G3IA 1CR0A 5F3WB 4IIEA 1PHRA 4CTNA 3LP6A 3F8WA 4CCWA 3RU7A 2FR8C 3EZXA 4QGGA 4Y3UA 2Q3LA 5JZBA 1QE5A 2OFXA 5DM1A 5B7PA 2F8TA 4ASUD 5HZGA 2R1VB 4IJUA 4F9TA 5I8WA 2FAXA 1BGVA 3K8QA 4M55A 5FEUA 1J8FA 1H6DA 1VG1A 1CSEE 3DO5A 4E1VA 1M5UA 1TAHA 5KSWB 3SDSA 3EY9A 3K94A 5THXA 4B8WA 5DRTA 1ZM2A 2WR8A 3HCNA 4LJYA 4MEJA 1QJCA 4CKCB 2AR9A 1QHGA 3AP3A 4E5UA 4W6QA 3QWAA 3ROTA 3VKGA 2VSOA 3I9FA 3U6BA 5JS1A 1JEYA 3KZCA 1E5DA 5K3FB 5ITZB 3SQOA 4WNYA 1NW7A 3OY7A 4HH3C 2NQ8A 3RTBA 3TTSA 2ZWPA 5FB3A 1C1DB 2YQ4A 3I0NA 4TVKA 2NAFA 2PGAA 3QWBA 3AR3A 1D7OA 3AF3A 3NM6B 4HDQB 4WINA 4WZAB 3ZZNA 1FDVA 3ZDAA 1IN5A 1VCOA 5ALGA 5FA8A 4QREA 1PG0A 3N0WA 1M6YA 1MX5A 1YDWA 3EDCA 4NZ9A 1XRNA 1VYTA 2FPUA 2GK3A 2QP4A 3KJGA 4U0JA 5A3RA 2YXLA 1W36C 2H18A 3Q40A 2GCNA 1XZCA 1JJ7A 4XDHA 1FQOA 4BQPA 1I32A 2QJOA 4X1KA 4J2OA 2OBXA 1MQ9A 4CIXA 2AEEA 4QX6A 3IR5A 2IIQA 2R84A 3QYJA 3R09A 1ORHA 1YBHA 2C3MA 3SZRA 4WNIA 1SKUA 3W2EA 1WMSA 3FVWA 4OHBA 5FLYA 5JWOA 1U8XX 1N7JA 2P9ZA 5E6RB 1I30A 3STWA 4EKIA 1HTBA 2ISQA 2PNJA 4EG0A 5IULC 1J8YF 1AB6A 1C9EA 1AH2A 1SQGA 1IEQA 3ZU3A 1N6IA 4K6HA 4E3ZA 3MXTA 1CUCA 3S81A 1FBTA 4QUIA 2JIMA 2FE1A 1B8UA 3HZHA 2ICAA 3R7BA 1V9SA 1ZGBA 2R68A 5KYXB 4F3RA 1U7OA 1WCXA 4WUTA 3IX7A 2YY6A 1RQ2A 3ZLUA 4C6RA 1LBQA 3TPCA 1WL8A 3D3WA 1MOPA 1JDBC 1PFWA 5TPWB 3SK0A 2Z56A 2FPRA 1V26A 1W19A 2WHEA 2NYRA 3PUKA 1Z2AA 2BBOA 1N2SA 3M9XA 3D8RA 5TY0A 2HJ9A 2WPNA 1QGUB 2N1BA 4GWKA 1L4HA 1CRWG 2ZJAA 3UUWA 3CKKA 1U9CA 3K6JA 2QJTA 3VR1A 1PYGA 2VOEA 1I14A 4HYQA 1ADBA 2Y0EA 5CFNA 2C94A 5CLJA 1U4SA 4EAQA 3OUUA 3LLCA 4WEOA 1U2GC 4MINA 1E2MA 5CA1F 1UKVY 3BG5A 1B23P 3TRHA 1Q1AA 3QFRA 4ZZ3A 3RAEC 4RK5A 1PP4A 2Q5IA 4ZT2A 2C8JA 4CIVA 1D3AA 1N78A 1OBFO 1XP5A 3SQDA 2R6DA 3BQNB 3COPA 1CVIA 1G1MA 2NYVA 2O1EA 3MSXA 1W44A 2DAPA 4ZT7A 3UPTA 1UPTA 1UBEA 3UQZA 4O3FA 1YHZA 3VR5H 2YJNA 1U3WA 2FEWB 3BWVA 4E33A 2CT8A 2VWHA 2BSQA 3LXUX 4YQEA 1J0AA 4JNCA 1Z6PA 4R71A 2B8NA 1V8BA 4LF6B 4H1UA 3TOCA 3S7TA 4JB8A 4MQEB 5DHPA 3RDPA 4M6WB 3ENNA 4OH7A 4G3XA 4POAA 1ZCJA 3FSGD 3WIEA 4PTLA 4JOQA 2D8AA 4C3UA 1LKZA 1NLMA 3AM4A 1IDN1 1V6AA 2FE4A 2PSFA 1H4VB 1NXXA 3HO6A 3Q5EA 2NUTA 4LTNA 3UWDA 4EI9A 2IY9A 5FO0A 2X5OA 2V58A 2P5YA 1RYFA 2Z58A 1LH0A 3DMTA 5AYVA 3WWCA 3BD9A 1W1WA 2DPYA 4KXQA 1K7CA 3OIUA 1T4GA 1EFKA 3VA7A 3RUHA 3RVRA 1RXCA 1R6XA 3UFXB 1UZUA 4LWPA 1JKXA 1EJBA 4L73A 5EESA 1XRJA 5K0NA 5C51B 3GRRA 2I4NA 4TSFD 3BGSA 1QCCA 4UE3S 5GGYA 2XMBA 2WPDD 1J20A 1F2UA 2VYFA 5EP2A 1NVAA 1EP1B 3C6XA 3WGYA 4M1OA 1UJ5A 1ZL2A 3E9EA 3T9FA 3P9PA 1MVOA 3RQSA 3ZUGA 2PMBA 5IAEA 1MBZA 4LZJA 2Y71A 1ST3A 3BE5A 4YRNA 4C7OA 1JH9A 1SQSA 1FDRA 3I12A 4HVTA 4EHFA 5I45A 1QAOA 3CURA 1NU8A 4OL0A 2W98A 2AKYA 2X22A 4I6JA 1K9SA 1RIIA 2X3YA 4HPXB 4MYTA 4PGHA 2IK8A 2WUWE 3RBZA 4AB1A 2JEZA 3NBZC 3PFBA 5EWJB 3V8PA 4DMGA 1VMIA 1S9DA 2WJVA 3GC6A 3PKIA 3QVMA 3R4CA 4M8LA 4MAFA 4K46A 5AK3A 1D2NA 4G0XA 3TEJA 1ZMRA 1X92A 2HN9A 4WN3A 3V5NA 4QOSA 3ZBUA 3W5CA 1YZNA 3B85A 4RAOA 4RCZA 1SUDA 3TSAA 3A4VA 5D3MB 2BE7A 4WRRA 1E9BA 2G1AA 2IEBA 2ZJ1A 5AKZA 2DLCX 3EGIA 3H1EA 5BN3A 3FUUA 2C8LA 4KTTE 4DMLA 1BXRA 2GZSA 3AERA 3LH5A 1ZL0A 4C78A 2W4IA 5LMUB 1U94A 4EABA 5ITWA 5H83A 2BFDA 4XLTA 4CV3A 3FGOA 5JXJA 2A0XA 4YB8A 4HX9A 2WKSA 4AO8A 4PAMA 1NJGA 5H70A 3DV0B 1G20B 4DREA 4LVUA 2KI5A 4JI8B 1E62A 1QX3A 4QDJA 4X64B 3KZNA 1ZOIA 2XNJA 2IXBA 1NNUA 3KG2A 5KDOA 4JR0A 3PWTA 4Y6LA 1IN6A 1L9XA 2JLBA 1N2CE 1IQRA 1T34A 1RQRA 2D3WA 2QG4A 2I3DA 1QNFA 3R40A 1TYCA 1EWTA 1HTWA 1WXHA 3G89A 3OZSA 4L7QA 5ALWA 1JN0A 5SY9A 3TX2A 4KFCA 1GNVA 2Y6UA 2HQ1A 2QN2A 3NP7A 3DSRA 2VUSA 4MJ3A 4RJ2A 3RK4A 3VKUA 4CM8B 1BTOA 1QVAA 1Z0FA 3H4MA 1NLUA 4URWR 4ENSA 3LFHA 3ZE1B 4TWZA 4REQB 2H1LA 4EYOA 2OYCA 3L3BA 2B7CA 4G24A 5GMOA 3HXMA 3ZWOA 3HA3A 4R2WA 2JBHA 4OEHA 4N54A 4K7JA 3CLTC 3ROMA 3LQ1A 1EUCA 2PRJA 3ASYA 1J97A 3SR0A 3V4ZA 1AHHA 2GHQA 2Y1OA 4X7BA 2FRDA 3EF1A 6PFKA 2Q6VA 4LXQA 4YECA 3VM6A 2H5LA 1PSWA 3C6BA 1OZHA 3A25A 4NFLA 1YS6A 4F4IA 4HH1A 5DOZA 4E2FA 2VJYA 1JDBB 1HDGO 5JH7A 3IL2A 2F55A 2AZMA 1B2RA 2QL5A 3OLYA 3MTAA 4ZVKA 1F20A 5AW5A 3UJ6A 3LO8A 3PXXA 4F9EA 2WT9A 1QO0A 5K45A 3E05A 4PLZA 1BU8A 2ERYA 1XJ0A 3QBVA 4BP1A 2XD9A 2GAJA 1O8CA 1MKYA 3K9GA 3LCVB 1T6XA 1BGWA 3COZA 4JA0A 1NUHA 2Q2VA 1UIMA 3DE7X 3MCVA 4WFKA 1BFKA 5G0UA 3DHVA 2GZRA 1CY0A 2P9HA 2V5AA 3PJDA 4BPRA 4CM4A 1EAYA 4EATA 4JQOA 1Z08A 1BXKA 2CZGA 5B1HA 5ILGA 3TS1A 1AV6A 1SU6A 4F6RB 4HFNA 4QOHA 4TLMB 3BWBA 4E32A 1M72A 1OXKB 3AUYA 3CF6R 3N6VA 3PNKA 4JMLA 4LXHA 4BQRA 5K3OA 1RJ9B 2Q9CA 3TN7A 2QLBA 4DL9A 5KX5A 1CNMA 3AEZA 3MS4A 3T7AA 3T3MB 3OX1A 3QF4B 2NPOA 1JHQA 1YGPA 3M4YA 1JG7A 4Y2XA 4A6EA 2YMMA 1S3FA 1XYGA 1YI8A 3D4IA 1GLNA 2F62A 1UPAA 5JI3E 3ZZ0A 1N0UA 5EIBC 5CA0B 4NYJR 2IKSA 3C98A 3CONA 2WD9A 4S35A 2ZB8A 3ZWBA 3FYTA 1Y1SA 3HA2A 5EKUA 2GOYA 2F1RA 5BV0A 3Q1LA 2B8EA 4BO5A 3GGGA 3AVWA 2G67A 1SBNE 1GIAA 1PU2A 1Z5PA 3I9V6 1IN8A 1VPDA 4HS9A 5TQ0A 5BSFA 2D0PB 3I9KA 3GGDA 4F04A 3UXEA 3FHTA 1M54A 1NIPA 2NSHA 3PNVA 1B00A 1Y1PA 4AJ9A 5HRCA 2X9VA 1MJ5A 1ODIA 2RGCA 4WL0A 2G7ZA 3V4VB 4EK9A 2YW9A 3O8BA 4L0MA 3RRZA 1U6IA 5REQB 3ZD6A 1XZAA 4JLDA 2XVXA 3M6MD 2QK4A 2MMCA 1PL7A 2GKSA 2W42A 2ZM6B 1SD5A 1UMCA 3RVBA 2A9PA 1RM0A 2FY8A 3LPAA 3N2YA 4PAQA 1JJVA 3HV0A 1C0PA 4RL4A 4DKJA 1NJ8A 5DGDA 3RV3A 5C32A 2EBHX 4PR0A 2XRZA 3ZCUA 3PIDA 5DN6D 1HDEA 1E3WA 3PJEA 4MVJF 1I9GA 4C0SA 1E6EA 1P5ZB 2IHBA 1VBMA 2ANBA 4XZ3A 4R41A 3PD7A 3M4JA 2DFNA 2ZBGA 3LCJA 4D5GA 1EXVA 4TLLB 1W6UA 1VKRA 1ZOOA 3K70D 3VR3D 2B7BA 3QI2A 4J7AA 4LJ4A 1E0AA 1MX3A 2CLFB 2IFTA 5ADVA 5BNFA 2YC4C 1GRQA 1KY4A 1N7GA 1VPVA 4D2IA 1GNPA 2AJLI 4C87A 2AC4A 2A3NA 4QULA 5GOTA 5JVDB 2FWBA 3LY5A 4EEZA 5C35A 2GJSA 2QBYB 1KMIY 2OLKA 2W90A 2CNWA 4KXNA 2TRSB 2VOJA 1BEUB 1MA0A 5GY7A 5IBCA 2XAAA 3NW9A 4CLOB 1FUIA 1LZLA 1DEKA 2AQIA 4UAGA 4NBLA 1N5DA 4EUNA 1BXRB 3DNPA 4MR9B 1O5IA 2VUTA 3QFFA 5IMBA 1A4XA 1TI7A 3KDSE 4JGGA 4LBWA 4JI1B 3SC3A 1F7VA 1VYVA 3WA6A 1JAYA 1IBKB 4LY9A 5CX4A 3T9CA 3HZRA 4RTSA 2WW8A 4FMDF 4MZXA 4IDDA 3CN9A 2VDWB 2QSJA 4UAVA 3A1VA 2NG1A 3Q4GA 3BSYA 2NNWB 4FFBA 4ABTA 2WYIA 4UM9D 3SYNA 2F9FA 4M0FA 2QW0X 1IOZA 4DMUB 3MW8A 5IF3A 1NXSA 4NULA 3WB9A 1DUSA 4LWOA 4IGIA 3AG5A 1V16A 1KO1A 3GEIA 4GHWA 4GWLA 1B6SA 4M0DA 2J87A 3A58B 4QSHA 3I6BA 5J40A 1F8YA 3CC8A 4B4VA 3IQIX 3LBFA 4G4SO 3CUVA 1Y98A 2HQOA 4MS1B 1BCRA 3JV7A 4RK6A 5K6AA 3GG2A 4MV9A 4EW3A 1YCFA 1GQRA 1OBHA 1W0KD 2HWUA 1Z17A 4FR2A 1P39A 1KVUA 4NWIA 1HE4A 3W90A 3PNOA 3CX3A 4WFIA 1N5OX 3NTQA 1NVDA 3NKLA 5C3MA 3ADDA 3FI0A 1GUBA 1OLXB 3WGLA 2FFBA 3FLAA 4NFHA 4FCWA 5E4JA 1DJOA 2QRKA 4AY2A 2HJRA 3OZFA 4F56A 2GD6A 2G8LA 2R11A 1Z0DA 3K05A 3ODPA 1NR7A 4GQAA 1UKYA 2ILTA 5E6UB 5EUBA 4BE9A 3TOSA 4WXYB 1GNLA 1M1YA 5B3JA 1OH8A 1COZA 1V39A 1X0VA 2X3FA 1NQ5A 2ADOA 4EGSA 3QTBA 1US8B 5KMGB 4OFWA 4GC9A 3R9XA 4O4HA 4HUQB 3AF4A 3WWDA 5H3CA 3Q3HA 2C9CA 2IHJA 2QPLA 3UAWA 3K4QA 4LXUA 1DRUA 2NNLD 4G5FA 1RWPA 4ND2A 3WGTA 4B3IA 4D8VA 1K5GA 2O2EA 1Q2UA 3FUVA 4L08A 4PW0A 1JV2B 2EX1A 3RVSA 4QYMA 1THZA 2Q3JA 3I01M 2ZSIA 5HTKA 1YI0A 2CYCA 5DF1A 1OVGA 2A58A 5FWNA 4JI3B 2REOA 3SC2A 3MA0A 4V0SA 2HV8A 1YK1A 1TJNA 2GWHA 3NBYC 2WTXA 2OK7A 3OA0A 4GRIA 4PFKA 2DTEA 1OPRA 4ROTA 5JQWA 5CM9C 1R9JA 2KS6A 5WRFA 2W4MA 4H6VA 2B4RO 1XTKA 4NV3A 3LKBA 3NRBA 1EHYA 4NCNA 1GT91 2AOVA 3D2LA 3HUTA 3WV4A 3Q7RA 3W7AA 4CM6A 3EJ6A 2ZT7A 4L5BA 4RY2A 4DNXA 2W0MA 3JZAA 2M98A 4I6EA 3UAYA 1JLRA 2H51A 3I2FA 1XCGB 3CRQA 4V0ME 1KK3A 1L7MA 1SC3A 3KUCA 3R0QA 3TRFA 4XI9A 1AUXA 1YR1A 3ORYA 4N3AA 4NENB 1CIJA 2O14A 2EKPA 1TCCA 1CZOA 3CXUA 4HAIA 5A4FS 1MFZA 1VL6A 1E92A 3OX3A 1N3IA 3OZRA 1P2UA 5EMKA 4PQYA 5HFJA 1L5GB 4C04A 5B7QA 2B78A 5CM2Z 3AEUB 5BRJA 2I3GA 2WTMA 4IV5A 1NE7A 3ECAA 3SIXA 1Q3TA 5HJ2A 4BNLA 4DCPA 3GJXC 3WR5A 4LF9B 3TQSA 1COWA 2VP9A 3GDWA 3NUZA 4GLBA 1WMFA 3RTGA 4EIWA 4KBYA 2RAFA 2AFHE 2HTEA 4HL6A 4WN9A 5KOIA 3UWOA 3MRSA 2VDUE 3GZNB 2QWXA 2ZATA 5E4YA 3W3AD 1X2BA 3NT4A 1PWHA 4F2DA 4P0TA 2XXBA 5HX7A 2FSHA 1ZX1A 4X1OA 2IYQA 3NJ8A 1AA6A 4AAYA 1I2DA 1R64A 2HFKA 2P9EA 3T95A 1YZTA 1K8YB 2CLLB 3ZZMA 1NQUA 3R7FA 1W5AA 4QFBA 3F3YA 2QZ9A 3AFHA 2O2IA 3KLBA 3LL7A 4G07A 4Y9RA 4BV8A 3AFMA 2W43A 3S70A 1W30A 3ZKWB 1P44A 5KIAA 3LQRA 3C45A 4IDOA 3QU7A 3T54A 1EZZA 3PGMA 2FU5C 1XD2B 4FJ0A 4RIHA 3ZKAA 5AUOB 1QAMA 2C5FA 3P2KA 4N5LA 4D9BA 2P6UA 3IVCA 4JROA 1H4TA 5CCEA 4JBLA 3JAWB 4YXWA 1GZSA 2GLTA 2YIJA 3OKFA 5DBFA 5KU1A 1TVKA 4QBFA 5D85A 5GM2A 3DOUA 1Z25A 3TQTA 3P96A 1OMOA 1XVVA 1AKQA 1VLJA 1C9YA 2ID9A 4GFDA 4QAQA 3SXPA 4AY4A 4DYVA 1MP0A 2DEUA 3S40A 3TKAA 5ICMA 2AR7A 3GYBA 1SXGA 4I4IA 3VGJA 3JSAA 1B0PA 5JCOC 1VLZA 2H1HA 3O8RA 5MFPA 4MRSA 1DFIA 3G7NA 5I48A 1ZVMA 2GJAA 1RD4A 3IQWA 4LC0A 3DXXA 1VLLA 2D3TA 4WY2A 1TAQA 5BYBA 2FG7C 5IBQA 3DCJA 4RDXA 2XUFA 1KOJA 1FMTA 4JJEA 2YR0A 5LQDA 1X2EA 3LVFO 3M0EA 2AQ8A 1CUGA 2A86A 2I7DA 3OT5A 4V1CB 4MDFA 1JDZA 1M2JA 1KXZA 1T0HB 2A1UB 2NXCA 3EISA 3PHJA 2J4DA 4FQ7A 4ZD6A 4BJ5A 5DLQC 3A37A 2G6TA 3MBOA 2LCIA 2BGWA 4FT4A 2P91A 3OETA 4CEHA 1GZHB 1XKXA 1EGAA 1AS0A 1KHTA 1HDOA 1OGJA 1Y42X 3LY9A 4PC1A 5U1PA 1RJ9A 4IX9A 4EQ6B 4KGZA 5HMMA 4K2AA 3C6QA 3NAZA 3GVCA 1RRFA 1AT1A 3S6JA 1CJBA 4C3OB 4S24A 1IY9A 1NC3A 3BERA 3LJKA 4IDGA 5E9WA 3U26A 1AXEA 4WXRA 4WVLA 4DDUA 1E6UA 4LQDA 4F93B 1UC9A 2JAUA 3BMCA 1UCFA 2J1LA 1JA1A 3DBOB 2EIHA 4MULA 3CA8A 2AVDA 1CUVA 3AP2A 4BNWA 2ACWA 4EWLA 3NHZA 3MYRA 4IHAA 1OFIA 2V6FA 1FS5A 1T35A 4NJEA 4V2UA 3UB2A 4CIAA 2P7IA 3ICCA 4TKUB 1TEXA 5AJTA 1UINA 3Q7QA 1K0FA 3N87A 4DLWA 3BB4A 4FDAA 2AFVA 4MAMA 4YT5A 1A5AB 1KI3A 3EG5A 4J1SA 4JJAA 5BOSB 1DC8A 2HZ7A 4GUDA 2HMWA 1E9CA 3SM3A 4HZUA 1JA0A 2HGSA 1XMPA 4QPDA 3IRUA 3O4GA 5I6DA 2MOKA 2B6NA 2HZBA 3ZE8A 4CL3A 4FWTA 2UV8A 1C29B 2PWYA 1QFZA 3MEQA 4LVOA 3SXJA 2BEUB 1K63A 1SCIA 1BOOA 4DYHA 3DZHA 3IIIA 4JQYA 3HVUA 1Z18A 4P82A 4Y2PA 1NONA 2ZIAA 1MA3A 1O7JA 4RESA 3Q7IA 4RIGA 2JJ1A 4M8NE 4UE6A 4IIJF 1W75A 1Y8RB 3JALA 4LXXA 1FLDA 5C8YA 2EQ5A 4B4DA 3FCOA 1B8VA 1O94A 1W0CA 2WIBA 2BSXA 1LBIA 1A9XB 2GTIA 4MW2A 3AY3A 2X0JA 1HT0A 3CMMA 3M6AA 4IS3A 5JARA 4EKEA 4ZYWA 1EE1A 4M4SA 1MT0A 1NF2A 2OHJA 2WFZA 2V7XA 1YNSA 1BKYA 4TWJA 3N8IA 2H92A 3NOXA 1G8FA 3QPDA 1IZZA 3H2HA 3USZA 1V0JA 1K3UB 4EI2A 1V1MA 1IJEA 4S0XA 1NP7A 2PEYA 2WA1A 3HKBB 4WJKB 4YJGB 1EUZA 2HU2A 3MWDA 4I50A 1RYNA 4RZ3A 3U7FB 2JFVA 2GM9A 5CIQA 1GZVA 2P2CA 5CP8A 5DDIP 4XSGA 2NZXA 1X87A 3HWWA 4YMIA 3A4IA 1CERA 2JGKA 5ALUA 5ITVA 2QVCA 5C1PA 4RXUA 3T3EA 5IAAA 1F06A 1IBCA 5ILQA 4RHFA 3ET5A 1RDFA 1KJ9A 1YR2A 4UHCA 2VA8A 1UZMA 1N33B 3T8YA 1NXQA 1AXGA 1SVIA 2V6BA 3AY0A 5J2TF 3DCYA 2OE2A 4RV9A 3MT7A 1B1CA 3RRFA 3DULA 5LLSA 3BIWA 3KLOA 2CHQA 2VTBA 3AUAA 2ZWIA 1D6JA 2RH9B 4PO3X 3R23A 1ADCA 3IDFA 1EBFA 1TM2A 1PJ2A 3OZ7A 3C6ZA 4QODA 2ZQYA 1N1EA 2C2ZA 1T4DA 3DP9A 3NHPA 3LUCA 4PG5A 4RS4A 4U8HA 4DV6B 3W1EA 1DT5A 2Q8PA 1FYWA 1ZUHA 3E61A 3L18A 4KX5A 5BXQC 4R2MA 4NIMA 1N5JA 3ESDA 2Y05A 1G3QA 4D74A 2NU9B 3GVIA 1V11B 4HEQA 2CB0A 2NUTB 3P7MA 4BNYA 1LPOA 3I8SA 2P6RA 4WZAA 2EATA 1O1YA 4N12A 1MOSA 2E4ZA 5AIAA 4EELA 1IB6A 1RTKA 4NQRA 2YWFA 3AX6A 2QPOA 1WLYA 3GOHA 3KYBA 3NBFA 5K0GA 1R8JA 4UVIA 4M7RA 1PWYE 1FB5A 1AGYA 4OAPA 1NPTO 1QV9A 4RPCA 4W5OA 1DAOA 3L7JA 3IE1A 4ETWA 2J07A 1IY0A 1E59A 2BZ0A 1SXJD 1ESEA 1SZPA 1ZCAA 2W2OA 4J7XA 2C5LA 2RDMA 1VIVA 1A88A 4LSMA 1NNI1 5KZMB 1DBIA 2I6GA 2HIHA 2A78A 2L82A 4V03A 1KO5A 4D0GA 1ZQ1A 1EDZA 1JQDA 4GBMA 4WBNB 4F9FA 2YIDA 3ESQA 3K09C 3SIPA 4B75A 5F64A 1ODLA 3ZS8A 1Q6YA 3LT1A 1IWOA 4QJ4A 4CKWB 4N0DA 3A05A 3U5TA 1NOKA 1CS4C 4KAJA 2QRJA 1DKRA 2CDCA 2VH2A 4LCBA 5BV1A 4IHKA 1R3UA 2IQ5A 3O91A 4HAXA 5AKGA 3HNRA 4YA6A 2EHDA 5LJIA 1C2TA 2R8PA 3V4RA 4RUKA 1Z63A 1HFEL 3MJDA 4Q21A 3HY3A 5CDTA 1UZAA 1SFRA 1UKZA 2WICA 3KZXA 2QORA 4AMVA 1W2HA 3GLTA 3W5JA 1V35A 2X9NA 4EO9A 4I1RA 3ZG6A 3BX1A 3ICVA 4DR3B 1OR8A 4JC8A 4RZSA 4HO1X 2K7ZA 5KKCA 5L3VA 4HB0A 2O59A 3GGOA 1BN6A 1P4JA 3OX2A 1XNHA 1ES9A 1XZ8A 3L7DA 4YFYA 1H6CA 5IKXA 1EI9A 3F71A 4FE4A 1G2QA 1QRAA 1SJ9A 5DNDA 4O3MA 2VI5A 3D43A 2B8TA 3G2MA 1X7GA 1UQRA 1YZGA 3CH4B 4LHXA 3F74A 4DJEC 4EJSA 2QQFA 4IWYA 1YRBA 3AMVA 3KV1A 2DHCA 1GPWB 3VV3A 3HFSA 2C42A 4FE7A 4JR2A 4CR8A 2AT1A 3UJ8A 1MXHA 2KB0A 4GI3A 3CUWA 3OFND 1FYXA 2FPMA 1Z36A 2QT1A 3OQJA 4Q4DA 3NRJA 4RYLA 2V7QA 1W29A 2X9GA 1I3OA 4N3GA 3SEAA 2HA6A 2XTJA 3RKRA 4CDNA 3CKYA 4CE6A 4BWFB 2RMKA 1OBVA 3B6IA 4GIBA 4MCHA 3V46A 2CLKB 4PFJA 4R6WA 1XTRA 4YJFB 3ZEAA 3DKIA 4ZCTA 2FDXA 2JJ2D 3SDBA 3V4SA 1U5CA 1PNVA 1AA9A 3PFFA 5KS2A 4RPLA 1QUEA 4AQDA 4LPKA 2HSEA 2NZVG 5K8JB 2QS9A 1JR6A 2HNAA 1GTVA 1NT4A 1VJRA 2W4QA 2X4GA 4LZWA 5LP6A 2HU7A 2XCOA 2JJ8A 4YDQA 2NX2A 3N39C 3K70C 1YIOA 4CMAA 2I1LA 1A04A 3EUAA 3H8JA 4TRMA 1C2YA 4EW6A 2XVYA 3ZVKA 2BFPA 4UCQA 1RWWA 3QLVC 3DFKA 3Q7TA 3V4PB 2HT6A 3DBRA 2P3SA 4J7CA 5A9TA 3LX8A 4GXNA 2IQIA 4K6FA 1GRVA 4PWYA 4EL0A 4RO0A 1PFUA 1R5NA 5BVGB 2YASA 4U7HA 1GUAA 3A70A 1NMYA 1DINA 4O4IF 1EZ1A 3FSJX 4W1PA 1POXA 4D57A 3AR8A 3HDGA 4D8XA 3ZE2B 3S7ZA 1ICIA 3QKRB 5JHHB 2ZRQA 1ZDMA 4XRGA 3DFFA 1N1MA 3MCWA 3T9BA 2P9FA 2F67A 2DLDA 3HADA 3TQFA 4B3TB 4M8IA 3ACCA 1FMCA 1J9ZA 1KERA 1OAAA 1R37A 1RXSA 3PL5A 5EC8A 1QIJA 1HL7A 3G8CA 4OB6A 4F92B 3CWQA 5IKPA 2VRNA 2QLTA 1DAMA 4J1TA 1CEXA 2GN6A 3SOPA 4EGJA 1T1JA 4B7CA 3SC6A 2XQKA 4Q1CA 3FZNA 2R00C 3Q85A 5EZSA 3QVJA 3IAFA 5A7HA 1GG2A 1Z3CA 2G9UA 2CXNA 2OO7A 3I09A 3U3ZA 3N75A 4DUPA 3I34X 2P2NA 2JAQA 2H5IA 1XZLA 2WWWA 3DW3X 3NHYA 1FLVA 1USUA 3PFWO 4R9NA 4R8SA 3W8RA 5EQTA 4EQZA 5HXAA 4Q4AB 4ZOLA 3STTA 4AX4A 2H2IA 1U0OC 1OI7A 3AB8A 3KFXA 1YB1A 2G88A 4G6ZA 2H6EA 4UFOA 4BV9A 3EZ6A 1UKBA 4KEAA 4B2PA 2NOAA 5LP6F 3GLFE 3CUEF 1A3CA 2PVPA 1TZJA 4ZYTA 5EWLA 4FGWA 3FOFC 1ZD4A 1IBLB 3WLOA 4JWKA 4JMPA 4WNAA 4FZ5A 1WCWA 1D03A 2E87A 1PR1A 1U1DA 1GPYA 2LVBA 1C3OA 1OLSB 2PKQO 2WU0A 4R3UC 1ABBA 4I8DA 5BXYA 1W0JD 4G8CA 2WYHA 2GM4A 5M29A 3OQOA 1BMQA 1U6KA 1GYQA 1NQXA 3GRPA 3G5AA 5IBPA 4D9FA 4IJQA 1XAJA 3N8KA 5JEEA 1QQBA 2UUPA 2PGOA 1DNPA 2AYXA 3IUBA 3LQKA 1IXRC 4M54A 2B4AA 2GRAA 2BFMA 3D5QA 2W22A 2J3JA 4BOYA 4YT4A 4RVFA 1C4WA 1ZN8A 3KOZA 4M7WA 2B7LA 4AK9A 3Q12A 2OCDA 4KRGA 2PEZA 3IMEA 5TE9A 5JJBA 5LNK6 4J07A 2QOEA 4MS4A 4QQNA 4EGQA 2C7QA 1G60A 3UPUA 1ZR2A 5B30A 3D3QA 1K8ZB 3IAHA 5KWEA 3BS4A 4CV2A 3GMTA 4MPRA 1A76A 1N6RA 1M2GA 4H1VA 2JW5A 4DVGA 4WI1A 4AKGA 2IU4A 3GPCA 4MV7A 2FXIA 3BWDD 2ZIXB 2CY0A 4W99A 3REQA 3DMDA 1GFSA 2FXVA 2SKEA 3PPYA 2HGZA 2FGKA 3S2SA 4MKGA 4CF4A 2WF9A 4EB6B 4CL2A 3LUDA 2AOTA 1QG4A 4A5SA 3HSYA 3CLUC 4X3CA 4D9HA 1NMQA 1B42A 1F8UA 2R25B 4TRNA 5AP9A 3BWEA 1EYZA 2HA7A 3DBHB 5FR1A 4H27A 2FRDC 4Q02A 2WJHA 1C7IA 1TU3A 5F33A 2AW3A 3PIRA 4HNRA 1PK9A 2E4XA 1UJCA 3MD0A 4MICA 5G4KB 1QHNA 1O9HA 3A1TA 3MQ2A 4ZQEA 3TLEA 3TQHA 1ZLYA 4CFZA 2H31A 2CV1A 2ZZNA 4WNCA 4B7ZA 3ZE6A 2J3HA 3QLVA 1QBKC 1DO2A 1KMHA 4KPFC 3R76A 4C7KA 4BEBA 4F4HA 1Y37A 4EI8A 3KKEA 4U7FA 1YK0A 1MO5A 1VFNA 1OUMA 2C29D 2VRCA 2PD3A 2WTBA 3I9NA 3GJ5A 4TS1A 5CUQA 1RWOA 4CFYA 5A5EA 4F5ZA 2IYFA 1U4OA 1R9NA 4L9AA 1HE5A 2QAGB 4PYIA 4N47A 4BBJA 5JZVA 1FP1D 5ALEA 3W1VA 2Z98A 1IHPA 5JDIC 4QDUA 3AM3A 3B9RA 4IM7A 5AJYA 3GJ7A 3ORRA 4JIMA 2Q6TA 4TTAA 5FUYA 2Y4OA 3WKAA 4KN9S 3AKCA 3TMKA 1Z88A 2BBWA 1NI4A 1P3Y1 2I4TA 1LLUA 2UVDA 3B1KA 3HGQA 2XWBF 4YCMA 3THYB 1Y4SA 2IZ1A 3R6WA 4EJMA 3KELA 4BXOA 1VHLA 2Z6VA 4KVAA 1Z0UA 3NIWA 4HQOA 4Y7DA 2HAEA 3ANNA 2J9GA 5B2ZA 4DAOA 5JMWA 1RXYA 4C76A 1CY7A 2ZR9A 2UZ1A 1P5JA 4WKPA 3RUCA 4UW9A 2H1SA 1D1PA 3DS8A 3E9DA 5EIFA 3IPAA 1E64A 4QYIB 1E3TA 1X1SA 4R84A 5TF0A 3S2FA 4YY3B 1UMCB 2NO5A 1J09A 1M2OB 2VJOA 3G9UA 3A4TA 4YAFA 2FEPA 3V42A 2CNKA 1IBSA 2GXSA 4WJLA 1Y9DA 3JAKA 2HHLA 4Q3NA 2X0KA 1TKAA 1CQZA 4K26A 2VNHA 1XZFA 4HXYA 3BGDA 1DEOA 1LLQA 3IPRA 4I5IA 4O4HB 1VBFA 1O0SA 4D25A 3H19A 3Q98A 1EFRD 2VSYA 4KFUA 3S28A 4B43A 2JI7A 3MJTA 1L2TA 2M6SA 2FDCA 5E0KB 2C2MA 2OR3A 1UAGA 5B6JA 2PPVA 1K6IA 1CQPA 2O3TA 1CS0A 2QLFA 4UEOA 3P2JA 1R2QA 5F1YA 3VR5A 2AYYA 3ADBA 4CODB 1RWMA 1NP3A 3BKXA 2UVPB 4JEMA 3TZQA 4N0PA 1JB1A 2JKZA 4EG6A 1QIHA 4Z5XA 1MENA 4RQTA 2GT1A 5BR4A 4PZ0A 3N2GA 4RD2A 1BNCA 2GPBA 3EGXB 1MB3A 1NLZA 4K9PA 3NPAA 4G1CA 2LBPA 2W2NA 3N0RA 4L74A 4WGGA 4EMSA 1UMDA 2PIAA 3ADKA 3NT5A 4HGRA 4XR9A 3SICE 5FNVB 4HAOA 5FI1B 3QPUA 3KB6A 1T8YA 3DEYX 3HI4A 1QHYA 4MW4A 4GXTA 4WEQA 1OWOA 4H3VA 1OTXA 2I6TA 2Q1WA 1GPDG 2BUAA 2CZQA 2RJNA 2VT2A 1O6FA 2EP8A 3IQXA 3G3EA 4P4SB 3VR0A 1AQLA 3ZDEA 2B0JA 5G4LA 4LF8B 1NFFA 1NFQA 1CP3A 2OBNA 4IIHA 1NUSA 1T5DX 4R8VA 4IDNA 4X6XA 1PK7A 1CUFA 4G9BA 2ZRLA 3CZQA 1CY4A 4OQPA 5K1ZA 5HZHA 1KTIA 1ND6A 2IT1A 1C1XA 3UT6A 4UOZA 5C5IA 5LR6A 2A9FA 5ELMA 4ZRNA 3EW9A 3KZMA 1BMDA 1RHKA 1RQNA 3GPDG 1CUDA 4PYMA 3VVLA 4FONA 4Y2QA 3BMQB 3A6FA 2B1JA 2CJFA 3A6JA 2P11A 3GP3A 4G85A 5K8IA 2DH6A 2GAFA 3IAM6 4L15A 3P2OA 4IDAA 4YROA 3WJAA 1N6NA 3LT0A 5B57C 1H3FA 2QD5A 3PD0A 1GNRA 2BRUA 2VPPA 1DMRA 4RZ2A 3DZFA 1JEEA 2G71A 2O5VA 3KKPA 5FOSA 4NZYA 3OH8A 2AI3A 3L0BA 2PGLA 5CDYA 4WE3A 3L8EA 3NOQA 5HA5A 1AB5A 1EINA 4ZVPA 1YRHA 4XQ0A 2AZDA 1JQ5A 4GI2A 2WAAA 3HKEB 1AZWA 4KQWA 5TMEA 4RK7A 3VOAA 4CM9D 4KV9A 2I2FA 4GI5A 3PHLA 4NBKA 2JGAA 1V9CA 3W6UA 3DOHA 4CR6A 3LWNA 3VC2A 1JXQA 2ERXA 3LBIA 1NYLA 3TBKA 5IASA 1Z7GA 2Y1GA 1ODSA 3RFVA 5CFPA 4JJFA 1UODA 1XMOB 4CQLA 1DXYA 3QM1A 1BDHA 3KJNA 2GFQA 4EECA 1NW9B 2GBLA 2GJ9A 2VHWA 4IV8A 5CVCA 1HNWB 3BCUA 1SUAA 3L6BA 2ZI7A 5KWIA 3GROA 1O94C 2ATCA 3L1JA 1M66A 4UULA 5DNYB 3MRTA 2CCKA 2Z5FA 5LXTF 3EAFA 4ZQBA 2B37A 3OFKA 3RBAA 3FCCA 1UK9A 3H4TA 1IK6A 2CLMB 2D8MA 1E2FA 1O57A 5HIMA 1VSBA 5LBIA 5BV2P 1R1DA 4ER5A 4G63A 4YI5A 4O2LA 1EM8B 3H5OA 3TUZC 1W5BA 5GONA 2ZYDA 1AXRA 5JV5A 1ML4A 3P9XA 3W2HA 3OJEA 3NBKA 1XAHA 1YQ9A 3ICOA 4PNEA 5EZQA 2IHNA 1U4NA 4RFSB 3STHA 4D82A 4L3OA 3SF8A 5LKRA 4MIKA 1KDOA 5J4KA 2PRIA 4JBHA 5HS4A 3ECSA 4CPDA 4OJMX 4ESOA 2R62A 5EHZA 4NH0A 4ZP1A 3ESYA 3GGCA 4JITA 4OAQA 1AS2A 4X97A 1USVA 2ZYGA 1TMYA 3IPYA 4J0KA 4WESB 2E49A 4HGNA 4XWGA 1G8HA 3HFGA 4TXNA 4UBOA 2FFHA 2QD3A 1SPXA 5CG2A 3K92A 4PS0A 2D74A 3UT5A 1NXVA 2JLRA 3DEZA 4D6YA 1JGTA 2GEUA 4BEVA 5T3UA 4ZGGA 2W2KB 5BV8A 3GZJA 6REQB 4I9GA 5IT5A 3N76A 1FTWA 4WT7A 3QEJA 2QIPA 3CF0A 3K0HA 2OCGA 2QUBA 2XOXA 4LJKA 3SFTA 1TE2A 4BAGA 4C14A 5A06A 3ABZA 1E5TA 4OYRA 5KQRA 5IUJC 2BHLA 4PVDA 3TLBA 4OV6B 1KXJA 1R5OA 4XFDA 3W5AA 2Q1YA 1Z13A 4RD3A 3DHNA 4BKMA 1YE8A 1WZ2A 2RB4A 1G1AA 3GARA 3FPFA 2XQGA 1P8JA 3H75A 3WZ2A 2Q1XA 3LOPA 1YMQA 3T34A 3RIXA 1Q3HA 4A4DA 5CLQA 3TVTA 4NV0A 1HMPA 3U3JA 2QIOA 2ZS9A 3QUQA 1VBNA 4J7UA 3CO0S 2Z6QA 4V3BA 1LJ8A 3OOYA 2I4MA 4GRAA 1CIPA 5ALZA 2XB4A 1YZUA 2FA9A 3DMFA 2JKYA 4ENWA 2CLHB 1F17A 1JPUA 2XODA 3OIDA 5JC8A 5KKNB 3NJRA 4GMXA 4DLPA 1WDTA 2XITA 4AZVA 5LVAA 2VT7A 1QSGA 4Y8VA 2FW9A 5BQXA 1J21A 3WRYA 3OWXA 3U9SA 1O95A 1XU4A 2Z2XA 3FPJA 4CV0A 4BP9A 1J8VA 1IXSB 4LN1A 3QVGB 4HN9A 1YJ8A 1FXWA 2C04A 3IMFA 4Y67A 3GNTA 4DJ5X 4IILA 8LDHA 5FNVA 1BDIA 3SY8A 3DGEC 3FCXA 2FMXA 2ORWA 5A05A 2OG1A 1EMDA 2REQB 4I2VA 2D1FA 3PHIA 3NFYA 5D5HA 4ZEXA 1L3IA 5TX7A 1TCUA 4RKWA 2WIAA 1P4GA 2OCPA 1FQKA 3AW9A 4R1UA 4Q9HA 5HE9A 2JLSA 3ENWA 4U3JA 2Q5QA 4B73A 1YXMA 3D6HA 3ZE0B 4BUCA 1Z83A 2WT8A 4OXNA 4Q9LA 4D0LB 2RI1A 1HOTA 5LXTA 5J2UB 1ISMA 5EQJB 2CVZA 1T2DA 2YXBA 4H0CA 2WQ7A 3DUWA 1SXJE 3VV2A 1I2CA 3HBAA 2AWOA 5JAMA 3M81A 1RQPA 4RWEA 2JI6A 1TJ3A 4GGPA 4CF5A 1GSAA 4DV4B 2WMNB 4D4KA 4EB8A 1EFPA 4V0RA 2QV7A 4LJLA 4BYMA 5JALA 4WXEA 4PG4A 3PNPA 2FJ0A 1WR8A 4Z3KA 4M1SA 4X60A 5JCOA 2J45A 3HXLA 1FFEA 1PEYA 4MCJA 4KR3A 4D5EA 1FXUA 5K3SA 3LC1O 4I55F 4E4RA 1K3FA 2RGWA 4X3PA 5LLTA 3HWRA 2HY7A 3JYNA 3LSYA 4F3YA 1TUEA 4LCJA 2EKZA 3QRWA 5LA6A 1AS3A 1UANA 4BUZA 2Y0DA 4ABYA 2RAVA 3U44A 1EA5A 3VDMA 5H16A 3U6KA 1AQJA 3THWA 1G63A 2Z3ZA 1A0OA 2ZIEA 4BP3A 1EXMA 5DX0A 2P9BA 3NC0C 3CZ4A 3OQIB 1HWYA 2BEWB 4EY5A 2HREA 4J0DA 3WO0A 1C3LA 2FP4B 4REQA 1IUKA 2SCUB 3D6NB 4PC2A 1F3OA 1RPAA 5JVDF 1H0HA 1J33A 4NZPA 3LVRE 1H66A 2X7HA 4MQFA 5F5NA 5FADA 5IK2D 2HMVA 3S5UA 2DWCA 1IVYA 1EBUA 1XR3A 3E5NA 2SECE 2K2WA 1FX0B 4KAXA 1TYDE 1UDWA 2JJMA 1FFWA 3MTJA 4LQLA 5K0FA 2AS0A 4HAZA 2RIRA 3EFOB 4YV0A 5KVVA 4CWAA 2D1YA 2Y1DA 4DA9A 4TMTA 1D8AA 2VVTA 3FHOA 3P19A 3NXKA 4FOSA 5KYUB 4TT8A 3OQ6A 4TKMA 2Y27A 5IXYA 1N36B 1VIYA 3KIPA 1YBFA 2CFRA 4DT1A 5KEIA 4B7AA 1DT3A 5G02A 1SWVA 1E5QA 4IH9A 4QOFA 1VI6A 3SQNA 3SYTA 3WGOA 3NFRA 3C5CA 4H6XA 5LQSA 4MW1A 2VR1A 2UYQA 2JIQA 2UYGA 3VYVA 1FNBA 5HCNA 1YQWA 4D3FA 2MCFA 3RASA 2EQBA 1N9ZA 4F5WA 1DWOA 3G85A 5JECA 3NAMA 3WLPA 1CV2A 2E1PA 1KU0A 3KL2A 1LX6A 3F2VA 4AF6A 2WK1A 2ZUEA 3EZLA 4N40A 2JNWA 1U1CA 3SI7A 4YGYA 3L5OA 3O4RA 3O6VA 3VNVA 2JHAA 1D2HA 2ZFUA 2ZSFA 4N4AA 3S2YA 1FVHA 2G9QA 1USGA 2JFUA 4Q93A 3R9WA 3GLGB 2HI0A 1AX9A 3L0SA 4JQCA 5LP1A 1BE6A 3U62A 3H8WA 3KCNA 2HEIA 1DARA 3ZLVA 3IV7A 5C18A 1TAUA 1L5ZA 1MF7A 2QEQA 3LQ4A 1JJFA 1N6KA 3MJVA 3HZZA 1G8KA 4NOJA 1IY8A 1O58A 1FRQA 1SKBA 3NC1C 1SCUA 5FNVF 4ZJPA 4BJ6A 3FDXA 1QONA 1M8FA 3H17A 3GDHA 4YCJA 5AOAA 3D3KA 3IIJA 1F12A 5GIPE 1N2OA 1Z82A 1ZMXA 2A5LA 3DKVA 4KX3A 5HUQA 2NP7A 3RYFA 1WD7A 1G9SA 4EYEA 2Y67A 3D1VA 4OJNA 4TLAA 2XMSA 2OHIA 3GELA 4O02B 2B2CA 3E9NA 3MIIA 5KJ6A 1S3IA 2XKAA 2J09A 3OQBA 3GWZA 1X1BA 3GP8A 1Q19A 3EFHA 3IA7A 4UVEA 5K7SA 2XHEA 2A4KA 3F5MA 1I10A 3L6CA 1GG5A 4NU0A 2VXYA 4LYHA 2MT9A 3L1VA 1OFGA 2IH5A 3EG9A 5GVRA 3BGIA 3V1NA 4ZV4A 3GFGA 4Q15A 2O8EA 3C5HA 4M99A 1A4RA 1RAAA 5ALPA 1B4DA 1CJUC 4JEIA 1QQ7A 4QUBA 1KY3A 3RVJA 3UGQA 4RVCA 1SKQA 2ZAIA 5A9SB 1K92A 4BU0A 1V3QE 4R05A 3F5FA 3JPYA 1KAGA 3COWA 3BJZA 2ZUDA 3N28A 4D3XA 1B7GO 3FYUB 1PV1A 2H3EA 5KTYA 3QBTA 5KBYA 3OD1A 3R7SA 3GRVA 1B6GA 2XA1A 1P7CA 1PFVA 1E2NA 2WYVA 3COSA 4DLUA 4FNOA 3ESRA 4B47A 3ZCQA 2I91A 4OA8A 5CFRA 2VK8A 1N0VC 2ZU6A 2VXBA 3BQMB 3FPCA 2WB2A 4JZKA 4NOMA 5DGIA 2HCFA 2FB9A 1VM6A 2W70A 5CT6A 3CCBA 4YASA 2IUYA 4KGDA 4ZI3A 2CK3D 2QPAA 3L2OB 5A5VA 4RVHA 1EE2A 1XBTA 1DIAA 4BFZA 5GIOE 2EG9A 2C7GA 3JATA 4DW8A 1IQPA 1P17A 3JD2A 3R5XA 4P34A 4L3WA 1RJDA 3OBIA 4GW3A 4PYQA 4YI3A 5KCMA 2AOXA 2CFTA 2DSNA 4I4TB 2ZCUA 4RZXA 4N01A 4LW8A 1V37A 2CLSA 1AGPA 2X4DA 3OCCA 4N6OA 2Q0QA 5I9NA 3PEYA 4KPYA 1CBUA 3MBIA 5FTMA 4BTLA 2VP6A 4JYBA 2VKQA 1TOAA 121PA 1F2TB 4HDSB 1WVMA 1ZOPA 3HVIA 1MC4A 2HA0A 4Q1AA 3HEAA 1B2LA 4AJ1A 4OLFA 3WXMA 5LXTB 4NMHA 4G0NA 4XVQA 3GHYA 2DWUA 2R1VA 3WGIA 3A28A 1A50B 3VI4B 4JC0A 4CZ2A 3T9DA 3JQ6A 4LXGA 2HU5A 2JZNA 3BB3A 1YULA 3FD8A 4RFSA 3FVTA 4B9EA 3H5VA 2HU8A 4G09A 4X6UA 5T6MA 3SC4A 4IGAA 4DMMA 1T6NA 2L42A 1FFXA 3HY4A 3HPRA 4K9SA 4EEKA 3QWHA 2QE7D 1P1FA 4DBLC 2JIZD 4I8XA 4LSZA 2CNDA 4BU1A 2W6JD 3DDSA 4D81A 2QXUA 3G1UA 4EO4A 4UD6A 5IJWA 2F6RA 1HGXA 2HBRA 4TLDA 1RADA 1NATA 4M1MA 2QMQA 1IHOA 3BIOA 3D3NA 3QYAA 4XM0A 1FVFA 2B69A 3L7AA 4JHXA 1D6MA 4EGAA 3KB1A 4BRZA 3BRQA 3VQTA 5DE3A 4DWJA 4M88A 2H2HA 3W77A 3ANMA 1N3LA 2B1RA 2NTJA 4ZOLF 3W9SA 1XFAA 1MNAA 3LZCA 1JEJA 1XD8A 4QM7A 3SAJA 2FNAA 5TLSA 1E58A 1G5PA 2GZ3A 2HJHA 3I3OA 4UBNA 3WRXC 2GD0A 4OI0A 4IQ4A 2C61A 1NJ1A 3GLSA 4FGJA 3LK7A 4MGEA 3KPVA 3GFOA 3K1AB 3KSMA 3ZWWA 1VGQA 4EDFA 5EWMB 2VBCA 4BRUA 4M9RA 2GPWA 4AMYA 3MC1A 1LDEA 1WW2A 3DZKA 4UKDA 1TVKB 4WACA 4Z9YA 2C7BA 3JQFC 2AXPA 1AUPA 2Y92A 2Y8EA 3BRWA 1U3UA 2F8LA 4GI1A 1Q21A 5K09A 3GQBA 4IDHA 1ISJA 3BGOS 4IFEA 3IMCA 1ZM4A 4L0QA 2BR4A 2YWEA 3JAMA 2XT6A 4MX8A 1J39A 1G8AA 1R27A 2QW1A 2QD2A 3P0EA 4N5DA 5GJVC 4A2WA 4GU5A 4CCYB 1M1YB 2IXFA 2X6QA 2RHMA 1WXWA 4FYWA 3T4UA 3ROGA 5IK2A 1QH0A 3UZUA 3CRW1 1VYUA 4M76B 3I6ZA 2DWQA 2ZJ7A 4C5BA 2DTDA 1XDWA 4PZLA 1J2RA 3Q6MA 1H0SA 4L76A 4CGYA 1P5FA 1PUXA 1ZOLA 4N76A 1ARZA 3AJ9A 3BQ9A 2DQYA 2EIXA 3VDXA 4GSYA 5E7JA 3LI2A 2O2HA 2BDUA 4LDPA 5KYTA 4P0PB 5TB5A 4BNTA 2VO1A 5EN4A 3N5KA 1I24A 1E1NA 1EVYA 1WHTA 2XWPA 5EE9A 4EYSA 3ZGZA 2L19A 3PQFA 2WIJA 2LPMA 5AVQA 2DBYA 4ZWNA 2IZ6A 2WWYA 1EPUA 1PLLA 1XRPA 1ZIXA 5D01A 5K6RA 4AROA 3UMGA 1NLFA 1YSCA 2BEKA 3I4LA 4DLNA 1LVHA 3AUTA 3G59A 4DABA 4XYLA 3EW7A 4RTOA 3KTOA 3QG5A 3UMMA 3GP5A 2IPMA 4O8ZA 3D64A 4MI3A 2OV8A 2VHQA 1NUQA 2GTPA 2Q7XA 3LBNA 4D9KA 4D0RA 1ZH0A 1JG6A 4J43A 2RGXA 2DY1A 1MT3A 2QRVB 1Z6ZA 4D6XA 1C50A 2YKGA 3C85A 1DCMA 4PWZA 4Y30A 2D2EA 3OIYA 4MW0A 4XWKA 2I3BA 5C0OE 2R6ZA 5CA1A 4K0KB 4E5MA 1W8DA 4DJFC 1KKLA 2XT0A 3T9EA 4KSBA 3DFUA 2EZ9A 1BAPA 2IUUA 4YDRA 1E3MA 3GA5A 5ICSA 4WOBA 1MOQA 4YT8A 1Y8CA 4UEWA 1XCJA 2IWRA 2KM1A 3K9LA 3S55A 1AG9A 3HV2A 1CF4A 2R00A 3FE2A 3VKHA 5GM1A 2GVDC 5B37A 3FNFA 4K9MA 1W36B 5LZ4A 3H9UA 3NGXA 1VCIA 3IEPA 1P80A 3HZOA 1XYYA 4EKDA 4KR6A 1BU5A 4A2CA 4IWNA 5LMCA 1M2OA 4DAEA 2FK8A 2YL2A 3CLSC 1P2GA 4JEUA 4LY3A 4UAJA 4DCGA 3GZNA 4JP8A 2NV6A 1A9TA 1H69A 2JJ2A 4ZREA 3V7FA 1I5RA 1TJPB 2DWOA 3EAQA 1HSZA 4ZEWA 1J0DA 4LBVA 1A69A 1XVAA 2BV3A 2GCOB 2IW3A 4NS1A 5B1IA 4EFLA 5BRAA 1Y8RA 1RTTA 5DI9A 1BD3A 3FNIA 1QO7A 1C0LA 1KBQA 2BPOA 2XJ9A 4TVOA 3BA6A 4UHKA 1G6OA 1VRVA 2GNAA 2PWZA 3LPNA 4P4UA 1ZKMA 1ENOA 1HE1C 3OFNA 3CEMA 3PJFA 2E48A 3UC5A 2R86A 1ZW6A 1NT2A 2VEOA 4MVJG 4JU9A 4FFRA 4UJ5A 4R0MA 4WCFB 4YRBA 2D4HA 2YZMA 4Q05A 4L8GA 1QTIA 5IJ0A 1TX4B 1DP4A 4JLMA 3EB9A 3IUMA 1OWMA 1C80A 1YOVB 3ER9A 2C78A 1THTA 3HDQA 1N6OA 2XCQA 3NDBB 3T1OA 4D8UA 3OF3A 3QF4A 1W4BA 4TTJA 3AONB 3C7KA 4B35A 4U2KA 5LOVF 2W71A 1K4MA 1P0MA 1KH3A 1FY2A 1UJNA 2ZYSA 4M0EA 2XMRA 5AVJA 4MCAA 4EFDA 3V34A 4Q1BA 3FGPA 1JDTA 4YJHB 4QTUB 2QTAA 4C0BA 2FR8A 2BLLA 1F8XA 1AUVA 1U98A 2PL5A 3T5PA 1SUIA 3BL6A 4C08A 2XBLA 1X1EA 1D0SA 3CNLA 1TM3E 1M8PA 4UM5A 5EXSA 4Q24A 2ZUTA 3T1VA 4RPHA 3MOSA 1DU4A 1NF3A 4PZYA 4UC0A 3UUGA 2DULA 3EMDA 4KSYA 5JDCC 4BX9A 2PKXA 4P7JA 2OQ2A 4AICA 2BJWA 2QTTA 3IIKA 4FPXA 4I08A 2DU8A 2GHTA 3B6MA 1NULA 5LN1A 4JJ6A 3PUXA 2ZCJA 4MXDA 2C4TA 1AY0A 2BTQB 2Z2JA 3V3TA 5AI6A 3WRVA 2V8OA 3SSOA 4HDCA 3RVPA 2WINI 2CEAA 1NUUA 1ZUWA 1UUFA 2DF8A 2ZR8A 1QPBA 2V54A 1KO4A 3FSRA 4GPTA 4XLZA 5BT9A 1ULHA 4EG3A 2DYKA 3B9QA 4ZVVA 3JQPA 3RS0A 4ILKA 2ONKA 1CB7A 3PI6A 1U9IA 4RXTA 3IP1A 3WKCA 2NMVA 2YFYA 4OHVA 2AXNA 2BJVA 2C4KA 2D1TA 2IP1A 1N2ZA 2PQ6A 4GE0A 4PVCA 5E3IA 4TKVA 3F9RA 3EMKA 3ESXA 2QMYA 5EJ9A 4R8MA 1HF3A 1O77A 4FZJA 5TQ2A 1F9EA 3DNFA 3T7IA 5F9MA 1F1BA 1HY3A 1N6LA 3BRWD 3ISJA 3KWFA 4JC5A 5TRTA 3V1YA 4M1KA 4DKXA 1NQWA 5KNLA 3VSBA 4F2GA 1H8HA 2IH2A 1KQ3A 5LFAA 1SRRA 1VJDA 3UK6A 1AQYA 4PN3A 3TJMA 1SBCA 2Z2IA 5EWMA 2IXTA 1Z37A 1ZITA 4LI0A 4Q3CA 2D5IA 1ZU5A 4DQ0A 4WA8A 4Z53A 1RNLA 3KQOA 1L7VC 2IZ5A 3SJZA 3OC6A 5JNWA 2WSYB 4FB5A 1TZMA 2VZEA 1H3NA 1TC2A 3ME5A 4NQZA 3FTPA 4NYIR 3UKDA 3BRCA 4RE6A 1V8ZA 3IP7A 4A9AA 4BQSA 4B7XA 4RX1A 2ZYVX 1YB2A 1MH1A 2CW5A 1T1IA 1PQPA 3A6DA 4JJGA 2UZIR 1FC0A 1E7SA 4LX0A 4D42A 3E7PA 1TIBA 4QUDA 4HVLA 2DB3A 3KX2A 2WLSA 4BUJA 2DC1A 2BFCA 5ALQA 4E1BA 4UTXA 2C2OA 2Q3MA 3RUPA 2FWIA 5FLXA 1ESMA 3HI6A 1KIMA 2FPLA 2I54A 2PZFA 2J5QA 1LZKA 3QPVA 1R0BA 2ZRBA 4KE6A 3G1WA 3I8XA 2XCRB 2XUKA 4L8YA 3EXG1 2QDXA 2YZ7A 3AVOA 4K86A 4EVQA 3QVWA 2YFQA 1QLJA 4Y9TA 1TT5B 1JYSA 5CA0A 3U7QA 4A7PA 1Z26A 3KYJB 1QIEA 4RH3A 3QJGA 3L1KA 1EP2B 3V1LA 3AESA 4W8HA 6ADHA 4FHZA 3E9MA 3E3AA 2G17A 1Y4AE 3HYCA 4ZT4A 1MC8A 5HGXA 1H5QA 1LSOA 1QOQB 1QYXA 2OILA 2ECOA 2FWMX 2PH7A 3AR9A 3K9CA 3K9NA 1WV0A 2X0DA 5JFOA 3ZDDA 1B74A 4QOGA 4E94A 2PUEA 3QSYA 3JQ9A 4K6MA 2VHXA 2XUPA 3MWDB 2Z8XA 5K6TA 1KO8A 2LDBA 4OXYA 4NXNB 5F9HA 1DTEA 1H2XA 5C8VA 1KZ1A 1LLFA 1U8EA 1W47A 2OM2A 2P4EA 2M1ZA 5U4XA 4K6CA 5DBHX 3O4VA 4YRIA 3H5TA 4FZRA 3WYNA 4R51A 1KFCB 3ORQA 1UBTS 3NAQA 4XA8A 1V8FA 5TPZD 3N2NA 1CJSA 1GGMA 5AFSA 1U2DC 3HLKA 3NGLA 3P9NA 2VF2A 4ZJUA 2QRQA 1I7NA 2Q45A 2VQ3A 1GM5A 1T9DA 3BHIA 3T3DA 2KBEA 4E07A 4CQNA 2DHQA 2I99A 4HYTA 5JDCA 1WSDA 2RH4A 1NSTA 2WUGA 4DN6A 4DUYB 1NM5C 5HRUA 2MSKA 1A5SB 5I7VA 4QDKA 4UMFA 2O0JA 2Y76A 3KYCB 4FFPA 4BECA 2BFAA 1AKTA 2ATXA 4RBNA 3K09A 3ZJVA 1RHMA 5FP0A 5C5DA 1WXFA 5LP6B 2CL5A 3OCZA 1UXGA 1E1LA 2B4YA 4G0PA 1Y4UA 3PJRA 4J49A 5KJCA 3CUUA 1EP3B 2GSDA 3HACA 1BXZA 3T1TA 5EJGA 1HZZC 2FUCA 2YMQA 4O6VA 2GAIA 2O07A 4FCVA 4XWOA 3LPLA 5CYGA 4R2LA 4FINA 2QZJA 2YHIA 2PZKA 4A91A 1XEWY 4IJ6A 4XX0A 2J6IA 2XGGA 4BNDB 1E94E 3C3JA 3AR5A 2O5RA 2FLKA 5DISB 2WV7A 1E7WA 4H7DA 5JSZB 2VNAA 3UBTA 3BFJA 5ESDA 2XX3A 1PAUA 3WISA 2ZULA 3PHBE 3ROFA 1C7EA 4XM2A 5CD9A 4Z2AA 3U4DA 4B6FA 5JLJA 4HAVA 4LQCA 3UFBA 1SH7A 4XOUA 3H4IA 2VRCD 1NY5A 1SZCA 5HR5A 3ZLJA 1BO6A 3EZ9A 4I7EA 4CMCA 1Z0IA 3FTQA 1GEGA 2LIVA 4DNPA 4FBGA 2J0QA 4L22A 4E31A 2WRZA 1JSXA 2B0CA 1H42A 3L4SO 4CNBA 1XROA 2IXDA 2Z1DA 3MLAA 4BN4A 4DV2B 4GPD1 2NT4A 4DQKA 3LAWA 4BGEA 1X94A 3BMNB 1ZA1A 4HNQA 4LEIA 5CFZA 1XNRB 2QMUA 2JGLA 3V48A 1WDKA 1ECGA 1IOWA 5ECWA 4YAOA 4Z4HA 1N8SA 5EIEA 1BHQ1 1NVVR 1SHTX 4HRVA 4Z99A 1SUCA 1P60A 3I6IA 1JFTA 5DWQA 3U3KA 4L8LA 3LD9A 3QG1A 1ZK0A 3JZDA 3PU6A 4AJPA 2LDXA 2YVQA 4B2YA 4QEKA 2BKLA 3ZU4A 4RL6A 1LXCA 4W5WA 3HYNA 5GTDA 4FYYA 1PR2A 3RHZA 2Y0PA 3L4EA 2BJHA 1SKAA 2GFIA 2I4LA 3HJFA 4O2BF 2AG5A 3AZPA 1Z4OA 5CYFA 4X00A 4LZLA 3WYGA 3PC3A 2CF5A 1XLWA 1GFZA 1JQEA 1JYEA 5A3VA 2BMFA 3K2EA 4K9DA 1ZGGA 4JK3A 1MG5A 3T7SA 1UOQA 1L5HB 5A3QA 1ECJA 1CJTC 1RMQA 4YRSA 4RVUA 5KYUA 3E9CA 3T52A 4I46A 1K86A 1OGIA 3DQQA 4FDVA 3TJZA 3IHKA 4ZI7B 2NVOA 4FN4A 1BHO1 1YDGA 4PCUA 4PHTA 2ZSKA 3B5IA 3WLAA 1DC7A 2BI7A 3JQ9C 2CXRA 3C2QA 3F4LA 2X4LA 2H1IA 1FX0A 4TKVB 1JZTA 2ORYA 3DO6A 3K0CC 2G9VA 3ABSB 3RIMA 1KTVA 2YYZA 3VNSA 5EPUA 4BNFA 1BMTA 3C1OA 1HC7A 2VKTA 1GHTA 4MHTA 4AI6A 1LI5A 3T61A 2P41A 5CJJA 1ZVKA 2FMUA 4FP9A 1JXAA 4L16A 5P21A 5ES4B 4IHJF 3LE8A 2ID8A 4XTCS 4HKTA 1S3GA 4ZICA 1RP7A 4FYVA 4IHQA 2HK6A 1E66A 3ETGA 3KHTA 1J5XA 4C4RA 4QTYA 1BDMA 4YLGA 2E37A 4DCSA 1RYYA 4PRYA 1RKVA 1RIFA 2VPIA 4I5FA 5BVGA 2E21A 2GEDA 1BA2A 1X7HA 2JGNA 2Z8YM 4UEQA 5LOVB 3IEUA 3A6PC 4E5YA 3DE0X 3QX8A 5FXMA 3QEMB 4LRTB 3GW8A 4CW7A 4ESVA 4M0MA 4U6NA 3WO1A 4X93A 4Z9XA 3U7QB 3WAKA 2C4HA 3VPGA 4H7PA 4D1YA 1FMLA 2XUIA 4LVCA 4DZTA 4QBIA 4HQRA 1HYHA 4WZZA 3C3BA 3DV0A 4OUKX 3L93A 5C7IO 4R2JA 3D6VA 5CT5A 3NTXA 3B82A 4YGXB 5HCUA 4BX3A 2I7VA 2V98A 1EE9A 3FZGA 3Q5GA 4L4ZA 2MYTA 3GLQA 5DOVA 2EKDA 4DC0A 3E2IA 4F5EA 4GR4A 1EVEA 3LU1A 3AEUA 2NV0A 2NPFA 3BREA 5AUPB 5INTA 4NAVA 2M6LA 4KYVA 2RHGB 3CX8A 1WD5A 4HWKA 3GY0A 3MTGA 2CCJA 4ZQCB 3PX7A 3GPBA 1R3DA 3URMA 2VJPA 1FFCA 2C2WA 1WAMA 2OL4A 3AVPA 1IN7A 4RA9B 1NJ5A 1FSSA 2HMSA 5JC1A 1E63A 5FHQA 2Z09A 5AW2A 3O1JC 1JJBA 1WVGA 3LWZA 4K03A 4EH1A 5KSPA 3DE3X 3LS2A 2Q6KA 3BIFA 1KMNA 2XRMA 5FA6A 1KY2A 2C31A 3FGNA 3DLPX 5DMXA 1U7PA 1KJNA 4M21A 3W2IA 4BNHA 4H1HA 2ODBA 1Z15A 1OC2A 3BBPA 3O3CA 3BTUA 4RM3A 3N7UA 1QFSA 4P7KA 1KYXA 3F3SA 3TTVA 1WDMA 2N9UA 4NYIQ 4KTVE 2NZ8A 4RSGA 1YB7A 2I65A 5LYYA 1ECCA 3V3KA 2GHRA 2FHSA 1X7ZA 2C9DA 2QVYX 1QANA 3K16A 3P0JA 4QU5A 5JWHA 5HUJA 3OCXA 1I6LA 5BVHA 4KREA 4W82A 2H7VA 4E2YA 3DFIA 5K5EA 4G0WA 2X8JB 5ALXA 9MHTA 1JG4A 1PT5A 1OY1A 4DANA 3TR0A 1OXVA 1XZPA 2JLQA 4OQNA 4NATA 4CM5A 7ABPA 3LDHA 1JFRA 1G6KA 2WWTA 4P22A 3VOTA 4IDBA 2I6QA 4XDZA 4NCIA 2FSSA 1NL3A 4J9UE 4WUVA 3ONEA 2PT9A 5HF5A 3QXGA 5C8YB 2VPWA 1NBEA 4BNDA 1YAJA 4XVUA 2O2CA 2V7TA 2QI9C 4XRRA 3B38A 3QWFA 5FQOA 4MUGA 4NFSA 5K3CA 3QE0A 3WJ7A 4EGCB 5IVPA 2VK2A 5K3AA 4WKCA 4MV3A 3TLKA 3JTEA 2JDID 4B82A 2C2XA 1Y9AA 2WP8J 3A32A 2CSUA 3EEBA 2PFGA 2JAHA 4RCYA 3I72A 5BSMA 1MU0A 1MC5A 1SBZA 2ASEA 2J5XA 2ZUUA 1SCNE 2COKA 3R4VA 2WTEA 4I50B 3DD5A 4OY3A 4COKA 4X44A 3OPYB 4TYMA 1GAWA 2OFWA 1KYIA 2F9LA 1NR5A 4FN5A 5EIAA 1H4SA 3NV7A 3U4QB 3FDJA 4OHPA 1GV0A 2XBUA 2A5GA 3KVYA 1ORVA 1U0HC 3I3SR 1ECFA 3GLFA 1CK4A 3TUIC 1C7ZA 4M53A 4GC5A 4ZU3A 1KYVA 3EXG2 1LPAB 3AWIA 4C4XA 2N46A 1DKOA 1E4YA 2F3RA 2NPIA 5FV7A 5BWOA 2IS6A 4RXMA 3ISVA 1ZBDA 2FF7A 2WNHA 4YMLA 1P2BA 4TSRA 3ECCA 3Q8KA 3EXHC 3U7JA 3A1WA 2IS4A 5AOBA 4F96A 1DIBA 1K5DA 2WEKA 4EMTA 4UDYX 4Q9KA 2JEOA 1N8KA 3EDYA