1ZO8A

X-ray structure of the haloalcohol dehalogenase hhec of agrobacterium radiobacter ad1 in complex with (s)-para-nitrostyrene oxide, with a water molecule in the halide-binding site
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
252
structure length
252
Chain Sequence
STAIVTNVKHFGGMGSALRLSEAGHTVACHDESFKQKDELEAFAETYPQLKPMSEQEPAELIEAVTSAYGQVDVLVSNDIFAPEFQPIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKRKSGHIIFITSATPFGPWKELSTYTSARAGACTLANALSKELGEYNIPVFAIGPNYLHSEDSPYFYPTEPWKTNPEHVAHVKKVTALQRLGTQKELGELVAFLASGSCDYLTGQVFWLAGGFPMIERWPGMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords halohydrin dehalogenase
publication title Structural Basis for the Enantioselectivity of an Epoxide Ring Opening Reaction Catalyzed by Halo Alcohol Dehalogenase HheC.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Lyase
total genus 91
structure length 252
sequence length 252
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 4.5.-.-:
pdb deposition date 2005-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1zo8A00
5GZ1A 4CUJA 2YDYA 4A0SA 4IPTA 2WD7B 1PJTA 1BDMA 4O5OA 3CMCO 4R16A 4CR7A 2PGDA 1NBOA 4JP3A 3KYDB 3WBFA 3FD8A 4Q3CA 1Q7GA 3IS3A 3TN7A 2GR9A 5HS6A 5A5FA 1JKIA 1FMCA 1P0CA 1PR9A 2NM0A 4HV4A 3FPLA 3RJ9A 3SVTA 1Y8RA 4YXFA 2Y1CA 2H6EA 3NDRA 4R5HA 4D41A 3GHYA 4DMMA 3MJVA 4HWKA 1H2HA 1FDWA 1P45A 3EZLA 1KIFA 3JQBA 3DAGA 4YT8A 3VPGA 3JYLA 5JC1A 2WE7A 1BW9A 2VWGA 1ZUD1 5CEEA 3E18A 2X9NA 4BL5A 2AQHA 5CDYA 3C3XA 1GQ2A 2JAPA 5I9MA 1XU9A 4HFRA 3I9MA 2Q2QA 4RPLA 3LLSA 4E5PA 1I2ZA 3QVTA 2D5CA 2X23A 5A1TA 1F14A 1KVRA 1ARZA 1PWXA 2VUSA 4OQYA 2X8LA 4KUGA 3R3JA 3RVDA 3ZWNA 3R3SA 3QVWA 1IHYA 3FPCA 4N5MA 4KWHA 3RC7A 3ZWAA 4CLOB 5B37A 4A73A 4FC6A 1M2WA 4TKMA 4TVBA 1SAYA 4MIEA 1TB4A 3JQ7B 2WM3A 1G1AA 3BXXA 3I5MA 4PLVA 4GSLA 2PFGA 4FSHA 2QYTA 4J6FA 1O8CA 3FNEA 1GZ6A 1ZKMA 4JIGA 3GNSA 3AK4A 4P4NA 3A06A 4UUPA 1FF9A 1SPXA 3DC2A 4XQGA 2HK8A 4BQRA 4KUEA 3RD5A 1IUKA 1NFRA 3PJGA 1EBFA 4MVJA 3ZHXA 4CM8A 2RH4A 3PP8A 3RUHA 4RGBA 3D7LA 3P7MA 4J1TA 3U49A 1A4UA 4OJNA 2EIHA 3GN2A 3ITKA 3MTGA 1CRWG 1DFHA 3PRJA 5C5IA 1ISIA 1PJ2A 3I9KA 1XHLA 4NNJA 1PTJA 4ND3A 1OI7A 4BO8A 3AJRA 2EV9A 1EQ2A 5GMOA 1Y8QB 2O7QA 4YTEA 4KZPA 4XYLA 3PWSA 3WJ7A 3KYCB 3ROKA 5A9SB 3L77A 3LF1A 4UUMA 1D3AA 2PD3A 1V0JA 1JDJA 1BXGA 4Y6SA 1WMAA 4NQZA 4Q3BA 4N5LA 5U1PA 1LSOA 3RUEA 1GCOA 1HSOA 1P1FA 2X5KO 3ZGYA 1BW9B 3H7AA 3HDHA 1KEPA 2DQ4A 1D8AA 2Q1SA 2VZ8A 1YVEI 4OKIA 4B4VA 2BD0A 4MVJH 3QV1A 3I4FA 1NNUA 1XSEA 3EHEA 4GVLA 1TT7A 2A94A 1X1EA 3WG9A 2H1SA 4H3VA 3LC2O 4E6PA 1LQTA 2UUPA 3FWNA 2NVBA 3EMKA 2CNBA 1VL8A 3ZWXA 4BGUA 2AA3A 4L8VA 4J7CA 4E2XA 2B69A 4NK5A 4ALKA 4PZCA 2C20A 1GZ3A 4UREA 5KOIA 1Z45A 2GF2A 4MIYA 1DHTA 3D3WA 4UVGA 3ZU5A 4NJMA 4L4RA 1HDYA 1J5PA 1NFQA 4E30A 1H9AA 2O48X 3D5QA 1SEVA 4LMRA 5COBA 4JP2A 3ZDFA 2EF1A 1K6XA 2W8ZA 1EVIA 3GEGA 4CM8B 2HMUA 4FB5A 4XGIA 4EJ6A 4FOOA 1H94A 1UDAA 3GY0A 4UUNA 1E7WA 3NV9A 1R0LA 4BNZA 2D3TA 5IZCA 3ANMA 3EZYA 3Q9NA 2JFGA 5T5QA 3WGGA 4IJWA 4RDIA 2GERA 3PVZA 1UXGA 1E7QA 3ZNPA 3JQAA 5GZ3A 3AW9A 1RM4A 4IM7A 2VWHA 2X1HA 2VHWA 1LC0A 3JQ6A 3L6EA 4EJ0A 1A27A 3FR7A 3MWEB 4P38A 3E5MA 4YACA 4IXTA 4TMFA 1GY8A 2HAEA 4NR0A 4CM6A 2OP0A 3JQFC 4KWIA 1I32A 5IDWA 4YAJA 3PHIA 3E03A 2NADA 1V3UA 4XB2A 4PIVA 1EDZA 2HUNA 1YRLA 1SOVA 2P4HX 2VCYA 4GQAA 2J5KA 4PLYA 4Q3EA 4ITUA 2PZLA 1XGKA 4DLBA 1J0XO 1CQIA 3T7EA 3QP9A 5TNXA 1LI4A 3I9OA 4I5EA 3KEOA 4JJFA 2EWMA 3WWYA 2XPCA 3BTSA 3VKVA 3WX0A 4GWGA 5G0TA 4CMEC 2HMVA 1RYEA 3PEFA 3KETA 2FSSA 4B8ZA 1P31A 2VT3A 5BNFA 3VPXA 2EKPA 3CINA 4Y98A 4TROA 5HS4A 1Y6JA 1LJ8A 2J5QA 3IKVA 4K26A 2HQ1A 3D3WB 5BSEA 4NJMB 2Q99A 4AJKA 1JWBB 3DXFA 3COSA 2J3HA 3JD1A 1H6AA 5JDIC 1U7TA 3WSVA 3V1YA 4XYBA 3ONFA 2QHXA 1K5HA 1O5IA 4RCVA 3WGYA 4IDDA 3UCFA 1FDTA 1HXHA 5JLAA 3VHRA 4BV9A 2OOSA 1QLJA 3HZZA 3V2HA 3ZV4A 3ETEA 1FK8A 2I3GA 2R00C 1NP3A 4BNMA 4I9UA 4NFSA 4IXWA 3R1IA 1I01A 3QA9A 2O3QA 3NDIA 3OQ6A 4MVJP 3C85A 4RDHA 3ZWPA 1R16A 3ZWYA 1EQUA 3VOSA 1I3NA 4BNHA 3OQBA 2IODA 3HE3A 2JCYA 1VL6A 3LC7O 2GRAA 4IBOA 4PRLA 3JQAB 1YGYA 3P19A 2PD6A 1GQYA 3EW7A 5AXBA 4DBVO 4IGFA 2CY0A 1GYQA 1PJCA 1MC5A 4ALMA 4BIIA 1JKJA 1QLHA 1XDWA 3L07A 4QX6A 1QP8A 2O3RA 1VPDA 3RKUA 2PKRA 2B5WA 4BKQA 1CWUA 4BO3A 1JLLA 1UP6A 3MOGA 3GRKA 1ZBQA 5DP2A 5I7SA 4D3SA 3VPHA 1HYHA 3I83A 5FFFA 1HDCA 1B26A 4XIYA 1VE9A 1J4AA 4U8GA 2D2IA 2Q2VA 3ENNA 2HMWA 2Y1OA 4RJTA 5EMHA 5AXDA 1VSVA 2NQ8A 5A4DA 4EI2A 2YY7A 3GMDA 3W4IA 3AM3A 3CMMA 2RHRA 2IDZA 3UOGA 4BMVA 3KVOA 1YWGO 2BFMA 2VTDA 3F3SA 5DN9A 3H5AA 5H83A 3TZQA 4F45A 3HN7A 1I5RA 4A10A 4JBIA 1UUFA 1ZSNA 4RPGA 1D1TA 1N7HA 1ISJA 3WWZA 1X0VA 1GD1O 1WLYA 3D4NA 4CM5A 3TOXA 5JNLA 4BNFA 1EZ4A 3PZRA 5JCJA 1XG5A 4E2ZA 1QRRA 1LDBA 3BZUA 3PXXA 1UH5A 8ADHA 3KZVA 4BGEA 5A02A 3AUUA 2YHIA 3KLPX 3AY6A 5BSFA 4J16A 3RC2A 1P33A 2CVOA 3DOOA 1BXKA 4BO6A 4ZA2A 3GFBA 2HMTA 4B79A 2AQKA 3I1JA 4TZTA 3UCXA 2F1KA 3BMNB 2ZTUA 3H5NA 4GKBA 3ZNOA 4ALNA 4EEXA 5TT0A 1PU2A 4LRTB 3DQPA 1UXKA 2VTEA 4A26A 3JQCA 4K1LA 1HSZA 4PLGA 2FR1A 4WLNA 3PWZA 4YJGB 4ONEA 1X7GA 3WYBA 5CDTA 2ZYDA 1C0LA 1HLDA 3DBVO 3HJAA 2ZYGA 1OAAA 3GH3A 2BELA 3ST7A 1EK6A 1PZGA 3AOGA 2E48A 1UXIA 1UP7A 2NVWA 5JAMA 3OHSX 4HNHA 4IJVA 4TRJA 2PZMA 4I5DA 3V5NA 3W6UA 1OOEA 4FFOA 2WYVA 1PJQA 2HK7A 5KVCA 4FJ1A 2P9GA 2Y0EA 3HB5X 4N18A 1ZNQO 5F5LA 3KHUA 1BVUA 4XQ9A 4E32A 1YDWA 3AM5A 4LCEA 2EKLA 3BHIA 1O95A 3JQFA 1UP4A 3TL2A 1J49A 1WZEA 4J91A 3RUCA 4FJ2A 4IUYA 1GCUA 2GN8A 2UVDA 3AUAA 1VRWA 1MXFA 4LSMA 4NU5A 3IJPA 1KVTA 3TL3A 2AQIA 3FTNA 3WR5A 1N9GA 5FI5A 1GV0A 4X54A 3U4IA 4NMHA 1PJ3A 1NHWA 1RJWA 4IMPA 1HDXA 4GWKA 5DOVA 3SEFA 1HWYA 2WEKA 4CMEA 3GDFA 2PZJA 3L6DA 4RF4A 1TLTA 1B8UA 4CLRA 5I8WA 4ZVVA 1QXSA 4IS3A 1NPTO 4BNNA 1DHRA 2NTVA 1B16A 1FXSA 1IHXA 4H16A 5DULA 5BQFA 2Y99A 3DBRA 4CM9D 5JDIA 4OOFA 5ADHA 1WZIA 3CSDA 1B3RA 5EN4A 1ISFA 1EVZA 2P9CA 3IP1A 4EITA 1N2SA 2DU8A 1LU9A 2VNSA 2ZCUA 3QVSA 4CV2A 1HE2A 2YYYA 5LCXA 4BO5A 1C0KA 1QMGA 2FR0A 4JNKA 2R00A 4CQLA 2HDHA 3RKRA 4UVIA 1D7OA 3PDJA 2IXAA 3GVHA 4DMLA 4BKOA 1GYPA 2Q4BA 2HO5A 1ZSVA 2IXBA 4Y6RA 3VPFA 4MP8A 2Q45A 4CJXA 3ZW9A 4B8WA 1DPGA 4TRRA 1ISGA 1C3VA 1SBYA 1ONPA 4OYRA 3GUCA 4AJLA 5EPOA 3DZHA 1XQ6A 3HWRA 1CDOA 2Y67A 3INRA 3WQQA 1YBMA 2P5UA 2RAFA 4GMFA 2VYNA 4YPOA 4A27A 1PQPA 2VZ0A 1N9GB 1YL6A 1Z7EA 2DKNA 3D4OA 3DO5A 2A92A 4PG5A 4C7KA 4R1TA 1WPQA 3HDJA 4GL4A 1AUPA 4TQGA 5BSGA 4PN3A 2CFCA 3KXDA 1F06A 4R1UA 3ZNQA 4YCAA 1P1JA 1U3TA 1Y1PA 4C4OA 2B5VA 4MVJE 5C7IO 4IQ8A 2GN6A 3IMFA 2Y0DA 1MG5A 4BMNA 4RPHA 2V6GA 5JBIA 4P8RA 2D59A 3JQ8A 4KTTE 4I1IA 2H63A 4PLZA 1EVYA 3VZSA 4PLCA 4P4GA 3DBRB 1FDVA 1PSDA 3EUWA 5AXAA 3TZKA 3F5QA 1VI2A 2VWQA 2O3JA 4B7XA 4CV3A 2POQX 2X22A 3CH6A 5I8ZA 3RI3A 3B20A 1GR0A 4WE3A 1DOHA 4B7CA 1U8FO 2C59A 3EVTA 1KYQA 3K96A 4BHTA 5F1PA 4ALLA 2QZ9A 2BI8A 3FBGA 2CF5A 3TZCA 2AG8A 1UZLA 3HUDA 4ZRMA 1UAGA 3IIEA 1I2BA 4AJEA 4N7RA 4Q3AA 3U4HA 1YDEA 3H9GA 2Y1GA 4LMPA 3JD2A 4XYGA 3RC9A 4CQMA 4MO2A 4RZIA 4RQUA 5DF1A 1HRDA 1TXGA 2B4RO 3EGOA 1ZXBA 3OMLA 1P3DA 1LUAA 2I67A 5CP8A 4B4WA 1LLDA 3Q9UA 4JJGA 5L3ZA 4CLEA 1H5QA 2GGSA 1E6UA 1U4OA 2YQ4A 4MDHA 1PQWA 2QW8A 1QKIA 2C0CA 3GEMA 1ADBA 4D46A 4WASA 4IIVA 5F21A 3NRCA 1BMDA 4GLOA 4ZICA 1KEWA 3D64A 4YAGA 4BNXA 4S1VA 1G0OA 1U5AA 3OECA 3ZW8A 2OL4A 3O26A 1T2DA 4ILKA 4J49A 2C5AA 4HX5A 4JN6B 3TWOA 2I76A 4R5MA 1C0IA 2PH3A 4Z6KA 4URFA 3EAGA 4D42A 2PY6A 3S1LA 1BRMA 3JQ8B 5CHEA 5ER9A 4KUHA 3ULKA 2ZB4A 1PR3A 2VRCD 3AUTA 3E82A 1PQUA 3AU9A 4WOKA 2P91A 4J2HA 2HSDA 3BMCA 4CUZA 1H93A 1LLQA 5BSHA 2DC1A 1ZK1A 3C24A 2HJSA 3FNHA 1QV7A 1T2AA 2HRBA 3GVXA 2P4QA 5JCXA 4EUFA 3FR8A 3NJ8A 1G6KA 1Z73A 3NT4A 4M1QA 4YT5A 3UF0A 4PLPA 3AOEC 3GNQA 4LN1A 4XJTA 4CM4A 4DC1A 5KWEA 9LDBA 3W8FA 2Q2WA 5DP1A 1ZVMA 5DCWA 5JAZA 1R37A 5GY7A 7ADHA 1L7EA 3NYWA 1DC4A 4CQMB 1ISHA 1R6DA 2IZ1A 4LGVA 3H2SA 5JC8A 1OZAA 2CVZA 3E9QA 1E6EA 3JQGA 5H81A 5T64A 5JDCC 3GZ4A 5THKA 1A72A 1Q7BA 4NU6A 3UICA 1R0KA 1P1KA 2JFHA 4FR5A 4CL8A 3K2EA 5LDHA 3U9LA 2DBQA 3DZJA 4WLUA 3VC7A 1IL0A 1Y5RA 1Z82A 3AI2A 4GX0A 5IDYA 2H9IA 4OGWA 1GUZA 1ISMA 3GG9A 3PQFA 4D7AA 5C7OO 4RVFA 1MUUA 4CV1A 5DBFA 2Y1FA 2FWMX 4RO0A 1NPDA 4OOEA 4D3DA 1PGOA 2WJPA 1BDBA 1ZW1A 2V7PA 4WLOA 2HU2A 5A06A 1AE1A 3GHHA 3MWDB 3FN4A 1I36A 2GUGA 1LSJA 4RPKA 3ORFA 2O2YA 3ZWOA 1U2GA 1HLPA 2LDXA 3K8ZA 1D4FA 4AG3A 4G5HA 2WWRA 4GKVA 2D8AA 1NR1A 4RVHA 4MKRA 4OO3A 2GYYA 3SC6A 3OJLA 1O94A 3FTPA 1E3SA 4DQVA 1Y81A 4NI5A 2OHXA 3RU9A 4WLVA 4OMUA 2W2LA 4CM7A 3GK3A 3O4RA 2CMDA 1DBVO 4KDEA 3TF5A 5LC1A 5TC4A 3JSAA 1HYEA 2J6IA 5CAEA 3RSHA 1FJHA 4CM4B 4TRMA 3KBOA 3WGTA 4DLLA 4R4JA 1QORA 1T25A 2X5JO 1U9JA 3G3EA 2C7VA 2E37A 5L7TA 5TF4A 3RIHA 2AQ8A 1RM3A 4YAIA 3RCBA 4BOYA 3O03A 4LCJA 4M87A 5KJ6A 4LW8A 1GAEO 5CDUA 1O6ZA 3AY3A 4CPDA 1PJSA 4XCVA 4M8SA 2QRLA 2Q50A 1EUZA 4MVJD 1U5CA 2XXJA 1RM0A 4U5QA 2VHYA 1H2BA 2NWQA 2DFDA 1R12A 4NJOA 4GMGA 1OC4A 3JQGB 1F8FA 4MVJG 3ZZNA 1ONOA 3KRTA 2JCVA 4OHUA 3JV7A 3Q3CA 2GN4A 1T24A 3FNGA 3H9QA 3DBLA 4R41A 1JWAB 3KB6A 1PL6A 4KQWA 5JMPA 1WVGA 3HDYA 5CFZA 1EFLA 4WLFA 4AJPA 1HDOA 2XF8A 5IDQA 2X0RA 4IY1A 3DONA 3PQEA 1B3BA 1TT5A 2NU9A 3WFIA 4PLFA 3ICCA 1IPFA 2CSUA 1NPYA 3GRPA 3INGA 1LC3A 3CUKA 2EP5A 4E3ZA 1C0PA 3GEDA 4FFNA 1ZEJA 1B7GO 3UFXA 4XRGA 5HRUA 4K6CA 1YL7A 1CETA 2DPHA 3JYNA 1EUDA 3TNLA 4PG4A 2Y68A 4XWYA 5G0WA 1JW9B 2Q1UA 2X86A 2YZ7A 4R1NA 1QYWA 4Y9DA 3RAJA 1I30A 2X9GA 1Y8RB 1HDRA 4AL4A 4ZHSA 3H8VA 3PGXA 3BMQA 5CPFA 3U3XA 1XQ1A 4AJJA 4WEQA 3Q11A 4CM3A 4MOWA 2YFQA 5JY1A 2G5CA 3F46A 3NT5A 3F1KA 2D4AA 1LRLA 4RVSA 4D45A 4N5NA 5BNIA 4DQXA 4E12A 1EK5A 1MP0A 1GV1A 1QV6A 4Q3DA 4OH1A 5KVSA 2FR8A 4D43A 2GSDA 4EGFA 4F6LA 1LSSA 1O9BA 3A9WA 1JKFA 1M75A 3TPCA 3L0DA 1DC5A 2IZZA 1PGQA 2HJRA 4Q39A 3AOEA 4B4UA 4Z0TA 5HWSA 4L74A 4FFMA 1DRUA 1U7HA 4J1QA 3O9ZA 3LU1A 4RF5A 3DBLB 4I5GA 4L0QA 1MG0A 1B14A 3UKOA 5ICSA 1GUYA 1S6YA 1X7DA 2JCXA 3PYMA 3JQAD 1AXEA 4BNLA 3BMOA 3GC6A 4J9UE 4IINA 4W99A 3RU7A 2QQ5A 4CLXA 5JMWA 4ZGWA 2VRBA 1M76A 2C29D 5JDCA 4MIOA 3ADPA 5DT9A 2FPGA 5HA5A 3V2UA 2X5OA 2YUTA 4IQGA 1DIBA 1OC2A 2H5LA 4N54A 3BTOA 4EZBA 1N1GA 5CG1A 1EMDA 1E7MA 3P2YA 1PJLA 4FJ0A 1BXGB 3VZRA 3OJ0A 2BH9A 2FN7A 4PGFA 1Z74A 4XEHA 3PZBA 3RBVA 5JE8A 3RUFA 2OBNA 1V9LA 1I3LA 2RH8A 3V2GA 4A03A 1XR3A 3V1TC 3L4SO 1YJQA 4K6FA 5EJ2A 1GU7A 3E5RA 4B4OA 1C1XA 3VDRA 3UVEA 1R0SA 4EUHA 1X15A 3U4DA 1WNTA 3CZMA 5KNLA 5JYEA 8LDHA 1XEAA 2OORA 5EQDA 3LYLA 3M2TA 4LK3A 4BKPA 4XJSA 2VHZA 2Q1WA 1HDGO 1A4IA 2O3TA 4QFDA 4AJIA 1M67A 2X7HA 1K6JA 4EDFA 3STHA 3QJ5A 5EINA 3WSWA 3T4EA 3F5SA 3NDJA 4PCVA 3MJ4A 1E6WA 2AE2A 2J8ZA 4TVOA 2HLPA 1Y5MA 4JQCA 3WGHA 3GOHA 5ENVA 2EP7A 3N7UA 1YB4A 3L6OO 1YB5A 4YB8A 1KS9A 5IG2A 1MX3A 4Z0HO 2QRJA 2AE1A 4DRYA 4ZJUA 1P0FA 3ONEA 3S8MA 3MTJA 3Q2IA 3ZU3A 5AYVA 3NKLA 5TRTA 2VOEA 1GPDG 1DRWA 4J90A 5I7EA 3X2EA 4WGGA 3PDUA 4EJMA 4WCFC 5T67A 4RVDA 2JL1A 4XRRA 3RASA 3C1OA 1ZK2A 3NTRA 1EEHA 2DBRA 3LT1A 4I08A 4W7HA 1E7RA 4E5MA 1KERA 5DZSA 2GCGA 3WGOA 1I24A 4XZ3A 1GYRA 1ZK4A 1MFZA 4R68A 3IQDB 1HZZA 3NEPX 3R6DA 2NU8A 1VJ1A 3K2BA 1PGPA 4DIBA 3CPSA 1KC1A 4PG6A 4WPGA 2EGHA 3D1LA 3G1UA 4FOSA 3ZWVA 3AU8A 3OFSA 3MJSA 2I5PO 3PQDA 1F17A 2OP1A 5K0ZA 4ND2A 4M55A 4QTZA 4HBGA 4NPCA 3BYZA 4FD3A 3SX2A 2WMDA 2J5RA 3GA0A 4DYVA 3B6ZA 5JY6A 2Q49A 4J2OA 4BNIA 4J4BA 1Z7BA 3GQVA 3D5TA 3MJEA 2YDXA 4OSOA 5JCJD 3AM4A 3I4CA 4IDBA 3VVCA 5DBGA 3JD0A 3DZKA 1VC2A 1KETA 3OP4A 5ENDA 5EQFA 3D3EA 4QQRA 1U8XX 3RFTA 2EW8A 4TSKA 1PS8A 1KY4A 2BRUA 3GUYA 1T4BA 1E92A 3HSKA 4FCCA 1V8BA 3ANLA 3E1KA 4U6SA 4ZRNA 4BUCA 2V65A 2ZQZA 4NIMA 4YT4A 2GZ3A 1KY5A 1P77A 1AHIA 4IGEA 4WUVA 4YQZA 3TJRA 3HN2A 5HM8A 3VPSA 2Q46A 2VUUA 2EHDA 4DYDA 4IQ0A 4K28A 2R6JA 4JBGA 1Y7TA 1YBAA 2DVMA 2NSDA 1WDKA 4XQEA 2O7SA 3G79A 3GDGA 1E1LA 1PZHA 4GI2A 4HKTA 4BO0A 4ALJA 5L45A 3QHAA 3KUXA 4AJ2A 4CL3A 2ZK7A 4OQZA 3WGZA 3U62A 1ZMTA 5A05A 3WGQA 3PHJA 5COQA 3B1FA 3LT0A 4IDFA 5CEJA 1U4SA 4NFYA 3JTMA 3LSYA 3JCZA 3GMSA 3F9IA 4G2NA 3GZNA 4PLWA 1AHHA 1N1EA 5KVQA 3OBBA 4YJHA 2D5AA 4YAKA 1NWHA 4YYZA 3KYBA 3VDQA 2YV2A 3ASVA 5EL0A 4CM1A 3PLRA 1B8PA 3B1KA 1MV8A 1GTMA 4E2WA 4XYEA 4DREA 5L95A 5ITWA 5IFLA 3Q6IA 1YOVA 3WFJA 4G65A 3TZHA 1NQ5A 5A3JA 3EYWA 2BGKA 2GASA 2NU6A 4WJZA 4DL9A 5JO0A 1PEDA 3LK7A 5L4LA 1DIRA 3CZRA 1YO6A 1NX6A 1PS0A 1KBZA 2YHUA 1U1IA 3GPDG 3IP3A 3ZV3A 1KVUA 3ROMA 5U4QA 3S2GA 2FMUA 2OFPA 4OXNA 1SZJG 4WNCA 5JO9A 3X2FA 1DC3A 5DDIP 1JVBA 4RORA 4FGWA 4B3HA 1LBEA 6ADHA 4CMGA 3DOJA 4C7JA 4IIUA 3BA1A 4J9VA 4UVHA 4IJKA 2YHIB 5JSFA 3GF4A 1P74A 4RF3A 5IF3A 3ETDA 4OSPA 1I3MA 2X0NA 2NACA 4NFHA 4Z9YA 4UUOA 3OIDA 3SC4A 3SXPA 4HFMA 2O4CA 4I5FA 4BNVA 4MVJM 5MDHA 3PIIA 2AW5A 4Z0PA 5T8KC 4BGIA 5B4VA 3WIEA 1SCUA 4CLDA 2VYVA 4IS2A 4AJNA 5BT9A 4P4LA 1DJNA 3JQEA 2DFVA 5ES3A 2GZ1A 1YL5A 3LT2A 5FI3A 4WCFA 3D4PA 5IZ4A 3K6JA 1C14A 2VYND 3DZIA 2PD4A 3OEYA 5DBIA 2C7GA 3ZNNA 4QEDA 2NTJA 2P5YA 4CODB 4IZHA 4HFNA 1NAHA 3LC1O 2C82A 2VT2A 3OJFA 1WDLA 2ZCVA 3GDOA 4QXMA 3RFXA 3K9QO 1L1FA 1EDOA 3LZ6A 1LRJA 2IEDA 1L7DA 3FHLA 3KLMX 4EYEA 3B1JA 3ZWMA 5MGBA 3PFFA 2OXIA 2WE8A 3VH1A 4WCDA 3WB9A 4CMIA 1M6HA 3ASUA 3DB2A 4TZKA 1B2LA 3HQ4O 3OSUA 4FIZA 4KTVE 3ZV6A 1YQGA 2UYYA 1KVSA 2JJYA 2VNAA 1EUCA 1H6BA 2EEZA 1YB1A 2W2KA 4FPXA 1W4ZA 3UAGA 1E3IA 1PWZA 3OF2A 4GBJA 4NBRA 3UW3A 4XA8A 4BNYA 1C1DA 3F4BA 2ILTA 2ZJ0A 2P9EA 4TKLA 4CLRB 3C7AA 2EERA 1DSSG 1EVJA 1T4DA 3DBHA 1B0AA 1X1TA 2W98A 2ZATA 3EC7A 4PLHA 4BVAA 2VHXA 2GZ2A 5G0UA 2B37A 3E9MA 1K89A 2C2XA 3O8QA 2ET6A 2GDZA 1LTHR 3AFNA 4LSWA 3QE3A 4CQMD 2PKQO 1YQXA 3AY7A 1PIWA 4XB1A 5F5NA 1ZJZA 2AEMA 3GVCA 3TFOA 3G0OA 1LDYA 1H6DA 2BI7A 2C07A 1BXZA 2JD0A 4QO8A 3RBXA 1TVEA 2VOJA 3OM9A 4GGPA 2NLOA 2YV1A 3GR6A 5L4NA 3TFQA 4CQLB 3RJ5A 5L7YA 4UEOA 2GO1A 2PK3A 4WCFB 1ZK3A 1SOWA 1XU7A 3NT2A 5THQA 3DAFA 1XYGA 3DZFA 3QWBA 2EGGA 3WLEA 3OH8A 4DGSA 1GQQA 5JXWA 1WMBA 4E33A 2IYPA 2B0JA 4B3IA 4YRBA 3F4LA 2UDPA 1YH3A 9LDTA 3E6AA 4QSMA 3SJ7A 3VKUA 2B4QA 2DTDA 2IZ0A 1E3JA 1YKFA 4YR9A 2NVUA 3PPIA 1A9YA 1QR6A 5EESA 5TQVA 4AVYA 2I6TA 4JJIA 4WEOA 1V6AA 3S2FA 4CMIB 3W6ZA 1ENOA 1GUFA 1BGVA 1HTBA 1DIGA 1VKNA 2R2GA 3FI9A 3IOYA 5KJCA 2AEFA 3KTDA 2W2KB 3JYOA 1HETA 4J1NA 1CEQA 5DCYA 4NK4A 3GVPA 5A5EA 3UN1A 4FFRA 3UHAA 4B3JA 2Q4EA 3CTMA 1T1SA 4GPD1 3A4VA 4XKJA 2W90A 5I9NA 4OM8A 1HYGA 1H9BA 4D3FA 1R66A 4Z9XA 1ZO8A 4E5KA 2PLAA 2ZIZA 3O8QB 1E3WA 1CYDA 1LDEA 1B8VA 4YA6A 4Z9FA 4E5NA 2DAPA 4NG5A 1E1KA 4XGKA 1NXQA 5DCUA 1DIAA 5AVOA 4RPJA 4W82A 5IDXA 2LDBA 1LXCA 1I0ZA 2OZPA 1WXDA 2XXBA 1LQUA 3AFMA 3G1TA 1PZFA 1QYXA 1J6UA 3VZPA 5L4SA 1M6WA 1EBUA 1N8KA 1LRKA 1U3WA 2HK9A 2Y93A 2ZB7A 3OA2A 1M66A 1T1RA 3I9JA 4A5OA 2ZYAA 3VAZA 3ANNA 3MEQA 1U28A 4II3A 4UEKA 4XYMA 1ML3A 3GT0A 4BKUA 1SO8A 4AJ1A 5T8KA 1BG6A 1YBVA 3BTUA 2DUUA 4J3FA 2DBVO 3FRJA 4GH5A 1O0SA 2AG5A 4EBFA 4Q9NA 4CMBA 2JHFA 4KMSA 3KO8A 5TGDA 3PLNA 4ROSA 4MJLA 4E21A 2VHVA 4Q3NA 1A71A 2VRCA 3WQSB 2FOIA 3DZBA 4WECA 1LX6A 1G0NA 4M89A 3DEYX 2X6TA 4O6VA 4W9NC 4AJHA 2Q1TA 3ENKA 4XR4A 4CLOA 3M2PA 1DXYA 4PG7A 1V35A 3GFGA 4J43A 5ER6A 3TSCA 1ENZA 4DQUA 4S3MA 2DPGA 1OBFO 2W2LD 5DNAA 3JQ7A 3VZQA 5CG2A 1KVQA 3JQ9C 4QECA 5TSDA 1Y9AA 1A9ZA 3DAPA 2YQ5A 3CXRA 1VLLA 4DUPA 4CR8A 2UAGA 5L40A 3QVXA 1GDHA 3PHGA 3PJDA 3KSUA 1DEHA 4HP8A 3LVFO 3I6IA 5B1YA 1NVGA 3K5PA 3V8BA 3D0OA 4QFCA 1BSVA 1PZEA 4A7PA 4DBZA 3BMCB 4JGBA 1NVMB 4E5YA 2EKQA 4L4XA 4FC7A 4OKNA 3NJ4A 4MP3A 3QVOA 1PL8A 1PS9A 5JFOA 1IY8A 3CKYA 3O38A 1I3KA 4WKGA 4BS9A 5G4LA 1DDOA 1Y8QA 4J0FA 3IDSA 5F1OA 2PTGA 5A9SA 3KYCA 4OAQA 4YEDA 5T57A 1DB3A 5TIIA 4L9RA 5EERA 3GGOA 3INTA 3WTCA 4BNKA 3I3OA 4DA9A 3WMXA 1DAPA 3S55A 2PWZA 4AFNA 3WNVA 3OEWA 1ZCJA 3K30A 1E3EA 5J23A 1Z6ZA 2PKQP 4INAA 1FDSA 3V1UA 1ZXLA 5KJ1A 4UAGA 2BGLA 4H7PA 1SEPA 3WLFA 5K6AC 1KC3A 4KP7A 2NQTA 3OETA 4XGNA 4RV9A 2A4KA 2RCYA 1HZJA 4FFLA 2DTXA 2NUAA 4CMAA 1MC4A 3PHLA 4L76A 2GLXA 2AEJA 1UDCA 3N58A 3TZ6A 3QLJA 3G17A 1X0XA 4ZQHA 3MCVA 1S7CA 4BNJA 4YJDA 1GADO 1IZ0A 2O50A 3LLVA 4FN4A 2UUOA 4FGSA 4AJ4A 3WBBA 5G0VA 1IB6A 1PJ4A 2V6BA 3OICA 4XIJA 4PVDA 3FCOA 5B12A 5IAAA 1XCBA 4JROA 1RKXA 2RBEA 1ZIDA 1UXJA 2UV8A 3WYCA 4L4SA 4E4YA 4W7IA 1LDMA 2E49A 4FBGA 4O1MA 3VH4A 4BMSA 4YVFA 4RVUA 1YONA 3MJTA 1ZK0A 1CJCA 4KQXA 2I99A 4UULA 4OXKA 1IYZA 2CF6A 3ZHYA 2PV7A 3EVNA 2VN8A 1YE3A 4CLHA 4R3WA 3H3FA 2BKAA 2ZTVA 4YAEA 1ADCA 3BTVA 3TRIA 4M86A 3VH2A 3RWBA 2AMFA 1IPEA 4LISA 4AJOA 5KVVA 5JAIA 5GZ6A 5KKCA 1I8TA 3BHMA 3LDHA 2O4UX 3U5TA 4EEZA 1UAYA 2P2SA 3HB4X 3HFSA 5I9LA 2PNFA 4BGVA 1VSUA 5COAA 5AQ1A 1ZSYA 1JAXA 3NAQA 2I3AA 4L75A 2TMDA 1XWFA 3RUDA 5TS3A 1DAOA 5C7LO 5KIAA 1UJMA 3VTFA 3JD4A 1AN9A 3GAFA 2OBYA 3IJRA 4BO7A 4IDGA 3MZ0A 4CR6A 2RHCA 4DXHA 2QX7A 4R9RA 4IDAA 2DUWA 1TT5B 1OFGA 3HDQA 4XD2A 1P44A 4BV8A 4Y67A 3ZWCA 1RYDA 1ZFNA 3PTZA 5JYDA 3DR3A 1LNQA 2C2YA 3WIDA 2J3JA 1VJ0A 2GNAA 5FYDA 3ADOA 2DT5A 2BFPA 4LVCA 4ZQBA 2CDBA 1P1RA 1Q2XA 3JYPA 3DMTC 1GPJA 3S2IA 4FW8A 2WSBA 3QWHA 4J7XA 2A35A 4YJFA 2Y0CA 4W9NA 3QWIA 2PGLA 5FF9A 3ON5A 4ND4A 4U7WA 4I8XA 4XX0A 2E4AA 3BMQB 3ZH2A 4A2CA 4K9DA 4E31A 3JQ9A 5JAQA 1R4MA 2QG4A 3IUSA 2Z95A 3H9JA 1ZH8A 5G4KA 4CMJA 2IRWA 5A04A 4JXKA 4ZQGA 1EFKA 4F3YA 1GZ4A 4HADA 3UGKA 3L9XA 5L51A 1NASA 3LF2A 4P22A 1YXMA 2NV6A 4OL9A 3NGLA 3ETGA 4W4TA 1JVSA 3PFWO 2GN9A 2ZKLA 2C54A 3I9LA 2G76A 1O89A 2BLLA 1JN0A 2Y1EA 3JYQA 2EJWA 4GGOA 4B7UA 5B4TA 1Q7CA 4FFPA 4ID9A 4ZQFA 1T26A 1B15A 1U2DA 3RBZA 3ZU2A 1D1SA 1I2CA 1F12A 2PR2A 3P5SA 4NHEA 4R1SA 1W6UA 1XLTA 3TDKA 3WNQA 4BNUA 1SB9A 4GX1A 1GL3A 4ZU3A 2Z5LA 2JKVA 5ITVA 2D0IA 3BMOB 3FSRA 4I9NA 3UXYA 2I65A 2IEBA 1AGNA 2I9PA 5IN5A 1E0DA 1K3TA 1WP4A 3MOIA 1XELA 2WTBA 1N7GA 3EY4A 1NQAO 4H15A 3HFGA 5K6AA 1QYDA 2QRKA 1HDZA 1ULSA 1QYVA 1NR7A 2QYSA 3DWFA 3IAHA 4MPDA 1ZJYA 3NUGA 1H6CA 1XKQA 2W4QA 3BIOA 3F6YA 3DFUA 4NBTA 4UVDA 1DFGA 4QUKA 4EW6A 3A28A 3KM0A 3IUPA 4D79A 4YJFB 4D44A 2VQ3A 1Q0HA 2Y05A 1YQDA 3GN1A 2B83A 2V6FA 1TI7A 5T6BA 1SNYA 4W6ZA 1NTOA 2NTNA 3PI7A 3ZWBA 1DFIA 1R4MB 1RWBA 5CPBA 1LEHA 2ZB8A 4GX5A 3G49A 4MVJI 3W8DA 2WDZA 5G4KB 2FSVA 2X0JA 2XOXA 5FWNA 1C1XB 1T2EA 3E8XA 1CIVA 2X9VA 4RL6A 5F3RA 2Z1NA 2OMEA 3SJUA 3BMNA 1K0UA 2X4GA 3FWZA 3QWAA 1XIVA 2X0IA 3C7CB 2G0TA 2BMAA 4WOJA 1P1IA 2HCTA 3M1LA 2FP4A 4YJGA 1P9LA 3NTOA 5TLSA 5IJZA 1NQTA 1GEGA 3GPIA 4JCOA 2YFHA 1VL0A 5FEUA 5JW6A 3KSZO 1ZEMA 4J7UA 2GD1O 3WQRA 4NZ9A 1JA9A 4NH4A 3LQFA 1X14A 3DTTA 2CVQA 2EJVA 5DOZA 2YJZA 4J1SA 1JQBA 1K6IA 3C8MA 3DHEA 2O2SA 4IJUA 1R4NA 3W4JA 5CDSA 4ZQEA 4LRSB 1P1HA 4OIMA 5G0SA 1TA4A 4Z3KA 3DHNA 1NQOA 1ENYA 3OJOA 2J3KA 1VJTA 5A9TA 2ZTMA 3K92A 3QRWA 4DPKA 1F0YA 4RLSA 4R54A 4U0KA 1ULUA 3A14A 1HE5A 2F00A 4YT2A 4GVXA 1NM5A 5IXSA 4NBVA 4BNGA 4EUEA 2O3UA 2WYUA 5AXCA 3WYEA 1LLCA 4D0SA 2I66A 1BHSA 1ZMOA 4KDFA 3RC1A 2O23A 3U4CA 3C1AA 4HY3A 3U09A 5KTKA 2V6MA 3I23A 1IOLA 3PJEA 1HKUA 3UCEA 1ORRA 3DMTA 5KJFA 1PX0A 1N92A 4BO4A 2HMSA 4PVCA 4FDAA 3W1VA 1HL3A 4RZHA 3F1LA 6LDHA 5I7VA 5TX7A 3ZI0A 1PL7A 2GPTA 3H6KA 4QO7A 1Q0QA 3GAZA 4ESOA 3P2OA 2SCUA 1LDNA 3ABIA 5A03A 4CMCA 3KEQA 3WMWA 3RROA 1X7HA 2BGMA 2HRZA 3DHYA 4DC0A 4BB6A 1E3LA 4YBZA 5ICMA 3DFZA 1DJQA 3PHHA 3ICPA 4CV0A 4DPLA 3OIGA 3WS7A 2EXXA 4TRNA 4XQCA 3RUAA 3OIFA 2JD1A 1ADGA 5K9ZA 1BWSA 3QY9A 4U0JA 3Q0EA 1T2FA 1KEVA 2IYOA 4ND5A 4UEJA 3I52A 4O59O 5KKAA 4HNGA 3F47A 5B4UA 3VTZA 3ZN2A 3ZV5A 3SLGA 1XA0A 3RQSA 2ZB3A 5CEFA 1R4NB 5HTOA 2AXQA 2VYVD 4XR9A 3T4XA 2QZZA 3QWFA 4J4TA 1YJ8A 4R69A 4ALIA 1U3UA 3AI1A 4RF2A 2OO5A 4E13A 1FDUA 1E7YA 4CMKA 3QSGA 3PK0A 2VWPA 3M1AA 1JTVA 4Z3DA 2G1UA 2BF7A 3RFVA 4FS3A 5L7WA 1CERA 2J3IA 4PZDA 3BAZA 4L73A 5L53A 2G17A 3JD3A 4ZD6A 1QYCA 3KV3O 1LSUA 1U3VA 3BHJA 3W8EA 2B4TO 3ZHBA 2G82A 4MVJF 4JLWA 3HNPA 1UZNA 3HG7A 5KCZA 3H9UA 3FBTA 4QT0A 1QSGA 1W0CA 4BO2A 4MINA 3IL2A 3GZNB 1MGOA 4G81A 4R3NA 4YJHB 3DOCA 1NYTA 2ZTLA 4KOAA 4OXYA 2B36A 3A1NA 4HUJA 2HKIA 2Q3EA 2FHSA 1N5DA 3IC5A 2OUIA 3S2EA 2ZQYA 3B70A 1VKOA 3HADA 3QW2A 1HF3A 2JAHA 4R51A 3WJAA 1WW8A 1E77A 2PA3A 4BO9A 3GVIA 1EE9A 4HFJA 3HHPA 5AOVA 1H0KA 3CIFA 3JQDA 4BNWA 3L4BC 4HXYA 5I7FA 7MDHA 3PGJA 1W73A 1YOVB 5IN4A 2TMGA 5CDGA 4II2A 4PLTA 4CM9A 4E2YA 3E48A 4NBUA 2JFFA 3GNTA 3C7DB 4BKRA 4MKXA 4E0BA 1UZMA 2B35A 3C1TA 1NAIA 3DL2A 4J4HA 4NDNE 1AXGA 1KOLA 4IMRA 1X13A 4YRDA 1IULA 1MFPA 4O63O 4D0RA 1LA2A 3E9NA 3Q1LA 2D1YA 4WK6A 3WGIA 1I33A 2C5EA 5IXYA 1JU9A 2P68A 2E6UX 3DDNA 4IDEA 1SMKA 3WDSA 4CUKA 1GFSA 2FPIA 3ROPA 1Z75A 4JK3A 4ZN6A 2ZJ1A 1SB8A 3DMYA 1Q1NA 5C3MA 2CDCA 2YV3A 3JQBC 1E1NA 3NX4A 2YW9A 4BQPA 1NFFA 1OMOA 2CDAA 2DM6A 4LVUA 2CUKA 2DTEA 2FY8A 3AWDA 5JPIA 4JBHA 3IKTA 4Y6PA 1DRVA 1HE4A 5L9AA 3PJFA 2FZEA 4DLAA 3Q2KA 3ZHZA 1V3TA 1V3VA 2CD9A 3AUSA 3CE6A 2O3SA 2Z1MA 3H3JA 3I6QA 3W4KA 4DTIA 4YRAA 2PH5A 4I9HA 3AI3A 1BVRA 1SC6A 3GGPA 3QQPA 4PFJA 3H4VA 2OGUA 1PGNA 1DIHA 1MB4A 1YS4A 1A7KA 2VZ9A 3WTBA 3R0IA 1ONNA 2DBZA 1HT0A 2RIRA 1K2WA 2X58A 3K73O 1BTOA 2PGJA 4ND1A 5KJEA 3ZU4A 1DO8A 3NGXA 3M6IA 3U0BA 5U9CA 4YWJA 5HBRA 3OJEA 5A9RA 4RVGA 5H82A 1A5ZA 2Y66A 3LT4A 1A7AA 4AICA 4BO1A 3SBOA 2E82A 3RUIA 2XAAA 1E5LA 3VH3A 1E5QA 3H65A 3H9EO 1LDGA 5TT1A 4DVJA 1CF2O 1VM6A 1MXHA 5G2OA 4M49A 4UVEA 2BFAA 1I10A 1ADFA 1MLDA 4BB5A 1C1DB 1DLJA 1KEUA 5EIOA 5ILGA 4U6QA 2BHLA 3UH1A 1IZ9A 3I9NA 1F8GA 3WOHA 2IE0A 1HE3A 3L9WA 1WWKA 3PIDA 2VUTA 1MA0A 3DZGA 3DBHB 1HEUA 1QG6A 2NU7A 2EW2A 5TJHA 5C37A 3OA0A 1Y9EA 3WICA 1DLIA 4DWVA 4Y8VA 2JHGA 1E7SA 5JS6A 4IDCA 4MKZA 2WD7A 1R15A 3VVBA 3ITDA 4PZEA 1JAYA 3FF4A 4IZIA 3PYXA 4TWRA 4DIOA 1NVTA 3N74A 4BNTA 3T7CA 1NWCA 3PWKA 3NTQA 3GGGA 1ID1A 3KYDA 3GLQA 1WAMA 3EK2A 3KOUA 4RLHA 4XDYA 2PZKA 3TOZA 1PJBA 3GG2A 4YQYA 4PRKA 1ENPA 1EE2A 4M54A 3FNFA 4DIFA 4GSKA 1ZZEA 1IE3A 3SLKA 4GLLA 1GEEA 2CZCA 1W8DA 1T2CA 3CEAA 1E1MA 2WD8A 4FQ8A 3PYLA 5BNTA 2WYWA 3ZWWA 4R01A 4JX8A 1UXHA 2FZWA 2A9FA 4F46A 1RM5A 4WLEA 2NVUB 3MJCA 5F1KA 1NHGA 4F6CA 3TQHA 4O0LA 5TJ9A 2DLDA 2FPPA 4PG8A 4DPMA 2FRDA 2BFOA 1UDBA 5ILOA 3OQ1A 2JD2A 3EDMA 5BR7A 3ZCXA 4R9SA 3QIVA 3K31A 4CMHA 3DTYA 1CQJA 4NBWA 1PGJA 5IZCC 1LLUA 1WDMA 2AHRA 4GX2A 3L4BA 3WXBA 2NNLD 3ROQA 3ONDA 3UUWA 1TEHA 2QIOA 4MP6A 4XDZA 4YDRA 1RPNA 2EG9A 3KSDO 5LDGA 4J0EA 1Q0LA 3H2ZA 2Y1DA 1UR5A 1DC6A 3H5RA 1E3WB 4WNIA 4GAEA 5A3VA 4RQTA
chains in the Genus database with same CATH superfamily
3N2ZB 3IGFA 3WBKA 4A0SA 3TEJA 2VF2A 4LJ5A 3SJAA 3AHHA 1DCTA 1DQNA 1S2MA 3GDHA 5IJWA 2GWRA 4MV9A 4IX1A 3UHJA 4IKOA 3L02A 2PGDA 1LPSA 4YCMA 5AVRA 4AQ7A 2H4JA 1OH8A 1SVWA 2QB5A 2QENA 1MW9X 4NZYA 4Q3CA 2KX7A 1Q7GA 3WBFA 1JTEA 5FUYA 3TN7A 5IABA 2GR9A 4KRXA 4ER0A 1W87A 1PR9A 4E70A 3SVTA 1KMMA 3G2QA 3ANSA 4V02A 1CNFA 1DKQA 1TK2A 1T5HX 2EATA 2ID4A 1RJDA 2R8OA 3EVZA 1L5GB 4HWKA 3B6JA 1I2MA 1T1JA 3OLYA 2J9XB 3VC2A 3PENA 2FEPA 4AY4A 1IUNA 3KR1A 1KXZA 2FN4A 2VWGA 3E18A 4NPAA 4G07A 4YRLA 3HCRA 4UFOA 5CEEA 1BDIA 2UXBB 3F7NA 1OLUB 2FX5A 1F9EA 3KZ1E 1XU9A 1C9JA 1YUMA 4Q00A 2CJYA 2F90A 3KKLA 2NXJA 2GCIA 3HBFA 3AKDA 5KHLB 3K5IA 1SUPA 2D62A 1D1QA 2VUSA 3IR7A 5IYZF 2LTAA 2X8LA 2XNDD 1TRKA 4KUGA 5ALWA 1T3GA 2IDMA 2QT9A 3GRFA 1II8B 4Y7DA 3WLHA 4LJLA 5AM4A 3ZWNA 1YR8A 1D2CA 3V2IA 3BH6A 4N5MA 4DDMA 2OLJA 1CUUA 4KWHA 3RC7A 4CLOB 2LCFA 1P9WA 3BGIA 4TVBA 2YBEA 1SAYA 3R5KA 1RWKA 1ESZA 3THYA 2JVIA 4AXBA 5GIOE 3O1HB 3JQ7B 4RM2A 4H1WA 1EHIA 1GR1A 4Y2XA 2VHCA 3L46A 3ZHUA 4HNVA 1G21E 2ZIEA 3LWNA 3CUTA 2XYRA 3EIWA 4J6FA 1CY8A 4N4AA 1V6SA 1F1BA 2CKMA 3AK4A 2BFCA 3OT1B 1XZQA 4XUCA 1AQLA 4UUPA 4DR7B 1SUIA 2E7ZA 2M6RA 4L8YA 5B7GA 2E6KA 2QORA 3H2JA 4TXLA 3D1VA 5I4IA 1OGJA 2RD2A 2GYVA 2IS4A 3H5WA 2R6HA 1MQ9A 1SVNA 3RUHA 3IAAA 1X1RA 4PF1A 1G55A 4YFVA 2QN2A 1A4UA 3GJ7A 3GQBA 4IILA 3IDFA 4UCXA 1K0FA 4MWZA 4KE7A 3MGBA 4K2HA 1YZGA 1O4WA 4P7KA 2B1IA 1ZUWA 3PKZA 4EG3A 2WHRA 4LRQA 2ZJ6A 1DAEA 4FI3F 1Q91A 1MB3A 1L5KA 1R9JA 1V47A 5A9SB 1DV1A 1K8XB 1RRKA 5ENZA 1L4NA 1J09A 3NHWA 5DK4A 3VR3D 1KOGA 1OA1A 1FJ2A 3PFIA 1V0JA 1THMA 3PIRA 4I50A 1IAQA 1Y4AE 2OCGA 2WIAA 4Y6SA 4ZI5A 3WMEA 1JSZA 1U7DA 2R86A 3NBUA 5K8UA 4RSMA 3RTDA 4GYYA 5U1PA 1CF4A 3BXEA 3RUEA 3TQFA 1HSOA 3GCDA 3MNFA 4OHWA 3E84A 5EWLB 4MUAA 1KEPA 1SKYB 3B6KA 3H7IA 3PPXA 4O4LA 4MVJH 2PR7A 3SMVA 1IBCA 3GLRA 3MM4A 3BSWA 2A94A 3LBNA 5FBLB 4MULA 4Q15A 2BMVA 2H1SA 3EYAA 3LC2O 2VPTA 2VPQA 2G36A 1IHDA 1TX4B 3EMKA 3FWNA 2DE0X 1NN3A 3X1KA 1FP1D 3E22A 3DS8A 5HILA 1GO2A 3IBYA 5DN6A 3OU7A 4NEGA 4NK5A 4ALKA 4CG1A 3B3QA 1ZGGA 4UREA 4HNTA 4Q05A 4R1QA 3RS0A 4ESVA 3PGA1 3THYB 4MCAA 1GDDA 1MBZA 1Q14A 4RABA 2Q3HA 4AZTA 3ZU5A 3FG9A 4NJMA 2HX1A 1J5PA 4E07A 1Y1QA 2JNWA 3I2FA 2EBWA 3ILHA 4N3AA 4OV6B 5CIYA 3D6JA 2JEOA 2V7TA 2PMFA 4LMRA 3EUFA 3HJTA 3VNUA 4MUNA 4V0QA 1RKQA 3PHCA 2HXYA 4JP2A 1EVIA 1AUXA 2AGVA 4QHSA 5JQGA 3IT3A 3FYUA 1TGYA 2HMUA 4RKEA 1K08A 1QHIA 2R11A 1XTJA 3IEPA 4PNPA 3RVJA 4FB5A 2CNDA 1L9KA 1R9NA 2I71A 1ZN8A 5EYPA 2XUFA 2BHRA 3A1FA 2ZULA 2NUBA 2OBLA 2NT4A 3GY0A 3LECA 5DO9A 1N36B 3QLEA 5MN4A 3C5VA 1JH9A 4JMLA 4LS3A 3FFAA 1HNWB 5BN1A 4KCGA 3DLTA 3HJNA 1ANKA 1Q19A 2IYNA 1NZJA 5IH3A 1L7BA 4Q02A 3RJMA 1U8UA 2NTEA 1SHKA 3M6FA 2GERA 5AK3A 1V8DA 4HVLA 1UXGA 1E7QA 3OMWA 2K2WA 4OI4A 3JQAA 4P98A 5GZ3A 1J2EA 1NP6A 3CZPA 4IM7A 5D87A 4UD2A 4RDCA 4OJKA 7REQA 5LLDA 5ELXA 1GFWA 1SC9A 4XIGS 1TPZA 3FR7A 4KJXA 3UKJA 1ECBA 1RYMA 4IXTA 1GGNA 4TMFA 4FDVA 1L5SA 3PNSA 1XL1A 1Z56C 2HAEA 1WF3A 4ZXPA 4TLCA 4LUCA 1O95C 2OP0A 3JQFC 1I32A 4FKMA 3H99A 4KWIA 2FFBA 2ID8A 2NADA 2SKDA 4DQ0A 4L02A 4O4LB 4IG4A 4B9AA 1SOVA 2PQ0A 2WSSD 2Q1XA 4LY9A 3QOXA 1JJ7A 2VCYA 4GQAA 4UQOA 4EO9A 2I6QA 1XGKA 1J0XO 3MRTA 4B2YA 5HOQA 5CCBA 2EWMA 5LLTA 3WWYA 4DV0B 3BTSA 1Z39A 3OOSA 5FTJA 3VSEA 4GWGA 2GESA 3PQ7A 3AXSA 3CNBA 3L2OB 3CPJB 2HMVA 4KMOA 3K70B 3REFA 1QRAA 2FSSA 3KUCA 5MN5A 1P31A 2Z8YA 5BNFA 2N47A 4RANA 3VPXA 1TCCA 1NXPA 4DC9A 1G5PA 2IE8A 3WK8A 2B25A 2Q21A 1LJ8A 4Q82A 5HZKA 2QSJA 4IYJA 5PNTA 4EG1A 2MCFA 4NJMB 3GAAA 1TZMA 5AI5A 3JD1A 2J3HA 5A3JA 4ZCSA 3SXUA 3ESRA 3WSVA 1B74A 1ZCAA 4FGJA 1BOFA 3V1YA 4CT0A 1YRYE 3ONFA 2QHXA 5ICFA 1ZD9A 4H1UA 3WADA 1IDN1 2IHTA 2CL5A 3FYUB 3GIWA 3LE8A 5GGXA 4G26A 4TM8A 3UGTA 4YMIA 4V24A 3ESDA 1NJSA 1N5OX 3ELBA 3GCWA 5BQ3A 3ZV4A 2TSYB 3CN9A 1I4TD 3WRWA 3OZAA 3NWEA 2I3GA 4ZO7A 1QRUA 4C3VA 1NATA 1UFQA 4K6HA 3QA3E 2XT6A 4BNMA 4PN7A 3OWOA 1EVQA 5I7RA 1NNEA 3R1IA 3QA9A 1RYFA 3SJCA 2HHHB 2J5XA 2O3QA 3NDIA 1EX7A 2FRXA 2R8PA 3CCFA 1FC0A 3O7MA 1DOZA 5E7IA 3JQPA 1VL6A 2C7RA 1GQFA 2GRAA 4IBOA 1HGXA 2Q6IA 3HO8A 1C29B 1YGYA 3JQAB 4HDRB 4LEIA 4PRLA 4KITB 1YHYA 4UOZA 7REQB 1QIJA 3EW7A 1U7UA 1BX1A 4IGFA 3I8OA 5BVGA 4EVIA 3A1CA 3HCWA 1U63A 1NVFA 5LPNA 1Z0JA 4ALMA 1JKJA 3U3MA 2I6FA 5DSXA 4EB6A 3RKUA 2B5WA 5EIBD 4EL5A 3RFUA 4D4KA 2QRMA 3MOGA 4C4PA 3UOWA 3FDFA 3EWNA 3RVMA 3SSMA 1BCSB 5I7SA 2DB3A 1L6RA 3QFRA 5FFFA 2GEJA 2PRJA 1RJ9A 4FDTA 5JXGA 1WBDA 2GFQA 2ZSEA 1Z2CA 4GU5A 2L19A 2N1BA 2QZ4A 5CCEA 1RHMA 5GM1A 1VTKA 3THXB 5KNCH 1KDVA 4U2BA 4U8GA 3TTTA 4RLFA 1BIFA 3LKVA 5EMHA 4LXHA 4QASA 4RIFA 4H2DA 5A4DA 2YYSA 2CHVA 1X1CA 2XCIA 4JNCA 5ES4B 4YCBA 1QGDA 4EIWA 3ZZTA 2HEGA 1GWNA 2AI2A 1D9XA 4ZEVA 2QNBA 3EZ7A 3CMMA 4MQLA 2RHRA 4LJAA 1Z13A 3B52X 3KVOA 4ZVNA 3ZLUA 1YWGO 2BFMA 3F3SA 2FQQA 3KR9A 3TZQA 3T9DA 2FN9A 3L1UA 1XZJA 2ZI4A 3IO3A 2IEIA 3TMKA 4QGFA 1ZSNA 5AKIA 5C5DA 1D1TA 2VTBA 3KWLA 3NIGB 4IEEA 3WWZA 1X0VA 3AB8A 4K40A 4ZTBA 1Q0TA 4JI0B 3KKKA 2ZR9A 5CMLA 1AA6A 4ZYWA 1LLFA 3PZRA 4DJEC 3AIKA 2I34A 5ICGA 3UK2A 1QRRA 4O0MA 1JB1A 2J4CA 2V7GA 3ID6C 4RENA 1JF8A 3M5WA 4YUYA 4RHTA 1KIMA 1K7SN 5A02A 5BYAA 2HUPA 3KLPX 3OEEA 1QRTA 1CZNA 4RK1A 3LIPA 4C76A 5DGHA 5LQAA 7GPBA 2DQZA 2PKEA 2PAAA 3KEFA 3OFVA 5CFNA 1T3LA 3E9CA 4X7RA 4JU8A 4ZC8A 3K9BA 5FWXB 1HLGA 4TLLB 1MJHA 4ZA2A 2HMTA 3KFLA 2AQKA 4XTRA 4TZTA 4W1SA 3WAJA 2FSIA 4EEXA 1GARA 4IJ6A 3T38A 1PDVA 3MAGA 3GOQA 5LWHA 3DQPA 2AUMA 1R3DA 2ONYA 2Q62A 2QPLA 1FYDA 1W88B 2VTEA 2WOJA 3JQCA 1HSZA 4K1LA 2DFLA 3M5DA 3PWZA 4ONEA 3WYBA 4MW0A 4PCLA 4UPVA 1HLDA 2CNOA 3HJAA 3GH3A 3ST7A 2QT0A 1E98A 1H1TA 1BYUA 1PZGA 3ZE7A 4EA9A 2P67A 3PE3A 2I78A 4X84A 1U0HC 1UXIA 4KWEA 1X39A 4HNHA 1DQRA 4TRJA 1UBJS 4PZLA 3V3KA 1U65A 2JHAA 3V5NA 3JVEA 4HF7A 3T8YA 5KYKA 1LTQA 1NC1A 4RCZA 5KC9A 3DKIA 5IT0A 5KVCA 4FJ1A 4CFYA 4KDRA 1QIMA 1ZNQO 2DQSA 1KZHA 3ZD8A 3WNZA 1A9SA 1O96A 1SXJB 4E09A 4RIHA 4LCEA 1OHHD 2EKLA 4JI2B 1O95A 3JQFA 4UJ5A 2QTGA 3ELUA 2AZ4A 3OUUA 3TLXA 2Q27A 3K32A 2XSZA 4BZZA 4UCWA 1KRWA 2ORWA 3AUAA 4CKWA 4NU5A 2V96A 5IFKA 4F9FA 2AQIA 1VJCA 3U3RA 2VI5A 2MWMA 4JXJA 3WR5A 4U5XA 1N9GA 4RIEA 1GV0A 5AQEA 2VTBB 3W1WA 2M32A 3U4IA 1PJ3A 1NHWA 2G6BA 3LYHA 1RJWA 4IMPA 4OATA 5DOVA 2XD4A 2JVKA 5CU7A 2WEKA 4M0UA 5CLQA 1K4YA 3E3MA 3GDFA 4COOA 5KSYA 3PC7A 4EY8A 1Z4JA 2OPBA 1C4WA 2F9FA 2EKDA 1N0UA 3F9RA 1GAJA 1NXWA 1ZQ1A 5I8WA 4ZVVA 2WZDA 3IYLW 2PL1A 4IS3A 1KE2A 3RTAA 2FAXA 2Z5VA 4L5JA 2DWOA 1B16A 2VH2A 4N49A 3EBOA 1IHXA 3OLZA 3T9BA 4N0DA 1JA1A 5DULA 3EVGA 5CFLA 3DBRA 3NQ41 4LZNA 4QEZA 3DKVA 2C5LA 4EGAA 1RXWA 4MX8A 1H1DA 1WZIA 3WLOA 2J4FA 1UQRA 3E2IA 5EN4A 2O8FA 2P9CA 3E3LA 1V11B 4BX2A 3S27A 1Z36A 3FPFA 1HE2A 3IT0A 2DR2A 3K9HA 1BN6A 1P6XA 1QMGA 2KB0A 1MA3A 2XEDA 3HJUA 3HU3A 3QF4B 1LK0A 1TYEB 4QVKA 4FYJA 1L2TA 4UU7A 5K51A 1VYTA 3CCBA 2HDHA 4LHXA 3UWMA 1FQWA 3G9QA 3E27A 4UVIA 1A4RA 4HTAA 5FRDA 1S3GA 2CMGA 1K7YA 2IXAA 3N8GA 3PDJA 4PX5A 5HQJA 5IUKC 4DMLA 1SOAA 1FVFA 2OWDA 1U5BA 5KZMB 2CXSA 1EESA 2HSZA 3I12A 4Y6RA 3VPFA 1YRBA 2OKGA 4BDTA 2QBYB 3KS9A 4RKFA 3HU2A 3NIFB 4G1FA 5LM3A 1RWOA 1M6NA 4JVNA 1ISGA 1O96B 1C3VA 3S1AA 1Y1SA 1MRSA 1UFKA 2NAFA 5A5DA 4WY2A 3AMVA 3VU9A 3G2LA 5FWAA 1U0GA 1IUOA 1XQ6A 1CDOA 1L7OA 2QJTA 1M6YA 2LKCA 3INRA 4GT1A 2P5UA 3M1YA 4P84A 5DHPA 2F3PA 4B6RA 3GLIB 4DB2A 2X4IA 2VYNA 2PUTA 3FVVA 4WN3A 3W2HA 1EFUA 1VJRA 2GAAA 3LVQE 1DX9A 4OXRA 5IVIA 4FP9A 1N9GB 2IPXA 1Z8HA 3HJFA 3IE2A 5JXJA 3BB4A 5E7MA 3DFKA 1K75A 5BR1A 2DKNA 4PG5A 1YS7A 1DC8A 4G0NA 2WF6A 5CA0A 3WK9A 2QTFA 1F06A 1L4YA 1FX0B 4OBEA 3TEMA 2OZEA 3WL8A 4Q4HA 4IZ6A 5AW7A 1WOMA 3DP9A 4PS0A 1Q6ZA 4B40A 3LQKA 2Y0DA 2J07A 3S7TA 4Q4DA 2C2BA 2XUJA 5ANRB 1CY2A 1YMQA 4RPHA 3E15A 2D0OB 1BMQA 3JQ8A 3SE7A 4PAGA 1EVYA 4LY0A 4CZ2A 3FUXA 3LPCA 3EF3A 4P4GA 3DBRB 5L3VA 2WF5A 3CNQS 3F5QA 2NP6A 1VI2A 2P27A 2VWQA 4B7XA 4CV3A 2X22A 3ZY2A 2DRIA 2WYOA 2OFWA 2BHNA 3T15A 1MJ5A 4WE3A 1DOHA 1KPIA 2BCGY 1REQA 1WTCA 3DPSA 1R6XA 5K3FA 2GX6A 1ZN9A 4FHEA 2P1RA 5FPPA 2QZ9A 4KXNA 2BI8A 2H31A 2W6QA 2CF5A 1QIFA 2ZTSA 3L7IA 3R3HA 1VPWA 1KFBB 3N3BC 3HUDA 4Q1DA 1EP3B 1N4DA 3IIEA 1J07A 2HGSA 3LGSA 4Q3AA 1QOQB 2B30A 4C0XA 4Q37A 5EKUA 5JHHB 1R0RE 1TAQA 3IMEA 3MS2A 3GW8A 5EZYF 4CQMA 2P6MA 3Q7TA 4RQUA 3RVPA 1JEEA 4L5YA 1XXLA 1HRDA 2B4RO 4OHYA 3EGOA 3OMLA 2QI9C 5CP8A 2I67A 3Q3VA 4RWZA 2G1KA 3PGKA 2K7FA 1Z4MA 1K3FA 2I8AA 2YW2A 2GGSA 1JFLA 4CHGA 4TPKA 1XAHA 5HK9A 1E6UA 3MT0A 1KWGA 4LZPA 3QEMB 4ND8A 1PQWA 1ZX1A 4PWYA 1W76A 2WINI 1KAOA 4M98A 1NBMD 1KL7A 1QK5A 3ZVNA 2A30A 3GEMA 5JJCA 3RU3A 4EDHA 1AX9A 4M8KA 4ZO9A 1CJTC 5F21A 3T5CA 2IQ5A 3G5UA 3WYFA 1QX3A 5JH7A 2JZCA 3BJEA 1YE8A 3RYCB 1WVMA 1MNAA 3BOSA 4BNXA 1P60A 4HNQA 4FFBB 4S1VA 1G0OA 3CRQA 4JKYA 1NLMA 1RU3A 1UEIA 3L8FA 4Q4HB 4V3CA 1T2DA 1NDHA 4ILKA 5DPMA 2C5AA 1H5NA 3ESCA 1DELA 4MH0R 4URFA 4Y2SA 5BO5A 3S70A 5JD6A 3EAGA 5EE9A 2PY6A 4D42A 3SQXA 3JQ8B 3KPUA 4AQDA 2O5EA 1QO0D 3I3SR 5ER9A 4KUHA 4D2IA 5D3MB 4DA7A 4KQ2A 5IJ9B 3AU9A 4J2HA 1SFRA 3BMCA 4CUZA 1H93A 3FA2A 1ZK1A 4YP9A 2JAQA 4HWSA 1GPBA 5JS1A 1G8KA 1D0VA 3SWWA 2HRBA 2V7VA 3NJ8A 1G6KA 1TCUA 2LVBA 1Q3HA 3VMMA 3VYRB 3T5TA 2AI3A 1E0JA 3OFNA 1BMFA 4PLPA 1WLSA 1XZBA 4O2AF 4LN1A 1FRZA 1D2RA 2OK8A 1QVWA 3UT5A 9LDBA 3W9UA 3M5PA 4TM7A 2Q2WA 2IEAA 1JI3A 1AHPA 1DTSA 1VG8A 1E4YA 1WX1A 1X8KA 3L0ZA 1ULHA 5E7QA 5JAZA 3VRHA 3TRKA 2B2NA 1AMOA 2RC5A 4HEA6 2QY6A 2ZIVB 1DC4A 4CQMB 2WB4A 5C5CA 3H2SA 1P7PA 3RIEA 2CVZA 1ZJ6A 4KMRA 3MCAA 5H70A 3JQGA 2UZ4A 5JDCC 3DZCA 1SXPA 1GKLA 4RA6B 4RZXA 4H7KA 2WRZA 5FA8A 1NJ1A 1GNRA 3DB1A 1SVLA 3ENWA 3FVWA 2J48A 1U8YA 4CL8A 2C4HA 3K2EA 1CZKA 1QH0A 2DBQA 2NU7B 5JARA 3WAGA 5DNDA 4GX0A 3NPMA 4TTRA 5EKDA 5IDYA 3ZJYA 1QKKA 1GUZA 1B0PA 4G0YA 2QOEA 2Y1FA 2FWMX 4RO0A 1KO4A 1M7HA 3ELDA 3Q3HA 5EWLA 3N0VA 4OOEA 5HQ3A 1CUIA 4PQRA 1Y7PA 1G5RA 4IO0A 4WLOA 4Q9LA 3TLMA 4H3HB 4UZEA 4LDJA 1AE1A 4MGZR 4XLZA 2IHNA 5EXXA 5HYVA 3IAM6 2GUGA 3MTQA 3HSSA 4HEA1 4CIWA 3ZWOA 4TN1A 1HLPA 5DB4A 1ZRSA 4N48A 2C2KA 5ERXA 2JKYA 1FVHA 4DN6A 1W48A 3IPXA 3JR3A 4GKVA 2VLIA 1RC8A 3RR2A 4MLPA 1CG6A 4XM1A 1RLUA 4W1PA 1RYYA 2OORC 2X13A 1E3SA 3N05A 1X3SA 1XVUA 2NTYC 3H3XA 4KH0A 1RXSA 3OVMA 4TMWA 4URZR 3RU9A 2IDKA 4JDUA 4OMUA 2W2LA 3T3NA 3W7AA 3TF5A 5ALZA 3K3PA 3JSAA 3OKPA 1RI5A 2ST1A 2FWBA 2ZE7A 3KL4A 4XJXA 4ER3A 3GGSA 1SU6A 4G5GA 4Y1FA 4DIMA 5CAEA 4I0WB 1ZZGA 4UMFA 1FJHA 4GC9A 3N2EA 2BGRA 4D9FA 2OYSA 4BQOA 1QORA 1U9JA 3U13A 3GFVA 5TF4A 3VI3B 1U7PA 4B3CA 1QHFA 4FYVA 2JH9A 4LCJA 3DTVD 1VHTA 4R2WA 4LW8A 5TVKA 3SZUA 3WHIA 1NVBA 3LP6A 1JIIA 2Q29A 1EWVA 1Z5ZA 2G6TA 2QNRA 3B7WA 3PUIA 3TKYA 3N7TA 4HB0A 2WYHA 3E3OA 1QFYA 1U5CA 2IYWA 2JW5A 3IAM1 5BXYA 3KKMA 4MGEA 4PAOA 4Y6GB 1FRNA 1WXWA 1F3OA 2FPKA 1H2BA 1K7XB 4QZVA 5KTRA 2W2TA 1VP3A 2ZIAA 4YAOA 4GMGA 3ROFA 2H00A 2VLBA 3JQGB 4NOMA 1JEYA 1BS2A 4H60A 3VO8A 1PLLA 1CQJB 2F8MA 3MB5A 4RC9A 3ZZNA 3N0WA 2KW5A 5FD8A 4KQKA 1SWVA 3E9ZA 3ADBA 2BEKA 2YHBA 5AM1A 1M8PA 2GN4A 4MB0A 1EG2A 3RVKA 3FNGA 4CIVA 2GZAA 3ZK9A 3LYUA 4LFBB 3DO8A 2GKSA 2XQIA 4PAWA 1PL6A 2G09A 2QTMA 3O0DA 2D7CA 2VDWB 4K0RA 2QRNA 3L1VA 4MLDA 5A4FS 5CFZA 2XR1A 1FXWF 4WLFA 2XF8A 4HK4A 5IDQA 4IY1A 3TW6A 1CBUA 2GZHA 3UJCA 1QPGA 4ZVUA 1HORA 1HZZC 2CC2A 4ABYA 1TT5A 2YOFA 1YKSA 2XUPA 2X2FA 1IPFA 3ZE6A 4ZCIA 3VR6A 2ATXA 1XAJA 2CL0X 3INGA 4UARA 5HQ3B 2ZOSA 2KJQA 3BEOA 4E3ZA 1ZEJA 1B7GO 5CNMA 1GAWA 4XRGA 5K3OA 4V0SA 2QUIA 1JMKC 1YR2A 4OP2A 2DPHA 4OHZA 3WMFA 4JEIA 2XUGA 1FNDA 2IJGX 1FX1A 1WP9A 5M04A 5AW8A 3V33A 4N5DA 4PC7A 1S96A 2C9YA 1B1CA 3WK7A 3WQBA 1ILEA 1RZ3A 3BMQA 4KAFA 5EUBA 3U3XA 3WDKA 1CIPA 1IRXA 2VDUE 2XUIA 1XZEA 4CM3A 1IZYA 1CY4A 4YP6A 1YCDA 4EABA 3C74A 1AXRA 8OHMA 4QSHA 1G18A 3RGWS 1LRLA 2GM5A 5CVCA 3O2NA 1E79A 3N5CA 2VHTA 5E8JA 4E12A 3U80A 1GNQA 2YVLA 2HWUA 4FHGA 4CCYB 1MP0A 1P7CA 5DVZA 5BSWA 3EJWA 5JYCA 1QV6A 1UBLS 2B8TA 4WFKA 4GZ3A 2WP0A 3CBGA 4HDKB 4D43A 5JU6A 2IU6A 4RPIA 4A15A 2Q5EA 3K1AA 2B98A 2Z5FA 3DAOA 3EZ2A 3ACBA 5DCLA 3IURA 2AYXA 1IUPA 2QGNA 4ZI7A 3IPYA 3MTIA 2Q9AA 1Y4UA 4M9QA 1IXSB 3WK5A 1M75A 1FRVA 2HREA 3HZOA 3T5MA 4CCWA 4LSGA 1PEAA 2DR3A 3B85A 4YUZA 4S2EA 2IYAA 1EFPA 2QN9A 4MZXA 3ONWA 1QVZA 4UNRA 1IU9A 1NY6A 3SZ3A 4BMPB 2JH8A 2ZQ5A 2I3DA 1U7HA 2E9SA 3PR1A 3NM5A 1TM2A 3IIJA 3A37A 3O9ZA 4R8KA 2IK8A 2YHAA 4F72A 5D5PA 3EMBA 4C6HA 1B23P 2PVCA 3MRXA 4RF5A 4X3CA 1JYEA 1NA5A 1NQXA 5ICSA 3GD7A 2XV1A 2BGNA 1GUYA 1X7DA 5BV7A 1A0OA 1ABFA 4Z2YA 1CEEA 4BNLA 4BASA 1L5VA 2FJ0A 4YLEA 3HXOA 3Q87B 3TLZA 2QQ5A 4XLTA 3AETB 1GAXA 1L1EA 2O8EA 1Q1BA 1R4ZA 3ENVA 3QBDA 3LUKA 2D1FA 4B3SB 1EFVA 2HWWA 1NVXQ 3IXLA 5JDCA 1S1MA 4MIOA 3ADPA 4O2BA 4L4YA 2H0RA 3C7KA 3REGA 3HCCA 1FRQA 4ZI2A 1V8ZA 1MQSA 3ZI7A 1NF9A 1H2AS 1XDGA 2XQKA 1TYCA 3P2YA 3R7BA 4J0DA 4LFAB 1PJLA 1T9GS 1IONA 1BXGB 3VZRA 3OJ0A 3OT4A 2AK2A 1XZDA 1E5XA 2MSDB 5FWDA 3P2KA 2YWFA 2VJMB 4M2LA 1NW5A 1QH8A 4L8FA 5JE8A 5BVHA 1C3XA 3DEJA 4TX1A 2JJQA 2J3DA 2XZDA 3GIDA 1UC9A 4M1YA 2V9ZA 1FYFA 4QJIA 1QOZA 3L4SO 4TS9A 4Y9TA 5K3SA 3V1TC 3VO9A 3ED5A 1YJQA 3ENQA 4KQMA 1EXDA 2P7HA 5EJ2A 2PJZA 3GGCA 3E5RA 1BQ3A 4Q3LA 3ORRA 2WSLA 4GQBA 4P08A 5EUMA 3LX6A 1G8HA 4WERA 4ZOQI 2FPUA 2A9KA 3BZBA 3ZKWA 2B82A 2FG6C 1WNTA 4JR2A 4P58A 1EB9A 7YASA 3OZVA 2GAOA 4JFRA 2OORA 2YMLA 3K1AB 5EFOA 3LYLA 1N7IA 3D0KA 5KI6A 4LK3A 3GDWA 3L6UA 4BKPA 4RK6A 1HDGO 4XPIA 4NU0A 2CL6X 3H1FA 2O19A 3BRSA 4TSFA 1A4IA 4QFDA 4DSNA 1ZA2A 4AJIA 1NVDA 5LP6C 4EA7A 4Q7QA 1DZIA 1EFPB 3BSYA 1K6JA 2FFHA 3KLNA 2I29A 3QYJA 3QJ5A 3PUJA 4KNWA 3TM5A 4EDFA 5HZHA 4RY9A 2V98A 1H2RS 1UMDA 3IX7A 3R40A 5EJAA 3T4EA 3F5SA 2ADFA 3VZDA 4PCVA 4CI0B 5AD1A 3W5BA 5FQNA 1E6WA 1BN7A 2J8ZA 2JASA 3FZQA 3G7SA 4TVOA 3WGHA 4RE5A 4G1CA 1OWMA 1YV9A 3VDXA 1RQPA 5KSZA 1JPNA 3DULA 4ABTA 1KAHA 4Z0HO 2C58A 5G3YA 5EJEA 1X42A 5AKGA 5I4KA 3ONEA 3S8MA 1WJGA 2CYCA 1AS3A 2F64A 3MTJA 5DLDA 3ZU3A 1W5SA 3NKLA 5AVWA 4II7A 2VOEA 3B5JA 2GHRA 4WUTA 2JANA 4YREA 2IU0A 2HQSA 1C8BA 3V3TA 3X2EA 1JAZA 5I7EA 1LCIA 2CB0A 2O5CA 5D2CA 3SF0A 4WCFC 5CA1F 1E63A 2Q5OA 5I9IA 5H80A 1CTQA 1U8TA 2VYQA 4XRRA 1ZK2A 3KKEA 3NTRA 1JAHA 3CX7A 1KK1A 1Q16A 5FL7A 1XCLA 2IA5A 4W7HA 4C5AA 3RT9A 1KERA 1PUJA 1RRVA 2GCGA 2V03A 3IALA 3IRVA 4XZ3A 1ZK4A 4R68A 3SXJA 1HZZA 3V8MA 1QH8B 4B6PA 3DVAA 2NU8A 4KSBA 1ABEA 5ARBA 5KQLA 1EHYA 2XB2A 3IFSA 5CT9A 4DLNA 1C9YA 3PLAE 4K9KA 1YDGA 2H17A 3KYIB 1DAKA 3FKJA 3HXPA 3O1JC 4K9NA 4LV6A 3MJSA 3G8BA 5H3CA 1IN1A 5B64A 2OP1A 3KDAA 4ND2A 4M55A 3Q3IA 5C4MA 1MOZA 3R3VA 4NV3A 4P86A 3TPFA 3OE7A 3HL0A 3ZKWB 1I51A 1N2BA 1XEXB 1J97A 2GRUA 5KVAA 5EWMA 4NENB 1HI9A 1DGQA 1J0AA 2GXUA 1U8ZA 4PYJA 1OLSA 3ZIDA 5EIXA 2YDXA 3U6KA 4XPIB 4HQRA 3FPEA 3M33A 4J94A 2ZETA 5JVDB 4UATA 1O9GA 2BTOA 3VVCA 2NYAA 1YQTA 2MOKA 1RPJA 1JQ5A 1O87A 1JGTA 2JIQA 2R2AA 2YY5A 3LT5A 3JD0A 3O92A 4YCSA 3RC8A 2XGGA 4NATA 1UMDB 2OC4A 3D3EA 4C01A 3NVKI 2WU0A 2XCTB 1MRNA 2B7LA 3IULA 1N5JA 3PEWA 4IEFB 3NHUA 4LY3A 1KY4A 1JP7A 3D7MA 4NU8X 2WILA 4DA4A 2GM4A 2JDIA 4EK9A 3HSKA 1E92A 4BUCA 5CYPA 3SOPA 1E6MA 1F4VA 4LYHA 4NIMA 1ZRNA 1U3FA 3N2KA 2JLSA 1P77A 3LO5A 2GFIA 1C8VB 4WUVA 3IHTA 3SIPA 4YQZA 2G9ZA 3HN2A 2ZYUX 4X8OA 3TJRA 3VPSA 2AN1A 4F56A 1KZGB 1VXRA 4MCHA 4BFSA 4GI7A 3AFOA 2V7WA 3NHPA 1XQ9A 1X94A 5ARCA 1HEIA 4HQ6A 3MWJA 4IQ0A 1K6MA 4K28A 3R5JA 3PG5A 2RE8A 2P1DA 5FIUA 2BSAA 3C3YA 1MAWA 2COKA 4KFSA 3THWA 4QXOA 3W5VA 4HN9A 4RL4A 4TKUB 3WLRA 4GOKA 4BO0A 5LMUB 1YI0A 5L45A 3KUXA 2QTZA 3A58B 4J8PA 4LJ7A 2ZK7A 3WKCA 4OQZA 2PHZA 3WGZA 4EG7A 3LQYA 3W8RA 4DMUB 4GLBA 5A05A 3PHJA 1H8ED 3LUCA 4LXIA 3DVAB 2ZZKA 4PZAA 3VYWA 3LT0A 3I45A 4PV7A 5EJ8A 5CEJA 2R5WA 2B7BA 3LY7A 1Z15A 3TQCA 4CHTA 1UBEA 2PBLA 2ROQA 2G71A 3GMSA 4XWGA 3AHGA 3F9IA 1EVKA 2H59A 1YA4A 3GZNA 4LOJA 2B4KA 4PLWA 1TC1A 3FCYA 5KPDA 5ULLA 4B4VA 4YAKA 3OZBA 2CVFA 4BYGA 1Z47A 1NVAA 2X19A 3KYBA 1WS6A 1DZ3A 4M9CA 2QTHA 3VDQA 3W5HA 5EWMB 3F5MA 3VX3A 3WHKA 4AKIA 1YVPA 3PLRA 4NV0A 4P4TA 4LYJA 4ZGGA 2WPDD 5ALKA 3OX1A 1OYWA 4XD7A 4DREA 5L95A 3LCVB 1UJ2A 3Q6IA 4QGSA 3WFJA 1K9SA 5L3QB 1NQ5A 1SH7A 2FNAA 2BGKA 5LQMA 1G59A 2ZIFA 4Y9UA 4ROTA 1U3CA 1K7FB 3GEPA 5IJAA 1NX6A 1T2NA 3ET5A 3A6JA 2B4AA 2RB4A 2WBLC 3ZV3A 3KR2A 1L5FA 1GVHA 1U90A 5CLGA 1I1QB 1WV1A 3S2GA 2FMUA 2OFPA 4OXNA 3NH9A 1FUKA 2IQIA 4HZIA 1E1DA 2J7KA 4WNCA 5JO9A 4EGQA 2RJOA 1JVBA 3FZYA 4J07A 2HCRA 4LXXA 3N2KB 1LBEA 1DIOB 4ZHQB 4D8XA 4R1LA 4CMGA 2A2ZA 4IIUA 2NXWA 3EDYA 4C7JA 5KTPA 3VBCA 1I6WA 5LP6A 1J8QA 1TKRA 2L69A 1Z4QA 2WVAA 4ZODA 2GPWA 3EDOA 3WL3A 1AK1A 1P74A 1UBKS 2FMTA 1XZKA 3EGVA 1I3MA 2OXRA 2XRMA 3IEUA 3DCNA 4UUOA 4Z9YA 2OD7A 5DLYA 4I5FA 3L4KA 1EBBA 1G20E 4Q9JA 3FPJA 2AYZA 1J5EB 2HNAA 3PIIA 3KP1A 3ZQJA 4P5PA 4AN1A 1ELOA 1IIBA 4BGIA 2WB2A 5K09A 4FGLA 2XZLA 4CLDA 3PXGA 1LBTA 4PXSA 2JLXA 1SHJA 3AHJA 3IV6A 5K0NA 4ZAGA 2QXUA 2J33A 4P4LA 3OOJA 1DJNA 2CB9A 1T8SA 1W0JD 2PMBA 4RSGA 1T2UA 1J0DA 5AOBA 5FI3A 4UM9B 1UC8A 1KDOA 4WCFA 1WZUA 2RGCA 1KF0A 4EI9A 3GZTB 4WOBA 5AW0A 1JDTA 5LXTA 3M6LA 1CY0A 3IBSA 3DW3X 4GD3Q 4XWAA 1JEAA 4DOMA 2M1XA 2PD4A 2Y3IA 3NOOA 3OEYA 4LVNA 1NTRA 2YKGA 4YDSA 2EKBA 4H08A 1Z83A 3FPGA 4MW4A 4CODB 5FPYA 1M1XB 4HFNA 4RHEA 1ECPA 5HMMA 4IXMA 2CHGA 2ORED 2O2IA 1XCOA 3BH7A 1W75A 1B93A 3C5EA 3ZD6A 5F2KA 1U94A 3ZWDA 3S5JA 5F52A 4YUWA 2ZCVA 3ORYA 4QXMA 3VM6A 3QNUA 3RFXA 1U8AA 5JLJA 2GT1A 3PCRB 2HEIA 4CW7A 5LZ8A 4E5SA 2GK7A 1L7DA 1EP9A 3KLMX 3FH0A 3K35A 3FOFC 4OQEA 1ZH0A 3U7EB 4WCDA 4CMIA 2ZJ3A 1YAHA 2WQ6A 3HR7A 1B2LA 2UYCA 1HUQA 1YQGA 3CW8X 5CW1A 2W6ZA 1DQYA 1EUCA 2EEZA 3LL4A 1YB1A 3WNBA 2XUOA 4BMZA 1IM2A 2Q8NA 3IP5A 1PV1A 1XRNA 2W2PA 4NBRA 5KB3A 5IS2A 4F1KA 1I3OA 3MJDA 1C1DA 2ZREA 2Y0BA 4HUQA 2XT9A 4BNYA 4R8RA 1XF9A 4CXMA 2ILTA 2JFBA 2D7DA 4KACA 2ZJ0A 3OM1A 4TKLA 5LP6B 1JEQA 5BSHA 1T4DA 2PIDA 3M6MD 4PLHA 3EC7A 3K6RA 3KALA 4D3XA 1H8HD 3EMVA 3KT8A 1U2PA 3BL8A 4IHKA 4AXXA 2G72A 4US2R 1NMZA 1WW3A 3AVTA 3FNIA 2ET6A 2BAGA 1T8TA 4I8IA 5EC8A 3PUYA 4AWXA 1TMOA 1I7SB 5JS2A 1BDJA 1LTHR 4IDOA 3QE3A 3O8DA 4DLUA 1PNRA 5JNSA 1YQXA 2BFFA 3ILVA 1RJFA 3AY7A 1WSDA 2J31A 4F4DA 2QL6A 2I2CA 3HCPA 4I3FA 1B00A 2AL7A 1TTHA 3A6HA 1FQJA 2JKZA 3V4LA 2BI7A 4HAZA 4RTSA 1C9NA 3HBLA 2NLOA 4OHOA 1F4PA 2PL9A 4KRFA 5L4NA 3TFQA 4CQLB 5L7YA 2GO1A 2OHFA 4WCFB 1ZK3A 2CK3A 1SOWA 2FYTA 5I9SA 2B6HA 4C0BA 2BEVB 3CF6R 2I91A 3GP3A 3KT0A 1VIYA 2GEVA 3BE5A 3OPYB 2A5YB 4YRSA 3LXMA 2OFXA 3G2KA 4S1OA 4B2LA 2FSFA 5BSVA 4DV4B 3IQZA 4B3IA 1O54A 3S2UA 3F4LA 3G5TA 2UDPA 5MFPA 1ICIA 5JC1A 1SVKA 4MUJA 2ZR0A 4G01B 3P52A 1T0IA 5E6RA 4KIJA 4JBYA 5HFJA 4D9CA 2QPAA 3LMKA 4CNBA 1E4EA 3A32A 1JLRA 2RDMA 5IVHA 4ETNA 3F2VA 4KBYA 3EOAI 5EESA 1PK7A 4UHKA 4AVYA 5FBVB 1FTYA 2NYRA 2HA2A 2W6ID 3EVCA 3G1WA 4GZ5A 3WGKA 2BP7A 4CMIB 1ZINA 5U4XA 3O1LA 4BU0A 1EWQA 2ERCA 1N5IA 3CA8A 4G4JA 5H3HA 4HPXB 5AHXA 3FI9A 1DIGA 3LPDA 1M3SA 2W2VA 3KTDA 4LX0A 1EUCB 3QMWA 4M22A 3OWXA 4DCOA 1WZCA 2IZ5A 4PZYA 5FUMA 3PXCX 4M37A 4OFBA 2BEUA 1CT9A 4RU1A 4P2BA 4HX2A 4HUQB 1RABA 3UN1A 4FFRA 1RIIA 4FOPA 5DJ5A 4AN4A 1T1SA 3ZYCA 2BGGA 2GA8A 2Q0HA 1JEQB 3VR5A 1RVV1 4JVSB 1I4WA 5I9NA 1HYGA 2I4MA 1E9SA 1NJ2A 2Y6UA 4DDWA 3HWSA 1R66A 1AF7A 1ZO8A 1FVXA 2GNOA 2JK0A 3HUEA 3DV0A 4HLNA 1SURA 4U39A 4AKTA 4B45A 1RDFA 2FI1A 2Q3LA 5AJVB 3KXPA 2JFOA 3SNKA 1PT9A 1GPMA 3AWIA 1EKXA 4FDLA 1U0RA 4Z86A 1E1KA 2GS9A 4I1RA 1Z5NA 5G53C 5JJ5A 1DIAA 3PCXA 3FFWA 1W9MA 1YZTA 4W82A 3RSZA 5CXXA 1P4SA 5IDXA 4BBAA 2DBYA 5CLIA 3Q88A 5A0FA 1WXDA 1Z4IA 2XXBA 3RVOA 3B3GA 1P5JA 2ERYA 1KMHA 3D7NA 1XTVA 5EIWA 1XRMA 3VZPA 2Q6OA 1VPTA 3L8YA 3YASA 1ETHA 2Y93A 4OLAA 1R8XA 1T1RA