1ZO8A

X-ray structure of the haloalcohol dehalogenase hhec of agrobacterium radiobacter ad1 in complex with (s)-para-nitrostyrene oxide, with a water molecule in the halide-binding site
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
252
structure length
252
Chain Sequence
b'STAIVTNVKHFGGMGSALRLSEAGHTVACHDESFKQKDELEAFAETYPQLKPMSEQEPAELIEAVTSAYGQVDVLVSNDIFAPEFQPIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKRKSGHIIFITSATPFGPWKELSTYTSARAGACTLANALSKELGEYNIPVFAIGPNYLHSEDSPYFYPTEPWKTNPEHVAHVKKVTALQRLGTQKELGELVAFLASGSCDYLTGQVFWLAGGFPMIERWPGMP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords halohydrin dehalogenase
publication title Structural Basis for the Enantioselectivity of an Epoxide Ring Opening Reaction Catalyzed by Halo Alcohol Dehalogenase HheC.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Lyase
total genus 91
structure length 252
sequence length 252
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 4.5.-.-:
pdb deposition date 2005-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1zo8A00
4RCVA 1KEVA 5AXCA 4EUFA 5DBGA 1U1IA 3ZV5A 4DQVA 1NQ5A 3UGKA 1G6KA 1B2LA 5JAZA 5MDHA 2FHSA 2NU9A 2AQIA 1XELA 4J0FA 4EZBA 4B3JA 3RUIA 1E6UA 1G0OA 5BNTA 1U5AA 3ENKA 3BMQA 3NT2A 4BNXA 1Q2XA 3PEFA 4WLEA 5HRUA 5DCYA 2EKLA 4E5YA 2HJRA 4RVFA 1XYGA 3T4EA 2OBYA 3CH6A 4J16A 1T2EA 1O5IA 1U3VA 2B69A 3OJFA 4LN1A 3Q2IA 1GD1O 2BF7A 4GSKA 5A5EA 1LDEA 3CINA 4Y6PA 1NWCA 2P4QA 2E4AA 4BQPA 3ZWMA 1I2BA 3W4JA 4E33A 3S2EA 4UUNA 2P5UA 2VT3A 1ZXBA 5IN4A 1YS4A 3GEMA 1M67A 2UAGA 2DUUA 1SC6A 1PQPA 1PWZA 4JJFA 1H6CA 2VYNA 4IUYA 5AXDA 3WBFA 2BH9A 3DHEA 3OSUA 3FRJA 3PHHA 4UUMA 1B15A 1HE4A 4BNNA 5JBIA 4GX5A 2YW9A 3SLGA 1HDRA 4DLBA 4MP3A 4ND4A 3RC7A 2IDZA 1QKIA 3EMKA 5KJ1A 4GL4A 4O63O 4RZIA 1VC2A 1QLJA 4YAGA 3E8XA 4AFNA 1LDMA 1KY5A 3ZHZA 4C7JA 3MTGA 2OXIA 2RBEA 3I5MA 5GZ6A 3PHLA 1ZO8A 4B7CA 1HRDA 2UV8A 2AQ8A 4Y6RA 1A72A 4N7RA 5A04A 3I4CA 1E6WA 2JL1A 4FJ0A 2BRUA 2WJPA 4J9VA 1PJTA 2W2KB 3NYWA 1I2ZA 4QO7A 5DZSA 3JQAD 1NVTA 4RPGA 5FFFA 4KUHA 3PYXA 3RUEA 3LC2O 4MVJD 4OHUA 3A1NA 2V6MA 3LT0A 2VQ3A 3WLEA 1JKJA 4WJZA 4E5PA 1P1RA 1JKFA 5ADHA 3ASVA 5JYDA 1GPDG 2LDBA 2X0NA 3GVCA 1KVTA 4J2HA 2QYTA 2R2GA 4KOAA 3O8QB 4FOSA 2XF8A 3PPIA 4XQCA 4QT0A 2GR9A 1FDTA 1MXFA 1U2DA 2X58A 3D3EA 5T57A 4CPDA 1PGNA 5CDTA 2I5PO 1CEQA 2VZ0A 2AQKA 1GYRA 2QZ9A 3PGJA 4Q3NA 5KVVA 3NGXA 4QO8A 1JQBA 5HM8A 1NAIA 5B12A 5KCZA 3P5SA 4BGIA 3PYLA 2P68A 2SCUA 3PFFA 3QVWA 4UULA 3UCFA 1ZZEA 4U8GA 3UCEA 3PFWO 4H16A 4IZHA 3I9LA 2QRJA 2NQ8A 3CSDA 3OA2A 1D1TA 1UR5A 2BFAA 2VT2A 3KYBA 1O6ZA 2RHCA 2IYOA 2NUAA 2AG5A 2PH3A 2FPIA 1NX6A 3JQ8A 1P9LA 5DF1A 3ZDFA 4E5NA 2P9GA 5L7WA 2A94A 2FWMX 5DBIA 1PJLA 3N74A 1KEPA 5TF4A 4DVJA 3ROMA 3OJ0A 4TKMA 4K6FA 1ORRA 3AFMA 2PKQP 1ADBA 3VZQA 4L4RA 1GUZA 1GV1A 1Q0HA 2NQTA 4I5FA 3DONA 4FDAA 3VVCA 3NTRA 4NJMB 1SEPA 3MOGA 1NQAO 4FSHA 1TLTA 3ANMA 4Z0PA 2HAEA 3SX2A 4RVHA 4PG7A 4YT5A 5ICSA 3KYCA 3M6IA 1IOLA 1I36A 1CETA 1MP0A 3OQBA 4P22A 3WGIA 4WGGA 3P2OA 4CV1A 1N9GB 1E3WB 2YY7A 3IKVA 3L4SO 4AJJA 4B7XA 3DC2A 3ABIA 2FY8A 3EZYA 1TA4A 2AXQA 4MOWA 2E6UX 3AUTA 3RVDA 5C3MA 2ZYDA 3W8EA 1WDMA 4BNKA 1IZ9A 4RLHA 3PWSA 2I76A 5JO0A 1M6WA 4HV4A 3NJ8A 2HKIA 4UREA 1ZXLA 3G1UA 3IP3A 3ZWPA 3X2FA 4ROSA 2CDCA 2Y0CA 2RHRA 3D4NA 2ZK7A 2OGUA 3ONEA 4OOFA 5ICMA 3AOEA 3AU8A 2VZ8A 4R3NA 2GZ2A 3F5SA 4PZCA 2B36A 1Y9AA 4PN3A 4XA8A 3G79A 4I5DA 1PR3A 1PZFA 1XWFA 3AOGA 4R1SA 4N5LA 2VHVA 2JJYA 3H8VA 3TFQA 3IOYA 2HDHA 2Y1FA 4RF3A 4D44A 1QV6A 2QYSA 3H5AA 4EDFA 4YRAA 4FFMA 4B4UA 4BO8A 1YDWA 4YJGA 3TJRA 4CMHA 3BTVA 4JLWA 4WNCA 5BSEA 3UUWA 3PVZA 4CM6A 1SB9A 3IP1A 2XPCA 5C7LO 3D5TA 1WNTA 4YAKA 4E4YA 3S55A 1H0KA 1BXGA 1FMCA 4DXHA 1X7HA 2DTEA 3H9JA 3VH3A 2BKAA 1A4UA 1VI2A 4GQAA 1BVRA 4HFJA 3I9NA 5F3RA 3CKYA 2CDBA 1A7AA 1EFKA 4P4LA 4EI2A 1BDMA 2O50A 1NPYA 3ETDA 1HZZA 4PLTA 4CLRB 1T2AA 1FDWA 3Q0EA 3UN1A 1E5LA 2ILTA 5KIAA 1V9LA 3UXYA 3ZV3A 4N54A 4TVOA 2ZTVA 5DN9A 2IODA 3TQHA 5CDGA 3DBLB 3GY0A 5IDQA 1QYCA 2QRKA 1QLHA 2P91A 3K5PA 2ZQYA 4OM8A 1ULUA 1MV8A 1DIHA 2BGKA 2NM0A 2E37A 3F5QA 3UAGA 3A28A 1F14A 3RIHA 2PWZA 4R41A 2A4KA 5DULA 5DOZA 5MGBA 1RKXA 2VUUA 4HFMA 1TT7A 1H6DA 2WTBA 1QV7A 1YB1A 3RUHA 4FS3A 1DHTA 4H3VA 5L4LA 2YHIB 1T1SA 1UDAA 4IXTA 4BNFA 5LDGA 1MG0A 1PJCA 5CPBA 4D79A 1E1NA 3MEQA 5IZ4A 4MP6A 1SCUA 1I32A 3RU7A 4B4VA 5IN5A 2FSSA 3HNPA 3KEQA 4KMSA 2B4TO 4YDRA 5JCXA 4NFHA 1PGPA 2PNFA 2VTDA 1KEUA 4KDFA 4XX0A 3CPSA 2VHWA 3WTBA 4FFPA 2NADA 2Y1EA 1UDCA 5TQVA 4JP3A 4MVJM 3M1AA 4FW8A 2VWPA 1DAPA 4AJKA 1ZIDA 4E30A 1SNYA 1Y8RB 3D7LA 2E49A 2IZ1A 4KZPA 3WBBA 3WR5A 4BB5A 3DZIA 1LQUA 3R6DA 2P9CA 4GMFA 4YEDA 3KETA 3KOUA 1TB4A 3DTTA 5THKA 1QYWA 2C5AA 3JD0A 2D5CA 4NG5A 3AI3A 4KQXA 2VWGA 4Z9YA 5TX7A 1PJQA 1DFIA 3W6UA 4DREA 1X1TA 4F6CA 5A5FA 4BGVA 2HMUA 3HZZA 4LK3A 1RM4A 1ADCA 3JTMA 4XDZA 1YONA 3EDMA 5JE8A 3WICA 3PI7A 3O8QA 4BNWA 4EUHA 5G0SA 4AICA 3TDKA 5A9SB 5EMHA 3OM9A 1ULSA 3H2SA 5DOVA 5JW6A 5KJCA 1F17A 2B5WA 3O26A 5I9MA 1JVSA 2DAPA 4KTVE 1B16A 1GQYA 4OMUA 3E82A 4PVCA 4BS9A 1W6UA 4DTIA 1PJ2A 1ZK0A 3V1YA 2QIOA 1C0KA 1HLPA 2ET6A 2NACA 4M49A 3GZ4A 1GV0A 2POQX 4A5OA 4WLNA 4WCFB 4OQZA 4ZQHA 5EPOA 1T4BA 1JW9B 4O6VA 4WEOA 2G0TA 3E03A 2YJZA 4FFLA 5KVQA 1TT5B 1FDUA 1KS9A 3D5QA 3IIEA 1WWKA 1ZK4A 3ENNA 4CLOA 2AEJA 4R54A 2J5QA 4D41A 5L51A 2Q49A 3K2BA 1A4IA 3K9QO 3DZKA 1P77A 3WSWA 2Y99A 1N92A 1UXHA 1UP7A 1E7MA 1P1JA 2VYVD 3STHA 5DNAA 1P1FA 4YB8A 3D4OA 2EERA 3FNHA 5L7YA 1U9JA 1U28A 2Y68A 1NQTA 5I7SA 2X1HA 4GLLA 3AOEC 2EEZA 4NJMA 2ZIZA 5U4QA 1YWGO 4DMLA 3TZHA 4JBIA 4GH5A 4Y9DA 2LDXA 3OH8A 1YVEI 1AHIA 1YBMA 3KLPX 4XWYA 3BIOA 1ZCJA 3OIDA 3AI2A 1VSUA 2HK7A 2I65A 3NEPX 4E5KA 1X1EA 4CMAA 2JCYA 1GDHA 3DHNA 4J1NA 3I4FA 1N9GA 1E3WA 3OMLA 5T67A 4LGVA 3DZBA 1Q7CA 3VDQA 4E6PA 4ZGWA 2PGDA 3ONDA 4FC6A 1FXSA 3IC5A 3QLJA 3ON5A 1VSVA 1YO6A 2A35A 1BG6A 3QRWA 2BGLA 3SJ7A 3L6DA 2G82A 3DO5A 3BHJA 4WOJA 1KYQA 3RUCA 1IHXA 1FK8A 2WWRA 4B7UA 2VOEA 1PL7A 2PGLA 4ILKA 4J4TA 1P1KA 4EJMA 3I6QA 3AM3A 1LJ8A 1H6BA 2VTEA 2XAAA 5I9NA 3H6KA 3DBRB 4WEQA 1OFGA 4MPDA 3RJ5A 5CDYA 2PZMA 1BW9B 1YOVB 5C7OO 4L73A 3VZRA 1Y7TA 3ETGA 4PZDA 3EK2A 5C37A 4IDAA 3AY6A 1Q0QA 1OI7A 2PZJA 6LDHA 1VLLA 4PLPA 2PY6A 2GF2A 3A9WA 4KDEA 4DPLA 1V3UA 4ZJUA 2D4AA 1U8XX 4WK6A 3MZ0A 3FF4A 2NNLD 3G17A 3QWHA 4NBVA 5ER9A 3FHLA 3QVSA 2H5LA 4NU6A 2GN6A 1T2DA 3UH1A 4OXNA 1LLUA 2YV3A 3VPHA 4XGKA 2Q1TA 3QY9A 3DTYA 1HE5A 2VRCD 4YT8A 1IULA 5ENVA 4CLRA 3C24A 1RYDA 2CUKA 1PJ3A 3F4LA 4IQGA 4W7IA 3VKUA 1HF3A 1T24A 2ZJ0A 3BTUA 2BHLA 3DBLA 2OO5A 1J5PA 2O2SA 1DIAA 5EN4A 1T2FA 4L0QA 3L6EA 2DTXA 3RUDA 5B4VA 3IJPA 1OC2A 3WYCA 3PJGA 1PGJA 4PRKA 3JQGB 4UEOA 5A3VA 4A10A 2W2LD 2PZLA 4XYLA 3GUYA 2ZCUA 5A9TA 3U4IA 5IDWA 2VN8A 3AFNA 4IY1A 5GMOA 1BGVA 2C7GA 4IPTA 5IXYA 3NDIA 2YHIA 4GGPA 3AUSA 3RCBA 2YV2A 3H9UA 2WMDA 4OXYA 3GGGA 5HWSA 1R4MB 1AHHA 2JCXA 2DC1A 1OMOA 1JA9A 1C3VA 1ZVMA 1VL0A 2G17A 3I1JA 4PCVA 4GMGA 3DZJA 3HSKA 3H7AA 3H65A 3VPSA 4YR9A 1DIGA 3PHJA 2PKRA 4MKXA 3SXPA 3AU9A 1QG6A 3D4PA 4Z3KA 3E18A 4CQMB 1VM6A 3JQ8B 3GMDA 1OAAA 1XG5A 4G5HA 5JMWA 4TSKA 5BQFA 1Y8RA 3C8MA 1BMDA 1ID1A 3CUKA 3QVTA 3V5NA 3RBXA 2YFQA 3JQ7B 5ER6A 4F45A 3DOJA 2EJVA 3PXXA 4BNIA 1R12A 1CQJA 3EAGA 3OICA 4RPHA 3LYLA 1PEDA 3BXXA 2IXAA 4RV9A 4IJVA 5CEEA 1YGYA 2VUSA 1EVZA 1JN0A 2QX7A 2YYYA 4Z9FA 3RU9A 3AW9A 2UDPA 3FTNA 3WB9A 3FWNA 4U5QA 3GEDA 3ZH2A 2PA3A 3ZU5A 3KXDA 1BXKA 1Y9EA 3AUUA 3HDJA 1VL6A 1EQ2A 2HRBA 4A73A 2DBRA 3ZV4A 4XRRA 2YQ4A 4YAJA 3GF4A 5EJ2A 1FF9A 5JYEA 2WYWA 4BKUA 4JGBA 3UW3A 1O89A 4DLAA 4A03A 4URFA 4NH4A 1NHWA 5L40A 2CNBA 2Z95A 3DFZA 4J2OA 1V6AA 1E3SA 1ISGA 1E92A 2RCYA 1ZMTA 5BSGA 4KWIA 5COBA 1K2WA 1MB4A 3LLSA 5KTKA 5CFZA 4WCFA 4ZRMA 4IMRA 2Q46A 3M2TA 2UVDA 2X8LA 3BHIA 1TT5A 1L7DA 1LU9A 4IJKA 4JP2A 4NZ9A 3EZLA 3GDFA 5HS4A 3KSZO 3BA1A 2PK3A 2CFCA 2WEKA 3GN2A 2FOIA 3ZWVA 5LCXA 1ZK1A 4JX8A 1Q1NA 1GZ6A 2HUNA 4WLUA 4ND1A 3VKVA 4R3WA 2VHXA 4OJNA 1R4NB 4QFCA 1ZMOA 1HDZA 3KEOA 2FPPA 1YH3A 5JAIA 1W8DA 1F0YA 1NWHA 5EL0A 5I8ZA 4RVUA 3KHUA 4ND2A 3ZZNA 1XLTA 4E21A 2GUGA 3L77A 1BXGB 1XQ6A 1OBFO 4IBOA 3G1TA 4PG6A 4R01A 3F1KA 3LSYA 5BSHA 2W98A 1BDBA 2AMFA 1MA0A 4QQRA 4AL4A 1WAMA 5JDCA 3ADOA 3PRJA 5JLAA 4YCAA 3WSVA 3JQDA 2W90A 3U9LA 1ZJZA 3H3FA 1J4AA 1DRWA 2V6BA 3WGQA 2FP4A 2JHFA 4YQZA 4XQ9A 2B83A 3KUXA 4JBHA 3IL2A 5H81A 2NV6A 4CV3A 5BNIA 1NFQA 1E77A 5IJZA 1SB8A 3WNVA 4GX2A 3IUPA 4YACA 1PS9A 4GX0A 4BNUA 3DBRA 4KP7A 2FN7A 3VPGA 4FC7A 4PRLA 1BW9A 4CM3A 3FNGA 3OFSA 1YOVA 5IAAA 3IS3A 1MXHA 2GZ1A 2C2XA 4NK4A 4J4BA 3PP8A 4P4GA 3HWRA 3I6IA 5DP1A 2G76A 4Z9XA 4JXKA 2X4GA 2Q2QA 3WOHA 3ZN2A 2PD3A 2DUWA 1JAYA 2DBVO 2B35A 3ZWBA 1JKIA 2VUTA 1QSGA 3TZCA 5KWEA 4CMCA 3DR3A 2YDXA 4J7CA 3PIDA 2VRBA 1KETA 3FNEA 3W4KA 1GAEO 1HL3A 4MKZA 4RORA 5JCJA 4NR0A 5CDSA 4QEDA 1E3IA 4FOOA 4O5OA 4J0EA 4UEKA 4Y98A 1WPQA 4ND3A 5IXSA 4U0JA 4YVFA 5G0VA 1B8VA 4RVDA 3RC9A 4TZKA 4P4NA 2FR0A 1ENOA 1XU9A 2Q1UA 3I52A 3OJOA 4D0RA 1EK6A 3PJDA 2BD0A 4CV2A 4M89A 4WOKA 1B3BA 4CMJA 3H9QA 2WE8A 2AQHA 5F21A 4M87A 4IQ0A 4RF5A 4LSWA 3LLVA 3GPIA 3K96A 4UVHA 5L53A 1B3RA 3HADA 4QX6A 1JU9A 1NFFA 4TZTA 4YTEA 2ZB7A 4M1QA 2OFPA 4E32A 2G5CA 3JQGA 1V8BA 4YYZA 3WJAA 3QIVA 2DU8A 4RO0A 1L1FA 5T64A 5A3JA 4UVIA 1PTJA 3WGOA 1QYXA 3ANNA 1PZEA 4BO7A 3SC6A 5DCUA 2NTVA 2VZ9A 4FFRA 3ITKA 1R15A 2BI8A 2QG4A 4HXYA 5JPIA 1R4MA 2HMVA 2JKVA 4JNKA 3TSCA 9LDTA 1I24A 1T4DA 4B8ZA 1UJMA 5JSFA 3LZ6A 3RD5A 1WMBA 3RBVA 1FDVA 1YJ8A 2GZ3A 3JYPA 4WUVA 1SMKA 4AJ4A 2QW8A 1G1AA 1YXMA 4CM4B 2AEFA 3VDRA 4I5GA 5T5QA 2GO1A 4CLOB 2OORA 3F1LA 3GGPA 3NX4A 3BMCA 3D1LA 3B70A 4XYGA 4TRMA 3W8FA 4JBGA 4CQMA 3R0IA 1C1XA 3LT1A 5EQFA 4Q3CA 1K6JA 4BO6A 2EP7A 4OH1A 3ROKA 3H9EO 2EW8A 1IPFA 3WJ7A 3JQ7A 4XQEA 1GZ3A 2X0JA 3GVHA 2D3TA 1UZNA 4WCFC 4GX1A 6ADHA 1Z74A 4XQGA 2IEBA 5A05A 2ZYGA 3B6ZA 5COAA 3KRTA 3Q3CA 4ITUA 1GYPA 3I9OA 3ICPA 5A4DA 2O2YA 4Q3BA 1EVYA 3E1KA 1H93A 5J23A 3ZU2A 2Y1GA 1MFPA 3KLMX 1YRLA 2JHGA 1ADFA 4J3FA 1A9ZA 2WDZA 4LW8A 3JQAB 4RDIA 4YA6A 4Y6SA 3DBHA 4FIZA 2O4CA 4XYEA 4AJEA 2GERA 4IIUA 4FGWA 1ADGA 2J3IA 2J8ZA 4BO1A 2HSDA 1UZMA 1JVBA 4DQXA 1I3LA 4MJLA 3U5TA 3PWZA 1BWSA 2JAHA 2B37A 1NAHA 3GK3A 1UH5A 3OEWA 3O9ZA 1Y8QA 2Y1CA 3I9JA 4NI5A 4ZN6A 8LDHA 3HB4X 3GHHA 4XGIA 3C1OA 5ILGA 4MDHA 4QUKA 5TJ9A 3NTOA 5IDYA 2JFGA 1YBAA 3K30A 2O23A 1IB6A 2OOSA 5JDCC 2PD4A 1TVEA 4NU5A 3T4XA 2QZZA 4AJHA 3QVOA 1A9YA 2H1SA 3OQ6A 1QMGA 2TMDA 1O0SA 3HJAA 1EDZA 4WCDA 4YRBA 4BB6A 3QWIA 4YT2A 2BFMA 1M76A 4IJWA 1XKQA 3VH2A 1LSJA 1PL8A 1PS8A 5DDIP 1R4NA 1MGOA 3B1KA 5A02A 3GOHA 2WD8A 2DPGA 1HSOA 5ENDA 4R1TA 3LT2A 4YPOA 5T8KA 3U09A 4K28A 4XCVA 2HMTA 4ZA2A 4NHEA 1Z45A 3DMYA 3T7EA 4CM9A 3PLNA 5L4NA 5KOIA 1HDCA 1K89A 4JK3A 3I83A 5EQDA 4E2YA 1LTHR 3H3JA 3HDYA 1M6HA 5CG2A 4OOEA 3S2GA 1ZSNA 2J5KA 5TS3A 1QRRA 1HWYA 3QSGA 4J7XA 2VNAA 2C2YA 1AUPA 1U2GA 4L8VA 3OP4A 1S6YA 4E13A 4BO3A 5TGDA 1NM5A 3ZNPA 2HK8A 3RFTA 3F3SA 4YAEA 2GCGA 3GAZA 4BIIA 5CDUA 2EG9A 4NJOA 5ILOA 1LDYA 1LLCA 4K6CA 3SBOA 4NNJA 4XR4A 4PLWA 4BMSA 2PKQO 1B0AA 1BVUA 2D8AA 1I33A 1MLDA 1M75A 1D3AA 2I66A 2Q99A 3LT4A 1DAOA 2Z1MA 3IQDB 5G0UA 4K1LA 1J49A 2NLOA 3ICCA 2J5RA 1YE3A 4DC0A 1P31A 4A27A 1LC0A 1RWBA 3OA0A 4F46A 1E5QA 2WYUA 1KEWA 3JQEA 1WVGA 3GVXA 3DAPA 1PWXA 1Y81A 1VJ0A 2PTGA 3S2IA 2CSUA 3DAGA 4NFYA 1UAGA 5JDIC 1JTVA 5JS6A 1DXYA 3G0OA 5G0WA 4CMKA 4CUJA 2Q3EA 3HDHA 1YB4A 1PJSA 2EHDA 2PGJA 3JYLA 4G81A 4BO4A 3LF1A 4E2ZA 5L95A 4D43A 2BFPA 4MVJF 2EKPA 5JXWA 1A27A 3I23A 2O48X 4Z6KA 3ZU4A 2OZPA 4CLHA 2ZB4A 4XGNA 1ISIA 4INAA 1NYTA 3ETEA 4MIEA 2DQ4A 3MOIA 5IFLA 1VJ1A 5K6AA 4C7KA 1R37A 5CG1A 3FD8A 1KVRA 4R1NA 5FEUA 3ZWCA 1EQUA 5HS6A 3V1UA 1N5DA 2B0JA 5JC8A 1HE3A 4UVEA 3FWZA 1LSOA 3HN7A 3WMWA 4Q3EA 4BGUA 3AM4A 2VCYA 3ROPA 3HFSA 5IZCA 3QWAA 1E6EA 3ONFA 1P3DA 2VHYA 2X5KO 1Z75A 4MVJG 4LMRA 3EYWA 2Y67A 1E3LA 2P5YA 4S1VA 1E1KA 3N58A 3OF2A 3INRA 4AJNA 1ZH8A 2FSVA 3QQPA 1HSZA 4EJ0A 3E9MA 5I7FA 1GPJA 1EFLA 4PLGA 5F1KA 3KYDA 4GWKA 3JD3A 4QSMA 2NVWA 2ZYAA 2J6IA 4E3ZA 3O03A 1DC4A 5JNLA 3R3JA 4CM4A 3L0DA 2CVOA 3CZRA 8ADHA 4RVSA 1EVIA 4IDEA 1V35A 1KOLA 2VYND 2ZTUA 4PLCA 2Q1WA 3JD4A 4E12A 3HG7A 4BNHA 3DHYA 1R66A 3FR7A 1DIBA 3KTDA 4D45A 3QHAA 4JCOA 2P2SA 1DC5A 4I8XA 3KZVA 1VKNA 1EVJA 3BMNA 4L4SA 2Q45A 2JAPA 3JYQA 3JD2A 4AJIA 5DP2A 2JFFA 5JCJD 5A9RA 2OMEA 3PK0A 3KV3O 1DDOA 3NDJA 2AEMA 1M2WA 5KKAA 4BKQA 4BNJA 1E1LA 1NPTO 3CMMA 1OC4A 3GH3A 2HCTA 4OL9A 5LDHA 3K31A 3PYMA 2C20A 3JQAA 4I1IA 1AXEA 3WMXA 3IJRA 2O4UX 3L6OO 4WLOA 4QFDA 4RPJA 2H9IA 4OQYA 1PX0A 2C29D 4MVJA 1P33A 2JCVA 4N5NA 1AGNA 2ZJ1A 3NV9A 2BELA 2R6JA 4O1MA 1PGQA 4WPGA 1ZNQO 5T8KC 3U4DA 4WASA 3DAFA 3SC4A 4DBVO 5JMPA 2FMUA 4OSPA 3NKLA 5EINA 1XDWA 4KWHA 1KBZA 3HFGA 1KIFA 3BZUA 3VTZA 2BMAA 2CD9A 4CL8A 4BGEA 3E9NA 2X22A 5A03A 1O9BA 1F06A 1IYZA 3U4HA 3INGA 1IUKA 1JWAB 2IZZA 5TSDA 3ZNNA 3QJ5A 4MKRA 4MP8A 3JD1A 1LDBA 2Q1SA 4MIOA 3KBOA 1U8FO 2WYVA 4MVJE 4II3A 4RF4A 4XD2A 4E31A 1LBEA 2YUTA 4R16A 4ZHSA 4TMFA 1YKFA 1Z7EA 3CIFA 3QWBA 3GHYA 3DWFA 3TN7A 4HWKA 3Q11A 4UVDA 3ZCXA 2QHXA 3TZ6A 1PL6A 2V6GA 3PLRA 2NTNA 2DPHA 3GMSA 3ZWOA 4NIMA 3UOGA 1PIWA 1LUAA 1SOVA 2X9NA 4CQMD 5I7VA 2IE0A 4EEZA 1X7GA 3LDHA 1XHLA 4J90A 1DO8A 1GUYA 1HT0A 3WIDA 1RJWA 1P1HA 3QA9A 4OKIA 3I3OA 4W99A 3EY4A 5G2OA 4U6SA 1EE9A 2O7QA 4W9NA 4ZU3A 3INTA 1PQWA 1CIVA 3NRCA 3D64A 1VE9A 4RVGA 4EITA 1XA0A 3LQFA 4UAGA 1GADO 3C7DB 3WGYA 4GGOA 4Q3DA 3WXBA 1JDJA 3LF2A 5I7EA 4PGFA 2ZTLA 5L9AA 4XZ3A 4D0SA 1I01A 2E48A 4RGBA 1DOHA 3AUAA 3DL2A 2DBQA 1EE2A 4AVYA 3U49A 1TI7A 3ZHXA 3WLFA 3FBTA 1X13A 1P74A 3WFIA 1ZSYA 1PS0A 1T1RA 1WP4A 1UP6A 4EBFA 3AI1A 1DRUA 3E9QA 4IGEA 4EJ6A 5K6AC 1CWUA 4ZD6A 4ALMA 3KM0A 2Z1NA 4J43A 4TRJA 4BV8A 4PLHA 4XB1A 1XCBA 2GRAA 4LSMA 4IDDA 4W4TA 4GI2A 4DL9A 2V6FA 1QYDA 5IZCC 2FPGA 1ISFA 5B37A 2OP1A 3UFXA 2CF6A 3KSDO 4I5EA 3BMCB 1SZJG 5AOVA 2J3HA 1C1XB 3DBVO 1HDYA 4NMHA 1JLLA 2XXBA 4D3DA 1GCOA 1M66A 3V2HA 1SPXA 4D3FA 1DHRA 1U7HA 3WYBA 4GSLA 5CEJA 3M2PA 4HY3A 4RDHA 1Q0LA 3QVXA 2NVUA 3PJFA 2DKNA 1T2CA 5AYVA 2ZQZA 1K0UA 1LDNA 5C7IO 4DQUA 2ZCVA 5TRTA 5TT0A 4CUZA 2C7VA 1GQ2A 5I9LA 5A06A 1WDKA 2ZB8A 4B4OA 3HE3A 1GL3A 1GEEA 4HUJA 1CYDA 2BGMA 2GLXA 2JD2A 2AG8A 2NU7A 4PLFA 4DPKA 1QXSA 1D8AA 1RPNA 1PJBA 4CMGA 1LSSA 1EBFA 3DBHB 3H4VA 3AM5A 2NU8A 3RKRA 4ALIA 1IHYA 3GPDG 3FTPA 4TROA 1Y8QB 4ESOA 4FFNA 2DVMA 3ITDA 2B4RO 2PH5A 1P45A 1ZEJA 4A26A 4D7AA 3OHSX 2AE2A 5F5LA 4LMPA 1P0CA 2BFOA 4ALNA 1C1DB 4W6ZA 4YRDA 1YL5A 2P9EA 4M8SA 3C85A 2O3RA 5EESA 5LC1A 1CQIA 1X15A 1YL6A 1KY4A 1VRWA 4MIYA 3T7CA 4RQUA 4AJ2A 4HX5A 1NR1A 4R4JA 4BV9A 4ALLA 1E7YA 1XQ1A 3Q6IA 1F8GA 4HNHA 1UZLA 3RI3A 1HYHA 2D2IA 5TT1A 1P44A 3VOSA 4R69A 2EWMA 3EC7A 2EJWA 3HB5X 1H2HA 3FN4A 2RAFA 3VC7A 1ARZA 1E0DA 2GDZA 3WDSA 5KKCA 1E1MA 4E5MA 3GVIA 1XU7A 4WLVA 1LX6A 3MJTA 4I9HA 4CLDA 2YZ7A 4R5HA 3FI9A 3SJUA 4CJXA 4Z3DA 4MINA 5DT9A 3JCZA 3OIFA 4LCEA 3M1LA 3ZWWA 5ES3A 3SVTA 4W82A 3TZKA 1RM5A 2AE1A 4J91A 4AJOA 1WDLA 1B14A 1G0NA 5KJ6A 3IUSA 3ADPA 4XIYA 1HXHA 2BI7A 3VZPA 5AQ1A 1U7TA 3TRIA 2HQ1A 1RM3A 2X9VA 3GEGA 3W4IA 5IDXA 1ISMA 2WD7B 5FYDA 4CM8B 4D3SA 3H5NA 2X6TA 5AVOA 2PZKA 3FSRA 4CMEA 3K6JA 3DZGA 3R1IA 3GZNA 2HMSA 4XEHA 1ISJA 1YQGA 5BNFA 1SO8A 4OIMA 1LRJA 2EKQA 3B1JA 3JQ9A 4QECA 2NTJA 1I0ZA 1XEAA 4BKOA 5F1PA 3K2EA 4CODB 1KVSA 1IZ0A 4FJ1A 4W9NC 4B3HA 4HP8A 4H15A 4ZQGA 4F3YA 4BNMA 2GNAA 4GVXA 3DQPA 3L4BA 1A7KA 1ENZA 3GN1A 3ZW8A 3MJ4A 2GGSA 1CRWG 1EBUA 4IZIA 2EXXA 4FD3A 5ITWA 3FPCA 3PHIA 3AWDA 4A0SA 3H2ZA 1NBOA 4JN6B 5DCWA 3ANLA 3ROQA 3WG9A 3WQQA 4AJPA 4AJ1A 1ZFNA 2RH8A 4ALKA 2YDYA 5U1PA 4XYMA 4EW6A 2CF5A 5JFOA 2CVQA 5F5NA 5TLSA 3BAZA 1FJHA 1DB3A 1QORA 4GBJA 1A5ZA 1VKOA 3C3XA 2GYYA 3OJLA 4IQ8A 1EUZA 3WQRA 3WGHA 3LU1A 4Z0HO 4WLFA 2VYVA 1J6UA 1YDEA 1HE2A 4EGFA 5CHEA 4BNLA 3RC1A 4YBZA 1GZ4A 1GUFA 4IIVA 2G1UA 1BXZA 4O59O 1YB5A 3CXRA 2IRWA 4R9RA 1R0SA 1Y1PA 7ADHA 5L3ZA 2PV7A 1HEUA 4CMIA 1Z6ZA 4XYBA 1LA2A 2Q2WA 4L75A 1HETA 4B79A 3B20A 2DFVA 2O3SA 2ZKLA 1NR7A 3HN2A 2D59A 4BNVA 3IKTA 3BTOA 2C82A 2GPTA 3U62A 4YWJA 4CQLA 3A4VA 5JDIA 1OOEA 1GYQA 1UXJA 4YXFA 2HJSA 1OZAA 5FF9A 1LDGA 1DC3A 1ZKMA 3ZHYA 4PLZA 4GLOA 3BMOA 3EW7A 4DYVA 1PR9A 3W8DA 4DWVA 2Y1DA 2O3UA 3KYDB 4XRGA 5L45A 2F00A 4CL3A 2XXJA 3PWKA 4M55A 3C1TA 1DPGA 4YJDA 4CUKA 2HU2A 5FI3A 5G4KB 5HA5A 2Y66A 1GY8A 4NK5A 3WWZA 1ONOA 3L9XA 2CDAA 4WKGA 4DLLA 2HMWA 3CTMA 4G2NA 1MC4A 4J9UE 4U7WA 1I3KA 4OO3A 4OXKA 2X5OA 4HKTA 4YJFB 2F1KA 1X7DA 1WZIA 4BO0A 4YJHB 4R9SA 3WIEA 2EV9A 3A14A 1GTMA 3RWBA 3DOOA 4IS2A 3RASA 1ENPA 1NTOA 2O7SA 4J4HA 1U5CA 1NQOA 3ZWYA 1CDOA 3RAJA 5BSFA 3GFBA 3EVNA 3GUCA 4DRYA 1PJ4A 3PDUA 1HDGO 1I3NA 4QTZA 3ZV6A 3OQ1A 3BMNB 2C0CA 1MUUA 1H9AA 1PU2A 2IEDA 4RF2A 2AA3A 4JROA 1R0LA 3D0OA 1NXQA 3MJEA 4KUEA 4P38A 4IMPA 4XJTA 4PFJA 3D3WB 2W4QA 2WM3A 1JWBB 1YQXA 4ALJA 4CLEA 2VRCA 3GAFA 1J0XO 1A71A 2NWQA 3Q9UA 2DM6A 2Y0DA 4WNIA 1B7GO 2B5VA 3DDNA 5BR7A 1NHGA 4IXWA 2OHXA 3O38A 3V8BA 4A7PA 5TC4A 1WMAA 2QQ5A 2BLLA 4DYDA 2GSDA 2JD0A 3EGOA 4RZHA 4IM7A 3BYZA 3UHAA 3G49A 1SBYA 3RUFA 1W4ZA 3ZNQA 3E6AA 4RLSA 5F1OA 2GN8A 1QR6A 2W2LA 2NU6A 3RJ9A 1L7EA 4PG8A 4BO2A 3FPLA 4EUEA 4GKVA 1C1DA 4ZQEA 1VL8A 4R51A 1UDBA 3L07A 1I30A 3O4RA 1WW8A 1GR0A 1RM0A 5K0ZA 1H9BA 1QP8A 3PDJA 4CMEC 2I67A 1DEHA 2O3JA 2I6TA 3S8MA 4GPD1 5COQA 3V2GA 2J3KA 1LI4A 1W0CA 1SOWA 1Z82A 1IE3A 3LK7A 3JQ9C 1N8KA 3GFGA 3ZW9A 4CR8A 4BKPA 5FI5A 1K3TA 4HFNA 3LC7O 4HNGA 4II2A 2IZ0A 1MG5A 3VH4A 1LLDA 5JC1A 3QV1A 4LVUA 5G0TA 1S7CA 4BKRA 5I8WA 2V7PA 3QP9A 3UKOA 3L4BC 4MO2A 3TL2A 4BNYA 2DLDA 4JIGA 5KJFA 5EIOA 2JD1A 4UEJA 1B26A 1BTOA 1TEHA 4M86A 1YL7A 1E3JA 4BQRA 3QW2A 4BNTA 1EUDA 1P1IA 2WD7A 2X9GA 3GRPA 4CM8A 4TRNA 1MC5A 4H7PA 1AXGA 5JAQA 2EIHA 4JQCA 5HTOA 5JO9A 1EK5A 3ASUA 4XJSA 5L7TA 3RROA 4A2CA 4TRRA 4CR6A 1NVGA 2J3JA 2OL4A 2R00A 4DIBA 4OKNA 3C7AA 2UUPA 1YJQA 2A9FA 3KB6A 3E5MA 1O94A 1IY8A 4D46A 3H9GA 2E82A 3MJCA 5KVSA 5CPFA 1Y5MA 3RBZA 2FZWA 3WNQA 1E7SA 3L9WA 4BO5A 4CMBA 4RQTA 4BO9A 1FDSA 1H6AA 1QYVA 3FNFA 3K73O 2CY0A 4Q3AA 3PZBA 1T26A 4U6QA 5U9CA 3TOXA 3VAZA 2C54A 1N7HA 3QWFA 3V2UA 1W73A 3UF0A 2WE7A 2Q50A 2PR2A 1PSDA 1N1EA 2CZCA 4UVGA 4K9DA 3WFJA 2DTDA 4MVJP 2JFHA 1E7WA 2TMGA 3UCXA 3VZSA 2OBNA 3P7MA 3OBBA 1V3TA 2C07A 2XOXA 3ZHBA 5ITVA 4DIOA 4FFOA 1GEGA 3NT5A 1GCUA 4KTTE 2GN9A 4DC1A 2PLAA 1N1GA 1E7RA 1DLIA 3WGGA 1Z73A 3GNQA 1V0JA 2NVBA 2X7HA 3F6YA 1WLYA 3W1VA 4BOYA 3LC1O 2Q4EA 3A06A 2ZATA 1N7GA 3CZMA 3JYNA 2NVUB 3S1LA 2X0IA 1LLQA 1NNUA 4B3IA 1ZEMA 1BHSA 1NPDA 1B8UA 1N2SA 3DXFA 1X0XA 4AJLA 1BSVA 1MX3A 1ZBQA 4XR9A 3VVBA 1IL0A 1B8PA 4J49A 2H6EA 1JAXA 1R0KA 2W2KA 1NP3A 4I9NA 2RIRA 2Z5LA 3ZI0A 5JY6A 2HLPA 2VOJA 3H5RA 3K8ZA 3PQFA 1D1SA 4PLYA 5TJHA 1GQQA 4ONEA 2X23A 4DIFA 4ZICA 3IDSA 3MJVA 1EUCA 4CV0A 4E0BA 1VPDA 3RSHA 1LRLA 4P8RA 1KC1A 4J1QA 4WECA 1AN9A 1XSEA 2Q2VA 3WYEA 2Y1OA 2AHRA 3SLKA 3ZWNA 3Q1LA 2PD6A 3GT0A 3KVOA 5IG2A 3HQ4O 5G4KA 4IJUA 2CMDA 1YBVA 4S3MA 2W8ZA 2EW2A 2NSDA 3GDGA 3GLQA 1LQTA 4B8WA 1U3WA 1DBVO 4L4XA 1HDOA 1X0VA 3OJEA 1U4SA 1UXGA 4HADA 4J6FA 3WS7A 5T6BA 2UUOA 3CMCO 4FPXA 4YJFA 5A1TA 4RPKA 4PG5A 4YJHA 1RYEA 1F12A 4L76A 3JQFA 3HHPA 3VPXA 3Q9NA 1YQDA 4E2XA 2UYYA 3PQEA 1X14A 2CVZA 3JQCA 3VHRA 1U3TA 3NGLA 1WZEA 4U0KA 3GDOA 3GR6A 4ZQFA 1EEHA 1LEHA 3DB2A 5FWNA 4DPMA 4EYEA 2HRZA 4NFSA 2X5JO 4FB5A 2Y93A 3EUWA 3UICA 4ZVVA 5KVCA 4BHTA 4J1TA 3RKUA 3ZGYA 4BNGA 1U3UA 1HDXA 4XKJA 4FGSA 4BMNA 5K9ZA 4CM7A 2O3TA 3P19A 4D42A 4Z0TA 1H94A 3TFOA 1HLDA 3DZHA 4BL5A 4BVAA 4DBZA 2I99A 4LISA 1CERA 3D3WA 4L74A 1SAYA 4OYRA 3RC2A 5TIIA 1O8CA 2DBZA 1H2BA 1KERA 4OSOA 5H82A 4M54A 2D1YA 1LNQA 3FBGA 1ZSVA 1DRVA 1HZJA 3COSA 4N18A 3WX0A 3OEYA 3RFVA 3WGTA 1DIRA 4GVLA 3QE3A 3KSUA 3GGOA 3DMTA 1DLJA 1UXKA 5TNXA 3JYOA 3GZNB 4C4OA 4G65A 1IPEA 4LVCA 3JSAA 4NPCA 1Y6JA 1TXGA 4FQ8A 4DMMA 3NTQA 5DBFA 4NBUA 3EVTA 5JAMA 2AW5A 4TWRA 3U0BA 1KVQA 4IINA 1P0FA 1Q7BA 2B4QA 2Y0EA 3I9KA 3GG2A 4Q39A 3BMQB 1ZW1A 4YT4A 4CLXA 2OP0A 2Y05A 3WGZA 1H5QA 3ZWXA 4L9RA 1HYGA 4XIJA 3PTZA 3NUGA 5H83A 3GNTA 4IDFA 2VNSA 3JQBA 1KC3A 3B1FA 5L4SA 3ORFA 1K6IA 1PZHA 3AY3A 5HBRA 4E2WA 2R00C 4KUGA 2IYPA 2O3QA 3OECA 4RJTA 1XGKA 4XDYA 1F8FA 3F47A 1DSSG 4K26A 9LDBA 1NASA 4AG3A 1GU7A 1I10A 1WXDA 3MWEB 1I5RA 1GFSA 1AE1A 3IMFA 5CAEA 4LCJA 4CR7A 3ST7A 3K92A 3WWYA 3R3SA 4CM1A 4F6LA 4GKBA 4LRTB 5CP8A 5B4UA 3VH1A 4TQGA 4FCCA 1Y5RA 4X54A 4IDGA 3ZNOA 2D0IA 3GA0A 4J1SA 1ZUD1 1C14A 1O95A 3C7CB 1UUFA 4UUOA 4MVJI 4IDBA 1PGOA 3SEFA 3CEAA 1NVMB 3PHGA 2EP5A 1CF2O 4RPLA 4FR5A 3GG9A 2D5AA 3F46A 2WSBA 3LVFO 3G3EA 4CMIB 1CJCA 5IF3A 1ZK2A 4PZEA 3UVEA 2Q4BA 3W6ZA 4PG4A 3E5RA 1E3EA 4KQWA 4NQZA 1PZGA 3NDRA 4HFRA 4TKLA 4CQLB 3TNLA 3TF5A 2H63A 5EERA 3WTCA 2YHUA 2YV1A 2YFHA 4DUPA 3MTJA 2ZTMA 3HUDA 3BMOB 4Y67A 1DC6A 4NBRA 2PFGA 4FBGA 3ULKA 4R1UA 2GN4A 4GAEA 3CE6A 4IDCA 4I9UA 2VWQA 3TZQA 5GZ1A 2FR1A 1Z7BA 3F9IA 5KNLA 1UP4A 3ZWAA 7MDHA 4FN4A 3PGXA 4N5MA 2VWHA 2DT5A 3EHEA 4R5MA 4PVDA 3PQDA 3PZRA 1ZJYA 1EZ4A 1Q7GA 3GQVA 4HBGA 3GRKA 4CM5A 3MWDB 1HYEA 4OGWA 4XB2A 3DOCA 2FR8A 3GNSA 3Q2KA 4YQYA 2FRDA 3DEYX 4JJGA 2RH4A 3DZFA 2HK9A 2P4HX 1ZK3A 4PIVA 4O0LA 4Y8VA 3MCVA 1HKUA 1KVUA 3DFUA 3RFXA 3MJSA 1PQUA 3VTFA 5C5IA 5G4LA 1D4FA 3BHMA 2X86A 3C1AA 5GZ3A 3FR8A 4W7HA 3F4BA 3AK4A 3TOZA 3P2YA 1DJQA 4ND5A 4TVBA 4BNZA 3X2EA 5B1YA 4NDNE 1MFZA 2QRLA 3IAHA 3KO8A 4OAQA 3RUAA 3JQFC 4DA9A 1C0PA 2EGHA 3NT4A 1ENYA 4CM9D 3NAQA 1K6XA 2HO5A 1DJNA 4IS3A 2ZB3A 1LSUA 1R6DA 4ID9A 2GD1O 5BT9A 1HTBA 4Q9NA 3NJ4A 3TWOA 1D7OA 5THQA 3S2FA 3U4CA 1I3MA 3I9MA 3TPCA 1VJTA 2EGGA 2I9PA 1LRKA 1ONNA 3TL3A 3E48A 2IXBA 1DFHA 3WQSB 1R16A 3KYCB 2X0RA 1I2CA 1XR3A 5B4TA 1I8TA 4PLVA 4MVJH 4ZQBA 4LRSB 1ONPA 5A9SA 3PIIA 3AY7A 2I3GA 1UAYA 4GWGA 1BRMA 1C0LA 2EF1A 2I3AA 4DGSA 2C5EA 4J7UA 4I08A 4NBWA 3VPFA 2A92A 1EMDA 3JQ6A 3HDQA 3GVPA 3FCOA 5GY7A 3DMTC 4R68A 4B4WA 1ISHA 3RQSA 3U3XA 4JJIA 5AXBA 2YQ5A 3N7UA 4IGFA 1XIVA 2VHZA 5CEFA 1UXIA 3AJRA 3JV7A 3ZU3A 3GC6A 5AXAA 5KJEA 1E7QA 2GASA 4EEXA 4NBTA 3BTSA 4BUCA 2DFDA 3OETA 4FJ2A 4QXMA 2OUIA 1EDOA 3PJEA 1NFRA 4UUPA 3V1TC 1DFGA 1T25A 3JQBC 4BMVA 2V65A 4RL6A 1LXCA 1ML3A 1U4OA 5JY1A 2FZEA 4YJGB 2C59A 1C0IA 1K5HA 1LC3A 4ZRNA 1SEVA 4WE3A 3OIGA 4YAIA 1V3VA
chains in the Genus database with same CATH superfamily
3KR9A 2XUJA 4EUFA 5CM8B 3FCSB 2ZUDA 5DBGA 1U1IA 3ZV5A 5J43A 1FU8A 5CCXA 1GXSA 5JXJA 2Y3IA 4D4MA 4DQVA 3REOA 1ZMBA 4AWAA 2GTIA 2JFUA 2YWDA 2HBZA 1P3Y1 5MDHA 2OXFA 2PVPA 2QL5A 3QK7A 1U5AA 1G42A 1O95C 1Q2XA 3E8SA 5IVHA 4PC1A 5JWRA 2EKLA 2ZJFA 2HJRA 4PGHA 5FBHA 3TJZA 4JI8B 3PFKA 2ZM5A 1A2OA 2NUPB 3JSXA 2XJ4A 1E5XA 1E98A 1Q0UA 2W7TA 5G40A 3A58B 3TRKA 3VOAA 1GL9B 2FEMA 3EPHA 1NUTA 2FKAA 3Q2IA 2YZKA 4GSKA 2NZUG 4HDKA 2YWJA 3WIUA 3ZIAA 5A5EA 1G38A 3ZJVA 1NWCA 4DDUA 1H8ED 2AD1A 2FG7C 1VOTA 1E9VA 3IDZA 4G5YA 2DECA 3VPDA 5JEDA 3M34A 3SG0A 1QB7A 4HX9A 4EF5A 4WK0B 2ZOSA 3KQQA 4US2R 5FJJA 4A15A 2P5UA 1KBQA 2VT3A 4RY9A 3A27A 1V25A 3EWNA 3UB4A 4DR1B 3GEMA 1M67A 3L4EA 2UAGA 2DUUA 1POXA 1PQPA 4JKIA 4BVGA 1E2KA 1C3OA 1H6CA 4RXUA 3QPVA 3DHEA 4UUMA 4EX6A 3FRJA 1B15A 1HE4A 4FXOA 4IGAA 2FI1A 3NEJA 3WO0A 5JVDF 4EJSC 1E2FA 1C9NA 2JAQA 1SCUB 2R68A 2OO7A 4XEUA 5TE9A 3QH4A 4DLBA 2FZ5A 2E5FA 5E2AA 4MP3A 5KWSA 3DAOA 3RC7A 3ZK8A 3EMKA 5H68A 3BDIA 1EU1A 3QI2A 3B6IA 4GL4A 4O63O 3HCEA 1MIOA 3IUYA 3E8XA 1WXIA 3ND7A 3OUUA 1I51A 2WBLC 1KY5A 4IVQA 5ADWA 3G9QA 2QN9A 2XMQA 2NGRA 4FYPA 2D1QA 3N2IA 5CA0B 3I5MA 2UYGA 5GZ6A 3PHLA 3QTBA 3TM5A 1A9PA 1HRDA 3VTKA 2FR8C 2PXAA 3AHDA 1KO1A 1XBTA 3MTBA 1A72A 1GHTA 1ZOPA 2NO9A 3BERA 4N7RA 4Q1EA 5EIFA 3ZLBA 5JZMA 2Z6AA 2HTFA 3UK7A 1USGA 3MAAC 2WJPA 4YMIA 3I45A 4J9VA 3BHNA 4NOLA 3UK6A 5LNK6 3KAQA 1NVTA 1JDBC 2GCNA 5T4FA 3VYTB 1H5UA 4AZVA 1AV6A 2X0KA 3FUUA 3PYXA 2G5PA 5KPDA 4EPTA 4QBKA 3IPLA 5FWXA 1M0SA 1MABB 2W4MA 3FWYA 2V6MA 3LT0A 1QTQA 4U8HA 1K2VN 1JKJA 2QAGC 4P7BA 3CX8A 3KBBA 3LAWA 4QPZA 4KX3A 4BUZA 2LDBA 2Q5QA 3OCYA 3GVCA 3PNYA 1U8YA 1P0IA 4JITA 4JSRA 2JAUA 2FW8A 2QYTA 2YTZA 3DT6A 421PA 3G88A 4L5AA 1GNQA 2OYSA 3O8QB 1KZ9A 2WIFA 3OPQA 4LE2A 4MI3A 4V0LA 4D9MA 2NXCA 2CNKA 1P2VA 1AOXA 5EZYA 2XWJI 3D1VA 4YUZA 2EJCA 3ZYCA 2ZP1A 4ENSA 2CNWA 2CL7X 2Q0HA 3K4HA 5EG5A 5BN5B 3TDNA 3LFHA 2A7XA 3A1DA 2WABA 4TVKA 5LDDC 2D8MA 4EA9A 3NIFB 1RJ9A 4QASA 3TSWA 5JZ9A 3NGXA 5KVVA 1QBKC 1VXRA 2AYYA 1W5TA 5HR5A 1JR4A 4G1FA 2XBMA 1EFTA 5FNVA 3FMGA 3BCUA 3P5SA 3PYLA 4TUYB 3CX6A 4Y6QA 1J33A 3K0AA 3UHFA 1ZZEA 4U8GA 3ZPXA 2QRVA 3SKYA 4A8JA 1SUSA 2E87A 4H16A 4IZHA 1IC6A 4J0CA 2QRJA 3TGWA 3V80A 4LXIA 2PZGA 5KYVA 2XKKA 1GNRA 1Q95A 1O6ZA 1SVSA 3IELA 4JYMA 5BY2A 1Z4PX 3ICQB 1U7WA 2AG5A 2J3LA 2PH3A 3OMXA 4AYTA 2FPIA 4Z4FA 2JFPA 3ZDFA 1NBIA 2VBCA 1EG7A 2P9GA 3O90A 1SXJB 5THXA 4X1KB 3TQIA 5L7WA 3RC8A 3KSMA 1T6XA 2QUIA 1D4ZA 2ZPAA 1KEPA 4Z1MD 3F97A 3QFHA 5DJ5A 2OFXA 3U31A 5HPYB 3I3SR 1QO0A 4RNDB 2O14A 5LPNA 4XX1A 3SCZA 1GAXA 2OLJA 2PKQP 5KWIA 1ADBA 1Q0TA 4Q1DA 3KJEA 2E4YA 1GV1A 2WFMA 4N5DA 2GF9A 3QJYA 1SA0A 4I5FA 1HMPA 1QONA 1C3LA 4L78A 4RCYA 4FDAA 1Z8HA 5EJAA 2QXUA 4NJMB 5JG7A 3RRZA 1TQDA 4U02A 3SQXA 4P1ZA 3OEHA 3SX2A 3MTDA 4PG7A 3TD9A 2B4YA 3GIWA 3KYCA 3PRKE 1CEEA 1JECA 2HMAA 1GUAA 1I36A 2GBCA 1PT9A 1GRNA 3LBAA 1MP0A 3TLJA 3WLAA 6YASA 1IOWA 3P2OA 1P2FA 3RRMA 3JWJA 1M72A 4ZOLB 1E3WB 2K7ZA 3FHJA 3SBEA 4AJJA 1X6VA 3EA4A 3P2IA 4HD8A 2R6ZA 4N49A 4B7XA 3LP6A 4I9FA 2H4ZA 2JVIA 4UUBA 3EZYA 3OKCA 4LYDA 1TA4A 1Q1GA 1J22A 4HWTA 1R6BX 4LDRA 3H4TA 3L6CA 5AWFC 2FDXA 4QLOA 3RVDA 4CU5A 4EP1A 2A9PA 2J59A 3TINA 3WOVA 4HGRA 2OR3A 2FWPA 2X3FA 4UDNA 4F0JA 3LXUX 1FRFS 2I03A 1SQ5A 1I4OA 3MRTA 4XW2A 5JO0A 5BOVA 5BN1A 4HV4A 2QK4A 1M2OA 1V16A 2G5GX 1GPYA 1ZXLA 4WW0A 3X2FA 2IHUA 2H48A 3DYVA 4MHOA 4ROSA 3VR1A 1GIAA 2QSJA 4PCLA 1L5HB 2C5FA 4HDRA 2OGUA 4F96A 5ICMA 2VZ8A 4BTEA 3UPUA 3GLFA 5P21A 2C9MA 3ZBQA 3F5SA 2B36A 2GZAA 4EH1A 4XVRA 2WF5A 4I5DA 3EQ9A 3CRW1 2ZUVA 1NUAA 2Q07A 3DBIA 4R1MA 1IIBA 4LDZA 3R74A 3SEAA 5A0TA 5LBUA 3C4QA 3IOYA 5L3RA 5KYYB 2IY7A 1I0IA 1M73E 3BF8A 4EKDA 1PNOA 3MMNA 1GZVA 2SNIE 4UBKA 4FW9A 1PJZA 2O8EA 4UBNA 1U90A 2ECOA 5EE0A 3UUWA 3PVZA 4CM6A 5HUJA 1SB9A 4L3OA 5LKRA 3DOUA 4OHPA 3SIPA 2C00A 1X87A 2PHZA 5HCNA 1WNTA 3R2JA 4FE7A 4ND6A 4BVBA 3QBDA 1EG2A 1F4PA 4WY2A 5KYXA 2ZWPA 3A31A 4JL6A 1BXGA 1FMCA 3QXSA 1X7HA 3H9JA 1QRAA 2D3WA 3MQFA 3OZIA 3UGTA 1E9RA 2DR0A 4F4CA 4IZOA 2UYCA 2E3JA 3I9NA 3G6WA 4F56A 4JJ6A 4Y2QA 5IDVA 1A7AA 3I9V1 2RH5A 2O50A 4XIGS 2QD3A 3RRXA 5DTMA 4ARVA 4AX8A 3THXB 4CLRB 4YXWD 4I4CA 3G2QA 5A4JA 1Q83A 2CDNA 1FDWA 4HYYA 1E5LA 2ILTA 2F3TA 3UXYA 4O29A 3HB1A 4N54A 2RONA 2ZTVA 5DN9A 3KT3A 1AXRA 1CR4A 3TQHA 1T9GS 2J85A 3Q88A 1W36C 1QQ7A 3IMEA 1DWQA 1EFVA 1JHYA 3K5PA 3W34A 1C7JA 3NBZC 2BFCA 3D3QA 2CLOB 5L3SB 3AEQA 4LNUA 3LQ1A 4RHCA 1Q91A 1R5BA 1JXMA 3T9FA 4R41A 2BRUC 3AINA 3BN3A 2PNJA 3U1VA 5FUMA 5ALEA 1QCZA 4MIKA 4W9MC 2AKAB 3ZDAA 3NCTA 5FRDA 2Z3ZA 2VUUA 1TPZA 1ZS9A 1YB1A 3U80A 2ZEJA 2Z57A 1AT1A 3G5UA 3K4QA 3MXTA 4JUBA 3ZZTA 4EHBA 1KY3A 2I29A 3R7NA 1DQSA 1XJCA 3L1UA 2ONJA 2PGIA 4Y30A 4JZYA 2FB9A 4L6CA 5KOJA 2J6BA 1A5BB 1K4YA 5CPBA 4X6UA 1O5TA 4ER7A 4MP6A 5IZ4A 2Q3HA 4F60A 3BE8A 3LUDA 1PFYA 1U7UA 4YCBA 2FSSA 5A4FS 1D2CA 1Y5NA 3UUFA 3N8HA 4JEUA 1ZA1A 1ECFA 3PPVA 2RFLA 3AONB 3H2GA 4L0MA 4BTVA 4KDFA 4PYKA 4XX0A 2DQZA 4YRGA 2NADA 2Y1EA 1UDCA 4LEIA 1E2PA 4LKOA 5IC6A 2ES4A 3ZE1B 1XZ8A 2CLFB 4JP3A 5KTTA 3QKRA 3MHTA 4EHLA 2AK2A 1VL5A 1ZIDA 4IVNA 2R6R1 3ENZA 2IZ1A 2FUG6 4BB5A 3IVCA 2P9CA 4GMFA 2G1PA 1OPRA 1IBCA 1K6EA 5EEHA 2RGCA 2PYIA 1K97A 1RQLA 2C96A 1IN4A 4GDMA 1LBHA 3ZZUA 1RWQA 4BB9A 3EEYA 5JS1A 5ICSA 4XWOA 2Q9BA 2ODWA 4RWZA 3AX6A 3AO0B 4NG5A 5CLGA 5SV2A 4DCOA 1SC1A 3P0HA 2XNKA 1FSGA 5IAGA 2QRMA 5CT8A 3T12A 3QLUA 2EBWA 1Z6PA 3R0XA 3AI7A 4AUMA 4DREA 2JH3A 5A5FA 3WNDA 4Y7CA 4EVRA 4LK3A 1RM4A 3JTMA 3NWBA 1YONA 2VTVA 3HJRA 4IHQA 4RS4A 3PI7A 5JE8A 3T9EA 1X38A 5FV7A 5ICEA 1VB3A 4IJQA 2BBSA 2DJ5A 2J3DA 2PKEA 2V8OA 3TDKA 4BX3A 3B2QA 3OM9A 1E9CA 3HLTA 3JAWA 3D3KA 1RXUA 3IA2A 4O4HB 4PHTA 2FZLA 3QU7A 1IJBA 1CULC 4ACAA 3FGZA 3A9SA 3O26A 4XM0A 4UTRA 3EWIA 1TKAA 4IWNA 2OYRA 1B16A 2YS7A 3ZDQA 1KI3A 4BGIA 2ZYWX 5HW0A 1HTTA 3E82A 4MX8A 4X62B 3IILA 1W6UA 2WZQA 2O07A 2PG3A 4HLCA 3QTTA 4NE2A 3UWMA 4DTIA 1ZK0A 5HZMA 2B78A 1M10A 4RPCA 3TTYA 3QMMA 2JFXA 2WHRA 3LNCA 4ZHSA 1XTJA 2J67A 2QPOA 3HJFA 1WHSB 4PYNA 4FGLA 3RARA 1T4BA 3IXQA 5BURA 5K2OA 4WEOA 1P4GA 2QLBA 3CPHA 3CVWA 1QHHA 4FFLA 4IVPA 3CVYA 2QBYB 1VLZA 4ZCRA 2QTGA 1WWKA 2JVKA 3VMFA 4LDJA 1C30A 5L51A 4UHDA 1GWNA 4LDAA 3L49A 1E4OA 1U6IA 2YWGA 3DZKA 3GLHA 3QE2A 2Y99A 4RC9A 2WAMA 4UMVA 4XWAA 1W0JD 4UARA 1SQGA 2VDPB 2J9FB 2DERA 5F12A 1P1JA 4ENWA 3FOZA 1NXTA 2BEKA 1ACMA 3STHA 5M5BA 2VG8A 3R0ZA 5BN3A 1KEEA 2D7CA 3BEOA 1N6NA 3H11B 3SLRA 2EERA 1TFRA 5LIRA 1PNRA 1QC5B 1R7RA 3RAFC 1TZJA 1IMOA 2JEZA 1IBMB 4FLFA 3WWEA 1JR3D 4BE9A 3HI4A 3FFAA 2R1ZA 2AI3A 2RHOA 4GLLA 1TVCA 2E89A 2ZIZA 1A2QA 3EEFA 4GH5A 4Y9DA 3VSDA 2VQ6A 3OH8A 5AFSA 1QZ3A 4ZHQA 2IYXA 3BIOA 5T4HA 1FFXA 1NJ6A 5JNWA 4B9AA 3IE0A 5EWMB 4E5KA 2NU9B 1ISSA 5HFJA 3T15A 1GDHA 1O57A 3I4FA 1PFVA 3Q0IA 4Q00A 5DN6A 2PWYA 4M8KA 1XCMA 4KXXA 3GGDA 4MLZA 5I4BA 5K99A 3C3EA 3CHYA 3HDTA 3IC5A 4LGMA 1V11A 3V4ZA 3QLJA 4AJ9A 1QPZA 1VSVA 3N0TA 1YO6A 2PAAA 2A35A 5FORA 3VHXB 5BW8A 2Y4OA 3RS2A 2BGLA 3K9CA 3R3YA 4DLUA 1JTEA 3INYA 4MRMA 1FU4A 3VZCA 2OGSA 4MHTA 1QIKA 4AXXA 4JBLA 1IXKA 4WOJA 5D84A 1Q50A 3A3OA 4OJYA 2WWRA 3FAKA 5B7NA 2UVQA 3T99A 3YASA 1PL7A 2W48A 2HIHA 1P1KA 3B7GA 3ELUA 2C2BA 1RFGE 3IEVA 2HV9A 1L4FA 3SR3A 4ZIRB 3SJAA 1HZZC 1H6BA 1TIPA 3ACCA 5AIBA 3H6KA 3DBRB 3I8XA 4FIDA 4MPDA 4WEQA 2WY2D 4GDFA 5K3CA 4DJFC 3KQHA 2R8RA 2YVLA 2PX3A 3SC2A 1XNJA 4E3WA 3MAGA 3DTNA 3LHKA 4S1TA 1AUQA 5C7OO 1DTWA 1Y7TA 1GPMA 5C37A 3L7IA 1SUAA 3QBVA 4HEHA 2O52A 2WNHA 4RANA 1Q0QA 2PZJA 4OFWA 2ZJ3A 1Y3DE 2PY6A 1K0FA 2OHVA 4FFVA 4AUEA 4A6EA 4F93B 1FQKA 3A9WA 3EE6A 4JQYA 4KXLA 4LE0A 4ZJUA 4MB6A 5EWJA 3GFFA 4L22A 3DJFA 2UXDB 2CVPA 3FF4A 2NNLD 4G4SP 5EGNA 1E5TA 3FHLA 6REQB 4TSFA 4NU6A 1GZDA 3AHEA 2PT7A 5DHRA 3OZRA 1EXMA 1T2DA 1RI1A 2IHJA 1OWOA 1JFSA 1ZC3A 3PNKA 4O4HF 3K9LA 1B43A 1LLUA 3AVUA 3ZJUA 3GCWA 1DTEA 1U31A 2ZUBA 4UOEA 2QUJA 3CEHA 4FSXA 5K51A 5T6MA 2CUZA 2CYBA 3MMZA 4Q21A 2XVXA 1T0PA 5KQGA 1FOEB 1JUDA 1NUSA 1FRNA 1XRSB 1E6MA 1ZUHA 2MYPA 4HK4A 4KKVA 4KQIA 4MGIR 3DGFC 2Z6UA 4XH9B 3G23A 4NCHA 2H7YA 2OSVA 2PUTA 3P9RA 1ATIA 1XHEA 2JPDA 4W7IA 2QP9X 4EFMA 1G20A 2BHLA 4KN5A 2H1IA 2O2SA 2ECPA 3RUDA 3L6EA 3RHZA 3IJPA 2W42A 2IQIA 5DIZA 1K88A 5H3HA 3WDMA 1SK9A 4JYBA 3WYCA 4EJSA 4PRKA 2NP7A 3UOAB 4AW9A 5A3VA 3H5OA 4U39A 3F6CA 3K70C 1M2GA 2W6IA 3EFHA 3HPQA 4KN6A 4XYLA 1E2DA 3A1TA 2WWXA 2ZCUA 5A9TA 1MAUA 3N0XA 4I55B 5E2BA 5IDWA 2Z5FA 1JHUA 1ODCA 3AFNA 4IY1A 1TJ3A 4J0DA 1KZ7B 4IZ6A 4CNQA 2C7GA 3DTVB 1DT5A 3Q7TA 4HLDA 1VPTA 4YN3A 5IXYA 3T7DA 3SSNA 3QXJA 1Q11A 4EGQA 2A88A 3SNHA 4GGPA 5B6JA 1GSHA 1NBMD 2YV2A 4KMRA 2WMDA 1Z0IA 1GL6A 4NCIA 3CF0A 2ASEA 1H4VB 5BR4A 4RTMA 3QU9A 4PQYA 2C0PA 3J80A 1ZVMA 2O8BA 4OHBA 5EMMA 3I04M 1KI9A 3TW4A 5K0JA 4TLMB 1FMTA 2VSNA 2WB4A 2X5XA 5FBKA 4KPUA 2INGX 2QAGA 3PHJA 3V8PA 3AU9A 2UYHA 3D4PA 3T1HB 1ULTA 1VMIA 4EB3A 3DKRA 3D43A 3JQ8B 1XDBA 1XG5A 3KUUA 5LXTA 5BQFA 1Y8RA 1VB5A 2HA7A 5CFRA 3VKHA 4MICA 1CHDA 1VE6A 2EJTA 4BVHA 4OBWA 4K2HA 3DM5A 2FUCA 4Q9KA 3LWZA 5AOBA 5E6SA 2C04A 2FMHA 3K9NA 1X9GA 2O06A 2YFQA 3JQ7B 2QTRA 3EVDA 4NLLA 5ER6A 5A4KA 3GCZA 4BNIA 2PS0A 4O1HA 4OYLA 3L41A 3M5WA 4EATA 4TLEA 3OICA 4KKXB 1C7ZA 2X7XA 3I6BA 3LYLA 4HEA6 4W5HA 2XRYA 1XF1A 2GVNA 2JG3A 3A6LA 1WE2A 1JL3A 1Y1RA 2FQQA 2WTEA 1KI7A 3FYHA 2VUSA 4K1XA 1N6OA 3TR5A 4BVLA 2P4UA 4EW2A 1PYDA 1NRJB 3DH0A 4Z9FA 4YRNA 2VJLA 3WB9A 3MB5A 4H4CA 3FWNA 4UBOA 3ZS9A 5J4HA 1KKLA 3GEDA 2EVWX 1U0TA 2JGLA 3WA7A 3WMRA 4NU0A 4PZZA 3OFVA 1IEWA 3KKPA 3TEFA 1LTKA 4F38A 2XRZA 3QNMA 1O94D 2CXOA 2OPBA 4F4DA 2XGGA 2WINI 1GPWB 2GK7A 2ZANA 3UW3A 2M1XA 4URFA 2P0EA 1G5QA 2V98A 2CNBA 1CRZA 1W5BA 4H0FA 4O2RA 3ZG6A 3LVQE 6NULA 1XC7A 4G4SO 1E92A 4WXEA 2DFKB 4F2GA 1ZGCA 1QU3A 4KWIA 4LY9A 5COBA 3CW8X 1MB4A 2A9JA 1WZUA 3H5VA 2OZEA 3LLSA 2XCQA 3QPAA 1FB5A 4WCFA 4YUXA 5BPFA 1V1RA 2I1LA 1BMTA 3M2TA 1XQXA 2ZLBA 4KSCA 4YX9A 1VLJA 5ELLA 1NY5A 4P80A 4RACA 2AC2A 2XMCA 4BFCA 3BHIA 1P5FA 1LU9A 4MGHA 3OZFA 2JH9A 2ZS7A 1FP6A 4GPIB 4JP2A 4Q3LA 4AKGA 1XMXA 3CR8A 1YB6A 2WSIA 2QNRA 5IM4F 5K6TA 2L18A 3BA1A 3AF1A 3CUVA 4RD3A 3MYRA 2WEKA 1NZFA 3AR2A 4OU4A 4WZAE 2FOIA 4B35A 1PYOA 1SHJA 5JPCA 4KR0A 4GICA 4ZODA 1ZK1A 4RLQA 1H66A 2AWOA 1S2IA 4D97A 2XB8A 2QMHA 3E7DA 2AFIE 3X2SA 2HUNA 4NNPA 5GP1A 5A7GA 1RIIA 3IO5A 4X0EA 3VKVA 4PN7A 3B13B 2BE9A 5LYJA 4DLPA 3JX9A 5BSVA 1R4NB 2YYSA 4QGAA 1THMA 2VDJA 1HDZA 3KEOA 3E9EA 5TQ2A 2NSJA 2JGJA 1PFQA 1CDEA 2P2LA 2WV9A 3E9DA 1F0YA 1NWHA 4NL4H 3WJ2A 5I8ZA 2JDID 1Z4QA 1UCFA 1UKZA 3W5IA 3ORYA 4ND2A 3ZZNA 1XLTA 3ZIUA 4E21A 1GZUA 2CV1A 1UKYA 4I55F 4KQ2A 1XQ6A 4G41A 5CW1A 3SQLA 4LJ6A 2EFEB 3GDHA 3KZXA 3LE8A 3UG6A 3F1KA 2MSKA 4A4DA 4ZXPA 5E8RA 2WRZA 3LSYA 2C7QA 3DFIA 4WADA 5I8PA 1BDBA 2AMFA 4QQRA 1X3SA 4JS0A 1W0KD 1OI4A 4NEQA 4TLBA 1C7RA 1Q3KA 4OCZA 2QN1A 2XITA 3B85A 4I5IA 2FUEA 1U6KA 4YCAA 5JLAA 4BLPA 3TZEA 4XOUA 2ZITA 1KYIA 2J6HA 1KFJB 2ST1A 1U8CB 3IVXA 5IKXA 1DRWA 1ZN7A 1H2FA 2I7DA 5KSYA 6ABPA 1NJ5A 2FP4A 3UEOA 2VPPA 3JQPA 3N8KA 2JJ1A 1NRWA 4I36A 4CF5A 2GBIA 3H2JA 3VSEA 4ROTA 2GFHA 3N8NA 1SOUA 5ALNA 3R6WA 4DJEC 5DI9A 4FX5A 3NNNA 3B5IA 1OLSA 4GX2A 2GVZC 3IUPA 3L0BA 3W9YA 1PS9A 4GX0A 4BNUA 4UHEA 2SBTA 4KPEC 3LS2A 3ZGLA 2J08A 2BPOA 1OWPA 5LQCA 4MUGA 3IAAA 4U7HA 1BW9A 5B5SA 2J4CA 4R2IA 4Z1OA 2QRUA 3MJFA 4I1UA 5SYMA 3IS3A 4EVIA 5IAAA 4GPZA 1NDHA 2Q7OE 4ZC1A 3ZVKA 1XU4A 2QJWA 4IXNA 1VSTA 4J4BA 1YMUA 1H9CA 4L7QA 4Z9XA 1MOSA 3LRXA 3DVRX 1RS0A 2Q2QA 2QVGA 3G0IA 2B99A 3OPXA 3T7IA 2DUWA 3B89A 1MJNA 2BMWA 1JAYA 1N2GA 1UWVA 1UC5B 3SQOA 3F5DA 1ZWLA 3VU9B 2OHOA 4F5YA 3WAGA 3O3NB 1N2IA 3PIDA 3VAAA 4ENRA 4WI1A 1S4MA 1KETA 3FNEA 2QT9A 3W4KA 3D81A 4H6VA 3A4TA 3FW1A 1DC7A 1NVVR 1HL3A 2BGRA 3LUJA 4MKZA 3JAMA 2LZ0A 4XQ0A 5CDSA 4QNRA 5HJ7A 1GLGA 4PSUA 4IIJA 5DYYA 3OKAA 3B5EA 1TTQB 4Y98A 1WPQA 3DP9A 2IGBA 2I33A 5G0VA 1QH8B 4YRRA 4BFTA 4YPFA 1Y98A 2ZI3A 1L8AA 4Q9LA 3OJOA 3BL5A 4D0RA 1EK6A 3PJDA 2BD0A 4RDXA 5JJBA 4J76A 2WK1A 3TGPA 2BH2A 4CMJA 5KX5F 4W9RA 3H9QA 4M87A 4OHKA 5LIPA 3ASZA 3VSAA 4UVHA 2QI9C 2A0FA 2VLBA 1B3RA 1EWKA 3ZE9A 2FWIA 4C30A 2PV0A 1XDUA 3HKEA 5TPWB 1NFFA 1VIDA 4GUAA 2OFPA 4E32A 1T35A 3KZNA 2JASA 1KF0A 5TEWA 3PFIA 1OFHA 4RO0A 3FFXA 2JH8A 5T64A 3TNYA 2HSEA 2GH1A 3A7EA 2Q1XA 5E2IA 5A3JA 4UVIA 1V5EA 3A70A 4NECA 1CP3A 1RCUA 3AVXA 3A0UA 1AKNA 5C4GB 4B6JA 3IKLA 2X19A 4JJKA 2IF0A 3EDQA 4RKRA 4RYLA 4EI8A 4CVNA 4W5JA 2VCHA 1RLJA 1KSJA 2I6FA 3ITKA 3ERCA 2VF4X 5CLHA 4DRZA 2GN2A 3EXAA 3VVMA 2W2XA 4HXYA 2XUPA 2PCLA 4QL3A 5JPIA 3C8DA 3NVKI 3GD7A 4J2TA 1I24A 1T4DA 2WHPA 4L5CA 4GWLA 2WT8A 3WE7A 3ZTWA 4I2VA 3RD5A 4I2NA 4S05A 1WMBA 3RBVA 3WLOA 2ROQA 2ZE5A 1CS0B 3LCJA 4A91A 2FDRA 1SG9A 3EVCA 1YXMA 4PQFA 3C87A 5A6SB 4I5GA 2QNIA 4H9GA 4XYGA 1PO7A 5KTYA 3W8FA 1K1EA 1N2CA 3FDFA 2Z8YM 2IYFA 4JBGA 4Y2YA 2DWOA 2J3EA 3HA5A 3LT1A 1MR3F 4YASA 1M34A 3TCXB 4KXQA 4C6RA 4UFOA 3QF4A 4JOBA 1NY6A 2EP7A 1HK7A 3V6MA 1E1QD 2WU8A 2FOLA 3WJ7A 5HK9A 2JW5A 1R1DA 1VIYA 2Q4DA 4GP6A 3GVHA 4EGJA 1KTVA 5PGMA 4GX1A 3W2IA 1AQJA 5A05A 5H4HA 1TO2E 1TA9A 4OJTA 1PD1A 5EUQB 2HRQA 3KRTA 3SIXA 4D6XA 1XROA 2ZBPA 1JIJA 5A4DA 3VR3D 5IK2D 1ELOA 3U61B 4ZDWA 3WKEA 4UTXA 3KJZA 3ZU2A 4GGMX 2X6QA 3P8ZA 3E3OA 4U7GA 2QTBA 3KLMX 1SH7A 2IHYA 4I99A 3C6YA 5REQA 3ZDXB 5EVCA 3GBSA 5GM1A 4MW7A 1N2JA 4RDIA 1SVOA 1J0CA 4YA6A 2CCGA 5D87A 1NN0A 4UKDA 4AO6A 4YFYA 3VJKA 1ADGA 4ZEMA 3Q7QA 1SIWA 1QRDA 3O8DA 1UFVA 2VJDA 4DLRA 2QL6A 4HDNA 4L07A 2QVYX 3DE4X 3VX4A 5ARBA 3FPAA 3NHWA 1SUEA 5EEGA 1DPFA 1YUMA 3MFQA 1BKDR 3GHHA 5DSZA 2RIPA 4R2MA 2WF8A 3T3DA 1YQEA 4Q12A 3RF6A 1Q74A 3UJBA 4D8WA 3G89A 4ZVKA 5BNZA 3LVRE 1WF3A 3FYCA 1ORWA 2JFGA 5FA8A 1J9EA 2NUTB 4F1WA 1MHTA 3DUFB 1TVEA 3L4JA 3RTBA 2WMYA 2QLMA 3QVOA 4BZWA 3GW8A 1FU7A 1A9YA 1ZIXA 3GJZA 3OQ6A 2TMDA 3UWDA 3HJAA 3R7FA 2XI4A 4JP1A 4HEJA 3QWIA 1X94A 1UK7A 4H31A 4ZXFA 4XDHA 1O6BA 4MYHA 2M6KA 2WU1A 3JWPA 3VH2A 1LSJA 1LZKA 1H2ZA 1ABEA 3I2JA 4O4IB 1F3OA 5ALTA 3F3MA 4RESA 3QI7A 2PQ0A 4XAQA 3W04A 2O8FB 5JZSA 5I7OA 3U09A 4YPOA 2VDLB 5T8KA 3UAOA 3UK2A 4K28A 1NZJA 4F06A 2HMTA 3QUTA 4NX2A 2V97A 4HWGA 1OWLA 3T1VA 1Z5NA 3WIOA 3MA0A 1UJ2A 1XEXB 3NYQA 1TL7C 2XUHA 1A3CA 4NHEA 3OU7A 1PT5A 3CWQA 5ALMA 2HZBA 4OU5A 4V0NA 5IUJC 1EUQA 5BQXA 1U8TA 5DM1A 5KOIA 3PE3A 3EVFA 2VQEB 4JK3A 4KE7A 4CT4B 1Z63A 2VSXA 1IPHA 5KHAA 1TD1A 3MF4A 3H3JA 3S5JA 2JKYA 4M53A 1OLUB 2J5KA 2JGMA 4CW7A 1E18A 4RQAA 3NWEA 4FN5A 3CLRC 2IDMA 4C06A 2C95A 1WETA 3ZTTA 1J25A 3BCHA 3GLUA 3ITEA 4J7XA 2I7VA 4J0QA 4MWEA 3UJ7A 4DV3B 2CLSA 1Q6YA 1GZ5A 1T0JB 4ODIA 3BDVA 3QXGA 4DV0B 3JWHA 2C1XA 5FCDA 2ZUFA 1NW3A 4P5PA 4BLTA 1Z37A 3ZNPA 2PUGA 2HK8A 2OHGA 4YAFA 1H3EA 4C07A 4YAEA 1ZH6A 1DAKA 2GCGA 3OQPA 4KX5A 1SRQA 3OQIA 4YBRA 2EG9A 1E9BA 1PKEA 1AB6A 2Q6OA 3KELA 3OOYA 5CNKA 3TB6A 4NNJA 4ABTA 3NQ41 3EXHC 4UQPA 4XGQA 1B0AA 5G3ZA 3P32A 1T34A 1DAOA 2EFCB 3IAFA 3WGLA 3KHTA 3O4GA 5AKEA 5G0UA 2DPLA 1J49A 2NLOA 3EAQA 3VR4D 4XWKA 3U39A 2FFHA 2QTVA 3QLEA 3OA0A 5EKDA 3EJWA 3MM4A 5AT1A 3THOA 1E5QA 4F46A 2R1VB 5AJZA 1GKKA 2WYUA 1KEWA 3CCFA 1T9DA 3GVXA 3QMPA 4OBEA 4YLEA 5CD1A 3FNRA 1RHJA 1Z6AA 2PTGA 5EJ7A 3N76A 4RHYA 3KVYA 4TXNA 1Q21A 4TQUS 5ALYA 2C5LA 3TMKA 3M3HA 3TBKA 4C21A 5T3YA 1UAGA 1TW3A 4QU5A 3HJUA 5JS6A 1DXYA 3G0OA 2FK8A 3IQFA 4ZZ1A 4DADA 2G5TA 2GBLA 3K0KA 2Q3EA 4F4FA 1YB4A 3REQA 1D6JA 2EHDA 121PA 3I5UA 4FNOA 5C81A 4Z7JA 1KOGA 3LPDA 3JYLA 3VJMA 4BO4A 1IM2A 1YACA 4N0DA 1N7JA 1Q3TA 3IRVA 2EKPA 2O48X 3DD5A 1OX5A 2OZPA 1L7NA 1XQWA 1O9GA 3AJDA 3QPDA 5T41A 4YV7A 1X2EA 4INAA 1UADA 1SR8A 5DLPA 2ZT5A 4MIEA 1CQJB 2ABWA 2DQ4A 2YOFA 2ZI9A 2ZJZA 3G2OA 3IXLA 3L8MA 3MOIA 3U7GA 2BFNA 2YZNA 1RQRA 2PM8A 4C7KA 1R37A 1EGAA 1KVRA 2A84A 3OZAA 4M0MA 2XCRB 5EQJB 4C3OB 1V8OA 2IZOA 2Q5IA 3F9RA 4F3NA 4RK1A 3FOCA 4MK4A 4UVEA 5F2EA 1LSOA 3HN7A 2V3WA 3WMWA 3NXKA 1CVLA 1Z0DA 5FA6A 3BIWA 1MA3A 5K0SA 2E5LB 2VCYA 4QREA 5IAOA 1LF0A 3OPNA 3WDLA 1G59A 2NU7B 1E6EA 2VHYA 2X5KO 3PUIA 4H6PA 3EYWA 2Y67A 1F2TB 3PUJA 3QVUA 2X7JA 4KQKA 4CCSA 1P9RA 4WZAB 1XX6A 3ETCA 4MKIA 5B58T 5GADl 3OF2A 1E6CA 4EENA 2X1LA 4N4AA 1ZH8A 3LC0A 1HSZA 1Q12A 2JGEA 3E9MA 3BKXA 3PA6A 1GPJA 3B1VA 4KH1A 4YJKA 5F1KA 4O4IF 4TTJA 3KYDA 3O82A 2HLHA 2MSLA 3OKFA 4QOGA 3ZQKA 3ZCSA 4GWKA 1P8AA 3HY4A 1J21A 3JD3A 1NXSA 2WQ7A 4JDUA 2ZYAA 4KPYA 1M6VB 3M1IA 5LZ8A 4BBAA 1CY4A 4CKBB 1H3NA 3ECCA 1W46A 2WF6A 1SQ0A 2JFVA 3C5EA 2AUMA 1J8FA 2G4LA 3L0DA 1J2YA 4Q9HA 3N8DA 4B47A 3I32A 4RVSA 2OC4A 1E0KA 3ZJYA 1KOLA 1QP7A 1V35A 3P0EA 4PLCA 4ND8A 2ZR0A 4R3UC 1Z12A 3JD4A 4E12A 1V96A 1JKXA 5AR1A 5FOQA 5DK4A 3KTDA 4FGUA 4PQEA 3NUQA 2PGOA 2QTHA 5EGSA 3SI7A 4HB4A 3WRXC 1J00A 5C35A 2OLKA 4MV6A 4CEIB 5A0VA 1NTRA 2IXDA 3L2OB 1VKNA 3NXSA 1BHJA 3RYCB 3LX5A 1VXOA 2Q45A 1UBRS 3QIAA 3JASA 3RYHA 3NAMA 3H0KA 1SKAA 4HRAA 3L6RA 1ZCBA 2JFFA 1U8UA 3LK6A 3P2EA 4DDWA 1YRQA 3JWGA 3GGCA 1CDDA 1OQAA 2AEMA 2IKQA 2NXWA 3A9UA 3IUMA 3TUIC 1E1LA 2EU8A 3ZHRA 4OPMA 1MOQA 1SVLA 1ZGGA 4OL9A 1LK5A 5IC4A 1UFKA 1XRJA 5FBZA 3TIIA 2C20A 3B78A 2WHEA 3JQAA 4G5QA 3I34X 4I1IA 4JD5A 4Y1RB 5GGYA 3TQTA 2TECE 2X76A 3L6OO 3TR6A 1S2DA 1XYYA 2H16A 2C8KA 4OQYA 3DB1A 4J3JA 1RXCA 3KEFA 4MVJA 1EGHA 1LBTA 2ENUA 3K20A 3W3AA 2Q5LA 3E5NA 3NV9A 4B87A 5ADUS 4EO4A 4WASA 3EIWA 1S8FA 4DXDA 4BJHB 2VF7A 3OHMA 3PXEA 4NBKA 4Z7NB 1W7AA 3SICE 4LHEA 1EJ6A 1DZIA 1PZNA 5EZQA 2ZE6A 5EINA 1NKTA 1XDWA 2K5UA 1RC1A 4MQ6A 2QPTA 3CT4A 2HJGA 3GO4A 4NH0A 2OK7A 4A0GA 1AM4D 2ONYA 2ZUCA 2AD5A 3IIJA 4BGEA 4EGAA 1SC9A 2IF2A 4C6TB 4ZO8A 3EZGA 4NMWA 1FYFA 1T36B 4I66A 1IUKA 2VHQA 1JWAB 3B7PA 3DQZA 2MMGA 1DARA 3QJ5A 5IASA 1BX1A 3D2AA 3JD1A 4MIOA 4WZBE 5EE9A 3BXOA 1WHTB 2IX9A 1Y1LA 3DPUA 2DRIA 5JWHA 1NM5C 3QWBA 2OVBA 3DWFA 3C14C 1LNSA 1G3UA 4U6NA 4CL2A 5DNWA 1OH6A 2PUVA 3UJ8A 4AT1A 4MMYB 3F8SA 3L04A 3IMKA 1XLUA 4YRFA 1PL6A 4JT4A 3PLRA 4DXAA 5AUPB 2NTNA 3GMSA 1EFHA 1F0PA 1T8SA 3P4YA 4B75A 4FZ3A 3ZDDA 3ZZ1A 5K8LA 1LUAA 1SOVA 3U6BA 1XZIA 1Z0SA 1WJGA 3BPSA 1TZBA 1T8PA 3MCTA 3MXOA 4BCBA 1P60A 1KNQA 4PX3A 3IQWA 3IE1A 1MNAA 3HN6A 3WIDA 1BX3A 4G89A 1X1DA 2G25A 2K2QB 3QA9A 4AN1A 4EBBA 1PEAA 2OUKA 4W99A 2V3CC 1GSIA 3G0BA 2Q0SA 1QO0D 3EY4A 1CUZA 3KFXA 3PFCA 5ICFA 4IHJB 1EE9A 2O7QA 4ZU3A 1OI2A 1S3SA 3IESA 5DLEA 3NFYA 1CIVA 3S2YA 3OLQA 3ZQJA 2IEZA 1I4EB 1ZAKA 2B92A 1XA0A 4MR7A 4R8RA 3WYNA 3HVIA 3J7TA 3JZMA 1AURA 1RABA 3OEHD 4WRRA 3RGWS 1KMCA 3PX2A 2DY1A 3T9DA 5I7EA 4PGFA 2EP8A 1N33B 1PKXA 5K3FB 1XA4A 4Q4CA 1QHXA 1MEOA 3OWOA 4DA8A 2OGZA 2E48A 3AFGA 3DL2A 3A3PA 1UFRA 2DBQA 5AW7A 4AVYA 1SURA 4KIWA 4UNSA 3FG9A 3U49A 3ZHXA 5KMGB 3FBTA 1KJZA 1T1RA 2XXAA 3B48A 1PP4A 1R5OA 1XKTA 3NIWA 6Q21A 3RUPA 2FMTA 2AN4A 3ZDZB 4E7OA 1YZLA 3VKWA 4RKEA 2O5CA 4Z4QA 3U1BA 2O0HA 1M2VB 2V7BA 2VQFB 4QGSA 1SG6A 3A1UA 4NICA 3SS8A 4BV8A 1UEJA 2QU7A 4WXYB 4KLRA 4G5RA 3BXFA 3N75A 3L92A 4XB1A 3U3ZA 4E03A 3OQJA 5G53C 4IDDA 4W4TA 4GI2A 4JKYA 3E23A 1ISFA 3QNUA 3OI7A 3UJDA 2ZYIA 3UFXA 4HR7A 4JASB 3P26A 2XE6A 3ET4A 4PQGA 2AXPA 2WNSA 5CFPA 1MENA 2IIBA 1CJTC 1TJ5A 1QDEA 2H4YA 2VJAA 3BMCB 3DYIA 1YRYE 4AZTA 3LDAA 2FSVC 3DBVO 2OM6A 3ANYB 2FW7A 3H0EA 3C16C 3KE8A 4IEEA 2XMRA 4L9WA 4PBRA 3UAWA 3WMXA 4LJRA 1GCOA 1M66A 4EMSA 5IUKC 2CK3A 2G07A 2JIPA 4D3FA 5CIYA 1EDEA 4QJIA 4R2XA 1YUBA 3DDOA 4HY3A 4LA4A 1Q0LA 3EF1A 5AVKA 5C5CA 3PJFA 3EVZA 1KU0A 2PU5A 1K7FB 2XEDA 4RUKA 3RVNA 2ZPUA 4TLLB 3D5EA 4G0ZA 4AQDA 4EO9A 4U3JA 4AKEA 1T4MA 4FQ7A 1JSZA 4YYZA 2C2GA 3AR6A 1J23A 3GARA 4G8JA 5TT0A 5I9LA 2R3SA 1BC5A 4LC9A 4WUTA 4YI3A 1WDKA 4QD3A 1RPTA 1PT6A 1HMYA 4LYHA 1JG2A 4S2EA 4B4OA 5ALSA 5CB4B 3IUBA