1ZO8A

X-ray structure of the haloalcohol dehalogenase hhec of agrobacterium radiobacter ad1 in complex with (s)-para-nitrostyrene oxide, with a water molecule in the halide-binding site
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
252
structure length
252
Chain Sequence
b'STAIVTNVKHFGGMGSALRLSEAGHTVACHDESFKQKDELEAFAETYPQLKPMSEQEPAELIEAVTSAYGQVDVLVSNDIFAPEFQPIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKRKSGHIIFITSATPFGPWKELSTYTSARAGACTLANALSKELGEYNIPVFAIGPNYLHSEDSPYFYPTEPWKTNPEHVAHVKKVTALQRLGTQKELGELVAFLASGSCDYLTGQVFWLAGGFPMIERWPGMP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords halohydrin dehalogenase
molecule tags Lyase
source organism Agrobacterium tumefaciens
publication title Structural Basis for the Enantioselectivity of an Epoxide Ring Opening Reaction Catalyzed by Halo Alcohol Dehalogenase HheC.
pubmed doi rcsb
total genus 91
structure length 252
sequence length 252
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 4.5.-.-:
pdb deposition date 2005-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1zo8A00
2ET6A 1XG5A 4U5QA 1LLCA 4XYMA 1BDMA 1YH3A 2HAEA 2J3HA 2DU8A 2H5LA 2VNSA 3M2PA 4J0FA 4J49A 4R9SA 3WWZA 5ADHA 3HZZA 3QW2A 3QVTA 3BTVA 1PJTA 3L4SO 1R4NB 4PG8A 1XR3A 5EIOA 3NJ4A 2FR1A 4E2YA 2JJYA 3KYDB 2PH3A 3EZYA 3HFGA 4OOFA 3WQSB 3ZH2A 1ZFNA 3DAPA 2E48A 1A4IA 3GAFA 1B3RA 1ONOA 1P1JA 4NK4A 4GMFA 5JYEA 4GAEA 5CG1A 1NFFA 4WJZA 4YJFA 3KEQA 1E6UA 4N5MA 4DMLA 2QX7A 4FD3A 4MVJP 5A06A 2ZTLA 1T1SA 2B37A 4TRJA 5HS6A 5A02A 5HA5A 1Q0HA 4B7XA 3DMTC 3JQ7A 1KS9A 2YV2A 4NQZA 4OQYA 4J9UE 4PLYA 4QECA 1GPJA 2YDXA 4CLHA 4DBVO 2GUGA 1L7DA 2P5YA 3KLMX 3OHSX 4WPGA 4YT4A 3ICCA 3WGHA 4WECA 1H9BA 5I8WA 3D7LA 4ZA2A 5MDHA 4IDFA 4DPLA 4EUEA 2QYSA 4R1TA 3QSGA 1U7HA 2DLDA 2Q1UA 3ITDA 3OP4A 4K9DA 3F47A 3UAGA 4DMMA 1BRMA 3O4RA 2PA3A 2ZYGA 4XB1A 4YT8A 2GZ1A 4NH4A 4NMHA 2OXIA 3ZV4A 3DZHA 3I4FA 1LRKA 3PFWO 2OFPA 2HMUA 3ETDA 3PJDA 3BMNB 3GVHA 1WW8A 1YO6A 2W90A 2J3KA 1DXYA 1M67A 4Y8VA 3R3SA 3UXYA 4YAIA 4HNHA 4K1LA 3D3WB 3VZQA 2ILTA 3JYPA 4UULA 4Z0HO 4PLFA 3AU9A 1F06A 1ZXBA 2Y67A 3ADOA 3D3WA 2RHRA 5DN9A 4EYEA 2PLAA 4MINA 3VVCA 1ZK2A 3O9ZA 2YY7A 4CMAA 3AM5A 4YAKA 4Y98A 3IS3A 3TZHA 3GN2A 5JCJA 4YVFA 3IC5A 2P9GA 4IDDA 1A27A 4PLPA 4S1VA 4XZ3A 4NBUA 1ZSNA 4OL9A 3O8QB 2JKVA 3E9QA 3WNVA 1DRVA 4MVJI 5LDGA 3DOOA 4ZICA 4GKBA 3IQDB 3DTTA 2QIOA 3IKVA 1NX6A 4PRLA 4RF3A 5IN4A 3DB2A 3PWZA 4CQMD 1Q0QA 1ZMTA 1EZ4A 4J0EA 4W82A 4OYRA 3P5SA 4UVGA 1GADO 3DBHA 3MZ0A 4A73A 4YXFA 2ZYDA 3M1LA 2Q46A 2PNFA 3WQRA 2Y1GA 4B4WA 1HYGA 2X0JA 3PWKA 4NHEA 3ZN2A 4Z6KA 2G17A 1BTOA 4ZVVA 4AFNA 1Y5MA 3ZHYA 3NTOA 4W7IA 1K3TA 3PI7A 3I4CA 1XQ6A 3OJOA 3JQAB 2I5PO 3JQGA 3OJEA 2QRKA 1BG6A 2BGLA 3ZCXA 2WD7B 3GY0A 2X22A 5IZ4A 5L3ZA 3P7MA 3BMQA 3E03A 2ZTMA 3BTOA 3W6ZA 3H6KA 3TF5A 1VJTA 5HM8A 3EHEA 2IYPA 3KYCA 2A92A 4GSKA 3A4VA 1Y5RA 4RZIA 2BGMA 1T1RA 4CLRB 2I99A 3JQFC 1V6AA 3JQ8B 2X8LA 2BGKA 3RC1A 3QVXA 4R16A 4PLGA 1I0ZA 2PY6A 2OP0A 3OICA 1NQ5A 4CPDA 1YB4A 1KYQA 4J1NA 4CODB 1SMKA 5ER6A 4EW6A 4IQ0A 2GN6A 4W9NA 1NQOA 5F3RA 1LLDA 3TQHA 1I01A 1W0CA 3W4KA 1HETA 2DBQA 4YJHA 4I08A 1K6XA 1YBVA 3NAQA 3OECA 2PR2A 4BMVA 2JFHA 4J91A 2HK8A 5G0UA 5KJ6A 2DFVA 4U0JA 1X7HA 1SB8A 3WYEA 1N7HA 3RBXA 1DIHA 5CAEA 3DZKA 2EP7A 3PDJA 5JS6A 3V2UA 1WNTA 3VZSA 2FPIA 1T25A 3PIIA 2O3JA 1IHYA 4OJNA 3U5TA 3WXBA 4HX5A 1P1IA 3DR3A 2UAGA 2HLPA 2Q50A 4QTZA 3H3JA 1DFHA 3ZWNA 1PGNA 1XCBA 1PZGA 4L75A 4D46A 3OFSA 4I9HA 4JROA 2GRAA 2HMVA 1QG6A 3QA9A 1I32A 4XGNA 4BO7A 2BHLA 3TWOA 2VUSA 3KB6A 1ZXLA 4NU5A 5JDIC 1FDWA 2B0JA 4FC7A 1H6DA 3A9WA 4J1QA 2W2KA 5DP1A 4TWRA 5B37A 1AN9A 2YYYA 1E7YA 1GEGA 1ZJYA 2W98A 3GZ4A 1LDEA 3OIDA 4HFMA 3VPHA 2AW5A 4F3YA 4BMNA 4BNWA 3ZHXA 2A94A 3WGZA 2VT2A 3FNEA 4FQ8A 5GZ1A 4I9UA 4AICA 4HUJA 1UAYA 4OSOA 3TZ6A 1SZJG 4DLAA 2I9PA 5U4QA 2C5AA 1UP7A 3L4BA 3SXPA 2NADA 3LT4A 2FPGA 5B1YA 3L6OO 1MB4A 4A2CA 2CVQA 4J7XA 1RWBA 2NV6A 3HJAA 3W8FA 4AJIA 4IZHA 1PZHA 4CMEA 1N5DA 4D3FA 1WMBA 1SC6A 4QO8A 4BGEA 4JN6B 1M2WA 3LLVA 2SCUA 4XQGA 3MJTA 2J3IA 2Q1SA 4WEQA 4CJXA 4FOOA 4YDRA 3E5RA 3VPXA 3QWBA 3PZRA 1YOVA 4J9VA 3RI3A 3VTZA 2YJZA 2AQIA 1DPGA 4PIVA 4Z3KA 2UV8A 2I67A 3GDFA 3K92A 5DOZA 2B5WA 4P22A 4QSMA 1GUZA 3QIVA 1DO8A 1JAYA 1U3TA 5THQA 1Y8QB 1NPYA 3F1LA 3PWSA 4U8GA 5CEJA 5JSFA 1QYWA 1ZK1A 4XGIA 2JAHA 1PS9A 3ZWPA 3S55A 2ZATA 4GL4A 5F1OA 4A10A 1A71A 1SOWA 1GL3A 2VNAA 4IS2A 3PPIA 1F14A 1P1HA 2HJRA 1DC3A 4AJ2A 1LC3A 2YV3A 2O3QA 3SLGA 3OQ6A 5JAZA 5GMOA 1LI4A 2D5CA 3LC1O 4AJKA 3JQEA 4CMHA 3RJ9A 1XLTA 4GGOA 5DBFA 5A9RA 3UH1A 1DLJA 3WICA 3BZUA 3TL3A 1XSEA 3BMCB 4D0RA 2AEMA 1ISIA 1PL8A 1PU2A 4FW8A 1PQWA 3EGOA 4BO0A 1NNUA 2NU9A 2H1SA 4NBWA 4QXMA 3W8EA 4WCDA 4XA8A 1MP0A 2GYYA 3DC2A 3IUPA 3GNTA 4JP3A 1ZZEA 2ZQYA 3NTQA 5AXBA 1NPTO 3RD5A 4B3JA 2ZCVA 3F4BA 4NJMB 1MV8A 3I9OA 3LSYA 1QORA 4R3NA 1P3DA 4I8XA 2CVOA 3IUSA 1LX6A 2CF5A 5DZSA 1X1EA 1NVMB 4BKOA 4RPGA 1W6UA 1PL7A 2EP5A 3CMMA 3FRJA 1YJQA 1GU7A 4NPCA 5L7YA 4PVCA 3WDSA 4EBFA 3EMKA 5G0VA 5BSHA 4L4RA 4BNFA 4ITUA 3DBRB 5COAA 1D7OA 2X4GA 1P1KA 4PVDA 1EFLA 4F46A 4A27A 3QHAA 5TT0A 1Z75A 4J4BA 3JYLA 1M6WA 4ONEA 3NYWA 4HFJA 1DC5A 3CZMA 4BO8A 1E1NA 2H63A 5IJZA 4MDHA 3EVNA 1E7RA 1XDWA 1TLTA 5BSFA 4QX6A 2NACA 1TB4A 1PGJA 4YEDA 4U0KA 3K2BA 1RM3A 3HFSA 5I7FA 2DFDA 3ZV3A 2DTXA 2XPCA 4GLLA 3AW9A 1SNYA 5FYDA 4OXNA 1F12A 5FI5A 4K6FA 1A9ZA 3G1UA 3NDRA 5L4SA 1E92A 5L51A 1F8GA 3FPCA 3RQSA 1O8CA 3E9NA 4BKPA 3EC7A 1KVQA 5FI3A 5F5LA 5KJEA 5B12A 2Y1FA 3S2FA 3PLNA 2C07A 2FR8A 3ASUA 5TNXA 1FJHA 3FPLA 2NU8A 1KEWA 4CV0A 2Q2QA 4CMBA 1ZIDA 2P4HX 2DUUA 4XB2A 4E21A 2WD8A 3ROMA 3K73O 1HZJA 5ER9A 4PLCA 1C0PA 1EVZA 3I9NA 1YONA 2VTEA 1Z82A 3KBOA 4RVDA 4BGIA 1GR0A 1YB1A 3U0BA 4QQRA 3T4XA 4EI2A 1I30A 3WSWA 2ZTVA 1K2WA 3UN1A 1Y7TA 3OMLA 4Q3AA 4O6VA 3ROPA 5L4LA 1YL6A 1E7MA 1XYGA 1E3LA 4XRRA 1ORRA 1WMAA 1B8PA 5L45A 3DAGA 2BFAA 1GFSA 4RVHA 3ROKA 5EQFA 3SBOA 4CM4B 5EQDA 1GPDG 5KVSA 2H6EA 5EERA 2H9IA 3B6ZA 3Q2IA 3ZNPA 4ND2A 4BO4A 1VRWA 2CVZA 1LXCA 2O7SA 4PN3A 2D1YA 3PYLA 1BMDA 4DVJA 4FGWA 4CUZA 1GCUA 4IGEA 3W4JA 1HRDA 4D41A 1QKIA 2GERA 2DPHA 2V6BA 3F5SA 3ONDA 4M89A 4TRRA 3ZNNA 1ID1A 4ZQEA 4TKLA 3QRWA 3IKTA 4O1MA 2VWQA 1CEQA 4E30A 3W8DA 5T64A 4O5OA 2WYVA 4N18A 4ROSA 4WLOA 4BKRA 4YBZA 1LBEA 3ZHBA 2DVMA 1PTJA 1TI7A 3RUDA 1E3SA 4BUCA 2AQKA 7ADHA 2ZIZA 3GVIA 1H0KA 1VKNA 1EVYA 1E3IA 2PD3A 1HXHA 4R69A 1XA0A 3ZWVA 4U7WA 3RKUA 2W8ZA 3EK2A 5G0SA 4LVUA 1JVBA 1YE3A 4CM6A 5KTKA 4KUEA 4D79A 4FFRA 3KHUA 3MJEA 1O0SA 1U3UA 4FFOA 1YQXA 3PEFA 4W6ZA 1R4MA 3IOYA 3T7CA 3NDJA 5BNFA 2EGHA 1C0IA 4FB5A 5B4VA 3BA1A 3JQ9A 2VWPA 2VZ8A 2G0TA 3I9LA 2NTJA 2IEBA 1ENYA 4L9RA 2HSDA 4YCAA 2X58A 1RKXA 3AI1A 1A7AA 1YXMA 3TOXA 3GMSA 1PZFA 2AEFA 5JDCA 1MC4A 3GA0A 3PGJA 4GMGA 2YUTA 3GVCA 1PJ2A 3FNGA 3LF1A 2FSVA 3IIEA 3AM3A 5AYVA 3UF0A 2XXBA 1H2HA 3ORFA 1O89A 2Y99A 4UVDA 2D3TA 3TPCA 3R6DA 3QWFA 2Y1CA 2I76A 4BGUA 2PFGA 1P31A 4IXTA 1HTBA 3AI3A 3JD4A 4N54A 3KRTA 1J49A 3RKRA 3U4DA 1ZKMA 2AEJA 4RVSA 4E13A 2VHYA 2HMWA 4RF5A 4DQVA 1IE3A 2NU6A 5L7WA 3K30A 1B3BA 1N9GA 4AJJA 3CEAA 4NBVA 1B16A 1ZJZA 2Q1WA 1X15A 2NVWA 3E18A 4G65A 4MJLA 1VLLA 5CPFA 5C37A 5A3VA 1P77A 2PH5A 3SC4A 5KWEA 3ZI0A 3MJ4A 4YQYA 1GTMA 3AOEA 3DZJA 3FSRA 3PLRA 4LRTB 3U49A 1UXIA 1V8BA 1U3WA 3WBFA 4OIMA 2OBNA 3WR5A 2CSUA 3FWNA 1NAHA 2DBRA 3KO8A 1UR5A 4I5EA 1G1AA 2WYWA 3ICPA 5A9SA 3KUXA 3LLSA 4CQLA 4DYVA 1IULA 1CERA 1KVSA 2DKNA 4WGGA 4AJNA 4E0BA 3D5TA 2C59A 3D4OA 1FK8A 3K9QO 2WJPA 3L07A 4EGFA 4I5GA 1J0XO 5FFFA 3VDQA 1HSOA 1QLHA 2X1HA 1E7QA 3H9JA 4ZQFA 3UCFA 3BMOA 4PLZA 4MVJM 3GLQA 3WJ7A 5KCZA 2JCYA 2NM0A 4FJ0A 1ENPA 3MJVA 3PP8A 2JCVA 4FFNA 5J23A 1MLDA 3KVOA 4J90A 4JXKA 4MVJD 3MOIA 4PFJA 2JHFA 1LRJA 2WD7A 2HJSA 3WB9A 1WVGA 3WIDA 2EKPA 1N92A 2F00A 3ANLA 5JCJD 7MDHA 2NVUA 1B0AA 4AJOA 3LU1A 4RL6A 1SB9A 4BNZA 3I23A 3VTFA 3ZW8A 1UP6A 1PWXA 1YDWA 1V3VA 1DHTA 2BLLA 2RH8A 4ZRMA 3QVOA 1I8TA 4FBGA 2XOXA 4ALLA 1KVRA 3NT5A 5T5QA 2AE2A 3PYXA 3N7UA 1BW9A 4IS3A 4Q3BA 4JIGA 1RM0A 4KTVE 4CR6A 3DFZA 1FDVA 1UDBA 2NWQA 3LT0A 4WLUA 3DZGA 4L74A 1XU7A 1AHIA 3LDHA 4W99A 4KUGA 3RBVA 4B79A 5IF3A 4CMIB 3WBBA 1E7WA 4E5KA 2D0IA 1YDEA 3QJ5A 5DOVA 1LUAA 2ZCUA 2O2YA 1F17A 1D8AA 4CL8A 3OM9A 5DCWA 5I7SA 1EVIA 2FRDA 4BKUA 3FTPA 4DRYA 2DTDA 3NT4A 1DHRA 4MKXA 3R0IA 4DA9A 3K2EA 1C1DB 4XDZA 1ZBQA 1I33A 3C7CB 3HHPA 2IDZA 2JL1A 4P8RA 2IYOA 3GHHA 2VYND 3ZU2A 4GX0A 5TGDA 1EBFA 5JDCC 4CMEC 1DSSG 4I5FA 3JQ8A 5IXYA 1O5IA 3WS7A 3LQFA 1SAYA 3ULKA 5A5EA 1CJCA 4XX0A 2EHDA 2GZ2A 1V0JA 4GWKA 3Q11A 2VYNA 1O95A 5A4DA 4YRAA 3MOGA 5JBIA 1JDJA 5MGBA 2W2KB 2O2SA 3OSUA 1U2DA 4RQUA 3DBLB 2FR0A 3Q9UA 3SEFA 3FNHA 4YAGA 3ONFA 2PTGA 3WGOA 4FR5A 4UREA 4S3MA 2CY0A 1I3KA 2C5EA 3OEWA 2V6FA 1U1IA 2QRJA 1F8FA 1UAGA 4L4SA 3D5QA 3BAZA 3ZNOA 4LVCA 4JX8A 3B1KA 1GZ4A 4CLXA 6LDHA 2ZYAA 2HUNA 1EE9A 2W2LD 2PZLA 3WGQA 4Z0PA 4JJFA 3U4CA 2QYTA 5JC1A 3GNSA 3C3XA 2YHUA 3PTZA 3DWFA 1HE3A 3UCXA 3VVBA 3GVXA 3DMTA 1HDOA 3HNPA 4RLHA 1JU9A 3R3JA 1BDBA 1OC2A 1IUKA 1H6AA 1WAMA 4BNJA 4NK5A 4R4JA 2CDAA 2P5UA 5A03A 1YJ8A 2BD0A 2YV1A 2WWRA 3L4BC 2Y0CA 4R68A 4DC1A 4FJ2A 2W2LA 3ROQA 3RUHA 5IN5A 1DIBA 1VJ1A 1OBFO 2BELA 4YAJA 1YOVB 5I8ZA 1K6JA 1R16A 3BIOA 4WLFA 4BB5A 1KC1A 3AI2A 3MEQA 4NFHA 4PLWA 3GEMA 4QFDA 3EY4A 3AUUA 3H9UA 3RFTA 5HTOA 1TA4A 1ZMOA 3HB4X 1PEDA 3DZFA 4WLEA 4CQMA 3GT0A 2VOJA 3S2EA 4CM1A 2HO5A 1XQ1A 1NVGA 5F1KA 1LDNA 4P4NA 1O9BA 1B14A 2TMDA 4P4LA 5FF9A 4BNIA 2Z95A 2FZEA 2FHSA 1MG5A 3ZZNA 1GUYA 3W4IA 4XJTA 3RJ5A 2X6TA 5IFLA 4ID9A 5IDQA 1HF3A 3UUWA 3JQ6A 4LISA 1GAEO 4B3HA 1DFGA 3HDYA 4NNJA 2EJWA 3JYQA 3UHAA 4FFLA 4CUJA 3LT1A 1X7GA 3B70A 1KC3A 1E3WA 2Y0DA 3DAFA 3T7EA 4W4TA 1PJCA 3U62A 4AJEA 5H82A 3HDQA 1LSOA 1E3WB 4MIOA 3JQAA 1T4BA 1DC4A 1N8KA 3IJPA 2EKQA 1KVTA 3DL2A 4QFCA 5F5NA 1Y9EA 2PZMA 1SOVA 4Y6SA 1A5ZA 1ML3A 4TRNA 4TVBA 2NTVA 4J1SA 2W4QA 5ICSA 2Y05A 2C7VA 3JQCA 3KV3O 3KXDA 2BMAA 2O4CA 4H15A 1P0FA 3IP3A 4LW8A 4YJGA 3UFXA 3GZNB 4M55A 3DOJA 1R12A 5AXCA 2Q2VA 2QZ9A 1WP4A 2CMDA 3UW3A 5IZCA 2X0IA 3VZPA 1ZNQO 4URFA 1JVSA 1PZEA 8LDHA 1EE2A 3F9IA 3FBTA 1J6UA 3AJRA 5DT9A 1IZ9A 1ULSA 1JQBA 3GMDA 3UICA 2OMEA 2ZTUA 3MWDB 4JBHA 3TNLA 4Z9YA 4FCCA 4BO3A 5EESA 1KEUA 3VPFA 3NT2A 3F3SA 2VOEA 4DTIA 1FXSA 2VHZA 3F1KA 3LVFO 2CNBA 4PLHA 1UXJA 3JQGB 3UOGA 1H93A 1YBAA 1ADFA 2J3JA 2R6JA 5BQFA 3INGA 2A35A 4J2HA 1QYDA 2GCGA 4YT2A 3BMQB 1ISGA 4TKMA 3L9XA 1R66A 2DAPA 2OORA 3K5PA 3LC7O 1LSJA 4WLNA 2J5KA 3WGYA 5B4UA 3ENNA 3GEGA 3I6QA 1OAAA 3TZKA 3WYBA 1E3JA 4ESOA 2PGJA 4CR8A 5JCXA 1E1MA 3OJFA 4DWVA 1DLIA 1DAOA 4KWIA 4CLOA 4KQWA 1HDGO 3EZLA 3JQFA 4DGSA 1E1KA 2LDBA 1CDOA 3TFOA 3C7AA 4WCFA 5ENVA 2RAFA 2BKAA 4KOAA 2I3AA 1JAXA 1NFRA 1UZLA 1WPQA 1OC4A 4IY1A 3RVDA 4BNGA 4J1TA 3I83A 3PQDA 2X0RA 5KNLA 3K8ZA 3GUYA 3RUEA 4ALNA 4NDNE 2R2GA 1NXQA 1HDCA 4BO1A 3E9MA 5EJ2A 2NQTA 3INTA 4CM4A 1PSDA 4XRGA 2E82A 3NV9A 3FD8A 1PGPA 2C7GA 4IJVA 3DDNA 4GX1A 3ZGYA 1YQGA 1Q7BA 4RORA 5U1PA 5G0WA 4A5OA 2D59A 4OSPA 4TZTA 4B8ZA 4O0LA 5CEFA 3WNQA 3PHJA 5BNIA 4KWHA 4E4YA 5G4KB 4CM8A 5KVQA 1UZNA 4R54A 3L0DA 4QT0A 1YL5A 4I9NA 4Z9FA 2VRBA 4HFNA 3PHLA 3PXXA 3BMNA 4XWYA 4CLEA 4JJIA 3IAHA 4TVOA 3EUWA 3K96A 2B4RO 4YAEA 4CM7A 4ZJUA 4TZKA 4IDAA 1ZVMA 4BHTA 2PK3A 1KERA 1EMDA 3JD2A 4NU6A 1SEVA 3BXXA 4IJWA 4HXYA 3DBVO 3I52A 2V65A 4PZDA 1LSUA 2HCTA 4L4XA 4E6PA 3DOCA 3HE3A 3I5MA 5H81A 1UXGA 1LLUA 2JD1A 3WLEA 1JKIA 3MCVA 4M54A 3CTMA 1IHXA 4BNNA 5JYDA 1R4MB 1P74A 3DXFA 1VKOA 4D45A 4E2XA 4PG4A 4LSMA 5C7IO 5A04A 5ICMA 1T26A 3NTRA 2JFFA 2EXXA 1XHLA 1HWYA 1C0LA 2FSSA 2ZB4A 5H83A 2C2XA 3GG9A 3UCEA 1SBYA 1UXKA 2DQ4A 5EINA 1QRRA 1ISFA 2AXQA 2JHGA 2O3SA 5BR7A 1T24A 3SJ7A 4XJSA 3QE3A 5L53A 2X5KO 3LC2O 3SVTA 4DQXA 4IJUA 3HN7A 4B7CA 4ALIA 1YL7A 3VKVA 3AY3A 4GWGA 3U4HA 1RPNA 3VH3A 4XR9A 1W8DA 2GN8A 2VZ9A 1CQJA 4LRSB 5COQA 4AVYA 2PGLA 4EUFA 5GY7A 2DTEA 2FZWA 1WWKA 2RBEA 2BF7A 2V6GA 5DCYA 3VC7A 2IEDA 3GAZA 1D3AA 3ZU5A 2R00A 3F5QA 3IDSA 5ITWA 2EV9A 4DYDA 2AG8A 2GF2A 1DOHA 2GLXA 5G4LA 3H5NA 3JYNA 1ISMA 1N7GA 2BFMA 3RASA 1R0KA 4E5PA 1U7TA 1CWUA 2BI7A 4WLVA 5G0TA 1UDCA 5TLSA 1JKJA 1PGQA 1LQUA 3QV1A 3V2GA 5KKCA 1Y1PA 2JAPA 5JXWA 1TT5B 2PZKA 1GV0A 2WYUA 3FHLA 4NJOA 4UVIA 2IZ0A 5IG2A 1R15A 1WLYA 1HL3A 3WMWA 1R37A 3NX4A 3KOUA 1PJ4A 3IP1A 4I5DA 4ND1A 6ADHA 1U5CA 3C85A 4PG5A 3PFFA 3VHRA 2PD4A 1NP3A 5EPOA 3WMXA 5IAAA 1FDUA 4OH1A 2ZKLA 1C1XA 4PG7A 2C0CA 4H7PA 5TRTA 2XXJA 2AA3A 4X54A 2GPTA 3WGTA 3KTDA 1QV7A 3TFQA 3OJLA 4XGKA 3ZU3A 4AJ4A 5IZCC 3F46A 1DFIA 3DBRA 1HZZA 4J2OA 1P44A 2Y0EA 2C2YA 4J16A 3H7AA 2OL4A 4CM9A 4GX2A 4J4HA 1NR1A 1X0VA 2GGSA 1DAPA 4JBIA 2EGGA 2IODA 3PHIA 3RSHA 5ITVA 3ZU4A 4H3VA 1JA9A 4UEJA 1ADGA 4YACA 4GVXA 2VT3A 4L76A 3ZHZA 2QG4A 1DJNA 1R0SA 5THKA 1YS4A 5FWNA 2CF6A 4CM3A 1KEPA 2A9FA 4LCJA 5IDWA 1GQQA 1XWFA 5T8KA 2Y68A 4R9RA 4BNVA 4BOYA 1OI7A 1ARZA 3I6IA 3JV7A 3ZWOA 1PX0A 1PJ3A 1UUFA 4OAQA 1F0YA 2FOIA 3RUCA 5CDGA 3V1TC 4WOJA 1Y6JA 1YGYA 2HKIA 3C1TA 4EEZA 2X23A 3I1JA 3AM4A 3ANNA 5K0ZA 1M76A 2VRCA 4RDHA 1VSUA 4RQTA 4FJ1A 2B35A 3ANMA 4NFSA 1X7DA 4RF4A 4IXWA 4YQZA 2C82A 4ALMA 2GSDA 2NTNA 3VZRA 1P45A 3QWHA 5KJFA 3V5NA 2RCYA 3OA0A 1NWHA 3A06A 4IPTA 4XQEA 1KOLA 2FP4A 5A05A 3WTCA 3EVTA 3E5MA 4IZIA 1DC6A 3E8XA 1QP8A 4D43A 3MTGA 2X9VA 1EDZA 3NDIA 1T2DA 3GRKA 1ZCJA 3RC9A 8ADHA 2P4QA 1RM5A 2UVDA 1LDBA 1D1TA 1W4ZA 2HMSA 1NFQA 1U3VA 1OOEA 5JO0A 5L95A 2TMGA 4CV2A 3PK0A 5BT9A 3SJUA 3OQBA 5A1TA 1BGVA 3H3FA 4BGVA 2EKLA 1GEEA 2OUIA 4XD2A 1PJQA 4M1QA 3E6AA 3GVPA 3SX2A 3B20A 4TRMA 3GGGA 3GDGA 2HMTA 4KDEA 3HN2A 4CUKA 3E82A 4J7CA 2D8AA 4ALKA 3KYDA 2XAAA 3O38A 1PGOA 4FS3A 4IMPA 5AXAA 4Q3NA 1A4UA 5DBIA 1K0UA 2O48X 4Q39A 3OF2A 1UJMA 3UKOA 4ILKA 4ZHSA 3NUGA 4BNLA 4JLWA 2AMFA 2GNAA 3PHHA 2WSBA 4XIYA 2HK7A 4K6CA 3UVEA 4OKIA 3U9LA 4XYLA 4D3DA 1UP4A 4AJHA 4RVGA 1N1GA 3KSZO 3Q6IA 5JE8A 4EJMA 1MFPA 1ZEJA 2O3UA 3D0OA 1C14A 3GC6A 3I9KA 3L6EA 1U9JA 3GHYA 3O26A 3OA2A 2GR9A 2HK9A 4NZ9A 1H5QA 1LA2A 4GGPA 4ZQBA 1J4AA 1HDRA 1DIAA 3WWYA 5I9NA 1AHHA 1IB6A 4KUHA 4MVJE 3S1LA 1BXGA 4R01A 5DNAA 2EG9A 3V8BA 4C7KA 5CG2A 3INRA 4KMSA 4BQRA 3QY9A 2B4TO 3EDMA 1HDYA 5L7TA 4JNKA 5TF4A 4FDAA 1MUUA 1KVUA 1DRWA 3AK4A 4MVJG 2X5OA 2JD2A 4M86A 1B8UA 5IDYA 3IMFA 2D4AA 4XKJA 4BO5A 1PS0A 1EUZA 1AXEA 4GH5A 5JY1A 5A3JA 1N9GB 2YFHA 5C5IA 5JY6A 3EAGA 4FSHA 3D4PA 4XEHA 2GN9A 3NGXA 1ONNA 4AJLA 1U28A 3CE6A 3FR7A 1FDSA 4W7HA 1DRUA 5DBGA 1GYRA 3BHIA 1B26A 1PL6A 2C54A 3ADPA 1LC0A 1HE5A 4IGFA 5I9MA 4RJTA 1P33A 4LMRA 1QLJA 2DT5A 1LLQA 2B4QA 1L1FA 4UAGA 4KQXA 2CDBA 4MKZA 3S8MA 1B8VA 5TX7A 4DIFA 1SO8A 4II3A 1BXKA 3OH8A 1S7CA 3PDUA 4AL4A 1BVUA 3VAZA 3N74A 2J5RA 4TROA 5CDSA 4PZEA 3KSUA 1EDOA 3ABIA 4R1UA 1GYPA 1L7EA 2YFQA 1P1FA 3K6JA 1JLLA 2G76A 4ZQHA 1ENOA 4XQCA 3OIGA 4BO6A 1GD1O 2HRBA 2Q4BA 4IQ8A 4MPDA 1LJ8A 4RZHA 1OZAA 3ZDFA 1YKFA 1ZSYA 3CPSA 4IINA 4XIJA 4A03A 2QRLA 2Q49A 3DZBA 1E7SA 1Y8RB 4OKNA 1HT0A 1E6WA 4NJMA 4IJKA 4LCEA 3HUDA 2FPPA 2NUAA 4XYEA 1MGOA 4XQ9A 3KYCB 4P38A 2O4UX 3CMCO 4OGWA 4C7JA 5TT1A 5TS3A 4DC0A 1NTOA 4NI5A 1RJWA 1SEPA 3DHEA 5JDIA 4G2NA 4XCVA 1NWCA 4RDIA 4YB8A 2YQ4A 3JQDA 1HYHA 1LNQA 3G3EA 3VPSA 1ZUD1 5TIIA 1JW9B 1WZIA 5IXSA 4WK6A 4U6QA 4HFRA 2NLOA 2ZJ0A 4ZD6A 2AHRA 4A26A 4BB6A 1HKUA 4PRKA 3CZRA 3JD3A 4Q9NA 4BNTA 3GH3A 4B7UA 1WDKA 4WCFB 3VH1A 4GVLA 1VI2A 1B15A 4BNXA 4Z0TA 5LCXA 4YRBA 2CUKA 3ZWCA 1GQYA 1ZEMA 2XF8A 5K6AA 4MP6A 1X1TA 1HSZA 3ZNQA 4DPKA 2YHIB 1MXHA 1FDTA 3H9GA 1PWZA 3PQFA 1H6CA 2NSDA 2YHIA 3Q2KA 1HLPA 5IDXA 3BHJA 3NRCA 5ES3A 1P0CA 2ZJ1A 1N2SA 1VC2A 1IPFA 1ADCA 1NBOA 1EEHA 3WTBA 2EWMA 4Q3DA 1A72A 5AQ1A 4GX5A 2E37A 1KIFA 4R1SA 3IL2A 2ZK7A 1TEHA 1MXFA 1IPEA 4OXKA 3VPGA 4BS9A 2PKQO 3G0OA 4KZPA 3HG7A 3DHNA 1PIWA 3PJFA 4Z9XA 1N1EA 4KTTE 3H5AA 2UUPA 2V7PA 2PD6A 1X13A 4GKVA 3H9EO 3D1LA 4M49A 1M66A 1RM4A 2PKRA 3RIHA 2DBVO 2VRCD 3H8VA 1S6YA 2Q2WA 4ND5A 4NR0A 3JQ7B 4ALJA 5KOIA 3PZBA 3GFBA 4K28A 1IZ0A 2CZCA 4IIUA 3WLFA 3AUTA 1X14A 1O94A 3D3EA 4RCVA 2ZQZA 2AQ8A 4OM8A 2Q3EA 2OHXA 4M87A 2F1KA 1J5PA 1ZSVA 2OO5A 3WGIA 2HDHA 3PGXA 1EVJA 3JQ9C 3L6DA 4OMUA 3O8QA 3C8MA 5T67A 2YQ5A 4BNYA 2RHCA 1A9YA 4ZRNA 4RPKA 3WG9A 4JK3A 3G79A 3PJEA 3ZWMA 1IY8A 1VL0A 3DONA 3WX0A 5CEEA 5TJ9A 3ITKA 2FY8A 3S2IA 1U2GA 4CQLB 4B4OA 1K5HA 3TZQA 4ZU3A 1T2CA 4YA6A 2O3TA 2V6MA 1GV1A 4FC6A 4B3IA 4DLBA 3DBHB 1LEHA 2VWHA 1YBMA 3P2YA 3ZW9A 3PYMA 3OETA 2VHWA 5TC4A 2NVBA 2OBYA 4UUNA 4EEXA 4HP8A 1HE4A 2Q4EA 4A7PA 2RIRA 1LTHR 2CFCA 4YYZA 4RLSA 3DMYA 1DJQA 2Q45A 4YWJA 1UH5A 4P4GA 3GR6A 3GZNA 2P9EA 1XIVA 3EYWA 3HQ4O 5B4TA 3X2EA 2OP1A 4DQUA 1DIGA 2PKQP 3TSCA 4D7AA 2PGDA 5CPBA 2Y66A 4RV9A 1PJSA 1HEUA 4R1NA 4D42A 3TJRA 2R00C 2BI8A 3KETA 4KP7A 3W1VA 1AUPA 3UGKA 3BMCA 1GCOA 2EIHA 4IM7A 3JQBA 2BRUA 4MVJH 1IYZA 1P9LA 5JAQA 4YJDA 5KKAA 2GO1A 3ZWBA 1BSVA 4II2A 4DBZA 2P68A 5K6AC 2P91A 1VPDA 4LSWA 4FFMA 2OZPA 1E5QA 3MWEB 5ILGA 2GD1O 4JQCA 3V1UA 1HDZA 2Q99A 4IIVA 2ZB3A 2E6UX 9LDBA 1EQUA 4Q3EA 4LMPA 4AG3A 3C1OA 2AG5A 3KM0A 3OBBA 1Q1NA 4Y67A 5G2OA 3GGPA 4B8WA 1D1SA 4FN4A 1NAIA 1TT7A 1WXDA 1AGNA 4JCOA 2GDZA 4QO7A 1VL6A 1HDXA 3QWAA 3A28A 4AJPA 3TRIA 4ND3A 3I9MA 1NVTA 4YTEA 3H9QA 3ZV5A 1G0NA 1SCUA 1ZK0A 1QYXA 2IXBA 4CMKA 1AXGA 1KBZA 5GZ3A 3WQQA 4E31A 4RO0A 4Q3CA 1U4SA 3NEPX 2QQ5A 3RUAA 3P19A 4HADA 1MX3A 1A7KA 4R51A 3ZWWA 3VH2A 4YJFB 3MJCA 3DEYX 5JMPA 5L40A 2X0NA 2VUTA 1U4OA 5EMHA 3P2OA 9LDTA 4GLOA 5KIAA 1KETA 4YJHB 2UDPA 2Y1DA 2D5AA 5I7EA 1HYEA 4FGSA 3I9JA 3AU8A 1I2BA 2VN8A 3BTSA 2VYVA 3JYOA 3GFGA 4CMGA 4NBTA 4B4UA 4WEOA 3PHGA 4DIOA 3U09A 3FN4A 1I3LA 4INAA 2WM3A 3WFJA 1PR9A 3FNFA 1ISHA 3GUCA 3ST7A 4AJ1A 1Y9AA 1MA0A 4JGBA 1JWAB 1JKFA 1EUCA 3GRPA 2HRZA 2DC1A 3ZWXA 4DLLA 4XYBA 3ASVA 4CMJA 1YWGO 1M6HA 4CLDA 2ZB8A 1VM6A 4QUKA 5JFOA 5CDUA 4E12A 4E5MA 1KEVA 3RU9A 4R5HA 1YQDA 4ND4A 5U9CA 4H16A 3Q0EA 2B69A 1XELA 4XYGA 1LQTA 4UUOA 4L0QA 1E77A 2X86A 3B1JA 4MP8A 2QZZA 4OOEA 1I3MA 4NFYA 5KJ1A 3RCBA 3ETGA 3LK7A 1GZ6A 3O03A 5HBRA 1NQAO 1NASA 1CIVA 3SC6A 5JAIA 4EITA 2BFOA 1ZW1A 2DPGA 4G81A 3U3XA 4DXHA 1NPDA 4NG5A 2GZ3A 1DBVO 2YDYA 5I9LA 4WNCA 1YRLA 3D64A 5DULA 4IDGA 5AOVA 2JD0A 3LZ6A 4CQMB 1BVRA 4WOKA 4TMFA 1X0XA 2I65A 2FWMX 3ZWAA 1EK6A 2CD9A 5ENDA 4OHUA 3MJSA 2EW2A 1DB3A 2O3RA 2ZB7A 1BWSA 3HDJA 5A9SB 4NBRA 3VOSA 1RYEA 1GYQA 2NQ8A 1EK5A 4CR7A 1V9LA 1LDGA 4CM9D 4IDCA 4PCVA 1U8XX 3OJ0A 3ENKA 4TSKA 4CL3A 2Y1EA 2IXAA 4R41A 4FFPA 5ILOA 3TOZA 2BH9A 2YZ7A 3RWBA 2UUOA 3JQAD 1K89A 1I2ZA 3GN1A 4OQZA 3DZIA 1PJLA 4MKRA 4BIIA 1LSSA 4UUPA 4RF2A 2VCYA 4BQPA 4Z3DA 2GN4A 3RC2A 3N58A 1TVEA 3AWDA 3FBGA 3QQPA 1E0DA 3Q3CA 1Y8QA 2B83A 2UYYA 2YW9A 3G1TA 1H9AA 4BNKA 1HE2A 2Z1NA 5C7LO 2Z1MA 4YRDA 4UEOA 1K6IA 3RU7A 1UXHA 4OXYA 1I24A 5JNLA 4YJGB 4LGVA 4UEKA 1Q0LA 2G1UA 2G5CA 1TT5A 4BNMA 4ZN6A 1CQIA 1CYDA 3W6UA 3LYLA 2FMUA 1EQ2A 3HWRA 3V1YA 2J6IA 2AE1A 2Q1TA 3CUKA 3BTUA 3L9WA 3DHYA 4GI2A 1VL8A 3GF4A 4ZQGA 4JP2A 3QWIA 3WGGA 4M8SA 3JD1A 2I3GA 1U8FO 5LDHA 5JW6A 1DEHA 5A9TA 3RAJA 1SPXA 1UZMA 1ZH8A 2J8ZA 4EDFA 4IBOA 1LU9A 1Z6ZA 5CHEA 1QMGA 3DFUA 5TQVA 3TL2A 1Z73A 3RROA 2O23A 4HBGA 2WDZA 3G17A 3GNQA 3PIDA 4D3SA 4EJ0A 2LDXA 1E5LA 1T4DA 4HNGA 2VUUA 4IQGA 1ZO8A 5JLAA 5L9AA 1H94A 2VYVD 5LC1A 4N5LA 4L8VA 3GDOA 1VJ0A 4B4VA 4R3WA 3RBZA 3ON5A 4O63O 1Z7BA 2CDCA 3L77A 4ZGWA 1I5RA 2P2SA 3MTJA 4IDBA 4UVHA 5COBA 5DF1A 3HADA 3F6YA 1PQUA 1GZ3A 4BL5A 1E3EA 3A14A 4O59O 3QVWA 4BO9A 2OGUA 3CIFA 2WTBA 2JCXA 5TJHA 3AUAA 4WCFC 4FOSA 3RFVA 2C29D 2Y1OA 2NNLD 3GG2A 3GQVA 2O7QA 1WDLA 1W73A 3QVSA 4MIEA 4WE3A 4RGBA 4A0SA 3C7DB 5F21A 4CV1A 1O6ZA 1Z45A 3CXRA 2I66A 1Q7GA 1V35A 4PLTA 4DPMA 3OIFA 1Z7EA 3GGOA 1C0KA 4LN1A 4IUYA 4WNIA 4KDFA 3PRJA 5CDYA 1PQPA 3WJAA 4BO2A 3Q9NA 2WE8A 2X7HA 3AY6A 1PS8A 3JD0A 3B1FA 5BSGA 3KSDO 1ULUA 2JFGA 4YT5A 1NYTA 3VKUA 1WZEA 1V3TA 4BV9A 2C20A 1E6EA 1EBUA 3QP9A 1Y8RA 4PLVA 1I10A 3CKYA 4J3FA 4J6FA 4I1IA 4TQGA 2NVUB 1GDHA 4OO3A 1LRLA 1AE1A 4MVJF 1NHGA 5CDTA 1ONPA 3T4EA 4CM8B 5A5FA 1ADBA 3GPIA 3I3OA 4GQAA 2VTDA 4YPOA 3F4LA 2PV7A 3CSDA 1QYVA 4E3ZA 2QHXA 3M6IA 3AFMA 2Z5LA 1R0LA 4PZCA 4DREA 1XGKA 1BW9B 2WE7A 3CINA 2IE0A 4L73A 4C4OA 1TXGA 1M75A 1I36A 2O50A 2RH4A 5EL0A 3WSVA 5AXDA 1D4FA 1PJBA 5JPIA 1EFKA 4GBJA 3WOHA 2AQHA 1CF2O 2IRWA 3AUSA 3BHMA 4HWKA 4CMIA 2A4KA 1GQ2A 4PGFA 4JJGA 1DIRA 3VH4A 4IMRA 1QYCA 1ENZA 3STHA 4IDEA 4J4TA 3IJRA 1XKQA 3HSKA 4J7UA 2X9NA 4GSLA 2EF1A 4FIZA 5F1PA 2Y93A 3SLKA 1Y81A 1IOLA 1ISJA 4XR4A 3RFXA 1C1DA 1B7GO 2WMDA 3WFIA 3PVZA 2VZ0A 1E1LA 1DDOA 4G5HA 4WASA 2IZ1A 1R4NA 1LDMA 3M1AA 4LK3A 3E48A 3FCOA 3H2SA 1G6KA 4HKTA 3TN7A 4Y9DA 1NM5A 2BFPA 5HS4A 5BSEA 5KVCA 4CLOB 5BNTA 1YB5A 2DM6A 3R1IA 5FEUA 4BMSA 5C7OO 1I3NA 2GASA 3K31A 1LDYA 4CM5A 3TZCA 1NR7A 5AVOA 1P1RA 3DBLA 1Q7CA 2EEZA 3FF4A 4Y6RA 1FF9A 4N7RA 3ZWYA 3GOHA 1PR3A 4D44A 2DBZA 5C3MA 3AOEC 2OOSA 2VHVA 3CH6A 1I2CA 3S2GA 1BXGB 5T8KC 1XEAA 2X9GA 2IZZA 3COSA 4CMCA 4MO2A 4UVEA 1QXSA 5L4NA 2EERA 2HU2A 4JBGA 4E5NA 4QEDA 2NU7A 4D0SA 4DL9A 4UUMA 3QLJA 5G4KA 3H4VA 4MOWA 3JQBC 2POQX 4BNUA 3HB5X 3VDRA 3FR8A 3OEYA 4WUVA 4E33A 3NJ8A 1H2BA 2PZJA 1Z74A 1WDMA 3KZVA 4RPLA 4RPJA 5KVVA 1QR6A 3TDKA 1Q2XA 3FI9A 3NKLA 1H6BA 4GPD1 3X2FA 1ZK4A 4J43A 4EJ6A 3KYBA 1JTVA 1JWBB 1KY4A 1MC5A 3C24A 1C3VA 2HQ1A 3RC7A 2EJVA 5JMWA 3H5RA 5DDIP 1IL0A 4MVJA 3DQPA 2PWZA 1VE9A 1MG0A 1XU9A 2E4AA 4K26A 1V3UA 5DP2A 2DUWA 3AFNA 4BKQA 3WIEA 1OFGA 3GPDG 1BHSA 1QSGA 1U5AA 1R6DA 1VSVA 4Y6PA 1BXZA 4MIYA 1QV6A 1RYDA 1YVEI 5TSDA 3KEOA 1MFZA 4FPXA 1NQTA 1OMOA 3DTYA 3ONEA 3RUFA 4F6LA 1NHWA 4NIMA 4U6SA 3HDHA 5GZ6A 2EW8A 4R5MA 4E2ZA 4YR9A 3D4NA 1B2LA 5K9ZA 1ZK3A 1HLDA 2VWGA 3E1KA 3NGLA 4E2WA 3JTMA 4BVAA 3AY7A 4DIBA 4F45A 5JO9A 3ZV6A 2J5QA 3GK3A 1CETA 5I7VA 2X5JO 4W9NC 4BV8A 5CP8A 3GEDA 5JC8A 3EW7A 3V2HA 3FWZA 5T6BA 5JAMA 1T2AA 3BMOB 3PJGA 2QW8A 4PG6A 2FN7A 5HWSA 4DUPA 1GUFA 4HY3A 1FMCA 5KJCA 4E32A 3DO5A 4HV4A 5EN4A 5T57A 1T2FA 4F6CA 1GY8A 2P9CA 3H2ZA 2VHXA 4XDYA 2B36A 3JSAA 1T2EA 2WEKA 3OQ1A 4CLRA 2VQ3A 1CRWG 4N5NA 3H65A 5HRUA 3AOGA 5DCUA 2G82A 5CFZA 3U4IA 3ETEA 3BYZA 3JCZA 3LF2A 1JN0A 1KY5A 1EUDA 3C1AA 3M2TA 4CV3A 4EUHA 3KLPX 3G49A 1G0OA 3Q1LA 4RVUA 2D2IA 4BNHA 4E5YA 4RVFA 3LT2A 4MP3A 4WKGA 4RPHA 3WYCA 2I6TA 2B5VA 1UDAA 2E49A 4EZBA 3RUIA 1C1XB 3FTNA 3PQEA 3A1NA
chains in the Genus database with same CATH superfamily
3QEKA 3TRKA 1KO1A 1XO1A 3HBFA 1U7XA 3A1DA 4OI0A 3G2QA 4PYJA 1PJAA 4R2MA 5SY9A 1AGPA 5I4IA 1YH3A 2HJGA 2CWDA 3SF8A 4J75A 1U2QA 1PR0A 5DBHX 3QVTA 3TUJC 3BTVA 1GR1A 4PG8A 2VT7A 1TUGA 4FLFA 2QN6A 2V97A 4TSFA 4ARAA 1O8BA 2NTYC 2EFCB 2ABWA 3KYDB 4L9SA 4TWJA 5I9MA 3UPDA 1KYXA 3WQSB 1PP4A 1GT91 5REQB 3BN3A 5EZ6B 3UY4A 1BWQA 2E48A 3OU7A 2ZIVB 3QY0A 2BSQA 1P1JA 1ONOA 1E0KA 2HRQA 1UCFA 2HPHA 3ES9A 5KVAA 1Y9ZA 4FCWA 2GTHA 4GMFA 1RLJA 3WMGA 1GTSA 4YCCA 4C3UA 1Y82A 4MQEA 1C3EA 2G67A 4HAZA 5CVEA 3KEQA 5D2CA 1BVYF 1E6UA 4YC7A 2WWYA 1QFYA 2X13A 5K99A 3T7SA 3IVAA 4MVJP 3OZCA 2HLDA 4MW2A 4EK9A 5DBOA 1UBKS 5A02A 4RA6A 5AVRA 1Q0HA 3B3QA 2EQ5A 3DMTC 4OQYA 3GFPA 3L7OA 2BLNA 1SKMA 3WKAA 4BLOA 3BFJA 3IUBA 4PQGA 2V54A 1VMEA 1BOFA 4OJMX 3ZLTA 5F9MA 3IR5A 1VPTA 1PWHA 3A26A 3WGHA 2X8BA 1H9BA 1QGDA 1KK0A 4ZA2A 3RRMA 4PZYA 1Z6TA 4EI7A 3EPRA 4ZU1X 2AJ8A 1T8RA 4R1TA 1HNNA 3DKPA 5CLLA 1JEQA 2AG1A 3QSGA 4LY0A 1DIOB 3LPDA 2I91A 3OP4A 3ITDA 4RIHA 4AZSA 2QVXX 3F47A 4JVNA 4DMMA 5LU9A 5JQGF 1NBHA 4B75A 4HCJA 4FGLA 2J3MA 3CEPB 1MX1A 2BFEB 4NMHA 5GJWC 2OXIA 4B7AA 1XN4A 5F33A 1KJQA 2GVZC 1D9XA 3BMNB 3WHLA 1R5NA 1ISSA 2J3KA 2W0MA 3R9XB 2CW5A 1DXYA 2H2HA 1ZOLA 3R3SA 3ZCTA 1NIPA 1IDOA 4HNHA 4I1OA 3VZQA 3D3WB 2ILTA 3JYPA 1ZC3A 1QPGA 3C4JA 2BR4A 1ESEA 4PLFA 2Y67A 5ALXA 4HGYA 4EYEA 2UYGA 2FPWA 1S3FA 1H1LA 2Y9PB 3OX1A 4TXHA 4UASA 3VVCA 3G0GA 1FVHA 1C1HA 3GJ5A 1Y98A 2MMCA 3BK7A 2V6IA 4UNPA 1E61A 3CLTC 3LM8A 4X97A 1O96A 3JR3A 4D9GA 4XZ3A 3E8SA 1W88A 2EU8A 4NBUA 4OI4A 4PPFA 3AG5A 4QICA 1QZTA 5FTLA 3LXMA 3O8QB 4C7OB 1O4WA 4TS9A 3QMMA 3DT9A 3WNVA 3WKCA 2C3PA 4D0LB 3KVVA 4EHJA 1PLKA 5AK6A 4GZLA 3QLEA 2YXBA 3DTTA 4FCVA 3H2HA 3GAMA 4J0QA 4Z0NA 3FROA 2QN3A 1FSZA 1KQOA 4Z5XA 1ZMTA 1SUIA 1EZ4A 4J0EA 1XZKA 1A69A 4OYRA 5KNCD 1QGYA 4UVGA 1O08A 4DXDA 5LPNA 2DLCX 1FVOA 1GITA 3MZ0A 4NTZA 4OLAA 2WPNA 3M1LA 1H5UA 2Q46A 1A50B 1JPNA 2Y1GA 1HYGA 3K1YA 2ZR7A 4Z6KA 1TYCA 4XVCA 3HV0A 4LX8A 4P9NA 3ZBQA 4AFNA 1RQGA 3NTOA 5T41A 3L05A 1M7GA 1K3TA 2HTFA 4U2KA 5DRYA 3ROFA 3LQQA 4EFKA 1RRKA 2OHVA 1GGNA 1N6OA 1L5WA 2FSPA 3JQGA 3LIPA 3OJEA 4OQEA 2W2NA 4NMLA 4OL0A 1VI5A 4E46A 2WD7B 2EBHX 3C14C 4WL0A 3T41A 3GXOA 1N2EA 4CGZA 3TTVA 2PAFA 1MQ9A 1T0BA 1NQWA 2FPRA 4BP8A 4P81A 1EX1A 3BMQA 3I8XA 1U2TA 2ORWA 4YONB 1JAZA 1CU1A 4EHHA 2VJKA 3OMXA 1PR5A 1L5OA 1QVZA 2G40A 3EHEA 2IT1A 3KYCA 3A4VA 3MMSA 3Q4GA 4RZIA 5CU7A 1FC0A 3VZBA 4RM3A 1GTZA 5LUAA 1RLUA 1T34A 3ZYCA 1HX7A 2XA2A 2PRKA 2GPAA 5H3CA 5CH3A 3H75A 4YRZA 3A1FA 2X8LA 1NW7A 3NRJA 1P2BA 2COUA 4HMQA 4HQRA 3T1NA 4EG7A 2GD6A 8MHTA 4I36A 4R16A 4PLGA 5J2UF 2PY6A 2OP0A 3L82B 4PXYA 4P4SB 3U17A 2ZRQA 3HEBA 4J1NA 2YWBA 5ER6A 4UPEA 1T3GA 2HWYA 2TRSB 2HQOA 3ZZUA 5BMVB 2ECKA 5D3ZA 5BOSA 3HZOA 3J7TA 1HETA 2DH6A 3NAQA 2PR2A 4KWTA 5KX5B 2I2CA 4IR7A 2JFHA 3EGDB 2GN2A 4J91A 1U8UA 1M2OA 2QMUA 3PR1A 5J47A 5K4HA 1GTL1 1NMSA 2FPUA 5IT4A 1OLSA 4G3XA 1OYVA 4D9NA 1YJ5A 1JHXA 5AK4A 3P20A 1JFTA 4TQAA 4GC9A 5HE9A 4KBYA 1IC6A 1DIHA 1KAOA 1G291 5CAEA 2GH1A 3DZKA 5K3EA 1DAKA 3AM1A 3GT3A 4NE9A 3S81A 3PTLA 3NIBA 2PAAA 2X8JA 4Q9KA 4OJNA 3U5TA 4LF5B 2SKDA 3OZAA 3TMKA 2VDRB 3OMWA 1Q95A 3DLPX 4BX9A 3R3ZA 2KHZA 3DUFA 3IAM6 4MW7A 3SDZA 5CVUA 3KVYA 1PVDA 1XDSA 1XCBA 3EW9A 3ZWNA 4IX1A 3AHHA 2HIGA 1JSXA 1HOTA 3G9ZA 3PE4A 5FOSA 4D46A 2GZMA 3DT6A 4BLWA 1QG6A 2BEVB 3UK2A 4YPVA 1BN7A 5CYOA 2NUBA 4NICA 4QD3A 1K66A 3TWOA 5BWMA 4WFJA 2DF8A 2VUSA 3KB6A 4NU5A 3X43A 4QIHA 5BMOA 4CKWA 5JALA 1N6LA 2HM7A 4O4JB 1PK9A 5GPBA 1XAIA 2WMNB 3X1MA 3H1TA 2GZHA 3M3HA 2ZVPX 1GQSA 3VR5A 5GZ1A 3UMYA 4IJMA 3P52A 3PL1A 4BNWA 1RJEA 1VGQA 3OQIA 5AIBA 4DAOA 1ZJ6A 3JRNA 1VG9B 3IOMA 3EFOA 1MABB 2N1MA 2XMSA 1QFJA 3B13B 4FQ8A 4MYUA 1QTNA 2A9OA 2GJSA 3NHKA 1ZQ1A 4B6QA 1UAYA 4ZCMA 5JH7B 4PICA 4OSOA 2VAWA 4QXRA 3TZ6A 3ZZ1A 3ZCVA 4DLAA 3F78A 5BN4A 1QQAA 4L22A 4NEHB 4GECA 3L4BA 4KXNA 2NADA 1JLKA 2FPGA 4F4CA 3ICEA 4PX2A 1Q14A 4J7XA 1RWBA 3PE6A 1YE5A 2ZRAA 3GLGE 5IAGA 5IYZB 1CJBA 4HDRA 4KLNA 4AJIA 2NT3A 4IZHA 4CMEA 5IEJA 2UYOA 1GFWA 2ZVJA 5KKNB 4D3FA 1R6AA 2AR0A 2YVLA 4H0NA 1Q3TA 1XLWA 1L5SA 2J3IA 4CJXA 3BAFA 1JSCA 3E5RA 1QGED 3QWBA 3EY9A 2P40A 1H1LB 4Z4FA 3FIUA 2AQIA 4DW8A 1DPGA 2H4FA 3IAS6 1QO0A 2I67A 1L2TA 1J70A 5H02A 1MEJA 3HSYA 2IYFA 4P22A 2BUCA 2JFQA 1GUZA 3I37X 4QSMA 3QIVA 6YASA 1B74A 5THQA 5IM4A 3RTBA 1NPYA 1XHEA 1P8AA 4EO4A 3PWSA 4U8GA 4LXUA 5B1EA 2JAHA 2J0VA 4EFDA 4ZALA 3D7SA 4I4NA 1Z26A 2WWHA 2ZATA 1C3LA 3C8HA 4UM9B 4GL4A 5A4FS 4RIFA 2H1CA 1A71A 2FQWA 1J09A 1SN7A 1U3FA 4ZEXA 4DABA 2IGTA 1F14A 3RREA 3BPSA 4N0DA 2HJRA 4OQQA 3QTLA 4K0RA 1LC3A 3DYIA 2QG9A 4LJ9A 2LVBA 3SLGA 3WB2A 1OBOA 1LI4A 2OLKA 4Y2PA 1K8XB 2H2FA 3WLJA 4FFSA 3KOOA 4OP1A 2WQZA 3BZUA 5IBQA 3TL3A 1IPHA 3BMCB 1WB5A 3WI7A 2FEMA 4Q7MB 3M6UA 1PU2A 4RTNA 1PQWA 1L5MA 3MMNA 5KDLA 1NNUA 3NQ41 4Q47A 4QXMA 1SHKA 4GR5A 4NYIR 3MGKA 1AS3A 1OU4A 2A57A 4Q4AA 1CLUA 4JP3A 521PA 4MW1A 5AXBA 4B3JA 1K5GA 2VPXA 2ZCVA 3UAXA 3FTDA 5FR2A 3I9OA 1JDPA 4R3NA 3EDOA 3VJKA 1P3DA 4I8XA 2GZSA 2BM0A 2P62A 5FA6A 4W5OA 1M7HA 3U81A 2G88A 4RCYA 1PUJA 5LKAA 1NVMB 2JLSA 2YZGA 3G2LA 3KXLA 4LPSA 2XD9A 4NS4A 3KUDA 4QUJA 4UTPA 5A0TA 3V1MA 1KYWA 2G06A 3GNLA 4KO8A 4LE1A 1XPRA 3WDSA 4XTRA 3RYIA 4DWJA 5G0VA 2JGKA 1IG3A 3IEKA 3JWIA 4DSNA 5BSHA 1D0SA 1N2ZA 3L1UA 4ITUA 4A16A 3V8EA 3AETB 1P1KA 2DMRA 2V4MA 2H1VA 4I8DA 4KIUA 2LE0A 3GGSA 2AJBA 2ZJOA 4NZMA 2RK4A 4U8HA 4F46A 5BV7A 2VHUA 2XUZA 3K9LA 2ICAA 3NUZA 2ZUFA 1YB7A 2M6LA 4EPVA 2CDNA 1VTKA 2QTRA 2Q3DA 4BO8A 3FPAA 3SFVA 4MDEA 3ODGA 4LDRA 5IJZA 2O8CA 1UMBB 2H11A 1F1JA 1SC3A 2I4IA 2OXFA 3EVNA 4QL3A 1E7RA 4N5HX 1D9ZA 3BRWD 2ACEA 3S0JA 1U8CB 4Y9SA 1PGJA 4U0KA 1RM3A 5I7FA 2CKDA 5C80A 2DTXA 2JRLA 3AW9A 4IF4A 5AJWA 1IN6A 5EQJB 1M2VA 1SUSA 1X2BA 4XI9A 4XQ0A 1A9ZA 3G1UA 2W6QA 3NDRA 5L4SA 2V7UA 3DLHA 4YAOA 1F8GA 1RD4A 2P0AA 3FPCA 4R8RA 3EDQA 1J39A 1O8CA 3RQSA 2GF0A 4EA8A 2IP4A 3EC7A 2IHUA 2O2IA 5FI3A 3SIXA 2Z04A 4Y2XA 4B3MB 1YUNA 2Y1FA 1RFLA 4W8HA 2JFWA 3R6GA 1XAGA 1FP1D 3AH8A 3OF3A 3E9ZA 4GP9A 4BUJA 3UMGA 1XRQA 4KGZA 1NJ1A 2DUUA 4XB2A 3CZAA 3UENA 4WN9B 2DFNA 3T12A 3ZDCA 4DMGA 4PLCA 2C4WA 4RVDA 4BGIA 1AO3A 1Z82A 2LCIA 2VTEA 1GR0A 1XA3A 4QQRA 2OO5C 4DKXA 3WSWA 2ODPA 3NVDA 2B8JA 2ZTVA 1K2WA 2G04A 2NUTB 3U3ZA 1TM1E 2HHAA 2HOQA 1S5PA 1AXRA 1YL6A 2ZIAA 1OBVA 2PMDA 2I8CA 4XRRA 1ORRA 5A3QA 3KFLA 2QB5A 2QIPA 5L45A 2DT8A 3RQIA 4L8YA 4I4IA 1A9QA 2G70A 3SHWA 4HN2A 4YRMA 1XF1A 1IWBB 3AHJA 2MHCA 5FXMA 1CJMA 1JZSA 1YFZA 3EXHC 4IIEA 1UWKA 4N8SA 4KFSA 4YAWA 3WYAA 4K3UA 2Q0QA 3RS3A 5EERA 4D4MA 1AVTA 4LYGA 2INGX 1HQDA 4NESA 5HQ3A 1GCGA 4D9HA 2PEZA 2BW0A 1VCMA 2HJ9A 4JC4A 1RI2A 3C3DA 3AINA 4DVJA 3V1LA 2M6SA 4B3SB 1PLLA 4O2LA 1JEOA 4B31A 4IYRA 1VE7A 2GERA 4G1FA 1ZI8A 1XTIA 3F5SA 1D8TA 4EKDA 2QYOA 1ID1A 3IBCA 1TQHA 2GXQA 4ZODA 4O1MA 1RZVA 1CEQA 3UYLA 5A6VA 2JIZA 3QNMA 4N18A 5BP7A 1WDWB 2AC4A 4YBZA 1LBEA 1PAUA 4FNMA 4QVIA 4X1IA 1GNLA 1PTJA 1TI7A 1E3SA 1ZNWA 1KMMA 2AQKA 3IIJA 4ITVA 4CIAA 4B3GA 4R9UC 1J5EB 3I30X 4M98A 2CLSA 2ZIZA 1KQGA 3IEPA 1EVYA 2H2AA 3OQNA 4ZI3A 3D7RA 4U7WA 4XDHA 3VSDA 3RKUA 1FFAA 1XMXA 3EIUA 1H8HD 1QWSA 2HYDA 3GLSA 2HY7A 4IKOA 4MQFB 5KTKA 4TYPA 4F97A 4KUEA 1B93A 4R40A 1T9DA 5C1BA 4DLNA 1EVLA 4WJKB 1XEXB 1GNSA 3B7WA 3RTGA 3LPMA 3PEFA 4LDAA 4M37A 3IOYA 4W6ZA 2V4UA 3T7CA 5KZMB 4UE6A 2JGRA 1JF8A 2O8DA 1E4YA 2G80A 1ML4A 3BA1A 2Z08A 2OTCA 3WKBA 1C30A 2G0TA 1R9JA 2AB0A 2OBFA 3K9NA 4LWZA 4MV3A 3VHLB 2XCQA 4XIGS 4POAA 4YCAA 1YU6A 5D3QA 4OGKA 1RKXA 5FRDA 3AI1A 3TOXA 5BUSA 3GMSA 5HJEA 4R8LA 2B9VA 5JDCA 3GA0A 1R6BX 4JYMA 3H9CA 3PGJA 1VL5A 4I2VA 1NOJA 3L02A 1BHO1 5HGXA 1IOZA 1YFJA 3TQFA 2P1RA 4KPUA 4Y1GA 2ZU6A 4F8JA 1REQA 4Q19A 1EWTA 2J0UB 1RC0A 2ENWA 1LPSA 3D2LA 1FS6A 3F90A 5ED4A 1P72A 1KE2A 1FUIA 1P75A 3QWFA 1BEZA 1E94E 3B38A 1Y37A 1KTVA 1CUSA 1BWRA 3QYJA 3FM9A 4EIWA 4ZOQI 3E9EA 4IXTA 5B5SA 1EFUA 3VX4A 4WOCA 4ASUD 3F97A 3R5FA 1RWMA 5TY0A 3VPCA 4C5BA 3RKRA 3BL5A 3W2HA 1ZKMA 4FFBA 5DHAA 1OH8A 4RVSA 1W96A 2R1ZA 1OXTA 1FQKA 2QXUA 2VHYA 3ZY5A 1V4VA 3C7KA 4F5YA 1O6CA 2XCTB 1TCCA 4WRRA 1CY8A 4UD2A 3DDUA 1HT2E 2AG6A 3HVJA 3QE9Y 1IHPA 2N42A 1HOXA 4DIDA 1YA6A 5FUYA 2QVZX 1ABBA 3LFHA 2F9MA 2CFRA 2C5HA 3AERA 1L8QA 2J3EA 2YJTD 1P73A 3HS3A 1RQPA 1FLVA 2F3PA 2RSLA 3FSGA 4RY0A 5DXFA 3SC4A 5FUWA 3ZI0A 4DE5A 5ALUA 4ZRDA 3W7AA 4EY7A 3OCZA 3KOWA 1CP2A 3WYDA 2QGZA 2BJWA 4IJ5A 1UXIA 1OXBB 2W93A 2PCLA 4JQOA 2OBNA 1QC5B 4I3HA 3WR5A 2PWYA 2CSUA 2G8NA 1TKCA 3BIXA 2G4CA 2Q0SA 2V0NA 2WP8J 3O8NA 4ARBA 3ICPA 4CQJA 5A9SA 3KUXA 2EFDB 1S8NA 3QUSA 1FYWA 1CX9B 1ZUHA 3EBPA 4DYVA 4DS3A 1KVSA 4E0BA 1C8BA 4QPPA 3D5TA 3LAWA 2C59A 2ZUWA 1ODLA 1WLSA 4C6SA 2B2CA 4AKSA 1QFXA 3SOZA 3BXPA 4G67A 3LLUA 1O97D 2RB5A 4MCAA 1P2FA 2XW6A 4I5GA 2IBSA 2II6A 1BROA 3EF0A 3O47A 1KZHA 3I3SR 4D3XA 2VJDA 2X1HA 3PPVA 3QHQA 1JHAA 3F73A 1E7QA 1MO2A 2YOGA 1G3UA 3CF6R 3UCFA 1RI5A 4Q7QA 2QTFA 1ODTC 3BMOA 1SD5A 4CT4B 2IYTA 4MVJM 4PPNA 1KFJB 2I2WA 2ZCJA 2NM0A 2ZVQX 4FKMA 4P36A 1ENPA 1QNFA 1N3YA 4FFNA 5J23A 1OT5A 1H42A 3KVOA 1Z5WA 4FGZA 4GBED 4YCDA 1OWMA 1SD1A 1QHNA 4EUNA 3ANLA 2UXCB 1JZTA 3LKDA 4I55A 3VR4D 2XF2A 4MV5A 2GUWA 2NVUA 3EXEA 3U7GA 4AJOA 4TYYA 2D1SA 3LU1A 4RL6A 3ZHQA 2WRZA 3G68A 3W05A 3AF1A 4ACAA 4MR7B 3IPLA 5I45A 3I23A 4UTVA 1T8WA 4M3NA 3T3IA 1YDWA 2FUNB 3CVXA 1D2AA 5I6DA 1QUFA 2EQBA 5U4XA 1HQCA 1AGYA 2RH8A 1CK4A 2O1WA 4ME6A 5ALYA 3RYHA 3NOQA 1I2DA 1O77A 1MV5A 2AYYA 2HF7A 3R3UA 5EUCA 5JS7A 5GM2A 3RWOA 2PUVA 1Y7IA 3NT5A 4JC5A 1AH2A 1K3UB 2PKWA 4TM8A 2XNJA 4EW3A 4MUFA 4BDSA 1GFIA 1OX4B 2YX1A 2H92A 3DOIA 3GP5A 2C4VA 1JG3A 3V33A 2ZYWX 3V4PB 1QIIA 3WBJA 1R0ZA 1FDVA 4HB3A 1UDBA 2IU6A 5AVZA 4WLUA 5C52B 3D2BA 3DZGA 1XU7A 3LXRA 3LDHA 4L74A 4W99A 4KPFC 1C4WA 3V8VA 2VF4X 4B83A 4HEA1 3FUUA 3SYKA 5IF3A 2OLJA 4ABTA 3K09A 1E7WA 4WESB 2O52A 3OKPA 3WLNA 4X93A 4XFDA 2O2YA 1F1BA 4L51A 1EESA 3SJBA 2QUZA 3NAGA 2PBFA 4TTSA 4A0RA 3OM9A 5DCWA 1L9KA 3R7LA 2CN1A 4H7EA 3VYSB 2FRDA 2DTDA 4Y2YA 3K2EA 4HLUC 1U8EA 3BGWA 3TGPA 3DWGA 1ZBQA 3DV0B 5DHQA 1CE8A 4PHHA 2RHJA 1JLMA 4Z4IA 2GCPA 1D2NA 1NE2A 2IYOA 1L4HA 3DMGA 3GHHA 5IXYA 5JSQA 3DFMA 3JQ8A 2WWWA 4EKIA 1NW4A 3LQFA 1A82A 4V24A 1CJCA 4YCLA 2EHDA 2GZ2A 1XDDA 2VPPA 3G0BA 3NBXX 1NSYA 4GWKA 3CG4A 4KHZA 1EPUA 2PGOA 2QD4A 3U3RA 4C1BA 4JT8A 4XXHA 5E3JA 4M0KA 4ZXPA 4LJ7A 5JEEA 3IDOA 1X7WB 2WG2A 4TYWA 2W2KB 5JVDA 1JQ5A 5J4YA 5JZBA 1LY1A 3IHWA 3I12A 1X1DA 3R0ZA 3FNHA 1QZUA 3OCXA 1A96A 1ESZA 2FU5C 1WSDA 4IO1A 1KOGA 1U2SA 1I3KA 3OEWA 4TTJA 2QM8A 1F8FA 2PTHA 3L8GA 2P6OA 1D4ZA 1AIPA 4PW0A 4JB2A 4B80A 3WMRA 4QXPA 4HNUA 3N75A 1P4SA 2ZYAA 4MRVA 4NU8X 3AEUA 5D85A 1A9PA 2PZLA 1Y5NA 4U7TB 5CT9A 3WGQA 5BV0A 2Y1WA 1YRHA 1I4LD 4WXMA 5DTJA 2QYTA 2XWBF 4GC5A 2YHUA 2G28A 3K1AA 1Z37A 4JJ8A 4MKHA 2XLBA 1HE3A 3TNJA 4BFWA 3VVBA 3MWFA 2VPYA 3FCEA 3HNPA 2VCEA 2QXTA 4URWR 5EZSA 2JLUA 3R3JA 5H1YA 5KTSA 1EWQA 1BDBA 3LUKA 1H6AA 2RGXA 1GG8A 2PDAA 2QR2A 4R4JA 1ILWA 2CDAA 2ZI5A 3L4BC 2AOWA 4GP7A 1GKIA 4G8JA 3P71T 3OE7D 1SG6A 5BW4A 1DIBA 2FMKA 5AW6A 1RWPA 2BGWA 3IEXA 3B1VA 1P9NA 4KQEA 5FAXA 3Q3IA 1K6JA 4RESA 5B1HA 3BIOA 3O8LA 4ABYA 2J32A 3C6ZA 4QXQA 1KC1A 3AI2A 4PLWA 1HH4A 2PX2A 3AERB 4M88A 4X3PA 5EMMA 3B1ZA 4QFDA 3RFTA 3AUUA 4ES6A 2HW8A 5LQDA 4A23A 1FRZA 4M0UA 5EAIA 1Z8NA 4KPGA 3GT0A 2VOJA 4WLEA 3S2EA 4CQMA 4DBLE 4GZ3A 1S2DA 3RG2A 3GJZA 1KMQA 1NVGA 5F1KA 1E58A 1ECCA 2EWVA 3KYJB 3INYA 4DF3A 5C8YF 2RONA 4RXUA 5ALGA 1JFFA 1D03A 5I9TA 4EHDA 5LP6F 1ZHFA 3DULA 4JSTA 4BNIA 1MG5A 3ESBA 2H0RA 4GPAA 3N05A 4QDUA 3T9CA 1QF9A 1R5JA 4EM6A 4X3OA 2CVHA 1O94D 4BECA 3EQ7A 3I09A 1NYQA 2HFKA 4M1KA 5IFLA 3G85A 4MGHA 1JA0A 1RVDA 3JQ6A 4LISA 4QREA 4ECEA 4B3HA 3IV6A 1DFGA 3HDYA 1Z2NX 4CUJA 2Q3BA 5FPPA 1TQ8A 1MO5A 4R1QA 2E87A 3HXLA 4FYMA 3O91A 4BFUA 4B76A 2CJYA 5F98A 1ELOA 1ATZA 4IIYA 1E3WA 3LKZA 5EG5A 3T7EA 4LGMA 4NS1A 1UMCB 3U62A 2REBA 2A78A 1EP2B 3OLCX 2WU3A 3JQAA 3ET4A 1C81A 2H16A 2X1MA 5ULLA 1N8KA 1CB0A 2AKEA 3E3AA 3IUJA 3R20A 1GPUA 3ZDXB 1Y9EA 1YS1X 1DRJA 3V48A 1A5ZA 1SXPA 2HSGA 1ML3A 3DYVA 1HA3A 4TRNA 2J59A 3TBHA 1SBQA 4G0QA 1Z0ZA 3AIMA 2W4QA 4E07A 5ICSA 1EGMB 2ID7A 2Q9AA 2X5NA 3BOSA 3GXBA 3R40A 1Q1GA 3UFXA 3W3AH 1M8FA 1IXRC 1E62A 1SCQA 2WJVA 3K0AA 4JFRA 1OZHA 2X7JA 3LG2A 5DLPA 4COKA 2O06A 3B51X 2PT6A 1FP2A 1TIBA 2X0IA 3BBLA 2QLJA 4QXAA 4URFA 1P6UA 3E53A 3VR3D 2ZSKA 4PEVA 3FBTA 1FU4A 2F8SA 1KO4A 1USWA 4M46A 1HK7A 4M9ZA 4Z8YA 1ULSA 3GMDA 3I2HA 3MGGA 5K8LA 2I1WA 3TTXA 2OMEA 3WA6A 5YASA 4JBHA 3TNLA 5CT5A 4BVGA 4FCCA 4BO3A 3QFFA 4C6TA 4TKVA 1KK2A 5GV7A 3KQWA 4QUGA 2OEPA 1KEUA 2K5UA 4J0IA 3K05A 4YJ3F 1UPAA 3RTEA 5JUWA 1IBSA 2AGVA 3JS5A 1YR1A 2QPAA 3LQ1A 3F1KA 4PLHA 2R5FA 2ZWVA 1NJ8A 1I9CA 4WFIA 4QLAA 1D6JA 4WX2B 2J3JA 4OGGA 3IRUA 5TR9A 3RLIA 5BQFA 3INGA 5HP4A 1M73E 3M4NA 1P18A 3UJPA 3LUBA 1IY9A 1QYDA 1L4YA 2N46A 4KMMA 3AVPA 3BMQB 1ISGA 1QX3A 4TKMA 4ZO4A 5IUKC 3L9XA 1R66A 1FS5A 2OORA 4EHNA 2VXBA 3K5PA 5KWIA 4X62B 3PJRA 3LC7O 5AKKA 3KKKA 1OROA 1YBFA 3K2QA 4FIDA 1L7RA 1HMYA 3GEGA 4D5EA 3FMIA 3GPBA 4M9CA 4D99A 1OAAA 3CUTA 3IVCA 2YNMC 4P4UA 1T9CA 1WXEA 3EQ2A 4FYVA 2BP7B 1RRFA 3DNFA 4KWIA 3FXAA 4I1UA 2MJLA 3I6YA 4LDZA 5KC9A 1CIJA 2WIKA 3U9SA 2JH3A 2IF0A 1OFUX 3G1WA 3IKLA 3MILA 3USES 1HPLA 3C7AA 4QDKA 4WCFA 1T8PA 3NBQA 2YHBA 3PKJA 5CT8A 1M8PA 1NFRA 2I3AA 4M99A 2YWDA 2EATA 1U8ZA 4LBZA 5HDBB 4QG7A 3RVDA 4DSOA 3O5AA 1GILA 4JBYA 4RTMA 3T3GA 4E1BA 5KYYB 1L1RA 1T4GA 5DW3A 3GUYA 4C7MA 3I76A 2QUHA 2XUFA 5EUQB 3AF6A 3HJGA 1HDCA 1VJGA 2Y77A 4F8YA 3K9HA 5EP2A 1EGVB 2ZGVA 3NORA 2OCDA 5J58A 1P5RA 2JJQA 2E82A 3NV9A 3CH4B 3SC3A 2X1LA 3FD8A 1PGPA 4IJVA 10MHA 1PT7A 1FDOA 4I4CA 1NZJA 3I5XA 2V96A 3GJ7A 1N2BA 4RORA 5SV2A 1GGMA 5KYNA 3NBYC 1SA0B 5C4IA 1E2KA 1GAWA 5I3CA 1NW6A 1RWNA 3QVMA 4LXXA 4QTTB 4UEQA 3PHJA 1ZL0A 1IVYA 4UOEA 1RYBA 5AW2A 4O8CA 5G4KB 3T5DA 3TLMA 3NVMB 5CXXA 5IYZA 1UIMA 4NCHA 4R54A 3MG9A 1L8LA 1JG1A 3IQIX 4FR2A 5GAJA 4KO2S 3FGPA 5L6LB 2AOVA 2YVAA 4EKGA 2GXAA 4I9NA 4MUXA 4DR6B 4IGKA 1RQRA 2VRBA 2KLHA 4KFCA 1TO2E 4QQNA 1Y4AE 1UPCA 3LQRA 3UV6A 3LY5A 1AKQA 1PEAA 3IULA 4IVPA 2ZSIA 1AKEA 4MGKR 3SZGA 1SFRA 3EUWA 1EXNA 4CM7A 2W6JA 2CE7A 2KMLA 5K8CA 1KXZA 2GD2A 3H11B 4ZJUA 1TADA 1YZQA 4TXLA 2Z6QA 1ZVMA 3I92A 3JALB 3PUWA 4BHTA 4WBSA 1DKPA 4UBJA 4BQNA 1DUSA 1YTLA 3UJ7A 1ISPA 5AT1A 1RYHA 3SDSA 3OZVA 4JOQA 4PZDA 3LCJA 1A5AB 1NQVA 4E6PA 5H81A 1WXGA 3H2GA 1UXGA 3U13A 1SQ0A 1P4GA 4BNNA 1IHXA 2ON6A 3RVKA 5JYDA 5MHTA 1P74A 3DXFA 4D45A 2OGWA 3KUCA 4U3JA 4E2XA 2Q4DA 4DIMA 1FFSA 1JT9A 1YZYA 2CDRA 5ICMA 5DX0A 2H85A 1DAFA 1W46A 4LFBB 3ZD6A 4AU1A 1FUEA 2O0HA 4GXRA 1QRRA 1ISFA 2AXQA 3IQZA 2O3SA 1KP3A 2NO1A 3N6XA 3QE3A 4HLUA 4YP5A 3M7IA 4IIJB 1T6YA 3M9LA 2ERCA 1J8QA 2XUGA 3B52X 3ZS9A 4DQXA 2P2GA 3SVTA 3LBFA 2ERYA 3SYLA 4GWGA 3USZA 3VKVA 4F7DA 5D1NA 5KMGB 5P21A 3U4HA 1DL5A 2B1QA 3R44A 1XMPA 2YWEA 1W8DA 2GN8A 1ULAA 3TLKA 1CQJA 3OPVA 3AXSA 4ZREA 1XCOA 3CSSA 1U80A 3OZFA 4AVYA 5IT5A 2UUCB 4EUFA 2DTEA 5K51A 5H9VA 1YK1A 2W2TA 4HDSB 5DCYA 3SR4A 3SWWA 2IEDA 1D3AA 1FQJA 2VG8A 2R00A 3DTNA 3IDSA 4QJ3A 1KJNA 3SHQA 5EJIA 4DYDA 2I7CA 5IK2A 2V5VA 2QX9A 4CKBA 4HB0A 2GLXA 2D4HA 3EAQA 3HABA 4UBKA 1X1CA 2RGEA 5G4LA 3SHFA 4B8YA 2PLRA 3HCRA 2HX1A 2IEAA 2V9CA 4Q5IA 4RX1A 3QKUA 3RYIB 1PQ4A 4ZT6A 4E5PA 4CL2A 2XB9A 5K0GA 2HV9A 2VHCA 3ER8A 2FPKA 3K1JA 5AKLA 1JJFA 1LQUA 2XE8A 2VBCA 3QV1A 1LF5A 3V2GA 2WVGA 5LQMA 5KKCA 2J30A 4XM0A 2OB1A 5JXWA 1TT5B 1NW5A 2PZKA 2WKRA 3FHLA 3NB0A 4UVIA 1RQNA 4MR9A 2R48A 4O5AA 1GWNA 1FFDA 4EABA 4G26A 1M72A 1GQOA 4ANFA 3WMWA 3O4HA 2ZJBA 3ND6A 1EAMA 2CHUA 5A7FA 4GOKA 3CR7A 4FYYA 4B6GA 2B2XA 6ADHA 1U5CA 1I51A 1PR1A 3ABSB 4PNPA 3PFFA 4RKWA 2QNRA 2WPDD 4KLCA 2WJWA 3WJ1A 3WMXA 3D6AA 4OGFA 1GLGA 3AY0A 1F8XA 2J31A 1ZU4A 1C8VB 3E0XA 4JQZA 3NWJA 3TDNA 4D02A 1C1XA 2ZQ5A 1OB5A 4H7PA 4QARA 2UU9B 5I48A 3NHMA 2CNWA 1KBOA 2XXJA 3TLEA 4AO8A 4X54A 5I4BA 3D8RA 1THTA 1OLSB 5E95A 2GPTA 5C0OE 4CCYA 3U6BA 5K2OA 3GLGA 1JSLA 3VFDA 4YI3A 2P9BA 3II6X 4AJ4A 4EFMA 4N40A 2AX4A 5DGIA 1QIGA 1O03A 3DJYA 3F46A 4ADSG 3L7MA 1HZZA 1IOWA 1DDIA 5FOWA 5TPWA 2XWSA 3NRBA 4J2OA 5IABA 1XDBA 2Y0EA 3DF7A 1WUJS 3H7AA 3MTQA 2P78A 4WZZA 5D5PA 2OL4A 4LWPA 4CCSA 1UBEA 4GX2A 3CSUA 2OMKA 3AHEA 3GUZA 1XTQA 3I45A 3LKBA 1NR1A 3EOAI 3R3WA 3NM5A 2XOKD 4JBIA 3RSHA 5MFPA 3PHIA 3QELA 1E79A 1RWOA 4L6CA 4ZQIA 4B6RA 2ZT7A 1Z6QA 3DMFA 4URZR 4RK6A 5T4EA 2Q5LA 1SHTX 4QU5A 3ZHZA 4MWZA 1R0SA 3B3GA 4KFTA 3OJWA 1P9RA 1QV9A 3UGQA 2IBMA 5FWNA 1GNVA 5CYPA 1FFGA 3LBNA 4LCJA 4NOKA 3RIMA 2N3ZA 2Y68A 4R9RA 1FXWA 4RZUA 2C4MA 2JC3A 3I5UA 3KQQA 5EWJB 3V6MA 4BOYA 4PF1A 2Q3CA 1XJWA 3AKCA 3IBFA 1PX0A 3I05A 3GV0A 4HDNB 1COWD 2G9UA 4OAQA 4OREX 3RUCA 3FTEA 1QE5A 4WOJA 4G8DA 1RXUA 3D3NA 3C1TA 4EEZA 3AM4A 2RJNA 1YNOA 1QPZA 4Y9TA 4PONA 4GRDA 4ML3A 3I72A 3NZEA 3CFYA 3AHCA 5CIWA 4IXWA 3L8ZA 4YQZA 3PE3A 1LB1B 4ALMA 2X0EA 3A31A 3GWZA 3VZRA 1FNDA 5MGNA 1ZD9A 2WT4A 3A6EA 3QWHA 2RGGA 5BVGA 1K97A 3IQXA 4MWBA 2RAVA 2H07A 3Q10A 5KJFA 3VKHA 1N1DA 3JVIA 4IPTA 4XQEA 2FP4A 4UCQA 4CBVA 1EXDA 3LGXA 1K2VN 3E5MA 1SC1A 1UPBA 3S8EA 1DC6A 5FBQB 1XMSA 3ONWA 3PUKA 1QP8A 1SXJA 3C16C 4D43A 2XCOA 1EDZA 2D7JA 3BSSA 2VK8A 2ODWA 1ZCJA 2XQFA 3GRKA 3QPWA 1XTUA 3HA2A 5NLLA 5GONB 8ADHA 2P4QA 1RM5A 2PKEA 3CRNA 3JY6A 4R8MA 4RHXA 5LB4A 3FNIA 1QGOA 4G1VA 1SZDA 2JAXA 1P4AA 2JI7A 4NNPA 4G4SO 1O96B 2GEBA 1OOEA 1XQWA 2P5TB 3M4ZA 4BWFB 4F4JA 1KYIA 2C5BA 5EFZA 5BT9A 5DGDA 3LL4A 3H3FA 2WTEA 1G8MA 2I7VA 5JD6A 1T91A 1L4NA 2DR0A 1WSBA 1PJQA 4RSGA 5JVDB 4EL0A 3W77A 4KPYA 1N1MA 4LYHA 4DLPA 1Z4NA 4GPBA 5MN5A 1QTRA 4XOIA 2VBGA 3SX2A 2FEWB 2FH5B 4XTCS 4YUYA 1O5OA 3GGGA 2ASEA 3W78A 4W9MC 1G16A 2C97A 1GGFA 1YSCA 3MNFA 4D4KA 3HUUA 3TQOA 1ZGCA 1LK7A 3KYDA 4IMPA 3BILA 3IEIA 2F9LA 3WLHA 1MB0A 1BNCA 4RE6A 4ZEWA 1A4UA 5JZMA 1YQWA 2ZAYA 1MOQA 1UMDB 3I2JA 2P9TA 1BGWA 5B2ZA 3SQWA 3WA7A 4G23A 2GO7A 2ZWPA 3FYCA 2YINC 3NETA 4MQEB 1EWVA 2E18A 3D7KA 3DS8A 3A25A 4J3NA 1XMVA 1S9HA 4DVGA 3U9LA 3SNHA 3R0XA 4U7PB 4AJHA 4B46A 2VAMA 2CNOA 1N1GA 3KSZO 4WN3A 2NUPA 5JE8A 4EHIA 5EJ4A 3GIDA 1YACA 3FOEC 1B8OA 3G2NA 1MAAA 2C03A 3L6EA 3GHYA 1QH9A 3LUAA 3MXTA 1ZINA 2HK9A 2X9QA 4TMZA 2QZJA 3SZ3A 1MZPA 1TO1E 1JDVA 3UMRA 1NI4B 5D3MB 4B2PA 4DLZA 2PUHA 1HDRA 3WGUA 1HM5A 3H13A 1EB8A 1WDTA 2EZ4A 1Q74A 4ND8B 5EHQA 5I9NA 2X8AA 3H86A 4X71A 1Q1ZA 4UTNA 4MR9B 1BE8A 1BXGA 5DNAA 4P7FA 2NPOA 4DLSA 3IT1A 1SCAA 3V8BA 3BRWA 4L5IA 1EWYA 5ESWA 1A9XA 3ET5A 1GVNB 1UM8A 3WADA 2C0PA 3CRZA 1HDYA 3DQQA 4HEHA 4PSVA 5C1OA 4RQBA 4FDAA 4RHYA 4V3CA 4C43A 4NXNB 2KB0A 2HSZA 4ZTBA 1TLFA 4U00A 3P9QA 1RC8A 2IX3A 1QRSA 2I78A 4GP6A 1W4BA 2PRZA 3HYRA 3IMFA 3L41A 4JDUA 5ALZA 1QP4A 1EFTA 1OXVA 3L79A 2RARA 1PS0A 1EUZA 1U90A 5KUTA 1ULBA 1YFKA 3QBJA 2FCAA 3DDCA 5JY1A 3VU0A 1W5TA 5FL7A 3GJ0A 3HH8A 5HQJA 5IPFA 2QNBA 2AVNA 4JLSA 5JSYA 1FU8A 3EAGA 5J5AA 3P9YA 1T36A 3H04A 3D4PA 3ZCRA 3C1UA 3NGXA 3RODA 1O97C 1ONNA 3CE6A 1KSFX 1P91A 1FW6A 3BM5A 3UV3A 2E4VA 3PPYA 4JB3A 5KNBA 1FDSA 3L7JA 4F2PA 4O2AF 3SSNA 1I14A 1MVNA 2CB9A 1B26A 3CBGA 4QVGA 2C54A 4BVHA 5HOQA 4MVYA 4BP9A 4RJTA 4D9KA 1V8PA 3IE1A 1JDBC 1QLJA 3QVGB 4QBHA 2PUJA 1VE6A 3MIIA 2D2XA 4OJTA 3Q7TA 3SBEA 1KRWA 2CDBA 3AJAA 1B8VA 1E2HA 1Z5UA 2HXYA 3GCGA 3KD2A 3Q41A 5TX7A 1B6GA 3T3MB 5H59A 4BNDB 5LU8A 4AL4A 3BBPA 4RK5A 3TYXA 3K1ZA 4IVNA 4L07A 2J5RA 2B20A 4NEGA 4OHFA 4PANA 5AOBA 4B09A 4C3OB 2VC2B 2BHTA 3ABIA 3JQQA 1A1SA 1L7EA 4R1UA 1GN9A 1JHOA 3OLXA 4WCVA 1JKMA 5ECGC 3EEBA 1KQNA 2P9HA 3CZQA 5JVDF 4HDMA 4HPXB 1NXTA 1OXXK 3UATA 3LUPA 4JJ7A 4JEHA 4MPDA