1ZO8A

X-ray structure of the haloalcohol dehalogenase hhec of agrobacterium radiobacter ad1 in complex with (s)-para-nitrostyrene oxide, with a water molecule in the halide-binding site
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
252
structure length
252
Chain Sequence
STAIVTNVKHFGGMGSALRLSEAGHTVACHDESFKQKDELEAFAETYPQLKPMSEQEPAELIEAVTSAYGQVDVLVSNDIFAPEFQPIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKRKSGHIIFITSATPFGPWKELSTYTSARAGACTLANALSKELGEYNIPVFAIGPNYLHSEDSPYFYPTEPWKTNPEHVAHVKKVTALQRLGTQKELGELVAFLASGSCDYLTGQVFWLAGGFPMIERWPGMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords halohydrin dehalogenase
publication title Structural Basis for the Enantioselectivity of an Epoxide Ring Opening Reaction Catalyzed by Halo Alcohol Dehalogenase HheC.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
total genus 91
structure length 252
sequence length 252
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 4.5.-.-:
pdb deposition date 2005-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1zo8A00
1F14A 4NJMA 4RDHA 5G4KB 3C1AA 3WLFA 3GG2A 3R3JA 1BDBA 4J4HA 5CEJA 3JD1A 3ZV6A 1B7GO 3PGJA 4WCFB 2I66A 3MTGA 2NU9A 5C5IA 3GDGA 3N7UA 1WWKA 4HP8A 4B7UA 1ZMOA 2C5EA 3GDFA 3U3XA 4XDZA 4KTTE 3Q1LA 4FGSA 1T2EA 2AQHA 2R6JA 4XA8A 2OO5A 4C4OA 3ASVA 4B3IA 1SPXA 4JCOA 1HSZA 1K6XA 1GAEO 3UF0A 2BGKA 4JJFA 4J90A 5DBGA 3CMCO 4WOKA 2ZB3A 3FD8A 2QRJA 5EIOA 2VRBA 2ZYGA 3QWIA 4J0EA 3HHPA 3DBVO 1CQIA 3UCEA 2J3KA 4MVJH 3VKUA 3VPXA 2X6TA 2YDYA 3P5SA 1H0KA 1N1EA 2W2KB 3K2EA 4RORA 1H9BA 5ICSA 3VVCA 1P0CA 2W2LD 1NASA 3MJ4A 4MVJF 4WCFC 1E5QA 1MA0A 5CG1A 3EVNA 3S2FA 1J49A 1JW9B 1ENOA 2GLXA 4RPHA 4BNWA 4O63O 1KVRA 3LLSA 4GX2A 1XU7A 5CHEA 4GX1A 4BNGA 4XQEA 5A02A 4CPDA 2ZJ1A 1CIVA 1ZSYA 3H9EO 3Q11A 1MFZA 3M1AA 1DC4A 4ZQBA 5MDHA 2JAPA 3QVWA 4BKQA 2YV1A 4WLEA 2IRWA 4A73A 4FCCA 4XJTA 2FHSA 3K5PA 4CMHA 3STHA 1M75A 4YT8A 4PVDA 1EUDA 1A7KA 2YJZA 1HEUA 4YCAA 3LT2A 5C7LO 2JCXA 2Q50A 4ALMA 2FY8A 4DLLA 5G0TA 3D4OA 4QSMA 1SEVA 4RQTA 1R0LA 3E82A 1QLHA 4U6QA 1CQJA 1OC4A 2Z1MA 5A1TA 1DO8A 5U4QA 2C54A 1M67A 1NWCA 4XQ9A 2BFPA 4R1SA 4G5HA 2YDXA 3K9QO 5JW6A 4L76A 4U5QA 3K73O 4YB8A 1AHIA 5A03A 4IQGA 1HL3A 4J4BA 4OOEA 4K9DA 1EK5A 3UFXA 2CSUA 4AJLA 3OECA 5T57A 1LDMA 5MGBA 1P77A 1MUUA 5K6AC 1VJ1A 1XDWA 2OGUA 2Q49A 1TVEA 5JPIA 1ZFNA 3MJEA 4FFMA 4WJZA 3T7EA 3JQGB 3DFUA 2EJVA 3WR5A 2XOXA 3OJOA 4WECA 3V2HA 3VZPA 4TWRA 1PZGA 4MKXA 2VZ0A 4ALLA 4DTIA 4I9UA 3UHAA 1H5QA 2DUWA 2D1YA 3DFZA 4O1MA 3RBXA 1A4UA 3H5AA 4LGVA 1R66A 5DP2A 1GPDG 4O59O 2NACA 2ZCUA 2VOEA 5JNLA 2B37A 3JYQA 3ANMA 4MVJD 4C7KA 3PQDA 4CLRB 5TS3A 2JD1A 3IKTA 1CJCA 4U0KA 2DU8A 3ZNNA 4LW8A 4MKRA 2HSDA 4ND2A 2NU8A 2JAHA 1EQUA 4ALKA 3S2IA 3DB2A 3DZGA 2B4TO 1NQAO 2VUSA 3F1KA 3U4HA 3DTYA 1MX3A 4Q3DA 3DQPA 3BZUA 3E9QA 4CM3A 5BNIA 1Y9AA 3HUDA 3OFSA 2WYVA 2JFFA 3QVSA 4YJHB 2GN9A 3IQDB 1F0YA 2J8ZA 3OJEA 1JTVA 1U3VA 1NFFA 3LC1O 4Z3DA 2C20A 3KHUA 1NQ5A 2VZ9A 1ADBA 2JHGA 3ZI0A 3QRWA 4K26A 5K9ZA 1JN0A 1O0SA 1IULA 1CWUA 1CEQA 1YJQA 2DTXA 5C7IO 1FDWA 3LF1A 4OXKA 2VWPA 4CM4B 3NV9A 3SLGA 1EDZA 1WDMA 4OXNA 2BFAA 4CMIB 2X9NA 1A7AA 1LRJA 3ENKA 3LT4A 2P68A 4MJLA 3ZWVA 3FTNA 4JIGA 1I3MA 3BYZA 4FSHA 2ZTMA 3GVHA 1LDYA 3E18A 1N1GA 2FMUA 2B4RO 3ZWMA 2E6UX 4IJVA 1DRWA 3H9GA 5I9MA 4HFJA 1Q7CA 3ONDA 3P7MA 4LMPA 4DPMA 1SOWA 3RUCA 5FEUA 4MO2A 2GASA 5L7YA 1KVQA 2PFGA 3W8EA 3UCFA 1UR5A 1T4BA 3C1TA 1Y5MA 4B4UA 3TPCA 3GH3A 1J0XO 3JYPA 4YAGA 5DDIP 3ULKA 2UAGA 3V8BA 3IJPA 1DC5A 4R51A 2ZQZA 3S8MA 2SCUA 3BTOA 2UUPA 3WGHA 3GNTA 4IM7A 4ND3A 1KBZA 3H8VA 2VZ8A 4OGWA 1N7HA 1O95A 1N7GA 3JYLA 3GGGA 4P4NA 2P5YA 1YQXA 3PDUA 1TT5A 5I8ZA 5KJFA 4R1TA 3I9MA 2Y1DA 3WBFA 3HFSA 2BI8A 2EW2A 2P4QA 1NR7A 4IDCA 1C0KA 4Y6RA 3CINA 1A4IA 1ID1A 2O7QA 4WUVA 1U4OA 1YONA 1R4NB 4YAJA 4MIEA 4MKZA 1NVGA 1OOEA 1QORA 3T7CA 1T4DA 2HJSA 3OICA 4IDAA 4YVFA 4CMAA 3LU1A 1UXIA 2AA3A 3O9ZA 2RAFA 1LLDA 3IP3A 3AY7A 4BNVA 1GUZA 2IYOA 4NK4A 4EDFA 4E31A 7MDHA 2ZATA 2O2SA 4IIUA 1LRKA 1UZNA 1OFGA 1MG0A 5JCJD 3BIOA 3F6YA 3QV1A 4BL5A 2RHRA 4XZ3A 4BV9A 2UDPA 4H7PA 2OBNA 4NDNE 4Q3EA 4DIOA 4EGFA 1B26A 3GG9A 2H63A 1NHGA 5F5LA 3D0OA 2BRUA 2VTEA 1XSEA 4FBGA 3E9MA 2J3JA 1R4MA 2WEKA 1BHSA 3WYEA 1JDJA 4IUYA 4CM6A 1ZW1A 1PS9A 1QG6A 4PG4A 1Y5RA 3WXBA 2B5WA 1VJTA 4BNYA 5KJ1A 4PLFA 1HYEA 3VDQA 5G0SA 4D43A 1MXFA 3PQFA 1MLDA 3SEFA 1LI4A 1A71A 3ANNA 5JY1A 3EY4A 1YBAA 3G0OA 3W4JA 3V2GA 2Q2QA 3LDHA 2P9GA 3D7LA 5I7SA 1OMOA 1E3SA 4MINA 4O5OA 4I5FA 1SBYA 2YQ4A 1G1AA 4NR0A 4JBIA 4KQWA 3RI3A 3DBRB 4GLOA 1YL6A 3GK3A 1WDKA 4R16A 3KV3O 3QWBA 4TRJA 1A27A 2DT5A 4PN3A 4YPOA 1K6JA 1A9YA 4GH5A 1UP7A 3ZGYA 1FXSA 4EUFA 2C82A 2J5KA 1QKIA 1XLTA 3NYWA 2ZYDA 4FDAA 5ENDA 1GPJA 2W98A 4E4YA 1MC5A 2EGHA 4I08A 1N9GA 3GPDG 1XYGA 1E6UA 5IAAA 1WMAA 2DPHA 3D1LA 1HDOA 3BMNA 4CODB 2J3IA 4DC0A 3A14A 1V6AA 2PZLA 2CDCA 4L4SA 1LC3A 1NP3A 4I5GA 2D4AA 1SEPA 2CD9A 1JA9A 3WJ7A 1YXMA 2WDZA 3B70A 4XIJA 2X0RA 3VHRA 2D2IA 2Q1TA 4FC6A 4ZRNA 3TOZA 2Q1SA 1EFKA 4CV0A 1O8CA 1I10A 1YKFA 1U8XX 1GQYA 1PJQA 1PGPA 4TSKA 4RPLA 4LVCA 3M2PA 1A5ZA 3FSRA 3ZV3A 4UREA 4ALIA 3CZRA 4PCVA 5CAEA 1V3UA 1GZ4A 2YHIB 4N18A 2VUUA 5F21A 1UDBA 3RKUA 1PSDA 2Y0EA 3OH8A 2X58A 4L4RA 1P44A 4YAKA 4KUHA 3UGKA 4XYMA 4Z6KA 2PZMA 1PS8A 1KVTA 2OOSA 3VTFA 3ZDFA 5JLAA 2F1KA 5ES3A 3ON5A 4IJKA 4NFHA 2BF7A 3K92A 1JKFA 2HRZA 4ZQEA 3ZHZA 1VM6A 4R4JA 2XPCA 1UAGA 1DIHA 3I6IA 4WGGA 3PYMA 3OM9A 4CMBA 3QW2A 1Y8QB 1K5HA 8ADHA 3WJAA 1YOVA 1C0PA 3L9XA 1LUAA 1XA0A 3I9OA 3AI2A 4I8XA 3PHIA 1DIAA 4HFRA 3OIFA 9LDTA 1O6ZA 3GQVA 3VAZA 1ZXLA 1E92A 2NQ8A 3HDQA 2NLOA 4AJPA 1C1XA 4HX5A 5ER6A 1FF9A 5LDGA 4DGSA 1DIGA 2X4GA 3I9LA 1RM0A 3O38A 3RU9A 4BO7A 2R00C 1UZMA 3JD4A 1QV6A 3P2YA 1E7SA 1HE4A 1P1JA 3EZLA 4BNKA 1U1IA 3BHIA 4YAEA 3KYBA 4WKGA 2Z1NA 1WDLA 5B1YA 5CFZA 2PGDA 1QLJA 1HDCA 2OBYA 1B2LA 4HFNA 3ST7A 2EP7A 3A28A 1MXHA 1KC3A 1Y8RA 3RJ9A 3NTOA 4MDHA 2YV3A 3WYCA 1XHLA 3LYLA 5DCYA 2I3GA 3OP4A 5KVVA 1E1KA 4ILKA 4OH1A 1RM4A 4YA6A 5AXAA 4NPCA 2GN4A 4BO2A 2NVUA 2BGLA 2P4HX 4A5OA 4D0RA 4BGVA 5A9SB 5EMHA 2Y1OA 3QWHA 3EMKA 4NBVA 3ZHYA 2ZIZA 4CMGA 1NTOA 3QQPA 4YBZA 2NVWA 1HLPA 3LLVA 4I1IA 1Y9EA 2AEFA 3AOGA 4NMHA 5ER9A 3F3SA 1U5CA 1XU9A 2WJPA 3MOIA 3R3SA 4KTVE 2AXQA 1UAYA 1PZEA 2HMUA 2WMDA 4D3DA 5T6BA 5BSGA 2UUOA 3GPIA 1ENYA 3QVOA 4TVOA 1FDVA 1BVRA 5BSFA 1KEVA 1FDTA 3INGA 3QLJA 4CQLB 4LN1A 1X1EA 2VT3A 3WQQA 1BRMA 5IDYA 3WFIA 1E7QA 3R0IA 4YT5A 1VE9A 5IXYA 2DTDA 4YAIA 1EE9A 3SXPA 2Z95A 4OIMA 1QV7A 4UUNA 3RU7A 5JDCC 1Y81A 2Q2VA 3DZHA 3R6DA 5L40A 2A94A 4WLNA 1QMGA 3GFGA 1SNYA 4E5NA 2Y1FA 3GVPA 3F1LA 1UXHA 3WX0A 1AXGA 3GNQA 5BQFA 3OA0A 1PJ2A 4XEHA 1GDHA 1ZK2A 4PLPA 1I0ZA 3OBBA 4EEZA 1O9BA 4RVGA 3NKLA 1U2DA 1BXGB 3AU8A 5FFFA 2O3JA 1S7CA 3JD0A 1J5PA 2V6BA 3HG7A 3JQ7B 4J7XA 3WFJA 2TMGA 4P4GA 1LA2A 3ZNQA 1TLTA 3DBLB 5GY7A 1XKQA 3G3EA 1ZJZA 4LSMA 1LSUA 5CEEA 1B3RA 2X7HA 2VUTA 1DSSG 2X0NA 4WOJA 2NADA 2A92A 5IG2A 5G0WA 1TT7A 3EK2A 4GLLA 2PKRA 3Q3CA 2FR1A 2GPTA 1LQUA 1ULSA 4RQUA 2ZQYA 3I3OA 2JHFA 3KYDB 1IYZA 3ROMA 3I83A 2WD7B 5DZSA 4Y6PA 1NM5A 3BTVA 5F1OA 1WZEA 1GTMA 3GHHA 5DBIA 5KIAA 3JQCA 3IL2A 2AG5A 4IS2A 2I99A 2VHZA 1BGVA 3TZQA 2RHCA 2XXBA 1C3VA 5DOZA 3UN1A 1GZ6A 4KUEA 3FNHA 3VOSA 1JVSA 2POQX 4XDYA 2GCGA 1HDYA 3TZHA 4TRNA 2VYND 1GADO 3AOEA 2NUAA 1K2WA 2BFOA 2YYYA 1X1TA 2GZ3A 3BMQB 3RBZA 1RJWA 3JQAA 1IOLA 4J4TA 4GPD1 1QXSA 1NHWA 2QG4A 4FFNA 1LSJA 1NR1A 1XEAA 4CL8A 5AOVA 3TL2A 5CDTA 3D5QA 2P5UA 1HDZA 1NNUA 2Q1WA 1WW8A 4NFSA 1ONNA 3AM5A 1X14A 3RROA 2VYVA 1UXGA 3LF2A 4OSPA 3I4FA 4R3WA 4UUOA 3PK0A 1T25A 5DF1A 3K96A 1ZIDA 1HT0A 3RFVA 4BUCA 1KIFA 3H65A 3U4CA 3JQ9A 3PHJA 4XCVA 1V0JA 3NGLA 2Y1CA 2QZZA 3WGYA 1DEHA 4BOYA 4EUHA 5IXSA 2GRAA 3JYOA 4P38A 4XR9A 4YT4A 4KUGA 3NUGA 4E32A 2W90A 4E2ZA 4BO5A 4G65A 2OUIA 2VWHA 3S2EA 4BO4A 4BO9A 3CZMA 3GN1A 5JYEA 4ND1A 4XJSA 3ZWCA 5I7FA 4S1VA 4YTEA 1ARZA 3PXXA 4R54A 2D5CA 4FQ8A 2E82A 3RC9A 5L4SA 1ZCJA 5DP1A 5H83A 3WG9A 1SO8A 1KEPA 3PP8A 2TMDA 4AJHA 4D3SA 2C2XA 3ICCA 4EJ6A 4IJWA 2NTNA 1X0XA 4DWVA 1EVJA 5J23A 5KVSA 4C7JA 1C14A 2VHYA 1LLQA 1M76A 4W7HA 1X7DA 4RLHA 1ISIA 1BXZA 3QJ5A 1AE1A 3OQ6A 4TZKA 4BB5A 3NDJA 3QWAA 4YJGB 1GL3A 4QT0A 2GZ1A 3INRA 1NPDA 2VRCA 5KKAA 1ZXBA 5ITWA 3IS3A 3DZJA 5LCXA 1ISJA 1PJTA 1U5AA 3WYBA 5JCXA 1LLCA 3H4VA 1LQTA 4BB6A 3DAPA 1T24A 4E2WA 4R9SA 4IXWA 1C0LA 4I9HA 2PY6A 3LVFO 1VC2A 1VL0A 3UW3A 5HA5A 3VZRA 2VN8A 3ICPA 1LC0A 3N58A 4W82A 2PD4A 4R5MA 3L9WA 1B16A 3PEFA 1H9AA 4AJJA 1B8PA 1DIRA 4IGFA 1FMCA 1NXQA 4N5LA 4F3YA 5IF3A 3H9JA 5L51A 3CTMA 4JX8A 3RUAA 4XR4A 1Q7GA 4YQZA 5LDHA 3G49A 3VPSA 2WWRA 2PWZA 3HWRA 4QX6A 3WMXA 3BA1A 1M6WA 4XWYA 4UVDA 3C7CB 4PZDA 4LMRA 2Y0DA 3PJFA 1PR3A 4UAGA 2HMVA 3FF4A 2EKPA 4J91A 3JV7A 1RPNA 3BMOB 5CG2A 1N92A 1U8FO 3ENNA 3IOYA 4RPJA 4BHTA 2Y67A 1R16A 4DBZA 1ISGA 1K89A 4M8SA 4R5HA 5AXBA 3JQBC 2CVQA 2UV8A 5T8KC 3JQFC 1BMDA 1Y7TA 4OKNA 2AQKA 2J3HA 1WXDA 3WGTA 3JTMA 2VHXA 5JDIA 1XCBA 1I3NA 2Q4EA 4FC7A 2FSVA 1B8UA 2P91A 2YHUA 2PGLA 4RPKA 5TT1A 4CM5A 3C7DB 2BELA 3PHGA 3MJVA 3RD5A 2CVZA 5JMPA 3ZN2A 3IJRA 1U3TA 4L75A 4TKLA 3Q0EA 4AJOA 4CLDA 3WWYA 1NFRA 4E0BA 2YUTA 5KVCA 3MJTA 1QYCA 1P0FA 1W4ZA 3F47A 3DOCA 3O03A 2WE8A 5TSDA 5A5EA 3QE3A 1DDOA 1PQUA 4IXTA 4H3VA 1D4FA 1MB4A 3KYCB 3WWZA 4CM8A 4BKUA 3O8QA 1YGYA 2ZB8A 1A9ZA 1ZBQA 5GZ6A 2I6TA 2G76A 5JXWA 5U9CA 4GSKA 4YJFA 4GMGA 1CETA 3B1FA 4AJIA 4J1TA 4D45A 4J1QA 1LX6A 1HDGO 4NG5A 2OP0A 2O2YA 3JSAA 4J0FA 4GL4A 4PG5A 2Q46A 1LDGA 1NVMB 2CDAA 1PJLA 2J6IA 3DMTC 3KVOA 1BXKA 5A9RA 4CLOA 4EZBA 3K6JA 2GGSA 4L9RA 3F9IA 4GGOA 2PZJA 3NGXA 1AN9A 5BT9A 4DXHA 4B8ZA 5C7OO 2NNLD 4NZ9A 1ENPA 1PEDA 5BR7A 3NJ4A 5DN9A 4KWIA 4BO6A 1TEHA 1QYXA 3I52A 1E3WB 2H5LA 2HCTA 4CMKA 3DZIA 1U9JA 2OZPA 1I2ZA 4IGEA 4DA9A 4WCDA 2HU2A 4WNIA 3JQDA 3WNQA 4AICA 2X5KO 1B15A 2EKLA 2IDZA 4U7WA 3RFTA 4DYVA 1GYRA 4CQMD 5EJ2A 1ADGA 4XRRA 2RH8A 2YV2A 2GDZA 4GMFA 2XXJA 3GEMA 4GGPA 1VSVA 2NV6A 5TQVA 4IBOA 2X0IA 5G4KA 1SB8A 1BW9B 3PRJA 2G17A 4QFCA 4CMEC 3ONFA 1GCOA 1E3IA 4DLBA 3MCVA 4II3A 1DJQA 1UXJA 4CR6A 4MOWA 4YRBA 2VNSA 3UCXA 1E1LA 1MFPA 2XAAA 5F3RA 2PA3A 5AYVA 1NAHA 1ZK4A 3PQEA 4M89A 3C1OA 1QRRA 4L8VA 1EVYA 3WICA 3FNFA 1P1FA 3ADPA 3W4KA 5COAA 4LCEA 3PWKA 5KTKA 3GVXA 9LDBA 2G5CA 1YVEI 4L4XA 1I3LA 2W2KA 4ROSA 3OEYA 3QIVA 5C37A 3GRPA 4CQMB 3GMDA 3WQSB 1J6UA 3FBTA 1QYVA 3K8ZA 4BQRA 5JAIA 3GVIA 1KOLA 2HDHA 3COSA 3RCBA 3WTCA 1KEUA 1TB4A 4N7RA 1P74A 1KY4A 3LSYA 4E2YA 1D3AA 2HK8A 1YB4A 4GBJA 1HXHA 1LXCA 1PU2A 4U8GA 4FN4A 4R01A 1T2CA 3CE6A 2V65A 3IDSA 4OM8A 5EQFA 4PLYA 4ESOA 5L95A 3ZWNA 2HO5A 5TT0A 1EUZA 1HZJA 5K6AA 3TFOA 2ZYAA 5KOIA 1R0SA 3KSUA 4P8RA 5TIIA 2FPIA 4J9VA 3KXDA 4QO7A 3GGOA 2WYUA 4RVFA 3LT1A 5JAQA 1YJ8A 4ONEA 2GSDA 1PJ3A 1W8DA 1I36A 1DC6A 2IZ1A 3TRIA 5A4DA 3JQ6A 3SLKA 1EK6A 3H3JA 2W2LA 4NHEA 3EAGA 3OIDA 4L74A 1IE3A 2B5VA 3EW7A 3TNLA 1DRVA 3EUWA 3C24A 5THQA 1ZEJA 4BO1A 2DTEA 3DHEA 3VPHA 5JY6A 1PWXA 1SC6A 4FR5A 2DBQA 2ET6A 4Z3KA 4B4WA 5I9NA 3BTUA 4IIVA 4WNCA 2OP1A 1CF2O 2P9EA 4BKPA 1PL6A 1HE5A 1I01A 4E30A 3GZNB 1E5LA 1GYPA 3JQGA 1VRWA 1HZZA 3TZKA 4J2HA 3WNVA 4FOSA 4NIMA 1B14A 3PJGA 3W6UA 1DC3A 4CLXA 4CM9D 2X9GA 1IZ9A 4DQXA 4JP3A 2HUNA 3L4BC 1DFIA 2FPPA 1TXGA 2Y93A 1Z82A 4CR8A 3DHYA 2EEZA 5ENVA 4E21A 4OKIA 4CMJA 1GV0A 4UEJA 5CDUA 1IY8A 1Z7EA 4E5PA 1WMBA 2E37A 2DUUA 2PNFA 4CLHA 3Q2IA 3WLEA 5B4UA 4CLRA 4RDIA 1LTHR 2Y68A 4N5NA 5DBFA 4B79A 4Y8VA 1N8KA 3A4VA 3KSZO 3NT5A 4EUEA 3NJ8A 1QSGA 4D3FA 1NPTO 4N5MA 4RF4A 2LDBA 3K2BA 3RUHA 3LK7A 1IB6A 3QVXA 3PIDA 1H93A 4E6PA 1LJ8A 1UUFA 1ZSNA 5KJCA 3WTBA 4NBUA 2D8AA 5BNTA 4ZQFA 4YJHA 2OXIA 2IEDA 3AWDA 4OL9A 5FYDA 4J49A 4UUPA 1FDSA 3PDJA 4BNMA 4E33A 1F8GA 2DFVA 5L7WA 2ZB7A 4Y9DA 3ZU4A 4CM4A 4TQGA 4GX5A 5ITVA 3D4PA 3ROQA 4CMIA 4F6CA 3VZSA 3H7AA 5EINA 4D44A 1LRLA 1W6UA 3ASUA 5CDGA 1JKJA 3V1TC 1PGJA 4MVJA 3PI7A 3TFQA 4RVSA 3DO5A 1UJMA 2ZK7A 2AEMA 4Q3NA 3GOHA 1UDCA 4ND4A 4Q39A 1SZJG 2DQ4A 1PQWA 3UUWA 2FZWA 2YFHA 5HS4A 1QR6A 3QA9A 4RZHA 3VPGA 1YB1A 1U7TA 2B35A 3VH2A 4EJMA 2HKIA 3ZU5A 4DL9A 4UEOA 1PX0A 3RJ5A 4OHUA 4TVBA 2EGGA 3FR7A 2P2SA 3E5MA 5I7VA 4BNTA 3GY0A 1YRLA 1L7DA 4J1NA 4CLEA 1O5IA 2O3RA 2DKNA 3OEWA 2J5RA 3D64A 4WLOA 1Q0LA 3PLRA 3TSCA 2Q3EA 5JMWA 1VSUA 4IDGA 1UXKA 3HDJA 2X5JO 4P22A 3D3EA 1D1SA 1XG5A 2Y0CA 5G0UA 1ZO8A 4KWHA 4AG3A 1YB5A 1EUCA 1KERA 1KEWA 2AMFA 4E2XA 5IN4A 5T5QA 2HMTA 2B83A 4OQYA 5BSEA 4GSLA 2EF1A 2C7VA 2AEJA 5AQ1A 3PZBA 2PKQO 3MJSA 5TJ9A 1R4NA 1HYGA 3FCOA 4ZN6A 2AE2A 2OMEA 2JCYA 2E49A 1E3LA 4F45A 4MVJP 2NM0A 2CMDA 1E3EA 4PG8A 4J16A 2C0CA 2ZTVA 5GZ1A 4TROA 3BMCB 2WYWA 1SB9A 4QFDA 2CDBA 4KOAA 4O0LA 3D3WB 3H2ZA 3AM4A 4IQ8A 2CFCA 3RWBA 3PIIA 3DBHB 1XQ1A 3GF4A 1D1TA 2W8ZA 1ONPA 1C1DB 1NX6A 5TX7A 3KM0A 4BO3A 4AJ4A 3UOGA 5EPOA 3DHNA 2JCVA 2DLDA 3KOUA 1ADFA 3X2FA 2QX7A 3WB9A 4XIYA 1ZH8A 3TZCA 2B69A 4M49A 5BNFA 4DREA 4JK3A 3WGGA 1HETA 2AW5A 3U09A 1HTBA 3F46A 1GCUA 3ZV5A 2HLPA 3GMSA 3RUDA 3RC1A 3DC2A 1P9LA 3FNEA 1PR9A 3NTQA 4NNJA 3MTJA 4WK6A 1G0NA 1EBUA 2QZ9A 3FTPA 1V8BA 3H9UA 1I33A 3QP9A 4GVXA 2I9PA 2JD0A 1SAYA 4TZTA 1HDXA 4BGIA 4HNHA 2O50A 3ETEA 1E3JA 3OHSX 2IXAA 4MVJM 3NTRA 4E5YA 3WQRA 5JCJA 2E4AA 4CUKA 4EBFA 1LDBA 4UEKA 3DAGA 4NJMB 1IPFA 1DPGA 1GUFA 1ULUA 3FWNA 3JYNA 3DBRA 7ADHA 2B36A 1DLJA 3ADOA 2NTVA 3QVTA 2NTJA 2I76A 2V6FA 3W6ZA 4BO0A 1YS4A 3FWZA 3PWSA 1FK8A 1GY8A 3EHEA 5JSFA 1Z6ZA 1VPDA 3AFNA 3JQ9C 1B3BA 3L6OO 2NSDA 3ONEA 4J43A 1BSVA 3CXRA 4NU6A 4JGBA 4XGKA 2X86A 4MP6A 3FBGA 4W99A 2BKAA 3ZWBA 3L6DA 1E7YA 2WM3A 5JO0A 3VH1A 4DPLA 5DT9A 3QHAA 4W9NC 1XIVA 1EVZA 3L6EA 2JJYA 1ZSVA 3F4LA 1YQDA 2JL1A 2CUKA 4A2CA 2AQ8A 3C8MA 1MP0A 3WGZA 1P33A 3L4SO 1P1IA 3EYWA 3JQ8A 1ZZEA 4GX0A 1WP4A 2ILTA 3FNGA 3KLMX 5BSHA 3C3XA 5IZ4A 5JFOA 3WS7A 1E6EA 3K31A 4BV8A 3VVBA 4XYBA 3R1IA 3M2TA 1D7OA 1GEEA 6ADHA 4EJ0A 2VCYA 4Z9YA 1HE2A 1XR3A 4BVAA 1DJNA 4FB5A 2DAPA 1I2CA 5A04A 3ABIA 4DBVO 4AJEA 2EKQA 3DDNA 3UVEA 4H16A 1RYDA 1LEHA 1LNQA 4HXYA 5A05A 3SX2A 4LK3A 2O23A 1T2FA 2YHIA 3D5TA 3JD3A 3GUCA 3SJUA 4L73A 1WPQA 3H2SA 3WSVA 4ALNA 1RKXA 3DAFA 3DXFA 1I24A 2R00A 5COQA 3RKRA 4R68A 2JFHA 5EQDA 3AI1A 2G0TA 2X9VA 3DMYA 4RF5A 3RUEA 4PGFA 2Q4BA 4NH4A 3Q9UA 1KY5A 3F5SA 4M54A 5DNAA 4UVEA 4JBHA 3OA2A 1HE3A 4OAQA 2QYSA 1YE3A 4BMNA 4FFOA 4JROA 5B4TA 3E48A 5C3MA 3AY6A 1WVGA 1Y8QA 2CF5A 2YY7A 3O26A 1ZVMA 4L0QA 1LDNA 3GEGA 2VQ3A 2D0IA 2RIRA 1KVUA 4RPGA 1H6BA 5IZCA 4I9NA 2DVMA 1GFSA 4DRYA 4IS3A 5TGDA 1DIBA 1YQGA 2IZZA 1X7HA 4OXYA 4BKOA 1YH3A 4QXMA 4PLTA 4TKMA 1NBOA 4E12A 5ILOA 3DZBA 3KEOA 1SCUA 3HADA 4HNGA 4R1NA 1WAMA 1FJHA 3ZW8A 2I3AA 3U9LA 1DAPA 3PYLA 4FOOA 1RM3A 1TA4A 3ORFA 4BNHA 3DR3A 3SC4A 3A06A 3OQBA 5KWEA 4FJ2A 1DAOA 1UP4A 2A4KA 1LSSA 3CSDA 3ZZNA 4B3JA 5GZ3A 1R6DA 1E1MA 5A9SA 5B4VA 3TF5A 4M55A 1KETA 2C2YA 4OYRA 1V3TA 5JDCA 2C7GA 5H81A 4OJNA 1PTJA 4PRLA 3RSHA 5EL0A 3B1JA 3I1JA 4BKRA 2GERA 2Q1UA 4UULA 2PH3A 3TOXA 4LCJA 1ZK3A 1OC2A 3AUSA 3RAJA 1RWBA 3E5RA 3ZH2A 3OF2A 1I3KA 3L07A 2GO1A 5HTOA 2FR8A 3MWEB 1J4AA 2PLAA 3BAZA 4MVJI 5U1PA 1NVTA 3LT0A 1I30A 1RM5A 1ZNQO 4ZVVA 4CQLA 3HE3A 3HQ4O 3EZYA 2HMSA 3I5MA 5KKCA 1PJSA 5TRTA 2O4UX 3AY3A 2OFPA 1PL8A 1ENZA 1X15A 1JU9A 1EDOA 4LISA 2ZJ0A 3NT2A 4WLFA 4E13A 1ML3A 3KB6A 1VKOA 1VLLA 2CY0A 2DBVO 2UVDA 2WSBA 4BNUA 4ZD6A 3B6ZA 3E03A 4WEOA 3WMWA 4NFYA 4PG6A 4RZIA 4EEXA 5F1KA 3ZWYA 3DOOA 2ZKLA 3KBOA 5H82A 3AUAA 1CDOA 1BXGA 3GNSA 5HS6A 4U6SA 4Y6SA 1MV8A 3JQ7A 1H2HA 4IDEA 3KLPX 1JAXA 1AGNA 2Y1GA 5A3VA 4BIIA 2EXXA 2GUGA 3A9WA 1R15A 3DBLA 1ORRA 3CUKA 4Y98A 3ROKA 4IINA 2NQTA 4FJ0A 1EEHA 1SOVA 2BMAA 5FI5A 3KETA 1FDUA 1UDAA 1Z73A 4MIOA 2B4QA 1F12A 3GVCA 4EITA 3MWDB 1LLUA 3KYDA 1VKNA 3O4RA 5G4LA 4B7XA 2EWMA 2WD7A 2X1HA 2QQ5A 4ZICA 4O6VA 1L7EA 2PV7A 4GKVA 3BHJA 3KZVA 4GWKA 4H15A 4XQGA 1TT5B 2A35A 3DL2A 1X13A 4JJIA 5ILGA 2B0JA 3BXXA 4G2NA 4HBGA 4BNZA 3NX4A 5A9TA 3H9QA 4FGWA 3GC6A 4FJ1A 4URFA 1LDEA 5L4LA 4HV4A 2AHRA 4AJ1A 1G0OA 1Q7BA 1EFLA 2AQIA 4DLAA 1CYDA 1OI7A 2H1SA 4I5EA 4Z9FA 2BFMA 4F46A 4YXFA 1VJ0A 2DBRA 4R41A 2DC1A 4CR7A 5L45A 4X54A 3BMQA 1GV1A 1ISFA 1YDWA 2EP5A 4RO0A 2OL4A 1DRUA 3PVZA 3H6KA 3LC7O 1S6YA 4Q3BA 4CL3A 1JAYA 1NQOA 3DONA 4AL4A 1ONOA 1WLYA 2O3SA 2Y66A 4UUMA 2FOIA 4NQZA 4YJDA 4NI5A 3HDYA 4CM1A 3HFGA 5KJ6A 4AFNA 1PQPA 3VZQA 3KUXA 1JVBA 4J6FA 1N5DA 1NFQA 3VDRA 3OMLA 4QQRA 5JAMA 4KP7A 2RCYA 1R4MB 1P1HA 2O4CA 3QY9A 1LSOA 1NQTA 4CV2A 3FI9A 3KTDA 3MEQA 3PFWO 1DOHA 3HN7A 3E9NA 4ZRMA 2GF2A 2VYNA 4A7PA 4NK5A 5HM8A 4ZGWA 5JE8A 4B7CA 4LVUA 2YW9A 1Z45A 2VOJA 2QYTA 3AJRA 3ZU3A 5JO9A 3S55A 3ZHBA 1W0CA 4D41A 1GEGA 3MJCA 1ADCA 2PK3A 1IHXA 1F8FA 4RF2A 4D79A 4IY1A 4EYEA 5L3ZA 8LDHA 3NDIA 3BHMA 4WCFA 4YT2A 5CPBA 3ZHXA 1HLDA 1YWGO 4QEDA 4EI2A 2AE1A 2Y05A 3OJFA 4YJGA 4BQPA 2AG8A 5JYDA 1Z75A 1PGQA 5T64A 4AVYA 3T4XA 1GQQA 1HDRA 1I8TA 4CUJA 2O48X 5TJHA 4RCVA 4K1LA 3DOJA 4FW8A 3KEQA 4K6FA 4OMUA 4MP3A 1IHYA 3EGOA 3AFMA 2BHLA 2X23A 3JQBA 1E7MA 4RL6A 4ITUA 3JQFA 5T8KA 4DIFA 3OQ1A 1N9GB 4RVHA 4ZU3A 2V6MA 4PG7A 1CRWG 4AJ2A 3BMNB 1DFHA 3GAFA 4ZQHA 3L0DA 5EESA 3CPSA 4TRMA 1A72A 4IDDA 3TDKA 5ICMA 3ZNOA 4PLCA 1E1NA 5L9AA 2CNBA 5IN5A 3RFXA 4BNXA 3N74A 2BH9A 1YBMA 4A0SA 3C85A 1E6WA 2IEBA 5L53A 3H3FA 2HAEA 4IDBA 4KQXA 3BMOA 4PLWA 2EV9A 1GZ3A 1DLIA 3IUPA 4BGEA 1XELA 3V1UA 1YBVA 4XQCA 2HMWA 4IQ0A 4J7UA 1P31A 4ID9A 3T4EA 4BGUA 5K0ZA 1N2SA 4XB1A 1WNTA 2Z5LA 2WE7A 4MIYA 4K6CA 2FR0A 3EDMA 3H5NA 3HSKA 3G1UA 3HZZA 3I6QA 3WIEA 4MP8A 1EVIA 1IL0A 3TQHA 3WOHA 3ZV4A 4JN6B 3ZWPA 5I7EA 5TLSA 3GEDA 3RC7A 4YYZA 4D7AA 1V3VA 4LRSB 3DMTA 1EQ2A 4BNFA 4R1UA 3G17A 3NAQA 3VPFA 1JQBA 2JKVA 4Z0HO 4PIVA 1MG5A 3TWOA 3WIDA 4DQUA 2WD8A 4NU5A 2G82A 1CERA 1Q0QA 5JBIA 3KRTA 4MVJE 1DFGA 1YOVB 2BD0A 1H6DA 3KYCA 4PVCA 2NU6A 5B37A 1UZLA 3V5NA 2PD6A 1Y1PA 3M6IA 4QECA 5KVQA 2NWQA 4G81A 1ZEMA 4NBTA 4BNNA 3ETGA 3PZRA 4B4OA 3ITKA 4R9RA 3FN4A 1C1XB 2X0JA 4XYLA 5IFLA 2DPGA 4ZQGA 1ISMA 2I5PO 3FPLA 3GUYA 2YZ7A 3EC7A 1EZ4A 2HJRA 3IKVA 3U62A 5IJZA 4CM7A 1Z74A 2JD2A 4J2OA 4FFRA 5AVOA 3PJEA 4II2A 4PLVA 3AW9A 3LZ6A 4GVLA 2P9CA 4MVJG 1WZIA 3U0BA 4OO3A 3WGQA 2I67A 5FI3A 3ROPA 1K3TA 1H2BA 3GT0A 4CMEA 4UVHA 1Y8RB 5DOVA 4PLGA 3QWFA 4A10A 2QRKA 2NVBA 4D0SA 3UAGA 1YL7A 3I9KA 4LSWA 1T1SA 2O3TA 2NVUB 1XGKA 3GFBA 3I23A 4RLSA 4A03A 3PHHA 3GGPA 3PWZA 1IUKA 3INTA 2VWQA 1E3WA 4YR9A 5G2OA 2Q99A 3G1TA 3TZ6A 2VHWA 3PFFA 4S3MA 3WDSA 4FS3A 4TRRA 2C07A 1EMDA 3VH3A 4BMSA 2IE0A 2VTDA 2YFQA 2GNAA 3ANLA 3GHYA 3IAHA 3IIEA 3W1VA 1DB3A 3F4BA 4DPKA 1H6CA 2IODA 1IPEA 4IMPA 1K6IA 3KSDO 1W73A 1Y6JA 2PZKA 3Q6IA 4YQYA 1BW9A 4E3ZA 1QYDA 4XB2A 4I5DA 4DMLA 2VT2A 4YWJA 4NBRA 5F5NA 3CMMA 2GD1O 3HB4X 1OAAA 1R12A 4JQCA 4ZA2A 1Z7BA 3S2GA 3A1NA 4U0JA 5HWSA 4BNJA 3P19A 5EN4A 4IMRA 1HKUA 2X5OA 4Q3AA 5CP8A 2QRLA 2FZEA 1BVUA 2CF6A 3HDHA 1HYHA 5LC1A 3CH6A 1ZUD1 2GR9A 3RUIA 4Q3CA 1HF3A 4R69A 4AJKA 3S1LA 1PJBA 5IDWA 4LRTB 1PJCA 4RF3A 3U4DA 3V2UA 3NT4A 4HFMA 1BG6A 3D4NA 4GI2A 5L7TA 1HSOA 2W4QA 1T2DA 1PIWA 3FR8A 5JC8A 1KS9A 1PGOA 3I9JA 3AUTA 2IYPA 1E77A 4HADA 3SBOA 4CQMA 1R37A 3JQ8B 3FHLA 4Z0TA 1ZK0A 4YRAA 3JQAD 3WGIA 2X22A 1YO6A 4DYDA 3ZU2A 5HRUA 1VL6A 2FN7A 4J7CA 2V7PA 1BTOA 2OHXA 1M66A 4YEDA 4Z0PA 1PZFA 2FRDA 4RV9A 4XGNA 4IPTA 4J3FA 3PJDA 4YACA 1P3DA 3B1KA 4BNLA 4FD3A 4NJOA 4CV3A 2VYVD 4ZJUA 1MGOA 4XYEA 1NWHA 4GQAA 4Z9XA 5ADHA 1C0IA 1BWSA 1I32A 1U3UA 1X0VA 3TJRA 2QHXA 2VNAA 2QW8A 2EW8A 3FRJA 2HQ1A 3OIGA 5COBA 3W8FA 4E5MA 1GYQA 3ZW9A 2QIOA 3UICA 5IDXA 4D42A 3VKVA 3VTZA 4PZEA 3E6AA 3Q2KA 2CZCA 4M87A 1UH5A 2Y99A 2IXBA 3ZWXA 3GRKA 4YDRA 1GU7A 4YRDA 2PGJA 3VH4A 3DEYX 2VWGA 3PTZA 1PS0A 1XQ6A 4DIBA 2A9FA 4ZHSA 1PWZA 3I9NA 1AUPA 3L4BA 4FFPA 4K28A 5CPFA 2HRBA 2ZTUA 4QO8A 1TI7A 2Q2WA 5CEFA 3JQAB 3GR6A 4NBWA 4IZIA 4W6ZA 2RH4A 1H94A 3HB5X 1KC1A 4JNKA 3NEPX 2EG9A 5JC1A 1ZKMA 3CIFA 4B3HA 3H5RA 1LU9A 2D3TA 5DCUA 2XF8A 3DZFA 3AUUA 1HRDA 1O89A 3WBBA 1DBVO 3RIHA 1DXYA 1V9LA 3WGOA 1PZHA 1U7HA 3IUSA 1GR0A 2EHDA 3GZNA 4HUJA 4FPXA 1B8VA 2VRCD 2EERA 1H6AA 1T2AA 2ZCVA 4WE3A 4DMMA 4QTZA 1D8AA 4W7IA 3RASA 3AOEC 4DC1A 2BLLA 3U5TA 2BI7A 1VL8A 2EJWA 3EVTA 2JFGA 4J1SA 1YL5A 2GYYA 2DFDA 4XRGA 4RJTA 2GN8A 1PL7A 5TF4A 3SJ7A 1PJ4A 3OSUA 1JKIA 5AXDA 5AXCA 4WPGA 3G79A 5B12A 4WEQA 1F06A 5IZCC 3HN2A 2CVOA 3OETA 2I65A 1K0UA 3ZWAA 1ISHA 1NYTA 5KJEA 3ZNPA 1X7GA 4PRKA 4M1QA 5I9LA 4UVIA 2RBEA 4KMSA 1M2WA 3SVTA 3U4IA 1U4SA 5G0VA 2H6EA 2IZ0A 2PKQP 4JXKA 4KZPA 2HK7A 3ETDA 2HK9A 4MPDA 1QP8A 3ITDA 1Q1NA 2BGMA 5JAZA 5F1PA 2PTGA 4DVJA 3UKOA 2V6GA 5GMOA 2G1UA 3UH1A 4CM9A 3IP1A 4FIZA 2X8LA 3U49A 6LDHA 2LDXA 3LQFA 3GLQA 3SC6A 4CUZA 3L77A 4E5KA 4GAEA 4Y67A 3DTTA 3CKYA 4HWKA 4Q9NA 2D5AA 1F17A 4J9UE 4JP2A 3M1LA 1T1RA 1PGNA 2C5AA 3GN2A 4P4LA 5L4NA 4XGIA 4XX0A 2H9IA 3ZCXA 3IC5A 4WLUA 1L1FA 3JD2A 4WLVA 2Q45A 3W8DA 1I2BA 3PPIA 2C59A 4N54A 3RBVA 3TL3A 3AM3A 2F00A 5IDQA 2WTBA 1XWFA 2Y1EA 1VI2A 3WSWA 1Q2XA 4XD2A 5A5FA 4CV1A 2J5QA 1GQ2A 3NDRA 4RVDA 1RYEA 3RQSA 3ZWOA 1GUYA 3I4CA 5HBRA 4KDEA 4HKTA 4JLWA 5CDYA 3MOGA 1EE2A 3OJLA 4CJXA 4OOFA 4A26A 1ZJYA 2FPGA 1JWAB 1DHTA 2GZ2A 3QSGA 3E1KA 1B0AA 4A27A 4GWGA 1IZ0A 1Q0HA 2VHVA 5DCWA 4IJUA 4B4VA 4FFLA 1U2GA 3PGXA 5FF9A 4W4TA 3RUFA 4D46A 1GD1O 1JWBB 2D59A 3X2EA 4OQZA 2PR2A 2ZTLA 3JCZA 1AHHA 1U28A 2C29D 4RVUA 4R3NA 4F6LA 1R0KA 2NU7A 4BMVA 4RGBA 4HY3A 1ZK1A 4EW6A 4TMFA 1YDEA 4JJGA 3W4IA 3GAZA 3PHLA 4AJNA 4DUPA 1U3WA 1ZMTA 3HJAA 1NAIA 3OJ0A 1KYQA 1V35A 4ND5A 1I5RA 1M6HA 4IZHA 4M86A 3P2OA 3ZWWA 4BNIA 5A06A 3DZKA 3FPCA 4GKBA 5DULA 3V1YA 4CM8B 1P1RA 3CEAA 3O8QB 4IDFA 2UYYA 1E0DA 4PFJA 5THKA 3GA0A 3JQEA 1SMKA 3BMCA 4PZCA 3C7AA 1OZAA 4UVGA 4WASA 3D3WA 1QYWA 2R2GA 4YJFB 1O94A 1T26A 2DBZA 3E8XA 3K30A 3LC2O 5JDIC 4OSOA 3RVDA 1DHRA 1BDMA 2PD3A 1EBFA 3HNPA 3DBHA 4BO8A 1JLLA 4PLZA 3DWFA 1C1DA 2EIHA 1NPYA 5KCZA 1KVSA 4QUKA 1UP6A 4CLOB 2FP4A 3PYXA 1E7WA 1HWYA 3GZ4A 2ZB4A 2FWMX 5T67A 2YQ5A 2O3UA 5TC4A 2E48A 3F5QA 5CDSA 4PLHA 3B20A 1E7RA 2GN6A 1P45A 3TN7A 2O3QA 4JBGA 4CMCA 2DM6A 5FWNA 3MZ0A 3Q9NA 1LBEA 3GDOA 3KO8A 4INAA 5I8WA 1P1KA 2PH5A 2FSSA 1AXEA 4XKJA 4XYGA 5EERA 3UXYA 5KNLA 3RC2A 3VC7A 3PLNA 4DQVA 3AI3A 3AK4A 4B8WA 3IMFA 1OBFO 1MC4A 4W9NA 5TNXA 4ALJA 1G6KA 2OORA 4BS9A 3NRCA 5JS6A 3AU9A 5A3JA 2O7SA 4KDFA 3BTSA
chains in the Genus database with same CATH superfamily
4FWTA 3C1AA 2NN3C 3GG2A 4QDJA 4WN9B 3RE1A 3RQIA 4DDVA 2A84A 2ZIVB 3K2IA 5KNDA 1VPWA 1PT7A 2BR5A 3I42A 4RZSA 1RJ9B 4TTTS 3MTGA 5CM9C 2NU9A 5BPHA 3GDGA 1NJ5A 1L5WA 2X3UA 3ZHRA 1XT6A 4B7UA 1BX1A 1M2EA 1ZMOA 2J46A 4KTTE 2FEOA 1OHHD 4FGSA 4QRDA 1F0PA 4XA8A 5CFOA 4HJXA 4M1TA 1E1CA 4RD6A 1T5DX 1ESMA 4JCOA 1RKQA 3ED5A 2DCMA 4U2DA 3L7AA 1Y6QA 4CCYB 1MH9A 5KQMA 1UC9A 4I81A 2G06A 5DBGA 4WOKA 3IUQA 3TYXA 4JI2B 4DDHA 4XSHA 1VMDA 3QLTA 3HHPA 4E08A 1QU3A 1S1MA 3IB6A 1HDIA 3RVMA 2V6JA 2TRSB 2VR1A 3ZKWB 6REQB 1PHRA 1QGED 1SBQA 4OI1A 1H0KA 4MVCA 1N1EA 3K2EA 1QLWA 3G0HA 5JXHA 2R47A 2ATIA 4AK9A 3IBYA 1PP4A 2FCRA 3NM5A 3K1JA 1E5QA 2GM9A 4ZODA 3E9DA 3UQZA 5CG1A 4QWWA 1RYYA 1KKUA 4AF6A 4FONA 4UBLA 4C43A 4L8WB 2QAGA 1JW9B 1S96A 2QZ4A 1G3UA 2RC5A 1ENOA 2GLXA 3S2ZA 2HEIA 1O08A 3WL8A 5DBEX 2FUG6 4GX2A 3ZHQA 5CHEA 3IMCA 1NZDA 3U5ZB 1QP0A 4MUBA 4YP7A 3AYZB 4XQEA 3K1TA 3OLXA 3HVKA 1N6HA 1Y3FE 1KMQA 1KL7A 1N7IA 1V7QA 2ZJ1A 1MFZA 5HE8A 2RGRA 4O2LA 5FCDA 2VF7A 3O92A 3QVWA 3IEIA 2HADA 5KSPA 5B58C 1ISRA 2I4NA 3LWZA 4Q3KA 2PZEA 1N2ZA 2NSYA 1LNSA 4CBVA 3JW8A 4A91A 4CMHA 1RRPA 4HRAA 4ATNA 1KBOA 1EXMA 1CHNA 1QK5A 1A7KA 3A27A 3BB1A 2XI4A 3LT2A 1G8GA 2PJRA 1JL3A 2RIPA 3OPXA 2FW1A 2FY8A 4IMJB 4GI7A 3ZY4A 2W2MA 2Z08A 3CA8A 4QSMA 1VXRA 4MWTA 3U56A 5K20A 4ZOCA 1R0LA 5EXPA 1RLMA 3RYFA 1IPHA 1QLHA 2NSJA 2BGUA 2Z1MA 2NUBA 4UUQA 4YDHB 4C1BA 3M7IA 4U5XA 4PTYA 1UMBA 3IMKA 1NWCA 3VTKA 5LD2B 4YRMA 3NNNA 2BFPA 1WTAA 2YDXA 4TX1A 2HD4A 1CY1A 2Q29A 4ZVTA 5L3VA 4YB8A 1G1MA 3E3OA 3I2GA 1HL3A 3HYCA 5FLEX 3W8RA 4LDQA 2OCKA 2FE1A 1VA4A 2CSUA 2PBFA 2ZJ8A 3L7CA 4J75A 4KBFA 3U4AA 4ZI7A 1PR1A 1FRZA 2GX6A 1NW9B 2XMCA 4C78A 1L3CA 1NMZA 2AYYA 2XOKA 2O2JA 3DDUA 4LZPA 4BFCA 1P77A 5MGBA 1VJ1A 2IY8A 2XVZA 1XDWA 4K8RB 5IK2A 3L18A 2D5IA 1TVEA 3WVNA 1YUMA 1ZFNA 4FFMA 3Q8MA 1RZUA 3T7EA 1Z0JA 4JOSA 1WF6A 1XTTA 2XDWA 2LIVA 4NG4A 4QC2A 4AMUA 4DMRA 2EJVA 2OY0A 3AMVA 4AZ0B 2VS1A 4QTYA 4HEA6 3M81A 3V2HA 3MQFA 3WAGA 1RLTA 1PZGA 4JH0A 4E09A 4JJZA 1WBJB 4A0RA 3C6MA 4TXMA 4ALLA 4DTIA 4OI4A 3UHAA 2DUWA 3DEHA 1S4QA 1K4MA 1TIKA 2D1YA 2D7CA 2WTMA 3AB3A 1QH8B 3M82A 3N0RA 4PIPA 1FFGA 3RBXA 4F6RB 2C95A 3JPYA 2QPAA 1R66A 5DP2A 3OZBA 1JPVA 1NF3A 4O59O 3TB4A 4FX5A 5FP0A 1AMNA 2Z9CA 2VOEA 1JB9A 2B37A 2Q27A 4XASA 2O5RA 4DANA 4C7KA 5TS3A 2JD1A 1UMDA 5JMTA 3TINA 3LY7A 1YIAA 3ESBA 3ZNNA 4LW8A 2X42A 1Y1KE 2HSDA 4ND2A 2NU8A 4N3NA 4O4LA 4YI3A 2V5UA 4FZ5A 1J2RA 1R0RE 1EQUA 1TO2E 2D00A 4BP9A 3C6KA 5A4KA 4LF8B 3EGDA 4EX6A 1QP7A 1FVFA 4WFKA 3GLGE 1AS2A 4QYTA 3PV0A 2ECQA 2QG6A 1G8AA 3FETA 3OFSA 1KI6B 1ZD4A 2ZSIA 1Y3CE 3LYUA 2JFFA 2ZJBA 3QIAA 3IQDB 3FCUB 1Y42X 3ZE6A 3PGVA 2WKSA 4Z3DA 2C20A 3EZ9A 3KHUA 1PZXA 4UFPA 3Q7QA 1CF4A 1ZBDA 2R62A 1QBGA 1ZGCA 2W6NA 3E81A 4D74A 3ZCSA 1T15A 3HJTA 5D8DA 4IIFA 3QRWA 4K26A 3CU5A 3DE5X 3AM1A 2HSGA 4YDQA 2DTXA 3ER8A 1FDWA 3FVWA 3ANSA 4G1FA 5FA8A 3AJDA 3DFIA 1V48A 3P2IA 3NWBA 5CCEA 3ZV7A 3E7WA 2RHTA 1PFQA 5J2TF 5H8WA 3PE6A 1A7AA 1LRJA 1XN1A 3ENKA 3NTUA 4IR7A 4MJLA 5A7HA 4B9EA 1T5SA 3V4ZA 1SH7A 4FSHA 5ALGA 2ZTMA 1SULA 3GVHA 3QYJA 1X39A 3GJRA 4XB6B 2XNHA 1FRNA 1J42A 4IJVA 4KG7A 2FB9A 2XGOA 3ME5A 1SOWA 1SN7A 4P32A 1M1YB 3LD9A 2AN3A 4NNPA 4MO2A 3WLLA 4RTSA 1JQ3A 4LOAA 1KVQA 2GZSA 3W8EA 2YZGA 4AN0A 1IN5A 5FV4A 1J2JA 2WNHA 4BE7B 2AF3C 2CUTA 3GQBA 3JSXA 4B4UA 2IS1A 3NFYA 4IMIB 3JYPA 4JI3B 1QH9A 5DT2A 5DASA 5DDIP 3ULKA 3BM5A 5CW1A 4YAGA 3U6KA 5JUWA 4AXBA 2FK7A 2XCTB 2VP9A 2OC9A 2BFFB 1MAWA 3QBVA 2OFFA 1KGSA 2SCUA 3KAPA 2UUPA 2CJWA 5JJKA 2GKGA 1H4VB 2H85A 4Q48A 5T7BA 3WYGA 3GNTA 4Z7JA 1KBZA 4HATA 1DKUA 2QN2A 3H8VA 2P6RA 2O8BB 3TZEA 4M1OA 2XB2A 2OB1A 3C39A 1KBQA 1Z5UA 3U3KA 3JYLA 1J8VA 4P4NA 3GW8A 4EA9A 1AC5A 2C2HA 3PDUA 1GKYA 4JODA 2OAQ1 5KJFA 1J70A 2IIQA 1YQUA 1KMNA 1KZ6A 2Y1DA 3BB4A 3DC7A 3HFSA 3WKAA 5DNCA 4FLFA 8ATCA 4FZRA 3UMYA 2YNMA 2P4QA 4C6SA 4EGCB 1JFFA 2BM0A 3OY2A 4Y6RA 4BV2A 2O0MA 3CINA 1ID1A 3K5WA 4DLPA 1G8MA 1CB0A 1RZRD 4EARA 4H6WA 2O7QA 3S29A 3WL6A 4AZWA 2AI1A 5EHQA 1NRIA 4G0MA 1FVOA 1VGRA 1DBIA 4MKZA 2W6ID 1QP4A 3Q7PA 2J3LA 3LAWA 5BVGA 2D5BA 1T4DA 5FNZA 1C9MA 3B5JA 3I2KA 2AA3A 3O9ZA 2RAFA 2VDOB 5HTKA 1LLDA 3BXHA 2J0SA 1IWBB 2RJNA 2FRDC 2XMSA 4ENSA 3HJRA 7MDHA 2MYNA 4IIUA 1LRKA 5FNVB 1W2WB 1Z83A 2P6NA 1JR3E 2QTZA 1N0UA 3BIOA 4TZ0A 2CLMB 1R9MA 3PF9A 4LDZA 4BL5A 1MQAA 4H7PA 2OBNA 4Q3EA 1E6MA 3GG9A 2J1LA 5F5LA 4WNAB 1MORA 1AS3A 1J97A 2JRCA 4LYYA 4Z7NB 2Q3HA 3E9MA 1SQ6A 3DKVA 2DUJA 1R4MA 4UBNA 5K0BA 1BHSA 3SS8A 3WYEA 1P4RA 5LVAA 1QG6A 3N6XA 1Y5RA 2XCSB 2B5WA 3E58A 4EFKA 2FH5B 4RA9B 1NI4A 1YZGA 4JKYA 2IL1A 3VDQA 5H4HA 4GOKA 4JLAA 5G0SA 2XB6A 3WBJA 1E6CA 3U3JA 1LI4A 1A71A 1QGYA 1RZVA 1FBNA 4DS3A 1M34A 2IVFA 3CM0A 4ZDJA 1FP4B 2XBMA 3JASB 3JQPA 2XQGA 3B6MA 3V2GA 3LDHA 5ELXA 2YRXA 4QJBA 1L5MA 1NI3A 3NG1A 2PGOA 3A1VA 5EXSA 3P27A 3ZGYA 1JEYB 1AGXA 3IAEA 3QKSA 4O5OA 1IAQA 1UOOA 4LY6A 3SFTA 1I0LA 1SBYA 1WCIB 3WGVA 2YQ4A 1NKVA 4DR7B 2G1AA 1AUXA 4M0KA 4KQWA 3DBRB 2ZULA 3W34A 1WDKA 1MRNA 4M1KA 1JHZA 3I8XA 1LWNA 1KJQA 2BUCA 2C03A 4ER3A 1A27A 2I8AA 4HVAA 5K3OA 4FFBB 1XI2A 2DFNA 2DH6A 2J45A 4XFJA 1D4OA 2XUHA 1A9YA 4XOUA 5GAJA 1GN8A 5H7XA 1UM8A 1POXA 2C9BA 3SJCA 1MW8X 1L5QA 2RK3A 3AUKA 4ETNA 3HCRA 4FDAA 3ER9A 3UJDA 5KC9A 4I08A 2P30A 4Q3LA 4QPCA 2JASA 4KC0A 2WJZB 1E6UA 5HX7A 1WMAA 1OXXK 1HDOA 2OCDA 4JLBA 1NN3A 1HNZB 1CD5A 1MB2A 3A14A 3C8UA 3B9BA 5KYWA 3QUCA 2PZLA 1AO0A 1H22A 2XCOA 2A7XA 4ZVPA 1YR7A 1XYVA 2D4AA 5ANRB 1YMUA 5B1DA 4DLXA 2Z2ZA 5AW3A 3WJ7A 4NOLA 4JLPA 3GLFB 1NN5A 5K3AA 4R81A 2JJ2D 1J39A 3GRVA 4LNAA 2V58A 5EWLA 1TK2A 2Q1SA 3OU6A 2ZR8A 1I10A 3FJYA 3M4JA 3Q3GE 3TBFA 2MJLA 2ORWA 3G0BA 1NBAA 2QY9A 3OQJA 4K2HA 4PR0A 1GILA 3TAXA 5B5SA 1PGPA 2ZAYA 3QU4A 3OC6A 1FLVA 3D7RA 1W8IA 2H11A 1A5ZA 1CEXA 1ML4A 1Q7EA 2ATVA 4AW9A 5HF6A 1GAQA 4TXHA 2LCFA 3KZKA 2RHLA 4M1ZA 1V3UA 2PWPA 5HIAA 2ERXA 1W0JA 2YHIB 1CYEA 2V7VA 3SMVA 3AO0B 2M1ZA 5KNCA 2E4YA 5F21A 4HUTA 1D4AA 1KK1A 3A4YA 3COWA 4DQDA 1PSDA 4LYAA 5JI2E 4UE6A 2AD5A 2ZRPA 2X8BA 4HDSB 4KN6A 3TS1A 1UKVY 4GNKA 1KVTA 2QPOA 3AUXA 3ZDFA 3OTWA 5ES3A 2OXCA 4NFHA 4F2DA 1W4BA 1Y4AE 1SUCA 4J0GA 4PPYA 4RTOA 4TL7A 1ZVKA 3AEXA 2J9FA 3AKDA 4ZQEA 3TSWA 1VTKA 2C97A 4IHJB 4R4JA 3ZGXA 4OXQA 2IU4A 3NM4A 3U37A 3H8JA 5B36A 1DO2A 3QUTA 3FHOA 4G0PA 4S1OA 4X71A 2PYDA 4IHQA 3ABZA 1Y8QB 1K5HA 1X8KA 5I4IA 1YOVA 1F2DA 2OCLA 1XA0A 2OEPA 4W8OA 4PN7A 3I9OA 4FMBB 1KFCB 3PHIA 1I2AA 3AH8A 1L7RA 3OIFA 1BKSB 3NBAA 2P9YA 2C9OA 3VAZA 3VR3D 4QFMA 1E92A 2B21A 1RIFA 2NLOA 4AJPA 4HX5A 3MHPA 1TYCA 5LDGA 4ARZB 4DGSA 5BXQC 4QOFA 3ZHTA 4QZVA 2HDWA 2OXEA 2R00C 5CA0F 1QV6A 3P2YA 1JDUA 3IAAA 2ZWOA 4YBRA 4BVBA 2JB9A 4RXTA 4KRGA 4CM7A 1R9GA 4KQJA 2FFRA 3SBEA 2I7VA 4RQBA 3BDIA 4D02A 2Z1NA 1U28C 3E23A 2JA1A 4PGMA 2F8SA 4DHEA 4KHZA 1A9XA 1E5XA 3ST7A 4HFNA 2HRQA 1GKKA 4CF4A 4NDAA 5KQLA 4XM2A 1CDZA 2FU5C 3NTOA 4QIHA 4F92B 4OYHA 2J3DA 2YV3A 3ETCA 3WYCA 5DCYA 4KPGA 5FR2A 3OP4A 4WY2A 1E1KA 4ILKA 5ULLA 4TTVA 2A8YA 4FZ3A 1PT5A 5AXAA 3U4QA 1XZLA 1XZKA 3BJMA 1L4HA 2P7IA 4KIJA 2AFVA 1OGJA 2NUPA 5ALNA 5ENZA 3TMYA 4EVIA 1R6BX 1BS2A 1YK1A 1QO0D 3EMKA 4KXQA 1TTPB 2GA9A 2ZIZA 5CXSA 1SCQA 2RGWA 3TTXA 3FHCB 3KEFA 1Z6YA 1HLPA 5EE3A 3VNAA 4PPQA 4W5NA 3NTXA 3F3SA 5AM4A 4UBOA 5HF8A 4ZMBA 2AMJA 4UUAA 4Q9HA 2AXQA 1Q77A 1UAYA 3OZSA 4TM8A 5LFAA 3NORA 3SEZA 5EWJA 5CA1B 1P4GA 5A0TA 2GJ8A 3LUCA 3ZXUB 2UUOA 1R4AA 2WW8A 3ENWA 5CH8A 1KYVA 2F9LA 4PNPA 5BSFA 4NYJR 2V1UA 5ECGC 3QGMA 1VLMA 5BQXA 3FYUC 1LK0A 5A5VA 4BU0A 3E70C 3TLEA 4BB0A 3OZEA 4EHLA 4HCJA 2Z6QA 1E9AA 1LPPA 2VH1A 3IO3A 4ZKEA 1X1EA 1CY4A 2VT3A 3ND8A 4CEJB 1XBTA 5KINB 3WFIA 4RNCA 3BQMB 3QEJA 3ZW7A 3S28A 2DTDA 3OAAD 3F6SA 2I7DA 4JGIA 3UW1A 1JMVA 2ODPA 2Z95A 2WZCA 5PGMA 4Q01A 5BR1A 1Y81A 2JHCA 4DV0B 2Q3DA 2A94A 2AMVA 1QMGA 3GFGA 3U16A 5AUQA 3S2SA 2Y1FA 4E5NA 3PQCA 2H0AA 4HRYA 4EG0A 3OA0A 1PJ2A 3UV3A 4W5QA 1ZYUA 4PLPA 2FG5A 1GG9A 1NSFA 5TVKA 4BVFA 4URXR 1ZU5A 1U2DA 5LU9A 4C03A 2QD5A 1RKUA 1A7UA 4CIVA 4U3JB 1ZNZA 4AI6A 1J5PA 2V6BA 5DTJA 4RWZA 4J7XA 3BZBA 4WIAA 4YGXB 1YSCA 2TMGA 2VJMA 3DBLB 2JIZD 2CK3D 2DE0X 3KQTA 4LSMA 1ZJZA 2ZDQA 5GY7A 2ZI4A 2VUTA 3KB1A 4YONB 4EW2A 1DSSG 4XWOA 4CKWB 2PUWA 4HAWA 1IATA 4GLLA 1MCZA 2WIBA 3Q3CA 4RSGA 4UTOA 5A0FA 2FPOA 3GUUA 4JUIA 4IIBA 4U00A 1ULSA 1TW3A 2OO5C 2WIJA 4RQUA 4YS6A 4DZRA 3AF5A 3B1XA 5KOHA 3O8DA 1ORTA 4ERNA 1QIDA 4GMXA 1WU7A 4NE2A 2WUDA 3B36A 1OBHA 2WJYA 4Y6PA 3WDKA 4O8CA 2AD1A 5CNKA 1OWMA 3V46A 4H7DA 3S1SA 1GTMA 3T9EA 1Q0UA 1E3TA 3M5WA 3UXHA 3RRMA 2R1UA 2EBHX 1L5NA 5AVYA 1L7PA 1LZKA 1KY2A 1GU1A 2AG5A 2E89A 1BGVA 1CR0A 2VCHA 2X6RA 2RHCA 1ST3A 1NJ1A 1GT91 3GLTA 4W8HA 3UUEA 2IPXA 2AG6A 3E2MA 4S24A 4DT1A 2ENWA 1C41A 3FPKA 4KUEA 2AG0A 2OBLA 3L8YA 1YJCA 5CHYA 2POQX 5LJIA 3SM9A 2GCGA 3R3WA 3K35A 4Y2VA 3TZHA 2GPAA 1M2JA 4DFDA 3FDZA 3IT2A 5AHRA 1GADO 1U5BB 1K2WA 2QTAA 3Q5DA 1G63A 1Z7GA 4Y0NA 1EJ2A 1QQTA 3BMQB 5AJXA 6AT1A 1I4EB 4ZO9A 3PNYA 4MMZB 2Y2VA 1NHWA 3UPUA 821PA 2O0LA 1K7XB 1NR1A 4HAXA 1XEAA 1EFRD 4FNMA 2NZ2A 2VJBA 1NNUA 3G5LA 3Q98A 4RHYA 1QVRA 1RWNA 5JEDA 3FBWA 2JFBA 2JBAA 2QTBA 1EZ1A 1X14A 5C18A 3UENA 2I62A 1PYDA 1XVUA 2G8NA 4QXQA 1G17A 1Z9BA 2HF2A 3FGPA 4OSPA 3ESRA 2BEWA 3I4FA 4QEZA 4RA6A 2IU3A 1T6NA 2WJ3A 3OQVA 3PK0A 3UAYA 3QY0A 1PVDA 1T91A 3GJSA 3IV7A 3VVBA 1S4MA 1Z6AA 4M99A 5H80A 5F9MA 3EISA 3B8HA 4BUCA 2ZYUX 2QXTA 3T1NA 1R8YA 2P69A 4UARA 1NP7A 3PHJA 4H6XA 2Y1CA 5KAPA 4MRMB 3NXKA 5FLKA 4BZWA 3GYBA 3DWGA 4HNVA 5IXSA 2GRAA 3JYOA 4XR9A 3G23A 1KNQA 5B1HA 1WZ2A 5IAKA 4PZAA 4E32A 4BO5A 4URHA 2V7QA 4KCGA 4B3SB 4MV6A 3S2EA 1RD4A 4BO9A 1FQJA 1XTJA 3CZMA 5JYEA 3R3ZA 4MI6A 2ENUA 2QL5A 3LOQA 1A9PA 2VDNB 2EU8A 4KO2S 4BP3A 2QAIA 4HVLA 1RJFA 4ZOQI 3FDIA 3QEOA 5I7FA 5KBYA 1ZI6A 2XVAA 2VSQA 1ARZA 3FMGA 3PXXA 1SQ5A 1GO2A 4H1HA 4LZWA 4D96A 5L4SA 5DP1A 4MR7B 1SO8A 2GF0A 1MO4A 1JIXA 2E4ZA 1Y4ZA 2NTNA 3QVMA 3BXOA 2W2OA 5LQSA 5KVSA 5J23A 3FB4A 1FYFA 2QD1A 2WIAA 3B78A 4JQYA 4DV7B 4W7HA 1LLQA 4RGQA 3M3DA 1FRFS 5CURA 3JTEA 4OGKA 4XTCS 1ISIA 1CUFA 2H08A 2QRQA 4TXJA 2GXUA 5DHQA 5AUNB 4FI3C 5BY2A 3NDJA 4TYYA 2GD6A 2QSUA 4LOJA 4RZUA 3SWWA 3GT3A 3BXEA 2QBYA 3BH7A 3C3YA 1J0AA 3EHDA 2PIDA 4QSHA 1VGVA 1Y3AA 5HE9A 5K3SA 4TKVA 1KQFA 4DUYB 2O2HA 2HL6A 3PD7A 4R8VA 5KSYA 1PJTA 5BWMA 3YASA 1FSFA 3OF3A 4G0NA 3F6BX 5KDOA 5IVKA 4BB6A 3DSRA 1ILEA 3PUYA 3CG0A 1T24A 4B44A 4EB0A 2WSIA 3GEHA 2F55A 4MQ5A 3L1HA 2PY6A 3LUHA 1VC2A 1VL0A 1GLGA 3QNUA 2VNHA 1Z36A 5TQJA 3DDSA 5HA5A 3VZRA 1JE0A 1FUEA 1FU4A 2PO7A 3OBIA 3R24A 2FAXA 3PXUA 3N58A 3VPSA 2PD4A 2Z3WA 3KT8A 4P81A 3RFCA 1JP7A 5DYTA 3L04A 1BMQA 4B48A 4IGFA 1FC0A 1FMCA 1NXQA 1V16B 2ZZKA 4QUGA 5F76A 2BGNA 2LCIA 3DL7A 3PNLA 1T6YA 4JX8A 4YQZA 1MO3A 1VBMA 5DCLA 5LDHA 5J4YA 3OWHA 1RP1A 2YWFA 4OK5A 2QD2A 1M6WA 2AOWA 4IFIA 3ZDRA 4AMGA 5LQAA 4URYR 3PJFA 2FDRA 3EFBA 1WMFA 2IEIA 3QKRA 2HMVA 3FF4A 1ABBA 4UATA 4UBMA 3KD3A 1RPNA 1U8FO 1RRGA 1E69A 3G1WA 3LY9A 2Y67A 1R16A 1UAAA 1Z5GA 3RS9A 3OF5A 5DNEA 4YCSA 1G98A 3FYHA 2YJ4A 1BMDA 1YKGA 3LFUA 3BSSA 4OKNA 3FFXA 3UBTA 1YZNA 2DCUA 2FX3A 1Z56C 2J3HA 1F2UB 3AKEA 4LHYA 4C08A 5JTUA 2GYUA 4C20A 3A6FA 3AR8A 3LGAA 1I2MA 4QYIB 5HCNA 3GEIA 3L6CA 4RPKA 2IOYA 5J1TB 5AW2A 3C7DB 3MS7A 4O4HF 3RD5A 3JZMA 3IJRA 4BEWA 4IH4A 4DR4B 3VX4A 3R0JA 1VE3A 2PAFA 3FYCA 3Q0EA 4NYMR 3PPWA 3WWYA 2YUTA 1USVA 2OC4A 5HUJA 4PQYA 1VSQA 1QYCA 3DOCA 3O03A 2WE8A 3UTDA 5EMMA 3FROA 5TSDA 4BDTA 5A5EA 4R7ZA 2H7YA 4MV9A 5B6JA 1D4FA 1BZYA 3KTAA 2JEZA 1MO2A 3G9TA 3KQOA 4AUNA 3O8QA 5LQMA 5BR8B 3EG5A 3GLGB 2WU4A 4MKIA 1XJQA 1YGYA 2EX0A 2H0RA 4MB0A 4W7SA 3RYHB 3IRVA 4GR4A 4RMGA 3T9DA 4PZ0A 1ZBQA 5GZ6A 1L1QA 4Q1AA 4BIMA 3UJPA 3R8CA 4YJFA 4BRSA 3GLIB 1D1QA 4CIBA 2HMYB 5H70A 4YRGA 1UBLS 4J1TA 4AJIA 3SJAA 1G4UR 5KYGA 2OP0A 2O2YA 2COKA 3JSAA 4HB4A 4HB3A 4KMRA 4CCWA 4DNPA 3D6JA 4EF4A 2SECE 2Q46A 4PG5A 2R8YA 3CJRA 3O2JA 4HUQB 1Y7LA 1E1QD 3B6EA 5AI0A 5HXAA 3ZZTA 3OEED 2ZSFA 4L9RA 1QVWA 1EFTA 2PZJA 1GA6A 3GPCA 1AN9A 1JG6A 1UC8A 3NGXA 4MA4A 5AKHA 3UANA 4ID3A 5AM2A 2OILA 1XAGA 4AN4A 3VYRB 3REOA 1NN1A 5DLDA 2SKCA 2YJ6A 3SKVA 4ZPJA 1J00A 2FFAA 2R7MA 3JZDA 1QDUA 3EH1A 1ENPA 4NZ9A 2P1DA 4D3XA 4QATA 5DN9A 2BGGA 4C01A 3ZWQA 4F4UA 3FCSB 1TEHA 1TQHA 3EGVA 3AZQA 1KMIY 1QYXA 4HGYA 2HN9A 3I52A 2HCTA 5LN1A 1E2BA 2FDXA 3PXAA 4DA9A 3KL4A 4BJ5A 2Q5HA 2VK8A 4TZ6A 3H7IA 4IZOA 5IM4F 5EYPA 5TPWA 3OU2A 1OBCA 5F2EA 1ORIA 4U7WA 4L85A 2IDZA 1AK9A 5CVEA 3UWSA 4YMUA 5JROA 3U44A 3RRBA 3IQGX 3SE0A 4OAOA 3AESA 2YV2A 4MAFA 3GEMA 1ZAYA 1C3XA 4W5TA 2QD3A 3VNQA 4NWIA 2X0IA 2X7JA 3I12A 4G26A 3ZD9A 2LZ0A 2Q21A 4MUGA 4O4JB 1K66A 3IUEA 5E0KB 2ZBVA 3PD1A 2DQSA 1CY8A 4HZUA 3V1LA 1E3IA 4KX5A 4A6PA 4BYMA 4HDRA 2JLUA 3CKKA 2D3WA 4P5DA 1L5VA 2F62A 2N47A 4ZVKA 1UXJA 4AQ7A 3SFZA 2HH9A 2UXCB 1W5BA 3EUAA 5AOCA 2CSXA 2VNSA 4G25A 4TKZA 1JG7A 1X1BA 4P33A 4IILA 3QX8A 2CYCA 1D0SA 1T6XA 2PA3A 3EVFA 1XMQB 1N2CE 3RIEA 1ZK4A 2C3YA 5JCJA 2PX5A 1M2VB 3JAWA 5BSWA 5C4MA 2VO1A 4L8VA 1Z33A 4U2GA 3VGJA 4G0UA 3FNFA 3WGMA 1S2MA 4AKIA 4JB8A 1P1FA 1PR2A 2YVLA 1ODJA 1WR8A 2X3FA 2OZVA 4L4XA 2ONJA 2EL9A 3UOAB 2EFJA 4AN1A 2HGSA 4ZCRA 3LX6A 1SIOA 1TCCA 2EHJA 3II6X 5TEWA 3LUGA 3C5WP 2K87A 2OBBA 3OEYA 4M60A 4HYYA 4BVLA 1N1MA 2HV9A 2XGMA 3TRFA 1N34B 1L4YA 4IIEA 1M34E 2DQZA 5HRAA 1QYVA 1WUYA 3K8ZA 4QLOA 1M72A 2JZOA 2MTBA 4IIXA 1G2QA 4QM7A 4E7PA 4O2AB 3DMFA 1GKUB 1RXSA 5GV8A 2FXIA 1JRLA 1NBMA 3KUDA 3KTFA 4WBNB 1DG3A 1NW4A 3H2YA 3JYHA 4IUBS 3RYIA 3N8KA 4IGIA 2E4UA 3LTNC 1N32B 1RLIA 4RKFA 1M1ZA 4C4AA 2YX1A 4IIJF 2KYRA 5TB5A 2VATA 3ZY3A 2C3PA 2HXYA 1WULS 1YB4A 5ALDA 1ECGA 1HXHA 5HQJA 3MJHA 3R7FA 4JXZA 4J0CA 3TSAA 4FN4A 4R01A 3IDSA 4OM8A 5L95A 4PLYA 5DMHA 1UPTA 2YWEA 3W5DA 3GEBA 1U1GA 4YAUA 2ZYAA 3H5WA 4ZHQA 5KTTA 3L7NA 4P8RA 1Y82A 1LX7A 2FPIA 3B3AA 1FDOA 1GVHA 4J9VA 4ZEXA 1CUCA 1AZWA 1CULC 2ZBDA 3DZCA 4M6WB 1V7CA 3T0GA 4EB6B 2ZBGA 1NONA 1VLHA 4JLUA 4BX8A 1FFWA 3ACCA 5K6RA 4HBZA 1TQ8A 2WFLB 1JIKA 1SUAA 2O2CA 2X40A 4PV7A 2IZ1A 1DEOA 1OXBB 2RARA 2AFHA 3TRIA 1JDPA 1ZLYA 1MVNA 5E6SA 5A4DA 3R3UA 2PCJA 4HS9A 1S7GA 2R6HA 1QGUB 2W2LA 3H3JA 4NHEA 3COZA 3RRFA 4AZ3B 1HORA 2LXNA 4DWOA 4RK5A 1DRVA 1K3UB 3C24A 3BWDD 3KJZA 1ZEJA 5C0OE 1QQAA 4HTAA 5EZ5A 4ODIA 1V5WA 3TEJA 2DTEA 3DHEA 2BFBB 3MB5A 4DMHA 1L8LA 1LW7A 2EOAA 2HA6A 3M6LA 1U1CA 2ET6A 3F4KA 4LX0A 4DEYA 3AUFA 3HTXA 3GROA 5I9NA 4RJKA 2B9EA 2QY6A 4IIVA 1KYXA 4D81A 3VZBA 2OP1A 4BKPA 1PL6A 3FKSA 3THXB 3CF4A 1OX6A 1CBUA 3HLYA 1I01A 4EFNA 3JQGA 1WUHS 2ORIA 3ND6A 5DJ5A 2CDRA 2RONA 1H2ZA 3GLHA 4GC5A 4F2HA 5ALVA 4DY6A 5I7AA 4NIMA 4EF5A 4F91B 3W6UA 1SA0A 1DBRA 1O96A 2Y76A 3DOIA 4DQXA 2X9GA 3PEWA 3N6RA 3MQ4A 2E0IA 4U9HS 1BRTA 1P29A 2MSDB 1DFIA 3BE5A 3UOWA 1BX3A 4CR8A 3TLCA 5CCDA 2EEZA 1AS0A 2TMKA 4RK7A 2I6XA 3RAGA 4E21A 4MTLA 3G2QA 3KHTA 2R8RA 1GGNA 4F96A 1E8DA 1GV0A 4HNAA 2GARA 5CDUA 4CQJA 4MQBA 5B3AA 4W9MC 2DUUA 2PNFA 3DYVA 5IASA 1NR5A 3K6RA 1AKEA 4HDNB 2BSXA 1IEXA 1UMKA 2IDKA 1S2IA 4Z0NA 3WLEA 5A5DA 1LTHR 1U8ZA 2Y68A 4N5NA 3ZUPA 5GIPE 3NVDA 2J7PD 4Y8VA 3RJ9A 1N8KA 1ZHHA 3KSZO 3SQDA 2JEOA 4LRYA 2ZWAA 4DIOA 3K0SA 4MUAA 2QI9C 1EAYA 4D3FA 1OSNA 3WP1B 2AEEA 5AM1A 5BWOA 2GBFA 2HPAA 1M83A 2JZNA 3LK7A 4FILA 1IB6A 2QSYA 3VU8A 4CIYA 2C3MA 3R74A 2VDMB 2VNKA 4NBUA 4ZJZA 1BC5A 3E15A 1GRQA 2CUNA 3G0GA 4YJHA 4ZQFA 2OXIA 4JBLA 1JH9A 1WL8A 4AS2A 4C04A 1PL0A 1S2NA 3CZCA 4UU8A 4UUPA 4CTKA 3WLHA 2UYCA 3FNIA 1YDFA 5CBKA 4FM9A 1CG6A 1NRWA 2B1RA 1NYQA 2HIMA 1HA3A 1F8GA 2DFVA 3KPYA 3PDJA 4OQNA 3WC4A 1PKXA 2PYIA 4WKCA 3T9CA 1TMYA 3IUBA 2XECA 5FWYB 1TU4A 3CZ9A 3UHFA 3ZU4A 2XMBA 4TMWA 1L0BA 3G68A 4N65A 4YO7A 4CM4A 4RFSA 5ITVA 2OWEA 4C0KA 1Y1TA 3I34X 1EFVB 2C2MA 2CMGA 1PTKA 5EINA 1LRLA 2C0QA 3ASUA 1R50A 3AETB 3A9UA 2WPNA 4JUAA 4O2BB 1Z4NA 3UT5A 1E4EA 4Q4CA 3DGFC 2PRJA 3PI7A 4RVSA 1BYUA 3PR1A 3K6SA 1V11B 3L0OA 3QKUA 3UA4A 2XY4A 2RFLA 3GOHA 1A3CA 4ND4A 1N2JA 2DQ4A 3VKFA 3UUWA 2DQYA 3EOBI 1GR1A 5HS4A 3SD7A 1XB2A 4QULA 4RZHA 3ETNA 3VPGA 2PMDA 3WGKA 2LR0A 1SVIA 1DTEA 4KFRA 3RNOA 5CW2A 4XVUA 4DV4B 1SVNA 3V1KA 2HKIA 3BCUA 3CPJB 2RKOA 1L4FA 1D0VA 1ZMXA 1PX0A 3K0AA 1TQ2A 2PM8A 2YZ2A 5CLIA 4COKA 4HH3C 3D0RA 5CU7A 1D6MA 1FLAA 2KE5A 3FR7A 1GT6A 2DF8A 1RKVA 2P2SA 4BQSA 5I7VA 3BDAA 1ZVQA 4DIDA 3C6XA 1L7DA 4GI5A 2VSYA 3T52A 5HF5A 3A7DA 4CLEA 4EUNA 1NJGA 1O5IA 2O3RA 2OE2A 2YJ3A 1H5UA 3O21A 4K6MA 3EPJA 2J5RA 4WLOA 5CX1B 2EX4A 4UCQA 3SIRA 2Q3EA 2YJTD 1GNRA 2PQ6A 4IDGA 3TSCA 1CR6A 2QMYA 5KYKA 4MYRA 2TS1A 1D1SA 2V7WA 2YKGA 2AC2A 3E5HA 2YL2A 3PFBA 1ZO8A 4KMOA 4RTQA 4A8PA 4BB9A 3TRDA 1YB5A 4MQLA 2GVNA 1TMGE 5DGXA 3ZQ6A 4E2XA 5IN4A 2HMTA 1E99A 1S1CA 1YHYA 2PX4A 2GEVA 2TECE 3NC4A 4H0NA 1IBRA 4WXPA 1EP2B 4GSLA 4A15A 3ZEIA 1K3FA 2NV0A 4MCHA 3PZBA 1A8UA 5THXA 3ONVA 4RULA 3TCNA 3I37X 1L5OA 1R4NA 2FX2A 1HYGA 1X7YB 3FCOA 4C1NA 1QE3A 1S8FA 2P6PA 4U2FA 1UPXA 5FBVB 1U65A 5KYYA 4C6TA 2E49A 2A78A 2I22A 3KEMA 4F45A 4N12A 1XMVA 2ZWIA 4MVJP 4QU9A 1TUBA 1Y8CA 2CMDA 2H9AA 1GPLA 4LNHA 5IW8A 1Z28A 3PFKA 5AJZA 1U7PA 3AV0B 3LUKA 2C42A 3BMCB 2XKKA 5JRJA 1SB9A 2VJQA 3KQWA 2CDBA 4KOAA 4O0LA 5DIZA 3TRKA 2ONCA 3AM4A 3H2IA 5EJ4A 4DLRA 1M0WA 5F2KA 1FFCA 3PIIA 1XQ1A 3KKEA 3LX5A 1D1TA 3M4ZA 1JLLB 1ONPA 1QONA 3MLAA 4QDTA 4Q9KA 4A2PA 3RR2A 1U3FA 4P7GA 4MDEA 2AOTB 4PYQA 2GBGA 2VXBA 4EHAA 2OCGA 3KM0A 4BO3A 2NSLA 3W5SA 4AJ4A 4DG8A 1RE0A 2FP4B 2QLTA 2ZB2A 3UIEA 5EHZA 2BM1A 4JHLA 3HKBA 1DINA 2OV1A 2ZM5A 3UMBA 3GX1A 3KZXA 1XFAA 2GHQA 2H5JA 3DF9A 4DREA 4EY4A 2VC2B 3G13A 3K20A 4WBXC 3EX7C 1J5EB 5FBRB 1UBCA 2B20A 2AW5A 3LMKA 3VJMA 2G9NA 3SZMA 1A50B 2HRRA 2PU5A 5B55A 4KPEC 1WXFA 3GMSA 3H18A 3RC1A 5I4BA 4XUEA 4NNJA 2AN1A 2ALJA 1O94C 2WKPA 3SQMA 2PJUA 1DZ3A 3DL0A 2X0DA 3VO2A 3W5VA 1G0NA 1EIWA 3FTPA 1FPMA 5JVDA 1LQ2A 2KW5A 3M1IA 3MQ2A 4ZFNA 2PX8A 4KYUA 2I9PA 2JD0A 4UQPA 4QBHA 3V80A 3IL2A 3ET5A 1HDXA 4LWOA 3TLMA 4BLRA 4GGMX 3I92A 2VAXA 2OGTA 3N86A 2IXAA 2HHAA 3EA0A 4MVJM 3G8YA 3PG5A 4QBIA 4FHZA 3T5CA 3UBMA 3WQRA 2DHCA 4L0MA 4LZNA 1GG2A 1C3LA 2E4AA 4PONA 2NO4A 4QXPA 1LDBA 1Y3DE 2CUZA 3U40A 4XSGA 4MAMA 3V4PB 4AP9A 1SHUX 4BLUA 4XIIA 4YV0A 2VPZA 5FBQB 1ESDA 3P5BA 3QXJA 3D1JA 3HR4A 4N76A 1DLJA 4M1YA 4X6LA 2NU9B 3DNFA 1YNSA 2V6FA 3W6ZA 2NV2B 1YS4A 4BLVA 3FWZA 1V25A 1FK8A 2IYLD 3EHEA 3PGA1 1Z6ZA 1VPDA 2AWOA 2RE8A 1B3BA 1PR4A 4ZEWA 1FP7A 4JR2A 4MV0A 1TRHA 4NU6A 1K08A 3OLQA 1E1CB 1U8TA 2ZS8A 5D7NA 1E5VA 4MP6A 1QHIA 3NKFA 4DV3B 4G8DA 2ZJZA 3ISJA 3L6DA 1E7YA 4MRSA 3ZWBA 4RKRA 1B1AA 3K94A 2PL5A 4YJ3A 1QE5A 4EMBA 4R8RA 5ALYA 1Z5VA 3K3PA 3Q5GA 4L02A 1R9NA 3KJNA 3V1NA 3BH0A 4DPLA 5DT9A 1GNLA 2E21A 3TIVA 4BMOB 4W9NC 4GMKA 2WWTA 1JR6A 1QIFA 2CUKA 4JGGA 4IV5A 2CNOA 3WGZA 1QAQA 2W37A 4XD7D 2VQSA 5TMPA 1P19A 1WP4A 2ILTA 3U9SA 2GEJA 4JC5A 5G3YA 2HWUA 3A6EA 1R8XA 3C3KA 3KOZA 4K86A 4L57A 4WMLA 1K86A 4DIEA 2P11A 4D9CA 5CBPA 2Y9MB 3WS7A 3HB7A 2H2HA 5IZ4A 4AY6A 3QPVA 1PT8A 3EF3A 1K68A 1P80A 3IVMA 3CVUA 1QE0A 4BV8A 2QAGB 2SICE 4RLFA 1NSTA 1H8EA 3KZ1E 1PFGA 1GEEA 1JFRA 3S6JA 5G40A 4EJ0A 4L6AA 3GRFA 1HE2A 3GPBA 1WXWA 3BIJA 4FB5A 4ZCSA 4B3MB 1W5FA 5AI8A 5A04A 4AJEA 1A04A 2EKQA 2IQ5A 5ALIA 3O74A 5AVKA 4D8UA 1UODA 4H16A 3R2JA 4HQFA 4JMLA 2AJDA 5FBLB 4Q7QA 5BMVA 1LEHA 1LNQA 4NE7A 1TCVA 4FZJA 5A05A 4LK3A 3SZRA 2PZBA 3DP9A 4PFKA 4NONA 3D5TA 3NFRA 3ICEA 5L6MB 1EE1A 4MUJA 1M1UA 1YRYE 4AWBA 4BUZA 2A1TR 2HNBA 3WA7A 2M6KA 3H2SA 3WSVA 1NSYA 4ALNA 2GT1A 1N0WA 2WHXA 2BPOA 2R00A 4XCXA 3QOWA 2ZRHA 2JFHA 3T7JA 1VHDA 4KRYA 1KARA 4UBJA 1XVVA 3RUEA 4ZEVA 1MKYA 3ICOA 1PD1A 1H3FA 3RYFB 4KREA 1X9HA 2UUAB 1GPMA 1FTYA 1KY5A</