3KJEA

Empty state of cooc1
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
254
structure length
254
Chain Sequence
b'MKLAVAGKGGVGKTTVAAGLIKIMASDYDKIYAVDGDPDSCLGQTLGLSIEEAYAITPLIEMKDEIREKTGDGGLLILNPKVDGDLDKYGRYIDDKIFLIRMGEIKKGGSQCYCRENSFLGSVVSALFLDKKEAVVMDMGAGIEHLTRGTAKAVDMMIAVIEPNLNSIKTGLNIEKLAGDLGIKKVRYVINKVRNIKEEKLIKKHLPEDKILGIIPYNELFIELSLKGEEIWQSTNPAFVNLHDIYQKLRLEVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CO dehydrogenase/acetyl-CoA synthase complex, accessory prot
publication title Crystal Structure of the ATP-Dependent Maturation Factor of Ni,Fe-Containing Carbon Monoxide Dehydrogenases
pubmed doi rcsb
source organism Carboxydothermus hydrogenoformans
molecule tags Hydrolase, metal binding protein
total genus 75
structure length 254
sequence length 254
ec nomenclature
pdb deposition date 2009-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kjeA00
3PENA 3T61A 4ZIRA 5DISB 1VYVA 1FFHA 1Q1BA 3AF4A 2D7CA 521PA 1V43A 1GNRA 1HE1C 3L0SA 4X8LA 1GNQA 2GKSA 3IQWA 1OIXA 3ZIAA 3SBEA 3Q9LA 4QOSA 4RFVA 1CF4A 2VP0A 4LPKA 1N6OA 4LYJA 4FIDA 4FMCB 4KJZA 2ZRLA 4L9WA 1G5RA 2NZJA 2WKPA 5D3MA 1GL7A 1SHZA 1VYUA 1CXZA 2CE7A 4C9BA 4A36A 5EZ6B 3KZ1E 3BK7A 3I61A 1A2KC 3I92A 4GBMA 1Z6AA 4KODA 1Y3AA 3SYNA 5FUYA 1AQUA 4OYHA 1OKKA 4G5RA 4CEIA 1GFIA 4FCWA 2PZGA 1Z0JA 3GJXC 1KO5A 1YRAA 1KI4A 5DN6D 3WYFA 3EASA 1VG9B 2XNDD 4JJKA 5JWOA 2F9MA 3T15A 1XFAA 5BWMA 3DEFA 4LBZA 2W00A 5D3QA 3KFVA 1BMFD 1J90A 4B71A 1HH4A 2BMJA 1C1YA 4KI0A 4ZDWA 2IYZA 1EFUA 2QSZA 3G82C 4ILEA 4DT1A 1X1SA 1U90A 5DHAA 2IBMA 4ZDKA 1IBRA 2VSOA 1RVDA 2P6NA 3I32A 3LW8A 3NHBA 3QXSA 4KU4A 5JRJA 5IT5A 4DLSA 2FF7A 3W90A 1N6IA 3L8ZA 2KWIA 4BFSA 4YMUA 3LQQA 2YVUA 4Q21A 2X77A 1L7VC 1K5GA 4NCJA 3TH5A 1X1RA 1XMVA 1QDEA 5TB5A 1YZUA 3GLHA 4GOXA 2ZJ8A 1KKLA 3VTKA 4V0OA 3CWQA 3OFNA 4ZKEA 4EKDA 5KHOC 2YWHA 1HYQA 3GLFE 4V02A 5IHPA 4M9QA 4GP6A 3PCRB 5G41A 5KNCA 1ZD8A 3AVXA 1PLLA 4NONA 1OPXA 5FI0B 4F4JA 3O8RA 5H1YA 5E7IA 1T4GA 1LW7A 4BFTA 1IN7A 1IN6A 2BMEA 1E2KA 2V54A 2ZPTX 2QMUA 4G5QA 4QGHA 5GVRA 4Q4LA 4WA7A 4EJSB 3OE7A 5C4MA 4B2LA 1P2TA 4QXAA 3O47A 1U9IC 4RZ2A 4PO9A 3O8DA 1NP6A 2HV8A 3UMRA 2O8FA 1NN1A 4P0TA 1YR6A 3OZXA 1XXHE 1YVDA 2LCFA 4O2LA 2W58A 1MRSA 2J7KA 5KSOA 4H1VA 2KI5A 4RVCA 5FPSA 4BQSA 1TUEA 3CONA 2W2XA 3F3YA 3TNFA 3CWZA 4JLMA 1LVGA 4BFZA 1Z8FA 2ZE8A 4F38A 1GKUB 4OK3A 4NYJQ 2QAGA 4JLJA 1CLUA 1FMJA 3W6PA 4HEJA 4MA4A 2KJQA 1YJ5A 3U3MA 1JPNA 5TY0A 4BRWA 4UXJA 5EE1A 2IX3A 4XTCS 2O8EA 2FEMA 3EARA 3P26A 4ESVA 3U6KA 4YXWD 4ZI3A 2R6GA 5HCNA 2BHRA 4NCIA 5FPHA 4EJSC 1MO6A 1DBSA 2VP9A 2HT1A 2G9NA 2JAQA 1MO3A 3R9XA 1JR6A 1KSJA 4Q7KA 3KFXA 2X1VA 4KV9A 2IYWA 1KSFX 1Z29A 2Q21A 3ZZUA 4HSEA 4RKEA 2VPPA 1VMAA 1KYIA 4A92A 4D81A 3WP0A 2EFDB 1YZTA 1HQYE 2KBFA 3LDAA 4PANA 4Q5IA 5CLLA 4Q66C 4C0KA 4BEBA 1QHIA 2F43A 4PPQA 1N3BA 1QHHA 2ZR7A 4EFNA 2UZ3A 1ZD9A 4RFSA 2OCYC 3UG7A 1N5LA 2WJJA 3C15C 4Q00A 4LCBA 3WYGA 1CR4A 4Q4JB 4M53A 4DCNA 4DEXA 4JL6A 3LV8A 3KJGA 2GESA 4AC9A 4V0LA 1DAGA 3H1TA 1WP9A 4TYWA 2FGKA 2GXAA 1BOFA 3QIAA 3QPUA 2MSEB 3BOSA 3C16C 3EZFA 1ZIPA 3P1JA 2YWEA 1W4CA 4FN5A 1KZGB 2F3TA 4WOPA 3LNCA 3QUSA 3FMPB 2XTNA 2F1IA 3SQXA 2GDJA 2IUSA 5AJYA 4CEHB 3AF0A 1KHTA 2R9VA 4M8NE 2IC5A 2GAAA 3U44B 2O0JA 1E79A 1AS3A 4OHYA 1NLZA 1R5BA 1KY2A 5B57C 5K8TA 5CYPA 4B34A 2VEDA 4P32A 3LXXA 1ZUIA 3NDBB 2JLUA 3CX8A 4GOJA 2IS2A 4OQNA 3X1ZA 2Z4RA 4PXAA 5HE9A 1NJFA 4FXPA 1IM2A 1NVVQ 2RH5A 3FHCB 2ZUBA 2XITA 3QG1A 5FBLB 3TUJC 1XEXB 4AYWA 5KNBA 1G17A 3WYAA 1ZNXA 5FOVA 1OB2A 4I99A 4TYNA 5BXQC 4NL4H 1Z3IX 3IHLA 3A4MA 2ORIA 3K0FA 1OH5A 4ZV4A 2IWHA 1BS1A 3A4LA 1CJMA 2JJ8A 4OBEA 1GVNB 2PEYA 4UJ5A 3SJBA 2ZVQX 3D6TB 4BFWA 1F2TA 1SXJA 3E70C 5SZIA 1SVWA 2QTHA 3AVWA 1XMSA 3KB1A 3MFYA 3G0HA 1LF5A 3RSLA 1KDRA 4TTPA 2J87A 3T1VA 2QMOA 2FPMA 2QMEA 4ESHA 5C46F 4LZZA 1XCPA 1KDOA 1XNJA 4B35A 2QGZA 2ZRGA 3VKWA 2BMFA 4UNRA 4TTRA 5J4YA 2JJ2D 4B3BA 3CZQA 5B30A 1G7SA 2GJAA 1KAOA 1KI6B 3QPVA 1XB2A 4ASUD 2CDNA 5J47A 1M2OB 2Y8EA 2RGEA 3EZ2A 2RHDA 4LGMA 4YDSA 4D0GA 3THXA 4DUGD 3WRYC 1NKSA 1A4RA 1QHGA 1TU4A 1HTWA 1IY0A 5FL3A 3GJ4A 3ECCA 2WAXA 4UNNA 1CBUA 3BJIC 4B48A 2FE4A 2JGNA 2QTVB 5IRCD 1YKSA 2H16A 1GL9B 2NQ2C 2OUKA 1Q22A 2IEYA 2RGAA 1XPRA 5EQTA 1G1MA 2CNWA 1DAKA 2G83A 1GILA 3ZVMA 2HDNB 2VF8A 5AUOB 3FKSD 3K0SA 1EESA 1N6KA 1G5PA 2IHYA 1Q21A 2KB0A 4BFUA 1ZAKA 2W2VA 5DO9A 3VKHA 4Q9JA 2QE7A 1E3MA 5TARA 1OJLA 2J0UA 4TN1A 3CRVA 2BV3A 3BB1A 3CBQA 4HAYA 4OI4A 5JECA 1TTTA 3C5HA 2CLDX 3SYKA 4HDCA 2RKOA 4ACBA 3AVYA 3EX7C 5DH9A 2OV2A 3CRQA 2YC2C 2AFIE 4QBIA 4N0DA 3AVVA 4TSFA 4CDGA 1QZXA 1VTKA 1JQLB 3GFPA 4XWKA 5KSPA 1NMXA 2BKEA 3IIKA 4R9UC 2HJVA 3U3JA 3IO5A 1VG8A 1UF9A 4QHSA 4D4KA 2P6RA 1M7BA 2SHKA 1S8FA 2D2EA 5EP3A 3LFUA 4YMWA 2KE5A 2OLJA 4NYIQ 4GP7A 5AJVB 1COWA 3SYLA 2ZJYA 5CIQA 2V7QD 5CDFE 2CK3D 4MKFA 1VCOA 621PA 2O5VA 3UIEA 1EWRA 1CULC 3PJRA 5EP2A 3WNCA 1KI3A 4Q9LA 2CL6X 4Q1DA 4DSNA 4FMDB 4X8OA 1FNMA 1NN5A 3EPJA 1N2CE 2IXEA 1E2MA 3IEUA 2LKCA 3K8YA 4FMDF 1G19A 4LJAA 4RZUA 4RY2A 4UQOA 3UANA 1MKYA 1E2IA 1ZUHA 4Q9HA 2GNOA 3I8SA 4GI7A 3WBJA 3IGFA 5KDOA 4II7A 3GJ3A 2VF7A 4ON9A 2QORA 1HV8A 5EP1A 1V5WA 2B92A 1QHYA 1UPTA 3QBTA 1JNYA 4BECA 1TMKA 5SZHB 4R98A 2F1JA 3PUWA 2GWHA 5EUQB 4K46A 4Q1EA 4N0EA 5HKKA 1OXSC 4Y0AA 1TL7C 3RNLA 3KKQA 2WWXA 3M0EA 1P73A 4JLOA 4PAQA 3WBKA 1N6LA 3P32A 3GLGA 4F4CA 1XD2A 2QROA 5GJVC 2JJ1D 1W2GA 3RABA 5JEEA 1DTSA 1JEDA 4XSGA 3H2YA 5FPTA 3EPLA 1E9AA 4F7WA 4I4LA 4O0MA 4H1UA 2GF0A 3EPKA 3QE0A 4TMZA 4M1KA 4PC7A 2VP4A 4AURA 4KAXA 2GBLC 4TMTA 2MMGA 1I2MA 2N42A 3MWLA 2JLZA 2OAQ1 3D31A 4TTQA 2IUUA 4B75A 3DMDA 3CX7A 1JB1A 1HQCA 4HATA 4QHYA 2H5EA 2W6JD 4DSUA 3EZ9A 1ZVQA 2A2ZA 2EVWX 2Q9CA 1TU3A 3IPXA 5FOUA 3CB4A 4NU0A 1ZM2A 2O0HA 2V6IA 1JBKA 1E1QA 2YHSA 4HUQB 1Z2CA 3ZGXA 3KXKA 4ZDJA 3OEED 1LTQA 1XD9A 5BYKA 2CHQA 2YWGA 3TUIC 1JI0A 5DLQC 3RDPA 4TMKA 5CK5A 5FH9A 1NN0A 2FMXA 1AA9A 2R6DA 4LHYA 1AGPA 3QJYA 3ZVLA 3FWYA 3B6EA 3GLFB 1ZMXA 4NKRA 4V0MA 2Q3HA 4MDFA 1S9HA 2OHFA 5F2EA 3T06B 3ZZTA 4AWXA 1G21E 3Q5DA 2QQEA 4DLXA 1W1WA 1NSFA 4POAA 1G20E 1H8ED 2PL3A 4JBXA 1B0UA 4ARZA 3NBZC 3QF4A 2QRNA 2GZDA 2W6IA 4IXMA 1W5TA 1WMSA 2ODNA 3L2OB 5CK4A 3PXGA 3W3ZB 4B2PA 3MJHA 3A1SA 5TDHA 4F91B 2YOGA 1CR1A 1WBDA 4M1SA 4NYIR 1YRBA 4QFMA 5B2ZA 1IXSB 4Q19A 3EA5A 2IS4A 2IUTA 4OQFA 3BORA 5JWHA 1G3UA 1J99A 3KTAB 3SJCA 4C7OA 1CS4C 2VTKA 3B1VA 3VR5A 3W5IA 4Q01A 2PX0A 4BLPA 4GDFA 2ZRNA 4KYIB 3SZRA 1KMHA 5DYGA 1K6MA 5JHHB 3FKQA 2NO6A 4A1FA 2HF8A 2GXUA 2ZE6A 4ABYA 3O8BA 1U94A 1BYUA 1I4TD 4Z54A 2F9LA 3E2IA 1AGRA 4JMPA 4IKEA 2GEDA 1G3MA 2A9KA 3ASZA 1S2MA 2WWWA 3AUXA 3RLFA 4AK9A 1R0YA 1DG1G 3HU1A 1KI9A 3NBYC 5FOSA 4E09A 3X2SA 4XTRA 1Z6TA 2IW3A 5KU1A 3QXHA 4JYCA 5G40A 5SZKB 4W9MC 1N0UA 1US8B 1U2RA 2EU8A 2DB3A 3E5HA 1BKDR 4ZPXA 1NL3A 1U81A 5AR1A 3SNHA 1KK3A 2BIFA 2QP3A 2WICA 2YOFA 2JEOA 2XJ9A 2NO9A 3SHFA 4ITRC 4KXFB 4WZ6A 4I81A 1N5JA 2OEPA 4MKHA 2OXCA 2NIPA 3EPHA 2WMNB 3QEOA 3ZD7A 5A5GA 2O8DB 4K81B 3K0AA 3Q7PA 4L9SA 4M9SA 4R2IA 2EYQA 4AG5A 1E9RA 2REBA 2ZRCA 2F6RA 3LA6A 2ZETA 4M1WA 5JJIA 3PG5A 4MQBA 4EFLA 3U60B 1DELA 1KO4A 2RGNA 5EE5B 4G5OA 1IOZA 4IJMA 1TEXA 1GKIA 2JASA 3TW4A 2V1UA 2ZJBA 3P27A 4M21A 2ZEJA 3Q5EA 1KSGA 1ODFA 1P9RA 3AUYA 4BASA 5CITA 1KO8A 2HEIA 4HLUA 2V9PA 2R2AA 3HU2A 4RZXA 3NG1A 1MH1A 2B21A 3DL0A 1DAIA 4P3YA 5E3HA 4C0AC 4TL9A 4Z8XA 4DBLC 2YKGA 5GJBA 3KKNA 1R0WA 2IYLD 3THYA 5AK0A 1FP6A 1UAAA 3LXRA 4Z51A 2PCJA 3PUZA 3CF6R 3EXAA 4D4LA 3B2EA 4W5JA 1EFRD 4P4TA 2NG1A 3VNUA 4Z8YA 2QBYB 4EIWA 1WQ1R 2FSIA 4WXRA 3FMOB 1MO4A 1O87A 2QGNA 5FTLA 3U3OA 2QSYA 3BFXA 3THWB 4LHZA 2BCJQ 4QC2A 1ZM4A 3LW7A 4V0NA 5DGXA 3HR7A 2CXXA 1GOTA 1JR3A 2A30A 4D2IA 2GA8A 3FPAA 1JEEA 3BD9A 3IILA 1X3SA 2IYSA 4Q4HA 5E95A 5BW8A 2VYFA 1NBME 1M8PA 1F2UA 4IDHA 3OAAA 4KVGA 1GRQA 3TUZC 1TF5A 2ECKA 2A5JA 3NXSA 1PVOA 3QKTA 1U8YA 2J0QA 2PLFA 3QQ5A 4TLAA 4YC7A 2NGRA 3EA0A 1I4LD 1CTQA 1VCIA 1XTJA 2P5SA 5FBRB 1A5TA 1ZP6A 3ICQB 1KK1A 1W2HA 1N6NA 3ND8A 4UXIA 5HPYB 1M7GA 2XXAA 1KGDA 2X2EA 4GRAA 4PPNA 4AI6A 1RRGA 2Q3MA 5HE8A 2ODWA 2XJ4A 4J0QA 2ZJ2A 4U5XA 4BWYA 1M34E 1LNZA 1S3GA 5EE9A 4L16A 2XTMA 2MSCB 2F7SA 3C7KA 4L15A 1U0HC 3MG9A 5EZ5A 2XOKA 1UFQA 2P2LA 2JCSA 3B78A 3D8BA 3N5CA 1SKQA 4LJ5A 1BYIA 1D9XA 5P21A 2FFAA 4TLCA 2ZI4A 4DDTA 3OIVA 1Q1ZA 4IVQA 4JVSB 4A8JB 4IOMA 2RAPA 3ZVRA 2WSSD 1GRNA 1CEEA 2HXYA 3N70A 2GVDC 5ELXA 2NMVA 4XWOA 1KOFA 1X8JA 4A0HA 5JMTA 3U7FB 1HY3A 5FBWB 1YZQA 2NZ8A 4CEJA 3TLXA 4AKHA 4LY6A 4Q4AB 1QG2A 2ORWA 1ZNYA 2EFGA 2AD1A 2QPTA 3CR8A 4XSHA 3TE6A 3HPRA 2ZU0C 4JBYA 1IN8A 4L4UA 2O8BB 1YR9A 2QN6A 5C4GB 4D4JA 1II0A 4TQUS 3TMKA 2QY9A 4X8HA 1Z47A 2C77A 2XZLA 3TGPA 4HLDA 3LQRA 4CT4B 4PR0A 2CCJA 4QBGB 4JLNA 3VR3A 5L3QB 2ZI3A 2IF2A 1IAQA 3CNLA 1D2MA 4A8JC 3BH7A 3L0IB 3KQHA 2CE2X 3HDTA 5JFGA 5TXGA 5DHFA 4EPXA 2CVFA 3NDPA 1KK2A 3DM5A 4DLWA 1VKJA 2BCGY 3EZ6A 4TL6A 2CJWA 3GLHE 2ANBA 3QOFA 4XVUA 3QKUA 1WRBA 4US0R 1EFTA 2QPAA 5DI3A 4D0LB 2ZRBA 1FZQA 4C2UA 4LRWA 2R6AA 2GCOB 4NTZA 1KY3A 4R2HA 3AQ4A 3U61B 1ZD1A 1AN0A 2P6UA 3M1IA 3K9NA 4TYYA 4HDOB 1KZ7B 2XB2A 4JT2A 1RJ9A 1U0LA 4M2LA 3SFVA 1GTVA 3LD9A 1L4YA 4YDHB 2OM2A 5DYIA 3CLVA 4LK2A 1SVIA 3R9IA 4DLRA 3UK6A 3L8YA 2LWIA 2QAJA 4FMBB 3DPUA 2HF9A 3VR6A 2G77B 4OJQA 1XRJA 3MSXA 3VHXA 5KTYA 1E1RD 3RRYA 5FUXA 2ZRKA 1EGAA 1L4UA 3VU9A 4A9AA 4IOJA 1G8PA 2AD5A 2WJHA 4URUR 1P61B 1TF7A 5FTJA 3ETLA 1IJFA 2ODBA 1WF3A 2OCAA 4MGIR 2DCUA 3FE2A 1I4DD 4D25A 1OFUX 3FDIA 4G3XA 1UJ2A 4HB2A 1E0AA 1Z07A 2WKQA 4G0NA 2CVHA 2PT7A 4PHFA 1NVUQ 3ZQJA 2J7PD 5J4HA 1N0VC 3WMEA 4HB3A 4CW7A 4PQFA 2W0MA 2GBLA 2GCNA 1W5SA 1U8ZA 4EPRA 2QPOA 3IQXA 4DCUA 1XPUA 4AIIA 5FFMA 2CMKA 4JT4A 2WJVA 2Q3FA 3W34A 5TVKA 1P6XA 5AUPB 2QP4A 3R8CA 1ZM7A 4EQ6A 5GVSA 1MRNA 2G6BA 2QM7A 2DWPA 2DY1A 4QHTA 4MRNA 1NG1A 2JA1A 3B9QA 4GNKA 1XZPA 2HJGA 4DLYA 4C0BA 4AYTA 1OH6A 1Z0IA 3AKDA 1G9XA 4KYUA 2IT1A 2XZPA 2HYIC 1LF0A 4QM6A 3T1TA 1KAGA 1KJZA 2H57A 5F9HA 3AF2A 1N0WA 4Q1BA 4LI0A 4AKEA 3BFKA 5JCZA 2BM0A 1SVSA 3FFAA 2HLDA 2JIZD 2REOA 3QG5A 2ZAOA 1XU4A 2JLRA 2V8OA 1ESNA 2X19A 1TPZA 3PQCA 4G1UC 4RSGA 4Z1MA 2J46A 3T35A 2BKUA 2V55B 2ZRHA 3I1FA 2GZAA 2B8TA 3KJIA 4EPTA 2FX3A 4HAXA 2BBSA 3AP3A 4YONB 3KKOA 2PJRA 4JSTA 2FOLA 1IHUA 1KSHA 1YZGA 2RB4A 5A0FA 4X8MA 4OK5A 3QEJA 4HI0E 1EX7A 4Q48A 4KHZA 5FL7D 3TR5A 1G8FA 1UDWA 2AX4A 4BRUA 1KIMA 4DKXA 2ZRAA 3MRSA 2WHXA 1Z28A 2BVNA 4KSCA 1IXRC 1GP2A 3PIRA 4LJ4A 2YOHA 2WVJA 3SC3A 1P60A 4MYUA 1UKVY 1OE0A 1Q3TA 2VHQA 5BN4A 5LD2B 4TT3A 3VKGA 3IO3A 5L3SA 3WNBA 3BE4A 2ODEA 1YE8A 2ZI6A 4JLPA 4PO8A 2VSXA 3OESA 4LHVA 3C14C 1A1VA 4KITB 1SXJE 2DHRA 3QKSA 4AYXA 3RS2A 2BM1A 4IW3B 2R62A 5FOXA 2WWFA 4HZUA 5EJEA 1XXHA 2GCPA 4DC9A 1W0KA 4QJ4A 2J9RA 4I1SA 1W7AA 1XEWX 2QRZA 2IS1A 1ZIOA 2A3RA 4B3XA 3A37A 4GZMA 4RCZA 3SI7A 2QTFA 4LX0A 3PITA 3HJNA 3T12A 1EG7A 3BH0A 4H9GA 4A6XA 4AD8A 2NOAA 1H8HD 5LD2C 4A0FA 4QJ5A 4PZYA 1Q44A 1E99A 4URWR 1E9DA 3NEJA 1FX0A 4L5BA 2WZQA 2C99A 3I8XA 3X1XA 2VO1A 2B8WA 4U02A 2N1BA 3RSOA 5A4JA 1EFHA 4CT5A 3GJ8A 3KQUA 1Z0AA 2PZFA 4W7SA 4XWAA 1WE2A 1L2TA 4O3MA 1Z06A 5AJZA 3RAPR 3I62A 4GOKA 5KSYA 4YMSA 5JHGB 4WVFA 5IK2D 4HZIA 2AL7A 1S3SA 3EIHA 1RRCA 3U3RA 3LY5A 5C2JB 4M22A 2EYUA 3I4LA 4DRZA 3LVQE 3BFVA 1WDTA 1UEIA 2CCGA 5KUTA 2FSHA 4Q7JB 2VP5A 2JDIA 4Q9KA 1FMLA 3ASYA 3B8HA 5CLQA 4LBVA 721PA 2WPDA 2RMKA 3C8UA 3AKYA 4M1TA 4EUNA 1MABB 1SZPA 4DDUA 2OFWA 2I3BA 2VP6A 5L3RA 1XMIA 1R6BX 4B32A 4GZLA 3ZZ0A 2B6HA 2Z6VA 3F8TA 3B9PA 1CR2A 3MAAC 3NIBA 2ZSDA 2WMOB 3U4QB 3BB4A 4NBSA 2FPLA 5FOWA 2REXB 4XIGS 2VL7A 1VIAA 1JPJA 2WJIA 4B47A 1WCV1 4Q03A 4IFBA 4JIMA 1MT0A 3H0KA 4FW9A 3W6OA 1OF1A 5JWRA 1QG4A 5JEDA 2QM8A 3KQNA 3MWJA 3NH6A 1BH2A 1R8QA 1QVAA 2IYQA 4KVAA 1E4YA 4MUAA 4PSKA 4YMTA 3NC0C 1OHHD 4LYAA 1O3YA 1J2JA 2OFXA 2OG2A 2ZS7A 4Q1CA 3SBDA 1I2DA 3W8RA 4ZIRB 2ZU6A 3N2EA 1HA3A 2QUZA 3OEHA 2DR3A 4Q7MB 2CL0X 2BBOA 3OAAD 3FMFA 4KFSA 2E1RA 2ERXA 4IHQA 1CR0A 4DLVA 1C9KA 2W2TA 3NKVA 4IDOA 1G7CA 5J5CA 1E94E 3S1AA 3GEEA 4A15A 2I4IA 3GFTA 1GSIA 4YMVA 2IYYA 1II8A 3GLIA 3LAWA 4XH9B 5D3MB 4MUBA 4KSBA 4CIDA 1W36D 1T3LA 3AB3A 3K9LA 2OZEA 5G53C 4RD4A 3U6BA 3GLGE 2ZRPA 2GTPA 2Q6TA 3CUEF 1DG3A 1P2VA 2O0KA 1W4BA 1XMJA 1IQPA 2XSZA 3CR7A 3OHMA 4RZ3A 1R5NA 4N1AA 1AIPA 2RGCA 5FTKA 3TAUA 3G5UA 4CEIB 4B6FA 3R7WA 2J3EA 1KO1A 2FPKA 4A6PA 4NZYA 4EPWA 3WHLA 1ZM3A 3UG6A 3SQWA 5F3WB 3RS0A 2YYZA 3CPJB 1M1YE 2IK8A 5BN5A 2WWGA 1T8UA 1NJGA 3DOEA 4RD0A 3GJ0A 1G3IA 2D74A 2YINC 3CM0A 1HURA 2YNMA 5EE3A 1UBCA 3VHLB 4URVR 1X8LA 5DN6A 4DT1B 2XNDA 2G0TA 4IVPA 2WOOA 1NBMD 1TQ2A 4P4SA 2YZ2A 5JSZA 1BMFA 1FQKA 3KUCA 1D8TA 3T5GA 1T3SA 4LC0A 1E0SA 4QGFA 2IS6A 4MYTA 3OIUA 2QENA 4URXR 3F0TA 2IL1A 1ZBDA 2FNAA 4S35A 1XPOA 2P0EA 3CIOA 1LFDB 3W8NA 2O8CA 2ZS8A 1W4AA 3DVLA 1ZJ6A 5HZHA 2OBLA 1YZKA 2ZYVX 4AG6A 2Q9BA 3GLHB 5JCPA 5EXSA 1JAIA 3QSYA 1DOAA 2BJVA 3OIWA 3AVQA 3QBVA 3RYTC 4DB4A 1YZNA 2IYRA 1F6BA 1P7CA 2FDCA 2IEZA 2LKDA 3I72A 2GETA 5H68A 3EZ7A 4TQAA 3RS7A 4TLBA 3SU8A 4MRVA 3IDQA 1SHKA 5EXTA 1XTRA 2VHCA 3ZIAD 3U2QA 1OT3A 4BUJA 1NIPA 5EE0A 2O8FB 3W5JA 3I5YA 3AKEA 3UXMA 1NY5A 1FW6A 1CRPA 1G5TA 2IHBA 1M6NA 2MMCA 2PMDA 2WWYA 5FOTA 2IXGA 3BRWD 3UKDA 4U7DA 4M9XA 5K8UA 2F3RA 4I1OA 3I5XA 2V3CC 1OXVA 2PCLA 4PHGA 1WB9A 1GKYA 1UBGA 3UMSA 1OKKD 1GL6A 3J81k 1XF9A 3QY0A 3TBKA 2J5XA 2QAGB 3DM9B 1G7TA 2NPFA 1YQTA 4MKIA 4JKYA 1Y63A 1KI7A 4DCTA 5B58C 2O8EB 2X8AA 3BH6A 4JLAA 3AVUA 2WTUA 2ZJ5A 5JI3E 2HT6A 1W44A 1J8YF 1Z0KA 2F55A 3A58B 5FR1A 5C18A 2F1RA 2JLQA 2J1LA 1G4UR 1FTNA 3AGPA 2A5GA 2GF9A 4B33A 2FG5A 1KNQA 1T0JB 1VCMA 3BB3A 4BFVA 2QT0A 2JLVA 1DADA 1U9IA 1DPFA 4DLTA 5JBQA 3LBIA 3A1WA 3LRPA 4LYHA 4D82A 4M1OA 1GWNA 3GQBA 1QF9A 4A2PA 4TZ0A 4QJ3A 5G3ZA 4IOKA 2PJZA 4TLEA 1FUKA 2QAGC 1U8AA 3M6AA 1XZQA 2D2FA 3OFND 3RHFA 1QHHB 3BWDD 4RFSB 1XTKA 1SGWA 1XTIA 5HZKA 1UKYA 3NC1C 1AS0A 1OSNA 3NWJA 2ZI7A 1G16A 4IFEA 1HUQA 2JLSA 2ZYUX 1E2LA 2RCNA 2D3WA 3OE7D 4NP6A 2C9OA 3REFA 1E4VA 2AWNA 1AQYA 1K5DA 5EXXA 5EUMA 4W5HA 2E87A 3TSZA 4ZCLA 4EJSA 2DFTA 1U99A 4NYMR 1Z0DA 1P4SA 1TEVA 3W6NA 1TAGA 1VIYA 3ZQ6A 3BAFA 2UVQA 2GJ8A 2IA5A 3VX3A 1R2QA 121PA 1XP8A 4PC6A 1E98A 1ZINA 3EAQA 3RWOA 1PUJA 4JLBA 2JATA 2HLDD 3O8CA 2W83A 2P67A 1NLFA 1RRFA 3MUFA 4PZLA 2NO1A 5HR5A 4AKIA 2OLKA 4RCYA 5LPNA 3V4RA 2D62A 1VDZA 3IUYA 4OQLA 3ONWA 3B1WA 3K0EA 2BC9A 3K0FB 1AZTA 1P75A 2BWJA 2RHMA 4MRSA 1W48A 3B5JA 3GEHA 2JLWA 3AKCA 1JR3E 3WRXC 1F2TB 2V6JA 3GJ6A 1SXJB 2IYVA 3Q7QA 4N3NA 3SEAA 4FCTA 1XJCA 1RC8A 3D7MA 5LB4A 3KQKA 1XCGB 2QG6A 3AP1A 3RS4A 2OFOA 5IF9A 1UKZA 2AXPA 3UMFA 3D3QA 3MCAA 4OQXA 4WAUA 3ZDQA 4E07A 1VYTA 5LBIA 1Q1QA 2ZE7A 1E2GA 3LWNA 1Z22A 4E22A 3ADDA 2C03A 2B7CA 1W46A 5KNDA 1GDDA 1L8QA 2J41A 2AK2A 3QVUA 3FHOA 1PLKA 3WHKA 3EC1A 4FCVA 4B76A 2RGGA 1NRJB 1OYWA 2R6FA 1GZSA 3B1ZA 4QBHA 2JJ2A 3GD7A 4UNPA 2OSBA 4BLQA 1P2UA 2ZSEA 4PPFA 3THXB 4PZZA 3K0CC 1UKEA 2H92A 4MDEA 4ASUA 2ZR0A 1FOEB 2QMHA 2NO7A 1OV4A 2F1HA 2G88A 1TX4B 2OO7A 3JZMA 4A4DA 1E2NA 3RANA 1SXJC 1TUIA 1P62B 1W0KD 1XDBA 3DZDA 1AS2A 4Q4JA 3SN6A 4DUGA 2AKAB 3MMPA 2OILA 3RS5A 3BIFA 3EC2A 3N2IA 3ZLJA 2AWOA 1D9ZA 4EAQA 3CNOA 5FI1B 1ETUA 1FTSA 4OHXA 1E79D 1OXXK 4TYQA 2V1XA 1GAJA 4NH0A 2ZROA 4MYCA 1D2EA 2H17A 4US2R 2J0SA 3DZ8A 5H70A 4O2RA 1LS1A 2FJUA 2ZRMA 4CEHA 3ZJYA 4R71A 1MR3F 2VLIA 3U44A 1Z83A 2C9CA 3PV0A 2VRWA 2J0UB 4UJ3A 5CYOA 2DFLA 1Q3HA 3QF7A 2ONKA 2ZYTX 4HDQB 2FA9A 1GM5A 3U3KA 3ICEA 1AK2A 1MOZA 2C9YA 3LLUA 1CJUC 3CPHA 4KCGA 1G41A 4LOAA 2KSQA 1N5KA 5EP4A 5FTMA 3WMGA 1OW3B 1XEXA 2WIBA 4LJYA 1SXJD 4PPGA 4FI3C 3CF0A 4DLZA 1E2QA 3CF2A 1E9SA 1GITA 4B3CA 2GJKA 3HWSA 2ORVA 4WW0A 3ZH9B 3Q72A 1VPLA 2D4HA 4JLKA 4C0LA 1Z6YA 2EQBA 4DDVA 4IDPA 3SS8A 4OQMA 3LLMA 4LV5B 5CB8A 2A78A 1CRQA 1KTVA 2CCKA 4M9ZA 3HP1A 1B23P 1SVOA 2V7QA 2IYUA 4BZXA 4PAOA 5E7JA 1DVRA 3AVOA 2NPIA 3KX2A 1KI6A 2VIIA 3UWKA 2RGBA 4WIAA 4FWTA 1S1CA 4NPHA 3U7GA 1ZU4A 3T5DA 1PLJA 3QPWA 4K8OA 1KKMA 1E2PA 1ONBA 3SHWA 1G64A 1T8TA 3CRW1 1J7KA 1P72A 2A7QA 2Z83A 3WNDA 4DEYA 5DNYB 5JS7A 2CNWD 3JZAA 4F4IA 2A5FA 2AXNA 3BS4A 1G7RA 3UATA 4IXNA 3U5ZB 3GLGB 1Q20A 1G291 4OHWA 2OXRA 1XD2B 2ZRDA 3EG5A 1OXTA 821PA 1E9FA 2OAP1 3I3SR 4LC1A 2QE7D 3RRMA 2VSFA 4PHHA 4DXAA 2WM9B 1DAEA 5H8WA 4ERNA 4BLSA 5L8VA 2VHJA 4KO8A 1W49A 4Q1AA 4ZCMA 5KSZA 2X2FA 3KXLA 2JJ1A 2DFKB 5KO2A 2GK7A 3GCGA 2D7DA 4TSFD 3MWYW 4TMWA 1X8KA 2WOJA 4JKIA 4NCHA 4S2EA 2NTYC 3R8FA 3EW9A 1AKYA 4FWIB 4IRUB 4C30A 2G1KA 2HUPA 5AJWA 2HYDA 1EWQA 3PFIA 4LBWA 2FEOA 2ZS9A 4UNSA 5IDVA 2XSZD 4UXHA 4WZBE 2C96A 4MRRA 3OIYA 3LVRE 5DI9A 1Z0FA 3LX8A 1COWD 4FMCF 3K1JA 1VECA 3FVQA 2ZRJA 5K8IA 1EX6A 2W6JA 3QENA 4Q18A 1KMQA 1G3RA 4IVRA 4TQ9A 2ZTSA 4JBWA 4BPBA 2E9SA 3V4FA 3KL4A 2C8VA 1Z6GA 3L43A 1NMZA 5JI2E 1LY1A 3VQTA 1NLYA 1SVKA 3OEEA 4DSTA 1D2NA 5HCIA 2ZAMA 2WBLC 3FMIA 3TRFA 4C3ZA 3AP2A 2C04A 4O25A 3ADKA 4ARZB 8OHMA 1NKTA 4ACAA 1NVWQ 2DFNA 1DEKA 1E69A 3QF4B 4MYHA 4NMMA 4UNQA 1T6NA 1TNDA 1H8EA 2XX3A 3PEYA 5HKKD 4RKFA 3AVTA 1R0ZA 4JVNA 2L0XA 4LV8B 3QI2A 1OLOA 2ZR9A 4GT1A 5JJLA 4C7OB 3GEIA 1TQ6A 4G5GA 5B64A 1Z6XA 3ZS8A 2NO0A 1E9CA 1Q1EA 4JZKA 2DBYA 4A82A 2GXSA 5L3VA 1TADA 1KMHB 5J4VA 1KDTA 3SR0A 6Q21A 3WP1B 2UKDA 3VR2A 2Z5FA 5UKDA 4TMVA 2ANCA 3JVUA 3IIMA 2IF0A 4IEIA 4NHOA 4LSGA 2CBZA 3L0OA 2IXFA 1SKYE 4LHWA 2XZOA 1BIFA 4TYPA 3B7GA 1DO2A 2H7VA 5KDDA 1CJKC 2ZXUA 4A0GA 4PSAA 5GJCA 3ZVNA 4DZZA 4LDJA 1OIVA 1E1QD 1VHLA 2FFHA 5BQ5A 1IXZA 1R8SA 2GXQA 3GFOA 3A1TA 1RRPA 4M1YA 4MGZR 4OI2A 5AUQA 1ZCBA 2QEQA 4I1UA 1P9WA 1PZNA 2HXSA 4QRHA 5F9FA 1OH8A 2O52A 1HT2E 1T5LA 2P65A 4KBGA 3WXMA 4HUQA 3LBHA 3C5CA 3IPYA 4PAMA 4WZAE 3K0AB 2QNRA 3TVTA 4DCVA 4QM7A 3JVVA 1RPZA 1C4OA 1YU9A 3MWKA 2VP2A 4TL7A 3A6PC 1KDPA 2BBWA 4TZ6A 2AKYA 1G6OA 3BGWA 2FH5B 4DHEA 2W6ID 3GLFA 4OK6A 2G0NA 1FL9A 2ATXA 5FTNA 1T0HB 1E9BA 2KBEA 3EWSA 3TQCA 3IIJA 3C4JA 4PX9A 3SJAA 3L82B 3V00A 2ZI9A 3LO5A 1XJ0A 4HYYA 1YHNA 5KOYA 1RYFA 4E03A 5CIWA 3AF1A 1P2SA 3GMTA 2CEAA 1Q12A 2H18A 2WSMA 5KPDA 1JECA 3ZD6A 3RC8A 4LJ6A 1W0JA 2QL6A 1JQJC 3BXZA 3CX6A 5GJWC 2K5UA 3W9YA 1E2HA 2YC4C 4Q1FA 4C0QC 4DJTA 1VG1A 5FPYA 3K70B 5TV2A 3THYB 1MO5A 4OKSA 3KTAA 5LB2A 4HB4A 2PT5A 1KJWA 2GRJA 2C78A 1GNPA 1IN5A 3K9GA 2TMKA 1Q57A 2Q0HA 3TAHA 5G3YA 1VCNA 3QKRB 4EPYA 2ZE5A 3DDCA 3B60A 2DWOA 2RGNC 5FR2A 1R5OA 4KFRA 1EFRA 4CRWB 3HU3A 1CP2A 1E2DA 3X1DA 2R44A 1KI8A 1QRAA 1XWIA 1FP7A 1FPMA 4HLQB 4Q4HB 1F2UB 5FUVA 3IKJA 5CJPA 2EWWA 3R9WA 4IEEA 4XVQA 2ASEA 1CJVC 4HLUC 1E96A 5SZJA 1N6PA 1G8HA 3IHWA 2GJ9A 4HLCA 1NMYA 4A0RA 4RD1A 1RE0A 1ZCAA 1US8A 2DYKA 4DSOA 5C1BA 3TVDA 1OYYA 3K70C 2FWRA 2CL7X 421PA 2ZITA 3P20A 1JJ7A 3UPUA 1W36B 2ZREA 4Q02A 4C0HA 2FFBA 2ZIAA 3Q3JB 4C0SA 2ZUCA 4CYMA 1S0UA 2XXAB 1N25A 1FNNA 1P5ZB 4FD2A 4XD7A 4YQFA 2EWVA 3K0CA 2O8DA 1G3QA 1QBKC 3GPLA 1R0XA 2GZHA 3KKPA 4PO1A 4LUCA 4Q47A 3ADBA 3FOZA 1II9A 1EK0A 2J0VA 1T91A 3SE0A 1T5IA 4B73A 5FBVB 4PHTA 4M1MA 2N46A 1E0JA 3MD0A 3GLIE 1GIAA 2QZ4A 3HYRA 2PBRA 3K9HA 1UEJA 4LJ9A 1IONA 3SFZA 1XJQA 1XTQA 1PJRA 1UADA 4KBFA 4NYJR 3K70D 1A2BA 3NH9A 1SULA 1W36C 4ZI2A 1OB5A 3HPQA 1R4AA 3PUYA 4CEJB 3V9PA 3CH4B 2WSSA 4US1R 3RWMB 4W5WA 2C2HA 4DIDA 1LS6A 2R6CA 1S96A 1YR7A 1NNEA 2AN9A 2AK3A 4BE7B 1DS6A 2IYXA 1S1MA 4EPVA 2ZANA 4U00A 4JJZA 1S4QA 4QBFA 1PUIA 1Z2AA 2QQ0A 1JR3D 3HR8A 3LH5A 3TSWA 2QBYA 4GL2A 3AVPA 4EFMA 2CLCX 3VFDA 3VAAA 2ZQ5A 3THWA 1JXMA 2BMDA 1QHSA 1JXOA 4PQRA 1W4RA 2P3SA 3KJEA 3SDZA 2BBTA 3QXCA 1BO6A 2MSDB 3X1YA 1IJEA 3TW8B 3REGA 4TL8A 2ZYWX 3H4MA 3BERA 2WJGA 4JL5A 2CJWB 3RRNA 3SJZA 4WXPA 3EIEA 4DB2A 3K09C 5DI3B 1ZYUA 1ZC4A 1CU1A 4A2WA 4ZKDA 5CM9C 4LBYA 3OF5A 4DIEA 2ZRIA 2ZSBA 2FU5C 2PZEA 2XTZA 1J8MF 1RJ9B 4BLTA 1OFHA 3DMNA 5CB6A 3PVSA 2G3YA 4NCNA 2XOKD 4QGAA 4Q9IA 3BBPA 4GMXA 4LHXA 5BN3A 4LYFA 3A1UA 2XAUA 1Z5ZA 4A2QA 1VHTA 3PEUA 4BFXA 1XEWY 3BC1A 4JSYA 2UZIR 1ZC3A 2CLSA 3SOPA 1AM4D 3FTQA 5JRZA 2FN4A 2IYTA 3VU9B 1N5IA 2QI9C 1N6HA 1NVVR 1RIFA 3KB2A 2ATVA 2ZJZA 1NF3A 4G01B 4NYMQ 4A8JA 2WV9A 1JALA 1GG2A 1E1RA 3CNNA 2WKRA 3WY9A 3UWOA 3B13B 1KI1A 2RGXA 3B85A 1EFCA 3FYHA 4B44A 1IY1A 3H86A 2BDTA 2XGJA 3PUXA 4Y0VA 2FV8A 1U0JA 2PEZA 5CM8B 1E9EA 5K8LA 3PR1A 4V0ME 4RJLA 4Q4AA 1UM8A 2P5TB 1UDXA 3B1YA 1IY2A 1YZLA 3AF3A 1E2EA 4D80A 4AY2A 2OBMA 3R20A 4DCSA 4OHVA 2J7PA 1ESMA 4D6PA 2C95A 2VHUA 4DVGA 2O8BA 4EQ6B 4I1VA 4QG7A 3P4XA 1MV5A 2I1VB 3DOFA 3AEZA 1KI2A 4HAVA 5M04A 4AKGA 3ND9A 3A8TA 1R10A 2J59A 1LV7A 3F5FA 1RYHA 1QHXA 3T1QA 2ZSFA 5DE3A 1DO0A 3RS3A 2EFCB 4D0NA 5L3QA 5JZVA 2HCBA 5CDFA 4JS0A 1XTSA 1DE0A 5DSZA 1DAMA 1OXUA 1TF2A 1XD8A 5BYJA 3TK1A 2EFHB 2ZSAA 3KJHA 4KLNA 4BZQA 4HAZA 2QT1A 2V4ZA 2DPXA 4HAWA 2OCBA 1J70A 4MGYR 4L8GA 2C98A 2OE2A 3MJRA 1RW4A 4QGGA 1F5NA 2GCOA 4P4UA 4PSVA 1A7JA 1HE8B 1U98A 1WXQA 1OFIA 2FFQA 2JIZA 4JL8A 2BJWA 4CF7A 1EXMA 1E6CA 2VA8A 4YXWA 4JVMA 2GEUA 1G4AE 3DO6A 5J4KA 3CZPA 5KPJA 1N6RA 5HTKA 2Q9AA 2ZM5A 2GAOA 4HUTA 1G8GA 2Z0MA 4C2TA 1CIPA 3KXIA 3X1WA 1K8RA 1T3HA 3ZS9A 1ZRHA 3VX4A 4FINA 3AH8A 2AR7A 5FL7A 4RD6A 4B43A 2GEVA 1M74A 4QL3A 2FSGA 1X86B 3THOA 1XBTA 4LJ8A 2F43B 1F3OA 1S9DA 3Q85A 4ZDIA 4NE2A 5L3SB 4MKGA 4CGZA 3ZYCA 4M0LA 5JLJA 3CRMA 1VG0B 5FBQB 2BOVA 2GVZC 1G18A 3NBXX 4ZO4A 1OH7A 3DKVA 3W3AA 2Z4SA 4MH0R 3P4YA 1SKYB 2FZLA 5KDLA 5JS8A 3QKSB 5JJKA 2FZ4A 4GFDA 4B3DA 3H84A 4B3GA 1XX6A 5J40A 3TIFA 1ZUNB 3RVBA 1RKBA 3QVVA 4GSYA 4HZUB 1XXHB 5AWFC 1QVRA 2R8RA 3QNUA 4D4MA 4MRPA 3I73A 5DIFA 1UBFA 5GADl 1NG9A 2YJTD 2JLXA 4LV6A 4ZCIA 4F92B 1CJTC 3PUVA 5KYKA 2RGDA 3CRRA 2H8KA 3NEYA 5AJXA 3PEVA 3VR4A 1H65A 4WBSA 4CZ2A 3QXJA 5ANRB 1SVMA 1A82A 4B6EA 3CKLA 1FX0B 4Z1MD 2OESA 5EXPA 2BEJA 1JAHA 4LWZA 1F60A 1SQ5A 2BEKA 3KKMA 4Q7LA 1H8HA 4YLGA 2VH5R 3KUDA 221PA 2IWRA 4IOLA 1F48A 3EWAA 4DWJA 2QA5A 1Z08A 5F98A 3WMFA 4JLVA 3AGQA 1NI3A 2OBNA 4F93B 3IBYA 1KO7A 1WBBA 4UKDA 1SVLA 4JLDA 4TLDA 4D26A 2ZJOA 2ZUDA 2WWHA 4NCKA 4KLZA 2PLRA 1KJYA 5IK2A 2CHGA 2EW1A 4OHZA 2A5YB 4JYBA 4NDZA 1GUAA 4QNMA 2PMKA 4TT3D 2PH1A 2ZVPX 1ZM9A 1P3JA 3CPEA 4DLUA 2GILA 4XVRA 3ADCA 1W47A 1ZU5A 4DDWA 4BGDA 4PFSA 1OIWA 1NSTA 5FUWA 2CHVA 3IBGA 4TWZA 2XEXA 4XOIA 4C4PA 1TQDA 5AUNB 2VBCA 3PEWA 1CKEA 3NBFA 2WIAA 4CVNA 1HT1E 1W0JD 4LJ7A 2G1JA 3M4YA 1XEFA 3B1XA 1Q0UA 4PC2A 2Z43A 4P31A 3TJZA 1Z63A 4JVLA 3C41J 3E1SA 3TKLA 3T34A 3IEVA 4GPTA 4XJXA 1ELOA 4PQYA 3KQLA 3DHWC 2I1QA 4BFYA 1UBEA 1E0KA 1NVXQ 3HYTA 4B2IA 5LDDC 5CJ2A 3RC3A 4BLRA 2HCJB 4BZPA 4OJKA 4BLOA 1AJEA 4E5UA 1RFLA 2D06A 1FUUA 3FFBA 4BEJA 3GP8A 1D5CA 2XB4A 4HAUA 2VQSA 2YWFA 2B7BA 5FPKA 4URYR 4RD3A 2AFHE 3FKSA 4URZR 3QKRA 2ZJAA 1G6HA 2OCPA 3TSOA 3NTUA 1WA5A 1OHHA 2W0SA 2J45A 2GK6A 2WAYA 4G5SA 1ZNWA 2WJYA 4KFTA 3AV0B 3CH5A 1JJVA 3TQFA 3S1AB 2XNSA 2EFEB 1IN4A 2VHTA 1TQ4A 3GLIB 3CW2A 1II8B 1E32A 2GJSA 1X6VA 1DAHA 3U7HB 3U7EB 5E7MA 4OL0A 3FGNA 1R7RA 3QXXA 3AM1A 3CO5A 4R7ZA 3EIQA 1RZ3A 3NHAA 4M4SA 3LX5A 4XD7D 4PTLA 1AZSC 3TR0A 5TMPA 3R7WB 1ANKA 3MGCA 3T1OA 1HEIA 1NIJA 2PX3A 2OT3B 1NN3A 2QP9X 4PC1A 2FSFA 1NY6A 2JDID 4QKQA 2R65A 2WPDD 1LB1B 3FB4A 2ZRFA 3A4NA 3DKPA 4IDNA 3Q8XB 2CK3A 4IDQA 1DARA 3KDSE 3RRZA 1KK0A 4PC3A 4B3FX 1D6JA 4GMDA 1FQJA 1M7HA 4KFUA 4P33A 5J4LA 1ZW6A 3FHTA 1XCMA 1MABA 2ERYA 4MITA 4P4SB 4V0KA 5JSZB 2YV5A 3LBNA 1PV4A 4MGKR 4EDHA 1YR8A 1ZNZA 4QNRA 2AHOA 4V03A 2JLYA 4TMXA 3VNVA 1P9NA 1AKEA 2O8CB 3GJ5A 4RD2A 1QHNA 1NBMA 2ONJA 2QU8A 3U4QA 4OI1A 3K53A 1E2FA 3A36A 2DWQA 2FGJA 1E2JA 2GHIA 1KNXA 4C0JA 4OI0A 1G8YA 3B82A 1OFTA 3VMFA 5E4FA 2WWIA 2C5LA 3K09A 2H1LA 3VR1A 3L0PA 4LPSA 1GRRA 3A1VA 3OEHD 2ZI5A 1DAFA 1T9HA 3GJ7A 4B74A 3MLEA 2A5DA 3NVAA 4HB0A
chains in the Genus database with same CATH superfamily
3L1VA 2RH9B 1TD1A 4ZANA 1VYVA 1HTTA 4RE5A 2QD1A 2D7CA 1V43A 3KEQA 1P0PA 5AVYA 4Q9NA 3BQ9A 1C41A 1DBVO 9GPBA 3DR3A 1RI3A 2GKSA 3IQWA 4ZO7A 1INLA 1MIOB 5E0KB 1I0ZA 3GCXA 1OIXA 3HXMA 5DM1A 1QRDA 5BR7A 1XIVA 5KC8A 4U6NA 1H1LB 1WBJB 1CF4A 4RNDB 4F4UA 3PF8A 2DHEA 3A4TA 1FBNA 1U1FA 2WT8A 4FMCB 4INAA 4KJZA 4N9WA 1E3IA 3LT4A 4L9WA 3U81A 1YK0A 1JHMA 3CISA 3FNFA 1E6WA 1VYUA 2CE7A 3GGSA 4FLEA 4FYPA 3FNEA 5EZ6B 3KZ1E 3BK7A 1M54A 3HXTA 3WJ7A 4YRZA 3I61A 4WPGA 4GBMA 1Z6AA 4JGIA 3O2NA 1QR2A 3NIDB 5K0GA 1VSBA 4GOLD 4QTTB 4KXQA 1RP1A 4XB1A 5AH0A 3L92A 4I2NA 1QK4A 1DX6A 1O6BA 1SZDA 2ECFA 2ST1A 2FK8A 3PHJA 4NNPA 4OYHA 4CM9A 3OU7A 2ZUFA 3K8QA 4FCWA 4X91A 3OJWA 4CEIA 1CUDA 2VDUE 2PZGA 4MEJA 1KO5A 1V4VA 1XLWA 2OLEA 3AX6A 3LS2A 2OZLB 2G5TA 2GLXA 3UMVA 1FJGB 1MXHA 1UWLA 1JDBC 1UXOA 1V8FA 4JJKA 2ZUEA 3T15A 1XFAA 3NHUA 1H66A 3SVZA 2HHJA 4AZTA 1C7JA 4PIVA 2XMCA 4BYGA 3G82C 4DT1A 1RLTA 1UM9B 1X1SA 5DHAA 1N2OA 5THQA 5E8RA 2P6NA 5JRJA 4BUZA 1NE2A 5IT5A 2VCEA 4DLSA 5DLEA 3OJOA 3L8ZA 1IHOA 1ZR2A 5DX8A 3GT4A 4YPFA 5BWOA 3UGQA 4M7PA 4RXMA 1H69A 5ALUA 4EG3A 1N32B 4Y1EA 4HNVA 3EGEA 4Q21A 2X77A 3IAEA 2I54A 4N49A 1K5GA 4RVDA 3ZJVA 1XMVA 1QDEA 5TB5A 4YGYA 4CLEA 5J2TA 4ZHQB 3OQPA 4JEUA 4BMSA 3KXDA 1Y8RB 5B4UA 2DUMA 2XVMA 3VTKA 1IFXA 3O8QA 4C22A 4V02A 4GLLA 1MRZA 3Q2OA 4ZT7A 4AB1A 5G41A 2WVHA 1B15A 3O8RA 5FI0B 3W5DA 2QTGA 3KBBA 4CR6A 1CF9A 1IN7A 1GARA 1H2AS 1E2KA 1V71A 1YSCA 2BMEA 1T5OA 1P3DA 2QMUA 5JPIA 4KDEA 4MICA 4HVLA 5C4MA 4ABTA 2C59A 4QXAA 2O7NA 3UV3A 3K3PA 5KAMA 1ZNQO 1F4VA 4PO9A 3UMRA 1QOPB 3IVRA 4P0TA 1YR6A 3ZGYA 1YVDA 2LCFA 3DMTC 4BMCA 3GLRA 4Y8VA 2Z5LA 3RT1A 5PGMA 5DW0A 3ZGLA 4AMVA 1C9EA 3ZQ4A 2J3LA 2HMTA 1IN1A 4QU9A 2P79A 4IDCA 1ICEA 1A0OA 3FCXA 3RQSA 3TCNA 1TUEA 3CONA 4CWAA 1GG9A 3F3YA 5CTAA 3FMVA 1EYZA 4ZU3A 1M2NA 4TXHA 1RBZA 1E1YA 1JHYA 1Z8FA 2M2IA 5B1SA 3WKAA 1XTTA 5HNKA 5LP6B 1JLHA 3LRXA 4JHXA 3CLKA 3BK1A 2X22A 4K9DA 2DETA 1G20B 4RPHA 1UXHA 3B36A 1E62A 4Q1VA 2HRZA 2F3SA 3UC5A 5LYJF 3F9IA 1WXDA 3VVMA 4MR8B 2WYWA 2FEMA 2PGIA 2X1MA 3W77A 2R6R1 3RT7A 3UB2A 4EJSC 1MO6A 5CMLA 4DLBA 2HMUA 2RARA 2VP9A 3EFOB 3CZAA 2F8MA 5CXQA 1LTKA 2I4OA 1JR6A 2HK7A 4EP1A 1KSJA 1C14A 4NCBA 3HO8A 3T0GA 3O03A 3KV1A 1BFKA 2WKSA 1PTKA 2I71A 1EFPA 1IIRA 2RHBA 2X1VA 4KV9A 4O1IA 2AFRA 3W7AA 5LMNB 2CWDA 3SKYA 2VPPA 1XAJA 1NW3A 1DXYA 1D6MA 3WP0A 5BQFA 3Q3GE 3QE9Y 1HQYE 2AUTA 1NAHA 3LDAA 2VZ9A 5FLYA 1JA0A 4G8CA 2OFPA 4PYKA 2HWXA 1SG9A 4RZIA 2VK8A 4LQ4A 4E94A 1QHIA 4F12A 2D1YA 4M7RA 3PX3A 3RSHA 1N3BA 1QHHA 2E5LB 2CNLA 1ZD9A 4BVEA 2BR4A 1M3SA 4DXDA 4ALKA 4Q00A 4LCBA 2V7TA 1YZFA 2P9BA 1SKUA 2GX6A 4K9LA 3C74A 3QEKA 3OLYA 4CTMA 4DR7B 3VJRA 3MJDA 1JFRA 3DDOA 3BSYA 3QM1A 3C3CA 4V0LA 5F52A 1N1MA 2I6XA 1TT5A 2FGKA 4AC9A 4TYWA 1IXYA 1TK3A 3BOSA 4YVFA 4XGIA 3O3MB 3SX4A 1XEAA 1QF7A 3FMPB 3TEMA 3MS4A 3VVLA 3OG9A 1BE1A 2A84A 1O95D 1S8AA 3UCXA 2OG1A 1KHTA 3C2QA 4M0CA 4REOA 2ZZKA 2OECA 1AZWA 3ZY3A 5EJ6A 2O0JA 4YO7A 1TM2A 4KIJA 1UJNA 1KY2A 3QUBA 1GPAA 1JSRA 1FLNA 1YCDA 2VEDA 4H7KA 3LXXA 2CLMB 2ZTHA 4IDFA 4P32A 3WRVA 5IJ9B 1U2PA 1U8CB 3BXEA 3CX8A 3L77A 1RCUA 4GOJA 1YQUA 3ZUPA 3O93A 4G0WA 3GUYA 3DQQA 1EUYA 4B3TB 4BLWA 1NVVQ 2RH5A 3HNRA 4Y2UA 3NJ4A 3QG1A 3IUMA 3QFRA 4QASA 4DIMA 3UJBA 4LF8B 1QHFA 4AYWA 5HUQA 3WYAA 1ZNXA 5FOVA 1OB2A 3LUAA 1JLLB 3FPHA 4TYNA 1D7AA 1YZ3A 3ZWVA 2QLNA 4DV2B 3K0FA 5C4IA 4N0MA 3O3CA 5H59A 4KPFC 1AF4A 2HSWA 2OHXA 1YFJA 4EF4A 4ZU1X 3MILA 2ZVQX 2PL9A 4LSWA 3VHQA 2ZWOA 4Z0PA 2GM9A 3OKCA 3V7NA 1JFTA 2KYRA 4K0RA 4KC0A 4BLVA 5DU2A 2M6RA 4AJKA 1GZDA 1LF5A 3RSLA 3NONA 3LKDA 4TTPA 3TZBA 3VU8A 4QU0A 4DN6A 5AXDA 2FPMA 2QMEA 3HVHA 4WNIA 4ESHA 4YI3A 2H1CA 1L5YA 4LZZA 1KDOA 2ZRGA 1X1DA 4UNRA 1R8XA 4Y2QA 2JJ2D 4FYKA 1FJHA 2GJAA 4TPKA 3UAYA 2KPOA 4UEOA 3ZXYA 4W6ZA 3WGYA 4MS3A 3BDIA 1ZK3A 4QPNA 3IMGA 3VSEA 3M5CA 3C97A 3HSYA 1M2OB 1X1TA 3W1VA 1BDIA 1XDDA 2JGDB 1R9NA 1Z6QA 4ZVVA 1X2BA 1TRHA 3QVKA 4P7BA 4ZI7A 1G2QA 5JVDA 1GTZA 4LGMA 3H2HA 4D0GA 1SQ0A 3MJEA 3WRYC 4L4ZA 2SICE 3GBPA 4XLTA 2AW3A 1EIWA 3LC0A 1JIIA 1HTWA 4JEMA 1IY0A 5C31A 1T1SA 4YRQA 4BFLA 2AA3A 2VAPA 4XGNA 3SZGA 1NJ6A 1R50A 5CT8A 2VKTA 4AN1A 1SRQA 4H7IA 3BRCA 4BU0A 5EJIA 2NZYA 2QRMA 4BNWA 4GSKA 2OUKA 5JZMA 1Q22A 4DJDC 3V4OA 3QJ5A 4EVRA 1G1MA 4FD3A 1XPRA 1K8ZB 4OD0A 3JD1A 3AHCA 2R84A 1GA6A 2DQYA 2YCBA 2R7LA 2IHYA 4C4RA 3ROMA 1Q21A 2AG1A 2IPXA 2VF5X 5DO9A 3B7WA 1I5RA 5JMWA 4CDNA 1E3MA 1ISIA 1OUMA 4RJ2A 5LP1A 2ZT6A 4WY8A 1L7OA 3GGJA 3FOEC 2CLDX 1M34B 4HDCA 1I1NA 4MZXA 5CNMA 5ECWA 4ZT6A 5KJ1A 3BX1A 4HK4A 5DH9A 3AVYA 2OV2A 3CRQA 1JSXA 1UBOS 2XWQA 4LN1A 4MWBA 4PRZA 4TSFA 1OZAA 3V3TA 4CDGA 4DILA 3M49A 3HLTA 4DDHA 4GU5A 3AXTA 1ZHOA 5H3LA 1BRMA 2JKYA 4O1MA 1WXEA 1F8XA 2WJ4A 4MV0A 1NBWB 4B09A 3IIKA 4R9UC 3U3JA 4YP6A 4EF6A 5CFLA 5KINB 2P9GA 2P6RA 1N7IA 1DFGA 5F12A 3ZI7A 1C3VA 4E70A 1T5SA 5EP3A 4WXYB 1HG0A 4UU7A 3HKCA 1ZI6A 4DA0A 1DEHA 3UY4A 1U6JA 2Q41A 4GP7A 1COWA 5CDFE 3U09A 4AP5A 3FF1A 5H82A 4MKFA 2I7DA 1WKBA 1NW8A 2VSYA 3L1KA 5CT5A 2QR5A 3PJRA 1VHJA 1I2BA 3AK4A 4ONEA 3W6UA 1GGHA 3IUNA 2VDJA 3ZCXA 2LUOA 4NV1A 3WWOA 1FIUA 3JX9A 1UT6A 4QSHA 3NHMA 4KNWA 1XSEA 3B6JA 1E2MA 3K8YA 3JAKB 1NJ5A 4RY2A 1I7PA 2IE0A 4NMXB 4Q9HA 4LXGA 3WBJA 4GI7A 3ESCA 4ZTZB 2C97A 4JMLA 3PWKA 2AMYA 2BGJA 4MVJE 2PV7A 3OTOB 1MP0A 2BT4A 3LSTA 4ON9A 1T4CA 3H5NA 2AW5A 2RH8A 3EUEA 2XKAA 1GQ2A 1V5WA 2B92A 3DB1A 3D3NA 3I37X 4X7PA 3V2HA 4EGFA 5LN1A 1JNYA 1GNTA 1WTCA 4BECA 3BWCA 2Q50A 3T4UA 2F1JA 2OORC 2BEWA 3I04A 1GLGA 3PEEA 4OU5A 3HRIA 4K46A 3A2NA 5EUQB 3EBOA 4M0EA 1OXSC 4Y0AA 1JKMA 3WGJA 4PS0A 1JKJB 1OWLA 3CIFA 3KEMA 2CNBA 2G4CA 3PIIA 4IIXA 4PAQA 3WBKA 4F4CA 1TJYA 2QROA 5B37A 3VZDA 5GJVC 1L9KA 4UFOA 4EJ0A 5I9LA 4PGMA 1DTSA 4D46A 3GJSA 1J1UA 2JIRA 3C6KA 2IZ6A 3FZYA 2A33A 1KP2A 4UW9A 3TNDA 4DSAA 5FPTA 1U9CA 4KE7A 4UVHA 1XROA 1HFWA 1DRUA 3CUVA 4AWBA 5LM3A 3WNQA 1L4EA 1O6FA 2Y1WA 5K51A 2G25A 1UK7A 1BMTA 1Z4NA 2ZJ6A 3F3MA 3HL4A 3H5WA 1PQ4A 1N57A 4PC7A 2G5CA 1B8VA 4JJEA 3WIEA 4QDKA 4K9PA 3MWLA 2N42A 1SHLA 4LOHA 5JCOC 5DEIA 3H2SA 4NFHA 2Q8PA 3R1IA 4I9UA 3OIGA 2H5EA 4DSUA 3MJCA 2ALJA 1BMDA 1PD0A 2HLNA 4II2A 2WNIA 5JH7F 4LCEA 4MCHA 3VOAA 3ER8A 1CS0A 3FGOA 2EVWX 3UT0A 1TU3A 1CW2B 1Y1RA 2XD9A 1KEWA 1A7KA 2WIJA 3CB4A 1A95A 4QWWA 3SZOA 5JZOA 1Q91A 2P62A 4ZJUA 2YHSA 4HUQB 1Z2CA 3NORA 3ZGXA 4EENA 3KXKA 4BQEA 5I7UA 1IDN1 3OEED 5EIBC 1KQOA 4OUKX 1DIAA 1MC8A 1IZYA 3F49S 1ORRA 4FKZA 4MCIA 4TMKA 5EZYA 2P9TA 3TOZA 3OFVA 2R6DA 4LHYA 5TQ2A 2FSUA 2OBBA 4JZYA 4F2WA 4NKRA 3UM9A 2DQKA 3ROQA 2GR9A 1NBOA 5F2EA 1PNQA 1SNYA 1OZHA 1W1WA 3ZHUA 1NSFA 1SU7A 3IJPA 4JLWA 4EYEA 1PYOA 3BTSA 1VDMA 1R4MA 3N5KA 1OROA 4QUAA 5AW5A 5C80A 1W94A 4U2KA 1JILA 2GZDA 2QRNA 2YMQA 1CF2O 1WMSA 4KOAA 1BZYA 3DO8A 5KJ6A 4C6TB 1YGPA 5ALGA 2R68A 1U0RA 1QIEA 2X5XA 2JIOA 3M3PA 1XYGA 2Q45A 4D41A 1Y1KE 3P45A 2VXBA 3EA5A 4Q19A 4TWRA 4ND2A 5FRDA 1RZVA 3H9UA 2MYNA 5EJ9A 4RADA 3L0ZA 1M83A 3ILYA 3KTAB 4LSZA 4H7FA 5JWHA 2I7XA 3W2HA 1CG6A 2Q1YA 3B1VA 4OLBA 3W5IA 3A31A 4E30A 3TQHA 1RXEA 1W9HA 4BO7A 1CB0A 4GDFA 2ZRNA 2BZ1A 2QTLA 4G97A 3FJOA 1TZJA 5JHHB 2NO6A 4GYKA 3M6UA 4MVXA 4ABYA 4UBMA 3CLRC 1EM8A 1ZK2A 1H6DA 2F9LA 3E22B 3MT9A 1A5AB 3FY4A 1XP5A 2DZDA 2RHGB 3M34A 4IHKA 3PCXA 4L95C 3OX1A 5C5IA 2BHNA 1ZX1A 3OTWA 4QVGA 1WXWA 2A9KA 1L7DA 3ASZA 4AK9A 2WV7A 3ANTA 2Y0CA 4KN5A 1R0YA 4F6RA 2Y1KA 3MRTA 3O75A 4S1OA 4R69A 2BN4A 4URHA 1SOVA 1YRYE 3C87A 4JT8A 3RSGA 3SR4A 4B4WA 2Q5JA 2PS9A 2HQOA 1K8YB 3A9SA 4TV9B 5IW8A 4Y7CA 4ZTUB 1KU6A 1N0UA 4ZO8A 4UE3S 2H29A 2K4MA 4KMSA 3S8EA 1EP2B 1BKDR 1ZRMA 2JARA 4ZPXA 1NL3A 3E18A 5E1OA 4GYJA 4ZOLF 3SNHA 1KK3A 3PPWA 4RACA 4IIFA 1SK9A 5JO0A 4O4LB 1PJLA 2WICA 1E58A 4B3JA 1BA3A 3SHFA 2PZLA 8MHTA 4RKRA 1EP3B 2BP7B 3ESDA 4AWAA 1A9ZA 1GKKA 1BN7A 2C5HA 3PFCA 5B55A 2NIPA 3DOJA 1KH1A 3ZDRA 4RKYA 2WMNB 3UBTA 2M1XA 1KU0A 1YJAA 3BRQA 2XCQA 4L9SA 4M9SA 4CR7A 3PHCA 1RYEA 1SCQA 3WFJA 2A9RA 2V7EA 3TPCA 4B84A 1JX6A 5CFPA 1ULSA 2XUOA 3INYA 2ZRCA 3OKAA 4M1WA 4YIKA 2Y6VA 1EXDA 5JJIA 2QZJA 2ZTLA 3PG5A 2O2XA 2QL7A 1I1QB 3UJCA 2PRSA 4WGFA 2FHSA 2KLHA 1A3CA 2VYVA 4NIMA 5BW4A 4MIKA 1C1HA 2DTEA 3KZKA 3G8CA 1TEXA 3KKEA 3PSAA 2FPRA 2Y0BA 2CXNA 2OKGA 1UODA 3S7ZA 4ZN6A 1VMIA 1TLTA 2H2WA 3PGJA 4M21A 1GU1A 1V8PA 3V6MA 1ODFA 2M6SA 1NQXA 4M88A 2NVUA 4FQ5A 4XFKA 1S7GA 4XIYA 1P81A 1NVGA 1WCWA 3L0CA 1J39A 2V9PA 4DA4A 1ESEA 1TAHA 1VBMA 2F62A 1QIHA 2R2AA 3K5PA 1MH1A 4N3BA 4QREA 4RZXA 5E3HA 1DAIA 2AEEA 2X13A 5REQB 3MMXA 4AMZA 4C0AC 3QYAA 4DBLC 5IG2A 5GJBA 3QFHA 1P7ZA 3THYA 3RBXA 1Q7GA 2GN1A 3KJNA 2DGDA 2WFZA 1EZZA 4YRGA 1GFWA 4NJEB 5KWEA 5FFFA 3CF6R 1CUVA 3B2EA 4W5JA 3GUUA 1DBQA 1ZOIA 4P4TA 5IM5A 4C0XA 4P38A 4Z8YA 1OVGA 2A0WA 2G06A 1FYDA 2IP2A 3L5OA 5HKAA 1OU4A 2QGNA 2REQA 2P9EA 3H65A 2VJNA 2QSYA 4MA5A 3HJCA 4ZARA 4DARA 3M4JA 1I32A 2BCJQ 3D81A 4LHZA 4QELA 2PWYA 4WFKA 5DGXA 1OZ0A 1GOTA 3BE5A 3CLSC 5SYMA 3DDNA 2CJFA 5U1PA 2FZCA 2DH6A 1BCSA 3BD9A 4J7UA 4Z7QB 3PC8C 5A06A 2IYSA 2W2MA 1VMKA 2I9PA 1NBME 1W19A 2H59A 1F2UA 2BGUA 1DBIA 2Z04A 4LE2A 6REQB 3IQDB 1Z74A 3NFYA 4X7MA 3FXAA 5G0VA 3NXSA 3QKTA 4O2BA 4DG5A 3LKVA 1NGSA 2GN6A 1E7RA 4YC7A 3DR5A 4JY7A 3S4YA 1YE3A 1CTQA 2Q2QA 3WKCA 1DJOA 4D3SA 2A35A 3WGHA 3FYTA 2D2VA 3ICQB 3CINA 1ISRA 5JAMA 1FFWA 5ILOA 1DB3A 1M7GA 1RWXA 1YJBA 3KQTA 1ODCA 4UTXA 1DIGA 2B3TA 1KGDA 1ZO8A 5GMOA 4QDTA 1LVHA 1RRGA 1O1YA 3KSRA 2Q3MA 5HE8A 5DXAA 2Z5VA 4J0QA 4OQEA 3WDKA 3FUTA 3HJHA 3IV7A 1LNZA 1Y9JA 5IVKA 5T64A 4RVUA 3E4CA 4L16A 1QH1A 2XTMA 1ZJ4A 3DVAB 3OKFA 4GXNA 3TG2A 1ZI8A 3ZH2A 2XIQA 3D9QX 3KRTA 1F06A 4CQLB 2FMTA 2V7PA 4BVKA 3ND6A 2OGTA 5EEGA 1ECGA 4CN9A 4P93A 1I3CA 4JK3A 4AX8A 1C3LA 4DDTA 2FR0A 2YQ5A 3OIVA 4A8JB 3MOSA 2B36A 2XDQB 3D0RA 3GZTB 3PKJA 4X44A 2P9CA 4JIGA 1HORA 2GVDC 4M9UA 3KU4A 2MT9A 4NFSA 2GO1A 4CL2A 3S8YA 5SYAA 1HY3A 3C3PA 2PKYX 1JI3A 5K0FA 1RNLA 1QOQB 1YZQA 2AOUA 3TRKA 4QQFA 3VDQA 4CEJA 4PX2A 4FXOA 3CN9A 1KKUA 3EJ6A 5IXJA 1CQJB 4P22A 1QG2A 1ZNYA 1AQIA 3AY0A 3RBVA 3R7BA 4DQ0A 2AD1A 1S89A 2AFIB 2FRDC 1ZD2P 4UUOA 2ZSJA 2YNMC 2EP7A 3H3FA 5K20A 4BKRA 5BOVA 3UMCA 4JBYA 1IN8A 2O8BB 4BX2A 4E33A 4YMHA 4D4JA 3KHTA 1B26A 1ZGHA 4WFQA 2R97A 3AHGA 3GLQA 2AN4A 4KTTE 1E4EA 3LQRA 4LHSA 4C76A 1QYVA 4QBGB 2A5LA 3SSMA 3R74A 3ECAA 2PV0A 4ER5A 1RM5A 2QVGA 3FFTA 2YZ7A 3DC2A 5B1DA 1D2MA 3BH7A 4R54A 1XLTA 2CE2X 2JD0A 5JFGA 2Z1DA 3O9VA 4QEDA 1A8SA 3TW8A 3NI2A 4C3VA 4EPXA 4M89A 4AW9A 2NSDA 4R1SA 3D7SA 5FA5A 2G5PA 2QK4A 3TM4A 1VKJA 2BCGY 3EZ6A 3H1GA 5IYZB 2XT9A 3OZFA 3RRJA 3QOFA 4GI1A 1K9VF 4P3XA 2CFCA 3NS7A 1YZYA 4PICA 4US0R 1J1IA 2QPAA 3JQ8B 5DI3A 5EIAA 2XYRA 4E13A 4YALA 3RJTA 2OYSA 5ER6A 1YVUA 5LUBA 4LRWA 2R6AA 2IV7A 1KY3A 3CMMA 1PP4A 2O8VA 1TYDE 2P6UA 2PSHA 3BQMB 4MW0A 4MMYB 4JT2A 4X6YA 4CMIB 1RJ9A 2X7HA 2GN4A 4M2LA 4L72A 3JXEA 3HBAA 2XKKA 1CVIA 2Z3WA 4YJDA 3K6JA 4FPXA 1Z7BA 5DNWA 2MR5A 5DYIA 4DLRA 1TQ8A 2GGSA 3UK6A 1W88A 3DPUA 2HF9A 3I42A 4KGVA 1ADGA 1GU0A 2CDRA 2BDUA 3VHXA 4UC0A 2X4LA 1MJFA 4IF4A 2V96A 2H0RA 2J31A 2F4NA 2HPHA 1IWBB 4I3GA 5KYKA 1EGAA 3UN1A 4G8DA 1JNXX 4QYIB 5K4AA 3VU9A 4CMJA 2DBZA 3VI4B 4JDUA 2AEFA 4ZEOA 3RS8A 4WACA 5BW6B 4XGKA 4URUR 2G40A 1P61B 5DBGA 1O4VA 1SURA 4BKPA 1G55A 3A6GA 2AMFA 4KQ9A 2CXPA 3NO4A 3FDIA 2FQQA 2RK6A 2ZK7A 4L7QA 1P9LA 4HB2A 2WKQA 4G0NA 5J4HA 1DIRA 1NVUQ 2R5NA 1PZMA 1QYIA 3VSDA 4DFDA 4HB3A 1DTWB 2GBLA 2GCNA 3EIOA 5CA0B 1NWHA 1K5PA 1Z38A 2W6PA 1RMTA 3EEIA 1BWSA 5I9NA 1N1DA 5DULA 3KUKA 1XPUA 1YA4A 2ZTVA 4U1RA 1FSZA 1PI3A 5FFMA 3C5WP 4X6XA 5CPBA 1SU8A 2P2CA 2F67A 2W22A 1P19A 5BYBA 3OJCA 1IWOA 1IMJA 1LLFA 1P6XA 1Z6ZA 2WE8A 4YRNA 2JFYA 5GONF 4EQ6A 5BWNA 4HP8A 3PDUA 3B1FA 4ZVNA 4MTCA 1Q19A 5EZQA 4FONA 4RWZA 5B6JA 2VPIA 1MOSA 2AR0A 2QVYX 3IYLW 2JA1A 3B9QA 1PVVA 2FFJA 4QJBA 4AYTA 1BE8A 3PIDA 1XNHA 4TX1A 2PA3A 3GNSA 3AKDA 4KYUA 3WX0A 1FXUA 1WS6A 4WCFC 4QT4A 5M29A 2C94A 2X3YA 3U17A 1LF0A 2Y0DA 4OYYA 2BRUC 2WT4A 1IM8A 1B2RA 1ORIA 3PDWA 3C6BA 1KJZA 3FOAA 5B7NA 2FR8A 3EG9A 4BY9E 5F9HA 1DJMA 3GRPA 4JUDX 3WB1A 3V8PA 3BFKA 2IH2A 3T5MA 4LK3A 2BM0A 4EJ2A 2IU0A 2HLDA 2JIZD 1XU4A 2JFGA 3IESA 4BNHA 3PQCA 3EMVA 3KR9A 4FOTA 2WYVA 3CO0S 3T35A 1VSQA 1JVSA 4TRRA 4E6PA 3P9RA 2FX3A 4J4BA 4BZZA 3QHAA 2BBSA 3AP3A 4MINA 1AB6A 4HN4B 4LE1A 2C9MA 4IH1A 1QGUB 2WPNA 4EELA 3T3GA 2PJRA 1PFWA 2V0CA 3HO1A 3P2EA 4GKKB 1HKUA 2FZEA 1FMCA 2VK4A 4LRTB 4A8TA 1KSHA 1YZGA 3WYEA 1OI7A 2RHLA 1QKKA 4O8CA 4Z6KA 1K9SA 2QYSA 5BMVF 1M2FA 3MOIA 4PLTA 5FL7D 1FDSA 4XVHA 5DSXA 3TR5A 4OHMA 5EWMA 3QUAA 1TB4A 2XQFA 4KN6A 3TSYA 1FFGA 2XTAA 2Y1LA 1NXOA 3MRSA 2A9PA 3QU7A 4NLLA 3EXFB 3W5VA 1SHJA 1Z28A 2BVNA 3ZJ4A 2GI4A 2IEBA 3CWCA 3UJAA 4EL5A 1XC7A 3G9TA 5C8XA 4KUGA 4RGYA 3PIRA 5ALIA 3RFUA 3TOCA 1BEUB 1U8XX 1OE0A 1Q3TA 1X9GA 3H9EO 4Z9YA 1I01A 4B1FA 3DGFC 4HZGA 1H0SA 3IO3A 1RHKA 3LUJA 3HUFA 3WNBA 4WCVA 3LA8A 1QX4A 1BVUA 5AI0A 3LKZA 1M2HA 3WB9A 3Q8MA 1QONA 1U0TA 4YACA 1ZVVA 2ECOA 5EIEA 3GY0A 3GDFA 3EQ6A 3JRNA 1ZUNA 2BMVA 4YAUA 2R62A 1RACA 2A4MA 1Y3HA 3JPWA 3E7FA 3VR0A 5A4DA 2ID7A 1XXHA 4XFJA 3KQYA 4UD2A 2NUAB 4QJ4A 3ELDA 2J9RA 4I1SA 1XQWA 1ZR4A 3GCWA 2QRZA 1QFJA 3BYZA 2IPOA 3BXGA 3ED5A 1WUYA 3A37A 3MLBA 4D97A 2VFAA 1RYZA 2BELA 2CXQA 1JBQA 3SI7A 3E2PA 4E5SA 4ARSA 3T12A 1EG7A 4OXKA 1Y34E 3PFBA 3RC7A 2RHHA 1Q50A 1YU6A 3D1JA 4GI2A 4K2HA 2Z3VA 4J0IA 3RIGA 1XU9A 1NR1A 1Q44A 2DHQA 3HA7A 3BSSA 4LDRA 4URWR 3WIDA 4JP2A 3V8QA 2NYUA 4JYMA 5E6UB 2C99A 1U3UA 5FDFA 2N1BA 3RSOA 1HXHA 4BX8A 5A4JA 4C88A 1BD4A 4LDPA 4G1EB 2XCLA 3KQUA 1Z0AA 3FSJX 5C34B 4W7SA 1MG5A 1L2TA 1G5FA 3KTDA 1YK1A 3NIWA 2ROQA 2W8BB 5G02A 4O3MA 1KFBB 3UUGA 1DEOA 1B6RA 1I0IA 2W98A 2PD6A 3KKLA 3WWCA 5KSYA 2Z4TA 5IZ4A 3P9CA 1SIOA 4EUSA 3GXBA 4WVFA 1NMQA 5IK2D 3PT5A 2R7MA 4W9NA 1ETHA 3TOXA 1TZBA 3VBCA 4HC4A 3EF0A 3H04A 2CBXA 5C8ZA 1N78A 4R3WA 1RRCA 3U3RA 2P9FA 5C2JB 4M22A 5HCUA 4BO8A 2EYUA 3MGBA 2ZBPA 1UMKA 3FZQA 1O4WA 4HL6A 3JD0A 1ACMA 2VCHA 4WESB 3RG2A 1WDTA 1UEIA 2H85A 3W5SA 3PPYA 5FV7A 1MEJA 2CY0A 2XA1A 4YB8A 1NPDA 3KEGA 3WYCA 1EFAA 3NEAA 2BPOA 3ASYA 5CLQA 1DIBA 2YIJA 4MX8A 1KDYA 1BVRA 1IZ7A 1MABB 2GB4A 4NI5A 2X86A 4JWKA 2OFWA 4ZC8A 3DOHA 3UAZA 1JWAB 4JLSA 3DV9A 4YUXA 5LLSA 4B32A 5DCUA 1K4MA 4HMOA 1OCEA 2Z6VA 4RZHA 1DT5A 1TM5E 3OTIA 4MV8A 5AKKA 3RVMA 3C4QA 1CR2A 4BGUA 4TTAA 3OPYB 4XWYA 4BV9A 1HYEA 2WMOB 4YRAA 1L8XA 4NBSA 1HZJA 4DV1B 4XIGS 1FFDA 1DV1A 3HVKA 5JZBA 3Q8LA 3FNGA 4DAEA 2WJIA 4IWNA 1WCV1 3ZHQA 5JANA 3W6OA 4IUCS 4IJWA 1XHLA 4AL4A 5KSWB 1NV8A 2NU7A 1QG4A 2Y99A 5HUHA 1Z7EA 2NXWA 2YH2A 4PQGA 1BH2A 3IP5A 4MUAA 3HGQA 1OV6A 4LYAA 3L0YA 1CUEA 1QFXA 1DCMA 5IP5A 1J2JA 2OG2A 3BPSA 4Q1CA 3SBDA 5CFNA 3U9SA 1I2DA 1MVLA 2PX5A 1V16A 1MNQA 5CFMA 5IMSA 2QX9A 4RVHA 2VJKA 2OHVA 2QUZA 3OAAD 3FMFA 1CR0A 4DLVA 1BXGA 1QH9A 1XZNA 3B2NA 4IJVA 1JEOA 4JOBA 2BZGA 1E94E 1YS6A 3S1AA 4A15A 3EQ9A 1XRLA 2JCVA 4OHRA 5CB4A 5AOAA 1KP9A 1QB7A 4HYQA 2POQX 5JMOA 2VWPA 5ALEA 5JSFA 1F7VA 2EHJA 3NATA 4EYQA 4RD4A 2QI9F 1E66A 2ZRPA 2GTPA 3OETA 2O0LA 3ZDYB 3CUEF 5JCJA 2JD2A 3JD3A 4XYBA 1XMJA 5F78A 1VPDA 1DX4A 1Z36A 2EATA 2QN1A 3ILSA 3WICA 3D5EA 1RM0A 4PG5A 1R5NA 4N1AA 5I9SA 5HX7A 4UVIA 4FSHA 3TAUA 3G5UA 2VDLB 4CEIB 2J3EA 1E89A 4A10A 5ITZA 2FPKA 5IAOA 3EDRA 1KBZA 5A0TA 3WHLA 5I6DA 2D1QA 5ICGA 1UJ6A 3RS0A 2II6A 5DXJA 1IHYA 1T26A 2IK8A 2WWGA 1NJGA 3UF0A 5CIYA 3GJ0A 1VBNA 3T3HA 3Q8KA 2IKSA 4MWSA 1G3IA 3VHLB 2WF6A 1CVRA 1FE8A 1GCGA 2WAOA 4URVR 1QKJA 4C01A 4UHHA 1FX1A 3PGMA 5JR3A 1ACLA 5AKGA 4MKZA 4DT1B 2VQEB 1Z8NA 2XNDA 1UZNA 3FOCA 3KEOA 3DVSX 3Q41A 1NATA 2GBGA 1JXQA 3CRNA 4DR6B 3A3KA 4OHFA 4I9FA 5KX5F 2JGFA 3RH0A 5HTOA 2Q9UA 4LC0A 3KVVA 2PE5A 3OIUA 4MV3A 1NXVA 2WTBA 2EDAA 4GMKA 3F0TA 6AT1A 1ZBDA 2JHAA 4S35A 5C8VA 1QYXA 4RJTA 4G1CA 2GT1A 3ZU5A 4L2IA 3JQBC 3KSZO 1R9MA 2GHRA 1VYHA 2NZXA 5M7EA 4JHLA 3HDHA 4HRVA 5J2TB 1FTYA 2ZYVX 2VDQB 1RWOA 4IHJB 2Q9BA 4DEVA 1XCOA 2I4RA 4QOIA 4S1TA 2GEJA 5C8DA 5C8YF 1PK7A 1JAIA 1E3TA 3OUZA 2IZOA 1QUFA 2B1QA 1DOAA 3O8QB 2GQ0A 3OIWA 4GR5A 3RYTC 4D3XA 2VJCA 1I7SB 2FZKA 3HCPA 4XCQA 1X19A 2K87A 2MTBA 2Q4TA 3RB8A 1F6BA 3NXKA 5THXA 2CYCA 4JYZA 4ALNA 2LKDA 3I72A 1WDLA 4H4EA 4HJRA 1DQYA 1LKZA 1I5OA 4GX2A 3HVUA 4TQAA 5G1OA 3G02A 4TLBA 3UUFA 5CDGA 2P9ZA 4K2AA 4P3PA 1IQUA 3IDQA 3QGMA 2ISQA 1J4AA 1FQWA 2VHCA 1H93A 4HRYA 1OT3A 2HU7A 3OZGA 5EE0A 4BUJA 3W5JA 1SFRA 1R4NA 1Z16A 5A6VA 2DF8A 2HCRA 1FW6A 1G5TA 2C20A 1NPTO 2JH9A 1M6NA 5BSUA 3W4IA 5JAIA 4OLHA 1A69A 2NSHA 4YCDA 2WWYA 4X84A 1OLUA 5FOTA 2NP7A 2Q2OA 1OX5A 1X2EA 4IMIB 4XGRA 3H18A 1T8RA 1L3IA 2ZZMA 1DIHA 5IKOA 2O59A 2PCLA 4EBBA 3O31A 3FCOA 1VOTA 1GKYA 1KERA 2D5BA 3RBZA 4Q24A 1GL6A 2B25A 1XF9A 2FY8A 3ICVA 4GHWA 3EA4A 3A9VA 4TS3A 3AW9A 4H35A 2HU8A 2IOHA 4GUAA 1K27A 2TECE 1Y63A 3JZDA 5E6SA 2P2NA 4DV5B 3FCUB 2RKWA 2X8AA 4RZQA 4UMFA 1X7GA 4KDCA 1QRSA 5AI6A 2VEOA 2HT6A 3HYLA 4IGAA 1D07A 2JK1A 2GK3A 1Y7HA 4EL0A 3AU9A 1MIHA 2H5IA 1E64A 4RK4A 2IPAB 3NIFB 5JDIC 3W9UA 1HDGO 1G4UR 3HA3A 4TKVA 1EFPB 1T6ZA 2X9LA 2YTZA 4FYHA 2AZXA 2FG5A 3PNYA 4U7GA 1U04A 3IBFA 4W82A 4BAUA 4XRGA 4BMNA 2QT0A 2O06A 2HXGA 3EEYA 3JZIA 2DULA 3M1AA 3AM4A 4S2UA 2Y05A 4XLZA 4JQZA 3JASA 3ABIA 4HFRA 3LQ4A 2HDHA 3SGLA 3V1TC 3P97A 1FY2A 2WYUA 3GQBA 4A2PA 3I58A 2DC1A 4ARBA 1T5BA 4F5WA 4A6DA 3B6IA 5TQ0A 4C06A 1FUKA 4FT4A 3LPAA 3M6AA 4ZEXA 3RHFA 2E3JA 1QHHB 1KZ6A 3QKIA 1BE6A 4NBLA 4N54A 3EXHC 3I28A 1NW4A 3OM9A 5PNTA 1AS0A 4KNVA 4J1NA 3DDWA 5FI3A 4UPVA 1EK6A 4C05A 3NWJA 1LBSA 1T2DA 3WGKA 3DMYA 3PTAA 1HO3A 3NBUA 1G16A 4JJIA 1M0TA 2ZYUX 4NP6A 3AT1A 3EQ7A 1TT5B 3EWNA 2O2ZA 3I9FA 3KL2A 1VE6A 3OH8A 1JYSA 4Y9SA 3HY3A 4YAKA 1BMQA 1N4AA 3I05A 4UTVA 3M3DA 1FSPA 1UT8A 4W5HA 5DWVA 1VLZA 3TSZA 4EJSA 3ENNA 3TZHA 4MUFA 4IIBA 3WLSA 4YDQA 3Q9UA 1Z0DA 3CLHA 1E1NA 1WQ3A 2CHUA 2FPGA 4NH4A 4HAOA 3W6NA 3ZQ6A 1DEXA 3R77A 1J20A 2UVQA 4GZ3A 3SEQA 5JALA 2PSEA 2IJGX 1R2QA 3D6HA 2CSUA 4ATNA 2O2EA 5IJ0A 121PA 1BHQ1 1U1CA 1UXJA 1PR2A 4PC6A 2KHZA 4OH1A 1YAHA 3ZV3A 3C3MA 1B8UA 3MUFA 3MT7A 5K03A 5JROA 3T3OA 5LBUA 1RADA 1U8FO 2OLKA 3DE7X 4ZAWA 2QYTA 2XMDA 5AHOA 1GCAA 3AUKA 3IUYA 1XT6A 3EDCA