3KJEA

Empty state of cooc1
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
254
structure length
254
Chain Sequence
MKLAVAGKGGVGKTTVAAGLIKIMASDYDKIYAVDGDPDSCLGQTLGLSIEEAYAITPLIEMKDEIREKTGDGGLLILNPKVDGDLDKYGRYIDDKIFLIRMGEIKKGGSQCYCRENSFLGSVVSALFLDKKEAVVMDMGAGIEHLTRGTAKAVDMMIAVIEPNLNSIKTGLNIEKLAGDLGIKKVRYVINKVRNIKEEKLIKKHLPEDKILGIIPYNELFIELSLKGEEIWQSTNPAFVNLHDIYQKLRLEVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CO dehydrogenase/acetyl-CoA synthase complex, accessory prot
publication title Crystal Structure of the ATP-Dependent Maturation Factor of Ni,Fe-Containing Carbon Monoxide Dehydrogenases
pubmed doi rcsb
source organism Carboxydothermus hydrogenoformans
molecule tags Hydrolase, metal binding protein
total genus 75
structure length 254
sequence length 254
ec nomenclature
pdb deposition date 2009-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kjeA00
2ZI9A 4B3FX 1MABB 1G18A 2ECKA 1DBSA 1CXZA 5C46F 4GMXA 1UKVY 3VR3A 1WBDA 2OE2A 2ZI6A 3THOA 2VP5A 1XTQA 3QPUA 1QHHA 1SVWA 4A4DA 1CRPA 4PC6A 2GJ9A 3KXKA 5FBQB 4DIDA 1Z47A 1GUAA 2B21A 3OAAD 2KI5A 2P0EA 1KO5A 1NI3A 1UM8A 1T3HA 4NU0A 4Q9IA 2FFHA 4Q1CA 2WJVA 2VA8A 1VCNA 2IYRA 3MWJA 4A8JC 1WB9A 3U3KA 4DLUA 4KFRA 1Q1BA 3W8RA 3TSOA 3TK1A 1S0UA 1NIPA 3UPUA 1ZIPA 4BZXA 2BVNA 2BBOA 4AI6A 2CHVA 1OSNA 4X8LA 1QG4A 2YJTD 3BOSA 4Q47A 3T1QA 221PA 2XZLA 4BFVA 1D8TA 3GLIB 4B2LA 3BH6A 3GFPA 1US8B 2B8TA 1DS6A 4DSNA 3MWLA 2Z4RA 2RGNC 4N1AA 2OBMA 4GT1A 4K8OA 4M9SA 5KDDA 2NIPA 3J81k 4YLGA 3KKMA 3D6TB 4LUCA 2W2VA 2VP4A 1S3GA 5FUWA 1D9XA 4IOJA 2IF0A 2FPLA 4XD7A 4CEJA 1R5BA 4GFDA 4LHZA 5JECA 2YNMA 3FVQA 5FH9A 3BFXA 4AYWA 3VX4A 4IDNA 4YXWA 1MO5A 1ZP6A 2QTHA 2ZJAA 4LYHA 2QM8A 2VP9A 1MO4A 3FKQA 3OAAA 1E9RA 3K70D 4CGZA 5LB4A 1R0YA 2ZRFA 3OEHA 4R2IA 4DSTA 1KI4A 5CYPA 3S1AA 3KKOA 5E95A 1IXSB 1NMYA 4M9XA 4A15A 3BJIC 5BYKA 2DB3A 1G20E 4BLOA 4RSGA 3K09A 3SFZA 4A82A 3BB3A 3CNNA 1KO8A 4ZCMA 3QENA 2IBMA 3CPHA 4C30A 1Z83A 2DFKB 3GLHB 3PQCA 1W4RA 5JCPA 1IXRC 1XJ0A 5C4MA 4HZIA 3PJRA 3D3QA 4LHYA 5GJCA 4OI4A 4LPSA 5EP2A 3MWKA 4MH0R 3SOPA 3VX3A 3BB1A 1G7RA 1XCGB 4CYMA 4ITRC 1SXJB 4A6XA 2XNDA 2OFOA 4DLWA 5F9FA 4URXR 5FL7A 2DFTA 2C9OA 2JJ1D 3Q3JB 4US1R 4HATA 1MKYA 3B9QA 2ZE5A 4CW7A 4DDUA 1KY3A 1SVMA 3EARA 2ZYUX 5G53C 1TTTA 4JSYA 1DADA 3FYHA 4I1SA 1G8YA 1Z0KA 1XBTA 1T5IA 1K5GA 4TLEA 2D4HA 4Q9JA 4JJZA 3L0SA 3FHOA 5LD2B 4TSFA 2ZSAA 1UJ2A 5FTMA 3B2EA 2HCBA 1Z6YA 3MMPA 2C95A 1II0A 3I5YA 1RVDA 2F9MA 2QNRA 3AB3A 3MRSA 2ZAMA 2WM9B 1EFCA 1BOFA 3CW2A 4JS0A 2CNWA 3QEJA 4MGIR 2R8RA 1GSIA 1T0JB 1E2EA 4EKDA 2E9SA 1JEDA 1W36C 3CLVA 1E96A 1E2KA 4KU4A 2YWHA 2IW3A 2GVZC 1IHUA 5AR1A 4TWZA 4YDHB 4QNMA 3UWKA 4ESVA 3UATA 4Y0AA 5CM8B 4I1VA 3R8FA 5JWHA 3ZIAA 4MGYR 3GP8A 1HYQA 2AK3A 2FGKA 4NP6A 3I1FA 4LK2A 4ILEA 1YZGA 2AXPA 2ZTSA 1P62B 521PA 5IT5A 4P4UA 1AZTA 3PEVA 4PQYA 2XGJA 1HE1C 4JLKA 2HDNB 4YONB 1ZUHA 3AKYA 3DL0A 5A5GA 4Z8YA 2PZFA 2DY1A 1CS4C 4A1FA 3U6BA 5FOXA 1M7GA 2HJGA 1IN6A 1XD2B 5KU1A 4B34A 1P9RA 2CJWB 1A4RA 1W1WA 2W83A 5GVSA 2JLXA 2GK7A 4IXMA 2VP6A 3MD0A 3R9WA 1W2GA 2EWVA 1JR3D 4PO9A 1VCMA 5D3MB 1TEXA 4WXRA 3TSWA 4BZPA 3BB4A 1P9WA 3QPVA 5EP4A 4C4PA 3KTAA 5DIFA 4GI7A 2IHBA 1BMFD 3SC3A 1CJUC 1BO6A 5AJVB 3UANA 3K0FB 2YYZA 3AVQA 4HZUB 4JLVA 3IQWA 4Q4AB 1DO0A 2H1LA 4JLMA 4MGZR 4MDEA 1PUIA 1YR7A 3VU9A 4MGKR 1E2FA 1VKJA 4PZLA 4CT4B 1E3MA 3RRZA 1FZQA 2VIIA 3Q8XB 4M53A 3WP0A 3DZ8A 1CJVC 1Z0JA 4EPWA 3GCGA 2OLJA 3KXLA 4XVQA 2ZSDA 1KYIA 1J99A 1W0JD 2JLSA 3D8BA 4B43A 1S1CA 4TQUS 1CJMA 1JPJA 1N6OA 5HE9A 2CDNA 3B6EA 4L15A 3TVDA 1Z6GA 1E0SA 3C15C 4U00A 2IYZA 3GEEA 3GLGA 4B3GA 3SR0A 3BAFA 2XXAA 4QRHA 4BFYA 3AUYA 4AKEA 2O8CA 4PAOA 1G4AE 4KFUA 1YKSA 1BS1A 2JLQA 1CR1A 2BMEA 1R2QA 4TQ9A 3V4FA 4CEHB 1DARA 4DDTA 2BBSA 1ZC4A 4H1UA 3P4YA 2WV9A 4PC2A 4Q1EA 1NMXA 5GVRA 3K9LA 3U3MA 1YRBA 2PX0A 4ZDJA 3TKLA 4Q00A 2ORVA 5B64A 2V55B 3L0OA 3VQTA 3SEAA 4JYCA 4EPXA 1E94E 2WVJA 1RIFA 4DCNA 3KX2A 3RDPA 4NZYA 5KNDA 1UBGA 4PSAA 1SXJC 3IO3A 3KZ1E 2ZRGA 1YVDA 5IHPA 1M7BA 2KWIA 1ZU5A 2JLZA 3T1VA 4D4MA 1RRFA 3A8TA 4KYUA 3GLFB 2ZSFA 2ZANA 2ONJA 1KGDA 2BJWA 4UXIA 2JJ8A 1RW4A 2AN9A 1W0KD 2J5XA 2PCLA 2BMFA 4KI0A 1S1MA 1GOTA 3T61A 3H86A 4HLQB 3AVXA 4QJ4A 2Z43A 3PUWA 2ZS8A 3QKRB 4IDPA 4I99A 4W5WA 3SYKA 3TQCA 5LD2C 4PFSA 4B2PA 4HI0E 5BN4A 2ZJOA 3B1YA 3IKJA 4TLBA 5FOTA 3CR8A 2I1QA 1OFUX 1WQ1R 4LHWA 5CIWA 4W5HA 3RS4A 2J87A 3B1WA 4EJSA 2WWWA 3SI7A 1F2UA 1W48A 3GEIA 3GLIE 1ZNZA 2WIBA 1M6NA 1I2DA 5FI1B 4WA7A 3WMEA 1OLOA 2CEAA 3LY5A 4B32A 4HEJA 3ZLJA 4NCIA 3WNBA 2GCNA 3N5CA 4U02A 3AP2A 5DHFA 3TH5A 3W6NA 3U7EB 4BFZA 1M1YE 3R9XA 3ZVRA 3B82A 2BV3A 2ZVQX 5P21A 1XPRA 2QZ4A 1ZUNB 3UKDA 1ZU4A 4V02A 4M9ZA 4NMMA 2EU8A 2AKAB 5L3QA 3I8SA 1YZQA 3U7HB 3G0HA 1G3MA 3CF6R 4B48A 3LDAA 3DMDA 1W44A 2MSDB 4IFBA 3U7FB 3TNFA 3QBVA 2OBLA 2QAJA 4OQMA 5L3SB 1PV4A 1XP8A 2WWGA 3QPWA 1Y3AA 4US0R 1NY6A 3WYFA 1DEKA 1F2TB 5CYOA 4UQOA 1E2LA 2C8VA 2MSEB 2VPPA 3NIBA 5TARA 2VHTA 3MJRA 5CK4A 1KO7A 2NGRA 4RFSB 2IYLD 5UKDA 3LFUA 2DHRA 3MFYA 2D7CA 1OIVA 1SVKA 1NN0A 3NKVA 1YZKA 2WJHA 3B9PA 3RS2A 3GLHE 2E1RA 4V0MA 2JA1A 3C7KA 1KDPA 3E70C 1NP6A 4S35A 5B58C 1EX6A 1J90A 2YWEA 3BBPA 5J4KA 4P33A 2JLRA 4RZUA 1SXJE 3X2SA 2FG5A 3UMFA 2D74A 1E0JA 1Q22A 2FX3A 4Q66C 4M2LA 4DC9A 3HPRA 3TR5A 1UKEA 3EZFA 1RJ9B 2P6UA 5M04A 4MQBA 3IEUA 1EWQA 1KDOA 5FR1A 2BCJQ 4WXPA 1KSGA 2GEUA 5JSZA 2OM2A 4FCWA 5EP3A 3GD7A 3EZ7A 3PXGA 3ZVNA 4N0EA 2YKGA 3DO6A 1NLYA 4TL7A 3MGCA 3ZVMA 2QN6A 3A1VA 1NVVQ 3WBKA 4ZPXA 1FTNA 2D06A 4TLCA 4TZ6A 3ZQ6A 4A2QA 2RGGA 2IC5A 3EW9A 3W3ZB 5FBRB 3VHLB 2J0SA 1G1MA 4JYBA 3K0AB 3VKWA 5FR2A 3B13B 1A7JA 3BK7A 2QBYA 2ZR7A 1GG2A 1UBFA 2C04A 1KAOA 2XZPA 3G5UA 3K53A 1E98A 4JVSB 4BFXA 3CH5A 2D2FA 5JJLA 4NTZA 1XXHE 2QPAA 4JKIA 4AD8A 5EZ5A 2WWHA 4F4IA 4TMXA 4XTCS 2FFAA 3K9HA 3EA5A 3RABA 1QHSA 1RZ3A 4Q01A 2P5TB 4FXPA 2X8AA 2R2AA 4GDFA 2OAQ1 3JVVA 3ZD7A 2QMOA 3BH0A 5JLJA 1G8PA 3SBDA 2PT7A 4WZAE 2R6FA 1E9FA 5E3HA 2QQ0A 2IYSA 1LS1A 5C18A 1P6XA 2BEKA 1JB1A 1S96A 2R62A 4FMDB 3GPLA 2EW1A 1AZSC 1N6IA 1OHHD 3B5JA 2VF8A 4JVNA 2AFHE 1XMIA 2DWQA 1EX7A 1I4LD 4OK3A 3UG6A 2WIAA 4UNSA 3SE0A 2XJ9A 5EE0A 1KI1A 3N70A 2W00A 4HAXA 1OIXA 2FSHA 2WSSD 4UNRA 1JAHA 2OCAA 4BFTA 1IBRA 2QI9C 1N6RA 5DI3B 5K8TA 1WCV1 3KQLA 5KUTA 5HPYB 2HF9A 3LQQA 2RHDA 2NO6A 2GEDA 4RVCA 1FFHA 1Z0FA 1AGRA 2G0NA 1SULA 2IT1A 1XTKA 2DYKA 3F0TA 3IIJA 5TB5A 3VR4A 2C9CA 3IO5A 5DGXA 1CR2A 3RNLA 1KDTA 1U8ZA 4C0LA 4LSGA 3SYLA 1UKZA 1DE0A 1KI6A 1HUQA 1Z22A 3VNVA 5KTYA 3IQXA 2RCNA 2IL1A 2VBCA 2J0QA 1TUIA 4GP6A 1XB2A 2C77A 4NYMQ 1KI8A 3THXB 1Z0IA 2ANBA 2J0UA 2GHIA 3FB4A 5ELXA 4NYJQ 1JECA 1DAMA 4P4SB 2QAGA 3WYAA 2IWRA 1OHHA 2CLDX 2GJSA 4NE2A 1AN0A 5G3ZA 1XEWY 4TL9A 2F43A 5KPJA 3O47A 5SZHB 2ZITA 2CMKA 1IN7A 4HDQB 5JWOA 3Q7PA 5DO9A 5AUOB 1VG1A 4D4JA 1TNDA 2AXNA 3FOZA 1FQKA 5CK5A 4W7SA 5JHGB 2VHUA 3CNLA 1NJGA 2O8EB 1CJKC 3PFIA 3EWAA 4AIIA 5KOYA 1J70A 3K70B 3H1TA 2FSFA 2YV5A 1T8TA 1W5SA 2ZE6A 4TTPA 4TLAA 2C5LA 1EWRA 2AD5A 1E1QA 2JAQA 1K6MA 4B47A 1U94A 2FMXA 2CL7X 1HA3A 3A4LA 3N2IA 2GETA 4Q4JB 4PC1A 1LW7A 4DJTA 1W4AA 3RRMA 1OYYA 2HT6A 1JR6A 4UNNA 2OILA 4PO1A 3QIAA 4LX0A 1AKYA 4D0NA 4F4CA 1KOFA 3FGNA 3HYRA 5E7MA 4HB2A 2R9VA 1E2GA 4NYIQ 2F55A 2QE7D 3QVVA 3IPYA 1E4VA 1XPUA 1UBEA 5J4HA 2PMDA 3AVPA 1NG9A 2ZEJA 3FFBA 3PCRB 3RWMB 1KMHB 3OF5A 1OXTA 2QRNA 3LQRA 2O8DB 1X1SA 3OIYA 4AK9A 3OE7A 3F3YA 2WTUA 2GXUA 1GKIA 1YRAA 2FFQA 2Z6VA 4HB4A 1VYTA 3LLMA 4GMDA 3RRYA 1FW6A 2XX3A 5KSOA 4EPVA 3CRW1 2J1LA 2GK6A 3HU1A 2F1IA 3BIFA 3AVOA 3LW7A 4RFVA 5EXSA 3KUCA 4EQ6A 4P32A 1ONBA 3VR1A 3EIHA 2NOAA 4B3CA 4IDQA 5TXGA 3NDPA 2CLSA 5F9HA 4Q4HA 1MOZA 4EFMA 4FWIB 1AS2A 4PHGA 1U0HC 3B60A 1MRSA 3ASZA 1H8ED 3AEZA 2HF8A 4FD2A 5KSZA 4LPKA 1VTKA 5HCNA 1R10A 1XDBA 2FOLA 1E2HA 4Y0VA 4DLSA 1X6VA 5DE3A 1AQUA 1FX0B 4JL6A 1U2RA 1GTVA 3TBKA 5AJXA 4QXAA 2IS2A 3VTKA 2C03A 2OO7A 4BFSA 4Q18A 1VIYA 1Z63A 4EIWA 2WKPA 2J46A 4ACAA 4NCHA 3AVVA 2GZAA 1LY1A 2PBRA 1WDTA 1XPOA 2GBLC 3NBYC 4E22A 2QUZA 3SU8A 2ONKA 3THWB 4NL4H 3CUEF 1G8GA 5J5CA 4TMTA 3TQFA 2Z4SA 4D4KA 3KKPA 2IUUA 2XITA 1W4CA 3R7WB 2V1XA 3OEEA 4LJ6A 4LJYA 3PUXA 5FUXA 4O3MA 3K0CC 2F6RA 3HWSA 4LYJA 4XD7D 3RSOA 3BORA 4Z54A 1KI2A 4OBEA 1QVRA 1UPTA 2FPMA 2HT1A 1ZM4A 3W90A 3GQBA 4E09A 2P6RA 3KQKA 4YXWD 2XAUA 4M1KA 3R9IA 4QFMA 3W8NA 3OEHD 2B6HA 4IW3B 5KDOA 5C2JB 1KKMA 4NKRA 4DCSA 5H70A 1NVWQ 1JXMA 1H8EA 2H92A 3B78A 4KLNA 4PR0A 4YQFA 1NKSA 1BYUA 2A5DA 3EWSA 4HB3A 3A4NA 4MYCA 2ZRIA 2IHYA 2IWHA 2QG6A 2AL7A 2IS6A 2O8BA 3RS0A 4RD4A 4MKIA 2BM0A 1GWNA 1GITA 1T8UA 3KKNA 5IRCD 4C7OB 3KXIA 1EFTA 4R2HA 3CX8A 5AUQA 2F1HA 1YZTA 2UKDA 3SHWA 3I4LA 4I81A 1M7HA 4Z51A 4DLXA 1YZLA 1Z29A 3LO5A 1ZIOA 2GDJA 2MMCA 1X1RA 2ZYWX 4HUQA 4JT4A 4KLZA 4EPRA 1Z2AA 1G7SA 2XNDD 2GCPA 3LBIA 4I4LA 1IM2A 3X1ZA 2G0TA 5FL7D 2JCSA 3PEYA 1QDEA 1ZMXA 2BDTA 1P5ZB 1RKBA 4D6PA 5TDHA 3LWNA 2BBWA 3LW8A 4XVUA 1R5NA 1D2NA 1SVIA 4UXHA 3UG7A 2EYUA 4C2UA 4ZIRB 2X2EA 2RGDA 1E0KA 3P32A 3I3SR 2DWPA 2N1BA 2OXCA 5JMTA 3AGPA 3QF4A 1LV7A 2C99A 4TSFD 3W5JA 4CEIA 1KK0A 1N0WA 2FE4A 2BWJA 2WWFA 3PVSA 3K70C 1G5TA 4LJ8A 3UWOA 4MA4A 2Z83A 4UNPA 5L3RA 5FL3A 4V0KA 1D2EA 4NCNA 4DT1B 4E03A 3MAAC 4FCVA 3EPHA 4I1UA 4ASUD 5G40A 3QEOA 2CNWD 3SJZA 5JCZA 5KHOC 4B35A 3PV0A 4RCYA 121PA 2PL3A 2E87A 1ZM9A 3WRXC 2DR3A 3TUIC 2J59A 3KFXA 2PZGA 2VH5R 5DLQC 5DISB 2G1KA 3EG5A 4URVR 2MMGA 5CJ2A 1I2MA 5JI3E 1BKDR 4LJ5A 3ZIAD 3DEFA 1ZNYA 2A7QA 5FPHA 3U3OA 4JBXA 4M4SA 4TMWA 4A8JA 1ZW6A 3SQWA 3EZ2A 2BKUA 2ZRPA 4Q48A 1KSJA 2OT3B 1E69A 2OHFA 4TMVA 3THYA 3ZZUA 3I72A 1JJVA 1IAQA 1FL9A 2VHCA 4URWR 1DAIA 4H9GA 3KQHA 1VCIA 3U44B 2O8FB 5AJWA 2EQBA 1II9A 1XEWX 3E1SA 1P75A 1XEXA 4KSCA 4BECA 1QHGA 3WHLA 2RGNA 3A37A 4M8NE 3TRFA 5JWRA 4TLDA 4ASUA 2WOJA 4A92A 4ARZB 2BMJA 5EE3A 2PT5A 3C5HA 4V0NA 2BKEA 5CB8A 2AFIE 5L3VA 1OH8A 4M0LA 3AVTA 2BM1A 3D7MA 4P31A 5LBIA 2GXQA 1Z6AA 3ZDQA 2J0VA 3D31A 4B6FA 1II8A 2GJ8A 1TL7C 1XXHB 1Z3IX 2B7BA 3QVUA 2FU5C 1G16A 3U4QB 4LDJA 2BIFA 3CIOA 5FTKA 1NJFA 4OHYA 3CRRA 3SQXA 1HQCA 1XEFA 1UFQA 4O2LA 1XZQA 2AK2A 5EQTA 1U8YA 3UXMA 1KNQA 3FDIA 1UDWA 4ACBA 1SVOA 4G0NA 1JALA 3KJHA 1W36D 1FUKA 5FPYA 5BW8A 1TMKA 5AK0A 4Q5IA 4KFTA 5J4LA 1VMAA 1OYWA 3AH8A 3IHWA 4Q19A 2FFBA 2FSGA 1NVUQ 1G5RA 1Z0AA 2GCOB 2YHSA 4OK6A 1FMJA 1HT2E 4TTRA 1XU4A 5FBLB 1IQPA 3CPEA 3AF4A 1CTQA 3GJXC 1ZAKA 5HCIA 3LV8A 4C0KA 4PXAA 4X8HA 1P4SA 3RSLA 3OFNA 2Q9BA 1Q44A 1X86B 3LXRA 5JJIA 3NHAA 5KSYA 2ERYA 2PEZA 1PUJA 1DAHA 4OL0A 1R0ZA 2Q9AA 1WA5A 1XX6A 2ZRAA 2P6NA 4RY2A 4DUGD 2X2FA 5HZHA 2FPKA 2IS1A 4LCBA 4JLNA 1G4UR 4FIDA 1XD9A 1G8HA 2QROA 1NN1A 3LRPA 3WMGA 4DWJA 1KTVA 2QP3A 3OZXA 1IJEA 3MUFA 3KJGA 3HYTA 3ZGXA 4OQLA 3I92A 4EFNA 4MKFA 3K0SA 3RC8A 3ADBA 1Q20A 4TMKA 4W9MC 3PUZA 2QPTA 2N46A 2ZXUA 1T4GA 1J8YF 2WMOB 3ND8A 2QT0A 4CRWB 1SGWA 3QKTA 5B30A 4Z8XA 2FJUA 3V00A 3L82B 4KVAA 1VIAA 1K8RA 4OHVA 2IX3A 2VYFA 3TGPA 2QMEA 4KHZA 1N6HA 4BLTA 5BN3A 3A6PC 4JZKA 4OI2A 4OQXA 1KY2A 4ZDWA 2IUSA 1VHLA 2IXGA 1UAAA 1TQDA 2RGAA 5FUYA 2IEZA 2NZJA 3FHCB 3NBZC 2G88A 3RS7A 1TU3A 3QXXA 2KB0A 4NHOA 2XB2A 4WW0A 4O0MA 1E9CA 3TAHA 4QKQA 2GWHA 3U7GA 1TF2A 1U8AA 3QUSA 1XMVA 1MABA 4B73A 2P65A 4C9BA 1TQ2A 3GJ7A 1TADA 4D2IA 4JLPA 4DUGA 1LTQA 4A0FA 3CR7A 1U0LA 3Q5EA 1PZNA 1IY0A 1GRQA 4RD6A 3ZZTA 1N5LA 2PX3A 5DHAA 3T34A 2WZQA 1R8QA 1F5NA 2WBLC 2R6GA 2RGBA 4MRNA 4CZ2A 3GFOA 4URYR 1CBUA 2JATA 2OSBA 1NSFA 4NH0A 1LNZA 3AVWA 4AKIA 4TYNA 3WHKA 2REBA 4AKHA 5EE9A 3X1XA 3B1XA 3NWJA 3SJBA 2G83A 2IEYA 2P5SA 3ZVLA 3U60B 5J40A 2O0KA 3OIUA 4GOXA 3CRVA 3TSZA 1W7AA 1J7KA 2FEMA 1JR3E 1N6KA 3LVRE 3PITA 2WWYA 3UMSA 3CRMA 1X8LA 3RS3A 3RLFA 4AG5A 3UIEA 3KFVA 1XFAA 1GAJA 2PLFA 3TIFA 3FTQA 1JNYA 1IN8A 1F48A 3GLIA 1TPZA 1YU9A 1SVLA 1US8A 4DRZA 2AD1A 2GVDC 3AP3A 2AX4A 4QBHA 2HXYA 1OPXA 4D26A 3CONA 2G3YA 1XTSA 4IFEA 3C5CA 1OFIA 1P2VA 1YR8A 2ERXA 2ODEA 4LOAA 3TR0A 1RRCA 1WBBA 3ETLA 3QE0A 1JI0A 4DCTA 3MG9A 4M9QA 1FP7A 2ZSBA 4OHXA 4B33A 4JLOA 4PPQA 4JT2A 2Q21A 4N0DA 2LCFA 4DSUA 2IK8A 3AQ4A 3UK6A 3PEWA 1OF1A 1HEIA 4AWXA 5CLQA 3A4MA 4F93B 2O0HA 1M34E 1F6BA 2D62A 2GAOA 2REXB 2HJVA 4LYFA 5IDVA 3CM0A 4GPTA 4PC3A 2ZU0C 3RYTC 1NY5A 1VECA 1RRGA 2QM7A 4BLQA 3NTUA 1W47A 3LA6A 4WZ6A 4Q1DA 4XSHA 1E2QA 2IYQA 5TV2A 2YWGA 4AG6A 4DCUA 5F98A 3VR2A 3NG1A 4XIGS 1G41A 4QC2A 1ZNXA 2OXRA 2CL6X 3CF2A 5EP1A 5C1BA 3T1TA 2GTPA 1XTJA 2XJ4A 4QGGA 3L43A 4M22A 1EK0A 1ZD8A 1DG3A 2QMHA 3GLHA 1GM5A 5FTJA 3QKSB 4G3XA 4L4UA 2QMUA 5AWFC 3TW4A 3U6KA 4FMCF 4HLUC 2RGEA 1TX4B 4FW9A 2ANCA 4AY2A 3CX6A 2DWOA 2GJAA 4YDSA 2QRZA 1SXJA 2VO1A 4KFSA 1GVNB 5G41A 1C9KA 3NEYA 5FOSA 4G5GA 2JLVA 3P1JA 1OFHA 1PJRA 4B75A 1E2DA 5HKKA 3X1YA 5GADl 1CJTC 2J7PD 2NG1A 3H0KA 1ZINA 1TQ4A 1E2MA 2YVUA 1O3YA 3AKDA 2ZE7A 4GRAA 1VG9B 2ORIA 4BZQA 1Y63A 1FNMA 1NL3A 4MRVA 1GKUB 2CVHA 2G77B 2W0MA 4TL6A 1KK1A 2RHMA 2RB4A 2QSZA 2F7SA 1H8HD 2ZAOA 1OXVA 1COWD 1AGPA 2PJZA 3TMKA 3CKLA 4LJ9A 2WPDA 1R7RA 1NIJA 4ON9A 3BC1A 1C4OA 2GNOA 1P61B 1XNJA 2AHOA 3QXJA 3B8HA 4PPNA 4US2R 1QHHB 3IDQA 3WBJA 1G9XA 4MUAA 1KKLA 2IYUA 1AS3A 2KJQA 1E2IA 2EVWX 3IGFA 2XNSA 4JJKA 4F92B 3U5ZB 4XTRA 1IY1A 1Q3HA 5FOWA 2YC4C 1N0UA 3EASA 1SHZA 4DSOA 3HU2A 1R5OA 1IN4A 1OW3B 5K8LA 1M8PA 621PA 3AP1A 4D4LA 1AK2A 2D7DA 2YINC 4HYYA 1WXQA 1GNPA 3HJNA 4HAWA 4KCGA 4LBWA 1OXSC 2DCUA 4XWAA 3M1IA 1GIAA 2VHJA 1IOZA 1G21E 4HLCA 1Z8FA 5FI0B 1CKEA 2J7PA 1OXXK 1XMJA 2QQEA 1XD2A 3NEJA 2CJWA 3SZRA 1MO3A 4XVRA 1U90A 4IVRA 4GSYA 2FWRA 5GJWC 5EZ6B 4KITB 4HLUA 1WP9A 1NVXQ 3BFVA 3DKPA 1RYFA 2FV8A 5DN6D 1D5CA 2WMNB 5D3MA 3X1WA 5DH9A 1H8HA 1HH4A 4XH9B 4DLYA 1COWA 1MRNA 2UZIR 4KVGA 2IF2A 2F3RA 5A4JA 4RZXA 4CEJB 2A5GA 1P73A 4KYIB 1RFLA 3K0FA 5K8IA 4HZUA 2KBFA 4Q4AA 1W46A 3A36A 4EFLA 4RD0A 3ZQJA 1U99A 2GILA 1WE2A 1Z28A 2FH5B 2SHKA 4WIAA 3AUXA 1T3SA 3FKSD 3T35A 2EYQA 1XJCA 2VLIA 1E1QD 1Q1ZA 1TEVA 2A5YB 3S1AB 3TLXA 4QJ5A 5KSPA 1NLFA 3C4JA 5AJYA 3DHWC 4Q7MB 3LNCA 3NC0C 2JLUA 1SKYB 1T3LA 2OAP1 1DOAA 4IOLA 1KI3A 1G5PA 2ZUDA 3CF0A 4JBYA 2XOKD 2WWIA 3TUJC 4TN1A 5J4YA 3BS4A 2HUPA 3QF7A 5CDFE 1T5LA 3CB4A 5DI9A 4LJ4A 2FF7A 4Q7LA 2A9KA 3AF2A 1HTWA 5JS7A 2ZVPX 5L8VA 4RD2A 3JZAA 2NPIA 2ZI5A 4DB4A 1GL9B 1RE0A 4CEHA 3OE7D 5DN6A 1UADA 5D3QA 4BRWA 1FUUA 3W6OA 3G82C 4RCZA 3MWYW 4C0AC 1LF0A 2JIZA 3L0IB 1I4TD 3CX7A 2WWXA 5TY0A 3PUVA 1OB2A 5J47A 2BC9A 1DAKA 3BERA 3BGWA 2R65A 3N2EA 4DKXA 3ND9A 1GNRA 2IYVA 1Q21A 1M2OB 1VG0B 3DKVA 3P4XA 4JLBA 3VAAA 3AVYA 1OXUA 4QNRA 3FPAA 4PTLA 1FNNA 1UF9A 5E7IA 2ZS9A 2ZJ8A 5SZKB 1U9IC 4DBLC 3FKSA 2H7VA 2GRJA 4FMBB 2ATXA 4NPHA 4DLVA 3GLFA 1QHNA 4QOSA 5JHHB 2CCJA 1E99A 2Z0MA 1HQYE 2VSFA 4HB0A 3KDSE 2XOKA 3AM1A 1UEJA 3VHXA 3QG1A 1ZCAA 3HPQA 3VR6A 1GL6A 1K5DA 1ZCBA 4FCTA 2FA9A 1F3OA 3QKRA 4ZCLA 2CXXA 1UEIA 2IA5A 2OEPA 2PEYA 3U3JA 2VSXA 1E32A 2OUKA 4P0TA 4BASA 1VG8A 3O8DA 1EFRD 1XJQA 1T6NA 3OESA 721PA 3E5HA 2ZSEA 3T15A 2ZJ2A 1N6PA 1L7VC 4C2TA 4EPYA 1RPZA 2DBYA 4QBGB 3CZPA 2ZI3A 4ZI3A 1N3BA 8OHMA 4IRUB 1QF9A 4PQRA 4B6EA 2QA5A 2R44A 2BCGY 1D6JA 3NBXX 1CEEA 3H4MA 3OEED 4B44A 4DEYA 3U3RA 1DAGA 2XZOA 2FNAA 4GNKA 4QGFA 5SZIA 3AGQA 2ZRMA 4JVMA 4Q9LA 1P9NA 1ZD9A 1ZUIA 4JIMA 3R20A 4GZLA 5B2ZA 5EXXA 5IF9A 2B8WA 4DLZA 2QP4A 4PQFA 3REFA 4RKFA 4PPFA 3DM9B 4EPTA 2QORA 2A3RA 1KO1A 3TJZA 2EFEB 1GP2A 1KNXA 3IUYA 5DNYB 3ADDA 1SKQA 3KTAB 1A5TA 4A36A 1Q1EA 4POAA 2AR7A 2Q3FA 2F9LA 3HDTA 3LX5A 1XCMA 4PC7A 1NSTA 2BEJA 2GEVA 3U2QA 1JEEA 5L3SA 4QG7A 3I8XA 3VU9B 4AURA 1CIPA 5BWMA 4TMZA 2V9PA 1TUEA 2MSCB 2ZPTX 1F2TA 3ICQB 2BJVA 1R8SA 1FTSA 4PSVA 2PJRA 4OI0A 1RRPA 1EFRA 4RFSA 4QJ3A 2PLRA 2QGZA 2QT1A 1WF3A 1LVGA 2CVFA 2ZJYA 5FUVA 4O2RA 2W0SA 5IK2D 2PMKA 4QHSA 4LJ7A 1G3QA 4TZ0A 3B85A 1XCPA 2HYIC 1G3IA 4CT5A 3T06B 4CF7A 1W36B 2G6BA 1KSFX 4M1YA 3GLGB 3GJ8A 1IONA 3EZ9A 2OV2A 3NH6A 4AYXA 4C3ZA 2XXAB 2WKQA 1MH1A 1MT0A 1Z08A 1E6CA 1YZNA 1Z06A 3LAWA 2O8CB 1MR3F 2IYWA 2PH1A 1RJ9A 5AUPB 3FE2A 2EFCB 4TYYA 1G291 2ZRKA 2XSZA 4JL5A 4QL3A 2EFHB 1EESA 4RKEA 4ZCIA 3CO5A 1EFUA 3Q9LA 4MKGA 1P3JA 4YMTA 3EIEA 3HR8A 3LVQE 5B57C 2ZUBA 3VKGA 4LHVA 3K09C 3ONWA 4KV9A 5H68A 3QBTA 2REOA 1DAFA 5HR5A 1E9AA 1ZD1A 2W58A 4NCJA 4Q1BA 5CITA 1T91A 3SYNA 1NBME 1S3SA 3KL4A 3UMRA 3AVUA 4AKGA 4PAQA 3WXMA 3IIKA 1QZXA 2BOVA 5CM9C 1OH5A 3K0EA 1PLKA 1J8MF 1QBKC 2GF9A 3C41J 3MSXA 4U5XA 2J7KA 4LV5B 3K0AA 2VHQA 4WOPA 4M1SA 1OH6A 3GEHA 5FPKA 5JJKA 3A58B 4RZ2A 2EFGA 2R6DA 1KMQA 4QBFA 5JZVA 2J9RA 2RKOA 4M1OA 3IEVA 1JAIA 4MRRA 3T12A 5FFMA 5K8UA 1CRQA 1HY3A 3EXAA 4WAUA 5IK2A 4ABYA 1KSHA 2GESA 3K9GA 2HV8A 1FPMA 4TYQA 3DZDA 2PZEA 4KBGA 1PVOA 1XD8A 3E2IA 2C78A 4Q7JB 2WJIA 1JJ7A 1D9ZA 4OQFA 4QHTA 4C0JA 2CK3D 4OHZA 5FBVB 1NNEA 4MYUA 4PANA 2JLWA 1ZM2A 1Z0DA 2QSYA 3BD9A 2CCGA 4EJSB 2HCJB 2GBLA 1ETUA 1F2UB 4ZKEA 3QXCA 5EXPA 4LJAA 1KI9A 2BMDA 4IOKA 3EC2A 4LWZA 1ODFA 1X3SA 5JFGA 1T0HB 2C2HA 4A6PA 2WAXA 4IJMA 2WAYA 3K0CA 1SHKA 3RWOA 2QPOA 2ZE8A 1N5KA 1CP2A 1W4BA 4PHTA 5ANRB 5F3WB 4FI3C 4Q02A 5DI3A 5L3QB 3DOEA 3RS5A 2LKCA 4R98A 2LKDA 2A78A 3Q5DA 4A9AA 4YMUA 2ZRJA 2QEQA 3CH4B 3QKUA 1DG1G 4A2PA 4IEEA 4Q1AA 2NO9A 5JEEA 3VNUA 1P2TA 2OLKA 4JLDA 4WBSA 4GOJA 1QG2A 1ZM7A 3ADKA 4Q21A 2ZJ5A 4LC1A 2Q9CA 1OFTA 4IDOA 5JI2E 2GAAA 2WJGA 2WKRA 4Q1FA 1NLZA 1T9HA 4URZR 3Q7QA 5EXTA 1JQLB 4M1TA 2I1VB 4BUJA 2YOGA 1SKYE 3I62A 2ZI4A 3BE4A 4FINA 2CK3A 3L2OB 5KPDA 1YHNA 3R8CA 3THXA 2OG2A 3TAUA 1L4UA 6Q21A 1BYIA 3WMFA 3OFND 5A0FA 1M74A 2QL6A 4DZZA 1Q12A 4XOIA 5DSZA 5LDDC 1XWIA 3F5FA 4KXFB 4P4SA 4BFWA 4BRUA 1DAEA 4EUNA 4DDWA 1IXZA 1XTRA 1L2TA 1ZYUA 1KHTA 2ODNA 1SZPA 4QBIA 3LXXA 2JEOA 3HU3A 3NVAA 2FZLA 3CBQA 2QY9A 1G3RA 2JJ2D 1N2CE 2O8EA 3LLUA 2A30A 4J0QA 5EE1A 5GJVC 3V4RA 4OI1A 3SDZA 3W34A 1LB1B 3WRYC 1PLLA 5JSZB 4AC9A 5KDLA 4LY6A 1KI7A 4ZDIA 1G8FA 4C0SA 4GZMA 3W9YA 3MCAA 3OIWA 1ZC3A 3DPUA 1HURA 1SVSA 5H1YA 1VCOA 4GOKA 1KK2A 4G01B 4Q4JA 4XJXA 2C96A 3SS8A 3NXSA 4TTQA 1EXMA 5E4FA 1FQJA 3K9NA 3LBHA 4NONA 2AKYA 1E2NA 4IEIA 2QBYB 1X8KA 3TW8B 1O87A 1IN5A 2PCJA 1F60A 2QU8A 2WICA 1G6HA 2O0JA 4R71A 2YWFA 2NO7A 1KMHA 2KSQA 2V1UA 2DPXA 3WNCA 2NO0A 2W2TA 2ZRDA 3IIMA 5AUNB 2NO1A 4G5RA 4PSKA 2O8DA 2JJ1A 1JQJC 1EFHA 1EG7A 2JLYA 4UJ3A 2OCPA 2P3SA 1ESMA 5FBWB 1S8FA 4D82A 2WJYA 4B3DA 2VRWA 3C14C 4TYWA 1NRJB 1ZM3A 2RH5A 3FMOB 1WRBA 1AQYA 2NQ2C 4YMWA 3O8CA 3A1WA 5FTNA 1OV4A 4JMPA 4Z1MD 3FHTA 4LBVA 2JJ2A 4URUR 4LYAA 1GFIA 3DOFA 4YC7A 4ESHA 3AKEA 1VPLA 1NVVR 2F1RA 4DDVA 4DB2A 3M6AA 4D25A 3P20A 3SJCA 2NMVA 3KB2A 3CPJB 2DFLA 4H1VA 4KJZA 1Q0UA 1L4YA 5CIQA 2P67A 3IBGA 3RAPR 3VR5A 5HE8A 1FX0A 4JLAA 1RC8A 3WP1B 2QGNA 1XMSA 1QHIA 4OYHA 5CJPA 1GL7A 3GMTA 2P2LA 4GBMA 3ZYCA 3DM5A 3O8BA 1AKEA 1DELA 4JVLA 5C4GB 5BQ5A 2V4ZA 4DCVA 3B7GA 4MYHA 3PENA 1E0AA 5EJEA 3GJ5A 2CLCX 4D0GA 1YQTA 4EJSC 3PUYA 4PZZA 2XB4A 4BEJA 2ZIAA 4B3XA 1G17A 2HXSA 4A0RA 3THWA 2KBEA 2XTNA 4BLSA 3PR1A 2Q6TA 1N5IA 1TU4A 4L9SA 4QGHA 2RAPA 3R7WA 1JPNA 1E1RD 1I4DD 2C9YA 4F4JA 4V03A 1Q3TA 3GJ4A 2XTMA 4LZZA 4R7ZA 2VEDA 1GDDA 2YZ2A 4LBZA 1KI6B 4U7DA 3KKQA 3H2YA 2O52A 1PLJA 1A2KC 2W2XA 4FN5A 4MYTA 1QVAA 3EPJA 3B1ZA 4Z1MA 4ZO4A 2YOFA 1G3UA 2GZHA 2J0UB 3AV0B 2ZR0A 2UVQA 2J41A 3FMFA 5BYJA 4I1OA 1JR3A 3QI2A 4A0GA 3EPLA 1S4QA 4NDZA 2Y8EA 3T5DA 4L9WA 3GLGE 2QAGB 1Z6TA 1KJZA 3PIRA 4BFUA 4ERNA 1LF5A 2F43B 4F7WA 2IYYA 1OT3A 2RMKA 1ESNA 1BMFA 1A2BA 2VTKA 4OQNA 4C0QC 1ZJ6A 2JGNA 2KE5A 5LPNA 4UJ5A 821PA 4C7OA 2H8KA 3BFKA 1G7CA 1W5TA 4HAYA 3KQNA 4B74A 4TQAA 2Q3MA 2G9NA 3EC1A 3SNHA 4II7A 1A82A 5TMPA 1P2SA 1SXJD 1UDXA 1OIWA 2O5VA 4R9UC 5JEDA 4M1WA 3QNUA 1VYUA 1XZPA 3IILA 3OHMA 1QHYA 421PA 2JDID 3C16C 4BWYA 4QM6A 4C0HA 1H65A 3T5GA 2WHXA 1W0JA 1CR0A 5HKKD 2IXFA 2QP9X 3IHLA 4IDHA 4ZIRA 2ODWA 4DLRA 2H5EA 1E1RA 4D81A 5KYKA 3EPKA 1FMLA 4S2EA 1XF9A 2VSOA 2WSMA 3A1UA 4BEBA 5SZJA 1C1YA 4M1MA 4NYMR 2I4IA 2ZUCA 1OE0A 4NYJR 4ZI2A 5JS8A 3V9PA 4A2WA 3ADCA 2H18A 1OH7A 2NPFA 2ZRCA 4UKDA 5FTLA 1OB5A 4DT1A 2IS4A 2OFWA 1BH2A 5E7JA 1CULC 4BPBA 2WPDD 3ZJYA 3T1OA 3FWYA 4FMDF 3W5IA 2ZR9A 4HLDA 3U61B 1ZRHA 3QSYA 2J3EA 4JBWA 4EQ6B 4G1UC 1QRAA 2H17A 3FMPB 2A2ZA 3GJ3A 4O25A 2DFNA 2RGCA 4YMSA 2EFDB 1UBCA 2V54A 2YOHA 3NBFA 1OJLA 3A1SA 3BH7A 4Q4HB 4E07A 4KODA 2F1JA 4OJQA 5LB2A 2ZS7A 3GJ6A 5J4VA 5BXQC 4F91B 2VQSA 2VL7A 4M21A 3QJYA 5H8WA 1LS6A 4ZV4A 1HV8A 3AF3A 2HYDA 3ECCA 3NDBB 1E79D 4L5BA 2F3TA 1FOEB 2V6IA 1GKYA 4TYPA 2ZQ5A 2JDIA 4DHEA 4PX9A 1W0KA 1NN3A 3QOFA 1S9HA 1AA9A 4HDOB 4NYIR 3KB1A 2BBTA 3IPXA 1Q57A 1CF4A 4MRSA 5BN5A 3H84A 4LRWA 4D80A 1E9SA 2FN4A 5JBQA 4L16A 3MJHA 1NF3A 3U44A 2O8FA 2OESA 3CRQA 4PAMA 3SFVA 4QHYA 5HZKA 2ZYTX 2CL0X 4HDCA 4LC0A 4LV6A 3SJAA 1N0VC 3FFAA 2OBNA 3LBNA 5KNCA 1N25A 1W49A 2ZREA 3Q72A 4CVNA 2QENA 1CR4A 3AF1A 4XSGA 2ASEA 1IY2A 4ARZA 3LX8A 1YR9A 1Q1QA 2UZ3A 3EAQA 1EGAA 4G5OA 2QTVB 4KBFA 5JRJA 1U81A 2OCYC 3B1VA 3I32A 4V0ME 1B0UA 4OHWA 2IYXA 2NTYC 4DEXA 2GZDA 2OFXA 2FGJA 1CLUA 3RVBA 3VKHA 1XXHA 3U4QA 3EZ6A 5CB6A 3EX7C 1E2JA 2FDCA 1Z2CA 3RHFA 4PHFA 2VF7A 2B92A 3CNOA 3I73A 2R6AA 4HAUA 1E79A 1QHXA 3TVTA 2O8BB 2CHQA 2EWWA 1YR6A 2GXSA 1TF5A 4B71A 4LHXA 1GRRA 5KO2A 1YE8A 1S2MA 1Z07A 4E5UA 3SBEA 5EUQB 3K1JA 1CU1A 1MO6A 1NN5A 1N6LA 3GJ0A 2BHRA 2H16A 3BXZA 3REGA 1D2MA 3M0EA 3RC3A 4AYTA 4NBSA 4HUQB 4LI0A 4KAXA 5DYGA 4GL2A 2GCOA 4MDFA 5GJBA 4Q4LA 1KAGA 1E9DA 2A5JA 2ZI7A 3QXSA 4N3NA 2QAGC 4XWKA 2I3BA 3EA0A 3DVLA 4C0BA 1OKKD 2L0XA 2RGXA 2JIZD 4OJKA 4B2IA 1E2PA 1GNQA 4RZ3A 4G5SA 3EIQA 1RYHA 2W6ID 3QF4B 1TQ6A 1DPFA 5EUMA 4CEIB 1R0XA 3ASYA 3Q85A 2V6JA 2GF0A 1KJYA 5AJZA 1DO2A 1IJFA 3OIVA 1G19A 2GJKA 4HAZA 4P4TA 2Z5FA 3M4YA 3BWDD 1AJEA 1WMSA 4NCKA 1KJWA 2ZU6A 2XTZA 1BIFA 4P3YA 1TAGA 4JSTA 2HLDD 3KUDA 3W3AA 2OCBA 4QGAA 2ORWA 3JZMA 1S9DA 5CDFA 4L8GA 3VMFA 1KO4A 3CWQA 4PHHA 2ZRHA 4MUBA 4WVFA 4D0LB 1KDRA 2Q0HA 4FMCB 2GA8A 1NMZA 4TL8A 1R0WA 2GKSA 4RD3A 4K81B 4Q9KA 5KNBA 1ZBDA 1V43A 5JRZA 3PEUA 3ZD6A 1KK3A 4A8JB 4DVGA 1X8JA 5CLLA 2XEXA 4IVPA 4W5JA 1KIMA 4JL8A 4LV8B 2ZRBA 3ZS8A 4B76A 4HUTA 4RJLA 1OKKA 4RD1A 5FOUA 3THYB 1ZNWA 2TMKA 4HAVA 1MV5A 2V7QD 3IBYA 1E9EA 1P72A 3AF0A 1AS0A 2H57A 2G1JA 4K46A 1VYVA 2W6IA 2ZRLA 2ZRNA 3NC1C 3SHFA 2YC2C 3LD9A 3WYGA 4UXJA 3TUZC 2R6CA 2LWIA 1SQ5A 2ZM5A 3KJEA 1TF7A 3BRWD 4V0LA 1XEXB 1AM4D 2Q3HA 1HT1E 2V8OA 3JVUA 3QG5A 2HLDA 4BQSA 1P7CA 1YJ5A 4G5QA 5G3YA 4X8MA 3K8YA 1NG1A 4TT3D 3RRNA 1YZUA 3ZH9B 1R4AA 1II8B 1ZVQA 2ZETA 3P27A 4IOMA 4MITA 4PZYA 1G7TA 3GFTA 4PPGA 4XWOA 4EDHA 2WSSA 3ZZ0A 1DVRA 2ODBA 3CWZA 1P2UA 4LBYA 3VFDA 3WY9A 3ZS9A 1LFDB 1W2HA 2VP0A 1ANKA 3P26A 4IVQA 4EAQA 3QQ5A 1N5JA 3A1TA 2ZJBA 3L0PA 2FEOA 4MKHA 3KJIA 1G6OA 4OKSA 2AWNA 3NH9A 2WJJA 1XRJA 3TE6A 2WOOA 4V0OA 4JKYA 4BLPA 3RANA 2FSIA 1E9BA 2HEIA 1E4YA 1P60A 2ZROA 5HTKA 1G64A 4OK5A 2V7QA 2ZYVX 4Q7KA 1AIPA 1L8QA 2CE2X 3GLFE 4IKEA 2ATVA 2A5FA 2JASA 2N42A 2GXAA 2C98A 3L8ZA 2V3CC 5FPSA 3I5XA 3F8TA 2AWOA 4ZDKA 3NHBA 2XSZD 1NBMD 2W6JD 1U98A 1FP6A 1Z6XA 4YMVA 3HP1A 4B3BA 2X1VA 3WNDA 4JLJA 2D3WA 3O8RA 3DMNA 1VDZA 3KQUA 2OZEA 4TT3A 2NZ8A 1VHTA 3FMIA 3LH5A 4WZBE 5FOVA 5DYIA 4CIDA 1B23P 2CHGA 2VP2A 1KZ7B 1DTSA 4GP7A 5F2EA 4MRPA 2K5UA 1KZGB 3PG5A 5FPTA 3HR7A 1GRNA 3QKSA 4A0HA 4BGDA 4IXNA 2IXEA 1HE8B 5EE5B 2FZ4A 4X8OA 4KO8A 4BE7B 1V5WA 2X77A 1ELOA 3QY0A 3W6PA 3AKCA 1GILA 1U9IA 4CDGA 2IUTA 4QM7A 2CE7A 1JXOA 1UKYA 4Q9HA 1A1VA 2CCKA 4DXAA 3QXHA 3MLEA 4BLRA 1R6BX 4F38A 3L8YA 2CBZA 2X19A 3C8UA 1J2JA 2B7CA 2J45A 4HSEA 1N6NA 2QE7A 4KSBA 3I61A 4Q03A 1GZSA 4PO8A 2ZJZA 2QTFA 5TVKA 3ICEA 4ZKDA 2D2EA 1JBKA 3CZQA 4DLTA 4LGMA 3X1DA 1NBMA 2W6JA 3SN6A 2IYTA 4IHQA 1NKTA 3DDCA 4UNQA 4FWTA 1U0JA 1Z5ZA 4DIEA 1XTIA
chains in the Genus database with same CATH superfamily
1TLFA 1C8VB 1G18A 2ZQZA 5TQ0A 4EKYA 3VR3A 1UKVY 3WK7A 1T1EA 3OCWA 3R5KA 4Y1RB 1XCJA 5AW9A 4I8IA 5U1PA 1QOPB 1TMOA 1RI2A 1JFRA 1P9OA 1X77A 1CRPA 3MW8A 2PWYA 4EEZA 1Z47A 4L1KA 4GI3A 1Y4SA 1WTAA 4D0SA 1TJNA 4W4TA 4EECA 1GR0A 1B00A 3OAAD 2BGWA 3NAGA 1T3HA 2F90A 1NUTA 2FFHA 4OMFG 4Q1CA 2VA8A 2IYRA 3MWJA 1VGVA 1WB9A 4LXUA 1RRMA 2Q7XA 2ZWPA 2OP0A 3KP1A 3PE4A 2PGXA 3RVPA 2AF4C 2AYXA 3TK1A 1EI9A 5K3FA 1W8DA 2WIJA 3H5WA 2OBBA 1T6ZA 3PA6A 2OK8A 3OLZA 2BVNA 1GEGA 2YMLA 3GRKA 4FD3A 4EOGA 4AI6A 2PH5A 1OSNA 2B4RO 2YIDA 2BMAA 4Q47A 3ZIDA 221PA 1EJ0A 3WGHA 3S8YA 1D8TA 4N9WA 2W2KB 3PNPA 4M9CA 1HFKA 3DXXA 1MAVA 4KPEC 2EQAA 4PXYA 1N3YA 4DSNA 3QPAA 3QEBZ 1DJOA 2RGNC 2ZYGA 3ONVA 5B1DA 5C53B 2JBHA 1E2BA 2OBMA 2D1QA 4GT1A 4M9SA 2XCIA 3TQQA 1E5TA 4X71A 4EY5A 3J81k 1P6QA 1M1YB 4YLGA 2B78A 2QYOA 3T5MA 1JKMA 3AYZB 3MELA 1N3LA 2XLBA 3BM5A 1I4EB 3LDFA 3GDHA 2Z9DA 5LYYA 3VSCA 3WWCA 4CEJA 1NI4A 4LMBA 3WL5A 1BWSA 1IZ9A 4M0FA 5KOHA 2YNMA 1A4UA 1D5WA 4GYWA 2ZT5A 3ZCVA 3VX4A 2GN9A 1J8VA 4HKTA 1F8FA 1MO5A 1YUMA 1ZP6A 3K5IA 4IDNA 4TXLA 4YXWA 3JAWB 2VP9A 2FLWA 3OAAA 4IKOA 3A4YA 3WLJA 1D4AA 3W3AH 3ZWBA 3M8KA 4L6IA 2ZWVA 4HRYA 3F47A 3UUWA 5CYPA 5K6AA 1QGYA 2Q1SA 3MGGA 4Y67A 5EWJB 2C07A 5DM4A 3ZHTA 4A15A 2YFHA 1MDBA 4L8LA 4QPDA 1G20E 5BYKA 3KE8A 2ZZKA 1S7GA 1DB3A 2WRZA 1YC5A 1B0AA 2Q1WA 3GRAA 5F4BA 5K6RA 3BB3A 3CNNA 1DQPA 1WHTB 1KZYC 3N8IA 1FU4A 4LXIA 4YRAA 2E4YA 2HA4A 4R0NA 4C30A 2QK4A 2DFKB 3PQCA 4XX0A 1W4RA 2Y92A 5C4MA 5DYYA 3WLFA 3D3QA 5GJCA 1ODLA 1UKCA 3CG4A 4II2A 1Z39A 2RK6A 4NX2A 4MH0R 2B5VA 1GCOA 3L8EA 3SOPA 3BB1A 3VX3A 3BRSA 3MBOA 3LO8A 4IRXA 2AFIA 3K72B 4DLWA 3SZGA 3F5QA 5A9SA 3PC8C 2DFTA 1N9GA 4P4GA 3OPVA 4R31A 5TGTA 4DC1A 1DT5A 3B9QA 4UZFA 1EFAA 1AHHA 1X74A 3OPYA 5E4JA 1N0IA 4DDUA 1SVMA 1C81A 1TTTA 3C39A 3EQZA 4IUBS 1W6UA 1MIOB 3THXA 2G67A 2QVBA 1O03A 1O9GA 1U8EA 2ZP1A 3AHGA 1XBTA 4I1SA 4WWHA 4B80A 1T5IA 1JAXA 3M82A 2D4HA 2WIFA 3ODPA 5I7HA 4P98A 3FHOA 2C0PA 5LD2B 4TSFA 2ZSAA 1UJ2A 3NYRA 3ONFA 4DOMA 2YN0A 1LLUA 2HCBA 1Z6YA 3B38A 1K7YA 1M2OA 3D8NA 3H2IA 4YXFA 2C95A 3VTZA 4GBED 3KHSA 1KVTA 1RVDA 2IYAA 2F9MA 3AUFA 3I2GA 4X3OA 2WJPA 2Q4EA 5FUBA 2QNRA 4I3FA 1XVVA 4N54A 3LUAA 4WLEA 5FXMA 3C5EA 3IUSA 4JS0A 3HWX1 4JA0A 4GPAA 3D4OA 5AP9A 1ZOPA 1ZONA 2E9SA 3ENNA 1TW2A 1THTA 3PUIA 3QX8A 4P5DA 5DBIA 1E2KA 3QUAA 5LA6A 3P2YA 3PFKA 2IW3A 4NV0A 4RF5A 4KPFC 3RODA 4ENTA 1IHUA 3EQ6A 3W5BA 3UJNA 2W42A 1PQWA 3R0JA 2B2NA 3VAZA 5EJ4A 2HR1A 1X7ZA 1FFGA 4QNMA 5ADVA 1I24A 2BP7A 3EMKA 3UWKA 1MJ5A 3KZOA 3UATA 4Y0AA 4MUYA 1AN9A 4J2OA 3G2IA 4COKA 1H1TA 4MGYR 1JLLA 1HYQA 1AO0A 2FGKA 1EXNA 2CLHB 3CLKA 4BLUA 4ILEA 1YZGA 2ZTSA 4RENA 1P62B 4Q03A 2H9IA 4P4UA 4P34A 4WADA 4LZPA 521PA 4PQYA 4YONB 4FBMA 3U7QB 3K5PA 4X6YA 4I46A 4WZAB 3PDJA 4L57A 4Z8YA 1ZSYA 2O1XA 2PZFA 4D4IA 1C4KA 2W9XA 4RX1A 3UJ9A 4KRYA 1QR2A 1M7GA 1QVZA 3VYUB 3HNPA 3KELA 3QUBA 4B34A 2CJWB 5HSGA 1USWA 4AKTA 1W1WA 4KLRA 3VTFA 2W83A 5JS1A 4U39A 1U5BA 1GXSA 4X3CA 3WLQA 2OBFA 3DG9A 3D6MA 5CT9A 3ESQA 2GK7A 4IXMA 1N2GA 2VP6A 2FPPA 2KM1A 4YECA 5IJ9B 3DC2A 1XLTC 2YL2A 2D0OB 1VCMA 1Y3DE 2CXTA 2IV3A 3WV4A 2FMHA 4BP1A 2WM2A 1UBJS 4H6WA 1PJZA 2ZYDA 5EP4A 2IXTA 4RY8A 1NVKA 2XUAA 2JI7A 3M3HA 1FTQA 5FQOA 1D1QA 3X2FA 2IHBA 3D2BA 5A06A 4R8RA 2PDAA 5J43A 1A2OA 2JGDA 3W79A 3K0FB 2YYZA 3F5SA 2NSJA 3KPUA 1JA1A 1MAAA 4HZUB 1A9RA 4P3XA 4MOWA 1PUIA 1YR7A 2ET6A 1U2QA 2GOYA 4FC7A 4UVGA 2VATA 3H9UA 3MN1A 3WGUA 3BMNB 4C6TB 1MV8A 3W2EA 2V6BA 4YJDA 1P5HA 1BFUA 3RYFB 3OHPA 1FQWA 1Q0QA 3VC1A 1D7AA 5HS6A 3Q8XB 2FWPA 4M53A 2P1DA 3WP0A 2JGEA 1MC8A 2GBGA 3ETGA 4UZEA 1SKAA 1JVNA 1PHRA 1J99A 2JLSA 5GPBA 2PKQP 3D8BA 1PZHA 5LP6F 4F4UA 1HMYA 4TQUS 4MWBA 4KJXA 3OJ0A 1KU0A 1JPJA 1JWAB 1KXZA 4Q9NA 2VXBA 2X8JA 3Q3CA 3VRHA 1E0SA 3IMFA 4POOA 2IEGA 2OR3A 3C15C 2ZVDA 4WXMA 5H4GA 2D6FA 4B3GA 2I33A 4HGOA 4QRHA 3I52A 3K1ZA 4AKEA 1K0FA 2DUUA 1P44A 4PAOA 4D74A 1AB5A 1G4AE 4BMCA 1YVEI 2ON6A 1Z2EA 2RHRA 3E3NA 3RUEA 5DM70 2BF7A 4WDRA 2BMEA 2VNAA 4WHMA 3K4HA 4JU8A 5FPPA 1R2QA 4MVWA 1G6KA 1OC4A 2XYHA 2X8WA 1ZVMA 3AYXB 1GPLA 3KKZA 4RDHA 4XI9A 2VXYA 1AURA 1U2ZA 2NTJA 5JYBA 2NTNA 2WV9A 4LVNA 3MERA 1NMXA 4DY6A 4F3TA 2EBHX 1YRBA 3HCCA 5D6OA 1YF3A 2HMTA 3I05A 1CZNA 4Q00A 2VPQA 2POCA 2ORVA 2C4WA 1Y1QA 2Q0SA 5B64A 2Z2JA 3V2GA 2V55B 3IP7A 1SCJA 1IPHA 1Y4DE 3N59A 1T3ZA 4XYEA 5AKXA 3VQTA 4NRDA 4EPXA 2GWRA 4DCNA 3OE4A 2HPHA 4YLYA 5EKSA 3KB8A 1UBGA 4RL6A 2HTEA 1MVLA 3DOJA 4WINA 4MV4A 4G0XA 1M7BA 3H11A 3WB1A 5ES4B 2JLZA 1LW6E 2QW0X 2P9EA 1JJIA 3TJRA 5G1OA 1KWKA 1QG6A 2BONA 4LE2A 2RBKA 4BS9A 4CQLA 2ONJA 3KD3A 3M6IA 2BJWA 3DPIA 2AZXA 4WXHA 3I2HA 3RIYA 1X0VA 2PCLA 3SP1A 3TNJA 2IYFA 1PR4A 2ID9A 3VHXB 1RBQA 3W5AA 4H0CA 1QPBA 2FPIB 3F6SA 2QTLA 1Y3FE 2Z43A 3JQ8A 3QKRB 4W5WA 3SYKA 2DQKA 1WLYA 1Y1SA 2OP1A 3WGTA 1U0RA 1A9XB 4HI0E 3U48A 1DBRA 4HEA1 1CK4A 4UFOA 4V0SA 4F9EA 3EBLA 1PT5A 2NXEA 2Q27A 3CR8A 3ONEA 1OFUX 5CIWA 1QDLB 3LUJA 1DC7A 2EJVA 3B1WA 4XOUA 5KJEA 3ZV4A 5KVVA 3CVXA 4EJSA 2N1MA 1F2UA 2PS9A 4IIUA 4RKYA 3WX0A 1I94B 3D7NA 5JSHA 5E6UA 3WGVA 1YKGA 1ZNZA 4R0MA 1U1FA 3GLIE 1I2DA 3Q7IA 2OHJA 2GARA 3I1IA 5FI1B 4JI8B 1R0RE 1UM9A 3AINA 1IRIA 1DXQA 5FLYA 3WYNA 3MWDB 3ZLJA 4O4HF 5D3ZA 3RHSA 3WNBA 4X0EA 2RIRA 4MV5A 1BX1A 1DNPA 2JAPA 2GCNA 2P2GA 4NZ9A 5K3BA 4JJGA 3TH5A 2Y4OA 3W6NA 3ZVRA 2IRWA 2E0IA 3B82A 4DSAA 5JS6A 1AH2A 2ZVQX 1XPRA 2QZ4A 5IJ0A 1ZUNB 3R0VA 1Q7CA 4NMMA 3MRVA 3QTBA 1T25A 2AKAB 2X22A 3C8DA 3IURA 3I8SA 2H5IA 5I8PA 3ERCA 3HS3A 2G7MC 4IILA 1YZQA 4F84A 3U7HB 3LXMA 1FNCA 2XUHA 3CF6R 4HY3A 5IC5A 2X5XA 4UVIA 4CHGA 3AU9A 4H3SA 3QBVA 3TNFA 2OBLA 3O7WA 1N2SA 2QVCA 3K1TA 2CBGA 4RK1A 5K3AA 3SSNA 2Q2QA 3VVBA 5L3SB 1IOWA 4AZ3B 4N0MA 2WWGA 2GASA 2A9QA 1EE2A 4ZZ0A 2WEKA 4EW1A 3QPWA 2R0QC 3VC2A 1U8FO 5D7NA 1QX4A 4H31A 5FFFA 3GUUA 4I9UA 1RAIA 1E2LA 1YACA 3RVQA 2FW1A 1QANA 2Y1XA 1F8GA 2CMFA 4WXYB 3OIFA 5TARA 3MJRA 5IU6A 3NBKA 4XLTA 2AEMA 5JCJD 3FPCA 1E4OA 1WW2A 4HGPA 4B4WA 2UXCB 1D6MA 4YUXA 4EJ2A 4ZAGA 4DDHA 1U0GA 1FS5A 1X39A 1ZGBA 1M2VB 2E1RA 2QZSA 3ELWA 4B8YA 3DE5X 3C7KA 1PWZA 4CKEA 2WVAA 4RTOA 4C4XA 3RI3A 1T4CA 3DWGA 3NIDB 1WVGA 1KQNA 4EY4A 1EX6A 9ABPA 4U2KA 3FCXA 4FSXA 4A5OA 1CUWA 3C1TA 5FLXA 4FT2A 3D3NA 3R4CA 1JDVA 4GE3A 5D00A 2XCOA 4M2LA 1K4MA 1FLDA 3AILA 2Q3LA 2RJ3A 3DVRX 1RJ9B 1ZUWA 2XTAA 3FAKA 2YCBA 3BMCA 3EUFA 3IEUA 4GQIA 3ZXYA 1YE5A 2CXQA 3BTSA 2P90A 4MWOA 5G2OA 3UFXA 3UXHA 4E5VA 4ZO9A 4EL0A 2BCJQ 4WXPA 2K6GA 1JMYA 5JSZA 1YA8A 2BGJA 2R3SA 3AQIA 3AV3A 3PXGA 3TTWA 1SCKA 2IPLA 1RYDA 2ODTX 3AUTA 4MO9A 1BVYF 1NLYA 2H0AA 4HCJA 4N0EA 1A27A 1V6CA 3A1VA 1PU2A 1NVVQ 4HRXA 4MCAA 3WBKA 3CEHA 1FTNA 2R7AA 1I3LA 4BO7A 4A2QA 3LLVA 2IC5A 5ALLA 3E9YA 3PFHA 4D3DA 3FPGA 1T8RA 3QK7A 13PKA 3ETNA 3FSJX 3U4GA 2JJYA 3W3ZB 3RUFA 1QMPA 4XRGA 2G09A 4LFCB 3ITDA 1A7JA 1CUFA 1QNFA 3BK7A 5KNBD 2ZR7A 1UBFA 3RIMA 3LKZA 1TZMA 1QAOA 5KVSA 2XZPA 3G5UA 3LLSA 1QLWA 2CB9A 2C7RA 4CMJA 4RE5A 4ZA2A 5JCJA 4YX9A 3PIIA 2WYOA 3PTZA 1YIDA 3Q6NA 3JRWA 1QIHA 3IH5A 5JJLA 1Z75A 4NTZA 1RKUA 4FI3F 4DG5A 1ZNQO 3UJCA 3B36A 2C3YA 5EZ5A 3RYHA 2OMEA 3DW1X 2PHZA 4ZTUB 3TQSA 4FXPA 1D2CA 4GRIA 1F0NA 2W37A 3AR2A 5DEOA 2OAQ1 2ZIXB 4JHLA 3ZD7A 4BQIA 4N7BA 1RRKA 2BGLA 3QE3A 4DXDA 3SBDA 4UEQA 5JC8A 1NUHA 4BNDA 2VDWB 1PGQA 5E3HA 2QQ0A 3CZAA 4WK6A 1YV9A 3LHDA 3NNNA 2BEKA 1S96A 1WNTA 2EW1A 1CT9A 1Y1TA 1MC1A 2OD9A 4R8KA 1I4OA 5I7WA 1C8KA 1CIJA 1XMIA 4MAMA 1OBCA 4E1VA 1EBBA 1S2LA 4K26A 1TKBA 5CA0A 3RJTA 1JXQA 4NEGA 4OK3A 3DL7A 4FZRA 5J2UF 4YRGA 5L7YA 1D8AA 4B6SA 1S5PA 1TO2E 2WSSD 4LXTA 4OP2A 1JAHA 2OCAA 5L4LA 4P4NA 6REQA 4RHYA 4W9NC 1NBEA 3HB0A 1OTXA 4JCCA 1TZKA 4JNCA 4F97A 1WM1A 1Q77A 3DVAB 4HH3C 1CUEA 4EHNA 2NO6A 5NULA 2X4LA 2XKAA 1JSLA 2DUWA 3C4QA 1Y9ZA 4Q3OA 2QZ9A 3ZY6A 2IT1A 5TB5A 2DPGA 3ADOA 1TUBB 3GZ4A 4UFNA 2XUFA 4ZQHA 5ECGC 3TQIA 1QHEA 3V3TA 4CODB 1LBHA 4FGZA 4XGKA 5A2QA 3F9RA 3G2KA 1FMFA 1UBMS 3SYLA 1E62A 1UKZA 5C5CA 5C1PA 3CH6A 2BDEA 3IQXA 3PFBA 2RCNA 4JC4A 2PQ6A 4LNHA 4NOMA 4DNFA 4G81A 4GP6A 1W94A 1XB2A 2C77A 1FEZA 1EUCB 2VHZA 3PICA 4FGKA 1SVNA 1XRPA 2QD4A 1XNRB 1P81A 1XKQA 1YQXA 3FB4A 1HTBA 3DJFA 4NYJQ 5P8WA 1D09A 4ZCQA 4H27A 1SU4A 2R5FA 3L6EA 1SQ6A 2GJSA 5G3ZA 4TLLB 4QVIA 1XEWY 4IG4A 2EARA 1AKWA 3DF7A 3TNDA 5LZ7A 1JDPA 2BZ0A 5D5HA 4ZVSA 4HDQB 1BDBA 2FQ1A 2QN9A 2SNIE 5KCMA 1TNDA 4OQYA 3TW0A 4HQKA 2HWUA 2H1WA 2I6XA 3R3SA 4QAJA 5KREA 3CNLA 4FEGA 4W9RA 3I6IA 1FTYA 1CJKC 1WO8A 3A2MA 3EPRA 3GJSA 2O8EB 4N0PA 1J70A 3R3UA 2WFZA 4MR7B 2XMDA 4RZQA 5AOBA 2R6R1 3V7YA 3Q98A 4LMRA 2C5LA 2SCUA 4TS4A 3PX7A 2FVYA 3DL4A 1E1QA 4GM4A 1K6MA 4B47A 3Q3VA 1TAHA 3BD7A 1MMFB 4ICIA 2CXHA 3A4LA 4Q4JB 3REOA 2M9MA 4MUKA 5IM5A 4DJAA 4ER0A 1LW7A 1L4LA 1W4AA 5BYAA 1DAPA 5JVDB 2A67A 2EC5A 1SUFA 2BELA 4CXMA 1GR1A 4PO1A 2HRZA 3OM1A 4LX0A 1AKYA 3QWAA 2J9FB 4YT8A 2X0JA 4CMIA 3HYRA 4F4CA 3IP9A 1XKTA 4XARA 3QVVA 5CM2Z 2XDQA 3IPYA 5KX5A 4ETWA 1YAJA 4G0WA 3A05A 1XPUA 5J4HA 3AVPA 2EJBA 1NG9A 5KYNA 1U2PA 1N4DA 4MVCA 5DWDA 3DVSX 3OX4A 3RWMB 2PX5A 1KMHB 3EVFA 4XWYA 1OXTA 2IHZA 4HDMA 3QX3A 1Z88A 2DZDA 4FX2A 3ELBA 5G0WA 1KRXA 3H9QA 3E18A 1X1SA 3JAKB 3V1YA 5CDGA 3OIYA 3WGNA 2Q49A 4AK9A 3ROFA 4CM9D 4ARUA 1CB7A 3BREA 2FFQA 1ZN7A 2GZ1A 1VYTA 2VF5X 3LLMA 1FW6A 4CM8A 1DL5A 2X7XA 4TMYA 4ND4A 4TWIA 2GK6A 1EUDB 3T7JA 3BIFA 4UW9A 3B89A 2VZEA 3CB2A 3KUCA 2E4ZA 4J3JA 5C35A 3TLMA 4YWJA 4B3CA 3PGKA 4FB5A 4YT4A 1VXRA 2B5WA 1H22A 4Z5XA 3LCJA 4Q4HA 1JU3A 1MOZA 2ZBQA 4YO8A 3C3MA 4FWIB 2QV0A 4EFMA 1R6AA 1Y5RA 4W7HA 3AI3A 3ASZA 1ZA2A 2UZ1B 3ZGYA 4YUYA 2HF8A 4FD2A 3IUJA 5B5SA 5KBYA 2HA2A 3KLPX 4FFNA 1R4NA 5BW8A 1KFBB 4CV3A 1FUEA 3RT7A 1R10A 1WX1A 4W7IA 4LZJA 4YNBA 4C2AA 3L7YA 1XRQA 4YFYA 4ZZ2A 4DLNA 1OTYA 2O2YA 1U2RA 4RMJA 1EFVA 3HADA 3DAPA 1PO7A 4QXAA 4REQA 2IS2A 6PFKA 3VTKA 5HF5A 2C03A 4DYVA 1W34A 3T3IA 1PR1A 4MI9A 3IMKA 4RWZA 5ARCA 2ZIZA 4F21A 3DDUA 4JJEA 5H0IA 2CXPA 4ACAA 3AVVA 1RHMA 1XQXA 1XZMA 2WPNA 3WFZA 1WDTA 2OCGA 1ONSA 3DMTC 3RWBA 1ZXLA 2QUZA 4ZTBA 1QORA 2XBUA 3UK2A 4J1NA 2CWDA 1QKIA 4TMTA 3Q12A 1XEAA 4L27A 3OCCA 1L1EA 2DHDA 1JSCA 3L6OO 4B4KA 1TIPA 1L5ZA 3SQLA 3OEEA 4B82A 3D8SA 1P3Y1 5FUXA 1GPUA 4Z54A 2F6RA 1JSXA 4XD7D 4KX3A 3UJBA 4BMXA 2Q2WA 4N5HX 1J5XA 2R68A 3GN2A 4IHJA 1YMUA 4KUGA 4L7QA 2P6RA 2LTAA 3FETA 1K1EA 4YQZA 2XAUA 1M2WA 2Q29A 5EGNA 4BO8A 3H4VA 4PAWA 1KRHA 1L7BA 2B6HA 1P17A 2PNJA 5BQOA 1KKMA 3AERB 4HFRA 1O8BA 5H70A 4B79A 4Y2VA 5MGBA 4RORA 4YQFA 2WJ3A 1XXLA 1YSCA 1J24A 2ZIUB 4DJJA 1U3GA 5KNLA 1Z33A 2P2DA 3RS0A 4RM3A 5IBCA 2RCYA 2HJWA 4J1SA 3A2KA 3F4KA 4Z4QA 4GKAA 4KWIA 1GYRA 4X24A 2JPDA 3CX8A 4YAOA 4ARBA 5AVRA 3LK7A 5LJIA 2CFTA 3QH4A 3FFTA 4JYZA 4I81A 1M7HA 2DT8A 1MX1A 4DLXA 3CU5A 2W93A 4OGWA 4RABA 4EW6A 1X1RA 3TPZA 3K6SA 2BFWA 3NHKA 3PNSA 4X1IB 5EJ7A 3LBIA 3TR6A 1IM2A 1NHGA 3X1ZA 2G0TA 5IYZF 4EG1A 2P35A 4MQUA 3HXQA 1IAVA 4L73A 3ZGLA 4G84A 2BDTA 1P5ZB 3HDJA 4KW7A 3K05A 2F00A 4ZHQB 4D6PA 1XK6A 2BBWA 1ITZA 1OLUA 1CY7A 2JKZA 2P2ZA 1D2NA 1SVIA 2X86A 3DAGA 5F73A 4ZOLB 3UG7A 1M34B 5L53A 1GV1A 3CXUA 3H83A 4TUYF 1RNLA 4IIHA 2OXCA 4JMLA 3AGPA 3QF4A 3ITKA 2PM8A 4CEIA 1MF7A 1KVSA 1FK8A 1DRWA 1L4NA 1N0WA 3GFGA 4Q3AA 1KVQA 2WWFA 1E3TA 2DLDA 4QYIA 3WV5A 2NQTA 4LJ8A 3ZCRA 2IUFA 3UWOA 4BLWA 4MA4A 2Z83A 2BDUA 1KYVA 1SOUA 5FL3A 2RAFA 2P1ZA 5DLDA 1JEQA 3RSZA 3MAAC 5BR1A 1C0IA 4G4SP 5A4KA 2BY4A 5B1HA 1CUZA 3P7MA 4I4TB 4MR8B 4OHBA 2HUNA 4QJBA 3UH1A 3ZBQA 4L0QA 5F35A 4L51A 3PV0A 2HQBA 2BZSA 1Z0SA 1ENPA 2WINI 4CU2A 3HVRA 5DXFA 2E87A 4I1RA 4YAKA 2DR3A 3FRJA 2M6RA 4PLTA 4R5MA 2J59A 3IP3A 5TS2A 3ZXIA 2VH5R 3CMMA 3FPBA 4MHTA 4G4GA 4ZCRA 1LDMA 1S89A 2Y99A 3Q6MA 2G1KA 2QRJA 3HKDB 3QFRA 4YUVA 2BFCA 3KSMA 3HXOA 2W2QA 2P6PA 5CJ2A 4S0ZA 2ZBEA 4RVHA 5JI3E 1JLSA 4AX8A 1BQ4A 3S2FA 4UAUA 2GAJA 1T2EA 2A7QA 2LCQA 4PRYA 3LUCA 4WGFA 4QGSA 2BW0A 5GOTA 4M4SA 4XR4A 1TMGE 2AR0A 3KHKA 4K6CA 4Y6PA 3F6BX 4A8JA 2EKLA 4RLFA 4BMZA 1WVMA 4F5ZA 5J1SB 3FLEA 2PKQO 3RIEA 5BSHA 1AUQA 3QRWA 3QELA 2AQKA 4WBNB 4JB8A 1F0PA 3THYA 2QWXA 3ICOA 3MNFA 3WIOA 5BN5B 4DBZA 2O23A 3TNLA 2ZUFA 1IAQA 3COWA 1WDWB 4WDQA 5SICE 1OV6A 4URWR 1XU7A 2AC2A 1BDIA 1II9A 1QX3A 4LVCA 3E1SA 4B7CA 3S2UA 4C7JA 5CNKA 1P75A 1OLSA 3D54D 1XZHA 4HMPA 4YBRA 4AY3A 1QHGA 4HF7A 3WHLA 3F74A 1ICIA 3GAAA 2H2IA 2RHGB 2PO5A 4K28A 4TLDA 3I83A 2WOJA 3VYSB 2BMJA 2J31A 3PR3A 4D96A 3IQGX 3TLAA 4DIKA 2ZUUA 3V8NA 1OH8A 2OHIA 2BM1A 3VPHA 4EGCB 1Y6GA 1E1DA 1BXRA 1Y8RB 2J0VA 4ZQGA 1SRRA 2ZATA 2WSLA 3KPYA 1X38A 1I6KA 3V1UA 1K2WA 4XYBA 3STXA 4M87A 3ZZMA 2P9YA 3KEFA 1S01A 2XWQA 3KALA 1KPGA 4LDJA 4KR3A 1QIJA 2JFHA 3SM9A 4HBZA 3OD5A 3ZZ1A 3WIBA 4Z0TA 4YMLA 2E4AA 3I12A 5FTKA 3TRJA 3CRRA 1L3BA 3LA8A 3LLCA 1YJBA 2HLNA 4GC5A 1W0CA 2IEDA 5BWBA 1NJSA 2W71A 2QMZA 4HEQA 4TKUA 9LDBA 5E6SB 1KNQA 1N2XA 4ME6A 2PT6A 4EHAA 2HNKA 2W2NA 4GU5A 4NJMB 3TD9A 4J16C 4KIGA 1DUIA 2F8SA 3O4HA 1S6YA 1X2BA 1QOQB 1YAHA 3FNRA 4RLQA 4IDFA 1Z35A 5FPYA 3BT7A 1TYEB 4LA4A 4KFTA 1NW6A 1TT5A 4Q5IA 5AKEA 5C7LO 1VMAA 5J4LA 1RWBA 4CMEA 4D02A 1T13A 3IHWA 5CT4A 3IMEA 4G0UA 1XV5A 2W8BA 3T4XA 1Z0AA 1G5RA 4TTRA 2GZSA 1FMJA 1LX7A 3IUEA 5HIJA 3ZV5A 1QGOA 3GLUA 5DW3A 5HZGA 2O2SA 2IYNA 1GCGA 3KSDO 4JOQA 2P4SA 3LXRA 5BORA 2ZKIA 3KU4A 2VUTA 3B52X 2PEZA 3NJRA 4XIJA 1PUJA 1YTUA 1WXIA 4HN9A 5DM1A 3TL6A 4AG3A 5CCXA 1I1QB 4Y2TA 3E58A 2ZIGA 1H85A 2XY4A 2WT8A 1Y4UA 2C2GA 3LPNA 5AVWA 1HNZB 4XEHA 5HZHA 2P5YA 4G8DA 2IS1A 5E3JA 4AB1A 2XDYA 4R3UC 1B42A 4HEHA 4IIJA 4TTAA 3FZYA 1J06A 3LRPA 2WWRA 4Z2YA 1NN1A 2GKOA 2PSSA 4HFMA 3SIPA 3WMGA 5KNDD 2PD4A 3T8YA 3KKKA 1U0BB 2QP3A 3L18A 3B7WA 5LQJA 3O93A 1PSWA 1CSEE 3IPAA 4OQLA 1PFVA 5LIPA 1AV6A 4MKFA 3REQB 3RC8A 3ETHA 4BZWA 4DV3B 1G6Q1 4AXXA 4TMKA 3WRVA 4W9MC 4RJTA 3MGAA 3KNZA 1PDVA 1NR7A 2WMOB 2BFOA 3ND8A 2X5NA 3TN7A 3A27A 3IKTA 1VPVA 5B30A 5CFPA 2FJUA 3AL2A 3GV0A 1J8FA 1VIAA 1K8RA 4IMPA 4Z9XA 1IUNA 2YYSA 4HX5A 5M2QA 2XQKA 5A4MS 1ZLYA 1CY6A 4JC8A 4JZKA 4OQXA 1KZ6A 2GN6A 1FVHA 3RVOA 3SXUB 5AVVA 3WHIA 4DJEC 5HZMA 4GUDA 2IUSA 5KYWA 4BY9E 1VHLA 5JXJA 1YBVA 3G89A 1TQDA 4F12A 2NUTB 4NQZA 4CV1A 4S05A 2IEZA 2NZWA 5EYPA 5DSXA 1Y9EA 1HDGO 2ZSJA 3FHCB 2TMGA 5EFOA 1V7QA 4NAUA 2KB0A 4NHOA 5SYAA 3DZJA 4WW0A 5JSQA 5IWAB 3TAHA 1K98A 2PMEA 1OZGA 2GWHA 3L6CA 4KQCA 1Z5UA 1A9TA 4YAGA 2XRFA 5LUBA 1DFGA 2I4LA 4N5NA 4BYGA 3QU4A 3VZBA 4JP1A 2W6NA 1VSTA 1XTVA 5J2UB 2TMYA 3QEMA 2JGJA 3INTA 3R0XA 5BVHA 3TLYA 1M1NA 4D2IA 3GJQA 3PC7A 4JP8A 2FP4B 4J1TC 4K2HA 2ZUWA 1U0LA 5K4AA 4MX8A 4OMCA 2CDBA 1V7CA 3AJRA 4RD6A 3ZZTA 4ATNA 4UBKA 5TLSA 3P9RA 1G9TA 4UOEA 4I9HA 3SSOA 2WBLC 4M9UA 3G1UA 3ANSA 3K30A 2BEWB 5KMGB 2F2TA 3LBAA 4O63O 4URYR 1K9VF 1CBUA 2JATA 1NSFA 2G4VA 3K0KA 3AVWA 1PT9A 4R40A 4HQOA 2QRPA 2REBA 4JITA 3AWIA 1ZCZA 1U4NA 3E03A 2P40A 5EIBD 3X1XA 4A0QA 2F59A 2BAGA 3U60B 3QVSA 4YRSA 5J40A 4ZVQA 2O0KA 3U62A 1E7YA 1VL5A 3NEAA 3RTGA 1FDIA 1IEWA 1J7KA 1JR3E 1N6KA 1QFSA 1UJ6A 2UYYA 4UD2A 8AT1A 1UOOA 1EEXB 1RXEA 4KMSA 3L7AA 1TB4A 3N2GB 3RS3A 1E1MA 1R64A 2SECE 1XFAA 5MFZA 1GAJA 2PLFA 3TIFA 1PS8A 1SA0A 3FM9A 1KP2A 9GPBA 2W2LA 3NM6B 4DY4A 3RJZA 2E3JA 1SVLA 1YOBA 3GEMA 3N0XA 2DY0A 1JXAA 4HQ0A 1P77A 2PZKA 2OBXA 3CONA 3OQOA 2VYVD 2XRZA 1K92A 1OFIA 2LZ0A 3CRZA 3LF1A 3EG9B 3VZDA 4GPEA 2EZ9A 3TR0A 2J3LA 5HBGA 1ZFNA 4IH1A 3ZIUA 4BUZA 3ETLA 3T9AA 4BGVA 1JB9A 1XVLA 4NBVA 1Q7EA 5JADA 3JQGB 1YGYA 5BMVF 5MF6A 1J1IA 4JLOA 4JX9A 4PPQA 4JT2A 4BB5A 1ZO8A 4RULA 2WUFA 1QWSA 2IK8A 1E6KA 5EIOA 3IEPA 1WXDA 2Y6UA 2NU6B 2DEUA 1LSUA 3IEXA 2X15A 1MX5A 2JCGA 4FJ0A 4LYFA 5AM5A 2HJVA 1XYYA 3AM5A 1P1BA 3FCUB 3P8ZA 2FZVA 3IFSA 4GPTA 2ZU0C 1YJ8A 4XQ0A 2I4NA 2QM7A 4BLQA 3NTUA 4KR7A 3JQAD 4P84A 1E4EA 1NNUA 4KVFA 4AG6A 2ZYAA 1P7PA 1GGVA 4U6NA 2HX1A 2GEKA 2A0FA 1G41A 3A6HA 1UXOA 3D6VA 2CL6X 5JYEA 3KTDA 1LQTA 1XTJA 2XJ4A 3LOQA 4YCBA 4DEVA 4M22A 4OUDB 3PRYA 3BIOA 2X1HA 1G0NA 1ZK4A 3GLHA 2QXYA 3MJEA 3PXEA 2Z8YA 1CDEA 3WJAA 2BFPA 2RGEA 4FW9A 2ANCA 3ZEIA 4CKZA 4GKVA 1SXJA 1OLXA 4HD8A 5EMMA 1GVNB 2GK4A 5JS2A 5JSFA 4CJXA 1XZFA 5FOSA 5L45A 4Q37A 3NGXA 3L6DA 1I13A 5HF9A 3DZIA 1IULA 4X1YA 2JA2A 5DVZA 4UBJA 3VYVA 4M0KA 2F3QA 3X1YA 3ZUPA 4XVCA 2DVMA 1C2TA 1CJTC 4O2BA 2J7PD 1V41E 2PA3A 2XCTB 1ATIA 1P4RA 3RVMA 3WMXA 2G82A 4OQZA 2PL9A 3IVXA 1ENOA 4EHIA 2PUBA 4M0CA 4FYPA 1JDBB 3AJ9A 1Y63A 2WJ4A 1HT3A 1NL3A 1SZCA 2Y1EA 5BWOA 3NANA 2CVHA 2G77B 4IRMA 4G07A 3PL1A 2D54A 2QSZA 3ZK8A 2VCEA 2ZAOA 5J2TF 2ECOA 3HKBA 3WRWA 1COWD 1AGPA 2PJZA 2WPDA 3Q4GA 3ZGVA 2GNOA 1CY1A 4U2EA 4GLBA 3R6LA 2WHRA 1KYXA 4G56A 5FWNA 3IDQA 2AG5A 3TLKA 4FM9A 1G9XA 3D2AA 2IITA 4MUAA 1KKLA 3OX3A 4R7TA 2Q7DA 1HDXA 1U2TA 2XNSA 3U5ZB 1A8UA 1IY1A 1KARA 2DWUA 4Y3UA 4ZQFA 3K6JA 3GAMA 1JN0A 3GRUA 2B0CA 1E3WA 1G2PA 1MXFA 4Z0PA 3QHAA 1OW3B 1P5FA 5K8LA 2YVQA 2NYUA 2FWJA 4HJXA 3OURA 5IMBA 2OHXA 2YINC 1DKPA 1NVDA 3VV3A 5B55A 4PR3A 4CDMA 3HJNA 1C7EA 4GXQA 4WN3A 3MUOA 5DX1A 1JPUA 1RS0A 4IIFA 3AIKA 3U7RA 4AP5A 2FPGA 3D6AA 2OVBA 1CQJB 1IOZA 1IBCA 1Z8FA 5FI0B 2J7PA 2KW5A 2P5UA 1XD2A 2H3EA 3Q5GA 3NEJA 5BVGB 5F1OA 4R1UA 2IP2A 4I5FA 1MO3A 5KYUB 1T9KA 4Y1FA 1VRCA 3NBQA 1Y80A 3N8DA 3NEPX 2Q2VA 2YR0A 2PXCA 1FSSA 2DBQA 5BSWA 4KITB 1TVKA 3DBRB 4HADA 4QBTA 3KSUA 3BFVA 1NVXQ 1U3DA 5ALPA 5JJCA 7MHTA 5CHEA 4I1YA 4OM7A 5DN6D 2WMNB 4TKVB 5D3MA 1SHTX 1C7JA 4K3VA 4K86A 4PS0A 1W1UA 3ZKWB 4XH9B 1GUZA 1COWA 3LGAA 4FNAA 1CS0B 1RJDA 1ZG3A 2Q5IA 2R25B 2YXEA 3GOQA 4MS1A 4JOSA 1Y37A 1JZQA 2J5BA 3K0HA 4RZXA 1R9NA 1F1JA 2A5GA 1W9HA 4BVEA 2NVBA 5BWLA 1RFLA 3KXPA 4BB9A 5K8IA 3R6WA 2KBFA 1AGYA 4Q4AA 5IX8A 4ZYUA 1W46A 1Y8ZA 1U99A 2GILA 1Z28A 4K3UA 5JZBA 1AZLA 4HWKA 3FKSD 5FHQA 3W5UA 1ZMOA 3G17A 1TKCA 1XJCA 2VLIA 3TLXA 3S1AB 3V4VB 5K0BA 5K0ZA 1P1JA 5DBFA 2Y2VA 3FPSA 4DZTA 3DHWC 4WUVA 3B2QA 2FOXA 3LNCA 4NMHA 4Q7MB 4Q3BA 1SKYB 4ZOAA 5IJZA 4GLLA 4DV5B 2OAP1 3I9V1 4EA9A 1KI3A 3CF0A 4EI2A 1IVYA 4JBYA 2MYPA 1Y82A 1RD4A 4MB2A 2QZJA 3W6UA 4A91A 1R8YA 3E8XA 2IGBA 4J75A 3F6CA 1T5LA 3R5JA 3Q8MA 1HK7A 1FNSA 2H1HA 1BXZA 1YOVB 1OX4A 5C1IA 2Y66A 1HBJA 1QC5B 3TYXA 1ADGA 1ECJA 3RAEC 3MTAA 1KJ9A 1QSGA 2BZGA 1NYTA 2SKDA 1HTWA 3UAXA 3V2UA 4CI0B