3KJEA

Empty state of cooc1
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
254
structure length
254
Chain Sequence
MKLAVAGKGGVGKTTVAAGLIKIMASDYDKIYAVDGDPDSCLGQTLGLSIEEAYAITPLIEMKDEIREKTGDGGLLILNPKVDGDLDKYGRYIDDKIFLIRMGEIKKGGSQCYCRENSFLGSVVSALFLDKKEAVVMDMGAGIEHLTRGTAKAVDMMIAVIEPNLNSIKTGLNIEKLAGDLGIKKVRYVINKVRNIKEEKLIKKHLPEDKILGIIPYNELFIELSLKGEEIWQSTNPAFVNLHDIYQKLRLEVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase, metal binding protein
molecule keywords CO dehydrogenase/acetyl-CoA synthase complex, accessory prot
publication title Crystal Structure of the ATP-Dependent Maturation Factor of Ni,Fe-Containing Carbon Monoxide Dehydrogenases
pubmed doi rcsb
source organism Carboxydothermus hydrogenoformans
total genus 75
structure length 254
sequence length 254
ec nomenclature
pdb deposition date 2009-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kjeA00
4JIMA 3KKOA 4HDQB 1EFHA 2HV8A 4JJZA 2GF9A 3CRVA 3C8UA 4WVFA 3M6AA 1Q1ZA 4LV5B 4HB2A 4NYIR 4FINA 2A30A 2R44A 4M0LA 2VHUA 4C0BA 2LKDA 4QHYA 4YDHB 5KU1A 3JVVA 3OE7D 2ZQ5A 3VU9B 4LCBA 1O87A 4US0R 5CIWA 1X6VA 1QZXA 3U3JA 2RGGA 4AKIA 1YR8A 1TMKA 2PX3A 1JAHA 1UBFA 1ZNZA 2VP0A 1OXTA 4X8OA 3ICQB 2GCNA 2IYUA 2JLYA 3AGPA 5J4VA 2C9CA 5B30A 4O25A 2F1RA 4R2IA 3P1JA 4B76A 1CXZA 1WB9A 4ZCMA 2GBLC 1OT3A 3PUYA 1XB2A 3W5JA 4QOSA 1Q0UA 1E2PA 3CRMA 3MJRA 5M04A 1GZSA 1RKBA 1XPRA 4KSCA 4MDEA 3TLXA 1LTQA 2CK3D 2O5VA 2PEYA 4OHXA 2CCKA 2ZSAA 8OHMA 3LW8A 2XB4A 2NG1A 5ELXA 2FSGA 3THYA 4B73A 3DL0A 1BIFA 4DLTA 3CO5A 1W36B 4B75A 4ARZA 1J8YF 1KO7A 3AVTA 4A2PA 3THXB 1WE2A 2BBWA 3OEED 4DSNA 3NIBA 3ASYA 2D2EA 1W47A 4BEJA 1VECA 2YYZA 2GVDC 5CYOA 3DVLA 3UANA 1T3LA 1XNJA 2IA5A 2WJJA 1T0JB 5JSZA 5F98A 2WMOB 3DMDA 3WRXC 3TR5A 1G21E 2EFCB 2W0MA 1W36D 3EA0A 1BYIA 3VR4A 4DUGA 5CB6A 3I5XA 3ZD7A 3V00A 4G01B 4AKEA 4C9BA 5FBQB 5JI2E 3REGA 2HF8A 2OE2A 3AVWA 4YLGA 2PT7A 1I4LD 1N6HA 3SHFA 1E0JA 1ZC4A 1OE0A 5AJVB 4G0NA 5FR1A 5FUYA 5HCIA 4CT5A 2VSOA 1WXQA 1JQLB 2ZRNA 4RVCA 3I72A 1CJKC 2QZ4A 2UVQA 4Q1DA 3K0SA 3UPUA 4MRNA 2O8DB 2DFLA 2XXAB 1KJWA 4XOIA 3G82C 1XXHB 3FMPB 1W4RA 4II7A 3LXRA 2EWWA 1NVUQ 4P4SA 1YZNA 3LBHA 3EPJA 3UMFA 4NE2A 1CULC 1KI6B 4Q1AA 2IYTA 2RGNA 4K46A 2YJTD 1EK0A 4Q47A 421PA 3EWAA 1YRBA 2V54A 2Z83A 1X1SA 3H86A 3A1TA 1QHSA 2E9SA 2J9RA 3H4MA 4HUQB 3EXAA 2WM9B 3PUXA 1HUQA 3ONWA 2QE7A 2QN6A 2D2FA 3QEOA 5CM8B 1Z6XA 1RRFA 4HI0E 4A92A 2GJ8A 3ND9A 1ZNXA 4URYR 4MGKR 4HAYA 2VF7A 4MKGA 1R5NA 1D2EA 2ZS7A 2C77A 2OCAA 5FPHA 1VIYA 2BMFA 5DO9A 4R71A 5E4FA 4EDHA 1PUJA 3NBZC 4G5OA 1KKMA 3IUYA 3AVUA 1MV5A 1KI9A 3CF2A 3RWOA 4IEEA 1CJMA 4RZ2A 1A82A 3W5IA 1T4GA 4D82A 1Y63A 1XCMA 5IT5A 1NN3A 3RAPR 2JGNA 1E9FA 3QENA 1DADA 4YONB 4ITRC 4B48A 4DT1B 1P5ZB 4I1UA 4IOMA 2GXAA 2V4ZA 1H8HA 1XEWX 2XSZA 3FHCB 5FBRB 3X1DA 3BH7A 2O8BA 3RC8A 4HLCA 4DCTA 1P72A 5LD2B 1II8A 1PLKA 5TDHA 4A0GA 1OFHA 3T61A 1WDTA 1E9AA 4V0MA 5AJYA 4BFXA 4D80A 4BFVA 4AK9A 4MYUA 2PZGA 4GDFA 4IOJA 3PV0A 5F9FA 4NL4H 4D4MA 1AS0A 1DE0A 2XTZA 4O3MA 3AP1A 2W6ID 2A9KA 2FFQA 4EPYA 1D2NA 3ZS9A 1JECA 2BCGY 2QAJA 2IUTA 2NZ8A 2H1LA 2NTYC 5GJVC 2CLSA 4EFNA 3UATA 1GKUB 3BK7A 1TUEA 3IIMA 2DCUA 3WHKA 3U60B 1E94E 2OBLA 1KKLA 4JL5A 1X1RA 4RCYA 5DISB 1EFCA 3TMKA 1CS4C 4BLTA 3KQNA 3GLFA 1SKQA 2QORA 3N2EA 4PR0A 4A82A 1F2TA 1J90A 3FDIA 4DLUA 1ANKA 4YMTA 3DKPA 3A58B 4I99A 5JMTA 2DB3A 4BFSA 3EIQA 5JFGA 5FTKA 3SS8A 1G7RA 2WPDA 4XJXA 3UXMA 3WYAA 2ZS9A 4HATA 4JLPA 2G1KA 1W1WA 1NVVR 1K5GA 2W58A 2WBLC 2XITA 3NWJA 3THWB 2PBRA 3KL4A 1W7AA 2FN4A 1U8YA 1T3SA 3KUCA 3EPKA 1XTJA 3CLVA 4B2PA 1G20E 1Z0IA 3ZS8A 3NH9A 4B3CA 2IHYA 3CWQA 1GAJA 2V6IA 1G8FA 1HEIA 2AWOA 2NO1A 3F8TA 4TMZA 1OKKD 1ZM2A 2FGJA 3GLIA 2WWIA 2YWFA 1B0UA 2XOKA 1VG0B 3L8YA 1AJEA 4CF7A 1NKTA 2AX4A 4M1YA 1UDXA 3NG1A 5JS8A 2WAXA 3HDTA 3QPWA 4QGAA 4MITA 4RD6A 4G1UC 2IXFA 1UBEA 2ZUBA 3ECCA 4W9MC 1YJ5A 4P0TA 1T9HA 4PPGA 3W8RA 3WHLA 2QPAA 1Q21A 1A4RA 2DWPA 2VF8A 3AEZA 4GOJA 4BFYA 4N3NA 1KDPA 3DM9B 2D62A 4BECA 4XSHA 1T8UA 2NO0A 2ZJZA 5CJ2A 3RS3A 3L0OA 1E1RD 4ZKDA 4PAQA 3MAAC 2D3WA 2JATA 1TQ6A 4B44A 3EPHA 5CYPA 1UBGA 1XD2A 5LB4A 4WA7A 2WJGA 3SR0A 2KSQA 2G9NA 2X2FA 4BZXA 4D25A 3B13B 5EP2A 3VU9A 4ZV4A 4EIWA 2FU5C 1M1YE 4H9GA 1GUAA 2C9YA 1VDZA 1F60A 3PEUA 4NMMA 2B6HA 4GPTA 3EZFA 2VIIA 5FL3A 5C18A 4QJ3A 2OEPA 3SJCA 4A8JB 4O2LA 4BLQA 4AYXA 5KNDA 3TIFA 4A8JC 1NG9A 1D9ZA 5DI3B 4MGZR 2QSZA 5EUMA 3EIEA 2QRZA 2FG5A 1G7TA 3MCAA 3QXHA 4LC1A 1DEKA 2GBLA 3LWNA 1JPJA 2REBA 4DIDA 5FL7A 2KBEA 1P9WA 1E9SA 4PSVA 2DR3A 3TW8B 3ZGXA 1E9RA 4D0NA 4EPWA 4ZDJA 3T35A 4P31A 4C0KA 1KO1A 2J0VA 1G7CA 3FHOA 3E70C 3K53A 2NMVA 2IYQA 3NBXX 4A4DA 1Z0KA 4QJ5A 2XJ9A 2CBZA 2NO9A 5GADl 3NTUA 2GZDA 1U90A 2NOAA 3U44B 5KSPA 1G5RA 5D3MB 221PA 4S2EA 5KUTA 1Z29A 1CRPA 3KZ1E 1VPLA 5GJWC 1BKDR 5FBLB 5L3QB 4F7WA 3THXA 4B32A 2ZROA 2VLIA 3DPUA 4X8HA 4G5RA 4LJAA 4D0LB 3KXKA 3HYTA 1WRBA 2OFWA 3CH5A 3VX3A 5G3YA 4G5SA 4X8MA 4HZUB 1WP9A 4MRRA 4NYJQ 2JLXA 5JEEA 3O47A 4PZLA 3NDBB 1XPOA 4KYUA 2PH1A 2XJ4A 1ZUNB 2DPXA 4DSOA 4TYQA 2H92A 1MRSA 1W44A 2IYRA 1P9RA 3OFNA 3QJYA 2WWGA 2FGKA 2P5TB 3AF3A 1JBKA 2ZRAA 2CJWA 4MUBA 4BEBA 2ZI7A 3BRWD 4YXWD 4IW3B 3U4QB 3D7MA 1XFAA 3JZAA 2ZR7A 1OH8A 3S1AA 3B5JA 1ZUHA 3LVRE 1E96A 3NC1C 4BLOA 4OJQA 4FCTA 2KWIA 5L3VA 4CVNA 1NN0A 1SHKA 2FPMA 2OAQ1 2UKDA 1FUUA 1P2UA 2JIZD 2F1JA 5JCZA 1GTVA 3ADBA 2HLDA 4DCSA 4XVQA 1GDDA 1E9EA 2JCSA 2X77A 4KO8A 1OFUX 4RZUA 1R0ZA 2EQBA 3TUJC 2ZU0C 2R6AA 3LNCA 1Z0JA 3HPRA 4NH0A 3REFA 2H7VA 4XSGA 1CEEA 2A5YB 4Q66C 4BLRA 1EGAA 3THOA 2OO7A 2EFGA 5F2EA 4XVUA 821PA 1SVWA 1JB1A 4XD7A 4XH9B 5FOWA 4F93B 3C15C 4ARZB 2NQ2C 1JNYA 4E03A 3T1QA 5DN6D 4CEHA 3P4XA 1XCPA 4KODA 4OHZA 4B3DA 2V1XA 4DWJA 5TMPA 3LD9A 3ICEA 4AWXA 5C4MA 3FKSD 5SZJA 4JSYA 1PUIA 4ESVA 5JSZB 4LBZA 4YQFA 2C04A 2J41A 1YZGA 5IHPA 1BH2A 3GCGA 3PCRB 5FTNA 3KX2A 1PVOA 2QG6A 2AKYA 3LW7A 3PQCA 3QKRA 1CLUA 2J0QA 1UBCA 1E0KA 4Q7LA 5TARA 1LVGA 1YQTA 2OXRA 3CZPA 3LX8A 5KHOC 3K0FA 4ZIRA 1E2EA 1TNDA 4JVSB 5JECA 4BLPA 2YOFA 5FR2A 5IDVA 1AIPA 2XB2A 2ODEA 3M1IA 2R2AA 4IOLA 4DUGD 4HAZA 3ZYCA 3ZJYA 4RY2A 1YR6A 5E3HA 2BHRA 1FL9A 4CZ2A 4D2IA 3LRPA 4OK3A 4EQ6B 2HYIC 5CB8A 3QUSA 3SQWA 2C9OA 4TZ0A 1FQKA 5LDDC 4F4IA 1KSFX 1GG2A 1L4UA 2GJSA 4FMDF 4N0EA 1M34E 4FMBB 5FPYA 1IHUA 1DAIA 3B9QA 4B34A 2V7QA 3AUYA 2HCBA 2N46A 4NZYA 1SULA 2NO6A 4LYFA 2OXCA 2G1JA 2QSYA 3AVQA 1CJUC 2DY1A 1VCNA 1N3BA 1KI1A 1Z3IX 3BFVA 4OHWA 4TLAA 2Q0HA 4UNRA 3TUZC 4CEJA 1G8YA 1XTKA 4HDOB 2HJVA 4KV9A 4WXPA 5E95A 3VHXA 4V02A 4KBFA 121PA 3SFZA 2BEJA 3AB3A 4U7DA 4JLKA 1Q3TA 4LHVA 3DDCA 3RRNA 3V9PA 3L0PA 2ZI5A 5KYKA 2WSMA 2Q9CA 4AURA 4NCNA 3CONA 3KB1A 3MLEA 2QGNA 3CPHA 4FD2A 5HCNA 2G3YA 2FV8A 1Z63A 1SQ5A 3L2OB 2F3TA 2SHKA 3B7GA 3TNFA 1NVXQ 1AGRA 5FBWB 4A9AA 2J3EA 1P7CA 4U02A 2ZXUA 3IILA 2GZHA 3SYNA 1DO2A 1QVAA 1UEIA 1ZD1A 1QHIA 3B85A 3QKSA 5K8TA 1E2HA 2ZRBA 1HURA 3VX4A 2O8BB 3CX8A 3KJIA 3IPXA 5AJWA 1I2MA 1HE8B 1NJFA 2QENA 1KI4A 2V1UA 4CEIB 3J81k 1OHHA 3NXSA 3WMEA 2BKEA 4W5HA 2BIFA 4B33A 4F38A 3TAUA 2GK7A 4JLDA 4N1AA 3T12A 3I3SR 2VHCA 4RD0A 4C0LA 2G0TA 1G6HA 2XSZD 3O8DA 5TXGA 4GOXA 4GNKA 3K70D 1DARA 2H16A 1KJZA 3QF4A 3Q72A 4FIDA 4QC2A 3QEJA 5A0FA 1KI3A 3IKJA 2ZIAA 5D3QA 2B8TA 4B6EA 3KKMA 3W6OA 1P60A 3P26A 2ZE7A 3GLFB 4HSEA 2VH5R 4TMTA 1F2TB 1OPXA 4QL3A 2IWHA 1RW4A 3IBGA 2FFAA 2CLDX 1P73A 5HZKA 3PITA 4WAUA 1P75A 1G9XA 1KSJA 1NBME 2VP6A 1OV4A 1K8RA 1IN5A 1S1MA 4URUR 1XU4A 5TY0A 2IBMA 4NP6A 3EAQA 4A0RA 1R6BX 2JLQA 1IY2A 5UKDA 1CIPA 5IK2A 1IOZA 1KSHA 4PQFA 4FI3C 1E4YA 3C5CA 2C99A 2J45A 1RYHA 3RWMB 3TBKA 4C0AC 4TT3A 4A8JA 3BS4A 2P6NA 2K5UA 3R9IA 2WPDD 3I92A 3DMNA 2PZEA 1SVSA 1M7GA 5BYJA 2WJYA 4XWOA 5EE9A 1Z47A 3FB4A 1H65A 2WKPA 1W4BA 1U0HC 2FSFA 1X8LA 1SVIA 1A7JA 4AIIA 2R8RA 1IQPA 3VR5A 3SE0A 5EP3A 1QG4A 621PA 1Z0DA 3K09A 1NY6A 2H5EA 3BORA 2ZI3A 2GHIA 3AUXA 4TMVA 4PO8A 5HPYB 1XRJA 3MWYW 4MRSA 4UNNA 3K0AA 3EASA 5EQTA 1J99A 2RGCA 3X1ZA 1E2FA 5BN5A 3NHBA 1RE0A 1DAEA 2UZ3A 3CX6A 2Y8EA 1ZU5A 2GEUA 3QOFA 1FOEB 1TQ2A 1YRAA 2QMUA 1KDOA 4MYCA 4IVRA 4RFSB 2GZAA 2ZRMA 2G6BA 1UPTA 5J40A 1YE8A 2G88A 4JLVA 3IHWA 2PJRA 3IIJA 5FOVA 3DKVA 4IVPA 4L9WA 1XD2B 5EZ5A 5FTJA 3LLMA 1G1MA 5JS7A 2IS2A 1C4OA 3T1TA 2HXYA 4KSBA 4V03A 4US2R 1CJVC 2XX3A 4HB0A 2WJHA 3U4QA 2IS1A 2ZYUX 4JBYA 5HKKA 3GFOA 2P65A 4PSKA 2OUKA 2GETA 3PENA 1F5NA 1N5JA 2JEOA 2FNAA 1SXJE 2ZRGA 1FW6A 3AF2A 4CDGA 4ZI2A 2HDNB 1E2DA 1PZNA 2HEIA 2A78A 1ONBA 3IPYA 1DVRA 1HE1C 3AVXA 1QF9A 3C5HA 4A0HA 3AVPA 1G3RA 2YOGA 4PO1A 1Z5ZA 4FMDB 3MFYA 2IYZA 3GLGE 4PX9A 1XMJA 3A4MA 1YVDA 2C95A 2YINC 5H1YA 3WNBA 2WHXA 2JJ1A 2FPLA 1COWA 1HY3A 4MGIR 5P21A 3RRMA 2GK6A 1N25A 4E22A 2R62A 3RYTC 2ZAMA 2Z43A 1VCIA 4I1SA 1TF7A 1VCMA 3ADKA 4PZYA 4JLJA 4LYAA 3UK6A 1M2OB 2OAP1 1YZLA 2ZEJA 3U3MA 2PLRA 1OXSC 1YZUA 4GRAA 2CL0X 4B3FX 4YMUA 3GLHE 3AV0B 3MUFA 2V9PA 5FBVB 2PCLA 4FW9A 1LY1A 3P20A 4I81A 4MQBA 4KYIB 1RRGA 4UJ3A 2MSDB 2YWEA 4AI6A 1JR3D 2ERXA 4X8LA 5DLQC 3CWZA 5FPTA 5H8WA 1A2KC 2IX3A 2CJWB 5FOSA 3I5YA 4R9UC 2IL1A 3BOSA 2XGJA 4TMWA 3WNCA 1FFHA 3P4YA 3BB3A 1E99A 4B2LA 4MA4A 3S1AB 1SVKA 4GT1A 4Q9JA 2QT0A 3C16C 4KAXA 2W6JD 4M1OA 3UG7A 2C5LA 5DI9A 1XTRA 4Z8YA 3VKWA 2PMKA 2ZR0A 3CX7A 4GZMA 5DSZA 1GNRA 4EQ6A 2CEAA 4DLSA 1PJRA 4TL6A 1Q57A 3OIVA 3QXXA 2MMGA 1OIXA 3KJEA 3VR6A 2CNWA 5FUVA 3RVBA 3ZIAD 2XTMA 3AF0A 4QBHA 4TWZA 4C0QC 4QFMA 4WXRA 1EWQA 4Q00A 1E4VA 2KJQA 4B74A 3ZH9B 2ATXA 2J46A 2HLDD 3DHWC 4BFZA 2AD1A 2AL7A 4LJ9A 5KSYA 4CEHB 5C2JB 4TQUS 5LBIA 3QKTA 4B3GA 2GXSA 2XTNA 1I4DD 1EX7A 3I61A 2J0SA 1PLJA 3WP0A 4LYHA 5JWOA 1L4YA 2WKQA 2RGXA 3PUZA 4JVMA 4XD7D 4OI4A 3TQFA 1F2UB 4RD1A 1FTNA 2IUUA 5JRJA 4JYBA 1NG1A 2TMKA 2IEZA 2G77B 3AF1A 3GD7A 3QKRB 1CU1A 1XWIA 2GJ9A 3FMIA 3UKDA 4YMWA 1M8PA 3K0FB 5AJXA 4DDVA 4JVLA 4ZIRB 3SQXA 2QAGA 1FTSA 5BW8A 4PXAA 4HAXA 2QP3A 2W2TA 1N6OA 3U3RA 2F55A 1E2QA 1P6XA 4QM7A 1H8EA 1MKYA 2YZ2A 3OHMA 1GM5A 1KNQA 1Z6TA 4FWIB 2DYKA 4C2UA 4D4KA 1L2TA 1GFIA 1FMLA 1TPZA 3CF6R 4Z1MD 1E9DA 4CEIA 2QM7A 1P2TA 2FFHA 4BUJA 3B1VA 4XWAA 3RS4A 1TEVA 4GOKA 4BFTA 3VR3A 4C7OA 1NSTA 2OLKA 2XNDD 2OZEA 2ZJ5A 3QXSA 2CMKA 2IS6A 2GXQA 3N70A 4Q48A 3D8BA 5E7MA 1AK2A 3RRZA 1MT0A 2VP2A 2ODBA 4DHEA 2GJAA 1MABA 2ZYTX 2C98A 1TU4A 5J5CA 1VYTA 1N2CE 3CF0A 2P3SA 4CEJB 3U6BA 1GVNB 2ZPTX 3HJNA 5AWFC 2VHJA 4TLEA 1FPMA 2OCBA 4DEYA 2ANBA 4AG5A 1KDRA 2EFDB 4DSTA 2IYSA 3D6TB 3WNDA 4US1R 1CR0A 1V43A 4KITB 2X8AA 4LUCA 2REXB 1NL3A 2ZJ8A 1ZD9A 1XPUA 2ZANA 1GKYA 1W0KD 3ETLA 2GWHA 3GFPA 4BWYA 4DDUA 2ZRPA 1E79A 2BJWA 1OSNA 3KFXA 3FE2A 3L43A 3K9LA 3U61B 4ILEA 2NPIA 3QKSB 3RS7A 1ZNYA 3I73A 3MWJA 5TVKA 1LB1B 4NYJR 1GKIA 1YR7A 1E6CA 3I1FA 4URWR 4M4SA 5KPJA 4JT4A 4BZPA 4TL7A 1ZM7A 2FSIA 1NMXA 3W3ZB 1E98A 3BD9A 1FZQA 3CPEA 2IYXA 2ORVA 1W46A 2PZFA 2KBFA 2MSCB 2JJ2A 1AQYA 2NPFA 4OK5A 2D06A 5B2ZA 4P33A 1QHHA 1E2NA 2JAQA 4M22A 4U00A 3I8SA 1L8QA 1OHHD 3MWKA 3SEAA 3IEVA 3QF4B 4MYHA 3OF5A 5KPDA 2DWOA 4JL6A 3CW2A 1YHNA 4NCHA 4B35A 5A4JA 3X1XA 2XZLA 2ONJA 3X2SA 3TKLA 4QRHA 3U7EB 4JLBA 3BJIC 2IS4A 1JR3E 3B1ZA 3K8YA 4M9QA 1T3HA 4TSFA 2EYUA 3T15A 1T91A 2P5SA 1VCOA 4ON9A 4BZQA 2OBNA 2F3RA 3G0HA 2GRJA 4D81A 1JR6A 1BMFA 5HZHA 1D5CA 3VAAA 3A1UA 4RFSA 1IBRA 4HLDA 1KZGB 1MO6A 1SKYE 1Y3AA 3T5DA 4QKQA 3DOEA 4MH0R 1U0JA 3ADDA 1S1CA 4Q4AA 3Q8XB 4QGGA 4BFWA 3U7GA 4PSAA 3AQ4A 5JLJA 3Q5EA 2GVZC 3GEEA 1AZTA 3BGWA 4HAWA 2ZVPX 1XCGB 3FOZA 3L0IB 4IDPA 2QL6A 4JLOA 2AHOA 2J7PA 2CXXA 5G53C 2RCNA 2R6GA 1OH5A 3OE7A 3NDPA 2LKCA 4LHYA 1M7BA 1S8FA 2FZLA 4MRPA 3KQLA 1BYUA 5CLQA 3BAFA 1XXHE 3SYKA 5J4YA 3R8CA 2OSBA 1LW7A 1CBUA 3NEYA 1SVOA 1TQ4A 4IKEA 4Q5IA 5B57C 1N5KA 2C96A 2PMDA 5IK2D 2N42A 2QI9C 1YZKA 1VMAA 2BC9A 1C9KA 4PFSA 1E2IA 3ZVLA 3WY9A 1G8PA 3T5GA 3Q7QA 5DNYB 4KFRA 3AF4A 3HU2A 3A1VA 1DAKA 4EPTA 5AUPB 3T06B 1AM4D 1P4SA 1YKSA 3PEYA 4WZ6A 1IM2A 4P4UA 3K09C 4LYJA 4NHOA 2BM0A 5B64A 4M1TA 3IHLA 3K0AB 3NVAA 1SVLA 1T8TA 2CK3A 3HYRA 4LJYA 1X8JA 2ZE5A 2YNMA 3GJ7A 3Q85A 2WWXA 4Q4HA 1NNEA 2O8FB 3WYGA 1J2JA 2JLSA 4YC7A 1KK2A 5BXQC 2PEZA 1T5LA 3KKQA 3M4YA 2AXPA 1E0SA 2OILA 2VPPA 4QHTA 4CT4B 1ELOA 2QQ0A 3QE0A 1IXZA 2VP4A 4C0JA 2IHBA 5E7JA 1RIFA 2Z0MA 1I4TD 1Z28A 3AKDA 3C4JA 1A5TA 3E1SA 4FXPA 4JT2A 3RRYA 5CDFE 4BPBA 3GP8A 2O8CA 1XEXA 1AKYA 4HEJA 4ACBA 3ND8A 1W2HA 2GJKA 1N6LA 1DAGA 4GI7A 2Z4RA 1DTSA 1QG2A 4L5BA 1ZRHA 5G3ZA 1KY3A 1ZMXA 2RAPA 4M9XA 1XEFA 1W0JA 1GOTA 3TH5A 4Q1FA 4A36A 3GQBA 4IFEA 1AN0A 2EW1A 3LBNA 3K9NA 2RB4A 2WJVA 1R5BA 3OEHA 1QRAA 2QMEA 2HJGA 4PC3A 4RZ3A 1U9IC 4M53A 3CR7A 4OJKA 1VYUA 3H0KA 4OYHA 4TYYA 3CRRA 1K5DA 3F5FA 4KBGA 2ZI6A 3UMRA 3BFXA 2EYQA 4TYWA 3EG5A 2QTVB 2ZM5A 1VG1A 4L4UA 5JWHA 1ODFA 4C0SA 2O0JA 2JDIA 5HKKD 4W5JA 2R6FA 5HE8A 4ZO4A 1U0LA 2V55B 4A0FA 1G5PA 4DCVA 4D4JA 3B78A 2WICA 1LV7A 4RCZA 4OK6A 1ZAKA 4LV8B 1WA5A 1VYVA 2IXGA 4TLDA 1KYIA 2JLUA 2F1HA 4K81B 4MKFA 3X1YA 1Z0FA 5H68A 2J1LA 4UXHA 3RC3A 2ZETA 3QPUA 1YZTA 1EWRA 1S4QA 2OLJA 4TL8A 4TZ6A 2F7SA 4N0DA 1S3SA 3QXCA 2HYDA 1XJ0A 3T1VA 1RRCA 1FQJA 1XZPA 4A2WA 1JEDA 3VNVA 4WIAA 1S96A 1ZVQA 3H1TA 3C14C 1F2UA 1IAQA 2WWFA 5KSOA 2W2XA 1S9DA 1X3SA 2ODNA 3R7WA 1VG9B 3GJ3A 3NEJA 3AP3A 5BQ5A 1R8QA 3CR8A 1HT2E 1W49A 3Q3JB 1PLLA 5KNCA 4M21A 3F3YA 3LQRA 2QPTA 1R0YA 3QF7A 2FFBA 5DE3A 2VTKA 1GRNA 3B82A 4DLWA 1DPFA 2IXEA 6Q21A 4KJZA 3W9YA 2CCJA 3LX5A 4ZDWA 2ZUDA 4EAQA 2RGDA 2ZRDA 4IFBA 4V0LA 2Q9AA 2F9LA 3N5CA 1F48A 2BWJA 3G5UA 3P27A 4LK2A 4CRWB 1ZUIA 5J4LA 1KI7A 2RKOA 4Z51A 3A6PC 4URVR 4EPVA 5EUQB 4OQNA 1NN1A 2A5JA 3QNUA 1NSFA 4I4LA 2XNSA 1AGPA 1YZQA 1XD8A 3NBFA 4Q9HA 1JXOA 1Z22A 4MUAA 1KK3A 3VQTA 1LS6A 3BERA 1DAHA 2VYFA 3KTAA 4PHHA 2O0KA 3WRYC 2OCYC 2KE5A 3SHWA 4KLNA 1SXJC 1A2BA 4JYCA 5AR1A 3SZRA 1DOAA 1ZM9A 2B21A 3BWDD 2RHDA 2D7DA 1G3QA 1IN4A 4I1OA 4JVNA 3PFIA 2FJUA 4PHTA 1SHZA 1WF3A 3KKNA 2X2EA 2QRNA 1FNNA 3GLGB 4ZDKA 1TUIA 1JQJC 1OLOA 3BB4A 2QE7D 2ZRJA 4B47A 3KQHA 2JJ8A 4OI1A 2WWHA 4HLUA 3B1WA 3CRW1 4OQMA 4Q1BA 3SOPA 2BMDA 2NIPA 2ZAOA 4LBWA 1W5TA 4LZZA 1BOFA 5G41A 4OHYA 3LLUA 1KMHB 2QAGB 4QBIA 4E5UA 1KDTA 2PJZA 1QBKC 2GILA 3LVQE 4JZKA 1E2KA 2IK8A 2QAGC 4M2LA 2OCPA 5C1BA 5EP4A 3IIKA 1S2MA 2GDJA 1G291 4PAMA 4TLCA 1A1VA 4UKDA 3GLHB 4PTLA 4IEIA 2QPOA 4A1FA 1HQYE 4Z54A 3I62A 4RZXA 5SZKB 1KO5A 4JLNA 1ZM3A 4XIGS 1ZP6A 1R0XA 1UKZA 1MH1A 4LI0A 3VR1A 2ECKA 2VO1A 3ZQJA 5K8UA 4QJ4A 2ODWA 4C7OB 2WWYA 2GCOA 2WMNB 1H8HD 3VKHA 3SNHA 4UNSA 2BBTA 2DFNA 3TK1A 3PIRA 2IYYA 5SZHB 5F9HA 3UMSA 3TW4A 1T0HB 2DFKB 1TL7C 1OKKA 4BQSA 1MABB 5KTYA 4JBWA 2I4IA 4IOKA 2FA9A 4IDQA 3EC1A 1OYYA 2VP9A 1GNPA 2H8KA 5DYGA 4D26A 3FHTA 2YOHA 5B58C 4QGFA 1G8HA 1Q1QA 2W83A 1EG7A 2IF2A 2VRWA 4BRWA 4IJMA 1XTSA 2EVWX 4JSTA 3FVQA 1E2MA 4G5QA 2FWRA 1AA9A 3PJRA 3QY0A 4C3ZA 4LOAA 4B71A 2I1QA 4LHWA 1N6RA 4P3YA 5HR5A 3I8XA 3AH8A 1CKEA 4TYPA 2EU8A 2HCJB 5GJCA 4UNQA 5DIFA 1W5SA 2Q21A 4RSGA 3AGQA 4M1SA 1G41A 1PV4A 3D3QA 1E9CA 5BYKA 1U8AA 3N2IA 2MSEB 1E3MA 3Q5DA 1VHLA 2VSXA 2PT5A 1JXMA 1OFTA 4YMVA 4PAOA 3LXXA 1M7HA 3GFTA 4ASUA 3A8TA 1JALA 1DAMA 1ZYUA 2BDTA 4DLZA 4DXAA 1TADA 2QUZA 1RRPA 1TTTA 1GRRA 1OW3B 2PL3A 2ZRIA 1KIMA 4LX0A 2Q3HA 4EPXA 2ZITA 1EESA 4KU4A 5J47A 3U6KA 2IW3A 4DB2A 1TQDA 4JS0A 1U8ZA 4PHGA 1QHHB 3DEFA 3RLFA 4C2TA 1KO4A 1UFQA 4PC7A 5IRCD 4CW7A 2FH5B 3TGPA 3R20A 2A3RA 2O52A 1EFRA 2GNOA 3K0EA 1XD9A 4JBXA 4JLMA 4L16A 4L8GA 3SYLA 2GAOA 3ADCA 4RKEA 4LJ8A 4Q01A 2Q9BA 1U81A 1ZINA 4LY6A 1US8A 2QQEA 4FCWA 4NYMR 4RD2A 1N0WA 2O8FA 1ZW6A 3GPLA 4PC1A 3TJZA 3LY5A 3NKVA 2XOKD 1HH4A 1X86B 3FTQA 1W2GA 2WKRA 1KI8A 1NLFA 1RPZA 3EZ7A 2AFHE 3P32A 4WOPA 4J0QA 2NO7A 5FPKA 1EFTA 4DZZA 4P4TA 1R4AA 4TQ9A 4GFDA 1G3IA 3CBQA 3EPLA 1RYFA 1GITA 1QHNA 1MOZA 3FKQA 1W4AA 4LHZA 4Q4AB 1CF4A 2BMJA 3PR1A 4IVQA 1HA3A 2JLZA 4F4CA 2AWNA 3IGFA 1QDEA 5FH9A 3FMFA 3L8ZA 5CJPA 4E09A 5L8VA 4F91B 4MRVA 4EJSB 1N0UA 3FPAA 4DSUA 1OXXK 4EJSC 5FUXA 3MRSA 4F92B 1JEEA 4OI2A 2FEMA 1U9IA 2ASEA 2QMOA 2YVUA 3CNLA 3PEWA 3CNNA 3WXMA 4YXWA 5JBQA 4URZR 2FE4A 2CL7X 1D6JA 3BH6A 3FWYA 1UF9A 3ZVMA 1XZQA 2JA1A 1G4UR 2F43B 1NBMA 1Z6GA 4JMPA 1P3JA 1EX6A 2J7PD 1FUKA 3PG5A 2ORIA 5KO2A 3U7HB 4LPKA 5CLLA 5A5GA 2IYVA 1QHYA 2QROA 1ZBDA 1ZJ6A 2JIZA 3LO5A 1CP2A 3VMFA 2ZRHA 3C7KA 2O0HA 3VNUA 4R7ZA 5AUQA 4O2RA 3F0TA 2BM1A 4A6XA 3KB2A 5FL7D 5KOYA 5J4HA 5FI0B 4WZBE 3WBKA 1QHXA 3EZ6A 4M1KA 4Q4HB 4KXFB 4V0NA 1G8GA 3WYFA 4LSGA 2GEVA 2WAYA 1KSGA 1JPNA 1R0WA 2CVFA 3RS2A 3B9PA 1EFUA 5HTKA 3SU8A 4UXIA 3AVVA 5DN6A 3B8HA 2LWIA 1OH6A 3VTKA 2OHFA 1LF5A 1P2VA 1WBBA 1LF0A 5GJBA 2O8CB 2IUSA 4GMXA 2GESA 1AZSC 3C41J 1XEXB 3FKSA 3LDAA 3NH6A 4GP6A 4Q9LA 3HR8A 5AJZA 5JWRA 1U2RA 2FEOA 3CIOA 1OB5A 3CM0A 3H84A 4M9ZA 3OAAA 3UWKA 1GL6A 3PUWA 4DB4A 1AS2A 1G16A 3AKCA 3LQQA 1W36C 3ZLJA 1JJ7A 1R7RA 2IT1A 4FMCB 4S35A 3GJ6A 1ZM4A 3W8NA 4TYNA 4Q19A 4D0GA 2BMEA 2JASA 2GAAA 2WOOA 5KNBA 1UM8A 4QBGB 3OIYA 1ZCAA 2G83A 4W5WA 3OFND 3PEVA 4LRWA 3W34A 1KI2A 4FN5A 2RHMA 1SKYB 3A4NA 4BRUA 4QM6A 1FX0A 4NKRA 4QBFA 1XTIA 1E2GA 1NF3A 1W0JD 4IDNA 4DVGA 4LC0A 4V0ME 5JRZA 5EXSA 4ZKEA 4DEXA 2OG2A 2L0XA 1VHTA 2J0UA 4NYMQ 4OBEA 3K1JA 5FFMA 1RJ9B 1W4CA 3OEHD 5GVRA 2G0NA 4F4JA 4Q4JA 1OIVA 1L7VC 2AK2A 3GJ4A 4RD3A 4Y0VA 5AUOB 3JZMA 1ZNWA 3K9HA 2H18A 1FNMA 2ZS8A 1SZPA 1XMIA 1SXJA 2JDID 3B6EA 2R65A 4OQLA 1HT1E 3Q7PA 5JCPA 5ANRB 2ONKA 3RSLA 1Q12A 3KDSE 2PCJA 5FI1B 3VFDA 2ANCA 3TE6A 5FUWA 1MO4A 2BJVA 1GL7A 4K8OA 1IJFA 1E2JA 4BE7B 3GLFE 3GLGA 4KLZA 2ATVA 2EFHB 3QSYA 2DFTA 5JJIA 3FFAA 2CL6X 1G3MA 4Z8XA 3KJGA 3TAHA 4A6PA 2BCJQ 4E07A 2IC5A 2FF7A 3SFVA 3TVTA 2Q3MA 4QG7A 1OXVA 3R7WB 3H2YA 4CGZA 2UZIR 4GZLA 4XTCS 2VA8A 2YC4C 4NYIQ 3A37A 2QBYB 1KMHA 1KK1A 2VQSA 1F3OA 3MWLA 1ZC3A 1IXSB 3K9GA 4KCGA 3DO6A 3GLHA 3QG1A 3VR2A 2H17A 3ZQ6A 4PPNA 4U5XA 4QNMA 2GTPA 5EE5B 5DHAA 2FDCA 4UXJA 3IEUA 3CZQA 2Z4SA 2GXUA 2YHSA 5DGXA 5BWMA 3FYHA 2P2LA 2ZSBA 2X1VA 4V0KA 4WZAE 4B3BA 3GLIE 3L82B 4B6FA 4GSYA 3E5HA 4Q7JB 4NU0A 4DCUA 1XBTA 1ETUA 2R6CA 1LS1A 1Z0AA 2REOA 2WJIA 3KTAB 2YWHA 3KJHA 4DIEA 1B23P 3BB1A 1FMJA 721PA 4H1UA 3CRQA 1R10A 3PXGA 2O8EA 3CNOA 1KGDA 4KFTA 4TTPA 2DWQA 5LD2C 1M6NA 2CE2X 4D4LA 1CJTC 1D9XA 1XF9A 1Z2CA 1UDWA 5J4KA 2A7QA 4KFUA 2V8OA 1UADA 2DBYA 1E1QA 1G4AE 1C1YA 2V7QD 1XTQA 4QXAA 3DZDA 1KAGA 4JL8A 4PQRA 4Q18A 1XEWY 4LJ5A 4TL9A 5EZ6B 5L3SB 4TQAA 3GJXC 3QPVA 1N5IA 1ZU4A 1FP6A 2XAUA 4W7SA 2OM2A 2EFEB 1TEXA 3NBYC 1DG3A 5HE9A 3EZ9A 4HLUC 1OF1A 2D7CA 3W3AA 3LAWA 1JI0A 1YR9A 2OT3B 4KVGA 2BOVA 1DS6A 2WV9A 3IO5A 3TVDA 3QI2A 4DRZA 4DLYA 5CK4A 3O8BA 4Q7KA 3EWSA 3E2IA 2QTFA 3A4LA 1V5WA 2XEXA 4POAA 5SZIA 4C30A 4NPHA 3FMOB 4B3XA 2E1RA 3R8FA 4IXNA 4P32A 3TSZA 3EARA 5EJEA 3AVOA 1QVRA 2R6DA 1KNXA 2WSSA 1XX6A 5DH9A 4HZIA 1N6IA 2AKAB 4EFMA 4HB3A 2GCOB 2ZJAA 1NMZA 3R9WA 2FOLA 1E2LA 1G18A 2ZYWX 3UG6A 4QNRA 1NI3A 3SJZA 3KKPA 1D8TA 4JKYA 4WBSA 3IQXA 3TUIC 3AM1A 3UIEA 4JJKA 3HWSA 5LPNA 1U98A 1Z08A 2ZRCA 1RFLA 1HYQA 3LV8A 4AD8A 2Q3FA 1OFIA 1MO3A 5DYIA 4ABYA 2GKSA 3A1WA 3CH4B 4HYYA 1BS1A 3R9XA 4TMKA 4EKDA 1WCV1 2CCGA 2NGRA 3ZVRA 3GEHA 4XWKA 2IWRA 1NP6A 2GEDA 5LB2A 4ERNA 1KK0A 1SGWA 4C4PA 4B43A 1DG1G 2IF0A 3RS0A 1KTVA 1KZ7B 3AKYA 1N6NA 1GNQA 2OESA 1M74A 1IXRC 1P61B 1T5IA 2QNRA 4EJSA 2CDNA 4AG6A 1IN6A 1HV8A 5F3WB 1R8SA 2OBMA 4PC6A 4URXR 1MR3F 2MMCA 4HUTA 5C4GB 1ESNA 3U3OA 4MDFA 1IY1A 4OHVA 4Q1CA 2CHGA 2WZQA 2ZJ2A 3DZ8A 2ZSFA 1AQUA 3TQCA 5FOXA 2F43A 4TMXA 1IONA 1NRJB 2N1BA 1GL9B 3HP1A 3BC1A 3T1OA 1Q44A 1ZIPA 4GP7A 4ASUD 2AXNA 1XJCA 2RGEA 4TT3D 3U5ZB 3MJHA 4DC9A 1Q22A 2CHQA 2I1VB 2KB0A 4H1VA 4V0OA 2QU8A 5EXTA 5TV2A 4DCNA 3O8RA 1RC8A 1RZ3A 3EIHA 1MRNA 3ZZTA 3WBJA 5IF9A 4Q03A 3DOFA 2FMXA 3GJ5A 5KSZA 2A2ZA 4G5GA 3W90A 2V3CC 2JLRA 3SN6A 2QY9A 1US8B 1XMSA 4NCIA 4RFVA 2HXSA 1Z6AA 5CIQA 2FPKA 4GL2A 1IN7A 2QTHA 1EFRD 2VHQA 4RJLA 3W6PA 2P6UA 2ZE6A 3OEEA 3K0CC 5C46F 2B92A 1NLYA 4OI0A 3NHAA 2P0EA 4TTRA 4NCKA 3TRFA 5CM9C 4M9SA 1O3YA 5JHHB 4L15A 2EWVA 1P9NA 2QP4A 3QIAA 2WIAA 2FX3A 4NBSA 2C2HA 4LV6A 4PQYA 1G6OA 4MKIA 4TN1A 3TSOA 4ZDIA 4NONA 1JR3A 3VKGA 2RH5A 3BXZA 3SJBA 2LCFA 1R2QA 1NVVQ 1DELA 4GBMA 5FPSA 4ZI3A 3EX7C 1GILA 1KO8A 3RS5A 2RGAA 2J7KA 3KXLA 1S0UA 3JVUA 4CIDA 1OIWA 4PPQA 4CYMA 1E32A 2J59A 2W6JA 3IDQA 3BFKA 3SJAA 4O0MA 3ZZ0A 2WTUA 4A15A 1DAFA 2ZSEA 3UWOA 3QXJA 2QM8A 2A5DA 1RJ9A 2ORWA 1CRQA 3QBVA 5L3RA 4TLBA 3SI7A 1E0AA 3SBEA 1CTQA 4RD4A 3LH5A 1GP2A 2HT6A 1G3UA 4KFSA 2P67A 1NBMD 1Z8FA 4KI0A 3ZIAA 1GIAA 2IYWA 2XXAA 2O8DA 4BFUA 1ZIOA 4IDHA 1XXHA 1ESMA 3Q9LA 3QQ5A 5KDOA 2VSFA 2VHTA 2FSHA 1TAGA 3EW9A 5AUNB 4DLXA 2VL7A 1FP7A 2HUPA 3IBYA 5H70A 1KI6A 1Q3HA 4A2QA 5KDLA 2JJ1D 2A5GA 3B1XA 1COWD 2Z5FA 3QBTA 4HLQB 3SC3A 4FWTA 1KY2A 1NJGA 1KHTA 4M1WA 1AS3A 1GRQA 4L9SA 3GJ8A 2OFXA 4HUQA 2D4HA 3NC0C 3THYB 2ZRKA 3OIWA 4UNPA 2ZI4A 3MMPA 3RNLA 2ZR9A 4XTRA 1G19A 1II9A 2AD5A 3BE4A 2D74A 5JI3E 1UEJA 2QBYA 4G3XA 3ZDQA 1UKYA 3RABA 1N0VC 3DM5A 1G17A 1OYWA 2C78A 4DJTA 3U7FB 4PPFA 2OV2A 4OL0A 1OXUA 2J87A 1G64A 1UAAA 4HAUA 4B2IA 1K6MA 4ZCLA 1NY5A 1JAIA 2IEYA 3AVYA 5CDFA 3OAAD 1FX0B 5BN3A 1NN5A 2QP9X 3RANA 4EUNA 1E69A 1UKVY 2JLWA 2J0UB 4Z1MA 2ZSDA 2FZ4A 2B8WA 3KXIA 4LJ6A 1WBDA 4LBYA 3AKEA 1NKSA 3WMFA 4R2HA 3CB4A 2WWWA 4Q4JB 3LFUA 3B2EA 3MD0A 4DT1A 4AKHA 3U2QA 4PO9A 1XDBA 3LBIA 2W00A 3LA6A 2XNDA 5FTMA 1XMVA 1U94A 2QT1A 2R9VA 1G7SA 3TSWA 1LNZA 4I1VA 3RSOA 1SXJB 1VTKA 2WVJA 5FTLA 5EXXA 1IJEA 4AY2A 2X19A 2BKUA 2YWGA 4P4SB 2CNWD 2GF0A 1TX4B 2Q6TA 2W6IA 5AK0A 4D6PA 3ZD6A 1Q1BA 3ASZA 2I3BA 3AP2A 2OFOA 5EE0A 2A5FA 3ZZUA 5GVSA 4PANA 2RGNC 4IDOA 3ZVNA 2ZVQX 2ZJYA 1VKJA 3A36A 4OQXA 4KHZA 4PC2A 1SXJD 2HF9A 4LGMA 1G5TA 1QHGA 1CR2A 4FCVA 4NDZA 5L3SA 3FGNA 3KUDA 5CITA 521PA 1TF2A 2H57A 1J7KA 1KJYA 2AFIE 4EFLA 1NLZA 2RGBA 4LJ4A 5K8LA 4AKGA 2ZJBA 2XZOA 5CK5A 2ZTSA 4QHSA 5K8IA 2E87A 1ZCBA 4RKFA 1W0KA 1Z6YA 3GMTA 3RDPA 4JLAA 3M0EA 3KQKA 3O8CA 4FMCF 1D2MA 2DHRA 3SDZA 4DLRA 3I4LA 1Z83A 4GMDA 4KVAA 4C0HA 3IQWA 4Y0AA 4DDTA 2GA8A 3EA5A 4NTZA 1J8MF 4OKSA 2AR7A 4NCJA 1S9HA 4DLVA 2IYLD 4WW0A 2BBOA 2RMKA 2ZYVX 1I2DA 4PHFA 1TU3A 2ZRLA 1CR1A 4YDSA 4M1MA 4M8NE 5JEDA 2BVNA 3B60A 4LPSA 2ZU6A 3QKUA 2QMHA 1H8ED 3PUVA 3HPQA 4R98A 2KI5A 3THWA 3U3KA 5DHFA 1HTWA 4LHXA 3QVUA 2ZI9A 1XJQA 5FOTA 2P6RA 1X8KA 2HT1A 2VEDA 1Z2AA 5G40A 3A1SA 2WOJA 1MO5A 4Q21A 3K70B 1UKEA 3V4FA 4TTQA 3T34A 2O8EB 1N6PA 1NIJA 3K70C 1II8B 1R5OA 4AC9A 2F6RA 3CPJB 2F1IA 1TF5A 4LJ7A 2YC2C 1OB2A 3X1WA 2BBSA 1OH7A 3B1YA 4ACAA 1Q20A 4AYTA 2WIBA 3QG5A 3HU3A 3HR7A 2W2VA 5JJLA 3BBPA 4PZZA 1GWNA 2ERYA 4ZCIA 1DO0A 3OESA 4MGYR 3GJ0A 4Q02A 1AKEA 3MGCA 1J70A 2QA5A 5BN4A 2ZUCA 1W48A 1F6BA 3QVVA 4ZPXA 3L0SA 5JZVA 3OZXA 1E1QD 5EP1A 3CKLA 3GEIA 1BO6A 2JLVA 1E1RA 1VIAA 3MSXA 2PX0A 4OQFA 4XVRA 1CR4A 2GCPA 3BH0A 1DBSA 1E79D 4DBLC 2V6JA 4Q9IA 5EE1A 1U99A 4IRUB 2VP5A 2J5XA 5FOUA 4Q9KA 4DKXA 4AYWA 1WQ1R 1ZD8A 2AK3A 3HU1A 3EC2A 4HAVA 3WMGA 2CVHA 2ZE8A 1YU9A 3I32A 2CHVA 3PVSA 3V4RA 2B7BA 2ZJOA 3IO3A 1T6NA 2ZREA 1Q1EA 2QGZA 4YMSA 1VG8A 4IHQA 1KOFA 2CLCX 2YKGA 2WSSD 2VBCA 2JJ2D 1II0A 1RVDA 4MKHA 3D31A 1LFDB 1N5LA 1KMQA 5DI3A 3CUEF 5E7IA 1Z06A 2F9MA 2XZPA 4BLSA 4ESHA 3OIUA 5KDDA 5JHGB 4UQOA 1UJ2A 1JJVA 2BV3A 4Q4LA 3VHLB 3KFVA 4IXMA 1EXMA 5EXPA 1S3GA 2YV5A 2PLFA 2CE7A 3MG9A 3TR0A 3EZ2A 3W6NA 2C03A 1NIPA 2NZJA 3GLIB 4HDCA 5JJKA 1N6KA 2AN9A 3K0CA 4EPRA 4LWZA 1OJLA 1Z07A 1NMYA 4HB4A 2Z6VA 2ZRFA 2QEQA 1P2SA 4BGDA 4UJ5A 3WP1B 1SVMA 5EE3A 1WMSA 1XP8A 3U44A 4LBVA 5D3MA 1KAOA 1GSIA 1HQCA 4TSFD 4DDWA 3KQUA 2C8VA 2B7CA 1IN8A 4MYTA 3BIFA 3FFBA 3SBDA 5L3QA 4BASA 1BMFD 1P62B 3RHFA 4JKIA 1E9BA 4Q1EA 1IY0A 2W0SA 4Q7MB 2BEKA 5TB5A 4LDJA 1NVWQ 4QGHA 4HZUA
chains in the Genus database with same CATH superfamily
4CKBB 1LPPA 1QQ7A 4FFBB 4J0IA 4LOKA 3UK7A 3M4JA 1HWYA 1B3BA 1Q1ZA 2V8BA 4HB2A 1O03A 4LV5B 4FINA 3T1HB 1O0BA 2GHQA 4YRIA 2R44A 2QRGA 2ZYGA 1SRQA 2X86A 3IB3A 4B6OA 3S40A 3CW9A 3OE7D 4FFMA 3EXIA 3OMWA 1TJ3A 5TS3A 4ENRA 4LCBA 1O87A 4US0R 5KU7A 4C87A 3FYDA 4I55F 5FOQA 4BMPB 2ZQZA 3HFRA 4DPLA 1NR5A 3YASA 4UVGA 1UBFA 2VP0A 2NADA 2OHXA 4EGFA 4RTOA 2G04A 2P4QA 3KOUA 1GTG1 5JZOA 3ROGA 5BP7A 2JLYA 2E0IA 4K9LA 5JBIA 4YJ3B 4YI3A 3WLAA 4B4VA 2I78A 1U0GA 2GBLC 3ML1A 4KQ9A 4YP6A 1T9GS 3TZ6A 5I9NA 2C7PA 2EEZA 1N8TA 4HUJA 1ZIXA 4U2KA 5DBOA 4CBVA 5KX5A 2QN2A 3OOWA 3DLBA 1ZIDA 8AT1A 5PNTA 1L9XA 4ZN6A 5FUBA 1BX3A 4HGNA 3ODGA 5LYJB 1JEAA 1C3OA 4OHXA 3QUBA 4HBZA 3T4XA 1OZAA 5KKNB 4WCFB 4KNYA 5DTIA 3THYA 3MWDB 2WKSA 3DL0A 1Z82A 4B73A 4EUKA 1I94B 3MT0A 4ZI7A 3FCOA 4AECA 4J4BA 4B75A 1DC4A 4RIHA 1AGXA 1KO7A 4JJIA 1WE2A 1PCXA 1NW7A 4BE4A 4OHBA 2GCGA 3BWVA 4G1BA 4B3SB 1JDSA 2XQVA 1UBSB 2W48A 1LKZA 2AEEA 3RVPA 4LYYA 3VSCA 1ISFA 2GVDC 3PP8A 4HXFB 4XFDA 3NTVA 1MENA 1YH3A 2WJJA 4XUDA 5BSMA 2AFHA 2DBZA 1ICEA 2HMUA 1IZZA 3IR5A 3D6AA 1F8FA 1Q83A 1IZ8A 3DMDA 3QH4A 4MRAA 3S2YA 1G21E 1YVRA 2W0MA 3TR5A 3WRXC 4Z0NA 1NYRA 4NE9A 1BYIA 1EE1A 3I5XA 5EMHA 4EJ2A 1FPQA 3T54A 4WHMA 1FVFA 1M3SA 4AKEA 4DR7B 2HFKA 2R751 4ZI5A 4MV3A 2V3WA 3REGA 2CKMA 2HF8A 3K7EA 4F2WA 1BGXT 6LDHA 3BGIA 2O14A 1WXDA 1K6IA 4G0NA 4BAGA 2ODQA 3OF3A 3ZW7A 2Q4OA 4GWGA 3OTIA 3GY0A 2R5WA 1JQLB 5EZYA 2UVQA 3K5HA 1EX9A 2JIRA 4PLYA 1YACA 4XOIA 2MYUA 4G8JA 3F7TA 3L7DA 4O4JB 5BVHB 3LXRA 4MPTA 3PLAE 3DA8A 1ZESA 4BJ5A 2R1UA 3N8NA 3II6X 3X1KA 1R9MA 2JFNA 2P2GA 3OLQA 3BWBA 3TL3A 1LBEA 2IYTA 2RGNA 2HJHA 3WKAA 4AZTA 2R8PA 3SSAA 2PE5A 1JHXA 1NBHA 1X1SA 2J67A 4JJ6A 1HEUA 1Z7WA 5EIWA 3N2GA 1YGYA 1QRDA 3ESBA 2E9SA 5JNVA 3VJRA 1XK7A 3F6SA 1UJMA 4TWRA 3ONWA 3QKIA 5L6LB 3TCXB 1LLUA 2D2FA 4GRDA 1QM5A 1TAUA 3O84A 4WZBA 1AMUA 1RRFA 1GPLA 1QO9A 2GJ8A 3DO8A 3ND9A 3N0RA 4LZPA 4PVCA 1ZNXA 2PNFA 1IG0A 3BWMA 4URYR 4KGZA 3NHZA 3WWYA 3C5VA 3S2EA 2DFVA 3H8WA 2JPDA 4L3VA 3THSA 1IE3A 5DO9A 5EWJA 3PQ8A 4M9UA 2OYRA 5BUQA 1KKMA 1M1UA 1PR4A 5B2EA 3EXFA 3HACA 1KI9A 3CF2A 4JVOA 4QUEA 4LOIA 2AC2A 3PNLA 4IEEA 3JRNA 4ZAFA 4O08A 2CHEA 1A82A 1Z5WA 3W5IA 1Y9AA 4UULA 4RAQA 3PC8A 3RUEA 1HE2A 4E3ZA 2LVBA 1CZKA 1J4AA 4LXQA 4OQPA 3DT9A 2OFPA 5HOEA 1U2EA 1DADA 3NVMB 1KVSA 4G0PA 4ARSA 3CLSD 4B48A 3GB9A 3KELA 2ZDGA 3K5WA 3D4NA 3KR9A 3Q87B 4IKPA 2Z3WA 4Y0NA 3BTOA 2GXAA 1HQDA 1H8HA 4OSPA 3A26A 2VNHA 3O82A 4JQOA 3EIWA 3VOTA 4DCTA 1P72A 5LD2B 3W1WA 3QUQA 1II8A 2QN3A 2YX1A 3UIEA 1VJGA 1N2ZA 1SB9A 1U3DA 2RSLA 4V0MA 5F7XA 3FWHA 1ENZA 1X87A 4AK9A 1WBJB 4XGQA 2PZGA 1VL6A 1OBVA 1W9MA 1JSZA 4BFVA 2HIHA 2E4VA 3GC6A 5K4AA 4GDFA 1MVOA 2H51A 4ZZ2A 1EUZA 2XD9A 4NL4H 1DLIA 4D4MA 1F38A 5CP8A 1YL6A 3D5EA 4PNHA 3ZX5A 2W6QA 4EGAA 2A33A 3IJPA 1QYWA 4I8XA 3KAKA 2XTZA 2MCFA 4GKBA 4YJDA 2QIPA 1NA5A 1EQ2A 2P78A 3GNLA 3TL2A 3VNAA 4EUSA 2A9KA 4EPYA 3N39C 2X9NA 3PPVA 3JQ7A 1D4AA 3STHA 4ZI7F 3A11A 2NZ8A 2EW8A 2NUPA 4WKNA 1O4VA 2NTYC 5GJVC 4EFNA 2CLSA 2Q5EA 5J5AA 3QMWA 3KQOA 1GKUB 3BK7A 1TUEA 3PC7A 4YRAA 3U60B 3V4SA 4JFAA 3F71A 1IG3A 3RBZA 1HORA 4R1UA 2BSQA 3K96A 1CNFA 1EFCA 3C2QA 4G84A 1ADGA 1L5HB 1G63A 1QF6A 3OP4A 1J90A 4DLUA 2XUZA 4XRRA 4DWWA 4YMTA 3DKPA 3A58B 5JMTA 1P81A 2DB3A 1N0IA 3TLGA 4GPEA 5EWLB 3NRBA 4RUKA 2VUHB 3O2SB 4DSAA 1Z45A 2A0YA 1C9JA 3GDOA 1ULTA 3K9WA 1RBZA 4IIYA 4XJXA 3ZWYA 4HQ6A 4G0OA 3DDWA 5JUWA 2ZCVA 2GN9A 1K5GA 2XITA 4WINA 3U1VA 2J9YB 5IAJA 3BL5A 4I55B 4FFPA 4L5YA 4RLFA 3EWNA 4LRQA 1AKTA 3A6JA 3E3MA 1OA1A 2FN4A 3W2GA 2O50A 2QJRA 4HYTA 4X84A 4CMEC 5EZYF 4GE3A 2A1TS 3NOQA 3B70A 3JD2A 4UMFA 2IP4A 3ELUA 2FRDC 4M38A 4BN5A 3P0FA 1HEYA 1HDIA 1MUUA 1N1GA 2V6IA 2WF8A 1HLFA 3GGOA 4P4LA 2RK6A 4W63A 4PG6A 2CT8A 2QNIA 1ZM2A 4HWOA 3P2KA 2FPGB 4IIFA 1O7JA 3HVUA 1N8SA 1SFRA 2YWFA 3PJDA 4MV8A 1WCIB 3UCFA 3JQPA 1JIJA 2WILA 4KGDA 3PKIA 5DNCA 3RK0A 5JCJD 3L8YA 5LM3A 5IEJA 1BA2A 2HSGA 3ZJUA 3A31A 4M1YA 3GDGA 2VYQA 3NG1A 1NHWA 1MFZA 3EZLA 3M83A 3PWKA 2PH5A 2WAXA 2R8BA 1Z33A 2VS1A 3QYJA 5FJIA 4MITA 4PLZA 3W79A 5BMVA 5J3JA 3HA3A 2IXFA 3R0ZA 2XCRB 4P0TA 4PPGA 1Y8RB 2O2CA 3G6KA 5CVCA 5A4MS 5EJ7A 2XBMA 3IUJA 1P19A 1RHUA 4QXMA 1IMOA 1VLZA 3UV6A 4N3NA 3AUSA 2NU9B 1BXZA 4HNVA 5C1OA 1ONSA 1PVDA 2WT4A 2OORA 3QZUA 5AKKA 1LPSA 1RC1A 4BCCA 1LW6E 4XSHA 1GZ6A 2ZJZA 2O20A 4RA6B 4RKQA 1KJNA 5CJ2A 5B53A 1E1RD 5J1TB 4GMFA 3RS3A 3T4PA 3K92A 3N05A 4BLWA 3DHEA 4ZAYA 3PWZA 5ALEA 3EPHA 1RU3A 5CYPA 1SU6A 1Q74A 1P1HA 4G5FA 1TTPB 2KSQA 4ZCPA 2G9NA 2X2FA 4BZXA 3IAEA 5CAEA 2BFFB 3IP9A 4TT8A 4XXHA 4ZV4A 1GUDA 3N2LA 5B7NA 2FU5C 1M1YE 4H9GA 3PEUA 4NMMA 4ZAVA 3KLPX 2PGLA 1GZ4A 3B1FA 4PIPA 5FL3A 5C18A 4QJ3A 2OEPA 2FDXA 3FNHA 4A8JB 3E9DA 4YY3B 3NAQA 4AYXA 3WGUA 1TO6A 3WWZA 1NG9A 3N8IA 5DI3B 4CV3A 5IASA 3IL2A 3EIEA 3SJ7A 4CQMA 3CEMA 1ODCA 4LC9A 1ISSA 3RJ9A 3LWNA 3G1WA 1EKXA 2JJMA 3GBPA 3K6SA 1E9SA 1TYEB 3L0YA 4ZANA 3ZGXA 3S2FA 4LZOA 1GO2A 3B7WA 4P31A 3ELWA 1J5PA 3Q4GA 1RQNA 5JZ9A 2GD2A 4KYTA 1SXGA 1M75A 2X6RA 4MS4B 4DCJA 3G5MA 3C4QA 3ZH2A 2UXCB 1Z0KA 2PKCA 4QJ5A 5EIBC 2NO9A 3VYUB 2FSVC 5GADl 5AVSA 1U90A 3A25A 3BQNB 2FW1A 5KSPA 1G5RA 5I8PA 4YECA 1L1FA 3X1JA 4GR5A 1U4OA 4KXWA 5GZ6A 3VZPA 1SO8A 5A04A 4QUDA 1K9SA 4W5NA 1MX5A 3G9UA 3THXA 3R7AA 1B14A 2EGHA 3DPUA 2C1EA 2AOUA 4AL4A 4Q3EA 4LJAA 3R24A 1TZ2A 4ZQBA 4D9MA 3KETA 3A3OA 4N4AA 4J7AA 1PO7A 3HR4A 4X8MA 5EIAA 4HQFA 1KMNA 1DRUA 1RWKA 2QZJA 1M8JA 4UHFA 4R2JA 1FUEA 3QLTA 5JEEA 2Z8ZA 2HDWA 3NDBB 4KYUA 1XALA 4MI1A 2DPXA 2Z09A 2QK4A 2H92A 2RE8A 4P35A 4ZAZA 1P9RA 2A9PA 3H75A 1LRJA 2QPLA 1POXA 3G9ZA 2D13A 1FXSA 3K4PA 2X5NA 1DX9A 3OKFA 4EYEA 1KQFA 3MS2A 4JC0A 3EXIB 4TTSA 4D9EA 2OAEA 2ZI7A 3BRWD 2DUWA 1BOOA 2CZCA 4A23A 4EY5A 3D7MA 1QK5A 1TVMA 3JZAA 2ZR7A 1QX4A 4J9VA 3S1AA 3ESQA 3LVRE 3U09A 5GP1A 2CB9A 3KD3A 1ST2A 3NC1C 1YS4A 3LZCA 1T1IA 4G1FA 4JUFA 4QATA 4BVAA 1OYOA 4PWYA 2KWIA 2PAAA 2Q7DA 2C2MA 4QASA 1AHNA 2OGUA 4QODA 4YV2A 3DFIA 3UUFA 1WG8A 1YSCA 2FPMA 4PS1A 1Y0BA 3QUCA 3QFCA 3JASA 4Y6OA 4G0QA 1V2GA 1WKBA 4OKNA 5JCZA 1Y81A 3L0BA 1QWOA 4JR2A 4RH1A 1ULZA 2JFZA 1JR4A 4E11A 2ES4A 1E9EA 2X77A 5KX5B 1HMYA 3GCZA 4RZUA 2IZZA 3BKXA 2WV7A 4UTVA 4FM9A 2H7VA 1J21A 4QOIA 1C3OB 2P1RA 3IPCA 4HRXA 1GCUA 1EGAA 1FTYA 1U3GA 2JHPA 4QAJA 1GAXA 4K9SA 1TA4A 1C2YA 1RWPA 2DWUA 4XVUA 1CUZA 1PD1A 4F93B 2R8XA 1FFBA 1YASA 4CFSA 4E03A 4MSUA 2MR5A 2AOXA 2BP7A 2WR8A 4L4XA 5BMVF 4UUOA 1XCPA 4B3DA 2DULA 4K86A 4DWJA 4RTNA 2FUEA 4DAEA 4M1EA 2ZWIA 4EZEA 5JW6A 3BE5A 4TTVA 5SZJA 2AFHB 2ID7A 3FOCA 1P6UA 2C04A 4B4OA 1OVGA 2DFDA 3GCGA 3PCRB 1P0MA 1WW3A 3NM5A 5DIZA 4Q3NA 2WF9A 4HDNA 3PQCA 1VKHA 1CNEA 3PA8A 3AEQB 5C8YA 2WUFA 1E0KA 5JD3A 2NT3A 1FMTA 1MJHA 3CZPA 3LX8A 4G5HA 1FU8A 3GUZA 3SC4A 3K0FA 2PO5A 3VNSA 1E2EA 1O97D 1TNDA 1UKBA 3ZGOA 4ZIRA 3ET5A 3WOHA 1HYBA 4JD5A 4AUKA 2ZXFA 5DMHA 4RTQA 2ODEA 2R2AA 2GD0A 5EZYB 3ZYCA 3WYCA 3ZJYA 1AV6A 2H0AA 2XKAA 2AQHA 2GUGA 3IEPA 3OU6A 5I9TA 2GS9A 2VPYA 1FYEA 1UMBA 3SFTA 4Q0MA 1L7NA 4CZ2A 4O1HA 5F1OA 5LDGA 3QA9A 3AHCA 4O0LA 4WBNA 4G8CA 3R75A 2H3HA 1YQGA 4MV0A 3SQWA 1FQKA 1IHXA 1N9KA 1J97A 2Q5OA 4ND8A 4YQYA 5CCBA 1Z4JA 4J2HA 3VZRA 4F4IA 4YN3A 4EMUA 1T8WA 3GMDA 2QD4A 4DABA 1WO8A 3AJRA 1UBUS 4FBLA 4QXPA 1H66A 5GIPE 1UP6A 1IHUA 2IY8A 1DEOA 1L5QA 3G13A 3N2GB 4ZOBA 4ZOCA 4BU1A 4C07A 3UB3A 2Y27A 4DAOA 3ILHA 3RYFA 1X77A 5JSYA 3DNPA 4E14A 3QM1A 1F06A 3U7RA 1BE1A 4OQEA 4X7RA 3BMCA 4X93A 1C0PA 2OOSA 4UREA 1NP7A 1Y1KE 1CJUC 3ENZA 4WKOA 2GZ3A 1JDPA 1VCNA 3HCOA 4TLAA 3NIGB 4UNRA 2IV3A 3NIDB 2LDXA 4NZOA 1WSBA 3P9ZA 4PX5A 3TRJA 2HJVA 4P81A 4FYPA 1K4KA 5IVIA 2ECQA 3FN4A 4WUTA 1E1NA 1SIBE 121PA 3UOAB 3VHXA 1JJIA 3WQHA 1TEHA 4YIKA 5EWJB 1MB9A 2Q49A 3BHNA 2PQ0A 2BEJA 2RHWA 1F8GA 3RE1A 4U7DA 4M7PA 2O8CB 1ECJA 3KJFA 1Q3TA 1NNSA 3EXFB 2FWNA 3H1FA 4TTTS 3FIJA 2ZI5A 3HHPA 4A03A 2WSMA 2FX5A 5BSEA 2Q9CA 4NCNA 2XRYA 3CONA 3KB1A 2QGNA 3NRJA 3CPHA 1HOXA 4OY3A 5HCNA 4EMBA 2GYUA 2FWJA 2QL7A 3FWPA 2HSWA 1U2SA 5EERA 3HN6A 2Y77A 2H1OA 2Y4NA 4XFJA 3HCRA 5C7OO 1O9HA 1AUOA 4YQZA 2MOKA 3F5MA 1KOLA 4A9AA 3LX6A 4PZUA 1LPMA 1QVAA 1FC0A 3IT1A 5IAGA 3PX7A 5C4IA 1OOEA 2HWXA 2HHAA 4EG5A 3WFIA 4XPZA 3JYHA 1F17A 3C87A 4O59O 4R2LA 3VX4A 1UZAA 3G0GA 5AJWA 3IPXA 2ZDQA 4UHKA 4XB6B 1BDJA 1K2WA 4C7KA 1PFKA 2BI4A 1X8XA 2IH2A 3U4MA 5C3UA 4CEIB 1KHHA 4AF6A 3DZGA 2O1SA 3HJRA 2UYOA 2BIFA 3IS3A 3GRKA 4F38A 3KSRA 1WM1A 3GG2A 4YBZA 4N1AA 1WMDA 1A9RA 2OCKA 1U5CA 1WU7A 2M1ZA 3OZAA 1G6HA 4JP1A 4RSMA 1BWRA 4UU8A 2XSZD 3NT5A 3BGSA 5C9ZA 1DUIA 4LK3A 3AUUA 1ZD2P 3I6YA 4K8RB 1KJZA 4R0VA 2IIQA 2WHYA 4XDZA 4QARA 2K87A 4ZXFA 1IB0A 1UM9B 3Q72A 5JDIC 2RHJA 3WA7A 4J0FA 1KI3A 3JQ7B 4O6VA 1UPXA 1XIVA 3SIWA 5C32A 1GPNA 1UOPA 1QCYA 2NUPB 1UT8A 1XZCA 4HN2A 2ZB8A 4M0MA 3KKMA 4FP9A 3P26A 3EBLA 5KI6A 1X13A 2ZTLA 3MT7A 3TTWA 1GKKA 3FZYA 4MWEA 4RA9A 4BP8A 2P5UA 4MO9A 4FOTA 9MHTA 4Z3KA 3DQZA 2VJLA 3C3YA 5KQLA 1EUYA 2FFAA 1H2RS 4WAUA 4NBLA 3U7QA 5I4CA 1JDBC 3TLGB 2AFIA 2FQ1A 2VP6A 3TO5A 3TQHA 1NAHA 3AU9A 4WT7A 4D9BA 1VI2A 4JFRA 4URUR 5C8YF 1NMSA 4G67A 4NP6A 3U4QA 1ULSA 1T1GA 3I5AA 3EAQA 2G06A 5IEBA 2IXAA 2N0SA 1R6BX 1V8OA 5TRTA 4A0RA 1EUQA 1IY2A 1GT91 3VPDA 1TIBA 1CIPA 1T5TA 3DMFA 1BTOA 3D4PA 1XMPA 5DK4A 1IOZA 3TPFA 5LQSA 5LZ9A 3T41A 5DNWA 3NR2A 2J45A 1RYHA 1X39A 4TT3A 3ZHUA 4GF5A 2Q3BA 1XU9A 1A2QA 4CQJA 2K5UA 2PKYX 1JHQA 2WPDD 3HZHA 3R9IA 1TM1E 5KJ6A 1IU9A 3HB7A 4WBNF 2HN9A 4Q4CA 3Q2KA 5JY1A 5CFMA 5C5IA 3E61A 5EE9A 3S28A 4RHCA 4RMIA 3HB5X 1GJRA 2Q6IA 4YLEA 3SR3A 3B5IA 3IDOA 2R8RA 1BQ4A 2J08A 2K2QB 2HWUA 3ANXA 2RKWA 621PA 1ZI9A 1Z0DA 4OMFG 4BNUA 3LDHA 2B0CA 3M1AA 3EOZA 2J09A 2GHIA 2O7RA 5FUQA 4TMVA 2C84A 4FHCA 4PO8A 2PR2A 3HYSA 1M67A 3G0BA 3K0AA 3ASUA 1E2FA 2BY4A 2FMFA 2Q0SA 4M89A 5BMVB 5I4KA 4MUGA 1QK4A 1V6SA 2HPHA 1BVYF 1U0SY 2VTEA 2ZVJA 1N36B 1K7EB 2GEUA 4IDEA 5F3RA 4ZVLA 3ZQUA 4UTZA 3R3SA 3VR5H 4RW0A 1WU8A 4MYCA 2O59A 1JPVA 4PYMA 5JAOA 4BO9A 2A59A 2UDPA 5AJTA 1V45E 2EDAA 4ZYWA 5J40A 5GMOA 2G88A 3CCBA 3BJMA 1CUYA 3IHWA 1Z0ZA 2VWHA 1T8YA 1DTWA 3ROFA 1U63A 3S68A 2QX9A 4L9WA 1I5OA 4JKOA 2XUAA 5LXTA 1ACMA 3RVQA 3HLKA 2IS2A 3G2PA 2GM4A 1C4OA 2W2MA 4EX7A 1L5ZA 5CAEB 3IA2A 4HB0A 1T25A 3MMZA 5KMGA 4CKZA 4Y2QA 2HSZA 5IC4A 4WSOA 4B3RB 1ONNA 4MW4A 4J0HA 4E70A 1K8ZB 2IEBA 3CEHA 3FYTA 4EW1A 3PENA 1N5JA 4X5OA 4Y1RA 5KOHB 4QPJC 1SXJE 2ZJ4A 1XN4A 3NKFA 3ROMA 4RF5A 4X9XA 2DT5A 4CQMB 4CDGA 1AD2A 1C41A 3VTZA 4WLOA 1E2DA 1PZNA 4C43A 4ZI2A 1I3NA 2QTVA 4Q9NA 1HE1C 2CLMB 3G8YA 1XDSA 1HDOA 1YQXA 3C5HA 1YR1A 1DAPA 3K6SB 1QBGA 2YOGA 1Z5ZA 1CERA 4PFQA 1EVQA 1WUTA 1B3RA 1FW8A 1Z4MA 3AY3A 1XMJA 1K0UA 1X19A 3A4MA 4FYJA 4F3NA 1H2WA 3H19A 4B7ZA 3E7WA 3HJGA 4AJ2A 2X4GA 1NBEA 3DL7A 2X76A 1HRKA 2WHXA 2IQ5A 2JJ1A 4YPFA 1U1IA 1COWA 3Q7TA 4F1WA 3CLTD 1XRQA 4JJEA 1N25A 1NFFA 3RYTC 1WCYA 2F48A 3MZ0A 3W5BA 1VCIA 3K9FC 4NZZA 2WU3A 4MV1A 3PNBA 4YCBA 2P69A 2AOUB 2OAP1 3BE8A 5G0SA 3HCBA 3ZV3A 4FN4A 5B7QA 2X8BA 3MTQA 3U3MA 3Q1KA 4OFZA 4KMMA 4B3FX 1CF2O 1STOA 3VDXA 3WL3A 3AV0B 3QEAZ 1B41A 1DKQA 3M9WA 4FW9A 1LY1A 1NR7A 2V58A 3DLPX 3GL9A 3LOPA 3BCHA 4K0RA 4KYIB 4LNAA 4MQBA 4WOJA 4UJ3A 5GTDA 2MSDB 2YWEA 4AI6A 2AFRA 4RMGA 1GRCA 3TD9A 1LX7A 5KQRA 1N3IA 4BQRA 1RWOA 2B25A 4HNTA 4J1SA 1U2TA 1U8CB 2CC2A 4L02A 2PQ2A 4R05A 2JIMA 2NM0A 1U2PA 2IL1A 3BOSA 2XGJA 4JBIA 4TMWA 4NBVA 3P4YA 3WNCA 3FDZA 3ZUPA 1XXLA 1PR6A 5L51A 1BWPA 1E99A 4GXTA 2OFFA 2BF4A 3I9MA 3S1AB 2F8SA 2POQX 1Z4OA 3GH1A 2H6EA 3V8PA 2W6JD 5BOSB 4TS3A 5DI9A 1V3UA 5B12A 2PJUA 3Q40A 1XTRA 5CT5A 1GPUA 4Z8YA 2IBTA 4NULA 1GNRA 4OCZA 3M6FA 3MMXA 4EQ6A 4IX1A 4DLSA 2XZDA 1P0CA 1GG9A 1ZMBA 3O92A 5KVSA 3OIVA 1LDBA 2LV8A 3OO0A 3PVCA 3Q2IA 4DPKA 2VN8A 1GV0A 2WIDA 4EFDA 4HX2A 2WHEA 4DA4A 1FE8A 2IXBA 1XDWA 2CNWA 3RVBA 3LGXA 4J7UA 1CY6A 3D81A 1W76A 2QD2A 1ZXXA 4YRTA 4MPRA 5KNBH 3OQVA 4B74A 1IPHA 3PDHA 3ZH9B 3OJOA 1QOQB 3KK0A 1CQPA 1Z68A 2Y0EA 3IC5A 4L6CA 2HLDD 5HIAA 2AL7A 1YS9A 3CH7A 5LBTA 4QLAA 1FSZA 2ACKA 4P98A 5LBIA 1OX4B 4QNNA 2XTNA 2YMQA 1C81A 5AK4A 1EX7A 5ITVA 1PL7A 1PLJA 1AO3A 3E05A 4QTUB 4UM9B 2IHVA 3GARA 1T9DA 3I5UA 5G1NA 4HV4A 5DVZA 3C6BA 4Y6RA 3ZI7A 3LNTA 4CGYA 4XD7D 1NXVA 1KMCA 2QRUA 4OI4A 2CVQA 4RD1A 4X1YB 4DLPA 4KXNA 4LXYA 1Y5MA 2G4VA 1MVLA 1RKXA 3HZOA 2P7HA 1DQZA 2I4MA 3GUVA 3MF4A 3OFSA 5JMOA 4OMDA 1XWIA 2QN1A 3UKDA 3HXLA 3FDXA 4HYEA 5CT4A 4RE6A 5C8YB 1NUAA 3UXYA 3UF0A 5LXTF 2C7GA 2PRSA 2Q7XA 2R7KA 2X1HA 3K0FB 4ZIRB 1X7WA 2R5NA 3SQXA 1FTSA 4YRLA 4FDTA 4HAXA 2QP3A 2OBFA 1NVEA 4BIIA 5CJJA 2ZGVA 1PGOA 1S5PA 3OHMA 3LT5A 1NUQA 3FGPA 4ZYUA 2DYKA 4LE1A 3EIUA 1C4WA 1PWHA 1UMBB 1VL0A 2O2IA 5G0WA 4KQMA 4WBNB 5L6MB 1VIDA 2G7MC 1P2TA 2FFHA 1JKIA 2PVPA 2WLTA 3LWZA 2ZRQA 2LIPA 3KT6A 2TYSB 2D2VA 3TVYA 4ND8B 1TEVA 1N5MA 2YYYA 1CF9A 4LJKA 3GR6A 4RGYA 2UZAA 5U1PA 2PGDA 1WSWA 2XNDD 3QXSA 3STWA 2GXQA 1RHKA 1VLMA 1BFKA 4KPEC 1OZ0A 3T7KA 4OB8A 3D8BA 4G9GA 4M0FA 3RRZA 2Q1WA 2R7NA 1ORIA 4J6FA 1FUIA 4AO6A 5ALHA 2GM3A 2ZYHA 1TZMA 3BGDA 1MABA 1E1CA 1HDRA 1VYTA 3BMCB 1N2CE 3DL2A 1IQRA 3FX2A 4TWIA 1L5KA 5BV7A 4XGIA 3ZXUB 1NQOA 2HKIA 4B46A 3PWTA 1R37A 4ARAA 1W5BA 4B7UA 1GVNB 1YVEI 2X4IA 2ZB4A 2ZPTX 3HJNA 3OCXA 4LNHA 4OQ4A 4RACA 5AWFC 1ADBA 2ZBQA 3VHXB 4WNCA 2ANBA 2CLKB 4XJVA 4AG5A 3FPCA 2IYSA 2LW7A 3D6TB 4WFQA 3KLBA 1V43A 4ZO8A 4RS4A 1ISIA 5I7EA 3USCS 5JDCA 2JAPA 3OWOA 4GL4A 2BZ0A 3HNOA 4LSMA 1KTIA 1ZD9A 1XPUA 1DQYA 1NX9A 2VXBA 3QRWA 4MUHA 1T15A 3HB4X 2OR3A 3F4KA 1I3OA 2V5AA 1E79A 1YBMA 4TKMA 1U0RA 5K4GA 5B7GA 2FN9A 3L43A 4G24A 5DWVA 5U4QA 1H85A 2GN8A 5ALIA 4R6XA 4B5KA 3CS3A 1H6AA 2NPIA 1E3QA 1NT2A 4XW2A 2PDAA 1GQOA 1DDIA 3I73A 5I7AA 1XC7A 3R5JA 1GKIA 3RM3A 2ZUWA 1CUCA 1YR7A 3HKDA 4QLOA 1RXSA 2PPVA 2Y1LA 3SVZA 4B9EA 4EZIA 1P8AA 2GEFA 3G2HA 4JT4A 5ALFA 2QYTA 4LYGA 3KQWA 3QNMA 4RKYA 2F3SA 3TRIA 5L53A 1IZ7A 1UK6A 1P77A 2WUDA 1A5SB 5T4FA 3R8XA 5E9JA 1N3YA 4X0EA 1QHHA 4M22A 3T3OA 2LGJA 1U31A 3SICE 2QZPA 2XNJA 5IXJA 3SEAA 1KS9A 3AQIA 3FNGA 2FLKA 3NM4A 2NZVG 5REQA 2EG9A 2JJYA 3RASA 5TPZD 3TTYA 3WS7A 2YXBA 4IXTA 4NCHA 4B35A 2XZLA 3X1XA 1KXZA 4EOGA 2Q1UA 3X2SA 3TKLA 1POWA 1T8PA 4QRHA 5HCUA 3U7EB 5JXIA 3NYRA 1M0WA 1PT5A 4JLBA 2ECPA 2IS4A 2OMEA 3W4JA 4FR5A 4ADSG 8ABPA 4JI8B 2EYUA 3TPCA 1ADJA 4HOYA 4ON9A 1X38A 4RANA 4U7PB 1R0BA 3OQIB 1YCGA 2F3RA 2OBNA 4RA9B 3PC2A 3GWGA 5HZHA 4B4KA 3O4JA 3VAAA 3PCTA 2BEUA 1KZGB 1UINA 1Y3AA 2C2KA 3B9RA 1FJXA 2G07A 4FFLA 3ADDA 3OC0A 1X2BA 3EQ6A 4Q3OA 3SM9A 2FP4A 1RWNA 4BFCA 4BNDA 4UTPA 3U7GA 1AZTA 2I2XB 1Z13A 4HAWA 1FNCA 3BX1A 4HWPA 1VE1A 3GPIA 4CN8A 5C8VA 3URMA 2Y1KA 2AHOA 2CXXA 5AI8A 5G53C 5EHNA 3WTBA 3QX3A 2R6GA 4EJ6A 3OE7A 4CR7A 2YQZA 2LKCA 3AJAA 1XT6A 3TD6A 1NVBA 2AJTA 3N2ZB 4H17A 4OFBA 3OQ1A 1CR6A 2WTEA 2OSBA 2ZWPA 4IUDS 1CBUA 3ZCXA 5BR4A 3NEYA 1ZMRA 2VJOA 4AS3A 1L8XA 4BE9A 3IP1A 4XA8A 3N2KA 3ONVA 1YZKA 3RSFA 3VC1A 4BKMA 1VXRA 1TE2A 1YB7A 4PFSA 3AHFA 2Q6OA 4ANFA 3TPZA 4S12A 5DNYB 3MS4A 1A9ZA 3AF4A 1QH1B 3HU2A 3RQIA 5A6VA 3VTFA 5AUPB 1WZEA 3GJTA 3ZKWB 5K0EA 1QANA 1P4SA 1WMEA 1AB6A 3P4UA 1RC0A 4Q6BA 4BYGA 1IM2A 2A4MA 2BM0A 5K3CA 1T9GR 3PXEA 5FLEX 4W82A 3K0AB 3NVAA 4BAZA 2C3MA 5ETJA 4JC5A 3Q85A 4Q4HA 5J1SB 1NNEA 2O8FB 2WSBA 1J2JA 2JLSA 3CMMA 2D3TA 1KK2A 1L4BA 3M4YA 1T5LA 2FMUA 2O57A 3BGOS 4TWJA 3K6KA 4XLZA 1YRWA 3RK1A 4PCAA 4GKVA 4BU0A 2BR4A 2PKXA 4RDIA 1HLDA 2VP4A 3LRTA 4G2TA 3UK2A 3DVQX 2Z0MA 2D0IA 1A5TA 4JB3A 3HVHA 2DY0A 3GP8A 4E4YA 3HC7A 2O8CA 2Y0PA 3FYUC 4MKXA 1P0QA 4FQ7A 4G25A 2W22A 4ZO6A 5E0OA 1CDZA 2RHLA 5LXTB 1ZK1A 4M0KA 1FMCA 1OR8A 1ZRHA 1ZMXA 5M7EA 1ODIA 3EVAA 1ODSA 1V0JA 3O1LA 1W0JA 3W7VA 4Z4QA 3U26A 2WHPB 3TH5A 3PYLA 5BXYA 4AN0A 5KMGB 4A36A 4IFEA 2DR2A 2F1KA 5H8WA 4CUJA 2D2XA 3ZE0B 2WJVA 3IOYA 4PC3A 5FWAA 5MGNA 2QMEA 3RIMA 1CQWA 4RV9A 1V9LA 2O2YA 4Y1RB 5CVDA 3VKFA 1SHUX 3F74A 4OM7A 1ZN7A 1ZQ1A 3DNFA 3H0KA 4CCSA 2JCBA 2ZI6A 1TA9A 3ZHOA 2NP7A 3BFXA 1ZUWA 3D6FA 4ZT6A 2QTVB 5HGXA 2B9VA 2P9CA 2PSSA 1G60A 2R68A 4L4UA 1KDZA 4ZMRA 4C0SA 5B4UA 4W5JA 4QDZA 4O3FA 1XPJA 3TMAA 4AMUA 3ZJTA 3GFGA 5H7XA 2F8LA 4DF3A 1JS1X 1LQUA 9ATCA 5I4BA 2HA4A 1G5PA 1LK5A 4D4JA 4Q37A 4DCVA 7AT1A 4I19A 3T94A 1ZAKA 2HLPA 3GDHA 4ER3A 1K7YA 1VA5A 3OZUA 1KF0A 5ALVA 2CV1A 2FWBA 1LDEA 2I7XA 2IXGA 1KYIA 3QVKA 2F1HA 1S2LA 1GGHA 2AMYA 4IP0A 1Z5VA 3FZNA 4UXHA 3PI7A 5EG5A 5B2FA 3MB8A 3ORRA 3ZI0A 1I6MA 1ADFA 1VL2A 1YZTA 1YJBA 2AOWA 2LIVA 1DBQA 2R84A 3EVEA 5K0NA 2HZBA 1P0PA 1RRCA 1PJQA 4A2WA 5D5QA 5AW1A 1X9HA 2OLEA 2R6JA 4DYDA 4WIAA 1S96A 1PWEA 2Z3VA 3C14C 3WRVA 1F2UA 1MC4A 5KSOA 5DHPA 4LG1A 2ODNA 3R7WA 2QB5A 1K08A 3GJ3A 4LEIA 5BQ5A 1DJPA 4YO8A 5K45A 3NHRA 4AKSA 1MZPA 1GKLA 1VPWA 4F1KA 5KNCA 3LK7A 2HV9A 3F3YA 2QPTA 2YZKA 4M21A 5KOHA 1XMOB 4ISCA 1UAYA 1Z4NA 2EBWA 3FDZB 2JRLA 5DX0A 3TLYA 2BM8A 3ANNA 3B82A 3R6TA 4O5OA 3ZHXA 4H1WA 1CIVA 1DPFA 2FWAA 3LP6A 4LDNA 5TT1A 3WYNA 3C1UA 2CCJA 2Q1TA 2OO3A 4UTNA 2WYHA 2ZJ1A 4IFBA 1IC6A 3PI6A 2J48A 2Q9AA 2AMVA 5D6OA 3A10A 3I1IA 3JRWA 3T7JA 2XNCA 2XEDA 3P27A 4LK2A 2RBGA 5J4LA 1TW2A 1UC9A 1ZUIA 2QTMA 1WMFA 1I32A 1GZVA 3BIOA 4EPVA 1G55A 4OQNA 1YFLA 2A5JA 2OHIA 3QNUA 1SUAA 4LDQA 1SIWA 5IVKA 5H3LA 4R1TA 5AIBA 1AGPA 3LDUA 4BNIA 3CRZA 4C3OB 1XD8A 3VSBA 3NOXA 4Q9HA 4LW8A 1JXOA 2OCDA 4IZ6A 4MUAA 1VSTA 4X7PA 2ZCJA 4DIFA 4XCVA 1P74A 1IXKA 2VT3A 3IVAA 4Z53A 4P36A 2AZXA 1LSUA 1NYTA 2O0KA 1R18A 3PNMA 1U5AA 4DMLA 1EFKA 1OVMA 4JYCA 1DOAA 3HYCA 4IHAA 3U3ZA 5BMOA 1PTKA 2GTIA 3BWDD 3AJDA 3OURA 4QYWA 3ILVA 4BB9A 1GQQA 3KPWA 2B7LA 1PR0A 4I1OA 4LRXA 3ZY2A 3M33A 5F77A 2PUCA 2PU5A 4ZZIA 2D1TA 4PFJA 1CEQA 4INZA 4EG8A 5IXSA 3SVLA 3AX6A 4U7HA 4ZDKA 1TUIA 4ZYXA 4BX2A 3QLJA 3WDMA 3L8MA 4FZ5A 3CKYA 2BT4A 4B47A 4FYVA 3SX0A 4QU8A 1UT6A 2LE0A 3KZMA 1VPEA 1PZFA 3CRW1 2YS7A 4OQMA 3WSWA 4I6JA 4DNQA 4CG0A 1OC2A 1LDYA 2I1LA 3AY0A 4L3WA 3ROQA 3WICA 4F6RA 2EKBA 4FNMA 4KXLA 4M3NA 1BOFA 2Q5IA 1JZSA 4WEQA 4YGXB 5E38A 2V0GA 5SYMA 1X7WB 1DJLA 2BFBA 2JCXA 4E5DA 1A50B 1RADA 1EFPA 1QBKC 4FEAA 4O4LA 1I1OA 2IK8A 1B2RA 2QAGC 2XE7A 3K2QA 3UJAA 5JE8A 1UJ4A 4HY3A 1Y48E 2GDJA 4PAMA 5EGSA 1IQ0A 1A1VA 4O1MA 3DEHA 3PYXA 2X5KO 3PHBE