2YHIA

Trypanosoma brucei ptr1 in complex with inhibitor wh16
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
267
structure length
248
Chain Sequence
b'EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE, PUTATIVE
publication title Exploiting the 2-Amino-1,3,4-thiadiazole Scaffold To Inhibit Trypanosoma brucei Pteridine Reductase in Support of Early-Stage Drug Discovery.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Oxidoreductase
total genus 90
structure length 248
sequence length 267
chains with identical sequence C
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2011-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2yhiA00
4IQGA 3PYMA 3RKUA 1O95A 1YL5A 2I6TA 1UXIA 2O3RA 3ENKA 1WDMA 1DRUA 3H9UA 2GNAA 4B8WA 1R16A 4YCAA 3VPFA 2QG4A 2VYND 1HLPA 4WCFA 1HTBA 2NU8A 5JE8A 2I3AA 3GOHA 5IAAA 1D3AA 1SC6A 2BMAA 3PI7A 3NTOA 4CMGA 1EBFA 5ICMA 3OF2A 4FFNA 3V2HA 3DONA 4LSWA 4DLBA 1H6DA 3GFGA 5TT0A 4BNIA 3LT1A 2CFCA 3GY0A 2B5WA 2E49A 3D5QA 1P31A 1F06A 4PG5A 3TN7A 3RCBA 1B3BA 5DZSA 1Y8RA 1Y8QA 3OEWA 5ENVA 1D1TA 1LJ8A 2D4AA 4YRBA 2EG9A 4ZRNA 5HRUA 1ZJYA 4FS3A 3BMCB 5L7TA 1E3LA 3L6EA 3W8DA 2ZCVA 2C7GA 5ER6A 4CLXA 1BXKA 3VVCA 2O3UA 5B1YA 3ENNA 2GR9A 2GYYA 4JX8A 2VHVA 3U4HA 3ZV6A 1CJCA 1Y5RA 3OQ1A 4KWIA 3DZBA 3N7UA 4BNLA 1Z82A 4J43A 4DPLA 1P45A 2CDAA 5L7YA 4WCFB 2WYWA 3U4CA 4CMAA 1B15A 1OZAA 4BMSA 5I8ZA 1LDYA 3PEFA 1WW8A 4J6FA 4EUFA 1SB8A 5DCUA 4B4UA 4EGFA 3KZVA 2YQ5A 1ZK4A 1KIFA 3G1TA 4GGOA 3IQDB 4XD2A 4XYEA 2W90A 4OSOA 3KTDA 1SAYA 5EN4A 2GRAA 4YDRA 1I3LA 2Q4EA 3IJRA 4HY3A 2Z1MA 2V6BA 5B4UA 4S3MA 4Z0HO 4JNKA 3PFWO 3AJRA 3DBHA 2PR2A 4L73A 2WJPA 5EESA 5DBIA 3GAFA 3ETEA 3EZLA 4R54A 5I7EA 1T1SA 4J49A 5TT1A 5I7FA 4UAGA 2CY0A 3HN7A 1U5AA 3GNQA 4UEOA 3V5NA 2Y1CA 1BGVA 1UP4A 2DBRA 1E1LA 3T4EA 3DWFA 1FMCA 3PLRA 2JD2A 3DOOA 3KV3O 4P8RA 3WLFA 5F5NA 4E4YA 4XCVA 3S2IA 2P9GA 4QFDA 5G0VA 3KYCA 4ZA2A 4MKRA 5KJ6A 1CYDA 1LLCA 2VN8A 3QP9A 3U9LA 4I1IA 4MVJM 5F3RA 4DC1A 1JVSA 4KTTE 4WUVA 1IULA 1X1EA 2NQ8A 2NTJA 3S2FA 2AEMA 2VWPA 1NP3A 3FBTA 5T6BA 3K5PA 4DREA 3DMTC 3SLKA 2BRUA 2Q49A 3LU1A 4TRJA 4K26A 4XJTA 5FI5A 1YWGO 3INRA 4GLOA 4FOOA 1LSSA 3TFOA 4BV9A 1PJBA 4QO8A 4DQVA 3UFXA 3ZU3A 1KVSA 4CM4A 1U5CA 2CVOA 1T2AA 1U3UA 5U4QA 4YAEA 4ND1A 4MKZA 2IYPA 3IKTA 2EERA 1RJWA 2QHXA 1EDOA 5IFLA 5BR7A 1IUKA 3H4VA 3JQAD 2IE0A 1BW9B 2E82A 3HDHA 4XDYA 1LDEA 3MJCA 1EFLA 1RWBA 3LYLA 1XSEA 1W6UA 2YDXA 3DBLB 4ZQGA 5HA5A 2RAFA 3JD0A 5BSHA 1PJLA 2GD1O 2AE1A 4WCDA 3P2YA 1HYEA 3AU8A 1YOVA 4P4NA 1W73A 3CINA 1GCOA 1UAYA 2WWRA 4FFMA 5FFFA 3W6ZA 3VPHA 3ADOA 3NDRA 3TF5A 6LDHA 5I8WA 5K9ZA 4AJNA 3PK0A 1YXMA 3OJOA 4CR6A 2Q1WA 3TNLA 3H9EO 3GHYA 2EJWA 2B4QA 4CM4B 2WE8A 5JAZA 4IPTA 2G76A 3V2GA 3H3FA 2YDYA 5C3MA 5CAEA 1HDOA 3HQ4O 1ADCA 1XDWA 4BB6A 2VRCD 2YQ4A 2VYNA 1KY4A 4YEDA 4BGIA 3IMFA 3RUIA 3I4FA 1CDOA 3NT4A 5DNAA 3GR6A 4I5FA 4H3VA 1W8DA 4ONEA 1O89A 1JW9B 2QYTA 3ZWNA 1NTOA 2RHCA 3RIHA 5JY6A 1ISGA 3ORFA 1WDLA 4PG7A 3EY4A 3I83A 2FZWA 5L4NA 4CPDA 4JN6B 1P1IA 4Q3DA 3TJRA 4UVDA 1J0XO 1J5PA 1FK8A 1IHXA 4CLRA 1JA9A 1P33A 2BFAA 1M75A 3K9QO 4XGIA 5COAA 4YRDA 1GL3A 4YJDA 3PYXA 2P4QA 5IG2A 3LC1O 4HUJA 4BKPA 4BO4A 3I9LA 1ZK0A 1Y6JA 2GASA 2XPCA 2PD6A 2YUTA 1PJ2A 3DEYX 4WE3A 3WQQA 1UXHA 4YYZA 1E1NA 4K6CA 4KMSA 5AOVA 4XYMA 1BXZA 3Q1LA 1PSDA 5J23A 1KEUA 2PWZA 2QYSA 2Y0CA 3AM3A 3FRJA 4P4GA 5AXBA 3PDJA 3NYWA 3BMQA 4UVHA 5HTOA 1ZK1A 1PWXA 2Z5LA 1MUUA 4XYLA 1KVRA 2NADA 1YKFA 1QSGA 3KSDO 4LCJA 3RKRA 1DRVA 4F6LA 5JAQA 4RQTA 3GGPA 4NBTA 2D59A 1P0CA 1WPQA 4NU5A 5DF1A 2DPGA 2GDZA 4CLRB 3F5SA 1MFPA 2UVDA 3GK3A 4CMIA 4WOKA 2VZ0A 5DP2A 1LEHA 3EZYA 1O5IA 4LSMA 2YFQA 4WLUA 1C0PA 1QXSA 1Z73A 3ZCXA 3ZV3A 4Z9FA 1ORRA 1EVYA 1X7GA 3FBGA 3M1LA 4GVXA 4NJMA 3H9QA 3GNTA 1E6UA 3LSYA 5JFOA 1I3MA 4C7KA 1HRDA 3BAZA 1AGNA 2WMDA 1TVEA 3UCFA 3KBOA 3HG7A 3RC9A 1A4IA 3VHRA 1K3TA 3OMLA 3GNSA 3DZGA 4N18A 2J6IA 3FI9A 2HAEA 4DIBA 3JQCA 5HWSA 2X0JA 1F0YA 2NNLD 1PL7A 1QORA 1DO8A 1PS0A 2DLDA 2HKIA 3GEMA 4TRRA 1RM5A 1A4UA 3FN4A 4JCOA 2ZB7A 4JIGA 1XCBA 5TQVA 5G0TA 2NVUB 4DYVA 4Z6KA 4EBFA 1DAPA 2V65A 4HWKA 2B37A 3SC6A 3A9WA 3JQGA 2EF1A 3FF4A 4PGFA 4ALLA 3FWZA 5CEFA 3NDJA 2HJRA 3EVTA 1P1HA 5JY1A 3ZWOA 2FPPA 2FP4A 3E5MA 4CUJA 1MG5A 4ZQHA 3WICA 1EUCA 1EDZA 3CXRA 2UUPA 4BMNA 1GEGA 3JQDA 3VOSA 1QV6A 2NU6A 3NGLA 2WD8A 3EMKA 3EVNA 3NKLA 1ENOA 1RM0A 3JQAA 4AG3A 2QW8A 1M76A 4I5DA 1DB3A 3U0BA 3WGQA 3ZWVA 5CP8A 2UAGA 2AQ8A 4PLCA 4JGBA 1LX6A 5TJHA 2YHUA 3QVWA 3LK7A 3HE3A 3C7CB 5KVQA 1EQ2A 2XAAA 4CM7A 2OBNA 3QVXA 4IMPA 1E6WA 4EJMA 5A3JA 4A73A 3L6OO 4CM9D 3OSUA 1NAHA 4R1UA 3HADA 4KOAA 1UUFA 1X1TA 2BI7A 4MP3A 3RBZA 4B3JA 1PEDA 1Q0HA 2GN9A 4BKUA 1UDCA 5FYDA 2JFGA 1HDCA 1GPDG 3AM5A 1HDRA 2GN8A 2CDCA 2VHZA 3D4PA 3IJPA 3BXXA 4JQCA 5G0WA 5LC1A 2YY7A 3E5RA 3KXDA 2ZK7A 3JQAB 3F47A 1NQOA 1AHHA 3VPSA 1KETA 1KBZA 4CJXA 2VRCA 1HZJA 3DTYA 4M55A 4HV4A 1JKFA 3E9NA 1ZEMA 2WD7A 3QWHA 1U8FO 2C2YA 4W7HA 4O63O 1ISFA 4HP8A 2X9NA 1YBMA 2PZLA 4AJHA 4YXFA 2OUIA 3KRTA 4DIFA 5GZ3A 1LRJA 5TRTA 4BNFA 2PGJA 4CLHA 4M8SA 1X7DA 2D0IA 3D5TA 3RUAA 5ADHA 3U5TA 1B16A 1Y1PA 4BO5A 1XELA 3K92A 3ROKA 2PKQP 3PQFA 4BNNA 5AVOA 5CG1A 5GY7A 5LDHA 4BNUA 2HMUA 1M66A 1Q7BA 4WEQA 3RJ9A 4R51A 1PL6A 3B70A 2HK8A 5HBRA 5JYEA 4Y6PA 3GN2A 3DMTA 2XF8A 4O0LA 3V1YA 2OP0A 2GERA 5L40A 2ZJ1A 2PD4A 4XGKA 1F17A 3AOEC 2B36A 2VOJA 3P2OA 3CIFA 1IE3A 3RI3A 1DEHA 1I30A 4NJOA 1I3KA 1Z7BA 1ULSA 4BNHA 1ISMA 2ZJ0A 1S6YA 3QJ5A 1SPXA 4BMVA 4U5QA 9LDBA 2X58A 3ASUA 1ARZA 1Y81A 3Q6IA 2P9CA 2I5PO 2G82A 2BFPA 4D3DA 4QQRA 3E9QA 1YL6A 1GV1A 4FOSA 1DC4A 2GO1A 4CLOB 5ITVA 3GUCA 3WSVA 5BSEA 2JCXA 1T2CA 2I66A 5CHEA 3WGYA 1QV7A 1Z45A 1X0VA 2JFFA 3HFGA 2V6FA 4IGFA 3KETA 3AM4A 4PZDA 5TJ9A 4CMHA 3QA9A 1MA0A 1QMGA 4OYRA 1Q7GA 4E0BA 1PQWA 4GX1A 3LDHA 1EUDA 4BIIA 4DQUA 3RROA 3NDIA 4RF2A 2O48X 2HDHA 4CQLB 3CMCO 3G79A 1OBFO 1VPDA 2A4KA 1DC6A 2OMEA 1NR1A 2Y1DA 3CZRA 3AY3A 4P4LA 4B7UA 4HBGA 2X0IA 5LCXA 4BVAA 1IZ0A 2DTEA 2OL4A 3GHHA 5IN5A 3S2EA 1BG6A 3AI1A 4IJUA 3MJEA 2QIOA 2X1HA 2OORA 4HFNA 1NPYA 3TZ6A 3DB2A 2IDZA 4MIEA 4U6SA 3ROQA 1TT7A 4IDEA 3H6KA 1H2HA 1Q7CA 3TDKA 3JQ7A 3WBFA 3WTBA 4IDAA 3HDYA 3MJ4A 4RPLA 1ML3A 2YJZA 5MDHA 1JWAB 5A9SA 3OIDA 1U7TA 4FFPA 4NDNE 2PFGA 4PLPA 1IL0A 1E3WB 1VJ1A 1LDMA 3NT5A 1N92A 2GZ2A 4RF4A 3AFMA 5A1TA 2YFHA 1JQBA 1NQAO 5G0SA 4G5HA 1NHWA 1VRWA 2DBQA 3PIDA 3ZGYA 2FR1A 3I52A 3D4NA 5F1PA 3ZWXA 4CMEC 4G65A 2X22A 2OBYA 5U1PA 3IAHA 4UEKA 4AJ2A 2ZTVA 4OHUA 2Y99A 2AG5A 1C1XA 5CPFA 2C5AA 3SVTA 1LLUA 2VHYA 4U8GA 1ZBQA 5IZCA 1NWCA 2EW2A 2P2SA 3C7AA 3EW7A 3I9MA 4BO9A 3ZI0A 1GTMA 4BO1A 3MCVA 2PZJA 2E48A 3ZWAA 5A9SB 1J49A 4IY1A 1HYHA 4J4HA 4NI5A 1LQTA 3LC2O 1CEQA 3IUPA 2PKRA 1H6BA 1N2SA 3L9XA 4C4OA 2Q46A 3KLMX 3L0DA 3PTZA 3I9JA 5TLSA 3OETA 2JAPA 1YONA 3MTJA 3PDUA 3PGJA 1R0LA 2GF2A 1XU9A 2FPIA 3WR5A 4TVOA 2HRZA 4HNHA 5K6AC 4HFJA 3ZZNA 1PZFA 2D5AA 1C1XB 3DHYA 2H63A 3OP4A 1ZKMA 4D79A 4B4VA 2GCGA 4JBIA 3Q11A 5DN9A 4D46A 1WXDA 4KTVE 3PWZA 4NHEA 1A7AA 4IZHA 1LC0A 1HWYA 3R6DA 4L0QA 4RF5A 5C7LO 4NBUA 5FWNA 5KVVA 4KDFA 4TWRA 4PLGA 4YA6A 3KSZO 3ONFA 2Q1SA 1KEWA 5T67A 1G6KA 4MP8A 3JV7A 4CM8B 4IDCA 3SJUA 1NXQA 1V3UA 5CDSA 2H1SA 1KC1A 4WLNA 5A9RA 2SCUA 4J1SA 4YT2A 3I6QA 3FR7A 2Y0DA 1QYDA 1C0IA 3L6DA 4EDFA 4RLSA 2O4CA 4DPKA 4TSKA 4E5MA 2VCYA 3HB4X 4AVYA 3BIOA 3Q2KA 3R3JA 4N5LA 1AHIA 1NVTA 3WWYA 4XYBA 4A7PA 4YT5A 3BMCA 1DBVO 5A9TA 4CMBA 1T2DA 4E3ZA 3GDFA 4MVJP 3UOGA 3UICA 1HE4A 4RF3A 4F3YA 4J3FA 4IQ8A 1I5RA 1BDMA 4IDGA 3H5NA 3QWIA 1NQ5A 1V35A 1PGNA 2ZTUA 5DULA 5U9CA 5ILOA 1X0XA 2O3TA 2D3TA 5TX7A 5BNIA 1CQIA 5C7OO 4PIVA 1YBAA 1NFQA 3OJFA 3Q3CA 5GMOA 4GL4A 4CMCA 5DBFA 4FBGA 3HHPA 2PH5A 3WGOA 4CLDA 1DIBA 3AUAA 4NH4A 4GMFA 3ZWCA 4TKMA 4AJ4A 4ZVVA 3V8BA 5EERA 1PJ4A 3IKVA 2DU8A 3C1OA 2AEJA 4YJGB 1SBYA 1RYEA 1VJ0A 3GC6A 3KB6A 5ES3A 5EINA 2IZ1A 1VL8A 1NQTA 2Q2VA 3PXXA 3TWOA 1PR3A 4LRSB 5JBIA 3DBRA 4O6VA 4D0RA 1DSSG 3VH4A 5A4DA 1DRWA 1KVUA 3UUWA 3JYOA 1GCUA 1VKOA 3DO5A 3QE3A 4J1NA 3HDJA 1KC3A 4FN4A 2NTNA 3K2BA 4UULA 3NGXA 5A06A 3E03A 3DC2A 5HS4A 1TI7A 4S1VA 3C85A 4LMPA 1UXGA 1EQUA 1EEHA 2IRWA 4MVJA 3ZU4A 2Q50A 4BOYA 4YAGA 4MINA 4ZJUA 4BO0A 2FR0A 2J5RA 2O7SA 4TZTA 4XIJA 4L76A 1K5HA 5DP1A 3TPCA 3ULKA 1DFGA 1KVQA 2O23A 3AOEA 2VRBA 4Y8VA 2R6JA 1GUFA 1IHYA 1ZEJA 2CVZA 3ZNOA 1A7KA 3DBRB 3OICA 5JW6A 3E18A 4CQMD 4KWHA 3PHIA 1HDYA 3ZHXA 4PLTA 3OBBA 1XWFA 1WZIA 3JQ6A 4PRLA 1LU9A 1HZZA 4GSKA 4R3NA 4R9SA 2X5KO 3STHA 4IS2A 3GN1A 3T7EA 2EHDA 5JPIA 4ILKA 5BNTA 2CD9A 4R5HA 3FSRA 1IY8A 1UR5A 1C0LA 1QKIA 1BW9A 3QW2A 2NVWA 4ID9A 4BNWA 5KJ1A 3VDRA 1O0SA 1RM3A 4YQYA 2FWMX 3RUFA 3KM0A 3QWBA 2X7HA 3I3OA 4GKBA 3DBLA 4ALIA 1K6JA 2C07A 4R5MA 1QYVA 5A04A 8ADHA 4H16A 5IJZA 3H9GA 4J2OA 4K6FA 3W8EA 3B1FA 4DL9A 4KDEA 4L4XA 3WTCA 2ZTLA 3JQ9C 2HQ1A 4I9NA 3G0OA 1GQQA 4N5MA 4GAEA 1E7MA 3PIIA 4QTZA 3GLQA 2FY8A 3IS3A 3PVZA 2PY6A 4PRKA 4O59O 5CEJA 2H6EA 3UXYA 1T26A 4J91A 5F1OA 4N7RA 1PL8A 1PZGA 2AQHA 2Q2QA 1YE3A 1E7RA 4YR9A 2Y67A 2RCYA 4P38A 1U3VA 3JCZA 5BQFA 5DOZA 1GZ3A 1OI7A 2B69A 2IYOA 3NJ8A 3PHHA 2C20A 4PG8A 3WGHA 3HB5X 4EUEA 3TL3A 3T7CA 3D3WA 3N58A 1NWHA 4D43A 1C14A 2VWGA 1KY5A 4I9UA 5AQ1A 4R1TA 4MVJG 3WGZA 2EJVA 4E21A 3FHLA 1OOEA 1M67A 3LLVA 4GWKA 1U1IA 4D0SA 3EHEA 4BKQA 1A71A 3VTZA 3JD2A 4MKXA 4O1MA 5KKAA 4E31A 1BXGB 3PLNA 3GG9A 2ZYGA 4A2CA 1E5LA 3GFBA 4DWVA 2ZCUA 3H65A 3L9WA 4UREA 1LSJA 3H5RA 1Y9AA 3DDNA 5ICSA 3AWDA 3WS7A 2HU2A 3NV9A 5T64A 3TL2A 1I0ZA 1KS9A 5A02A 3FTNA 1GU7A 4FJ2A 4CMEA 1D1SA 3ON5A 2ZATA 5KIAA 1E0DA 3GPDG 5KVCA 3D3WB 3AU9A 3L07A 3PWKA 4Q3NA 4R69A 4WLEA 2DUUA 5L9AA 4AL4A 4TQGA 4UUMA 3QWFA 1NM5A 2IZZA 5ENDA 3OQBA 5GZ6A 3NTQA 1QYWA 2HO5A 4J0EA 3SC4A 2NQTA 3E9MA 3E48A 1JLLA 4B3IA 1QLJA 3FWNA 4BL5A 1W4ZA 3ZW9A 3D4OA 2VT2A 3WGIA 2VHWA 3AW9A 3Q0EA 2VQ3A 4RV9A 4Z9YA 3RC1A 5IN4A 1PS9A 1H9AA 3FPCA 3JYNA 5KCZA 4QO7A 3MEQA 1R0SA 4OM8A 4I08A 4MVJI 3VZRA 2W98A 1HKUA 3WYCA 1L7EA 1B2LA 4GX5A 1CETA 2H5LA 2G5CA 1UDBA 2P68A 3TOXA 4DA9A 2J3KA 4A0SA 3P19A 3UCXA 1MG0A 3CE6A 1EK6A 5K6AA 1V9LA 3DR3A 4QXMA 1EVIA 1PX0A 1V3VA 2ZQYA 4E12A 4ZICA 4OQYA 1U9JA 1X14A 4M1QA 4BNMA 1FDUA 1IPEA 2X0RA 3AY6A 4I9HA 5ER9A 5IZCC 2OFPA 3DZHA 1AUPA 2IZ0A 4DMLA 3INGA 2VUUA 4GPD1 3ONEA 1LC3A 1KEVA 1YB4A 1VC2A 1N7HA 3F1LA 3EDMA 1YRLA 3KYDB 4MVJH 4XA8A 3V1UA 3FR8A 2HMSA 3JQ8B 4OQZA 1NX6A 4B7CA 4DYDA 3O8QA 2NVUA 3VDQA 1WZEA 5IDQA 4PLVA 3PHJA 1HDGO 4XRGA 3F4LA 3TZCA 4D7AA 4ROSA 2R2GA 2OGUA 3NJ4A 4CQMA 3JYQA 1UZLA 2W2KA 1UDAA 1J6UA 4U0KA 3O38A 4DVJA 5C5IA 5DOVA 5A5FA 3F6YA 4PN3A 1YB5A 3QVSA 2IEBA 1U3WA 4BV8A 1V8BA 4PG6A 1TB4A 1BVUA 4IM7A 2Y1EA 3G3EA 5L51A 2PZMA 4LW8A 1A72A 3QVTA 3U4DA 5KOIA 2EXXA 2I76A 3PQEA 1TA4A 3WGGA 1H94A 4XIYA 4YTEA 2BI8A 4EJ6A 1NHGA 1QYCA 1GDHA 1F8FA 1ZFNA 4BO7A 3OJLA 3GVIA 5JSFA 2VWQA 3O8QB 5L95A 2TMGA 3GH3A 1UAGA 1XEAA 2FMUA 3EGOA 3UN1A 4G81A 4IDBA 2ZB8A 4QX6A 4IXWA 1R4MB 4RPKA 1EE9A 5L4LA 1YO6A 4DTIA 4CQMB 1NPDA 3GQVA 2W2KB 4WECA 4NFHA 3TZKA 2PTGA 2HRBA 3LVFO 4HXYA 5TIIA 4DUPA 1B8PA 3H2SA 1ISJA 4E2WA 4L4RA 5AYVA 5IDYA 2P4HX 1U7HA 3DAGA 1KVTA 1G0OA 5JO9A 2HUNA 1QP8A 4Q3EA 1C1DB 4AJEA 4BHTA 4W9NA 4K9DA 1SEPA 1ZIDA 1GY8A 5F1KA 1ADFA 4AJLA 3HFSA 1I2CA 3UVEA 2DFDA 1DIHA 1R15A 4C7JA 1FJHA 2A9FA 4LGVA 4X54A 2FZEA 1EFKA 3MJVA 4QUKA 4R01A 2O2YA 2DBVO 1GFSA 4UVGA 1YJQA 1H2BA 1IZ9A 3JSAA 1T2FA 1BMDA 4NMHA 3I9KA 2HMWA 4IIVA 3ZDFA 5IDWA 3UKOA 2EKQA 2HJSA 1ENZA 3PP8A 3QVOA 3SBOA 3ZHBA 2FN7A 1EBUA 3VC7A 4QEDA 3L77A 3ST7A 5ITWA 1E3SA 4PLHA 3DZKA 1Z74A 2DPHA 2NUAA 2IEDA 4XR4A 3U3XA 3HJAA 1BVRA 1NYTA 2R00C 1XG5A 2G1UA 3L4SO 1MC5A 3MWDB 1LDNA 4A03A 1HE2A 4QECA 2DKNA 3IL2A 3RC7A 3GEDA 4II2A 1Q0LA 4DBVO 3WJAA 5L53A 4BNYA 1WNTA 1F8GA 4IQ0A 3H5AA 4N5NA 2VT3A 1Q0QA 4YBZA 2FR8A 1JDJA 3KUXA 4W6ZA 1XQ1A 4FPXA 1HETA 3RFTA 1U8XX 1DHTA 3BHJA 3BMNA 4OKIA 5HS6A 5H81A 4UVIA 4F45A 3RU9A 1ENYA 2CSUA 3HSKA 3OIGA 4WPGA 3TRIA 4Y67A 4CLOA 4ZGWA 4RO0A 2C2XA 4Z3DA 1NVGA 3PGXA 3OFSA 3ZU2A 2X9VA 1WMAA 1M6HA 1H6AA 4RVFA 4RDHA 1QG6A 3JQ9A 4BNKA 5JMPA 1B3RA 4YJHB 4CV3A 2Y66A 1X13A 5JXWA 2DVMA 1DAOA 1LUAA 1ISHA 4WNIA 1DFHA 4JJFA 4ZHSA 1J4AA 4WKGA 3KSUA 5JMWA 1DDOA 1PQUA 3GPIA 2AE2A 4XB2A 3VH1A 4J9VA 2C82A 4TRNA 4CQLA 1U4SA 4EEXA 4KUHA 3WWZA 1SB9A 4W82A 3DZFA 1HT0A 1H93A 2GN6A 3DFUA 4WLFA 5CG2A 1PGOA 3BMNB 3GVPA 3TFQA 1S7CA 1HE3A 2JAHA 3AI2A 3RUEA 2JD0A 3RQSA 1Y7TA 1PZEA 4WEOA 4IINA 2JHFA 1ONNA 2WDZA 3GZNB 3B6ZA 2DAPA 3JTMA 4BQRA 1XR3A 1HSOA 3S55A 2CVQA 3WBBA 3ONDA 1FDWA 3GT0A 1LI4A 5A3VA 4TMFA 5BT9A 3VAZA 3WYBA 3LQFA 1R4NA 4O5OA 3M1AA 2EGGA 3AOGA 3ZNNA 1E3WA 1Q2XA 1VE9A 4BKRA 3RAJA 4RPJA 3U09A 3ADPA 1TT5A 2TMDA 1Q1NA 1R66A 2PGDA 5JAMA 1AXGA 1VI2A 1O9BA 2C29D 2LDBA 3ABIA 1CRWG 1MV8A 1TEHA 3ITDA 3JQFC 4ZD6A 4ALMA 4BO2A 2O2SA 4NK5A 4YAKA 1K2WA 2Q45A 5DDIP 1LXCA 1V3TA 1AE1A 4CM1A 3L4BC 1NFRA 2VOEA 1P1FA 2ZKLA 2BFMA 4CM5A 4AJIA 3DHEA 2POQX 1T25A 3IP1A 4FJ0A 4NR0A 5FEUA 3PRJA 1FF9A 2OP1A 1BWSA 3SX2A 4U0JA 4JK3A 3ZHYA 2ZB4A 4M86A 4XQGA 3F5QA 1K89A 4XX0A 1N1GA 1R4NB 4RPHA 4XR9A 4MP6A 4Z0PA 1F14A 4J7CA 5HM8A 3FCOA 5TF4A 4ND2A 1TT5B 5JO0A 1ZK3A 3I4CA 3OECA 1HDZA 2AHRA 2GUGA 2X5JO 3GA0A 1LDBA 1DXYA 1E1MA 3O26A 4A10A 1PR9A 3GRPA 3UGKA 4FD3A 2PZKA 2DUWA 3DXFA 4B3HA 3F4BA 3B20A 3GDOA 1PJSA 4CR7A 4NG5A 5TSDA 3TZQA 1EZ4A 2F1KA 2GZ1A 4KZPA 4HFRA 3HNPA 4OXYA 2X5OA 3VZQA 3ANNA 1EVJA 4HADA 4JBGA 4RZHA 1N9GB 4EYEA 1ZMTA 2BGMA 3HN2A 4CM9A 4E30A 3A28A 3RFXA 2Z1NA 2ZB3A 4XWYA 4YVFA 5KJEA 5A03A 1ZNQO 4CM8A 4W99A 1N7GA 1PS8A 1GZ6A 2D8AA 3OH8A 2BGKA 4B7XA 2YV1A 3V2UA 4OSPA 1HE5A 3EUWA 4HX5A 3GF4A 4TVBA 5EJ2A 4B79A 3AUTA 3MOGA 3S2GA 4L4SA 1LRLA 3FNFA 3GVHA 3ETDA 5F5LA 2I99A 4J0FA 2Q99A 3M2TA 2Q3EA 1ZMOA 4D44A 4E33A 1A27A 1U4OA 4L9RA 3GRKA 3CMMA 4BB5A 2OOSA 1ADBA 4PZEA 1FDSA 4YJFB 4YT4A 3RD5A 4YQZA 3QRWA 4J4TA 5AXCA 1YGYA 3P7MA 3PJGA 4OH1A 5BSFA 4XYGA 3O4RA 5KNLA 4GLLA 1GUYA 1MFZA 2GLXA 4IS3A 2GGSA 3QY9A 2LDXA 1P1RA 4E6PA 5IZ4A 1E6EA 2AG8A 4CV1A 5KKCA 4B8ZA 1JKJA 2J5KA 1WLYA 2NVBA 1E7WA 1GR0A 3KEOA 3KO8A 4FJ1A 4E13A 1WP4A 3BYZA 4P22A 1YQXA 3QWAA 3CEAA 2GZ3A 3CKYA 5EIOA 3KVOA 3N74A 2G0TA 1QRRA 3Q9UA 4JXKA 4ALKA 3I23A 1GADO 4BNXA 4LISA 2DTDA 4H15A 3A1NA 3VH3A 1DJQA 1SZJG 5CDGA 1PTJA 2RIRA 2WEKA 2Y1FA 1I01A 2RHRA 4E2YA 4BS9A 1NR7A 3UAGA 4YJGA 4TRMA 3KYBA 2EW8A 1YH3A 3DAPA 1YQGA 4AJPA 4RDIA 2RH8A 4GWGA 1ZW1A 2VNAA 4MPDA 5AXAA 5IF3A 1GV0A 2UUOA 3WDSA 2XOXA 5T57A 3KLPX 2HLPA 4FFOA 4LVUA 4WLOA 1P9LA 4A26A 4A5OA 4OXKA 4CM3A 4BNVA 4M89A 4IJWA 1HYGA 1YB1A 2FRDA 3K96A 1B7GO 4GI2A 4R16A 1FDTA 1U2DA 1RYDA 1OC2A 1VM6A 1PGJA 1LQUA 4WOJA 2J3IA 4ZRMA 4E5NA 3H7AA 4PVCA 2JJYA 3QIVA 1AN9A 3ZNPA 1MP0A 1PWZA 2I65A 3ZHZA 2EGHA 4DLAA 2W2LD 1GUZA 4G2NA 1UZMA 4ALJA 5JC1A 3ZNQA 3RBVA 5L7WA 3WQRA 2E37A 4E2ZA 4WLVA 3WXBA 3OJEA 4LMRA 5JS6A 1LRKA 3MZ0A 4PLFA 4XQEA 2R00A 2WE7A 3KOUA 1A9ZA 1YL7A 2W8ZA 2NACA 2VWHA 2ET6A 4GX0A 4W9NC 4CL3A 1R12A 5DBGA 5I7SA 4Z9XA 4YT8A 3AUSA 2BH9A 1P0FA 2ZTMA 1QYXA 3D7LA 2Q1UA 2I67A 3C3XA 4NFYA 2AXQA 3WGTA 1EE2A 4DPMA 4YPOA 5I9NA 1N1EA 1T2EA 1X15A 5I7VA 2OXIA 1B26A 1ZJZA 3WJ7A 4NPCA 5AXDA 2I3GA 2HK7A 1GYQA 3FNGA 3PJFA 4U6QA 5L3ZA 1B0AA 3LT4A 9LDTA 3EK2A 2YYYA 3A14A 1DOHA 1GQ2A 3I6IA 5IXYA 1JWBB 1PJTA 3QLJA 2C5EA 4GBJA 4R1NA 4CM6A 4GSLA 4QT0A 2DC1A 1GQYA 1NASA 2BF7A 5JDIC 1E7QA 5JDCC 1DJNA 1N8KA 1GEEA 1GYRA 2V7PA 3LLSA 4OAQA 4DBZA 2AMFA 3QHAA 4IDFA 1I2BA 3I1JA 2A94A 3TOZA 4E2XA 3LF1A 2YHIA 3U49A 3WMXA 3CH6A 4J1QA 1YDWA 4NNJA 2Y1OA 3OA0A 4KUEA 3FNEA 3K6JA 4D42A 4UUOA 1SO8A 1Y8RB 1Y8QB 2FOIA 3HDQA 4FGWA 3VPXA 3LF2A 3ROMA 3BA1A 3JD4A 5JNLA 1MB4A 4ZQBA 2A35A 1KOLA 4IGEA 4WJZA 4AJKA 3R0IA 2V6GA 3OA2A 2YW9A 1M6WA 5IDXA 2EWMA 3GZ4A 1BDBA 2HMVA 1CF2O 5KTKA 1HEUA 3BTUA 4OOEA 1D7OA 3MWEB 2ZYDA 3S1LA 4LCEA 4RPGA 4BGUA 1A9YA 1V0JA 1CIVA 1EK5A 1O94A 1RPNA 2E4AA 3G1UA 3ZWWA 4R68A 1BXGA 3PHGA 2JKVA 4N54A 4CUZA 3A4VA 1MGOA 2YHIB 1VLLA 1UH5A 2H9IA 2PV7A 3C8MA 3NX4A 4XKJA 3LC7O 3NUGA 3W8FA 1I32A 2P5UA 3BHIA 2QZZA 4NBWA 1I10A 1P1KA 3G17A 2Q2WA 5T8KC 1ENPA 4GKVA 1CWUA 3DOCA 3NTRA 3ZV4A 5EMHA 3DBHB 3E1KA 2DM6A 3JQFA 3HZZA 2X4GA 3QSGA 4A27A 4Q3AA 4ND3A 1P3DA 3PFFA 1N5DA 3ROPA 4PVDA 2G17A 3F3SA 3RU7A 3M6IA 5CDTA 1YVEI 3L4BA 3RFVA 4FQ8A 3RUHA 2EP7A 4BNGA 3QQPA 4XB1A 1HLDA 4ND4A 1LBEA 3A06A 3AI3A 4IJKA 4ZQFA 4BGEA 4F6CA 3HWRA 2FSSA 1DIAA 2YV3A 1JU9A 3KYCB 1D8AA 3BTVA 6ADHA 1PJQA 3OEYA 3VTFA 4FR5A 1OC4A 3VPGA 3ZN2A 1UXJA 5JCXA 3NT2A 3GDGA 3C7DB 1HL3A 3JD1A 1I24A 4GQAA 5A05A 4I5EA 3RBXA 2VZ8A 4D45A 2O50A 5ILGA 4L8VA 2HMTA 3D64A 5C7IO 1YDEA 3Q9NA 4IXTA 4FDAA 1IB6A 3LT2A 5JYDA 4D41A 4EI2A 2DTXA 1JAXA 3DZIA 2O3QA 4EJ0A 3V1TC 1F12A 1WDKA 3C1AA 3PHLA 1GAEO 5TC4A 3ETGA 1I3NA 5COBA 3OIFA 3WQSB 3ICPA 1RKXA 3X2EA 4FCCA 1MLDA 1G0NA 1H0KA 4J9UE 3UF0A 3AUUA 2W2LA 2Q4BA 2XXBA 1PGQA 1P74A 3WNQA 3X2FA 3JQBC 3KYDA 3I5MA 1SOWA 2NU7A 3U62A 5IXSA 3JQ8A 1KEPA 3IOYA 1XHLA 3PPIA 3WFJA 4ALNA 5FI3A 1E3IA 1T24A 1VJTA 1MX3A 2QQ5A 4F46A 4YRAA 5COQA 1PJ3A 2QRJA 2FSVA 3SLGA 1YOVB 4INAA 3PWSA 3WG9A 3ITKA 5I9MA 4W4TA 2GN4A 3QV1A 1A5ZA 1O8CA 3VZPA 4WASA 1Y9EA 4PLWA 2PH3A 2B35A 4WNCA 1OAAA 2FPGA 3C24A 2B4RO 4BUCA 4I5GA 4Y9DA 4RJTA 2CZCA 1IOLA 3K30A 2A92A 3CZMA 2QX7A 5T5QA 1SCUA 3K2EA 1XKQA 2VUSA 4HNGA 4II3A 3DL2A 3ASVA 3SXPA 1L7DA 1WMBA 2IXAA 1NFFA 2O3SA 3SEFA 3BTOA 4RORA 3BTSA 4IZIA 4NU6A 1QLHA 2QRLA 2X9GA 4NK4A 4J4BA 5TNXA 3RC2A 1EVZA 2PNFA 1NNUA 1O6ZA 3CSDA 3FD8A 2UYYA 1NVMB 3GEGA 4ZQEA 2B5VA 2DBZA 1R4MA 3NRCA 5JLAA 1ZH8A 1ZUD1 4OIMA 4HFMA 3MJSA 2WYVA 5JC8A 3MTGA 7MDHA 4U7WA 2BHLA 3DAFA 3GGGA 3RVDA 2Q1TA 2NWQA 4BO3A 2PK3A 3IUSA 5FF9A 3KEQA 4OO3A 3OQ6A 4PLYA 2CMDA 4Y6RA 4Z0TA 3K31A 4DRYA 4YWJA 3KHUA 1BSVA 1NBOA 3D3EA 1MC4A 3F9IA 1RM4A 4D3SA 1C1DA 3FNHA 1VSUA 4QFCA 4MIOA 4AICA 4FB5A 4YACA 1GZ4A 4XZ3A 2D1YA 2E6UX 1HF3A 4OJNA 3VH2A 1HXHA 3RWBA 1DHRA 1BTOA 3WOHA 2UV8A 2VTEA 4RVDA 1JAYA 3EAGA 4Q3BA 1YJ8A 4CMJA 4BQPA 1CERA 5DCWA 2GSDA 2VYVD 3GVXA 1WAMA 3BMQB 3BZUA 4NIMA 4Y98A 5KVSA 1B8UA 1GD1O 3E82A 4OL9A 1UXKA 3R3SA 4EZBA 4CUKA 2CDBA 2P9EA 4GVLA 4ZN6A 1XGKA 1K0UA 5B4VA 2CF5A 2B0JA 5EQDA 2AW5A 2WM3A 3D1LA 3OM9A 4UUPA 3B1KA 2J8ZA 5CDYA 1DIGA 3EYWA 1Y5MA 4DXHA 2BLLA 1SNYA 4CMIB 1CQJA 1NAIA 1BHSA 1JKIA 3W4IA 1ID1A 1IYZA 2B4TO 1ADGA 5G4KA 4L74A 2NSDA 3DBVO 2AA3A 3JQEA 5KJCA 5LDGA 4LVCA 4NJMB 2VTDA 3DOJA 2BGLA 3AK4A 3F46A 4MIYA 4RQUA 3P5SA 4XRRA 2CF6A 4BNTA 4B4OA 2EIHA 4TKLA 4JBHA 1R37A 4BGVA 3WLEA 1I33A 2EKPA 2VZ9A 4R41A 5THKA 3UHAA 3PZBA 1YS4A 3W4KA 4UUNA 4Q9NA 1OFGA 2OHXA 3LT0A 3GMDA 2V6MA 1E3EA 3DFZA 4GH5A 2JCVA 3CTMA 3WIEA 1QR6A 3PYLA 2EKLA 4J16A 1E1KA 3GGOA 2Y0EA 1ISIA 4RGBA 1I8TA 3IC5A 4WGGA 1NPTO 5JDIA 3PQDA 3AY7A 5JDCA 1DIRA 4GMGA 4WCFC 5DCYA 4FW8A 2Y68A 1DLJA 4YJHA 4XGNA 4OGWA 5G4KB 1DPGA 2RH4A 3JQGB 3I9NA 3VZSA 3GUYA 4ZU3A 4FGSA 4RCVA 4CR8A 1UP7A 2J3HA 3W6UA 4IJVA 3ZWBA 1T4BA 4IMRA 3MJTA 4TROA 2C59A 1JVBA 1T1RA 1U3TA 5G2OA 3S8MA 3ZWMA 1LSOA 3PZRA 4Y6SA 1ZXBA 5G0UA 4FC6A 5CPBA 4W7IA 4E5YA 1D4FA 3D0OA 3M2PA 4I8XA 1ONOA 1W0CA 3VVBA 1XLTA 4DGSA 3WNVA 4JROA 3RUDA 4TZKA 4XJSA 4EW6A 3H8VA 1V6AA 1E7SA 3DQPA 3GZNA 1E7YA 1ZXLA 2JL1A 5H82A 1K6IA 2OO5A 3GG2A 3ANMA 1E92A 1UP6A 4Q39A 4JLWA 1C3VA 4UEJA 4MVJF 2JD1A 4JJIA 4QSMA 4J2HA 2HK9A 2YV2A 3UH1A 1VL6A 5H83A 1T4DA 1TLTA 1R0KA 3E6AA 5T8KA 4RVUA 3GMSA 3UW3A 1UZNA 4FIZA 2D5CA 2NM0A 4J7XA 1XU7A 2HSDA 2GPTA 1WVGA 4KP7A 4KUGA 3HUDA 3WX0A 4DIOA 1LA2A 4BO6A 2C54A 2J3JA 3B1JA 1X7HA 2WSBA 2VNSA 3H9JA 1YQDA 1B8VA 4BO8A 3JYLA 5MGBA 4K28A 4YB8A 5JCJD 1UJMA 3U4IA 2PKQO 4NZ9A 2WD7B 4M54A 4RLHA 2ZIZA 4FFLA 2ZYAA 5C37A 1ZSYA 2QRKA 5TS3A 1XQ6A 3IP3A 4R1SA 2DT5A 3DHNA 2CUKA 1I2ZA 1LSUA 4BNZA 1SOVA 1ZSNA 5GZ1A 2BELA 2PA3A 1ZZEA 2J5QA 2NV6A 4J90A 4XEHA 4Z3KA 3W4JA 5G4LA 4ITUA 3COSA 1PU2A 3TZHA 4IIUA 2BKAA 1PIWA 1DC5A 1I36A 2NTVA 4J1TA 4NBRA 2BFOA 1Z75A 4AFNA 5JAIA 5BNFA 1G1AA 1FDVA 1SMKA 5L4SA 3ZH2A 1JTVA 2NU9A 4J7UA 4NQZA 2ILTA 2WYUA 2ZQZA 3WYEA 4CL8A 1ZSVA 4CV2A 1LNQA 4R3WA 1Z7EA 1E3JA 2P5YA 1L1FA 4ESOA 1ZK2A 5K0ZA 4B4WA 3MOIA 2X86A 4E5PA 3LZ6A 4OXNA 1JN0A 1MXFA 3UCEA 2P91A 1PZHA 2VYVA 5EPOA 4EUHA 3ZV5A 2FHSA 2RBEA 3VKUA 2O3JA 1N9GA 3INTA 5TGDA 4NBVA 2IODA 3IIEA 3OHSX 1E77A 4R4JA 2I9PA 3JQBA 1HDXA 4E5KA 4BNJA 2B83A 1H6CA 4R9RA 1U28A 4M49A 2BD0A 2CNBA 2C0CA 2EV9A 2Y1GA 3K8ZA 3FTPA 1ULUA 3H2ZA 3I9OA 2X0NA 2JFHA 4XQ9A 1KERA 5KWEA 4IUYA 4EITA 1H5QA 3C1TA 4URFA 1YBVA 4YAJA 3K73O 3DMYA 1VL0A 4MDHA 3VKVA 4GGPA 1DLIA 4H7PA 2VUTA 2Y93A 3NAQA 4PCVA 5DT9A 4MVJD 3PJDA 4JJGA 4LN1A 1ZCJA 2X6TA 3DTTA 3AFNA 4K1LA 3WB9A 4AJJA 4MJLA 5L45A 2W4QA 3EC7A 4UVEA 4YJFA 3BMOA 4RL6A 3GVCA 1AXEA 5KJFA 4MVJE 2X8LA 2DQ4A 5THQA 3IDSA 2PLAA 1WWKA 4RZIA 5CEEA 2D2IA 3RUCA 1LLQA 1M2WA 3G49A 1ZO8A 1TXGA 4FC7A 4OKNA 4AJ1A 1VSVA 1IPFA 1KYQA 8LDHA 2C7VA 4PLZA 1R6DA 1U2GA 1XA0A 2XXJA 4CV0A 1PQPA 4Q3CA 1HSZA 3WSWA 3DZJA 4CODB 3H3JA 1P44A 1PGPA 1OMOA 1GYPA 3JQ7B 4BKOA 1ONPA 1LDGA 3O03A 4XDZA 4YAIA 4MO2A 5EL0A 3ZWYA 4EEZA 3JYPA 3T4XA 4LRTB 2O7QA 1EUZA 2F00A 5CDUA 4DMMA 1LTHR 2JCYA 4NFSA 2O4UX 3BMOB 3ICCA 1E5QA 5B4TA 4HKTA 3O9ZA 4PZCA 5B12A 4OMUA 4WK6A 3W1VA 1P1JA 2YZ7A 4PG4A 1DC3A 3R1IA 1LLDA 4IBOA 1PJCA 2NLOA 3WMWA 2WTBA 7ADHA 3FPLA 2UDPA 4RVGA 3WFIA 3GAZA 3ZWPA 4CLEA 3PJEA 3ANLA 5A5EA 1GPJA 2AQIA 5B37A 4KQXA 5BSGA 2DFVA 4CMKA 3OJ0A 4PFJA 1P77A 2IXBA 3CPSA 3RSHA 4AJOA 2VHXA 1XIVA 4OOFA 4M87A 4FSHA 3TQHA 2EEZA 2QZ9A 4JP3A 5F21A 4IDDA 1DFIA 1FXSA 3E8XA 5I9LA 4DLLA 1K6XA 3WIDA 3ZW8A 4L75A 3SJ7A 2EP5A 2Y05A 3JD3A 5EQFA 1SEVA 2JHGA 2HCTA 2PGLA 4KQWA 4RVSA 1BRMA 1EMDA 3RASA 5JCJA 4XQCA 3Q2IA 4LK3A 4D3FA 2AEFA 4RVHA 3NEPX 1C0KA 1VKNA 5CFZA 1XYGA 2Z95A 2X23A 4MOWA 2OZPA 2PD3A 4JP2A 4DC0A 1ZVMA 4E32A 3RJ5A 4FFRA 2AQKA 3CUKA 3ZU5A 1MXHA 1Z6ZA 3TSCA 4ND5A 3BHMA 4DQXA 3F1KA 4GX2A 1B14A 1H9BA
chains in the Genus database with same CATH superfamily
1N0WA 4BX8A 1NUHA 1X9GA 2I6TA 3GLUA 1WDMA 3ZU6A 4B8WA 2O7NA 3X2FA 3O90A 1H3EA 3GLKA 4V1CA 3G2LA 3I39X 2QG4A 1NJ6A 2VYND 1N0VC 3NASA 3VPFA 4MA0A 2BGUA 1RQGA 3MT0A 1JGTA 2RB4A 2BWJA 2IOYA 2JA1A 5K05A 3K70B 3D3JA 4BQFA 3GOHA 1KO8A 1SC6A 3BBLA 2I55A 2IY8A 3UFBA 4OQPA 4CMGA 1W4AA 3SJAA 4V2IA 4W8GA 3V2HA 1FQOA 4S1PA 1C7IA 3O94A 4Q03A 1E79D 1H6DA 1XRPA 4BQOA 3LT1A 1EWRA 3GCXA 2B5WA 4OQNA 2EWWA 3U61B 1FFDA 1YUBA 3O9MA 2DY1A 2JFBA 3IGFA 2I3DA 3SVZA 3KD3A 5CX1B 5C8YA 3VR6D 2O8DB 1Y8QA 1Q6YA 1D1TA 2I2DA 4GICA 3QOYA 4F9EA 1GKYA 1ZVJA 2FEMA 3G0CA 3N75A 3QU4A 4YY3B 3BGSA 4ON9A 1WJGA 1EEXB 1E2UA 1HYQA 5KC8A 1QB8A 4NC9A 3PX3A 5ALKA 3Q40A 1G60A 2NVOA 1BXKA 4RJLA 1W34A 3W8DA 4CLXA 1VSQA 3H2HA 4QOIA 1CNFA 2GYYA 1WIWA 1YRWA 3AEQB 4N3AA 4D9GA 3TBKA 3CN7A 1Y5RA 4IEEA 4O2BB 4L4UA 4J16C 4QG7A 5IBRA 3ZV6A 4AQDA 1CUXA 3RB8A 4MAFA 3T5GA 2F8TA 4YXWA 4WCFB 1X42A 2HA7A 1OWNA 2WYWA 1II0A 1FQKA 1L7VC 1V8ZA 2QE6A 2O14A 4CG2A 2ERCA 4EFNA 4BMSA 3U56A 5EE5B 1EWKA 1KEEA 4ZTBA 1WW8A 1X7ZA 2ZYRA 3TD9A 4DRZA 1NSFA 2GZDA 2OFOA 4J6FA 5B64A 1D4OA 4B4UA 4EGFA 1CE8B 1KIFA 2W48A 3N28A 5KNBA 2FFJA 1ZGAA 2VJNA 4V39A 1SAYA 2ZRHA 2GRAA 4B6OA 4FUTA 5I4CA 4LOAA 2CV2A 3NC4A 3SQWA 1XVIA 2OXTA 4S3MA 3O1JC 5B4UA 1Z25A 2P40A 4KVZA 4UD2A 4MUBA 3AJRA 4Z0HO 3SN6A 3DBHA 3UWSA 2IEGA 2WJPA 1OXKB 4P98A 4CG1A 1HNXB 9GPBA 4K6HA 1YFZA 1FU8A 1MD9A 2JVJA 3AFOA 3FGOA 4JGGA 3UAWA 1AQUA 1GSAA 4LXTA 4J49A 4EFDA 2YWCA 4BGDA 5HZMA 5I7AA 2ZXFA 2I1LA 4RCZA 1NW5A 4PHFA 4EG7A 1QHXA 2A88A 1H1LB 1QIIA 2CY0A 3QBDA 3HN7A 3HP7A 3GNQA 4HS9A 4M9QA 2Y1CA 1RYZA 2Z30A 5EJIA 1AZTA 4ZV4A 1Z4MA 3NZEA 3PQCA 4PYMA 3DWFA 3FCYA 4P8RA 3C2QA 3QXXA 1NN5A 5F5NA 4ZO6A 4AZ3B 1F6DA 3GJTA 3S2IA 1RHQA 2JH3A 4QFDA 3KYCA 1BDIA 1CYDA 3N70A 2IOFA 2RONA 3U9LA 4GF5A 4TYNA 4DC1A 4FI3F 4PC6A 3L1IA 2QE7A 2IC5A 1UFVA 3RBAA 3HBMA 2DPLA 1X1EA 1ZVKA 4LNUB 3PQ5A 4MICA 4Q4HA 1J2JA 2VATA 3FTDA 4Q1BA 2P2GA 3MLBA 4RMJA 3G68A 2AEMA 2VWPA 3A10A 3BC1A 1F51E 5BN5B 1G9SA 1PR6A 4B7ZA 4DCUA 2QVCA 3KR2A 3LL7A 1A1VA 1UWVA 1DINA 2C94A 3ER8A 5B55A 4AC9A 3LU1A 1XZAA 3IULA 4I3GA 5FI5A 1FP4A 1YWGO 4GLOA 5L3SB 4FOOA 1IXRC 2ZRFA 3EWIA 4BV9A 1OE0A 4EG3A 4EB8A 4F1JA 3TFOA 1X2BA 4NFLA 4H2DA 4ZOEA 4DQVA 4JELA 2AJTA 3UFXA 1D0SA 2CLLB 3ZU3A 1WMDA 3W5CA 1BIFA 1YU6A 3UJHA 1GWNA 2FFQA 3LQ2A 3GD5A 5DSXA 3TR0A 2H1IA 4DV0B 5E4TA 2PL3A 4YAEA 2O9JA 1TM3E 4Y0AA 1HFJA 1QH8B 2DUMA 1EVEA 3LBNA 2WLTA 2QP4A 4JV5B 2QHXA 1EDOA 4GR4A 2XTJA 4QELA 3TQTA 5AVVA 3QVGB 2IDKA 3NHMA 4R83A 5AKZA 4F5ZA 5CH5A 1BW9B 2E82A 5J5VA 4CGZA 2QXUA 1LDEA 5H0IA 3EPRA 2GJ9A 2L17A 3BH0A 2IWRA 2QTTA 3NHWA 5BSHA 1ZGHA 1KI4A 3JD0A 1PW5A 4G9GA 4US1R 2GD1O 2NO6A 2ZPUA 3I62A 3EFOA 3OJWA 1HYEA 3EMVA 1F38A 1Q7TA 1XZJA 3JALA 3AU8A 4P4NA 2X2FA 1W73A 3CINA 3KOYA 2AI2A 2B4KA 3ADDA 1UAYA 2WWRA 4C0KA 3H5WA 1YE5A 3ADOA 4CIWA 5K45A 4GLBA 6LDHA 1G3QA 3UJ3X 1YZVA 3B38A 3AXTA 3PK0A 2Q1WA 3QM1A 4J94A 3LOQA 4OHMA 1P6QA 5AFSA 1FMTA 2YJ4A 1OX5A 2D7CA 1WXXA 1HA3A 1HEYA 4BWFB 5JAZA 1UBJS 4QTXA 5FUBA 1RWKA 2X4LA 5BN4A 2EDCA 3L7OA 4CF6A 1F9AA 5C3MA 5EGNA 3OZIA 1NMQA 4UBKA 1Y8CA 1OZHA 2Q6LA 4MR8B 3S6JA 3BSSA 2RAPA 5B6JA 3LFHA 5LZ8A 2ID8A 1VG0B 2NZUG 4AP9A 2BZGA 4QHYA 1SKUA 3CO0S 5DNAA 5INTA 3LZCA 1DS6A 1OGJA 3GR6A 3C3MA 3VYTB 1O89A 3O4HA 2QYTA 3ZWNA 1P75A 4K86A 5TQ2A 3RIHA 5K6TA 3L82B 4N3NA 4YGYA 5AKYA 2MDTA 3UBTA 1KR2A 1WDLA 1XD2A 3CPJB 3ORFA 1ZQ9A 3I83A 1ESEA 4CN8A 2O8BB 2WDPA 4JEIA 5AJTA 3WAGA 4D02A 2XWJI 5HXAA 4QNRA 4JN6B 1GA1A 1JQ5A 1S1CA 2OAP1 1USUA 3M4YA 3OM0A 3D3KA 2DWCA 5A4FS 1J5PA 1XN4A 2C5LA 2M1XA 1CUSA 3OVMA 4KLRA 2JI8A 3LY5A 2NZXA 1YS2X 4XGIA 1GL3A 4GPZA 3T3DA 2P4QA 4D4GA 3LC1O 1JDPA 3GFSA 4BO4A 2XIJA 3KTOA 4MGEA 1KKMA 1JHOA 2GASA 2XPCA 3QVKA 2YUTA 3B6KA 3WQQA 4YYZA 1UXHA 4XM1A 5ARBA 1E1NA 2WT8A 3EEYA 1EK0A 1CUHA 1YTUA 4XYMA 2OXEA 3Q1LA 5CFRA 5J23A 3OQOA 3IILA 1G41A 1O54A 3QFSA 2JG3A 2PWZA 3AM3A 3U1TA 3SQLA 3PJRA 1OW3B 1G8SA 5KSOA 4MK4A 2ZM5A 1Q1EA 2LKCA 5JMOA 2NADA 4LCJA 1EGVB 3A2KA 2DRIA 4GPIB 1KAEA 1SBQA 3TQIA 1NUSA 1ZUWA 2V54A 4FQ7A 5IKEA 2PKCA 1XZDA 3L8FA 4YLGA 5AW9A 4F6LA 3O8CA 3FPJA 4QPPA 5ELMA 2PTHA 3VNUA 3TM4A 1DZ3A 4GQBA 3HXLA 4O25A 1P0CA 1WPQA 4ZYWA 2VK8A 3BF8A 5DF1A 3W7VA 4DJFC 1UPCA 2UVQA 2II6A 4WVFA 5EXEA 5GM2A 3GK3A 3OT1B 4L9WA 3RREA 1G4HA 4KXVA 4PWZA 4EHNA 3SDZA 4HT3B 2VZ0A 2IUFA 1DV1A 1AK2A 1WRBA 4O4LB 1N2HA 1QXSA 1Z73A 3QH4A 1L5MA 3M7IA 3L7KA 4FT4A 3ROTA 1QKJA 2BGIA 2J30A 2JIPA 3FBGA 4RV5A 2FH5B 2JARA 5CLGA 5EP2A 3W2EA 4B3RB 1J42A 5CVEA 1S9HA 3LSYA 2A0YA 4HXGA 1KSJA 4JAVC 2IU0A 3KBBA 2ZI6A 1DGQA 4RS4A 4CL0A 1HRDA 1YHZA 1TVEA 2L69A 2NPFA 3NPMA 3KBOA 3SJZA 3TW6A 3OMLA 4W6QA 2VDOB 1IBCA 5LQAA 2HRRA 5EIFA 5F7JA 2GPBA 2J0UB 1ANKA 8GPBA 4XIFA 3OTHA 3QTBA 2X0JA 3DTVA 1F0YA 1PL7A 1PS0A 2ERYA 4Y1RA 4DV5B 1U31A 2J08A 1RM5A 4YMHA 2WTUA 4FHFA 3HACA 3FN4A 3JATB 4OJQA 2JIRA 4ESEA 1DG9A 2AN4A 2FCRA 3O0DA 3F96A 4FYJA 4ZAVA 3WLRA 4EG0A 4LC1A 1XCBA 4Z6KA 3HRHA 1GNQA 1WW2A 4QL3A 3CNBA 1DQZA 4ZV7A 1R1DA 1AKWA 1EG2A 4PTYA 4ALLA 1ZA2A 1P7CA 1ZKDA 1P1HA 3DVLA 3FGZA 2VP6A 3H13A 4PWYA 3PTAA 4IO1A 3JWEA 1DQRA 1VRCA 3G5TA 2GT1A 3A4TA 1VPTA 4K05A 4YLYA 1WF6A 2ZJYA 3VOSA 5AVSA 5IJWA 5EC8A 4FR2A 2DKOA 1C7RA 4U02A 3W06A 3OEED 2WD8A 2AOUB 2A0UA 3EMKA 3NKLA 4GLFA 1KTVA 4FDTA 4F4HA 4AG3A 4Z2YA 3C6XA 4I1VA 1WXFA 3WGQA 1Q1ZA 1J9EA 3QNMA 2J3DA 3PNBA 3K9FC 4KPYA 1W4RA 2QU8A 2XNDD 1SC9A 3P2IA 4I1OA 4Z4EA 1U0FA 1LX6A 4QGGA 4BXOA 5HF6A 5TJHA 2JJ1D 1TZBA 3AINA 5ICCA 4DJ5X 1U63A 5TMBA 1Z2CA 4I99A 3ANYB 4YJ2A 1E1QA 2REBA 2WVHA 4LXHA 721PA 3GA7A 3BICA 1FW6A 2GZHA 5FF9A 2C4WA 3OLWA 2F9FA 2DOKA 1R4ZA 1X1TA 2BI7A 2FPPB 3H5IA 1PEDA 4EW2A 1OFTA 2WBLC 2GN9A 3RVBA 3QMVA 1UDCA 2PZEA 3ZKAA 3L7IA 5J63A 2CJWB 2I7DA 1BD3A 2FG7C 1E4OA 2VHZA 3BXXA 3L0BA 3GP8A 1HTTA 4E94A 3E5RA 3KXDA 4YCLA 1YR9A 4H77A 3UQZA 5EPUA 3RHFA 4B34A 2C2KA 1E9BA 4CJXA 2VRCA 1HZJA 3LX8A 5DRTA 3DFFA 1JKFA 5LMCA 4GHWA 4WX2B 4BBJA 1OCEA 1UKEA 3O8BA 2OYRA 1U8FO 3B3QA 5JEEA 2C9YA 3CLVA 1FRVA 4LHZA 1ISFA 2DULA 1NW8A 1QAOA 4OFZA 3AKCA 1CQXA 3A6FA 5FPYA 2OAQ1 4J07A 4YXFA 5ERGB 2GBGA 1FUIA 3EF3A 1MB0A 1HT2E 3KJGA 5ICFA 1RRKA 3GRFA 4N3GA 4C7MA 4DIFA 2UKDA 1Z7GA 1NBMD 2JHPA 1JFFB 3JQQA 4JI5B 1UEXC 2QUAA 1PR5A 1V47A 3RUAA 3B9QA 3I6BA 2KMLA 3NHZA 4DEXA 5ADHA 1B16A 4NSNA 5LYYA 1Y1PA 4BO5A 3DLIA 1XELA 1RI2A 1TYEB 3K92A 2JKYA 1U5BB 1O96B 1NA5A 2IHUA 2WPNA 3EAQA 4I46A 1QK3A 4TTAA 5ARDA 5AVOA 3TRJA 4C22A 1WMEA 4TXNA 3T54A 5D85A 4AZ0A 1JG3A 3B70A 5H16A 2ANCA 2Q5OA 1U04A 3VR6H 4DCJA 5JYEA 4YMWA 3MTEA 3OFND 4P5EA 2EZTA 3GP3A 3DFKA 5AR1A 3WWDA 4DT1B 2C2MA 3B60A 4I2VA 5C46F 5L40A 3BFXA 4R1LA 4XGKA 4DSUA 4CCYA 3AOEC 4K9QA 5C1BA 2JLZA 3ZDCA 1TJ5A 4CKYA 2W83A 2QZSA 4AX4A 2MINB 4H1WA 3RRNA 2L18A 1DEHA 3E22A 3KQSA 3WK9A 1TTPB 2VF7A 3P8ZA 1MX1A 4AP5A 3LLMA 1FNDA 1I0LA 1OD6A 3PQ2A 9LDBA 5KOJA 2G1AA 4Y2GA 3Q6IA 3W7BA 5KI6A 1T0PA 2P9CA 3H84A 2Q4TA 1LVGA 3LQ1A 4MW2A 1NY6A 4HZUB 5JU6A 1PK8A 5BMOA 1YL6A 3D31A 1RYMA 1DC4A 3ICQB 3VNVA 2JIQA 3EXHC 3I32A 3WSVA 5BSEA 2HJGA 1GUAA 1T8RA 2JCXA 3NHRA 4G9EA 3GLGA 1R0XA 1QV7A 2ZJ7A 2Z04A 4KAFA 1X0VA 3BFKA 2QTLA 1RBQA 1ZM7A 4K03A 2QX4A 2V6FA 4E88A 1THMA 5D8DA 4YRSA 5EAIA 3V1KA 4CMHA 5EFOA 2D2XA 1MA0A 1JJVA 1Q7GA 1Z0JA 2QG9A 4ZDIA 4EAQA 4CTJA 4MZXA 4MR9A 3M6XA 4GX1A 1AKQA 2IYYA 1D4AA 4DQUA 3FMOB 1NOKA 4YCNA 3NDIA 1N2JA 4JHLA 4BN0A 1N57A 2KWIA 4JL8A 3CMCO 4HQ6A 2CUTA 1VMAA 3G79A 4GI5A 2EFDB 5LR6A 1ZLYA 2C4UA 4EY5A 2OMEA 2XDQB 2A6PA 2Y1DA 3DE6X 4U5XA 5J5CA 4GOLD 3DNPA 5JSZB 2FEOA 5L8VA 1GNRA 1UOPA 2R6CA 3K1AB 4P86A 1AKNA 3WK4A 1HQCA 1IEQA 4HBGA 3AR4A 3KUUA 4EM6A 3RYCA 4L4ZA 4IJUA 3AVYA 5M29A 1X1RA 2GNPA 2QIOA 1WBBA 1E96A 4QUEA 3ROFA 4K9RA 2X1HA 4CF4A 2E21A 3AT1A 3DB2A 3F9RA 2IDZA 4MIEA 4U6SA 4RJJA 4MHOA 4ZEXA 5E9WA 4BE9A 1B76A 1CKEA 3G2QA 3B2QA 2GD0A 2ONCA 3TDKA 4RL4A 1E2KA 1R6TA 1L4BA 1W85B 1HMPA 2KPOA 3HDYA 3MJ4A 1ML3A 2YJZA 3VSAA 1Z39A 3OIDA 1N5RA 8ABPA 3VR0A 4R1MA 5DK6A 1IL0A 2FZ4A 2EIXA 3NT5A 3W05A 1XHFA 5ALWA 3HCAA 5A1TA 1JQBA 2ZJOA 1NQAO 3D7SA 3PX2A 3AEZA 1KMHA 2WIGA 2QRQA 1VCHA 5TVKA 1VRWA 1A9TA 4LV8B 3FYUC 1MJNA 3I52A 4K5QA 4UXIA 3RWMB 5J43A 4G65A 4ENWA 3I1IA 3M82A 3AFGA 4ZCMA 4ZT4A 3IAHA 3MAGA 2KYRA 3URMA 2CLMB 3UMGA 3PUWA 4OHUA 4MWCA 2C88A 1X86B 3OTGA 2CYCA 4RK7A 3M9XA 4DRXB 1LLUA 3LUBA 2QTAA 2VHYA 3O3NB 4DXDA 4LOJA 4KNWA 1NWCA 2P2SA 3CG0A 3H75A 5D7NA 4B40A 1WHTA 2VEOA 3GLIA 3EIEA 2PMWB 3ZI0A 3CEHA 1G7SA 3Q6MA 3EW9A 4Q4DA 1OILA 3D6NB 2PZJA 4P33A 1U0GA 1IMOA 1FLDA 1DU4A 1J07A 3DUFA 3GEPA 5AHRA 3LUCA 4UNIA 5FBQB 5TGZA 3WB1A 4BVEA 1EFCA 4IY1A 3WMFA 2WZDA 4J4HA 3KZOA 4LAFA 5KYNA 5BSKA 3AVXA 3A3NA 4PC2A 3ES9A 2OVFA 4MMZB 1B74A 1T5SA 3IUPA 4GPAA 3HA7A 4O4HF 1QRSA 1WA5A 3QKSA 1H6BA 3L9XA 4C4OA 5KX5B 1SCNE 2WM8A 1ZJJA 1CZNA 4BVGA 3I9JA 2IHJA 3EEBA 3QENA 1TK3A 1JHQA 1Y1QA 4O4IB 2EW1A 5TLSA 3R6LA 2MCFA 4C01A 4HWRA 1ZH4A 3BL6A 3BG5A 1Z29A 1D03A 3IAM1 3PDUA 1UBRS 2CE2X 1KAQA 4QOEA 5KYUB 1MMFB 4N3CA 1XU9A 5CA0F 2XMDA 3VSEA 3A4LA 4CKXA 1ACLA 4FIDA 4TVOA 2PXAA 4OPMA 2HRZA 1CHDA 4F1WA 3EVZA 3WYAA 4OHKA 3DHYA 1ZKMA 2V7UA 3RHTA 2ZRMA 3MTQA 5HZKA 3T5PA 4OP1A 1II9A 3H2KA 3CLKA 1QIHA 1WXDA 2FSFA 2VIIA 2ZUSA 5DXFA 4CTKA 1EXNA 4IZHA 1MPXA 1N2EA 3ZLJA 1HWYA 1C7EA 5C7LO 4ZVUA 3OAAD 4A23A 2B5OA 4KDFA 5CB4B 2XWSA 2XWBF 1YE8A 2VF4X 2P0EA 4NAHA 4PLGA 4TWRA 1AJEA 3KSZO 3ONFA 4M1OA 4MYCA 1G6KA 3UGQA 3VZDA 2DFPA 2Y0BA 2ZUUA 3F7OA 3H6GA 1NXQA 4NYIQ 1N2CB 2H1SA 1PVOA 3B7PA 1TEXA 3O93A 2SCUA 2JHCA 5AM2A 2JAUA 3ZI4A 2W71A 1YZTA 2QD2A 3TD2A 5LKRA 4XM2A 4UHKA 1EFHA 4IFEA 1K88A 4AS1A 5HHTA 1X8XA 3ZWAA 2ZIXB 4PR0A 1W0JD 3L6DA 3K9GA 1PSZA 4LJ4A 2PEZA 2UXCB 2PEYA 3NORA 4PZ0A 4KITB 4TSKA 1D04A 3AEYA 4E5MA 2VCYA 3FWYA 1I1HA 2O07A 1T3TA 3HB4X 4J29A 3Q2KA 4AVYA 3THYB 3UUEA 1DL5A 3HCNA 2OFFA 3OKAA 1U4NA 1W2HA 2LR0A 4F2GA 5CDFA 4BLVA 2QTMA 2XX3A 1KYYA 3PNSA 4N5LA 2OLKA 1EH5A 3CF6R 3HCFA 1XF9A 3HGTA 2H4ZA 3V4LA 3WNDA 5HKOA 1XV5A 4XYBA 1B6RA 4L6IA 1JSXA 4W1PA 5F5XA 1DG3A 5MN6A 1I4EB 2XWQA 1YI1A 1AM4D 1TD1A 1T2DA 1ULTA 5TQ0A 4FYIA 3GLHE 3UICA 1NKVA 4WKPA 3RVPA 4G5OA 2GJ4A 3QNWA 1SY7A 5IJXA 1Z0ZA 1ATZA 4IDGA 5LL6P 3G2NA 1JKJB 1PZNA 5DM2A 5U9CA 5DULA 5K03A 5ILOA 1PZMA 2D3TA 2I1VB 3GUUA 1CQIA 4PIVA 3QXJA 2P0YA 4RFVA 3FVQA 1J1ZA 3WBKA 3OJFA 4DMRA 5JLJA 3BH7A 4WN9A 5CH8A 2IBMA 5I7UA 2W42A 1VLHA 3O91A 3LP5A 4NL4H 4DV3B 5ALDA 1HX7A 1SXJA 2YHAA 1ORDA 4Q12A 2B4AA 3RFUA 4ZOLB 4KK4A 1P4SA 3CC8A 3BIWA 4TKMA 4AJ4A 1KK1A 4DG8A 9ABPA 5KYWB 4ZVVA 3RSGA 1BCSB 1J21A 4GZ6A 3CY6A 2Q2NA 3ZQ4A 5BUZA 1PJ4A 3IALA 2PS1A 2WLSA 1DTWB 3HI4A 3PITA 3HA5A 2GCEA 3OZUA 1M2HA 1SBYA 4YJGB 1VJ0A 1LVHA 2XVAA 3K15A 4MV9A 1B6SA 1TQ6A 1E2DA 2EFYA 5REQB 5KCZA 5LZ9A 2JZCA 2N47A 3WADA 1PR3A 4H7JA 2JGJA 5JBIA 4BAUA 4WIAA 4O6VA 5AK5A 1GAXA 3VH4A 3VZCA 3BRWA 1T0BA 2BMWA 4C2TA 1ZJ5A 2MJLA 4YHHB 5ANRB 1KVUA 3V9AA 3MERA 3WE7A 1IVYA 3D0QA 5J1SB 2WJGA 2OAGA 4LBZA 3QE3A 3DO5A 4LJAA 3UAOA 4EX6A 5FV4A 4FN4A 5AKGA 1F6WA 3K2BA 1NJSA 1WQ3A 1Y3IA 2OLJA 3FZEA 3DC2A 4KACA 4PXYA 3TIIA 5AD1A 3IEKA 5HS4A 1LX7A 2QY9A 4S1VA 1U0OC 3RYHA 2PQ0A 3FIUA 4KXQA 4KR2A 3K71B 4X1OA 2PLNA 3ZC3A 5CGZA 3P9CA 1F3LA 4P84A 3LECA 4CCSA 2R48A 1FMFA 2XADA 3T94A 3GFVA 4N49A 3BUSA 4KC0A 3DEHA 3RSQA 3GIWA 2A8YA 2PX2A 3L8MA 1E9FA 3BWVA 4OY3A 3HNRA 4BO0A 5JDCC 1FSFA 2AXNA 4C76A 3OZXA 1N25A 3T1OA 4QZVA 4TWIA 3QTTA 3LM8A 5MHTA 4R8KA 2QYHA 4L76A 4WKBA 3WY9A 4CIXA 1CVLA 2Q5EA 2EFEB 1BWRA 2V45A 3AOEA 4TTJA 4BIMA 2ATIA 4DY4A 1YR1A 1ZEJA 4LCBA 2QNIA 3ZNOA 1L7RA 5KVAA 1QGED 1QO0D 3TGWA 5B3LA 6NULA 2I6QA 1O6FA 4KGZA 1J8YF 3VHLB 4OUDB 5LM3A 5B30A 2ZJ5A 3PHIA 1JB1A 2PDAA 5I4IA 1BS1A 3ZIAA 1TMKA 1KZ9A 1LU9A 5BSUA 2YWFA 2JGIA 4R3NA 3T7EA 4JX9A 1WP9A 3GJ0A 4HHEA 2GA8A 2EWVA 2CJPA 1QYIA 1UR5A 4DMKA 1C0LA 1MDFA 5FL7A 3VSCA 1Q1AA 5EE3A 3KR1A 3GELA 1RM3A 3EXIA 5E4JA 3EXHA 1IVNA 3VC2A 3QWBA 2HBZA 1KBOA 1K6JA 1IHPA 5GPBA 5FDFA 1UMCA 4H16A 2ZVJA 2R6R1 3IVGA 3Q4GA 2VRNA 5ULLA 4CT4B 4Z8YA 2JCGA 1E98A 1QGUB 4GXTA 5E38A 3VV2A 4PC3A 3FXAA 1K68A 1Z4IA 1Z62A 4FM9A 4L4XA 1DARA 1WY7A 1P61B 2VPQA 2L82A 1T8UA 3T0FA 3T35A 1QHHA 5FB3A 2C9DA 4I9NA 1VXRA 4N5MA 5E6SA 5LBUA 1VE1A 2F3SA 4GAEA 3PIIA 3AL2A 2IW1A 3NDPA 4PRKA 2H2FA 2XQVA 2D2FA 4LZPA 3VM6A 4C05A 2H6EA 2YZNA 3UXYA 5CEJA 2V0GA 4J91A 2XUJA 1TGVA 1G1MA 2OZEA 4FWIB 2ON6A 4LTDA 3V7YA 3HMQA 2EQBA 3TIVA 2EX4A 4AF6A 521PA 3VVMA 3QELB 3SHWA 3JCZA 1QVWA 1JR3E 2VH5R 1GZ3A 2B69A 4JKYA 5ALRA 2XBUA 3SM9A 3NJ8A 4RESA 5KUTA 1AV6A 2G9QA 2C20A 2G7MC 1XE3A 3FCCA 3DL4A 3SF8A 1NSYA 2XT0A 4PG8A 2QP9X 1IY2A 3N58A 1K4MA 1XWIA 2K2WA 1K27A 2EOAA 4R0VA 5F4ZA 3NNNA 1KY5A 3DR5A 2UZIR 4BFSA 2WVGA 1YB2A 4KYVA 2ZZMA 3O3MB 5IVKA 1RWNA 4MVJG 1VI5A 5JQGA 1QVRA 1S2MA 3O7WA 4F04A 3ZGVA 4D0SA 5HX7A 5LOVB 4R9UC 1H9CA 5HRAA 2QMYA 2FGJA 4W5QA 1E2LA 3A37A 3BDIA 2P2ZA 4LFCB 4C0LA 3VTZA 3MUFA 2HREA 3W1EA 5EXXA 4O1MA 4DHEA 5JH7A 3R8XA 2LNDA 5KTYA 1BOFA 5C34B 1EA7A 1K5DA 1TVKA 2ZYGA 4A2CA 4A8TA 4C5CA 5B1SA 2FFAA 1YI8A 1E8DA 3L9WA 3H5RA 1Y9AA 3DDNA 4Q1FA 3H04A 2XQJA 5ARCA 5EVJA 5HMMA 5AI9A 1A1SA 1M8FA 3NV9A 3V1MA 4B71A 1TKBA 3UMJA 3FTNA 3FYUA 3ND8A 4GT1A 1GU7A 1JE1A 2VSQA 3KZCA 2QLMA 2OCAA 2BSXA 3FI0A 2Q6VA 2ZATA 3OOEA 1L4FA 1E0DA 1P60A 1W0KD 1FE8A 3GPDG 3D3WB 4HSGA 3W5HA 3OZFA 3IOBA 4AIIA 3IBGA 4F6RA 5BT8A 3IHKA 1OR8A 2ZI5A 4UUMA 3D7NA 9MHTA 2VDWA 4TS3A 3SD7A 4M9UA 3RTGA 1HMYA 4B2YA 2G8NA 4R2LA 4HUQB 1QYWA 4XI9A 3RU2A 4OHFA 3R6TA 3SC4A 1ZUNB 3SU8A 4DSNA 5AW3A 4MDFA 2NQTA 5I9SA 4ARIA 3IAEA 4EQZA 2YZGA 1S8OA 4X7RA 5E95A 1U11A 3NBXX 2WJ6A 2AEEA 4PZYA 1L5KA 3ZY2A 3D4OA 3ZW9A 2QSYA 3WGIA 3GLGE 1LF5A 4RXTA 4Z9YA 5IN4A 2I9KA 5B1HA 1E2HA 2VC2B 2ZJ6A 3M6LA 1V11B 1D07A 4FTWA 4HWSA 1UK6A 4QO7A 4U7PB 1USWA 4OI1A 3WQHA 1R0SA 1B93A 1P7VA 4BU1A 2PMKA 4WFIA 5DGIA 1DAEA 3UA4A 1YS9A 3KSRA 2W98A 4LRYA 3V7FA 1H85A 2P2CA 3MBKA 5KTOA 1RD4A 5CW2A 5T3YA 4IIJA 3ND6A 4RZSA 3OIUA 3PEVA 2KW5A 4F1KA 3MB5A 1JDNA 1BMFD 4DA9A 1QFJA 1EFVB 1JT2A 2FW8A 4L07A 5ESRA 1TUBB 2YXEA 3AETA 2WIFA 1EK6A 2C2BA 3DH0A 3DR3A 4TTTS 4HDAA 3VTAA 5JFGA 1AQYA 3AHHA 1J8QA 3WXMA 1Z8FA 1PX0A 3A0UA 4HCJA 3OZ7A 4P9NA 4EY4A 3N2NA 2OOKA 1DEOA 2ZQYA 2BMEA 4KYTA 3SR3A 2GMWA 4MA4A 3TZLA 4E12A 4OB6A 2PUEA 4C6TB 4NU0A 1QDEA 4M1QA 1SUWA 1QIEA 1S2IA 1TQDA 4P4SA 4TN5A 5DGCA 1IPEA 1LPNA 1H2ZA 2YXNA 3AY6A 4HWOA 5M34A 1Z26A 5F9HA 1A0OA 1T9ZA 2ENUA 5JD5A 1RWWA 1THTA 2E4YA 3DZHA 2VDPB 2ZYTX 2IZ0A 3SPXA 4DMLA 4G8BA 2VUUA 1EPUA 1HT3A 3CLRC 1SCQA 1Z17A 1VC2A 1N7HA 3EDMA 2C0PA 4Y1FA 1KSHA 1FU7A 2PIDA 3KYDB 5F52A 5BN3B 1ESZA 1TM5E 4J0GA 4OQZA 2XGJA 4MEJA 4B7CA 3G23A 1VPEA 4G85A 1USVA 5EQJB 4PPNA 1Z6TA 4FDMA 5B58C 1NV9A 1HDEA 5HILA 3PE6A 4Z4QA 2R2GA 1IBKB 2QM8A 1NVUQ 1T3HA 2AUTA 3L41A 2ONKA 2OGUA 3FGNA 2NYUA 3CEPB 3CCFA 1JXQA 1UZLA 2ZFUA 2XA9A 2EKZA 2R11A 4B0OA 4I55F 4DVJA 1I7SB 3GD7A 4F84A 2IEBA 1Q20A 1U3WA 1E4EB 4BV8A 1PD1A 2J9FB 1TB4A 2XUIA 5J4HA 2KBFA 2ZVDA 3PENA 4O4JB 4LW8A 3U4DA 3Q72A 2JLWA 1YS1X 3G2MA 5KOIA 1KKUA 2EXXA 3SS7X 3PQEA 1TA4A 3CX7A 3IHLA 4RACA 2EP8A 3G89A 3GWGA 1H94A 2QORA 2FMFA 1UDWA 2I1WA 2QMHA 3EH2A 1QYCA 4X65B 1T43A 1ZFNA 4B17A 4BO7A 3OJLA 1RDFA 5JSFA 3QE9Y 4HAIA 2WJAA 4OJMX 1E8MA 1R6VA 3S28A 4H6WA 1JSCA 4R8SA 2JF0A 1A98A 1XEXB 4RPKA 1YQ9A 2WG2A 1GJRA 3B1JA 4ROTA 3CKMA 2DECA 3IEVA 4DV6B 1WY5A 3RTDA 2WIAA 3UMYA 4PYQA 2DPXA 2X3YA 4X7MA 3D6FA 3IOEA 4HXYA 3HJHA 5TIIA 2ZWAA 4J0IA 4TL6A 4MH0R 4YRKA 2IA5A 1RQ7A 3K4QA 4FKBA 3U1VA 1U7HA 1P2VA 2CDRA 2VRWA 1R5BA 4HN4B 3ILHA 4NBKA 3RK4A 3RIEA 3IXQA 4W9NA 3QLVC 4LJSA 1HLGA 3NBAA 1DAFA 3BIJA 1DQYA 3VR5A 4ZKEA 3HL0A 2ONZA 3HFSA 3T7AA 3UVEA 4EGJA 3M5WA 2BE7A 2NG1A 3KPYA 4C7JA 1E9EA 1CR6A 2JFXA 3QE2A 2D6FA 3HO1A 4XUGB 2QN9A 2YXPX 2JGKA 1QHEA 1VHJA 5I5GA 4IILA 1URPA 4JLKA 4X7PA 2W93A 1UBHS 4UVGA 3DS8A 2FRDC 3FYCA 4HAZA 4PE5B 1H2BA 4ZAGA 5KS2A 4Z51A 5F12A 3ZYZA 4YP0A 1FY2A 1RYHA 1T2FA 4YIKA 4C1NA 1H66A 3EZ6A 3G5AA 4DB2A 3Q7QA 1Q14A 2EKQA 2HJSA 5IU6A 1KZGB 2XEXA 2FV8A 3VC7A 1JIVA 3L77A 3FYTA 4DHWA 2PSFA 5JJIA 1SU4A 3A2NA 5ITWA 1TIBA 1RAAA 3IRUA 3N3AC 2NUAA 3B5IA 1PV4A 2FMXA 2OILA 1S4MA 3U3XA 4RVOA 2R00C 3DDZX 3LY7A 3NTUA 1RABA 2V5VA 1FYFA 3OEHA 3OUUA 5H70A 3VR2D 4OQMA 2HBRA 5C8YF 1MC5A 5HUHA 5A0VA 2JBAA 3GEDA 4D8WA 1Q0LA 4DBVO 3WJAA 1J24A 1WCV1 3R7NA 4JI0B 2WT9A 3C6MA 3H0CA 4HATA 3KEFA 3WLMA 2H7CA 1GU0A 2VT3A 4QJ3A 4JI8B 3RRZA 3NIBA 4YBZA 5FR1A 5AHKA 3GPLA 2D06A 1KKLA 2DKFA 3NTLA 2EDAA 1TTTA 4G0UA 1NLMA 4FPXA 4FE7A 1HETA 5F9FA 4OKIA 1G66A 4NE9A 4DMFA 2ZRLA 2OK8A 3EUFA 3RTCA 1GRQA 1RAFA 2YBEA 5E3HA 4YV1A 1ZD5A 1M2KA 3RU9A 1O03A 4ZPJA 3HSKA 1AUXA 2W43A 4CLOA 2W2XA 4P1ZA 2B61A 2C2XA 1FVHA 1NVFA 4XOUA 5G1PA 4DIDA 2XTNA 4V0OA 3FY4A 4ZVLA 3UOWA 2R0QC 1RZRA 2P90A 1OU0A 4BJ6A 1LBQA 1WMAA 3ITEA 3FZGA 4LOLA 1F1BA 2BMVA 5B6PA 5DGTA 5DYNA 1G8JA 1OLSB 2IUEA 4QOFA 2HF7A 4NZZA 4YJHB 4CV3A 1UF9A 2X7XA 1X13A 2RBKA 3N2ZB 2Z6VA 4ZHSA 2OSVA 2XKBA 3T3PB 3PUYA 3KSUA 3F3YA 1DDOA 1WTAA 1CUGA 3BEDA 4J9VA 4CQLA 4BNMA 4DUGA 4RGYA 4BJ3A 2VSFA 1T9GR 4LJRA 3KQMA 2AN3A 3E70C 1ZN2A 2C9MA 3DF7A 5K3FA 3WWZA 2LP4Y 2VAPA 3GZJA 2EFHB 2XYQA 5JR3A 3FPHA 1QIGA 1TF5A 2JAHA 3DV0A 3TFQA 4DJTA 3FHTA 1XK7A 4NICA 3O2NA 3RQSA 4E70A 2GYUA 3CR8A 3N2IA 4P3YA 3ICWA 2N3ZA 2X19A 1U7OA 3BWEA 3D8HA 2JHFA 4WEOA 3OJCA 1ZESA 3B6ZA 1MZVA 1FDIA 1ZU4A 2IYVA 4Q9KA 4Y2XA 1VPLA 1S4QA 5FNVA 1COWD 3ONDA 3GT0A 2QB5A 3E15A 2CN1A 4MHTA 2RJ3A 1GRVA 2P6PA 4V0NA 1AMOA 4TMFA 5BT9A 1S2GA 3VAZA 4EABA 3HEBA 1AKMA 2JASA 2UVPB 3F9CA 4BX0A 2J0EA 1IK4A 5LMNB 1E3WA 1Q2XA 1VE9A 3Q3GE 1R5NA 2O8VA 3BD7A 4WZBB 1GTJ1 2BTEA 2OYSA 3ADPA 2WA1A 2Z08A 3QGMA 3K6RA 1ODLA 4LC9A 4TL9A 4YONB 5LP6C 3SZ3A 1AXGA 3OOJA 3L1VA 1O9BA 1E2JA 3Q87B 3S99A 3U7QB 4HDSB 2B6NA 1Z3IX 2XCRB 3ABIA 1CRWG 3ITDA 4D6XA 1OWOA 1UBGA 3OOHA 4XIIA 2O2SA 4LDZA 3WISA 3ZXIA 1T5DX 1QVAA 1ODTC 2J5BA 2PUVA 3ABQB 4EHLA 1ISRA 4YAKA 1TF2A 2NZYA 1MABB 1CQPA 3IPXA 1SVKA 3PL5A 3F90A 4UQPA 5BRJA 1BS9A 1ZL0A 2Q3DA 3PE4A 4ZVPA 4YPFA 1M1NA 2QMEA 1AE1A 5DEIA 3QOWA 4EVIA 2P5SA 4I4TA 1SZDA 3OPYI 3DHEA 4CM5A 1E58A 2JA2A 2ZJAA 1XZGA 1IXKA 4ZOCA 2E9SA 3W6NA 1FF9A 3W6OA 5C9ZA 4OREX 2OP1A 4H6XA 2IV2X 1J0AA 3IX7A 1RJEA 4LF8B 1Y4AE 4J6EA 5LFAA 1M34E 1WPGA 3OMWA 3SVLA 4W5NA 1GTZA 3E3NA 1MAAA 3GEBA 4KFUA 4OM7A 1R4NB 4XX0A 4EY3A 1GT6A 2VDUE 3AJEA 4TT8A 2PRYA 4XR9A 4Z0PA 5KTNA 2BC9A 1OWMA 4UNPA 5TF4A 3EGXB 1T3GA 1YRYE 1SWVA 4ND2A 3SYKA 5CGQB 3U17A 3NYQA 1HFEL 1HDZA 2A5LA 1NT2A 2AHRA 2GUGA 4RUKA 1LDBA 2BFDB 4L50A 3O26A 3LGXA 4EPWA 2M6LA 3I8SA 4DW8A 4G07A 1YAHA 4YAWA 1DEXA 4BLTA 4FD3A 1WDTA 4REQB 1PRYA 1YMQA 3G2PA 1YD7A 3H9CA 3DXFA 2BBSA 3O0TA 4M8IA 2EKDA 4XDHA 2POCA 1K9SA 3E81A 3B20A 3L7MA 3OCJA 4C0BA 1N3IA 4YAUA 1Z36A 5JECA 5TSDA 1A9QA 3JWJA 4K46A 3TZQA 3M33A 3HNPA 3AERA 3QX9A 3QFHA 4OIFA 3VZQA 3ANNA 3O2SB 4JBGA 2YINC 3BZBA 5GOTA 4B6FA 1N9GB 2JJ2A 4PINA 5EJ6A 3UJNA 3BIFA 3RT7A 1VE7A 4N01A 4YP5A 2R8PA 3FLMA 3IQGX 4E30A 4DC9A 3A28A 1UC5B 3V6LA 3MMNA 3RFXA 4JLNA 4TMTA 2HDWA 4U3JA 4XWYA 3AUJB 3MFYA 4HEQA 5A03A 2CFRA 1IM8A 2HIGA 4NCXA 5EGSA 1KTIA 1I6KA 4JDPA 3I2GA 3R6GA 2FPWA 4WNAA 3MG9A 1JRLA 5EIBD 2HU8A 3GQBA 2BBTA 3PRKE 5JSUA 3UJ7A 1OUMA 1XZCA 2RJOA 1HE5A 3IP7A 1N0UA 1V96A 2G5GX 3KOMA 1MO2A 1EJ2A 3PC2A 5EJ2A 4BE4A 2YL2A 1O94D 2ZYSA 1Q0TA 3HJUA 3TNFA 3ZZ1A 4N7JA 4JEUA 1H8HA 3S4YA 5CVJA 5J58A 1L5HB 5I48A 5J47A 4LF4B 1AURA 1L5WA 3TOCA 1ZMOA 4D44A 4A0HA 2ZWVA 3H87A 1RFGE 2JLCA 2QN3A 3A3OA 1VYTA 2P35A 4L9RA 4PYIA 4AIRA 2FN4A 2GETA 3AL0C 2OOSA 4FVTA 1FDSA 4YJFB 3EN0A