2YHIA

Trypanosoma brucei ptr1 in complex with inhibitor wh16
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
267
structure length
248
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE, PUTATIVE
publication title Exploiting the 2-Amino-1,3,4-thiadiazole Scaffold To Inhibit Trypanosoma brucei Pteridine Reductase in Support of Early-Stage Drug Discovery.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Oxidoreductase
total genus 90
structure length 248
sequence length 267
chains with identical sequence C
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2011-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2yhiA00
4Z6KA 2O3TA 3O26A 4QXMA 1SOWA 1UH5A 1NVGA 1UZMA 1YOVB 4C4OA 3QA9A 4Z9FA 2V6GA 1UUFA 2VHWA 3VZRA 2RBEA 4PG8A 1MFPA 3JQBC 1DC4A 1W8DA 4Z9YA 1T2FA 3PHGA 1LDNA 5I7EA 3PQFA 4LW8A 2VHVA 3AK4A 1Y1PA 4GSKA 4LRTB 2OBYA 4MJLA 4E5NA 2FP4A 1VI2A 1DJNA 3FTNA 4O0LA 2GF2A 3OJEA 4BVAA 4WLUA 3ZU2A 1B8UA 5JC8A 3QY9A 1E7SA 3PJEA 4I8XA 2QX7A 3WGOA 1E7QA 1LA2A 3WBBA 1X15A 2HU2A 3HFGA 2G76A 3D1LA 4WPGA 2YDXA 2DLDA 1DIHA 2CVQA 4Y8VA 1KVRA 1YQDA 4FS3A 2X9GA 3LT1A 2O2YA 4NFHA 1GUYA 3H65A 1YOVA 4K1LA 1ZXBA 4HX5A 4OQZA 3GMSA 3EVNA 3P5SA 3H2ZA 4IDAA 3GVPA 4YAIA 2X7HA 5THQA 1PS8A 1IY8A 3JQAA 5GZ6A 4DBVO 3W4KA 1XQ6A 2NVWA 3H5RA 1TI7A 1U8XX 2W8ZA 2I76A 1PQUA 5JDCA 5MDHA 2FSSA 4ND5A 3H3JA 1DC6A 3TZCA 4E5KA 2DKNA 4XYEA 4D0RA 3GDOA 2D0IA 2GN8A 3DQPA 4G81A 4BO8A 3GRPA 4EUEA 4ZICA 1HDXA 1MG0A 2VWQA 1CDOA 2VOJA 5HS6A 4BNJA 4DIFA 4LN1A 1E7RA 1H2HA 4O6VA 2JD2A 2OUIA 5C5IA 2P4HX 4R5MA 2VWPA 2HRBA 4WNCA 5IDYA 4NDNE 1I5RA 4FFNA 1XEAA 4XCVA 1J5PA 5U9CA 1AUPA 1B8VA 2P9CA 1WP4A 2YV2A 4YA6A 3HNPA 1IE3A 5JAIA 1VE9A 4BB6A 3HWRA 4ZRNA 1QSGA 4GL4A 1JA9A 3JCZA 5KJ1A 1GV0A 2JFHA 1ARZA 3VZPA 4BNLA 2HSDA 1Q2XA 4Q3AA 2PKQP 5LDHA 3D5TA 4D41A 5FEUA 1GR0A 2YV3A 3LLSA 4B7UA 1T2DA 3ONFA 1NR7A 2BFAA 3A1NA 1G1AA 3ZHYA 3AOEA 1H9AA 1LSOA 3BHIA 5KIAA 1YBVA 4EZBA 4RLHA 2QZZA 1GYQA 2NU7A 2ZTVA 4XEHA 4GH5A 2X23A 1E0DA 3H5NA 5HTOA 3NUGA 5L3ZA 2O7SA 2XXJA 4PGFA 2Y68A 5JPIA 4L74A 4WCFC 2NU6A 4I9NA 5I9LA 4CQMD 5IDXA 3RUDA 2ZIZA 4F3YA 1D3AA 2ZCVA 5EMHA 3KTDA 4CPDA 2ZQZA 2B37A 3A28A 3LK7A 2OXIA 1IYZA 2DU8A 3DFUA 3AOEC 1E3EA 2VHYA 2WSBA 5JY6A 4XDYA 1W6UA 2CD9A 1VJTA 3E5RA 3TNLA 3GOHA 1QRRA 1JAYA 4L9RA 2ZYAA 1SPXA 1ZSYA 4IXTA 3RD5A 5TS3A 3DBLB 4GMGA 1PGJA 2UUOA 1L7DA 2EP5A 3COSA 4OXNA 5TT0A 1NNUA 3DXFA 1FDWA 1BXZA 4A73A 1A4IA 3DAFA 4OH1A 4BUCA 5BR7A 5JY1A 1DPGA 2X5JO 4MVJD 3IDSA 1PZHA 4QO7A 3UHAA 1VC2A 1EUDA 4WEQA 4W9NA 4DTIA 3TFOA 3DZIA 1NM5A 1P1IA 1SBYA 4I5EA 4JLWA 5TNXA 2C59A 4N5NA 1K89A 2YDYA 4ND3A 1YB1A 4AJJA 2ZJ0A 1GZ6A 5EPOA 4QTZA 1JLLA 2UV8A 4M1QA 3UF0A 4HP8A 2V6BA 3GG9A 3R0IA 3DBLA 1YL6A 3GG2A 4YRAA 2O23A 1AXGA 1W0CA 2BRUA 2PD6A 4YEDA 4UUNA 2YFHA 1FXSA 1XU7A 1T2CA 4O5OA 1GZ3A 5A3VA 4FCCA 4XZ3A 4XDZA 2FHSA 5FFFA 4IDCA 5A05A 2HLPA 3WWYA 3SBOA 3DBRB 4HXYA 1M76A 2D59A 2P9GA 1UXJA 1GADO 2JHGA 1K5HA 1YBMA 3ZNOA 3H9UA 1NQOA 1QYWA 3OQ1A 4RPKA 2VYNA 4UVDA 1YQXA 2DUUA 4TWRA 1RM3A 4RPJA 5DBIA 1BMDA 3DBHB 4CM8B 3GH3A 4D45A 1P1KA 2IYOA 4J1TA 4YDRA 3E8XA 2FOIA 1PEDA 1U8FO 3LU1A 5KVSA 3WGQA 4EW6A 5AVOA 3ENKA 3FWZA 3LVFO 1C3VA 3Q2IA 4CMBA 4WNIA 4CL8A 3TSCA 2RH8A 1Q1NA 4HFMA 4Y6RA 3DBRA 2Y66A 3WBFA 3L9XA 1DXYA 4AFNA 1GZ4A 1M6WA 3JQ6A 3OQBA 4J6FA 1ZJYA 1N1GA 1PJBA 4F6CA 3WNQA 1GDHA 3GN2A 4QFCA 4WOJA 4BKQA 3O03A 1DRUA 3SJUA 4L8VA 1N7GA 2C5EA 3DBHA 4MDHA 4QUKA 3C85A 4CM5A 4CM8A 3I9MA 4A5OA 3JYQA 5L51A 3LT4A 5JSFA 4XJSA 1U5CA 4DL9A 3S8MA 2DC1A 3FBTA 3PZRA 1ZIDA 2E37A 2A94A 5CPFA 3DHEA 5B4UA 4LMPA 2B69A 4NBTA 1ZXLA 4FPXA 4YPOA 2UDPA 1YS4A 1OC2A 1JVSA 1VJ0A 2C0CA 5LCXA 2VZ8A 3DZGA 3LF2A 4FSHA 3ZV5A 2YFQA 1EE2A 2ILTA 5IN5A 3W8FA 1NFQA 4FD3A 1M6HA 1F06A 1R16A 5FYDA 3C3XA 3PDUA 3WQRA 5BSHA 4BNHA 4D7AA 3U09A 1XELA 1W73A 2YQ5A 3UCEA 1BRMA 4GMFA 4KWIA 3SLKA 3OQ6A 3HJAA 2R00A 4JBGA 4AJ1A 4DMMA 2CUKA 4CMCA 1UXHA 2W2LA 4XX0A 4BNWA 3DC2A 1U7TA 2XPCA 2B5VA 4O63O 4DVJA 1OZAA 4FQ8A 2XF8A 3G49A 1VL0A 2DTXA 3RC2A 3WLEA 3AWDA 4OJNA 1E5QA 4IMPA 4ZN6A 4XB2A 3FHLA 1L7EA 4BQRA 1RJWA 5TT1A 1GAEO 1WPQA 3C7DB 3PWSA 4DPMA 4E12A 3CTMA 3DONA 3I9JA 1FDUA 1GUFA 1CIVA 4XRGA 4HFJA 3WICA 1UXKA 1B16A 5L40A 3MEQA 4DGSA 2B0JA 3RFVA 1WZEA 3PFWO 1F8FA 4CV3A 1R12A 2R00C 3GMDA 3MWDB 2DAPA 2FR0A 3NGXA 1HE5A 3JQDA 3AFMA 4YJHB 1A27A 1A7KA 1T1SA 2EV9A 4J0EA 1DIAA 2AG8A 1BXGB 5KJCA 4CUZA 2AW5A 2F1KA 3H9QA 4B4UA 1DRVA 1HL3A 2E6UX 4BKPA 2EIHA 1IHXA 4NI5A 3FPLA 4PZEA 5JCXA 5JMPA 2VHZA 1TEHA 1UJMA 4QEDA 3FNEA 3SC4A 4YTEA 1IZ0A 3MOIA 4LSMA 4CM9A 3BTSA 3KUXA 3OJLA 3DDNA 3ZGYA 1SC6A 4ROSA 5K9ZA 2IDZA 2QRLA 1BGVA 1U28A 4IIVA 2GR9A 5DOZA 3N7UA 1A4UA 1X7GA 3GT0A 4RVHA 3AUAA 2HJSA 3AW9A 3LC7O 1UR5A 4QT0A 1KS9A 4GLLA 5I9MA 1B3BA 1PJQA 2ZB8A 3E18A 2TMDA 3EHEA 2GN4A 3RUHA 4CUKA 4YJHA 4X54A 3WGHA 4AJKA 3DZFA 1U3UA 1BXGA 2ZB3A 3INTA 4UUPA 2XAAA 1XGKA 1YL7A 5KTKA 1H0KA 5L7YA 1O89A 2GERA 4AJPA 3WFJA 4RVUA 2I3AA 5AXAA 5FI5A 1UP4A 4YRDA 1EBFA 3IS3A 1KYQA 1ZK4A 4PLTA 3S55A 1EFKA 1Q7BA 4J4BA 5CPBA 2AQ8A 1WW8A 4PCVA 3UH1A 1SEPA 1DEHA 2VYVA 2RHRA 1NTOA 3KV3O 2AEFA 1EVJA 2DBZA 3B70A 1DBVO 3KB6A 5JAZA 5JXWA 5A3JA 2O3QA 3PGXA 3ITDA 4W7HA 5CDUA 4D3DA 2J3KA 2QRKA 3Q11A 4BMVA 3CIFA 4F46A 3PFFA 1XU9A 2J8ZA 4WOKA 3AOGA 2EJVA 2IEDA 4GVXA 1MFZA 4BO9A 4K6FA 1Y9AA 4IJVA 3KHUA 1UXIA 3OH8A 3VH4A 4E2YA 1BG6A 1DLJA 3RUAA 3SC6A 4E13A 2CMDA 3ZWXA 2GLXA 3KBOA 3FSRA 4G2NA 3IQDB 5KJFA 2BELA 3VH1A 3NT5A 2WD7B 2Q1SA 3RI3A 3UW3A 4HY3A 4CV0A 3WOHA 4U6QA 4AJNA 4WKGA 3CXRA 4UEKA 1VL6A 3K73O 5C7IO 3KOUA 4NJOA 3FR8A 1MUUA 1HRDA 3JQ7B 4J7CA 3I23A 3ONDA 4GI2A 4YQZA 3UVEA 5I8WA 3F3SA 4FB5A 5G0TA 3NGLA 2GO1A 3K92A 2O3UA 3HN2A 5ENDA 4R69A 5THKA 4ZHSA 4ZJUA 5CFZA 4URFA 4EEZA 4HFNA 1LSSA 2WE7A 4CLRB 3ZCXA 1ZSNA 4WLOA 4JN6B 1XG5A 1YGYA 3INGA 3WYEA 3NTRA 2AQKA 3FNFA 3M2PA 3STHA 1JWBB 3ZV3A 3TOXA 3G1UA 1DRWA 4XR9A 4Z0HO 4CLOB 1C0PA 1X13A 1QV6A 5L53A 1ML3A 3H5AA 1BXKA 1B2LA 2DTEA 4TVBA 4YQYA 1UZLA 1OMOA 3TZHA 1TA4A 4E21A 1BVUA 3RBZA 5A04A 1YB5A 3L07A 5TJ9A 3ETDA 4NR0A 4BGVA 1EZ4A 8LDHA 1E1LA 3RROA 3WSWA 3HADA 1JQBA 1I2CA 4B79A 4CMAA 2B5WA 1HT0A 3OETA 3GDFA 5TLSA 5JYDA 4J16A 1KBZA 4DC1A 1PWZA 1CQJA 1H6AA 4GX0A 2Z1MA 4NU5A 1EFLA 4QECA 1GCUA 3BXXA 1XWFA 3CE6A 3MTJA 4J1NA 1R66A 3HDYA 3JQCA 4U8GA 4JBHA 4MVJE 1NVMB 4CLOA 3U5TA 2VRBA 4RZHA 4W99A 4YACA 1PJ3A 2Q1TA 3KSZO 4IZHA 4NBWA 1RM0A 3OSUA 1RKXA 3NT2A 1DFHA 1MGOA 2UVDA 2AQIA 2WYVA 3V2HA 3SVTA 4BNXA 4WLVA 2OORA 3A4VA 1I2ZA 4M49A 5IZCA 3LF1A 4XWYA 3QP9A 1AXEA 3ABIA 3VTFA 3PI7A 1IUKA 1LEHA 4RPHA 4BO6A 1KERA 2O7QA 1PGOA 5BT9A 3D3WB 1N7HA 5U1PA 5KKCA 3UAGA 4ALNA 1K2WA 4TRNA 3PQDA 4ZQBA 4J2HA 5AXCA 2CDBA 1UDBA 1J6UA 1W4ZA 1ZCJA 2GPTA 2VTEA 3JQGB 3K2BA 5JLAA 2UUPA 3QVTA 1YKFA 4ESOA 1NR1A 5K6AC 2NSDA 1MXHA 3HZZA 2X5KO 3IAHA 4J7UA 1ID1A 2AEMA 5T8KA 1BDBA 4RORA 4WLNA 4WE3A 3JYNA 1TXGA 2JCXA 2EKQA 4MINA 4KUHA 5G0VA 3BMQB 3L6OO 1XLTA 4R4JA 3ZWNA 4BKUA 4K6CA 4BB5A 2I99A 1YE3A 3D3WA 1E92A 2WYUA 5DT9A 2ZTUA 3QVXA 4FFMA 3AUUA 2OZPA 2X6TA 3RU7A 5L4NA 1NPYA 5BQFA 1YO6A 4XYBA 2HKIA 3JQGA 4KZPA 4EITA 1OBFO 1T26A 4YAEA 3ROQA 1F0YA 2DPGA 4GAEA 5DP1A 4Z3DA 4LK3A 4GKBA 3WIDA 3EUWA 5KKAA 1HKUA 4UVHA 1PQWA 1OFGA 3PIDA 4I5GA 3Q1LA 1S6YA 4YAJA 2HK8A 1R15A 5IXSA 1E6UA 3RAJA 3RKUA 4AJ2A 2CVOA 5IJZA 3WYCA 3BMQA 1O6ZA 3ORFA 3D5QA 1VKOA 2HMUA 1VRWA 1CETA 1HDOA 3JD1A 2AHRA 3OEWA 3NRCA 4AJOA 4IJUA 4B7CA 4IGEA 1T4BA 2OMEA 5DDIP 2CFCA 3JQBA 1A72A 3FTPA 1MA0A 1X1TA 3ZWAA 2IYPA 1UXGA 3TWOA 4RPGA 2Q45A 3M1AA 4ND2A 3WLFA 1Q7GA 3EYWA 1G6KA 1T1RA 2CF6A 3GAZA 5I7VA 4BNVA 2F00A 4AL4A 1E3IA 3OFSA 3CPSA 5H82A 3TZQA 2W2KB 3I4FA 1LQTA 4ND1A 4JXKA 1IPFA 2O3RA 2VTDA 1N2SA 2RCYA 3BMOA 2V6MA 1I33A 3EMKA 3TDKA 1VM6A 3JQAB 5ITVA 4C7KA 2PGLA 2RH4A 4TRRA 4LGVA 4R41A 2X5OA 2PD3A 3DOJA 1E3SA 4WK6A 2OP1A 1ULUA 3W4JA 2YJZA 3ZWVA 4DMLA 1V3TA 3HB4X 3ZHXA 2IXBA 1K6JA 3U4HA 2C2XA 2GGSA 3E5MA 3WDSA 5U4QA 4CQLB 2C20A 1SEVA 3MJ4A 4L4SA 2BKAA 4KQXA 1NASA 1QXSA 3NKLA 1NQ5A 5EQFA 2FSVA 4I9UA 4PZDA 1ISJA 5KJ6A 5KNLA 3L4BA 1VSUA 2NTNA 5DCWA 2VWGA 3OIDA 5TRTA 3WNVA 2X58A 2C5AA 4EJ6A 2W2KA 4B4WA 2Q4BA 3UGKA 4AJEA 3F47A 1B3RA 1JKJA 3L6EA 5A5EA 2Q2VA 4CMJA 5JBIA 4I08A 4FJ0A 4FGWA 3HB5X 3Q3CA 4KDFA 4CM6A 3MJCA 1T25A 3HSKA 4DREA 4IJWA 2PA3A 2X1HA 2DBVO 4CLDA 2NADA 3LC1O 4FC6A 3WIEA 3I6QA 4EUHA 3LT2A 3OIGA 4B3JA 1DLIA 3CZRA 1OC4A 1D1SA 1YRLA 2OGUA 3ITKA 3V8BA 2JCYA 3EK2A 1UP6A 4WCFB 5K0ZA 4R3NA 3AU8A 3L4BC 4CQLA 2IZ0A 3RFTA 5TX7A 4BKOA 2GZ3A 1HDZA 1FJHA 2PR2A 3EDMA 3JQFC 5JAMA 1ZW1A 2FWMX 3P7MA 1KVUA 3PPIA 1M66A 4RGBA 5C37A 2PWZA 1P77A 2AXQA 4N5LA 2RIRA 2PZMA 1PJ4A 1P1RA 4BNZA 4PLCA 3BTUA 5HWSA 4KMSA 4RVDA 5IDWA 3E9MA 3TF5A 4E2XA 2NLOA 4DXHA 3G1TA 5B4TA 4R9SA 1U2DA 1QR6A 4WGGA 4A03A 4WCFA 3TZ6A 1GFSA 4ID9A 4EJMA 3FRJA 4M89A 5FI3A 1HDRA 3GQVA 3VDQA 3DHNA 3EY4A 3ON5A 1DIRA 5KVCA 3EGOA 3MJTA 3N74A 2EHDA 4YJFB 4EI2A 2IZ1A 3E6AA 3GF4A 1PJTA 3SEFA 1CJCA 2JAPA 4E5MA 1KEUA 2EG9A 5JFOA 4XGIA 4NK4A 2Q46A 4UVIA 2DT5A 2W98A 4QX6A 3K96A 2GASA 4RDIA 5ITWA 3QRWA 3V2UA 4IDFA 4XYGA 3ULKA 4K28A 2E4AA 1WWKA 2CZCA 4I1IA 4JIGA 1QLJA 4DLLA 2AE2A 4XRRA 2D5AA 4DLBA 2GNAA 5F5LA 1R4NB 2ZQYA 3D3EA 4IINA 4R3WA 3S2IA 2AEJA 4NIMA 1EMDA 4HFRA 4EBFA 5JO0A 4R01A 4ALLA 4G5HA 2I3GA 4CM1A 5T5QA 1KC1A 1RPNA 4YT8A 1KOLA 4KUEA 3CZMA 1NPTO 4YJFA 4YT5A 5A02A 2X8LA 3JYLA 1PR3A 2GZ1A 1PSDA 3BA1A 1JN0A 3QLJA 1O94A 2WMDA 5JE8A 2PH5A 4D0SA 1P0CA 2BHLA 1CEQA 1JTVA 3ANNA 4GX1A 2B4RO 4PRKA 3MJSA 2GRAA 2Y1CA 3U0BA 1A9ZA 1ISGA 3PVZA 1Z45A 4P38A 3GN1A 3HDQA 2VHXA 2PZKA 1H94A 1NXQA 1R4NA 2PK3A 2VYVD 1MG5A 1EE9A 2VNAA 1VL8A 5AXBA 1M2WA 2VUTA 5JDIC 2ZCUA 3E1KA 4GSLA 4MIOA 4PFJA 1P1JA 3DL2A 3UUWA 4JROA 3D4PA 4RV9A 1EUCA 3H4VA 2FPIA 4RVGA 4OAQA 5GY7A 4BL5A 4ZU3A 2OOSA 1GY8A 1TT7A 2OP0A 3H9EO 1ADCA 1ISMA 1R0SA 3ZV4A 1DIGA 3H3FA 1Y6JA 3HDJA 4D46A 2G17A 1NVTA 2EW2A 3DMTC 4YBZA 4RJTA 3V5NA 4E2ZA 3CMMA 5TQVA 5J23A 1AHHA 3WJAA 4KUGA 1O9BA 3PRJA 3C1AA 2PZJA 1O0SA 4NFYA 5B37A 4WLFA 3ZDFA 4O1MA 1ORRA 4BNKA 3KXDA 4M87A 2Y1GA 1ZKMA 2DFDA 2EGHA 4BNTA 3KEOA 4PZCA 4OHUA 1FF9A 3PJFA 3GVCA 3QWAA 4YT2A 3ANMA 3FPCA 4J1QA 3W6UA 5BNIA 1ISFA 1NYTA 3CSDA 3BYZA 2O4CA 5AOVA 2Y67A 3QE3A 1VSVA 4RVFA 1NAHA 2BGLA 4RO0A 5I7FA 1U3TA 3PQEA 3WGZA 2HQ1A 3KETA 3CH6A 1ZK3A 1LDYA 3GFGA 2BGKA 5IF3A 3FNHA 3VPHA 4DBZA 4QFDA 4JK3A 4L4XA 3I9NA 5JO9A 3VDRA 2IEBA 3F1LA 4E4YA 1NHGA 2J3HA 4TRMA 1T2AA 2W4QA 5IXYA 5KOIA 2NU9A 4AVYA 4R54A 4Q3CA 4FR5A 4RCVA 4J49A 3E82A 5H81A 1WXDA 2CDAA 3IJRA 3IUPA 4FW8A 3OEYA 2VQ3A 2ZYGA 2XXBA 3ZZNA 2ZK7A 4ZQHA 1ZZEA 2YHUA 4DIBA 3KZVA 4I9HA 3TL2A 1Q0QA 3AUTA 3KO8A 4JNKA 4IDGA 4Z9XA 1DO8A 2DQ4A 4JBIA 1E3JA 4UAGA 4ALJA 4JQCA 3RQSA 4WEOA 1IL0A 3K8ZA 1ZJZA 2G5CA 2AQHA 1VJ1A 4YR9A 1HYHA 1Y8RA 2QQ5A 3LC2O 3MTGA 2X0IA 4K26A 4Y67A 2W90A 5H83A 4D44A 1RYDA 4I5DA 4N54A 3OJ0A 5ADHA 4PLFA 1BVRA 3NJ8A 4D43A 1LRJA 2FZWA 1DB3A 4G65A 2BFPA 4BO2A 1HDGO 4IPTA 1ENZA 3AU9A 4ZQFA 3CKYA 3RC9A 4FN4A 5A03A 1X1EA 1WAMA 2AE1A 3HN7A 5JW6A 2V65A 2EKLA 1H6DA 3FF4A 3WXBA 3LYLA 2NVBA 5TC4A 1LLDA 3K2EA 4KTVE 4YYZA 2ZKLA 1LDEA 3TJRA 5MGBA 3QVSA 3JQ8B 2R2GA 3QWIA 5CEJA 3W4IA 1EVYA 5IG2A 1I3LA 5FF9A 4ZVVA 1ZMTA 2NM0A 9LDTA 1I24A 4GPD1 1R6DA 3PTZA 4JJFA 2JD1A 4R1NA 3L9WA 4LISA 1NBOA 1UAGA 2VNSA 2FPGA 1NPDA 1NQTA 2NQTA 3DZKA 3HUDA 3S1LA 4B8ZA 4CV1A 4E2WA 5B12A 4H3VA 1A9YA 3E9NA 3PHLA 4CR6A 2WE8A 5T64A 3ZNPA 1R0KA 3T7CA 3C1TA 1Z73A 5CDGA 3EAGA 2HRZA 4N7RA 4UEOA 3VVCA 3JQ8A 3EZYA 2I65A 1GCOA 1QYVA 3GHHA 5ER6A 5A06A 3AM4A 3DTYA 4BMSA 4ILKA 1H9BA 1ONNA 4YB8A 3QWFA 2G0TA 4MVJI 1DSSG 4GKVA 3E9QA 4Z0TA 3Q0EA 3WGYA 3TQHA 3GA0A 3P19A 3PHHA 3JD0A 4FFPA 4DPLA 2WTBA 2CNBA 2DFVA 1H2BA 1SCUA 5CG2A 3JD4A 4B4OA 2YW9A 1I3MA 4K9DA 2DBQA 4XD2A 1V3VA 2O4UX 2D8AA 3RCBA 3NT4A 3F46A 5JYEA 4GLOA 2D2IA 1HLDA 4DWVA 1XDWA 1GL3A 5C7LO 3AY6A 2NQ8A 2H5LA 2BD0A 3PYMA 4RL6A 1HDYA 3WG9A 4CLXA 2J3JA 1U4SA 3FR7A 3ICCA 5F21A 3W6ZA 4E32A 2EERA 2VZ0A 3IIEA 2DM6A 2JFGA 2DPHA 3BMNB 3JQ9C 2IRWA 1MP0A 3I9OA 3WMWA 1BSVA 4IZIA 4D79A 4NNJA 3ZU5A 1FDVA 1K6XA 2WJPA 4DLAA 5KCZA 2QG4A 4NBVA 1IB6A 4RDHA 1P3DA 2O3SA 3H7AA 3K5PA 4BGUA 2O3JA 2VUSA 3JYPA 3JV7A 4MIEA 5A5FA 1ZSVA 4E31A 9LDBA 3AUSA 4FBGA 2GUGA 2HCTA 3RFXA 4FGSA 2VWHA 3LQFA 4R9RA 2V6FA 1K3TA 2CF5A 5EINA 1V8BA 1ZNQO 2EWMA 4DA9A 5DZSA 2GSDA 1DHTA 2Z1NA 4PIVA 3RC1A 5EJ2A 2PGJA 3I9LA 5EERA 3BMNA 5T6BA 4B3IA 1X0VA 5COBA 3VC7A 4D3SA 2J6IA 2Y1EA 4H7PA 2JAHA 4NZ9A 4UEJA 4XIYA 2O50A 1WZIA 3IP3A 5BNFA 4F6LA 1B15A 4OOFA 1B8PA 3JQAD 5L45A 1O95A 1DAOA 4H16A 4J90A 4OOEA 3IOYA 1SAYA 4XA8A 1I3KA 4HV4A 3WS7A 4Q3NA 3TOZA 3ANLA 1JKFA 3RUEA 2CVZA 1YDWA 2EGGA 4P4LA 3WYBA 2Q99A 3CINA 4ITUA 4FDAA 2OBNA 3NTOA 4BO1A 4OQYA 2FRDA 3A06A 3DHYA 4MIYA 4CM4B 5JAQA 1GUZA 3C1OA 2OO5A 2X9NA 4A0SA 4B8WA 4EDFA 6ADHA 3MJVA 3GNTA 3AI3A 5DF1A 2PV7A 3S2GA 1HSZA 3IJPA 1LLUA 1CF2O 4DUPA 3B20A 4IQ8A 1PIWA 1XHLA 4RF2A 4RF4A 5CEEA 3PGJA 2J5KA 3TN7A 3OJOA 1TVEA 3PJDA 4GGPA 4PLPA 4M54A 4PLVA 4O59O 4IDEA 3DEYX 1QP8A 4BO0A 2I66A 4BOYA 5FWNA 4MP3A 4KDEA 3ZHZA 3UN1A 3HDHA 3ZN2A 3OA2A 1QYDA 4NH4A 3K6JA 1NHWA 1AGNA 5K6AA 4INAA 3PDJA 4HUJA 3RU9A 1NFRA 3PLRA 4CM4A 5L95A 1PGPA 3OHSX 3VZSA 4W6ZA 3OBBA 2ZTMA 3ADPA 4FOOA 3QQPA 4XGNA 5F5NA 2VRCA 1PJ2A 3VKUA 2EXXA 3RASA 1Z6ZA 4HADA 3RUCA 2DVMA 4BO7A 5LDGA 4PG6A 3DO5A 3ZU4A 3ZWYA 3ZWWA 3GNSA 2PKQO 4J1SA 3OA0A 5COAA 1ISHA 1Y9EA 3AM5A 3U4CA 3PHIA 5B4VA 4BS9A 1E77A 2LDBA 1EK6A 3D4OA 3MCVA 1X7DA 1Z74A 3AM3A 3QSGA 3ROPA 2AA3A 1D8AA 4EUFA 5KVVA 4CV2A 2B35A 4Y98A 3OECA 3QW2A 1IZ9A 3ZHBA 4OXKA 3TZKA 4M8SA 1KC3A 2FR1A 2EF1A 3WTCA 3VH2A 1E6EA 4IMRA 1HXHA 2FPPA 1K0UA 2O48X 4M55A 3PYLA 1DHRA 1LDGA 1OI7A 2GN9A 4BKRA 3GNQA 3DOOA 4UULA 2P4QA 1WNTA 1MLDA 1MV8A 4CMEC 4W7IA 1C1DB 5CEFA 4P22A 4Z3KA 4CM7A 2HMSA 1P1HA 2ZB7A 5LC1A 3DZHA 4FC7A 5TGDA 3JTMA 4DRYA 1DAPA 1QLHA 3WGIA 1V9LA 1GEGA 2CY0A 3EW7A 1H6BA 1UDAA 3F6YA 5T67A 5G4LA 2J3IA 5JCJA 3V1YA 3BTVA 3PWKA 1C14A 4ZD6A 5L4SA 4YWJA 3GVXA 2JJYA 4LSWA 2WD8A 3WR5A 1EBUA 1GU7A 3GUYA 3BMOB 3NEPX 3GDGA 1YH3A 3OJFA 4YRBA 1NFFA 3U9LA 3PWZA 2Q2WA 1MXFA 1XA0A 1P31A 2QYTA 2C29D 3IUSA 3PHJA 4GX5A 4A2CA 1LX6A 3ZW9A 1IHYA 4BNMA 2VOEA 4L0QA 4MOWA 5F1PA 3DMYA 3DAGA 1EQ2A 3DFZA 3GRKA 4NU6A 4U7WA 2H9IA 2PGDA 1C1DA 3P2YA 4D42A 2E48A 3V2GA 1S7CA 3VPXA 1YONA 1YWGO 4BO5A 3GPIA 3GUCA 3T4EA 1MC4A 3VZQA 3UFXA 1I2BA 1CYDA 3BMCB 5ICSA 2VYND 1U3VA 1BW9B 2YY7A 3O4RA 4UVGA 4XQGA 4YAKA 3B1JA 2Y0CA 1WLYA 4TQGA 1WDMA 3F9IA 1U5AA 4Y6SA 2ZYDA 1GQYA 5G4KB 2X22A 2JKVA 2WEKA 2X9VA 3V1UA 4BNFA 4BNYA 3GVHA 1DC5A 1UDCA 1N5DA 3B1FA 3NDJA 1QG6A 5ENVA 1HYGA 1P45A 3KVOA 1ZBQA 1U7HA 4DC0A 1ZVMA 3C24A 3GPDG 2UYYA 3EZLA 4JGBA 5ES3A 3VOSA 4PG5A 1PU2A 3M1LA 2YZ7A 5F1OA 3UOGA 1PWXA 2JHFA 2YYYA 1WDKA 1FDTA 4PG7A 3BMCA 4WUVA 3VKVA 4XJTA 1BW9A 4J2OA 2IE0A 3T4XA 3ASVA 1TLTA 3NYWA 1PX0A 4ALMA 1NAIA 1PZFA 3JQFA 1GYPA 5I7SA 5G4KA 5HS4A 1E3WB 4IQ0A 2RAFA 3L77A 3GZ4A 3GHYA 2A35A 1O5IA 3BHJA 2BH9A 1ADGA 3U3XA 1Y5RA 1HDCA 3BHMA 1B0AA 4J4TA 2Y99A 1YXMA 3KYDB 1N9GB 4J91A 1X0XA 1EVIA 4A7PA 5TJHA 3NV9A 4BQPA 2BF7A 3VPFA 2WM3A 3U49A 3TRIA 1X7HA 2NACA 2EW8A 3SLGA 3DOCA 2JD0A 4YAGA 3QHAA 1P44A 3GEDA 1VKNA 3GK3A 4FFRA 3WWZA 2Y05A 1C0IA 3S2FA 4N5MA 1E7WA 1HTBA 4F45A 1R37A 3G0OA 1E3WA 4GQAA 3TFQA 2E49A 3GEMA 3GR6A 4Q3DA 2B4TO 2W2LD 3ZU3A 3OICA 4MVJP 3MJEA 3L6DA 1RYEA 2QYSA 3G79A 5G0SA 2QW8A 4B7XA 1NQAO 2DTDA 3ROMA 4TMFA 3KYDA 1N9GA 1H6CA 3H2SA 1N8KA 1J0XO 2WWRA 7MDHA 2GCGA 2PKRA 3MWEB 3F4BA 1KETA 1ONOA 4II3A 1A7AA 1DOHA 1DJQA 2B4QA 2X4GA 3MZ0A 1LJ8A 1SB9A 4EJ0A 2I9PA 4R16A 1BHSA 1H5QA 4CLHA 2A9FA 1PL8A 1MB4A 2VCYA 4Q3BA 1ADFA 5JDCC 4UREA 4BNNA 4MP8A 3AFNA 1T24A 3JYOA 1I30A 4NQZA 3U4DA 3IKTA 2PH3A 3DTTA 4XQ9A 4QO8A 2VZ9A 2E82A 3JQEA 1HE4A 4CUJA 2Y1OA 4II2A 1R0LA 4ZQGA 3VPSA 1LSJA 4CM9D 1I36A 1JW9B 4L73A 1MX3A 3I3OA 3EVTA 3L4SO 4HKTA 3ZWBA 3ZWPA 2HDHA 5TSDA 4OKIA 4NMHA 1LUAA 1XSEA 4P4GA 4OKNA 1P1FA 1YVEI 1LDBA 2VT2A 4A26A 1C1XB 1DFIA 2I6TA 4FFOA 2Q49A 2V7PA 1YDEA 4GX2A 3UKOA 4M86A 3IL2A 3TPCA 4UUOA 5JDIA 3ROKA 2HMWA 1JVBA 1ZUD1 5B1YA 2VN8A 3GGPA 3ETEA 1N92A 3I4CA 2NNLD 4W4TA 1UP7A 3C7AA 3H9JA 3PJGA 4D3FA 5CG1A 4R5HA 4ZRMA 1VLLA 3Q9UA 2IXAA 5DN9A 1I3NA 4ZA2A 4E30A 4LVUA 4CL3A 3HG7A 4R1UA 1EVZA 4R1SA 2J5QA 4HNGA 3RVDA 3NJ4A 3DMTA 2NU8A 1G0OA 3O38A 1LXCA 1RM4A 4BO3A 1LRLA 1F12A 3OP4A 4TRJA 4R1TA 4EYEA 1IPEA 3V1TC 1E6WA 3NAQA 4J7XA 3W8EA 4U0KA 1C1XA 1E5LA 1V0JA 5JC1A 2BI7A 2GYYA 5ILOA 2OFPA 4JCOA 4C7JA 5KWEA 4BMNA 2D4AA 5EESA 3K30A 1KVQA 4AJHA 4RQTA 3D4NA 1HWYA 2BLLA 3ZNNA 2EKPA 1GEEA 5BNTA 4OXYA 4NFSA 2EJWA 1NX6A 3R1IA 5BSGA 4MKRA 5L7TA 3JD3A 2EP7A 4NBUA 1PL6A 3FI9A 1LDMA 3E48A 4Z0PA 2YUTA 4BV8A 1LBEA 1KIFA 2NTJA 1BWSA 4P4NA 1SO8A 4OSOA 1GQ2A 2C2YA 2H1SA 3KEQA 3GEGA 2BI8A 2PLAA 4KP7A 4XIJA 3U4IA 5AYVA 2YQ4A 4WASA 5DCYA 5L7WA 1JDJA 4CMKA 1LC3A 2QHXA 3VVBA 8ADHA 4UUMA 1Y7TA 4DIOA 4XYMA 4W9NC 4GWGA 1ZO8A 2H6EA 3DR3A 4IDBA 5DBFA 1GPJA 1AHIA 1XCBA 2BFMA 3PLNA 3Q6IA 3Q9NA 4JJIA 1LLCA 3I5MA 1YBAA 4XR4A 4MP6A 3CUKA 4R68A 3VHRA 2NUAA 1YL5A 1ZK2A 1HYEA 1EQUA 4XKJA 1HE3A 4GBJA 1IULA 1PJCA 1JWAB 1FK8A 2FMUA 4OIMA 1E1MA 2BMAA 3KLPX 1EK5A 1Y8RB 3KRTA 1L1FA 3KYBA 1PZGA 3L0DA 4QQRA 4YT4A 4MVJG 1FMCA 2PY6A 3RJ5A 1D7OA 1KY5A 4PG4A 1KVTA 4MO2A 4E0BA 3BIOA 3LZ6A 3ZW8A 1Z7EA 4JX8A 4KQWA 4QSMA 1J4AA 2P2SA 1Z75A 1NWHA 3INRA 4CR8A 5BSEA 1H93A 2YV1A 3DWFA 1ZH8A 3I9KA 4H15A 4PLWA 2G82A 2X0JA 2I67A 5IFLA 2GN6A 1R4MB 5TF4A 4IQGA 3WFIA 3UICA 4ZGWA 1LC0A 3X2EA 4RVSA 3R6DA 4AG3A 4BNUA 1T2EA 2AG5A 2Y93A 2PZLA 4PLHA 1ENPA 1ZK0A 4FJ2A 5DNAA 1Y5MA 1FDSA 3C8MA 3H6KA 3FD8A 3HQ4O 3ADOA 3GGGA 2XOXA 3DZJA 1M75A 5F3RA 2Y1DA 1UAYA 4XYLA 3QWHA 4IM7A 4GWKA 4PVCA 4BNIA 4AJIA 2HK9A 3PP8A 5HM8A 4GGOA 1KEPA 1NWCA 1I8TA 2ZTLA 3AI2A 5CP8A 4N18A 1ZK1A 4OSPA 2JL1A 5CDTA 1PTJA 4YJGB 4ALIA 2B36A 1E7YA 6LDHA 3OM9A 1B14A 5IN4A 1MC5A 2ET6A 3H9GA 1EUZA 4NPCA 4BGIA 4BO4A 1HZJA 3MOGA 3JSAA 4OMUA 1HLPA 1R4MA 2POQX 2VRCD 3F5SA 2HMVA 4E5PA 2HK7A 3KM0A 3KYCB 1HSOA 1E7MA 1EEHA 3K31A 3Q2KA 1JAXA 5L9AA 4J9UE 4NHEA 3N58A 1SZJG 3QWBA 4J3FA 4HWKA 5A9TA 4CQMB 5ICMA 1PGNA 2X0NA 1KVSA 5DOVA 3RJ9A 4MKZA 3WGTA 1N1EA 2X86A 2CDCA 1GV1A 3U62A 3RSHA 3D0OA 4JP3A 3T7EA 4YJGA 4NBRA 3ZWOA 2HO5A 3IC5A 4JJGA 3QV1A 3M6IA 1BDMA 1D1TA 1M67A 1RWBA 3LDHA 3PYXA 4E33A 2Y0EA 1G0NA 5EQDA 2GZ2A 2PFGA 1XKQA 4WECA 1P74A 1TB4A 4E5YA 1ENYA 3S2EA 4R51A 1K6IA 2B83A 4XQCA 5HRUA 3KYCA 5I8ZA 5G0WA 1I01A 4TZTA 1HEUA 3HHPA 2QRJA 3GY0A 2OL4A 3DB2A 4CLEA 4EEXA 3OF2A 4IBOA 1GD1O 1SOVA 1PS0A 1EDOA 4KWHA 4CQMA 2X0RA 3F1KA 4OGWA 2AMFA 2C7GA 4FFLA 1E1NA 4ALKA 2TMGA 4OO3A 5A4DA 5JCJD 2SCUA 1YB4A 5COQA 1F8GA 3IKVA 2Q4EA 2Z5LA 2J5RA 4A27A 5F1KA 1PS9A 1AN9A 5C7OO 4ND4A 3JQ9A 3HE3A 3PEFA 1TT5B 3WQSB 2NWQA 3O9ZA 1AE1A 4OL9A 3ZNQA 4YJDA 4NG5A 4JP2A 1ENOA 4CM3A 3E03A 1SNYA 1JKIA 5GMOA 4KTTE 2PD4A 1D4FA 3F4LA 1ZEJA 1GYRA 4CMIB 3VAZA 2H63A 5CDSA 3DAPA 4TZKA 3VH3A 1ONPA 3SJ7A 2WYWA 3O8QB 3ETGA 4MVJH 1SB8A 3FCOA 4L75A 4L76A 1C0LA 4B3HA 4MVJA 3W8DA 1U4OA 4I5FA 4S3MA 3WTBA 3FWNA 3ST7A 3GAFA 2DBRA 3ONEA 3RBXA 1WMAA 3UXYA 1HE2A 1Q0HA 5JNLA 4OM8A 1LLQA 1TT5A 4YVFA 5AXDA 2Q3EA 2PTGA 4TROA 3UCFA 4NJMB 3IP1A 3ICPA 1HETA 3DBVO 3BZUA 4YXFA 4CMIA 5IDQA 2C82A 1LRKA 2JFFA 1PJSA 2GD1O 2NV6A 3GVIA 4IS2A 1QYCA 3GC6A 4RQUA 4UVEA 4YCAA 3M2TA 2FZEA 2Q1UA 3O8QA 1P0FA 1B26A 3KSUA 2GDZA 2HMTA 4L4RA 5HBRA 1PJLA 4LMRA 1V6AA 4U0JA 2UAGA 4J9VA 1DIBA 1PQPA 4E3ZA 4MKXA 4AJLA 2QIOA 4XGKA 3WSVA 4OYRA 4PLYA 5DULA 1QMGA 3NX4A 2VT3A 1JU9A 4TKMA 3X2FA 4HNHA 3ZWCA 1Q7CA 3ASUA 2R6JA 2C7VA 1Y8QB 2HAEA 4IDDA 1VPDA 4NJMA 4TSKA 4Y6PA 2C07A 3ZH2A 2BGMA 1J49A 3VPGA 2P5UA 5T57A 2A92A 3A9WA 3PK0A 1Q0LA 1U1IA 2ZJ1A 3FN4A 3R3JA 1WDLA 4ZQEA 5ILGA 4CR7A 4XQEA 5A9SB 2D3TA 3C7CB 5GZ3A 1SMKA 1Y81A 1IOLA 3GLQA 4PN3A 3RUIA 3GFBA 4CODB 3G17A 1HZZA 2C54A 3ZI0A 1CWUA 3P2OA 2WD7A 5I9NA 4RZIA 4MVJF 4XB1A 5GZ1A 1NP3A 1Z7BA 2RHCA 2IODA 1C0KA 2OHXA 4IUYA 3SXPA 3RWBA 1KEVA 4DYVA 1QV7A 3RC7A 3QVOA 2DUWA 1YQGA 3A14A 3DZBA 4J4HA 4NK5A 3JQ7A 5HA5A 3LLVA 1A71A 1CQIA 4PRLA 4DPKA 1Y8QA 3QIVA 5JS6A 1ULSA 3GGOA 1PZEA 4J43A 4FIZA 3QVWA 3WQQA 1YJQA 1WMBA 3I83A 1U9JA 2P5YA 4CLRA 4AICA 5EN4A 3WB9A 3WGGA 3WMXA 5A9SA 2HJRA 3UCXA 1KEWA 5DP2A 3GZNB 4DQXA 1ZEMA 1XQ1A 3D7LA 2HUNA 4PLZA 5EIOA 1LU9A 1GTMA 4GVLA 2O2SA 1ISIA 3R3SA 1LNQA 3G3EA 4AJ4A 4RF5A 2PNFA 3JD2A 4CMGA 4IIUA 3AY7A 5DBGA 1B7GO 4J0FA 3QJ5A 4FOSA 4P8RA 2P91A 3K9QO 4TKLA 1DFGA 2NVUB 4BIIA 1PGQA 2BFOA 3KLMX 1O8CA 3I52A 4WLEA 3F5QA 2VUUA 4W82A 4BHTA 4DQUA 1LI4A 4B4VA 1I10A 3WX0A 1XYGA 2LDXA 4CMEA 2ZATA 3AJRA 2WDZA 4U6SA 3HFSA 1DC3A 2IZZA 3RBVA 1OOEA 4DYDA 4CJXA 3AY3A 1P9LA 3OMLA 3ZWMA 1F14A 5A9RA 5BSFA 7ADHA 3B6ZA 1E1KA 3SX2A 1LQUA 2P68A 1QORA 4BV9A 4Q9NA 1LTHR 3LSYA 3GZNA 1YJ8A 1XR3A 3PXXA 4IS3A 1LSUA 1EDZA 3EC7A 2D5CA 3AI1A 3I6IA 3NDIA 4Y9DA 2FR8A 1V35A 4LVCA 3B1KA 5IZ4A 3CMCO 1RM5A 3PZBA 1HF3A 5IZCC 1WVGA 1PR9A 4Q39A 1E3LA 5DCUA 3OIFA 1ZMOA 2Z95A 4IY1A 5KVQA 2NVUA 5CAEA 4BGEA 3LT0A 2ZB4A 3KSDO 4TVOA 3RIHA 3ZV6A 1V3UA 3D64A 4IGFA 4EGFA 5IAAA 1CRWG 1BTOA 4ONEA 3TL3A 2FN7A 3BAZA 1QYXA 1GQQA 4CMHA 3NTQA 4A10A 2Y0DA 4KOAA 2Y1FA 1X14A 4RPLA 1U2GA 3RKRA 4PLGA 1F17A 4LRSB 1OAAA 5CDYA 1DDOA 3WJ7A 4MVJM 5CHEA 2NTVA 3H8VA 2CSUA 5T8KC 5TIIA 4BNGA 4HBGA 2YHIB 4LCEA 4S1VA 1T4DA 2JCVA 4LCJA 1PL7A 3NDRA 2Q2QA 4U5QA 1Z82A 4IJKA 1QKIA 2QZ9A 3CEAA 3IMFA 5ER9A 2I5PO 1GPDG 4PVDA 1ZFNA 4FJ1A 3VTZA 2FY8A 2Q1WA 5A1TA 4E6PA 5G2OA 4IXWA 4Q3EA 4MPDA 5AQ1A 1KY4A 5KJEA 5G0UA 4WJZA 4DQVA 1CERA 1P33A 2EEZA 3BTOA 3RUFA 2P9EA 4RF3A 5C3MA 2G1UA 1A5ZA 3FBGA 1XIVA 1UZNA 1I32A 3I1JA 3PIIA 1I0ZA 4RLSA 3FNGA 2Q50A 3ENNA 2YHIA 2D1YA 5L4LA 4WCDA 5EL0A 2A4KA 3W1VA 1U3WA 1ADBA 5JMWA
chains in the Genus database with same CATH superfamily
2A1TR 2O3TA 2AZXA 1CC1S 1BNCA 1Z0SA 2V7VA 5LIPA 1JIKA 1UZMA 1YOVB 3WP1B 2H00A 1W59A 4RADA 4C4OA 1L8LA 3QA9A 2D1FA 2V6GA 2NZ2A 3D0KA 3HCCA 4YMTA 1QIJA 3U1VA 1ICEA 2RBEA 5TV2A 1MFPA 3JQBC 4KR0A 2WZDA 1Q19A 4GEKA 1LDNA 3AHJA 3L05A 2WF7A 4NH0A 3WIVA 1Z22A 4MGEA 5EFOA 4Z3OA 3P9CA 3HSSA 5HXAA 3D4IA 1DJNA 1O6CA 3GLKA 3NFRA 4EOGA 1QO7A 4F2PA 1OX5A 4WLUA 4URUR 4IVQA 1T3HA 4HF7A 1RHRA 1TTPB 4M6WA 4PHTA 1UPFA 3RS2A 3TO5A 4I8XA 5BT8A 3UHOA 3DFFA 4M0DA 3BKXA 3WGOA 4QD3A 2QV7A 3V7NA 3BFJA 2W71A 3B3FA 3NZEA 4WVFA 3V8RA 5DM4A 5LUAA 3PUVA 5C4GB 2XGJA 3GIWA 2YDXA 1W0KA 3GUUA 1FOEB 3H2KA 1DIHA 3QKUA 1PSZA 1ZH6A 3NVMB 2DUMA 3TTVA 4BP1A 2ABWA 1KVRA 4HB2A 2ZS7A 5AH0A 2X9GA 1PW7A 5EJFA 3DO8A 3H65A 1YOVA 1ZXBA 4GYYA 2V5VA 1Z0FA 1LJUA 3DH0A 4YAIA 2X7HA 2XYVA 1PS8A 3JQAA 2HSZA 1ZHFA 2ZPUA 1VGQA 3W4KA 2NVWA 1F38A 3PBKA 1MZPA 3PT9A 5GP1A 1CNMA 2X8JB 1TI7A 4N0MA 3K2IA 3QTTA 3R09A 2R4TA 1IUNA 3BOSA 3SJAA 3CURA 5EMMA 1PQUA 2H31A 2BMVA 4OUKX 4UAVA 1L2TA 2W6PA 2FSVC 1DC6A 1EFDN 4QNRA 4CBVA 5DHUA 1E96A 4KACA 3T3NA 1Z68A 2YRFA 3I0ZA 2X2FA 3Q12A 5DGCA 4C2TA 1B00A 3DQPA 4D98A 3BXPA 1G7RA 4JQZA 3Q8KA 2JLXA 1GNTA 2GJAA 5HS6A 4TMVA 2IWRA 1RHKA 3L1UA 5F4BA 5H3CA 5L3RA 1NZJA 1E7RA 1XNRB 5A4KA 2OAEA 4NV0A 1T5IA 1Z25A 4WACA 5C5IA 4WNCA 3QPUA 4D82A 2CWDA 2C94A 3EDRA 4F6RB 4FFNA 1R3DA 2OFXA 5U9CA 1JRLA 4B31A 3KQTA 5I7UA 2CNWD 4YA6A 4OJQA 4JU8A 3P9YA 1NI4B 2ATCA 2C42A 1IE3A 3NO4A 4B0OA 2NXCA 4BJHB 1KZGB 5JAIA 1VE9A 5HF5A 4PQGA 2X8JA 3HWRA 4ZRNA 1N0VC 4GL4A 3OEHD 5KJ1A 4PZLA 1GV0A 4MB0A 2JFHA 3RM3A 4B9EA 1OH8A 1KRWA 3S4YA 4BUJA 4M60A 4G4IA 2JVKA 3V34A 5C8XA 1Q2XA 2J6CA 4Q3AA 1WOYA 4O4JB 1ISSA 1EVLA 4ZARA 2VJLA 1WBJB 2BEWB 1OLUB 2FLVA 3HJBA 1QUFA 2EIXA 1P4JA 4R7ZA 2C9BA 1YA8A 4B7UA 5I7RA 2R6CA 2B3DA 2BFAA 2R4UA 4I6GA 4U6NA 5BO5A 2WFZA 4DV0B 3DAYA 2FEMA 3R0XA 4AJ9A 1GYQA 2ZXEA 1KKLA 3KPVA 2ZTVA 4JLBA 1N6RA 4XEHA 2J9YB 4GH5A 3TFWA 5HFJA 2Q3FA 1JLMA 3NIWA 4G25A 4F6RA 3A4LA 2QQEA 2ZI5A 1LH0A 3NUGA 3CKLA 1A9TA 4MUEA 4MUGA 3HVRA 3IAFA 2R6HA 1HQKA 5BXYA 1TU3A 3CZ4A 1NI4A 4IDOA 1QF6A 2DH6A 1YJAA 2ZLBA 4U7HA 4ZRDA 1L5HB 1SUPA 2Q9UA 2OXIA 3H1FA 4ZOAA 3DCNA 4LDQA 3AQ4A 4IHJB 1M5RA 3LTEA 2WFAA 3ZGVA 2DR2A 3DFUA 3NHUA 4O4JA 4PYKA 1IEWA 2A2ZA 2BEWA 1OLUA 4MQLA 2IUUA 1MIOB 4C7VA 1JMVA 2XB6A 1Z0ZA 5H5JA 4FHDA 4JLJA 1DAMA 1DP4A 2D5LA 1TFUA 4AG5A 2BE7A 3V4ZA 3IAM6 1GPWB 5F77A 3LUHA 1QRRA 5BNWA 3QPVA 2G9NA 1SPXA 2E4XA 3OE4A 5CA0B 4LAFA 1R4ZA 3I34X 2UUOA 4DLKA 4OXNA 7YASA 4POAA 5F9HA 2R11A 4MVCA 2JZOA 2QLMA 4FOPA 4RK6A 3Q7RA 4EQZA 4Q9HA 5B1DA 4RD0A 3PNVA 3TUJC 3F5MA 2B8TA 3A27A 4K9OA 1D6SA 2WYOA 3EQ9A 3OOEA 4EM6A 1CS4C 3OWOA 2FMIA 2X5JO 4L07A 4MVJD 4NZZA 3IDSA 5AKXA 1PZHA 2Q1YA 2ZIAA 4QO7A 1ZD8A 3OT1B 3R8CA 1L5HA 1U8YA 1T1JA 4DM7A 1NM5A 5TNXA 3S28A 3A37A 2C59A 2JHCA 5HHTA 1K89A 1TW2A 2QV0A 4IHJA 4CKBB 5A4JA 4I99A 1MT3A 1G5IA 3FPGA 3HJHA 3I3SR 3ICOA 3KPJA 4AJJA 5C81A 2ZJ0A 3ORSA 1PFKA 4Y30A 3UMGA 4ETNA 5B7QA 2J45A 1MIOA 3V8VA 1ZN9A 5JJCA 5LP6F 1YFJA 3I2HA 2ZRIA 4QGAA 1NONA 2UV8A 3ZBPA 2NO9A 2AXEA 1MHPA 1SUIA 2IXEA 2V6BA 4L0MA 4K9LA 2WUEA 1E2MA 1W96A 4H7FA 1T0JB 5FOTA 5CA0A 1BH2A 3E9DA 4K87A 4LZAA 4INJA 2UUCB 3BVPA 4DM4A 2HF8A 3IAS6 4F7DA 2JBWA 4L6IA 2XMBA 3KR2A 1DRKA 1SUWA 5A05A 4UC0A 1R4AA 1G2PA 1Z56C 4X3OA 2ZXUA 1YFZA 3OUZA 5AKGA 2HJWA 5HF9A 4ER0A 1UXJA 4E51A 4FE7A 4YAFA 1YBMA 3R4CA 2GBCA 4CKBA 4AM8A 4PV7A 3OE5A 2VYNA 4RLQA 5E1OA 1A9XB 2FOLA 4TWRA 1XJQA 1TJYA 5DBIA 2PRKA 2FKNA 4G5SA 2HMYB 2JNWA 2W8BB 3LQ2A 1LQ2A 1WPRA 1XD8A 1RW4A 2H48A 1OROA 3GH3A 3LDGA 3QG5A 5T4HA 4EB3A 1X7ZB 4NCHA 4F1KA 1P1KA 3SLRA 4Y9UA 3O2SB 1MAVA 2GYUA 4MKIA 3R7SA 1QIKA 1W6RA 4KQGA 5A4AA 1JSCA 3QUSA 1Z6QA 5L6MB 2O8BB 3IEVA 4GYJA 3KNZA 4RLFA 2GD2A 2LWIA 3WGQA 1WTCA 4PF1A 3Q7PA 5FH9A 3VGJA 1JALA 3ENKA 3FWZA 1CY2A 1C3VA 1VGVA 5SYAA 1GTSA 4CL8A 4V03A 1RZRA 3TSCA 3EGWA 3SMVA 4AP9A 1VB5A 4DMKA 4HFMA 2JJ8A 3HJNA 3OTQA 4A26A 1LWOA 3WYNA 1P62B 2L18A 3L9XA 4AFNA 1M6WA 3JQ6A 4GSYA 3WIBA 4AX8A 1Q14A 3A9UA 1H9CA 3NP7A 1E1QD 1N1GA 3HEAA 2KMLA 3KKMA 4RA9B 5K8LA 1RXSA 2Q3DA 3FCYA 1A9XA 3GN2A 3GT4A 1DOZA 5IHXA 2XT6A 3O03A 1FFYA 1VDZA 3WZ2A 2DJ5A 2YOGA 4ZVMA 2W8BA 3W2EA 3C85A 4LYGA 4QXQA 5B1HA 5ADWA 3OHPA 1X7ZA 4HTAA 1W19A 2PEYA 4FNGA 3G9TA 1U5CA 3BBLA 2PGXA 1QPZA 4XX0B 3S8MA 2NNWB 1Z5PA 1RBMA 1ZUHA 2GPWA 3K0CC 4JUAA 5CPFA 5H9WA 3I61A 2O8BA 4JJZA 1JAHA 1RJ9B 1D7AA 1ULHA 4UPEA 3IRVA 4QREA 1WX1A 4G26A 2V7QD 4E94A 3AVYA 5IXJA 3K0KA 3L7JA 1VE7A 1OC2A 4O1IA 4M38A 2C0CA 3IOCA 1OT3A 3SJUA 5EGNA 2VZ8A 4CEIB 4TYWA 3TEMA 1Z35A 1C1YA 2C95A 2YFQA 1ACJA 3S1AB 2ISCA 1ICIA 1A77A 1MA3A 2XTNA 2YINC 5AKJA 1JHOA 1NFQA 5J43A 2GBLA 1QZZA 1F06A 4LKRA 1IVNA 3K4QA 3C3XA 5I5EA 1ND6A 5BSHA 4RA9A 5C18A 4KN6A 5NLLA 5KQGA 1NT2A 2VTKA 1W73A 3UTDA 4GMFA 4X91A 3SXUA 1B74A 4KWIA 1YGPA 1YFKA 2ORIA 2XUZA 5CB4F 1XX6A 4AJ1A 2CHQA 4F4JA 4DUYB 3PDHA 3KJZA 4HQOA 1FDRA 2C1XA 2PL5A 4OU5A 4XX0A 1GOTA 3ZVRA 3EULA 2GCNA 3DC2A 1U7TA 3SXUB 1LX7A 1XEWY 4AC9A 4CG1A 2Z30A 4DAOA 2AFHE 4ECAA 4Z4HA 1V48A 3ME5A 1RJ9A 3PFNA 3RC2A 3TL6A 3WLEA 3M6XA 5AVUA 4I4LA 4ZVRA 2LKDA 2WV9A 4XB2A 2V9ZA 1GAEO 5JRDS 1N0WA 1JT2A 4YUVA 4CEIA 1K6MA 4DANA 2P3OA 4Q15A 3U7IA 3VZDA 4PQFA 3S1AA 5JT1A 1SKAA 3OKAA 5DI9A 2QF7A 3ROFA 5MFPA 2C2KA 3LGAA 1WZEA 4HLUA 1F8FA 2WBLC 3GDWA 4A0GA 3VGPA 2KQUA 2QM8A 1HG0A 4FHFA 2C8LA 2DAPA 2EWVA 1UDXA 3MQFA 5DTIA 4MUJA 2AJBA 2EV9A 3BSYA 2ZXFA 3KFVA 4DLRA 4KPEC 5CYOA 3W9UA 4YECA 4G1VA 2QRGA 3ZCPA 4ARZB 1WDTA 4B4UA 1FLAA 2EIHA 3ND8A 5CYFA 5DM60 4R05A 1QOPB 4M0UA 1TEHA 2D2VA 1YR8A 4FNOA 4MV9A 2FZ5A 1ETUA 2BKEA 3HYLA 3MOIA 5DASA 2WTNA 4Q7KA 1FXUA 1RRPA 1JNXX 3BH7A 3LYUA 4A1FA 4XOIA 1SC6A 1MN6A 2A84A 4G1BA 4ROSA 2QRLA 3T9CA 2QGZA 3EDYA 2ECKA 2HO4A 2JGMA 2XTAA 3KCNA 4IHQA 5DOZA 3GT0A 2WPDD 4JJ8A 5CT4A 4XX1A 3AW9A 3L8MA 1IY0A 2MTBA 3AIOA 2LCQA 2F43B 2OZEA 2EFEB 3G82C 4JI6B 2P79A 1J22A 1E9CA 4K6KA 3EHEA 2GN4A 3A25A 4E1AA 3EPHA 4MHSA 2PGOA 4X54A 2AJLI 3DZFA 1GFZA 1ECCA 3REFA 3UAXA 1U3UA 2FZ4A 2GO7A 2BHTA 2JIDA 2QYHA 3TE6A 1XGKA 1EFAA 5FTNA 3L7MA 4ARZA 5KTKA 5JJLA 4DCOA 1EP9A 3TIGA 3WFJA 4L7QA 2H3HA 3VU9B 1GP2A 4RFLA 4WXEA 3SYRA 1P1BA 3H5OA 3G2OA 3DT8A 3IS3A 3L1JA 4EO4A 2OK7A 3DKKA 1EFKA 4K8OA 4PCVA 4KXNA 4KFCA 1L3CA 5ERYA 1AX9A 2RDMA 4WNAB 4CN9A 1U0TA 1XVUA 2VYVA 1WF3A 3VJLA 4E6EA 3FTFA 1IATA 1NTOA 1PG0A 3KV3O 1WQ4A 4QKQA 1XZBA 5BVHB 1CUFA 1LW7A 3FYHA 4F4HA 3BSSA 2JS7A 5KNBA 1JU4A 3KB6A 4QQ8A 3K35A 5CD1A 5DYNA 3PVCA 2P0EA 2O3QA 3O1HB 3PGXA 5CDUA 4D3DA 2WT8A 4PC3A 2F43A 2J3KA 2CMKA 1F6DA 2SHKA 3H83A 4BZPA 3OZFA 2EU8A 3PFFA 3STYA 1XU9A 3ZVMA 3K71B 1HBJA 3D2BA 1KIMA 2IEDA 2IUTA 3T1OA 2OZKA 5AOBA 2PGNA 1Y9AA 3VH4A 1OFTA 3RUAA 2VJYA 1SU4A 2QOEA 4E13A 1NYQA 4NCKA 3BGWA 3VU9A 1FFCA 3IQDB 2BP7B 2BELA 4BCDA 1NR5A 3GJRA 1BYUA 2YMLA 4I4TA 3RI3A 1Z88A 2AMJA 5HFNA 4DV6B 4MDYA 4CV0A 2QMEA 2XQVA 4WNAA 2G5PA 2WG2A 1Z15A 3CXRA 4IX1A 4C3ZA 3GRUA 1VL6A 4D81A 3C3PA 4HH4A 2WAYA 3H8SA 1T34A 1E5XA 3JQ7B 1Z62A 1P2TA 1E2LA 3PRYA 3MN1A 3LDUA 4KCGA 1AKEA 2CBGA 4DWJA 2GO1A 3K92A 5THKA 2TRSB 4E46A 5CFZA 3MILA 3AEZA 4URFA 2GF9A 2XQIA 4HFNA 4CHTA 2PZ8A 3ZCXA 4ECEA 1ZSNA 1E2JA 1TM5E 3AR4A 3C5CA 2CJFA 4R83A 2VTBB 1F2TB 3D54D 2QTZA 3GPBA 2YXPX 3CYFA 5FWAA 3WYEA 3ZLBA 4DNFA 4EKNB 3W6PA 3M2PA 2HEIA 2CBZA 1QIIA 5J5VA 4Z0HO 1C0PA 5TMPA 1V2HE 2PO5A 3TUIC 2O2ZA 4UUAA 1LK0A 2NG1A 3EW9A 3FDZB 4YQYA 5DNEA 3QFCA 4ER6A 1CV2A 1ABBA 3O8CA 1OMOA 3IXQA 3TZHA 1TA4A 2GBPA 5LZ8A 4PO1A 1BVUA 1Y1KE 2OYSA 1P2SA 4RW0A 1YB5A 2YOFA 4RNDB 4KE9A 3RBZA 1E2IA 1TM7E 4FVTA 1E66A 4LG1A 4EGAA 3LBAA 1JEDA 4HO1X 1WDWB 3LXXA 4ZZ1A 7ABPA 2QTRA 4MMYB 1X1AA 3RROA 3T8YA 2YOHA 1JQBA 1R64A 3MQ4A 3DT6A 3C7TA 1U3DA 4KU4A 4KYIB 2B5WA 4LX8A 3UV3A 2HJVA 3GDFA 5MFZA 1KBZA 4DC1A 4C0QC 2E55A 2H1FA 3I2GA 2IITA 5E95A 1IOVA 2JGRA 1OSNA 3DLIA 2RJOA 3KHSA 4L8YA 4DWWA 2NZYA 1F2TA 1YC5A 3GLHB 4DR4B 1EINA 1TAHA 2CMHA 1KI3A 1HPLA 3JQCA 2AHOA 2I1WA 4U8GA 3NHJA 4MVJE 3TB6A 3C43A 3U5TA 2Q1TA 2VA9A 2X14A 2WTEA 2BZGA 3KSZO 2DCUA 1RM0A 2G07A 5G1NA 1RKXA 3KKNA 3NT2A 4B6OA 3FDZA 1PYOA 1X2EA 4EZIA 2FRDC 2WMOB 4EY7A 2FPKA 2UVDA 3LE8A 1AKYA 4I19A 3KK0A 2PU7A 5J59A 2AVNA 4BNXA 4WLVA 3AF1A 4MITA 3N70A 2OORA 3A4VA 5ALDA 3T0IA 3G0GA 3H1PA 4G6ZA 4M1TA 1TD1A 1QIGA 2N46A 4ZVLA 2CHFA 4YWHA 1TC2A 5LYJA 2ZWPA 4UQPA 5B6PA 2ZIEA 1XTSA 3EIOA 5BWOA 2GCPA 4DDUA 1MO3A 4LY9A 3G1WA 3QPAA 1PGOA 1GQSA 1SXJD 1D0IA 3DLAA 1C7JA 4L28A 5U1PA 2I62A 3CF6R 3GLHA 3SKXA 5AJYA 4BZXA 1AS0A 4PZ9A 2E1PA 1K2WA 2GS9A 1GU1A 4DB4A 1ZNZA 2BHSA 5EP1A 4MTCA 5K51A 4GQBA 1ADJA 1KAOA 1ZU4A 3EQZA 5GJCA 2OXTA 2H4ZA 1NW7A 2JIBA 1FYFA 4Q9LA 2O0MA 2JLQA 3VYUB 1BD4A 3GO4A 3IUEA 3JQGB 4D8XA 1X1BA 2CUNA 4TPKA 3RNLA 3QVTA 4ESOA 1NR1A 4AMUA 4C78A 5DRTA 4DR2B 3IMEA 4PR3A 5BR4A 1G7CA 2A0FA 2DHRA 3SSNA 5JH7B 1FTWA 4LOHA 4DCGA 1HT2E 1NN3A 4R1PA 4UNQA 4XE5A 1G9XA 2JFBA 1MO5A 5FBHA 4BC1A 4WLNA 1Z4IA 3M6LA 3ASYA 1G3UA 3UJPA 3JYHA 1QQTA 4KUHA 1SC9A 5G0VA 1SVNA 1XLTA 3ZWNA 4G2TA 1SU7A 4NESA 3D4LA 2I7XA 2AG6A 3FSEA 5AVQA 4IFIA 3VUFA 4AX4A 4TS4A 1YE3A 4WK4B 1E92A 1OE0A 1V4BA 3E9YA 3GU3A 3RR2A 1YBHA 2WYUA 3U3MA 3MRTA 3ZU6A 4LZWA 1AOXA 1I14A 3ODGA 2X0EA 3UMJA 2BIFA 4N5HX 5GQSA 5L4NA 4C30A 1NPYA 1O97D 5LNK6 1KEZA 1JQAA 2QNRA 4XYBA 1ORVA 2WR8A 2HKIA 4KQ1A 4R71A 3JQGA 2C2HA 1OBFO 4I46A 2Z4RA 4YRCA 4YAEA 3ROQA 4ETMA 2O19A 1F0YA 5MHTA 2AS0A 1M8GA 1PT5A 1WB9A 2C0QA 2GKSA 4LK3A 3WISA 5KTMA 3JASB 3EUWA 1A76A 1HKUA 3VZBA 3AHFA 2I80A 4R1MA 5JCPA 4Q03A 1D5CA 3PIDA 3WV5A 4RTLA 5MF6A 4QVIA 4YAJA 2HK8A 1WV1A 1RYNA 1N9KA 3PV0A 1MEEA 2V3VA 3FTCA 4KL8S 4QJBA 3RKUA 3W2HA 4OBXA 3WYCA 3U31A 1O6ZA 4WXRA 4EO9A 1UANA 3KXPA 1L7PA 3J7AC 4AUEA 4LXUA 3JD1A 3GUZA 4NYMQ 3SC2B 1P7YA 1M34E 4JVLA 4L6AA 2XCLA 2ZDHA 4AP5A 1VLVA 1GSAA 3JU3A 4IJUA 1ZIPA 1SUDA 4EHHA 2QORA 4PXYA 1T4BA 2OMEA 4PEVA 3JQBA 1A72A 2YRWA 3FTPA 1QP4A 2QJRA 3T7AA 1X1TA 5ALLA 1PI3A 1UXGA 3TSZA 1P4SA 3TWOA 4JI1B 2QRHA 4EYOA 4Q19A 5AKKA 3WLFA 2ZSEA 4N0DA 3WLQA 3ZK9A 4V0ME 5I7VA 2RGGA 4YLEA 4JKYA 3QSYA 3FLAA 2XUJA 1FMFA 3JASA 4ZZ0A 3QVVA 1Y6QA 1U94A 4ON9A 5LLSA 1KYVA 3RC3A 3I4FA 3ZEIA 1EWKA 1JKJB 4HNQA 1W46A 3CG0A 3INYA 1VSTA 3KZOA 3SIXA 3H05A 1M9NA 4BVBA 5AJUA 3RDPA 1NW6A 1N2SA 1W5AA 4ME6A 4KFSA 1JIUA 1T8RA 3C6ZA 3TDKA 2IYYA 3SC2A 3GEBA 3MJHA 1JH9A 3Q6MA 1P9NA 1VJCA 2RH4A 1VECA 1T8SA 1Z2PX 2MSDB 1A97A 2L2QA 2AR7A 2G25A 3KT3A 2PD3A 3LW8A 5CUQA 1E3SA 3SIRA 3UKJA 1E58A 4GDMA 4URYR 4YCBA 4O4IB 2JFNA 1DAKA 1H4VB 1ZVJA 3E5MA 2YYZA 1OPXA 4ZI3A 4L4SA 4YRGA 2ZU0C 4H7IA 4OM7A 1IEXA 3NKLA 1QXSA 3G0HA 2FSVA 4I9UA 5ALPA 4PZDA 1JJ7A 1W94A 2GAIA 2M6SA 3I6YA 5KJ6A 3SAJA 3L4BA 4PIPA 5DBOA 3L84A 3OIDA 4QUDA 2AV6A 1N4AA 1UIRA 4B4WA 2Q4BA 4EJ6A 5K6RA 2GEVA 2NO7A 3F47A 1B3RA 1JKJA 4L50A 3LC0A 5HQJA 5KNCA 4KO8A 3PDWA 4I08A 4PO8A 1KJQA 1OXVA 1LTQA 2G63A 1GVHA 3IV7A 4FJ0A 4FGWA 4PAWA 3R7BA 4EAAA 5B6IA 3ZIAA 4D25A 2PSSA 4EJSA 3MJCA 1DUVG 4C7MA 4IJWA 2X41A 2TYSB 2PA3A 3T7KA 4ZMRA 2VT6A 2H2GA 4CLDA 5IJWA 1HYQA 2YVAA 3WIEA 3HXPA 4EUHA 5ICGA 4MB2A 2QVLA 4IIFA 3ROEA 4C6TA 1D1SA 1QHHB 1LK7A 2O20A 1HOTA 2ZJ6A 3DPUA 2JCYA 3R3WA 3TMYA 3ZDZB 4DLWA 5K0ZA 4CGZA 4O4IA 4R3NA 1U9IA 5CTAA 4GT1A 4RL4A 4L4ZA 3EZ7A 4N3GA 4B2YA 4LWPA 2RK6A 1P19A 5IM4A 4AKIA 3K9BA 2FVXA 4YCMA 5TX7A 1MPTA 1W93A 4IUDS 5FQOA 5GGXA 1N6PA 4X61A 4LF7B 1TCCA 2PR2A 4NC9A 2HHCA 1ZW1A 4KN8A 4MWZA 621PA 1M66A 3F6CA 4RGBA 1XRQA 5KTTA 5CNKA 2NYUA 2ZDQA 3UMMA 3MJDA 2D74A 4Q3LA 4YCJA 2AG1A 1PBTA 1YVPA 5J2UF 2AC4A 5I7HA 3I1IA 5FTJA 2EFCB 4PGMA 5HWSA 2Q8NA 4HAIA 3AJDA 3TF5A 1F9EA 3CZ5A 1RI3A 5CYPA 1T35A 1QHHA 5TGTA 3SYKA 1QR6A 3LPDA 4A03A 3IQZA 1GFSA 4RXTA 4KQ2A 3ZCUA 4OHBA 2JHPA 2PJZA 3T0GA 3ZJYA 4D9IA 2IH5A 1FJGB 3DV9A 1NKVA 3QXGA 4HZUB 3EGOA 4DZTA 3N74A 4E7OA 2EHDA 2YN0A 1CZUA 5CVEA 1T3SA 2CCJA 2Q6TA 3GF4A 1E9DA 4CU5A 3WHIA 1MB2A 2G9RA 3TNFA 4DUZB 3BXHA 1HNXB 2PLWA 3DDCA 2W6JA 2Q46A 3EYAA 3W7VA 4K7JA 2PVSA 3EZGA 2GASA 3K96A 4ICIA 4M9RA 2MYPA 4RDIA 1EHCA 2P7IA 3PA8A 1PFYA 4Q4AB 5BPFA 2B21A 3S70A 5L8VA 2V59A 4X85A 1N6LA 3ULKA 1DAEA 4IWXA 2E4AA 3HU5A 3GLGB 1XXHE 2Q0SA 4KK3A 2D5AA 3ZI4A 2HV8A 4DLBA 5AI9A 2QTAA 4BLRA 1EGAA 3D3EA 1EXMA 1AMNA 1KARA 1ZW6A 2WJAA 3R24A 4G1UC 4H59A 1VYTA 3BDIA 1YUNA 4IINA 3S2IA 4HFRA 2WSIA 4EBFA 5HP4A 2ALJA 4HZUA 4RJJA 2O57A 2PTHA 3E0QA 1F60A 1A7UA 1QG0A 1SIBE 2I3GA 3G0IA 2PT7A 1M8JA 3OQVA 4LRYA 3NOXA 1FA9A 1NPTO 2GPJA 3CZMA 2OAP1 4OGLA 4WKOA 2X8LA 4WXYB 3LUKA 2GZ1A 1PSDA 4ZXFA 5JOQA 5CYGA 1C3JA 1EJ0A 4KQEA 1UBNA 2WPNA 2IF2A 2VKTA 2WMDA 2C04A 3QLJA 5JE8A 4PN7A 5K01A 4LNAA 4ARCA 3FTQA 3LBIA 3IPLA 2QI9C 4H3SA 4HGOA 2FX5A 4RX1A 3AB3A 3AXSA 4PRKA 4Q7EA 4Q4AA 5LB4A 4Z7NB 4TTPA 2YKGA 4K0KB 1OI2A 5JECA 1GG9A 4DV5B 1RNLA 4DY6A 2BZ0A 2HN9A 4QHYA 1HT1E 1WHSB 3VVLA 3W3AD 3GLGA 3GLIB 2VHXA 3LRPA 4GVPA 3F4KA 3E9RA 4OLAA 1I6MA 2GEUA 3FPHA 1T10A 4HAOA 1B41A 1JMYA 1OBOA 3RARA 2LXNA 4XM2A 4EL5A 1M2WA 3A9SA 3A2LA 2ZCUA 2XVXA 4GSLA 5C5CA 3ADKA 4NV3A 3RC8A 1J97A 1WKBA 2CFOA 4B40A 4PX9A 1H65A 1JEYB 4IXNA 2V4ZA 2JLWA 4Y1GA 4RVGA 3O47A 4K9MA 4ZU3A 2OOSA 4AT1A 1R9MA 4GF5A 1PFVA 1ZGZA 4RNCA 5F9MA 5HIAA 4HVTA 2ZSBA 3H9EO 3ZVKA 4WOCA 3ZCTA 1ADCA 1ISMA 1XZAA 2JKYA 2JAQA 3QF4A 5EFZA 3UMYA 1SY7A 3H3FA 4DMFA 2RIPA 2O7RA 4D46A 1I1HA 1RDFA 4IIDA 3DMTC 3IUQA 3GBPA 4ZO9A 2WLSA 1ZVVA 2IYUA 3D1JA 3TDNA 3GLIA 5J23A 1CUHA 1WHSA 1FS4A 2VAMA 1O9BA 1FYEA 2VP2A 3RAGA 4OL0A 2FCAA 4OGFA 5B37A 2RARA 5KSYA 5DU2A 1XZKA 4KREA 3OIUA 1NNEA 3AHDA 1T9KA 2YY5A 5AW3A 1NF3A 2SKCA 2Y1GA 4DNOA 1GILA 5JQWA 2JFUA 1ZKMA 4ZI2A 4KXYA 2J87A 1JEYA 4DR3B 3KEOA 3WLRA 4PZCA 3L0CA 3OT4A 3NALA 1WSAA 2IYEA 1FF9A 1SXHA 3I05A 3M49A 2Q41A 2Q3CA 1C7ZA 2FEKA 3FPCA 3GFRA 2B7CA 1SWVA 1LB1B 3N75A 4OXQA 3W6UA 3LZCA 1ISFA 3CSDA 4QL3A 3VISA 4OI2A 2C97A 2O4CA 5AOVA 3FCUB 4V2IA 4UFNA 3K0CA 3B52X 1VSVA 4RO0A 5I7FA 2CNKA 1U3TA 3GA7A 1XCPA 1PV1A 1WXGA 2D0OB 2QTTA 5DX1A 3JZDA 3TQFA 1ZK3A 2HLHA 4ZKEA 3UJDA 2B98A 4TWIA 1SKYB 3BWEA 3Q5GA 4KPUB 5KUTA 4F5EA 1W5FA 3NOVA 4JK3A 5F3WB 4PSCA 3I9NA 5JO9A 2PWYA 1AO0A 4X71A 3E5HA 4S35A 1Z36A 3N1UA 1T2AA 1I4LD 4LHEA 4FR5A 4M9CA 4Q3CA 4RCVA 4BVEA 4XUCA 3A1WA 3QJYA 1XYYA 1UJ5A 1U0OC 3UFBA 4JEUA 4B2LA 2EFGA 2H4JA 2VQ3A 4RVCA 1RWPA 5AW4A 2P6PA 3SVLA 1E4EB 4M8LA 3TL2A 3CVOA 3KO8A 2VSFA 3FFTA 2GHIA 3PSAA 2VSOA 4Q3KA 1L5RA 4YP9A 4JI4B 2A5FA 3RS3A 2W70A 1H05A 2O14A 4NWIA 1XPUA 5JJBA 1WZCA 3U44B 1QRDA 1O9GA 3K8ZA 1WULS 3GLGE 2HA4A 2AQHA 4YR9A 5P8WA 4MUKA 2DYKA 3MTGA 2A78A 5PNTA 1IUPA 4JB8A 1IOZA 2W90A 2XNHA 2ZUWA 3I0NA 3IA2A 4H18A 4HH0A 4HWSA 4XB6B 4HRYA 4NZPA 2H7XA 4RQBA 5TPZD 4M36A 4NONA 5J5CA 1YACA 3CN7A 3CVVA 4RKQA 5FB3A 5GAJA 1EJBA 1OYYA 4FIDA 2ORWA 1SCNE 2EW1A 4HLNA 2FPGB 3KS9A 5FXMA 3I09A 1V16B 1NNI1 3E22B 3TZLA 1UBTS 4IPTA 2E5WA 3HO8A 3D4BA 4XFKA 3CKYA 3RC9A 3G5MA 3G9UA 3V42A 5A03A 3LV8A 1XA3A 5EZ5A 3U39A 3HN7A 5E38A 4F2WA 1QRTA 3SC3A 4MI6A 3FF4A 4P32A 1E4EA 4ZWNA 1UBKS 1HGXA 3K2EA 5AKIA 2YJNA 1QQAA 1K5PA 4D57A 3RVOA 1I7PA 3QVSA 4NS4A 4EGSA 2N1BA 3NUZA 2I7TA 1SUFA 4NY1A 3U44A 1T6NA 2XMZA 3QWIA 3QYAA 2H9YA 4Q1EA 4RCYA 2BJVA 2OK8A 1M3SA 3FKSD 1KP9A 3L7YA 4PRYA 2RGRA 5FF9A 9LDTA 3HVKA 3SG0A 3FOCA 3NH6A 1FQKA 1CLUA 1ISPA 1TA9A 1OH6A 2PSEA 3LIIA 4AKTA 1UMBB 3HO6A 3BILA 3GEEA 1CY0A 3HC7A 1O57A 4U9HS 4XUDA 4CZ2A 2WVGA 1RXYA 1UAGA 1NOJA 4RIGA 4JI3B 1DDGA 2FPGA 2ZSIA 1ORHA 2Y9PB 4KVAA 3BK1A 1V16A 3VYVA 1NPDA 1WB6A 2RGBA 3U3KA 3HUDA 1N3IA 5J47A 5B12A 5FV4A 1MO6A 2B78A 5B7GA 4J3NA 2OESA 1XALA 1JB1A 3HCEA 5LKAA 4CR6A 1K4YA 1XCGB 4ASUD 4XUEA 5LOVB 4YYEA 3BQMB 1EUQA 3T7CA 3TGPA 1TKCA 5ALOA 2Z83A 3A6KA 1OPRA 3EAGA 3PRKE 3EJWA 3QELA 4N7RA 4P08A 4ZO7A 1I1OA 5BRNA 4AMZA 1T9CA 5CT5A 1E2PA 2BEJA 4QDUA 3SZOA 5EVJA 4BMXA 1GCOA 1QH8B 3H5WA 5A06A 4P31A 1I51A 4DXAA 1OI4A 2ERXA 2QQGA 4ZOEA 3VYTB 5IRCD 1H9BA 1ONNA 2CK3A 3AUKA 3U6KA 3PFGA 4BRSA 4YP6A 3V2IA 1YHZA 1SXPA 3UPDA 2GEKA 2YFKA 1DSSG 4HLQB 4GKVA 1UMBA 4N7MA 5DM1A 2OKCA 4Z0TA 3RSOA 5HDBB 4P4TA 5JXHA 2VPYA 2QLFA 3YASA 5JV5A 2X9QA 2ADMA 2GVZC 5B1SA 4NOLA 1KY2A 1DKPA 1RMYA 2BFDB 1H2BA 1A9QA 1S3FA 1XCOA 3KKEA 1XVIA 5GJVC 3NBFA 2JEZA 3KDSE 4IL5A 2YW9A 4D3XA 2AK3A 3MS4A 4L8LA 4EI7A 5M2QA 2NPFA 5LOVA 5CVUA 2JDIA 5G40A 1V3VA 1NVWQ 3KSMA 4S1TA 1YZTA 5ALGA 5FLKA 3GW8A 4AULA 1RYYA 5BP7A 3HCBA 1VKJA 3AZOA 1I3OA 3F46A 3NT4A 4GO1A 4MUFA 1HLDA 2ZRFA 3K4HA 4DWVA 1FW8A 1ZGAA 1XDWA 2WKWA 4Y2UA 1X9HA 3AY6A 1QBGA 3OM0A 2AYXA 1XP8A 4UZEA 5K03A 1QH8A 3GWGA 3P2IA 4B6SA 3S8EA 2F1OA 1HDYA 1YS2X 1QG4A 2ZJBA 3T5GA 2J3JA 4GKKB 1U4SA 2XVMA 5D6NA 4KZKA 4EZEA 1FX0B 2ZRHA 4WERA 2XB2A 5E4YA 2WJGA 3JWPA 4QOJA 4E32A 2FW1A 5JNRA 4TV9F 1TYCA 3NWBA 1Z3CA 1QHEA 1SU8A 4MGZR 4UBOA 5DBHX 2X42A 5FWXA 2IRWA 2PJUA 3FMPB 3U4MA 4LF5B 1NU8A 1PUIA 2WUFA 3ZU5A 4ENSA 4ARVA 1K6XA 1ZN8A 2BFDA 4QOFA 2QG4A 1XVTA 2XZLA 1P3DA 2R6ZA 1CY7A 3H7AA 2DECA 3K0EA 2N75A 3SU8A 4BGUA 2VBGA 2W2XA 2O3JA 4HAUA 2VUSA 3FDXA 3NHBA 3I62A 3D7RA 4V0LA 4RMGA 3FCEA 3PGMA 1G55A 1ZSVA 4HAVA 3LCJA 4C5CA 5HJEA 4E31A 9LDBA 4FBGA 1D04A 4MA0A 1G6OA 1XZFA 3SWWA 5HZGA 4DZZA 4JV5B 1UOEA 3AL3A 3E9ZA 4TMKA 4XWKA 3LQFA 3KVNA 1G59A 4R8LA 1A50B 3WLAA 1FX0A 5E8RA 1QE3A 1V8BA 1ZC4A 1ZNQO 5ALEA 4PNPA 2EJCA 3A4MA 3GJZA 4HDMB 2ZR7A 2YWHA 3B6KA 4MS4B 2Z2IA 3EVZA 3N8DA 3I9LA 5EJ2A 2I4OA 2VDLB 5EERA 4OYLA 3JZAA 1PR0A 1G5QA 4FB4A 4B3IA 5DXFA 5D5HA 1X0VA 4MZDA 1FFBA 5COBA 5HIMA 4D3SA 2Y1EA 3RRJA 2O9JA 4F21A 4UE6A 4LQ4A 3IP8A 2POCA 3SNHA 1WZIA 3PPWA 2BKLA 4WFKA 1B8PA 3JQAD 5DXAA 4H16A 1AKWA 1N1MA 1TE2A 3CWZA 1WSWA 1GGFA 5F7JA 4HXFB 4LYFA 5HIJA 2QU8A 4D9HA 3LOPA 4Y2PA 2W48A 1YDGA 1RFGE 4MGKR 1IBKB 4D9MA 3TOZA 1R74A 1LV8A 2RI1A 2OLKA 1JKFA 1ZQ1A 2EGGA 2XD4A 1EQAA 5GWXA 3ZXUB 1RI5A 9MHTA 2PKXA 5F76A 4BMCA 4EFNA 3IKLA 1NLYA 3RB8A 4FZ5A 1GCGA 4CFZA 3A04A 1I3CA 2O1WA 2IHTA 2JFOA 4GW3A 1G42A 2FRDA 4K3VA 3A06A 1J0AA 3DEFA 2V3CC 1L8QA 2EX1A 1U2EA 5JAQA 1EFTA 1SD1A 4WHMA 4HDMA 1T6XA 4KLRA 4LK2A 4JVMA 4MS4A 4DSOA 3M81A 2DRIA 5ALNA 3KG2A 1YQWA 5DF1A 3S1SA 1X1QA 2MT9A 1BX3A 2WKSA 4FYHA 4NENB 1NSFA 2ZRCA 2ZSKA 3AJ8A 3RHFA 1AY0A 1SOUA 3IIMA 3MC1A 4LHXA 4B48A 3WGUA 1JKMA 2CYAA 1TKAA 1TO6A 2XCTB 2QR3A 4RF2A 1SVSA 2H7CA 3STXA 4RF4A 4XARA 4B47A 3PGJA 4TLAA 5HKBA 1NSYA 1NYLA 2V0NA 1KQNA 4PLPA 4M54A 1BDHA 3PKJA 2IVZA 4FHCA 3DEYX 4O59O 3MT7A 4RM2A 4BO0A 3ZGZA 1MVNA 1CUEA 4M98A 1ULBA 4MP3A 1KK0A 2ZS9A 3TRKA 3W7BA 5AJZA 3VX3A 2ZTSA 2IQIA 3M1YA 3K6JA 5B58T 2W2MA 1DJLA 3FPBA 1VHDA 4ZOLB 5DNCA 1IN4A 3BJRA 1KMQA 3L92A 1NMSA 3PDJA 4RENA 1JL3A 3RU9A 3VMMA 2I2AA 8AT1A 5WRFA 3H11B 3IIKA 2C4UA 2H0AA 4IKOA 4XFJA 1PGPA 4X1KB 3QMMA 3OHSX 4WV3A 3ZYCA 4WZAE 3TNDA 4ZCPA 1U6KA 1FQOA 1PFQA 3QEJA 4PICA 1XMJA 1II8B 3OBBA 4LOKA 4EP1A 4HT3B 5AM1A 1IHPA 2FN4A 4FOOA 4NENA 3H2GA 1Z0DA 4ZO6A 3OQJA 3P96A 3VKUA 1CJVC 3UJ3X 4ZGGA 3BICA 2HD4A 2ZBFA 2R47A 5BSWA 3ZE2B 5KNDA 5HOQA 3V1MA 3G2PA 5LDGA 3ZU4A 1ND5A 3KSBC 3H7IA 1NC1A 1J0EA 1LBSA 5AICA 1Q0SA 2WC1A 3G5TA 1ISHA 4J1SA 3V7FA 1OWNA 4LQDA 3D4OA 1EK6A 1ZGBA 1P6UA 1TCUA 1TX4B 1X7DA 1Z74A 4MS1B 3GFVA 2CCKA 4K6MA 3BRQA 3ROPA 5KVVA 5KI6A 3DEHA 3FMVA 5FLYA 1XRLA 2DZDA 3EH2A 3OECA 3CT6A 3QW2A 4QUEA 1JHMA 4ZOLA 5CLHA 5CU7A 4IMIB 2PKWA 5KSZA 1KK1A 1Y3CE 1WSDA 1Z0UA 3H11A 4NICA 1UL1X 3RVNA 2BEUB 4X1KA 1USKA 4KAFA 3VH2A 1GLNA 4DV4B 4TTAA 4UDYX 3R76A 3UEOA 4ZEXA 1II8A 3GRCA 4XM0A 3LQRA 2FN9A 1DHRA 1LDGA 2JFWA 4BKRA 5B30A 2QLLA 3MWGA 1XQXA 2PVCA 2D54A 5HILA 4UULA 3IBTA 1L9KA 1MV8A 4DMCA 4QBTA 5EZYF 2ISSD 3DMGA 4MUNA 4W7IA 4W63A 5DGDA 2AXPA 1C1DB 1USUA 2BBWA <