2YHIA

Trypanosoma brucei ptr1 in complex with inhibitor wh16
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
267
structure length
248
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploiting the 2-Amino-1,3,4-thiadiazole Scaffold To Inhibit Trypanosoma brucei Pteridine Reductase in Support of Early-Stage Drug Discovery.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE, PUTATIVE
total genus 90
structure length 248
sequence length 267
chains with identical sequence C
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2011-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2yhiA00
2WD8A 4MIYA 1YDWA 2WD7A 2Y67A 2Y0CA 3DZIA 3I1JA 2O2SA 5A9SA 1NQTA 4WCFC 5DCYA 1U3WA 1XR3A 2IEDA 4B7CA 3S2FA 1WDLA 1H5QA 5CDSA 3TF5A 1UR5A 1VPDA 1T4DA 5FFFA 2QQ5A 4NMHA 4XGNA 2X7HA 5I9NA 1YQXA 1JKJA 1LDEA 2O3QA 4YQZA 4CV1A 4Q9NA 2P9EA 2GGSA 1E3JA 3TOZA 1X0VA 2NU8A 2X9VA 3W8FA 4DPLA 3TL3A 4LVCA 3ZNPA 3MOGA 4J6FA 1NYTA 3GF4A 4CM6A 1CQJA 2HCTA 1ONPA 2YDYA 3LSYA 5IXSA 1C0IA 2FSSA 1OOEA 2B4RO 1MB4A 3AM3A 2BFAA 3T7CA 4DBVO 2YFHA 3TDKA 4W9NA 5HA5A 3K2BA 4CMKA 4IDCA 3WJAA 4FD3A 1RM0A 1VSVA 3G49A 3I6QA 2LDXA 1NR7A 3FNGA 4CJXA 4IDBA 2P91A 3R3JA 1ZK2A 1NFFA 4MKRA 1A72A 2UV8A 1FF9A 2I76A 4DVJA 3DC2A 3VDQA 5C7IO 1WW8A 4OYRA 4BNZA 3B1JA 4F3YA 1I5RA 3WQQA 3RI3A 3TQHA 3GHYA 5AXBA 3RBZA 1PQWA 2H9IA 4XD2A 1FJHA 2O23A 4BKOA 4TZKA 1AHIA 5FF9A 4F6LA 3RUFA 3C8MA 3IC5A 3JQ6A 4J16A 3S55A 5LCXA 3AWDA 2E49A 5BNIA 3ANLA 4U5QA 3W4IA 4IQ8A 2WYWA 4PFJA 3G79A 1PJ4A 1VLLA 4KP7A 4NBVA 1AHHA 3JQFC 4JX8A 1MGOA 2QIOA 3S1LA 5B12A 4YBZA 3W1VA 2Q49A 3PWSA 4IXTA 3D5TA 3FPLA 1B15A 3EZLA 4BO5A 2VNSA 4PLWA 4DL9A 4AJ1A 1Q0QA 4PG5A 4ND5A 3OM9A 3WR5A 1X15A 1LEHA 4IDDA 4P38A 1V35A 2W90A 2TMDA 3NGLA 2BI7A 3L4BC 3AJRA 2GYYA 3DFUA 4BMVA 4B3JA 4G5HA 4PVDA 1WWKA 4OMUA 1JVBA 5A06A 5JE8A 4FGWA 3TSCA 5DZSA 1QKIA 4B8WA 3ZWYA 4R69A 5CG2A 2VZ8A 1VL8A 1T1SA 1X14A 2NLOA 3DBHB 3CPSA 3K96A 3QWIA 4G2NA 3ZNOA 1A7KA 1DIRA 5GY7A 3OMLA 4RPHA 2DBVO 3AU8A 4IIVA 2X0NA 5IXYA 4JQCA 1BGVA 4PZEA 5L4NA 3O26A 4QTZA 1EVJA 4PLCA 4PLZA 1IPEA 4GL4A 3BMQA 4KZPA 4BO7A 1UUFA 1PJSA 1H6AA 5I9LA 1PSDA 2PZKA 1N2SA 3G0OA 4GQAA 3TPCA 4BNNA 4BNTA 4RVUA 2PD4A 5CPFA 3HN7A 8ADHA 4K6FA 4NZ9A 3KSZO 3DONA 1BDBA 2VT2A 4UEKA 2RAFA 4BNYA 5KVQA 2B35A 3IDSA 4CM4A 2E48A 1A9YA 1ONOA 1KBZA 1PGOA 3I9LA 1BW9B 5ADHA 1ADCA 4J9UE 3D3WA 3ROQA 3L0DA 4MVJE 5BSGA 1A4IA 1K6XA 5F3RA 1JKIA 5U9CA 3ABIA 2PFGA 3VZQA 2A94A 3AI2A 5T67A 3ZNQA 5AXCA 4KUGA 1HE3A 1Z45A 3P7MA 3NDRA 4LSWA 4XGIA 1PR9A 4TWRA 5JDCA 1C0PA 4N18A 4CLRA 2B37A 4FBGA 5HS4A 1ULUA 3QW2A 4YJFB 3ASVA 3UGKA 4R16A 2AG5A 4WNCA 5JDIA 4HUJA 4LW8A 3MWEB 3AFNA 4FIZA 4FPXA 4Z9FA 4XIYA 2AQHA 2IXAA 2HRZA 1RWBA 1XHLA 1I3LA 3OIGA 4YVFA 3VOSA 3AW9A 1RKXA 3QVSA 1E6EA 5I7FA 1NPYA 4B4OA 1YL5A 4YT8A 3JQ8A 3WSVA 3A1NA 4DYDA 4HFJA 1Y8RB 2HK7A 1E92A 1PJ2A 1PR3A 4PLFA 4I5GA 3E9QA 4GBJA 5FI3A 1T2DA 4KTVE 4L8VA 5A3VA 3JQ7B 2BFOA 1NVMB 1LRLA 3HDJA 3OF2A 1BHSA 1GYRA 1MC4A 3L4SO 4TROA 1Y5RA 3TZCA 4BGVA 4CMJA 3SVTA 1XA0A 4EZBA 2ZIZA 2IXBA 4BOYA 2QRLA 3PHHA 4B3IA 4TVBA 2XXJA 2Y1OA 2DU8A 3UF0A 4EJ6A 1ZXBA 1ZMOA 3WICA 4ZRMA 2OBNA 4TRNA 3E1KA 1B7GO 4OIMA 5IN4A 3PZBA 5IN5A 3GFBA 4PG8A 1U2DA 2O3JA 3Q2KA 1E1KA 4Q3BA 3VVCA 4DC0A 1BWSA 4HP8A 4BVAA 3F4BA 3RU7A 1DC5A 3ETEA 1W6UA 3AK4A 4U6QA 1YBMA 2I5PO 1WDKA 1IZ0A 2CMDA 2FY8A 2VT3A 2AEMA 4ALJA 2IYOA 4OO3A 5JW6A 4A0SA 2F1KA 4BO0A 3W6ZA 1JWAB 3AOEA 1XLTA 2JJYA 3PDJA 3ZCXA 4A26A 1J49A 1GQQA 3KM0A 3GRKA 3JQBC 1ZNQO 4WK6A 1UXJA 3VVBA 4N5MA 2J5QA 3KSUA 3RUEA 5DULA 3WGZA 2B4QA 1P3DA 1T4BA 4D3DA 1M75A 2W98A 2IODA 1E3WB 1MA0A 1TXGA 1UAGA 3RKRA 4EITA 1DSSG 1X7DA 1L7EA 4YRAA 3TJRA 1B8VA 4EEZA 3GVCA 4CQLB 3WBBA 4PCVA 1P1FA 3OEYA 2BGMA 2DTXA 3OQ1A 1T2CA 2ZB4A 5THQA 3RIHA 2O7SA 3HZZA 4D41A 4W99A 3V1TC 1R12A 1HF3A 3AM5A 3LT1A 2IDZA 4CUKA 5HTOA 1CDOA 1E0DA 4NJOA 4TQGA 5BSHA 2C07A 4JBIA 2CVQA 1V3TA 4S1VA 4YXFA 3KEOA 2AE2A 1Y7TA 3DBLA 2D2IA 4YAEA 2IE0A 2G82A 2BFMA 1AGNA 1NX6A 4JLWA 4MP6A 1NTOA 1WMAA 1P9LA 2RHRA 1LQTA 3ZDFA 3SXPA 5CEEA 1R4NB 1UXKA 1IB6A 1NVGA 3JYOA 1AUPA 1P33A 3FD8A 1LA2A 1P1JA 3QRWA 4MVJP 5CDUA 1Y5MA 3L6DA 1ISIA 1DC6A 4PLHA 5H82A 3ROMA 3W4KA 1I36A 4RF5A 4MJLA 1TI7A 1F0YA 1I3NA 3FRJA 4CV0A 4FOSA 3CEAA 4FFOA 2Q4EA 4NK5A 4OGWA 2OHXA 4RV9A 1H2BA 2O4CA 4S3MA 1YONA 2ZQZA 3DZJA 3ENNA 1P31A 2JFFA 1EZ4A 1ZEMA 2W8ZA 1GADO 3DMTA 3JD3A 3U4CA 1IUKA 3GH3A 2V6MA 4YT2A 1H0KA 1KIFA 3WFIA 9LDTA 4IDAA 1Q0LA 3ZWOA 4YDRA 1BXGA 4HX5A 4J4TA 4UUMA 5ITVA 2FPIA 3RUIA 2NUAA 4ZQFA 1H9AA 1SPXA 2CD9A 3TN7A 4MKZA 2VZ9A 4O1MA 3FR8A 4IXWA 3H3JA 2VCYA 3KYCA 3R3SA 4IS3A 3EAGA 4CM9D 3RWBA 1T24A 5BNTA 4OQZA 4OH1A 1SB8A 2HRBA 4QO7A 3A28A 4CL8A 3HSKA 5K6AC 2YDXA 3M1AA 3DEYX 1ULSA 4JROA 3DOJA 4NBWA 4NG5A 4AJKA 5L45A 4CL3A 4L74A 3DWFA 3BMOA 4IQGA 4IZIA 3VTZA 3NJ4A 5C7LO 3BTOA 2PR2A 1E3LA 1XGKA 4PLTA 4P4LA 1I2CA 2WYUA 1EDOA 1P1HA 4K9DA 1C1XB 3ZU3A 4XR9A 3RROA 2IZZA 1KVRA 1UJMA 4MP3A 2Q4BA 2XAAA 4K26A 2EJVA 2DT5A 3PJEA 4RDHA 3L6EA 3GVXA 3DFZA 1W73A 3V2HA 1JA9A 3ZW8A 1AXEA 1PGQA 1DIHA 3GDFA 4KUHA 2C0CA 4BKQA 3JQAB 3AM4A 1QP8A 1MP0A 5I7EA 2DLDA 1ZSVA 3WMWA 3EC7A 3JTMA 2GO1A 1EMDA 4I9UA 3OP4A 2EJWA 2TMGA 2YHIB 3F47A 3U5TA 1T2EA 4ITUA 5BT9A 4R5MA 2FZEA 2DM6A 2WEKA 3AOGA 4DA9A 5TQVA 3W8EA 3W8DA 2RH8A 3G1UA 4R1UA 4FFLA 4B79A 3D4PA 4LSMA 1G0NA 3BZUA 3QJ5A 4P4GA 5I9MA 3V1UA 4ALMA 1JTVA 3S8MA 5L7TA 3ZWAA 3JD1A 4H3VA 1NASA 3GHHA 2VWHA 5ICSA 2Q1WA 4QSMA 3GG2A 2PZLA 1Y8QB 3W6UA 1MFZA 4CM8B 4DQUA 1LDGA 5KJ1A 2CDAA 1Z73A 5HS6A 1SBYA 4DIFA 3N74A 1X7HA 4HV4A 3ANMA 1KOLA 4J7CA 4KTTE 3QHAA 4ND1A 1SEVA 5KKAA 2GPTA 1KY4A 1LLDA 1UAYA 5A4DA 1SOWA 2PWZA 3GK3A 1QV6A 4R51A 3VH1A 4BNHA 4CLDA 1P0FA 3KBOA 5GZ1A 3ZWNA 3AUTA 1X7GA 2NVWA 3EGOA 4YRDA 3JYLA 1E7YA 3W4JA 4I5DA 2BKAA 8LDHA 5IFLA 1F8GA 3IP1A 5DOZA 4EUEA 5IDQA 2EG9A 3RAJA 4YA6A 3IIEA 1IY8A 4BKRA 1YO6A 2C2XA 4XIJA 1LNQA 1U8FO 2O7QA 3VH4A 4R3WA 4D45A 1PWXA 5KJCA 3L07A 3GVPA 2YV1A 2VNAA 2Q1SA 1OC4A 4OL9A 4XJTA 3ZHZA 3L6OO 1RM3A 4E0BA 3SX2A 5FWNA 3BYZA 4CV2A 1QSGA 4RPLA 2O3SA 1I32A 4CLRB 2GF2A 4R9RA 3WGIA 2UUOA 4YJFA 1S7CA 4PLGA 5I7VA 3GLQA 3HQ4O 4BNFA 1DC3A 1LQUA 4XQCA 2HMUA 4XYEA 1J0XO 1ENPA 3CIFA 3INGA 1Z75A 5DT9A 2HU2A 4IDGA 2FP4A 4AL4A 4N7RA 2G5CA 1U5CA 3ICPA 3AUUA 3K92A 1O6ZA 4NJMA 5JYEA 3FCOA 1ZK0A 2GN8A 5L51A 4BL5A 4XYLA 1N5DA 2VWGA 1J6UA 1UDAA 2X8LA 3IOYA 4IJKA 4QXMA 1SB9A 2OFPA 4E30A 3MJSA 2QG4A 3JQ8B 3JQFA 3PYLA 5TJHA 3U4DA 3VH3A 1Y8RA 2P9CA 5CFZA 1ADGA 2O4UX 4OKIA 4FW8A 3PQFA 4GWKA 4ILKA 2RBEA 2X4GA 5COAA 3OBBA 2UDPA 1E3WA 5EPOA 3S2EA 3GGOA 3NYWA 4FFRA 4B4UA 3U09A 5AYVA 3L4BA 2AW5A 4BNKA 3DOOA 1PJLA 2FSVA 1LBEA 2JL1A 5KOIA 2CZCA 4YJGA 1GZ6A 1YDEA 5TSDA 3QWAA 4CLEA 2FR1A 1CWUA 2DTDA 3KTDA 3VC7A 4RLSA 3DL2A 4J2HA 4PG4A 4QFDA 3GUYA 4E21A 1MLDA 3WGOA 4ZHSA 5HM8A 4YAKA 4C4OA 5BR7A 4Q3CA 4PLYA 1JU9A 5TNXA 1YGYA 4GKBA 4BV8A 4W4TA 4Z0HO 4MVJM 3NGXA 4XZ3A 3H2SA 3FF4A 1LSUA 3NDJA 5B4UA 4HWKA 4RORA 2NV6A 4BKPA 1DRWA 3F3SA 2EGHA 2DTEA 2YJZA 3PLNA 4TRJA 4FFNA 2WE8A 4IJUA 2WMDA 3BAZA 1CYDA 4O59O 2XF8A 3HG7A 4CM3A 2P2SA 3FHLA 3AUSA 5KJFA 3OJEA 1ZK1A 2X58A 3KYDA 2AQIA 4AICA 1F17A 1QV7A 3ZV5A 1WAMA 4OAQA 1Y9EA 4WPGA 2HMSA 1DO8A 1BXKA 3RUHA 2DAPA 3Q9UA 3ZGYA 2UAGA 1Q7GA 3F1LA 3KLPX 1GEGA 1U9JA 2PTGA 3PHLA 1WPQA 1JDJA 4IS2A 4L9RA 2XXBA 4ZQHA 4BV9A 1KEWA 6LDHA 2C20A 5JDIC 2W2LA 2BLLA 3WGHA 3CINA 2BH9A 4MVJA 4NQZA 2VRBA 1Y9AA 5MDHA 4WLEA 3Q2IA 2JAPA 1OC2A 1NP3A 2GN4A 2QX7A 5LDGA 2QZZA 1DOHA 1GQYA 1PEDA 3TZ6A 4E5NA 5IAAA 1HDXA 2PKQP 2EW8A 4RCVA 5LDHA 1I3MA 2ET6A 3BHJA 4YACA 4X54A 2DVMA 2VTDA 3ORFA 4GI2A 1GV1A 3DDNA 3IUPA 2FRDA 3QVXA 2PKQO 3ZWXA 2VYVA 5EIOA 2VYVD 3FWNA 3WQSB 5DCUA 3DHYA 3VDRA 1IL0A 4IINA 2ZTUA 2IRWA 3AU9A 1N1GA 3B20A 2GUGA 5A5FA 3P2YA 2WTBA 2FZWA 2PK3A 2D59A 3QVWA 2VHYA 3KVOA 3L77A 3U9LA 3PPIA 3H5NA 4NFHA 2JFGA 4RF2A 2W2LD 3DZKA 4J1NA 5EQFA 4E2XA 3EK2A 4PIVA 1LLUA 2OP1A 1MFPA 3F5QA 3UICA 4NNJA 3RQSA 4XA8A 3SJ7A 3D4NA 3E6AA 2X6TA 1LTHR 3JCZA 1C3VA 1KERA 3S2GA 4QFCA 3KUXA 4GGOA 2NVBA 4R4JA 4Z0PA 3K8ZA 1XQ1A 1GV0A 5EN4A 1RPNA 1BTOA 4UVHA 2B5VA 3E5RA 1DFIA 2Z1MA 4CMIB 1FDSA 2QRJA 1K5HA 2GN6A 4TSKA 4WLVA 4L0QA 1PGPA 2J3KA 4UVDA 2PGJA 3FBTA 4Q3DA 4JXKA 4R1SA 4IIUA 1T2FA 3P5SA 1LSJA 2UVDA 5TS3A 5JBIA 4ALNA 4IDEA 5CG1A 2AEFA 1YOVB 2CVZA 1NQOA 1PJBA 1YKFA 3JQBA 3ZHXA 4JJGA 1LLQA 3D5QA 4FGSA 4L75A 4D0SA 2ZYGA 1M6HA 1GPDG 2HDHA 5CDGA 4QECA 4EUFA 3WTCA 5EMHA 1GTMA 4MP8A 1UDCA 2QYTA 2PZJA 3KETA 3OJOA 4B4VA 4CM5A 5IG2A 4LCEA 1ZVMA 1QXSA 2GD1O 4ID9A 2VHWA 1PS8A 2Q2WA 1M6WA 1QYVA 3PK0A 4K28A 4L4SA 3I4FA 3BMOB 2FWMX 2I9PA 3ITDA 3K31A 1HE4A 3PIIA 1B14A 3ROPA 1CERA 2Y1DA 3H9UA 3I9NA 1GPJA 1IPFA 1PTJA 3FSRA 4UVGA 4WECA 1FDTA 3IP3A 2I3GA 3JSAA 4KQWA 1CETA 3KEQA 4YJHB 4BHTA 1LJ8A 2I67A 1IULA 2WWRA 2YQ5A 3ZWPA 1VM6A 1A27A 4BMSA 1RYDA 4I5FA 2C82A 3PGXA 1RM5A 1UXGA 3E9NA 2AMFA 2FR8A 3WG9A 4FJ1A 2YV2A 3JQAA 2B5WA 3I83A 3LU1A 1XG5A 4M54A 2Y1FA 4GVXA 3DHNA 4BNLA 5TC4A 3HDQA 4EDFA 1ZK3A 2VUTA 3GNSA 1LU9A 3KV3O 1M2WA 3EMKA 3RFVA 1TA4A 4BNGA 4JN6B 5KVSA 1B0AA 1HDRA 2NTNA 2YV3A 1Q1NA 4YAJA 3TZQA 5TRTA 4R01A 4O0LA 1A9ZA 1JN0A 1KEVA 2EF1A 2EP5A 2GSDA 1AN9A 5G4LA 2RH4A 4H7PA 2QHXA 3SJUA 3OIDA 4M8SA 5FYDA 4UREA 1VKOA 3BTUA 4PLPA 1ZMTA 1YB4A 3IJPA 3ONEA 4KWHA 3UKOA 5K0ZA 5THKA 4J1QA 3FI9A 4L4RA 3PJDA 4GX1A 4H15A 2EGGA 4NIMA 1K3TA 3ZV6A 4RVFA 5L40A 5IF3A 4RQTA 1NXQA 3LQFA 1HYGA 2O50A 1PJCA 1EE2A 1YE3A 3WNVA 4GSKA 4ALKA 4Y8VA 3H5AA 3PZRA 2C7GA 1DHTA 4R3NA 3PVZA 1GFSA 1JKFA 1F8FA 4KWIA 5CAEA 1PGNA 1IOLA 1EE9A 3PHJA 4R9SA 2WSBA 3ROKA 4OXKA 4JBHA 4TRRA 4XYMA 4RPKA 5A3JA 2X23A 3C3XA 3GZNA 3H9QA 1LC0A 4BNWA 2Q2VA 5I7SA 2RIRA 5C7OO 1MXHA 1C1DA 2Y68A 4RF3A 5JC1A 3RD5A 4IMPA 3DXFA 1KVSA 3LT2A 5K6AA 1LXCA 2CY0A 1G0OA 1ZSYA 3ADOA 4FSHA 5EESA 4Z3DA 4ND3A 1GD1O 3RKUA 4RGBA 3ZNNA 3QY9A 4IBOA 1KS9A 2BD0A 4A5OA 3WIEA 4CQMA 3DTTA 3F5SA 1DIAA 4ZGWA 4M1QA 1GEEA 2ZATA 2BI8A 4Y6RA 2J3HA 3PYMA 4JBGA 1O95A 2JCXA 1I3KA 4ZD6A 4HFRA 5KJ6A 4RO0A 3HNPA 4KDFA 2HSDA 4MINA 4TRMA 3VAZA 4UAGA 4BGIA 2ZB7A 4CUZA 1U28A 3GN2A 1PL7A 1DXYA 3HJAA 3H4VA 4C7KA 4XB2A 1Q7BA 2V6GA 2HLPA 3JQAD 5KWEA 3GEMA 3GNQA 3UVEA 4U0JA 1TT5A 4M49A 4XKJA 5C3MA 1ADBA 1PJTA 5A9SB 3VPFA 1P44A 1ZEJA 2C54A 4NFYA 4RLHA 2DPHA 5JAZA 2Y93A 3U0BA 1F12A 3IKTA 3WGTA 3NDIA 2GZ1A 1P0CA 1MG0A 1MX3A 3OFSA 1Z6ZA 5G4KB 4GSLA 4XQGA 1ENYA 3D0OA 1VE9A 2I65A 5JLAA 3U49A 1HT0A 2B36A 3NRCA 4J2OA 2JAHA 1HEUA 1WZIA 2I66A 1EVYA 4OSPA 3WOHA 3LLSA 4FN4A 4Z0TA 5TJ9A 2EV9A 4BO1A 1U8XX 4CV3A 4M87A 4BB6A 5F1OA 1VSUA 1EQUA 3LC1O 2JCVA 1PZFA 2CDBA 4ROSA 2NQTA 1XSEA 1PJQA 3PQEA 2W4QA 1LRKA 5DBFA 3M2TA 2G0TA 1PS9A 4CPDA 5EINA 3GPDG 3DB2A 4M55A 2ZQYA 4GWGA 3IQDB 5AQ1A 4GLOA 2A35A 5L53A 1U7HA 2YHIA 3QWFA 1EUZA 1E3EA 3ZWVA 4B7XA 2VUUA 1O8CA 1X0XA 3P19A 3BTSA 4W7HA 3WBFA 7ADHA 5IDXA 5B37A 4NI5A 2Y1CA 3MCVA 1N8KA 4BNVA 4ALIA 1UDBA 4MPDA 1K6JA 3G1TA 5G0SA 5JMWA 4Y67A 3D64A 4CM8A 3WNQA 1XKQA 1EEHA 1WDMA 4E5MA 1O0SA 3BMCB 5GZ3A 1ZSNA 2IZ0A 5DBGA 4JIGA 4RVGA 2WYVA 1WZEA 4HNHA 3WFJA 3GVHA 2EKQA 4U8GA 2VWPA 4N54A 4PVCA 4UUOA 1U4OA 5G0UA 1EFKA 5JCJD 4EGFA 3GAZA 1GAEO 3I9OA 5I8ZA 1GUFA 1NWCA 2JFHA 1NNUA 2C29D 1NFRA 3RBVA 2AA3A 1YL7A 2EKPA 2Q50A 4QT0A 5A9RA 3E8XA 3ENKA 4OJNA 5JXWA 1EQ2A 3QV1A 1ZIDA 3AY3A 3PWZA 2SCUA 3PXXA 5EJ2A 3ZV3A 2HKIA 5FEUA 5MGBA 2GCGA 2OZPA 3T7EA 3BTVA 4CMGA 3DMTC 4PZCA 3OECA 1A71A 1KYQA 4R5HA 4JP3A 2OO5A 5JY6A 3K6JA 1GY8A 3BA1A 2PZMA 2NADA 4LK3A 5JMPA 1B8UA 1QYCA 2DBZA 4INAA 1DBVO 1E7MA 3RC7A 2VUSA 3MWDB 3PJFA 2CUKA 1VI2A 1S6YA 3JYPA 3QA9A 3LYLA 3BMQB 3U4IA 1QMGA 4WCFB 3KRTA 3ZWWA 1GZ3A 3IS3A 3KLMX 3LZ6A 3L9XA 2EERA 4CLOB 3VTFA 1N7GA 1FXSA 4BO6A 1HZZA 3Q0EA 1F14A 1ZW1A 4GVLA 5U1PA 2YYYA 2VHZA 1N9GA 2Y05A 1UP7A 4QO8A 2POQX 1UP4A 5CEFA 3VPHA 4E31A 1EBUA 3GFGA 1Q2XA 4J90A 3SC4A 2NACA 3F4LA 4II3A 3ASUA 4HADA 3KB6A 1EK6A 2DPGA 1X1TA 3DHEA 4ZQBA 1R15A 1DFGA 1KVQA 2P4QA 2BHLA 4OOFA 3WGQA 1V0JA 2V6FA 4TZTA 1WXDA 1Y1PA 3SC6A 2VZ0A 2VTEA 5ER6A 2HO5A 2GZ3A 3K5PA 4E33A 4WKGA 1QLJA 3C1OA 1ZJZA 2Y1EA 4XGKA 5U4QA 4IUYA 1SCUA 4Q3EA 2E82A 2HMVA 4YT4A 2AHRA 1CQIA 2A4KA 3V2UA 3PQDA 3GMSA 1JQBA 5KVCA 2FHSA 4UULA 2H6EA 4IPTA 3MJEA 9LDBA 4Y6SA 1BSVA 3ZHYA 2CFCA 4D46A 2V7PA 3JQ7A 1ADFA 3INRA 3NTRA 5AXDA 4YJHA 3AI3A 4R41A 2E6UX 4W6ZA 3MJTA 4Z9YA 3RCBA 3FN4A 1HRDA 5L95A 3OICA 3RU9A 3OJ0A 3RUCA 4E6PA 1O89A 2XPCA 2DKNA 4GMFA 2O3TA 2BMAA 1NFQA 1R0SA 3HADA 3BMNA 1L1FA 4NU5A 2R2GA 3EY4A 1FK8A 2JD1A 4RPJA 1NAIA 1HSOA 1V8BA 3O4RA 4Z6KA 1C0KA 4R54A 4ESOA 2WDZA 4QX6A 1K0UA 3WSWA 5B1YA 4EJ0A 4PRKA 3DZFA 3QVTA 3H5RA 1ZUD1 3U4HA 4J7UA 5L4LA 5F1PA 4MVJI 1A5ZA 3PP8A 1XQ6A 2HUNA 2HK9A 2GRAA 2JCYA 3PEFA 3ETGA 3GGGA 1UZLA 5KVVA 2X0IA 4TKMA 3VPGA 1P74A 3H7AA 1M76A 4U6SA 4PLVA 1BRMA 4L73A 1HKUA 4IZHA 1PWZA 1ZKMA 3CE6A 3JD2A 1HDCA 1ZBQA 4RJTA 3B1FA 2PGDA 4PZDA 3MZ0A 3R6DA 4GX5A 1I01A 3GEDA 1ISMA 1TT5B 3C7AA 1LX6A 5TT0A 1T2AA 2G76A 5C5IA 1ZJYA 3MEQA 2YZ7A 1QG6A 1WMBA 1ZXLA 2GDZA 1E6UA 3I5MA 2I6TA 3JQ9A 4CODB 5KKCA 3E9MA 4YJDA 4I8XA 5EQDA 4J1TA 1PZGA 4BNMA 4DYVA 1GR0A 3GZNB 4E2WA 2P5YA 1LRJA 1Z82A 1VRWA 3LF1A 3OQ6A 4CMHA 2C2YA 1Z74A 1K6IA 4MOWA 5JO0A 1GUYA 5IDWA 3I52A 3QQPA 5IZ4A 1AE1A 1LDNA 1UXHA 1GDHA 4FFPA 2D3TA 1HYEA 5IZCA 5JC8A 4NH4A 2X22A 4YB8A 5JO9A 2Q1TA 4B4WA 4RZIA 5HRUA 1QR6A 3C7CB 4BGEA 4RVDA 3DBLB 4BUCA 3CTMA 1FDVA 1H93A 1JWBB 1O9BA 1PIWA 3CXRA 4CMEC 1ENZA 4E5PA 1NR1A 2WE7A 2NU9A 1MC5A 3KSDO 1G6KA 4F6CA 5L9AA 3INTA 3OHSX 4LRSB 4W82A 4EUHA 1IZ9A 2X9GA 4D44A 5TLSA 3GMDA 3UOGA 5J23A 2J5RA 2GZ2A 4YT5A 4Z3KA 3BXXA 2EWMA 3ZWBA 1HE5A 2VHXA 2ZTMA 4FS3A 3QVOA 2P5UA 3Q6IA 1QYDA 3COSA 5ILOA 2BFPA 3OJFA 2HQ1A 4BO8A 3DTYA 4MIOA 4UEOA 4XRRA 5ES3A 2P4HX 4J91A 5G2OA 4XDYA 3WJ7A 4DUPA 4WOKA 2DFVA 1XDWA 2PGLA 4CMAA 4DIBA 4OKNA 3RSHA 5H83A 4DC1A 3JD4A 1UZMA 2HK8A 1JVSA 3OH8A 4RQUA 3JQCA 2V6BA 2H63A 1D3AA 4IQ0A 4ONEA 4CQMD 4J3FA 1BXGB 3GR6A 4AJEA 2ZYDA 4YAIA 3GAFA 1Q0HA 5T8KC 3UW3A 3VZPA 2UYYA 3G17A 3GY0A 2X86A 5JS6A 3L9WA 4J1SA 3H9GA 3LC7O 2WM3A 3DQPA 4XCVA 3PJGA 3UHAA 4MVJH 4AJIA 1E5LA 2YFQA 2X5KO 4XWYA 1VC2A 3IKVA 4EW6A 1DJQA 3HB4X 1U3TA 4A73A 1PGJA 5A5EA 5HWSA 2CDCA 1BW9A 5KNLA 4XYBA 2PLAA 4YWJA 3M2PA 1NPTO 4LMRA 3QP9A 4FFMA 1ORRA 3O38A 3PLRA 3GN1A 1FDWA 3DAGA 4YCAA 1KETA 2HMTA 5TF4A 5GMOA 5F21A 3DR3A 2QRKA 2OXIA 1H6BA 3WIDA 2GR9A 5T5QA 1UP6A 4FB5A 1NVTA 4WOJA 3IJRA 4J4BA 1QYXA 4EEXA 1NWHA 2IZ1A 4ZRNA 1E3IA 3LDHA 2UUPA 3WYCA 2DBRA 1YB1A 3SBOA 1E7SA 3CZRA 4E5YA 1MG5A 2NNLD 3GOHA 5AOVA 1XIVA 2Y66A 3PYXA 4MO2A 1W0CA 5TGDA 4GAEA 4A27A 3B70A 3BMCA 4E2ZA 3I3OA 3ZU5A 5ITWA 4U7WA 3VHRA 1GZ4A 1DJNA 1U7TA 1OBFO 2H5LA 4WJZA 3STHA 4YAGA 3E18A 3B6ZA 3WGGA 3EVTA 4ND4A 3BHMA 4BO4A 1DC4A 4BKUA 3NKLA 1U4SA 4P4NA 1BDMA 1G1AA 2Y99A 1HSZA 3UAGA 1ZK4A 4IDFA 4PG6A 4G65A 3RC1A 4M86A 4BMNA 2X9NA 4XQ9A 1B3BA 3DAPA 3FNHA 3EVNA 1E77A 4AJHA 3FTNA 1FMCA 1AXGA 3MJ4A 4Q39A 4JGBA 2FPPA 4J49A 5AVOA 3NT4A 1ISJA 3HN2A 3E48A 4A10A 2EXXA 5COBA 1T1RA 1K89A 4W7IA 2ZJ1A 3CZMA 4CR6A 4GPD1 3AY7A 5BQFA 3V1YA 5DCWA 4PRLA 4TMFA 1R16A 2Y1GA 1SNYA 3DZGA 3C1AA 1IYZA 4FCCA 3VPSA 3ULKA 5COQA 2Q99A 4BNXA 5JAIA 2R6JA 4UVEA 4K1LA 4DPKA 1GCUA 4MKXA 2B69A 3WDSA 4WCFA 1R4MA 2OGUA 3O8QA 3QIVA 3UCXA 3UCFA 4C7JA 2F00A 5KCZA 1U3VA 4OM8A 3HWRA 5T57A 1DIBA 4CLOA 1RYEA 1E5QA 4DXHA 1EVIA 2CVOA 3PHGA 2DFDA 4JJFA 4ZA2A 3RUDA 4O5OA 3VH2A 1O5IA 5A03A 1N7HA 5CDYA 3H65A 3JQGB 4UUPA 3WWYA 3T4XA 4JP2A 2VYND 3FR7A 3F46A 3GT0A 4IMRA 3VPXA 3IMFA 3DBVO 1IE3A 1DRVA 2YW9A 5DN9A 1KEUA 5F5NA 3OA0A 2Z95A 3NT5A 3D1LA 5JNLA 5CDTA 3FNFA 3BHIA 3GUCA 4Y9DA 1LSSA 1EVZA 3ZWCA 3KYBA 3KO8A 4CMCA 2EIHA 4Y98A 2H1SA 5JY1A 3JV7A 3MOIA 3Q3CA 2W2KB 3I9MA 3HDHA 2VN8A 1U2GA 4LRTB 1BVUA 3V8BA 4O6VA 4AJOA 1Q7CA 2GERA 2Y0EA 1P1KA 3CSDA 5LC1A 1M66A 4KOAA 1DPGA 2IEBA 1LUAA 1E1MA 3ZW9A 5A04A 3RFXA 3RASA 1GU7A 4IM7A 3E82A 3AFMA 3LLVA 5CHEA 4YJGB 5T64A 1LLCA 3TL2A 2QW8A 2AXQA 2YHUA 4WCDA 1ISHA 1QYWA 4I9HA 3ZHBA 3KZVA 1P1RA 2DUWA 5G0TA 4LISA 2R00C 2IYPA 1YH3A 2O2YA 4K6CA 3GVIA 1I2BA 4L4XA 4P8RA 1GCOA 4WE3A 1OI7A 2BGLA 3RC2A 4YR9A 2J5KA 1ID1A 1RJWA 4NDNE 5CEJA 2OUIA 4DBZA 4NU6A 1SZJG 1DFHA 2LDBA 1PS0A 4BO9A 3WGYA 1LC3A 3TNLA 3X2EA 2QYSA 2AQ8A 1TB4A 1WLYA 2NQ8A 4HNGA 3VZRA 3CKYA 3GC6A 4CR8A 5JAMA 2O3UA 4E5KA 4BGUA 4MVJF 4OHUA 3EHEA 4BQPA 4NBRA 5G0VA 1N1EA 4DQVA 3AI1A 3JD0A 4P22A 3ZV4A 4HBGA 2JHGA 3M6IA 1HLDA 2J8ZA 3KYDB 4B7UA 3AY6A 3C85A 2OL4A 1WVGA 1TVEA 3D7LA 3I6IA 4LCJA 4CLXA 4YRBA 3EZYA 4CR7A 5DOVA 5KIAA 1NBOA 3R0IA 3GEGA 4ZQEA 4QUKA 4WLOA 2A9FA 4IJVA 4D43A 5DNAA 3OEWA 1HDOA 4ND2A 5JYDA 1P45A 3ZU4A 1E1LA 3HFSA 5KJEA 4WLUA 4WLFA 2Z1NA 3C1TA 5ENVA 2CF5A 1ENOA 1ZFNA 3PI7A 1EFLA 2ZYAA 3RFTA 4EJMA 4LGVA 2HMWA 1W4ZA 4IY1A 4D3SA 1NHGA 3BIOA 2D1YA 4ZQGA 1Z7BA 4DPMA 5A02A 2BF7A 4RVSA 5TT1A 3S2IA 3OA2A 4BB5A 1DHRA 1OFGA 4LN1A 3JQEA 1PL8A 2G17A 1DB3A 4D42A 4MIEA 4BIIA 5A1TA 1H9BA 2RCYA 4OXYA 3WS7A 2CNBA 4XB1A 4OOEA 1KY5A 1SO8A 4H16A 3H9EO 2OMEA 3IUSA 3PRJA 1HDGO 1TLTA 1KVTA 1LI4A 4HKTA 4IJWA 4FR5A 4FJ2A 4OQYA 4ZN6A 1YB5A 4ZVVA 5H81A 4B8ZA 5GZ6A 3GG9A 4U0KA 4RF4A 4UVIA 4AG3A 3I9JA 3WX0A 1E7RA 4DMLA 1YBVA 4E4YA 1DRUA 5FI5A 3PWKA 3TOXA 2GASA 1SAYA 4AJ4A 2X5JO 1VL6A 3TRIA 1V3VA 4DMMA 1I2ZA 1GYPA 1U5AA 2DQ4A 5I8WA 2ZTVA 3ZI0A 1SC6A 6ADHA 1Y8QA 1H6DA 4XX0A 2HJRA 3EUWA 4OXNA 3PDUA 2AEJA 3ONDA 3E5MA 2AE1A 1XEAA 4GH5A 3O03A 4J0EA 4CMIA 2ZCUA 1DLJA 1VJ1A 3H3FA 1J4AA 1JAXA 3V2GA 2ZTLA 1PU2A 3D4OA 4F45A 1C14A 4W9NC 2Q2QA 4I9NA 4R68A 5EERA 3AUAA 4ZJUA 3QLJA 1B8PA 3DBRB 3GZ4A 2DUUA 5IJZA 3F6YA 2E37A 4HFNA 5JSFA 3P2OA 1YOVA 4II2A 3WWZA 3CH6A 4BQRA 4DRYA 1Y81A 1ONNA 3O9ZA 4PG7A 4YQYA 1MXFA 1PJ3A 1KEPA 3FTPA 4CM1A 1LDYA 1D7OA 2NVUA 2D8AA 3TZKA 3ADPA 1QRRA 3RC9A 1ARZA 1YRLA 4L76A 4AJ2A 1HDYA 3DOCA 1SOVA 2VYNA 1A7AA 1R0LA 1YXMA 5DBIA 4GMGA 3GGPA 2PKRA 4NR0A 1HWYA 5JCJA 1FDUA 2JHFA 1CJCA 4AFNA 4BO2A 3GDGA 4YTEA 1PQPA 3GRPA 2BELA 3EW7A 1R4MB 4XJSA 2Y0DA 3UCEA 2D5CA 4DLAA 3H2ZA 3OSUA 2O3RA 4NHEA 2Q1UA 2FMUA 5IZCC 1YVEI 2QZ9A 3CMCO 4NJMB 4TKLA 1IHYA 4CM4B 1BXZA 2NU6A 3R1IA 1ISFA 3DZBA 1R66A 1GL3A 2PH3A 2ZJ0A 3D3WB 4WUVA 4CMEA 1NHWA 4A2CA 3C7DB 2X0JA 4I08A 1OZAA 3LT0A 4JJIA 4WEQA 2ZB8A 1CRWG 1I24A 3ONFA 5F5LA 5B4VA 2C7VA 4IGEA 4J4HA 3T4EA 4EBFA 1YBAA 4DTIA 1ZO8A 4IGFA 4KDEA 1EUDA 5A9TA 3Q1LA 3WYEA 3ZH2A 3H8VA 1NAHA 5TIIA 1DEHA 1SMKA 3K30A 7MDHA 1CIVA 1B26A 2PA3A 4NPCA 4J43A 3OJLA 3IL2A 3PHIA 3RJ9A 4AVYA 2FR0A 1KVUA 5IDYA 3MJVA 4ZU3A 3JYNA 3GQVA 2OBYA 2I3AA 3D3EA 3TFOA 4D79A 4JK3A 3UFXA 1VKNA 5L3ZA 4B3HA 1BG6A 1R0KA 1TEHA 1IHXA 1H6CA 3GPIA 4GLLA 4KMSA 4RVHA 1CF2O 2VRCD 4D0RA 3QSGA 3FWZA 2I99A 4YYZA 3FNEA 3K9QO 3OETA 4RZHA 5F1KA 4HXYA 4I5EA 2JD2A 5JDCC 4NBUA 3K73O 1NM5A 2AG8A 4CM9A 3B1KA 1NPDA 2VQ3A 4N5NA 1R6DA 4EYEA 3JYQA 2FPGA 3ZU2A 1HLPA 1HXHA 4MVJG 1TT7A 5AXAA 4PGFA 3HHPA 3JQGA 5TX7A 4BS9A 4BNIA 2WD7B 4RPGA 3PFFA 3NV9A 1ZZEA 3U3XA 1LDBA 4J9VA 1Z7EA 1HDZA 3M1LA 4CQMB 1ISGA 1H2HA 2VOJA 4R1TA 3ST7A 3NUGA 3C24A 4XDZA 1NQ5A 5C37A 4AJNA 5L7WA 2PNFA 2PV7A 4F46A 1P1IA 3QWHA 5ILGA 3RBXA 1M67A 4CLHA 1DIGA 3I23A 1PQUA 3QWBA 2W2KA 5K9ZA 1MUUA 1K2WA 4XEHA 1E1NA 4AJJA 5BSEA 3TFQA 3H9JA 5DP1A 4A7PA 1F06A 4GX0A 2FN7A 1DLIA 1I8TA 4KQXA 4Q3NA 4E32A 2HJSA 3DAFA 4UUNA 1R37A 3K2EA 1VJ0A 1DAPA 1DAOA 3HDYA 3SLKA 3VZSA 3PGJA 2C59A 2GNAA 2DC1A 4LMPA 4J0FA 2PD3A 3A14A 1HYHA 1ZH8A 4FQ8A 5G4KA 3TWOA 4J7XA 1VJTA 4NFSA 2A92A 2BGKA 3LT4A 3HUDA 1PZHA 1YJ8A 3ANNA 3ETDA 3LC2O 3LF2A 3OIFA 1H94A 2FOIA 1RM4A 1VL0A 3SEFA 3ICCA 4ALLA 3F9IA 3WXBA 3ZZNA 4DGSA 3FPCA 4R1NA 4FOOA 1E7WA 1I33A 3AOEC 3HFGA 3JQ9C 1E6WA 3I4CA 2D4AA 1U1IA 3A06A 2NM0A 1UXIA 2EP7A 1YQGA 1PZEA 2Q3EA 4FDAA 2J3IA 3PFWO 3Q11A 5ENDA 1D4FA 4YEDA 2Q45A 1U3UA 2HAEA 2PH5A 1BVRA 3WTBA 1ML3A 1JW9B 4D3FA 4OSOA 1C0LA 2YQ4A 2EKLA 4D7AA 1E3SA 2CSUA 2X5OA 1E7QA 1HZJA 4G81A 5L4SA 4CMBA 4Q3AA 2BRUA 2NWQA 2WJPA 4HFMA 2D0IA 3CMMA 1B16A 2ILTA 2J6IA 2X1HA 3G3EA 3N58A 3ZN2A 1YWGO 4KUEA 3LVFO 5B4TA 1JLLA 1SEPA 5CP8A 1P77A 3RJ5A 1GYQA 3UH1A 3UN1A 4AJPA 4GGPA 2Z5LA 2OP0A 5DP2A 4A03A 1XELA 4HY3A 4BNUA 2PD6A 1XWFA 3EYWA 1LSOA 3DBHA 4XR4A 4DIOA 1HETA 4N5LA 2OOSA 5JFOA 3NAQA 3ON5A 3WQRA 1V9LA 1PX0A 3VKUA 1EK5A 3MTJA 1XCBA 3A9WA 1N92A 3EDMA 4QQRA 1V3UA 3ZWMA 1Y6JA 3DBRA 4E2YA 2P9GA 3IAHA 2VOEA 2P68A 3ITKA 5JPIA 1D8AA 3MTGA 1HL3A 3NT2A 5DF1A 3KHUA 2NTJA 3O8QB 3TZHA 1D1SA 2O48X 3KYCB 2VHVA 3RVDA 2GLXA 4E12A 2C5EA 5G0WA 1BMDA 4ZICA 3NEPX 4PN3A 1T25A 4FC7A 3NX4A 4WEOA 1I10A 1GQ2A 3U62A 1V6AA 5BNFA 5JAQA 2CF6A 3VKVA 2OORA 3PIDA 3I9KA 3CUKA 5T6BA 1O94A 5T8KA 2ZCVA 2VRCA 3QE3A 1X1EA 3KOUA 3Q9NA 2EW2A 4XQEA 1OAAA 1QORA 3GA0A 1YJQA 2Q46A 5BSFA 1A4UA 1C1XA 2VWQA 5DDIP 4M89A 2R00A 2XOXA 1I0ZA 3X2FA 1ZCJA 2ZK7A 2DBQA 1B2LA 4CUJA 3NTQA 2B4TO 5A05A 3OQBA 4DQXA 1DDOA 4E3ZA 1I30A 5CPBA 4LVUA 1MV8A 4GKVA 2J3JA 1EBFA 2V65A 3JQDA 4RL6A 2PY6A 3A4VA 3DO5A 1W8DA 4NK4A 5KTKA 1EDZA 1UZNA 5L7YA 4URFA 1N9GB 2E4AA 2JKVA 3FBGA 1XYGA 4FC6A 4Y6PA 5ICMA 4WASA 3NJ8A 1T26A 4E13A 2EEZA 3WB9A 3DZHA 1EUCA 4BNJA 1GUZA 4FJ0A 1WP4A 4XYGA 2NTVA 4DLLA 4JNKA 1WNTA 2NSDA 2ZKLA 3GNTA 1HE2A 5EL0A 2RHCA 5HBRA 1D1TA 3NTOA 4NBTA 1L7DA 1YS4A 2B0JA 3V5NA 4CQLA 4YPOA 1OMOA 4WLNA 2GN9A 3WMXA 1CEQA 1YQDA 4WGGA 1QLHA 2NVUB 1C1DB 3E03A 1JAYA 1XU7A 3N7UA 3RUAA 4DREA 3KXDA 4RDIA 3SLGA 4O63O 3MJCA 1UH5A 3WYBA 1PL6A 3GDOA 3WLEA 4UEJA 1NQAO 4QEDA 4AJLA 1LDMA 3DMYA 1KC1A 3PTZA 4TVOA 5JCXA 1HTBA 4MVJD 2D5AA 4EI2A 4DWVA 4MDHA 2JD0A 3HE3A 4I1IA 3H6KA 3WLFA 2EHDA 1X13A 2AQKA 4DLBA 4GX2A 2YUTA 4WNIA 2YY7A 2ZB3A 4JCOA 4BO3A 3F1KA 1B3RA 1YL6A 1R4NA 3LK7A 3UXYA 1XU9A 4Z9XA 4CM7A 2X0RA 1KC3A 3HB5X 2B83A 4XRGA 3UUWA 2G1UA 1J5PA 2NU7A 3BMNB 2C5AA 5ER9A
chains in the Genus database with same CATH superfamily
1L5OA 1KZHA 4H7HA 1E3TA 2P77A 1VLHA 2Y67A 4FOPA 2JG3A 4UBOA 4F11A 3I1JA 1CZKA 4D0LB 4BRZA 1V1MA 2CL6X 3HYTA 3KFVA 1AK1A 3L49A 4IJ5A 2IEDA 1L8XA 1VIAA 1H5QA 3U81A 1D7AA 3D43A 1W5SA 1BFKA 1T4DA 2X13A 4QGSA 4NS1A 4L95C 4NMHA 4XGNA 2X7HA 3T5MA 6CHYA 2O3QA 5I9NA 3QI2A 5LQAA 1PJ8A 3FFTA 5AJYA 1E3JA 4FBLA 2AI1A 2BTQB 2NU8A 2Q9UA 4YDQA 4P4SA 2QENA 4B75A 4FLEA 2ZI6A 2FU5C 4QL3A 4IIHA 2YWXA 2JVIA 5IWAB 1NYTA 1H3NA 1Y1QA 2B25A 4CM6A 3HJRA 3OQOA 4D0NA 3LUCA 4KO3S 4IIFA 5IXSA 2W71A 2WWFA 5G3ZA 1MB4A 4QLBA 5JQGB 3DG9A 4DBVO 5JTTA 2YFHA 3S3TA 1JQLB 4ZI7A 3TDKA 4C4SA 1TX4B 1ZKDA 3SNHA 3WJAA 3TG8A 2BEVA 3V2IA 1B74A 3F6CA 4FD3A 1X9IA 1VSVA 5DXAA 4LY0A 4X90A 4P0QB 2PUHA 3SZ3A 4IDBA 3S44A 2P91A 2LCIA 1KZ1A 4HX2A 1NFFA 1RJ9A 1A72A 1XMOB 2UV8A 1RCTE 3HABA 3VDQA 4KQHA 4Q4CA 1YRBA 2JK0A 3A1WA 5C7IO 1WW8A 2RGXA 2NSYA 2VPIA 2WYOA 4ZT2A 3K1AB 4BNZA 2QEQA 4GQIA 3ZK7A 1YZTA 3T1OA 5CLQA 4LWZA 2OG1A 3KVVA 3WB1A 5AXBA 1B2RA 1PQWA 2P5SA 3OSZA 4BKOA 3SXUB 1C3OA 3OE4A 1GCGA 3RUFA 5KI6A 4DMGA 2M2IA 2A9VA 3IC5A 4J8PA 5AIAA 5JI2E 1QIEA 5B30A 2J4FA 1U90A 1ZD2P 2XNSA 3KQOA 4Q4DA 3TD2A 3T3HA 4L2IB 4W5NA 4DKXA 1Z18A 4R6XA 4PFJA 3G79A 3DR5A 5GV8A 2G80A 5B12A 3JQFC 4OV6B 3AQIA 2Q49A 2ZAMA 3DJYA 3PWSA 3EZLA 3GFQA 4BO5A 2VNSA 4DL9A 4B3TB 1PT9A 4AJ1A 2I4IA 1K4MA 1TZCA 3V8VA 4ASUD 2NIPA 1QS0A 3AL2A 1AQYA 4RSHA 1A9RA 3EZXA 2TMDA 1OBOA 3NGLA 2WIJA 3PB3A 3L4BC 1E20A 4FM9A 3N1UA 2PR7A 2AZDA 2AXNA 2GYYA 4BMVA 4B3JA 1NMZA 2XWBF 4G5HA 4PVDA 1JIQA 5A7GA 4MLPA 5FTLA 1RR6A 1WWKA 1ZIOA 3HEBA 4ZRDA 3ZJ5A 4JI2B 1CUDA 1PEKE 1II9A 1UJ2A 1RXCA 2QTGA 4XPZA 5JE8A 3PNKA 4FGWA 3IT0A 3O8NA 3QMMA 2I91A 3DO8A 4QYSA 4NATA 1G98A 2N0SA 3N59A 4R69A 3URMA 3L7AA 2B7BA 2VZ8A 1GNPA 1RAHA 1L5HB 2NLOA 6NULA 5KYVA 5ALVA 2QL6A 5LYJB 1V3QE 1EGMB 3GAMA 1A7KA 4G5FA 4B9EA 1N2CE 2CLCX 3SEAA 2DBVO 2VNKA 4IIVA 5IXYA 1M6NA 1R4ZA 2R97A 3AFOA 3B6EA 1GJRA 1Y98A 2CUZA 3O26A 4QTZA 5B3JA 2P4EA 2EBHX 3A6EA 5ALXA 3BMQA 4B3SB 3LGAA 1ZN2A 1UUFA 5JYBA 1Z68A 2JJQA 4GOXA 4QHSA 1QTIA 2VTKA 4BNNA 4CDMA 1SHUX 4TOIA 2GWHA 3UQYS 4RVUA 4F84A 1J70A 5I7RA 2VJLA 1DADA 2X9QA 1G2OA 4NZ9A 2RAFA 4MUAA 1PK8A 4AUEA 5KVQA 1L5QA 3IDSA 2G72A 4CM4A 2E48A 3T5GA 1YR9A 5KNDH 1I9GA 4J9UE 1NRJB 1B4DA 3BBPA 2A86A 1MABB 1L7RA 2B8TA 3D3WA 3HZRA 4X1KA 3OP1A 2WC1A 5LOVA 2G8NA 2PFGA 3SYMA 2A94A 2C8VA 2XGGA 3ZNQA 4AF7A 1BYUA 3SPXA 1NVXQ 3TLBA 3WWCA 4EHKA 5FO1A 1ESCA 4CGZA 3AM1A 1ZA1A 1M2VA 1QLWA 5C46F 3GLGE 3MLEA 4CLRA 1GGNA 5DBOA 3WNBA 3QW2A 4YJFB 1J8MF 3ASVA 4IHJA 4WKPA 3KR2A 2Z2YA 4FDLA 2HWWA 4ZYVA 4KYVA 4LW8A 3MERA 2FZCA 1RKBA 4F2GA 1H22A 4G5OA 3AFNA 1SCQA 1FPMA 1P4JA 3IR6A 5C0OE 4Z9FA 4ZGBA 1Y6FA 3TQFA 2IXAA 1QHFA 2BV3A 2M1XA 3JVIA 2PU5A 1KKLA 2VKQA 3OIGA 1Y4ZA 1SY7A 1PFUA 3QVSA 4P3KA 3E22A 1NPYA 2L17A 3UJHA 1GFZA 4MWDA 4PZAA 2OE2A 2HSGA 1PJRA 2QRNA 3EOAI 3K05A 1PQ4A 3KQVA 1K7EB 3L3BA 1ZU5A 1JIJA 2UVPA 2HK7A 3OIUA 1FFBA 4RJIA 3RSCA 3UJ8A 2JBAA 1RPTA 3H2JA 3C97A 4PLFA 3E9QA 5FI3A 1VI6A 5AW7A 2ZJ3A 1MVLA 4FZVA 3VR5H 1NVMB 4WOCA 2IHVA 1LRLA 3OF2A 4U2DA 1BHSA 3OOEA 3OQJA 4UU0A 1MC4A 5JPCA 5KWIA 3ER8A 4TROA 1CFZA 4L0CA 3BWDD 1EHIA 4M0MA 3O1JC 1PWHA 4XGQA 4K7JA 2C5BA 1XA0A 3PRHA 1JJ7A 2QN3A 2ZIZA 4KNVA 1W1UA 2XA2A 1NW9B 5EE1A 2IU0A 4B9AA 4EZBA 3PHHA 4B3IA 2EG5A 3ELUA 4FYHA 5ALTA 3R5KA 4R71A 2XTMA 2Y1OA 3RSOA 4R8RA 3UF0A 4JEHA 1TYBE 1YHNA 1RS0A 4DAOA 5EJ7A 5BOVA 1YKSA 3PGKA 3S7ZA 2GJ4A 2GVNA 3DV0B 1FFWA 3KJIA 5K3EA 5IN5A 5M34A 4LJKA 1U2RA 5SY9A 1CRLA 1JDTA 2J46A 2ECOA 3OU7A 1OJLA 1SU8A 2MJLA 2Q9BA 4NMMA 2QUHA 4OVKA 1E1KA 2V0NA 1BWSA 1UFQA 4HP8A 4BVAA 1TU0A 1XO1A 1E4OA 2REQB 3TNJA 1DC5A 3ZY3A 3ETEA 3B2QA 5DU2A 1W6UA 3O83A 5IAOA 1YBMA 1RXIA 4X00A 1SUWA 2CV0A 1H1LA 2PCLA 3FUTA 2IELA 3UJNA 3PD0A 2ODBA 2F1KA 1TTQB 3M1YA 1KAQA 1JWAB 1KI1A 2QX6A 1GNVA 2H54A 4YV1A 1W49A 1XLTA 4GPZA 4GUDA 4OG2A 2B30A 2MIIA 3IERA 2ZRKA 3KM0A 1HFJA 2QRVA 3OZEA 3L6RA 5GQSA 4YRIA 4WK6A 1W581 3L7JA 2NN3C 3KSUA 3O90A 1JLMA 5DULA 1Q11A 2O8VA 2V7TA 4XQ0A 3VR4H 1RRKA 3SY8A 3Q8MA 2P65A 5K8IA 4O4LA 3GQBB 2FK8A 1E3WB 2WABA 3V3KA 1G3IA 1Q7EA 5J2TF 5CD9A 2ZKIA 3KPJA 4EITA 2AFHA 3OY7A 3BWVA 4DCVA 1L7EA 1QCDA 3UQZA 2J6BA 3KSAC 1ABFA 1AS2A 3H05A 3I04M 1T9HA 3WBBA 1E1DA 1YDGA 4PCVA 1UQUA 4D6YA 4DC9A 2AG1A 3NO4A 2DTXA 2NUTB 4KQ6A 4KW7A 1SXGA 2RKBA 5ALQA 3JYHA 4ZCIA 4I4TA 2ADOA 4YCBA 4MQMA 4XB6B 1AD2A 4PC1A 4KR9A 4TSRA 1DQPA 2GA8A 4M83A 3V1TC 3V8QA 4AKGA 2EQBA 4X0EA 1EG7A 1R12A 2H0AA 2Y92A 3AM5A 2AX4A 1O6FA 3E61A 4LZJA 1CDOA 3IE0A 4LXIA 4NJOA 4QUHA 2FAXA 2C07A 4MUNA 4TQGA 3SU8A 3L46A 4KQ9A 4N7JA 3D3JA 2I4TA 3KEOA 3EGDA 3UA4A 1Q0TA 2Z2KA 3DE3X 3W3AA 1AGNA 4JLWA 4S0XA 4D80A 1WMAA 4BWFB 1YDHA 2V7WA 2FG5A 1IXRC 2RHRA 3IDAA 2NUPA 2W8BA 2ZUVA 1LQTA 3K53A 2XVAA 2B1JA 4TMYA 3SXPA 2V9PA 3PUWA 3UMMA 3B3JA 2F6RA 5CEEA 1OIVA 1R4NB 1BXRB 1NVGA 3HKCB 1GL6A 4HGYA 1RQNA 4KGDA 5LQJA 4AUNA 2CE2X 4S2UA 5HMLA 4CTNA 4QE3A 4X95A 3TGWA 2C5GA 3THOA 1S0UA 1Z2PX 2QI9C 3H86A 3P9SA 4EW3A 1FUYB 1F48A 1DI0A 1YRHA 3LLUA 1DO0A 3K0AB 3L6DA 1ISIA 2PNJA 4PC2A 3IB3A 2CLSA 1G7SA 3W2HA 2OAQ1 1FW6A 1TI7A 3YASA 3V32A 1JEDA 3GXBA 2E1RA 3TI7A 4B3GA 2COEA 3E35A 8OHMA 1JKXA 2QB5A 4OGWA 1NXOA 2MR5A 1SJ9A 4G9BA 4L72A 4UHCA 5K3FB 2V7GA 4QHYA 5HKAA 1VJ5A 2IS6A 1S2NA 1PSZA 3U4CA 2V6MA 1TLLA 3X1JA 3WFIA 2K4MA 3ZWOA 1L3CA 3SGLA 2Y0PA 1OLXB 1WA5A 2V3WA 5B7NA 5ITVA 2XMZA 4BQEA 1SPXA 1NSYA 1YC5A 2CD9A 4AUMA 3R6LA 1S9HA 3R3YA 1E89A 2P6NA 3FR8A 3Q8KA 2ZI4A 1TEVA 2VCYA 3KYCA 2IU6A 5KEIA 4F93B 2BR3A 4CM9D 1ZM2A 4U7PB 2ACWA 3I28A 4LX8A 1T24A 4MGIR 4HMPA 1CUCA 3RARA 1LB1B 4M60A 1VJGA 1P7CA 1SB8A 3CGWA 5ALOA 2H07A 4DUGD 4LIPD 4Q4AB 4X3PA 3A28A 3QPUA 1YGPA 1KE1A 4CL8A 1UKZA 5DM2A 3DMNA 4GIBA 1H2XA 3JVVA 3KQSA 4DSZA 1U63A 3QE2A 3R0ZA 3DEYX 3DOJA 4RUKA 1VRCA 8MHTA 3DWFA 2JAUA 4KQGA 4HL6A 2G0AA 1E3LA 1ILEA 1QZUA 3QNWA 4OFXA 3FMPB 3V4LA 2PT7A 4G23A 1NDQA 4HAVA 2CW5A 1I2CA 2XOKA 2XQFA 4KU4A 4XD7D 4K9DA 3B13B 5J1TB 1CB7A 2X1MA 3AVOA 1DJMA 1N2JA 2GRUA 1O58A 2IZZA 2ZE6A 4J0IA 3V9AA 2XDWA 3ZD8A 5IC4A 2KSQA 4TTJA 2H85A 1V16B 2EJVA 3OT5A 4JJZA 3L6EA 4H6PA 4LYGA 2QX4A 4G3XA 3GDFA 4NJEA 1BKSB 3O8BA 3OFVA 4G5SA 4K9PA 4KVAA 4P7FA 4YV2A 2B5OA 1QFZA 1SG0A 3CZCA 4NCBA 1DAFA 4Q9HA 5I7EA 5H3HA 2CEAA 1ZSVA 5H4HA 1T1GA 2CLLB 3ZVMA 1GPKA 2PPLA 4RZ3A 2B4YA 4I7EA 4RMGA 2ISSD 2EJWA 2WF9A 2VZEA 4RMIA 2YHIB 3AXTA 2FX3A 3WISA 2YYZA 2FZEA 1C81A 1M2VB 1YNOA 2GBCA 4XM2A 3ZHOA 2AFIA 2RH8A 3G1UA 3OFJA 3ZJUA 1HOTA 3THWA 4AKEA 1J33A 1DV2A 4DIUA 2VFAA 3T4UA 2HD4A 3QJ5A 3V1UA 2IYYA 3ZE2B 4U2KA 3T0FA 3D2CA 1U7PA 1J1IA 1QX4A 3A36A 3UWPA 3AVQA 3GHHA 1GRVA 3B51X 3F7MA 2WSYB 2VWHA 4NKRA 3AKDA 2C8KA 4QSMA 3GG2A 4HQOA 5B7GA 1VPTA 2EX4A 4FHDA 2YJ5A 3JPWA 3W6UA 1HI9A 2YBDA 4HLDA 4WESB 1MFZA 2BE7A 4ZTBA 5KYUA 3QZUA 4CM8B 3E22B 1ADYA 5CW1A 2O20A 4NF2A 1E59A 3KWJA 1SBYA 3OZIA 4R2KA 4QWMA 4BRWA 4DIFA 5I4KA 1YA6A 4KMRA 3HM9A 3IEIA 5HBGA 4HX9A 4LECA 1E18A 2D5LA 1UBNA 4HRAA 4EGAA 5AJZA 4L07A 5JD3A 4DV5B 2J0SA 2ZUTA 3ND8A 4FDMA 1QGAA 2PEYA 5JCOA 2Z3WA 3BICA 1RKUA 2ZYUX 2BM0A 2PWZA 2ZR8A 3KKEA 2Y1LA 1MC8A 3GK3A 2VEOA 4QOHA 4R51A 3VH1A 1W2WB 3HYLA 2FLWA 1QVVA 3AUTA 1X7GA 1Y3DE 2J9FB 2NVWA 3EGOA 3H13A 3JYLA 1E7YA 2F9LA 4I5DA 3SBEA 4YECA 2CHGA 4BQIA 8LDHA 1CRPA 1F8GA 2IKQA 2QRMA 1KK2A 2BEWA 3N9IA 1G17A 3IIEA 3FUXA 4KWTA 2GHIA 4PTYA 3GLHE 2C2XA 5AVWA 2D00A 3HP1A 4F8EA 1B93A 2WWYA 1KDRA 2J59A 4YUYA 3O4HA 1ZXXA 2QI9F 1CT9A 1YQQA 3CVJA 3HS3A 1J09A 1Q92A 3WWPA 4OQLA 4F1KA 3LQRA 1VL5A 1ZOIA 1U0LA 4E0BA 3L6OO 2YWFA 3RS0A 3C0KA 5JD5A 1QSGA 1T6YA 2G6TA 4FMPA 2JGRA 3JZAA 2ABWA 4PZ9A 4QOFA 1KDYA 3RS4A 1ZVQA 4CLRB 1LJUA 4R9RA 4EYKA 3DAYA 3H5LA 2UUOA 1SK8A 2ZIAA 1S7CA 4IHJB 4PLGA 1OXUA 3LTEA 4MVYA 3F0TA 4A8JB 4UXHA 1Q22A 2A67A 1M34E 2QD5A 1JEOA 1DC3A 3VR0A 2EX1A 3D6VA 4XQCA 3R77A 4ZV9A 4W9MC 1CFJA 2QMQA 3CIFA 2WNSA 4I4NA 1DKQA 4F7DA 5EZYF 7AT1A 1JLKA 5JJIA 1O6GA 4QATA 4OL0A 3UWSA 1MIOB 2G5CA 1Y6QA 4NLLA 3K92A 1Q84A 5L51A 3FCOA 3VO1A 4XYLA 3KWMA 1N5DA 1IM8A 1UDAA 3EF0A 4Z1MA 4QWWA 4ENQA 1SIBE 2C9MA 4WKBA 1SB9A 2RH5A 4G25A 4B4DA 3JQ8B 4XOIA 1N6NA 1QRTA 3DAOA 1MOSA 2NO0A 1JR3A 1L4BA 1TCAA 3MNFA 1FVXA 4OKIA 3UMCA 4FW8A 4CEHB 4GWKA 4GZMA 1XVAA 2AIRA 4JC8A 4RLFA 4NAUA 3GQBA 3LOUA 2UDPA 4AMUA 1O4VA 3MVEA 1QIJA 3CH4B 2R5FA 2Y2VA 2NZ2A 1DCMA 4JI1B 3NXSA 5AYVA 4BNKA 3LVQE 1KGDA 2GBPA 5FR2A 2K6GA 3L0ZA 3T12A 3USCS 2H5JA 3SZLA 2XYQA 4B6OA 3CT6A 2CZCA 1B1CA 3ZDXB 2QTRA 4YJGA 5TSDA 3MGAA 1D07A 5CURA 1QTQA 1CWUA 2GAOA 5FJJA 1TGYA 2I03A 4BDTA 4DR7B 2AF4C 4QFDA 1UBFA 2XYGA 1U0HC 3W79A 2C3OA 3WGOA 2PXCA 5AI5A 1WXXA 2PUEA 3VI3B 3GRVA 1JU9A 4XI9A 1A04A 2GRJA 2WSLA 2PN1A 3N28A 1CQIB 3Q3JB 2WHPA 2XQGA 4PHCA 5JADA 4JUDX 4XZ3A 5AK4A 2ZIXB 1EINA 1UJ5A 4IV5A 4E03A 3ACCA 4IOKA 1CP3A 5B4UA 1WKBA 4UTXA 3D7NA 1CQWA 1V96A 3BG5A 2LP4Y 4L9WA 3UJAA 1ESDA 3NVMB 2IZ5A 1ZITA 3CJQA 5LB2A 3BGVA 2IYNA 4FFNA 3CQ9A 4OATA 1ECCA 1B6SA 1MIHA 2WMDA 4YRFA 1YB2A 3HG7A 1OTHA 3UT6A 4I1RA 4NPHA 4R40A 2LCQA 3AUSA 3L79A 2UKDA 4KQ2A 4Q4LA 1ZK1A 2X19A 1ZC3A 3BFPA 3HA7A 2CLKB 3K5HA 2P67A 4NONA 3KYDA 2UXCB 2DCMA 4HR7A 4LTNA 3I1FA 1OGJA 4AICA 1ULHA 4AY2A 4G4IA 1G8MA 2W6IA 1WAMA 3NC1C 5A0FA 2PQ6A 2E5LB 1NA5A 4TSFD 3TMYA 3VZCA 1DO8A 4F2PA 5LQKA 3T35A 1SCKA 3ORSA 2HEGA 3BRWA 5DHTA 4ZAWA 4ZI5A 2R4UA 1U9JA 2XDQA 4MGHA 2XBLA 3RAPR 2HXYA 2ORVA 2XXBA 3AYXB 2HJHA 4WNAB 4DWJA 1K98A 2I7VA 3G7SA 1CY0A 2BT4A 4L27A 1KEWA 3VU3A 6LDHA 1MPXA 3ESZA 3IV6A 5B5SA 1A98A 2PCJA 2BLLA 3BCSA 4QYTA 3TLKA 5IJ0A 1JA1A 2BH9A 4PYOA 4RPIA 3MIZA 4BVKA 1FMJA 1ATIA 2ETXA 3STWA 1JG7A 1BD3A 2AC4A 3NDPA 5LDGA 1DOHA 1GQYA 1PEDA 3QUCA 2H8KA 3TZ6A 1GGMA 1HDXA 2Z57A 1EK1A 4JKOA 1DV1A 4CIBA 5LDHA 4REQA 3FAKA 1CR4A 4EG8A 1BH6A 2ZRCA 4A6DA 2SCUB 4NEQA 1G5IA 4JOSA 1C1YA 3CX6A 1NSTA 1F3LA 3ZWXA 4BTEA 2G71A 5EIOA 1W88B 4C2UA 4DQDA 2PG3A 3HXKA 2DX7A 3WWOA 4Q12A 2ZTUA 4GOOD 4KIUA 5E4TA 3UATA 2IRWA 3F71A 1N78A 4AP5A 1CC1S 1ND6A 1QH0A 2ZRQA 3MTBA 4L5CA 4TMWA 2ZIEA 4N6OA 3JW8A 2PK3A 4Q66C 3SM9A 1P6QA 1F6WA 2VL7A 1Q91A 1G20A 3QVWA 5CDFE 2J48A 3KVOA 3PPIA 4RF2A 3UJ7A 4Y1RA 3FG9A 5JUWA 3KZXA 5HIMA 4CTJA 4J1NA 3KIPA 2AFVA 4E2XA 2LUOA 2BUBA 2FZ4A 5BV1A 1KK1A 1LLUA 1X42A 2O0MA 2P40A 2OP1A 2BGJA 3AJEA 3FPHA 3UICA 5F5XA 3SR3A 3NOOA 5CXSA 3D4NA 1M72A 1QH8B 3SJ7A 4JJ7A 4OB8A 3TS1A 1K5PA 3E6AA 1SELA 3JCZA 4Z4QA 2D0OB 2R68A 3LCJA 4G5RA 3S2GA 1SURA 4BZQA 1VMEA 3SMVA 5ESDA 3T1HB 4GGOA 3PR2B 4WXHA 1RXWA 3WRXC 1TMOA 4R8VA 1UT8A 3MSXA 3I8SA 4R4JA 4C9BA 3WGLA 1VL2A 1GV0A 4F1WA 2DQSA 1BTOA 2YVKA 3DFFA 4KQKA 4XSHA 3TPZA 1TRHA 3E5RA 3F6BX 2C97A 5K3FA 1W29A 1YKGA 3VOAA 4CF4A 3MOSA 1MQ9A 3W5AA 3JQQA 3AR2A 3BB4A 4TL7A 1K7CA 4WLVA 3M82A 3F8TA 2HEIA 4P98A 2J3KA 1BMFD 3FBTA 4Q3DA 4ERXA 3OG9A 3RTGA 4CTOA 3PDIB 2NZVG 1KMQA 1H05A 1LX7A 3UAZA 1LSJA 2UVDA 4D9EA 1T9GR 3GJSA 1XD2A 2V0CA 4ALNA 3OLWA 3HH8A 1U0TA 3E84A 4IDEA 1JPVA 2ZYWX 1OLSA 5DLQC 1GTRA 2XUGA 1NQOA 1PJBA 1F2TA 1LLQA 3D5QA 3INYA 5D3MB 2OYCA 3RYIA 4D0SA 2AKYA 4K6OA 4OHPA 1GPDG 2HDHA 3FWPA 2R96A 4QECA 5CDGA 3LHDA 4A8PA 1Q3KA 3O8LA 4GZ5A 4MP8A 5B1HA 1GL9B 2PZJA 1CVIA 1EGQA 4ID9A 1PS8A 2P8SA 1MJFA 1XA4A 4XUEA 4J0GA 5JSZA 5EZ6B 4BU1A 4M8KA 3I4FA 3O3OB 3BIXA 4MV3A 3PIIA 1B14A 4MICA 4P33A 1CERA 1XTRA 4Q4JB 4RH0A 5ALDA 3OUZA 2BE9A 1UMDA 3UV7A 3ZYZA 4AP9A 5HQ3A 1XUOA 1VG9B 2PGIA 4NC9A 2H51A 4JLJA 4KQWA 3BJRA 4BHTA 3C39A 1LJ8A 5BPHA 3ZLBA 1IULA 1N3IA 2WWRA 3BWYA 3IT2A 2YQ5A 4WL0A 1X8XA 1RDFA 4ESEA 1JA0A 4F4FA 1RYDA 1EFTA 1ZOLA 2C82A 3HBJA 1CXZA 1CD5A 1UXGA 4RDCA 1Y7IA 1L5SA 4RY0A 4F5EA 3ESQA 3LU1A 4DCPA 2F8MA 4O2AB 3DHNA 1MO3A 2B0CA 3HDQA 4EDFA 1FYEA 4RZQA 4YRZA 2ZDGA 1TA4A 3ECCA 3LNCA 1NJ1A 3H4TA 4KAXA 1C7FA 1Y5NA 2NTNA 1JG1A 5JSYA 2YV3A 1WPGA 1J07A 4UJ3A 3IBFA 5F4ZA 4AYWA 2FEPA 5BWOA 3TZQA 3WKAA 2PT5A 5E2BA 1KEVA 1CJVC 3HZHA 4UMEA 2EP5A 1FSGA 3AL3A 5HUQA 4B82A 2YIMA 1GM5A 1RJFA 5LYYA 5ADUS 1PE0A 4DHWA 4MEAA 3OIDA 2AOXA 2LZ0A 3GFOA 1ABEA 4UREA 2VSNA 3DMFA 5DNDA 3UKOA 3EEOA 1YB4A 3IJPA 3X44A 4C4YA 3K9LA 4KE9A 5DH9A 1H2FA 2R4TA 2RKOA 4J1QA 3I32A 1MIOA 5THKA 3FI9A 5TY0A 4YX9A 3BWEA 1RD4A 1M8GA 4H15A 5JXIA 3WXMA 1ZJ5A 4WESA 4EP1A 4JI7B 2NNWB 3BD8A 1J2YA 4P4UA 2OBMA 3DF9A 2V8OA 3PXGA 3EGXB 3AHFA 5K0TA 5MN5A 4TN5A 3R76A 2NZWA 5JYCA 3RNLA 2WG1A 2OESA 3D4BA 3ZD6A 1Q7RA 3PSAA 3PZRA 2J6CA 1KMCA 2Z0MA 3S29A 2YMQA 1F8FA 3PD7A 3EY9A 1BE1A 1TM1E 1PGNA 3OE7D 4C21A 4ZCTA 1IWPB 1DOZA 2WSBA 2Y8EA 1JG3A 4TRRA 4Z4GA 5E7MA 1QFMA 2X23A 2J9FA 3C3XA 4JUIA 3AZPA 3AR6A 4D96A 4JMPA 1OLUA 1VQ1A 4YMHA 5I7SA 3G1WA 5C7OO 3IOEA 1PRYA 3TTYA 5BXQC 1LPSA 4XVCA 3QY0A 2HRQA 2B21A 2P9TA 4LOJA 1CF4A 2AMYA 1KOFA 1JQ5A 2V8BA 2W5UA 5F2NA 3QBJA 5ALIA 2GF0A 3JAKB 3F2VA 4NBKA 4HZUA 4MLDA 1G7RA 3H6HA 3TB4A 5EKSA 1ZSYA 3RKUA 4FSHA 1CS0A 3DE1X 1GD1O 2GM9A 2SHKA 4ND3A 5GAJA 1B8NA 2BD0A 4IUBS 5KSPA 3WO1A 2OC4A 1VIDA 2UYGA 3FPBA 2BJVA 3WIEA 3R3ZA 1DBSA 1NIJA 1G3UA 3KEFA 4IEIA 3HR7A 4DMFA 1DIAA 1YUBA 1YSCA 5CFNA 1OA1A 4Y6RA 1U0NA 2ZATA 3LBHA 2NU9B 3NU1A 4KR6A 4JVOA 3FWYA 4M36A 2CNDA 3H5VA 3KYJB 4CCYB 2ZVJA 4JOQA 4RO0A 3AKEA 1FMLA 1M33A 3DZDA 2OHFA 3AIIA 2P4SA 3BCUA 3KZ1E 1E0JA 3VAZA 4BGIA 1HKHA 1X92A 2EJCA 3NM6B 1U28A 2IYRA 4XTRA 3V4SA 4KWCA 5JH7A 3L02A 1HM5A 1P72A 3B8EA 2XLBA 2D2XA 4QTUB 5BUSA 2HLPA 3JQAD 2JAOA 2BFEB 1P6XA 2CJPA 3ESDA 1TT5A 3I12A 2GQ0A 4M49A 2UYQA 5C3MA 1HNWB 3LVRE 1T8SA 5GOTA 2C54A 2GX6A 4RLHA 2GPNA 5DSZA 1AB6A 1AG9A 1QVWA 3W2EA 5KWSA 3U0BA 1F12A 1U0FA 1J42A 2V96A 3DLHA 4AWXA 2GZ1A 3EHDA 3KUDA 1MG0A 1MX3A 4JZKA 1M7BA 1XRQA 3WZMA 2WWHA 4TL6A 5G4KB 4XQGA 1ENYA 3D0OA 3QU2A 3FI0A 4G0VA 2EGUA 3BK1A 4F2DA 1XWIA 5A6SA 4LJ6A 5K0LA 4RTLA 3TECE 3SEZA 5EI5A 1CNFA 3U1TA 9GPBA 1V4VA 5IYZB 3BC1A 1WZIA 1J9ZA 3SVLA 2WLSA 1EVYA 5C5IA 2ZT8A 2R7MA 1OXKB 2FEMA 3ESXA 4EDHA 3EOZA 1U8XX 2BPOA 1R9JA 1VSUA 3I9V6 4LZNA 4LOAA 1LCIA 1D2AA 3GJ4A 4H6XA 1TZKA 5IAGA 3PQEA 3ROXA 5IU6A 3HLKA 3O4FA 3ISJA 1PS9A 3G9QA 5B2ZA 4A5SA 2R6ZA 3GPDG 3C3EA 2GOYA 2I1VB 2BONA 1D2CA 1QVRA 2SKCA 2AT1A 3IQDB 4XDGA 3NTLA 4V0MA 4GLOA 2A35A 2VHCA 1ZY2A 3ZWVA 5K0JA 1S96A 4J0JA 1OWNA 1O8CA 1STOA 5NLLA 4L4ZA 4YY3B 5KTRA 3FYUC 5JSHA 7ADHA 2EJUA 1XVVA 2IIVA 2GZSA 3BKXA 3VKGA 2PM8A 5B37A 4YP6A 3CS3A 1W93A 4QTXA 3W9SA 3BH6A 4Y9SA 5K3BA 3CKMA 4G8BA 4MI1A 3HU2A 4OY3A 2AD5A 2SECE 1W1WA 4RK0A 4D0GA 2N9UA 4ZT5A 4MPDA 3ISVA 4JT9A 3DE7X 3G1TA 1NJFA 3M83A 3RRFA 1C9EA 5JMWA 4P3OA 2EZUA 1FTGA 3D64A 3RHZA 3WNQA 2Z83A 3UMYA 5CCEA 3C74A 3DE6X 1V8DA 3QYPA 1O0SA 1XZFA 2IZ0A 4NICA 3BE5A 5KVAA 4N6GA 4RVGA 2LV8A 3B53X 1N2EA 3OQIB 2OCDA 1SVMA 1AN0A 3A2NA 3LKDA 4N54A 4PFKA 2AVNA 5EZYA 4F06A 1EM8A 1U4OA 4E7OA 2IY7A 3CZAA 1O9HA 2WTNA 4TT8A 2P9FA 5DGHA 3ZDAA 1BEEA 1GUFA 3G5MA 4EABA 2EFDB 1NFRA 4RD1A 1IDOA 2AA3A 3RBVA 1GAXA 2FPMA 3ZS8A 4QT0A 5A9RA 3E8XA 5ALNA 3PUXA 4HWTA 5FUWA 1EQ2A 2PBZA 3AY3A 2SCUA 3PWZA 4US0R 2Y2UA 5EJ2A 3ZV3A 4G41A 5FEUA 3T7EA 2NZXA 3LQYA 3P4YA 4CF5A 2D6FA 2DSTA 3OECA 3TGLA 1I6KA 1F6BA 2X8JA 1R6UA 5DM1A 1EZ1A 3LW7A 1KYQA 1Z4JA 2MOKA 2NXCA 5DLYA 4JP3A 2JLZA 1NNSA 3I72A 1UBKS 4E08A 3GFTA 3ESYA 1G3MA 1GY8A 3A25A 3IVGA 4EI9A 4CL2A 5C53B 3ELDA 2NZ8A 2DE0X 4RH3A 5JSZB 5EQTA 5JMPA 2O7NA 1WPXA 5JZMA 1E9FA 2DBZA 3CNLA 2MMCA 3PJFA 5K1ZA 2CLIB 3GD5A 2C0PA 2ZANA 1BE8A 3MHTA 1EWQA 3O1LA 3I5UA 3KRTA 4ZOLA 3ZWWA 4OKSA 1F0PA 1XKXA 4DA7A 4YNBA 5EPUA 3PR3A 2I7TA 4KAAA 2VK8A 1TDJA 2H7XA 4KG7A 4RV5A 2EERA 1OXBB 4B3XA 3K8YA 3R9IA 1PNVA 4BO6A 1HZZA 2BM8A 3A04A 3MC1A 4RLQA 4OQNA 2GN0A 3V7NA 3KVNA 2YYYA 5FRDA 4AZ3A 1RRGA 3EZ6A 3KOOA 4CKYA 4H7IA 2A0YA 2Y05A 2POQX 5CEFA 1UT5A 4N01A 5F7XA 3PXCX 5LP6F 4E31A 1F51E 1EBUA 1A5BB 3BWMA 1Q2XA 5HIJA 3SC4A 2MYTA 2NACA 4RSMA 3ZXYA 3ASUA 3KB6A 3PDIA 3SP1A 2HF9A 1DNPA 4EG5A 2ZB2A 3E9CA 3K70B 3B9PA 3MRVA 1DKOA 2DLCX 3NYRA 2A1TS 4LV5B 1T29A 2FUCA 1ZGCA 2V6FA 3ZCSA 1WXDA 4BFCA 1AKYA 1GPNA 5EXEA 4M0UA 1G6OA 3A9CA 4EHIA 2VTEA 1E2JA 2ZJYA 5AHKA 3ELBA 4OGFA 3TUZC 2XCRB 1QK4A 1QLJA 3KALA 4JEMA 1H1TA 1GKYA 3PC4A 1A5AB 3L1IA 2F17A 1JJIA 4DLSA 4WN3A 3T61A 1TRKA 1ONBA 2JEOA 2OV1A 2ENUA 3V8NA 5FADA 3VNRA 1E79D 1XZLA 1RAAA 2A4KA 2FUNB 3CRMA 3PQDA 4EENA 4RACA 1IUNA 1JHDA 3TNYA 4HG2A 4ZVRA 2FHSA 3FPKA 4A9AA 4DEXA 1V4NA 1GTL1 2OAEA 3HSSA 2GYVA 4OQFA 4Z49A 5KTSA 1SKUA 1NVVQ 2WIFA 3UBMA 5B2EA 1GUAA 4RZUA 1ODCA 5AT1A 1ADFA 4BZPA 4CIYA 1SKMA 4N7BA 1W75A 3INRA 2RGRA 2QVXX 3M33A 3T3GA 4PSVA 3HI4A 3EMBA 3PNYA 3ICQB 5AJTA 3HYCA 1XPJA 3DLAA 3T52A 2QR2A 5DNUA 5CMLA 3A2MA 3RU9A 2OXFA 5L95A 2D0PB 3GLHB 1JQEA 2B9VA 2PHZA 3GAAA 2XPCA 2WKWA 2OSBA 3BN3A 4KPUA 4UE6A 2O3TA 2BMAA 4TVKA 2ZWOA 1AO0A 1L5VA 1C30A 2I4MA 3NUZA 3HADA 3P2EA 2VHJA 3D4IA 3CLRD 3LHFA 4WA8A 4DIKA 3ND6A 2WBLC 4NDZA 4D92A 4W1SA 2X0EA 1JIKA 2PWAA 1K0UA 1CS0B 1XNRB 2O1XA 1YDMA 3SEQA 1D4OA 4I9GA 1OFVA 5DM0A 1RC0A 4JB2A 4WI1A 4B6SA 1YFZA 4BP3A 1Z63A 2D13A 4Q19A 4Z51A 1H2AS 2P3QA 5F1PA 4IQ4A 1ANKA 1RADA 5AW4A 1TVMA 3T1VA 3PP8A 1E2NA 4DBLC 1JKJB 1Q1GA 1QOQB 3L41A 1TPYA 2FWPA 2B8NA 3KOYA 1J21A 3B5EA 3QBEA 4H4EA 3WHIA 3BJEA 4X3OA 4U6SA 1ACJA 2QGFA 3E27A 3F8WA 1GGVA 1PX2A 2JI8A 4PLVA 2XADA 3DT6A 3CE6A 1US8A 3MRSA 4K6KA 5EWMA 5T4FA 1QQBA 1HDCA 2HYDA 1L4HA 3VA7A 2QRQA 3MZ0A 1E2MA 2SNIE 2YXEA 1I01A 3LO8A 4DRZA 621PA 1W5EA 1T2AA 3C3DA 4AZTA 1GPUA 1K7SN 1MQAA 3IHTA 4BB9A 2P75A 3DVLA 2VQDA 3EH1A 3MLAA 2P5TB 2RG1A 3DXXA 1UIRA 5KOHA 5KKCA 3UPTA 1UEJA 1XRMA 4CT0A 2RHHA 3JU3A 3RT7A 4RVCA 2CEKA 4CTMA 1PZGA 4ZT7A 1YRWA 2QDXA 2XUOA 4X7RA 5DVZA 1RBZA 3CLUD 1LRJA 4N39A 1Z82A 2HF2A 3A6HA 3OQ6A 2YNMD 1EHCA 4L15A 1AURA 1Z74A 4W8HA 4F56A 4YALA 1W4RA 4FX2A 5JO0A 1GUYA 4IJ6A 3AP3A 2AN3A 2AZ4A 3UC5A 3KKPA 1YCDA 4XFJA 2IUTA 4KQMA 4R1QA 2D3TA 3U13A 1HYEA 3M5WA 1N6HA 1JBKA 3I6ZA 5KMGB 4NENA 1GT91 1H0SA 4QELA 5JC8A 3JATA 4KMMA 3IPLA 3RSGA 2VTVA 4INOA 3NPMA 1KH2A 3D7MA 4IIBA 5F7JA 4XTCS 2Q1TA 2XODA 2PLWA 9ABPA 1YR6A 1QR6A 4GBGA 4BGEA 5DGXA 1WXWA 4DZZA 4BUCA 4HBZA 1FDVA 2F4VB 1G9SA 1O9BA 4IIXA 1ZUWA 2AMJA 1K97A 2XA1A 4LY6A 3MT0A 3I37X 1NR1A 2BKVA 2WE7A 3FKSA 3L0PA 1LW7A 4HB3A 4QDJA 3EW9A 2M6LA 3U7QB 4DM4A 4DXAA 4UBNA 3UAOA 4JJKA 4H77A 3JSXA 4HSGA 1IZ9A 4EG3A 5TLSA 4WZ6A 4MCIA 2QPAA 2J5RA 1QG2A 4M1TA 2WU1A 3B5IA 1AQNA 1AK9A 2CYBA 3WMFA 2FQYA 3EXAA 4HWOA 1RYNA 3A0RB 1XLWA 3BXXA 1XCMA 3ZWBA 4Y0VA 3LYUA 1VYTA 1UWCA 1U11A 1IC6A 5LKAA 4C89A 1WW3A 4HXFB 2G9VA 3COSA 1NLMA 3HEMA 3U9SA 2H4WA 2R5NA 2F3RA 3O4VA 4S35A 4MIOA 1O57A 4UEOA 4XRRA 5ERGB 1XNGA 5TF0A 3FLBA 3S0JA 3MT7A 1WXQA 2P4HX 2BMJA 5G2OA 5C8YB 1QWSA 1PR0A 4A1OA 1UJNA 4HUQA 2XXAB 3ZWKA 2G5TA 1X70A 2PMFA 3HXPA 1PDOA 3W5HA 2L42A 3ZWQA 2LW7A 2Q5FA 1JVSA 4M1OA 4RWZA 4B35A 1X7ZB 3OZ7A 4YP1A 1TIKA 3ZPXA 2Z2IA 1D3AA 1KJ9A 3HLTA 2C04A 4ONEA 4CQMD 4EVIA 4GMDA 3FGNA 2HWXA 2ZYDA 3DTNA 4X84A 4YAIA 1ACMA 1E99A 3PA6A 4G0PA 1IUPA 1IZ8A 1ZD5A 4HQ6A 3VZPA 3GY0A 3IODA 5A1JA 3L9WA 5JS6A 4J1SA 2QTNA 3SF8A 4MTLA 1B1AA 1ZVKA 2DT8A 1Y89A 4AJIA 5B64A 3VVMA 2YFQA 4KXWA 5BN5A 4EW6A 1DJQA 3TMKA 3TW0A 4A73A 2OLEA 3CN9A 3EMDA 5L3RA 2CSXA 2PZAA 1CPYA 1KZ9A 1P1BA 2VRNA 2X8JB 1RAGA 4HQ0A 4M9QA 4WAUA 2PQ0A 3DEZA 3EGWA 2X0DA 4C7XA 1UKVY 1QJCA 2VK4A 3LJKA 1U8AA 1YJ5A 4KN8A 4ZCQA 1QZXA 2ZTSA 2HIGA 3SJBA 3CTPA 3QP9A 4EAQA 4IGKA 4PPNA 3KP1A 1FTQA 3GN1A 4Q15A 3EZ7A 1ZAYA 3HACA 4U2BA 4M1SA 4QODA 4YQEA 3ORRA 3MQ4A 3ORQA 3VNAA 2PSDA 2R2AA 4IDQA 4ENWA 3ES9A 3WIDA 3I53A 4UNRA 5T5QA 3AEUB 1P5RA 1YZHA 1MV5A 3BHNA 4JYZA 2EFYA 3BWCA 4EEXA 1JEAA 3I34X 4ZRNA 4V1CA 4BCBA 1E32A 2NMVA 4L3OA 3FPAA 1Z26A 4URVR 1YB1A 3HVUA 1CEEA 3CZRA 4E5YA 3I2HA 4LFCB 2FLKA 5FUBA