2P30A

Crystal structure of tthb049 from thermus thermophilus hb8
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
177
structure length
177
Chain Sequence
MELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQARRLKGALPSLPAFSSDLLRARRTAELAGFSPRLYPELREIHFGALEGALWETLDPRYKEALLRFQGFHPPGGESLSAFQERVFRFLEGLKAPAVLFTHGGVVRAVLRALGEDGLVPPGSAVAVDWPRRVLVRLAMDGEEATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ribazole-5'-phosphate phosphatase
publication title Crystal structure of TTHB049 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 59
structure length 177
sequence length 177
ec nomenclature ec 3.1.3.73: Adenosylcobalamin/alpha-ribazole phosphatase.
pdb deposition date 2007-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 2p30A00
4MA4A 2HIAA 3F3KA 3QPUA 3DCYA 2HHJA 3BIFA 2P77A 2P78A 4JODA 1EBBA 2A6PA 3ZHCA 4D4LA 1E58A 2OWDA 4ARSA 2AXNA 3E9CA 1NT4A 5AK0A 3NFYA 3HJGA 4IJ6A 2BIFA 4ARUA 4EMBA 4ARVA 3GP5A 1BQ3A 3IT2A 1DKQA 2P75A 3FDZA 3D6AA 3NTLA 5CDHA 3FDZB 1YJXA 3IT3A 2WNIA 5HTKA 4D4JA 1BQ4A 2WU0A 5AJXA 1SK8A 1DKNA 3IT0A 5PGMA 2P79A 2I1VB 2H52A 1FBTA 4GPZA 1SK9A 1RPTA 3K4PA 5AJYA 2P30A 4GPIB 4JOBA 3PGMA 1SKBA 5AJZA 1DKMA 4EO9A 3O0TA 2P2YA 2P6OA 2RFLA 1T8PA 2P6MA 3FJYA 2GFIA 4FDUA 1XQ9A 3KKKA 4QIHA 1FZTA 2DWPA 2ENWA 1H2EA 3MBKA 1E59A 2HPAA 5AJWA 1H2FA 4FDTA 4PZAA 3OI7A 2P2ZA 5CX4A 2EKBA 1UJCA 2ENUA 1V7QA 2A9JA 1ND5A 2H4ZA 1YFKA 3EZNA 1V37A 3C7TA 3QPWA 3QPVA 3LL4A 1DKLA 3LG2A 1QFXA 1DKPA 2P9FA 4PZ9A 3IT1A 1IHPA 3K4QA 4PGMA 5HR5A 4IJ5A 1RIIA 1BIFA 4D4KA 4E3WA 2QNIA 2P9ZA 2F90A 3GW8A 1C81A 3D4IA 3EOZA 2OWEA 2P9YA 2PA0A 3E9EA 1C80A 3GP3A 3F2IA 3E9DA 4ODIA 1ND6A 1C7ZA 1QWOA 5CU7A 2EKZA 2YN0A 2EOAA 2H4XA 4JOCA 3DB1A 2H0QA 3D8HA 4TSRA 3R7AA 3LNTA 1CVIA 1TIPA 1UJBA 1K6MA 4AROA 3MXOA 1SKAA 2DWOA 1QHFA 2WNHA 5AJVB 1DKOA 2IKQA 2YN2A 4D4MA 1RPAA 4HBZA
chains in the Genus database with same CATH superfamily
1V35A 4DMUB 3FDXA 3VPDA 2J1LA 4GKAA 5EHZA 1JX6A 4OU5A 1J42A 3TF5A 3QXJA 3VNVA 3A37A 4PW0A 4YRGA 2NAPA 3C8HA 1T3ZA 4EHIA 4RULA 1PL6A 1PSZA 1O95D 4XWGA 221PA 1FUIA 2RCYA 2JGMA 4MGHA 1YH3A 2ID8A 1QDEA 2Z1DA 2RDMA 3AR6A 3DD1A 3MG9A 4ND4A 4WNYA 3DO8A 3P19A 3MHTA 3LBIA 3DS8A 1M6EX 3GBPA 3QWIA 3T38A 4F4JA 5EZYA 4HS4A 5JZOA 5GAJA 4P4GA 4FCCA 2QP3A 2Q45A 2C9MA 7MHTA 2Q7DA 3ZD7A 1J8MF 1EIZA 2RH5A 2Q6TA 3MT7A 4YMIA 4C01A 3CF0A 3PFFA 2HEIA 1E6EA 3AF5A 5F1PA 4QOIA 3A1CA 1SUWA 3WSTA 4E94A 1ONNA 4MRMA 3STVA 4N3BA 4PIPA 3KE9A 3OU2A 5TV2A 2NU7A 4F8EA 2YWCA 5ERXA 1OF1A 2VLBA 1Z4JA 1EWRA 2XWJI 3E7XA 4JENA 1PNVA 1JEDA 1F6BA 3VC7A 2C9OA 3IDSA 3BB1A 1O58A 3H8JA 4L75A 4OKSA 2OY0A 2C92A 1ZH8A 3ROEA 2P9HA 1SPXA 2HMAA 4WOKA 2AVDA 5AVWA 3ZXUB 1P1KA 3CIFA 3QXGA 3GRFA 2NTYC 4LRUA 4REMA 1UKCA 4D80A 4AJ1A 3SXUA 5JJ5A 4JELA 4ZK2A 2O8BB 2HNKA 1XFDA 1GZHB 2C84A 4P84A 4DA9A 4MW0A 4LFAB 3P9CA 4QL3A 3THYA 5ADVA 4QLOA 3LC7O 3C1AA 4B47A 1Z5WA 1J33A 2BFFA 5KJFA 3GLUA 1MB4A 1TMYA 1N25A 1SA0A 1T5TA 2YHAA 3A2NA 3C6ZA 4IZHA 1FJHA 2R7MA 4OK5A 1T9AA 1VRVA 2YNMA 5AESA 2VHVA 2CNWA 3QPWA 2HF9A 1V96A 1ESNA 2XUGA 4K7JA 1SUPA 1XRRA 1U0RA 3JZMA 1ZFNA 1FUEA 3JQQA 4P7FA 1NLFA 1QBKC 5EXTA 1YDWA 5FBZA 1WZCA 3FB4A 1PBTA 2JAOA 2ZKLA 1OXMA 1OYOA 1NQAO 5AMXA 3LK6A 3W7VA 3TIGA 2RBEA 2CVHA 2R2GA 3ROGA 1XL0A 3IERA 4II2A 3VH4A 4CI0B 4G0ZA 3ZLJA 4HQLA 4LMRA 4XJSA 5L4LA 1SBTA 3D8SA 4KUHA 4R9NA 4UPVA 4ZT3A 1YA8A 5K0EA 5C80A 1W4BA 3HN7A 3IPLA 3NJRA 4KOEC 3WGVA 4ZO9A 2H17A 1NRWA 1VMAA 5BP7A 3BGOS 3NOXA 3QIAA 3CLHA 3BD8A 4F71A 3EDOA 4RLHA 2V3VA 1NAHA 1B3RA 2PSFA 5FA5A 3NHBA 1XCJA 3FA2A 3VSDA 5A5FA 5KUTA 4DA6A 5LM3A 1HNZB 4TSRA 4UOZA 4D4HA 2CHUA 3O1IC 4FSHA 3VR6A 4EUNA 2J7KA 2POCA 4NENA 3JWGA 1CR2A 3NHSA 4L4XA 5L40A 1J99A 1GLNA 3H9CA 2VDLB 2RIPA 3Q7PA 4AZWA 3QYPA 5KS2A 1WMEA 5FTNA 3MAAC 5GY7A 2WJGA 5EE9A 4TXLA 2IS1A 1V4VA 4RU1A 3B78A 2JBHA 1G3IA 3B7PA 3FHLA 1TADA 3ONVA 4H35A 3AEUB 2ZBEA 3RV4A 3OY7A 3W6OA 4DXAA 4YHHB 2HA4A 2RAUA 4GE3A 4AIRA 1A04A 1DBWA 4GG1A 4AQDA 3BIFA 4HSGA 8GPBA 1ML4A 2GPJA 5FTMA 4ENWA 1DO8A 3VGPA 3OEWA 1I1NA 3UUWA 2QQEA 4KNVA 4JVMA 4AKIA 5L6LB 4H1UA 1LH0A 1VJ1A 4F0JA 1JHPA 1XHLA 3MSXA 3PXUA 4WOBA 2X0NA 1V3UA 3GL9A 3PUYA 4GO1A 1MEOA 5C5EA 4M1YA 3VH2A 4F45A 5EMNA 4LFBB 3GEPA 3E8SA 1T0JB 2ID4A 4CM6A 1HLFA 3HBAA 2NUBA 2DUUA 4MS1B 3SZLA 2Q5OA 4E4YA 1M6WA 2V55B 1ZRNA 3I4LA 4FGSA 5AUOB 3EEQA 2Z2XA 1XZEA 4RJIA 4G9GA 4F4UA 2GB4A 1NDHA 3BREA 1EGMB 1Y1KE 2BPOA 2AH5A 3FYSA 3L9WA 2GNOA 4QHYA 2QRUA 3TLZA 5KYWB 3TDMA 4IEIA 4MUXA 2BUBA 2WU0A 4FX5A 1FDOA 1NQXA 1N7JA 1X7WB 1XXHB 4QUHA 1JI3A 1Q95A 2GN1A 3DF7A 5DX1A 5I9LA 4PYMA 1ISIA 3H13A 2HPHA 4JJGA 1I6MA 3K0CC 3LS2A 3MJFA 5L53A 1XDSA 3K9FC 1MMFB 2VXOA 4ZHQA 3QWHA 5LOVA 3N75A 2REOA 5FR1A 3URKA 3N39C 1U8YA 4KO4S 4H60A 5IHXA 3LSYA 4PLZA 1GU1A 2VZ9A 2OO7A 4HT3B 4KWEA 2YV4A 1FTQA 3T3DA 3I62A 3ELDA 5GOTA 2QUZA 1RYFA 4C7KA 5JS1A 4MMYB 3QUAA 1CUFA 4WXRA 2J6CA 3T34A 3IOMA 3TLCA 3D7RA 1FTWA 4QFCA 3E03A 1HBJA 4UDNA 1Q7RA 2QRKA 4PSVA 4TXJA 2WHRA 3HCAA 2XA9A 3KG2A 2QZPA 2G04A 3OQJA 2FB9A 2UZAA 1OAAA 3KJQA 3O5AA 3ASZA 2PMDA 4JI4B 4D92A 4UATA 4Q9JA 2H4ZA 1M66A 4TMVA 2P2LA 1DAIA 4LE1A 3JD0A 3NETA 2Y0PA 2WWXA 3QVOA 4EZEA 1C9EA 3KD2A 4F2WA 1DE0A 1DC6A 2V5UA 3AUAA 1CNFA 5B2EA 1GT91 2F3TA 4KWTA 4N1AA 3ZHRA 1W85B 4TS4A 1YVUA 4FHGA 3WL4A 1OROA 4A16A 4G3XA 5DK6A 3C2QA 3OTWA 3DAHA 2MR6A 4CG1A 3TGWA 3TZHA 1TIKA 2QUJA 4NFHA 5ILGA 2G72A 4NVRA 3NAZA 4X8HA 3GYGA 2A0KA 3AF2A 1J8YF 3MUEA 3FKSD 4ZT6A 4D43A 2C8JA 4HDNA 4LOJA 5HKKA 2P67A 3ADDA 1GN9A 4EWLA 3K1AA 3IAM1 3LT0A 3RK4A 4F1WA 3ORQA 3AL0C 4MAMA 4NU0A 3RUAA 3X3HA 3UMRA 1KVRA 1UBGA 2ADFA 3WIUA 4QQNA 1BJTA 1H65A 4HFNA 3VYTB 1SBIA 1P7YA 1IPFA 2Q8PA 5FD8A 2PFSA 4PTZA 2GASA 1E9CA 2G80A 2WFLB 4CEIA 1PVDA 1Z22A 1K6MA 2Q4TA 3RADC 2O8EA 2CXUA 3EZYA 4OAPA 3SR3A 1N32B 3W77A 1N6PA 3K09C 3KJXA 2DT5A 2BMWA 1KVTA 3DR3A 3OC0A 3RNOA 1UQUA 5CIYA 5KKAA 5JMWA 1XQ1A 3A7DA 4OO3A 4KPEC 4JYMA 3SBXA 1WSBA 4ZK6A 1IMOA 4U8HA 5AVQA 2ZUDA 4DFDA 1JLMA 3S2UA 1W25A 4LY0A 4RPLA 3GEHA 4ESEA 2A9VA 3DZKA 3L49A 2IQ5A 3KVOA 5TS3A 5TMPA 2FWAA 3K0AB 3ZC3A 1JA0A 2VC2B 4MUHA 1KNQA 1CQZA 1SC3A 1B4DA 1IEXA 2AC4A 2LV8A 4BO8A 1NP3A 1RCTE 2G06A 3GN2A 3L07A 5LZ5A 2GZAA 3DSRA 4NF2A 2AJ8A 3UK2A 3VFDA 2WU8A 3B12A 5BY2A 1IPHA 3RHSA 1EFPB 4FYMA 3KSUA 1JJVA 4LGVA 4B79A 2GEVA 1GLVA 4FZJA 4QEZA 4U3JB 3NTLA 2HMVA 1NFRA 2JFGA 3EH1A 5DEIA 3IT3A 5KTKA 1VL8A 2GBCA 2J4DA 5KWVA 1QU3A 2XTNA 1MXFA 4AN1A 1QF6A 2BFEA 2ERCA 2VZ8A 1OBFO 3M81A 3PHLA 2O3SA 3OE7D 4YJHA 5BN4A 4YC7A 1TO2E 6AT1A 5EWJB 2GT1A 4TWJA 5BT9A 1BEZA 2AR7A 5DBGA 4U9UA 4G89A 1RWOA 1K7FB 4ZEOA 4ZZ3A 1P6XA 2VFAA 4MS4B 2R0QC 4EG3A 2J0UA 1KO4A 2CJYA 2GXSA 2ID7A 3L6UA 1QHHA 1SEPA 3FGNA 2OYCA 3R3HA 5K6AA 5AYVA 3P0IA 4YGXB 3KFVA 1AZTA 3DMYA 1LX6A 1M7BA 4RA6A 3V2IA 9ATCA 5LJLA 3DZBA 3M5DA 1JG1A 3CLUD 4RIGA 3BB3A 3S27A 3WNCA 3W3AD 5M3BA 3WTCA 4HK4A 1WW2A 2JI8A 3O2NA 3UTCA 5AW2A 3THWB 1KVUA 2FXVA 2A78A 2V74B 3Q9UA 1DAPA 3ORYA 2H48A 4YREA 2PH7A 4WFIA 4OLFA 2QSZA 3RYHA 2I4MA 4U0KA 4LOAA 3A8TA 1CETA 3HR8A 2NVUA 1ODKA 5TJ9A 1BCRA 1XA4A 4ARAA 2C7PA 1NNLA 4ND1A 3ELYA 1CHDA 1Q1NA 1QMGA 1T1EA 4KKVA 3S7TA 4ER6A 1R27A 4HJXA 4F8JA 3TB4A 4CKXA 5GVSA 3AIIA 1KSFX 3IX7A 1Q7TA 3A4YA 3NAQA 4NQRA 4XUGB 1C14A 4QOSA 1KZHA 3TBFA 2A5FA 3U2QA 3AI2A 3HP7A 3I09A 3QU9A 4J0KA 4RF5A 1PT8A 3O03A 3O8LA 4EKGA 1YRLA 2FAXA 3D9QX 1N1DA 4RORA 3P2MA 1GQSA 1XYGA 3DLIA 3E2MA 3I73A 2IEGA 1Y9AA 4KXXA 3MTBA 5NULA 7GPBA 4AZVA 1L5NA 4YXWD 3NKLA 6REQB 1HDRA 2Y6VA 1M1YA 4XCQA 3ZWWA 4DNOA 5DNUA 2H1WA 1XZAA 3RFVA 3WK9A 2R1UA 3LYLA 1I01A 5BSEA 2WUGA 4DSTA 3WWDA 5FPYA 2BEKA 2PO5A 4HDQB 1TQHA 1CY4A 1OPXA 1RQNA 4M1OA 2C99A 3GT7A 4TMFA 2WWRA 4KH0A 4Q0MA 2JZOA 2QX4A 2H1IA 3ROZA 1JHXA 2PSSA 3CF4A 7ADHA 1HNWB 1MVNA 2HBZA 4MNTA 3HCCA 4PGGA 1U8ZA 1JVSA 3WIVA 4CM9A 3T1OA 1NLYA 3T3HA 4K9OA 3EC1A 1P72A 4J1TA 4D3DA 1R4MB 1T43A 2HU5A 3S8YA 1CR4A 1QB7A 2BC9A 3AU9A 3DC2A 5EJ8A 5I9TA 1KPGA 5GZ3A 2CB9A 2PLAA 1VGRA 4ZU3A 3ZDEA 4HLCA 3LH5A 5CEEA 1PX2A 1P74A 2NAFA 1UDAA 1OY1A 5CBPB 3KBOA 2WTUA 2RHHA 1E4OA 2J3EA 3DM9B 3ISTA 1RHKA 4CRWB 1M2FA 2X41A 2WA1A 4TMYA 4XDGA 3GLVA 1W7AA 2GARA 1GTG1 4LDZA 3P1JA 1VG8A 4ITRC 4S1PA 4IXTA 3KM0A 3VZSA 1CY8A 4DG5A 4CIBA 5K05A 1QIKA 5CDUA 5HGXA 3L4JA 2Y67A 1ZOLA 3AOEA 3GT0A 4E2ZA 1LX7A 2JJMA 1YDGA 1CRPA 1NI3A 2XDQB 2CNBA 4H77A 5I3CA 2E9SA 3CF4G 3GP5A 1LLUA 4MRRA 1B3BA 4U00A 1R0KA 1XCOA 4B76A 2W2LD 2IEBA 2IS6A 3HYCA 5BQOA 3NT4A 2VAPA 4JDUA 1NXSA 1WUKS 2I78A 3BMQB 4JD5A 3KWMA 2QJRA 121PA 1AM4D 4Q4DA 1Z9BA 2HCFA 2OCYC 3M4YA 2GYVA 3IAFA 3N28A 5C7LO 4YMVA 2JLYA 4FKMA 2J85A 1WM1A 4Q00A 4NNJA 3QV1A 1YKFA 2RG7A 1UBUS 2PBFA 1UZLA 3PTLA 1G3QA 2RH8A 2W90A 3EVNA 4Z53A 5JYEA 2B3TA 4IXDA 1AN0A 1C3LA 1G0NA 3MNFA 4FOTA 3KHKA 4FUQA 1M1UA 1L8XA 1QKJA 1LTKA 1XXLA 2IHKA 2P5UA 4QTXA 5I8ZA 3ZBQA 1RI1A 2AKAB 1LLCA 2MDTA 3SFTA 1U2DC 3K70D 1MX5A 4GOLD 3AVWA 1LDYA 3DLTA 1NVFA 3Q85A 1ZJZA 1WB4A 4W7SA 1GG2A 5HIIA 3RT7A 3HP1A 1ZMTA 3U9TA 1W581 2C4TA 3HFRA 2QVXX 1ZZGA 2VJOA 2VPXA 1D5WA 4MTCA 1BDJA 4O5OA 3UT0A 1K5HA 1KI8A 4LGMA 4BKMA 1HYGA 1RMYA 2BR3A 3E05A 1QPBA 1EFRD 1OFGA 3GJTA 3FTDA 4EHNA 4R1MA 3FRJA 1BWQA 3I53A 3O74A 2H4FA 3GGSA 4OMFG 1G1MA 4HRVA 4CKEA 5H02A 2AKEA 4LVUA 2NM0A 2V7BA 2UVDA 4K26A 2DQSA 3U62A 3L04A 5BW8A 1OGIA 4C76A 4D9BA 5F64A 4X1YA 4HQRA 5JIBA 2ATIA 1GYPA 2HCRA 4PNPA 4D6PA 3U44A 3GLFA 3OBBA 2AR9A 3BFKA 3KR0A 5L51A 4AMZA 1L5SA 5BVGA 4DA4A 3TUJC 1XOIA 3QV2A 4ECAA 2CEAA 2O8NA 4B2YA 3K6SA 1SHKA 4LYHA 2DMRA 5CMLA 4RS4A 1Y4DE 1P0CA 5E4JA 3AESB 3L0IB 4I5EA 3K5IA 1KYTA 4RA9B 3EPKA 1LNQA 3BJMA 5D01A 4DHEA 3GGDA 4RSGA 4EZBA 3Q8MA 1L6IA 5ALVA 3REOA 4LE2A 3ZVRA 4Q37A 1T34A 1F2UA 1N7IA 4K9MA 1FTGA 3B9BA 1L7DA 4WNAB 3R6TA 3DTNA 1FLDA 2EOAA 4RIEA 3WLEA 2LE0A 2UXCB 4W5NA 1NMSA 2B34A 1FTSA 4G0VA 4YDHB 1N5JA 2JAHA 3FIJA 4OAOA 1B16A 1TIPA 4UM7A 2ZJFA 4OX9Y 4P1ZA 3VUFA 4HYQA 2R1TA 3OZVA 1N0HA 4Z0TA 2XTAA 3O1LA 3RVPA 2KM1A 4YO7A 3V3TA 1AMUA 2H5EA 4LX0A 4CHTA 4RSHA 2DPHA 3DCYA 4C3ZA 3JD3A 2OEPA 2J08A 5AKHA 2LRHA 5DLEA 3RVLA 3ZX4A 3WK7A 2VJYA 2PA3A 1KQGA 3ZIUA 1AS3A 2IXAA 3NYIA 1I32A 3L6EA 4FU0A 2OXTA 5KHLB 2A6PA 4KFCA 3ZV5A 4DQXA 2E0IA 2CXRA 1U0EA 3IJRA 5ERYA 5KTMA 4FYPA 1Z5PA 4R8SA 3EZGA 3KKOA 4XVHA 4RVGA 5SYNA 3ZE2B 3G0IA 3CUEF 1IEQA 3DVRX 1GY8A 4FXOA 4Q4HA 4EHLA 1NV8A 2ZYAA 3DT8A 4QICA 3OEHA 4RK1A 4O6VA 2ZJ6A 4JCCA 5JEDA 2Q49A 3H9UA 2HDHA 4G8CA 2Y05A 2JFHA 1QOZA 1SUSA 4IZ6A 4IUYA 3BKXA 1EDDA 4IFBA 4P4SA 2H9IA 4C7XA 4P4NA 4A4DA 1ESDA 3ZCTA 5CA0B 3KAJA 2UUOA 4K40A 1TIBA 2W43A 4DV5B 3TSOA 2FG7C 1TVEA 3IAM6 4JOBA 1P4JA 1C0EA 5ECWA 4DQUA 2IXFA 4X6XA 1HLPA 1O77A 3CLTD 2J41A 2HIHA 2GK3A 2BCEA 2PS9A 3P0EA 2A14A 4DJAA 1AVTA 2OD9A 4S1NA 2R9VA 4U7PB 4TTQA 4PSUA 4KMOA 4QYIA 2IYYA 3P96A 4D3YA 4DZTA 4II7A 4NFYA 4IHJB 4PVCA 1AGNA 2EJWA 4R8VA 4J91A 2BLNA 4S2EA 5FHQA 1KPIA 1IM2A 3TCXB 4ZYXA 1VRWA 5A5VA 1L5MA 2FWIA 1QRRA 4MPPA 2Q0XA 3JX9A 1H2FA 5HTOA 2H59A 4IUBS 4BXOA 3AVQA 2YY5A 4WGGA 4Y1RA 4PZEA 1X77A 4H1VA 4GYYA 5FEMA 2WVAA 4PLWA 4OQNA 4BC1A 1OBOA 4MWOA 1P2BA 1Z5ZA 2E3JA 3GZNA 5L3RA 3CO5A 2IOFA 3QVTA 5D6NA 2VDRB 3I01A 3UB3A 2X9NA 4A6DA 4HUTA 2D4HA 1YU9A 1E1KA 1PR1A 4J8PA 4D4KA 5J4YA 4PS1A 1GNPA 3GPCA 4CWAA 2CVPA 4XQ9A 2ERYA 2GLXA 4G1CA 3ESAA 4KLCA 3TAUA 1BE8A 3DZJA 3R6GA 2Z95A 4JC8A 4HVAA 4UXJA 3ZD9A 3VOSA 1NN3A 2PUBA 3BXEA 5CFPA 2VT2A 3RS8A 4BNDA 4DIMA 4MRVA 2DY1A 2VBIA 5KNLA 1PV2A 3K0CA 1LGYA 1ORHA 1SRRA 4IHQA 3FZQA 4EOGA 1HDCA 3G1UA 2C5HA 2XTJA 1I36A 3KJEA 3Q6MA 3FNGA 4MR8A 2CK3D 2ILTA 1Y3AA 2HIGA 1HYBA 2NNWB 3PQ3A 4AN0A 1CFJA 3M5CA 3GLGA 3GGPA 2R8BA 1SKAA 3JCZA 2HWKA 2IZ5A 2QQ5A 3LXXA 5E7JA 1GL3A 3U4HA 3WLAA 2VHCA 1H8HD 3FAZA 5EIHA 2AMYA 1W96A 2DQYA 2I4RA 2J09A 2QE7D 2XA1A 3FHCB 1NR1A 2VK8A 4MA4A 2CDNA 4RZ2A 4EMSA 1C1DB 1J00A 4J49A 1XDBA 3RSFA 1YI0A 2RHMA 3OVMA 2FEKA 4CLRA 2NXEA 2ZOSA 4G4IA 4MICA 2PXAA 3SBEA 4INAA 3Q9LA 2C3OA 5HFNA 2GD2A 3ZXYA 4E22A 4UNSA 5ADWA 4GC5A 3MCTA 3ZHSA 4D4LA 1NDQA 3DTVB 3FNRA 4GRIA 3E22B 4Q05A 3SYMA 3UF0A 1JVBA 2AXNA 5B58T 4EYSA 3KFLA 4ZTUB 5EPEA 3AX6A 3VA7A 2BEUA 3WP1B 1IQPA 4R9RA 1OWMA 3RIYA 2NO7A 3OLWA 1B15A 2FW8A 1MC4A 3JTMA 1Z2CA 4GICA 5CVCA 5AM0A 1Y3CE 4BE4A 4JI5B 1ZGZA 4G4SO 2HF8A 3ENKA 4AVYA 4D0SA 2JFVA 5JAIA 1A82A 5BO5A 2J6BA 2OKGA 3NP9A 5IDYA 2YXPX 3LX5A 3RH0A 1TK9A 3JQRA 1ZCFA 2LP4Y 2HBYA 3QGMA 5HMMA 1XLVA 5ALJA 3TSAA 4Z9BA 1G19A 2ZRLA 3KPYA 1Z28A 2O2XA 3PKIA 5B7PA 4KHPB 2R62A 1XZFA 3QE2A 1ZIOA 2AOTB 4A6PA 4C0XA 2XGGA 1UFRA 3CRRA 2VK2A 4OUDB 1RAGA 1ZN9A 1SGWA 1V5WA 3AXSA 3K0EA 1JW9B 3VUEA 4OJQA 5E9JA 4AZ3A 4MJXA 4ZICA 4MQEB 2XE8A 4JGGA 4WZBE 1YBAA 4HADA 4S1OA 4GVXA 3SYTA 3TW6A 4ND8A 1ECLA 3D3QA 4KR3A 3BWVA 3DBHB 3D1VA 3VJMA 4J7AA 3NEAA 3BIXA 3CE6A 3MGGA 1AD2A 1ZH0A 4RDCA 5I9MA 1U0OC 4H6PA 4N6GA 3T5DA 4B3GA 1JEAA 2HMUA 3K09A 1P6UA 2Y71A 4R2WA 5H68A 5T4HA 1ZOOA 1ILWA 3CUTA 1XQXA 5KPDA 4L9RA 1GM5A 3H9EO 1OFVA 3IXQA 3OI7A 4JA0A 2YCBA 3KKNA 4W5JA 2QLLA 1P7PA 1T0PA 2J4CA 3FNHA 4QUGA 1Q0UA 1DQNA 4NZ9A 4R0NA 4BYGA 4C9BA 1NZJA 5BSTA 3ZVKA 4IHJF 4Q3LA 4MYDA 5DASA 1QH0A 5EJMA 1GFWA 5BV0A 4B7UA 5LVAA 2O2DA 1YS2X 2JPDA 1SBZA 2JW5A 1YK0A 2ZE8A 2V03A 4ITUA 2AMLA 3OCVA 4QWWA 4EI2A 4W5QA 1Z6ZA 2GZSA 3H83A 4R83A 1JDJA 1EGAA 3E3LA 2QN3A 1E6MA 2DR3A 5DLPA 4QU0A 4ZQCB 5GP1A 5E6SB 4EUEA 1OTXA 1T10A 2BONA 2O52A 3UO8B 1CIPA 3GOQA 3EVBA 2H92A 2OB2A 3L06A 3QUSA 5KOYA 1WAMA 3LPLA 1SQGA 3QKIA 4OKNA 4MZDA 3UXYA 2MHCA 2NLOA 2WLTA 1YE3A 2YN0A 3NYQA 3S8MA 1PTKA 3GY0A 1ZXXA 1J24A 1LWOA 1TPZA 1ZCAA 5LCXA 4DQKA 4WESB 2XE7A 5B1YA 1Y33E 3EZ7A 3PWZA 3FPEA 2QDKA 2SKCA 3DO6A 4FN5A 1V3TA 1VHWA 4LC9A 5BMVA 4Z49A 5B3LA 3CPEA 4GL4A 5E3HA 3IPRA 2G88A 4NV1A 3O8QA 1B0PA 3G7NA 4BMSA 2GUWA 2VQSA 2WAAA 2GA8A 3P9ZA 3ZWCA 4ID9A 3UK6A 1Z6AA 1C3OB 4Q3KA 4HS9A 4K28A 1NUUA 2GYUA 2PH3A 3AUUA 3GEEA 3FG9A 3OX4A 4U7HA 4LSMA 5TDHA 4E14A 4JJEA 1O89A 1TLLA 3B60A 4OOEA 4WVLA 1OH5A 2Y1LA 4PAWA 4UDYX 3ZHCA 5G1NA 1P5RA 1BRMA 4PZPA 2WV9A 3TPCA 5JXGA 4V02A 1DIAA 4FFNA 3DOJA 4P36A 5GM2A 2RHGB 3TQQA 1WSWA 2I87A 4MLPA 4JUBA 2XVAA 5I5GA 3N8GA 4P83A 4X7MA 4XEUA 5DGCA 5HRAA 1HKHA 5ICSA 1YB6A 4QUBA 4MYCA 4RO0A 1FB5A 4A3SA 1JJIA 1NTRA 1USWA 3I28A 4R1NA 2UZ1B 4EQZA 2WNSA 4C43A 4HNAA 1DBQA 4NJEA 4HCJA 4N54A 4MS3B 2XMPA 4H27A 2OQVA 1JQ3A 2GK7A 2ZS8A 2O1EA 4NRDA 4EG8A 4MEBA 2CSXA 2NVBA 4QSHA 3V8EA 4YASA 2AG8A 2FPUA 1VIYA 1C9DB 3KELA 5CNMA 5EOVA 2Q29A 5ITZB 3W2EA 4YQYA 1C7EA 4G84A 3OHPA 1O7JA 2C83A 3FOFC 1XZBA 2O7SA 3Q7QA 5DNCA 2AOVA 1JR4A 3FSRA 3K2BA 2Q9AA 4JSYA 2REXB 4AY5A 1Z34A 1GPMA 1LU9A 2X0JA 4CL8A 5ICMA 5JNRA 3UICA 2PXCA 4O8CA 3FJYA 1T1JA 4RBNA 5TQ2A 5JXHA 1A1SA 3RRJA 5CCXA 3EA4A 1KHTA 4PYQA 4DR6B 5D85A 5KOHB 1E60A 2YIJA 3CPJB 3QRWA 2EP8A 1MCZA 2O3UA 2WJIA 4M9ZA 4ON9A 2PQ6A 1AV7A 3JZIA 4AUNA 1YXMA 1TKCA 3JQFC 4D9FA 3CT4A 2Z09A 4IG9A 2YJZA 4C03A 3BMOA 2NMVA 1QGOA 3U7FB 4KACA 2J5KA 2D0PB 4X91A 3RWBA 4N3NA 3L82B 5JNTA 1V6SA 3L01A 2N47A 2YX1A 3SLRA 1DDIA 1VBFA 4HX9A 1QSGA 4MDHA 2VVTA 1E1DA 5CGQB 2GTHA 1J0DA 2JRLA 3A9VA 4UTZA 5G0WA 3EUWA 3ZHTA 3QEAZ 3PT5A 4HGNA 1SIBE 1RWNA 1TKBA 3DR5A 4LJ9A 4RLFA 4ZTBA 4CMGA 1Z35A 1T2NA 1W9HA 3EQ8A 2Q6LA 3AUTA 3B52X 3H2ZA 3TSCA 1MOZA 2J3DA 3D81A 4Z8XA 3FWKA 1F48A 1T3HA 1RU3A 2VA9A 2B99A 2Z1NA 4ZAWA 3ICQB 4LZJA 4PR0A 2C82A 5F5XA 3BSWA 4PX2A 5AW7A 2W5UA 4BLSA 3G0BA 4HNSA 1PL8A 2C3PA 3CCBA 3SSNA 1H93A 4XCXA 5HQ3B 2GDJA 3HFSA 4XPIB 1BNCA 3I9MA 2I55A 4BP8A 2GTIA 4LDPA 3D8UA 4G5RA 3KOZA 1LSJA 2O1WA 3AHJA 4L27A 2M6SA 3D8NA 2YWJA 3C1UA 3HEBA 3VYWA 3ZUPA 1C29B 3IR6A 2X5KO 4JLOA 1PYOA 1N2CA 1CF4A 1YZGA 1QORA 2V0NA 1GZ3A 4M83A 4S12A 4WZBB 5DM0A 1FMLA 2NPIA 2OLKA 4QATA 4UZFA 1O96A 3IEXA 1KO1A 3ZWDA 5TJHA 5BXYA 1FLAA 1OA1A 1T25A 2AEMA 1D2NA 2FHSA 4AWAA 1T0IA 1E1QA 2D1SA 3FGPA 4IQFA 4PSAA 5AVTA 2ZAGA 3UMFA 4S04A 1UT6A 5JWHA 4CF5A 3ZWVA 4Q9HA 3FR8A 4BVAA 4IY1A 2QLTA 3Q8LA 1LEHA 4DOMA 4TYNA 3BT7A 4ES6A 1ZA1A 2FMUA 2RI1A 2Z5VA 4R81A 4X97A 1QIHA 1Y9EA 5KSPA 4LDNA 2B0CA 4YECA 1JAIA 1EG7A 3EWSA 4JVLA 1BS1A 2CLSA 1HLGA 1PGNA 2CNKA 2H07A 4XJTA 2R6JA 1EJ0A 4PC7A 1CVLA 3H9GA 2CBGA 5A3SA 1KQNA 4N5DA 1XKXA 4QXRA 4YA6A 2A0UA 1VP3A 2P68A 3FDZA 4JJZA 5DTQA 3WGOA 2CVOA 3HU5A 10MHA 5A1TA 3VDQA 2OYRA 3IAS1 4CXMA 1I4LD 1KETA 1SK8A 3MAGA 2P6NA 1CUBA 1NUTA 3E9RA 1QGED 3IQFA 1H0SA 4M46A 4QELA 2ZI9A 1CJVC 2JLCA 2H1OA 1A8PA 1ZU4A 2NGRA 4K9LA 2B20A 1LPPA 1US8A 3GDWA 4OL9A 2SCUB 3VAZA 1HDZA 2AYZA 1HE1C 3DWEX 3OAAA 4LHXA 4TXMA 4YY3B 1RCUA 4FGKA 3C4JA 1NY6A 2C5GA 4LTNA 1XDUA 1A98A 2B8WA 4FW9A 5JYDA 4AMBA 1A2KC 1EK2A 4P2BA 2FFRA 5DT9A 4BIIA 4FGLA 2CD7A 3F8SA 4JLJA 4QQFA 2BGRA 1W0CA 4CV3A 1H2EA 1QR2A 3LQ1A 1JDPA 2ON6A 1PGQA 3RVRA 4RTOA 3L0ZA 4L6AA 4N18A 4QDOA 4WXHA 5B53A 2C0CA 3JW8A 3NBQA 1DMSA 5CCDA 3WHIA 4TKVA 1U28C 2EIXA 2R7LA 3BWYA 5F3WB 1BTOA 1TL7C 4TLMB 4OBWA 3T7DA 3W9BA 1CJKC 2YZMA 5H4GA 5K0CA 3S8EA 4I9NA 4BGDA 4ILEA 3VTKA 1W93A 2R8PA 1RRKA 1F0PA 1ZESA 4B8WA 1IXSB 1F4LA 1GTRA 3BZUA 2VT6A 2TSYB 3DE3X 3P2JA 3L6CA 3RAEC 4FBGA 5HFAA 4DUYB 1HZJA 3QKWA 5CPBA 3SQNA 4WY8A 5IABA 3PCXA 5K0FA 4R8MA 4KGDA 1C3JA 3LHKA 1XD8A 2ZIVB 3E3AA 4P3XA 5EKSA 1I6KA 1XZHA 3ZCSA 4LW8A 2YQ5A 4B43A 5FUXA 4B6QA 4HEJA 4CDNA 2PEYA 2GM5A 2IOHA 5EQDA 1XQWA 1J5PA 2P27A 2JLZA 2PX3A 3KL4A 2IH4A 2XUFA 1D2HA 1MO6A 1PR0A 5JFOA 3G82C 4L4RA 4M98A 5JAUA 3NIFB 2VNSA 1ZSYA 2XKBA 2ZBFA 3NORA 4M0MA 4YLEA 2JIPA 1EVKA 3HXOA 4NJOA 1R0XA 4WZZA 5KYYB 1QONA 3NIWA 5F33A 4E5VA 2D2XA 1BGVA 3HV0A 3E1SA 5EVCA 2XVXA 3WXBA 2IHNA 3VHRA 1BH2A 1L5QA 3P27A 3PQ8A 3DHNA 1YQ9A 2CHVA 2JVKA 2UZ0A 4GEKA 5KU7A 5E4FA 2H5JA 4R16A 3C5WP 3O82A 2NACA 3PQCA 4P4TA 4PG6A 2CFCA 4FYVA 3P26A 3T3MB 1J7JA 3WGHA 2HA0A 2I91A 2CLLB 5ARCA 5IBPA 4RHCA 1KYVA 2FQWA 4GYWA 3EWAA 3IDZA 3N8HA 4UU1A 5K45A 1P75A 1G5TA 2ZS7A 3HJTA 4M8NE 2WTAA 3Q6IA 3VPGA 2QR5A 1J0XO 3R7WA 3U3XA 2C4VA 1FQOA 4BVKA 3WXMA 3CPHA 2ZCUA 1HV8A 1N7GA 2G9ZA 4G81A 3RF7A 4BNWA 4E07A 1CW2B 2GZDA 4O29A 1CUWA 2DFNA 2FPOA 4EVSA 3HKDA 3S2YA 3MGKA 2AHOA 1PFQA 1A7KA 4RVNA 2O0HA 2HWWA 3G8AA 4LY3A 4D0GA 1KJZA 1W5TA 4FLMA 4J90A 4FNGA 4OJYA 3V80A 2Z4RA 3QFRA 5KYUB 3BWMA 4JL8A 4OY3A 4HEA6 1TCBA 4YP6A 2BGKA 4HDKB 1CEYA 1J49A 1E2DA 1UR5A 1ZICA 2ZSBA 2P1DA 5LQJA 3H9QA 1ES9A 1CZRA 2RAPA 1PR2A 1X3SA 2A57A 3BHMA 3R6LA 4OQZA 4BJ1A 2FR0A 5JU6A 3GDFA 1B41A 4Q1FA 5LDDC 2ZB2A 1V2HE 2QRJA 1JIXA 4FPXA 4HR7A 1NOIA 4B3TB 4DY4A 5FTKA 2QMHA 2ZIXA 3IA7A 3WAKA 4MGKR 1DMRA 1JU4A 2CZQA 3V1KA 3N2KA 5IVPA 4FWTA 1A77A 1T2VA 4FBMA 2B7CA 3TNLA 4K2HA 5EHGA 4Q9IA 3GLIA 5DDIP 4E46A 2I4LA 3QXCA 2B1GA 4G1EB 4XQGA 5JAPA 1AXRA 3I8SA 4HWKA 2CJWA 4UTNA 3K9CA 5E1DA 3FUUA 4IEEA 3ITDA 5KNCH 1LY1A 2I71A 3MUNA 3IP1A 3GUHA 2P2ZA 2B4QA 3JYQA 3UQZA 4N5MA 4HAUA 5BWBA 3D7MA 4CT4B 4FS3A 4GWLA 3GHYA 3ZU4A 4XWAA 3V4PB 3REFA 3RUHA 1Y98A 3ZBTA 1UWLA 1G7CA 2P9QA 1R6BX 5AJHA 2X3UA 4AO6A 2F1KA 1N92A 4D8TA 3L7AA 3N2YA 2HRQA 1E98A 5EYPA 5ES4B 1LRLA 3HYTA 3CMMA 1J8FA 2WHPA 4MEJA 2PQ0A 4JFRA 2JLXA 1A7UA 5B4VA 3HVKA 3HLTA 1UK7A 3FFWA 4PONA 1LPBB 1MRZA 4A8JB 4UEOA 3SFZA 4YRRA 4U7WA 2CLCX 3MFYA 4EYEA 2YCLA 5BR8B 3UMBA 1O6GA 4ZCPA 1XAJA 3E48A 3ZHXA 1QFZA 2IYEA 3VC3A 4BZWA 4E6EA 5ADHA 2NU8B 3NW9A 4QQ8A 1FS4A 4RQUA 3GA7A 5A4KA 1NDUA 1P60A 1T0HB 1OXVA 3L7BA 3ZLBA 3VSAA 1T8YA 3GFFA 3ZWPA 4DDMA 4QUAA 4C4OA 4EG1A 5H7XA 2BWJA 2Q3EA 4B3XA 2IU6A 4I6JA 1OWLA 1VI5A 2OVBA 3H8VA 4OQPA 1GZUA 4G9EA 4RXUA 3QK7A 4G24A 3ZVLA 5KNCD 4W5RA 2FF5A 4PBTA 4RTPA 4GLLA 3OQOA 2HRDA 4UNRA 1RXIA 1QQ5A 1S96A 3KWLA 3W2IA 1ZVMA 1KK3A 1L3BA 1TZMA 1Q16A 3NPMA 1RZVA 4LWOA 4MVJP 2PANA 1UEJA 4KG7A 1W0KA 1U3CA 4G97A 4LRWA 4BZZA 5JZMA 1BVHA 1AF7A 3W7BA 3WB9A 4IX1A 2KHZA 1T4MA 4Z2AA 4D41A 5C1DA 4IIYA 2GHTA 3A3OA 3VU8A 4RMJA 1FLVA 1NGSA 5EZYB 2EWWA 3WYFA 8ADHA 5E1BA 4F9EA 4X41A 4QYTA 2VKTA 1FQWA 2VIIA 3W2GA 2C77A 1GGNA 2ACEA 1PAUA 4Z86A 1HETA 4ZVKA 1NHGA 4MRMB 2ECPA 3PJDA 1PVVA 4KE9A 2X86A 3KYBA 1U99A 2I65A 2NU7B 3L4SO 4G8JA 4X8MA 1TM4E 1KWGA 2I1VB 3PLNA 1JIKA 1WMSA 3FTCA 4LXQA 4QFMA 4YAWA 4DADA 1UDBA 3I8XA 3IIKA 1NV9A 3ZBUA 1ZSNA 9LDBA 1IM5A 1QCCA 1U7ZA 3CNBA 2IXDA 5CTJA 4Z6KA 4J7CA 5AT1A 2AQHA 2OV2A 4X71A 1BE6A 1FF9A 2XLBA 3S5JA 1JKIA 1QZ3A 1JLKA 2OPBA 1E2MA 1SPBS 2I2AA 2UYGA 2W6NA 2HC9A 3SXUB 1UDRA 2EBUA 3FPSA 5AI5A 2P3QA 4YQFA 2VN8A 3C3MA 4H15A 4KIFA 2DUJA 3THYB 5E3JA 5AIAA 1H5UA 2R84A 3KQSA 3MCVA 1WP4A 4Y2TA 3SYKA 4DBLC 1UPAA 4DSZA 4KAAA 4F5ZA 2BFFB 2P7IA 4UOEA 3M2PA 1SA0B 4XGRA 1HDOA 4M0EA 4UDXX 5EFOA 3GFOA 4WKPA 1GPNA 3R3JA 3H2BA 2R11A 1YSCA 2C88A 2D8AA 2WYUA 1MG0A 3LDGA 4WCDA 3K31A 4JQSA 2D13A 2P9EA 2ZRPA 3R1IA 4J9VA 1N6OA 1QKKA 3B1YA 5FJIA 3C6QA 3PUZA 3SS9X 5EZ6B 3C3BA 4MKRA 3ACBA 3UJ3X 5LU8A 1FFEA 3TOVA 3DB2A 3PI6A 4L5CA 5C4MA 1YS1X 2P2SA 3TJZA 3OQ6A 5P8WA 2BMJA 1WZIA 4UNNA 2VWHA 3WDSA 4B6OA 4BX0A 5K0SA 3WNDA 1ZHOA 3NHYA 4HXFB 2JB9A 4J75A 4LJ6A 4M4SA 3G8YA 3HVHA 5GZ1A 5KVAA 2YXEA 3AKZA 5AW6A 1OWPA 1R64A 1I3LA 1S4QA 4KIWA 2IKSA 4LYJA 4PN7A 2CL0X 4GECA 4OI0A 1H5NA 1O3YA 4PBRA 3CCFA 2ECQA 2HJWA 5KJEA 1QFSA 2YWFA 3JQAB 4FOLA 5L9AA 1CVIA 1KIMA 1TKAA 2FZEA 2UVQA 3G2JA 3RIMA 4NENB 3VV2A 5FKJA 1UOOA 3FLAA 3DMHA 2GS9A 2YN2A 2OVFA 4RQTA 4DDWA 3SSOA 4R1PA 3JD2A 3DEJA 3E84A 4GWKA 2JKZA 4X61A 2I8AA 4PRKA 2QTVA 3TTUA 3VHLB 1A69A 2YVAA 2YC2C 3AF0A 2B0JA 2ZPTX 1WR8A 3OKAA 2H1LA 1QS0A 3UGQA 3WGJA 5TMDA 4I50A 3L40A 2MIIA 3JQFA 1STOA 5EJ5A 3FF1A 3CLSC 3DL4A 3R7SA 2YJTD 1BE0A 2DTXA 3L79A 4PZ0A 2QD5A 3T7EA 4X54A 5JJKA 2N9UA 1PZEA 4YAJA 4MTLA 4MWZA 4E5UA 1T3LA 5IUKC 3SJCA 4PAGA 2YWHA 2ZREA 2V7GA 3E53A 4AJ9A 1DUIA 2FSHA 2H2GA 3QBVA 4NI5A 4DKXA 3JQGA 2XMRA 4M9CA 1BDBA 1M1YE 2O20A 4X6UA 2AFVA 1UDXA 1POWA 1GZ6A 2JGIA 3ZXXA 2C7OA 4BLTA 3A3YA 3WISA 1KIAA 3KKPA 3H8WA 3OOJA 3QUCA 4URFA 3HA3A 1LBQA 2B35A 4IOKA 3VMFA 1DKNA 1TQ6A 3DHEA 4GR5A 4PG4A 5DB4A 2IBSA 1JZTA 2HMYB 1IZ7A 2CLIB 1LDNA 4XASA 3AM3A 5EZYF 4JGIA 1WXDA 3HSSA 1IY0A 3NBAA 5IYZA 3KOXA 2IHUA 2KLHA 1L4HA 1MX1A 5TMEA 2AMJA 3X1ZA 4AYXA 4YRPA 4BQPA 2I6QA 3TDNA 4ZHQB 3V4FA 2GZHA 5LOVB 1HTTA 3HACA 3JZFA 5HUHA 5A7FA 3K8OE 1UEIA 3Q7TA 4LSZA 1I0LA 4XLZA 3RVOA 4IGIA 4QBTA 5FOQA 2P6RA 2JGLA 3AM4A 1RQGA 5E8JA 2KMLA 2C2ZA 3F3MA 3RT9A 3TR5A 2Q3CA 3DLBA 3KWJA 4S24A 4MROA 1YBMA 1JUDA 4MR7A 3QFSA 2AXQA 1N1EA 1UANA 3JAWA 1FVHA 3CWZA 3IIJA 5HF8A 2GR9A 4LOLA 4K1XA 4ZD6A 4BLPA 5FH9A 4F3KA 3C8UA 1GGVA 4R7GA 1P1JA 3LG2A 4BRWA 2WFAA 1U2TA 3IP8A 1I3OA 4G1BA 4P0QB 3M6UA 3AF4A 4R68A 1D2RA 1DIRA 3FVRA 3FROA 3PQ4A 3VZBA 3FOEC 1EVYA 1EDBA 1LA2A 1SM4A 2ZLBA 3P9SA 4YJ2A 4U4AA 5CHYA 5JSKA 2IVFA 4LOKA 3TZEA 3ZBPA 5IULC 3WLNA 2WWYA 2RHDA 1VA5A 4GI1A 2W2MA 2I99A 1GARA 1HEUA 3BAFA 1K8YB 4N5IX 3MUFA 1B23P 2AMVA 3MTJA 3OIVA 1O8CA 1XJ5A 1JG6A 2FSFA 4F3NA 4DIKA 4MWSA 4HDNB 4CF6A 4RKRA 5TB5A 2O2ZA 1OAOC 2BKLA 2OBLA 3STWA 2OG2A 3EPPA 3K1AB 4I5DA 2XGOA 2QJOA 1A5TA 3GD7A 2LWIA 5AHKA 4N76A 2PWBA 1QYWA 1Z6QA 1NVAA 1TB4A 2X14A 3HJHA 3WLTA 3F5QA 3VU3A 5A4DA 2B4YA 4JJFA 2E7ZA 1FIUA 1XT6A 4CEIB 2IY7A 1RE0A 2O8EB 3J80A 4I4TA 4R98A 5AJVB 1W73A 4TXHA 1F0YA 2IHTA 2KE5A 5ALLA 3RS5A 3F71A 5KHAA 1NVVR 2PCJA 4EHFA 1UBHS 1JU3A 1M34A 5EMJA 4KR7A 1DT5A 3NVAA 4KBYA 3AINA 3TR6A 1XNQB 2YFHA 1U28A 2W71A 1Q20A 2AN3A 1SD5A 3RC1A 4C4PA 4LPKA 5JVDA 4P2GA 3PDWA 1YS4A 5AKLA 5B58C 3RASA 3GLFE 2BN4A 3DULA 3HUEA 4ZZ1A 3EC7A 2D2VA 1HYEA 3H1BA 3ORHA 4RAOA 1NATA 2IF0A 1GAJA 3T9BA 1QE5A 1SXJD 5G2OA 3WIOA 3LJKA 1IVSA 5ALDA 2Z5LA 4G86A 3SWWA 5FFMA 4R5MA 4V0MA 1VMIA 3ONWA 3S1LA 3M6WA 1SQSA 1NBMD 2MT9A 2P75A 2ZI6A 3D6VA 4OGFA 5BSRA 1HURA 1NLZA 1RXWA 4CKCA 3EPHA 1H05A 5E6UA 4BN5A 1ULZA 3QF4A 2Y1XA 2D5CA 4IHKA 3TRJA 3P9KA 1YT5A 1W29A 1KFJB 1OREA 5J43A 3OPYI 1ECPA 2FDCA 2BFEB 4H18A 4YJHB 5BN4B 1UKBA 3L5KA 1ZAYA 1JFSA 1ZISA 1TCVA 5FB3A 4MW1A 3EGDB 3IO3A 5DP2A 1DZIA 4BB0A 2FPRA 5FCDA 3HO6A 4IUDS 1OE0A 1TZJA 2J0UB 5FNVA 2OGSA 4I4NA 4GD3Q 1QHHB 2PGIA 2QLNA 5EJIA 2FXIA 3L7MA 4B31A 4BLQA 2A5LA 3IPCA 3ST7A 3WL8A 1VLVA 2LBPA 2FMXA 3DAFA 4RA6B 1TAHA 2ODPA 1CX9B 4TT8A 1EDEA 3TW8A 4KSYA 1QOQB 2DBQA 2O6HA 3A4VA 3G2KA 4RPJA 4UCXA 4WE3A 1VLHA 1E1RD 3WMEA 1U2QA 2AG6A 3DKRA 4MA5A 3GFGA 3GT4A 3WO0A 2EJTA 4QARA 2XNSA 2XCSB 3DE1X 2DETA 3SE0A 3SJBA 5LOVF 3B51X 3NR2A 4LIPD 1IZ9A 4LYAA 4CV1A 1XCMA 3JY6A 3U4CA 1QHEA 3RYHB 3HXPA 3HJRA 2NVUB 3RRYA 4FR0A 4KQ9A 4Q1VA 1BCRB 4DM7A 2HK6A 2IX9A 1K8ZB 3IP5A 3PGLA 1KAOA 1GTVA 5CB6A 3CW9A 3ELWA 4RHXA 2II6A 3MCWA 2W83A 2YMLA 3SNHA 4YUYA 1N2HA 2BGLA 1YB2A 4OI4A 2ZYUX 2QVBA 1P2DA 2VDMB 2Z0MA 4XM0A 3EYAA 2J0QA 1BOOA 3EN0A 2PGNA 3L8YA 4UPEA 2WKQA 3H1EA 4MVJA 3T4XA 4AW9A 2WG0A 1XYYA 3W5DA 5C3UA 2AV6A 5JZ9A 4XYBA 3P2EA 4MGZR 4R2XA 1PNTA 2GD1O 4EX7A 1N36B 1XZCA 1M1YB 1YBVA 3EEOA 3VKWA 5SZJA 4UCQA 2EKZA 4JYZA 2E18A 5TRTA 1T5OA 1VHDA 4Z0PA 4R2IA 4GR9A 2A84A 3Q8KA 4BNNA 9MHTA 2P6PA 4LTMA 3INYA 4NHEA 3SIXA 3EODA 3O31A 3U0BA 2IW1A 4KXWA 5CT4A 2FQ1A 1BFKA 1Y3DE 3NKFA 5ALPA 3FBWA 5FPSA 5SY6A 2YUTA 1EBFA 3I9LA 3LV8A 2DWOA 1JBQA 4BU1A 3SBDA 5IKMA 2PT9A 5JCJD 1OFIA 1U80A 1RPZA 4KJZA 5L4NA 4LHEA 1NUSA 3HA5A 3KLMX 2EFEB 4H1HA 4UBMA 2WPDD 3LT2A 4B6JA 4C0KA 1E8NA 5I47A 4KMRA 4DR2B 1JIJA 2C4KA 2Q5HA 2RBKA 2X58A 3SYNA 2V6MA 3GEBA 5DLYA 1WXGA 4FP9A 4B4OA 2BM1A 3PXCX 4MUBA 3A04A 2JD2A 3KLOA 4GRAA 2ONJA 3ZE9A 4P81A 5T67A 2FZWA 3ZGZA 2HRCA 2WOOA 5I7VA 1CTQA 4ZAFA 3MGBA 4H4EA 1EJ6A 3K1YA 3TKLA 1BXZA 2G9RA 2OYSA 1MRSA 1PQPA 2IYVA 3D0QA 1NL3A 1C50A 1RAFA 3I1YA 3ME5A 5DCUA 4ROTA 4DM4A 2JLQA 3HJCA 3VHQA 3GOHA 1ZVJA 3MTAA 2HMTA 3JVDA 1J90A 4FMBB 4W7IA 5ALXA 2PJZA 3QBDA 3UGTA 1RPJA 1XPJA 3GRUA 4BLWA 2CFSA 4LXXA 3K9WA 4UBLA 3TZ6A 4KQIA 4PHCA 5K01A 1CP3A 1G8AA 1X92A 1Z37A 3DVSX 4DTIA 4HB4A 4R9UC 5FFFA 3GF4A 1NXQA 3A1TA 1N5OX 4F3TA 3WJ2A 4G63A 4RY9A 1BYUA 3E5NA 4HGYA 4W8GA 2WWVD 1G3RA 5K20A 4NXNB 1V25A 2F9MA 3GLGE 4J0QA 1U1GA 3SQLA 4BHTA 5IXYA 3KU4A 3G02A 1RSZA 1XTZA 3ZV6A 3PEWA 3U4AA 1F2VA 2E1RA 4GR4A 2NO6A 4CM5A 1XRJA 2QP9X 4Y2YA 5K8UA 4O3MA 5P21A 3ANNA 2EW1A 1YRWA 3DONA 3WGKA 1KTIA 2YZ2A 4KR0A 1I2AA 3NM6B 3MBKA 1XAIA 2GKSA 5BSGA 2OXCA 1MENA 4U6QA 4PO3X 5IJAA 1X3LA 1JI0A 2C1XA 5BT8A 2GWRA 4QNNA 5KSWB 3GQBA 2OQIA 3C70A 4PPNA 1SOMA 4DUGD 1JTVA 3IAAA 1FP4A 4P8RA 3WLLA 1I4OA 621PA 1AZWA 1E0SA 3EGCA 4CT0A 1UT8A 3CMCO 1LJ8A 3E23A 4N40A 1T36A 2VNJA 2PSJA 1AKMA 1P4AA 2KQUA 4LJLA 4Z99A 1JSCA 3MT8A 2IUTA 3QLUC 2RAVA 4X1YB 4CTMA 2VZ0A 3U44B 3GLFB 2EAUA 1GVNB 5KAMA 4KR2A 3EG9A 2PR2A 5CRIA 1GFZA 1N2IA 1ZQ9A 2ZUUA 1F7UA 2NUTA 5BVGB 3OM0A 1VJ0A 2GN4A 5D5HA 1DWPA 3K6SB 4QVGA 4YUWA 3L8EA 5HX7A 4BPBA 4WTOA 1VHQA 4JQZA 1Y8CA 3A6KA 4FHDA 4QE3A 3PNLA 1E2HA 3FDJA 4MW2A 1PF7E 5GVRA 3FHJA 1Y4UA 2GQ0A 1J07A 1F2UB 2FFAA 2YV3A 1SUEA 1ZD8A 2WSBA 1CB7A 1IJEA 2IV2X 4HXGA 4ZXFA 3VISA 4JUIA 1HM5A 2QZZA 4I1UA 2ZANA 4DV3B 2X19A 2HD4A 2WABA 1UJBA 3MOIA 3CLUC 1YDHA 3OHMA 1N4AA 1H9AA 1PWEA 1YRAA 1EFTA 3RS7A 4YDQA 3CGGA 3V6MA 4G65A 5COAA 4P86A 1G4HA 2P1RA 1AKQA 1PQ4A 2QD2A 2R1TB 3IS3A 3IVCA 4PLYA 4BB9A 3IMEA 1EG2A 1E5DA 1Y6RA 2WT9A 1FOEB 1NPDA 1YVEI 2G36A 2XBUA 5DNVA 5AM1A 3WMWA 4I14A 3KSRA 4BNJA 1KJJA 3RSZA 1HQCA 3CLVA 1AZSC 1ODSA 4Z4QA 1QZTA 5I7WA 4R31A 1BCSA 3PI7A 3V46A 2WWTA 4C14A 4ENTA 1SU8A 2O8DA 2VYCA 4Q82A 5HS6A 4MB0A 1RFLA 3PNPA 4JWKA 4OHCA 1YL5A 1XZDA 2O0JA 3EA5A 4WKBA 3MM4A 4G01B 4UNPA 1TQ2A 3TKYA 1WXQA 1T29A 4Q4HB 1MX3A 1PJ8A 1WDTA 2QR3A 3PPXA 3V1MA 1CJMA 3E5MA 1G5IA 1HE2A 3WRWA 3PRKE 1LNZA 4TT3D 2GPSA 3TSZA 4CNBA 3I2GA 3VO1A 2WHEA 1CNMA 4E1BA 2EZUA 2PGOA 4DCUA 1HMYA 3E9ZA 3O47A 4NNPA 4RIIA 4FHCA 4WEQA 1IHDA 1S2MA 5EWLA 3ZLVA 3G5MA 4AKTA 4P4SB 4IR7A 4DIUA 1YJCA 4UQPA 5EJFA 1LK7A 2C3MA 2CEKA 1L5HA 5KSYA 5T57A 1KO8A 3PQDA 1PSWA 3IBGA 3WHLA 2RARA 3O8NA 3UHFA 4RXTA 4F8YA 4Z9XA 4TV8A 4FN4A 1RR6A 2F9FA 2M1XA 1RQ2A 4KITB 2N3ZA 3UK1A 1YRQA 1G6HA 2Q7XA 1YR2A 5JXJA 2C7GA 2XLCA 2OFOA 1TUBA 4GF5A 5FUMA 4IFTA 1G2IA 4TYMA 4IQ0A 4Y9UA 2XUPA 3RROA 4Z2YA 3OC6A 3F49S 2EX0A 2ZK7A 4QULA 2JIDA 3EHEA 4XI9A 5FO0A 4BO6A 2RGRA 3MTQA 4BXOB 4N49A 1YJ5A 2I3DA 3H6GA 2WE7A 4LX8A 3A06A 1MT0A 2W0SA 3AR2A 4Y1RB 1KK1A 3OF2A 1HORA 1RQPA 4Z1MA 3NHRA 1B1CA 3KUXA 1YGYA 2VAWA 5B7GA 5JEEA 1FDWA 2PRKA 1DAOA 4GQIA 2QDXA 3GZNB 3D31A 3HPRA 3P4YA 5K0TA 4IIUA 1R8SA 4W6ZA 1JHDA 1OFHA 3T8YA 5IS2A 2GJ8A 4UJ5A 4BUJA 2CNDA 4EHAA 5EIBC 4M8KA 1VSVA 3UYKA 3I12A 2WICA 3DVLA 3BHJA 2X0EA 1NKSA 1VG9B 5A4JA 5FV4A 4HLDA 3PWTA 4ZU1X 1KEPA 2VF4X 1A50B 5K0LA 1G8GA 4ASUD 1C1HA 3HMQA 3E9DA 3HDTA 2OGZA 1MPTA 2IIPA 1QIJA 1TMGE 3C3EA 4BNDB 1YJQA 2QTFA 1W6UA 3WDLA 2DJ5A 1UADA 2F1JA 3OIFA 1B2LA 3R5SA 3WQHA 4CQMA 3K70C 2WC1A 2HRRA 2X1VA 3CVVA 4MR8B 1Z25A 1BMQA 3SG0A 3ZGVA 3LBYA 5CYPA 1SCBA 4DREA 3GLGB 3H4TA 1KI9A 4ZYWA 4GM0A 3F46A 2Q1XA 1ESCA 3F7TA 4TN5A 2ZVQX 4KVFA 4DLKA 1PS0A 3S99A 5KYXA 1IU9A 3BQMB 3CX7A 3DCIA 3KQHA 1H0KA 3GJ4A 3C3AA 1G9SA 3MJSA 3QKRA 5IU6A 5DRTA 4XSVA 2IL1A 2PL1A 3GRCA 4CLRB 6GPBA 5I4KA 1YOVA 3M1IA 1RXUA 2G4LA 4AY6A 2PYZA 3V3KA 1V5GA 3KEGA 1M74A 3ED5A 4BRZA 2QT1A 2P11A 1QM5A 3E9CA 4UW9A 2HSZA 5ERGB 4X20A 5T6MA 1C8LA 1V95A 4A9AA 3OD5A 3U7QA 2A35A 2BEUB 4J7UA 4JIGA 1OZ0A 1Q1EA 2ZTHA 3GRRA 4I55A 3PIIA 3LC2O 3LUHA 4O4JA 1Z7GA 4D9EA 1E0AA 1SFRA 2J8ZA 3QTBA 3SNKA 4GXTA 1G9XA 3A27A 3BGVA 3L93A 4BFCA 2ZBDA 4MLCA 1TC2A 4BO5A 3EEYA 3K5WA 3LQQA 3X44A 1M7HA 4HX2A 1VJGA 3HI4A 4EL5A 3O26A 1IUPA 2QU7A 2A94A 2EZ9A 2PVSA 3QJYA 4NZNA 4C0QC 5FEUA 1YL7A 3HR7A 1OAOA 3PVZA 1SO8A 2A2ZA 1TJ3A 1Z62A 2FLVA 4OATA 4N3GA 4DZRA 5H59A 3ACDA 1OVMA 1WIWA 1V5FA 4KHZA 4AZ3B 1UMBA 4BRUA 1I1HA 4A6EA 1DXHA 1TUGA 2IEIA 4MIOA 2GDZA 5FTJA 3TINA 2NT3A 3ZGYA 4WACA 4AJ4A 3HCPA 1CULC 2INGX 1W0JA 4L15A 4MO9A 1GN8A 3O0DA 4ND8B 3QSGA 3C5EA 3UMGA 3CZPA 1XQ9A 1YJ8A 2ACWA 3HDHA 1UH5A 4YCBA 3SMQA 1V8DA 1SBNE 1T91A 1KZ9A 4HMQA 1U81A 1WMAA 1SAYA 4P7GA 1P62B 1H0RA 4D9JA 4FFBA 5D51S 1B00A 4FX2A 2XSZD 1W34A 3R3UA 5FOVA 5C8YA 2QQ0A 5T8KC 2XKAA 2RB5A 3QEBZ 2IELA 2JCSA 2XKKA 1KZ1A 1WKVA 4YIHA 2MSEB 3AY3A 5A02A 5BUCA 1XNGA 4LBZA 5FQNA 5AKJA 3IUNA 1QGDA 2PIAA 1Q15A 4L5AA 1UPCA 2DPMA 4IIVA 4N5HX 3KJHA 3U1TA 2CL5A 1AB5A 4F6LA 3AKYA 4PGMA 2P69A 5HR5A 1HE5A 1NF2A 2XOKD 3NJ8A 3OFSA 4DDTA 5AI9A 2NSHA 5ECYA 4K9PA 2NSJA 1F5SA 4I5GA 1KVQA 4X6YA 3C14C 2XIJA 4DLXA 1Y7PA 1XD9A 1ZDMA 2I7DA 1LDBA 3A9WA 1RI2A 3G1TA 3OLYA 4RZ3A 5FOWA 1ECFA 1XKLA 1KKLA 1TI7A 2FPPA 3AJ8A 4RCVA 3WQRA 3DZ8A 4B4UA 2FPMA 1II8A 3A11A 3AONB 1S2OA 1CV2A 1N8NA 1TJ5A 4EI9A 5KDLA 2QT9A 3W8RA 2DPXA 3QKTA 3RYCA 2QVLA 4KXFB 4IJQA 1VYUA 3CLTC 4I08A 4XE5A 4JSTA 2I2BA 1W35A 3H1AA 1WOYA 2LIPA 5ABPA 3O9MA 5HNKA 2QW0X 5DYIA 1JL3A 2X23A 1N6LA 3ET5A 4BKOA 1ELOA 3DZGA 3HZZA 2AFHA 2XRFA 3EFBA 3NGLA 4FGJA 4JUFA 5BMVB 2CMFA 4DDVA 1EQUA 5C1PA 5DNYB 2GHRA 3O8QB 1J8DA 4N47A 3NDBB 3MWKA 4JLVA 3ENWA 3K96A 3KAQA 3WKEA 4IGEA 5JDCC 3TIFA 2EP5A 1ACLA 1TE2A 4TROA 5FXMA 3LWBA 2FF7A 5EGNA 2BLLA 3T9FA 1G5FA 1JV2B 2I7TA 2PEZA 3THSA 1X1EA 4RHUA 2J9YB 5C8XA 5IAEA 5HVNA 2FUCA 5L45A 2A9KA 4C05A 3MCAA 3LNCA 2Q6KA 3FTPA 3L41A 3QYAA 2R66A 3DPUA 4XSGA 3I23A 2GGSA 2DECA 1N75A 3LDHA 5DM4A 6CHYA 3P45A 3T95A 5I7FA 9LDTA 1Q91A 4JVSB 3R09A 1U2RA 1JR3E 5AUPB 1CHNA 4HNAB 1PZMA 4NJEB 1DKRA 2G83A 4HZUA 1Z63A 4M1KA 3E81A 2WINI 3FY4A 4MV5A 1W48A 1CY1A 3OUUA 1S1MA 1EMDA 4BQEA 3I5UA 4J0HA 4AF7A 2FOLA 3CNEA 4KODA 3QVGA 1D9ZA 2JJ1A 2R79A 1LZLA 4HP8A 2VTDA 3O1HB 1U8TA 2ODAA 4LMBA 1X1RA 4YNBA 4DR4B 1KEWA 4WKCA 4DYDA 3QLEA 4XH9B 1MTOA 3AM5A 1GADO 1XEXA 2A30A 3FNBA 4W9NC 5BR4A 2M32A 3I05A 3SKVA 5EIAA 5TQ2B 3WGZA 1K98A 3GMDA 4JUDX 2D59A 3B6MA 3E4CA 3OESA 5JZSA 3ADCA 4EEXA 4MGEA 2RE8A 1I8TA 2Q1UA 3B20A 3MPUA 5JQWA 3JYPA 3HB5X 1VE9A 3KOOA 3OURA 4E0BA 1TJPB 2AFIA 4YBRA 4YRJA 2B8EA 1G8JA 1N3IA 1G7SA 3RTEA 5JH7A 3I2KA 5B12A 1AO0A 3DDSA 5JNSA 1XFAA 1XU9A 4ZGWA 2EQBA 2HQ1A 3N59A 1DBRA 3BMOB 2VT7A 2A1TR 4OD0A 1VYVA 5H81A 2HW8A 4N5NA 3CH6A 4FTWA 4IIFA 4DCSA 4DW8A 4JR0A 4JC4A 3PXAA 3U4IA 2J3QA 3GUYA 4Y6GB 3VYUB 4DC9A 1YVDA 2GPWA 2IODA 2V6FA 2V45A 5I48A 2HLDD 1NQWA 5DNDA 2C3UA 2RC6A 3V2GA 4I6GA 1XZPA 3MJDA 5H80A 2IZ1A 3BEOA 1B8NA 2BR4A 5AW8A 4Q6WA 1I9CA 4XD7A 4ND2A 5K8CA 3SHTA 1KR5A 2Z5FA 3LYHA 4Q3AA 2A9RA 3O7WA 4R54A 3ZCUA 1EM8A 1AC5A 4IF4A 1BXRA 3FKSA 2Y2VA 3MMZA 5IKEA 4KFTA 2ASVA 5K0NA 2NSLA 3W4JA 1VKNA 2ZRCA 1RRCA 1Y8AA 2IOFK 2DCUA 2I2WA 2HDNB 3T12A 2FZCA 5DXJA 1TEZA 3MS2A 1OWNA 3IV7A 1QG2A 4MVCA 4MWGA 2DUWA 3G68A 2YW2A 1RD4A 3GLIE 1R5NA 3EARA 2PGLA 2JBAA 2B8JA 4IJMA 5GMOA 3A3PA 2BAGA 2WJ6A 3NHPA 4UKDA 3A1WA 2BEWA 4G5YA 5JAOA 1HA3A 5D86A 1QHFA 1VPDA 5JWOA 4EPRA 2P8JA 1VL0A 3B9RA 1C9NA 3PR3A 1N2CB 2FN3A 3CVWA 1QAQA 1Q3KA 1GCAA 1OV6A 4CLOA 3EK2A 5D00A 1UQRA 1UC4B 3PVSA 3QELA 4PQGA 4XWKA 1O96B 3MMPA 2UKDA 1GZSA 1TYDE 1Z2PX 4BX9A 4EPWA 4Z7OB 4JQOA 4RKEA 1R66A 5ITSA 1EVIA 1LPMA 2GFHA 1CUHA 2CE7A 3HZHA 4PRYA 3VYVA 1RI4A 4ALNA 4E08A 5BMVF 5KQLA 3TQCA 1JXQA 1ZCZA 1CQWA 4OHVA 4KPFC 5KTRA 4PFQA 2BDEA 3ASVA 2BRUC 2H2DA 4CFYA 2PUGA 2ACVA 1C41A 2CHEA 2OFPA 2YTZA 3QLUA 1HDXA 4MJ7A 4MQBA 4PZLA 1OXTA 4PCAA 4ZEVA 1CYEA 1JNYA 2XQIA 5ICEA 4IDFA 3D0OA 3KR9A 5AM5A 4GDFA 1V39A 3HDVA 3FDFA 1VSUA 4RZSA 3BJRA 3LUBA 3QFTA 3TXXA 4EKIA 1BX3A 3FDZB 1A8UA 3RJMA 5M2QA 1X9GA 5AM2A 3THRA 2B2NA 4PLTA 5CM8B 3WNVA 1KMIY 2H1SA 3OE7A 1BWSA 3B6IA 3JWEA 3NJ4A 4NJMA 3NNNA 4Q7MB 1EX1A 3TVYA 3IP7A 5IF9A 5FWAA 4ZYYA 4OHUA 5JI2E 3OCXA 1ID1A 3USES 1RWPA 4WXEA 4QZVA 1T26A 3PD0A 3CN7A 2W4MA 2VWPA 2RK3A 3L0CA 1VGVA 4TMXA 2C4NA 5AW9A 4E5DA 1US8B 3KVRA 4HPXB 4GOND 1HTWA 5SICE 4MYHA 1PJSA 4RADA 2W11A 1JALA 4L8FA 3NVKI 4EY4A 1KARA 3DQPA 1SCKA 2V6JA 4YP0A 2PKCA 4PYIA 5H3HA 5FX2A 2DWPA 4B75A 1K7XB 4L9SA 2CFIA 2Y27A 3A3KA 1M83A 1B1AA 2FSUA 1GU7A 2QZ4A 4CR6A 1FW6A 2PLNA 3ZJ5A 1ZSVA 1I3CA 1P61B 1QNFA 4Z7JA 1ZITA 4TKVB 5G0VA 4YI3A 1BMTA 1D8TA 2ZULA 3KUUA 3NDIA 5AOAA 3ZV7A 4IKOA 4C4ZA 2Y4OA 2WPNA 4RVCA 3AVUA 2GI4A 2PZ8A 2SBTA 2JAWA 4CM3A 3I72A 3C7TA 4JXKA 5BYBA 2VSOA 1L3IA 1G2OA 3KLBA 3ZV4A 3IDOA 1JJAA 3DE6X 2NZYA 3AJDA 2EG9A 5F1YA 3R7NA 2GOYA 3N7TA 3G0DA 2OCLA 2I9KA 4OXRA 3KUCA 5E1MA 1UAYA 1WTCA 1H8ED 2VQ3A 2YWDA 3IT1A 1MHPA 4YCJA 5CXUA 3EIHA 1TOAA 4ICIA 1NIJA 2LKDA 4I4IA 3UWDA 3EEBA 3QYFA 2QNIA 4WJZA 1BEEA 1VQ1A 2AQIA 1WB5A 3CFYA 1D03A 1NR7A 1SB9A 4MV9A 2QTZA 3MYRA 2PE5A 1KOLA 2PUDA 4CEHA 3MJHA 4OYRA 3AF1A 3FR7A 3W5UA 1X8LA 4IDAA 4WUVA 5AKKA 5EVJA 3L1KA 4B7XA 1V8BA 4ECEA 2O8CA 1THZA 4QASA 5EWMA 3KPJA 3WL6A 5AK3A 3E2IA 3OZIA 4RESA 5CFNA 2WZDA 1T2CA 4HLUC 3O90A 4RTNA 1A3CA 4GIBA 2WTBA 3T5CA 1J0EA 4G0WA 1G5RA 5BMOA 3ANTA 1DL5A 2B2CA 1SOAA 1H1DA 2A7XA 3TOXA 1Z45A 2XNCA 1DTEA 1YB4A 2ICAA 4WXPA 4HN2A 1GG5A 2QRLA 3IP6A 3P7MA 3IELA 3VNAA 2WUFA 3IQEA 1OXXK 2H2AA 2O2EA 3MK31 3G9QA 3NKVA 4NPAA 1W88A 2DKNA 2QZJA 4NZZA 1G21A 1H3FA 1PT6A 1IIBA 1K4MA 2P62A 3P2KA 3T1YB 3Q3JB 1D2EA 1C4OA 3ECAA 3PNOA 1E8DA 3H8SA 1P1CA 1AKEA 5TT0A 1GPYA 1CJTC 1IUNA 5JBNA 4DLPA 3ICPA 4LDAA 3HNRA 1WF6A 2VP6A 4II3A 5FI3A 5F2NA 1GYQA 2OV3A 2KBEA 5F5NA 3RANA 1FFDA 1OZHA 1GEGA 1WKBA 1BN6A 4KI0A 4ARSA 4ZI3A 4MVJI 2YV5A 5TPWA 4NAUA 3HKDB 2CCJA 1X0XA 2QROA 1T24A 2GEJA 4P80A 2N46A 2Z04A 4G36A 4HMOA 4UARA 4BMNA 1KY2A 2QL9A 3NVDA 4PGHA 3HUDA 7REQA 3OZDA 5KHOC 3RCBA 3COVA 2RI0A 2PX6A 2X9GA 2W2LA 3NH6A 3CUKA 4RH3A 4Q7EA 2FWPA 2CDRA 3UH0A 5KTSA 1HL7A 3VXKA 1XEWY 2DGDA 3MQ2A 3NAGA 4OK6A 4BGEA 4LVOA 2HA6A 2XCUA 4RC9A 1PR5A 1QX3A 1DC4A 1QK5A 4U8GA 4AS1A 1Q7EA 2QN6A 2ZUVA 4PS0A 2VJNA 3EISA 3GVPA 1PT9A 3MLAA 1FRNA 2XUHA 3RU3A 3T4PA 1VJCA 1H6CA 1XCLA 1JT9A 2DOKA 1NMQA 3N2KB 2FDXA 3KE8A 3KEFA 1HYQA 1TRHA 4IWYA 4BFZA 1GLGA 3FCAA 3D02A 1OUMA 3HUTA 4FZVA 3GLIB 1DJNA 2WJ4A 1OCEA 3FZNA 4ZCLA 1NYQA 3BCHA 3KXKA 1MP0A 3B7GA 3FRIA 4BKQA 5B7QA 1G6OA 2CJWB 2RBGA 5AO9A 2A58A 3WB0A 4F85A 2HPAA 2H0AA 3RVQA 4RKWA 5K8VA 3FFTA 3LHIA 5TVKA 4DLAA 1MFZA 4WSOA 1RZRD 1YZHA 1Q6ZA 1W49A 3OZXA 1ND5A 3IPAA 4K8RB 5HF9A 1JTFA 3ZG6A 1VE5A 3DUFA 3LVFO 2NYVA 5ECDA 3GYBA 2VTEA 4MLDA 5ADUS 5L3SA 3VKHA 4CODB 4YMTA 3H0EA 4BZXA 5JG7A 1RM5A 5IZCC 1FP2A 4ZARA 1K3UB 3B36A 3GX1A 2Z4SA 2HQSA 3RLFA 1V9LA 3MBIA 5EYPB 3H17A 4V38A 2IXTA 2QI9C 2XCOA 3I9V1 2WHPB 3AVVA 4AS2A 2A3NA 3TRIA 2G28A 5LP6C 3ZHOA 1UC8A 3SYRA 2XGMA 2CJPA 2PYIA 2PNJA 1EJBA 3BRCA 3PDJA 4C4AA 1P2UA 2X77A 1GNQA 4CMAA 1KYXA 4ZOEA 1YTUA 3AB3A 2CWDA 5IVIA 1MJHA 4WASA 2XOXA 3VZDA 3O3CA 3R0ZA 5LKAA 1BFUA 3R6WA 2VCEA 2YRFA 4LNAA 4LRSB 1B6TA 1IG3A 1W9MA 1QR6A 2ZRGA 3RS9A 5J1TB 4J1NA 3CNLA 3JYOA 4LQ4A 4B6EA 1CIVA 1KC1A 2GPAA 4QU8A 1A8HA 1JLHA 1UODA 5B30A 3V6LA 5GOZA 3EQ2A 2ZRBA 1KYQA 4MVXA 2XYHA 2Y2UA 1TF2A 2OC9A 3PFHA 3CNQS 2AVNA 3NBMA 3VKFA 2R8OA 2WD8A 4QEKA 3UUEA 4MAFA 2NUAB 1GTL1 2QTMA 5TVGA 2PT6A 6LDHA 4Q3CA 1JG3A 4O1HA 4MPTA 4X3OA 1TYCA 1U1DA 3G5TA 2EZ8A 2Y0BA 1UJ2A 3RSCA 3ZK7A 4DIFA 3LHFA 3O38A 1RBYA 1CFZA 1U0TA 3F98A 1M0WA 2JGRA 3D4PA 4H7IA 3ETLA 3IUJA 4FNOA 4R05A 3KD3A 5HS4A 4H7DA 3SMVA 4FR2A 1AH2A 1U4OA 1JHZA 1IC6A 1TLFA 5ALHA 2XUIA 4M8IA 1GQ2A 4EMBA 2GBIA 3J7TA 5CB4F 2ZR9A 2JEOA 4RK5A 5DGIA 3Q1KA 2KYRA 4BYMA 1TEXA 1W2WB 1RTKA 5E3IA 2P9CA 3KWFA 3UA4A 4JJKA 1VCNA 2ZUSA 3T4UA 4BVJA 5KAPA 4DWWA 3RFCA 4RK0A 2G0AA 3DMTC 4WECA 1HQDA 2ZW9A 1ZD5A 2PGDA 2WWHA 2CJFA 4RTRA 1N0UA 3JR7A 3HB0A 4LECA 5DEOA 3LXMA 1IVNA 3OD1A 4O4IA 4X7PA 1YA4A 1C7IA 1FSFA 1RCFA 2DSTA 1QKIA 3DDNA 3JQPA 3EF1A 4WERA 2I62A 3FPJA 4MKZA 3TQRA 1AQIA 3FNFA 1ZD3A 1HY3A 2IP4A 2PH1A 1Q21A 5CJPA 4QOEA 1MW8X 2AZTA 1RPTA 2Z6UA 1EE1A 1K63A 5D7NA 1RYZA 3F3YA 4Q01A 1AKNA 4IL5A 4WUTA 2D00A 2PSHA 4XYEA 1GR1A 1E2LA 1X1QA 3L1HA 2VEOA 1QHIA 2DX7A 4FZ3A 2GTPA 4QTTB 4J0JA 2HADA 3FPGA 3B1FA 1FDUA 4KEAA 3R7FA 3FCSB 4LRTB 4MQ5A 1WZNA 4M22A 1SWWA 1XA3A 1M34E 2AK2A 4W8HA 2DFLA 4F2GA 5ALTA 3JV7A 4JT2A 2A33A 4FK8A 3IESA 3ZDAA 4RD6A 4URYR 1IH8A 1ORIA 2QAGC 4I1IA 5KTPA 1XU7A 2VDWA 2PKEA 3UT5A 3ZX5A 2I6GA 5AVKA 3T41A 5JDCA 3LVBA 3OQ1A 1XN4A 2K2QB 1ATIA 2ESRA 4XB6B 2NN3C 1ODFA 3KB2A 3T9DA 4F11A 2HBRA 3C6BA 2HBQA 1KKUA 4Q7QA 4U9IS 4U2BA 1Y8ZA 3S7ZA 2Y68A 3LY8A 4OXYA 5ENDA 1GGKA 1P6QA 1U98A 3MJ4A 4WLEA 3INRA 5EE0A 2XUJA 1QUFA 4V0ME 5JBQA 3W5VA 3ZY2A 3BICA 3K9GA 1IQRA 3GJ7A 4Z9YA 2V7TA 4R8RA 4F46A 1X94A 2O8FA 1XVVA 1E2PA 1TPYA 1NRXA 4M88A 4XOIA 2OQRA 3FWZA 1DRWA 1PYDA 3COSA 3MWJA 3OETA 2ORVA 2A7QA 1VIDA 2EWVA 3OEED 3D4IA 4I9FA 4TMKA 3EOZA 2IIQA 3CEJA 1WA5A 1K92A 5HFJA 2J9XB 1VM6A 1M2WA 2GJKA 4HQNA 4XVUA 3QX9A 3UKDA 1EA5A 3DEAA 4OIMA 4PHHA 3V8PA 4N7RA 3OM1A 4LYYA 2C4WA 2ZI3A 2CBXA 2W6ZA 2H1FA 5LSAA 1U9IC 1H22A 3B1VA 1ZY2A 3MWEA 1MHTA 4LC1A 1ZLXA 1FYDA 2JJQA 3AEYA 1QGAA 3CEPB 4XGNA 2QEQA 1LFDB 5FAXA 3REQA 3RW9A 5DN6D 4NS1A 1GR0A 2W8BA 1H8HA 2XDYA 1KFKB 4W9NA 2B69A 4MKGA 3VZRA 1COWD 1E64A 1HK7A 1K4KA 2WILA 2QE7A 1QNLA 1WQ3A 2HWUA 3MWLA 2QJTA 4P3KA 4MI6A 5I4CA 4I1VA 2C5SA 2VHWA 1QBGA 5J47A 5KVVA 4EYKA 2OOKA 2IPAB 3ELBA 4G5SA 2V96A 4LCBA 1VFNA 1CUJA 2R85A 1DOZA 2PZKA 2QTVB 2FUG1 3M6XA 4KIJA 3DDWA 5C9ZA 2LCQA 5A5EA 1QS0B 3VTFA 1S2GA 2R25B 3OQVA 1P91A 2O14A 4I50B 3KT3A 4KRYA 5KX5A 3TGLA 4BX3A 1JRLA 3KVYA 3WLHA 2F62A 4WRRA 2DRIA 2GPYA 1O6FA 3QE4A 4DCVA 4EQ6A 4WOPA 2EFHB 2VRCD 3KZXA 3OLCX 4MVJE 1Q1ZA 4AMUA 5BN1A 3WMXA 3GLQA 3M9WA 3RRNA 4DF3A 1PG2A 3AETA 2IYNA 1EFUA 4HAVA 1Z5UA 3LUDA 2RKWA 2X2PA 2XY4A 3EXEA 4M37A 4NYJQ 4JL6A 4IIDA 3JQGB 3SR0A 5A4IS 1BZYA 1NKVA 1WBBA 2PFKA 5DU2A 4FGUA 2WD9A 2QYTA 4UD2A 1AGXA 3E1KA 4JBWA 1ZN7A 3NRBA 4O25A 2H1RA 1ZOPA 4HVLA 1Y81A 4MRPA 4TM8A 1S9DA 3HXTA 1II0A 1ISFA 2P65A 5AR1A 3CVXA 4U9HS 2ZTSA 1R0BA 4OHKA 3A6HA 4E5YA 1FBTA 5IYZB 3QE9Y 1E9SA 4MEAA 1K7YA 1EZZA 1C9YA 1K8XB 4UE2A 3AHHA 1GQFA 4A5SA 4FFRA 1ST2A 3CTPA 4WZAE 4N7BA 4YHBA 3C85A 4G1VA 4O2BA 2RMKA 3GLSA 1FE8A 1DRJA 3A7EA 3UH1A 1K68A 1NY5A 3BE5A 3TLGA 3HEMA 3K8YA 3KNZA 5CFOA 4GNRA 2F43A 5CXXA 3UFXA 5KZMB 1Z5OA 4F1KA 3WFIA 4NV0A 4O63O 3UC5A 4Z1OA 4OQYA 4MR7B 5I7SA 1AUVA 1N3YA 2H9AA 1N3LA 3JAWB 4H3SA 2GLTA 3ZH9B 4KX5A 4C3UA 3BD9A 3SHFA 3VO9A 1DRUA 3QE3A 5BR7A 4W5HA 4TLLB 1PZNA 1Q1GA 3CZMA 4FIDA 4AM8A 1Q1AA 3VR5D 4CEJA 3EIXA 1Z5VA 4C89A 4IS2A 1NUHA 1Y1PA 2XKJE 3PYXA 5FWDA 4F21A 2BRUA 3ODGA 1ZH6A 1RI5A 3K1ZA 5D3MA 2KS6A 4YJ2B 4BNHA 3N2LA 4C6HA 3KRTA 1Y4SA 1GKLA 2AIRA 4KRGA 3H1GA 1HSOA 3SBOA 4PANA 2AF4C 4EPYA 1TEHA 2FZGA 3IE2A 4CCYA 2RGUA 1HRDA 4JUCA 2QHXA 4ZN6A 2CT8A 2WFZA 4YAKA 2OHOA 3ITNA 4RY0A 4GQBA 5IXSA 3B3AA 2XTZA 1CQXA 3AR9A 3GJYA 5FUQA 4B84A 5LP1A 4DEVA 3ABIA 2APJA 5K3OA 3GJQA 4CG2A 1KF0A 2XHZA 3BE8A 1W59A 3DFZA 1VXRA 3KX2A 1V43A 3VU9A 5TPZA 4GX1A 1PDOA 4AJ2A 1E7YA 3ZZ0A 1KDPA 3ZTTA 4BL5A 2H2IA 4F38A 4D25A 4F86A 2AW3A 1U1IA 2R00A 2GZ2A 1DIBA 5K99A 2GAJA 4I4TB 4IFEA 4QBGB 1YI8A 1EWKA 3I9KA 3FCCA 3QHPA 4UREA 2AC7A 5H4HA 2RH4A 3HXQA 1IY9A 1L7OA 3GHHA 1M34B 4JQYA 3W5HA 2AUMA 2HHHB 1NWHA 2AS0A 3IAHA 3G2NA 3NLLA 4GE0A 3HB7A 4EPVA 2Q0QA 2FP4A 5JPCA 5E7MA 2R44A 1Y5IA 5JVDB 1YR1A 4RPCA 1Q12A 4ME6A 3EF0A 4KNYA 2VDUE 3T5PA 4ROSA 2K7FA 1YU6A 3TJMA 3H5RA 4WXMA 5HCUA 3KKMA 1EKXA 1MXHA 1R5JA 1K8RA 1XL1A 1QV9A 3HBFA 2NU9A 3GR6A 4I50F 3UAWA 3VJKA 2HHAA 1N0WA 2E5WA 2KB0A 2OHVA 2ZWMA 4IDBA 5MN4A 3THWA 4NMMA 3I9V6 3SS7X 2IU0A 4CUZA 2BFDA 1YZYA 3HC7A 2CMHA 3Q3IA 3GP8A 2NXJA 1G42A 4YRDA 3V9AA 4CKCB 1GNSA 1YR8A 2BF7A 4IBOA 1QP8A 3FMIA 3QF4B 3SR4A 5CCEA 1NIPA 3SC4A 3AUJB 2OHXA 2X0FA 4J0FA 4XXHA 1MJFA 1DC3A 3FLEA 2GM9A 2NQTA 4R7ZA 5CPFA 2D62A 1L1EA 2REBA 3WADA 4GXQA 4JZKA 3W8NA 4HLUA 3IB3A 2NYUA 4ZZ0A 1JTEA 1NXXA 2J5QA 4WCFC 5K51A 1AQJA 2XWQA 3G9ZA 5GIOE 2J7PD 3NOQA 4GUDA 3AW8A 5FNVB 3GFRA 3FXAA 5LMNB 1GOTA 4RY8A 3DH0A 4KBGA 2VAXA 3QXSA 2CMGA 5FBVB 2QMUA 5FBKA 3VC2A 3M5WA 1Z0KA 3TW8B 5BSKA 3D5EA 4DBLE 5IYZF 3GUCA 2Q9CA 4Y2SA 3V8RA 1ECBA 3I42A 3ZJYA 2J3MA 4GX2A 2PUTA 3UJ8A 3ZIAD 5JCOA 1YHYA 2E87A