2P30A

Crystal structure of tthb049 from thermus thermophilus hb8
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
177
structure length
177
Chain Sequence
b'MELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQARRLKGALPSLPAFSSDLLRARRTAELAGFSPRLYPELREIHFGALEGALWETLDPRYKEALLRFQGFHPPGGESLSAFQERVFRFLEGLKAPAVLFTHGGVVRAVLRALGEDGLVPPGSAVAVDWPRRVLVRLAMDGEEATG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ribazole-5'-phosphate phosphatase
publication title Crystal structure of TTHB049 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 59
structure length 177
sequence length 177
ec nomenclature ec 3.1.3.73: Adenosylcobalamin/alpha-ribazole phosphatase.
pdb deposition date 2007-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 2p30A00
3KKKA 3MXOA 2HHJA 2P9YA 4D4KA 4ARVA 2PA0A 3E9DA 2EKBA 5CX4A 2I1VB 3D8HA 2F90A 1E58A 2WNHA 2IKQA 1ND6A 1SK9A 3K4QA 2P9ZA 5PGMA 1H2FA 5CU7A 1RPAA 4ARUA 4ARSA 2P6OA 2BIFA 1C80A 2P6MA 1UJCA 1DKQA 4FDTA 5HR5A 3HJGA 3PGMA 4IJ6A 2P79A 5AK0A 5HTKA 3QPWA 3LNTA 2P2YA 4EMBA 3QPVA 4JODA 1DKPA 1TIPA 5AJVB 2WNIA 4HBZA 2RFLA 1NT4A 3R7AA 3FJYA 3LG2A 5CDHA 3BIFA 2OWDA 4FDUA 4TSRA 4D4LA 3FDZA 1FZTA 2QNIA 1DKMA 4JOBA 4EO9A 2YN0A 2H4XA 4PGMA 1XQ9A 1IHPA 3E9CA 1H2EA 3GW8A 3LL4A 2P78A 4D4MA 3D4IA 3MBKA 1CVIA 3K4PA 3EZNA 1RIIA 3C7TA 2P77A 4PZ9A 2WU0A 4D4JA 3EOZA 2H0QA 4IJ5A 1V7QA 2EKZA 5AJXA 3GP5A 1C7ZA 4JOCA 2A6PA 2H52A 1EBBA 2HIAA 2A9JA 1K6MA 2OWEA 3IT3A 4MA4A 3QPUA 2AXNA 1QHFA 2P30A 2YN2A 5AJYA 2P2ZA 3E9EA 1BQ3A 2DWOA 1SK8A 1C81A 3OI7A 1DKLA 1T8PA 3IT2A 1QFXA 3F2IA 3FDZB 2P75A 3IT1A 1YJXA 1DKNA 3F3KA 3IT0A 4ODIA 2GFIA 2ENUA 1E59A 5AJWA 3D6AA 4QIHA 3ZHCA 2H4ZA 4GPIB 4PZAA 2ENWA 2P9FA 4AROA 1BQ4A 1UJBA 1FBTA 1DKOA 1SKAA 3DB1A 3GP3A 3O0TA 1YFKA 1BIFA 3NFYA 4GPZA 1V37A 2HPAA 5AJZA 3NTLA 1SKBA 2EOAA 2DWPA 1QWOA 1RPTA 4E3WA 3DCYA 1ND5A
chains in the Genus database with same CATH superfamily
1J8YF 1DX9A 2VH5R 3A4NA 1AUXA 1E32A 3KVVA 4L02A 2FR0A 2VRNA 4XM0A 1B00A 1PUIA 4ZRMA 1VE3A 3RYHA 5M04A 4M9RA 2YZGA 3I2GA 2ZRLA 4WVLA 3WJ1A 2BCEA 2ZVDA 4DSTA 2EWWA 4EHKA 3KUCA 3DAFA 3NHZA 2ACVA 2OR3A 1YS4A 4K81B 3OZGA 3QPAA 3NJRA 3U62A 1T2CA 2EJBA 3CO5A 4HQKA 3L40A 1KI6B 3FOAA 4K26A 4QREA 4GI7A 3TQRA 5LDDC 2QQ5A 4CF3A 5A5GA 1NMEA 3GAZA 4K9DA 1AURA 2P5SA 1AUVA 3WHPA 2H17A 3HNPA 2QUHA 2D1TA 3I9KA 4I1IA 4IDQA 1MRZA 3AWDA 3M5DA 4MV8A 2QMHA 3WOHA 2CLEB 2H2HA 3MS7A 1BDBA 4R1SA 5E4JA 3I9MA 4YCDA 4WJLA 5EIEA 3H2IA 1C29B 3AFGA 1SUEA 3CO0S 1A1SA 1FTWA 1SXHA 2G0NA 2QI9F 4IV5A 1FJ2A 1Z5GA 5CJPA 4Z4GA 1J0EA 2XGMA 4H15A 4U7FA 1NUHA 2AFIE 2ZJ7A 1WVMA 2A5FA 3OZUA 1UBUS 5E1DA 1QZZA 2ZBUA 5AW3A 1GKLA 1GDHA 3ONNA 4C76A 2H4XA 4D3ZA 4U9HS 1JSRA 1E7SA 1XIVA 4BVGA 5SY9A 3NHSA 1FTSA 4JI0B 2FKAA 2H7VA 3AVOA 3PIRA 2G0AA 1QF7A 4XKJA 1NN0A 1CD5A 1MGPA 2QL6A 1CETA 3QKUA 2CHVA 1BMQA 2YXBA 2WZCA 1ZUNA 1XNHA 4YCJA 2YIMA 3SZUA 4B2YA 1TRKA 1EFLA 1NOJA 2JVKA 3CUKA 4LAFA 4Q24A 4LMAA 5T64A 2F8SA 3KQUA 4X1YA 2Q4DA 3NWOA 4DQ0A 4BEJA 1UADA 1QIHA 1QYIA 1YD7A 3D7MA 3FHJA 4IIJF 4NJMB 4OKSA 4LFCB 3H1PA 1J2UA 2GD6A 1QOQB 2PRJA 2XZDA 3EPHA 4ZCQA 3V4PB 3Q5EA 2BM0A 1GNSA 3W8NA 4JL5A 4OBBA 3LUKA 4UFOA 4DC0A 1TF7A 2FGKA 3I6MA 5SV2A 1PJBA 3NUZA 1ZESA 3C87A 1MC1A 2V7TA 1XT6A 4Z9YA 1H9AA 1NW4A 3A04A 3EXIA 4P36A 5EQFA 5FL7D 1JFFA 3BJZA 3PBKA 2WMOB 1G9SA 3UK7A 3WSTA 5EP1A 1P61B 2XNHA 3QA9A 4WZBB 3N07A 1HDEA 1Y8QB 3DQQA 1ZXXA 2C1EA 1QF6A 3RDPA 3F7MA 1YJXA 2DEUA 3K8YA 1WUJS 3GGDA 2TS1A 3GNQA 2GEBA 3C6KA 3IBTA 3R0ZA 4FHFA 4XOIA 2YYZA 2PPVA 4S0XA 3MQ2A 4L5AA 1CHNA 4LBZA 3SM3A 1BMDA 4F72A 2QUAA 1TVCA 4CUZA 1GGMA 3QW2A 5A5FA 1N1DA 4V1CA 3R9WA 3L7YA 4NU8X 3DMYA 2XH8A 3D6JA 3I1FA 3ZW8A 5FBRB 2NXJA 1OROA 1W4LA 2EJUA 1UOOA 3VTKA 5K0FA 2PQMA 4CQLB 4MQMA 2P9GA 3JQBC 1S7GA 3OZFA 2EVWX 2PCJA 2E37A 1A8QA 5GJWC 2OBFA 4RTQA 4K9MA 1LPBB 5FV4A 1B3RA 4J1NA 1QIMA 3R1IA 4TS1A 2IU0A 4HNVA 2PD6A 1OU4A 1Y82A 4FFLA 7YASA 2W37A 3E8MA 3OY7A 4ETWA 5EJ9A 1L7RA 2OY0A 1K92A 3PR2B 2AFRA 2HQSA 4FS8A 4KDRA 1AK2A 3WK5A 5DM60 3HV0A 3CW8X 3J7AC 1TE2A 2AQKA 2HL6A 2IC5A 3RTBA 4ALKA 4JUCA 5C2JB 1CDOA 1UEIA 2J3KA 2GWRA 2RH4A 3RNLA 3V8MA 2DWUA 2HF8A 3VI3B 1DU4A 3D8SA 2DBYA 2F90A 3K2QA 2ATEA 2VPYA 5KSYA 1UP4A 2NQ8A 1TFUA 1PNTA 3MOSA 4GL4A 3BCHA 2O0HA 1XC7A 4DIFA 3GZNB 1IVNA 1E9BA 3LSYA 5KQSA 2CFTA 2DJIA 2QTGA 1NDUA 2PLFA 4FPXA 4WAUA 4DIDA 1WCIB 2Q3MA 1YDGA 4LECA 1REQB 4AU1A 2GGSA 1CPYA 3H2JA 4OHOA 2C0CA 9ATCA 5HKKA 5IJ9A 1HDXA 4NYMR 5DWQA 2WIBA 3V1NA 4PBSA 3FVTA 2GCEA 3CZ9A 1O5TA 3EULA 3OFND 1GARA 2GASA 1B8UA 3FM9A 4IIJB 3U9LA 5KPJA 4DEYA 5ALOA 4BXOB 5K0SA 1IWPB 2P27A 3ZD7A 1MO6A 1WMSA 2MMGA 1QYXA 3OJ0A 4HLDA 4F56A 2AN5A 4BVBA 3R7FA 5E7JA 1ES9A 4D57A 5L4LA 1G291 1O5IA 3PKIA 2I6FA 3W5SA 4V0SA 4Q21A 3RJ5A 3UV7A 2Z9CA 2IOFA 3ZWVA 1NP3A 1YL5A 2ISCA 3VC2A 1WXWA 1MMFB 3KT3A 4CKEA 1SUWA 1X1TA 5FADA 4MS4B 2QRPA 4XH9B 3I1JA 5ECYA 3CLRC 4L3OA 4MW6A 3RIHA 2MHCA 1QYWA 2JGRA 1RIIA 1F2UB 3R5XA 4MUGA 3MJHA 1KA9H 3A32A 3OE4A 3OOJA 4ZQIA 2E4WA 1M75A 1K7EB 4PZCA 4OLFA 4ZO9A 4PICA 5A3SA 3ZNOA 4JI3B 1OF1A 1R9NA 3NBUA 3OSZA 1MEOA 3P4UA 3A9CA 4IGFA 3QE2A 4X6UA 3TZKA 3V1TC 3V6LA 1BEEA 1Y1PA 3TRHA 2BSQA 1IUNA 4U6NA 1SXJA 4L5BA 4LI3X 5I4BA 1V41E 1ZW6A 4HZGA 1RWVA 3LUPA 2XB2A 1WWKA 3CVXA 4HDQB 1LPSA 5IULC 3K9GA 4CMEC 3OQJA 4E7OA 3DAGA 3TM4A 2ONCA 4QAJA 2HFJA 2SKEA 3E9EA 1E3JA 1FMTA 3R7BA 1FP4B 1L4BA 1N2OA 4KYUA 3DM5A 4C5AA 1FFWA 3OMWA 3NHFA 4TQUS 3IVCA 2RG7A 5TXGA 1U7ZA 2XA9A 3VJLA 3EWNA 4YP6A 2FUKA 2CMDA 2VDMB 3LX8A 4F21A 1T2FA 2QENA 3MWDB 4INZA 4HDKA 1XSEA 1EB8A 3ZEIA 3WLSA 2EWMA 1WCWA 3BRCA 1OTYA 3FKSD 5DM70 4KXNA 3D2BA 1HMPA 1OLUB 4FU0A 3TLCA 4EYOA 4F3RA 3VDNB 3PNLA 8OHMA 2C29D 1VMKA 3JZDA 5HCIA 1EUCA 3PGA1 4MQ5A 1J2EA 1YK1A 3JARB 4QPJC 1L1FA 1YVUA 4FKBA 3O8CA 3ZE9A 4L5CA 4TRMA 4ZAYA 2ADOA 2B2XA 2J5RA 3DZDA 3OTGA 3SVZA 5CDFA 5T6BA 1YVRA 2OHJA 3IRVA 3A9WA 4WW0A 5KAPA 4EUSA 2C9YA 2ZSKA 3QE3A 1Q0PA 3LDGA 4TKUA 1MVOA 1KO5A 1SEPA 2MSKA 3F98A 3FB1A 3HCNA 4PO8A 1G63A 1H23A 2PH1A 1ZMOA 2VRCA 3ABOB 3BORA 4URFA 3OO0A 4FJ1A 4ZC1A 3N8GA 4P3NA 3K1TA 5BPHA 1Z4JA 1Y98A 4G5HA 2QJFA 4IXTA 1QBKC 2HK7A 3TQFA 4Q47A 4P31A 1CJBA 2NACA 3TL3A 4HB2A 5HOEA 2XUHA 3SFTA 4OHPA 3SQLA 4KKXB 4HRVA 1MX5A 3OBIA 1DVRA 2UUPA 4X7MA 4ARBA 3WMGA 3S29A 2WZQA 1U3VA 4UPEA 4QUDA 3AESA 3DXXA 4N7BA 4MV7A 1EDZA 1NY5A 3RVLA 2FX3A 3NIDB 2XZOA 1E4YA 2X9NA 1H2BA 1RJ9A 4IW3B 1E79D 1XVAA 2N1BA 3DVQX 1GNVA 4MROA 1P5FA 4AN4A 2A78A 3FPJA 4UHEA 4ETIA 4TV8F 1WKVA 3DVAB 4XX0B 3ZK9A 2JHGA 5JROA 4EB6A 4HN4B 3ONFA 2A58A 3VKWA 3E22B 5M7EA 3O4HA 4I1SA 3V97A 1KARA 4JP3A 4EZEA 2DY1A 3IPLA 4HGNA 2QRGA 5COQA 4AYTA 4Q9HA 3PQ2A 1NVWQ 3N5KA 4J2TA 1X7GA 3WSVA 1JXQA 4CM5A 2ZQYA 3IBSA 1KOGA 3ZVRA 1P5HA 2H4JA 2IYWA 2J45A 1WQ3A 2XMQA 2ZIUB 5DTQA 3W2EA 4S24A 4RFSA 2NUPA 2BFBA 5H80A 1TUGA 1DQYA 1U8UA 1F0NA 2ASEA 3F3YA 4Q7JB 1OR8A 4P5DA 3G2MA 2LVBA 4JGIA 2PUGA 4XQGA 3U56A 3OP4A 3D0KA 3GT3A 3RROA 3OJLA 4NBLA 2PUDA 3H0EA 1UBRS 1KRHA 1YBVA 2FK8A 4MW0A 3PXEA 1J1IA 4YRSA 3B6EA 3T7AA 1DAPA 3OJWA 1S8NA 3L6OO 4HHEA 2VWPA 2G25A 4LSGA 3PHCA 4FILA 2JK0A 4DIUA 2NVUA 2X0EA 1Y3AA 3GEMA 1K3UB 2JK1A 3D5QA 3JQGB 4JLSA 5KTMA 5ECGC 4JCCA 2HY7A 1BKSB 3ITNA 4XJXA 3VR4A 1YQTA 2AG5A 3A26A 1SU7A 5DKFA 2HCRA 4M87A 4CMBA 5B7NA 3GELA 1EFAA 3CVUA 1WPQA 5JYCA 4C30A 2HB6A 1B8VA 1AKQA 4KOAA 4QG7A 2PNJA 3TX6A 1W5SA 1EG7A 3Q3VA 2Q3DA 4P3PA 1SC9A 1Z7BA 2BONA 2X19A 2BCJQ 4HDRA 4X84A 4BLPA 3L9XA 5F98A 4IRMA 1CB0A 1DIOB 1BHJA 2BBWA 3ZWCA 2WJ3A 2IXFA 3L8HA 3K31A 3QLVC 4BFTA 3COJA 1X15A 2QGZA 1UFRA 2JASA 3PE6A 4HDSA 3R9XA 1C3JA 2REQA 2VRWA 4Q4AB 4RDHA 1XHLA 2C5AA 2JGFA 4JN6B 4ODIA 1AZLA 2CE7A 2OCXA 3BHIA 4RVUA 4P4GA 4IDCA 2GHRA 1QR2A 4FGJA 5IS2A 4ZQGA 1E9CA 3A2NA 2Y1KA 2ZRGA 1JHMA 3CEHA 4J1TC 4CLRA 1Y5LA 1CT9A 2B94A 3GP3A 3OOSA 1LQTA 5EZYF 3DEHA 2FX5A 1TCAA 1VJDA 4TV8B 3WNVA 2GQ0A 4F6CA 4GVLA 3MMNA 3FYUA 1S2LA 1G5QA 4GWKA 4C0WA 1SKUA 2B4QA 5E7QA 1MZVA 2WA2A 5NLLA 1DJOA 4DVGA 3MWEB 4ZQCB 3QVXA 3QU9A 4D79A 3OTWA 1KY4A 4O4IA 3TG2A 5FTKA 2UZ1B 3ANLA 3C7CB 4IYRA 1XKQA 2IYUA 3HYTA 2O2XA 4CKZA 4PINA 3GXOA 1YZ3A 4N8DA 5TARA 2GN2A 1W88B 3W8FA 3NDBB 3FLAA 2NXNA 4KE9A 3RVQA 5JMTA 3QLJA 3SHVA 3K30A 1AHNA 1C4XA 2KM1A 3BKWA 3TQCA 1BC5A 2DWQA 1PR9A 5DLDA 4XIYA 4K40A 5KQLA 5D85A 4WY8A 4IFEA 2O07A 5KSZA 2ZJ3A 4QPDA 3BSYA 3AR5A 3ZV4A 4E6PA 2R4UA 1M1NB 5E2AA 5A05A 2X5NA 3RK4A 1WS6A 3NHJA 2AKEA 2FZKA 1SELA 3UB3A 4YRZA 3CLVA 5KSOA 1DIAA 2QMZA 4MRRA 1FDOA 4E5UA 4OLAA 4JLAA 2E7ZA 4CI0B 1YZVA 3AVTA 2YV4A 1C14A 1Z34A 3ZQJA 1W73A 1RWMA 1HL3A 3D2LA 4Y7CA 1PS8A 4M0FA 4LVUA 5D2CA 2NNWB 1QVWA 4MLCA 1Y6FA 4QELA 3RS7A 2IYZA 2VPPA 3A6GA 4ITVA 1NVTA 2OYCA 4B84A 1GG9A 2GEFA 2VT6A 4OY3A 4UE6A 2N46A 4ECEA 1BFUA 2B8NA 1QQTA 4XCVA 3D7NA 3B6JA 1UCFA 3ND8A 3HJRA 2GBGA 3CH5A 4F1WA 1BXRB 3LXXA 2AOWA 1MB2A 3PYXA 3T3OA 3QKSA 4IEFB 4NE9A 5FTMA 2HR1A 1HYHA 3PJEA 4PC6A 4XFJA 2G80A 2FRVA 2Z3WA 1YCFA 2H0QA 1JDSA 1TC1A 2Y4OA 3B12A 5BN4A 3ZDDA 4WKNA 1NVFA 2JFPA 3PXAA 4R1LA 2ZZMA 4RZIA 4F5EA 4FONA 4M22A 4MHOA 1NZJA 3UMRA 2G9UA 2Z9BA 4LRXA 3UBTA 4FSDA 5DXAA 5EZYB 4TS9A 2QTTA 4J7UA 4D0NA 3W8DA 1ZSNA 4WHMA 3IVMA 3TXYA 1EDDA 3NRJA 1P2FA 3SF8A 4MA0A 3S5UA 1ZRSA 2C1XA 1ISRA 3LO5A 3VZCA 4DIBA 5E6RA 2Q49A 4LHEA 4PHGA 1R4MA 3AEKB 3ASVA 4JIMA 1DB3A 4QGGA 4QSMA 3ZS9A 4JYZA 3JASB 3IJPA 3DT8A 4OQMA 2II6A 2QYTA 3IA2A 2EKDA 4CR8A 1DKLA 2ZATA 1EEXB 4YQYA 4D3DA 1A72A 1KYXA 1L4UA 3DKRA 3E70C 3E3NA 4AKHA 1ISIA 4G89A 1Y1TA 3VO1A 1HNWB 1ESZA 4IDOA 2Q3BA 4BNGA 2P1ZA 4UNPA 1RAAA 5IMBA 1W0CA 3DHWC 3L02A 1ITZA 4K9OA 3BMQB 3EA0A 3SCZA 1NQAO 5B7QA 5BVHB 1EHYA 3EQ2A 4LCBA 3LS2A 2BGUA 3V1MA 3GT7A 3DE4X 1U2SA 1JW9B 3ZWYA 2GSDA 5KSPA 4IZOA 4FYMA 4BMNA 3VPBA 3PI7A 4D8UA 4BFVA 2ZI7A 5EE5B 4I50F 1RKVA 2C2BA 3A36A 5LU9A 4DHEA 1CRPA 2H1LA 4NAHA 4RVCA 3ENZA 2XCSB 4F5WA 4IMRA 2P3OA 3IP6A 1GU7A 3SEZA 3EXAA 1F0KA 3TMKA 5FP0A 2WM2A 4ENVA 4IIBA 2PJDA 1SCDA 4R1QA 4IUBS 3W3ZB 4TWAA 2A3NA 2ZDQA 3NAZA 3UQYS 3HDGA 4OLBA 2HHJA 4QAQA 4WY5A 2QTAA 3OLZA 4WBNF 4DCTA 1YZTA 2EKPA 2ADFA 1CJTC 1QHEA 3VNBA 2N9UA 5JLAA 2GCIA 1Q21A 2IPOA 2X1HA 4PSVA 3HB7A 4B31A 4PYRA 4KRXA 1P2VA 3NEPX 4I2VA 4ZT7A 1WXEA 1II9A 1KPGA 5K0NA 1YUNA 2UZ3A 4I66A 1EK0A 1IIBA 2XA2A 3CX3A 1C3LA 4A8HA 1NLMA 2IQIA 2BIFA 4KIFA 1WPGA 2QRNA 1EI9A 4GI5A 4JXXA 3RSQA 3O84A 5ELXA 2KWIA 1XNJA 1HLGA 2O0JA 3K35A 5EE1A 3IAUA 4LJSA 2D1QA 3L06A 3HCCA 2X0JA 3OPXA 5C1DA 2WFLB 2ABWA 4UARA 2B25A 5TGTA 5IAKA 3UHJA 3KOZA 3UGQA 1MP0A 3OT1B 4IZ6A 1ISGA 2OD9A 1YBAA 4QA9A 2QVXX 4BQPA 3HLTA 4EFMA 2AXQA 2VHYA 3BAZA 8ABPA 2VJNA 5GAJA 2C84A 3OU2A 4CETA 3KTOA 1ZOOA 2DKFA 2FI1A 2OAQ1 4UASA 5CLHA 1GR0A 3RSFA 3TLEA 1EUDA 3BHMA 3LJKA 2GN0A 1VPDA 1LTKA 3MPUA 3L7OA 1TUEA 4GOJA 5C7LO 3OIDA 4Q9KA 3JD3A 1HX7A 2VTVA 3H11A 4QU5A 4BO7A 2GTPA 3E2PA 4DMGA 1FJXA 1DJPA 1ZX1A 3FPAA 3TD9A 4D5GA 3GRUA 2GTHA 4C88A 5K8TA 3HU1A 1FLNA 1IY1A 4OTZA 5GONA 3I53A 5B57C 1XMIA 3DWGA 1WHTA 3NO4A 1U90A 4JKIA 1FXWF 3NWEA 4QT0A 1HMYA 1JWLA 3QOYA 4OQQA 4YDSA 5ULLA 1A2BA 2RAUA 4LTNA 3HYRA 3CG4A 3PCXA 3SOPA 1SHZA 4M1TA 2QV7A 3NJ4A 9LDBA 1W2GA 3F3SA 2J87A 3T5BA 2R6DA 2ZB3A 3KUXA 2Q29A 4I50B 2XQVA 1QIGA 3ZY6A 5KDDA 4L6AA 3DO6A 4XGNA 3UWMA 4CQMB 1PGNA 5KYUB 2V58A 1WJGA 3B82A 4BJ3A 1ZK1A 4IGAA 2LCQA 3EHDA 2BRUC 4M89A 3DAHA 3F3MA 4I4TF 4BRWA 2JGEA 1O7JA 1TJ5A 2I03A 1NYQA 4ABTA 3UMVA 4W5QA 1RM0A 1X19A 2BZ1A 2QQ0A 4KN5A 4D4GA 5K6TA 1DDOA 1ETUA 3OM8A 1XMSA 2FW8A 4B4OA 1K8RA 3FF4A 1NSYA 4W8GA 1Z0UA 2WKSA 3ESBA 3BE5A 5BQFA 1FQKA 2D7DA 5A6VA 2IHTA 1PQUA 3F9IA 4G4SP 1J0BA 5FBZA 4ZDIA 5JS1A 1TO2E 4OL9A 5A3JA 5A6SB 1O08A 2HMUA 1G5PA 5CLLA 2AI1A 2BVNA 1DG1G 2PMBA 3PFWO 5DF1A 1KI2A 4LF9B 1DLIA 2Y93A 1TPZA 1GYPA 2F1KA 2AN9A 3UAOA 2BFDA 2WFMA 4IF4A 1ZLXA 4DJEC 3I64A 5B4UA 4Q3EA 3EGCA 2QTHA 2NTJA 4L22A 3ZWMA 5FX2A 1SY7A 2C57A 1ID1A 3JZMA 4PCAA 4F91B 2F62A 1MO5A 2FW7A 2ZYVX 3RWOA 1VPWA 3AGPA 1AG9A 2Z5GA 3DC7A 2M98A 4PQGA 4D9EA 4U7HA 3N76A 3MCAA 4BQOA 4DLXA 1VJ1A 2PUBA 2HEGA 1FSPA 2X3FA 4JC4A 3K70B 4OL0A 4JOQA 4TYNA 2PZMA 1SG0A 2R47A 2R8XA 1Q6YA 1XHFA 1XL0A 4NE2A 3WLKX 2XXBA 3WNQA 3AL3A 5DWDA 2B1RA 4RK4A 4F2HA 1UBSB 1TUBA 1YS6A 2Q6OA 5TQ2A 4W1QA 1OFTA 3KVYA 1GRNA 1BWSA 2J5BA 3UH1A 3WGJA 5CT8A 4IPTA 1T8YA 4K6FA 2DQKA 5T8KC 5F3WB 4Q34A 3B3AA 3QPVA 3ZCQA 4ZO8A 4EY5A 3IEPA 3OHPA 1TZBA 1XFAA 4W5JA 3RFVA 1VL6A 1PG5A 3MTIA 1E1CB 1X1BA 3UJBA 1MBZA 3UC9A 1XYGA 3OAAA 2HRCA 4HNQA 3DNMA 2B99A 4YRIA 3VKFA 3PHBE 4B6PA 4ZOAA 5AI9A 4J6FA 3ORRA 4ZVVA 5HTOA 1Q19A 1VP9A 2H5LA 5KC9A 2D3WA 3T9AA 1T2UA 1P33A 2X2EA 1C0IA 2ICAA 5TPZD 1Y5IA 1LLCA 2F1RA 3H1BA 5FUBA 5FNVF 3P45A 2O05A 3T9DA 3T7EA 1EE9A 4DA4A 3TSWA 2C97A 2YV5A 1AY0A 3MD0A 3PT9A 3VKVA 4PIVA 3W1EA 3FFAA 1N5KA 4C0BA 1UBNA 4LZZA 5A1JA 2F4NA 5ADVA 3H5TA 4I4TB 4C0KA 3K73O 4EHJA 5ISMA 1MFPA 2O3UA 1N5RA 3B9QA 5CT6A 3O94A 1KGDA 3ZHYA 1RYEA 5JYDA 1N6KA 2VDVE 1P72A 4YCAA 1FPMA 3KS9A 3Q3HA 1J2TA 2NZ2A 4KW7A 1CE8B 2DUWA 2WYOA 1ZOSA 3ZTTA 2O8FA 3P96A 1PZNA 4F7DA 3IULA 1M2NA 1T0JB 3S2GA 2A9JA 1UM9A 3VU9B 1TYDE 5KOJA 3IP3A 2VHXA 3KKQA 5C51B 121PA 3PDHA 4G5FA 5AVJA 4KR9A 5T6MA 3UF0A 4UAVA 2QTCA 2ZSDA 1I9CA 4RW0A 2R6GA 2VPIA 4HMOA 4KQHA 4N7JA 3AJ8A 1MLDA 1XXHA 2JJ2A 2J85A 4B73A 1ID8A 1BCSB 4QUKA 1WEHA 3U7QA 1IZ8A 1Q15A 1I10A 1E2GA 2GZDA 4RAOA 4DSOA 4KTVE 1CV2A 2P75A 3EMDA 4OQYA 3RS8A 1GTZA 3BA1A 4J76A 1R0WA 3CVOA 3I58A 1KU0A 1GFZA 3N2ZB 4YT2A 2IYEA 5A71A 1PWEA 1E59A 2DF8A 3M6LA 3I6QA 1YGPA 2VN8A 3DAYA 3SZ3A 1IN7A 4JX9A 3AM1A 3A2LA 3KZMA 4XQ0A 3WDMA 3BREA 1QOZA 4QQFA 1JA0A 3CTMA 3GARA 2XSZA 4LRSB 3CSUA 5A2GA 3O8RA 8MHTA 3DT9A 4CM6A 1DKOA 3UPUA 1OB2A 2PX4A 4LF7B 1BDHA 5HKBA 1EVEA 4OBWA 4B74A 3ZVMA 3H83A 1R6TA 1QRUA 3FSRA 2NV2B 2XCUA 4H1VA 3NIWA 5DTEA 3ZE6A 1RE1A 3C8ZA 3U7RA 1M0TA 3MIIA 4YCNA 2YWRA 3EZ7A 3L04A 4OFZA 4AJIA 4NPHA 4JEHA 2G88A 5LOVA 1A98A 2WT8A 2VNHA 4M99A 2UDPA 4TTVA 1XA3A 3KNZA 1SIOA 3DUFB 3K16A 3PDJA 3VO2A 4EITA 1ORVA 2KB0A 4OYRA 5IVIA 4MS3B 3VI4B 3VNAA 4ENPA 1B2RA 4PEVA 2WICA 1BX0A 5K0JA 4DDKA 5BO5A 1ZKDA 5GZ6A 4W9MC 2JKZA 3BSSA 3N59A 3FPCA 4FNMA 4ZOLF 5FNVB 3S5JA 1GG5A 1XLTC 1R5JA 3IUBA 5H3LA 5EHQA 3IB3A 1IAVA 2C98A 2FY8A 5JCOC 1ARZA 1O6ZA 1SK9A 2BM9A 1S5PA 5ADUS 1H2FA 4CGZA 4WY2A 1PBNA 3BD8A 4F3CA 1I33A 1YKSA 2I4LA 1Q12A 3AJRA 3GCXA 2I7XA 2OK8A 3PUXA 3R09A 3EGXA 4X3PA 5HTKA 3X1YA 3HY3A 3ZNQA 4CMHA 4TQGA 2DTXA 2YV3A 4CM9D 5D3MB 1JR4A 3M81A 1AO0A 4Q05A 3D2CA 1GUYA 4HDMA 4H27A 5ES3A 3A2MA 1YJCA 1H6CA 4OHZA 3EGDA 2Y66A 1P91A 4PLFA 3SKYA 3MVEA 1GL7A 2QNIA 3QW4B 5B1EA 2OHGA 3EPRA 2QUJA 3JQBA 3VR5D 3SSNA 2APJA 1G2IA 3TB6A 4C07A 1RXIA 1L8QA 3PDIA 1CR6A 1MVLA 3H5OA 2CXOA 2V7XA 4II7A 3KTAB 3V8QA 2WUDA 2BHRA 4C0AC 3W05A 1XMXA 5BQOA 1ZA1A 2HEIA 4HQ0A 5KQPA 5K8JB 2E21A 2FFAA 1YJQA 2IYAA 2BSAA 1HSOA 3FZEA 1C9YA 3LX4A 1DBSA 4EFDA 4Z9XA 5BW6B 2D2EA 4LF8B 3BL5A 4NS1A 5ALZA 3MINB 1RHQA 4RUKA 1MXFA 1F14A 4LQDA 4Z1MA 1COWA 1KO7A 1PJSA 1PNQA 1UXHA 1H8ED 4H7IA 1DWPA 2H52A 5HK9A 5DJ5A 1DIRA 3EQZA 1IUKA 1XGKA 4JI7B 3R7DA 2CJWB 4FFDA 2AK3A 5CVUA 4DCCA 1K3FA 1Z75A 3H8JA 4DDHA 4EF4A 4FMCF 1HETA 4CW7A 2M6RA 2PGJA 1C4KA 2AYXA 1N9GA 2W42A 3LZ6A 3W7BA 4EAQA 4WX2B 2D5LA 2BGGA 2GYWA 4FFVA 3NHLA 2IEDA 4UJ5A 1FP6A 5AHRA 5FUVA 2BM8A 1TUIA 5M2QA 3AERA 3WKDA 1H65A 1KPHA 1AQIA 2XHZA 3PUWA 2AE1A 3G9XA 2GZSA 1U0BB 3GEGA 2BI8A 4KEAA 2DFKB 1E1RA 4ZOLB 4BB5A 4FYXA 4QUHA 4BGVA 1QP8A 4DLBA 3U44B 2EP8A 2H4ZA 4HF7A 2TYSB 1HA3A 2LIVA 2P9FA 3L7AA 4DLLA 4QYWA 2OFOA 5LP6C 1T4GA 2AF4C 1SXJE 1FFBA 1SEVA 1UDAA 4PPGA 2QN3A 4R71A 3C3WA 3TBFA 3BRWA 2ISQA 4MYUA 2EYQA 2AC2A 1PJCA 1TI7A 1K5HA 2WF9A 4FKMA 4A0GA 4G2NA 1BQEA 1VYVA 3CZPA 4BZZA 3HY4A 1P2SA 4L15A 5K2MA 1YB2A 1KDOA 4IFBA 3BFJA 3LRTA 3JVUA 5SICE 2AZ4A 2QT9A 1U8FO 1YDMA 1Z4LA 2J33A 2RGWA 2ZE6A 3B3QA 4G0OA 4IGIA 2R6R1 1GL9B 1YNOA 3CH4B 3IGFA 3E9MA 5AJTA 2VPXA 1AS2A 1L0BA 1OT5A 2JPDA 2PV0A 3D8RA 4EA9A 7REQA 3THYB 4YUVA 2C7QA 1QGAA 1I14A 4F0JA 1GFIA 2AIRA 1KZ4A 1L3IA 4AJHA 1XRNA 3DKKA 3GBSA 4KPUB 4KXUA 4OCZA 4HNUA 3KLPX 2XUZA 3QWIA 4RCVA 4ASUA 2CSXA 1JG3A 1ETHA 1R10A 3E8XA 2HK6A 2PIDA 4FX2A 4O0LA 3VJKA 4AYXA 1KQFA 3OE1A 4LYEA 5JS7A 5CDFE 4BO8A 4KSYA 3NHKA 2E4UA 2CMHA 4JJ4A 1TOAA 1YQXA 3GX1A 5EQDA 4G4GA 4PLWA 4ZT5A 2ONJA 3SR0A 5HR5A 4P53A 4RTLA 5F21A 3BH0A 3FOZA 4XB6B 1EESA 4H6VA 4D46A 5G2OA 3AUSA 4HI0E 4CQMD 2VYCA 1Z28A 2EU8A 3M6XA 4FYIA 3DVLA 5HRCA 3RRFA 4UD6A 2O8CB 1RBQA 1ICIA 1YS9A 5FTJA 5JXHA 3MERA 3KU1A 4F97A 5MGBA 1PAUA 2LDBA 3TTYA 4FFBA 5FBWB 4FMCB 3JYOA 5E2IA 4CLOB 4J43A 3W5AA 1OV6A 3C4VA 1E3IA 1JEJA 2P67A 2VBGA 2YYSA 3HADA 3MYYA 3PNQA 3WICA 4FTWA 1M2GA 4EPYA 5HWSA 1KYVA 2JLUA 2QIPA 1M7GA 1TU3A 5EZQA 3OQIA 3JYNA 3OG9A 1GSOA 2AL7A 2WHQA 4TROA 2VQEB 1DO2A 3TR6A 3THXB 4B3CA 2ES4A 3RASA 4MWSA 3W79A 3GWZA 4GOMD 5K0TA 4NONA 2FPUA 3KBOA 5J2UA 4L57A 4MUIA 1TRHA 3BL6A 4GR9A 2NZVG 1OC2A 1MB3A 2W00A 3C3XA 2FAXA 4MP3A 5AVVA 1TEZA 1V4NA 4HTFB 4PGFA 2PMFA 3EF1A 1ML4A 3GZ4A 4U6SA 2R7KA 1NTRA 1FW8A 4OK3A 4UBNA 4ZO6A 3PXXA 2A1TR 2GHIA 3CSSA 3HSKA 4MUHA 1AXEA 1BHSA 3KR9A 2WM9B 3RT9A 4D0LB 4DEVA 2DLDA 5GJVC 5CA1F 1R8SA 4EJFA 4ZI7F 1KHHA 1WB9A 5G4KB 5HCUA 3H0CA 4J7XA 1Q1AA 3QJ5A 5LB2A 3ZDXB 5J2TB 4OU4A 2IEAA 2FDRA 2JD2A 2V96A 4DC1A 1O9BA 2MR5A 2VCYA 3E5MA 4IGKA 1YQWA 3QBJA 4A3SA 5HMLA 4CTNA 4H0CA 4NAVA 1X7XA 3ECCA 4O2LA 4OM7A 1KBOA 3LA6A 3K70D 4WBSA 2JIQA 3BZWA 1LS6A 4GBED 4QU0A 3DTVB 4WFJA 1LKZA 1SVMA 4MI1A 4XVUA 4CF5A 5EL0A 1V5FA 5HIJA 1W47A 3M1LA 1Y9JA 2FVXA 5B58T 4J91A 1Z17A 4R4JA 1BE8A 1CP3A 2DECA 1EFVB 2EBHX 2HUPA 3LD9A 4RVFA 5F52A 2ZITA 5TGZA 1E2HA 1PFWA 1RADA 1GCIA 2C7OA 1RC8A 3TOZA 5CFNA 2QTVB 1JEEA 4AZ0A 4WKGA 4KFTA 1R64A 1BEUB 2HPAA 2F64A 1JZTA 5AJZA 3HR7A 1PL8A 3NTLA 1GGNA 2Y68A 1TJPB 2VJQA 4EKEA 1IZZA 2IY9A 4KXXA 4L4XA 2AV6A 1YV9A 4LWPA 3EDCA 4ZU3A 1UPTA 1GLGA 1W4CA 3GDOA 5BR1A 2WAOA 4F7WA 5GMOA 2I7CA 4L1KA 1RABA 4QJIA 3UV6A 1AKVA 5DX1A 4Q4HB 3V4VB 5DSZA 2HU5A 2IEIA 3TLBA 3AKZA 1MGOA 4K46A 4O1HA 3AKYA 2JGLA 1WW3A 3FFXA 4NCXA 4DCNA 1EZ4A 3AFMA 3FI0A 4EJ2A 5JLJA 1K0FA 4M1QA 4ES6A 1KZYC 1O94D 1RHMA 3G2OA 3GCGA 3G1TA 3FZQA 4JAVC 2YQ5A 3RVJA 2HBZA 1Z0FA 2YY7A 2V9ZA 3QLVA 4XEUA 4C01A 5ALGA 2LTAA 4MRPA 2WYHA 4EHNA 4EW2A 5K3CA 4YUWA 4FLMA 1J39A 5FT9A 3QUBA 1TGVA 2HU2A 3CB2A 1RI3A 3WO1A 4YJHA 3IQGX 3ZHZA 1H5NA 4YMGA 4ZYUA 1PE0A 5T3UA 1RAGA 1P2GA 3KPWA 1UAYA 5CA1B 1PFKA 1L8LA 4E4TA 4ZI7B 5IZCC 1KFKB 2EBWA 2VO1A 1VHTA 3NBXX 4J9VA 1RMYA 3O93A 1R9JA 2H5EA 2OP0A 2B4RO 4GYJA 3M5WA 2GA9A 3E3OA 3Q15C 1UH5A 4RU1A 1K7YA 4O0MA 4Y8VA 4Y6SA 2XRYA 2CBXA 5H8WA 3DMPA 3K5WA 2C78A 3U7JA 1LI5A 1AHHA 4N3NA 3T3PB 3A1UA 3A10A 3KWFA 4Y2XA 4OP2A 4EY6A 3PHJA 3UMYA 4MGHA 3ELUA 3FYDA 1DMSA 3WGYA 2FMHA 3FTDA 3LQFA 4S1PA 4RQUA 4JYPA 16PKA 1A7AA 3INTA 1TLTA 4GZ6A 5LBIA 2AH5A 2HQRA 1BW9A 1VLJA 3HI6A 1C7ZA 5A0FA 4RIIA 1TA9A 1WXFA 4M1OA 5HM6A 2JLZA 1CEEA 1KWKA 2P6RA 4E4YA 2ZRMA 1CJVC 4GECA 2HT6A 2QZJA 4Q03A 5JCXA 1F4LA 2I4TA 3OQPA 1KYTA 3TCXB 4JI8B 5KWJA 3ASUA 1B8OA 4QDKA 1GV0A 2Y6VA 2Y0CA 5C1BA 1V3TA 1U2RA 1IB6A 3O1LA 3S44A 4ZDWA 3PFCA 3K6KA 4ZGGA 1NQ5A 4LV6A 3NONA 3VYSB 3DMGA 4PYNA 5FA8A 1KFCB 1ACLA 1T3SA 3FTEA 2EW2A 1M67A 4LYGA 3CX8A 3VSEA 3EZFA 1YCHA 4D7AA 3F2IA 2ZT6A 4NS4A 4IR7A 4YEDA 1V1RA 4TUYB 3SQNA 2QGNA 1A8SA 4CT0A 4HNHA 1RVDA 3DG9A 3WKAA 2PXHA 3DD5A 1E61A 2PN1A 4ZD6A 3SSOA 3BGIA 4D0GA 2OCPA 1Z4QA 3VPCA 1W29A 4X24A 3ZTWA 5B58C 4WK6A 2VWHA 3OPYB 1SRRA 2BKUA 1UKBA 4QULA 2AMVA 5D6OA 1UZNA 2FPLA 4NKRA 2NU9B 3ICCA 1L9XA 5DASA 1QRAA 1Q1GA 2BGLA 2E18A 2I1WA 3T9CA 2Z6UA 4OKIA 3STYA 4E5PA 1RXUA 3O73A 2AFVA 2AW5A 1S01A 2I2WA 3BIWA 3JTMA 3ZWQA 3A4YA 4OXXA 4D74A 1EXVA 3EDRA 1CNEA 1E2KA 3N2GA 1MC4A 3DCYA 4EF5A 2IHVA 4B7UA 3EOBI 4BCBA 3WQHA 5TVGA 2WSIA 5FWXA 5BSFA 3MJTA 1HBJA 2ZRNA 3K9BA 3JWJA 2QLLA 1EK1A 2EL9A 2GJKA 3QFTA 4RQTA 4TXHA 4WXRA 5DHSA 1H4TA 1CRLA 1M6VB 1ZFNA 3H13A 3G5AA 1A8HA 1T0UA 4JYCA 4CI9A 1OFGA 3WFZA 2J59A 2QY6A 3QXGA 1NMYA 2BEUA 3CC8A 2WJYA 4XYEA 5B30A 1W5EA 4WE3A 3VHXB 1TA0A 5JMWA 4NPAA 4R69A 4ARSA 3EBPA 3VR6D 2OC9A 4BQQA 1GUAA 1ZU4A 1UEJA 1LDNA 1VOTA 1KNXA 3EHEA 1QNFA 3C7KA 4RKFA 2A0XA 4BNHA 4MGIR 1JKFA 4ZQFA 1P1IA 2MINB 3LHSA 3NV7A 4JVLA 4OAQA 2WBLC 1R37A 3VR1A 5SZJA 3R20A 3TQTA 4X7PA 5ICGA 1IN4A 1MIHA 3RRXA 4RX1A 1ZM2A 4LF4B 4R51A 1OAOC 2Q0QA 3AUXA 3N3AC 1JB1A 5I4IA 3KLNA 4S1OA 1FX1A 3QVGA 3K8QA 1E7RA 2C2YA 1XAIA 1UWCA 5JSUA 2CF6A 3IKMB 5DTJA 3ONEA 2TSYB 3FI9A 2PK3A 4DT1B 4FYJA 2AOXA 2GZMA 2GYUA 4P38A 4HJXA 2Q5LA 4TVOA 4DSUA 2FTKE 1Y3BE 4QM7A 1JEOA 4J9UE 4Z0HO 1OAKA 3O92A 1JMKC 3C74A 3NG1A 3VOAA 1U1GA 5BR4A 5LYJF 1JLLB 4RIHA 5FUYA 5C31A 5I7SA 3KVNA 4HVLA 1KI9A 1B6SA 3CUUA 3H84A 3BWBA 4U2DA 2FXVA 4DFDA 3IV9A 2JF0A 2FKNA 3QIVA 4WA8A 3VVCA 4DL9A 3PNOA 1Y48E 2QE7A 4TL9A 1PJTA 1N36B 5EMNA 4CF4A 3FTQA 3HJBA 1W34A 4QPZA 4MVJG 2OV4A 4L78A 5JTUA 1FS4A 3B9BA 4P35A 3EARA 2JJ1A 2ZBDA 4GKVA 3URMA 4URHA 1WQ4A 1S0UA 2I1LA 2CC2A 2CLOB 2OOKA 4O8CA 3HZZA 1TJ4A 4M6WA 3PPYA 4A8TA 1I94B 1HEYA 2XCOA 1XQXA 5BQPA 4LHWA 1SHKA 3MELA 2GN6A 4EIWA 2XUFA 1H2ZA 3A06A 3F9CA 4UTRA 4MWBA 5CD9A 3BVPA 3D81A 3A7EA 1TQ8A 1E2QA 1NI4B 3M1AA 3HACA 5D87A 2E5LB 4R2HA 3RV4A 2PMDA 2X2FA 1PHPA 1P7CA 3SXPA 2NO4A 2PUEA 3ZS8A 2J3HA 4LGCA 2LGJA 1O97D 4OJKA 4PVCA 4R2XA 5LJLA 3TRKA 1MOZA 3WIBA 5MN6A 2E82A 3F5QA 1VKRA 3RS0A 3CE9A 2CMKA 2FPSA 3KPUA 3FW1A 3BOSA 4G1VA 4EI9A 1ULBA 5TT0A 2EERA 3GLIB 1IHDA 5F33A 1QAQA 2JFNA 1VDMA 1PJRA 1RQPA 1RHRA 4M7PA 4PFKA 1E98A 3GCWA 4R2JA 1U6JA 1UODA 2O7NA 4U2BA 1GNRA 4W5WA 3EFOB 1FMFA 2JH3A 3Q3CA 5ELLA 1RPTA 3V2HA 3ETEA 4U00A 4C6SA 1D1PA 2ZRDA 4KLRA 2J3QA 1R5BA 1BVUA 1GRRA 2VDWA 3WP1B 1GGVA 5K3FB 3TTXA 1AT1A 2EZ8A 1N2EA 1XAJA 1D0SA 2NSJA 1Z15A 3C3EA 4WZAE 3WG9A 3MTQA 3KT6A 3PTZA 4K1LA 2Z2IA 4NTZA 1XRPA 3H1TA 1PI3A 4X7BA 1XDDA 2M9MA 5ALMA 2B61A 4PYQA 3D31A 1MPTA 3WA7A 2NNLD 3LC0A 3NS7A 1F6WA 3M4JA 4YIKA 2VKTA 1M2EA 3WL3A 5LYJB 1KR5A 4AK9A 1KYWA 2B5WA 2BRUA 2XY4A 3MWFA 5ALTA 4BO3A 2OYRA 4F4JA 4XQEA 1DKQA 5BSEA 3LYHA 3AQ4A 1FJGB 2F43B 3C70A 5EJFA 4D8WA 4CCYB 4Y6RA 4UNRA 1YRQA 4UMDA 1EVLA 3RT7A 2PY6A 2YDYA 2C94A 1NKTA 3O21A 2PNFA 1DT5A 4ENRA 4LY9A 3FDJA 4UBMA 1UKYA 1A5BB 1TVEA 2PSHA 4XB2A 3KQSA 3WI7A 3CLTD 3WGUA 3PR3A 2YJZA 3LUFA 1QDEA 4ADSG 2C5SA 4WGFA 1DG9A 1OHHA 4JB3A 2Y1CA 5CB8A 4RANA 2OQVA 1X7YA 3DTVD 2QSUA 4YP0A 4NG4A 2GPJA 4BLVA 2AHOA 4QO7A 3JWEA 3LL4A 4NDAA 3UXMA 1JBQA 2KPOA 2ZAMA 2D0IA 2Z57A 1QLHA 4BNTA 4DZRA 1YMUA 4H7EA 1SB9A 1NC1A 5H1YA 1U2DA 1GPWB 1CZLA 4E03A 3OX2A 1PJ2A 3IBCA 4WECA 2PVCA 1I2DA 2ZJYA 1MQAA 3IOBA 3WIVA 1ZD3A 3EOZA 2HIHA 4F9GA 2J9YB 2R96A 4FCCA 4IDGA 2C2KA 4BNJA 4YN3A 1J8MF 2FPXA 1KKMA 4PG6A 3EC1A 5FEMA 2G3YA 4P7KA 2G04A 1QRDA 4RA6B 4KFRA 5CXUA 5KYXB 2RC6A 1YI1A 2VPZA 4C4SA 1U2QA 1GU1A 4KQXA 5NULA 1ZONA 1FUEA 3HMQA 5KVAA 3E9RA 1XEAA 4DR4B 4EQ6A 1BRTA 3KR1A 1V45E 2FWBA 1YB7A 4BQNA 2ZVJA 1XZDA 3JVDA 3S2FA 3C14C 4EH1A 4EL5A 3L8MA 2QV0A 2Z6AA 1XDUA 1HSZA 2Q6VA 4G25A 3SC2B 2J3IA 2RONA 1X1AA 3QVTA 3RYIA 3WNCA 4C4ZA 6NULA 1P1CA 2MWMA 2H2DA 3NPAA 1B16A 3U4CA 5C9ZA 1CIPA 2W90A 4AAYA 4DNQA 5L7TA 2O8DB 1ESMA 3GZTB 4JROA 4J49A 1XX6A 2R65A 1E1YA 4IJUA 3G6KA 2O3RA 3WGHA 4OB8A 2Z56A 1IG3A 4X1IA 3RAGA 2OENG 2XOKA 1XG5A 3DZHA 5ALLA 5LC1A 2XWSA 4XWOA 4LRQA 3JAKA 4B3IA 2R25B 2WWIA 2WV9A 5FUMA 2PT6A 1M1ZA 2FXIA 2ISSD 2WAYA 2PGIA 3OWOA 5DYWA 3CNEA 3TMAA 1MD9A 4EGSA 4WESA 1YFKA 2OHIA 2R7LA 4YMVA 1WF3A 1M72A 3V46A 5B4TA 1ZI6A 3UMMA 3DJFA 2OV6A 3EWAA 2AW3A 3ESQA 3AJAA 2RB4A 4HMQA 2CLIB 2EZTA 5JADA 1RAIA 3RUIA 4M8SA 5CR9A 1UUFA 3OPMA 1S3IA 5H3HA 1A2QA 1XZNA 1JS1X 5ITSA 1SVOA 2LP4Y 3TWOA 1I7LA 1YFJA 3NRCA 4WZZA 1TVKB 1P2DA 1YR9A 1NV8A 2FZGA 3G2PA 3G7NA 3M5PA 1LBTA 3B3JA 2QP4A 5TMEA 1K5GA 3CPHA 1V9SA 1FUIA 3AP2A 4QVKA 2VQDA 1YQDA 3H9QA 4C1NA 1GV1A 2JKYA 2FG5A 3PC8C 4NNOA 3MM4A 4TWBA 1H05A 2H1VA 2Y2VA 3MGBA 1KJJA 4LYYA 3S55A 4XFDA 2V6MA 1H0RA 3UANA 1LRKA 1W5FA 2WIAA 4INPA 4JL8A 3A9RA 4Q48A 3TW8A 4BQIA 1EE2A 3P0FA 4TT8A 1XROA 5IK2D 3PHLA 4UCQA 2CV0A 1KS2A 1OASA 2IRWA 4M0EA 3WNBA 4XVHA 2UYCA 1LV8A 4R05A 2GK4A 4NZ9A 3P26A 3SXUA 4EO4A 1Z62A 3LZDA 4CF6A 2OC4A 2DFNA 2FDXA 3D64A 3F49S 1KSJA 3ZE7A 1BWRA 1QUFA 2A9PA 2PT7A 3BJEA 1IU9A 3IDOA 3VZSA 2G40A 3ZU5A 2QZ4A 2GBIA 5K51A 2AZXA 3EE6A 4R2MA 5AICA 3KD2A 4PTYA 5JMPA 1U5BA 4CIAA 3R9IA 2WQ6A 5DP1A 1Z16A 2HU8A 3ZHQA 5HS6A 1AKRA 1U7PA 4WH0A 1C9JA 1WZCA 3AU9A 4YV7A 4YAJA 4AMUA 3FCUB 4Y0NA 1RC0A 1Y8CA 3G8BA 3HFGA 4X62B 3M4YA 5F12A 3QE9Y 3C7TA 1E3WA 3EVBA 1ZRHA 4P22A 5ED4A 3R5TA 3LK6A 2WD7A 1SXQA 2AN3A 1Z0AA 5C8ZA 4K9NA 4ZTBA 4AT1A 3B7PA 3RSSA 5IJWA 1V7QA 4BWFB 4DLAA 1EB9A 4WXMA 5L3QA 3SBEA 2PG3A 1QP0A 1D04A 2EHDA 3B1WA 4CNQA 2DR0A 1VA4A 2NUBA 2VA8A 3LW7A 3IR5A 4TS4A 3OCWA 4FCVA 4NYIQ 3NBFA 4LE2A 5MFZA 4EY7A 3QRWA 2X4DA 1NM5A 2DFDA 2BMJA 4NJOA 4OXQA 5C1OA 2VDOB 2ZAOA 4R54A 2CUTA 5KYKA 2HA4A 3U4HA 4F4IA 1FYWA 1E5LA 1OTHA 2DQSA 2EJVA 4BV3A 1E3TA 3ZIUA 3U39A 1S9HA 4C22A 2QL5A 4XCQA 4OQDA 5HIKA 3WYAA 4G0MA 2V7WA 4AQDA 1F8YA 2DXIA 1ZVMA 1DX6A 3WDKA 4DJTA 5KNCH 1YQGA 3H2ZA 5L3SA 2UAGA 1U9ZA 4XAQA 4JUIA 3VTZA 3HN6A 3EXEA 5EMKA 1RLTA 3F6RA 3OZAA 1ZWLA 2ZIEA 3LT2A 2AS0A 5K1ZA 1M34B 2FPIA 3FMIA 1QB8A 4BLTA 5B12A 4KH1A 3JAWB 1C3VA 2VP4A 4ZAGA 3KQTA 4QICA 4ENUA 5BSGA 4K8RB 3DKIA 3KSDO 2HLDD 4QLAA 4MO2A 1VXRA 4EG0A 3BZUA 4GR4A 4RHFA 4PPNA 1YZHA 3FETA 3QU4A 3NDJA 1E4EB 1I36A 3QWHA 4RH1A 3UK0A 2OZLB 3K8OE 1G59A 4L8VA 1WPXA 3IHKA 5CXXA 4HV4A 2NUAA 1QIEA 1P1HA 3WA6A 1U81A 3V80A 1TLLA 4EBFA 1JFTA 3PUVA 4JSYA 4NZPA 4OLHA 3TKAA 2Q7DA 2OV8A 1OLOA 4W6QA 5BOSA 1WBDA 4LRWA 1KAQA 4F4CA 3B89A 3DQZA 3A1DA 2XMZA 3HKDA 1LY1A 3HXQA 3SLGA 1NQOA 1YHYA 4X63A 4PAOA 5FULA 3LPMA 1HQKA 1S7CA 1TT5B 1J2RA 5HK8A 1MAWA 4RTRA 1VRWA 1QP7A 1TB4A 3TQSA 4NXMB 1QE0A 5LN1A 2YTZA 3E2MA 5I9LA 2QVCA 1Z25A 1AGXA 4L4RA 4FC7A 2OO7A 3C8DA 4IOKA 3U09A 4NIMA 1XZCA 2P79A 4L5YA 5KKAA 1XALA 3CRMA 3DZCA 3F71A 4HLQB 3LC2O 5SYMA 2FPPA 1UINA 2CXHA 2LWIA 1I32A 2H92A 3IP1A 2ZP1A 2HADA 3UQZA 2HBYA 3DDNA 4JEUA 2QNBA 4LYFA 4N49A 1E7QA 2XRMA 3OLWA 3VU1A 1AX9A 4OUDB 3EGIA 3IIJA 3JQCA 5TMDA 3P2YA 4CDGA 2FE1A 5DDIP 3HXTA 4KWEA 4ROTA 1SIWA 1FOEB 2QM3A 4CKXA 1U8EA 1M66A 4PM4A 5JW6A 4YLGA 2SICE 4A4DA 2I3DA 2C31A 2BYTA 1XQ6A 1THTA 4M8IA 2JFOA 3GPBA 2V3CC 5LM3A 4PU0A 3L7BA 3U3ZA 4QECA 2XCIA 3C8UA 5AKXA 3WLHA 3SVLA 3ZKAA 4PX3A 3PUIA 1F7VA 3NMUF 3GFTA 2VTKA 3EIQA 2RH9B 5ER9A 5T4BA 3BTOA 4MDEA 2PJUA 3IURA 2I2DA 1W4RA 2Y1DA 1UMBB 3FRJA 3R24A 1AC5A 1U6IA 3R5FA 4NQRA 4TMTA 5KEIA 1SXGA 4NX2A 4OHMA 1EA7A 4HXYA 2ATVA 1GUFA 4N3AA 4ZCMA 3AEQA 1G6HA 4R2KA 1I30A 1U4SA 3TRJA 2FFQA 2IZ0A 4DQUA 3SVTA 1VB3A 5JH7A 1VG0B 4YUAA 2GEJA 1IN8A 3T1OA 1RM4A 1OWNA 4LHXA 3FMOB 3EDOA 4ZRDA 1XJCA 4I8IA 5E6UA 1NFRA 4E33A 1L3BA 1RXEA 3GAFA 1J70A 2DLCX 3FGOA 4IAOA 2G08A 2QA5A 3P2EA 5I9IA 2WWHA 5FBHA 1ZISA 2DPGA 1H3NA 2HHCA 1ZN7A 1E2NA 2PUHA 2INGX 3KBBA 1DBVO 3OKCA 4JK3A 1QIFA 4AIRA 3GUZA 4BIIA 3S28A 3SIXA 2RD2A 1HUQA 2YY5A 1K98A 1JI3A 5HMMA 1DAHA 1BYIA 4HVTA 4Q4JA 5FHRA 4MLZA 2BEVA 3GLQA 1XF1A 4ZVOA 1UKAA 4DCVA 1UDRA 1T24A 4O2AA 5CDSA 5AR1A 4CTMA 3W0LB 1YDEA 2REBA 1WXGA 2I55A 5CFMA 3IC5A 2Y67A 5CDGA 5JWRA 2Q4RA 4GPIB 4BNUA 4I3HA 5CURA 3W6ZA 2BEWB 4ZVUA 1SZDA 4ERXA 5JNUA 1YQ9A 3C3PA 2CNOA 2WOJA 1BG6A 2C82A 3FLMA 4ZV9A 3DLAA 3QOWA 1RC1A 4KAXA 1ZRNA 1PR2A 1QM5A 2X3YA 3JW8A 3SJCA 4RELA 4IHJA 1WZ2A 2GOYA 2VBFA 3VO9A 2ECQA 2FZ4A 2OQ2A 3RVNA 1OUMA 1LBHA 4MIEA 4Y2PA 3EUWA 1YR7A 2IWRA 3QBDA 4IQGA 3KJZA 5C37A 3IBGA 1U02A 3D3NA 3GPIA 4MQEA 1NMZA 5DYIA 3W9BA 5CD1A 2YMLA 4K7JA 1KK3A 2C77A 4I5DA 1XZEA 3JWHA 4CEIB 1NWHA 2JHFA 3VC7A 2IZ1A 3COYA 1U0LA 1QHGA 3RVKA 4G26A 4NNPA 2O7QA 2QD1A 1TM2A 3ESDA 5CFRA 2FSGA 1DOAA 1UFVA 3F6EX 3KKOA 2HJGA 3CR8A 4D8TA 5IXSA 2OA0A 1OYWA 2DSNA 3KSZO 2VP9A 4XASA 5ILOA 3R23A 2WU4A 1U65A 1YQUA 3EVCA 2BMVA 2W43A 4KQMA 1YFZA 4A2QA 4A73A 2DPXA 1YB5A 2BJHA 4FYVA 2FCAA 1OA1A 1FFAA 3NBZC 4JGBA 2D1FA 3CRW1 1OX4B 1EUYA 3K9HA 3O7WA 2QRUA 5A3QA 2P9TA 5K8IA 5AMXA 1WDKA 1CNFA 1FC0A 4HMPA 1NBIA 4KDCA 2HT1A 3DV0A 3GLSA 4CDNA 2Z8YM 2I3GA 4Q6BA 1C30A 1R15A 3TLGB 2UXCB 2P2GA 1MAAA 3M89A 2XF2A 4O6VA 2WFAA 3GUVA 4ANFA 3OICA 2QTZA 1NULA 3PRHA 1N8NA 4TPKA 3GH3A 3OEHD 3Q3GE 3R76A 3EGWA 4MVCA 4PWYA 1R4NA 1YUMA 4R9RA 3UM9A 1YNSA 4XOUA 3BHJA 4L07A 1PUJA 2WYIA 1QC5B 3A14A 1IBCA 4H9GA 5CAEA 3UG6A 1P18A 1HFWA 2AFHB 3PFIA 4ND6A 4B76A 2A4KA 2RGYA 3HM2A 4R8SA 5JNSA 1GRQA 2HTFA 1CIVA 3KYDA 4ON9A 4UUPA 1PR6A 3WWCA 2HCJB 4EUNA 2JEYA 3FPFA 2YHIA 1E96A 3A1NA 4MR7A 5HOQA 221PA 1KIFA 1MCZA 1S2MA 4KGXA 3VAAA 3TH5A 2C9OA 4QTXA 3G2JA 4GPTA 4IJ5A 3BULA 4QFCA 4RVDA 5CXSA 4XWWA 3COVA 3CMCO 4QQ8A 1C3OB 1YR3A 3U7EB 2O4CA 2G9ZA 5CBKA 1VE9A 2KQUA 3T95A 5EJ8A 3K92A 5EHNA 1O9GA 1TTHA 2PO7A 4MPDA 5FFFA 2DUMA 4O4JF 3OA2A 4B71A 4CM7A 3GCZA 1D2RA 1I2CA 2HK9A 2WYWA 4RS3A 5EJIA 3AY7A 4D25A 2E85A 3Q10A 3A3NA 1XO1A 3WZMA 3SQMA 3TEMA 1J99A 3I9OA 2VP3A 4E12A 1RWQA 4J7CA 5IM4A 4QPNA 3NBQA 3P5BA 5G0TA 1H6BA 2GDJA 1SJ9A 3FOEC 5C1IA 2X5OA 4FHGA 5JATA 4EF6A 5A62A 4ESOA 3C16C 5JVDF 2PLNA 1HXHA 4KFCA 1T5TA 4A2WA 2IDKA 4E5KA 2EFJA 4U2CA 2IS1A 1G21B 3HB9A 1U0RA 2ZYTX 2WILA 1X7ZA 1ZVQA 2F9MA 3EJ6A 3L2OB 5B6IA 2CL7X 4Q3CA 2PAAA 2GVNA 1Z5WA 3AF3A 4YIHA 4G1FA 1MJNA 3ZZUA 1ZSVA 2EG5A 2Q5OA 4HYEA 4KQGA 2I2XB 1HT2E 1G4AE 4JLVA 3EDMA 3LF1A 4G1UC 5IDYA 5A7FA 1SCNE 1G4HA 4FX5A 4L9AA 2YH2A 4ZYXA 1EK2A 2RI6A 2WZBA 2XTAA 2Q7XA 3B1KA 1VL8A 1ST3A 4RHUA 3NT5A 2PL1A 2QD2A 5GOZA 4P98A 4MVJI 2ODWA 5FNZA 5TMBA 3QEMA 4BJHB 4MW5A 3QVSA 5EERA 4D9CA 3RVSA 2XXAA 3BJIC 1MFZA 2DR3A 3PPIA 3UFXA 2LBPA 5J5CA 3HCBA 1AGNA 4JB8A 5L7YA 1YU9A 4CKBA 1JJVA 4ZAFA 1NOKA 4RY9A 5I9SA 4GXRA 2HSGA 2IYXA 3JRWA 4OU5A 4IMJB 1C0PA 5G40A 3T1QA 1EDBA 1RW4A 2ZS9A 3PD0A 1MXHA 1W1WA 5AVYA 4B7ZA 3BXHA 1IVYA 1T15A 3CRRA 4KLNA 5B55A 1ZR2A 1PGJA 4GSKA 4EHIA 2OBLA 2BGJA 3DLIA 3ICOA 4FDTA 3TIXB 2IH4A 3KB8A 1NE7A 4RJTA 3TQOA 1CJSA 3HKEA 4G4SO 3JQ9C 1YR6A 4OJMX 1FU4A 5D1NA 3WDLA 1XMPA 1VCNA 4RULA 4MPPA 2QTMA 1VHWA 2AEMA 2BTQA 5EWJA 3ZDZB 2HMTA 3JV7A 3ZKWA 4F3KA 1EXDA 3C48A 1VSBA 2O7SA 3HA7A 3HHEA 2YBEA 2PX2A 4O4JB 4QXQA 5EG5A 1P77A 4EGQA 3FBGA 1CUAA 2CD7A 2G6BA 2B9VA 2QG6A 4L0DA 4NOKA 4NQZA 3GMDA 3SG0A 4F2GA 3HK2A 1G3UA 2GETA 2B1JA 3C15C 1ECLA 2BKLA 2G71A 4FQ8A 4HFNA 3ZWBA 2UVPB 3EEQA 2QUBA 2NTVA 1YZGA 3A6KA 3L1VA 4CXMA 2ZWAA 1JN0A 2V5UA 2DHCA 4RZXA 4YHBA 5ERYA 3X1KA 1PR1A 3HXLA 1M2HA 4EUKA 3RFTA 5AW0A 4UZFA 4QQKA 4YRQA 4KX3A 4M8NE 5JVDB 3TW0A 2ZYIA 8ADHA 1ZH6A 3MCUA 1IM8A 5DRTA 3LL7A 4RKWA 2JL1A 1XU4A 3PEEA 3L1HA 4AMVA 2PHZA 3HNRA 3B8HA 1N5DA 1HE5A 1TZ2A 3ORQA 1O03A 1CUYA 3IQHX 2G72A 1ZMBA 3BFXA 1N57A 2IY8A 2X2PA 1DXYA 2Q3FA 2GUWA 3KPJA 3QI2A 2XQFA 4J1SA 1XV5A 4IOMA 3UXHA 3NBKA 4GPD1 2ZYSA 4IFIA 1J22A 2GCGA 2O3JA 3BE4A 4HZUB 4XJVA 1SOAA 4C7VA 5KNDA 3FUTA 5KJ6A 2H1CA 1FFXA 4WQMA 4EW3A 3RC1A 2D1RA 2IDMA 5IG2A 2DFLA 3LUHA 4B3TB 4MICA 3RIYA 4AO6A 4QOFA 3L6DA 4KHZA 4YAOA 1V11A 5FI3A 1RXYA 1DFIA 3L8CA 1UJ4A 3CJTA 5IKPA 1LTHR 1V0JA 3I2FA 1QV7A 3HU2A 1QVRA 5M29A 4BNVA 2ZIFA 4FFWA 1GXSA 1Y6QA 5JISA 2EEPA 1UP7A 1JSCA 2XVAA 1AJEA 5DNVA 1LPNA 1RPNA 2PZFA 4F4UA 1RQRA 4U1RA 4IIXA 2FEKA 1P8AA 2V0GA 3LCVB 1YDFA 1JPNA 1MNAA 3B2QA 4N1AA 4DCOA 2FPGB 2FZ5A 3NKLA 1GUZA 3O2JA 1WHSA 2QDXA 2Q3EA 1BFDA 1A27A 4AYWA 3KSAC 2V7PA 1CKEA 5DIFA 1O0CA 1VSUA 2Y4NA 1G21E 3CKYA 3DOHA 2WWRA 1J8VA 1A95A 1Y6RA 2VRBA 3FSGD 2GZ2A 2ETXA 3PYMA 1CC1S 3H1AA 1UIMA 1XDZA 3IQZA 1ENOA 2DC1A 1F9EA 2AJLI 1GCGA 3D6TB 4GGOA 4XVQA 1I01A 3SQOA 4B45A 1NNSA 5IFKA 3PGKA 4OYYA 3BSFA 2F8LA 3BRSA 3FVRA 3V8VA 4Z4IA 2HCFA 2AK2A 4LDZA 1UBOS 3DNFA 2CBZA 4YDQA 3F9RA 2YV1A 4UD2A 3QBTA 1Z8NA 1JSLA 5LQSA 1GR1A 4F8YA 2GS9A 1NR1A 4JB0A 1Z0DA 4ARVA 1FSSA 1DQSA 3OCCA 4RIGA 4AKGA 1AKTA 4FDLA 3QUCA 3WLLA 5JO9A 1QPBA 5G02A 2OSBA 2PRZA 2CLHB 2VNSA 4GZLA 4A8JC 4BO4A 2NGRA 4WK4B 4Z7JA 5CT4A 4IO1A 4Q7KA 1ZUNB 1T4BA 2IEZA 4EGCB 3I2YX 5ENVA 3PCRB 1Y3FE 3QKRA 5KJEA 3VU3A 3ZV7A 2CB0A 4Y1RB 1OKKA 2C3OA 3AK4A 4OXKA 4B8YA 1H1DA 2YS6A 4R1UA 2P2YA 4X1YB 5PNTA 2PBFA 2I4RA 2ID7A 5C5DA 1G19A 3WNDA 2Q1TA 4L6IA 2P9CA 1CQZA 4CMCA 1M73E 2RHGB 3KJHA 5AO9A 1A1VA 1T3TA 3QX9A 3F96A 3JQAA 3P0JA 4JQOA 5G3YA 5HQ3A 4YUYA 2R751 1CUUA 4EJMA 3UT0A 4BE9A 3G49A 3QMPA 1G20A 2XWPA 2VXYA 3DYIA 3JCZA 2GRUA 2EFYA 1DRKA 1FP1D 3EVZA 3FPSA 2RHHA 2MOKA 2XECA 1KIAA 3ZBPA 2DHRA 3I01A 3ZGZA 3HCAA 4B32A 1P1JA 4JNKA 3HRKA 5LQCA 4RAQA 3VTFA 3PQFA 4DWOA 2OCAA 3G7UA 4MGYR 1NRIA 1L4HA 5CVCA 1EFPB 4P5PA 4BJ6A 3U4QB 1H3EA 1IXSB 1GA1A 1YB6A 2ZUUA 1BE0A 3EIOA 1Q20A 1J1ZA 1R00A 2WW8A 2R1TA 3GJ8A 3H8WA 4UNNA 3O3CA 4AB1A 4CMIB 4CV3A 1LNSA 1OI2A 3RC7A 3AVXA 4ZVTA 3TINA 4L0QA 1GTJ1 3DS8A 2ZIAA 3UA4A 3C6QA 1GPUA 1AQ6A 3FOWA 2HLNA 4RD2A 1X7WA 1RLJA 3NB0A 1QF9A 4MUXA 2WD8A 2ECKA 3SS9X 5KVQA 4H3HB 4KN8A 1GWNA 4UBIA 3AT1A 5AI6A 4B3DA 3ZHVA 3FCEA 4O8ZA 5I7AA 2RAVA 1WQ1R 1MOQA 5L4NA 5EIOA 5KYYB 4GE0A 4UZEA 4XD7D 2JBWA 4I1PA 2I9KA 1XTBA 3DBRB 4DMMA 3ER9A 3LHKA 4GU5A 3DW3X 1EFRD 3DPIA 1Z6PA 2VWGA 2V6JA 2HF7A 1YIOA 1OBFO 1XZKA 1BXGB 4UATA 2MYTA 4B4UA 1LA2A 4AMYA 3UYKA 1KVRA 2A1UA 4KU4A 2ZRQA 3C7AA 5CK4A 5H9WA 1H66A 4WOKA 2E55A 2JH9A 5F4BA 4YWJA 1J9EA 2FEOA 2I2CA 4GC9A 3OE7D 5I9MA 3NXSA 4JZKA 5GWXA 4X65B 3TSAA 1W19A 3GROA 3Q0IA 1E6KA 4I4CA 2VAVA 5TC4A 3S8YA 4NYJQ 1OH6A 3EYAA 4OK6A 3NHWA 1PVOA 4JUDX 1KAMA 4QFMA 4IQ4A 3ZLTA 3C6MA 4HD8A 5JZVA 3IP9A 4UUQA 1WMDA 3UK1A 4AZ3A 3D6NB 2C0PA 2CE2X 3BE8A 3R7WA 3RTAA 2ZJFA 5ALWA 2VYVD 3BXZA 3MG9A 4HYTA 3BDVA 4D9IA 1RMTA 3SEAA 3ZJVA 1DXHA 5LSAA 1CVRA 6REQB 3CEMA 5K5EA 4C4RA 5F3RA 2YCBA 3SZRA 2B4AA 5ER6A 2Y77A 2HV9A 2CVHA 3RIGA 1PL0A 1G2OA 4LJ8A 1LV7A 2OV2A 3NAMA 3T0IA 1M8PA 3L7DA 3W6NA 1L4LA 5L8VA 3CYFA 3L4EA 2GKOA 2OXEA 4HX2A 4Q39A 5LXTF 1D7AA 3ZH2A 3CS3A 3R40A 1FQOA 1DBIA 3ECSA 2E4XA 3WIEA 3ZWPA 2LPMA 2ZAGA 1XQ1A 1JG7A 3R6TA 4OP1A 1TIPA 1I7QB 3GP8A 1Z5PA 3HCEA 3OC0A 2G5TA 4HDOB 4KO2S 1T0PA 4TGLA 4TSFD 4BCDA 1ESCA 4EMSA 1TA4A 3NATA 4J16A 5BV2P 4UBLA 1ATIA 1QH8A 1U0SY 4RHTA 3U1TA 3LPNA 4ZHQF 1HEIA 2JFQA 2Q4BA 3D4NA 1IONA 3K0KA 3K20A 3LI2A 4I9NA 4W1PA 4E51A 3UMBA 2WJAA 1GILA 1U63A 2O54A 4PAMA 1ONPA 4JP8A 4BATA 2B0CA 1HG0A 3NAQA 4GQBA 4DLYA 4NECA 4IBOA 1OVGA 2OO3A 4P9NA 3HCRA 3RADC 2A7XA 1Y9ZA 1MOSA 2FSHA 2P78A 3M6MD 4KITB 3HHPA 1BEZA 3BHNA 4XGIA 3AY0A 5CYOA 3QBVA 5DCWA 4WLUA 4I3GA 4CV2A 3OQMA 4CEJB 4V0MA 2W22A 1FDVA 3I05A 5AI8A 4XR4A 2HJWA 4GHWA 1EUCB 3JATA 4MRSA 2VF5X 3G2QA 3H4IA 4G0XA 5J1SB 3S1AB 5CBPB 4MEBA 2PZKA 2C2OA 2M1ZA 5HSGA 3FUCA 4F1KA 1KY5A 1JFVA 4JSTA 2JIMA 1NQXA 1O6BA 5C7IO 1K8ZB 3MBIA 3V32A 3AEZA 1G8GA 1MT0A 2XKJE 4RHCA 4TKUB 5ESWA 2GN8A 3CPJB 4N6NA 4X20B 1QHFA 1Q0LA 4Y9UA 4YT5A 1RYNA 3FJOA 4YDRA 3ST7A 5BUSA 2JLBA 4X7RA 4EELA 4DILA 3L92A 3G59A 4JBIA 3OU7A 1U5AA 3W7AA 3ZV5A 3B48A 1Q0ZA 4WUTA 1D2GA 4KQJA 4MVJM 1WB5A 4IV0A 4X90A 4JI1B 4BMXA 4RGYA 5EIXA 1ZOIA 3AESB 3S2YA 4N6OA 1CJKC 2BP7B 3LV8A 5CITA 4IVNA 3LCCA 3X3HA 2NAPA 2ZWMA 1RJ9B 3D6AA 3M82A 4H1HA 4PF1A 5AJWA 3TL2A 4D3XA 4CL0A 5KS2A 3G9QA 5BSMA 1DHTA 1G41A 1R50A 1V1MB 3R0QA 3UOWA 2ODBA 2BN4A 2R85A 1GSAA 2VZLA 3JVIA 3OCVA 1D1TA 1ZD2P 4BS9A 5LXTB 1CUHA 4OFWA 2LCIA 4EB3A 3ROXA 5C8DA 5LLSA 1LC3A 3DFUA 4MVJF 5AHXA 1VE6A 2BFCB 3VNQA 1MF7A 1WY7A 4QDOA 5E1MA 2PQ0A 3GLKA 5L40A 1SA0A 1DPGA 3L1KA 1UJNA 1W44A 3UWOA 3SZOA 1SVNA 1A9XA 1FPQA 4U7JA 1W581 4ZHQB 4C06A 2PMWB 3K32A 3V1UA 4BE7B 1WB4A 2G82A 1YVEI 4KQ6A 2DT8A 4MMYB 1QAOA 2TECE 4ZEWA 4H3VA 4PNHA 1UFOA 4UNIA 3UMJA 3KCNA 3WL8A 1Z39A 5GQSA 3TRIA 1XPJA 3K53A 2J41A 4ENWA 3DV2A 1VG1A 4Z0PA 3WBBA 5A5DA 1JFLA 2N1MA 1EVZA 1UMCA 3HPRA 1QO0D 4A5OA 1JLSA 4FYWA 5H82A 4FB5A 4KYIB 3O0DA 3G1UA 2QLJA 4M1EA 5DULA 3WZ2A 4Y1FA 3QE0A 4BO9A 3F74A 4H2DA 1Z29A 3LKBA 3AOGA 4PANA 1U3FA 2O8BA 1UDCA 4JLMA 2OFXA 3CLSD 3EQ7A 4DA6A 1B2LA 2HNBA 4KC0A 1X70A 4JDUA 2ANBA 4G23A 3EPLA 1XCLA 2VUTA 3FUXA 2JW5A 2I4NA 5CM2Z 5AWFC 5J4VA 4BGIA 2BJWA 3USCS 1FL9A 2AZDA 4JEIA 4KHPB 1BD3A 1IZ0A 3D7RA 3N70A 1M2OA 4PGMA 1VLQA 4R84A 5EZ6B 2WJWA 5KUTA 5LD2B 2Y3IA 3MJCA 4A91A 1YBFA 2BBSA 2CXQA 1L5QA 4NPCA 1II8A 1UXOA 3OZIA 5TQVA 4F45A 5HRUA 2ZYDA 4OIFA 2REQB 1F8UA 4TKVA 4C21A 4X97A 1ZMRA 4QRHA 2BEJA 5IBPA 3CNOA 1KQGA 4HH3C 3RKUA 3RODA 1Y4AE 4Q66C 4EZIA 3H5VA 1CY8A 3RT1A 5TPWA 4KJZA 1C8BA 2QJTA 4Z53A 3P9QA 3T5MA 2OOSA 3E1KA 1EVIA 2ZK7A 2CNNA 2OESA 2J09A 2XMSA 1GNLA 3EIFA 2XUPA 3KT0A 1K7FB 1UC5B 2KJQA 1EM8B 4KO8A 2QB5A 5I01A 5K6RA 1S3SA 4BKQA 3RC9A 2P9BA 2B1QA 3T0FA 2DYKA 4BN4A 1SQ0A 3GGJA 4EMUA 1W0KD 3W1WA 2YY6A 3ZXIA 3HC7A 1X38A 3PF8A 3HVIA 5JCPA 4RY0A 4WFKA 1A4UA 3TUIC 5FWNA 2PE5A 1YT5A 3Q5DA 4N03A 3GGPA 4CF7A 4KIGA 3GOQA 4QLOA 1J33A 3KQMA 4HAIA 4A6XA 2W70A 4US2R 3WKCA 3GGSA 1V39A 1FVFA 4UMEA 3L8GA 4EZBA 3SX4A 3IBFA 2IYVA 2OO5A 2Z08A 4AD8A 5ALYA 2XRZA 2ZCUA 3PGJA 2O7VA 2PWBA 2I2AA 1Q7GA 2V98A 2YHSA 3C7DB 3QBEA 3QXHA 4KR0A 3UJ9A 4YJ2F 4AROA 4C6TA 2W2QA 1RAHA 3SXJA 1QKKA 1YJ8A 2P4QA 3HJTA 3W4KA 1EJ2A 1K8XB 1VB5A 3K9WA 3JR7A 4IZHA 1K6EA 3RUPA 4WOCA 1PV1A 1K88A 3EUAA 4MUAA 1L3CA 4YXWA 3UW3A 5CXQA 1WTCA 4X61A 4B5KA 4IDHA 1P0MA 4W7IA 1D6MA 3AOEC 2VS1A 5JCJA 3LYUA 3JQRA 4NH4A 2Q4EA 4KV7A 4N5IX 5DN6A 3EH2A 2YZMA 3EMVA 3OF2A 3P71T 3BFVA 3GNLA 4WSOA 2GEVA 4NVRA 4A1FA 1ZBDA 5BWBA 4OIMA 3ZLVA 1Y9DA 1QAMA 4IINA 2PH3A 5AKZA 3OZXA 3PKJA 1BXKA 1PWZA 1XKLA 2IGBA 3W5HA 3WC4A 1WD5A 2NU6A 4XARA 4GH5A 1XN1A 3A05A 4OOFA 3TYXA 5JPCA 5FWAA 3T8YA 3GFOA 1Y0BA 2AF3C 4N47A 3DOOA 4DCGA 4Z3OA 3H6KA 1NZFA 2HHLA 1X0XA 5BP7A 3SYMA 1PT6A 4E1BA 1W46A 4N39A 1VHDA 2XWJI 3QMVA 2XT6A 5LQJA 4IDNA 1ZM4A 1HZZC 3CNLA 4XGRA 3LUJA 3FHCB 2G4LA 4J8PA 4TTIA 1WKCA 4CFSA 4O2BA 4G36A 3W5UA 4XUDA 3C6XA 3DP9A 4Q01A 3CEJA 2BI7A 2JI8A 2W8BA 4D5EA 5EHGA 1T3GA 1UK6A 1JAZA 1XTVA 2BUCA 2I2FA 2PUVA 1XFDA 3IUQA 4H7PA 4DV0B 3Q11A 5EWLA 4MIKA 1NF2A 3O2NA 4LMBA 4ZARA 3O83A 3VR4H 4LNUB 3OIYA 1MG0A 3OIUA 4RH0A 1ZUIA 3NDRA 4XDGA 3C5HA 1XEFA 1J9ZA 1QH0A 4CM1A 3BXGA 2PX0A 2H4YA 1KETA 4B4DA 5AVZA 5FPPA 4NESA 2B3TA 3LLSA 5C7OO 1YBHA 4UXIA 4EFKA 1APBA 3BCSA 3DZGA 4EG7A 5KZMB 4R8LA 2Q5FA 4R83A 1Z08A 4ZICA 4YJ2B 2K5UA 1YIAA 3DBHA 3RC8A 5CFOA 1II0A 2WU3A 4DJAA 4P7FA 1PZMA 2COKA 4YAGA 4R0VA 1T1JA 4S2EA 3VSCA 3PPWA 4QTUB 1Z45A 1JIIA 3UJCA 2ECFA 2WWGA 4YTEA 2QSYA 1QORA 3T3IA 2VYQA 3BQMB 2ZIXB 4CM3A 5B2FA 2O2EA 4OXYA 4KBGA 1E1DA 2FJ0A 2RMKA 1JNYA 1A82A 2PMCA 3P9KA 4KWTA 4LS3A 5FO1A 5MDHA 3QXXA 1CZRA 4TLEA 3RQSA 2ZJ2A 5D00A 2FSUA 1M2WA 4MVJH 1FK8A 5BN5B 4S35A 2RJ3A 3ZU3A 5H5JA 4W5NA 4BFYA 3THWB 3VZQA 1CQIB 2YNMC 1OFUA 3EOAI 4Q9DA 5I9NA 5JJCA 2NMVA 1UBKS 2I6QA 3N74A 3D8TA 1J2JA 1SBIA 1O54A 4HNSA 2YICA 1SCAA 1XTQA 1V3QE 2VPTA 1D1SA 1N9ZA 4MAMA 4W1SA 2IYFA 1P75A 1MORA 1AU9A 1JLMA 2FWJA 2I4IA 2I4MA 1VFNA 5BVGA 2ZXUA 3STTA 3WRXA 1MC8A 5I9BA 3S27A 1MAHA 1CUFA 1ZMXA 3JYLA 1L2TA 1IBSA 3DEZA 1LJLA 3EK2A 4CIVA 4CEHA 1C7EA 2XUJA 2Y6UA 4LY6A 2ADMA 1TPYA 3EX7C 4YJGB 2Q0SA 1BROA 1NQWA 2P35A 3W5IA 4QNMA 2ODPA 4LOHA 3JZFA 1M2KA 5EJAA 3FMFA 4L0CA 3E7XA 1EUDB 3F7TA 4D9NA 3LRPA 2EKBA 1ODFA 4OHXA 4OUDA 2L42A 3JRXA 3L4BC 1Y1QA 5E9AA 3RI3A 1X1CA 4ZEMA 2AOTB 3ZIAA 2CXXA 1RZ3A 1JR3E 5HF6A 1JQLB 2VHVA 3O1HB 1BMFA 3ZZ0A 1W7AA 1L8XA 2DERA 3M6AA 5EMLA 4H60A 1XCMA 4H6WA 4OFBA 3R6LA 2B4YA 6ABPA 2P6MA 3OF5A 2V7QD 4Z4EA 1GT91 1TO1E 2C2GA 1UMKA 3K0EA 1DBRA 1SUAA 4KTTE 4UOEA 1LPPA 2OTCA 4ECAA 1XLWA 4JODA 2C2HA 4XSHA 3HSYA 4ZAWA 1HLPA 1NNI1 3TZQA 5CEEA 2YWGA 4M0KA 4QVIA 4JJ6A 3ODGA 2Q7OE 5HX7A 1ZNQO 4ETMA 2R7AA 3A4MA 1JQKA 3WHLA 4C04A 1X87A 3U3DA 3Q6NA 4FE4A 4IP0A 2SHKA 2AQHA 2G06A 2FQQA 2Y0EA 1ZJ5A 3FTCA 4RK6A 3SKVA 1U0OC 2NUTA 3N7AA 4Y67A 2BKVA 3LY8A 1J0XO 3VAYA 4MV6A 1BS2A 2PSEA 2GX6A 1AA9A 4RCYA 4J0JA 4F9EA 1JE0A 4H1TA 5KOYA 1ISMA 3ZTYA 1F5SA 4IHKA 3ZDYB 3O03A 4KWHA 1DTWA 4KR7A 1UK7A 4BVEA 1HO3A 3ABSB 3MZ0A 3HGTA 2OSVA 1N75A 2GD0A 3G9UA 4FBGA 1Y4SA 2XVZA 5EJEA 1H22A 2CNLA 4FFPA 2R7NA 3OUTA 1LVUA 4FQ5A 1RZVA 4XI9A 4B17A 1Q0RA 1TD9A 3I12A 4KFSA 5IC6A 3MB8A 2DUJA 3ENWA 1FDIA 1G1AA 1FDUA 5DBOA 1U4NA 1M8GA 1VRVA 1ONSA 3THSA 2BFDB 3W7VA 3WKEA 2PL3A 4YAEA 4BUJA 3S1SA 1IAQA 4ZK6A 3JQ9A 5J1TB 2RHLA 1G18A 1YZUA 4FE7A 1BN7A 2OLEA 4NSNA 3E3MA 2V97A 1HRDA 3PL5A 4OAPA 3K9FC 4RSHA 4BMVA 3R8XA 1KK0A 1M74A 2RKOA 3ANSA 1JIUA 2CWDA 4HWPA 4CG1A 1V8ZA 4ZCLA 2PD4A 4LVCA 4TQAA 1OLSA 3Q1KA 1NQUA 1DADA 4KDFA 2N0SA 2W6NA 4Q02A 1QTNA 1TYCA 1YI0A 5AXBA 1TZKA 2BGNA 4B6RA 1Z6ZA 5TQ2B 3PNKA 2BY4A 2I33A 4XWYA 3TF5A 3MF4A 3VR4D 2JHCA 3GK3A 3AUTA 5D5PA 1Q0TA 3ROGA 4ME6A 3HRIA 4DV5B 1IRXA 1NBMD 5JAZA 4LBYA 4H4EA 4WTOA 4O25A 2IIVA 2OXCA 2PKQP 3RLIA 5TSDA 2VJBA 1WSBA 3QYJA 4ID3A 4Y6OA 8AT1A 4PTLA 1FFGA 5GVSA 1P2BA 1KHTA 3VR3D 5IBQA 4H1UA 4H6XA 4R01A 1YRLA 3SF0A 1O95D 5EXEA 1PFVA 2D54A 4JQCA 2QN2A 1ZH2A 3COSA 1GQYA 1ND5A 3WBJA 3ZZTA 3LOQA 4HFMA 4R0NA 4TLBA 3CUYA 5CVTA 3W2GA 4A92A 1V1JA 2B2CA 3G8AA 1LDGA 3B9RA 3PYLA 1K06A 4X8LA 1R6XA 3W4IA 3MT0A 1E63A 2PA0A 4QARA 1ZZGA 1G66A 2WTNA 1H0HA 3FBTA 4FYPA 4KQCA 4RLSA 3MCVA 3B2EA 5JZBA 1VIYA 5HM8A 1DGQA 1MTOA 1U1CA 2AZMA 4HOYA 3D0QA 4R0MA 1HF3A 1N5LA 1UBHS 2GA8A 3P20A 1FXSA 4G4JA 5GOTA 2OM6A 3D6VA 2F8TA 2V03A 1SVLA 1TYAE 4XM1A 1PTJA 3T9BA 3BGWA 1NNLA 4MVJD 4X44A 3P9RA 3WB9A 3C85A 3WXBA 2H54A 4W63A 4B3FX 3ULKA 1OWMA 1UL1X 4BLRA 5KOJB 1A9SA 1J0DA 3BH6A 3KZVA 3MW8A 1RKXA 2OBNA 2HXSA 4J0QA 4JQSA 4AX4A 1QOPB 1THZA 4MWCA 4P4TA 5FOUA 1SBQA 3H7IA 2G6TA 2DT5A 3ZK7A 3KEFA 1EGAA 1GEGA 2JS7A 2YOHA 1N4DA 1EX1A 4F12A 4URVR 4QBHA 1XXHB 3ETCA 2C7GA 3LF2A 2F1JA 3FTNA 4RD1A 4JA2A 1KC3A 2HJRA 4FBMA 3ZDAA 5GP1A 3I34X 4EENA 1NP7A 3LLVA 1GRCA 5LQKA 4MKFA 3I9FA