2P30A

Crystal structure of tthb049 from thermus thermophilus hb8
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
177
structure length
177
Chain Sequence
MELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQARRLKGALPSLPAFSSDLLRARRTAELAGFSPRLYPELREIHFGALEGALWETLDPRYKEALLRFQGFHPPGGESLSAFQERVFRFLEGLKAPAVLFTHGGVVRAVLRALGEDGLVPPGSAVAVDWPRRVLVRLAMDGEEATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of TTHB049 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
molecule keywords Alpha-ribazole-5'-phosphate phosphatase
total genus 59
structure length 177
sequence length 177
ec nomenclature ec 3.1.3.73: Adenosylcobalamin/alpha-ribazole phosphatase.
pdb deposition date 2007-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 2p30A00
3R7AA 2ENUA 1DKOA 2H52A 4MA4A 1H2EA 2PA0A 2ENWA 2DWPA 2EKZA 3EZNA 2H4XA 2P9YA 4E3WA 1T8PA 1V37A 2A6PA 4IJ5A 5AK0A 4JOBA 1IHPA 2H0QA 1RPAA 1YJXA 3IT1A 2WU0A 5CX4A 2P2YA 1NT4A 1E59A 3GP3A 2AXNA 1H2FA 1K6MA 1QFXA 4FDTA 3ZHCA 2EOAA 1ND5A 1DKNA 3D8HA 3E9CA 3LNTA 2P6MA 4GPIB 2HIAA 5PGMA 5HR5A 1RIIA 1EBBA 3LL4A 2YN2A 1V7QA 3MXOA 1SKAA 3C7TA 3LG2A 4D4MA 4TSRA 1DKPA 2HPAA 1SKBA 2P6OA 2QNIA 3O0TA 1QWOA 2F90A 1DKMA 3D6AA 3HJGA 2EKBA 4GPZA 1CVIA 3DB1A 1TIPA 4FDUA 3NFYA 3NTLA 4ARVA 3GW8A 2P79A 2HHJA 3BIFA 3DCYA 1FZTA 4ARSA 2RFLA 3IT0A 1RPTA 3FDZA 3IT2A 4QIHA 5AJXA 5HTKA 3IT3A 3K4PA 1ND6A 2P2ZA 1SK8A 2P9ZA 2OWEA 1UJBA 4D4KA 4JOCA 3MBKA 1BQ3A 3K4QA 2WNIA 3E9EA 5AJVB 4ARUA 3E9DA 2I1VB 5CU7A 3OI7A 1DKLA 1UJCA 4EO9A 1BIFA 4D4LA 1C80A 4AROA 1FBTA 1SK9A 2OWDA 5CDHA 3PGMA 3F2IA 5AJZA 4PZAA 3QPVA 2P9FA 3KKKA 4EMBA 4HBZA 5AJYA 3EOZA 1YFKA 1C7ZA 5AJWA 3FDZB 3F3KA 2P75A 1QHFA 1BQ4A 3GP5A 2P30A 2A9JA 2YN0A 2GFIA 2DWOA 2WNHA 3D4IA 4PGMA 1XQ9A 4PZ9A 4JODA 3QPWA 1DKQA 4ODIA 4IJ6A 1E58A 4D4JA 1C81A 2BIFA 2H4ZA 2P77A 2IKQA 2P78A 3FJYA 3QPUA
chains in the Genus database with same CATH superfamily
1WP9A 3VPCA 1U3VA 4OQZA 4P92A 2R2GA 4ZC1A 1JA0A 4JT8A 5HRAA 3M8KA 3ZWPA 5EKXA 1NUQA 3PSAA 5GJVC 2WA1A 4CKWB 1WY5A 2OZPA 3GC6A 2Q07A 3LGXA 4JL8A 4UQOA 1FP7A 2HGSA 4WLUA 2R5NA 2Y0CA 3CNNA 3G0GA 4TQUS 2X8LA 4ALIA 1FJXA 2JCYA 1L4MA 3AEYA 3HKCB 3P26A 4KGXA 5EERA 3ZDZB 4P0QB 3THXB 4DJ5X 2GSDA 3UG6A 3GH1A 1YULA 4CUJA 4IGFA 1MB3A 2VPQA 2QRHA 2QMQA 1N9GA 1VIYA 1C7FA 4LSGA 3ZYZA 2F6RA 1JUDA 3STYA 1K6MA 2IXDA 3K0KA 1AQUA 4PSDA 2A86A 3OCWA 4YRMA 4BO6A 2XEDA 2ZZMA 4TT8A 1JVNA 1Q0QA 4NYIR 3L82B 1RI4A 3T95A 3ZZNA 2VSQA 4C30A 2P9TA 1SCBA 1RXWA 1V5GA 4QTUB 2BTQA 2H1RA 3D4LA 4BP8A 4I5FA 3VO9A 1OILA 3NGMA 3RQIA 1RMTA 1I4DD 1U0JA 5IM4A 5A4IS 3ZIDA 1DO2A 1ABFA 3JVDA 2WD9A 4Y2SA 3K2EA 4RM3A 3DEFA 4JHXA 3PHHA 3UJAA 2YUTA 2ZE6A 4H0NA 3FTCA 4LXHA 4XVHA 4RAQA 3WSVA 4BN5A 3H0KA 1GUBA 5AW0A 4C1BA 2FRXA 3CF4G 3SZOA 3VC2A 3HCBA 4WKGA 2BEVB 2AS0A 1RYZA 3MS2A 3O2SB 1X80B 3QM1A 1N6OA 3KSBC 2NUBA 2BMEA 3WGGA 3NHWA 1IK6A 1HH4A 1QK3A 4IDCA 4A6EA 3ZEAA 3BFPA 1DSSG 3A9TA 4M1EA 1OC2A 2OM2A 2PU5A 1EG7A 1L5WA 2NSLA 3OZDA 4O1HA 1GTG1 4IIGA 3SBEA 3UJ3X 4BC0A 5LMNB 2RHBA 1RRVA 4YLYA 1NIJA 5FV4A 3HKEB 2NUTB 4CQMA 3S2EA 3L43A 4JLMA 4TZKA 1MAVA 1X86B 5AVQA 5AR1A 3SPXA 2CEAA 2F3UA 1G55A 1OA0A 4D4KA 5FWYA 3P45A 2UZ1A 4YK7A 1Y9DA 2HK9A 5AOAA 3PSHA 1Z82A 3UK7A 3CQ9A 3GDHA 1BN7A 3ER6A 1AC5A 3KAKA 3TFOA 4FDVA 1XC7A 1MX1A 1TUEA 3ETDA 3SIRA 3MMNA 1RKXA 3HO6A 1VIMA 2H0AA 4YT2A 4RY0A 3ETCA 1WDTA 5DW0A 3PNMA 5DOVA 4IDQA 4GNRA 5KINB 3WMRA 4QDXA 4JQCA 1DARA 2VSFA 3OCJA 4RD3A 3ZBPA 8ATCA 1IIRA 1DV2A 2H1LA 2NVUA 3EOZA 3QV2A 5HKLA 1DAIA 1OKKA 2OQIA 2FPMA 4W5WA 2NXEA 2OXEA 1VG8A 3CLSD 3DR5A 2RAPA 3OU7A 3W9SA 2VDQB 3GJ8A 4Q7QA 5I4IA 4BNNA 4XWTA 1FXWA 4BU1A 3EPPA 3Q6IA 3BTUA 3DZFA 2FSUA 3G17A 3KZ1E 1XYGA 1TZCA 2VDNB 3LXMA 4GQIA 1ZKMA 5TS3A 1OROA 4LNUB 1CUAA 2P3SA 2R8YA 3AHHA 3QEJA 1AOXA 3EF1A 3RTBA 3T99A 3R5TA 5I7OA 5C52B 2O5RA 2HCBA 2P0YA 1S4QA 1E63A 2G1JA 2KBEA 1Z5OA 5AI0A 1Z9BA 2DQSA 2IBTA 4CQNA 1USVA 3II6X 1WZNA 2IYLD 3M2TA 3OEED 5BQPA 4BO4A 1ZI9A 3DOHA 3GYBA 4EF6A 4PVCA 4CTJA 1GDHA 3RYFB 2IRWA 3N2ZB 4N7JA 2R47A 4HVTA 3NKLA 3ZDEA 2P67A 4I4TB 4BB9A 1J5EB 4UM9D 4XR9A 3WFIA 2A84A 5M04A 3EULA 1BCRA 1XCBA 4G1FA 4O4LA 2FFQA 1BN6A 1NQUA 2M1ZA 4HH3C 3WLJA 3ENVA 3W34A 2C58A 3OQIA 1AF4A 4N3GA 4ZYUA 3JARA 5AW3A 2ZYVX 5FLYA 2HT1A 1TA9A 1RR6A 1NBMD 2XKBA 4G0ZA 3INTA 4FX2A 4QU8A 2TMDA 3ELDA 4KWIA 5DEIA 4EUFA 2ZP1A 3GBVA 1UPTA 4DKXA 3LDAA 3DMPA 3DCIA 1MLDA 5E9AA 1J9GA 3ZDAA 2R44A 5E6UA 1OXMA 2X42A 3PG5A 4Q37A 4QTZA 3VQTA 3WK9A 4P3YA 3PVCA 2GN8A 4R81A 4UDXX 2NV0A 2X86A 4M87A 3WQBA 3ITDA 3H11B 1JDBC 3QPDA 1CEQA 1GARA 3E48A 3INRA 1CUJA 1XKLA 1WXGA 3JCZA 1E4OA 1E4YA 2X2FA 3NT2A 1T6YA 1ZH0A 2GHIA 3S55A 2GAAA 5B6IA 4XR4A 3UC5A 1NUUA 3U7IA 1XP8A 3L7OA 3R4VA 4JT9A 1RLOA 1NBMA 4KQJA 1DJPA 4F2GA 3IAS1 1ISHA 3I3OA 4IKOA 2I9PA 3K70D 1NP7A 1OQAA 4OXYA 2PRZA 2OEPA 4HL6A 1GFWA 3AGPA 3I2GA 2JF0A 3GBSA 3JQBC 3GRKA 5L4NA 3O2NA 4FS8A 4G9EA 1VIAA 2F62A 4H0CA 5CPFA 3NALA 3WLTA 1JSXA 2F3PA 4WXHA 5B7GA 3G7SA 1OLSB 5F7OA 1GL7A 4HZUB 3EEOA 3K4PA 3STWA 1GPBA 3C7DB 1F5NA 4LV8B 1H2YA 3W8EA 3GX1A 2JIBA 2FPRA 5T6MA 1EHYA 3IP7A 3SJUA 1ICEA 2WHRA 2CNWA 2RHLA 3RABA 2J5RA 3SK0A 1GCUA 2ECFA 1QIGA 5FUWA 5JANA 1U8UA 4ARAA 5C37A 2QU8A 1MW9X 2C5SA 1ZXBA 1V4VA 5HF8A 2MTBA 3ZLJA 3MTBA 2RHGB 4OO3A 4DWVA 2ZWIA 4KLNA 1P18A 2AMVA 1ZX1A 4HP8A 2QQFA 4BMOB 1G6KA 4EY3A 1XXHB 1R88A 2FPLA 2YVUA 1F8YA 1B3BA 1S2MA 1G291 2PJZA 4C0LA 5AHWA 1MZVA 5EVCA 3RBAA 3GLHB 4KFTA 3FGZA 4OPMA 2WTMA 4X90A 3EIWA 2GRUA 1QG4A 3T5TA 1ZJWA 2HI0A 1C0IA 1V7PC 3EPRA 3GPDG 4UXIA 2FF7A 3O4RA 1A77A 3OEWA 1OMOA 5ADHA 1KZ1A 1XDDA 3IURA 2JAHA 5F35A 4YXWA 1ACMA 4B45A 4ZO6A 2W4MA 1L5GB 1QLWA 3DDNA 1PJ2A 3DQPA 1ZICA 4WZZA 3QVMA 2JLUA 1GCGA 1TADA 4M89A 1WU8A 3R9KA 1KZHA 4XEUA 2GT1A 3AVYA 3RS4A 2HXSA 3KXIA 4J7CA 5H8WA 3MRSA 5L7WA 5JRDS 5EXXA 1FSZA 2MIIA 2Y4NA 3C70A 3RBXA 3SVZA 2ZRDA 4Q1AA 4RDXA 2O23A 5DHAA 4NENB 2FU5C 3M9XA 4L51A 4BO8A 5FUBA 3CNHA 4MR9A 3EDQA 4QGGA 4S2UA 1AQ6A 4XDGA 2WDZA 2C9YA 2B37A 1H2BA 1NC3A 1ZI8A 5IVDA 3MUEA 1G0OA 1U0EA 2ZIGA 3FB4A 5CA1B 4K9DA 3D6VA 4A15A 5JCOC 1AF7A 2V7WA 4TXJA 4TMVA 3CZQA 1NI4A 1CWUA 1OFIA 1Z2PX 2PL3A 2R6FA 3CKKA 4QPJC 4U9IS 4L02A 1LQTA 5HDBB 2FR0A 2WJIA 4B9AA 4EPRA 4G1BA 1CNFA 3NDRA 2QQ0A 5FOUA 3UBMA 1UXKA 2WVJA 2R7NA 1F8GA 2F1KA 1ML3A 3H99A 3L46A 3LNTA 3OFND 4TXNA 2PMDA 5AKYA 3C7KA 3TCNA 5TB5A 3IGFA 5J2UB 5J47A 5JNVA 1RLTA 4IQ8A 1EH5A 3DT9A 3GVXA 3NDIA 4FSDA 4PSCA 1SKAA 1XOIA 2AEEA 4MKHA 3RJ5A 3G9XA 2UZ1B 4P3XA 1MC1A 3GLIA 4IJWA 1A88A 2Y1XA 1JIVA 1XZQA 4P3KA 1MO5A 1N78A 3W4KA 3GQVA 2AFHE 1AS2A 3A70A 1J1UA 3A2KA 1UXJA 2EHJA 3D8NA 4EFNA 4YALA 3UKJA 1JA1A 1Y9AA 2FFAA 1RWMA 1LDBA 1IN8A 3H4VA 3HCAA 4AG6A 3O91A 1TCUA 3FMFA 7GPBA 1WMDA 3N0WA 4EY6A 1P3JA 1Q7RA 2ZIXB 2GAFA 4ME6A 2C5GA 5L3QA 1LBHA 4DRZA 5K20A 3FHJA 1VP9A 3LOQA 4MB6A 5AMXA 4PN7A 1V48A 2J4FA 4GR9A 4KSCA 2PJRA 2ONZA 3VJMA 3BXXA 1YJQA 1SVLA 1JFVA 2DM6A 4I9NA 3F9CA 1DB3A 2P91A 1K66A 4E46A 2DVMA 2F2TA 2JH9A 2QF7A 3ASZA 3P4XA 3O3CA 2B1GA 4HWKA 4MB0A 4GRDA 5EQTA 4DQLA 2ILVA 2PX0A 3IESA 3O82A 5ESWA 4RIHA 2XMGA 2O7VA 4Z7OB 2RB4A 1SUCA 3CFYA 3LLVA 4LCBA 2B1IA 1N2EA 1IQRA 1R0ZA 1WXIA 2MOKA 1SKYE 3H42B 3QPAA 4PZAA 4YQFA 4QARA 2JI9A 3DJYA 1WHSB 2IXFA 3SKVA 2OSVA 3X43A 3I6MA 3TBKA 2A0UA 1SVWA 2FX2A 3AJDA 3AVQA 5IMSA 5K6RA 2X0JA 1GTZA 2ODEA 1IJFA 2IP2A 2OV6A 3PXAA 3B7WA 1QQBA 1J39A 3LY7A 3C87A 2QN1A 3ZQUA 4DSAA 4IIDA 3F67A 3DE2X 2XDAA 1QIIA 1W94A 3D6FA 1K8QA 1QHHB 2NPOA 2WKQA 2HSWA 4FX5A 2WWRA 4S1TA 4GE3A 2C54A 1M2VA 2GI4A 4D44A 3FW1A 4MQ6A 1NPYA 4AN1A 3W6NA 1PK8A 5BR4A 4FEYA 1D6SA 2IL1A 3BE4A 4HGRA 5DNEA 2YJ6A 2ZJ5A 2B25A 2H52A 4HATA 2O8FA 2ACWA 4QGFA 3U2QA 3UK1A 3SSMA 5DW3A 1F9EA 1ZMOA 1D9ZA 1H6DA 4FFSA 1ONSA 1WKCA 3LMKA 3GLRA 2CWDA 5IUKC 3E9NA 4LHSA 4OAOA 3QTLA 4Q82A 2JFZA 4JLKA 5CLHA 1R2QA 5LYJA 1RU3A 2N46A 5K3DA 3ML1A 2HCRA 2IEAA 3WL6A 4ZYYA 4NEHB 3N7AA 1DWUA 1JN0A 1IVYA 3CURA 5KVAA 1P0CA 4A2CA 1FNNA 2CMGA 3EMKA 4JEIA 1V25A 5EIBD 1DIHA 2FE4A 2UZ4A 2BM9A 3I2FA 1NI5A 1ZW1A 1C7RA 3TI9A 3IHKA 2G8LA 1YBAA 3FI9A 1DCMA 4LQDA 4V0ME 4AUKA 1JEDA 4ALMA 4DRYA 1A5BB 3R6DA 3H9GA 4KPYA 4QJ3A 4M6WA 4PG5A 2BR5A 4HX5A 3AETB 3FCOA 1A8QA 3WISA 5KJFA 2J87A 4XTCS 1H2HA 1Z0DA 5HBGA 1VKRA 2ODPA 2P3OA 5GJWC 3TZQA 2XUZA 3MS7A 2NMVA 1YQUA 2BJHA 1OFUX 1ZK2A 4AJ1A 3AEZA 2RI1A 2IIPA 5LA6A 3GRUA 3ZWMA 1PZMA 5ADUS 3H5LA 1EFTA 3TZBA 3TRDA 1G18A 3ZQKA 3EAQA 5HJ7A 4M88A 4N9WA 5J4YA 3I01A 1FZTA 1NBAA 3A7EA 4B7AA 1U3UA 2JH3A 5JYEA 3ETGA 4UE3S 1QF7A 2WICA 5EZSA 3SD7A 4ZIRA 1FDOA 2FXIA 5I8PA 4ENSA 1KAEA 1SZDA 3BXPA 3NHYA 2ZQZA 3KFLA 4UTOA 4OKNA 1G21E 4AMVA 1M83A 1YR8A 2RKBA 1XG5A 4WFJA 1TYZA 1OLXA 1TU3A 3UWOA 3NTXA 1WZIA 1ZCBA 3F5QA 3U7QA 3NEAA 2O8BB 2C4UA 2EZUA 5T57A 3B82A 3QVGA 1RCFA 1Q7BA 3KO8A 4J94A 1B26A 4DHEA 5AK4A 3B13B 1UBUS 3CLRD 4LHXA 5E4JA 1DAFA 7MDHA 1R6UA 4A03A 5AW1A 2IU3A 3B2NA 2LKDA 1TC2A 2PGXA 2J9FA 4WGFA 4Y2JA 3C3CA 3SYRA 2HK8A 1GRVA 1DLIA 3OESA 2ZWAA 2VNHA 2J9ZB 1RDFA 5AJWA 3E7PA 3EZLA 4DR5B 1XLWA 1IQUA 2WYOA 2YWEA 5A9SA 3Q3IA 3QY9A 2C4TA 4Y0VA 2PHZA 3W3AH 1OCEA 2FHSA 4Y2GA 5EPOA 3ZXYA 4A0GA 4MO9A 4CTOA 2BGLA 1U1DA 5JH7B 1H9AA 5CEFA 5H9WA 1F7VA 1J42A 2C78A 3KWFA 2O0JA 4E5DA 4R71A 2AKAB 2NU9A 1WOMA 2H4WA 3F6RA 4KCGA 3MJDA 4MPPA 3ISTA 1KI8A 2J5QA 1XAHA 2GTPA 1JTVA 4N6GA 1OPXA 4LRQA 4O2BB 1UQTA 1XHLA 2ZVDA 4H59A 4PNHA 3FJYA 4JUFA 4NAUA 4XM0A 4RELA 1S96A 2WHXA 4P4GA 3BHJA 1XVLA 5EOVA 2NVUB 2FVYA 1CUIA 2BFDB 2KJQA 1K27A 2A0WA 2IHTA 4FOOA 2BBTA 1O5IA 2QMYA 1U7UA 2PV7A 2PGDA 2PBLA 2WC1A 3O1HB 4EO7A 1OHHA 4B3GA 4OBBA 2PZMA 2ZCVA 4FYWA 1G5FA 2VDWB 3JQAD 3LBNA 3U60B 3Q9LA 3FB1A 1Q1ZA 2EEZA 5FPPA 1JGTA 2PQ2A 2Z08A 4UD2A 3I2JA 1SVKA 2H9AA 3N86A 1YQXA 3R7FA 2XUAA 3KVVA 1D2HA 4HB2A 4TSFA 2NZXA 2X0NA 3U4DA 1UC9A 1EWKA 3VAZA 4ZYXA 3TL2A 1LW6E 3JQCA 2JFOA 2OV2A 4MGKR 5BV2P 2IBSA 3FMPB 4M9RA 2DY0A 5BR1A 2WDPA 4NJMA 1AHIA 1C0LA 3EYWA 3GG2A 3IB6A 3PRJA 4A8PA 2RAVA 2VI5A 3EEIA 5DK4A 1DRJA 1PF7E 1QC5B 2DBRA 3DE7X 3ETEA 4G09A 4MS3B 3O92A 3TOZA 3RREA 2Q6KA 3B8EA 1ZR2A 3B1ZA 4U5XA 5KYWB 1U7HA 3FIJA 2WE8A 4AY2A 2C20A 1CEEA 2OO3A 1FRQA 1QS0A 4IFIA 1MOQA 4LI3X 5DYGA 2HMSA 5AKEA 4B6EA 2INGX 1TTTA 2EZTA 5BY2A 3RRFA 2X5NA 3WDKA 1DHTA 3UXHA 4D0GA 1LJUA 3DVSX 4PZDA 2Y2VA 2C57A 4I4CA 3RC2A 5JARA 2DKOA 1FW8A 2E82A 1AXGA 5JPCA 3U61B 4Q03A 4BKMA 3KPWA 3TFQA 3IMEA 4KXVA 2WZCA 3TLEA 1V1RB 3WL5A 5KWIA 1YR2A 3U80A 1D0IA 4A1OA 2VP2A 1KEKA 2PMBA 2WMNB 4PC3A 4EI7A 4HVLA 1D4ZA 3BGVA 3TLMA 2I7CA 3HRKA 3QWIA 3PPIA 3VTKA 2PX5A 2CZCA 3V1NA 1I2DA 3GEEA 3I42A 3AL2A 1NG9A 1T43A 4MLDA 1B4DA 3X3HA 3NR2A 1DEXA 2QPOA 4MEAA 4EO9A 4MIYA 5IC4A 2Q3BA 5CDFA 1NJ8A 2W6JA 3AUYA 2PGAA 3KAPA 4XVQA 5IP5A 3GJSA 5CVVA 2YWBA 1BMQA 1X7XA 3SDZA 1OXKB 3PHGA 1QO0A 4E94A 5C32A 2ZUEA 2Q0HA 4TXMA 2O8CA 3JQFA 1KI9A 4IGAA 4ISBA 4P4NA 3T4XA 3IMKA 3M83A 1I14A 2C77A 1L7QA 1UP7A 3TZLA 3NWJA 1YHZA 1YASA 2ZBFA 4L78A 5K4GA 1GG8A 1UAGA 2B83A 2DHQA 3ZDXB 1R12A 5F2KA 3EVAA 4B09A 3X2SA 3KB1A 1Y4SA 1P4JA 2CXOA 2NZYA 4JR0A 3WWPA 1NXTA 3CNLA 4CF6A 3KJGA 5DHFA 4RPKA 4JKOA 3K9GA 2OAGA 2X9LA 1JXOA 3PFFA 1IBLB 4G8JA 1Y1QA 2JHPA 1Y34E 4I1OA 2VP5A 1VSQA 5BN4B 2PE5A 4M76B 4WXMA 4H3SA 5A4KA 4KBFA 3OO0A 4C88A 3ZGZA 2QK4A 4LZJA 4EHFA 2E4YA 2NU7A 2QUKA 3ZCXA 1IQ0A 1K8ZB 4PO9A 2ZTLA 4C2AA 4E2WA 5A4MS 2W6PA 4ZVQA 2J3QA 2CZQA 3WJ7A 2Q99A 3JZDA 3FOBA 1KO7A 1U8XX 3WOVA 4DAOA 4ZYTA 2KLBA 4QBGB 4D56A 5ALWA 4PG8A 5FEMA 1I4EB 1PQYA 2BSXA 4ZEWA 3TK1A 4R2WA 3CLHA 4D41A 2UUBB 2MINA 4HFNA 4V0SA 4JI6B 2C5BA 3B12A 2FFBA 3RTGA 3OLZA 1VKNA 2YXBA 4G63A 1M34A 3PPYA 3RUDA 3TB4A 2NADA 4RTNA 2TYSB 3OO1A 8ABPA 1NXVA 1SEVA 3MYYA 2H11A 1ENZA 1ID8A 1S89A 1Y4ZA 4DLUA 1KAQA 4I4LA 1K2WA 3TM5A 4CQMD 4BMXA 3JVVA 4W4TA 4Y6OA 4YAJA 3BULA 3NBFA 2X1LA 3VR2A 1IATA 2Q8QA 3IC5A 4J0HA 3V97A 4DBLE 5C5IA 5IJWA 2IHNA 1MJGM 3OX1A 4IILA 5ALFA 1D1TA 1EP9A 1IY2A 2PVSA 1TT5A 2XRYA 4KAXA 3HKEA 5B2FA 3NIBA 1Z6GA 1R5OA 4IXDA 1RWOA 5JECA 2GKOA 1GCAA 2C8VA 1UF9A 4DM3A 4LE1A 4LXQA 3PGXA 4M46A 2G72A 4HV4A 1XNQB 4EQ6B 2O8BA 1KDZA 4P7BA 4LF6B 1O08A 2VJMA 1A5TA 1VPVA 2FN3A 3OLWA 4I8XA 2GJ4A 2J67A 2PMKA 4EBBA 3D4BA 9ABPA 5CB8A 1X7WA 2ODBA 2XRFA 3JSAA 1Y6RA 2NG1A 3SLRA 3B3QA 2WTXA 3O94A 4PQYA 2VP0A 1SCAA 4CM1A 5KWJA 3TXYA 1I24A 5HS4A 3FWZA 2VTKA 3BBLA 2WP0A 3M6XA 5DB4A 3I4FA 4ZEMA 2ZEJA 4RXMA 2ABWA 3R7WB 3TQOA 1P2DA 3U49A 3JD1A 3NNNA 4E5VA 2FV8A 3TVTA 1T5DX 2YJTD 4QWWA 1SCKA 1SVMA 4YR7A 3EK2A 1NF8A 1QNFA 4EHIA 4P4UA 3I6YA 4F21A 3DYVA 5AUPB 1I7QB 2E4WA 4XUDA 5LZ9A 3NBZC 4MUYA 4U7DA 3O83A 1IZYA 2QJWA 5AVXA 4OK5A 2H5LA 4X63A 3SXUB 3LW7A 1Z8HA 4G5QA 1R15A 1N5RA 3BIWA 1DQRA 4N7MA 5HQTA 1Y8QA 2NYUA 2IUYA 3A0RB 3RC9A 2AOUA 4U7GA 2W8ZA 3QOFA 2HEGA 2FI1A 1POWA 1OXXK 1F3OA 1J56A 4QELA 1K88A 3DDHA 1XTPA 4C0BA 3HYRA 3KDAA 4ILKA 4YJ3F 3I04A 4BQFA 4CU2A 1QTQA 3BZUA 1ZD4A 2EFCB 4I3FA 5KHAA 2GBGA 3ANTA 4G2NA 4BZWA 4EGQA 5AOVA 3I0ZA 1GFSA 2P2DA 3JY6A 4Q7KA 1Z4JA 3DAYA 1D2CA 6YASA 5CDYA 4HEHA 3ZHXA 2W2KA 1AS0A 3GPBA 5FXMA 1I8TA 3VGPA 4EO4A 3I6ZA 3WZ2A 5CDFE 5F78A 1JAZA 1JEEA 3E5NA 3RKRA 1GV1A 3IBGA 2HBZA 3LYHA 4DIKA 1TT7A 4G5GA 3HR7A 5A4JA 5GZ3A 1TTHA 5ALDA 3KQQA 1OZFA 4U2EA 4JI1B 1U6KA 1XEFA 2AUNA 2PWBA 3D4OA 2C92A 1NW4A 4WOJA 2A3RA 1OI2A 2RH8A 2EIXA 2ZSHA 4FYPA 4K6GA 3JWEA 3MXTA 5KQSA 1WA5A 3H9QA 4TS1A 1NLFA 1GPAA 4W82A 4EG7A 2IA5A 4UU8A 2O7QA 4FGUA 3NV7A 4Q1EA 4XIGS 3DMFA 4K28A 4YCAA 3ICPA 3NWEA 5DSTA 3IQXA 4LRWA 5EJ9A 1V8OA 5T8KA 4DZRA 4CTKA 1DJNA 3H0CA 4WX2B 1M2WA 2F00A 3PJRA 3U7EB 2VSOA 3C3KA 3E27A 4YCMA 5DRYA 3G5AA 1JLLA 1CR0A 4WK2B 2CD9A 3BL8A 5F3DA 1YHNA 5FPQA 4YRPA 1GG9A 2W6NA 2X23A 4HAXA 4OBWA 2F8TA 1EK2A 1MT0A 2MMGA 2ZUDA 4GVPA 3QSYA 1OV4A 5IZCC 4I9HA 1SVUA 3O4IA 2DFNA 2PMEA 1YR9A 5EA2A 2VK1A 3JWHA 4W9NA 1LZKA 1D07A 1JT9A 1MRSA 3BSSA 1ORHA 3AY7A 5BT9A 1W19A 3DBVO 4UATA 2XXAB 1YI8A 3OP4A 4WZBE 4E6EA 5JG7A 1TA0A 1V0JA 2YOFA 1EKXA 5EI5A 3H84A 3AI1A 3CRQA 2QQEA 4IGEA 4OQQA 2QVZX 3C3YA 1YZKA 4UBMA 1FMFA 3BAFA 1W0JA 1WQ1R 2ATIA 1NQXA 2ZT8A 3ESXA 4OXQA 1KJ8A 1MEJA 3PA8A 1TIPA 4NU6A 3MMZA 4WLVA 4HD8A 3D7KA 5LN1A 2BPOA 4EL5A 1NA5A 1EQAA 1U11A 2CL5A 5AJTA 5J4LA 2YFQA 3IMFA 3R4CA 5FOXA 2FWPA 3TBHA 1G8FA 4CIDA 2RHCA 1KOFA 5E8RA 3IT0A 3TTTA 3ROTA 1F0YA 1KI4A 3I0MA 3IAEA 4AZWA 2IF2A 2V7VA 4MQ4A 5HILA 4C0WA 2GZDA 2HFKA 2FMHA 3U4GA 3BQMB 5ALZA 1XA3A 2G88A 2BUBA 2E9SA 4W1RA 5H16A 2G5TA 4HDOB 3GRAA 1PGQA 4CG0A 4ND1A 3EXHC 4MR8A 1YS4A 1QRRA 3IPXA 1P0QA 2JHFA 3NYWA 1EEHA 2Q2VA 3RFUA 3BMNB 3G3EA 5JCJA 4WY5A 4QGSA 5BVGB 2JGRA 3FOCA 3FYCA 3JAKB 1QYVA 3EVGA 3LLCA 4Q4DA 1G1MA 5K0NA 1KMCA 2YWHA 2I91A 2XQFA 2W6ID 2WSSD 2ZR9A 4L9SA 3QKRB 1BKSB 5J2UA 4POAA 4Y98A 4KWHA 2GKGA 4GQAA 1N2HA 1BW9A 3CZPA 4IOKA 4W7SA 2ZZKA 4CRWB 2PZEA 3LHDA 3VH2A 1X2EA 4TLAA 5KSYA 1QHXA 4BNTA 3ABZA 3BMOB 3A6KA 3DV0A 3K4HA 4Q19A 4ADSG 3AUSA 1MRZA 1KO1A 2UUOA 2YINC 1NW9B 3ZCQA 1O1YA 2FR8A 4ZC8A 5A0VA 2Y3IA 5T4FA 4G0OA 2MSCB 4PPQA 3WKEA 2A67A 3T7KA 2I66A 3Q3JB 4GM4A 4HLUA 3JQAB 4HNTA 4DA7A 1Q1NA 4RK6A 4U39A 2X8JA 1M34B 2ORED 1Y8CA 4LDZA 3GN2A 4IDHA 3SSOA 3DKKA 5GZ6A 1HSOA 3IUNA 1E61A 4FBMA 4LDNA 2V1UA 1F7UA 4EB3A 5SICE 1GEGA 4HO1X 4A0HA 1SVIA 1AK2A 3UAWA 4A5SA 3OU6A 1VMAA 2WT4A 4GM1A 4DQ0A 4O08A 3EWNA 4PBTA 3N3AC 1CY1A 1LRLA 2DUWA 1AKRA 2YV4A 4OY3A 5CFMA 2DWPA 1NN1A 2B7CA 1I1OA 2RGNA 3CH4B 3HVUA 3IDOA 4LOLA 2MU1A 1VL2A 2C4MA 3FVVA 3FUVA 3O26A 1NLZA 5E1DA 1QKKA 1JE1A 5JMWA 3TS1A 2Q6VA 3CLSC 4K3UA 2AEFA 1Q0UA 3HFJA 5AVOA 5L6LB 4UFOA 2EJBA 1ZUNA 1PEYA 2BV3A 2JGDB 3K30A 1OYYA 3AHDA 2X0EA 4XGRA 4UVGA 1DQZA 1B8UA 1SZCA 1L9XA 4FK8A 4NH4A 1DADA 2ZWPA 1LH0A 3UUFA 1KSHA 1NT2A 3K9HA 5JV5A 3PQ5A 3VU8A 5IT0A 1CIPA 1SHKA 1T9GR 2XJ4A 4F3YA 4O8ZA 4ZI7F 3FUUA 3H9CA 1DDGA 3H05A 1NP3A 4KBYA 1C9MA 2GBLC 4TS4A 5KDOA 4PFSA 4PC7A 4D42A 2P27A 4R69A 2PFKA 1CCWA 1CUDA 1NJ1A 3DO6A 4ASUD 2II6A 2PZGA 1GZ4A 1LVGA 2GEVA 2DTEA 5E1OA 3ZDCA 4TYQA 1G4HA 1WVIA 3H7IA 4HDNB 4LJYA 2YH2A 4BTLA 5DNAA 4YRAA 1OWPA 2CUZA 1I7PA 2PH5A 2QUIA 3GPCA 3SQMA 4JL5A 1JYSA 4M0DA 3J81A 1T1GA 2ZIUB 3LRXA 4UREA 1VE1A 2BEWB 5KJ1A 2FZEA 2X58A 5DU2A 3TLJA 1NNUA 4IAOA 4MVJM 5E6RB 2H2GA 2XAUA 3GW8A 5ESXA 4ZAXA 1JDNA 1JR4A 1XTQA 2CLSA 3FPGA 1K8YB 3IYLW 1ZITA 3T4PA 1EFRD 1U98A 3A28A 4KQWA 4ZALA 4BB5A 4AXBA 5I8WA 1P2BA 4ENWA 1GP2A 4AZ3B 3M6WA 4PLPA 4DA4A 4D9MA 3OMWA 4NH0A 4RABA 4TV8A 3DYBA 3K0BA 1SK8A 2NUAB 3BGSA 4G1EB 1RSZA 3WQQA 1OI7A 2DFDA 3KHUA 3JD0A 4P3PA 1U7OA 3HA3A 1ZJ4A 4JOCA 1Y3AA 1W4BA 2VAWA 4E33A 3ZLVA 3RAGA 2VHVA 5DM4A 4AJ4A 1WOYA 2BDTA 4YUAA 2R00A 2DMRA 4CMEA 3CNQS 5ER6A 1P81A 1VSVA 2QTTA 2REOA 1EDBA 4G0YA 3WNDA 2X2EA 1HURA 4LKRA 4NG4A 4UVEA 1A2OA 1JHDA 2OT3B 3O21A 4JJIA 1YE5A 2RGBA 1A4IA 1P39A 4X3OA 3E82A 4OQFA 3W8RA 5EQJB 1JH8A 3O3OB 1WL8A 3G0BA 4TV9A 3DHWC 2IOHA 2X5OA 2DHCA 2MDTA 3AWIA 4Q4AA 1KDRA 2C1XA 1YMUA 2GF0A 2OCKA 5E3HA 2YN4A 4QG3A 2VXCA 5DP1A 3PCXA 3ZCVA 3ZG6A 2E89A 2VO1A 2XNDD 3F8WA 1D6JA 2QTGA 4WZAE 5LCXA 5AW6A 2HBQA 1O97C 1PIWA 1RE0A 4CFSA 4XVCA 4WZAB 5T6BA 1AGRA 2WJ6A 3QE2A 3EODA 4IHJB 2R2AA 2FRDC 3KOWA 1W2HA 4PX5A 3RK1A 3MLBA 4DE5A 4DM4A 3VH4A 3KTFA 1ZONA 3DQQA 3OE4A 2QHXA 1PUXA 2XD4A 1P0IA 2B7BA 4OHUA 5DTJA 1HLDA 4YRZA 1KWGA 3RVOA 2EZ4A 1SB8A 2RCYA 3KSDO 2HK6A 3UOGA 1XA0A 4CYMA 2DQ4A 1U65A 1KEWA 2L42A 2O2IA 3PBKA 1WW3A 2C2HA 4US0R 1QYIA 3DUFA 4MJ7A 4H31A 4QM6A 2IZZA 4L4SA 3DAHA 1LDNA 4GICA 4ESOA 1H1TA 4PEVA 1SUFA 3NHJA 3R6WA 2G4VA 1Z33A 2DHDA 2GLUA 2XUJA 2J6CA 1XEXA 2DUUA 4K6CA 4MVXA 3ZC3A 5HJEA 5TPZD 4K7JA 3IAM1 5CMLA 4EX7A 4UCXA 2Z98A 3QLJA 4KK3A 5J5VA 1XLTC 3CBQA 3MRVA 2QTMA 1TCBA 4FNOA 4BRZA 5K7SA 3A1DA 5K8CA 4JYZA 3Q2IA 2LCQA 4GBJA 3D6HA 1E6MA 4TKVB 1Z15A 3REQA 3IVGA 4YDRA 2A5GA 3LQYA 4HTFB 3BK1A 2Y71A 2NUPA 2W6IA 2WSSA 3LSYA 1ZD1A 3O8QB 2JANA 4FMCF 1F2TB 4B6FA 3N28A 1A9XA 1Y5MA 1K4MA 1QVAA 3NQ41 3BH0A 4LTDA 1U5CA 1TJ4A 1KSGA 2HNBA 3FSGA 4LF5B 2HPAA 1OH6A 2O2SA 3W06A 1AA9A 3FPKA 1VSUA 2D5AA 3H2SA 1HT1E 2ISSD 2J9RA 2CDNA 2DQZA 1C7EA 1C8LA 1IMOA 2Z9DA 3BSWA 4HDKA 5JEEA 1CF4A 2ID4A 2F9MA 2IY7A 4RZSA 2VT2A 1A2BA 1RLJA 5DOZA 5EAIA 3MAGA 2FKAA 4NV3A 4RK7A 3GFFA 2X76A 1M6WA 3UKDA 4QDOA 2ZU6A 1WV0A 2F17A 4A16A 3ZW8A 5F5NA 2PSEA 3U3JA 3UYKA 1JJ7A 4M8KA 2PL9A 1N5LA 3M3DA 5KKAA 1XEAA 5HJ5A 1TT5B 2GCOB 3W4IA 3PQ4A 1THMA 3DC7A 4X7PA 3TFWA 2SKEA 1J90A 3NBXX 3QFRA 4YP0A 1VECA 1I9GA 3OFSA 4Z2AA 1G8YA 2OMEA 3Q7EA 3PLNA 1RAAA 4KK4A 1EZ1A 3H6KA 4LWQA 4JLPA 3KR1A 4ZP1A 1M33A 1Y3BE 4QVKA 1DWOA 3V3KA 3CVJA 3ZIAD 2UAGA 4F6RB 2ZRCA 2RSLA 3MT8A 4Y2QA 4HJXA 4MWOA 3FYUC 4QZVA 5LWHA 1PJAA 3T3DA 4G5YA 2RGNC 1CRWG 4M98A 1D1PA 1MC4A 3T94A 3QF4B 3BRWA 3DUWA 3E1SA 5EQFA 1SXPA 2I03A 3DZBA 4HWRA 4O3FA 3GNTA 3QELB 2HJSA 3WP1B 3ON5A 3RAPR 5GJBA 4TKZA 3O4GA 4NCKA 3U4CA 2RGRA 4GMDA 4PXAA 4C9BA 5CYOA 1RM3A 2HLPA 2V58A 2B4KA 2FWMX 3QVSA 1ZY2A 3NOXA 2GZ3A 4FZJA 1THGA 5AH0A 4OM8A 5D1HA 1TK2A 2FW1A 2WNHA 3AF2A 3AZPA 4HH0A 4HLUC 4DVJA 5A9SB 3KKPA 1L7RA 5LBIA 2IVZA 3TIVA 1J0BA 2JZOA 3GI1A 3K8YA 4QJ5A 4RMHA 4QOJA 5CM9C 4ODIA 2X77A 1MOZA 3UWPA 4MRSA 1QP4A 1Z0FA 4IHQA 4UBOA 4Y3UA 2PPVA 1P4RA 2E6UX 1CETA 5CVEA 3ZCUA 1ARZA 3MVEA 4JYCA 5EXTA 2HCFA 1GPWB 3MINA 3AJ8A 3D2AA 3KQWA 3NBYC 3U3XA 1CX9B 2VQ6A 3EHDA 4RL6A 3I58A 4Z1OA 3KRTA 1LVHA 1Y63A 3GMDA 3GHHA 2XMCA 1A7AA 1IXYA 3ZE9A 1WM1A 4AAYA 1DVRA 3LUGA 2A1UA 3F1LA 1N34B 2AE1A 2DYKA 4RFLA 4F5ZA 1VBMA 3L0CA 4HUQB 3KKEA 1P60A 2MSEB 4AFNA 3MQ4A 1TZMA 3MJFA 4QTXA 1OB2A 1BMFA 3C8DA 2Y1OA 5IKOA 4YRRA 2Y4OA 5AKHA 1SOVA 2VJDA 2W0MA 4IOMA 4OP1A 5HQ3B 2NYVA 1CR2A 5JSKA 4QM7A 1UL1X 3LS2A 3D2CA 1XB2A 3NAMA 1JPJA 3TSAA 4DLSA 3B78A 1J99A 5AJUA 2CNKA 4OQ4A 3RUFA 2OCYC 3TEJA 1UOEA 4RMJA 1YRBA 2VUUA 2RBEA 3EA5A 5IXSA 4RTKA 2FW6A 1T4DA 2F3RA 1VL1A 2IU6A 1ETHA 1PK7A 4TV8B 4EOGA 1I94B 1USGA 1V1RA 1FEZA 4D99A 3RYCB 1Y82A 3B85A 4JK3A 4L4RA 5JASA 3WYEA 1GPKA 3M6VA 1U7DA 3O4JA 2AF4C 4KXXA 4QHTA 5HBRA 1F0NA 3JATA 4YAIA 3OICA 5A05A 2YCLA 1RWNA 1W4LA 4KRXA 3EGVA 3KNZA 2NO7A 4GH5A 1E8DA 1G0NA 3AGQA 3JPWA 4HBGA 4D3YA 4YRIA 1FFYA 2DKFA 2G9ZA 3RSQA 3M6MD 3LYLA 1PV4A 2AX3A 2R96A 4Y7CA 1TMGE 2HQRA 3EZ7A 2OA0A 4ZCTA 1IVNA 1R4MA 3EUWA 3AYXB 1WXEA 3IKJA 4LOHA 4Y1RA 4BS9A 3KQNA 1P2GA 1LZLA 1J1ZA 3K72B 1OD6A 5F2EA 3UFXA 3EASA 4Z9YA 2Z9CA 4IJVA 5JWOA 3JWGA 2G5CA 2I9KA 5JATA 5F5XA 3RWBA 3KU1A 4O0MA 4MWZA 3QIAA 1FLAA 1I6MA 3BSFA 1B7GO 3T1NA 1MX3A 2R87A 3ABIA 3RHZA 5C9ZA 3ZWYA 4BP9A 4ZQFA 3TRHA 3PFKA 2O2YA 4RZ3A 5C5EA 1VG0B 2O3SA 2ZM6B 1IY9A 3HEAA 3PGA1 4U02A 1E62A 1UBRS 2CVHA 2XOKA 3MUFA 2ZJFA 1KSFX 3C24A 4QD3A 2E55A 2EZ8A 2AZTA 3BIXA 3DDZX 5KWEA 1VLLA 3AHFA 4MS4B 5B55A 3L9WA 1XQXA 4LC9A 1V26A 1JDZA 4D9KA 1JJAA 4J0JA 2ANBA 1XMPA 3CPSA 3HG7A 1SUPA 1PLJA 5FAXA 4E2FA 1E6UA 2ZQ5A 1FDWA 3INGA 4QFBA 1LUAA 3NTUA 1RRGA 1LX7A 1NW3A 3E7XA 1TYEB 4DMLA 2ATXA 4ZIRB 3HM9A 4KR9A 1UPXA 1JIQA 5JQGF 3EPLA 1N2XA 3VFDA 1JBQA 1W4CA 2VJMB 2VBFA 3E2PA 3QE3A 4MW2A 5A4DA 2C9CA 3AG6A 2Z1DA 3KBOA 2ZRFA 4IGIA 4IO1A 3A6HA 2P4UA 4IDAA 2ZBUA 1AXRA 2PSHA 1DL5A 1NY5A 5E1MA 1KAHA 3N5KA 2X22A 4L9AA 4CV2A 4FFBB 3SJZA 3O3NB 1EZZA 4I36A 4R1OA 3RFFA 4NXMB 5LP6B 3OQHA 2B2NA 1DI0A 5B5SA 2Q3LA 2GZ1A 2BHTA 3W7AA 2IT1A 1U0LA 1TYDE 3OSUA 2QPLA 3I8SA 4H1WA 1BC5A 3A6ZA 5DZSA 3U16A 1SIWA 1RQ7A 2CUNA 3CVYA 2O4CA 3WBBA 5HYVA 1DTSA 4OMFG 4J2HA 2D5LA 2P40A 3C2QA 3E84A 5HIKA 4TL9A 1DRUA 3H1PA 1PQ4A 3QLVA 3DVAB 1GSIA 1Y7LA 2GPSA 4KE6A 3TSCA 4DANA 1A50B 2IF0A 3P2YA 4FHGA 3Q7PA 3DOEA 1D2EA 4ZAWA 421PA 4CHTA 1ADYA 1NVDA 3NHAA 2EFGA 2O6HA 3MRXA 3L6DA 2QMZA 4P93A 4PLYA 3WIOA 3UC9A 1HPLA 4C22A 4KITB 4PS0A 4K8RB 2ZIVB 4L2IB 3EYAA 1F5SA 1M8JA 2W6CX 3AW8A 2IX9A 3MWFA 5CW1A 3I9KA 2FN7A 3ILHA 2B82A 2ZATA 3QEKA 5FFFA 2C3MA 5LMUB 2ZW9A 2BW0A 1VMDA 1U0GA 1YAJA 1DZ3A 2B4QA 3CZ5A 3EIFA 4ND8B 1Q3TA 4NFSA 1CRQA 2WKWA 4QDKA 4G89A 1SBCA 4X1KB 1TZ2A 4IIUA 5IJ9B 1Q16A 3N2KB 5F1KA 3PWSA 3UPDA 3BJZA 1Q15A 4GYJA 2BSQA 5G0VA 1P73A 4TTVA 1JHRA 4AWBA 2GVNA 1LPPA 1YR3A 3EXEA 3HA2A 4KMOA 1RZVA 1NKTA 2W00A 1U6JA 4NBLA 2XITA 2E87A 3TRIA 5FPKA 3A4LA 1RD4A 1P9NA 1X8JA 2H00A 3DZHA 1MJFA 3SZLA 1SMKA 1R1DA 2CLCX 2GDJA 2H0RA 2IEYA 3LYUA 2A9OA 4RM2A 1Z13A 3RLFA 2EQ5A 4EFKA 5JAIA 3GRRA 2FMXA 4HQOA 4HDNA 4OQPA 1IU9A 2KLHA 4GMXA 2TSYB 1U6IA 8GPBA 2D1TA 1AUOA 1QHIA 2R48A 4JUAA 1L4NA 3UW1A 9LDBA 2ZYAA 1M0EA 4PZCA 1ZI6A 3I28A 4XWYA 4WV3A 1R8XA 1WIWA 1DOHA 1QDLB 2GDZA 3GXBA 3VZSA 3WQHA 4G0XA 3WGMA 3CG0A 4EPXA 1JEYB 4Q7JB 2NXWA 3PL1A 4G4JA 4XJVA 4BMDA 4DC1A 5C51B 4BN0A 3CZ9A 5TEWA 1VJTA 3IODA 3LZCA 1U5BA 2DRIA 3B53X 3QV1A 1KOGA 3PC6A 3ZWQA 4M7WA 2ZJ0A 6REQB 5EINA 3LT4A 4QICA 3IKLA 1Y8AA 3NBMA 5IX8A 1Q0ZA 4TSKA 5ECDA 3ZYCA 4U7PB 1RHMA 1X38A 1GCOA 3REGA 1RI3A 2CEKA 3FCEA 1UWKA 4BJHB 1H2ZA 5IF3A 5KS2A 4GPEA 2XJ9A 3OQPA 3QQ5A 1SUSA 3DHYA 4PYRA 2I3GA 1RC0A 2H2FA 4EJSC 2AE2A 4Q4LA 2W2KB 2P6NA 2Y2UA 4BGUA 1R64A 3M33A 4YCCA 3HR8A 2BFAA 3I4CA 1C3XA 4MGEA 4PW0A 1CB7A 4Q6WA 1O89A 821PA 4TWZA 2OTCA 4Q4JB 5DHTA 1S2OA 3W5HA 1ISRA 1VZ2A 5C18A 2Q8PA 2Q5OA 1T24A 4KV7A 2FN8A 1YZVA 4DDHA 4C5CA 4UBJA 1Z88A 1E3EA 3G68A 1HNWB 4DTIA 4UASA 1X7HA 2ICAA 4JI2B 1Q0TA 3BFVA 5I9TA 2DWQA 4GBGA 1GV0A 2YJ5A 1M0TA 1P1HA 1SO8A 4RZHA 5AM4A 2G36A 3BPSA 3RYTC 3C43A 3TNDA 5AK0A 1NKVA 1EXMA 2O3UA 3MWDA 5FOQA 3U44B 4IIXA 1YUBA 3H2HA 3A6LA 3PLRA 2OOSA 1BHO1 4Y67A 4W8HA 4FP9A 1HEYA 3VYTB 4D82A 1HQDA 2XGMA 4JB2A 1YVUA 3N87A 3CPJB 1NGSA 4IIEA 4IHKA 2FJUA 4HI0E 3GEIA 4QYIB 1X92A 2V9PA 4DV0B 4RTSA 1RJWA 2HRCA 3NHFA 1FU7A 3QBDA 2TMYA 3N2NA 4FMPA 4UAVA 4LFCB 4CN9A 4TKVA 2OHGA 1KXJA 1Q7GA 4CM5A 5AXAA 1ZRNA 1ZRSA 2G09A 2JCBA 3HU1A 3OIWA 2VHZA 3G59A 3A2NA 5ARCA 2GK3A 3WHIA 1XEWX 1CUBA 3QVJA 4C43A 3HXOA 2VJNA 4DV7B 3KJXA 5FBVB 4RLSA 1NBHA 2WNSA 4YRDA 2X1VA 3UPTA 2J7KA 4NV1A 3JQ8A 4QG7A 5AXCA 5LXTA 1HL7A 2IUEA 2WYIA 5GGYA 1ISJA 4CLXA 4WKNA 1JL3A 3DEAA 1FRZA 2D0OB 2V7PA 3NHUA 3V8RA 5EJIA 2J5KA 3LXUX 4G41A 3L0IB 1O6FA 4Y9UA 4KXUA 4BMSA 2CXPA 4KHZA 4BYGA 2VSXA 4NCXA 3QFFA 2D8MA 2QIPA 2Q3HA 3EG9A 2QUJA 1TW2A 5FQOA 4DEVA 2V7QD 2VXBA 4FZVA 2Q0QA 4R05A 3WK6A 4KR7A 4DSZA 3T3PB 5I5GA 3DP7A 4BQNA 4ATNA 1NL3A 3GK3A 5F23A 3PI7A 2ZB3A 3E3MA 4IH4A 4TVSA 1FS6A 4QBHA 4Q93A 2WHYA 5FWYB 4ZU6X 3RIHA 1QP0A 1PUIA 4XM2A 4BNGA 3FKSD 1P9LA 3JRWA 4H2DA 2PRIA 3RNOA 3TZCA 1HTTA 3O9MA 2CMDA 1JFSA 2X14A 1F4VA 3KQSA 3NRBA 2P90A 4TM8A 3GJ4A 1LPSA 3T7AA 4ARZA 4Q47A 5KZMB 1AT1A 4L6CA 4N4AA 2RCNA 4TV8F 4Q9IA 4X1YB 4EBFA 3A3KA 3AFMA 1X74A 3AEUB 1LF5A 3T1HB 3GA5A 1TRKA 3PQDA 4MHTA 3ZS9A 1XTTA 3TIFA 3T54A 2EXXA 4KXFB 1E3IA 4CDMA 4EZIA 2ZI4A 3KFVA 1JU9A 4KRFA 1GA6A 4EZBA 2VDPB 2C97A 1XA4A 4JSTA 1TZBA 1DEHA 1Q14A 2C1EA 3RWOA 2XXBA 4ITVA 3B1FA 4I1VA 4HAVA 2WG2A 1YKFA 6PFKA 1L7DA 2OK8A 2VNAA 3E15A 3O93A 4LF4B 3FOEC 3R76A 4EFLA 5AI6A 4UNRA 1DBVO 4ZYZA 1V2GA 2G9UA 3RFTA 1DKQA 5J5CA 5KMGB 2JG3A 2DQKA 2XCUA 2NQTA 3OAAD 2CK3A 2YV5A 3MTDA 1CZNA 1XQWA 4E13A 3IOCA 5K0GA 1ORDA 1RQLA 2BFPA 1KDOA 2FZKA 3QPUA 4KQHA 4BO0A 5CDTA 3AR2A 3ANSA 1OT5A 2G76A 4HDRA 3E58A 3N74A 2Z3VA 5HF9A 121PA 5CX1B 4QUEA 4YCSA 1MPTA 2PH1A 4DBLC 3CLUC 4JXZA 3I3SR 5LIRA 4RL4A 1DC6A 4G0VA 1PU2A 2VBCA 4OOFA 1D0SA 3EQ9A 2QTWB 4XYEA 4DPLA 2DCMA 3NVKI 2Y1CA 4EK9A 2X15A 4J07A 1GGMA 1E3DA 3WTCA 5CHEA 3PIDA 3A3NA 1QFZA 3P32A 1UZMA 2RBGA 2SKCA 1SVOA 2R68A 2RHOA 3FWNA 4FDTA 4JB8A 3HZZA 1E5XA 4QBKA 4C07A 1IEWA 4DBVO 4P4SA 1GR1A 1NXWA 2H3HA 2XBLA 3NKFA 2G1KA 4IKPA 4PGHA 5BRAA 4MEJA 1P4GA 4WESB 1VPLA 1R00A 3AU8A 1E1LA 1PJCA 1QQ6A 3EUEA 2HHAA 3LFHA 1JIIA 4QRIA 4ZTUB 2B0CA 2I2AA 1H8EA 3L84A 3C98A 1C1DA 1GY8A 1TAHA 2IODA 3LPCA 4OFWA 3ASUA 3AF0A 3TG8A 2IQ5A 3N0VA 2GTIA 2QTHA 4R2MA 1KXZA 4XZ3A 2B4YA 4OMUA 3V7WA 4C0JA 1YQQA 1JSRA 2IUFA 2PCJA 3JU3A 4HWPA 1SG9A 1D4FA 4LHVA 3DOFA 1WZCA 1EJ0A 1TFUA 2ZIWB 4YAUA 2DLCX 4F92B 3W2EA 5BT8A 5AJHA 1RPJA 4IIJF 5FB3A 4GLOA 5J2UF 4XLTA 3IA7A 3MT7A 3DA8A 2WG0A 4BO7A 1NJ5A 1QV7A 4EUNA 4OJTA 2EDAA 3KUKA 5IM5A 4EHAA 4KMMA 1CUXA 2PLAA 3BILA 5DBEX 5JSUA 1P91A 3UUGA 2XAAA 2ATEA 3K1JA 1M6HA 3OF3A 2KM1A 3HVKA 1T36A 2PJUA 1F1JA 4XW2A 3IPRA 1I7DA 1L5OA 4IQ0A 3ZS8A 4NMXB 5GVSA 1CNMA 4Q6BA 2FP3A 2FWBA 5ALIA 4EPTA 3OY7A 3L8YA 4RE6A 2ODWA 4KJZA 1E5QA 4XOIA 1GKIA 4ZAFA 1FYFA 3I30X 1J07A 3DB2A 3QHAA 1Y5IA 1XTSA 4I5GA 4AJHA 1TPZA 4CQLB 2OG1A 5K09A 2G82A 3V4ZA 1NVVR 4LN1A 4EB8A 4UNQA 1LI7A 2WLTA 3WV4A 1GLVA 2P9FA 1K8RA 1DTEA 5LBTA 3P1JA 4XD7A 4CQJA 4U5QA 3LY5A 4J0FA 4LAFA 2ZUFA 5TMPA 2P65A 3EDYA 2L82A 1JFFB 2CFOA 4TVKA 1GQYA 1I7LA 5EPUA 4KG7A 4CG2A 2YN0A 3PTZA 4L0MA 3W5VA 4U9HS 3PGKA 4U0KA 4CV0A 3RYCA 4EDHA 4PZ9A 5ED0A 1Z12A 4Q00A 3R44A 5EHQA 1J20A 2GCPA 1ONOA 1XI2A 3F73A 4QYIA 2HF9A 4OJQA 3DF9A 1E58A 2ZJAA 1XL1A 2F59A 2AZXA 2AI1A 3FSRA 1E1QA 1PNTA 4LJLA 1FX0B 1FU8A 3OBBA 2QW1A 2VYVD 3D54D 3DMHA 4NOMA 1PX2A 4AXXA 4G1VA 3RVBA 3UMFA 1PZNA 3BD8A 5L6MB 1MV8A 1ZN9A 1HLPA 4TXLA 3S1LA 4REMA 3VC3A 5CB6A 2C82A 4BE4A 4B3SB 1A72A 1D7OA 4L73A 3FGOA 4BEBA 2BI8A 4HMPA 1ONPA 5FUYA 3LC1O 4HN9A 3OF2A 4P4LA 1MA3A 4Q21A 1NZDA 2H7XA 2X9VA 2CXTA 1QM5A 4GKBA 5FPYA 2IZ1A 3OQJA 4URUR 2Q9UA 1RJGA 3NIGB 4M4SA 2JIMA 1YS1X 3R3ZA 4ZU3A 3BWMA 2BD0A 1CQZA 3HKDB 1R6VA 2BE9A 5IDYA 4CKZA 1XVVA 3H4IA 2CXRA 1QE3A 4YI3A 5KKCA 2XCLA 3EAFA 1Z34A 5NLLA 3UOAB 4M9ZA 4CMAA 1SCIA 3I9OA 1DPFA 4BDTA 5BMVB 4NNOA 5A5FA 1EB9A 3SYMA 4X45A 3FLAA 1EK0A 4PZLA 1LF0A 4V0OA 3D8HA 3HV2A 4L72A 3T9DA 2NTJA 1Z0UA 1HRKA 2LDBA 4MWEA 4H17A 2KE5A 3VR0A 1BGVA 1QMPA 1M73E 3T7IA 2HWWA 3SX4A 4KDFA 3U3RA 1PHRA 4NY1A 1SPXA 3N6XA 3UAGA 3MTEA 4KXMA 2RK4A 4D9GA 1M0SA 1ZIDA 4ZHQA 1VC2A 3WGYA 3BDIA 3S1SA 3VZCA 4M0CA 2JGJA 3MGCA 3EZ2A 2PWPA 4LX8A 1CZKA 5I48A 2FE1A 3SQLA 2ZBGA 3HE3A 4JGIA 1MO2A 1JTEA 3BFXA 1NUSA 3VC1A 5JJCA 1RE1A 3JD2A 2A9PA 2YW9A 3FUTA 3H2ZA 4DARA 2JGMA 5HG0A 4EVRA 4CKCB 4LSMA 4EA9A 3LGAA 1KTVA 5LOVB 2AFRA 2PEZA 2WPDA 3R0XA 1PTJC 2J07A 2C3UA 1RJEA 2J9FB 4K9PA 3STTA 2DY1A 3THYB 3CTMA 3HH8A 1JF8A 1HT2E 4OU4A 3H5RA 4QFCA 3UMRA 4YV0A 3S1AA 4FXOA 4B6GA 2W58A 2OSBA 1G8PA 1VTKA 2IGTA 2CV0A 1ND6A 2I4TA 1MH1A 3FD8A 4RZIA 3ADDA 4M22A 1BJRE 4XYBA 1RYFA 1GZUA 1BA2A 7ABPA 4NE7A 2HO4A 5WRFA 1BDIA 3L8HA 3D0RA 3JD3A 3BWCA 4YMHA 3V8NA 1YZHA 4F06A 4JC0A 4X1KA 5LQMA 2M2IA 5I4BA 1EVEA 4XB2A 1ST2A 1T5LA 1CVRA 5ALTA 2UXBB 2BHRA 1Z39A 4D4LA 1B23P 3L4EA 3OTGA 2B3DA 1CP3A 4UHCA 3SXJA 5CG1A 3KSRA 5IC6A 1SOAA 2OV3A 1P1KA 2M32A 3TJRA 2PT6A 4I7EA 3BGOS 3CNOA 3TZHA 4RQBA 1G7RA 5EIAA 3BE5A 3NV9A 4KKVA 3WWCA 1BSVA 2Z0MA 1T2CA 4MINA 3OFKA 1ZXXA 1NSYA 4RH1A 1Z2NX 4K88A 3D9QX 2OGTA 2X2OA 1RYNA 5DWVA 5SYAA 4H0FA 1I32A 2QMUA 3OA2A 2PANA 5KTPA 2IYYA 1SC9A 5IHPA 5IN4A 3VHXA 2B94A 1JVSA 4B6QA 4KB5A 3RVDA 3QU9A 3VPGA 4OB6A 2RJOA 2I2FA 2PKQO 1X1DA 4G23A 4P7KA 3BWEA 4RJLA 4JLJA 2RH9B 1F0KA 2BMVA 2AV6A 4RPHA 4N49A 4OB8A 3ZTWA 2Z57A 3AERA 4G9GA 3EC1A 3EVFA 5SV2A 2BC9A 1Z7YA 1Z5VA 1O96A 3P97A 2H2AA 1G6HA 1VE7A 2WBLC 3AJ9A 5EKUA 4NBUA 1PJ4A 4GU5A 4C4YA 5K99A 4E3WA 4FB4A 5BWLA 2BBOA 4XWWA 1Z8NA 2ARKA 3NG1A 4HNHA 4IFBA 3HB4X 4WVFA 5DPMA 4IRMA 4WK6A 3DXFA 1UT6A 1HC7A 1JDVA 1XU4A 4FYVA 1J2YA 4ECAA 1EK6A 2Q46A 4DUZB 3EZXA 3Q7TA 2W2MA 5BWBA 3SR4A 4AZSA 5U9CA 1SUIA 2YYAA 4KFCA 3STUA 2WWVD 2G0NA 2DUMA 4RHFA 3JSXA 2NO5A 4LJRA 2RJNA 2X8WA 4NMMA 5K8TA 2B6NA 3MOSA 3RLIA 5ETJA 1QF9A 2MHCA 4BIMA 2ZSFA 2F7SA 4NJEB 3QYJA 3QYFA 4TWBA 2AR0A 5CEJA 3I09A 4S1PA 4BFXA 3JQ9A 4H1HA 3U17A 1NVUQ 4HQLA 2H6EA 2EG9A 2OHXA 1XT6A 3MWEA 1ZRHA 2MR5A 2BGIA 2OCLA 3D3JA 3UUEA 4K2HA 3PXUA 2JD1A 4ARSA 4BWYA 5JJLA 3DDWA 1LNSA 2B2XA 1ANKA 3ERCA 3ZLUA 1V8DA 4B40A 1XF9A 1AKUA 1RABA 2R6GA 2QRNA 3I2HA 1H1LA 4TVOA 4WNIA 4GP9A 2ASVA 3VMMA 5FI1B 4Q12A 1DRVA 4XSGA 4FOTA 2Z56A 3N2LA 2FP4B 3I8XA 1T0JB 3VM6A 1ZSVA 3VDRA 2Z5FA 1YE3A 3X0DA 3G79A 4EPVA 2LIVA 1GG2A 1HE3A 3DLIA 4YXWD 3G5MA 1S01A 3H9EO 3BWBA 2HBYA 4BMCA 2W6ZA 4B0PA 4E22A 1CUEA 2EDCA 4D9JA 3JQ8B 5AVZA 2YXLA 1MO3A 1Q44A 1Y7PA 4GECA 2WU1A 4V39A 2O06A 1Z4NA 3NCHA 1SOMA 3T9FA 2ZM5A 1G7SA 3ZY5A 5DM70 4NOKA 4MR7B 3ZOZA 1EUCB 5EJ4A 3T52A 1I9CA 1QGAA 1E7SA 4ND2A 3DO5A 3HTXA 1S8OA 1FX0A 3JR3A 4Z4HA 3OFJA 2Y67A 4ZK2A 1WMAA 1SG6A 1FFCA 2LVBA 1IDN1 2QUBA 3E5RA 3QPVA 1F9AA 2Q0XA 4NDZA 1FK8A 1EIWA 4CFZA 1VCHA 1WB4A 3VU9B 5C1DA 2NSDA 4LXTA 1XLTA 1ZRMA 4RW0A 3K0EA 4OCZA 1YS9A 1ILEA 2PFGA 3HGMA 4MR9B 1LK5A 4QJ4A 4ZT6A 4HN2A 4LHYA 2P30A 2WSBA 3V1TC 3ROXA 4CU5A 2WYVA 4BBJA 2Y99A 3G2HA 5K5EA 3GT3A 1CUZA 1KMNA 4G5XA 4GXRA 5CLGA 2GYYA 4LWZA 5GJCA 2XNCA 1C2YA 3VU3A 2BP7B 1PK9A 3HN6A 4MCIA 2V9CA 3U4AA 2NO4A 3I04M 3PS9A 4CTMA 4F71A 3K9FC 3CZCA 3FMOB 3MTAA 3G13A 1M6VA 2HV8A 2XLCA 5SZIA 1GNVA 4JJ8A 4DDVA 1L1RA 1QFMA 2YZNA 4I6JA 3TGWA 1NR1A 4XGQA 1QHEA 4BAGA 2C9BA 1PJRA 1UBOS 4KSBA 4PIPA 3TOSA 1CFZA 1US8A 4DJAA 3PGLA 1IRXA 3KLBA 5EYPB 4F5EA 4Q3EA 4AJNA 4GYWA 2BSAA 4WBNB 1SQ5A 2UU9B 4KNWA 2VPXA 1MC5A 4NULA 5K2MA 1DAKA 4LV5B 4QUIA 3T5MA 4UHHA 1S3GA 3WLKX 4BKOA 2I8LA 1V37A 5E7MA 4H18A 3DL0A 1KK3A 1U0HC 4DJFC 5L95A 3VKVA 3K09A 1P0PA 1VA4A 3MBOA 4QBFA 1HA3A 2V6JA 3S2IA 1MB9A 1AGYA 1BEUB 4G5OA 2Y0EA 1TTPB 2G1PA 1YZFA 3L18A 2IJGX 5CJJA 4LGMA 3VX4A 5C80A 1SC6A 4KIFA 1GNQA 1RZRA 4UARA 4AKEA 3GDOA 2H7VA 2ZSAA 5I9NA 4P4SB 4OHWA 4PYQA 3Q8LA 3PHLA 5CM8B 4XFDA 1EGHA 1OXBB 2XQGA 4JJAA 1J22A 3WR5A 1H3NA 1Y1TA 4J0CA 3AFHA 4FT2A 3EIQA 2GXUA 1G2IA 1J00A 3OCZA 1N1EA 2N75A 2P2LA 5JUWA 2ZDGA 3L07A 2GD1O 2AMYA 4G6ZA 5CYPA 2PX6A 3MRTA 5HCIA 2P4HX 1VCNA 4EATA 4DR1B 3K8QA 4GEGA 3EJWA 1OPRA 3LF1A 4JN6B 1FA9A 4NLLA 4RACA 2AG5A 4ZDKA 3CX6A 3JZAA 4MLCA 2ROQA 5IVIA 2HL6A 3WYAA 3EGWA 3PDUA 2CHEA 2XOEA 5DISB 3LC2O 3ESCA 2CVZA 2F1RA 2NO6A 3DC2A 1G9SA 3O5AA 4JQZA 4RCYA 5FV7A 5TXGA 3GGPA 3DOJA 1MKYA 4JLWA 4Z0NA 2IZ7A 5HA5A 2V7XA 4PLVA 4RV4A 3CXUA 4DNOA 3F3MA 4KDCA 4B8WA 3DFFA 3P19A 3QK7A 4A6PA 4GDFA 3A14A 4J8PA 1T5SA 5FH9A 3IJRA 3HJUA 4AJPA 5HCNA 2VF5X 1C7QA 5KPDA 3OD5A 2ZAIA 2YZKA 3P9SA 1OLUB 1MJNA 1GQQA 4RBNA 2O0LA 4QQNA 5TQ2A 4EYOA 2C7BA 3MCWA 3HHPA 3UVEA 4TKUA 2X6TA 1JWBB 4HGOA 3CZ4A 4IZHA 4AUNA 4DKJA 1JI0A 1W35A 1JAYA 3NBQA 4O0LA 1T3SA 4YN3A 1X8XA 3L7KA 3KQVA 1JMVA 2WAAA 3UUWA 3K09C 4C6HA 4FNMA 1JR3D 1REQB 4D2IA 3PB3A 3GJ0A 2QLBA 3WQRA 1QK4A 3HYCA 3E18A 3VR2D 2IBMA 2MSKA 3Q40A 5K0TA 2GBCA 2I55A 4FR0A 3TRKA 4AY6A 1FW6A 2B9EA 2BJVA 2WUWE 1E9AA 2QSZA 4PO3X 2W2NA 1M1NA 5LA6F 1LW7A 4ENTA 3K0SA 3K32A 3TX2A 3LTNC 2D1RA 3CLRC 3QXJA 1JBEA 4L8FA 1VIDA 2VYNA 5HUHA 3PRKE 4R2LA 1YIAA 1AUVA 3QBEA 3HVIA 3FNIA 1GXSB 3TEMA 2Z3WA 3LC0A 4GGPA 4QPCA 2QT9A 2I2XB 2Q1YA 4K81B 4OL9A 1CULC 3B70A 1R8YA 5CT6A 1Q2XA 1FJ2A 1J8MF 1Z6TA 2Z4TA 5F52A 2FMFA 2ISQA 1H3FA 2XGOA 4MQ5A 1UKEA 4DLBA 2A14A 3HRIA 3ORQA 2DECA 3N8HA 5JD5A 3FMVA 4TMTA 2QXYA 4UBKA 4CBVA 3M70A 4NRDA 3HKDA 1E7MA 1XZEA 3EZFA 3SYLA 2WUDA 1R6BX 5HKKA 1I0LA 5LYJF 3GAAA 1JHUA 2QYOA 2ZYRA 3DE1X 3R24A 4UFNA 3ZE6A 3ZWKA 1PNOA 3ZUPA 1P77A 1U31A 1ZC4A 3Q3GE 4I46A 3UJDA 1EXVA 1PD1A 1ZQ9A 4D9HA 1FYDA 1H9BA 1RW4A 3STXA 1ZGBA 3QVTA 1TXGA 4IEIA 4C05A 1O0SA 1IN4A 1QB7A 3D3WA 3JASA 4HHEA 5HUJA 2VK8A 4P4TA 4RO0A 1WF3A 3HWX1 4P36A 4RCZA 1CUGA 1KTIA 1CJUC 1WQ3A 1T2AA 2H85A 1GNPA 3NETA 1A98A 1QO0D 3C3PA 4MQEA 1RJ9A 1XTBA 2HDWA 2EX1A 2JD0A 4MV6A 1SBQA 3T9EA 2JIZA 4TSRA 2E3JA 1THZA 4MO2A 5AHKA 4TT3D 5HFAA 3DFUA 4KPFC 1VL5A 1Z0AA 3LE8A 1XIVA 2PKCA 3ZDYB 4MR7A 3G5UA 4FZ3A 5FORA 4X6UA 4AK9A 4KR6A 3VR4A 5LUAA 4XFKA 1LRJA 4ZD6A 1TAQA 1ZMRA 1BKYA 3RM3A 1U9JA 5BW4A 3FCUB 5GGXA 2HHJA 2JFQA 2PZKA 1TAUA 5ECYA 1PGNA 2YWGA 4M2LA 3U6KA 2X0IA 3LLUA 1SRQA 2Q3DA 2WK1A 2GEJA 4Q9AA 3VTAA 1VXOA 3IP1A 3IT3A 2GXSA 4QUBA 4N0DA 5DM1A 2WIKA 4JWKA 5IYZF 1A2KC 5K0EA 3NPAA 4FN5A 4IIFA 2QYHA 2VEDA 2GF9A 5JSHA 1BS2A 2Q1XA 4KH1A 2BFBA 4H7KA 3ELWA 1A97A 2AZMA 2C4NA 1MJHA 4JBNA 1TVEA 4PAQA 3WRVA 3PA6A 4LXGA 2NNWB 2PPLA 4H4DA 3A58B 4ARUA 5ABPA 2DWUA 3ECAA 3SVTA 5T7BA 4BE9A 1KYTA 2C29D 3BMCA 1E79D 3AF5A 4TTPA 4RNDB 3B7GA 3V32A 5CTJA 2Q45A 4RGQA 4ESHA 5HTOA 3AY0A 5DYWA 1L5HB 1RACA 1CJKC 2BELA 3VR3A 5A1JA 4Z4FA 1JZQA 1YDWA 5G4KB 3D8UA 1QZZA 4J4BA 5E9QA 5AVRA 4LVUA 4F5DA 5EE1A 1X1BA 2C2GA 2B2CA 3A32A 5LWQA 4KBGA 1W52X 3FDZB 4MX8A 3NHRA 3BF8A 4M9QA 2QT0A 1ENYA 3NM5A 4ZQCB 1G4AE 1IN1A 1ZR4A 4UTRA 1C1HA 1LQUA 4R9SA 4G0PA 2BH2A 1EVYA 2JGDA 3RRNA 2EQBA 1YA6A 721PA 3OMXA 1Y8RA 4HG2A 3K0AA 4KIUA 3JR7A 4OFXA 1KP3A 3T15A 3LZDA 1XWFA 1OBHA 4EITA 1MAAA 3ZW7A 3U4MA 2SECE 4N82A 4DDUA 1PDVA 1C8VB 5DBFA 4O2BA 5IK2A 4L5CA 4DGQA 1ES9A 3Q2OA 1RWBA 1Q0LA 4K2AA 4LECA 4O2BF 1OBOA 2VRBA 3L0OA 5E4TA 4W5NA 3PNKA 5M34A 1L9KA 2VWHA 1BD3A 3X1ZA 3VBCA 2JEZA 1Z37A 1R6TA 5EZ5A 3KZMA 5H0IA 1Q83A 3LVBA 4P38A 3WP0A 1GKYA 5D7BA 1TF7A 4GOKA 3UT0A 4D0RA 4YJFB 3DLPX 3KTAA 1UMKA 4XIJA 4J3NA 1QGUA 4RSGA 3DEYX 1W36D 3IUYA 4EUSA 2PUFA 4G0WA 1NR5A 2O2HA 3JS5A 4M53A 1CDZA 4CMIB 4JS0A 3DS8A 2WI8A 4YIKA 1SJ9A 3BWXA 2POCA 3AOEA 2LGJA 2XODA 2HA4A 4QJBA 1WDWB 5TQVA 3RF7A 1JIUA 4DR6B 3FPEA 2VPYA 1CTQA 4TL8A 1I13A 2P6MA 3CLUD 4EA6A 5JYBA 3LU1A 2HJVA 3FROA 1I1NA 2O8DA 4PLTA 1EBBA 4V0KA 1TNDA 1E1KA 1SZPA 2RB5A 3KLPX 4J2OA 3ZGXA 1ZS9A 4DY6A 5B6JA 3LT0A 3QIVA 3DBRB 3QG1A 4F11A 5IARA 3URMA 2IZ5A 2VHWA 3D2BA 2I99A 3G1TA 3GVCA 4BX8A 4Z9AA 5E6SA 1PTJA 1EM8B 2G8NA 2OXRA 3DTYA 4HX9A 4PS1A 3VVMA 4DA0A 5K6AC 4RS3A 3KQHA 4RQUA 1E9VA 4ZOCA 4GX2A 3DV2A 1BEEA 5K01A 3NJ8A 1QH1A 4U2BA 5TGTA 1XQVA 2OPBA 2ZVJA 4O3MA 3TJMA 4JWTA 4QNNA 1CY4A 2R25B 1KI7A 2BN4A 4NJEA 4MI6A 1QIDA 4KLAA 1YZTA 2C99A 1IUKA 3DLAA 2PS1A 4J4HA 1N5KA 4QQRA 4R1UA 2R8ZA 2EJUA 1SELA 3W1WA 3ID6C 4XJSA 2RAUA 1UK6A 2PBFA 3EZ9A 3ZJTA 1UDXA 3NM6B 3QWAA 3IDAA 4ZN6A 3DFKA 5B6PA 5CFRA 5BVGA 4ILEA 1A7KA 1KSJA 4NSNA 5EQDA 3KJHA 4L3WA 1Q1BA 1ZBQA 2A5LA 1W1UA 1IL0A 3OIYA 3KEFA 2YOHA 3MJEA 4ZREA 5H82A 5CDHA 3QENA 5JSZA 3VR6H 1F2UA 1JXMA 2A5FA 3DZJA 2GBLA 4ZEOA 1JAIA 2VUHB 1L8XA 3ADOA 4KO3S 3RS7A 2PRKA 3C7AA 1JSLA 4Q1VA 3N1UA 5EXPA 5C34B 1YD7A 3U5ZB 1EWQA 4R68A 4KX3A 2G06A 2R7MA 3KUXA 4L76A 3LP6A 4R0MA 3U7RA 1LDYA 4C3OB 1YFLA 5IBRA 4PWYA 1DJOA 2OFPA 5LQDA 1AGPA 5JS6A 1UXIA 1OLXB 2JIQA 5BV8A 5IULC 1AM4D 1FL9A 1Q2UA 1Z4IA 2YOGA 4ZXPA 1ZLYA 4AN4A 5FF9A 3HZHA 3FUCA 3AL3A 2GHRA 3RS5A 5GTDA 5DMXA 4AQYB 5DE3A 4G4SP 1FRVA 4XPIB 3WLLA 3ZWAA 5EHXA 2JRLA 4LUCA 2HRRA 4HT3B 4L5YA 1QRAA 4PYLA 3TAXA 2PT9A 2QY6A 1O4WA 3NH9A 1AQYA 2WIAA 1NUAA 2PA0A 1Z8DA 2BCGY 4HY3A 4Q48A 5ALJA 1FLDA 4W5TA 4UM8B 1ICIA 3RVSA 1FFSA 2IS6A 3H6GA 2OHFA 3L6EA 3BL6A 2C9MA 2CDBA 1DRKA 1PWZA 4M1TA 1ZHHA 1E1DA 3AONB 1NXPA 4RHUA 1XQ1A 4L6AA 4DDTA 2DB3A 3IEVA 2RK6A 1HM5A 2GBPA 2JIRA 1X9GA 3AJEA 3PNBA 3O8OB 5BSHA 5F9HA 1E2QA 2G9NA 4R1MA 4K9NA 3IH5A 1N0IA 2OLJA 3PUVA 3PZRA 4HDMB 4AX8A 2N9UA 1O9GA 1EINA 1KA9H 2Y27A 2F43A 3M89A 4R40A 3JAMA 2IKSA 4LSZA 1OH8A 5EG5A 3AFNA 3CUVA 3NP9A 3BORA 5EE3A 4GGOA 2FR1A 5CJ2A 2L19A 4YS6A 1XDBA 2WTEA 4JFAA 3L6RA 4JJ4A 2HWUA 5BNTA 2N0SA 4CT5A 4IJQA 4DG5A 2P5TB 1L5NA 1L8AA 2Q4EA 3I5AA 3MPUA 4F4UA 3A7DA 5CB4F 5JHHB 2XYVA 1GRQA 3TSZA 1QE5A 5CIWA 2XTMA 3VYUB 5I9IA 1J5XA 1H23A 3LLMA 1SKBA 1E60A 3NRCA 4O4JA 2HLNA 5F76A 5CNMA 1DC7A 4QT4A 1FXWF 1VJRA 1E2DA 4E30A 2B99A 2B8NA 3G2MA 4CLRA 3T38A 3TOXA 2ERYA 3HI6A 5CJPA 1TF2A 5JW6A 2KMLA 5DKFA 2Z09A 1L5HA 2YS7A 4MEBA 1M6VB 2K5UA 4PQEA 3QJGA 4FOLA 3ZJ4A 3ESQA 4YMWA 2J3DA 1SIUA 2PH3A 3UN1A 4Y2PA 1OW3B 2FWRA 4LOAA 4KVGA 1TO6A 3CEAA 4RTQA 3E35A 2FZGA 1WCV1 5BXYA 2AL7A 3KQPA 3S2FA 1GL3A 2FPWA 1Q57A 1ZSNA 3SJ7A 1QIMA 4ALJA 2E1PA 3RJ9A 1Q0RA 2W2LA 2ZE5A 1QQ5A 2I78A 3A4IA 3AK4A 1ISPA 1N6IA 3I37X 2Y0PA 4WIAA 4I9FA 4LMBA 4X7BA 4XI9A 4WI1A 4LBWA 1JG4A 1EGAA 1U3FA 4ZI5A 2YJ4A 4HWSA 1XZ8A 5DVZA 3GD5A 1BYIA 1ZINA 1G6Q1 2JGLA 3TRFA 4ZO9A 2D4AA 1FFBA 1U8TA 4IRXA 1EVJA 1IXSB 3ORYA 4UNPA 3TW8A 4MVCA 2FLKA 1DEOA 1T9BA 4IVRA 3C6KA 1PL8A 1QF6A 2MSDB 4OFBA 1AKVA 3W6PA 1M1NB 4XARA 1A95A 1Q74A 3LX4A 3PC8A 2ZJ4A 4GYKA 4ID3A 4IIYA 4RJ2A 1B0AA 2DPHA 5IH7A 3AM1A 3NDBB 4MLPA 3UENA 4FHFA 5EWJB 4CM4B 1A04A 4F91B 1AZTA 5LQJA 2DSTA 4IIVA 4RY9A 4XLLA 5JSFA 1ZAKA 4URYR 5ANRB 4B7CA 3TI7A 2ZBVA 5GQSA 1TQ2A 3FBTA 1R8QA 3E81A 1CQXA 1NSTA 3SF8B 2J6BA 5IMBA 3KTAB 4JODA 4OV6B 5E4YA 3CE6A 1FTSA 2PUTA 1W36B 1VOTA 1A9RA 3C6YA 4M0LA 4PTZA 3VKUA 2QLNA 4IJ6A 1UBEA 2GH1A 2ZIZA 5CVJA 1D0VA 1NQOA 2JAWA 1ZEMA 2SBTA 3RVQA 2NN3C 1XZMA 4IMRA 2QPTA 1T4MA 4Y0NA 1Z4PX 3MJRA 1MABA 1W5FA 1KH3A 2BH9A 4ZJYA 2CW5A 2RIRA 4MKRA 4NMWA 5JC1A 5DNYB 1AUXA 2Z3ZA 1X7DA 5JRJA 3W7VA 4BZQA 3ZDBA 1H5QA 1TQ8A 3PRHA 1AH2A 2XCIA 1PQPA 2QAGC 2XVXA 2YW2A 1CKEA 1SUBA 3A9VA 3N3BC 4MWTA 3RUAA 1KNQA 2W8BB 5C1PA 3IT1A 1Z38A 2PSFA 1LU9A 4BKQA 4OJYA 1JJIA 4B31A 4GZ6A 1G17A 2BFWA 3F7OA 3K5HA 1N8NA 1F6WA 3GWZA 4KQIA 2WD8A 4YRBA 4H27A 1FRNA 3I2YX 4MUNA 4MVJA 3QYPA 4DC0A 2B69A 3MS4A 3U7FB 4ZKDA 2IYZA 2XYPA 3HY4A 4URFA 5EN4A 4BQSA 10MHA 3HC7A 1L5YA 1RXSA 2Z6UA 1AQIA 4JBWA 2AIRA 1OFTA 3ZY4A 1TZJA 4F56A 4RVSA 5DWDA 1IRIA 2VDUE 2YN2A 1II9A 4DLWA 4LRTB 2Z30A 3FHOA 1NG1A 3G0CA 3OE7A 5EMNA 4GSYA 3RANA 3OPXA 2PQ6A 1NF3A 2XCOA 3IBYA 3C3BA 3O73A 1F38A 1Q95A 2QPAA 3OZFA 1NVWQ 3CYFA 1QWOA 4GKAA 4MHSA 4PHFA 2YC4C 4EM6A 2H07A 4F3CA 2QRVA 4ZZ0A 5LM3A 4Z3OA 2ZETA 2B21A 4E5PA 1AY0A 1N25A 3FCCA 4HGPA 1MFZA 3P94A 4YI5A 4P0TA 1RADA 4H6WA 2AK2A 2FUG6 2HIMA 3ROKA 5HGXA 5IKMA 3LT1A 2IYNA 1QYCA 2GPJA 3NX4A 4FHCA 4BVJA 3FBWA 2C9OA 3E1GA 3MWJA 4JCOA 4QYSA 5AUQA 2BRUC 1XWWA 3T3HA 2OVFA 4EI2A 2FSVC 3AUJB 3G9QA 5FNVF 4EUHA 5J4VA 2I2CA 2F64A 2PYDA 3B89A 5I45A 2R1VA 4WGGA 2HT6A 2VRWA 2BI7A 4JA0A 1B16A 2BHNA 1IHYA 5J4HA 2A9KA 2I6XA 4I0WB 4TMXA 2WWHA 5EGSA 1KC1A 2J5XA 1RCTE 4D98A 2WF6A 2Y9MB 4NZ9A 4QXAA 4ZCQA 3K0HA 4C7XA 2VQEB 2J3EA 1WCXA 1JEJA 4NFLA 1LPMA 3A9UA 4GPAA 1N0HA 2EF0A 1W4AA 2JPDA 1JI3A 2CLFB 2AF3C 1AB6A 2PZLA 4IX9A 3YASA 2A3NA 2PRYA 3H1AA 1CS4C 1QGYA 3OECA 4GSLA 4AQDA 3ZEIA 4BXOB 3EQ2A 2CBZA 1BWPA 3LHIA 4IIJB 1LTHR 3HV0A 1K89A 1INLA 1X8KA 1M8KA 3INYA 4WFKA 4WCDA 5KJEA 3CE9A 4TTRA 1XTJA 1KFBB 2IOFK 1TYAE 5TPWB 4DHWA 4P5DA 4P82A 1CRLA 3L0YA 1RAGA 5K4HA 4XQCA 1GKUB 2EZ9A 4DJJA 1Y3FE 2BEWA 3GGCA 4FBGA 4AG5A 4JBYA 1VYUA 4RANA 3WOHA 4DCJA 4D4JA 2EYQA 3AILA 4QSMA 5LQKA 3VO8A 3RHTA 1FJHA 1MJ5A 4JJ7A 2P78A 3JVUA 3DSRA 5DYIA 2HZ7A 1R0WA 2H59A 1Y80A 3R3SA 2XZOA 2I2WA 1QPBA 4YRLA 2HQBA 5FCDA 5JXWA 1Z5WA 3WGOA 1J70A 2VUIB 2VATA 1KAOA 3IQIX 4N0MA 3WAKA 2B7LA 3FMIA 4MP6A 5AIBA 4LMPA 1DFHA 2ZULA 1IHPA 2UVPB 1KEEA 3RUIA 2AFHA 1KNXA 4UQLA 1PG2A 2B8JA 1GTVA 2NU6B 4LTMA 4RPCA 2XH8A 5KVQA 4UHEA 5HOEA 3KIPA 1RLMA 1YR7A 2CLDX 2ZR7A 4RS4A 4V03A 5AD1A 4Y6QA 1JA9A 4CMJA 2R1UA 1EWTA 1Y3HA 2H1IA 1OY1A 2QGFA 1I3LA 2Z8YM 3BMCB 3CNEA 3IV7A 5I7VA 2I34A 3PNQA 5TF0A 1SULA 1P1FA 3F6PA 3VSBA 3TNJA 2C4KA 1G1AA 1FNBA 3AUFA 3BQ9A 7ADHA 2AYZA 4MROA 1EFLA 3HGTA 4Z5XA 1Q22A 2JBAA 3DEJA 3BSYA 4QEZA 4Q3AA 3N59A 2H2DA 3G89A 3CEPB 3M9WA 3N76A 4EGFA 1NNLA 4DUGA 1V1JA 4HVCA 1YF3A 1KYQA 2WJGA 1CEXA 3VPHA 3X2EA 4FGWA 3H5VA 3KE8A 1Y7HA 1SBZA 1K63A 3FYUB 3NEPX 4MAFA 4Z8YA 1R50A 1P5HA 2V6GA 4PAWA 2QN2A 2X3YA 4Y18A 1MEEA 1P5RA 2IC5A 1Z63A 5KHLB 4KACA 1UP4A 5IKXA 4IXWA 3V4RA 3IEXA 4Z4GA 5E6UB 3TW8B 2VYQA 3WL4A 2I6GA 5EE5B 4OXRA 3RT7A 1TCAA 3KKMA 3SEQA 2OZKA 3F96A 3NEJA 4E1AA 2QJTA 2WM3A 2VTDA 3C5HA 1EUDB 3C4QA 4NZMA 2Y1FA 4P7JA 5T67A 1COZA 1OZGA 4EHNA 2IYSA 1GM5A 1KP9A 3E3NA 4GI5A 4ZA2A 1Y1LA 1QV6A 4UTPA 2FETA 3P52A 1QIFA 3U3ZA 4LYEA 4B75A 3BYZA 3K4QA 3HMQA 1SWVA 1T5TA 2DLDA 3GV0A 1DKLA 1RRPA 1M5UA 2J32A 3KDPA 3VO2A 1HWYA 1O57A 4M60A 2OY0A 2CV2A 1GTJ1 3D6NB 1YS7A 1GR0A 3COVA 3F6YA 1NBIA 1QQ7A 1QCYA 1XMXA 3DZGA 1QHSA 6GPBA 3FZQA 1PJSA 3KG2A 5HKKD 3IKVA 3UY4A 2D00A 3C3WA 4N47A 3FYSA 1Y8ZA 4TTAA 1W1IA 4GI7A 4CMGA 3HU3A 4M21A 5FD8A 4BLQA 4UHDA 4B81A 3G9TA 4O4HA 4DS3A 4GMKA 1KPIA