2P30A

Crystal structure of tthb049 from thermus thermophilus hb8
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
177
structure length
177
Chain Sequence
MELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQARRLKGALPSLPAFSSDLLRARRTAELAGFSPRLYPELREIHFGALEGALWETLDPRYKEALLRFQGFHPPGGESLSAFQERVFRFLEGLKAPAVLFTHGGVVRAVLRALGEDGLVPPGSAVAVDWPRRVLVRLAMDGEEATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Alpha-ribazole-5'-phosphate phosphatase
publication title Crystal structure of TTHB049 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
total genus 59
structure length 177
sequence length 177
ec nomenclature ec 3.1.3.73: Adenosylcobalamin/alpha-ribazole phosphatase.
pdb deposition date 2007-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 2p30A00
1SKBA 2OWDA 3IT3A 3F2IA 2EOAA 3MXOA 2A9JA 2ENUA 1QFXA 4JOCA 4ODIA 3IT1A 1DKQA 2GFIA 3MBKA 1H2EA 1E59A 1ND5A 1BIFA 1IHPA 2HIAA 3GP3A 3DB1A 1C7ZA 1XQ9A 3D4IA 3QPUA 3K4PA 2P79A 1V37A 2DWOA 5HR5A 1SK8A 1C81A 2ENWA 2PA0A 3O0TA 3E9DA 1UJBA 4E3WA 1FZTA 2A6PA 1YFKA 1RPAA 4D4MA 5HTKA 1V7QA 3LNTA 3D6AA 1DKPA 1K6MA 3ZHCA 2P6OA 1EBBA 1QHFA 3NTLA 4FDUA 4IJ5A 4AROA 4D4KA 1TIPA 2HPAA 1CVIA 3FDZA 5AJXA 1QWOA 3QPWA 5CU7A 2P77A 3D8HA 3EZNA 2YN2A 4IJ6A 1T8PA 1C80A 4QIHA 3FDZB 2AXNA 3GW8A 3C7TA 5PGMA 2F90A 4PGMA 2P78A 5AK0A 1DKMA 2IKQA 1DKNA 4ARSA 2EKZA 2YN0A 3BIFA 4PZAA 4HBZA 2OWEA 2BIFA 3FJYA 3LL4A 2DWPA 4EMBA 3KKKA 3K4QA 1BQ3A 2HHJA 4ARVA 1ND6A 4FDTA 3IT0A 2WU0A 4TSRA 1FBTA 2P2ZA 4D4JA 2H4XA 3R7AA 2H0QA 4GPZA 2RFLA 4ARUA 3IT2A 4EO9A 5CDHA 2P9ZA 4JODA 5CX4A 1BQ4A 5AJYA 1E58A 4GPIB 3PGMA 3DCYA 5AJWA 3EOZA 2P9YA 3F3KA 3OI7A 3NFYA 1DKOA 3E9CA 2P6MA 2I1VB 3LG2A 4MA4A 2WNIA 5AJZA 1RPTA 1H2FA 1DKLA 2EKBA 2P75A 4PZ9A 2H52A 3QPVA 1SKAA 1NT4A 1YJXA 2WNHA 3E9EA 2P30A 1SK9A 4D4LA 1RIIA 2H4ZA 2QNIA 3GP5A 3HJGA 2P9FA 4JOBA 1UJCA 5AJVB 2P2YA
chains in the Genus database with same CATH superfamily
1DUIA 2JLAA 3O8NA 4G1EB 4HNHA 1EUDA 3D6JA 3RW9A 5E4JA 1TRHA 4IIJF 3FSGD 4GLOA 2KX7A 4QUAA 3U26A 2XUGA 4YP5A 6CHYA 1G4UR 2PXHA 1PFQA 3B3GA 1T0PA 3UJ8A 1TGYA 5HZHA 2VHYA 3GCZA 5EWJB 4DCNA 2P2GA 4YA6A 4GI2A 3TIFA 1YAJA 4EVRA 5DNYB 1M8JA 2H9AA 2KLHA 3O84A 1O94A 1Q21A 1BX0A 1HPLA 2PKRA 5E0OA 1B0ZA 1JIKA 1ZJJA 3CLSC 5ALSA 3STXA 3TG2A 1JR3A 2H2FA 2NXWA 4C5BA 2HD4A 5TVGA 5KB3A 3D4IA 5HQTA 1WZCA 3PBKA 2WTNA 1JWLA 1A98A 5JPIA 3TMYA 1NG9A 2HF7A 2IHJA 5DHPA 2Q1TA 5KVQA 5KS2A 3AM1A 3GT4A 3KK0A 3R7BA 2PT9A 4ZKDA 1CF9A 1GGHA 2ZUBA 1WMSA 2X1LA 4E5VA 1KJWA 4D79A 1CZHA 1GD1O 4F3CA 2Z4SA 4PO8A 3TMAA 3FDJA 1VP9A 1EFLA 5AYVA 1IC6A 1BWRA 2C95A 5IM4A 1Q0QA 4OH7A 4JU9A 4GXTA 4OKNA 3RROA 1GFWA 2UUCB 3NHAA 2BUBA 2QJTA 3DVSX 1VFPA 3Q6NA 4URHA 4XM1A 2IE8A 3P9QA 3EAGA 3HKCB 1JIXA 3ESXA 3RFTA 1WZ2A 3AIMA 3H05A 1X2EA 4K46A 1JSRA 3DFIA 3FUWA 3JR3A 5GJVC 2HCTA 5H0IA 3GFFA 4B2YA 521PA 1A95A 5KZMB 3ZY2A 4M8IA 2Z1DA 4UVEA 3B70A 3UK6A 3ZNPA 2IYLD 1ZSVA 2IVZA 3I1FA 4HS9A 4PX9A 1OXSC 3JARB 4N5IX 1H0KA 1SXIA 5LXTB 1SHTX 3ZWXA 4LNUA 3JVVA 3P9NA 3L7AA 3R3YA 2WWIA 3FPBA 1M34B 5MDHA 1IEVA 1B23P 2B5OA 5AUOB 4XIIA 3UHFA 1Y5RA 5JS1A 2OP1A 2Y92A 1PUXA 3TRKA 1ND6A 3FH0A 2K5UA 1K5HA 3P2KA 4M86A 1W5BA 4PICA 4E2WA 1KU0A 1CK4A 2ZSAA 5FBRB 1B1CA 1R8XA 3GMTA 4GKAA 3NHPA 4OSEA 1WDLA 7MDHA 3E7XA 1I0IA 3CEAA 4YCBA 3PWSA 4ZT3A 2YOFA 3Q9NA 5KYUB 4MTLA 3JD4A 3K1TA 2ONCA 3VNSA 4RKRA 4KWTA 5EZ5A 4B8YA 2K4MA 3AEZA 3HEMA 2FMKA 1KEWA 2GAAA 2MYNA 2Y2VA 5IF3A 5EHNA 2J48A 3PCRB 4YCJA 4EMTA 1FYFA 4O5AA 1Q0SA 4KN8A 1NP6A 3L1VA 4MJ7A 4ZV7A 1QZUA 3MRTA 1AB5A 3TZBA 3SQWA 1Z18A 3PUYA 1F8FA 4F56A 5KBYA 2FPIA 1GPBA 2BMDA 2GD0A 2ZPTX 1P2SA 3IVAA 4AO7A 4YDQA 2RHTA 1AZTA 2FWMX 1A5ZA 1K4YA 1IHUA 1O8BA 1FK8A 2G17A 3OQPA 3KBBA 4CLOA 1IFXA 2QU8A 3SAJA 1QO7A 4Q39A 4ZJZA 1U81A 2J5XA 1T3HA 3IO5A 4IVPA 4NULA 4YGYA 1RIIA 4KHPB 3ZQ6A 1RYHA 3U0BA 5ERXA 4NYJR 2BW0A 4CHGA 1J8DA 4E51A 1WQ1R 1GTZA 2BI4A 1XZQA 3RTGA 1WXFA 4AIRA 2I4MA 2E55A 1JEAA 2TMDA 4DDKA 4MVJE 5K0BA 4XLZA 2OR3A 1K2VN 1P7PA 1U90A 3VKVA 1GKLA 3MD9A 4XM0A 3SC4A 3QX3A 3W0LB 2ZYDA 4RK4A 4IOJA 3LD9A 3ZCSA 3KPVA 2CFCA 3U7RA 3LTNC 7AT1A 4OHYA 3BRSA 1GN9A 1KI7A 5DKFA 4B2IA 2HIAA 3AVVA 3LT2A 4TN5A 4ZK2A 3FPKA 3VC1A 1QO0D 2CFOA 1TYAE 1R0SA 2NQ2C 4JGIA 1WUKS 4HR7A 1K3FA 4NBNA 2FX3A 5ICFA 2YQZA 2I1QA 3NVAA 4YMSA 5T4HA 3A2MA 3OLXA 1E64A 4QTZA 2RK3A 3H16A 2XWQA 3A6FA 5TLSA 1W34A 1LGYA 4HPWA 4F5WA 4UHKA 1E9SA 4IQ0A 5L7WA 3N5KA 4KLCA 4BNDA 4CKWB 2PTHA 3O8QA 5FUMA 1PDOA 2C4MA 3KT3A 1CUBA 3I92A 3QE4A 4GOOD 2WB4A 4CCWA 2GLUA 5JS2A 1T25A 4OJMX 2C97A 2QN6A 4ASUD 2EW2A 5AO9A 2C4TA 1OI2A 2H7YA 2EGGA 2ZJ5A 3PTAA 5K8UA 1U8XX 4QULA 1MO5A 2QUAA 5FA5A 1KZ4A 4N7RA 4I4IA 2VJOA 3UF0A 4B82A 2OXFA 2VQFB 3O31A 2I3GA 3DDOA 3F6PA 2HGZA 3GUYA 3E8XA 4A6DA 4DLNA 4DNXA 1QGYA 2EYUA 2ZSIA 3LP8A 5LLDA 3G5MA 2AFRA 1YVUA 3DYIA 3VR5H 1T9KA 3CX3A 3E4DA 1ML4A 2A5LA 2A88A 2DUMA 1PJQA 1FP1D 2DHCA 2Z3ZA 4GSKA 3FMFA 4MWDA 3WGGA 4P83A 1NAHA 1Z6PA 3HBFA 1L7EA 3P45A 4QYIB 3WYFA 5IJ0B 1YZGA 5DCLA 4PAWA 1KVRA 2I8CA 4KXYA 1DC3A 4Q9DA 1E96A 2IDKA 1SOAA 3KYBA 3LC2O 3PDIA 4JB8A 4DCMA 1KI6A 3U7GA 5B53A 2O8DB 2HIHA 4CYMA 4CQNA 3AKEA 4MW0A 5JTUA 3GFGA 2ZRCA 1GPMA 1O5TA 1X14A 2IYRA 4ATNA 3U1BA 3L8MA 4UU0A 5KKCA 3SM3A 1W2HA 1ODKA 2R6CA 7YASA 2ZJ3A 4U7HA 1A8IA 5F9FA 1N77A 1E4EA 3IERA 3ONEA 3KOYA 4OXNA 4BO2A 1N0UA 2ZB3A 4U2FA 5LP6C 4O2AB 3OZGA 1BU5A 1BFDA 1VP3A 3BQMB 3IEXA 3KO8A 1Z4NA 3QEKA 4PCVA 5EESA 4DMGA 4RW0A 2HWKA 2XNHA 1NI5A 2CBGA 2I87A 2R86A 3GQVA 3FBTA 3R5TA 1RWQA 3CX7A 2FOIA 3JRWA 5AP9A 1L7VC 3UNXA 3PENA 1KOLA 5TQ2B 3N1UA 1AUOA 1UBMS 4IJMA 1JR4A 4LX0A 1V5EA 2Q3FA 3FFTA 2DPYA 1M1YB 3IV9A 1YIOA 3OP1A 3R0JA 4HBGA 4X92A 1R50A 1BHQ1 4RKFA 1MENA 2VSOA 3L49A 1MCZA 1UOPA 2OP0A 3L9WA 2NYRA 2VPZA 1GL3A 1VE3A 2BM9A 4OJKA 1XQVA 3WE7A 4RM2A 1KAMA 3SFTA 2YXLA 5IAAA 3SSOA 2WQ7A 2PJDA 2PMWB 5KOHA 1BE1A 4EZBA 4NC9A 3S81A 2CHQA 3E3AA 1MJFA 4YUWA 2DHQA 1XHEA 2Q6TA 3HJNA 3CX8A 3DZKA 3KWLA 3NBFA 2CVFA 2HNKA 2XMSA 4I46A 4KTVE 2DT5A 2X0IA 4MNTA 4Y2VA 1RCTE 2NUAB 2ZATA 1JEDA 3BB3A 3M9WA 3VU8A 4AZVA 4IDOA 4ZI7A 3BE5A 3AJEA 4Z5XA 3BUSA 4HYTA 2FSVA 3F6SA 4GUAA 4XGQA 1OH5A 2Y2UA 4GGOA 4MIEA 2ZSBA 1QYRA 2VI5A 3GLVA 2QRKA 1V71A 2CLOB 4G5SA 3BGIA 4C1NA 4P38A 5AJTA 4BVJA 4BE4A 1KIMA 4HOYA 3TE7A 4ND6A 1GL7A 3TRFA 2H92A 1N1EA 2ZUCA 3LYLA 1V4VA 2VBFA 3K09A 2AN1A 3LH5A 5BQPA 1P60A 3FTDA 3OE7D 4K9RA 4OUKX 2JAHA 2C1EA 4HGZA 4P33A 2I29A 3BIOA 4Y1RB 2QN2A 4BQIA 4YAUA 1WCV1 3SN6A 3W5AA 5IJXA 1DBWA 2YHIA 2FUCA 4HN4B 4F92B 4WCVA 4KQGA 5A5EA 1WZNA 3UW3A 2YQ4A 2C96A 4WHMA 3OKCA 4GQAA 3HRKA 5IMBA 3EIXA 3HPQA 3VDXA 3WIBA 2G71A 4KO1S 4MULA 3TIIA 1BJKA 3SZGA 4ENWA 2AW3A 3KXLA 2GK6A 1DJQA 3BD7A 3N2NA 2DUJA 4MB2A 3EIHA 4ZCPA 4D5EA 2IBMA 3MAJA 3ZWOA 3RAJA 1W48A 5CFZA 1KEEB 5LVAA 1E2DA 5DGXA 4LW8A 4A2WA 1W7AA 3ZZUA 1GSAA 4M49A 4ESOA 3MQFA 2VBGA 1QC5A 4HDNA 4MWBA 4A2PA 4BB9A 2LIVA 4PNPA 4P93A 5ITVA 1RWMA 2QV0A 1UBLS 3L8EA 4B40A 3KWJA 2XHEA 4JJAA 3RIXA 4B6FA 2L18A 5ILOA 4C4YA 1MEOA 3R6GA 3PQ8A 2HJ9A 5LP1A 1IPHA 2HSJA 4LJKA 3IXQA 2JS7A 1P8AA 5F7ZA 3AY6A 2WSLA 4LRYA 4XUEA 3EG9B 1JHZA 5FUYA 4L0DA 4B6QA 4DCTA 2Q5QA 3UFBA 3QEMB 1GKYA 1XVIA 1QV6A 3IAM6 1YVPA 4F91B 4KQ9A 1VL1A 5JZMA 4HDCA 5ICEA 5KNCA 3ZTTA 1CQIB 3P52A 3Q0EA 1W5AA 4UVDA 4ZCMA 4DDUA 1K9VF 2GZMA 3TW4A 5A1JA 3QOWA 4J8PA 3RUAA 1E2PA 5AXBA 2H0QA 1T2EA 4CV1A 1JQAA 2C7VA 2Z8YM 3HBAA 3HN7A 2X8AA 4EA9A 2G6BA 4JBGA 2VTBA 3FLMA 1Y1LA 2FSIA 4R83A 4V0RA 2R5FA 4CLEA 4MAAA 5BR1A 2GSDA 1H0RA 4FB4A 2NP7A 4OGKA 4OLBA 3AG6A 4TTQA 2WJPA 3L0CA 2QN7A 4GECA 1I3KA 5AHXA 4LMPA 2O7VA 4GVPA 5TARA 4XUDA 5I7VA 1O94D 1SRRA 4DR5B 2J5BA 1Q7EA 1JR3D 1UC4B 3HVHA 3SHOA 2IF0A 1E6MA 2PH1A 2YJ6A 2VJYA 2GUGA 4XFDA 4A0HA 2NTVA 3C3WA 4P32A 1ZMBA 2CHVA 4WGFA 2NG1A 1MA0A 3EPRA 1IDOA 4WWHA 4DLRA 4ZJUA 3X1ZA 5EPOA 3L0IB 2OD9A 1P0FA 1RWBA 3FPJA 1THMA 4R8LA 5F2KA 3AETA 2G5GX 3QHQA 1UBFA 1LDEA 3V1MA 1QH8B 1Y7PA 4PQEA 1MAAA 5CFPA 3PF8A 3WIEA 4CM8A 4O5OA 4LK2A 3SXUA 1E3MA 2GEKA 4QU0A 3ETHA 4IOMA 3TAXA 3EZGA 4TLAA 3LY7A 4GYYA 4JHLA 2IIQA 4Z7JA 2QTVB 3HBNA 5HA5A 4R5MA 4P6VF 4DMLA 2V6BA 3D3NA 3THWA 2GCNA 4PSCA 3IUJA 3OPQA 3I2IA 3C4JA 1YKSA 2D13A 1KKMA 2JW5A 2ONKA 2XT0A 2Y4OA 3N5CA 4RGYA 5JVDB 1OYWA 3TI9A 2I2WA 2JD0A 4HXFB 1GZ4A 3FN4A 2RDMA 4WOPA 3ELBA 4ZVQA 3SNKA 4Q3DA 4DW8A 4FOOA 2VCHA 3C3YA 5B1DA 4Q5IA 4B7ZA 5JMOA 5JATA 1L4FA 2BMWA 5B6IA 5ETJA 1JA0A 1WZEA 2Q4BA 1FOEB 5JHGB 3KUXA 3TS1A 1E0JA 2O8BA 2F55A 4LHYA 4HXYA 4KGXA 3ZDYB 1JW9B 4DLAA 2NT3A 2X0EA 4P7KA 4YO7A 1PP4A 2WJ4A 3QSGA 4Q66C 3ETGA 4NU5A 5F5XA 2BGTA 5TXGA 4B34A 1E1CB 2AYYA 5LB2A 1PJBA 4OHOA 1IBCA 1U4SA 3C74A 3NPMA 3OF5A 4KTTE 4QTUB 2ZXUA 1GDTA 5F3WB 1JQEA 4ZAFA 2I76A 3RRJA 4WXPA 4CF4A 3MMSA 3Q85A 4U0JA 2VJAA 4FYXA 1G63A 4X1OA 1Z0ZA 3T7CA 3Q11A 3E61A 3C5CA 3DSRA 4CF5A 4XVUA 5KNDH 1D2RA 2AJ8A 2HX1A 4ADSG 3C87A 2ZRFA 2W8ZA 4W8OA 3EVDA 5DTJA 3EZFA 3TTSA 2YNMC 2RBEA 2P8SA 1MBZA 3BH6A 3ND6A 3WGLA 3H6HA 5KSYA 4DIMA 1F2TB 3RSZA 2BCEA 4Q37A 2ZSJA 1WDTA 1P7WA 2G4CA 2VNHA 3I23A 4KYIB 4UEOA 1T0HB 2DHEA 3DEZA 4UQOA 4LSZA 2BMFA 2HHJA 4ZU3A 2ZI9A 5FWDA 2A33A 1NZFA 5E95A 1S8OA 2WICA 2Y76A 2Z8XA 1YIDA 5FORA 1GY8A 3IT0A 4L6IA 1J07A 5I48A 5CD1A 2R6AA 1S3FA 5FUQA 3C6XA 4PYRA 2JAXA 3P2IA 1NW3A 2QYHA 2JIRA 5IJAA 1K7SN 1Z08A 3UW1A 4DM4A 1CR6A 4LGCA 1XEXB 5LYJA 5JXJA 3NNNA 3ESCA 4MQLA 4JI5B 1GAEO 3EIQA 3KPWA 1R0KA 1TJYA 1RXCA 2NU7A 4H1VA 5KQSA 4EFLA 3UHJA 4MKGA 2P6RA 2I66A 4G0OA 5BSVA 3QWAA 1XXHE 2NO5A 3BJRA 3LK6A 3UN1A 2JBAA 4XD7A 2JGIA 3VV3A 1THZA 1L5LA 2Y1FA 4GLFA 3NTVA 2QVZX 4ZOLB 4BO8A 1NMSA 2JARA 2A9PA 5JFGA 3STYA 1T36A 3B1YA 3G7NA 1Z2AA 1HC7A 4QUHA 4RSMA 2QEQA 3MS2A 4KXVA 3MOSA 5AIAA 3SEZA 3VTFA 4BKPA 1AKEA 1D9XA 4LYGA 4M4SA 3W04A 1GLNA 3EEBA 5LZ7A 5A03A 2XOEA 4GLLA 1SKUA 1YB6A 4P2BA 1RS0A 3WJ2A 4H60A 2WV7A 4DC9A 3UUWA 2I65A 1WA5A 1Z36A 3H8JA 4N54A 5I51A 1QGDA 1QQ5A 2Y68A 5SZIA 1JLKA 5LZ5A 1A7UA 3K0EA 3T1TA 5IWCA 1B73A 1OZ0A 2XE4A 4ZRNA 4BC1A 4D3ZA 1AH2A 2YN4A 2AQ8A 3I9NA 3NYRA 5EGNA 1QV7A 1MOQA 1X8JA 2ZUVA 1G8PA 4F2DA 2X8JA 1XCGB 1KYZA 1NTRA 2G0NA 3KXPA 1U7OA 2CLEB 4MRRA 1VE9A 1SD5A 4MVJH 4U5XA 3W5VA 4DFDA 3LX8A 1A7KA 1QHIA 2R65A 2VF4X 1ZW6A 5AW9A 3A3YA 3KQVA 1HQYE 1MFZA 1PS0A 4BX8A 4AZSA 3V46A 1TJ3A 2R87A 1PYDA 4N03A 3VM6A 3SC3A 3HYCA 1BEUB 2R48A 1BMTA 3W5HA 4PN3A 1H2XA 2QHXA 5DXJA 3HB1A 4ZHSA 1HM5A 3CF4G 3U37A 1ZEJA 5TJHA 2BSAA 1T0UA 2HFKA 4KIJA 2II6A 3X2EA 4MLDA 5LYYA 2IZ6A 2IBTA 2BKXA 4UM7A 1RM0A 2NQTA 3A9TA 3E5HA 4IJWA 1UWKA 4D9EA 3EZ9A 2NMVA 4WTOA 2D7CA 4YUXA 3ADKA 5BSTA 3IQHX 2JKZA 5JBIA 1ZD3A 1G55A 2MU1A 1UK8A 7ADHA 1P72A 2ASEA 4N7BA 2GEBA 4YCLA 1KZ6A 2VAPA 3HMKA 4J9UE 2ZIXB 3UK2A 3Q7IA 4BNWA 3F9CA 4BP8A 4P34A 4B9AA 2EXXA 3HZRA 5DHTA 4L02A 4TRRA 2OD7A 3FFAA 2PYZA 5IJZA 3IULA 1INLA 2HLDA 3ZGZA 5C1PA 4DNQA 1U5BA 2B92A 2WM3A 1P91A 3N2KA 4RTJA 1K63A 1P74A 5E6UA 1EIZA 1J56A 4Q82A 5BUSA 4H16A 1CETA 1YQXA 1JJBA 2O4CA 2BKEA 5FFMA 2HLHA 4NI5A 1ZAKA 3ZYCA 2QBYA 1T8UA 3WLFA 3KSZO 2O7SA 1ZCBA 1O0SA 2QPOA 1Z7GA 4P92A 2FK8A 5EZYB 3K4HA 2J0EA 3CKLA 3LYUA 3UB2A 3U5ZB 4CEJB 3S0JA 3ASZA 3BILA 2IVFA 4PGHA 3V8EA 1CQXA 1R8JA 2V7GA 2TSYB 3GOHA 4NEHB 3NDJA 3VMFA 3PYLA 4AAYA 1J4AA 1TYBE 3TAHA 3VKHA 4LNUB 1T9AA 1R15A 2RHDA 2CUKA 2A0UA 2OZKA 2YQ5A 3D5TA 5ELLA 4E2ZA 4AO6A 4LHWA 2R7NA 1KPGA 3AI7A 1VI5A 4U8GA 1WB6A 3IEUA 4LHSA 3C3KA 4R01A 1WQ3A 1KS9A 3HFSA 4MOWA 4UTNA 1M2VA 1Z74A 4R2IA 2FFBA 2YY7A 4OQ4A 4K9NA 5HJ7A 3GEHA 1QLHA 1FF9A 1G5HA 3GPCA 3TD2A 3O26A 2WZDA 4RV4A 5E7IA 1EWRA 1VCNA 4II3A 1PD0A 3LRTA 5REQA 4CRWB 3COYA 4MV7A 4WERA 3DE3X 1LDMA 3FGOA 2C61A 3O0DA 1SB8A 1ZHHA 2IPXA 2BGJA 2WNIA 2WVHA 2WT9A 3P94A 3I01A 4KMSA 2IYNA 3NFRA 1Z2CA 4Q00A 1QRAA 5JVDF 1TKRA 2WAOA 2W6PA 1NVGA 4B5LA 1DWQA 5ILGA 2PGIA 4WJZA 4WY2A 1Q11A 2AZMA 3C7CB 1IVSA 4ENQA 2FPIB 4FYHA 1K89A 1OAOC 3V8PA 3CRNA 4BQQA 1A04A 1XCBA 4EQ6A 4CLOB 3GPDG 5GM1A 5IDVA 1HDOA 5J5AA 1MVNA 3PHCA 1PWYE 1Z5NA 4JCOA 3K96A 4FYKA 4WDRA 4ND5A 3CHYA 1N3IA 1RFGE 3IAUA 3L5KA 3ZV3A 2ZU6A 4Z1OA 3GEIA 4HQKA 1AKTA 3OOJA 1ZITA 3EVTA 1SNYA 1BXZA 3E27A 1L5RA 1UIRA 5H9WA 3GDFA 1NT2A 2GQ0A 2YZ7A 4P86A 4CV2A 1ENOA 1KGSA 1Y5MA 4ZCSA 1EX6A 2YHUA 3QU2A 2VYVA 3BE6A 1LJLA 4PZLA 1C7RA 4BLOA 1TRKA 3ZIAA 5CCEA 1MJHA 1T29A 2QROA 4ID9A 1QDLB 5DULA 2WWRA 4PGFA 3BFJA 5C1IA 3RC1A 3WP0A 1XZIA 4WXRA 2W6CX 3OX1A 3WOVA 4P4UA 5IBCA 4B7CA 2JGNA 2WQZA 1XCJA 2YRXA 3AL2A 4FHFA 3DHEA 4GXRA 5HIIA 1OI7A 5IXJA 1DXHA 3OT4A 1E92A 2I4IA 6GPBA 3CRQA 4RANA 5EVCA 3EODA 3MT7A 1EP2B 5KWSA 4OIFA 4Z4QA 3L0PA 4GG1A 4IP0A 2ZG6A 4RVUA 5AVKA 1TIPA 3CZCA 5C32A 2DKNA 2QSZA 4BNDB 1FFSA 2JAUA 3BM5A 3KHKA 3O8QB 3Q8WA 1DBQA 1F5SA 1GSOA 1D3AA 3WK9A 2BL4A 4GR4A 2X5XA 3SJBA 4DV2B 2ZQ5A 1NY5A 3H2ZA 2H7XA 5DVZA 3VR2A 3UC9A 2VTVA 3AUFA 5DK6A 4NZPA 4QOEA 4O0MA 5BV7A 1JAZA 1NVUQ 1NASA 4EHKA 1QG6A 1KR5A 2HU7A 1PU2A 4ZC8A 3DCIA 1VLHA 4TV8B 5GPBA 4AG5A 4JI7B 2MSWA 5ECGC 3T9DA 3U17A 2CSUA 1X3LA 4X7MA 4ZOLF 4BRUA 5E8RA 4G4SO 1PGNA 1Q1GA 3IBYA 4ENVA 4QJ3A 1MRNA 1S3IA 2WFAA 2XVMA 3BIXA 2GAOA 3PEFA 2I2XB 5FPYA 3E82A 3N28A 5FPSA 3RLIA 4BO3A 4EKDA 4EI2A 6Q21A 1IPFA 1U02A 3E3LA 1YUNA 1A82A 1IRIA 4J94A 2R00A 3LWZA 1IN8A 2I7XA 3PDIB 1KI6B 1LLFA 1WNTA 1CJBA 4YLGA 4KR0A 1RRVA 4PYJA 2JD2A 3DEFA 4NZMA 1LUAA 4C2BA 4C0BA 2MMGA 2XYHA 3BTVA 1FLNA 3NHWA 1OYYA 3CH7A 5C8DA 3NALA 2JK0A 4ON9A 2HMYB 5JSHA 4MLCA 5CXXA 5IC4A 3WAGA 5BO5A 3JVDA 5JDIA 2P91A 3I64A 4F72A 1IRXA 1Z8NA 2H1VA 3OUZA 3UAOA 3MW8A 2EZ9A 2WD7A 4B4WA 2HCRA 1VECA 1NHGA 3LQQA 3E9CA 4YQEA 3F9RA 1SHUX 1VBKA 2BJVA 2O2GA 3TL6A 5LLTA 4EHJA 1R10A 1ZUNA 2QS9A 3TZCA 4MZDA 2OBFA 1SKAA 4W99A 3DL4A 2G40A 3LO5A 3Q98A 4O4LA 4P4NA 3LFTA 1ODJA 3P4XA 3LDUA 2BEJA 4OG2A 4GEGA 5EY5B 4BQOA 2GZ3A 2VEDA 3TNJA 5AVQA 5I9LA 1M6HA 1QQ6A 5EIEA 1TU4A 2D62A 1KRWA 2ZBRA 4HL6A 4KXNA 4AZTA 1PWEA 2W4QA 3K0AA 4KIGA 1E6CA 1LVGA 3EFBA 4YGXB 4EGAA 4YHBA 3C39A 1G6KA 2G3YA 1SWWA 1T9ZA 5HDQA 5HUQA 1XD2A 1H93A 5KOHB 2M32A 4KVAA 2Z2JA 3SBOA 5JS8A 2OAP1 4M1OA 2IU0A 1FVFA 1G8GA 1L9KA 1SQFA 1CVRA 1JQKA 2C0PA 3DH0A 3G5LA 3BMOA 1WULS 3OZXA 2XF2A 4Q7EA 4C5AA 3RYHA 3KYCA 4I9GA 2JJQA 2KWIA 3T54A 1CJMA 4F6RA 2G77B 3H13A 4RHXA 2XTMA 3PDCA 4ZI7B 3FTPA 5EJ4A 5T64A 2OYSA 1YQUA 3QUTA 3OHMA 2LZ0A 1N6PA 4YT2A 5JWOA 4HEA6 4B4KA 5ALKA 2RGGA 3LM8A 4OJYA 2HL6A 2IOYA 3QI7A 5C3MA 2AOUA 1H3NA 4G4IA 3SOZA 4CU2A 1QE0A 1T4MA 1D9ZA 3TLAA 3P2JA 3CUYA 4RU1A 1L4UA 2QRLA 3P27A 4R71A 5C1OA 4QPPA 2IHNA 4M0FA 4AWBA 2EG9A 5F78A 4YT5A 4CE6A 2MR5A 1LSJA 4IFIA 1L3IA 4C1BA 4MITA 3ZQ4A 4ZOBA 1KI1A 5BWNA 2IX9A 3VFDA 1AKWA 2YHIB 1Q0UA 3PXEA 1FFXA 4GLJA 1N9GA 4P1ZA 4G0UA 4BX0A 4ZJYA 4ZD6A 2YX1A 1RU3A 3BDVA 3KOUA 1NG1A 1SZCA 1ZH8A 3KXIA 3OEWA 4G4JA 4P3YA 4XEHA 2PY6A 1ADYA 1U98A 4FE3A 2KSQA 1DARA 4HJRA 3TFWA 3H2HA 1E2IA 5T7BA 4KE7A 4XD7D 3HJCA 9ATCA 5DN6A 1B8UA 4A16A 2IUFA 3B48A 3FWPA 1PL6A 2LIPA 3DLHA 4DR3B 1HURA 3JQDA 4HWOA 5AHRA 2GKOA 3HHEA 4HDNB 2I6GA 2VKTA 3FAKA 1NUTA 2JH3A 5CFQA 3HA7A 3OU2A 3ILYA 4LUCA 4PZEA 1VL0A 4ARVA 4Y6SA 4ETMA 4RD0A 3EUEA 4KDCA 5LQNA 5KJEA 5EA2A 3NIFB 3KQHA 4IS3A 4JJIA 1IUKA 4Y6QA 5EIAA 3VR0A 3FKSD 4UU1A 1WBBA 2BFCA 1J2TA 4JAVC 4E7OA 4YRDA 3BJEA 3D5QA 1DV1A 2E0IA 1JRLA 2W2MA 3B82A 4RFSA 3GELA 2VAVA 3WFJA 1B0PA 2AYZA 4TM7A 1Z47A 3B52X 4V39A 4EY4A 3HACA 5SZJA 2VC2B 4D3YA 3T61A 3S1AA 3EW7A 1JDZA 1XZEA 3AR7A 2AOTA 2XY4A 3HLTA 2QL9A 3MN1A 4AJ2A 4BVBA 1KK1A 4D1YA 1GCIA 4F4UA 3DDNA 2R5WA 3NX4A 1J06A 2XCOA 3PIIA 1FDWA 5ICSA 4F7DA 2VTBB 1WCWA 4NIMA 1QUEA 5EUMA 3HDTA 5I7UA 2OOKA 4MRPA 4CV0A 4QUGA 2DU8A 3IHKA 5AI0A 4C07A 4W5RA 4E5KA 2L82A 2WTAA 1J25A 1R88A 2SNIE 4EJ6A 4LHZA 3L8DA 4KN5A 2R96A 4FS8A 1G5QA 1II9A 2AZ4A 2QLBA 2VSFA 3ENZA 4HF7A 3T7IA 2HB6A 5BQFA 3LCVB 1WVMA 2BSXA 1FP4A 2FETA 3AUKA 2EFGA 3I9V6 1GQFA 3DAOA 1WY5A 2CFSA 4H7FA 2ZWMA 4J4HA 3A10A 1OREA 5A2QA 1HA3A 1J49A 3WK7A 5LM3A 2GRAA 4K9DA 1JJ7A 1JPUA 1X94A 3GROA 3VU9B 3AF2A 1WOYA 1ICIA 2HM7A 5D5HA 3TKLA 3GP8A 1RMQA 1KI9A 2QMUA 1Q16A 3CWCA 3EJ6A 3I9KA 3I9MA 3AETB 3JYLA 3KB6A 1U9CA 2QL5A 4YJKA 2FJ0A 3HCOA 3TQIA 3WWDA 2H2DA 2FF7A 2FA9A 2HLDD 3RSCA 4CM8B 2ST1A 4V38A 4LJ9A 1DBSA 2B3DA 2ATIA 2FHPA 2W43A 3QPCA 5EQTA 4F8JA 1E6EA 5KTKA 4IRXA 3SLKA 4LKOA 3I8SA 1YA8A 3D8TA 4QWWA 1XJ5A 1YRQA 3ZQJA 1BWPA 1FIUA 1KO8A 1L4MA 3THWB 4MV3A 1X7ZA 1A69A 4PTLA 1ZUD1 4HWTA 5BXYA 2FMHA 4Q1BA 1JEYA 3THXB 3NVMB 2C2GA 3DE4X 5HTOA 5JBQA 5JAQA 4HJXA 2I6QA 4IUBS 4ZU1X 4E1VA 1E4VA 4BLTA 4YQYA 4BB5A 4X5OA 4IXDA 3OEYA 4EJSC 5KYYB 1OAKA 1S3GA 5KJFA 2HFJA 2OGSA 2O8BB 4PZUA 1D8AA 3X44A 2RI6A 4EF5A 3EFHA 1W1WA 4OLJA 1W0KA 1ODSA 1T8PA 2HNBA 2VUTA 4FFMA 4FWBA 4FGUA 4LBZA 5EJMA 4HNVA 1CB7A 2ZJOA 3Q7TA 1P77A 2O54A 2BDEA 3GI1A 1USIA 3PQ6A 3R0QA 4J1QA 5EHIA 4CN9A 1W36D 2VA8A 4J6EA 3SE7A 5KJ1A 1X6VA 4UFPA 1LY1A 3ZDQA 1GITA 1MNQA 1Z5PA 3L4JA 3QTTA 5JNWA 5TGTA 3FHTA 3HCBA 5CVEA 4E70A 2D6FA 1VB5A 3LC0A 1EWQA 1QYVA 4E4TA 3M6XA 3HP7A 2RHCA 1T8WA 3A9WA 3HU2A 5G1NA 4C29A 5H3LA 2AIRA 5DGHA 2OO5A 1O95A 1T3LA 3DXZA 4GDFA 1QGUA 4B84A 3AL3A 4XQEA 3TQTA 5KDDA 4XCXA 1NC3A 1ZISA 5KVCA 5F12A 2ZJZA 3KCQA 2XUKA 3SJUA 1UFOA 4BB0A 1N5JA 1BD3A 1KDOA 3DYVA 1CZOA 2VEOA 3DTVA 4DSZA 4QKQA 4S2UA 3EVAA 1UMDA 3BVPA 4IS2A 5DM1A 1IXRC 4BMPB 5I8PA 5FFFA 4PIVA 3VA7A 1ZJ6A 1M1NA 1AUQA 4XWWA 1LTQA 1VCIA 4N39A 4YJDA 1B26A 5JS6A 5LYJB 4DV6B 1DLIA 2INGX 1FNMA 1SPXA 5A9RA 2ACEA 2NU7B 2ATCA 3QMVA 2X5KO 3JAMA 1TJNA 2HF8A 3CCFA 1ETHA 2Q0HA 3KVVA 4B6JA 1P18A 2Q1SA 1S7GA 3GEGA 4ZI7F 1Z82A 2JBAB 3ZIAD 1R00A 4BEWA 4PVDA 2PL3A 2QA5A 3BSYA 4O08A 4OMFG 4BFWA 1KY4A 2B7BA 1I2MA 2VPIA 2VZ0A 3OIVA 3EZYA 4M87A 5HOQA 5KTPA 3W5DA 4XPIA 1ECJA 1T36B 4M37A 4BFYA 2ZAYA 2R85A 4MSUA 3WAKA 1UJCA 4XIYA 1OPRA 1YQ9A 3M70A 1QFSA 1TQ4A 4GW3A 3MFYA 4Q18A 5FCDA 4EHLA 2CZCA 4WXHA 4DMHA 2GTHA 4JLWA 4WNYA 2O59A 1WHTA 1GR0A 3D7LA 1F9EA 1FNDA 2FU5C 1TMKA 1U65A 3HYRA 4FQ5A 2C8VA 3HB0A 3IQIX 1T10A 2ZRKA 1A7JA 2ZJ0A 2JIBA 5I8WA 3MBKA 2A0WA 1Z2OX 2QUKA 2F3SA 3IJEB 4EA7A 2X8JB 4JDUA 2PVPA 1L7DA 1UFRA 3DMFA 4X84A 1JHRA 3IDZA 1ZH6A 4C4XA 1ID8A 3VR2D 3DDHA 3FJOA 3JCZA 2PUCA 4JHXA 2A9KA 3FY4A 1NV8A 1XQ6A 1VLJA 3N2YA 3B8HA 2YZNA 2PEZA 2ZPAA 4BEVA 5A05A 4ZXFA 4KXFB 4LOJA 1VA5A 4BNMA 1KFCB 1SC4A 3QE9Y 4PO9A 2GK4A 2YZKA 1XNGA 4PR3A 1E1DA 2P9HA 1RPAA 5AVWA 4BVKA 4S1WA 3ZHOA 2CL0X 2WEKA 4U9UA 2B21A 4V0OA 3DFUA 4XWAA 4AROA 3QA3E 3SIPA 1OBFO 4J1SA 2OZPA 5K1ZA 2M2IA 4NCKA 5C1DA 1XX6A 4AYTA 2PLAA 3MINA 3LZDA 4AG6A 4CFSA 4HVAA 4WFIA 3TF5A 3MTBA 1DRJA 1NA5A 4FSXA 4IMIB 4UBLA 3UG6A 2V0CA 5DMXA 3EZLA 8ADHA 1E1RA 5TPWB 4K2AA 1KRHA 2ZIWB 2RCYA 4WBNB 5JZSA 2SKEA 4IQFA 1I10A 1YUBA 2JC3A 1WBJB 3OCCA 3QX8A 4F3KA 4FK8A 4JXXA 4M1WA 3BFKA 3F5DA 5B64A 4NBKA 4PO1A 1Z28A 4TUYA 1JHAA 2ZDHA 1JLRA 1E7MA 1U5BB 3DZIA 4ZARA 4D5GA 4EKIA 4LF8B 1L4EA 1VLVA 3KKLA 1EX7A 2NM0A 3G2KA 2H4YA 3LBIA 3DNFA 4HFNA 5E6UB 3ZDAA 1XU9A 3L0OA 3FHLA 1A9XA 2EVWX 1FUEA 4HDAA 3IQWA 4EBBA 2XE7A 3PEYA 5JAMA 4L3VA 4LPSA 4ZQIA 3NC1C 1JFRA 1QTRA 1XP8A 2W00A 2X3YA 6YASA 4HGQA 4R1LA 2IZ7A 1RI1A 1PVOA 3INNA 4RJLA 3EA5A 2H54A 4KB5A 4JEIA 4E31A 4OSOA 4KXLA 2XZOA 2MINB 5CDUA 1VXOA 4JGGA 4L28A 2C31A 4W6ZA 4FNAA 4AFNA 5K3FA 1AKNA 1WKVA 4N6GA 5CLIA 5DTIA 1G8AA 2VHXA 2QPTA 3MCUA 3MGBA 2BGUA 3HY6A 3REOA 1YHNA 2NQ8A 4BLWA 4A23A 5G0UA 1UXKA 5KQPA 3S7ZA 2PX2A 5MN4A 3N0XA 1M2VB 4WXMA 2I7VA 1GGNA 1WMAA 3EEIA 1E5DA 3E0XA 4QAJA 2BP7A 1T1IA 3SR4A 2YJGA 1OBVA 1UXIA 1VBNA 1DC7A 2JFVA 5K3DA 3ZOKA 1W36B 2C88A 1LPBB 5REQB 1NE2A 1RLJA 2ZIZA 3GLSA 3G7SA 1TOAA 2WAXA 3PHHA 3WL8A 2ZIFA 4WMLA 1TQDA 3UA4A 1GQQA 2OC4A 1BS2A 2BGLA 3HGTA 4HKTA 2Q27A 4K6KA 4R3WA 1SIWA 2OAEA 2VOJA 3FKJA 1CNEA 4L95C 4TLLB 4RBNA 3SNHA 2GFQA 2YICA 3ZDBA 3B1ZA 2C94A 2PD3A 3V7UA 3PSHA 1QV9A 5CNKA 4F1KA 5B7QA 2CUNA 2OFWA 3H5WA 1EQUA 2R1UA 4OFXA 1AHNA 1ECBA 1KQNA 2EIHA 4DZRA 4EQ6B 3KOWA 3KX2A 3HYTA 4I9FA 5EC8A 3HCEA 3DAHA 1CEXA 4F97A 1ZR4A 1U2RA 3JQ9A 8AT1A 4QFMA 1FP2A 2KBFA 3E7DA 3R3UA 3N8GA 4NE2A 4UBIA 2Z0MA 3T7RA 4RMNA 2GYYA 2GD2A 3CPHA 1XEAA 3DLPX 5LB4A 4DSAA 4ND3A 4MV0A 1NRWA 2G9ZA 1RSZA 5KHOC 2CNBA 3BMCA 4M98A 1ETUA 1SUBA 2X1VA 3PXUA 3E9QA 4MRNA 4DAEA 5DN6D 3WNZA 2WINI 3LY9A 3Q2IA 1SK8A 4MKFA 1J0AA 2C54A 2VZLA 3PPXA 2O0JA 3DE5X 3UCXA 1VZ3A 1NNEA 1NNLA 4TWRA 4ZO4A 3FNHA 3H5TA 2POQX 4GI5A 5KTTA 1R27A 4OQYA 5IT4A 1UPUA 3DB2A 3OA0A 4XASA 3KXKA 3K9GA 3LT5A 4D4HA 3O91A 1T8SA 2Z30A 2GT1A 1QZ3A 3COWA 1GUBA 4YDRA 4O33A 5DTQA 3RT7A 5KWVA 3OQHA 2CLFB 2CD7A 1XVVA 2ANCA 1A8HA 1HYQA 1M7HA 3DKIA 4UCWA 4CG2A 3Q7RA 2CMDA 4LF4B 3UXMA 2QAIA 1F9AA 4KR9A 5L3SA 1XAIA 4WZBA 3R77A 1JR2A 3ELDA 4MQEA 3SKVA 1S8FA 1Y82A 3B60A 5CLFA 1SQGA 5A5DA 5LYJF 2REOA 2J6HA 4LXGA 4F38A 3GLHA 3BIFA 2A84A 1VM6A 5A2GA 3JQAB 5L3QB 4JXKA 3A32A 3CVWA 2GK7A 3QG5A 4PONA 3OESA 3LU1A 3LW8A 3OMXA 4M8SA 3O73A 2HIGA 4KO2S 4IIBA 2B2NA 2FX5A 3KD2A 5GJWC 4IDAA 3EEQA 4EM6A 5KTOA 4V0MA 4BN5A 3VGPA 4A2CA 1QU2A 7ABPA 2FSFA 1C1XA 2NOAA 4L85A 5DCUA 1SQ6A 1IIRA 4LXUA 1U8UA 3CZRA 1CRWG 4RJIA 3AERA 1UC8A 1OQAA 4QL3A 1W96A 3UJ9A 3UJAA 2JFUA 5IJ9B 4OQLA 4WN9B 1WB4A 5DBGA 4FJ1A 1T9BA 4JI6B 2RHBA 4AKIA 2FH5B 5L9AA 4DS3A 1SEPA 2XRMA 3KEQA 1J9EA 5JD5A 2ODPA 1AK1A 3Q88A 1G5IA 1SVWA 2WT8A 3L6OO 3QUAA 3RVLA 3HUUA 1EZ1A 4IGEA 1FMLA 1ITZA 1V5IA 1UDRA 3B9RA 2D4HA 3ENKA 5L6MB 5D6OA 4IG9A 2A78A 1O0CA 2F1HA 1JHUA 3M6LA 1I4DD 1UWLA 1OKKA 2O1EA 1LK5A 1I3NA 3CG0A 2AGVA 4FFWA 3AGQA 2ZCUA 4YRAA 2CJXA 3EF1A 2GXAA 3TLCA 1KSHA 4D6XA 2NVWA 4KQMA 4CM5A 4H1HA 2RMKA 1LNQA 4YLYA 4Q9NA 1AKRA 2IQ5A 3R5KA 1ZUNB 4YX9A 4TT3A 1U3UA 3F78A 1NUAA 2CEKA 3P97A 4OLHA 3ZJUA 4O4LB 4TMTA 3SF0A 1GVHA 4IEFB 5IFLA 1GJRA 1U2ZA 5DLPA 2XOKA 5E1DA 1AVTA 1G8SA 1VJTA 1PL8A 1S6YA 1UBTS 2QT0A 4L8GA 4QYXA 1LZLA 3EQ2A 3K0AB 1W0KD 2H1CA 4G1BA 1EGQA 2VP5A 3QWHA 4QJ5A 1XLVA 5FNZA 5A6VA 2P4UA 3G5AA 1XA0A 5B36A 2FZGA 2G82A 4FW8A 3I6YA 1EFTA 1XD2B 3UMFA 1POXA 5A7GA 3LUBA 3ZHUA 4EUNA 1FW8A 1M76A 4Q9IA 4Q47A 2Q3HA 3SWWA 1E3TA 3BMOB 2A4MA 3PXDA 4BFTA 4ZDJA 3KYCB 2GN1A 3L6UA 4CVNA 4G0QA 3C1OA 3OZRA 3KSAC 1FDSA 4E6PA 3V7WA 4NZYA 1JQBA 1XTUA 3LF1A 2PQ2A 3BD6A 3C85A 1LX7A 3JASA 1D6NA 2EERA 3HGMA 1O95D 4I5GA 4X93A 4LWPA 1X9HA 4EELA 1JEEA 2AOUB 3C6MA 4EL0A 2YJTD 3TL2A 1PYGA 1TGVA 1QKKA 3NBAA 5LZ9A 2IHYA 3Q7QA 4YCAA 1TK9A 3ZNQA 2Q29A 4IQ4A 3N0TA 3SHTA 5JNVA 2DFNA 2H4WA 4OP2A 3C43A 3AXTA 3ITEA 4QTTB 1YBHA 4R2WA 5B58T 4Y2QA 2M98A 1FFXB 2Q0QA 1ZD5A 1OPXA 2YWEA 3A3PA 1N9GB 3CF6R 3DGEC 3QTLA 4MINA 4BTEA 3KZOA 1OHHA 1UKYA 2QL7A 4P54A 2WTEA 5IEBA 5PGMA 3T7SA 4BTLA 2V3VA 5EUBA 2AG1A 3QJ5A 3VDQA 4LI0A 2EQ5A 4I2VA 3KKEA 2FW0A 4TVBA 2Z5LA 3PHBE 1DKMA 3GGJA 2OY0A 3WYDA 1KVUA 2H1IA 1ZNYA 2VYCA 3C3AA 3PUWA 4YH1A 3COVA 5JDCC 3TUIC 5CDFE 1U28C 4LC0A 5JOQA 1L0BA 4NXNB 3TR5A 3QE3A 1I24A 3HXPA 1OI3A 5TS3A 2I6TA 5M3BA 1JXQA 3MM4A 2IH5A 3CMCO 1J5EB 1M54A 3AFOA 1Y6ZA 2G0AA 1X1EA 3O47A 4OMCA 3ZBTA 3GFPA 3U5TA 1FYEA 4C0QC 2W42A 4C20A 1PQ4A 1J5PA 3KOMA 2X40A 5CJPA 2BGRA 3HCCA 2HT1A 1XZHA 1R0YA 1RVV1 4N3AA 4YALA 2JCXA 5AJUA 5ALRA 5C34B 4QO8A 3G0BA 4XYBA 4ZQCB 3W6ZA 2ZYHA 3UUFA 1G20E 2JBHA 2BFCB 1MAHA 1E3SA 4XVQA 1NBME 4DIFA 1FFDA 3BF8A 2NSHA 5F7XA 3DXYA 1HSZA 3I1JA 2PMCA 5GQSA 4RPLA 1Q57A 1BE8A 1U8ZA 4KN9S 4RFSB 1GPNA 5F9MA 1VBMA 4LFAB 4PZ0A 2AXPA 3GDOA 3K6SA 4Q3EA 4RL4A 2QG6A 5A0FA 3UJHA 5CFMA 1FNBA 3RS3A 3S1AB 4MQ5A 5JAZA 2AOTB 3ZHSA 1Z73A 5F77A 1IEWA 4L4UA 3H2IA 1GQRA 4O8ZA 4O59O 3A4MA 4CM7A 3VUEA 5JROA 3ZLUA 2SCUA 4JOBA 2H9YA 2Y6UA 1GLVA 4M9SA 4MYRA 3WDSA 1OVMA 2Q3CA 4BDTA 4JT2A 2PGXA 4WXEA 2Q50A 2VAXA 3SX0A 4DXDA 3AUUA 1TCCA 2DTDA 1E7QA 2HJVA 4W7HA 4P5PA 2FW8A 4YMLA 4RTSA 4D44A 2B25A 1DTSA 1FP4B 2JZOA 3RABA 3H4TA 2GD6A 1CUSA 1T5BA 3DZ8A 3HCRA 3K5HA 4KGVA 4MO2A 3X43A 5FHQA 3M1AA 2XMZA 3HTXA 4OA8A 2H5JA 3AR9A 3PLRA 5CH8A 4UHEA 1FDOA 2BR4A 1JIQA 2X5OA 3LFUA 3T35A 2WZBA 1XZBA 3UBMA 2Z1NA 2ZUWA 5CFOA 2JCSA 4ZA2A 1KZ9A 3GZJA 3DWEX 4QGGA 3MUOA 4I5DA 4DCPA 1FRFS 4DNFA 4G26A 3ZE6A 4B33A 3D3JA 5B2EA 1QVVA 1QK4A 4Q19A 4PQGA 4WLNA 3SQMA 4AJHA 4CF7A 2F7SA 3H7IA 2DLCX 3VYUB 4FKZA 1T4GA 2EZ4A 3O0TA 4ARZA 1GCGA 3M33A 1AQIA 1VHJA 3OZCA 4PX2A 3WSVA 4G0MA 4RTLA 2XB4A 1YS6A 5F1OA 5T41A 1QVRA 2JGMA 3ZHYA 1FFYA 3CTMA 1ORRA 1VB3A 2XQVA 4NCHA 3IAAA 2BM8A 1M2OA 1NXSA 1GO2A 2LGJA 4RD4A 1W4LA 3AB8A 2W93A 3PUKA 4KE8A 4RFVA 4CIXA 5JPDA 3F0TA 5SY4A 5H80A 4C4TA 2J8ZA 2P9BA 1G5PA 3KVRA 3P7MA 4F84A 4TVSA 1YOVB 2M6LA 5BQOA 5CLHA 4I4CA 5JPCA 4BLQA 2WF5A 4ZAZA 1Z33A 4Q15A 1WP4A 4QXOA 2VDQB 1CY0A 3USCS 1E63A 2Q8NA 3O8OA 5AWFC 3CVYA 1Y4AE 3N6VA 3WK6A 2HSWA 5HJ5A 1Y6GA 2XVYA 1M7GA 2EP8A 3I09A 2FG6C 1FFAA 2IXDA 3DZBA 3FOAA 3L05A 2W6JA 4MUNA 1D2AA 4J3FA 3QVXA 3IKJA 2HLPA 2H1OA 2CCGA 3ZY3A 5BPFA 1S8AA 4XFKA 3BICA 2ZFUA 1AS3A 1QGED 1Z29A 5CH3A 5AMXA 5HJEA 3D64A 1DHRA 1KAHA 2IODA 3UWDA 3PFWO 2ZRDA 8MHTA 2V97A 4II2A 2EIXA 4K9SA 4RVSA 2P2ZA 5JYCA 4ENSA 1V3QE 2E1PA 5LU9A 3ANSA 4MRAA 4G6ZA 1WXHA 3W7BA 2IJGX 2WUWE 3CUUA 1QGUB 2D5IA 4WK4B 5EWLA 3BIJA 3ZWDA 4B3CA 1KMIY 5F1KA 5AW4A 5JNLA 5EZQA 2O7RA 3L0BA 5DF1A 1FVXA 1I51A 3B6ZA 3EB9A 3IEPA 4O4LF 2JIPA 1P5FA 3RWOA 3O8RA 2BGGA 1ZKDA 5CT5A 3GJ5A 2QQ5A 2QQ0A 1D1QA 3GRKA 3LOUA 1IJFA 3GFTA 3OCYA 3DTVB 1SBNE 1Z4MA 1NZJA 2UV8A 3FVWA 4Q3LA 3D6NB 3FVRA 2EF1A 2W6MA 2UDPA 4OHBA 1SC6A 1MH1A 1TZCA 2JGFA 3INGA 1M1NB 4ZT6A 3KKPA 3BGWA 3OFJA 5TR9A 2RGRA 2C84A 3QFSA 5NULA 3DMTC 5IULC 2FG7C 5U1PA 3SPXA 1ONNA 3X1DA 1YL6A 3ROFA 3RSHA 1V3VA 2ZRPA 4L5JA 1D2EA 3L07A 2PXAA 2ZI5A 3WQBA 3AL0C 2JHPA 4CTOA 3D8BA 4LCEA 2AXEA 4AF8A 3ITKA 2HIMA 1N7JA 1II8A 4FEGA 3OLCX 5JW6A 4OHXA 1RQNA 1HZZA 4HX9A 3DDWA 4MZXA 1NLMA 3KALA 4XPIB 2UVPA 3MT8A 4YMIA 5JXGA 3RHZA 2BM1A 3ZGLA 4EZIA 4B48A 4UAGA 1WE2A 1P4GA 1VPVA 3E2PA 2FPLA 3ONVA 4JJ6A 1TMGE 1IQPA 4M1TA 5JZBA 3ZDCA 2R97A 5H3HA 3O3CA 1MD9A 3EXFA 4IIHA 2VRCA 3EXG2 3RF6A 4F9TA 4Y1GA 1NM5C 1Z5ZA 4QGBA 4C4OA 1WHTB 3MAGA 1C7ZA 3ZHBA 4KPEC 2OESA 3MMPA 1BVHA 1WDWB 3Q7EA 2DMRA 4ME6A 4ZT4A 5K2MA 1OJLA 2WIBA 2ZYGA 3F3MA 3KQPA 5FUVA 3VO9A 1K6XA 2B4TO 3KTAA 4URXR 3I72A 4KAXA 2CYAA 2GEVA 1RKBA 1FEZA 4JQOA 3LUHA 1XCLA 1X13A 4RA9A 1WMFA 3OBBA 4TMKA 3AHDA 1NJ6A 2Z5GA 1P1HA 2EP5A 4PZPA 1XTRA 2BEWA 8ATCA 1T2CA 2O6LA 2QN3A 4IHAA 4PLGA 1F51E 1C0PA 2ASVA 3KTDA 3LBNA 1B41A 1OIWA 1YH3A 3MWLA 4Z86A 4A1OA 1C9YA 1OLXA 3EDMA 3H65A 4XYMA 2N9UA 1KYVA 4TWBA 3QVMA 2NUPA 4M22A 5A4FS 2B1RA 1X1TA 4EYSA 4GOND 2ZTUA 2GCPA 4K40A 2PGAA 3G8YA 2XE8A 4RH1A 3KJXA 3WLNA 5DB4A 4DTCA 3MINB 4QFBA 3ETLA 4FFBA 1SQ5A 2GR9A 3IJRA 4OHUA 3TEMA 1ZSNA 1L5SA 2IPNA 2NACA 2V8OA 3PGLA 4E6EA 1CJVC 5IHXA 3HEAA 3LC1O 4UVIA 5KPDA 3RIEA 1DRVA 3F7MA 5EE3A 5H16A 4TLCA 5FR1A 2ACKA 5J4KA 3LL4A 5I47A 4MV6A 1FRNA 5ALWA 2F67A 4M55A 4F2WA 2WJVA 1YRYE 2VKQA 2WU8A 3GIWA 4WOBA 4EW6A 4GOKA 4I8IA 2G28A 2R1ZA 3IBSA 1CEEA 2G4LA 3OOSA 1GAWA 3G02A 5KOIA 3TR0A 1ULAA 1Q1AA 1KO7A 4OAQA 1A9XB 1VKRA 3L4BA 4TTRA 4ZEXA 1ILWA 3GN1A 1QS0B 1N33B 3F7TA 4TL6A 3HVUA 3L43A 3FCSB 1G18A 3D81A 5EMJA 2VG8A 2XOKD 4AUMA 2Q1WA 1XF9A 1WXEA 2XMDA 5AQEA 2RSLA 3KL4A 3KTOA 2IUUA 3HJBA 1DNPA 3OPMA 4UULA 4TMVA 1DEOA 1U4NA 1ZRNA 3NORA 4MVWA 3AJDA 1XTVA 3EGEA 3HS3A 4PNEA 1V41E 2BZ1A 1MT3A 2NPIA 4L4YA 2EKPA 4N5LA 5IANA 1X1QA 2CKMA 2QR5A 2VK4A 3GZNB 2P41A 1Z7WA 2GPSA 3OWXA 2DC1A 1D04A 1EVYA 2ZR0A 4IHJA 5ILQA 1VIYA 2BGKA 4KU4A 4BKOA 3T3DA 1I7PA 3E05A 3OJLA 3OMLA 1DJLA 4J0GA 4U7PB 3IIKA 4BV3A 4L9SA 1G5FA 1Y8ZA 4HAUA 1Z56C 3FW1A 5DM60 4MCIA 2GXUA 2UYHA 3GEBA 2WWWA 2DTXA 4M99A 1KH1A 2OV3A 1D4FA 1JT9A 1NBWB 2IYSA 3VR1A 4QGHA 3ETCA 4TXHA 2WPDA 3R9KA 2NYAA 3C24A 1PJ8A 2F9MA 4B4UA 1Y3BE 1SXJE 2CXRA 4KZPA 4QTXA 1P4HA 5FWNA 4Q12A 1OAAA 1BFUA 1UWVA 1EUCA 1XTJA 5L7TA 1CQJA 2BFBA 4M9QA 4TLMB 4K0KB 2G80A 3CZ4A 2PU5A 1FMTA 2E4XA 3BMNA 3FIJA 5JZVA 1OHHD 2QJFA 221PA 2XYRA 3ZD7A 1DO0A 4KZKA 3IIEA 1CJTC 3OHPA 2P65A 3FYUA 1O6BA 5F4BA 2C4UA 2G5CA 4NOJA 5DGDA 4HQ0A 4AQ7A 3WWEA 2CVHA 3DOOA 3N86A 1F5NA 5KDLA 4DEYA 3UZUA 4A6PA 1TLFA 3KIPA 3J7AC 3OH8A 1MDBA 1HWYA 5J4YA 5JLJA 4UC0A 3TINA 4BNKA 2GJKA 3G89A 4EHFA 2VQ6A 1SCIA 3IB3A 5FBKA 1E2FA 2EX4A 1UT8A 4MVXA 2P35A 2PNFA 2IKSA 4D99A 4DR7B 4R1QA 2G9QA 3OY7A 4LXXA 4NBUA 3G0DA 4DA8A 1YFLA 4C4PA 3FHCB 4DDVA 1UKZA 4KQKA 1JVBA 2POCA 1OWLA 5K0CA 1SVOA 2NX2A 2O0KA 1EP1B 5TPWA 2BC9A 3DW3X 1PX0A 2GTPA 3M1YA 4X44A 3R6WA 1IVYA 1R0XA 3WHLA 4DLZA 4DDMA 4EWLA 1T35A 4Q16A 4EHDA 1R4NA 2YHAA 3KEOA 4C4ZA 3O3OB 4UQPA 3LCMA 3PE6A 4PG5A 1I5RA 1W76A 5L3SB 2F64A 4WZBB 3GVPA 4MR7B 4A91A 4DOMA 3ZK9A 1Z6YA 3H3JA 5IKXA 3VXKA 3OPVA 1A7AA 3NGXA 1ML3A 2CDBA 3A27A 1SD1A 3HKDA 2QTHA 4RO0A 4CMGA 1JZSA 4FDTA 4LZNA 4D46A 2I6SA 4E88A 3PC8A 5E3HA 4LDAA 5KIAA 4TSRA 1HQDA 3GC6A 3PD7A 4CTNA 1FBTA 3GVXA 5LOVA 3I2KA 4IGIA 1ZRSA 4EUHA 3K0SA 4EPVA 2ZJAA 4V03A 2XIQA 3C5EA 5JJ5A 3PJEA 1A5AB 1OYOA 5JZ9A 5C4GB 2XRZA 3CLSD 1C1XB 4M0EA 4A4DA 3N6XA 5CAEA 1FNNA 2REQA 2RCNA 3L18A 2XXAA 2W11A 2D7JA 3AERB 3WLOA 4D9GA 1TUBA 3AVPA 2I9KA 2FR1A 5L8VA 1ZM7A 4XCQA 3WO0A 3IPLA 2HCJB 3PFGA 4R1MA 3NP9A 4R31A 1Y8QA 3AI3A 1QRTA 1VJ5A 3WGTA 1RQPA 3A7EA 3M9LA 2X6RA 1PQUA 2OE2A 1GNQA 4MKRA 4EY3A 4GC5A 5HNKA 4RF2A 1BJTA 3IGFA 5T3YA 1CJSA 1SK9A 3A70A 1YI8A 2WLTA 2E4AA 3R0ZA 3T95A 5A4DA 4UMFA 1XJQA 1QF6A 1SOWA 5C80A 3BOSA 2NPOA 4E21A 4X8LA 3ITDA 4M76B 1JS1X 3PCTA 1XELA 3H1TA 4OMDA 3QEOA 1YHZA 1UKAA 5TMBA 3USES 4I36A 1QWSA 1JEJA 1SMKA 2CXQA 4FC6A 1J8YF 3T3EA 4Q4AB 3E2IA 3LWBA 4N0MA 1OUMA 4RIEA 1DC8A 4CGYA 4IXMA 5I6DA 3I5XA 2P5UA 1JHXA 3EPLA 4KWHA 2BUCA 2I54A 3STWA 3MSCA 3SZ3A 3RVRA 3SIRA 5I9IA 2GPWA 1OTXA 3B36A 5I8ZA 1E3LA 3BL6A 3RGWS 4J0DA 3IMKA 3HYSA 3N58A 1J0BA 2XECA 4KMRA 5DYIA 2W6JD 4M36A 5AK3A 1TVKA 2E5WA 3TW8B 5BSKA 1FPMA 2X7JA 2IDMA 4H77A 4JBHA 2Z9BA 3SY8A 1D5WA 1YDFA 3RGGA 2D2IA 2IITA 3NIGB 4LV8B 4CEIA 1NN5A 1LDBA 3ZWVA 1HT0A 1MORA 2H8KA 3JY6A 4RWEA 3HVIA 2ZYSA 4RK7A 2RHMA 1H65A 3P9IA 3TZ6A 4LOKA 4TUYF 1CHDA 2BBTA 2D0PB 4Z53A 3JZDA 1I6WA 2HF9A 3SXPA 1DRWA 1E1NA 1Y81A 3NRJA 2EC5A 4JP3A 4ML3A 1PTKA 3JASB 3ZCRA 5F23A 1YVDA 5BW5A 3W8DA 4C0SA 3NVKI 1RRPA 3BSWA 4GP7A 1QKIA 2PG3A 3BCRA 2PIAA 1RRFA 1VHLA 3WV4A 3ROEA 4RMHA 3BT7A 2ZTHA 2UXBB 4FTWA 1WXGA 2EARA 4I5IA 5SV2A 3Q8LA 1ZIXA 5FTWA 1JDNA 2X15A 1DG9A 1KSJA 1NMQA 2ZYUX 2OBXA 1TEHA 1C0LA 2OHVA 1RYBA 2GAIA 1RPNA 5H81A 1EHCA 1MHPA 2QAJA 1TVMA 3UAZA 1VSBA 2RGYA 1F4LA 2WSBA 3PHLA 3X1MA 4HVLA 5KX5B 4J3NA 4ICIA 3THYA 1JFVA 1L1QA 3FA2A 2KQUA 2QWXA 1Q14A 4I9UA 3SYLA 3EUFA 3QVLA 1CRQA 3DFKA 3LT1A 1YU6A 5ALEA 2FPSA 3OF2A 3WP1B 3OOYA 2DJ5A 4MW6A 4OP3A 3NIBA 4U6SA 1W2WB 3ISVA 3DD5A 3JTEA 2KS6A 1U5CA 2O2IA 4LXQA 4UDYX 5AK5A 4K9KA 2B4RO 2Q7OE 2H5LA 1OA1A 1KYXA 3L41A 1K6IA 4HX5A 3DT9A 2B34A 1JDPA 4KG7A 3R76A 4KQ6A 3L7MA 1NVAA 2PSHA 3SEQA 2OBYA 1TQ8A 1K88A 1FDUA 3IBTA 3LLCA 1A8SA 3GEPA 4LZPA 4MA5A 4MUMA 2MYUA 1KY5A 5I5EA 3IELA 4UHBA 1O77A 3MJ4A 1Q7GA 1NFQA 1QR6A 2VRCD 4LTNA 4B6RA 1GIAA 4DQVA 3GUVA 1E32A 1WSDA 1ZLXA 5LCXA 3TQHA 3ZU3A 4ALNA 4NCAA 3NYQA 5BUCA 1MR3F 1N6IA 1BVRA 2AC2A 1DWUA 3ZNOA 4G5OA 2BCJQ 4ZAWA 4LY6A 3ZWAA 5CVVA 1IN7A 3I5MA 1ZOSA 1NYQA 4HB2A 2QVBA 2Q4RA 1PEDA 2D0DA 3FTCA 1CP3A 1KK3A 3M4YA 4MARA 4O2RA 1DJOA 2CVQA 3MHPA 3EXG1 2BE9A 3U9TA 3G2IA 4MDHA 4F8EA 2PT6A 1LF5A 4FEYA 1G9SA 2QD3A 3ZU6A 2OV8A 3KHUA 1ZRMA 3F5QA 4ESHA 2FFQA 2IP4A 1P1RA 5B7NA 3K2QA 3AOGA 2IPAB 2AN4A 1JBQA 2C8KA 2SCUB 5BNTA 2JKVA 3CEPB 5TS2A 5I9TA 3HN2A 3NBUA 2ZBQA 3AONB 2PZMA 3JYOA 4QEZA 4ZGWA 1IWBB 3G9ZA 1JV2B 5A4MS 3BJMA 2XA1A 3L0YA 4RIFA 4H1TA 4JVNA 3U4HA 1KMHB 2WABA 4GZ6A 3FCAA 1JGTA 4J90A 2C9YA 2VP0A 1X1SA 3V3KA 4RPHA 1C81A 2C5BA 2DAPA 4O1IA 4JLNA 2WYOA 5E1OA 1ADGA 1ZBDA 2WJGA 1I94B 1CEYA 1JA9A 2GZHA 3RQIA 3ZU2A 2C7PA 1PJAA 3W05A 3RYTC 3S55A 2P2DA 1JX6A 2AF3C 5GZ3A 1PJCA 1DMSA 2I2DA 1FYVA 1QHSA 1YE8A 2ZZKA 2B94A 2PQ0A 3RAGA 3W4IA 4F46A 2O5CA 7MHTA 1NSFA 1CVIA 4HLDA 3V6LA 1MO6A 3R5JA 4I1IA 4C22A 2F3RA 3NBQA 2PWAA 4B6SA 3JD1A 1VDZA 4AX8A 4RGQA 1U7DA 1V47A 1ZM2A 1M2OB 2EWWA 2Q45A 4IX1A 1JSLA 4DWOA 3RRXA 4LF6B 5CK4A 2GB4A 2QW8A 1H2RS 3OMWA 3ZCUA 1M0EA 1J90A 2QXUA 3B5EA 4OHMA 2OXIA 2F90A 1AS0A 2J9FA 3EMVA 3VZRA 1UC5B 2WWTA 3IUBA 4Z0PA 1X92A 2ZANA 2ZTSA 2CNLA 1EFRA 2C2HA 1V25A 1R64A 1Q19A 1Q7TA 4RZQA 5FOVA 4HBZA 5IKPA 3HN6A 3P20A 3PE3A 5GGYA 4Y9RA 4YMGA 3O8OB 3EJWA 4NZOA 4F4DA 4XARA 1E1KA 1QPBA 4YYZA 1HEUA 3LF2A 4IZIA 2AG5A 3IAFA 5ARCA 1I1QB 2NZJA 2QM3A 4IH1A 4DANA 5D1NA 1SUFA 3SMVA 5HBGA 4K88A 3R75A 2C3MA 1GP2A 1G8MA 4EPTA 4MKZA 5K01A 3KEFA 5CCBA 3JTMA 3OAAA 4IDDA 3PHGA 2I22A 5FWXA 1TYCA 3KKOA 1VZ2A 1YJ8A 2BTQB 2WPDD 1Z4PX 3ROQA 4ERXA 4CM3A 1UIMA 1R4MA 3HVKA 4WK2B 3I62A 1NJ1A 4AJIA 1SA0A 5EWLB 4CW7A 5HRUA 3VR6H 4JT9A 1XLTC 1XDZA 5JI2E 1XN1A 4FDMA 4UBJA 3N3AC 1AZWA 1EHYA 1VSTA 2WJZB 4IDGA 5G4LA 4Q0MA 4D0GA 3P4YA 1DIOB 4RH3A 4EPXA 3OSZA 2Y1KA 3SLGA 2FDRA 4BMVA 2SKCA 3IAS1 1F6DA 4P84A 5HF5A 1TUGA 1QFMA 3F4KA 121PA 1L3BA 1LK7A 5EXTA 5EZSA 4C0WA 3BXZA 3DAGA 3LUFA 2OLJA 4NAHA 4B6EA 4IYRA 5FOTA 2JGAA 3IDQA 1DQRA 4JJEA 3TZQA 1O94C 3IA2A 3OEEA 4NHEA 5CDYA 1Q91A 1ZVVA 4Y0VA 1VYHA 2RGCA 3FLBA 1IEQA 1WL8A 1IOLA 2RBKA 4PQFA 4R41A 4B3SB 3LYHA 2GA8A 3V7FA 2MYPA 2ORYA 4DMUB 5LIPA 4BVGA 3IODA 2J3IA 3A6LA 1A9OA 1E9FA 2VRBA 4DIBA 1JH8A 1ZM4A 1WXIA 2VZEA 2WIDA 4KPFC 2UVPB 1YRAA 4LRUA 3B1WA 2QTBA 3THSA 2ZIUB 4X8OA 4YV0A 5JHHB 4H08A 4C3OB 2YCBA 4GYJA 1L5QA 5CVCA 4G0WA 1WD5A 1VPLA 3OG9A 1KBZA 3HKBB 5JAUA 3KAJA 3SQNA 1U0EA 3PNLA 3EXFB 5CXSA 1Q1EA 1VDMA 1WV1A 3UCEA 1US8B 2J3KA 4G0ZA 3FG9A 2K87A 3WKBA 1J21A 5JEEA 1SWVA 1OIVA 2VLIA 3UV6A 3UMJA 3DFFA 2PU7A 3TOXA 1E79A 2UZAA 2PWBA 3TEFA 2OHFA 4QUBA 1HDXA 1I33A 2AR0A 1V0JA 2B2CA 1NI4B 1NVMB 1LBIA 4RA9B 3EUAA 2WY2D 1FSPA 1KEPA 1ZR2A 3FJ1A 1PAUA 2QP3A 4FR0A 4JUIA 2E3JA 1DO8A 1W29A 4EHNA 2BEWB 2WVAA 1BMDA 4C14A 4X65B 1G8KA 5IVHA 3HU5A 4MUIA 1R5NA 3GHHA 3LUJA 4KO3S 3FTEA 5CCDA 1KR2A 4C4RA 2CUZA 2VDKB 2NUPB 3C1AA 3EMBA 3OCJA 5E4YA 3AUAA 1QAMA 2PLRA 4AJEA 2GBLA 3TK1A 1T6NA 4KIFA 5FTKA 1W1IA 4C87A 4PG4A 5JASA 3PFIA 4FFBB 1M0SA 3BJZA 2YRFA 4HH0A 2AN5A 1KYYA 1DZIA 3ZWMA 1D0SA 2C9CA 2V98A 4E4YA 4H6VA 4P0QB 5JCJA 3IILA 3L7OA 1DX6A 2GBFA 4MYHA 1CR0A 1O2DA 1FJ2A 1TF2A 1UK9A 1I7NA 1Y3AA 1ZD8A 2P3OA 2W0MA 4NU6A 3OVMA 3WZ2A 4AUNA 3A1TA 1IEXA 2C20A 3TBHA 4AC9A 4FI3C 1RC8A 4Z3KA 4R8VA 2A7QA 1LFDB 3O4HA 2Q8PA 1X1CA 5SZKB 2O20A 4RVOA 1P2UA 3F74A 1L7PA 4DMCA 2JEZA 4KXUA 3NJRA 5CDHA 2FLWA 1YL5A 4CIBA 3F7OA 4LJ5A 1DBIA 3KC2A 5CLJA 3NS7A 4P2GA 1TM7E 2CLKB 4QGSA 1SC9A 2F1IA 1RMYA 4G65A 4GGPA 3E0QA 4KHZA 3HVJA 4YRMA 1IBSA 2HV9A 1P75A 1SXQA 2X19A 3NFYA 2O6HA 4Q7JB 4R84A 3W3AH 1T4CA 4JVOA 3H5RA 2Q9BA 1SQ0A 3K9NA 1Y4DE 1Y4ZA 3RVKA 3NYIA 3CUTA 1Z4JA 3CX4A 4PW0A 1VKJA 2LWIA 4Y2JA 4LGVA 4K87A 1IXYA 3A1UA 3MK31 4GBGA 5DSZA 1RKUA 1CRPA 3I4FA 3QVUA 4O8CA 3IALA 4JBIA 3IE0A 4QBFA 5BVGA 2PMEA 1EXVA 1B15A 3GJ3A 4FFRA 2AKEA 4JR1A 5G4KA 1A9ZA 1EJBA 1ENPA 4GX0A 1NLZA 4W7IA 3F73A 2Y1XA 3V2GA 1KK0A 5I45A 3DQQA 3TDKA 3DVLA 4JVSB 3D7MA 4DT1A 4WRRA 5JJCA 4FYWA 2NZYA 3K0FB 4J03A 1J7JA 5I01A 1XEFA 3UGJA 3FMOB 2RHJA 3FNEA 4LJRA 2BEVB 3AQIA 5CYFA 3IKTA 4OIMA 5EVJA 3TXAA 3RIHA 2PJRA 3H6GA 4E1AA 4EGFA 2I4OA 3PDUA 1GQSA 3Q2KA 1EIWA 2JVJA 1RBMA 4MB6A 3WGMA 3N75A 1EUCB 1CQJB 2R44A 3H1BA 2BFBB 1Y1TA 1KDYA 1GPAA 2E89A 1AKQA 4Q3CA 4S1TA 1N9KA 1SU6A 1P9WA 3BMNB 2AE2A 4DR1B 1C3OA 3E2MA 1JE0A 3SEFA 4X94A 4TXJA 5J2UF 4QDKA 2FEAA 5EJIA 5MN5A 3FE2A 1BVYF 3ZWPA 3FYUB 1NP3A 3LUCA 5DNDA 3OQIA 1MOSA 2D5AA 2VNIA 3EHEA 1GRRA 3UMVA 4COKA 1JWBB 1TO2E 5CIWA 1MIOB 1Z07A 4TMYA 2CDAA 2JA1A 2M6KA 4TS3A 2B8EA 3P2YA 4CDNA 4H31A 1YDGA 2B82A 1JL3A 4EFKA 1R6TA 1SVMA 2HJSA 3CY6A 4GL4A 5B12A 1P2DA 2QSJA 1NNUA 4MYDA 4R1OA 3L0DA 2OTCA 3ORQA 4JT8A 2DF8A 4BAZA 3LV8A 1QXSA 4OQZA 3AEYA 2K2QB 4ZAVA 4BLSA 1G3MA 2QN9A 1MRSA 1N3BA 3VDMA 1TKCA 4X95A 4YRZA 3U19A 2IKQA 3O8LA 4K6HA 3TR6A 1OZFA 1SBCA 2P6NA 5U9CA 1IY1A 1VI6A 1Y33E 4IKOA 4B83A 3ZV4A 1J1UA 3OY2A 2R6R1 1P9LA 2G1UA 1DPFA 2COKA 1UMCB 2JZNA 3KYDA 4FCCA 1IHYA 4RKQA 1VGRA 1EVJA 2Z83A 2GMWA 3VO1A 3Q9LA 3K3PA 1R4NB 3CH4B 3T1HB 4ZZ0A 5GIPE 2DM6A 3TLJA 2CN1A 4ZMSA 5FPKA 2YL2A 5HCUA 2QD2A 4O3FA 4NTZA 4BQFA 3N74A 4EGSA 1C4OA 3T4PA 4KLRA 1XNRB 3HKDB 2VHJA 3LCCA 5LZ4A 3DBHA 1SJ9A 3GRUA 1JIVA 4N8SA 1ESNA 5CA1A 3SFZA 3KTFA 1ESDA 3IEKA 2G36A 1AUXA 2YYSA 2GCIA 3AHIA 3G49A 2GBCA 4FFLA 4R3UC 2O2DA 3G9XA 3IUEA 4KUGA 3WYAA 5LOVB 1OLSA 2FW9A 2I78A 2IHZA 5CR9A 1BE0A 4KH0A 2OORA 4D9HA 3NB0A 5H1YA 1SKYB 3DV9A 4J0FA 4X8MA 1YZFA 1WJGA 3IKVA 5HUJA 1P6UA 2GJ9A 3WLAA 4E2XA 1IXSB 2K6GA 5CAEB 2L69A 4C7JA 2REQB 4N49A 1UDAA 2GWRA 2XXAB 4WXYB 1DKLA 1P45A 3R3WA 2JLUA 1TUBB 3Q3VA 1UH5A 2XMCA 3CC8A 3UM9A 2UVQA 3B2NA 3M34A 1H3FA 4LYHA 2FSVC 1PW7A 2PMDA 1N2ZA 1C1DA 1Y8QB 3HNRA 2NU6A 2WUDA 3K72B 4HNAA 4JQYA 5LQUA 1RZUA 3LUPA 2Z6VA 3KVOA 5EGSA 1I2ZA 1XQ1A 4IIXA 5JLAA 4W7SA 3VDNB 3LI2A 4CR7A 3W5CA 4MI9A 1UQUA 4D8VA 2VT3A 3ZHTA 1D0VA 5ES3A 4OTZA 4DLWA 4EHBA 3CJQA 2PRZA 3EFOB 3K09C 4ROSA 4C7OA 4BPRA 1CRLA 3KR1A 2G9NA 4DCGA 1B00A 4ZQGA 3HBJA 2YCLA 3H6KA 5B7PA 4RPGA 4AKEA 5B1SA 3G2PA 2GLTA 1KSFX 1YFJA 2P11A 3QOFA 4LWQA 2XMPA 4HP8A 3ZTYA 2QM0A 4NPCA 2P2NA 4QOIA 4KQEA 4Z4CA 1H2WA 4PZCA 3IR5A 4HDKA 5DNCA 5B4TA 3BD9A 2TECE 1ZBQA 3I37X 1V9LA 2X9QA 1T2DA 4KRGA 4XX0A 3LOPA 4L78A 1EFRD 2YV3A 2GO1A 4MK4A 5DHAA 1DPGA 1L7BA 1NIPA 4IIEA 2RGXA 4UTXA 5E7MA 5AVSA 2XB2A 2GCEA 1ODIA 5EE9A 2UUPA 2ATXA 1GPYA 1GZ3A 3K0BA 3EC1A 2J67A 4M7RA 1U5AA 1NC1A 1EB8A 1GUAA 4HMPA 1TVKB 1IWOA 5ADVA 4AJ4A 4IM7A 3O1LA 3FDXA 3TKYA 1RYYA 4MICA 5MGNA 1G0OA 4PY2A 1ILEA 1LBSA 1O9HA 4CEIB 1MDFA 1LPSA 3P1JA 3OAAD 4UTVA 5LP6F 3DT6A 1WABA 4Y6OA 3KJHA 5T5QA 2NXCA 5ALZA 3TZLA 4YAFA 1BTOA 4BWVA 2J4DA 3OX2A 4BMYA 4YQZA 1N5DA 5JH7A 5AKGA 1FFWA 4QVKA 3WR5A 3SQXA 3FPAA 5I4CA 1YBFA 5BWOA 2BZSA 1BDJA 4LJ4A 3P9ZA 2XUIA 1UPBA 1R6UA 1QQBA 1T91A 3LBFA 2VJBA 2VOEA 3PT9A 1ESCA 4FSDA 4QG7A 3WYNA 3QWIA 3HB7A 4FBGA 4AKSA 5JSZA 2Z2XA 1I4TD 4V1CA 2DPHA 3UCFA 1P73A 5HK9A 3FUXA 3U4QB 4MWZA 1L8XA 3H1AA 1B0AA 4WZAE 4D43A 5CT8A 4GBED 1NN3A 1ADJA 3MWEA 4C7KA 1AHHA 4RF3A 2AVNA 4AJPA 3THYB 5J43A 1BRTA 2WBLC 3OEED 2HV8A 2P5YA 4IHJF 1E2MA 1JG3A 3HMQA 2HAEA 4IIFA 5HKBA 1Y1PA 2H18A 3PCXA 4FKBA 3S2IA 2DH6A 3DV0A 2AFHA 4LMRA 4MUEA 5E6SA 2ZIEA 1N7HA 2OCPA 2EL9A 5EQFA 5HFJA 4YFYA 2OBMA 2I99A 3G0GA 2FSPA 1E6KA 1U6JA 1RZVA 2J9YB 2YWGA 2VHVA 3HC7A 3FPGA 1HTWA 1WEKA 3ABSB 2HPVA 3Q6IA 5IC5A 5F98A 5KOJA 3MEQA 3O83A 3GJ0A 2DWCA 2KLBA 1T1SA 3HV0A 5H59A 1JKJA 3NTOA 4PLZA 4IDHA 3ISTA 5TRTA 1DCTA 4PG7A 1U1GA 1NGSA 2IX3A 3TSOA 3QRWA 3CZQA 3GRRA 5HFAA 4G81A 1ISIA 1YR7A 2XR1A 1DSSG 4XM2A 1X7DA 3MUFA 3OE4A 3EE6A 4KP7A 2WM8A 1GDHA 1O96B 1E3WA 2EZ8A 1OFTA 1W5EA 2ZVPX 1E79D 4AZ3A 1F48A 5IN4A 2I3AA 3IP5A 3BWYA 3KE9A 1FMFA 5EJ9A 4BE9A 2BYTA 1FP6A 1NXOA 1W85A 4RH0A 2GYVA 1RYDA 2FRXA 5EIHA 4LNAA 2RB5A 4MQ4A 4YEDA 3RKRA 3WJ7A 3OPYA 3B2QA 2C2WA 4GQBA 4OYHA 2V45A 5FWAA 2HJGA 4PAMA 1GFZA 3E7PA 4N18A 4CLRB 3R09A 2YMMA 4RYLA 2VJLA 5DNEA 5JSYA 3OLZA 1IUOA 1IY9A 4J0CA 3ANNA 2PRSA 3CYFA 5BPHA 4JB2A 3U40A 3FWNA 1Y6FA 2P79A 3HGQA 5EQDA 1P8JA 1V37A 1XVUA 2E4ZA 1KYWA 4MIKA 1Z88A 3C97A 3KPYA 2CY0A 4AJNA 4F60A 3TGLA 2W6OA 2NADA 1L5HA 4MAFA 3V8NA 1WAMA 2TMGA 4PQYA 1JPNA 4LMAA 4CKXA 2HJHA 1ZK3A 3QKRA 3PWKA 5BUZA 3CONA 5EJ5A 3LUKA 2QENA 4CI0B 1XD8A 1R12A 4RLFA 1YNOA 2CW5A 4HGYA 3GAMA 4BO9A 4DCVA 4O3MA 1F12A 1Q0HA 2FSSA 2Y05A 5ISMA 1C9DB 4MR8A 1CF2O 1ZZEA 1FUKA 3DLIA 2QJOA 2R6FA 3NANA 2OXEA 1KQFA 1LNZA 2P5SA 5LWHA 3RG2A 1UPAA 3SJ7A 1WDMA 4F85A 2B8WA 4RYDA 5LOVF 3TUZC 3S40A 2G1PA 2BRUA 3AJ9A 2CB0A 4H0FA 4XJSA 4BMOB 3PFNA 5EE5B 5J2TA 2ZITA 3FETA 2FDXA 1R6XA 1XVAA 5BV2P 1CUUA 2B20A 1NVVR 3QENA 3PDJA 4XJTA 1T24A 2J9FB 4KO8A 1JIUA 3RODA 1GG9A 3AR3A 4TKLA 3LUAA 1CTQA 2HUNA 4G2NA 1N3YA 4A15A 4EJ2A 3ZDDA 4AI6A 3U48A 4P5DA 3UATA 3KR2A 4MGZR 4YI5A 2JFFA 1ODCA 1Z4KA 3MJFA 4HRYA 3WX0A 1PF7E 1P0CA 1ZC4A 2WDZA 3CBQA 3FPCA 3B6JA 3BWXA 2A59A 2NZVG 2HDNB 2WWYA 1K5DA 3RNLA 3G5UA 1K1EA 1TPYA 1YQDA 4NQRA 3KJFA 3OOHA 1JHOA 1YQGA 4RABA 1NRXA 3H1GA 3ONNA 1PZHA 1SIUA 2ZRHA 4H35A 1Z2PX 4HQ6A 3PUIA 1XYYA 2O0HA 3ZE9A 3WICA 3M6WA 5LBIA 5BNIA 4B4OA 4LRWA 3AWDA 3U4GA 5FWXB 1E9AA 1H8ED 4FHGA 4AICA 1RI3A 1XZKA 4YRRA 5BN4B 4FYVA 1R4MB 2NU8A 3PITA 3T4UA 4KAJA 1U0SY 1RQGA 4QYWA 3UAXA 2B1JA 4AN1A 2V7XA 4D6PA 1U7ZA 1SA0B 2AOWA 1LF0A 2PPLA 5IUKC 2FWBA 4IVRA 1N5MA 1T6XA 4I50A 5DHSA 5FI1B 2HQBA 5A3VA 1GZSA 4EYKA 4FOPA 3O9ZA 2HO5A 5C7OO 1QANA 3FRHA 5LUAA 4B71A 4YN3A 4XTCS 5ELXA 2H6EA 5ENZA 4BO0A 5GV7A 2OV1A 1K6EA 2XTAA 3IVRA 2X0RA 2BKVA 2XUDA 4LRXA 4NY1A 3T3IA 2A9OA 4U2GA 1CD5A 3HRHA 4MW4A 1D8TA 1PFUA 4GKVA 4R1NA 2BSQA 4L50A 1DAFA 2FEPA 4IQ8A 2I6FA 4LVOA 1SVIA 3HNPA 5A4AA 1VSUA 3RG8A 5KTMA 2WWGA 1JYSA 3IP1A 5AOAA 4WA8A 5TEVA 2FOLA 4P4LA 3L7NA 1DG3A 2GN4A 3A37A 3ZI7A 1XIVA 3CSDA 3FRIA 4MWGA 5A6SA 5FHRA 5KAPA 1PDVA 4GU5A 3TDMA 1MIHA 5KYKA 5DV9A 3LLVA 5M29A 4OI4A 3S8YA 3FWHA 2LNDA 3ZBUA 3EX7C 4BLUA 3U44B 621PA 5KTNA 2HT6A 2CJFA 3VQTA 3E3MA 1ZI8A 3GJXC 2R4TA 1SBZA 3GJQA 3OJWA 4JXJA 3ZG6A 5GMOA 5FJJA 4L4RA 2FW7A 1V6SA 3AEUA 1N2JA 3E5RA 1Y4SA 2WIGA 5KO2A 2G70A 1M8KA 1LA2A 3VC7A 3VUFA 4D9JA 4EPYA 1YKGA 3RVSA 4C2AA 5F5LA 3GEMA 3TW6A 4IWXA 3M1IA 4L15A 1J97A 3PK0A 5BWBA 3RC7A 1VXRA 1GG5A 4M0MA 2PN1A 1TTQB 4JZYA 3PQ2A 2OBBA 4C78A 4X3OA 1Y6JA 2D2EA 5KTYA 2NTNA 3V1UA 2D8AA 1WWKA 5KVVA 1U7UA 4M7OA 1G0NA 3AB3A 2QW0X 1EI9A 3I4CA 4K6OA 4EW3A 3M5WA 1IG0A 3HWSA 4DNOA 4HZUA 1GGVA 4LEIA 2A3NA 4IFTA 2AOVA 1E2KA 3WWZA 4YBZA 4ARSA 3IIJA 1I1OA 3UK7A 5EYPA 5JQGF 5JYDA 2X9LA 3K0HA 3HCPA 3HUEA 1OZAA 3BFVA 1QK3A 5IVIA 3I9FA 5FUBA 1GADO 1RKQA 1BQ3A 3DLTA 4CNBA 2PZ8A 1E1YA 5ESXA 3BRQA 4ZEOA<