3WWPA

S-selective hydroxynitrile lyase from baliospermum montanum (apo2)
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
265
structure length
265
Chain Sequence
EGFMVSAHFILIHTICHGAWLWYKLIPLLQSAGHNATAIDLVASGIDPRQLEQIGTWEQYSEPLFTLIESIPEGKKVILVGESGGGINIALAAEKYPEKVSALVFHNALMPDIDHSPAFVYKKFSEVFTDWKDSIFSNYTYGNDTVTAVELGDRTLAENIFSNSPIEDVELAKHLVRKGSFFEQDLDTLPNFTSEGYGSIRRVYVYGEEDQIFSRDFQLWQINNYKPDKVYCVPSADHKIQISKVNELAQILQEVANSASDLLAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords (S)-hydroxynitrile lyase
publication title Structural and functional analysis of hydroxynitrile lyase from Baliospermum montanum with crystal structure, molecular dynamics and enzyme kinetics
pubmed doi rcsb
source organism Baliospermum montanum
total genus 99
structure length 265
sequence length 265
chains with identical sequence B, G, L, M, R
ec nomenclature
pdb deposition date 2014-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3wwpA00
1ZD2P 3LP5A 4X6UA 1SOMA 3FWHA 4HVTA 1U65A 2C7BA 1QGED 4A23A 1L7QA 4GEGA 4WJLA 4MWSA 4H0CA 3SWWA 4EY6A 4Q3KA 1CUZA 2WU4A 1TQHA 1VOTA 1YCDA 2JGIA 5HKAA 3RKSA 3DL4A 4DSAA 5BOVA 3I28A 4HXGA 5ISMA 4FLMA 2DHDA 1JFRA 4C4YA 2DR0A 1UXOA 1QIHA 2WKWA 3B12A 1GPKA 4H7IA 3G8YA 4UBIA 4KAFA 4EA6A 3VDXA 4QWWA 5DWDA 4WFKA 5ALJA 4X3CA 3HABA 4Q82A 2JGJA 4ETWA 2H1IA 2ACKA 3DNMA 3O95A 3R41A 3C87A 5HQ3B 1AURA 3PF9A 5AHXA 1J2EA 1YR2A 1J1IA 4I4CA 5AM3A 4PF1A 4FBMA 1P0MA 4X71A 3A2MA 3EF3A 4EY8A 5CH8A 4B6GA 5HQ3A 4G5XA 3DS8A 2BUCA 3ESDA 5FKJA 2XMCA 1E3QA 1CUIA 4RGYA 3HI4A 4C4XA 4Y2VA 4CCWA 5LP1A 3IUNA 4UBJA 1QIFA 2G5PA 1UKBA 1X70A 4DMFA 2Y2UA 1ETHA 1BS9A 4OU4A 1ZIYA 1BRTA 2OQVA 1WHTA 4L3WA 4X92A 2OXEA 2BUAA 1CQZA 2XQFA 2OCGA 2AJCA 3KSRA 3L1JA 3UMJA 2DHCA 5AOAA 2R11A 1R3DA 3FOBA 4KACA 1WB4A 4XWGA 2GYUA 2O2GA 5ALSA 5FLKA 3WKAA 5HF5A 2PSJA 1DX4A 2GBCA 1JU4A 5DTJA 2PM8A 4OSEA 1X2BA 2GYVA 5A62A 1MNAA 4C4ZA 4WFIA 4BAGA 4KE6A 1E8MA 2QXTA 2WLSA 1FJ2A 1AC5A 5I9IA 5C81A 1ZICA 4FMPA 1QIGA 1QIJA 5AM4A 3DOIA 4AN0A 6YASA 1LZLA 2V9ZA 5JIBA 3BDIA 5DYWA 1ACLA 3YASA 2AJBA 3MUOA 1XQYA 1R88A 5ALKA 2CUTA 4U2BA 4C87A 1TCCA 4H18A 1ZOIA 4N8DA 5EIEA 2H9YA 3A6ZA 2JF0A 2VJAA 5H3HA 4F60A 1XKLA 1WB6A 1BU8A 4BTVA 1XRRA 1YAJA 4C6HA 1CRLA 4UBNA 3A2NA 1QTIA 4ARAA 4KE8A 4L0CA 4FWBA 2PSDA 1XZCA 4Q3LA 2Z3WA 2RHTA 3W06A 5JZBA 3STUA 3O4JA 3ANTA 2C58A 1A7UA 3E4DA 3RARA 5K3EA 3AIKA 5ALFA 1GGVA 4S0XA 5D7BA 4E11A 2QMQA 3H18A 3WIBA 2C0PA 2ORYA 1CUFA 5KBYA 4W1PA 1UOOA 3V1MA 5LZ5A 1QJ4A 3K2IA 1LPBB 2WIFA 1Q83A 2WTNA 1QIMA 2BCEA 3FAKA 2XQJA 1Y7IA 4GDMA 4J0KA 4BB0A 4KE9A 5AI9A 4P93A 3E1GA 2PX6A 3SX4A 5AIBA 4B82A 3C5WP 5CMLA 2HA3A 1VA4A 3C45A 3PICA 3D2CA 2G63A 4BBZA 4ROTA 1TK3A 2V96A 3QBJA 3WYNA 1QIKA 1CFJA 1GT6A 3EQ7A 1C7IA 4PO3X 5ALMA 5FUMA 3C43A 4G4GA 4C89A 3N2ZB 1DTEA 2YASA 3IULA 2VT7A 5ESRA 4Y2YA 4IH1A 1NX9A 4BVKA 1YAHA 5JD6A 4HRYA 1GKKA 2VAVA 2GYWA 4P08A 4ARBA 3IVMA 2QRUA 4KEAA 4YK7A 4L9AA 4QLOA 4B80A 1XZIA 2JEZA 3B5EA 3G9TA 3PF8A 4UBLA 4ITVA 4X91A 3O9MA 5FP0A 1BE0A 2WM2A 1LPOA 5LIPA 3NGMA 3BL8A 5JATA 2X5XA 5AICA 2WIKA 4OYLA 5AM5A 4ZV7A 1U2EA 2XUFA 2WTMA 3ILSA 3WI7A 4H7KA 2WHQA 3E3AA 1XZGA 3H1AA 4OUKX 3WKDA 1E89A 1UFOA 2XQGA 4KE7A 1ZD5A 4BDSA 4Y9SA 3VJKA 3O4HA 1XLWA 3WQHA 3LS2A 5T4FA 4CFSA 4P9NA 1N5RA 4B81A 5LLSA 2ZYRA 1K6EA 3HLKA 4G4IA 5BWCA 4J0JA 3PUHA 3WK6A 4BAUA 3G0IA 4ZXFA 3D7RA 4J0DA 2P8SA 3DD5A 2PVSA 4MWTA 2Z3ZA 1A8QA 1CUCA 4NMWA 4XJVA 2XUDA 1MNQA 5AKXA 1LPSA 4AMZA 3WIOA 3DYVA 3H2HA 1CUGA 2QS9A 2OQIA 3WLAA 4HAIA 1G66A 4DNFA 4QA9A 1HDEA 5AM1A 3IURA 2OGTA 5CT5A 1MX5A 3EQ8A 4H35A 3ZPXA 1CUXA 4IQ4A 2O7VA 3FSGA 4RNCA 3S2ZA 1OXMA 4J03A 4K6GA 3STTA 4KYVA 5C7YA 2XUPA 3OPMA 3HRHA 2BJHA 1EA5A 5JAUA 1W1IA 4FFVA 5D3ZA 1K63A 2WJ6A 2H7XA 3GFFA 3BWXA 3I1YA 3CN7A 3AIMA 1RP1A 3JW8A 3K9BA 2C5FA 3OG9A 3N0TA 5HFNA 2PKYX 5AK3A 5ALYA 1EDEA 1ZI8A 3OOSA 1THGA 1F0NA 4BE4A 3LCRA 3RK4A 2C5GA 2ROQA 1XZMA 1MJ5A 3AZOA 4FHZA 3D2BA 4K6HA 2Y2VA 2IITA 3C6BA 1BN7A 3L1IA 4CG2A 4H7EA 2CMFA 1CVLA 5K3AA 2PUJA 4YX9A 2C0QA 4UBMA 4HZGA 1Y37A 2K2QB 3HJUA 2ONCA 1GXSA 3R3YA 5ALXA 4EY5A 3G9XA 3C6YA 4TPKA 1CQWA 5KREA 4BP8A 2XMRA 5ALIA 5JYCA 4BZWA 4Q34A 2J3QA 5C8ZA 4UFNA 1KU6A 5SYMA 3ESBA 1BEEA 4DNQA 1VE7A 2YH2A 1QFMA 3FBWA 2UZ0A 2HDWA 4G9EA 5LKRA 3VKFA 4Y2UA 1EDBA 3I6YA 1CUSA 1AKNA 1UKAA 3FLBA 1CUVA 5FDFA 1ZD3A 2JEYA 5CURA 1CUYA 2WHPB 3P2MA 1HQDA 4FNGA 4TGLA 3IIIA 3QITA 1RWQA 3WWDA 3W2TA 4FBLA 1EK1A 5KWIA 2WHPA 2W6CX 1W6RA 5AKZA 1IVYA 5T4HA 2QVBA 3DOHA 1S8OA 3EIOA 1QTRA 4QNNA 3PUIA 3TEJA 2WFMA 3BF7A 4CG1A 4H7DA 4Y2PA 2FJPA 3I2IA 2WIDA 2PU7A 4AZ3A 2VT6A 1DINA 4NVRA 5ALDA 1FFCA 3U0VA 3M3DA 1EDDA 1QIIA 1E8NA 1R9MA 3ZLUA 1MX9A 2Y1KA 4PSCA 1H22A 1NU8A 5BWBA 2QOEA 2Y6VA 2PL5A 5AI6A 4MXDA 5DYYA 3FVRA 3O4GA 1W4LA 3ZI7A 3H0CA 5LZ8A 3M83A 3NUZA 2CJPA 2VJCA 2XUHA 1CV2A 3Q0TA 1JJFA 2I78A 5AOBA 4HTAA 3H2IA 5IVDA 2ZSHA 5LZ2A 1SCIA 3I2JA 4CIAA 3MGAA 2ZSIA 1H2ZA 2E3JA 5DTIA 1W75A 2EDAA 3D59A 2W22A 4QLAA 4N5IX 3WK7A 2RIPA 3E0XA 3SK0A 4EB0A 1F6WA 4W1QA 2D0DA 3H04A 5EHNA 4HS9A 2VAXA 5F4ZA 1EHYA 3BF8A 4KAAA 4MYDA 3AIOA 2JGKA 2XB6A 1ZGBA 3WK4A 2VTVA 2HL6A 3ICWA 4Y2XA 1BEZA 2XMSA 4X90A 1ZD4A 2AXEA 3FNBA 1C4XA 1YA8A 4J0GA 1QIEA 4CI9A 1XQXA 3H2KA 5LZ4A 5A7FA 3WWCA 3PDCA 2FJ0A 4RE5A 2BKLA 3R3ZA 3CCBA 1XRNA 3C6XA 2XUOA 1A8UA 4GHWA 5CT9A 4D9JA 4Y2QA 3X3HA 3NOXA 1VE6A 4J0IA 2AJDA 2HRRA 4EY7A 3AFIA 2Z5GA 3F8SA 4B83A 2X76A 3WL5A 3STYA 4HRXA 3BJMA 3PI6A 2GZSA 3IB3A 5FXMA 5D3KA 3I2FA 2WQZA 2WUFA 1H23A 2JGMA 5HF9A 5LYYA 4L72A 1YASA 4G1FA 5AKKA 3DJYA 3KWFA 4BAZA 2B4KA 2BAGA 4G4JA 4G9GA 4QDOA 2CKMA 4WY5A 1JJBA 4UHDA 3WJ2A 1R4ZA 3WKEA 2WFLB 4ZREA 2B20A 2NW6A 3OC0A 3I2GA 1OCEA 1UK7A 4C88A 4NZZA 5JZ9A 3I6ZA 1UWCA 1VXRA 2WILA 2WFLA 2ZVDA 3I1IA 4DNOA 4G8DA 3HYSA 2WU3A 5HF8A 5JANA 3W9UA 1VLQA 1VA5A 1DWPA 4PNZA 4H7FA 3A70A 1H2XA 2QJWA 1GQSA 1B6GA 3HC7A 1LLFA 4OD0A 3MUNA 4B0OA 5A6VA 4BZZA 4PSUA 2QJRA 3QYJA 4FNMA 5DNVA 2HA2A 3QPAA 3STXA 1LGYA 2CZQA 5AKLA 5AOCA 2JIDA 1IUPA 3AILA 1E66A 3M81A 2HA6A 2C4HA 3D5EA 1XZLA 4UPDA 4BYMA 1XQWA 4DMCA 3T52A 1OILA 1SCKA 1WB5A 4GBGA 1AX9A 1DU4A 5FPPA 4G8BA 4XX1A 5K3FB 1QO9A 4XVCA 3HEAA 1F8UA 4UBKA 5I7UA 4FTWA 3LIPA 4CG3A 5JADA 4U2DA 1YA4A 4CIBA 2Z8XA 4F5ZA 5CH5A 4AZ0A 1JKMA 5K3FA 4INZA 5ALQA 1QE3A 4YASA 2WUDA 5EI5A 1UKCA 4B9AA 4KR0A 4K2AA 5AKGA 1D07A 1DX6A 2O2IA 5E2IA 4OCZA 1ZGCA 2PBLA 3C5VA 1NU6A 1IZ7A 2VSQA 4MQMA 3F97A 2WFZA 4EZIA 1N8SA 3IUJA 5ALWA 2Y6UA 4FLFA 1EXWA 3STWA 1FFDA 2PSFA 3FLEA 5EGNA 4AN1A 4KJXA 2AJ8A 2V97A 4J3JA 3ZLVA 1TRHA 4GWLA 3HSSA 2GBIA 1T2NA 5HK9A 4E14A 1HPLA 2OLEA 3BE8A 4Q05A 4X6YA 2H7CA 1LPPA 3KOOA 3H2JA 2J4CA 1QONA 1QZ3A 4BVLA 4AX4A 5AKIA 4KRXA 1H2YA 2HFKA 4FOLA 2CBGA 1P0PA 4Y2SA 4JYMA 4H77A 2H7YA 2HA4A 3G0BA 5E4JA 4F21A 3MVEA 4MJ3A 4J0HA 5AKEA 1JJIA 4H7HA 3KWJA 4GW3A 1UT6A 1IZ8A 3NWOA 1MT3A 4AQDA 1EI9A 4K5QA 3DLTA 5JAHA 4LXGA 4I3FA 1MTZA 1J07A 1UK6A 4I19A 1Y7HA 4HXEB 1QOZA 3Q8WA 1IUNA 1THTA 4Q3OA 1PJAA 5EIAA 1XRQA 2OCLA 3G02A 2WG0A 5A7GA 2QTBA 3IA2A 4LYEA 4ZWNA 4DTCA 2JGFA 2WIJA 3G9UA 5I8PA 4UHHA 5D6OA 2XUKA 1HKHA 3F67A 4JNCA 2PPLA 1XZJA 3R40A 4QWMA 5AI8A 5JALA 1DWQA 4OPMA 4IO0A 2WUEA 5AH0A 4OU5A 3GELA 1E5TA 3PE6A 1DQZA 2YXPX 2I3DA 3R0VA 3F9CA 2EEPA 1SFRA 3ESAA 4UBOA 5E4TA 1ISPA 3QMMA 5IVHA 4W9RA 3WMRA 5AJHA 1KEZA 1AQLA 4QDZA 4GECA 3KDAA 1L7RA 2FX5A 2OCIA 3AZPA 1O6GA 4JUIA 4X00A 1ZJ4A 5JD5A 3ANSA 1CIJA 2BGNA 5CT8A 4FLEA 1CEXA 1BROA 4X94A 5EHZA 4PQEA 4AB1A 1XZHA 2QZPA 3TRDA 1K8QA 2XT0A 1ODSA 4W63A 1XZFA 1CUEA 1UZAA 3F96A 1Z68A 4Y2TA 3C8DA 1U8EA 2QKYA 1XKTA 1XFDA 3D2AA 1EVQA 2CEKA 4JH0A 5HKBA 1YS1X 2DFPA 5AK5A 1MAHA 4MEBA 2PUHA 4EY4A 3OTQA 1MX1A 3QMWA 1CR6A 4N8EA 4W1RA 3DCNA 3H19A 3TGLA 3C6ZA 2XUIA 4Q1VA 2VJBA 4QE3A 3W04A 2OPHA 3R3XA 2XDWA 4ZV9A 5CH3A 5ALLA 3QH4A 4WDQA 5KWJA 2HU5A 5AO9A 1EINA 2WIGA 1DT3A 1TAHA 2GBFA 1LPMA 5LZ7A 4BDTA 5FRDA 3TJMA 3HACA 5AKJA 2XUJA 1CPYA 4RPCA 4UHCA 3ZWQA 4MYSA 3VXKA 2G5TA 5YASA 2ZYIA 1AMNA 5ALGA 3FVTA 1DQYA 4UFPA 1R50A 1WCYA 2D5LA 2ZJ7A 4K6KA 3AUKA 1IUOA 4LHEA 3IBTA 3UUFA 3A2LA 2QM0A 2HU8A 2PSHA 4ZI5A 4H7JA 5JAPA 4LIPD 4QDXA 3FYUC 5AM0A 1F0PA 1JT2A 5JARA 2V98A 3K6KA 3WK8A 4CCYB 3IUMA 5A2GA 3PFBA 4TVKA 1G42A 3V1NA 3AINA 5CTAA 5ALVA 1Q84A 4ZRDA 2BUBA 4N8SA 3G9ZA 4X7BA 1AGYA 4FKBA 3ZV7A 3ZLTA 4CCYA 3AZQA 3QZUA 1GPNA 3QM1A 3V1KA 2QR5A 4OYYA 2XMQA 2I3ZA 2J4FA 3GROA 1ZJ5A 3H17A 3FYUB 4DMKA 1XZDA 1W76A 1SC9A 1VZ2A 3C8HA 1M33A 3WKCA 3FCYA 3BIWA 1VXOA 3HZOA 3GZJA 1DWOA 5ALNA 1RYYA 3RLIA 3FYUA 2HM7A 4AO7A 4UUQA 4GXNA 1ACJA 4WFJA 3VJMA 3WA6A 5JAOA 1ZIXA 1G4HA 4M0EA 3FSGD 3R3VA 1EB8A 5A71A 4BTLA 1O6FA 3WWPA 5LKAA 4LKOA 1K5PA 3I6MA 5JD4A 2VF2A 5ALTA 3V48A 1ODTC 3HXKA 1BCSA 4BE9A 3CCCA 1XRMA 5HCUA 3WL6A 4DIUA 3D3NA 4N5HX 1VZ3A 3D4LA 4OB8A 2XMBA 3WWEA 2ZYSA 1LPNA 4BCCA 1X2EA 3R3WA 1XQVA 4O08A 3DYIA 1QLWA 1TCAA 1LNSA 3STVA 1YSCA 5ALPA 3S8YA 1TKRA 4QDTA 1HBJA 5EHQA 1WOMA 1MO2A 3I2HA 5DLPA 1XZBA 4GLBA 4QZVA 1UOQA 1A88A 4DNPA 2RGUA 2BGRA 4FFWA 1N5MA 4IHAA 2WG2A 1JU3A 1CUBA 3EQ9A 3DEAA 3QMVA 2OG1A 3VVLA 5IH7A 4DLNA 4BCDA 4RE6A 5J3JA 4Y2JA 2FUKA 3WWOA 2WJ4A 1JMYA 2OGZA 2Q0XA 3WA7A 3DL7A 4J0CA 4MQLA 4AMYA 3FLAA 5IVKA 4UHBA 2AJLI 1CUWA 4PW0A 1QO7A 3WK5A 2YYSA 3DKRA 1SCQA 2XLCA 3IDAA 3M82A 7YASA 1ZI6A 1L7AA 1CUDA 5CXXA 2ECFA 1EX9A 2VEOA 2JGEA 3BJRA 2HHAA 5CT4A 1FFEA 4BC1A 5AP9A 2GZRA 3OM8A 1TIBA 1PV1A 3VJLA 1HL7A 4X97A 2WUGA 4PV7A 4OB6A 4Y7DA 1E8DA 5DNWA 3CXUA 1N1MA 2DHEA 3H1BA 4F0JA 1ORVA 2PSEA 2HU7A 1ODCA 3B3QA 2QUBA 2XE4A 2DQZA 1R9NA 4M0FA 4LXHA 5E4YA 4WCVA 2IIVA 2R8BA 2PU5A 4BRSA 5C8XA 1XLUA 3VISA 5FPQA 1CUJA 2JGLA 2VATA 2XUAA 2OAGA 5AIAA 2DQYA 2OAEA 1EVEA 4OB7A 4E46A 1MU0A 2OGSA 4UHFA 1WPRA 2RHWA 3G0DA 4DMHA 1LBTA 4BC0A 4U2FA 1BN6A 4ZGBA 1GPLA 1P0QA 5DYTA 4DM7A 3FCXA 1W52X 1I6WA 3GA7A 1MPXA 3W9BA 2XMDA 3O9VA 5AKHA 1VJ5A 3CN9A 4M0MA 1A8SA 2ES4A 1P0IA 1PFQA 1CUAA 2HA0A 3WYDA 5DNUA 1B41A 1MAAA 5CBKA 3QPDA 2RAUA 4IH4A 4BCBA 5K3DA 1T4MA 2CB9A 2VJDA 5ALHA 1LPAB 4B84A 3LIIA 4BRZA 1QIDA 5ALEA 1HLGA 4LXIA 5JZSA 1EB9A 2XUGA 2Z8ZA 4DSZA 4J7AA 4UHEA 3KXPA 3F98A 3WJ1A 3VVMA 3WL8A 3T4UA 1WHSA 4C01A 2HA5A 5AK4A 3LLCA 1GQRA 4A5SA 3DKKA 4U2CA 3ED1A 2ZYHA 3FYTA 1G5FA 3WKBA 5CXUA 5HK8A 2XQKA 3U1TA 2QXUA 4X93A 3W05A 2HIHA 4EHBA 3QVMA 1C7JA 2XUQA 4P92A 5K3CA 5DJ5A 3BIXA 1VKHA 1Q0ZA 4XIIA 5IKXA 3G0GA 1AUOA 1YS2X 2ACEA 1U4NA 4A16A 5CW2A 2XQIA 1ORWA 5HFAA 4AO6A 3JYHA 1XRLA 1WM1A 2O7RA 5C8VA 2VQ6A 1XZKA 5AI5A 2HRQA 5K5EA 3SC2A 2GBGA 2JBWA 5CT6A 1DT5A 4B85A 1QFSA 4BATA 1GKLA 3IUQA 5T4BA 1YB6A 2IX9A 1XLVA 3RM3A 1TCBA 2RONA 2O2HA 4JYPA 1H2WA 5BV7A 3EBLA 3D0KA 2XI4A 1FFAA 3BDVA 5AK6A 2B9VA 2HADA 3O4IA 2LIPA 5T4EA 2ZJFA 5SYNA 1JI3A 2VA9A 3BXPA 4AXBA 1MN6A 1XROA 5CRIA 2HFJA 1UK9A 1K4YA 1BCRA 2X8BA 4W1SA 4U2GA 3JWEA 3UUEA 4WDRA 3V9AA 5FV4A 4V2IA 5LZ9A 1LZKA 5HF6A 4HXFB 5AM2A 5EFZA 4DYHA 1ZI9A 4G8CA 2G4LA 5ALRA 4QEKA 4JEIA 3H2GA 5AI4A 1XZAA 3WL7A 2B61A 2XMZA 4X6XA 2XMGA 4KRYA 1AZWA 1JMKC 3AJAA 5ALUA 2DSNA 2EDCA 3OURA 1CUHA 2DCMA 4E15A 1YB7A 1WPXA 5ALZA 2BFNA 5A7HA 3DQZA 4KAJA 4X95A 4MEAA 5JASA 3G7NA 3WK9A 2WSLA 3R3UA 3WZMA 1R1DA 3WZLA 4B7ZA 4X85A 1UOPA 4BP9A 4Y2RA 1CLEA 3ESCA 3KD2A 2QUAA 2XLBA 4FDMA 5AKYA 3G0CA 1EK2A 4AO8A 2ZJ6A 1CUUA 1FFBA 2OCKA 4BVJA 2J3DA 1EH5A 4WY8A 5ALOA 5FOQA 4GI1A 1GZ7A 3L1HA 4Z49A 4DGQA 5IVIA 3V1LA 4QDUA 4EUSA 3I2KA 1Q0RA 4UFOA 2WHRA 1LBSA 1USWA 3GBSA 2RI6A 2WJ3A 5K3BA 3O0DA 2QT9A 4B9EA 4LYDA 4NS4A 1J06A 4EBBA 2I03A 3ICVA 3GUUA 3PFCA 2HA7A 5EHXA 4B0PA 3QPCA 4U2EA 4PSDA 5HZGA 4YPVA 1KU0A 3DDUA 4IH9A 5EIHA 1FSSA 1IMJA 2WG1A 5AI0A 1XRPA 3C70A 1UK8A 1XZEA
chains in the Genus database with same CATH superfamily
4JQZA 1ZD2P 4IIJA 2E4YA 2PGXA 1SOMA 2FFQA 3A26A 3B9PA 4G84A 4HVTA 4MIYA 1CJCA 2WP8J 2A7XA 3CQ9A 4MX8A 2ZRNA 5A6SB 4U6NA 3PXGA 4GBJA 5ICFA 5EYPB 4L95C 3TAUA 4YIKA 5BT8A 4F5WA 3FPKA 4EY3A 4A23A 2XCUA 3CINA 2IIPA 3RWMB 3R1IA 4WN9A 4GEGA 3OA0A 2IIBA 3SF0A 2FFJA 3BAZA 1LU9A 5AW9A 2O5VA 3FYHA 4D4HA 4OGKA 4MWSA 5DM2A 1IHOA 1I9CA 2GF2A 5A0TA 3V2GA 3SWWA 2H1RA 4LZOA 5F2EA 2OLJA 4KWCA 4Q3KA 2C96A 3WWYA 1VP3A 3AMVA 1NBAA 3O84A 1G20A 2Z3VA 3QKWA 4DM4A 4O4IF 4DV0B 3ZVKA 4BNDB 1OZHA 4E7PA 4QOHA 1Z25A 4HQLA 1X80B 3FIJA 5JOQA 4IOKA 4E33A 2ZKIA 3DL4A 2O14A 2GJ4A 1GPUA 4DSAA 3CZ9A 3EPPA 5BOVA 4C2TA 4KQWA 3BXGA 4YRIA 3LP8A 2GZDA 5L6MB 1E2IA 4HXGA 1XWIA 2PAAA 5EJ7A 1EGHA 3INGA 1NTOA 3GQBB 3L6BA 2V1XA 1R66A 2AR7A 2WSSA 2BIFA 1I14A 3GDWA 5B55A 5BOSA 4HDNA 1QLJA 1VI5A 1U8XX 3HY6A 5G3ZA 5BN5B 1UXOA 1T9AA 3BFKA 4OQ4A 1QU3A 4ENUA 3G8AA 2D74A 5HGXA 5D8DA 4EVIA 1GNLA 3B12A 3OF3A 1GPKA 3JZFA 1R16A 5A9SB 5AJUA 2HBRA 4JI6B 3PI7A 2L42A 4Z9FA 1MABA 3C39A 3ZDQA 4EA6A 3EXHC 1GNPA 3JALA 3VDXA 4BNXA 4ER7A 1QP7A 3L8HA 3ROZA 5M34A 4RWEA 3VR6H 4JCCA 2JJQA 3VTKA 1ZJZA 1BJTA 2RH4A 3OZEA 4UAGA 3V80A 4ETWA 5F64A 5IXSA 3LBIA 1KZ4A 4ZV4A 3MAGA 1XTUA 4CWAA 3UFBA 2NQTA 5HTKA 1EUDA 1R3UA 3RHSA 3KJEA 4W5RA 1AURA 4W8OA 1NAIA 5A4FS 2CHGA 3ZZ1A 3REOA 5IEJA 3EPLA 1J2JA 4C5BA 1J1IA 2LDBA 3FTDA 4YRKA 4FI3F 4FYKA 4L7QA 1UQUA 2JLCA 2XAUA 1P0MA 2SICE 4J43A 1XL1A 2BKVA 4EZBA 4ZCLA 1ZMBA 4JBYA 4BY9E 1W30A 3UCXA 4LDPA 3D6AA 4J4TA 4Y67A 1TZMA 3O2SB 4EKEA 1Z0UA 3KAKA 3KXIA 4BP1A 1W29A 4Y6GB 3U3ZA 1A04A 2Q3HA 2JARA 1I4EB 1BSVA 3BUSA 1XN1A 3OWOA 3I3SR 2VRWA 4QTXA 2JRCA 3HI4A 4ND4A 5IP5A 1I0LA 2GS9A 3OU6A 3HPRA 2NVWA 4NLLA 4Y2VA 5G1OA 4RULA 3IUNA 2GAAA 4N01A 2I4MA 4FIZA 1KDRA 1L5FA 5JSHA 3L7KA 4DBVO 3IODA 2I4OA 2ZT6A 1FU8A 4U2KA 3KWMA 4NYIQ 1UBKS 1QHIA 3NYIA 3OLWA 1UDCA 3G2MA 1O1YA 3PR2B 4H6VA 4JVSB 4YRPA 3RSCA 3VKWA 4Q3AA 5IFLA 1VHTA 1C1YA 4XM1A 3LBHA 4GE0A 3PS9A 4DA0A 3E1SA 1BS9A 2H65A 5LP6F 1KJYA 4IJQA 2LCIA 1ZIYA 3HCEA 4I2NA 4IHJA 5BSUA 4ZYUA 4X92A 3DTNA 4FFMA 5FUQA 4RPIA 3INNA 5D3MA 1XF9A 2X0RA 1E6WA 2OCGA 1V16A 3EWIA 3TSAA 3U7FB 4CM9D 2OECA 1N8NA 3PFWO 5B3AA 2EP5A 3R5KA 1UDBA 3O8NA 2QE7A 4YMSA 1M5TA 2AKAB 2O6HA 1LQTA 3X2SA 1FX0A 2VTDA 2YHIB 1PK7A 3VH1A 2VJLA 3MRVA 4MUFA 3BGVA 3V1YA 5L4NA 5CW1A 2PSJA 5E1BA 2XR1A 1PJ2A 2PX8A 1ORRA 1R0LA 2R97A 3BJZA 2GBCA 3DCJA 4ZJYA 1NONA 5BSGA 1JU4A 3I5AA 5DLEA 2PM8A 2ZITA 1MA3A 2ZWVA 3SC6A 1JAIA 4BVFA 2ZPUA 3IIJA 4YAFA 4JXKA 4K87A 4OSEA 2QRNA 4AULA 2D3WA 4ZT6A 2ZRGA 1SD1A 5EN4A 2HHJA 4BQQA 5A62A 1ZESA 4YTEA 4C4ZA 3LTNC 1YU6A 3VBEA 5CFOA 3MCZA 3F71A 1J8YF 4YRFA 2H8GA 2VSYA 4ND5A 2FEMA 2QL6A 2BMWA 1BIFA 3DXYA 4N0PA 1UJ5A 1G98A 4KE6A 5JAIA 2OBMA 2ZROA 2WLSA 4J6EA 2OESA 5THQA 1OZ0A 2H2GA 1MZVA 1WNTA 1FJ2A 4LHYA 2NPFA 2GNAA 1FDUA 4H1TA 4HO1X 2EFCB 1GPDG 1J39A 3TLYA 1AG9A 1RFLA 3CEAA 3LF2A 2HHHB 1A5SB 4FMPA 3ER8A 1QIGA 1E2EA 3W7VA 3HSYA 4I9HA 1XO1A 2MDTA 1LI7A 4Q4JA 5I7RA 4AN0A 2VLIA 5CCBA 2HC9A 3UKOA 1BFDA 4DCCA 3ZVNA 3GBPA 4YYEA 3AR9A 4BP3A 2YUIA 2NN3C 1YB2A 3BDIA 2CVPA 1E96A 1K9SA 3EZLA 5DYWA 1QG2A 4HRVA 4ZAGA 3BEDA 3KYCA 4JLAA 4BNFA 3K05A 3C3KA 3TAHA 1C4KA 1CIPA 5HUJA 1TCCA 4RVCA 3NJ4A 5CNJA 3E3LA 1CQJA 4C0XA 3HB5X 2P67A 4RXUA 4TSRA 5AVXA 5J43A 1M9NA 2A3NA 2IHJA 4BV9A 1MVLA 5T8KC 1PCXA 3OX1A 3CKKA 1H2BA 4GR4A 1II8B 4F60A 2VJAA 1FC0A 1EP9A 1XKLA 1WB6A 2HHLA 4FYXA 3MOSA 1XRRA 2ZBRA 3PWKA 3H87A 4LN1A 2Z57A 2JAHA 1CRLA 2PT5A 1HQYE 2G6BA 1O0SA 1PAUA 3DBRA 4JS0A 2RH9B 1QTIA 4KQGA 2XWBF 4MWEA 2GHIA 5EWJB 4ARAA 3UAOA 2V7VA 2P1ZA 5JY1A 4ZO8A 5JJLA 4FWBA 2FPIB 4Q3LA 2RHTA 2BF4A 5E38A 3STUA 1RRPA 3PYXA 3SZ3A 3ANTA 5DXAA 5TX7A 2C58A 1ZK4A 3W6ZA 5EE1A 4R0VA 4YXWD 4A15A 4NK5A 2JGRA 3AIKA 2X9NA 3W5DA 2VHUA 2VH5R 5KJEA 2HAEA 1BJKA 4NP6A 1EG7A 1G3RA 5JAZA 4YNBA 3EZGA 2W6PA 4DEVA 1G0NA 2R1TB 2VJNA 3B9BA 3AUTA 4I0WB 4M2LA 1PJTA 1FNBA 1JVBA 3FA2A 5D7BA 3UGTA 4E11A 3U16A 4ZJPA 1XALA 1TLTA 3WIBA 5C1IA 5CB4B 3IAAA 1B1AA 3ND6A 3HCBA 3KB2A 1WY5A 4BFZA 1UODA 1JRLA 2GCNA 3X2EA 4YRLA 1ZWKA 3A6JA 5JVDB 3O3MB 1WVMA 4W1PA 3U7IA 4POOA 4R3NA 5CDTA 2CYBA 2FUEA 2FEWB 3IEMA 3V1MA 3S68A 3IE0A 3K9NA 1URPA 3K2IA 4EVSA 3EW9A 5AESA 3TBKA 1JEJA 2R62A 4N5LA 2QG4A 4QTTB 4TROA 4ZVUA 1QIMA 5KAMA 5A3QA 1FMTA 1PR3A 2BCEA 4IGFA 4A6XA 1Y7IA 3QV2A 2BGUA 3ROXA 1D04A 4KE9A 1V5FA 2KLHA 4P93A 3E1GA 1JLHA 1GGKA 1FPQA 3K1AA 2PX6A 5KHAA 4DYDA 1VFNA 1OPXA 4KQJA 3SX4A 2EZTA 1QFJA 3L1VA 4AIIA 4L4ZA 1TOAA 4MS4B 1F38A 5AOCA 2VUIB 3UANA 5F7OA 1X1SA 3C5WP 2FJUA 5CMLA 1YMVA 2HA3A 3C45A 1FRVA 2B83A 3D2CA 3CF6R 4ENTA 3V4LA 1U2GC 4P7JA 2V96A 2G80A 4LOLA 1CFJA 2X4IA 2BBSA 1SJ9A 4FYHA 4PWYA 5F4BA 2OCYC 1QVWA 2VPWA 5IF3A 2PLRA 1ZVMA 3DE5X 3EQ7A 4IGEA 1H65A 1MB0A 2R8OA 1EJ2A 2QY9A 2CJYA 2JVJA 2ZK7A 3FBTA 3OU2A 4L4RA 5FLYA 4DA8A 2GUGA 5TR9A 4ZVPA 5JY6A 2D7JA 4L6CA 4JT2A 5IAKA 4C89A 4D9FA 5A4MS 1DTEA 3N6XA 1UMBB 4YJ2F 2YASA 3KBBA 4C03A 5CA1B 4LWOA 1C2TA 4GZLA 1U9CA 1Z2NX 3BULA 4MIKA 4PCVA 4CL0A 3IULA 4UASA 1C4OA 2ZTLA 3O93A 4W5HA 5ESRA 1YQQA 3KB6A 4O4JF 1N5LA 3MPOA 3S28A 2FWRA 3M6MD 2NZYA 3I52A 3MCAA 5DGDA 4AG6A 1X8LA 3A2KA 1MDFA 4HRYA 4KX5A 1V5WA 2ZQ5A 1KC1A 3IALA 4CI0B 3LGAA 4RM2A 1YD7A 2WA2A 4OX9B 2JNWA 2H4ZA 1XKXA 2FK8A 3OQVA 3G5TA 4KWHA 3IVMA 4MWBA 4JVOA 3CJTA 3L04A 5HMMA 3GLHE 5E1OA 3RSZA 4BGUA 2VDRB 3H5OA 3GB9A 1Y9EA 1MJHA 1WUHS 1YNOA 3MWLA 2Z2XA 3P0RA 4FEGA 3TZHA 3AGPA 2GCOA 4ZA2A 1KEEA 1KQFA 3JCZA 3M5DA 2LNDA 3RUPA 1EP1B 3WIVA 3ZNPA 2CXXA 4X91A 5ARCA 3O9MA 4G41A 2OXFA 1U9JA 2Q46A 1J09A 2ADMA 2XA9A 4FZRA 1PR4A 4NZYA 2FMUA 4OQEA 5FP0A 2RMKA 2WM2A 5K8CA 1QZUA 1XEXA 2Q27A 2Y0DA 2QT1A 3H7IA 4X3OA 1NSYA 4C1NA 2FFAA 4B74A 2JI6A 3L4KA 1RC1A 2BFPA 1VPVA 4LI0A 4D5GA 2EHJA 2AX4A 3LMKA 3V5NA 1VCNA 2I2BA 2YN0A 1JLLB 3KKEA 5DWQA 5ERXA 4QUDA 2IV3A 3ZTYA 4LRQA 1AUXA 1NE2A 3TNJA 2J32A 4EHJA 1CIVA 1DEXA 2O0KA 3WKDA 3K8QA 2QZSA 4QXAA 4ZIRA 4BU0A 1JEQB 1GZ4A 1UFOA 2YS6A 5AVWA 3JQQA 1D9XA 2XQGA 3KJGA 3KXKA 2Q3LA 2XHZA 5AXDA 4IXTA 3ZE0B 1UJCA 2HBQA 3ZWMA 5DI3A 4BDSA 3GQVA 4YV2A 3DMGA 3N53A 4JC5A 2PVPA 3P4YA 2BFMA 2HCFA 3LS2A 4J0QA 1G21E 5T4FA 3AQIA 4CFSA 4RABA 1N5RA 1T2FA 5KAPA 1R6UA 4GWKA 2ZYRA 5HNKA 4F11A 2IE8A 2HWXA 1NC1A 3MMPA 5BSFA 4JUBA 1JSZA 3F2IA 2VYVD 1ZS9A 1TEHA 1SR8A 4J0JA 3DC2A 5T6MA 3VOTA 4YP9A 1SWWA 3EEIA 4LSGA 3EGOA 1OI2A 1VPTA 4KUGA 4YT2A 4BAUA 1KFKB 1ODIA 4W7SA 2I99A 1ZJWA 4MWDA 4OYRA 2JCGA 2GAFA 1P2DA 1AU9A 2ESRA 3DD5A 1P81A 4W99A 1IG0A 5LOVF 1Z36A 3SIRA 3EY9A 4MR7A 4CKWA 1AS3A 2WPNA 1T1JA 2QU8A 4LFAB 1Z6ZA 1J9GA 4H9GA 5JQGB 4G0UA 4Q48A 4M9ZA 3QKSA 3VPDA 1BE8A 1DRKA 1LD3A 4ZAYA 1ZA1A 4AQYB 5IPFA 1A8QA 2VZ8A 1GPBA 4MTCA 4PG8A 1RKBA 3UCEA 1BXGB 3NZEA 4G1MB 1NP3A 3Q7PA 2X1LA 1B74A 4DV1B 1K2VN 5I7FA 2B8WA 3ZHOA 4NMWA 4ECEA 3THYA 1RFGE 1IJBA 4FHFA 2XUDA 4J76A 4KQHA 1MNQA 4XJVA 4E5UA 5JWRA 3CV3A 3IPRA 3MF4A 2MJLA 5AKXA 1FS4A 1GVNB 3C3DA 3DONA 1E4EB 1LPSA 3GLKA 5IULC 1R18A 1YO6A 3NS7A 3PFFA 3PWSA 2ORWA 3ZE8A 2PWZA 3BZUA 4UHJA 3N8NA 1Z6GA 1CUGA 1OSNA 1Q1NA 4ZVRA 4FVTA 4BLSA 4IJWA 1TQ8A 1YRBA 4JVMA 2OOSA 4EB8A 4FMDB 1K7EB 4LDZA 3IURA 2IEAA 2ZAIA 1Z6PA 4Y0NA 1EFAA 2LIVA 3O9ZA 3GRPA 1ZBQA 3FNGA 3PWTA 5J1TB 5JT1A 1OWOA 2ECOA 2YZ7A 4RJIA 3TPZA 1P1BA 2IYRA 2H4XA 1KJIA 4DY4A 4RNCA 4REQA 1YHNA 2CLOB 3ERCA 1W59A 2QTAA 2J5BA 4DLPA 1BQ3A 4EO7A 1PFUA 3P2IA 2Y05A 1N5DA 4XA8A 1IHUA 8GPBA 4NYIR 4KFRA 4D96A 1Q7CA 3WYEA 2XUPA 2YV5A 3BAFA 1ODLA 3BWEA 3FCSB 2F90A 3LHSA 3OPMA 4IMRA 5JWOA 1OBHA 1SNYA 4XIGS 1O6CA 1U2TA 1EM6A 4LOIA 4EJSB 4IRMA 5DSTA 2FUCA 3HGTA 5DM60 3D8UA 3HCCA 4OQQA 4MS1B 4ZOCA 3A6EA 3VNSA 3VVCA 4R8RA 1L5ZA 2B92A 3G13A 4IDCA 5JDCA 4TTRA 3SS8A 1VE1A 5DBEX 3MXTA 2JLVA 4KQMA 4PPGA 3MTIA 4R51A 1O54A 2QMYA 1UWLA 3DO6A 3BWXA 1PNOA 3I1YA 4I6EA 2QN9A 4ZHQA 1T9DA 3EXFB 4HDKA 1U98A 1NMZA 1OT5A 2EW2A 1SZPA 4MITA 1QV9A 3RVSA 4D45A 3W3AD 4O8ZA 1AGPA 1ZGZA 1B42A 3OT1B 3WO0A 3DDNA 1T8SA 3EEYA 4R7GA 2FDRA 4ZALA 1K7SN 2E7ZA 2HYDA 2RKBA 4Y9TA 2WY2D 1FXUA 5CITA 4W9MC 1XAGA 4B75A 2JFNA 2AYXA 4ON9A 2PKYX 3ANLA 1YJ5A 5AK3A 4NOMA 2YYAA 2VDNB 4TV9B 5E6RA 5EIBD 4KL8S 4CM4B 4AF8A 5BORA 4HLQB 3KS9A 5B1SA 3C1TA 5BUQA 5HM6A 2ZSDA 2QX6A 2FN7A 1RCFA 1QAQA 2QTRA 1F1BA 1Z8HA 3ND5A 1S9DA 1VLZA 2PZGA 3DWFA 4GPTA 4LFCB 1Y1KE 5LC1A 1Z8DA 1OZAA 1RRFA 2DH6A 2LKDA 3QIAA 3ZK7A 2ROQA 4F4JA 1RM4A 1YE5A 4L74A 4R1MA 1COWA 3PEFA 3FNIA 4I9NA 1MJ5A 3AZOA 3D2BA 1DUSA 1RYBA 3GVCA 1N2CB 4JFAA 3O1HB 1JDZA 4R1OA 3KQKA 5HR5A 2QRVA 4YRCA 2H3HA 5B1DA 2ZYDA 3FDXA 3HV0A 4M7PA 5KCMA 4OHRA 1FVXA 1G4UR 5GJVC 1BKYA 1IE3A 3RG8A 2A9OA 2CMFA 4PRLA 3HMKA 2YWXA 2A0WA 2A1TR 5FULA 3VO2A 4KMRA 4ZVNA 2AHRA 2EJCA 2J09A 4YUVA 3SQDA 3W8DA 2RKWA 1QHHB 5EAIA 3ZCVA 3KL2A 5K3AA 4LOKA 1P91A 2ZAOA 2WSMA 4F1JA 3I3OA 3VU9A 1Y37A 1WLYA 2PPVA 1GJRA 1H8ED 4Q9NA 4ZDWA 3V8EA 2FLVA 2F1RA 3IXQA 3T9EA 2AF3C 2CJXA 4XRRA 1V47A 4E2FA 4AG3A 2BFCA 3GGOA 2EP8A 3MJHA 3OZIA 4LRWA 4O2BB 4EY5A 5IMSA 2UXBB 1DKNA 1JQBA 4QGAA 3SZOA 2X1HA 5KREA 4NU5A 1UEJA 5LQDA 2HWKA 1KZ9A 5DK4A 1W5BA 2BPOA 2ID7A 3FUVA 3IOYA 3QE4A 2H8KA 4XVQA 1MAUA 4D79A 1LQ2A 5C8ZA 1PYDA 3QEMB 4UFNA 1OX5A 4PICA 1LRJA 3DHYA 3HU1A 4I9FA 4I6GA 4BUCA 5KHOC 1YK0A 4E32A 1Q0SA 1Z0JA 2P27A 3VAYA 3OZXA 2Z6UA 3MUEA 2IPXA 3HN6A 1F7UA 5JSUA 1UBSB 3PLRA 5CB8A 3OTWA 2YH2A 4GM0A 1X0XA 2X13A 1WXFA 3B7WA 3CNNA 4L5YA 5IJ9B 4OXRA 1ZH0A 4TKUA 3TI7A 3ZIDA 2IY8A 3FBWA 2UZ0A 5L4SA 3K5IA 5KYGA 3O8BA 3UYLA 1RWXA 3KJXA 4J0FA 2HZ7A 2VQ3A 1XDBA 3A9VA 4D43A 5IHXA 1EDBA 3E22B 5E4FA 1W0JA 2GNPA 1D2HA 4RD3A 3ZV3A 1ETUA 2H9AA 3QRWA 2ZP1A 3V42A 2JEYA 3ZDAA 2WHPB 3P2MA 3ZWKA 2PZFA 3I04A 3FX2A 3H5TA 4AS1A 3FNFA 3VR2D 4FNGA 5EKXA 4HB3A 4AMVA 3IIIA 2O8FB 4XWOA 1E7MA 1NE7A 3K0BA 5FPKA 3RYFA 3IO3A 4IV8A 4E22A 4FFOA 1C9NA 3A32A 4G0YA 1E2LA 3K0AA 4QYIA 3K0EA 5C0OE 1KDVA 1FRNA 1VMKA 1XTQA 1C14A 2Q21A 1Z4OA 2W6CX 4L76A 2EKBA 3UPTA 2JIOA 4BO2A 2QQ5A 1RKVA 1CJTC 1BWSA 3JRXA 1DKRA 2JJ1A 3EIOA 3IUEA 5BV0A 1G7CA 4BMSA 4WESB 3X1DA 4FJ0A 4RF3A 4IZ6A 4DUPA 3TEJA 1ZIDA 2ZI4A 1SOWA 1IZYA 4MUGA 4M36A 5I45A 1KK2A 5MGNA 1SKYB 3GVPA 1T13A 1EPUA 1WQ3A 1S3GA 5CDGA 2OC4A 3A3PA 3D8SA 2D62A 4H7DA 3MWGA 2DFDA 4YREA 3KT3A 3TGPA 4BO5A 1GLNA 1QMPA 1FXSA 1G5RA 3CKYA 5CXSA 1DINA 4QQRA 3TW4A 1FYVA 4AZ3A 3WP0A 4BLOA 1QV6A 4DHWA 1RYZA 3H42B 3G8DA 4NVRA 2JHFA 1Y9AA 2AQIA 1P3JA 1KMNA 3U0VA 5KCZA 4X8MA 4JBIA 1DC8A 1XA3A 2I66A 1JQJC 4M8NE 3PQ6A 6Q21A 1E8NA 4FE4A 4ZYWA 3TM5A 4KHPB 1DELA 3W3AH 3BZBA 1GQYA 1M3SA 2VHVA 4MR8A 4CQLB 5H59A 4DCTA 3I9NA 3HU5A 4PSCA 2FQ1A 1NU8A 2FPMA 4JJZA 5KX5B 1FLVA 1LWOA 3FPSA 4I1RA 1OW3B 3A9CA 1RQRA 4HN2A 1MUUA 1ODKA 3WY9A 3LCUA 4XCQA 1Y4ZA 2G28A 1NVMB 3DAHA 2J6IA 3W8NA 4CT0A 1RRMA 1PWHA 5BN4A 2A94A 4DQDA 4ME6A 4MWOA 2MYTA 4DHEA 4CQMB 2JBHA 3CGWA 1VYUA 3PPWA 4HUQB 4LZLA 1GUBA 4R2MA 2YY6A 4KIFA 3FHTA 2YYZA 3KZ1E 3G7UA 2VHCA 1WMBA 3OPNA 3C3YA 4K05A 4L27A 4EATA 5HCNA 4DQ0A 3CT4A 2Q3CA 1U63A 2I9PA 2QVLA 2BD0A 4LDQA 5ITZA 3H2IA 1YF3A 4WXPA 2Z9CA 5B3LA 2ZSHA 3ORQA 4PFJA 4X41A 3VR0A 1GN8A 3BERA 2PCJA 4OHFA 1N77A 1DJLA 1ZONA 4YP6A 4CIAA 3WRVA 1SQ5A 1RDFA 3DV0B 4UMFA 3ISJA 2H08A 2IKQA 2ZSIA 5A9TA 1H2ZA 4DBZA 5LLTA 4OO3A 4DQXA 1W75A 4B48A 3AHJA 4JLBA 3CRQA 1RJGA 3V7FA 4ONEA 1QSGA 3D59A 3IP8A 2Q0QA 4X1KA 1AUVA 1C3XA 1VG8A 3L0OA 4XSVA 5KQRA 5LU9A 1YQEA 3R24A 4EGQA 2BFFB 4IKOA 3AHHA 4O3MA 5E7QA 1U0FA 4RVGA 4V0SA 3HCDA 3WK7A 3AU9A 4W4TA 2RIPA 1IAVA 1E6KA 4KXMA 1U0HC 3SK0A 1NVAA 5BYAA 5IU6A 3K5HA 4QAQA 4RTSA 4W1QA 4MW4A 1RC0A 1ZK0A 2D0DA 5CVCA 3H04A 3HNRA 1XXHA 2WINI 3IOEA 4JB8A 1PV4A 1QYWA 3ECSA 1FQOA 4LYHA 1GHTA 5F4ZA 2BFEA 3TIIA 1E3SA 1GR0A 3COVA 3QBTA 1PG0A 4OKSA 3JXEA 3KQUA 4KAAA 5KTSA 1OKKA 4RKEA 3AIOA 4PLCA 4RY2A 3KLBA 4IIJF 5ILGA 3U7EB 2R1ZA 1ZM7A 2L18A 1MRNA 3P0FA 1JYEA 1TF5A 4ZAFA 2O52A 4F04A 3FJYA 4U4AA 3TPFA 3BRWD 1BEZA 3VC2A 5SZIA 4ZANA 2GK4A 2QV0A 5FUXA 2AXEA 1C4XA 1Z3CA 5K6AA 3AHEA 2JGNA 1YA8A 5CCEA 2B5WA 4OI0A 4LXXA 3BB1A 3ZEAA 4MP8A 1OBCA 4MVJG 2PSSA 3H5VA 3H2KA 5A7FA 1QX3A 3WWCA 2QU7A 2K7ZA 1K97A 4XJSA 3ROMA 4IJ5A 4UNNA 5I7OA 3R3ZA 4EI9A 5FHQA 1XRNA 4UCXA 1OY1A 4TMZA 1AIPA 2Y71A 3TL3A 3LZ6A 3WV5A 1ECPA 1A8UA 3MWYW 1MAVA 2NYAA 5K8TA 3IQDB 3EARA 4D9JA 4F4UA 5CLJA 3JAMA 2JKYA 1T36A 4Y2QA 2GVNA 2PIAA 1C3JA 3R4VA 4U7FA 1G41A 2W4MA 2ZIEA 3KV1A 4X7MA 3VV2A 3BOSA 3ZBQA 3AR6A 3V4ZA 3T94A 3OF5A 1CHDA 3TQFA 1ZD8A 2BHNA 3K4QA 3BORA 5FNVA 2PXAA 3EVGA 5REQA 3AQ4A 3M6WA 3T5BA 4B83A 2R4UA 2X76A 2W2QA 1Q22A 4FYPA 1XVLA 3FDIA 3IT2A 3U62A 1JLKA 2EWWA 3HB7A 4FN5A 5EE5B 2AWNA 1BVYF 5HRUA 1M2VB 2C3PA 4P31A 3I2FA 5DKFA 1CETA 3NBZC 1Z0FA 3RUDA 4PC2A 3TEMA 2FXVA 4B3SB 1G0OA 3HFGA 1MBZA 2QXYA 1JHVA 2AOTA 3P2YA 4FDAA 4NZOA 1RI3A 1HDOA 1IHPA 2C98A 2FRDA 3D0OA 2X7XA 1TQ4A 2GM4A 3UXHA 4R7TA 4E03A 1YASA 5GWXA 4D6YA 1RWMA 3GDOA 3VYSB 1GSAA 3I04M 3KWFA 1UPUA 4GZ3A 5A5FA 2V7QD 3FSEA 1DPFA 3EC2A 2G04A 4D4GA 4BAZA 1MCZA 3COPA 1L5MA 5GZ6A 3GJ5A 4DVGA 2FGJA 3NOVA 4G4JA 3JQ8A 4WADA 3GLFE 2CZGA 3KDSE 3PT5A 2ZI7A 1JJBA 1I7QB 2Q2NA 4EMTA 1O2DA 1Q0UA 3BMCB 4C7MA 1R4ZA 3QIVA 1OFVA 1O96B 3EE6A 2RBEA 3QEOA 4IYRA 4MULA 1PW7A 3KFVA 2O9JA 5B2EA 3CF4A 1YQTA 2VHXA 1ESZA 4F4CA 3KCQA 3GJQA 3U56A 1ESCA 2GRAA 4NFHA 3TXAA 1JR6A 3L92A 3M3HA 4NZZA 3FFTA 3LUPA 5JZ9A 3AR4A 2RJOA 4P5DA 1QK5A 4HMQA 2MINB 3KSDO 1S2OA 2IHNA 4BN5A 4B46A 1V5GA 1TQ2A 2C77A 3T6KA 1QQAA 4BQIA 4LDNA 5JV5A 4TYNA 4LQLA 1N2SA 3NYQA 1VHJA 2Z04A 3RRZA 3BE5A 4Y1RA 3S6JA 1VLQA 3OKCA 1DWPA 3D81A 3KU1A 4PZDA 2C1XA 1YJCA 3NX4A 5C4MA 2QD4A 4CL3A 3HHPA 3Q2IA 1CY2A 4M54A 4ESVA 3QEBZ 1GWNA 4F1KA 1F14A 3ZLBA 1HTWA 2PJDA 2C5BA 3N0XA 3RSLA 4D2IA 1JIKA 2FRXA 4IHJF 4J9VA 1LC0A 1Y3CE 4DLKA 4CL2A 5KNCA 4N48A 2MCFA 2H4WA 1P2GA 1EA7A 4QVKA 4X8OA 2YWFA 4RVNA 3EGXB 4OD0A 4MV3A 3GCWA 4PYMA 1XOIA 1I2ZA 2FMKA 3R5HA 4B0OA 2J6CA 4TL8A 5CEJA 1IN6A 1O3YA 1V8PA 4LJLA 4BZZA 3KYDA 1FJGB 3UW3A 3O21A 1Z33A 2BI7A 2IVZA 2MHCA 3DHNA 3RODA 3UJ6A 1HYEA 2B4QA 2CFTA 2QAGB 3ON5A 3PQDA 3W79A 2OC9A 2PDAA 4BEWA 2V3WA 3NB0A 2HA2A 1NOKA 3STXA 1SUCA 2QRKA 1IOWA 1CY4A 1U04A 5EESA 4BNHA 4BWYA 2GI4A 3TTYA 4D3YA 1NLMA 1KFBB 4DUZB 1I2DA 3CC8A 2AR0A 3GO4A 2EF1A 4PZZA 5EXSA 3HJCA 1X1DA 4R3WA 4F2DA 4RTKA 2C2XA 3GMTA 4XEUA 3UFXB 4DMLA 3M7IA 3D5EA 5EKSA 2RCNA 4YCDA 1YZGA 3MTQA 5EP1A 4F3CA 2VP9A 1WV1A 2YJZA 4N7BA 4UPDA 3LQ2A 4BYMA 3VZPA 3T52A 1OILA 1EGVB 4BO6A 1G8MA 3HCAA 3GJ7A 2IP1A 4D81A 3L8DA 1P9RA 4YAOA 1GZVA 4IF6A 3MFYA 4AZ0B 3AF5A 4G8BA 1ABEA 5K3FB 5AVQA 4Q9JA 1EWRA 1PT9A 1ULZA 3HEAA 3MBIA 1SM4A 4CEHA 2RGYA 3LUHA 4I50A 5T57A 3TEFA 3AJRA 4NCHA 2QGNA 1KEWA 3BREA 3V34A 1M67A 2CW5A 4FKMA 3SYMA 4B33A 3QEJA 4BU1A 1L7BA 2AOVA 3D64A 3WP1B 3NBFA 5IBPA 1E9FA 5F1YA 4J1TA 3RUCA 5B4VA 1V1MB 1MG0A 1YA4A 4YP1A 4TMVA 4F5ZA 4WEQA 1ECJA 3GYGA 3Q7RA 4FNAA 3F1LA 4MMZB 5CH5A 4LYGA 5G1NA 5IDVA 1DEHA 3SX2A 4OQZA 5EVJA 3OPQA 2J4DA 2JCSA 3PIDA 1B6TA 1QE3A 1LBIA 3FW1A 4JL6A 4TV8A 5EI5A 4B09A 2CNNA 3BD6A 3L0YA 2NV0A 2PUAA 3ZJ5A 1M2OA 3KUDA 2WSSD 1DARA 2GOYA 1P61B 4FHDA 2JFHA 4RTPA 3CEHA 4KSCA 3IDOA 4P82A 1NM5C 4Y1FA 1DBPA 4RK7A 1TMGE 1TXGA 3ELYA 5AKGA 3UJPA 2NO6A 3U44B 1D07A 1FXWA 4GOJA 3ZV5A 2A4KA 1Z5OA 3FHCB 3HM2A 5TDHA 3H6GA 4FZJA 1B0AA 1ZGCA 3FOZA 1GTVA 2W5UA 1TW3A 2AWOA 2F3RA 4URWR 2VSQA 3D8TA 3IKJA 5EZYF 5BVGA 1C9EA 4FB5A 1SBIA 1Z63A 2WFZA 4LBVA 3AL0C 5B64A 2NP6A 2ZRHA 2GRJA 1L5WA 4CKXA 4BS9A 3OX2A 3UO8B 4RKFA 1Y3AA 3HGMA 5JAQA 3V8MA 5H4GA 2ZB3A 3L0ZA 3BD8A 1JW9B 4L8YA 3UJ3X 4LF7B 3E9DA 4BL5A 3JQAA 5EGNA 1TM4E 1YI1A 4AF7A 2AJ8A 4HAXA 4JZYA 3TSWA 2V97A 1P39A 4LQDA 3MFQA 1FNMA 5EQJB 3DKVA 2ZJBA 2M6RA 1GKIA 3VU3A 1HURA 4AJ1A 2YZ2A 2FH5B 4BYGA 4RD6A 3SDBA 5KYXA 1DXYA 1TIKA 1Y5NA 2Q1WA 2WRZA 3ND8A 3PHJA 1M6WA 5AJXA 5C37A 1EXVA 2R6R1 3G23A 1LFAA 1IIRA 1U0BB 1XI2A 2AOUA 1HE8B 2VHWA 1Q0LA 5EPOA 5EJ2A 2F43A 2YX1A 4B8ZA 4REMA 2YY5A 4M4SA 2PZMA 5FHRA 3MWJA 2ZXFA 1L7PA 4NCKA 3PL5A 4WLUA 3PQ4A 1IVSA 3ISVA 3COWA 3OY7A 3DEFA 1UJ2A 3Q41A 1QONA 5MFPA 2RAFA 4BVLA 5J4HA 4LZNA 2A0FA 4NBWA 4AX4A 3H1FA 1RHUA 3AUJB 2BLLA 5GGXA 5J2TA 1MHTA 4C0BA 1GR1A 4KRXA 2P2ZA 2B21A 3KKMA 2G09A 1ODJA 1HFJA 1G5HA 1X7ZA 2CBGA 3KQQA 5KZMB 4RCVA 7AT1A 3TB6A 6NULA 1VL8A 3QG5A 1OXUA 3D02A 3E23A 3WLHA 1VMEA 4QUKA 2NYRA 2H7YA 3M2PA 3GJSA 2HMUA 4ESOA 3MNFA 1BDBA 4Y3UA 1D03A 1NNUA 2HUNA 2Z2YA 3MVEA 4MJ3A 5FPHA 3RK0A 2PXHA 1I5OA 1L1EA 2WSBA 3PJFA 4GOMD 3KG2A 2GM3A 3KWJA 4TQ9A 5FIUA 5FOUA 4UHKA 2Z1DA 4NEQA 1TM5E 1Z8NA 3AB3A 3DO5A 2W6MA 4TL7A 2QE7D 4B17A 2V4MA 2PKWA 3UJDA 1TFUA 1DCTA 1VRWA 1G8JA 1XT6A 2GWRA 4AQDA 1Y6ZA 3AY3A 1G5QA 2FZWA 3NYRA 4MVJA 3AHFA 3O1IC 5JAHA 1YKGA 3RYCB 1EFUA 3A36A 2GJSA 2PXCA 2ZBGA 4LXGA 1Z34A 2IFTA 1OZFA 3GFTA 3LUKA 1R15A 3QXHA 3C5CA 4F4HA 2NSHA 1UK6A 2QPTA 4ILEA 3FB4A 1RAIA 1IY2A 1QOZA 2DTXA 5GONA 4O1IA 3TN7A 1W46A 4B4DA 1PJAA 1SVNA 2Y0PA 2Q2WA 1JIVA 1Q2UA 1NMSA 2O8BA 1Q77A 3M6IA 2OCLA 4HYQA 1D4ZA 2WYWA 3USZA 4MCAA 2IEYA 5A7GA 5LIRA 4MSUA 3N07A 1JFVA 2QTBA 5TARA 1JX6A 4X20A 4LWZA 1F17A 1OXSC 2CVFA 3MS7A 1L5NA 1VL0A 4Y1EA 2Q7OE 4DTCA 4KSBA 4NPHA 4IMPA 2Q3EA 4OBBA 5B1YA 4R40A 1NVBA 1BKDR 2MSCB 3Q7QA 4FCCA 5I7WA 3EPRA 4CU5A 3V32A 2F3QA 2OTCA 1HKHA 1XTPA 1D2MA 1VYVA 4OBWA 4JNCA 4MUMA 4R9NA 5D1HA 3THWA 1LSUA 1TIPA 2Q2QA 3R40A 4HLUC 4CTKA 1YZVA 4F2HA 4CETA 3BCRA 5JALA 4MIEA 3FUTA 3V3TA 4WBSA 1MFZA 3QF4A 4I5GA 1MB2A 4UNQA 4OU5A 2P2DA 3GELA 4KOAA 4BNGA 4JZKA 2VWHA 1E5TA 4KNWA 4PR3A 1YJXA 5JS6A 1GYPA 3WGLA 1Y3BE 4K6MA 1DQZA 3OP1A 2AB0A 3CW9A 3S1LA 1QYCA 4OSOA 1XNJA 3CLHA 4RHCA 3ZGXA 4DC1A 1VIVA 2QR2A 4J90A 3R0VA 1GGNA 2P77A 3MJ4A 3PHGA 2A9KA 2EEPA 5FLEX 1SFRA 3HK2A 1VHLA 1NW7A 3ZNQA 3ESAA 3SQOA 3A4IA 4IDFA 3MCVA 5D51S 5K0FA 1FSZA 4G01B 3SM9A 1BWQA 5IVHA 1P5JA 3WMRA 2C7PA 3OCCA 2ILTA 3O8QB 2W9XA 3IQFA 4YECA 1YJQA 4WXEA 5TQJA 3HUDA 5AJWA 1N36B 3AZPA 2DJ5A 1ZISA 3V7NA 1O6GA 3W8FA 2JCYA 4ZI7B 2F64A 4WZAE 4JUIA 3RHFA 2QVXX 2WJGA 4OFZA 4PINA 5K3SA 4F93B 2R00A 3KP1A 2BGNA 5KNLA 5CT8A 5FBLB 3I5XA 1FYWA 3FDFA 1C0KA 5IXYA 5F9FA 1XNGA 1SC4A 4AJLA 4IIHA 2Q50A 1Q20A 1Q11A 1YVDA 1JKJB 1CRQA 2IYVA 3C7AA 2XTAA 4HGRA 1DC7A 3GRKA 4X94A 4V0NA 3LLVA 3EXG2 4PM4A 5LD2B 3U3OA 1O5OA 1OXVA 1M8KA 1BXKA 3DVLA 1XZHA 1B6SA 3N59A 1TL7C 3OCJA 4M53A 1K8QA 3DHEA 1DKLA 1POXA 4NE7A 5KMGA 1V7ZA 2ISCA 2REBA 1PE0A 2R2GA 3HB0A 3TJZA 3V8NA 3FKSA 2CLKB 2R8YA 1NHGA 1MJNA 2BCJQ 2WJJA 1F7VA 2BGMA 4HHEA 1Z29A 3ENKA 4HQFA 3KZXA 3U17A 1RAGA 3M4NA 4J6FA 4PLTA 2UZ4A 4P32A 1ST2A 3O8LA 3ZJ4A 4XSGA 5GM1A 3HUFA 2GPAA 2YC4C 1G9TA 2OD9A 3ZHRA 3DBIA 1LLDA 3P9RA 4YR9A 5J2UA 2JLUA 5FB3A 5KINB 2VAPA 4PGMA 3RYHA 1VYHA 3LGSA 5DNEA 3ITDA 1OB5A 4MKRA 4MYTA 3UJHA 1XFDA 3OETA 5CB6A 1HTBA 3D2AA 3LPMA 3MJCA 4JR1A 4UDOA 4RLFA 5HE8A 3E15A 3S2UA 1EVQA 4NEHB 3SJBA 2A92A 3GLVA 2I1QA 4Y6SA 3UH0A 4F06A 3I32A 4JH0A 2RK3A 3D7NA 4J0EA 5FPSA 5HQJA 2XSZA 3TCXB 4U7GA 4BO4A 5AK5A 4ZU6X 3QUQA 4HCJA 4JJ6A 3BK7A 3C15C 1H1LA 1ZK1A 3GYBA 4MEBA 5EMKA 3MUFA 2H0AA 2PUHA 4NY1A 3TW8A 1USUA 3LUBA 4V02A 3AVPA 1M74A 3DMHA 4EY4A 2AFRA 3QMWA 4NAHA 1WP9A 2FPXA 3DCNA 4LPKA 5JNTA 4M46A 3FWYA 3TGLA 4GKJB 1SHLA 1SPBS 4PGHA 2JK0A 2XUIA 4DQLA 1XCGB 3FFBA 4Q1VA 3WFJA 1QR2A 1VLVA 5ITSA 2J46A 2FG6C 4CMEA 4L0DA 2OPHA 4I5FA 3Q9UA 4OJQA 5C1BA 4PXAA 5FI5A 3DBHA 1CZUA 3QU4A 3WL4A 2VJQA 1RLIA 5ICCA 2A3RA 1SPXA 2MSNA 5KWJA 3HP1A 1NZJA 2LBPA 2W2KA 3H2YA 3OHPA 5IC4A 3IHTA 1EINA 4KGZA 3VPAA 1I94B 2WIGA 1J0AA 4L9WA 4OXXA 4QXRA 1TAHA 3DL0A 2GBFA 3GCZA 1RYHA 3K1ZA 1IEQA 4YMWA 4XTRA 3AHDA 3TKLA 5F5NA 4KXFB 1KMHB 3IUBA 3CKMA 4ZHQF 1HNXB 4DJEC 1TUEA 4G37A 3HACA 1IN7A 2EKZA 3LQFA 2IDZA 2XTJA 2GJ8A 3L0CA 3JY6A 3OE1A 4L5AA 1KORA 4UHCA 4DSUA 3C97A 3SICE 4Q3DA 4KH1A 4NR0A 3PVZA 2IHYA 4PZEA 3VXKA 2G5TA 4TTSA 3JV7A 5YASA 5ADVA 1UAGA 3DMTC 3UHOA 3K4HA 3ME5A 1Q3HA 1GGJA 3VZCA 1O4VA 2OD7A 5HE9A 1GT91 1RS0A 3NFYA 4OMDA 3PXEA 3A05A 1YRAA 4XDGA 1T9BA 1Y33E 2ZRKA 1C30A 2VSXA 2FE4A 1J5EB 3W5AA 2VPPA 4CTNA 4KITB 5K8VA 2I29A 3WLJA 4IILA 1KAMA 4HDSA 2B7CA 2NTJA 3NM6B 3E18A 3K9GA 2D5LA 1RWWA 2DYKA 3E9ZA 5IT9A 3PC8A 1YZFA 4K6KA 4WCFA 5AT1A 4LHEA 2QNIA 3CMMA 4MKIA 4PS1A 4CKEB 1I8TA 2F8MA 4MGIR 5BQPA 3RK1A 3TIFA 1BGXT 1Q3TA 1W5SA 3EEQA 4EX7A 3IT3A 4MVJM 3SR3A 4BOYA 1FK8A 2P79A 2QM0A 3SIWA 5L95A 1SIWA 1DAOA 1FYXA 1P44A 2I67A 2V5VA 3BMNA 2HWYA 4KPUB 1VGRA 2C2GA 1JNYA 3FG9A 4ML3A 5A5GA 3VTAA 5F5XA 2HO5A 2P9FA 2OV8A 4HD8A 2GGSA 3WK8A 4CCYB 1B43A 3G2NA 3IUMA 4NF2A 1B8UA 4G5RA 3SZMA 4AURA 1L4HA 1E3WB 4CMKA 4EEZA 1KFJB 4YMLA 3HJGA 4BRWA 4A6EA 3ZQKA 1NF2A 1D2AA 2QLJA 4C6TA 2H06A 4FYYA 2FPUA 5D84A 3CEJA 1QRSA 4ZMRA 2IOYA 1AD2A 1DJPA 3AINA 3GX1A 3LA6A 3RANA 5ALVA 3Q0EA 4QLBA 1PIWA 4M21A 2PZKA 4BPBA 1FF9A 3C2QA 1QB7A 1UXJA 5GJCA 4ZCTA 3ETDA 4KN6A 1N3LA 2D1QA 4FKBA 1MORA 1ZRNA 3AZQA 5JBQA 1U80A 4Z2YA 1IM2A 4R2XA 5AW4A 4RGBA 3QM1A 3U4AA 2B98A 3SFTA 4KXNA 5DBHX 2QR5A 3W7AA 4HYEA 1LBHA 3FTCA 3QVOA 3IEIA 5GMOA 2WYIA 2BEWB 3OHMA 3VHLB 1Z38A 5CK5A 3FAZA 1IC6A 1P1RA 1XL0A 1LEHA 2M1XA 3BYZA 4UE6A 1F8XA 2GZ1A 1R27A 3H17A 3K8OE 1P9NA 3U7GA 3KUKA 5TT0A 1W76A 2DHQA 2XZTA 2P41A 3F74A 2GAIA 4HF7A 4Q02A 2QP3A 5IRCD 2JGDB 1O94C 4XI9A 2DEUA 1KGSA 3NR2A 3WLTA 1LXCA 1VE5A 1X3SA 3N2IA 4HTFB 4OHZA 4DIMA 1VXOA 4EABA 2O8DB 5E9JA 3HZOA 3ZBTA 2YVQA 4BEVA 4YQFA 1Y1QA 3B48A 3OA2A 3NC1C 4DCJA 4OJYA 2G1PA 3IOBA 1P4GA 3I1JA 1SA0B 2C9DA 3OUZA 4PXYA 2Q9BA 1GFWA 2PRIA 4DCUA 2WNHA 1IQ0A 3VI4B 3S1SA 2AZMA 4O1MA 5COQA 2GSWA 2CUKA 3WA6A 5JAOA 5EFOA 2H1LA 3K2BA 4K46A 4CMIB 1ZIXA 4ZOBA 4A10A 5I7EA 3MWKA 1AQ6A 1TPZA 3MT0A 4HWSA 4RETA 4BTLA 1G19A 2BR4A 3GFSA 3WWPA 1YCFA 1U9IA 2CLIB 3ES9A 3HCFA 5DYGA 3MWEB 4MB2A 2NV2B 2HI0A 4LKOA 1X86B 3UXMA 5HOQA 5LQJA 5JD4A 4Z4HA 4M7RA 3K73O 4LCBA 5JNUA 2CEAA 1XDUA 1GPAA 2CNLA 1JDNA 4JR2A 4Z8XA 5ESXA 4ALIA 4HDAA 3PGJA 1L7NA 1HLDA 4ND8B 4ZAXA 3CCCA 1N2ZA 3PUYA 1IYZA 4G5SA 1Q19A 3C0KA 4HEJA 4H0FA 4MUNA 5TGZA 3D3NA 5M2QA 1S8AA 2WWWA 2XY4A 4OB8A 3IAS1 2BMEA 1P7WA 1UDWA 2J3EA 3N74A 2G1JA 5DPMA 4GZ6A 1LPNA 3DXFA 3EVCA 4RZ3A 4BCCA 4IDBA 1HT2E 3HCPA 4RYDA 2C2HA 1WSWA 3FVVA 2UZ3A 4CM7A 4HJRA 2RGRA 3TLXA 3DYIA 1LNSA 3LCJA 3AYXB 3KAPA 4E5NA 3CVJA 3VNBA 4GUAA 2CJWB 2OL4A 4WQMA 1MVOA 1SBNE 5DLPA 1EM8A 4NOKA 1ADFA 1BE6A 1J99A 4MPTA 4Y9UA 3OZFA 2IHUA 4R8KA 1BKSB 5FA8A 1QHNA 4DNPA 3HI6A 4IHKA 2G7ZA 1G21B 5A3JA 2I0FA 4UNIA 2ZU6A 2CYCA 3DOUA 5DGHA 3IPYA 3ZHXA 3RUFA 4CN9A 3BILA 2E2WA 4MVYA 1QE5A 1DRJA 2IW1A 3DOCA 1P2SA 2OZVA 2WG2A 1Z2PX 3UOGA 2DWCA 3GPDG 3O83A 3UN1A 1COWD 4DRZA 2X0DA 3UT0A 3CR7A 5D87A 1GRQA 2QA5A 3A1EA 4B5LA 2QYTA 1A9OA 4DLAA 1Y98A 4BCDA 4BMPB 1RJ9B 1WOYA 2FYTA 3DR3A 4O4HA 2ID4A 4RL6A 5J3JA 1RWVA 4ALLA 4B3RB 2FUKA 3WAGA 2WJ4A 3SLRA 4IDEA 2OGZA 2PBRA 4OQNA 2Q0XA 1FU7A 3EG9A 1VB5A 3PTAA 1RXIA 3OMWA 3KEOA 4J0CA 3B3GA 4P4NA 4RV9A 1VM6A 2B1JA 4KMOA 2VNSA 2ZIWB 3M6FA 5ETJA 1N6RA 1HZZC 2VSOA 4HB4A 1GTG1 4LMAA 5AW5A 3KETA 2D13A 2PX0A 1NVEA 2J5RA 1SZJG 2GEKA 1FA9A 3F6EX 4X60A 1MXFA 1TUGA 2RIRA 4JJ8A 2FVYA 1J4AA 1GD1O 2XLCA 1UP6A 3HCOA 3IDAA 4ATNA 4Q1DA 2P68A 2H4YA 3A6GA 3ESXA 3QNMA 2OP1A 5B5SA 1H8HA 3EODA 2P11A 4NV1A 1Z2AA 4YJ2B 5CXXA 1F06A 3EDQA 3L0IB 5IT4A 5ICMA 2WJAA 3WGIA 1PDVA 4IJMA 4YAEA 3H5RA 4RPKA 5CM8B 2O8EB 4J4BA 3U0BA 4EX6A 4INPA 4O4JB 1SCDA 1KQ3A 4P6VF 4TZ6A 5DNDA 2XYRA 1VL5A 2H1SA 4LV5B 5IZCC 3OBBA 2Y1DA 3HVIA 4TMTA 1PR5A 1QG4A 4E94A 1PV2A 1UPTA 5AP9A 3O91A 4A8JC 5FA5A 1H6AA 3ZY4A 4D0NA 4G5FA 1TIBA 3ELDA 2EKQA 4GOND 4M87A 5CFNA 3A9SA 1HL7A 4HV4A 3H16A 3LE8A 4QODA 4YMHA 3CPJB 3MAAC 3GR6A 3SBXA 4QUIA 2JVKA 4OB6A 2C9OA 4ARVA 1W0JD 1F20A 4Z86A 1CF2O 3HZHA 4J9UE 2X40A 4F0JA 1F0KA 3W5JA 5BNTA 1ORVA 5HRAA 1JJVA 2HU7A 2IZ1A 2QRZA 2MYNA 4NU8X 4OQDA 2QUBA 3SSOA 4LBZA 3LC0A 2GA8A 2O20A 1KH3A 3HKEA 2DQZA 2VQSA 2W4IA 2PFGA 2VPZA 3IL2A 5E4YA 4XR9A 1UP4A 2FVXA 1C3EA 2R8BA 5FBZA 3M5WA 3FBGA 3QWIA 1XLUA 5IAOA 4XDYA 1NV9A 2WA1A 5TV2A 3RFVA 2WAAA 2XE8A 4RSRA 2D1SA 3QOFA 4TX1A 3W6NA 2V6GA 2V5UA 2E49A 1FDVA 5JBIA 2D2FA 2DQYA 1JFTA 2G8LA 1PLLA 3QG1A 1WUJS 1OLOA 2Y9MB 1GSIA 4KZKA 1DQSA 1W5AA 2HSJA 4LSMA 2XDQB 5KWVA 2V1UA 1R7RA 3CY6A 1T6ZA 5F51A 3EH2A 2VAWA 2ZI9A 1TZJA 1KBOA 5FNVF 1MJFA 2YMQA 3B20A 4M6WA 3OOEA 1TGYA 4EW6A 5KIAA 3RC8A 2GCEA 3WB0A 5JISA 1LH0A 2ERXA 1M6NA 4CBVA 4R2JA 1LRKA 5LSAA 4ND1A 3RC9A 1E1MA 1WABA 2JFWA 4KK3A 3GJYA 3PWZA 5BR7A 1QPZA 4AKGA 1FBTA 1R0KA 2REXB 1WPRA 1T3GA 3EUWA 3F1KA 4RHEA 2BRUA 4UE2A 4FEYA 1PL8A 3TLBA 3O26A 4NZNA 2E6KA 3NO4A 2GD1O 1ULUA 3D7MA 1C8KA 4NJEA 4P35A 5FBHA 1LBTA 6CHYA 3GLSA 9MHTA 4BC0A 1JA0A 1N3YA 1RAFA 3BHMA 1NN1A 1WD5A 3CHYA 3FPAA 3HU2A 1BN6A 3R3HA 1QUFA 2AG0A 4N0EA 4Q24A 4BV3A 4EYSA 3T3NA 1XCBA 2NU7A 4OI1A 1P0QA 2IYPA 3QVLA 4U7TB 3UAXA 3VHXA 3G89A 3WAJA 4CTMA 1B26A 1KERA 2R2AA 4TMKA 5EKTA 3RVPA 3M4ZA 2GCPA 1MPXA 2JW5A 3ZZ0A 3FYSA 1OFHA 3PDWA 4HDRB 3W9BA 4DNXA 2FMTA 3FDJA 5AKHA 2ILVA 4LA4A 4GX5A 5IBRA 1MT0A 1Z22A 1J2UA 1XB2A 2AEFA 2GILA 4M0MA 5IDQA 1L8LA 2ZS9A 1P0IA 1S4QA 3DBLA 4JJFA 3VR3A 4CF4A 2HA0A 3A0RB 3WYDA 3BWCA 3CX4A 3P9QA 4N82A 4UM9D 3WGUA 4EPTA 1EESA 2YMLA 3E9MA 5B58T 4ECAA 1QYXA 2YXEA 3TD9A 4OOEA 2C84A 5TVGA 2PFSA 3NDBB 1MAAA 5CBKA 4F84A 2VYFA 2RAUA 5I7VA 4KSYA 1KVRA 1H1DA 2CF6A 1HTTA 3ZD9A 1L5YA 4EG3A 1T4MA 2CB9A 2ZT8A 3D3KA 3ET5A 2XRMA 3JQCA 1U8CB 4MV6A 4NOLA 1FSFA 3HJAA 2AMJA 4ER6A 5L4LA 1P31A 1IJKA 2XCQA 3HBLA 4C29A 5FBQB 3OZCA 5F9MA 5DGCA 2I91A 3SBOA 4B84A 4FUTA 4BRZA 4CMAA 1XXHE 4D6PA 5HZMA 4LJRA 2YRXA 2ZRJA 3O3NB 1U3VA 4UXJA 2Z6AA 3OFVA 4S24A 1EB9A 2A5GA 2FP4B 4L50A 2Z8ZA 2W98A 3NM4A 2NUTA 1TNDA 5HW0A 3A7DA 3EAQA 5KSZA 1Z4KA 4HNHA 1E6CA 4NCNA 5DZSA 3SXUA 2VPYA 3QU5A 4MDFA 3R44A 4UVIA 1XK7A 1J9ZA 3BE4A 3DWGA 3CUVA 4FEEA 2QRGA 2IYLD 3UA4A 1LLQA 2QM7A 3NT5A 2E6UX 1FLAA 4PBRA 2GLTA 2ODTX 4RZQA 3VVMA 4C01A 1WHSA 5F98A 5C18A 5AK4A 3LLCA 1RBZA 2NVUA 1JXOA 1TX4B 1ZCZA 4DKXA 3QFHA 2BSAA 2JFVA 4BVEA 3CLKA 2SKEA 4Z7QB 1FQKA 2AZ4A 4IIDA 4QXOA 1F6BA 2QMZA 1YIAA 3T9AA 4BLRA 2ADOA 4LTDA 2IP4A 1YFJA 3AM5A 3LYHA 4K1LA 5FQNA 3FYTA 4PYKA 4ZD6A 3AF6A 1GQ2A 1MC5A 2X2EA 1TJ5A 4C4TA 3QP9A 3VOAA 5LQUA 1Q0HA 1OKKD 3U1TA 1UC8A 1O8CA 4KO2S 2C3OA 1M72A 1VC2A 4IKEA 4TXJA 5CFZA 2QXUA 4F8JA 3GCXA 2XTNA 3JQFC 5LJIA 4Y6RA 1T26A 4TRNA 3HS3A 2HIHA 4E30A 1TM2A 4RCYA 2OFPA 1R5NA 4L5BA 1Q7EA 4XAQA 4FSHA 2JJYA 4LHVA 4L2IB 2R4TA 3D4NA 2C5HA 4M9RA 3ZXYA 1NYRA 4EJ6A 1NPTO 4EQ6A 3K70C 3TVYA 3EFOA 1J90A 5B57C 1C7JA 2EWVA 1X8JA 2FW1A 3WHIA 3PD1A 5BSKA 5BNWA 1UUFA 2XUQA 1BHQ1 4GFDA 4HLCA 1PZFA 2AOXA 4P92A 3N2KB 2DJIA 3AHIA 3CR3C 3BIXA 1VKHA 3Q88A 3QVUA 4QJ4A 4R3UC 4BN0A 1VB3A 2Y1LA 3BD9A 5A5EA 3JATA 3TLMA 1BE1A 3O82A 4A16A 3GDFA 4UU7A 2VP3A 4LRTB 4BGIA 2ZIXB 3AKYA 4YQYA 2J0UB 2GEFA 3PSAA 3KAJA 3SC2B 5BV1A 5KYWA 2NM0A 3V4PB 3HDYA 3K5WA 4LRYA 3NLLA 4X61A 4J16A 5HA5A 4R16A 3I73A 2OORA 2NTYC 2IWRA 3DAFA 3HWSA 4LSWA 4DV2B 1FUYB 1KI7A 4O8CA 3OICA 2ATXA 4KLCA 2FDCA 2O7RA 3ONDA 5DX1A 1E2BA 5AI5A 3LUDA 4JV5B 4QPPA 4TV8F 1UBMS 3T3GA 4KLNA 4PCAA 5ELLA 4DMUB 3H11A 2AFIA 4ARUA 3ZDDA 3RHTA 5D85A 1PNVA 4RK4A 4PYRA 2PS1A 5DWVA 3EULA 1E18A 1A9ZA 1EWYA 5JS2A 1H4QA 1GCOA 1GZ5A 2PL9A 2WAXA 1QFSA 1FXWF 1T4CB 2EEZA 3AOEA 4D3ZA 1KF0A 4M8KA 2IYUA 5HG0A 3FMGA 3VAZA 2CJFA 3KALA 4X9XA 4OA8A 3TIGA 4URZR 1N6KA 4KQKA 3DOEA 2VP5A 1XRJA 3HH8A 3DYBA 3PIRA 7MHTA 4CR6A 3T1NA 1RQ2A 2YOGA 5LQRA 2EFJA 4DIFA 3RM3A 3JQ7B 1E1QA 1ISFA 1HZJA 3FRHA 3LV8A 4WKOA 4M8LA 3OEYA 4W5OA 3I0MA 3JWIA 4TKLA 3VBCA 2O1XA 1MZPA 1H0RA 3GNQA 5ADWA 3AEKA 3OIVA 2NMVA 1AS2A 1JHPA 2ORIA 1ML3A 3H9CA 1QG0A 1HEYA 3SEAA 3ZZMA 4R71A 1QWSA 4P53A 2VDVE 4HAZA 1RIIA 4OV6B 2XVXA 1KO8A 3OVMA 3OZUA 4YFYA 5AWFC 2R751 1WCIB 4ESEA 2B9VA 1Z5GA 2J9XB 3M6LA 2ZCVA 4UZFA 1GYQA 4POAA 4WKCA 4HUTA 3MAJA 4U1RA 4KTVE 1ZIOA 1LQUA 1N5IA 5G4KB 2B2XA 1U0NA 3VKHA 1OLSA 1EFPB 1DI0A 4FOPA 4GOOD 4GYJA 4PZAA 4ZARA 3L8MA 4GD3Q 3RFUA 3CFYA 1HNWB 3AW9A 4OFWA 1N6OA 4TTQA 3OOJA 3SX0A 5SYNA 4CF6A 2Y3IA 3BXPA 3ETCA 4LAFA 5I9TA 5A04A 3WNDA 3OEHD 1FMJA 3V8BA 5AVJA 4GI2A 4Y7CA 1BOFA 2R5FA 1Y81A 3TQIA 2C54A 2X3YA 4F91B 4U5XA 1ECLA 1VCMA 2RGNC 3L7MA 3OOHA 3RABA 3D1LA 5J2TF 3RYTC 1PWEA 1MO4A 2G25A 3LWBA 4UM5A 3S55A 3SS9X 2HQ1A 2DBZA 3H5WA 4Q93A 1GDTA 4TMXA 3ANMA 5HM8A 2R8EA 3MYRA 4P86A 5HMLA 1X74A 4DCOA 3NAGA 4ZVSA 2C7GA 4R2IA 3F6SA 2F9LA 4MW7A 4V2IA 5BYJA 1LZKA 4EI7A 4I1YA 2C2WA 3BRQA 3GEHA 1MR3F 5BN1A 1G6KA 5K1ZA 1AA6A 4ZEOA 5EFZA 4DYHA 4IJVA 2CC2A 3ZQJA 3WAKA 1RWOA 1KIAA 3EZXA 3JS5A 3HDHA 2R4QA 4Y8VA 2GCGA 3TL2A 3WOVA 1HC7A 1KJNA 2VNAA 5ICEA 3EDCA 1T1EA 4RD4A 1KYIA 1IWOA 3RQSA 2BKXA 3IV9A 4FGWA 3N7AA 4G5YA 4O2LA 3K15A 2CD9A 1N2EA 1JBQA 2ZT5A 3D4IA 3Q11A 2OHIA 3WL7A 3IJEB 1BO6A 2WF5A 2ZJ8A 4M0DA 4CTJA 4DIEA 1LVGA 2Q3FA 3N7UA 4EJ2A 4X6XA 2YXDA 3W2HA 4MVJP 3PQ5A 1OQAA 2QBYB 2XMGA 2XNHA 1BXZA 1C5KA 4QUHA 1EWQA 3SF8A 3IP7A 2HT1A 3BGIA 3PG5A 1C1DB 3UV7A 2CNBA 3B6EA 1WZCA 4M7OA 3T1OA 5GONF 3RVOA 2P9JA 1J8FA 1BMDA 4IIUA 5CG2A 1DWUA 2DCMA 4RWZA 5CVTA 4TS4A 5IXJA 3JPYA 2COUA 2RI0A 3IIKA 2V55B 2V6MA 1WNFA 3DZGA 3CLRD 4BJ6A 1RJWA 2G70A 4FB4A 2BFNA 1YDHA 2OZEA 5A7HA 3JWGA 4X95A 1ZHHA 1R4NB 2VPQA 3BGDA 1FTWA 4Z8YA 4DJAA 3W78A 3WZMA 2V7GA 1Z0IA 1ZR2A 4I2VA 4WWHA 2VP6A 1EUYA 2ZUFA 1VCIA 4M9XA 4D1YA 1CULC 4Y2RA 4JIMA 1IY1A 2V7PA 3X1KA 1H0HA 4RFSB 1FP4B 2EQ5A 2QUAA 1F9AA 1E1YA 8AT1A 1M2GA 5DN6A 5IEBA 1ID1A 2O3TA 2XB9A 4CQNA 3UXYA 3EUFA 4R69A 3KZOA 1QP0A 2YR0A 4XM0A 1EK2A 1K6XA 4LZPA 1U28A 4OXNA 5E1DA 4UATA 3GLFB 1CUUA 3FMVA 4RD1A 4M0LA 2ZBVA 3NORA 1T0PA 1KYQA 4M1EA 2WNSA 2GSDA 3F3MA 3VI3B 4AT1A 1JDBB 5EWLB 1K2WA 1QR6A 2OCKA 2OQ2A 2Y99A 3C4QA 4OSPA 4RO0A 2J3DA 5CNMA 3G59A 4G1EB 5GOZA 1VLMA 3GP5A 1AM4D 4B79A 5AW3A 1EXDA 1W88B 1MEJA 1J5PA 3SZUA 2QTVA 4DPKA 4EUSA 1PI3A 1Y63A 3MCWA 3MIIA 4P3PA 1AV6A 4H7PA 1DIRA 4Q19A 4OI2A 4A27A 4DCMA 1U94A 2J45A 2RI6A 2Y27A 2UVPB 2UYGA 5JXHA 4GXRA 2WJ3A 1P77A 2X8AA 1RM5A 2P9YA 1Q1QA 2XXBA 3PGLA 3O0DA 5H02A 4B9EA 5J23A 4FUQA 5LNK1 1RPTA 3BGSA 2H4JA 4YCCA 1FFSA 4BZXA 3MCTA 1OH6A 2QWXA 5C7LO 2IP2A 2KWIA 4Q7MB 3SKVA 1G3QA 2I03A 3P2EA 4PNEA 2PLWA 1L5SA 3QELA 1E7SA 2WNIA 3D6TB 5TVKA