3WWPA

S-selective hydroxynitrile lyase from baliospermum montanum (apo2)
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
265
structure length
265
Chain Sequence
b'EGFMVSAHFILIHTICHGAWLWYKLIPLLQSAGHNATAIDLVASGIDPRQLEQIGTWEQYSEPLFTLIESIPEGKKVILVGESGGGINIALAAEKYPEKVSALVFHNALMPDIDHSPAFVYKKFSEVFTDWKDSIFSNYTYGNDTVTAVELGDRTLAENIFSNSPIEDVELAKHLVRKGSFFEQDLDTLPNFTSEGYGSIRRVYVYGEEDQIFSRDFQLWQINNYKPDKVYCVPSADHKIQISKVNELAQILQEVANSASDLLAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords (S)-hydroxynitrile lyase
publication title Structural and functional analysis of hydroxynitrile lyase from Baliospermum montanum with crystal structure, molecular dynamics and enzyme kinetics
pubmed doi rcsb
source organism Baliospermum montanum
molecule tags Lyase
total genus 99
structure length 265
sequence length 265
chains with identical sequence B, G, L, M, R
ec nomenclature
pdb deposition date 2014-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3wwpA00
3NUZA 1CUYA 2HADA 3OPMA 2QR5A 3AUKA 4J0JA 4Q3OA 5ALYA 1ODTC 5DNWA 1S8OA 2O2GA 2PPLA 1W75A 2QM0A 4PNZA 1IVYA 1IUNA 2QVBA 2I3DA 2XUJA 3O4HA 1A7UA 1LPMA 3R3VA 5FV4A 4MEBA 5CXXA 1K5PA 4MJ3A 3D2AA 1GT6A 1O6FA 3EQ9A 4GLBA 3HABA 1UFOA 5ALZA 3WYNA 1BE0A 3H1AA 1QIMA 3CN9A 3MUNA 3GROA 4B84A 4BE4A 2B61A 5EGNA 4H77A 1P0IA 2WJ4A 1XRPA 3BF7A 2WJ6A 3EBLA 5FPQA 4C88A 1GZ7A 1ZOIA 2HA2A 3R0VA 2WQZA 1EK1A 1QIHA 4M0FA 2XMQA 4EA6A 1QO9A 3RKSA 5HQ3A 1X70A 2C5FA 1CUFA 4AO8A 4HAIA 7YASA 3M82A 2XMRA 3WJ1A 2WIDA 4F5ZA 1TK3A 3RM3A 4QDOA 5KWJA 1JI3A 1IUPA 5JAPA 3QVMA 5YASA 1QZ3A 3DOIA 5JD4A 1QJ4A 2XMSA 4HTAA 5FPPA 2C58A 4Q34A 4W9RA 1KU6A 2BCEA 4B0OA 4AO6A 1ZD3A 4BZZA 1JU4A 1XKTA 4H18A 3W04A 2JF0A 3VKFA 2HA0A 1VXOA 4BRSA 5CH3A 1ZI8A 2O7RA 2WFLB 3H18A 3PFCA 2EDCA 4DNQA 2WTNA 3WZMA 1HPLA 4HRYA 3FNBA 5JYCA 3WWDA 3IUJA 3IVMA 1YA4A 4QWMA 3V48A 1H2XA 3ZWQA 3I28A 4H7DA 2ES4A 4BDSA 4OU4A 2OAGA 5EHZA 5IKXA 2WFMA 2BUAA 3I6MA 5CT9A 4OU5A 1N5MA 3GUUA 3HRHA 4GHWA 5ALFA 1XLVA 3ZLVA 3LP5A 1WCYA 1XZCA 2B20A 2OLEA 4UHBA 4A5SA 3AIOA 4QDXA 4I19A 5ALMA 1VE6A 2ZJ6A 3OTQA 4J03A 1YSCA 2VQ6A 1EVQA 3BIWA 4EY8A 5ALJA 1ZD4A 3STUA 4C89A 1FFCA 3NGMA 4RGYA 3E3AA 4D9JA 2XMZA 2H9YA 1LPOA 1XRLA 5BOVA 5FDFA 4KEAA 2WUDA 3PFBA 3FYTA 2XDWA 5AIAA 4BZWA 1H2ZA 4H7KA 1Y7IA 1K63A 4UBNA 3D0KA 4X71A 4EZIA 2ACKA 1TRHA 3CXUA 4A16A 3D59A 5ALQA 1SCIA 5HFAA 4EHBA 1UOPA 1RP1A 2EDAA 1P0MA 5JAUA 4Y2RA 4HXEB 4BP9A 5ALOA 5AM1A 1HL7A 1CFJA 4MQLA 2AJDA 5ALTA 2H1IA 4OSEA 4KAAA 4KYVA 5JAHA 2XLCA 3JWEA 2RONA 1BCSA 2W6CX 3B5EA 3WL6A 3GELA 3WWEA 5JZSA 1HQDA 5JANA 3BWXA 4K6KA 4N8DA 4PSDA 5T4FA 5AOCA 1JJFA 5ALLA 4JH0A 2WFZA 2GZSA 3ZI7A 3VISA 3QH4A 1J06A 1GPNA 1XZEA 2HRRA 1IZ7A 1VA4A 3O0DA 5JD6A 1NU8A 5DYTA 1DT5A 5CT4A 4UBJA 2XUFA 1CEXA 4N5IX 1LNSA 5K3BA 1XLUA 1CUAA 3W06A 4QE3A 3FYUC 3S2ZA 1K4YA 3G9UA 3HZOA 2RHTA 2VJBA 2CBGA 3U1TA 1FJ2A 3TRDA 3OURA 5ALSA 4J0HA 1QE3A 3D2BA 5E4YA 3RLIA 3G0IA 5SYMA 5HF6A 1U8EA 4MXDA 4Y2QA 5JD5A 1ZJ4A 3C43A 1BN6A 3BXPA 5LLSA 4IH4A 4HZGA 3W9BA 5KBYA 2CZQA 1UT6A 3HI4A 5AI6A 5ALGA 1CUVA 5HCUA 2PU7A 4DTCA 2ZYIA 3DEAA 3SK0A 1CQWA 5IVIA 2GBIA 2ORYA 3IUNA 1ZGBA 2BFNA 3PE6A 1YS1X 3MUOA 5K3DA 1J1IA 5ALXA 1LZLA 3QPAA 3ZLUA 2WIGA 1QIJA 1MX9A 1XZGA 3FVTA 5K3FA 1BEZA 5FRDA 2V96A 1UK8A 4V2IA 1VKHA 3FOBA 4DM7A 5E4TA 4L0CA 2AJBA 3V1NA 5ALWA 3ESCA 2JEZA 1W6RA 3M3DA 3HLKA 1NU6A 4N8EA 2AXEA 5LZ7A 2XUQA 3T4UA 3HEAA 1QIEA 3C5WP 3FSGD 3OM8A 4L9AA 3STTA 4UFPA 2QT9A 3D3NA 4HS9A 3DCNA 5HK9A 3ILSA 2I3ZA 4OYYA 4YASA 5A7GA 3WA7A 5EHXA 3WK7A 4G9GA 5A2GA 2UZ0A 2XMDA 5AKLA 4IH9A 4PV7A 4L3WA 3DLTA 1MT3A 1QIFA 1FFBA 5HKBA 5AKHA 4U2DA 2WG2A 3PUHA 4X90A 2VAXA 2JBWA 2QXTA 5EIHA 1EB9A 4QLAA 2DHCA 5K3CA 1BU8A 4CCYA 2XUAA 3GFFA 5ISMA 2PBLA 2C0QA 1E5TA 4BDTA 5AI8A 3DKKA 1DQZA 2H7CA 5ALRA 1R88A 2CEKA 1WB6A 3NWOA 5LZ8A 4J3JA 1R3DA 2XQFA 1AQLA 1JJBA 2Z5GA 4Y2JA 2PSEA 1MN6A 5HF5A 5ALUA 5CRIA 5EHNA 3KWJA 4FFVA 2QJRA 4WDQA 1Z68A 4P08A 4WFJA 3G9XA 5AIBA 1GQRA 3H2IA 1YAHA 4DMHA 4AX4A 1WM1A 4GBGA 4UBIA 2XQIA 3KWFA 4X6YA 3HC7A 4FHZA 4CG2A 1YB7A 3I6YA 1GKKA 1XQYA 1VA5A 3QPDA 2W22A 4ZWNA 1Y37A 3ED1A 1THGA 1EVEA 2H7YA 3F97A 2VSQA 3QMVA 3ESDA 4LIPD 5ALHA 1A8SA 4UBKA 5AP9A 1DX4A 2ZJ7A 3SC2A 5IVKA 3WI7A 1L7RA 5EIEA 2ECFA 1EHYA 2VT6A 1CUBA 1XZLA 3WMRA 5EFZA 1U2EA 5JIBA 5HQ3B 4X6UA 1OCEA 2XUIA 4E15A 3SX4A 3DOHA 3G02A 2C0PA 3G0BA 4X00A 4WY5A 2AJCA 3H04A 4I4CA 1LZKA 1XRQA 4J0IA 4PW0A 5LP1A 5HZGA 2XQJA 1YA8A 5AI0A 2CMFA 1Q84A 3MGAA 2Z8ZA 2DHDA 3ICWA 2XUHA 5ALEA 2OGZA 5BWCA 1DINA 4NZZA 5AKIA 1SFRA 4B6GA 1AX9A 5CT8A 1F8UA 4ROTA 3OOSA 1UOOA 3H2GA 4GW3A 1ZI9A 4U2FA 4AMYA 5EHQA 3QYJA 5DTJA 5DYYA 5AM4A 4BYMA 1Q0RA 3DQZA 1F6WA 4FTWA 1Y7HA 2WLSA 4KE6A 2OCKA 1QIIA 2V97A 3DYIA 4LYDA 4MYDA 5AI5A 1QGED 5D7BA 2HA3A 1BCRA 3C87A 1YAJA 5CMLA 1XRRA 3QBJA 1MO2A 2HU8A 4FKBA 3H0CA 5AKZA 4AXBA 1VZ3A 4HRXA 4QWWA 1XKLA 1R50A 1CVLA 1VJ5A 4CG1A 4X85A 3O4GA 4H7FA 1AGYA 2WG1A 2Y2VA 3WLAA 1WHTA 3QM1A 3AINA 4UBLA 5JZ9A 2QMQA 4KRXA 1A8UA 1WPXA 1TCBA 2VJAA 2LIPA 3ZLTA 2R11A 4U2BA 2ONCA 1UKCA 4X97A 2OG1A 3WWCA 3V9AA 5JARA 5CURA 1XZMA 1EDBA 4BVJA 1JMYA 4LKOA 4MQMA 2HHAA 2IX9A 4MWTA 1ACJA 5A71A 2D5LA 2EEPA 4M0EA 4H0CA 1E3QA 5HF9A 1F0PA 1R9MA 5AI9A 1QIGA 2G4LA 2WHQA 4TVKA 1ETHA 4Q3KA 5ALNA 3BIXA 1JT2A 4G4JA 2RHWA 4WY8A 3WK4A 1EDEA 2HU5A 3TGLA 2OGTA 2J4FA 3K6KA 3WL8A 3R3ZA 4AZ0A 1CV2A 1W4LA 1THTA 2GYUA 2C5GA 4CI9A 4UPDA 4Y2PA 2BAGA 4GEGA 3IDAA 4FLFA 1FSSA 1CUDA 3K2IA 4IQ4A 1XZBA 5DLPA 2XMCA 1CUXA 3O4JA 3R3XA 2ZSHA 4FBMA 4X93A 2FJ0A 3M83A 1SCKA 3O95A 3I2KA 4B9AA 2DCMA 5BWBA 2PM8A 4WCVA 4KE9A 2WHPB 3R3WA 2JGJA 1D07A 4U2CA 2P8SA 4J0CA 1DWOA 3DDUA 1C4XA 2CJPA 4B85A 1ZICA 1HKHA 2GBCA 1QTRA 3A2LA 5AH0A 1YB6A 1LPSA 1G4HA 3ANSA 2WUGA 4BCCA 3R3UA 5IVHA 3CN7A 3FYUB 5AK4A 4X6XA 4K6HA 4MEAA 2QXUA 1YS2X 1MX5A 4ZXFA 4OD0A 5AKGA 3KXPA 2WFLA 4ZRDA 3PF8A 5AKEA 1LGYA 1LPBB 2HL6A 4ARBA 2I03A 4OUKX 5HK8A 2G63A 2WU3A 3QZUA 1ZJ5A 1TCCA 4EUSA 2WM2A 4AN0A 5C8ZA 3C8HA 4XJVA 5CH8A 1QFSA 2PX6A 1ZD2P 2PSDA 1PFQA 3G9ZA 3WA6A 5FKJA 4B81A 4EY4A 2GZRA 2OXEA 5AK5A 2BUCA 2ZSIA 2ZYRA 4BBZA 4EY7A 2JGIA 1SC9A 1I6WA 3E0XA 3C45A 2D0DA 3ANTA 3DL4A 5H3HA 2C7BA 5A6VA 2VT7A 3FSGA 4QLOA 3G7NA 1JJIA 5FLKA 2RGUA 2XE4A 5D6OA 1CUCA 2HU7A 3PI6A 2G5TA 4G8CA 1MTZA 4G8BA 2Y6UA 3V1KA 5JASA 4MYSA 3WKDA 5AICA 4FLEA 2Z3WA 4Q05A 4XIIA 4UUQA 1JKMA 1YR2A 3RARA 5AM3A 5AO9A 3D5EA 5ALPA 4J0GA 1Q83A 5ALKA 1EINA 1F0NA 2OCIA 1QONA 2QOEA 1CUIA 1BN7A 1CUSA 1VE7A 4DNFA 3WYDA 4DSAA 4OYLA 3AZQA 2OPHA 5DNUA 1NX9A 5KWIA 3CCBA 3DNMA 4JNCA 3WK9A 4AB1A 3PUIA 4P9NA 1PV1A 1MNQA 5HKAA 1CUGA 2JGEA 3BF8A 1ODCA 4FFWA 3JW8A 1H2YA 5AKJA 5IH7A 4UHCA 2H7XA 3R40A 3F9CA 2WIFA 5FOQA 2WHRA 1OXMA 4Y2XA 1EX9A 2PSJA 3OC0A 3W05A 4BAUA 3H17A 3AZPA 1WOMA 1CR6A 1C7IA 1GXSA 2ZYHA 5LZ9A 4H7HA 3R41A 3F8SA 1LBSA 1LPPA 2WIKA 2FX5A 1BRTA 1W76A 3I2FA 5AM5A 5AOAA 1UKBA 3QPCA 4WDRA 5HFNA 1XRNA 1XZAA 3WKAA 4ZGBA 3G0DA 4CIAA 2Y2UA 5EIAA 3AJAA 3VDXA 3ESBA 3H1BA 3EIOA 2Z8XA 1C7JA 2OQIA 4UFNA 4QDZA 1XZJA 5EI5A 1ACLA 2IITA 4FNMA 4N5HX 1N5RA 2VAVA 4ZI5A 4KJXA 3STYA 2VJDA 1AURA 2BJHA 4LXGA 5SYNA 4X94A 3H2JA 1CRLA 1R4ZA 4CCYB 3VVLA 1ODSA 2WG0A 4Y2TA 3FAKA 1YCDA 1UK6A 2WSLA 3C70A 1XRMA 4X91A 5E2IA 1UZAA 2ROQA 1WB5A 3C8DA 2J4CA 4IHAA 4HXFB 1LPAB 1XZIA 1E8DA 2PUHA 5ALIA 5LZ4A 1E66A 5JALA 2V9ZA 1XZDA 3UUFA 3KD2A 1QIDA 3QMMA 3WZLA 3SWWA 4NVRA 1IZ8A 5I8PA 2O2HA 4BCBA 2XLBA 1GQSA 1H22A 4QEKA 4W1SA 3IURA 2HM7A 3HJUA 5DJ5A 1FFEA 1K8QA 3RK4A 3IA2A 3WK5A 2RIPA 1EB8A 3UMJA 5KREA 4DMKA 1UWCA 2PSHA 2XUDA 4UBOA 4ARAA 2PSFA 4U2EA 1IUOA 4F0JA 2HDWA 4KR0A 3QMWA 3WL7A 1J2EA 1QTIA 3LS2A 1ORWA 4DNPA 4X92A 4DNOA 2XMBA 3D7RA 1CIJA 3VXKA 4FWBA 2XI4A 1HLGA 3L1JA 4N8SA 4FBLA 1GPKA 3JYHA 4ZREA 4QNNA 1O6GA 1XFDA 5DTIA 4EY5A 4K6GA 4B0PA 1ZIYA 1VZ2A 4AZ3A 3C6XA 5AJHA 3MVEA 3O4IA 4QA9A 1HDEA 5C81A 2QKYA 5A62A 4KAFA 4BVLA 1OILA 2JGMA 4AMZA 4CFSA 2WTMA 2PL5A 2WU4A 3DS8A 2CUTA 1MU0A 3DYVA 4O08A 3A6ZA 4I3FA 3T52A 4B82A 2V98A 2ACEA 1USWA 2HA7A 4Y2UA 2E3JA 1B6GA 4FMPA 1XROA 3LIPA 3W9UA 1EH5A 2IIVA 2Q0XA 4ETWA 1DX6A 2ZVDA 1CUZA 3L1HA 5E4JA 1GKLA 1EI9A 4H7EA 1Q0ZA 4XX1A 1E89A 2HFKA 5AHXA 5IVDA 4E11A 1JU3A 4GXNA 5AM2A 1XZKA 4IH1A 4NS4A 1R9NA 4OCZA 2Y6VA 5HF8A 1CPYA 3WQHA 4Y9SA 4Z49A 2WKWA 1BEEA 3OG9A 5C8XA 5CXUA 1JFRA 3HACA 5DWDA 5JATA 1E8NA 3VJKA 4XVCA 1LPNA 4ITVA 3O9VA 4GECA 4KRYA 1ZGCA 4C01A 5K5EA 2PVSA 1CUEA 2QS9A 3EQ8A 4C6HA 5I7UA 4UHFA 4J0KA 2YASA 2B4KA 4JEIA 5CTAA 2ZYSA 2HFJA 4BTLA 3L1IA 4G5XA 4YPVA 3ZV7A 1VXRA 4DMCA 2JEYA 6YASA 5AM0A 4K5QA 2VEOA 1WB4A 4BP8A 2OQVA 2PU5A 3GZJA 1CUHA 1QO7A 3HXKA 3KDAA 4QDTA 4AN1A 3O9MA 2OCGA 1SOMA 1YASA 3H2KA 4F60A 4U2GA 4PO3X 5AK3A 4Q82A 3N2ZB 4ZV9A 4BTVA 3C5VA 3STVA 3FWHA 4BAZA 4X95A 4H35A 2BGRA 4LYEA 1DWPA 3GBSA 2WIJA 1AMNA 3BJMA 1M33A 2DQZA 1J07A 3F98A 5ALDA 1XQVA 2NW6A 3FLEA 1HBJA 3AIKA 3STXA 1DQYA 1W1IA 4X3CA 1MAHA 2JGFA 4BRZA 2XQGA 5AKXA 3BDIA 2OGSA 3TJMA 3Q8WA 4X7BA 3P2MA 3I2GA 3V1LA 5K3EA 4K2AA 4EY6A 1CQZA 4FDMA 2VA9A 3A2MA 5T4BA 1GGVA 1AKNA 3DL7A 4P92A 1WHSA 2X8BA 4E14A 4C87A 4UHEA 4PF1A 2ZJFA 3Q0TA 1ISPA 4J7AA 4BATA 5CBKA 1TIBA 3NOXA 3YASA 4YX9A 2DHEA 5FP0A 4BVKA 4G9EA 2QZPA 2QJWA 1UKAA 3V1MA 5JAOA 3TEJA 1UK7A 4B9EA 4DIUA 1XLWA 3A2NA 4AO7A 3DJYA 4OPMA 4OB6A 1ZIXA 4IO0A 2BUBA 2DSNA 3E1GA 3E4DA 4CCWA 3C6YA 1EDDA 4DSZA 3KSRA 3LCRA 2RAUA 3DD5A 4TGLA 5FXMA 4C4XA 1L7AA 5F4ZA 3F96A 1TCAA 3IUMA 4Y2SA 4OB8A 3WKCA 5C8VA 4WFIA 4RE5A 2AJLI 2CB9A 3G9TA 4S0XA 1X2EA 2WJ3A 4LXHA 3LLCA 5D3ZA 5CH5A 3B12A 4E46A 2YXPX 2DFPA 1A8QA 2J3DA 1KEZA 3D2CA 3WIBA 5CT6A 2RI6A 3KOOA 3IBTA 3DKRA 5T4HA 3C6BA 1XQWA 4P93A 5J3JA 3H19A 5K3AA 3STWA 5C7YA 4UBMA 2CKMA 1MAAA 3B3QA 3ZPXA 1BS9A 3VJLA 1L7QA 4BE9A 4B83A 1RYYA 2O7VA 3I6ZA 5FUMA 1MNAA 2GBFA 2VJCA 4Y2VA 2PKYX 4DLNA 4DGQA 2JIDA 4W63A 3QITA 1W52X 1A88A 2QUAA 3D4LA 5LIPA 4OB7A 4CIBA 2I78A 1MJ5A 4HVTA 2WHPA 3M81A 1DT3A 4EBBA 4KE8A 1EA5A 4BB0A 3S8YA 2XUGA 1XZHA 3LIIA 1EXWA 5LKRA 1FFAA 1GPLA 4JUIA 2XQKA 2XMGA 3G0CA 5BV7A 4W1QA 4B80A 2GYWA 3PICA 4L72A 3VJMA 4RNCA 3WKEA 1N8SA 3FYUA 5DNVA 3FCXA 1B41A 5AKYA 4Q1VA 5ESRA 1DTEA 1K6EA 3IULA 5AI4A 3HYSA 3G0GA 1XZFA 2G5PA 4KE7A 3WKBA 2J3QA 5K3FB 2Y1KA 2VTVA 5JADA 2DR0A 1DU4A 1PJAA 1X2BA 3I2HA 3ICVA 4G1FA 2HA4A 2FJPA 2C4HA 4EB0A 3A70A 1P0PA 3BL8A 3G8YA 4QDUA 2XUOA 3EF3A 4GI1A 2VATA 3PDCA 3FBWA 4HXGA 3BDVA 2HIHA 1FFDA 3HSSA 2GBGA 4A23A 1QIKA 3K9BA 1DWQA 3N0TA 4LXIA 3WJ2A 1ZI6A 4XWGA 4GWLA 2YH2A 4BC1A 1TAHA 4BC0A 4M0MA 1LLFA 2JGLA 3R3YA 4PQEA 1N1MA 5AOBA 3IIIA 4W1PA 2Z3ZA 2O2IA 5I9IA 1AC5A 1U4NA 1H23A 4UFOA 1VLQA 4FNGA 4NMWA 5LYYA 1U65A 4FLMA 3I1IA 4PSUA 2PUJA 1MPXA 3U0VA 1QFMA 1QOZA 5AKKA 1EK2A 1H2WA 1CUJA 4Y2YA 4DYHA 1G66A 2YYSA 1LBTA 3WIOA 1VOTA 3GA7A 1CUUA 3W2TA 2R8BA 2XB6A 3BJRA 4CG3A 4BCDA 4AQDA 3IUQA 4G8DA 1TQHA 2OCLA 4WJLA 2BKLA 1R1DA 4WFKA 5LZ5A 3I1YA 1IMJA 1RWQA 2X5XA 4KACA 4QZVA 1KU0A 1BROA 1XQXA 2JGKA 2HRQA 4KAJA 4RE6A 3C6ZA 2QTBA 2FUKA 3PF9A 5A7FA 4C4ZA 3H2HA 1UK9A 2B9VA 1P0QA 3F67A 5LZ2A 2QUBA 4BAGA 1E8MA 2WUEA 4JYMA 4TPKA 5CT5A 4C4YA 1MX1A 3AIMA 4YK7A 4G4IA 4FOLA 3I2JA 2WILA 3IB3A 2XUKA 4JYPA 5LKAA 5D3KA 3I2IA 4ZV7A 2WUFA 4Q3LA 1CLEA 2XT0A 1G42A 4F21A 3FLAA 4Y7DA 2HA5A 2OAEA 5DYWA 3BE8A 3VVMA 3AFIA 2K2QB 4RPCA 1TKRA 3CCCA 5T4EA 5A7HA 4INZA 1QLWA 3UUEA 1CUWA 2QRUA 4LHEA 2GYVA 3AZOA 5ALVA 1JMKC 5JZBA 3FCYA 3EQ7A 3FLBA 4H7JA 3WK8A 2DQYA 2AJ8A 3X3HA 3WL5A 1T4MA 1ORVA 2BGNA 4H7IA 3ESAA 4DMFA 1UOQA 1G5FA 2XUPA 3AILA 4J0DA 3WK6A 3WWPA 1AZWA 2X76A 4G4GA 3WWOA 2HA6A 5CW2A 1UXOA 4UHDA 4MWSA 4UHHA 4W1RA 1SCQA 1T2NA 4PSCA 1AUOA 1WPRA 4B7ZA 4GDMA 3FVRA 1ZD5A 2VF2A 5AK6A
chains in the Genus database with same CATH superfamily
5KNDD 5HGXA 1XTUA 4Q7MB 4IPTA 1H42A 3L0CA 4CGZA 1EE9A 3KYDA 1B93A 1Z7GA 2WSBA 1EP3B 1G5QA 1KMHA 1I24A 2JDIA 1WHTB 2OGUA 5ALYA 5SY6A 3FUXA 5ECWA 4P4NA 2AUMA 1KSGA 1D09A 2W2VA 4HC4A 3IKLA 4LJRA 5JS7A 3ZH9B 3KXKA 1SCAA 2W2LA 2O2GA 1L5WA 2CDRA 2EBWA 2L18A 1W75A 3HDQA 4QYIA 5TT1A 5H5JA 4D3DA 4GGOA 4TV9F 3UJ9A 4DIOA 2DKFA 3IP6A 3SHVA 4PNZA 3OFJA 4TZTA 1IVYA 5LQUA 1ZCZA 1JKJA 3NXSA 3RB8A 3A4MA 2D00A 3I64A 3VU0A 1IUNA 1AB5A 4KIUA 4ZI3A 2WSYB 5LXTB 3HU1A 4O5AA 3U48A 5TE9A 1WS6A 2HO4A 3JAWB 4L8WB 1KEUA 4NAHA 2VHZA 3G13A 3O4HA 4YP7A 5TMEA 4HRVA 4ENQA 5LDGA 1A7UA 3DC7A 4QLBA 2JCXA 3C97A 1LPMA 3LOQA 2QL7A 3B89A 3HEMA 1A04A 2RKOA 1KQPA 2NV6A 1A3CA 4F2PA 2O1WA 4U6QA 3ADBA 4MEBA 1Z38A 4W7HA 5P21A 4F4FA 3CVVA 4YGYA 3N07A 4TOIA 3CZMA 3NHZA 4Y9UA 3FTQA 4MJ3A 4OUDB 1XL1A 2RH8A 3D2AA 1KRWA 2V55B 4O4IA 1RZRA 3EXAA 4BJ1A 3ZBUA 4BLUA 2X6TA 4XJSA 5ALZA 2IPAB 2FFRA 4CMAA 4FFSA 2OP1A 2ZP1A 4NBWA 1K6IA 2ZJ0A 1L9KA 2FAXA 3P0JA 1RPNA 2W43A 5F52A 2JCVA 4TKVA 4KPEC 4BO1A 1S2OA 3WDSA 1TUEA 4MRPA 1J70A 2GX6A 2IY8A 4H77A 3KB8A 1P0IA 3BQ9A 1MJHA 1XRPA 1OROA 1YCHA 3G68A 1J49A 1E6UA 2DWOA 4WK4B 1EYZA 2VP9A 1Z73A 3GXBA 3LUPA 2NU8A 4S0ZA 5AVJA 3W5HA 1VB3A 3EBLA 3WJ7A 5FPQA 5B4TA 3JD1A 4C88A 4URVR 4MVCA 2AWOA 5ECGC 4NU8X 3WLEA 3TG2A 3Q8MA 1PVOA 1NW4A 1ECGA 3ZW8A 3OLXA 1ZWKA 1IN6A 2QX8A 3S40A 2HA2A 4I50B 3R0VA 2VXBA 3T1TA 3GMSA 1GNPA 2ZVQX 3W9YA 3L7LA 2X1VA 2YTZA 2YZMA 3E23A 1AY0A 1V48A 4FW9A 4JK3A 1SR8A 2WOOA 4EA6A 5EJGA 3IAM6 2XTNA 4R2MA 3BB4A 5TQ2B 3B70A 2J6IA 4AO8A 3A37A 1TUBB 3TRKA 4ZYXA 1MD9A 2Q4TA 2YV5A 5HYVA 5FBVB 4DA4A 3L6BA 1PK9A 1FPMA 2IH4A 4I4LA 1PF7E 1CCWA 3DGEC 1P18A 1TK3A 1UMBA 3IAHA 3OJEA 1K86A 2I8LA 2O8NA 3C8ZA 3RM3A 1V6AA 3T0FA 4DC9A 1K6XA 4FZVA 4P54A 1DJNA 5DGCA 4F5DA 4AMBA 1TEVA 2FX2A 3BTVA 4G25A 4JBYA 4HH4A 4X7PA 1NG1A 5CPBA 4BQNA 1E1QA 4EO4A 3OECA 5JAPA 3RVPA 2FW0A 5MN6A 4XX0B 4JGBA 3R77A 5C1OA 5FUWA 5TJHA 1WUIS 3DMGA 1ZMOA 5JD4A 3BC1A 2C2ZA 1IATA 2R5FA 3N8NA 3ZWYA 4ZMSA 1DFIA 2BFDB 2Q7OE 5C7OO 1JJAA 2O8DB 2O7NA 1I6MA 2X40A 4RMIA 2EZ9A 5FPPA 2C58A 1SA0B 2J5KA 3V97A 4WTOA 1PLKA 5CFRA 2ZJ5A 1OBFO 3L8MA 2VF5X 4LVCA 2QE7D 5GJCA 3T7KA 2IQ5A 4BZZA 4TTJA 4PHHA 3DBHB 3GGPA 5DN9A 1JU4A 2ZUSA 2W71A 3OAAD 4FT2A 1PS8A 4H18A 5AW7A 3W04A 1HI9A 1Z5UA 1GGNA 5A06A 3GRRA 3S1LA 3AL0C 1AH2A 2BONA 2QA5A 1PQWA 4F6LA 2I9PA 5I7WA 1P31A 1ZI8A 1ZRSA 1NW7A 2QSYA 3O2JA 4HJRA 2WFLB 1JG1A 2MJLA 1RXEA 3PFCA 4LNUB 3CRMA 4R6XA 4EAAA 5IXYA 1PVDA 3INTA 3H05A 2ZULA 3KL4A 4YRRA 4U9HS 2DWQA 4D9NA 1ULHA 4MRAA 4O63O 3U3JA 2EL9A 1EJ6A 4ZU6X 1V47A 4CFSA 2GD6A 3GEEA 4CLOA 2CXSA 3W8EA 4HVLA 3L8CA 4R1PA 1BXRA 4TUYF 3SBEA 3D6HA 1UR5A 3C5EA 1K7FB 1R6XA 4HDNA 4K26A 4RVSA 3GLVA 2BHSA 3KTFA 3JRNA 4LN1A 3ZWQA 2GAOA 4N6NA 3WS7A 4I2NA 4J6EA 4M9ZA 1TEZA 1P2SA 2ZR9A 3LOUA 1XWWA 2POCA 3ECSA 4H7DA 1ICIA 5IJZA 1KTIA 1U63A 2ES4A 3EUAA 4OU4A 2ZBQA 3LUCA 3DBLA 4PPNA 3U3KA 2XYPA 1L4MA 3E5NA 3VRHA 1J2UA 2IUSA 4E6EA 4RXMA 5EHZA 3JQ9A 1LNZA 3LUBA 1QZZA 2AFHA 3GJSA 1Z18A 4YQZA 3R9IA 2WFMA 3GBPA 3USZA 4FKZA 3VR0A 1QRTA 4HGRA 2H4FA 1RJ9A 3I6MA 4TTPA 4LKRA 1U2QA 3OD5A 4CKEA 3A27A 4OMCA 3M9XA 3GUUA 4GWKA 4FGLA 4RFLA 3UJ8A 1DJOA 2QVXX 3QEMA 3HRHA 4GHWA 1PK7A 4UM5A 3PRJA 4W6ZA 4ZT7A 2PSSA 1DLJA 2LD4A 3KHUA 3PEFA 2JFFA 3M70A 1Q0TA 1E58A 2D1QA 3RG2A 5KNBA 3GZNB 1MP0A 3L01A 3CJRA 4UHBA 4XW2A 4DWVA 3B3AA 5IXSA 1V1RB 5FUQA 4URZR 1WRBA 1KOFA 2NO1A 1E3DA 4RNDB 2VCHA 2VHQA 3EZ6A 3B9BA 4PG7A 4QDXA 3S6JA 3USES 3TTVA 1F4PA 4AYWA 4KDEA 2PZFA 5ALMA 5HUJA 5L95A 3TFOA 2R1TB 4BQPA 3RRMA 5EJ4A 4GNRA 3CONA 1CULC 2BDEA 3I1JA 2Z6AA 5A4KA 1O3YA 3D6AA 4U63A 5G0VA 1HSOA 3E70C 4KFSA 4UEJA 2P27A 1XCJA 2FUNB 2VQ6A 3BIWA 1PGJA 2A8YA 3O47A 1VCOA 1X80A 3BWMA 1U0FA 1HE5A 1GPBA 2C96A 2I2FA 1EX7A 5C4IA 1OB5A 4K6OA 2Z9CA 4GL4A 3DM5A 4HPWA 3RSHA 1VSVA 2Q9AA 1P1BA 2H65A 3JYOA 4RFSB 1YC2A 3QXXA 2BTQA 4JSRA 4N40A 2NP7A 2O6HA 2W6MA 2XMZA 2YHAA 1X19A 3MT8A 4UNNA 1GP2A 5K0SA 1XRLA 5BOVA 4KEAA 1VTKA 2G25A 2RKBA 1UBEA 1IFXA 4CETA 1SIUA 4L2IA 5FUXA 5M34A 3V7UA 3QV2A 1O94D 4YR7A 2ZM6B 5B1IA 1PZXA 3K92A 4N6GA 1LVGA 3TEFA 1V3TA 4WACA 1MC4A 2C61A 2IEGA 1OAAA 3BZBA 3I42A 2XDWA 2JGNA 5AIAA 3OEHA 5J2TF 4BZWA 3MFQA 2A1IA 4RK0A 1H2ZA 2JIQA 4NECA 4CM3A 1Y7IA 4CM8B 4G2TA 4WLNA 2B94A 4J2TA 2GZ3A 1BW9A 4G84A 5AVOA 4V3BA 5AJZA 4HATA 5TARA 2ACKA 4JI8B 2E21A 1P80A 2O5VA 1BJKA 3CXUA 4NJMA 3A9UA 2B99A 2I3BA 3F78A 3C5CA 5JO9A 3NHYA 3W2EA 4A16A 3FMPB 1UOPA 4PGHA 5G1NA 5A0FA 4KZPA 2W70A 3QMPA 3A9WA 1RP1A 4JAVC 4C21A 1OPRA 2GM5A 3Q40A 1Z5PA 2IYSA 1Z4OA 5JAUA 1FSPA 4BP9A 1VIVA 1M67A 1ZCAA 4XUDA 5EIFA 1F51E 4GOKA 4M7OA 2FETA 1HQKA 4Q7LA 4D4KA 2H1IA 4ZYWA 1RAHA 3R0JA 4BRUA 2G09A 4FR2A 4CTOA 3P9IA 2CDAA 3EZ2A 4KAAA 4MP3A 4ALNA 1IEWA 2FRDA 1PNQA 2I33A 1PEDA 3BD8A 2CDNA 2XLCA 4KPUA 1QRDA 2QRHA 3LZ6A 3W6PA 4FONA 1TNDA 3ZDXB 1I6LA 2E4YA 1UC9A 1FF9A 3WL3A 2W6CX 4OQQA 3CWQA 4ZO7A 1UM8A 3WL6A 1QH8B 4ZQEA 3U7IA 5KVSA 3WWEA 5JZSA 3G2MA 3SQDA 5CB4B 2GLUA 3PQ3A 3CNEA 4CCAA 2XIQA 4B87A 2ZJOA 5BNWA 3BWXA 3HVUA 2PYZA 3ASYA 1EUCB 3A28A 5A9TA 2GF2A 4BLTA 5AOCA 1DC6A 4R16A 3JWPA 4UVDA 3DCJA 4K3UA 3PC7A 5ALLA 4J07A 2ZXUA 4C2UA 4UTXA 5FBKA 2YVKA 3E9MA 5KNCD 4LVNA 3AF5A 4OL0A 3GB9A 4PXAA 5JMPA 3TZ6A 3F1KA 4MV4A 3BFPA 3M6UA 4XLLA 5EQFA 1FFSA 2OYCA 4TSRA 3I5UA 3B9QA 4B7AA 4R2WA 1G20E 3AEKB 3T7CA 1EXMA 1UAGA 3G1WA 4ZOQI 4AIIA 4FCTA 1P9LA 5BXQC 3QUTA 4X3OA 3BL5A 3D6MA 3HJHA 3BGVA 3URMA 5ED4A 2G72A 2PGNA 4FCVA 4QOHA 3H1TA 4KVGA 2BFOA 1JDBC 2VL7A 1GPNA 5M5BA 1KDVA 3EDYA 4EWLA 1IZ7A 2P9CA 3IDOA 2PS3A 3OIYA 3X1XA 3PG5A 1IC6A 4ZZ3A 4YCDA 3D1JA 5GZ1A 2A58A 2EP8A 1GQFA 1QQ6A 3EW9A 1Z39A 4MYCA 1R0SA 1QCZA 3PNBA 4RQTA 1SAYA 1QYRA 5CT4A 1H6AA 3HYNA 5G3YA 4KR6A 1KMNA 3KUXA 1L7OA 4BLWA 1CEXA 4PHFA 2HY7A 1MH1A 1K89A 4OBEA 1E3WB 3U40A 3GPLA 4OQXA 4RFVA 3S2ZA 5LB4A 4ENVA 5I48A 4TXMA 1EE2A 1UBMS 2FLKA 2O2CA 3BMQA 3DEKA 1E60A 3FLMA 3MWEB 3JQAA 4FQ5A 3WLKX 1ZY2A 1U28C 4B4DA 4CLRB 3RSQA 1WNTA 1CE8B 4ARUA 3ELUA 1Y6QA 1TW2A 1OLOA 1N8TA 2PKRA 1Y1TA 3UJ7A 2XOKA 1MA3A 3EUWA 1BMQA 1X1DA 4ENTA 5A5DA 5FFMA 4MPDA 3KBOA 2AMJA 1MVOA 1AV7A 3CLVA 2JI7A 1I2MA 1M6VA 1ZNZA 2R3SA 1UXHA 5EYPA 2IY7A 3OURA 3JQPA 4FOTA 1KRXA 5FO0A 3NEPX 4OMDA 4ICIA 2CFRA 4Q4JA 5TEVA 4XQGA 1W2WB 3SC3A 1SHUX 2I2BA 1ULBA 3T9EA 1T6XA 3RLIA 1NVBA 4EG0A 5BW5A 3JRWA 1U8EA 4UDNA 3Q0IA 5GOTA 4WNYA 1I4WA 5HS6A 5JVDB 3IDSA 4BFCA 4DMRA 5ARBA 4Y2QA 2NAFA 1PNVA 1D7AA 4L57A 4LQCA 1N7IA 2C77A 4FHFA 3TM4A 3IQHX 1F2UA 3UIEA 1IN1A 4B6JA 1IRXA 3CB4A 1BN6A 4K9SA 3U81A 2XHZA 3BXPA 4BZQA 4EZEA 1TM3E 5LLSA 1M1NA 1R64A 1ZHFA 4HZGA 4MIEA 2WE7A 1A76A 4Q7JB 3RU9A 2PXAA 3W1EA 1QHEA 4A27A 2QBYA 4HH1A 2JIZA 16PKA 1MPTA 2IQIA 3AWIA 3ZWKA 3RYCB 3W4KA 3I5XA 4XB1A 1RTKA 5I4BA 5KDDA 2DBQA 3Q2IA 3DE3X 5H70A 4X61A 4BMOB 1D6SA 3SHTA 1SUIA 3CEAA 1N2EA 4RORA 1JR6A 1SPXA 3DEAA 3DZGA 1T2FA 1TMYA 4HGYA 4F45A 2CK3A 4ER5A 4F3CA 3VKGA 1DRJA 4Q93A 3HUTA 1VLJA 4EMTA 1O1YA 1ZGBA 2PGAA 3JR7A 2ILVA 3KQSA 2VJPA 3C6KA 4MQUA 5FI1B 4MVYA 3O8LA 2AIRA 3B78A 3HY3A 4JUCA 4L5BA 4LJYA 2IU6A 3EGVA 3PE6A 5HKKD 4OLJA 1YS1X 1PJ4A 1QV6A 1YD7A 3MUOA 4KOEC 1G21E 1F2VA 4ND5A 4ZYLA 5KTSA 4U5XA 3GH3A 1KH1A 3PX3A 4JODA 3BHNA 1TA9A 4OEHA 2N0SA 2ZRBA 4ZICA 1VBFA 1Z7YA 2WF8A 2Y27A 4AG3A 5CDSA 3FGNA 4HSEA 3NNSA 3QVGA 4N1AA 3QPAA 1THMA 2IYZA 3G2QA 3IJPA 5CVDA 4B8WA 1XTSA 5KYGA 4I1OA 2C00A 4ONEA 4JASB 5JLAA 5FUYA 3NANA 1IM8A 3FVTA 3H99A 3PHGA 3FDZB 5B1SA 2QEQA 1FC0A 1FP2A 4HNHA 3WLNA 5EJ9A 2D7DA 4Q3BA 2Z2KA 2A7QA 3BMXA 3OE5A 4MYHA 3PCTA 3SF0A 5FRDA 3HU2A 2HCTA 5U1PA 4ZTBA 4Q15A 4ZFNA 5AJYA 4E2WA 1DBSA 2P6UA 5ECYA 3EA4A 2GNAA 5KNDA 1L5KA 4ZHQF 3NC4A 1VKHA 3FOBA 4M7PA 3SKXA 4DM7A 1JF8A 1JQAA 3RSGA 3B52X 2AJBA 4JJZA 3ACBA 1I10A 1P3DA 2I4MA 4U7FA 2JLYA 2LIVA 1I7NA 1KSJA 3KYCB 2VDRB 3CGWA 4IO1A 5I7OA 2GA8A 4LGCA 4DLZA 5JDIC 2B5VA 2ZK7A 4FEEA 1A8IA 3R9XB 3HLKA 2EX0A 4L9RA 4MV7A 1J97A 5K03A 1JIUA 1U9YA 1FXSA 3AFGA 3OOHA 4EP1A 4DV7B 1XD9A 2AHOA 2MR5A 4BLOA 1HGXA 1PZHA 2A1TR 2GM9A 2IF2A 2YV3A 4A2CA 5D2CA 3X43A 1VHWA 1QX3A 3MJSA 3MT0A 4KBGA 1X74A 2VRCD 4GM4A 3V32A 3WHPA 2QMUA 3C5WP 1VLZA 3S27A 2R84A 2O9JA 3KP1A 5HIKA 1U5CA 3STTA 2YWCA 5GJWC 1HE4A 3JQ8A 3ZDDA 3UMVA 1ULTA 1SKMA 2C07A 2VLIA 3IRUA 4X54A 2NUPB 4L0QA 1HURA 5HK9A 1E2EA 1W49A 1GZ4A 2I3ZA 4BNYA 2GM4A 2EFEB 5DPMA 4ZAGA 4DV4B 3E03A 4OF4A 4FM9A 3ZHCA 3AG6A 2IOHA 1YACA 2A9KA 2Z2XA 4ND3A 1UKEA 2E6KA 4DLXA 4W5NA 5KTPA 4GPZA 2AH5A 1U7XA 1NM5A 1PBNA 2XMDA 1FSGA 3OIDA 4R1TA 4BX2A 4ZC8A 1OTXA 2NSYA 3F1LA 4MS4A 2PXCA 1EVIA 1XEXA 4M86A 1T1EA 3ZKWA 4PLWA 4EKNB 1ENPA 4YNBA 1NUPA 3LHKA 4O2BF 1KI6A 2P0YA 5AKHA 3QOYA 1B14A 1J7JA 2WYOA 4J1QA 4MWBA 2CHUA 4E13A 1BIFA 3PUHA 4PY2A 2OCBA 4IHJF 3W8NA 1AVTA 1NXQA 2LKCA 1MUUA 3H6KA 1JB1A 2VAXA 2JBWA 3L77A 4FIDA 2YXDA 4YRZA 1A96A 2VDJA 2ZSKA 2JKYA 4HD8A 1FLDA 2P5UA 3CS3A 4XB6B 4QLAA 1ZXBA 2ASVA 5EAIA 3TXYA 4PAGA 2G9ZA 3RVKA 4CT4B 1YWGO 1HZZA 1N1EA 3DG9A 13PKA 2YYZA 4WXPA 1NBMD 3GFFA 4QIHA 4TS9A 3Q7SA 1HOXA 4MVJG 1ZZGA 3GFTA 3ZQ6A 4BDTA 3ZBPA 4RZHA 3PIDA 3VH2A 2XXAB 3DKKA 5DDIP 2FK8A 2H7CA 3AY7A 4MVJF 4MB6A 3LCJA 3DFIA 3VPXA 2Q3JA 5ALRA 3WHIA 3CQ9A 1WB6A 1L4BA 3NWOA 3U7EB 4KC0A 3GLGB 3HQ4O 2ECPA 5FNVB 3D6UA 3QLUA 5A6SB 1BHO1 2YHBA 2WIBA 2YXLA 1HZZC 1ZW6A 1P4SA 2XNDD 3QKSB 2PSEA 3S2GA 1J9EA 2IYAA 5EZ5A 1MN6A 3WGJA 1YIAA 3RSLA 4XTRA 5CRIA 1JIIA 4UE3S 5EHNA 2PLWA 3SBDA 3EULA 2HBQA 3FTFA 3EWNA 3Q3IA 1IOVA 2BEVB 2OYSA 4GKVA 4LRQA 4MGIR 4WDQA 4QSHA 4CMIB 5JC8A 3L46A 1Z68A 4P08A 4GEKA 3EIUA 3G9XA 4CHTA 2DH5A 2GF9A 3WADA 1GQRA 2CFOA 4IYJA 1QXSA 1V9SA 4KQIA 4OXNA 4ZU1X 3R0IA 1VCIA 3HS3A 4R1LA 1A9YA 4Q37A 1BXKA 2PMCA 1M5RA 3COZA 1WM1A 1PSWA 2N1BA 5F3RA 1GILA 3AO0B 5H1YA 1V2GA 1RPTA 4UBIA 2XQIA 3KWFA 4X6YA 5E2AA 3SC4A 2C42A 1L9XA 4FHZA 4FFBA 3UV3A 4CG2A 1RHUA 3RD5A 3IPCA 3GT0A 2QE7A 3R0QA 4UEWA 3KEGA 1DG3A 1OXUA 2CLOB 2CFCA 2W2XA 4HCJA 4EIWA 3KKZA 4YRTA 3OAAA 4GYWA 3NV9A 4MPPA 2Z2IA 2FEMA 3G82C 3QPDA 4MPRA 1NYQA 2PGXA 2W22A 1TU0A 3ANNA 3W6NA 3EGDA 2P2CA 4ND6A 1ML3A 2C4NA 3GCDA 3QW4B 1F2TB 1H1DA 2P3LA 2VP5A 1NVKA 2H7YA 1BMFD 2IYLD 3DCYA 2D54A 2X9LA 2VSQA 3DVQX 2Q5LA 4UM9B 3PNSA 3PHIA 2WF7A 4DV6B 3QXCA 4LIPD 1E69A 1YQDA 2X7JA 3QJ5A 4UATA 4ZALA 5FJJA 2QTCA 1DKQA 2I4RA 4L51A 2XCUA 2H85A 4QU8A 4IBOA 2EC5A 4RY8A 1PL6A 3V7NA 2BCJQ 2ZTLA 2VDVE 3HXMA 1XR3A 4EPXA 4HEQA 2NZWA 3NETA 1GAWA 3IUBA 1I5OA 2ZJ7A 1ANKA 2XNSA 5ESXA 2C7PA 1L7RA 5EIEA 3JTEA 3IDQA 4KKXB 4XYGA 3ER9A 1EHYA 4X1KA 3O8BA 2PJRA 1NXPA 2VT6A 2EBHX 4QFDA 1XZLA 1IB0A 3QX9A 3OLCX 1B74A 1JAIA 2G83A 2ID8A 2BLLA 3BH0A 4KIJA 1M5UA 3R5KA 4X6UA 1SCUB 1TMOA 3VYVA 4E0BA 1XZNA 2BEJA 3DWGA 4O4JB 3ISTA 3AEXA 3MJTA 4HEA6 2GEDA 3A1NA 2K7ZA 5E0OA 1JL3A 4FS8A 3BAZA 1Y5NA 2EP7A 1D8TA 4PZUA 1KYWA 3AR2A 4F2WA 4MICA 1UKVY 2GCPA 2ODAA 5GVRA 1JJVA 5CUQA 4KL8S 5LOVF 4O25A 3EZ9A 1RYHA 1AZLA 2AJCA 4U5QA 4TXJA 4L4XA 4RLSA 1YI1A 4I4CA 2ZE7A 1L8XA 1LZKA 2Z95A 1W4CA 1XRQA 1T5SA 1YB2A 2VCEA 3OJFA 4XWYA 1W9MA 3PUKA 3UO8B 1NVUQ 2YL2A 3AM4A 3AEQA 3EEYA 5DSZA 3WNCA 3PNMA 1QDEA 4PW0A 1OA1A 2ZE6A 3KHKA 5LD2C 1PNTA 3SHFA 4Q9LA 3PE4A 2YOGA 4M21A 3K9CA 4CQNA 2X1HA 1P72A 1F3LA 1UH5A 1O96B 1Q84A 1F4VA 4RO0A 3MGAA 3UWSA 1I3OA 1RYZA 2DHDA 2HPVA 3M6LA 1R8YA 5BWCA 2ZZMA 3WTBA 2J3LA 1DINA 3KR0A 2F43B 4O4HA 3DE7X 4FNAA 5B3JA 5CT8A 3QI2A 2VHYA 3RSFA 4YUYA 1M1UA 1WPGA 5J59A 3KB1A 2ZFUA 3CYFA 1OFTA 1P5FA 1AXRA 1ZI9A 5KTYA 4NPHA 5HGJA 4U2FA 1GL6A 2I6UA 1JQEA 2YVUA 1B0PA 5DM2A 5DYYA 4BQFA 1OREA 5KWVA 3NHLA 4QGBA 1F6WA 1QGDA 3ZCPA 1DV1A 1KGSA 4TVBA 1K9VF 3MBKA 4PIVA 1UXIA 4R3NA 4E6PA 2GK6A 3PJDA 4HTFB 1L5VA 1QIIA 3ZWMA 1NFRA 1O94A 3HKDA 4QQKA 1GSHA 5IJAA 1BCRA 3LDFA 5E9QA 3EUEA 4CM4B 3QHQA 2YYAA 4RL6A 3VV2A 1U2DA 1EWKA 2XWSA 3MLAA 4Y6PA 1MO2A 2VKQA 4FKBA 2HYIC 4DMGA 4ZYTA 3TR0A 1GNVA 1GA4A 2C83A 3FFWA 3UHPA 1R4MB 2EP5A 3Q8KA 4AXBA 1KBQA 3LXMA 3AJEA 1LTKA 2CNNA 2FEOA 2NUAB 2HCJB 3B9RA 4QWWA 3U7RA 4CM6A 3R7DA 3KALA 4JP5A 5AVWA 4IFIA 4MO2A 3TZHA 2ACWA 4DA6A 5LM3A 1VJ5A 5DCLA 2C7GA 1ISGA 3Q7QA 4BPBA 1Z12A 1JILA 3U5ZB 1P6XA 1XZPA 3O4GA 2WD8A 1ZN2A 4FJ2A 1T9HA 3QE4A 4KDRA 1IU9A 1DAFA 3LBHA 5B6PA 3K8OE 5C1IA 2IZ7A 3BBPA 3DW1X 1JR2A 3HJNA 3NT2A 2QL5A 1YVEI 3L06A 1J0DA 3D0OA 2X2FA 2NSDA 3OZDA 3QM1A 3RVOA 3UK7A 4PFKA 4PAOA 1KHHA 3CXRA 3OM1A 3ZKAA 2D5IA 3NGXA 5FWAA 2ZBFA 4UOQA 2LIPA 3D0RA 4B7XA 2XTJA 1G64A 1T35A 1TQ4A 3VR5D 4F1WA 5A04A 2Q5CA 3X2FA 1J5PA 1ORDA 4JNKA 4PWYA 4BN5A 1KF0A 4B3SB 4I4IA 3AV0B 3NB0A 4C08A 1K7EB 2QI9C 2ONCA 1AJEA 4LZWA 1GL7A 3H5NA 1PV2A 4HBZA 3WWCA 1I13A 2A33A 1LJLA 1NJGA 3EXEA 2BHRA 3KUUA 1TIKA 3DXZA 1I80A 1NDQA 3AF0A 5CURA 4FOPA 4X0EA 1SQFA 3EZLA 1OW3B 1U02A 3E35A 4MOWA 5B2FA 2HHAA 3LQ2A 2IX9A 1FDTA 2WMDA 5L4SA 2GT1A 3K71B 4G65A 2EU8A 4RMGA 1ACJA 1XCMA 2D5LA 3L1UA 3OPYA 4DJJA 2OC9A 5A0TA 1IY0A 4H0CA 5HF9A 4EVSA 1FFXB 2FZEA 3WMEA 2H2GA 5DHFA 1BRMA 1QIGA 1KL7A 3LW7A 1GT91 2G4LA 1IZ0A 2VPYA 3TMKA 3KWLA 1AE1A 1NMZA 1QZTA 4P3OA 4C4OA 4YV1A 2ZGVA 4IXNA 5ALNA 1K0FA 3ZDEA 3OJOA 4FE7A 2CB0A 8MHTA 5IABA 1G6KA 4H9GA 4WY8A 1BMDA 1TB4A 3TGWA 3ZG6A 2QN1A 2HNKA 4DMUB 3UMBA 4RDXA 1E7MA 2J08A 1ZM7A 1KH2A 4NAUA 3T41A 3WV5A 3R3ZA 2GASA 3CLUD 3GLHB 4L6AA 4RK1A 4AZ0A 3CC8A 5JMTA 2Y71A 1BJRE 2B8NA 3EWIA 1Y81A 5FQOA 3RRFA 4MIOA 1QBKC 2PLNA 2D7CA 2I3GA 3LZDA 3MCWA 4YJ2F 5L7YA 1GSIA 1B00A 3JQFA 3IDZA 1JU9A 3FSRA 4GEGA 3WNDA 3CUWA 5JSKA 3PLRA 2FP4A 3GLGE 4TKMA 3CZPA 1I94B 2PTHA 4LW8A 3D6NB 4X84A 1PK8A 3DL0A 1GZ3A 4XEHA 4ID9A 1JPNA 3KIPA 1WX1A 4X45A 2ZT7A 1HKUA 2ZSHA 1VL5A 2O50A 1HDGO 1RQPA 3NBUA 2VHUA 3OA0A 3QX7A 3T35A 1Y7LA 3OZVA 3ASVA 5A4JA 3JY6A 2ANBA 1A9TA 4DIDA 1FFHA 5IAEA 3SQOA 4B4KA 4LWQA 3VR6H 1MG5A 5HRAA 1JKFA 3VM6A 2J32A 1N6LA 1X7ZA 1DG1G 4IL5A 4XQCA 2Q41A 4RLFA 4CNBA 1IAVA 1UPAA 3UBMA 3I2KA 2I5PO 3LYLA 4FS3A 1PLLA 2IXEA 4EEKA 1X39A 2QX4A 4B9AA 1V6SA 1JHAA 2PX3A 4D0SA 2JVJA 2ZI7A 3ZD7A 3VVCA 4RHYA 5BWBA 3D3KA 2NO9A 4MR7B 5F73A 2EJUA 2AG1A 3SJBA 1FA9A 2OBMA 1W5BA 1C50A 2VDNB 1YDFA 2Y1OA 3BRWD 4KE9A 4ME6A 4WCVA 2NXCA 3HV0A 5DMXA 5FI0B 4ER0A 3UBTA 1D07A 1T1RA 2YKGA 1PW7A 1N6IA 2C31A 3OMLA 3KFLA 5KU1A 2D2FA 1AKQA 4LTMA 1DWOA 3T3GA 5C8YF 3L8EA 5CLLA 1XN4A 1BYUA 2AOUA 1IAQA 4KQKA 1M2VA 1ZICA 5KYXB 4J2OA 4A1FA 3NOOA 4TYWA 4UOEA 1VJCA 4YRIA 4WNIA 4Z4GA 4WUVA 2ICAA 4QAJA 1WKBA 4I5GA 3SQLA 3JQ7A 4FN5A 5I7HA 1XEWY 4OBWA 1LPSA 4D1YA 4LC1A 2V7EA 3FY4A 3BA1A 5KU7A 1UJBA 2GAFA 3THYB 2ZSUA 3ELBA 3S5JA 4C76A 4Y6QA 3VDQA 2R8PA 2I6FA 3BK1A 1VPTA 4L4UA 3S1AA 2DFDA 1P2VA 4EPRA 2J85A 2ZWOA 4HB2A 3TPFA 4M9RA 4X6XA 3OE4A 4LSZA 5AK4A 4YV0A 1B8UA 2IZOA 5HILA 3GG2A 1YS2X 4G97A 5KCZA 1VYTA 3CRVA 4BUJA 2C20A 1ZJWA 5IP5A 5J58A 3HKCA 3OCXA 1V43A 5AVSA 3ZGVA 3VOSA 4P7FA 1EHCA 1N7GA 2O2XA 1N9KA 2EQAA 3M33A 4EVIA 5DXAA 1Y5LA 3NM4A 1AD2A 1B76A 1GCUA 3QFRA 5HKKA 2PX8A 3ENKA 4BECA 2C5SA 1SKBA 4EG5A 3THWA 4FGWA 2G82A 5CJ2A 3QZUA 3RHTA 1CLUA 5CYOA 5IWCA 3GRVA 5J2UB 4AN0A 2X8JA 3TX2A 4XJVA 5CH8A 4HVAA 3I01A 2QP9X 1Y5IA 2A9OA 1LC0A 3HRIA 3SVLA 3HA2A 2PX6A 2OA0A 5EQJB 3SZOA 1CJCA 1LI7A 1NJ6A 3EXHC 3K5IA 1BU5A 1QKJA 4LE2A 4AICA 5B1EA 1Z74A 2H5IA 2FWAA 2RJNA 3VNBA 1FU8A 2HO5A 3DWEX 1OZGA 4HG2A 1M0TA 3FOWA 5DM0A 5SZHB 1FPQA 4B44A 1RI4A 3WA6A 5FKJA 4KUHA 1GO2A 2COEA 2NZ8A 3H4VA 3I6IA 2P69A 1FSZA 2RCYA 1CF2O 1FP1D 2FX3A 1SXIA 2ZSIA 2WK1A 2GJ9A 3VPHA 5KKNB 2FPGA 1OH5A 1PIWA 4HJXA 4MARA 5JCJD 4L3OA 1I6WA 3E0XA 3AX6A 1M7BA 2P4HX 1NXTA 3L2OB 1XDWA 2D0DA 1WW3A 2NG1A 2IOQA 2WU1A 3PHCA 5JS6A 1G3QA 4J4HA 4M1OA 5D3QA 4BMNA 4GT1A 3H2BA 2C95A 5G4KB 1FS6A 3DL4A 2WPDA 4V0MA 3SDSA 4ER6A 2AMYA 1CQJB 2VRCA 1DKPA 2FRXA 5A6VA 2ZJ4A 2NSJA 3TSWA 4AS2A 5JLJA 2JJ2D 2QAGA 2PA3A 5FTNA 4PZDA 1HE1C 3ONFA 4OP3A 4LEIA 4YLGA 2O1SA 2R6ZA 3NTRA 1HTWA 2XE4A 1M6YA 3IKTA 3KYIB 3G9QA 4NPAA 7REQB 2OFWA 3Q7RA 4FT4A 1M8KA 3ZDCA 2AN4A 1WSDA 2HGZA 1QC5A 1OWLA 2ZJ1A 2ATXA 1N8KA 3EGCA 4G8BA 2Y6UA 3DA8A 2VXYA 3V1KA 1XTPA 3PFKA 3KK0A 4DR4B 1VL1A 2YN0A 3MXOA 5JASA 5AICA 4FLEA 2GN1A 4F7WA 1WQ4A 4MR9B 4R01A 2HIMA 5AW9A 3IAEA 3RARA 1B16A 4URWR 3TL6A 3KUDA 1RWKA 3E8MA 4NG5A 3S2YA 4JJIA 2W2MA 4X5OA 2D2EA 1QVVA 2QRMA 1RJGA 3MINA 3D5EA 2O2JA 5CLGA 2JD2A 3C0KA 1E1CB 1YRHA 2Q1TA 1F0NA 3HVHA 2OCIA 5JI2E 1MABB 1C5KA 3PFFA 1T8TA 2FSUA 1CUIA 1JPVA 4WZBA 1WMEA 1SNYA 2OY0A 1KEEB 1WDLA 1RWOA 2ZAYA 5DYIA 4M1EA 1CUSA 4PPFA 5GAJA 1VE7A 3WLJA 4DSAA 1O03A 1OYVA 3RJZA 3STYA 1NX9A 2FVYA 3GP8A 2PYIA 2IHZA 2GJ8A 1MZPA 3HPRA 1NDUA 2RK3A 4PN3A 2RG7A 2SNIE 1ZINA 3DNMA 1M83A 1L8OA 1O4WA 1B26A 3ETEA 4R9NA 4TKUB 1NBMA 3IMKA 1RJFA 2WYUA 4E3WA 5JZVA 3WK9A 4LFBB 2ZIEA 3E1KA 3DQQA 4R2JA 4AB1A 2AR9A 1Y3BE 3I6QA 4FILA 4F85A 2OO7A 4B79A 1WR8A 1N9GA 2EJWA 4GRDA 3RO7A 1C1YA 1IJFA 3PC2A 3EQZA 5AKJA 5DEIA 5BYAA 5H59A 2GVZC 2L69A 2WHYA 1DS6A 1FTWA 5EMHA 1T2VA 2CL5A 3CCFA 3CR8A 4XGRA 5EN4A 3RS9A 1QK5A 1MG0A 2VYVD 1YS9A 1A5ZA 4AU1A 5FOQA 3TD6A 2R48A 5E3JA 2WHRA 1N0HA 4NZNA 2DY0A 3FUTA 4Y2XA 5TF4A 2GBLA 2XNDA 3PC8A 1EFKA 4EJSB 3COSA 5CITA 4IP0A 1GXSA 5LZ9A 1TVKA 4KCGA 3LF1A 3IIKA 3R41A 4XJXA 5AOAA 3SGLA 5GADl 2FG6C 1K1EA 2GPSA 3FSEA 1Y82A 5AM5A 1DAHA 2OO3A 2DPXA 4CQMB 2F8MA 4ARZB 5JY1A 4K9QA 3GLKA 1GGJA 1UKBA 3QPCA 1WMSA 4AJIA 5KQMA 4PFJA 3GLHE 5EE0A 4BASA 3WAGA 1T0UA 5IZCA 5JNUA 3QXJA 4NTZA 3KXLA 4REQB 1XZAA 4B7UA 2BGKA 3G0DA 4PLZA 3V2GA 4F9EA 5ADHA 4HQOA 2ZWPA 4E07A 3L49A 3BCUA 5EIAA 3VDXA 1XA3A 4UU8A 2VNSA 1E99A 4Y6RA 3I45A 4YRSA 2VUSA 3H1BA 3A1TA 4JBLA 3EIQA 2B6NA 3PC8C 4C0KA 4L8FA 5K9ZA 1RHQA 4C0BA 4TWIA 1XZJA 2WRZA 3R7NA 3HTXA 1N33B 3U37A 1TTQB 3OX2A 4O0LA 4W82A 4EMSA 1Z6YA 2J33A 2CL7X 2MR6A 2OBLA 2VAVA 3TLGA 2I2CA 4MW0A 4HWRA 1M0WA 3H6HA 3QU2A 4X64B 5AUPB 1Y1LA 2HNAA 2RHCA 3ZQJA 3W5CA 1XGKA 4RQBA 4S05A 1BMFA 1YE8A 3P0HA 3AYZB 2P7IA 4LXGA 1TAUA 2OVFA 3OCJA 2E5FA 3AHDA 4FGJA 4MRSA 2FZLA 3V4VB 1UDXA 1DTWA 2YV4A 1U3WA 4AS3A 1CRLA 4EHFA 4YXFA 3U4QB 2VBGA 4C9BA 2LKDA 1WD5A 1UBGA 3VVLA 1XEFA 2J3EA 2CNWD 4HN9A 1E2DA 2OK8A 5CEFA 2FN9A 3LRXA 3GBVA 4RSGA 2WSLA 4C07A 1KI7A 2YNMC 1XBTA 3C70A 3MLEA 1NLYA 1XRMA 3QU7A 1XXHE 2TS1A 1D4FA 4QULA 4EM6A 1KZ6A 2QRJA 4NARA 5ULLA 2XKAA 2FMIA 4IXWA 1UZAA 4N3GA 3SYTA 4AUMA 1HO3A 4DCUA 1WDTA 3GO4A 4LC9A 3SMVA 3JR3A 3TS1A 1DXOA 1Y80A 1L4GA 2YWDA 2QQFA 2J4CA 4IHAA 4LDNA 4RBNA 5EUMA 4F3KA 1LPAB 3D7KA 4JR1A 2DJIA 5JROA 3GV0A 5BSHA 4CF7A 5ES3A 1JEQB 2IUEA 4PG6A 1TA0A 2YYYA 3GEHA 4H6VA 4YDQA 1B15A 3UAZA 3KE8A 1JLLA 4PYOA 4AZWA 2WB2A 4A1OA 4AJLA 1XZDA 1BA2A 1U3TA 1T4CA 1P0CA 4HDRB 4IFTA 4D99A 1UT8A 1RMYA 1BX1A 2GCEA 3EEBA 3QMMA 4OHXA 3WZLA 4OQ4A 3M1YA 3NBXX 1T2DA 1I2DA 4NVRA 5I8PA 2HC9A 4E4RA 1WABA 2DMRA 3C1UA 3MG9A 3BREA 3PNKA 1Z8FA 4FHDA 4TTRA 1B1AA 4WXHA 3K1AA 1OH6A 1ADJA 1V5IA 3OIWA 1H22A 2GJKA 5F9MA 4QEKA 4I3GA 3UPUA 4GE0A 1OC4A 5JNVA 5E6UB 3AP3A 4POAA 2HM7A 4UUNA 1MR3F 2IKQA 3EQ6A 2Q99A 2FZ4A 3HE3A 1DRKA 1HYGA 3KUKA 3ZK7A 3SM9A 3RK4A 1UAAA 3IA2A 4DQKA 4I4TA 4Q48A 3WK5A 2QUZA 4YT8A 4QBTA 1DDOA 4CMEC 4QJ3A 1YCGA 4TT8A 3UMJA 5F7OA 5KREA 1HTTA 2P91A 2DH6A 4Q12A 4DMKA 2EF0A 5EUQB 4DCPA 5K8IA 4IZHA 1UWCA 2O3QA 5FULA 2O8FB 2CJXA 3IC5A 3OJWA 2FW8A 5JOQA 2B0JA 1TZCA 4HYYA 3TUZC 1H4QA 1YMVA 3PGLA 4D8WA 1KYQA 5BOSA 2JVIA 3AU8A 2VSNA 3O8DA 1AHHA 2O8CA 1XQ6A 1KIFA 1KXJA 3RS5A 2IXDA 3O7MA 2GVDC 1AK1A 3UXMA 3LCVB 1L4LA 4Z0PA 2P2GA 3W5DA 3EC2A 4O8CA 2G0NA 1U1EA 4KGXA 4BKQA 4DNOA 1EFDN 3FZYA 4LBVA 5DIFA 2RJ3A 1XDDA 5IRCD 1YZFA 2XMBA 3QLVA 3IP3A 4QUJA 3SDBA 3BIOA 4MZDA 1HLGA 2O5RA 3L1JA 3OIVA 3PGJA 4PPYA 6LDHA 1WUHS 3OCVA 3DULA 1N2GA 2GFQA 1N5JA 3JYHA 3DEYX 3KRTA 3E27A 3RODA 2DCUA 5G41A 3WMWA 2NXWA 5CHYA 3EPJA 3CNLA 2ZIVB 4K6GA 3I9V6 3BXHA 2JB9A 3PL1A 2Q1UA 5FYDA 4B76A 3KQUA 3SOZA 1S9DA 2ESRA 3CLSD 3B9PA 4HZUB 5FBHA 4V0RA 5WRFA 5THXA 3C6XA 1NP7A 1NLUA 3COVA 4EPYA 2GM3A 1EJ0A 5DI3B 3FPJA 2A5DA 3IO3A 4V39A 3MVEA 5FOSA 4RVOA 1Y3IA 2G36A 3O4IA 2JBAB 4TV9B 5CXQA 4I55F 4R7TA 4ZVMA 3SZMA 4WBNA 3ODGA 1O6BA 1ULUA 1LNQA 1W88A 1XFAA 3H5IA 4QA9A 1HDEA 1FTQA 4BIMA 4DILA 2PWYA 4UVHA 4R8MA 2A92A 2NUBA 4R4JA 2PVPA 2FUCA 4X60A 2HWWA 4J91A 2BM8A 1SQ5A 3B7GA 2F17A 1GDHA 2P62A 1PJZA 4KAFA 3JYPA 1TGVA 3AI7A 1OILA 1NOJA 3DO8A 1OSNA 1RAGA 1ZITA 2PZAA 1XU7A 2F8LA 3HDVA 1AKEA 5A7FA 2VYFA 1HFJA 2WTMA 4ZO8A 4Y7CA 4ESVA 4WEQA 3W2IA 3PHLA 4EL0A 5IJ9B 1OTHA 1GZ5A 5C0OE 1KZHA 5LU8A 4J7CA 1HDRA 5HS4A 3DE5X 4O08A 4EW3A 5DWVA 1W59A 3GCZA 5U9CA 1I51A 2H4JA 4Y2GA 3PLAE 4RK6A 4NCIA 2F4NA 4I1RA 1T4DA 4HQRA 4HMPA 1DO0A 2Q45A 2Y0CA 1W47A 2LZ0A 3FNHA 4RZIA 1EXNA 1I7PA 5KDLA 4ZYVA 1USWA 4YMVA 1RS0A 2ZWVA 5BQ3A 1PUIA 2Q7DA 5FD8A 3Q9NA 3OD1A 3R44A 3RHFA 4D74A 3Q7EA 5H3LA 1ZN9A 4XASA 4QJ4A 1M73E 1A5BB 2E4WA 2G08A 2W83A 3PHBE 1L5NA 1JECA 3W9UA 1UDCA 4YJFA 2FOXA 2QMEA 3DHNA 1K4KA 3VPDA 4FYHA 4B6FA 1DADA 2ID9A 3R8FA 2EJBA 2R4QA 1PBTA 3PUXA 1MGOA 2CCGA 5E4JA 1VMKA 1VB5A 4EG4A 2WSSD 4PZLA 3GEDA 4GX5A 2CLIB 3HL0A 1P17A 1Q0ZA 3L02A 4NJOA 1T2UA 2EFJA 4XX1A 2JFVA 5BN5B 4A6EA 2WYIA 4OQZA 5E2BA 2HFKA 2PG3A 3B48A 4DEVA 3RKUA 3RUHA 2IPOA 2PZJA 1MKYA 1Z3CA 3FIUA 3BJEA 3IVAA 5B7QA 1JHXA 1NJ2A 4BO8A 1UJCA 3FBGA 5FI5A 4D9BA 1PT8A 3HLYA 4ND2A 1WXWA 2QORA 2SKDA 4PU0A 1GZUA 2QW0X 5DULA 3FPSA 4IH1A 2R1UA 2XITA 4JD5A 4IS3A 2G6BA 2BHTA 4OCZA 2C9DA 2Y6VA 4Q4DA 4TMFA 5HF8A 2AN9A 5IKEA 4S2EA 3RASA 4DV0B 3NUGA 1V11A 1BEEA 3ZVLA 4Z54A 4JLVA 3LGXA 1VG9B 1QKIA 2ADMA 2NVOA 1RCFA 2FKAA 3HACA 2HB6A 5DWDA 1YFLA 1YZHA 1G8MA 1GNRA 3T7DA 1E8NA 1GUBA 2EQBA 3VJKA 1E7YA 3KKNA 5J40A 4B3HA 1Z3IX 4KLCA 3CBGA 3CEMA 4N0EA 1RPJA 3UENA 3O9VA 4HWTA 5JG7A 4LISA 1COWD 2I6QA 3LT0A 4KRYA 5K5EA 4FQ7A 1AGXA 2PVSA 4JSYA 2NPIA 5FJIA 1O2DA 4RGBA 1XIVA 3IPRA 1OFVA 3BRWA 1FX0B 3SQNA 2JH3A 2ABWA 3AOEC 3WDMA 2I1QA 2QRPA 3KZCA 4M4SA 2XVXA 3PRHA 4L3VA 1GSOA 1GJRA 3E3NA 4ZOLA 1TO2E 2VR1A 3DOFA 4JEIA 4M49A 4UAGA 4WLEA 4CODB 3UB4A 4IEEA 4BE7B 3Q3JB 3DVAB 2FCAA 2ZYSA 2HFJA 4WNCA 1QVRA 2HMSA 1JIVA 2K7FA 1Z16A 3DBOB 1W1WA 3OIUA 1OWOA 3AW9A 3KNZA 2P3QA 3IHWA 2B7CA 2XNKA 1QTQA 3HY6A 1RC8A 4ARIA 3ETLA 3G0HA 4HWKA 4RHEA 3TKYA 3P0EA 4LYFA 5TRTA 3RVRA 4TLBA 3ICOA 2VEOA 2G9UA 3N05A 4PTYA 4DLYA 1WB4A 1E3TA 2BR4A 5SICE 2JGDA 2J3HA 2VH2A 4H3KB 4FYMA 3HJAA 4WOBA 4CMBA 3F4BA 2F3PA 2V6BA 3HXKA 4N5MA 4PBRA 2MU1A 4QELA 2BDTA 3KDAA 4J76A 5TVGA 4YRPA 4DCCA 4DR3B 4QDTA 4LRYA 4PZCA 4OI4A 5ILQA 2B3DA 4BU1A 5LMCA 3N2YA 1SOMA 2HZBA 5L45A 2B98A 3JAMA 3S68A 4U2GA 5JWRA 1IY2A 4DC0A 1NF8A 3BS4A 5AK3A 1X7XB 1UFQA 4Q82A 2EIHA 2RARA 1PO7A 2GTPA 4OP2A 1AV6A 5HDQA 3UAGA 4I5DA 3EVFA 4ZV9A 4AKEA 4BEBA 4O1IA 5A4IS 3I37X 1RI2A 1Z0DA 3O2SB 2VBCA 2J0UA 3ECAA 3IBSA 3MS7A 5FH9A 2PKQP 2QI9F 3P9RA 5D3MA 3RS3A 2XV1A 3L43A 1TCVA 1X87A 3TVDA 3QLEA 4K46A 1HDCA 4RVHA 5L53A 3TNLA 3K72B 3M34A 4HUJA 4G0MA 1D6MA 2DPMA 4LYEA 1DWPA 1VL6A 3PENA 2HJGA 2JARA 4IJUA 5LXTA 4TTQA 2JFZA 4JLNA 3RVJA 2Z8YM 2WZBA 3JAWA 3U5TA 1II0A 1QPGA 3L7JA 1N8NA 4HDSA 5ALDA 3FLEA 2C4TA 4DEYA 2I6TA 4HO1X 1VSQA 1PHPA 1Q5PA 2OVBA 2WTAA 1G3UA 4I6EA 4IXMA 4IUBS 2I0FA 1C7EA 2IHJA 4L5AA 4NYJR 4X3CA 5JCJA 3DM9B 2I55A 2F59A 3O90A 1W0KD 3IHTA 1EQ2A 2JGFA 4L28A 4MAMA 5GWXA 2E37A 2H06A 4JI3B 3VTZA 1C8BA 4S1WA 3MFYA 1B43A 5AKXA 1VJ0A 1AQJA 1SQGA 2ZBUA 3BDIA 3D8NA 3D8TA 2A9FA 1DV2A 3TR5A 1ZK4A 1FU4A 1SUSA 3OZEA 1IHPA 2OGSA 4OJYA 3R9KA 5KQSA 3GW8A 3IMEA 4X7BA 4F6CA 1RTTA 3EISA 4ZI2A 5AW8A 1E9BA 4HNGA 5IVPA 3K6JA 2IXTA 1X7WA 5IMBA 2PUBA 5IN5A 2R25B 3P2JA 3V6LA 2OWEA 3ONVA 1G291 3H5AA 4YMHA 1GGVA 1DBQA 1PD0A 5KAMA 1ZN7A 1ISIA 3RSSA 4AJNA 1L7PA 2OZLA 8AT1A 2HKIA 4BX0A 2F7SA 2Y66A 4P92A 2X8BA 3NEAA 1P61B 1U8TA 1RACA 2AVNA 4EYSA 5CYFA 2GN8A 4JR2A 4WESB 2QTHA 4UZSA 1L5QA 1AHIA 1HT2E 1DAIA 1TO6A 2ZJFA 5DRTA 5J2TB 3RVSA 1P1CA 1GL3A 1V4NA 3BWVA 3Q3HA 4J7AA 5COQA 5CBKA 4B6QA 1Q20A 1A9XA 1B8OA 2CN1A 1XAGA 4MTCA 3U9LA 2IYYA 4RJIA 1GPAA 1U4SA 4QDKA 3ADDA 3I4LA 3SYNA 3TNDA 1XVUA 3TM5A 1YMUA 3PZRA 1MAUA 4OHRA 1TYAE 2OHVA 5G02A 1AM4D 3TFWA 4Y0AA 4DDTA 4YRBA 5TQ2A 4PLGA 4JKOA 1DCKA 4BVKA 4XB2A 1OE0A 1XX6A 4OXQA 2R6FA 5AW6A 1Q1GA 4G9EA 3QKRA 3IKVA 3LT5A 4PRZA 4WLFA 4YRMA 2QJWA 1KA9H 1KC3A 5K6AA 3V1MA 1Z6TA 1U31A 1JH8A 1KERA 4Q3EA 3UYLA 2YJ4A 4AO7A 3K9LA 3W5BA 1F14A 1P7WA 2AZDA 2XJ9A 3DJYA 4IFBA 3LK7A 2EKQA 4O33A 4OB6A 3ONDA 1Z0IA 3DZDA 4LOHA 3BDAA 3UQZA 5JI3E 1WO8A 4F06A 4XX0A 1J1UA 1DIHA 4IO0A 3ZJVA 2QRZA 3AF3A 3Q2OA 6ADHA 4L7QA 5L3QA 2BFDA 1HM5A 2VYVA 1ZH6A 5MFPA 2O8DA 1SH7A 2CNLA 1C2TA 2GPWA 1EDDA 2OESA 3BXGA 2NGRA 3C6YA 3DUFA 2IGBA 4HWSA 1QDLB 1YDMA 2EBUA 2FW6A 4RULA 1S1CA 1SA0A 1ZVKA 2ASEA 4JXJA 1US8B 2CVQA 2YCBA 3K0FA 3KSRA 3Q5DA 4N3CA 4EUNA 5LQNA 4UU1A 2PS9A 3AC0A 2PRSA 1NN1A 3K1JA 4S2UA 1PSDA 1Y6GA 5FXMA 4C4XA 3I72A 5AXAA 1N2CE 5B3KA 2OFOA 2ZIFA 1SD2A 4PO8A 4JLSA 4OB8A 4QOIA 3PUWA 4OMFG 1Z2EA 3EG9A 4WFIA 5C8VA 1DEAA 1TLTA 2CMHA 2YZGA 3IOBA 1A9RA 3AKYA 2AJLI 2C9OA 3H5TA 3KC2A 4NZYA 5JO0A 1SUAA 1H2EA 4RQAA 3D4PA 1TZJA 1X2EA 1C7QA 1L5HB 2C92A 4Y18A 4E46A 2AYXA 3W2HA 1YRLA 4JQYA 4QUGA 4EJ6A 2B1IA 2YXPX 4JP8A 3EMKA 2DFPA 4M6WB 3SM3A 3THSA 2PRIA 5C7IO 2D13A 5KVQA 3UGJA 4UXHA 2H16A 4X24A 5LP6F 4QM6A 4Z7NB 1LDYA 2QUHA 4RLHA 5T4HA 3C6BA 5FORA 1HDOA 1NONA 1Z34A 1FIUA 5J3JA 1CJUC 3H19A 4I9HA 4M83A 5K3AA 3HB0A 2AC4A 1SU4A 5J1SB 2H0QA 2HBYA 2VSXA 1HDIA 2QVLA 3AMVA 3OQPA 4RM3A 5C7YA 2EHJA 3ENWA 3OQNA 2GDJA 2JEOA 4V1CB 1M8GA 2QRVA 4U39A 4WY2A 3LX5A 1T25A 4AS1A 2LCFA 1IWPB 4OVKA 2R6HA 3LPNA 3I4CA 4TZKA 3ZY2A 4BLVA 4EFMA 3JD4A 3RYHA 3ZPXA 1E18A 1XWFA 4FUTA 4RQUA 1FMJA 5JYEA 1NVGA 4KH0A 1OI7A 5A4DA 2CNWA 1IM2A 1XPOA 2FFAA 4HR7A 5DHAA 3E05A 1AUVA 2O8VA 3WQRA 1VBKA 3TOVA 1RFGE 1M8FA 3GZNA 2NZVG 1X7YB 4QOGA 2LWIA 1EMDA 4H15A 3USCS 4KQXA 3B1KA 3WO0A 1V1RA 4G5HA 3PGKA 3CZ9A 1A2QA 1W52X 4KW7A 3H5WA 3IHKA 5EIWA 3GEBA 4OJQA 3Q0EA 4MHSA 4OK3A 4A3SA 4IMJB 4B6OA 1D0IA 1HUQA 3C3CA 3FVWA 3O4VA 5AESA 5EP4A 1EFVA 1ZSYA 3IFSA 4TRRA 1D0SA 5LA6A 5CA1F 4DKJA 3FCSB 5IZ4A 1RZVA 1VIYA 2ARKA 5T41A 4MW6A 4CKCB 1GGEA 4U4AA 1S4MA 4RK7A 1SM4A 1KOGA 1NZJA 1ZU5A 4F6RA 1EA5A 5FLXA 3SIRA 5AD1A 3TNFA 1FTYA 4LBYA 1KFCB 2C78A 4TQAA 1XU4A 4FX5A 4J1TA 5KQRA 2Q0SA 1T26A 1SQ0A 2O2DA 3DO6A 4ZARA 1BDMA 3SEQA 5AVTA 5LKRA 1QYXA 4YHBA 1L4FA 3S7ZA 3T95A 2QY9A 4JUIA 3UAXA 1LB1B 4HZIA 3EGWA 2XQKA 1QHHB 5CNMA 5DTMA 5CK5A 3MHPA 5BV7A 3HU3A 1QH0A 2KW5A 1YBFA 4W1QA 3DOCA 5A3SA 4Z7QB 1REQB 3PICA 4EG7A 4X8HA 4RNCA 4CR6A 3WKEA 3GK3A 3NCHA 4KK4A 1N8SA 3FYUA 3LLUA 5DNVA 3RPEA 4RYLA 3FTPA 3VKVA 1OASA 2CV1A 3U0BA 1TXGA 5BSFA 4Q7KA 4NIMA 1O0BA 4KP7A 5ESRA 1KR2A 1KYYA 3IULA 1NV9A 2B7LA 4X63A 4CM8A 1P6UA 2K4MA 5JFOA 4QFCA 4MS3B 4R2XA 2AB0A 3WKBA 1Y98A 5DHPA 1QH1A 2HX1A 1RWWA 1JXAA 2CFIA 1Q1AA 2QYHA 2Q6KA 1WCIB 1NDHA 2Y1KA 3GDGA 3IRVA 1P3JA 1Z4NA 2J09A 2VTVA 3Q12A 4GBJA 4PX5A 4REMA 3K0AB 3WICA 2VWGA 3REFA 2ATIA 2G0TA 3S5UA 4YB8A 2QMZA 4H4DA 4ASUD 3I5YA 3ICVA 3T5CA 2PHZA 3L8HA 3KB2A 4D41A 4PHCA 2J07A 3KKMA 4PNPA 4QXPA 4QASA 3TQFA 1FFWA 4AECA 3TVYA 1Z5ZA 2AYZA 4FWTA 3VHRA 3IIJA 1LI4A 4PHGA 4FYKA 2F9FA 4KQCA 4O2AA 1IRIA 2YMLA 4QDUA 4UDYX 4ZHQB 5CA0B 4R9RA 5JNWA 5E1DA 1QWOA 1X1QA 2Y0EA 3EF3A 3BCHA 4UM8B 4WWHA 3FWNA 2R66A 4QXRA 4I1PA 2JI9A 1T3SA 5CLFA 1YOVA 5EERA 4D57A 4IDPA 3T5AA 3BDVA 3K1ZA 1OZAA 1MOQA 2SKEA 1O5OA 2VQDA 3HSSA 221PA 1XAHA 2GBGA 1LLDA 2I76A 4FZJA 3RRXA 5LQMA 1QH8A 1XNGA 1N2JA 3NWJA 5CFZA 2H2IA 5LMZA 1DWQA 2ZUBA 3N0TA 3FCCA 5CB4A 3NIBA 1IZ9A 3QXHA 1F2DA 3FMFA 4OI2A 1W4RA 3MQ2A 3P27A 1EUCA 4MUIA 1F7UA 1AUXA 1LLCA 4HAUA 3SHOA 1T2AA 3MJ4A 5H8WA 4BC0A 3ZHOA 1NT4A 4XH9B 2V6IA 3KTAB 1Z36A 4PQEA 5EZSA 3GHHA 4YCAA 5A5VA 1E62A 4I81A 5AOBA 1ATIA 2FHPA 1ELOA 2J0EA 2Z4RA 3IIIA 4Q9NA 4W1PA 3SSMA 4B3CA 5JV5A 4YHHB 1T0BA 1PT7A 4R51A 1TADA 4LFCB 2FDRA 3AEKA 1U4NA 1RHMA 3EF1A 1EFPB 5CYPA 1JSCA 4UFOA 4FNGA 4W5OA 4NMWA 3BWEA 3DR3A 5DH9A 3C3JA 1VE1A 4OI0A 2VP3A 3NOVA 5COBA 1AO0A 4OHCA 1SULA 2ENWA 4URUR 1O95C 3RRNA 1OKKD 3P26A 3HHEA 4C7KA 1EGVB 5DBEX 1Y9JA 2CXUA 2HN9A 1PR2A 5DW0A 3NVAA 5EE5B 1V6CA 1MRZA 2PWPA 2RH4A 3AR3A 4IOLA 1BEUB 1QOZA 4MV8A 1Y34E 5AKKA 1EK2A 2E4ZA 4FFNA 2NU7B 1WSBA 1D04A 3A4LA 2G04A 2Y4OA 4IHJB 4JFAA 3AXSA 4UE2A 1DXYA 3MJCA 1W2GA 4NFHA 3RC9A 4DWOA 3OFND 4DYHA 2BRUC 3RIMA 5KINB 2X2OA 3L04A 1VOTA 4KMRA 4ILEA 3HFGA 1U2RA 3WGHA 1E3WA 2XCOA 3DNFA 3M5WA 1PYOA 2JLBA 4D79A 3K9GA 1QQBA 2G9RA 4Q3DA 3EZFA 4CLRA 2JFYA 2MOKA 3CVOA 4TKLA 4RD2A 2L17A 2WSSA 1C1DB 3I34X 2ZYGA 5JQGA 4KSBA 3PPIA 3HHPA 5E7QA 3ABZA 2VNKA 1G9TA 3CF6R 4R6WA 3PSAA 2A30A 5ESDA 3GJ6A 3S99A 4GQIA 1WA5A 4ZKDA 1V41E 4BFWA 1TU3A 4WJLA 2OHFA 2GCOB 1SHKA 4NBKA 3VDMA 2I65A 5FBZA 1W36C 1U0TA 2B8EA 1IMJA 3SS8A 2PVCA 8ABPA 4NDNE 3ZDYB 3DAFA 1GEGA 1RWQA 3ETGA 2LE0A 3DF9A 1ZFNA 3Q4GA 5CW1A 2D4HA 2A88A 3HA5A 2VF8A 3CO5A 4RUKA 3RBVA 4QZVA 1BX0A 4KWCA 4G8JA 1HG1A 4D6PA 4QBGB 1CB0A 4U7JA 1YV9A 4BB6A 2WU0A 3GPBA 3M6XA 2FUKA 3GGSA 3PF9A 4LHYA 1TJNA 1KK1A 2V5UA 5ER9A 3SU8A 4C4ZA 5HUQA 2XWPA 3EFEA 1W93A 3RRBA 1TM2A 3V80A 1P4RA 2B9VA 5L6LB 4MW1A 4KIGA 1EGMB 4UMDA 3VOBA 2BT4A 4J29A 3KQOA 1COWA 3K8QA 3RBZA 3OQBA 5A4AA 3NVMB 2ZRDA 5KUTA 5JS1A 4IIHA 3U3XA 4BAGA 2FE4A 3H0EA 5CNJA 4TMTA 3RTBA 4MKHA 3UT0A 1IL0A 1IEQA 3C3DA 3HI6A 4R1UA 4TLLB 4Z1MA 3RYCA 2PH3A 1GCAA 1V7ZA 2WUEA 3QOFA 5HE9A 4CKWB 2L2QA 3RTAA 3A3KA 4KVZA 2UYGA 2OXRA 2ZSFA 5DGTA 3KVOA 1OV6A 4TT3D 1E20A 2F3QA 4C4YA 1P2GA 2AQKA 2ZIXA 3COWA 4HNVA 1AIPA 2ORWA 3EZYA 4KN6A 3ZVMA 3IAM1 1MX1A 1Y8RA 5L7WA 1GDDA 1NE7A 2V5VA 3PDUA 2IP4A 5BR8B 1RWVA 4KRFA 1WULS 2WILA 2PGIA 3NTOA 3WX0A 1FMTA 2XVMA 4EO7A 4CT5A 1I0ZA 1S2NA 3AJ8A 5DE3A 3P8ZA 5CDFA 3WGYA 5BWMA 8GPBA 2OV1A 3A1DA 4AJ2A 4EGFA 2O3JA 2O6LA 3TXXA 1DBVO 4Q47A 3R8XA 5F7JA 2D1RA 2FEAA 2XE6A 4NYMQ 3SPXA 2I4NA 4N9QA 3RWBA 1DZIA 1MJGM 1POWA 2HMWA 2W2NA 3EFOA 4KYTA 1F8GA 1I0IA 1SVOA 2IEZA 1Z45A 2WPNA 4I7EA 3I05A 1KIAA 2XB4A 4BFLA 2O2SA 3QVXA 4NP6A 4MWCA 1E9VA 3UT6A 3WIUA 1CLEA 1TLLA 2Z2YA 4HOYA 4DUGD 4F21A 4HNTA 2VLBA 1MENA 4WKOA 2AUTA 2CV2A 3GCGA 2ACVA 4D9CA 2HYDA 3V2UA 1K88A 2P4QA 3EBOA 5C8ZA 3KOXA 1OFUX 3DH0A 4BMPB 1NJ8A 2ID7A 4FIZA 3BE8A 2PMDA 1O58A 1U90A 2ODTX 3FRJA