3DHNA

Crystal structure of the putative epimerase q89z24_bactn from bacteroides thetaiotaomicron. northeast structural genomics consortium target btr310.
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
222
structure length
216
Chain Sequence
KVKKIVLIGASGFVGSALLNEALNRGFEVTAVVRHPEKIKIENEHLKVKKADVSSLDEVCEVCKGADAVISAFNPIYDETIKVYLTIIDGVKKAGVNRFLMVGGAGSLFIAPGLRLMDSGEVPENILPGVKALGEFYLNFLMKEKEIDWVFFSPAADMRPGVRTGRYRLGKDDMIVDIVGNSHISVEDYAAAMIDELEHPKHHQERFTIGYLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase, lyase
molecule keywords NAD-dependent epimerase/dehydratase
publication title Crystal structure of the putative epimerase Q89Z24_BACTN from Bacteroides thetaiotaomicron.
rcsb
source organism Bacteroides thetaiotaomicron
total genus 59
structure length 216
sequence length 222
ec nomenclature
pdb deposition date 2008-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13460 NAD_binding_10 NAD(P)H-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3dhnA00
1RM0A 1Z45A 4IQ8A 4JBGA 4UVEA 3TN7A 1K89A 4NMHA 3TSCA 5ICSA 1VSUA 3IOYA 1EDZA 3MZ0A 5FWNA 1B8VA 4BO8A 1QSGA 2CDBA 2GO1A 2YJZA 4G81A 4MVJD 3OECA 4L75A 1PJLA 4W7HA 4W99A 4E0BA 5A9TA 3UOGA 4NK4A 1P1RA 1XQ1A 4I08A 3PEFA 2GNAA 2H1SA 3DOOA 3KUXA 4PLPA 1OAAA 4WLUA 3KYDA 3VAZA 4YAGA 1SNYA 1BXGA 1DOHA 3ITKA 4XIYA 4YAEA 4ZD6A 4MP6A 2R00C 2WTBA 4PG6A 3G3EA 3E6AA 3GZNA 3H3FA 2X0IA 5ENDA 4OM8A 1J4AA 4L4RA 4BO0A 3IIEA 5TF4A 3PQDA 3GMDA 1SMKA 3Q2KA 3KLMX 1E0DA 2O3TA 4NHEA 1GYPA 1PJQA 3CZRA 3HB4X 3QV1A 5L9AA 3G17A 2C07A 2A9FA 4AJLA 1BDBA 5JDIC 3P2YA 3ZU3A 3GVHA 4QO7A 4EUHA 2Q1UA 3C1TA 2D5CA 4IIUA 2AQ8A 5IZ4A 1IOLA 5C5IA 2AQIA 1T4DA 4D42A 2Y05A 3DMTC 4AJIA 2BFOA 5ITVA 3SJUA 5JAZA 1NAHA 3TL3A 4BNVA 1HYGA 4ZQHA 1MA0A 1SZJG 2Y0EA 1HDYA 4EEXA 2H6EA 4KQWA 4Z3KA 3JQBC 3WGYA 2NTVA 1JVBA 4PG5A 7ADHA 3DHNA 1LRLA 3CINA 1K6JA 5B12A 1K2WA 3U0BA 3RROA 3GGGA 5JMPA 2AHRA 4ALJA 3F3SA 3H9UA 3VHRA 5ILOA 1ISHA 4QECA 3BMCA 3ZDFA 2HK8A 1P1FA 5MGBA 4CUJA 4EJ6A 3QSGA 1XR3A 2R00A 1HE2A 1K0UA 3OEWA 4M8SA 3ZWYA 1SEPA 2AG5A 4ALNA 4B8WA 4ZICA 3EC7A 3ONDA 4XWYA 4GSLA 2QHXA 4N54A 4FOSA 2H9IA 2FR8A 1NTOA 4CMCA 4HP8A 5B4TA 1R12A 5TLSA 4UVGA 4Z9XA 3JD1A 1SOWA 2P2SA 4J2OA 4ZRNA 4BIIA 1R4NB 2VUTA 4A10A 2VOJA 1V35A 5JDIA 1C1DB 3F6YA 2X58A 2RH4A 2X9NA 4AJ2A 2DT5A 1PS0A 4ZJUA 1VJ0A 2C5AA 3AOGA 2XXJA 1E3WA 5GY7A 3I5MA 4BNNA 3AY6A 2YDYA 4YVFA 3K31A 4R1TA 4YQYA 5J23A 1OOEA 3JQBA 1HXHA 4WLVA 1KEVA 3M2PA 1ADCA 2X0RA 2O4UX 3TF5A 1BVRA 4BO7A 4H7PA 3SLKA 3FI9A 1ORRA 4NDNE 2Y0DA 1N5DA 4R16A 4HFRA 1P1KA 1R4MA 4J0EA 3RBVA 2Q46A 3QIVA 2VRBA 1ZCJA 2YZ7A 3IS3A 1E1NA 4OGWA 1ZKMA 4I5FA 3ZWOA 1X7DA 2I6TA 4XQEA 3LT0A 4GBJA 4NFHA 3VDRA 5EERA 3WBBA 2OP1A 3DBHB 1XEAA 3JQAA 2HU2A 2HK9A 1UXKA 3UXYA 5FEUA 1N1EA 3H9JA 1DHRA 1E6EA 2VRCA 3OA0A 3U62A 5HA5A 2HAEA 2W90A 5ILGA 1PS9A 1MX3A 1F8GA 1C14A 1L7EA 1NR7A 1CF2O 1GADO 2Q1TA 1EVJA 2FSSA 2IEDA 4JGBA 2PGLA 4PLTA 5H82A 2C2XA 5EQDA 1MLDA 1I3MA 2WWRA 4RVGA 1C0PA 1ZEJA 1XKQA 1L7DA 2Q2VA 1K5HA 1NFQA 1P31A 1A71A 1U2GA 1GEEA 1IPFA 3LSYA 4KP7A 2Z1NA 5IN5A 1AN9A 1A7AA 1Y81A 4Z0PA 2D59A 3UW3A 2AXQA 3MWEB 2ZQZA 2DLDA 3I6IA 2ZB3A 3D3WB 4AL4A 2FPGA 1MC5A 1VM6A 1UDCA 1Y8RB 5A3VA 1DLIA 1GCOA 4AJNA 3ZNQA 4DYDA 4MPDA 1ULUA 4DIFA 1U4OA 4J0FA 1B2LA 1N7GA 3I9LA 5I9MA 2NM0A 4JK3A 3SJ7A 3R1IA 2YUTA 2A35A 3GNSA 1EE2A 2EIHA 1E1LA 2GERA 1EVYA 1ZO8A 4XB2A 3ASVA 2I76A 3MWDB 4E2ZA 3AU8A 4R41A 3LZ6A 4TKMA 3WNQA 3G1TA 3HSKA 4HY3A 3PP8A 4II3A 2YHIA 3RI3A 1PGQA 3G1UA 4OHUA 2JFHA 5ER6A 2PZJA 3OA2A 2VHXA 1SPXA 2DQ4A 3FN4A 3HE3A 4XR9A 1GFSA 1GYRA 4DMMA 3SC6A 4OMUA 3TJRA 2WSBA 3ROKA 4AJPA 4OXKA 1EZ4A 2UUPA 4UEKA 1QP8A 3KXDA 1TT5A 1X7HA 1DRUA 3WXBA 5JY1A 2YYYA 4CLRB 1VE9A 4B7UA 3DDNA 1G1AA 4K28A 4PLGA 4WGGA 3WGGA 3WG9A 2GPTA 5FFFA 4NQZA 1NQ5A 2X6TA 4CV1A 4DQXA 3G49A 3U9LA 3UGKA 5F5NA 2B4TO 4HNGA 5JMWA 3DZFA 5BSGA 1PQWA 4BNIA 3E9MA 2X1HA 1HDCA 1LNQA 3T7CA 5BSEA 2B83A 1EK6A 1VI2A 4B3IA 2J5RA 5IN4A 5EIOA 1QV6A 4MVJG 2O3QA 1DRVA 3PDJA 4NR0A 3SVTA 1G0NA 2C54A 4WLOA 5BNIA 4W4TA 1V6AA 2DTDA 4CUZA 2GDZA 2GUGA 3QVTA 3CMMA 2ZTMA 4ZA2A 4FGWA 2OBYA 4MINA 4BS9A 1X1TA 4BOYA 3OQBA 3E9NA 5JAQA 1HF3A 4NNJA 1PGNA 1LDBA 1ZJYA 4J91A 2EERA 5L40A 1P45A 4RPKA 2P9EA 5KJEA 2NU7A 3OF2A 2JFGA 4FFMA 4XQ9A 4CM3A 4JROA 4XRGA 4I9HA 4OXNA 1EUZA 4ND1A 3NDRA 3VKUA 2VT2A 3GN1A 1M6HA 1IULA 4YJFB 3PTZA 4FW8A 4AJEA 4R1UA 3GGOA 3FPCA 3WJAA 1P0CA 3FTNA 1FJHA 5ADHA 4GL4A 1MG5A 2X9GA 3GVCA 1JN0A 2O48X 4OXYA 5IFLA 3PQFA 4BNFA 4DTIA 3L6DA 1QR6A 3INRA 2FOIA 4JQCA 4KUEA 4QFCA 4CV2A 1PWXA 1VL6A 2PD6A 3PWSA 4RORA 4WLFA 4CPDA 4PLHA 1Q7BA 1MUUA 5KKCA 2IE0A 1DBVO 1H5QA 4EITA 3DZHA 3W8EA 1XA0A 4RLSA 4A0SA 2DU8A 5DF1A 1VSVA 4CQLA 5JO9A 1LC3A 1GV1A 3NT5A 4NFSA 4RL6A 3ON5A 3RC2A 3K6JA 4YR9A 3WLFA 2CNBA 2ZCVA 3CMCO 4R5HA 3ANMA 5A4DA 1TLTA 3DXFA 1D8AA 4MVJP 1PL6A 4QUKA 3HZZA 4EEZA 1UP7A 1HDOA 1Z75A 4MVJH 4CM5A 4GKVA 1BDMA 1LC0A 4RVFA 4XKJA 3E18A 3WOHA 4PVCA 4E32A 2X5OA 3NRCA 1LDNA 4GLOA 1LU9A 1ZBQA 5JSFA 2NVWA 3VVBA 1KIFA 5AVOA 2DM6A 4ZVVA 4N5NA 1J6UA 3S8MA 4B7XA 1KOLA 4BHTA 1UH5A 1HWYA 5EPOA 2Q2WA 2WD7B 3TL2A 4D3FA 3L6EA 2VCYA 1CEQA 3A1NA 3DOCA 1KETA 3FBTA 2VQ3A 3FBGA 1DLJA 1GL3A 2DBVO 4NBTA 4QX6A 2AQHA 2P5YA 5JC1A 4BNKA 2BI7A 1R0LA 4E2XA 4GVXA 4RPLA 4XB1A 1YOVB 3FWZA 2FZWA 1IY8A 2HMUA 5FI3A 2A92A 3LQFA 5LCXA 1PGPA 5KJ1A 3D0OA 2VZ8A 3QHAA 4XQGA 1LRJA 3ZU2A 2GRAA 2IODA 4YDRA 3MJTA 2DTXA 4MO2A 1BMDA 4WCFC 5THKA 2HMTA 5TQVA 3OJEA 3PLRA 1H2HA 5LC1A 4J1NA 1I3LA 2AE1A 2P9CA 3O8QB 3E5MA 1H94A 1HDXA 3GH3A 3DFUA 1H6BA 1BWSA 3RFTA 3ADPA 4FD3A 3OICA 3SC4A 3ZCXA 3UN1A 4E31A 4J3FA 2BGMA 3BMQA 3H5NA 3W8FA 3FRJA 1E6WA 4BO6A 3CE6A 4IGEA 2NQTA 3JYLA 5A9SB 3EK2A 1X15A 2J6IA 4E5YA 4RVHA 1ZUD1 3CUKA 4U7WA 1T25A 4NI5A 4HFNA 4LN1A 4R5MA 3LT4A 3LDHA 1GCUA 4J4HA 4Y6PA 4XIJA 2ZIZA 3AJRA 2YQ5A 1U3UA 2O23A 3ZWNA 1ZFNA 3VH1A 1HLPA 4BL5A 1BGVA 3DHYA 3WSWA 4E5NA 4F46A 4Y8VA 4CM4B 4DMLA 2G76A 5EQFA 1XQ6A 3AWDA 4FFRA 1KEUA 4PLVA 4NPCA 3JQCA 1A27A 4AJ1A 4XGKA 1BSVA 3ENNA 2RBEA 3U49A 2NQ8A 1WP4A 1DJQA 2G82A 3OQ1A 4ND5A 4HBGA 1OC2A 4UUOA 3TOZA 3JSAA 4R3NA 5T8KC 4FDAA 4FFNA 2VWQA 1QXSA 1FDVA 2O2YA 1RJWA 1EBFA 6LDHA 1GZ3A 3O26A 4H16A 4QXMA 2DC1A 1YXMA 3E48A 4IS2A 1YO6A 3AUUA 4J49A 4R68A 1F14A 5KVCA 4XEHA 5A03A 2X7HA 3B1FA 1LDYA 1ARZA 2GF2A 2QYTA 3L9XA 5B4UA 1LQTA 3NTOA 3QY9A 2C5EA 2ZATA 1GQYA 5CPFA 2J3JA 4M87A 5A05A 3GY0A 3I23A 2Y93A 3QP9A 1W0CA 3WIEA 2QYSA 3NJ8A 3ZWBA 3CH6A 4A26A 4NG5A 1I36A 3UVEA 4BV9A 4TKLA 2WE7A 3GC6A 1LI4A 2Y99A 2BKAA 5JLAA 1ENYA 3EW7A 4O1MA 3BAZA 3RAJA 2C7GA 3EVTA 4HADA 1BXZA 3DC2A 5G0VA 5DP2A 4FR5A 1QYCA 2HMSA 3FR7A 4PRLA 1D7OA 1Q7CA 3TZHA 3IKVA 1F0YA 3TZQA 3GRKA 3HB5X 4XX0A 4CLHA 4WUVA 4IDCA 2G1UA 1I32A 1R4NA 1NQAO 3DAGA 4NU5A 2O2SA 5T8KA 2IYPA 5CDUA 4R54A 5BSHA 1LTHR 2ILTA 1K6XA 3C7CB 3WYBA 1UZMA 3EZLA 3NEPX 3RUHA 4Q3DA 4JCOA 3WYCA 1WMBA 3V8BA 3WGOA 2V65A 1DDOA 3GR6A 3QLJA 4GGPA 1YJQA 3GPIA 4TMFA 3NKLA 2VNAA 5T64A 2IZ0A 4FPXA 4HX5A 3T4EA 3V1TC 2FPPA 1CDOA 1WW8A 1YS4A 2PKQO 3F5QA 3H9EO 1U7TA 4GVLA 5H83A 4CMEC 2ZTUA 1H6AA 3H5RA 1ZK4A 4PG4A 3AU9A 3JYQA 4FCCA 3GEDA 3VOSA 3IKTA 3K30A 4XCVA 3DQPA 5B37A 3WBFA 4FS3A 5A3JA 2SCUA 3PIIA 3DBHA 5T67A 1ISIA 1LUAA 3AY7A 3O03A 5LDGA 2PR2A 4ZRMA 2VWPA 4YRBA 1B7GO 4NJOA 1LJ8A 4XA8A 1EE9A 4E6PA 4W7IA 2Y1FA 4ND3A 1RWBA 1MFZA 1A9ZA 2C29D 1R66A 1PJBA 3KOUA 2UDPA 1MXHA 1HSZA 3MJCA 4HNHA 4WKGA 4E5PA 4E12A 3OSUA 3D5QA 4E2YA 1YE3A 1LQUA 1YVEI 3B70A 1Y8QB 3OIFA 4AJJA 3QWFA 1WLYA 5JYDA 5GZ3A 3STHA 5A02A 4Y67A 1NWCA 2D5AA 4PLZA 3P2OA 1PZFA 3F9IA 4BNWA 4FC7A 2FPIA 1H93A 4CR6A 1LRKA 1TT7A 3EUWA 3GDFA 5JBIA 2LDXA 4PZDA 2CD9A 3AM3A 3Q11A 3PGXA 4Q9NA 4I9NA 1I24A 4IJKA 1KVUA 3K96A 5KVQA 3D1LA 1WAMA 4MVJM 4YRDA 4CMEA 2UV8A 3RUCA 4LK3A 2B5VA 1XYGA 3KB6A 3D3WA 3AW9A 1LSJA 4DIBA 1Y8RA 1IPEA 1XWFA 2VTDA 3GUYA 4PRKA 1U8FO 1LEHA 1EBUA 1WWKA 2PY6A 3EY4A 4WJZA 4DA9A 1SC6A 3BMQB 3EGOA 4BKUA 2IDZA 1HZJA 1IUKA 2D2IA 1Z74A 5JE8A 3V2GA 5KTKA 2FP4A 4EYEA 5ICMA 2DBQA 2NNLD 1XSEA 1BG6A 2PH5A 2YFQA 3QRWA 4BVAA 8ADHA 2GZ2A 4OQZA 1JAXA 1PZGA 1FDWA 5U1PA 4CQMB 2FZEA 3I83A 5JC8A 4YRAA 4IPTA 2Z95A 5C7OO 1SO8A 4BNXA 1GZ4A 4B4VA 5DCUA 2UUOA 3AI3A 1IHXA 3JQGB 1RM4A 2HJSA 3FNGA 3DB2A 1NQTA 3B1KA 3H8VA 2WM3A 1T2CA 2JJYA 3UCFA 1UDBA 5T5QA 1KVSA 3CXRA 2IZ1A 4NZ9A 4BMVA 3A4VA 3HFSA 1HYHA 2EKLA 4UVHA 2CVQA 1E1KA 2CUKA 2B4QA 3ABIA 3OQ6A 4ALMA 4CMGA 1D1SA 4CLRA 3AI2A 3GQVA 3GG2A 4D3SA 4KZPA 4IBOA 3H5AA 5CEJA 5JPIA 3GG9A 4IXTA 4TRJA 4BGUA 3R3JA 3OJFA 2X9VA 4N7RA 4IJVA 4Z9FA 1PU2A 2Y1CA 1JDJA 2IXAA 1J49A 5G4KB 4JN6B 4MIEA 3AFNA 3O9ZA 1GAEO 1EFKA 3PLNA 2ZK7A 1FMCA 1KERA 1DIBA 1DXYA 2VHYA 3NDJA 1NX6A 1NPTO 1DAPA 2BLLA 3NT2A 4TROA 2LDBA 1GR0A 1SOVA 4GGOA 1HEUA 1ZMTA 3WIDA 4ZGWA 4IZHA 3OP4A 5AXDA 1GV0A 3RUIA 2PKRA 5DP1A 1AUPA 1QKIA 1NFRA 5T57A 2GLXA 1HL3A 1D1TA 1LSUA 3U4IA 4RLHA 5IXSA 1TI7A 4CMJA 2VYVA 4K6FA 1JW9B 2X23A 3GVXA 1PL7A 2Q4BA 2W2LD 4IMPA 3ASUA 1LDGA 3TZKA 5B1YA 2EHDA 5KJFA 3MJVA 4PCVA 2GZ1A 4M54A 1RKXA 4JJIA 5EL0A 4YJFA 2CDCA 3GAZA 4RV9A 4RGBA 1FXSA 1U3WA 5ES3A 2HMVA 5G2OA 3WGHA 5I9LA 3U4DA 3QVOA 3SLGA 3I9OA 3FNFA 1O0SA 5I7FA 1RPNA 4UREA 4WEQA 3H2ZA 3ZWCA 4B7CA 3ZU5A 4YAKA 4IS3A 3L07A 4Z9YA 5JCXA 5LDHA 3BMOB 4ALKA 4Y6SA 1JLLA 2I3AA 4IDFA 2OMEA 3I9NA 4CV0A 1Q1NA 3QA9A 4HXYA 4KOAA 2EJWA 4OYRA 3W4JA 5ER9A 3RU9A 2ZKLA 4K26A 3ZN2A 4AG3A 5CDYA 3FPLA 5TT0A 1MB4A 3ROMA 3T4XA 1GY8A 3R3SA 3PHIA 4WLNA 4INAA 4R1NA 1MC4A 1BRMA 1VL0A 4XYEA 1GEGA 2O50A 1UXGA 3N58A 3SEFA 3VTFA 1V3UA 2Y1DA 4DLLA 2R6JA 2V6GA 1F06A 1TVEA 5EESA 2NUAA 2QQ5A 5FF9A 4IM7A 3TRIA 4NJMB 2NV6A 2V7PA 3RFVA 4B3HA 1DB3A 4ALLA 5DBFA 5F3RA 3H3JA 1GPJA 1DC5A 3WNVA 2C7VA 3RFXA 2G17A 4B4WA 4TVOA 2DUWA 4R51A 5L7YA 1N1GA 4O6VA 1R0KA 4N5LA 4J43A 4WPGA 1GU7A 2RCYA 1EVZA 4DC1A 3OETA 1LLQA 2J3HA 2WD7A 4PZEA 4TRRA 4RPGA 2ZJ0A 4YACA 1ENZA 5CDSA 1P1HA 3TDKA 2EW2A 4XGIA 3U09A 4MOWA 4MKXA 1CJCA 1XCBA 3DZIA 3GT0A 4M86A 1T2DA 2EKPA 5IAAA 1YOVA 4OJNA 1MFPA 4Z0TA 5DOZA 1E3EA 4EBFA 2NVUA 1DIGA 1O89A 3DBLB 1KC1A 3OMLA 4J2HA 4XZ3A 2GGSA 2AEFA 1CERA 1ZJZA 2OZPA 2QZZA 3FF4A 4MP8A 4FFOA 1KVQA 3ETEA 2EP5A 3QE3A 2GCGA 1IE3A 3WGZA 4DQUA 3EYWA 3WFIA 5CEEA 3MJEA 1ML3A 4EGFA 1TA4A 4BO2A 1VPDA 4URFA 2O4CA 4A7PA 1P74A 2AW5A 1WZEA 1TB4A 3GVPA 3R6DA 4R9SA 1U1IA 3O8QA 3U3XA 4RDIA 3VH4A 2VZ9A 1D3AA 1IB6A 1WNTA 4PLCA 1HSOA 1UR5A 4J4BA 1GD1O 2YV1A 4FN4A 3VTZA 1VKOA 1YB1A 2Q45A 1JQBA 2VYNA 3HG7A 4II2A 3I4FA 1JTVA 4CLOB 1CIVA 1P1IA 4Q3NA 5A9SA 4BGVA 1W73A 4E3ZA 3DWFA 3RBZA 1YBAA 4OSPA 1M67A 2FR1A 2OOSA 1DFGA 3JQEA 3W8DA 2O3RA 5IZCC 3RVDA 3HHPA 2EEZA 2HRZA 1J0XO 3IMFA 4W6ZA 3PIDA 5JCJA 2OFPA 1PZHA 5TJ9A 2Y1OA 3Q6IA 5A5FA 3BZUA 4ZU3A 5HWSA 4FQ8A 1BTOA 4W9NA 2FMUA 1Y9AA 3OEYA 1O6ZA 5IDXA 4OSOA 4EW6A 3IAHA 4YEDA 4BQRA 3CKYA 1Y5MA 4EZBA 1AHIA 4G2NA 4JJGA 4CM4A 5I9NA 2PZLA 1T1RA 2H63A 3DTYA 2CDAA 1C1XB 2HLPA 3QJ5A 3NUGA 5KJ6A 1T24A 1KBZA 2W4QA 4MVJE 3HADA 2DFDA 4CLDA 1IYZA 3H7AA 2JD2A 3BHIA 3AFMA 2X0NA 3L4SO 4L0QA 2JL1A 1YL5A 1PGOA 3VPFA 2O3SA 4PLFA 3HDHA 1DJNA 4MKRA 4QEDA 3MJSA 2NTNA 3TOXA 1ZSVA 3KYCB 4JNKA 5L4NA 2VHZA 3ZZNA 4DWVA 1F8FA 1HTBA 4YT8A 4GAEA 4BO4A 1HKUA 4BKPA 1DC4A 1Z73A 1AXEA 1JVSA 3JD2A 3IDSA 4BNTA 3L4BA 3IJPA 5IZCA 2Y66A 1NP3A 4YAIA 2E37A 1ZEMA 3PFWO 2ZB8A 1RYDA 4QQRA 3FNHA 2OHXA 3PRJA 1SB9A 5T6BA 1YQXA 3JQDA 4D41A 3HN7A 5GMOA 2CSUA 1E92A 1ZMOA 1I5RA 1R37A 2I66A 1NAIA 3DBRB 2OL4A 3SBOA 5FI5A 4YT2A 3HWRA 1PJCA 2WJPA 3KEOA 2QRJA 5K9ZA 3M1AA 1Y9EA 4F6LA 3WB9A 2VT3A 1GUFA 4FBGA 2NSDA 4Q3AA 1I30A 1R15A 4PGFA 4WK6A 3KLPX 3ZWVA 1K3TA 3PI7A 1HT0A 1HLDA 3GMSA 4DVJA 5HM8A 1F12A 4CL3A 6ADHA 3N7UA 7MDHA 4LMRA 1NFFA 4WEOA 9LDTA 4S3MA 4L8VA 3MOGA 4CM7A 3PK0A 3WTBA 2CY0A 4EUFA 3WS7A 4E33A 4EJMA 2DBRA 2EWMA 3DBVO 4GI2A 4DPLA 4DQVA 4BGEA 5JO0A 4KQXA 4G5HA 3MEQA 1G6KA 2JHFA 4B3JA 3HDJA 4BB6A 4I5EA 3VPGA 4FIZA 1CQIA 1YRLA 1HYEA 2J5QA 4ZHSA 3JQAD 3KRTA 2WYWA 3O4RA 3F1KA 1Z82A 2WMDA 5CG2A 4FJ0A 4UVIA 4XQCA 1UXIA 2WYUA 3EVNA 2ZYDA 3GDGA 3WQRA 2DKNA 3WX0A 2VRCD 5I8WA 1YQGA 4DRYA 4BNMA 3ZNNA 2C0CA 1ONPA 3NAQA 1SBYA 4BNZA 4U0JA 3DZJA 5KVSA 2CVZA 3L6OO 4U0KA 3I9JA 1DRWA 4ZQGA 1YKFA 2WDZA 3RD5A 4WOKA 2P4QA 4E21A 3GHYA 3K9QO 2YQ4A 3P5SA 4MIYA 4HFJA 3C7DB 2ZTLA 4JJFA 5K0ZA 1XELA 3VC7A 4ZQEA 4CMAA 2PLAA 3DONA 3GOHA 2QIOA 4IUYA 4Q3CA 3S2GA 4RF2A 1JU9A 5TNXA 1WDKA 1YWGO 3JD3A 4YBZA 4WCDA 4JP3A 1GYQA 4DBVO 1Y8QA 4KTVE 2NU6A 5GZ1A 1CETA 1LLUA 3BIOA 3ZWMA 2ZYAA 4GWGA 3DEYX 3MTJA 1OC4A 2NVUB 2OP0A 2BH9A 5COAA 4JXKA 1UZLA 3A14A 3M2TA 4WNIA 1XU7A 4DC0A 1AHHA 4U6QA 1VJTA 3OJLA 2B69A 1GTMA 2C82A 4A73A 1SAYA 3DL2A 5U4QA 4C4OA 4AJOA 1V0JA 4EJ0A 1ENOA 1L1FA 5L51A 4DBZA 1EVIA 2A4KA 3LT2A 4XJTA 4AJ4A 4BUCA 5DN9A 2DPGA 2QZ9A 4L76A 3F4BA 2VYND 5A1TA 1V8BA 1O8CA 1W6UA 2PWZA 5IDQA 2Q1SA 4B8ZA 2TMDA 3BMNB 4IY1A 3GFBA 2E4AA 1EFLA 1Q7GA 4XDYA 2D3TA 3ANNA 3VPHA 1N9GB 1PQPA 3PJFA 2BRUA 2BHLA 4I5GA 1U4SA 1EK5A 3K92A 5JCJD 1NVGA 3C3XA 5G4LA 1ZK2A 3S1LA 3IC5A 4C7JA 1MP0A 4C7KA 1EUCA 1H9BA 3PPIA 2BMAA 3ZV4A 4RPHA 5IDWA 3K2EA 2FSVA 4OL9A 3GK3A 5IXYA 2FN7A 1QLHA 2YFHA 4TQGA 1CYDA 4CQMA 1GQQA 1H0KA 2Q2QA 2YV3A 4UEJA 5ENVA 5IG2A 1YL7A 1E7WA 1X0VA 1UDAA 3JQFA 1Y7TA 3JQGA 3WJ7A 1UZNA 3C24A 3NT4A 1EDOA 5TS3A 5TIIA 1P1JA 2JD0A 2O7SA 1PEDA 1KEWA 3GAFA 3B20A 4YT5A 2JAHA 3NJ4A 4Z3DA 1ZVMA 2OUIA 3UICA 2EJVA 2O7QA 4IDEA 2BD0A 3W4KA 1WPQA 1XIVA 1M75A 4OOEA 1OFGA 1A72A 4P4LA 2V6BA 5CFZA 4IDAA 3TPCA 2VNSA 4B79A 1ZZEA 4DUPA 4MVJA 3BA1A 4TZKA 4D3DA 2WD8A 3NTRA 3JQ8B 5G4KA 4CJXA 3AI1A 1BW9B 1C0IA 4F45A 4TVBA 4OH1A 3FD8A 3NX4A 1EMDA 3GHHA 5EN4A 4R4JA 2P4HX 2X22A 3GVIA 3ULKA 2H5LA 4IMRA 4F3YA 1E3IA 4KUHA 2XPCA 3VZRA 1QMGA 1JKJA 3PYXA 4XDZA 5AXBA 3AUSA 1E6UA 5F5LA 3S2IA 1Q0QA 3LLVA 4BKOA 5DCWA 1P9LA 4CMIB 1IHYA 1FDUA 3BHJA 4FOOA 4RCVA 4DPMA 1GPDG 1M66A 3KV3O 3ANLA 3CTMA 1W8DA 2Y68A 4M1QA 1YONA 1AE1A 3FSRA 3Q1LA 3VDQA 4HV4A 2CF6A 4YCAA 3WDSA 3PXXA 4CV3A 4JIGA 1PJ2A 1KVRA 1X0XA 4UULA 2YHUA 2E49A 5DNAA 1DPGA 2EXXA 5C37A 4CM9A 1F17A 1ZK3A 2I5PO 4UEOA 3V5NA 3VZQA 3ST7A 4J7CA 3W1VA 4L4XA 5CDGA 5F1PA 2B4RO 4XYGA 1BHSA 1X13A 3T7EA 3W6UA 2DAPA 3ZU4A 1H2BA 3FNEA 1V3VA 1TEHA 1ZK1A 3TZ6A 2BELA 2RIRA 1P77A 3B6ZA 3BMOA 3HDQA 3ETDA 1LSOA 3F5SA 2NACA 2DBZA 3TFQA 4NIMA 3PYLA 4ONEA 2I67A 2Y67A 3WGTA 3QWBA 1U28A 2E82A 3VZPA 1OZAA 3O38A 4I1IA 3H9QA 3UHAA 3I9KA 1KY5A 2VHVA 1R0SA 4JBIA 1UJMA 4N18A 4AICA 3EAGA 2JFFA 3IUPA 3RKRA 1I2ZA 4Q3EA 4BNYA 1HE4A 4P22A 4OKIA 3D4NA 3Q0EA 5KOIA 4DYVA 4E4YA 3I52A 2I99A 2PA3A 5L53A 4D7AA 2JHGA 4HUJA 3KSDO 3JQ6A 4NJMA 3UH1A 5JAMA 1ULSA 3HN2A 5KKAA 4LVCA 2QG4A 3RSHA 1PQUA 5KCZA 1FDTA 1XG5A 2XXBA 3PFFA 3CIFA 1H6DA 2PD4A 1LSSA 1WXDA 3I9MA 3ZW9A 4DLBA 3CSDA 2JCVA 3VVCA 5L7TA 2NLOA 1ADGA 5GZ6A 3V1YA 1WDLA 4LISA 3UUWA 5JW6A 3ZH2A 2BGKA 3LC1O 3M1LA 1YBVA 3GEMA 4ZQBA 1ZXBA 4U8GA 4UAGA 5A06A 1I33A 4L9RA 3PHJA 4MIOA 3E82A 3JYNA 4BKQA 3ONFA 4J4TA 1C0LA 2BF7A 2RHRA 3DBLA 3RUAA 3VH3A 5AXCA 2QRLA 4L73A 3E03A 1DC6A 1P44A 3OHSX 1VJ1A 4I8XA 3LK7A 3UCXA 5TC4A 1I2CA 1W4ZA 1S6YA 3NTQA 5EMHA 5DDIP 5FYDA 3U4CA 4JBHA 5K6AA 5IF3A 3GPDG 1I01A 2O3UA 1E77A 3R0IA 4KDEA 3TQHA 1PS8A 1HZZA 1KC3A 1U8XX 1ADFA 3ZNPA 4BNLA 1E7RA 1N8KA 4IZIA 4J90A 2W8ZA 1T2FA 5AQ1A 1PJSA 1P33A 4CLOA 2TMGA 4IDGA 4IGFA 2PH3A 3JQ7B 4RDHA 3ICCA 3GGPA 3RBXA 3U4HA 1MG0A 2XAAA 1PJ3A 3Q2IA 3QWHA 4IIVA 1MXFA 4O5OA 5HBRA 2HSDA 5TRTA 3K73O 3DO5A 4ND4A 1B8PA 1P3DA 1LXCA 1NYTA 2VZ0A 3DOJA 4B4OA 4I5DA 1AXGA 2ZB4A 2DFVA 3K5PA 2Q4EA 4NK5A 4WE3A 3MTGA 1C1XA 2C20A 1PSDA 4F6CA 3F4LA 1EQ2A 2B37A 4IINA 3WQQA 3IUSA 3AOEA 4WOJA 4MKZA 3DHEA 5JDCA 3LYLA 3INTA 3JQ9A 4M89A 5G0SA 1Z7BA 3QW2A 5L4LA 5BNFA 2YV2A 4BNUA 2CFCA 2VWGA 3ROQA 3KYCA 3PZBA 2ZCUA 3C1OA 3MOIA 3ADOA 3ZWAA 4BB5A 1E7QA 4TSKA 3GUCA 4WCFB 2GN4A 3ITDA 4FFLA 4QFDA 3WFJA 3C85A 4ND2A 1KS9A 4PG7A 2E48A 4YAJA 2G0TA 1U9JA 1K6IA 3E1KA 4PN3A 1Q2XA 5MDHA 2FRDA 2WYVA 4D0SA 3P7MA 4CM9D 3G79A 4Y6RA 3I4CA 4YJGB 1Z7EA 9LDBA 2HRBA 3JTMA 1HE5A 3D5TA 3TNLA 4LW8A 4YPOA 4HWKA 3ORFA 4PIVA 4PG8A 1VL8A 2W2KB 3OFSA 2X86A 4WNCA 2EKQA 2JAPA 1DEHA 3DBRA 4NU6A 2YW9A 2IXBA 5F1OA 4RF4A 1ZIDA 4OOFA 4RO0A 3RJ9A 3PHLA 4K9DA 3TFOA 1YL6A 3UKOA 1NNUA 2Y1EA 4XJSA 1BXKA 1T2AA 2B36A 4A03A 1LDEA 4A2CA 4HKTA 3OJOA 3V2UA 4IQ0A 4NBUA 1WMAA 5TX7A 5BT9A 1A5ZA 3L9WA 4XYBA 4AVYA 1ZXLA 1ISGA 4R69A 4WASA 2JD1A 5TSDA 4LCEA 1PL8A 4UUPA 3PJDA 1OBFO 2ZQYA 1QYXA 2HK7A 2X0JA 4YYZA 1I8TA 1ADBA 3A28A 1HETA 4RQUA 5EJ2A 2GR9A 2PV7A 2A94A 4FJ1A 2ZJ1A 1HDRA 2Y0CA 1A4UA 3AUAA 5DT9A 2D4AA 3E9QA 4LGVA 3EDMA 2JCXA 3C1AA 4BO9A 4FC6A 1S7CA 4YJHB 3K8ZA 1B3RA 2J5KA 5I8ZA 4CMKA 5TJHA 1VLLA 3DMTA 4OKNA 3C8MA 3GEGA 3D3EA 5AYVA 3CZMA 1BVUA 3QVXA 1QYDA 1I10A 1A9YA 3CEAA 3PQEA 4LRTB 3VH2A 1NVMB 3FR8A 3WYEA 3V1UA 3HUDA 4PLWA 1I3NA 1A4IA 3KBOA 1QRRA 3Q3CA 1T4BA 1C0KA 4EI2A 1YH3A 2UVDA 1ENPA 5DBGA 5JXWA 3JD0A 2J3IA 2QW8A 3Q9UA 2BGLA 4RVSA 2AE2A 1HDZA 4Z6KA 3BTSA 3WWZA 4Z0HO 1U3TA 4BO3A 1DO8A 1ZNQO 4S1VA 1ZSNA 4DXHA 3WGIA 2VWHA 1QYWA 5AXAA 1R16A 1NPDA 3D64A 4XRRA 4W9NC 2X4GA 4NFYA 4DL9A 5JYEA 1KYQA 1PX0A 3KEQA 3RASA 5COBA 1JKIA 2C2YA 1GUYA 3PZRA 1E3LA 3L77A 2BFPA 4ILKA 2B0JA 1AGNA 1E7MA 3PVZA 1ONNA 2IEBA 1B16A 3PJEA 5CEFA 2XOXA 3X2EA 3TWOA 4O59O 2OXIA 1PWZA 3G0OA 1E7YA 1JKFA 4Q39A 1EUDA 3AY3A 4LSMA 1XHLA 4X54A 1EEHA 3BMNA 1U5CA 2BFMA 4GLLA 1XLTA 2V6FA 4BNHA 4WECA 2EGGA 1LLDA 2X5JO 3NGLA 3I1JA 3PGJA 4J7UA 1VC2A 4QSMA 3EHEA 4R1SA 1N9GA 3DAPA 2VUSA 3AM4A 4D0RA 1E5QA 2AMFA 3PJGA 1KEPA 1U7HA 4GX5A 1NM5A 4XR4A 3L4BC 1FK8A 3Q9NA 4FGSA 3L0DA 4U5QA 5CDTA 4J7XA 2JKVA 4CM6A 4UUNA 2QRKA 3DAFA 1NWHA 2VUUA 1WVGA 3A06A 1ISFA 2J3KA 3GZ4A 1EQUA 4CODB 4QT0A 1SEVA 1E1MA 3RC1A 3KTDA 2HKIA 2VTEA 4BKRA 5C7LO 4DGSA 4L4SA 3GLQA 4RVDA 1B15A 2Q49A 2ZB7A 3F47A 3KYDB 2FHSA 8LDHA 1BXGB 2AEJA 3DFZA 4OAQA 5IDYA 3H2SA 2NVBA 1DSSG 3COSA 4YJDA 1JWAB 2EGHA 3MCVA 3PDUA 5DBIA 4OO3A 2V6MA 4E5KA 2D0IA 1CWUA 3GNQA 4JP2A 3IJRA 3GZNB 3B1JA 3QVWA 4D45A 1ISJA 1ID1A 4LCJA 4W82A 1N92A 1JAYA 2DTEA 4MP3A 2I9PA 3JQ8A 2W98A 1X1EA 3H4VA 3H9GA 5C7IO 1BW9A 3BHMA 1A7KA 4KUGA 2BI8A 2EV9A 2VYVD 3WLEA 3VZSA 5TGDA 3PHGA 3ZV3A 3GRPA 2AA3A 2ZTVA 1O5IA 1H6CA 1YBMA 2JCYA 1J5PA 3VPXA 4CR7A 4NH4A 2Q1WA 4E30A 4KWHA 4BV8A 2Y1GA 1P0FA 4J6FA 1IL0A 2PZKA 1V3TA 5B4VA 2WE8A 5U9CA 2OGUA 3K2BA 4TZTA 3RUEA 5A9RA 4IJUA 3I3OA 4CMIA 1UP4A 4BO1A 3RC9A 3CPSA 1NHWA 4L74A 3HQ4O 4XYMA 4AFNA 4D79A 5F21A 4PVDA 2J8ZA 3ZGYA 3QQPA 4K1LA 4M55A 1XU9A 2HJRA 4R9RA 5KJCA 3OH8A 3BMCB 3D4PA 3LLSA 2VHWA 2HUNA 2ET6A 2P5UA 3OIGA 4RVUA 3OBBA 5THQA 4CUKA 1U2DA 2PZMA 4O0LA 1Y6JA 4AJHA 1LX6A 3WMXA 1H9AA 1PJTA 1I2BA 3PYMA 2UYYA 3WICA 3KSUA 3WR5A 1FF9A 4H15A 1TXGA 1FDSA 2OO5A 2DUUA 1T26A 1ZK0A 4FB5A 2GASA 4FJ2A 4IXWA 5F1KA 4XYLA 4G65A 3AK4A 2Z1MA 2B5WA 2XF8A 2GN9A 1DIHA 4RJTA 1PTJA 1YB5A 3SXPA 5HTOA 3LU1A 5L45A 3ZHZA 1HDGO 3OJ0A 1E3WB 4CM8A 1YDEA 1E7SA 4U6SA 4BMSA 2PGJA 3DR3A 4IQGA 4BQPA 2RAFA 4J1QA 5A5EA 1NPYA 1V9LA 4RQTA 1SCUA 4O63O 3RCBA 2FR0A 4E5MA 3SX2A 4P8RA 4GPD1 3EMKA 3JD4A 5HS6A 1PZEA 4P38A 2GN6A 3W6ZA 1DAOA 1R4MB 4BMNA 5G0WA 5BSFA 3S2EA 2O3JA 4KWIA 4RF3A 3BTOA 4OIMA 3UAGA 5CHEA 1QORA 2CMDA 2I65A 1O94A 2EP7A 4M49A 3ICPA 3JQAB 4PFJA 3ZWPA 4JLWA 2GSDA 2HMWA 4GX1A 1I0ZA 3ZV5A 3S55A 4RPJA 4PLYA 5EINA 2F00A 4E2WA 3MJ4A 1UXJA 3GF4A 4LRSB 1IZ0A 3JQFC 2OORA 4J1TA 2P91A 5JS6A 1O9BA 2Q99A 3DTTA 3KHUA 4IJWA 4B4UA 2DVMA 3HFGA 2GZ3A 3NV9A 2F1KA 2EF1A 4GKBA 4UVDA 5A04A 1U3VA 3F46A 3UCEA 2PNFA 3PWZA 2NADA 3D4OA 4YQZA 4DLAA 1G0OA 1YGYA 1CQJA 2BFAA 2GYYA 1KY4A 2AEMA 3LF2A 2NWQA 3RC7A 4I9UA 1LDMA 5G0UA 4EDFA 3RUDA 2X5KO 3U5TA 5JNLA 5L7WA 5BR7A 2E6UX 4WLEA 1QLJA 2RHCA 4BO5A 5C3MA 4A5OA 2CF5A 3LC7O 4YTEA 4GQAA 5TT1A 4GMFA 2PD3A 4Q3BA 4R01A 5HS4A 5JY6A 2R2GA 3E8XA 3FWNA 2PGDA 1XDWA 3QWAA 2NU8A 4D43A 3W4IA 3RU7A 5BNTA 2IRWA 1IZ9A 3JYOA 4RZIA 4CMBA 1T2EA 4Y98A 3WTCA 3JQ7A 3GN2A 5I7VA 2YDXA 1JWBB 5CAEA 1NBOA 2OBNA 4DIOA 1B3BA 3C7AA 5BQFA 2PFGA 4AJKA 4ALIA 5L3ZA 5CPBA 5I7SA 3OM9A 2YHIB 2Z5LA 3DZBA 3KO8A 3RWBA 3ZWXA 1YQDA 3RQSA 2AG8A 1QYVA 3JCZA 2NTJA 3WGQA 3BTUA 3X2FA 3BXXA 2PKQP 1M76A 4IDBA 1B8UA 3KYBA 3IP3A 4LSWA 2IZZA 3INGA 3KZVA 1TT5B 2C59A 1I3KA 1WDMA 2CZCA 4NBWA 3WWYA 4K6CA 1MGOA 1UAYA 5JFOA 1GUZA 3ZWWA 4D46A 3LT1A 3KM0A 4LMPA 2FWMX 3WSVA 3ONEA 3QWIA 3E5RA 4ITUA 4WCFA 2NU9A 1RYEA 1B26A 1VRWA 1X7GA 1E3JA 4JX8A 1ONOA 3GFGA 1M2WA 5I7EA 5L4SA 1ZH8A 3WMWA 2UAGA 1U5AA 1RM5A 3V2HA 1OI7A 1NXQA 1UXHA 3TZCA 2P68A 3AM5A 1DC3A 3KVOA 1GQ2A 4YJGA 2FY8A 2POQX 1LLCA 3D7LA 4NBRA 4YT4A 5KWEA 1NR1A 2W2KA 3ZV6A 4CM1A 1YB4A 2HCTA 5JAIA 3JV7A 3HNPA 4CLEA 4EUEA 1PR3A 3KSZO 3I6QA 1SB8A 1ZW1A 4FFPA 4KDFA 4YB8A 3ZHBA 1X14A 1YJ8A 3FTPA 2GD1O 1HRDA 4ZN6A 4ID9A 2VOEA 3IQDB 4GWKA 1QV7A 1T1SA 4OQYA 1ZSYA 5DCYA 2WEKA 5CP8A 1CRWG 5ITWA 5KNLA 4PZCA 5H81A 1JA9A 2QX7A 1UAGA 1M6WA 4A27A 5DZSA 1DFIA 4GX2A 1E3SA 1D4FA 1NASA 4BNGA 1PJ4A 2RH8A 5L95A 5G0TA 3RUFA 3N74A 5KVVA 1DIRA 1Y5RA 4RF5A 4D44A 4GSKA 3P19A 4J16A 3PHHA 4TRNA 4CM8B 2CVOA 2D8AA 2W2LA 1KVTA 4J9UE 4BNJA 1C1DA 4RZHA 2AQKA 2B35A 4Y9DA 2X8LA 3M6IA 4H3VA 3GDOA 2ZYGA 3IP1A 1N7HA 5COQA 4HFMA 4YJHA 4J1SA 2EG9A 2P9GA 4GX0A 1PR9A 4P4NA 4CQLB 4KTTE 4MDHA 5HRUA 1DFHA 4E13A 5K6AC 2G5CA 1N2SA 1OMOA 3RKUA 3HJAA 3FHLA 3BTVA 3F1LA 1UUFA 1NHGA 3DZKA 1NVTA 1PGJA 2PK3A 2Q3EA 4GH5A 4ESOA 1O95A 1Z6ZA 1LBEA 1MV8A 3A9WA 1UP6A 3OIDA 4LVUA 3AUTA 1DHTA 3BYZA 2HQ1A 3QVSA 3LVFO 3ZI0A 4BGIA 5DOVA 4FSHA 3WQSB 3PWKA 1HE3A 1LA2A 3DMYA 1VKNA 1Y1PA 3ROPA 3H65A 1GDHA 4CLXA 3ZHXA 4N5MA 5AOVA 2GN8A 3ZNOA 5KIAA 2VN8A 4ROSA 3NGXA 4DPKA 1R6DA 2IYOA 4XD2A 5CG1A 4UUMA 4R3WA 4KMSA 4CR8A 3UF0A 4YWJA 3ZHYA 3HDYA 3ENKA 3NDIA 1DIAA 4ZQFA 1Q0HA 1GZ6A 3IL2A 1RM3A 2YY7A 1B0AA 1QG6A 4YA6A 4DREA 3NYWA 3EZYA 3AOEC 3H6KA 3RIHA 4YXFA 3S2FA 3LC2O 2EW8A 1WZIA 4CL8A 5JDCC 1B14A 4P4GA 1YDWA 1XGKA 4XGNA 4MVJI 3JQ9C 4TRMA 2I3GA 4QO8A 2DPHA 2HO5A 4NBVA 4CMHA 5DULA 4CQMD 3KETA 5IJZA 3JYPA 1NQOA 3GNTA 1C3VA 3UFXA 2Q50A 1PIWA 1Q0LA 4QTZA 2HDHA 3RJ5A 1ISMA 4TWRA 4IDDA 4J9VA 4MVJF 3FCOA 3ZW8A 3LF1A 4MJLA 4GMGA 3DZGA 3VKVA 3GA0A 3ETGA 2PTGA 3VPSA 1E5LA 2D1YA
chains in the Genus database with same CATH superfamily
1RM0A 1Z45A 2P2LA 3A1FA 2XCIA 3K9LA 4JBGA 2CXQA 3TN7A 3ZLTA 2WHYA 4P5DA 1K89A 4KAFA 1YZVA 2XYRA 3O3NB 4NMHA 1VSUA 3IVAA 1EDZA 2G28A 1N2BA 3E3NA 4IEFB 2OB1A 1Y1KE 2GO1A 4TXHA 1QU3A 3HJFA 3FMVA 1TO2E 1YCDA 4W7HA 3SC3A 4E0BA 5A9TA 1YVDA 3D6JA 2CMFA 3MSCA 4I08A 4ZEOA 3PEFA 2GNAA 2H1SA 3BPSA 3L7LA 1KFCB 1OAAA 3NEJA 3PD7A 3KYDA 3VAZA 1BXGA 1DOHA 2C7QA 2ZSBA 1KDYA 5FUVA 5J2UA 1V1RA 1GLGA 3PDHA 3A4IA 3GJTA 4ZGGA 3GNLA 2OVBA 1QZ3A 4OUDB 4I50F 4DUZB 1AF7A 2R7KA 3THWB 3IOCA 2R00C 3A4MA 4PG6A 4LYAA 3AINA 4OYLA 2R1TB 1RAHA 4LAFA 5FOQA 1LBTA 4QBTA 2X0IA 5T4BA 1J4AA 3L7YA 2ZJZA 5FPYA 1JFSA 1IB0A 3KLMX 3IH5A 1ZUWA 1PJQA 3CZRA 3HB4X 4PC2A 2OEPA 4UM8B 4MS4B 4NC9A 3BXZA 5CDFA 2JLYA 3AEUB 2A9FA 4AJLA 1BDBA 4OEHA 5K03A 1Y3AA 4ESVA 2R62A 3UMMA 3P2YA 2WKSA 4OQLA 2HBQA 2WTNA 3GVHA 3F3YA 4QO7A 4YPVA 1UBNA 2Q1UA 4AU1A 1RRMA 1T3GA 4ZVTA 1XTJA 1IOLA 1PR4A 2AQIA 2C31A 1TEVA 2FTKE 2H7XA 5LZ5A 2WIBA 2IYWA 2Y05A 3QYPA 4N5IX 4AJIA 4DLKA 1YVUA 3SJUA 1VB3A 4R2HA 4BNVA 5ITVA 5JAZA 2YFYA 2WG0A 1SZJG 4GO1A 4EEXA 3DZCA 3FWPA 2C7RA 2AG1A 1K63A 1OXBB 4MYHA 2JFWA 3RRXA 1K4KA 1T1IA 1DTSA 3OZWA 4GOKA 521PA 2TS1A 3CINA 1RHMA 1T36B 2FK7A 3AV3A 3DP9A 2A9VA 4O2BB 3U0BA 5B12A 1RCFA 2FWIA 3SZLA 2D0DA 3CLVA 4BLSA 3F3SA 3H9UA 5ILOA 4EENA 4K6HA 4QECA 2XNDA 2G6TA 3BMCA 4EUSA 4ZVKA 3ZDFA 2XECA 5CITA 5IWCA 5LMNB 1PV1A 3GCWA 4G07A 3RHFA 4OA8A 4QDOA 2RGCA 3DV9A 3GLKA 1SR8A 3B36A 2HDWA 2FSFA 1BVYF 1K0UA 1X94A 3NWJA 3OEWA 4FHCA 2X0EA 2ERYA 2RGBA 4GICA 5LQSA 3WL4A 4IHAA 2YVUA 3MAJA 3CRZA 4B8WA 1SQ5A 1JQJC 3NATA 3ONDA 4RSRA 4RKRA 4N54A 4E09A 3K70D 2HLDA 2V4MA 4RS4A 1JNYA 5ESRA 2FR8A 5JXGA 4AZ3B 2C7BA 1ODTC 3A4YA 5TLSA 3Q8MA 5E9WA 3GJSA 3NB0A 4INJA 5FWYA 1JIJA 2P2SA 4WNAB 4J2OA 1R4NB 2D13A 4D2IA 2B7CA 2GK4A 1Z56C 3G0DA 3TXXA 1Z6AA 1HDEA 1UKVY 1GDTA 4P5PA 4F4CA 3TLEA 1DT5A 3KAPA 5H59A 1OLUA 4GZMA 1UJ6A 1YA4A 621PA 2COUA 4ZJUA 2NSLA 1QAQA 2C5AA 1CJVC 5DNEA 5ALUA 1E3WA 1YVRA 3I5MA 2F2TA 2XYPA 1HPLA 3AY6A 2GD6A 4GM0A 4HNQA 1ZVQA 4D25A 2EQ5A 3CZAA 4FB4A 4YQYA 1VKZA 2PUEA 1OOEA 2J31A 1CRPA 1HXHA 1XALA 3G13A 2YKGA 1ZNYA 3A9RA 2Y77A 3H8WA 1ADCA 2HTEA 3R6WA 4DKJA 3ZJUA 1XNJA 3HXTA 1YR3A 3X1YA 5EKSA 4KFCA 4I1OA 4K3UA 3QFFA 1TPZA 1NLZA 4WOCA 5F23A 4M99A 3JYHA 3ZQUA 4ERXA 3PNOA 4HFRA 4J0EA 4M9XA 2COEA 3ZXUB 2OZKA 2X5NA 1E62A 3QIVA 2NZYA 4KFTA 3MC1A 1FU8A 2OBBA 4OGWA 1ZKMA 3ZWOA 3LQ4A 3ZI7A 4V38A 3R3XA 4RPIA 3ROTA 3SHOA 3LT0A 4L5AA 4NFHA 1MB3A 4B2LA 5EERA 1W5FA 3N2LA 3DBHB 5H8WA 1Z4JA 1JXOA 2AHOA 2HU2A 2IITA 2N47A 2QGZA 2JVIA 2WTEA 1DQRA 2ZUUA 1FYFA 3CLTC 3DE1X 2PLNA 3DF7A 4B35A 2XCSB 3QX9A 5FRDA 1E6EA 1WXIA 4IJQA 4MMZB 4D8XA 4TLMB 2J9YB 1KO7A 1PVDA 4OB8A 5HA5A 5T7BA 1SG6A 3KB8A 1JT2A 1K4MA 3V7WA 2RB5A 3LWDA 2QPAA 3BDIA 4F5WA 5B64A 3MT8A 2BPOA 4RZUA 5AHXA 2QUZA 4TPKA 2NT4A 2BGNA 3UBMA 4TQUS 4I6JA 1EVJA 5CFPA 4A8JB 3EWIA 2H31A 1C41A 2CEKA 2GPNA 3LA8A 3U7FB 1U8UA 4TVSA 2C2XA 4P80A 3QXXA 2X19A 1AVTA 3DV2A 4FWBA 1L7DA 1B6TA 1K5HA 2BL4A 1WIWA 1D2EA 3KQMA 3AZOA 4OHVA 1A71A 1GEEA 4KGVA 3IDOA 5IN5A 2Z1NA 2EOAA 4TLCA 4IDNA 1AF4A 4ZCPA 3P2JA 2D59A 4QQNA 1Z2AA 3VX4A 2O1XA 3SHVA 2X1MA 2WIAA 3AH8A 3MWEB 1F3LA 3EE6A 3KJIA 3L06A 4M88A 3QEMA 2HXGA 2GJKA 2O7RA 4KLAA 1FTQA 1VIMA 2FAXA 4G9BA 4LKRA 3U19A 3QLUA 4YCBA 3L1VA 1TJNA 1EUYA 3OTOB 1GCOA 2MMGA 3R23A 4GR4A 2PRJA 1NU6A 3ZNQA 4PSKA 4DYDA 2BEUB 4M83A 1M5RA 1Z6PA 1SU8A 1G8FA 3G23A 3IIKA 4WJLA 5I9MA 4TOIA 2M6RA 4TKZA 3I37X 4P35A 1KBQA 2YUTA 5AUPB 2GERA 1S2MA 3HUUA 3RH0A 1KI6B 3FDJA 3MQFA 4JR0A 3HO6A 4XB2A 3AJDA 5HDQA 5A4IS 2I76A 3D6AA 1ZJWA 3FCCA 1ZUHA 3MWDB 4MYCA 1EFCA 3PUZA 4Q0MA 3LZ6A 4TKMA 3WNQA 4B6OA 4NPAA 4OKSA 3T1QA 2ZU6A 1U7DA 3PENA 1PGQA 3G1UA 1J25A 3DEJA 4DDVA 1SHUX 1ND5A 3HDGA 2JIQA 2VHXA 3FN4A 3R24A 2WDPA 1IEQA 1OYYA 1SKBA 1GO2A 1PLKA 3DWIA 3K20A 3PNBA 3UJ9A 4EK9A 1NBWB 4KRXA 5C5DA 4ND6A 3H3XA 3KVRA 2WSBA 4R1OA 2R1UA 3ROKA 2Z30A 1CR1A 5KTOA 2Y6VA 3R4VA 1Z7WA 4UEKA 3IE2A 2BZGA 2VR1A 5IRCD 1X19A 3OT1B 4LE2A 1TT5A 1X7HA 5GGYA 4NXNB 1MF7A 4DDUA 4ZZ2A 2H2IA 1VE9A 4AIIA 4J2TA 3ML1A 2BR3A 2YJ4A 3LDFA 4E14A 3DDNA 3PXBA 3PC4A 5FFFA 4L4ZA 2GI4A 1NQ5A 2XUJA 3HUTA 2PX8A 1MHPA 1XVUA 4DJEC 5BWCA 3BCUA 2B4TO 2PFSA 4UBJA 1AKMA 1BX0A 5DHFA 5BSTA 1TM7E 3RJTA 4XWTA 2H85A 5EXPA 1L5GB 4DDKA 4XE5A 1LNQA 3T7CA 2IS4A 3VR0A 1EK6A 1Y4ZA 1VI2A 3AL2A 8OHMA 5IN4A 4AD8A 5HZKA 4MVJG 3KQLA 2R96A 3IV7A 2F43B 1DRVA 3PDJA 3SVTA 2R9VA 1NVAA 4W4TA 1V6AA 3MSXA 2DUNA 2GDZA 2AFHE 3OT5A 2ZTMA 4ZA2A 1MBZA 3TSWA 2B8WA 5INTA 4XIIA 2CDNA 2OGZA 3FMIA 2OC9A 2FWBA 1WZCA 2VJLA 3BG5A 4XD7D 2UUAB 3TTUA 2A0KA 1UQTA 1YJXA 5I5EA 3C6XA 5IKXA 3UXHA 1HFKA 5ICCA 4ERNA 5JD5A 1P45A 3S2UA 2YYSA 4CM3A 1YS6A 3KKPA 4A2PA 4JROA 4XRGA 1Y33E 1V47A 4LMBA 1GUBA 4B31A 4AP6A 3DE6X 3HWSA 3RC8A 1DOZA 5IC6A 3TE7A 1T34A 2XW6A 1X2BA 1ZH4A 3Q3GE 3WHLA 3VKUA 1GPUA 2JKZA 2AF4C 3IESA 1MX1A 4NCIA 4YJFB 2ZVDA 4ZO4A 4XM2A 6REQB 5KHOC 3MQ4A 3OY2A 4G23A 4ND8B 4R1UA 1XCJA 1U04A 3WJAA 2W58A 4J1TC 4JR2A 1YRBA 3WAKA 1FJHA 3LXRA 1MG5A 1P5ZB 2X9GA 4MUJA 4RMHA 4Y9TA 2O48X 2QMEA 4BNFA 2GMWA 3GZJA 4B3GA 4DTIA 2Q21A 4LZWA 3LBNA 3MAGA 3JZDA 5GM1A 2ZSAA 3MCWA 4K9SA 1JLLB 1PWXA 1VL6A 3TI7A 4N03A 3OJXA 4D5EA 3TMAA 4N6NA 1N2JA 1MUUA 5ENZA 2OBLA 4NYIR 5DV9A 5WRFA 2RI1A 2WSLA 4FXPA 3K1AB 5KKCA 1Z7YA 2IE0A 3L8GA 4L2IB 4US0R 4ZZ1A 3OOHA 2LCFA 3W8EA 3TGPA 1XA0A 1SKQA 4HDAA 4U7GA 3T3PB 4A0SA 3BGIA 3FCUB 4CQLA 1EGVB 3MTBA 2GBPA 1UBTS 3RADC 4R0VA 1S2GA 3ZJYA 2A5FA 1BD4A 3RC2A 4KLCA 1S4MA 1E6KA 1W0JD 2ZCVA 3UANA 5JJLA 2IEYA 2VA9A 3HKDA 1TLTA 2LV8A 4NCXA 1XEWX 5KYGA 4QUKA 1S7GA 4B0PA 1SK9A 3PBKA 4ZXPA 1XAGA 3PKJA 2JARA 1WVMA 1KAHA 2J0UB 2AVNA 3AO0B 3MN1A 3Q8XB 4PVCA 4XKJA 5K3SA 4E32A 2BEWB 4BGDA 2XWSA 4JJ4A 4GLOA 3IP6A 1EFRD 3I6MA 3F78A 2A78A 1HLGA 1XLWA 3FUWA 2XRFA 1G7SA 2CXXA 4IYJA 1Z34A 3R9WA 4ZVVA 1IM2A 1J6UA 3ZHRA 2WBLC 2WD7B 3TL2A 4OV6B 3VSCA 5K0SA 2CHGA 4MI9A 3K0HA 3NHRA 3UWKA 4UNQA 4XARA 2VDWB 1FMLA 2J32A 2O0LA 3D8BA 1GQOA 4UDYX 3DSRA 4BNKA 2WUWE 1UADA 4IIJA 2PE5A 2ZG6A 5E1DA 2FZWA 5A71A 3UMCA 4FEYA 4LHSA 3A2MA 4Q4CA 2E1RA 3AB7A 3T9BA 5IJXA 4U2KA 3NWOA 3LQFA 5LCXA 2KQUA 5LYJF 3MJHA 2V54A 2JGDA 2CLHB 4LJ8A 1SOMA 1N36B 1N3YA 1YI8A 1F6WA 2GJSA 2V7WA 1ZCZA 3S2SA 5AM1A 5JD4A 5CFQA 4MO2A 3NBQA 1C3EA 4QULA 3OJEA 4BAGA 1Z25A 4GUAA 5LC1A 4J1NA 4QFBA 4A0RA 3TD9A 4L9WA 2P3OA 1CC1S 4J0HA 1Z0KA 3W90A 3N7AA 5KS2A 2DP4E 3ACCA 4ZQIA 1BWSA 3VHXB 2BMWA 2HSGA 3CLRC 3OICA 4FD3A 5U4XA 1HEYA 1U94A 3ZCXA 2Z6AA 1Z4QA 4IH9A 1EXVA 4HVCA 1XN1A 3SX4A 3P2EA 2Q9BA 3BMQA 4PTLA 2IDKA 3GZTB 5TB5A 3W8FA 3ELBA 4BO6A 1IRIA 3CE6A 5A9SB 1QO0A 2P7HA 2ZRDA 3EK2A 4KXNA 3IERA 4RVHA 2PRSA 3ZXIA 4ENPA 3EH1A 4HEJA 1GOTA 3ZHUA 1U2ZA 4U7WA 3P9QA 1QP0A 2OXCA 3ACBA 4R0NA 1T25A 2BMEA 3THOA 1VXOA 2A9PA 3WB1A 4HL6A 1KGSA 2IHJA 3JXEA 1N2CB 4ALMA 1QCYA 3OFKA 2M98A 1I4LD 2LGJA 4XIJA 2ZIZA 2YQ5A 1XD2B 3QLTA 4WA8A 5J4HA 4MJ7A 1XD8A 1FP4A 1HLPA 4MPRA 1BGVA 2AR9A 2EDCA 4OLFA 3NTVA 4Y2VA 3WSWA 2C2KA 4CG0A 4CKCB 4WOBA 4GKJB 3DVAA 4D8VA 3C6KA 4KLRA 4HGNA 5I7UA 2PGOA 3NAMA 1KEUA 4H60A 4PLVA 1HH4A 2HGZA 3P27A 1UKZA 1YS7A 1Z4NA 2HDOA 2IVZA 3FYCA 1B74A 4HXEB 4QSHA 6ABPA 1FFSA 2IIVA 1AZWA 4QUIA 3O1JC 2A0UA 1S8FA 4J16C 1NDHA 3E8MA 3OQ1A 4ND5A 4QQ8A 3TOZA 1Z0ZA 5TXGA 5T8KC 1LI7A 1XYVA 4FFNA 2LWIA 2VWQA 2XV1A 4M38A 4TSFD 1RJWA 1UFOA 2AFRA 1QHGA 4KNVA 1VA4A 3QNWA 6LDHA 1GZ3A 4QD3A 1QP7A 4MAMA 4QXMA 1H2FA 3QEBZ 2QL7A 1X80B 4MQUA 1FMFA 3K71B 5E0OA 2VPIA 1AX9A 5KMGB 1ZD2P 3IBGA 2ZANA 3LYHA 3AUUA 4IH4A 4IS2A 4L5BA 5CK5A 5CA1F 4BMOB 1OA1A 2J0QA 1G18A 5FBVB 4XEHA 4Z7OB 4DV5B 1G63A 4YYEA 3BWDD 2GF2A 2Q2NA 3LGAA 1RT9A 4IFEA 4QJIA 2PR7A 3H2HA 2XRZA 1QRUA 3UQZA 3QY9A 4X97A 2C5EA 5IPFA 1J2TA 1EWTA 3S4YA 1EQAA 2BDEA 2PRKA 5CPFA 4RKWA 3GY0A 3RVSA 3QP9A 1UEJA 2HSWA 4B3FX 3ZWBA 4PSAA 1I36A 1KQ3A 2FK8A 4WY5A 4C2AA 1ZESA 3FHOA 4R8RA 1ENYA 3EW7A 1JG6A 1DU4A 2VXCA 2D2XA 1NZDA 3DC2A 3PS9A 3ELUA 5DP2A 5G1NA 4FR5A 5FEUA 3QOYA 3FR7A 2GZHA 3MAAC 4P33A 2IVFA 4PRLA 4Y2UA 1OFHA 1N1MA 1WQ1R 5LUAA 1S9DA 1Q44A 3EWAA 5CNMA 2O8BA 2ZJ4A 3FUXA 5A4FS 1QFYA 3PIRA 2BCGY 4CLHA 1JEOA 1HORA 1KXJA 2XWQA 1UOPA 3FUTA 4IDCA 5EJ4A 4A82A 4RV4A 3UB2A 1OXXK 5BQ3A 5LQNA 4NEHB 5D5PA 1VKRA 3BT7A 4MWSA 5AI9A 1YE8A 4EYKA 5PNTA 1LTHR 2J41A 4JJ6A 3AF0A 4AUKA 1K6XA 4BEWA 2HZ7A 5KOHA 3IKJA 2XYQA 1UZMA 4A8JC 3EZLA 4PYLA 5CA1B 3IQGX 1Z5NA 3NDPA 4OFXA 2Q5HA 3MMSA 3OKFA 3WYCA 1KEKA 4IV8A 4C2BA 1PSWA 3TQOA 3WGOA 4OQQA 2HNBA 5J2TA 1MOPA 2HA7A 3RARA 3IUNA 4PSCA 1YJQA 1Y4DE 4TMFA 1N2OA 2H7CA 2A1UB 4X91A 1TDJA 3WWOA 3V1TC 3T4EA 3V34A 2PXHA 2VJCA 4YAFA 4JVLA 3Q40A 4WAUA 3F5QA 2ZGVA 1BCRB 1TAQA 2GM5A 3ELYA 1USUA 3GP3A 3H9EO 5H83A 1EK0A 4I14A 1U3GA 3URKA 1RAAA 3FDXA 4PG4A 1Z2DA 3AU9A 4QIHA 4TTVA 3OSZA 4DA8A 3AVVA 1M10A 5BRNA 2QQEA 1S4QA 3UK0A 1QF7A 1DEXA 4FS3A 1OFIA 1YCGA 2VJDA 1XAHA 3OQPA 4W5NA 3CH4B 1YC5A 4RW0A 1Z4PX 4G4SP 4W8OA 3ONVA 2W48A 3QLVA 1HNXB 4MH0R 1LJ8A 3M81A 4KYIB 4KQGA 5ARDA 3G2KA 1T8WA 1MFZA 4ZAWA 3KXIA 3N2KA 2ECFA 4KN5A 2XKKA 2XQGA 2FWPA 5GIOE 1NA5A 1MXHA 4YLYA 3E23A 4E5PA 2O8DB 1UKCA 3IR5A 2O0KA 4R8VA 3OSUA 3C45A 4XM1A 3SMVA 4DMHA 1QZTA 1Y8QB 2NU6B 3OVMA 3HCEA 3OPYB 1B6GA 5IMSA 1KBOA 3RNOA 2C7PA 4X84A 3AYZB 4I1UA 3P2MA 1W0KA 1NWCA 3K53A 1Q14A 3PUVA 3AVOA 4PLZA 4R83A 1YNSA 1JDTA 4WKNA 4BNWA 2FPIA 3NJRA 4LUCA 3EUWA 3HRKA 2QV0A 4GYKA 5FBKA 1JV2B 1QF6A 4F6RB 1DWQA 2ZS8A 3WRVA 1N5MA 3PGXA 1QHEA 1JR2A 3ZDZB 1KVUA 4CZ2A 2QVZX 2DR0A 1WAMA 1FDRA 3OIWA 1AUVA 4FKMA 5AP9A 3UUGA 1AB5A 3D3WA 2DRIA 4PC6A 4EY8A 1FU4A 4HATA 1R0XA 4AMZA 1JZSA 4EGSA 4U9IS 1O8BA 1DG1G 2H2GA 1T3TA 4L15A 4MKFA 4WXYB 5ILQA 2W2TA 1RPAA 4RTQA 1U65A 2ZJFA 4KH0A 5BSRA 3QELA 3UZUA 2NGRA 1U8FO 2P2DA 2PY6A 3EY9A 4U2FA 3U6BA 1A69A 4X95A 2FWAA 1SC6A 4OAOA 3RVKA 4DA9A 1GZ7A 4E7OA 1NN1A 2IDZA 4NAVA 3FYTA 2KYRA 3RAEC 2J9FA 2Z3VA 4Z1MA 2VPTA 5FP0A 1G8GA 3V2GA 5KTKA 3OBIA 4JI2B 3Q8KA 4ZYXA 16PKA 1EUCB 3FZQA 3P1JA 1VJRA 1A76A 2PH5A 2YFQA 3EUEA 4QWWA 3ICVA 4OQZA 1N2IA 2ZYTX 3TR0A 4HH1A 3RTAA 1NZFA 1G8MA 4ZK6A 5BWNA 2DFLA 3TD2A 1ZL2A 2GVDC 4L4UA 3KJXA 4TV8F 2FZVA 4EI8A 1N34B 5JC8A 4ZC8A 1UK8A 1EXMA 1N0IA 4BNXA 1GZ4A 4IW3B 5DCUA 2WD9A 4ME6A 4MW9A 3UAYA 1EM6A 1IHXA 5KREA 1T5TA 3FNGA 4D4IA 3ZY4A 1KARA 3RU3A 1NQTA 2HWKA 2WM3A 1EVKA 5FOVA 5T5QA 4NZ9A 4PAQA 2V6JA 4QOSA 2O2XA 3A4VA 3HFSA 1HYHA 4UVHA 1SKYB 1C9KA 2CVQA 3CLRD 1S2LA 2QUIA 5AW9A 5B58C 4RNCA 3CUVA 4PYRA 4CLRA 4KG7A 3AI2A 2AD5A 1UQUA 4JDPA 2AI3A 2QX6A 3K9GA 3A2KA 1WPRA 2VTBA 4D56A 3KEMA 3MMPA 1TGVA 3GG9A 4DZRA 3DE2X 4YR7A 3LPAA 1OH6A 2R6CA 4ZYUA 1ESEA 3OJFA 1OR8A 1Z13A 2YXNA 5DHPA 2IXAA 4HXGA 4UBKA 4A6EA 3O9ZA 1XRQA 1EFKA 3PLNA 3M3PA 4DDTA 3EPKA 4C2UA 1MU0A 1KERA 2WVJA 4KXXA 1KEZA 2G83A 5B6PA 1XTBA 3DUFB 3ZE2B 1NPTO 2YNMC 3WRXC 4U39A 2BLLA 4UNPA 4GXQA 1B2RA 2KJQA 1GR0A 2XMRA 2FYTA 3IAM1 1U0BB 4I6EA 1V4NA 3HBFA 2CGEA 2IU6A 3T9EA 2SKDA 2A7XA 2WA2A 4B7AA 1GV0A 3RUIA 4JU9A 5EJMA 4FYWA 1FUIA 1LY1A 2I2FA 4S2UA 2YYAA 4YH1A 1DKQA 1ZINA 5GM2A 4BBPA 1HL3A 2C3YA 1ZICA 4Z51A 4HS9A 1JR3D 4HDNB 1YZTA 4ZI5A 2EDAA 5FORA 4X90A 2DULA 2Q4BA 4IMPA 3TTVA 3THXB 3ESCA 3SAJA 1LDGA 1PVOA 5BWMA 1NT4A 4Q4AB 4E1AA 5KJFA 3EQ6A 1L7XA 3RKSA 1RHQA 1E5DA 4QAQA 5EL0A 1M8KA 4IOKA 4MS1B 2IH5A 1TU3A 3GAZA 5FI0B 4ENWA 4RV9A 1FXSA 1U3WA 2P4SA 1RAGA 5MN4A 5G2OA 3H5LA 5DWQA 3WGHA 2ORVA 3U4DA 2FFHA 2Z4SA 3EOZA 1H69A 2ZDQA 3FNFA 4LV8B 4XJVA 2AZ4A 3E3OA 3I1FA 4UREA 5FIUA 3ZWCA 1L5SA 1UKBA 1QH9A 4HMPA 1KP2A 3L07A 2V59A 4Z9YA 3IDZA 3GMIA 5IKPA 2WVGA 4X1OA 2W8BA 4Y6SA 5J59A 3MIIA 3B9BA 1JDBB 3C3CA 1F8YA 1NVEA 2JJMA 2YS6A 3TTSA 2EJWA 2PHZA 4OYRA 5D8DA 5GONA 5FTNA 4B2YA 1T0HB 1XWIA 2F1HA 4XH9B 3ZN2A 5KQGA 3T5AA 1Z15A 3FPLA 3VU1A 1KMCA 2IHYA 1HQYE 1GY8A 4WERA 4DXAA 5HKKA 3ZR4B 4Y30A 5ADUS 1AS2A 1O6GA 1OREA 3JY6A 4NS1A 5EFOA 4CKYA 2WUDA 5K8CA 2J0VA 1NL3A 1MC4A 1VL0A 2JI6A 2XTAA 2ZP1A 2FETA 2SBTA 3PPYA 4UEWA 4ZPJA 1XZAA 2O50A 1VCMA 1UXGA 2J4CA 3DWEX 4A91A 1V3UA 3U48A 2XCRB 2R6JA 3BCSA 4CTNA 3G6KA 3ZS8A 4CN9A 1JDVA 2Q0XA 5EESA 5DGIA 1NBMD 3H4TA 4WOPA 2W6MA 2QQ5A 4EHKA 4DW8A 3TTYA 4ZK2A 1P7WA 4HYTA 1R9GA 2V7PA 2NO7A 3IKLA 3KDAA 3W9SA 1DB3A 1CD5A 3U3DA 1GPJA 2JGFA 2JZOA 1DC5A 2ILVA 2V3WA 5EGNA 5HK8A 1V37A 4B4WA 4DJ5X 2V8OA 3I9V1 3KTAB 4UNNA 1N1GA 1KMHA 1R9NA 2V7BA 3M6VA 4KPFC 1GU7A 5F64A 1EVZA 5KCMA 3HLYA 1A2BA 1G98A 4RPGA 1ENZA 2X0KA 2ZXEA 4TWJA 3LL4A 3OIVA 4UM5A 4QGHA 1BS2A 1U0LA 1C4XA 2EZTA 4GC5A 1ZPDA 4J03A 5DGHA 4MOWA 3U09A 4LFBB 3SE7A 2IHBA 4QUBA 1NUAA 1J8DA 4ENRA 1U2SA 1YOVA 1NI4A 1TK9A 3O6VA 2QMQA 2EBFX 4K3VA 3OQJA 4OJNA 3R7WB 5DOZA 1T4CA 2H2WA 4EBFA 1V8FA 1JFFA 1O89A 4XZ3A 4ZI7B 2GGSA 2AEFA 2FPWA 1CERA 2IV7A 2OZPA 1IZYA 1J1UA 1UIRA 3FCYA 3WRWA 2CC2A 5A7GA 4FW9A 4MYUA 4YN3A 4LFCB 4UOQA 2VP2A 2MSKA 1KI7A 3ETEA 1DG3A 3ZQJA 4F3KA 2Z6VA 2G77B 5GJBA 1GZSA 2F3QA 3BRWD 3EWSA 4M9ZA 5A0FA 5J2UF 5H80A 4O0MA 5JSQA 4EGFA 2BUAA 3HBNA 4HWSA 4X1KB 3TUIC 2I4RA 2I1VB 3FSJX 1RWMA 3IELA 3A6HA 4P3KA 4A7PA 1P74A 1AK9A 1XDDA 2HN9A 2LE0A 4RDIA 4N12A 1KE2A 3THYA 4D9IA 1NVXQ 4FLEA 1X1RA 4J4BA 4QXPA 4XQ0A 1CJMA 3SZRA 2X4LA 4FI3F 3W2HA 4H7DA 5LU8A 1PYGA 1ZA1A 2X4DA 1VKOA 4OQFA 1RYBA 5DSXA 1JQBA 3HG7A 4GZ3A 3UOAB 1BWPA 2CNNA 4HPXB 1JTVA 3OE4A 3PHBE 1OGJA 1P1IA 1K06A 2EZUA 4BGVA 1W73A 3LO8A 1P81A 2EATA 3VNUA 3RBZA 3V3KA 1WKBA 4OSPA 2FR1A 4B3CA 4MV9A 3L02A 4HGRA 4ARBA 5AWFC 1K0FA 1T9KA 2BSAA 2K7FA 3D6FA 1O9HA 5JCJA 1X7YB 3JWPA 3CZQA 1VRVA 2PSEA 4CF5A 4W1RA 3WWDA 3ELDA 1H42A 1FPQA 1XV5A 4IMIB 4XDHA 2PV0A 1Y9AA 1XL1A 5ALRA 4JJZA 4LPKA 5IDXA 1WU8A 5K8UA 4I3HA 4BQRA 3FTFA 1FTSA 2AH5A 3BXGA 4X94A 2QE6A 4Y6GB 5KQPA 3GLIB 2VF8A 1M0WA 4X45A 4CM4A 2NYVA 2H63A 5JQGA 4PU0A 2CE2X 1C1XB 3QJ5A 2IDMA 1UZUA 4RZ2A 3LJKA 5KJ6A 1T24A 3FLMA 2G63A 1G38A 5KNBD 2AN3A 1QOPB 2IPNA 3CUWA 3IEPA 4N8SA 3ZPXA 5AVVA 1M6VA 2JD2A 3BHIA 4JWKA 2X0NA 4XWAA 1Z29A 4UU0A 4L0QA 1FYVA 2JL1A 4AY5A 2EARA 5J4LA 2ZJ5A 2O3SA 4RLFA 4Z8YA 5LQMA 5M7EA 3FYUC 4MKRA 2W4IA 4RY8A 3H87A 1GAQA 1M6NA 3E05A 3KYCB 2Z2IA 1NE2A 3ZZNA 5EXTA 3RS3A 1F8FA 4J3JA 1HG0A 3F90A 3Q6MA 4ZT6A 3EXEB 1G7TA 4JASB 5DM4A 1EFUA 1P8JA 1UANA 4HDMB 4BO4A 3EEFA 4LQ4A 4MYSA 2V7QA 3GO4A 4BNTA 5JZSA 3L4BA 4CCSA 5FBQB 3LDGA 1CDEA 2ZB8A 2HWYA 3SFVA 2H29A 2VPPA 4B76A 4Y9SA 5AKZA 4NZZA 4UUAA 5KI6A 5FYQA 3D8HA 4OK3A 2YIDA 2CSUA 5KINB 1E92A 1YTUA 1WXGA 2E4XA 1YULA 3PQ2A 4BFTA 1I5RA 1R37A 1TTPB 2WWWA 3PG5A 5DM60 1NAIA 1BFKA 5FI5A 2XVXA 4YONB 4PAWA 2WJPA 2HXYA 1G17A 1S0UA 1TUEA 3KEOA 1QG4A 2WV9A 5K9ZA 3JRXA 3L8CA 2GJ8A 3I34X 1F1BA 3NOQA 1C7EA 4G84A 4WFQA 3WB9A 1GUFA 4WADA 5KTTA 2PU7A 2WJZB 3G2QA 4Q4HA 4N6OA 2NSDA 1B1AA 1HA3A 1NQXA 1QYIA 1MTOA 2YNMD 2ZRQA 4PGFA 5DE3A 4DNOA 1K3TA 3OU7A 4H6XA 4DVJA 3CF0A 3QKSA 4AKIA 1SULA 4QXAA 3RYHA 2YW2A 1H3NA 4RTLA 1U11A 4JODA 3G0BA 3NM4A 1E1QD 4UM9D 2ZZMA 1USWA 2FUKA 3TNFA 3VNQA 5CB4F 2ZSEA 9LDTA 1U63A 4S3MA 2Z56A 4JVSB 3MOGA 3R7DA 4UFNA 2HWXA 1KHTA 2EWMA 3DBVO 4EF4A 4KQXA 1C7RA 1W30A 1P4RA 1J8QA 1FJ2A 1H65A 3AIIA 4G5HA 2ZZNA 1JH8A 2Q5QA 5J5VA 5M2QA 4AQ7A 4BB6A 4I5EA 2ZETA 5DYIA 4FIZA 4FMPA 1W4AA 5FA8A 4Z2YA 2IYYA 4O5AA 3G1WA 5KTSA 3S8YA 5A3RA 4GXNA 3F1KA 5JLJA 1Y4UA 1T15A 1Z82A 2BSXA 2HHAA 6GPBA 4EHHA 4XQCA 1UXIA 3H9BA 3WX0A 1C4WA 3UG7A 4A3SA 4BDTA 3AF1A 1COWD 3E0QA 1KI3A 1ULBA 5DN6A 2WZQA 3SF8B 1GNQA 1T6BY 2AJLI 2Q0SA 4MWBA 1QCCA 2ZBVA 2N46A 3NAQA 1SRQA 5FBZA 4BNZA 1SZDA 2Z4RA 4TN1A 2BAGA 3MNFA 5KVSA 3KR9A 3NETA 4K86A 2ZRKA 4YCJA 4G36A 5IT0A 3I9JA 4ZQGA 2V58A 1QVZA 4US2R 1SG0A 2WDZA 1CZKA 4WOKA 2RGWA 3CWQA 4ZAFA 4I2VA 3TB6A 3TI9A 1WY5A 3ZY3A 5KOJB 5LP1A 3QGMA 3ZK7A 2A9JA 1XTTA 2ZRIA 2PAFA 2YQ4A 4MIYA 2CHFA 3RUPA 4HFJA 1IOVA 2XNKA 2PMDA 1JLHA 1L8OA 2PUWA 3JAWA 5K0ZA 1QTQA 3RAGA 1XELA 1PE0A 4D81A 2JJ2D 3DV0A 1HO3A 5AK4A 3DE5X 5D2CA 3DONA 2VDUE 4MUGA 4IUYA 2PUHA 5ELXA 1YWGO 4WCDA 3CX7A 4JP3A 3OQMA 1YGPA 3DMRA 1VCIA 1C9JA 3PKZA 1RQLA 4UTXA 1BCSB 3GEEA 5GZ1A 4XAQA 4DV7B 2DUMA 3C3KA 2NO0A 2PRZA 4WXRA 1Y7PA 2WUEA 1AO3A 1OC4A 1VHDA 3IE1A 2BH9A 2O1WA 3HO8A 1ABEA 1FX0B 3GEHA 4WNIA 3S7TA 4DC0A 3I5YA 3SBXA 4F7DA 3S0JA 1YU9A 2B69A 2VPQA 4RQAA 5CVVA 1U0SY 4LJ4A 4XDGA 5FR1A 4RH3A 2ZIXA 4PM4A 2AK2A 2WW8A 3D2LA 4GYYA 5B53A 1L1FA 5C8ZA 3V8QA 4XJTA 5DHTA 3H4MA 3CM0A 5DN9A 1TQ2A 2DPGA 4DUGA 1JLSA 1XRSB 3K0CA 2ATXA 1TVKA 1N2EA 4L76A 1ABBA 1TVCA 3F4BA 1V95A 5D6OA 4D9HA 1W96A 1QBGA 1ABFA 2V4ZA 1DZIA 2ROQA 1JWLA 3DBOB 1EUDB 3GD5A 1O8CA 2CL0X 1QX4A 4B8ZA 3DXZA 1JFTA 2JCSA 1QHIA 2VDRB 3GFBA 3SDSA 2I8AA 2BGGA 2EBWA 1NUQA 1Q7GA 4BZXA 1BIFA 4KIFA 4S1NA 2A33A 3VPHA 1N9GB 4ZOCA 2BHLA 3IUMA 3K92A 2J46A 2ZBRA 3VZBA 3I8OA 1WXFA 2GS9A 4X8HA 2NYRA 3ENWA 4I5IA 4KAAA 1BKSB 3C3XA 4XUDA 5G4LA 4BVKA 3KU1A 3O0DA 4RTNA 2H4XA 5D3KA 2FE4A 1X38A 3TIIA 1MP0A 2WJWA 5DM70 4EB0A 1H9BA 3ZV4A 2BMAA 2O2CA 1SKUA 4P0QB 3A6PC 3H16A 5EUBA 5IM4F 3HJBA 2FSVA 1SBNE 1COZA 1IJEA 3ZOZA 2GPAA 1R18A 3QY0A 3OTHA 4CQMA 2RH9B 3CG4A 1H0KA 2YV3A 2RGYA 4LYDA 2YIJA 4PO8A 2QQGA 1RJ9B 4UEJA 2AC7A 4QBGB 2VSYA 3DDUA 1UDAA 2GAOA 3NHSA 3BS4A 1MQAA 3HLKA 4WSOA 1Y7TA 4LS3A 3FLEA 1WKCA 2E4VA 1S89A 1UZNA 1I80A 3NT4A 1EDOA 5TS3A 1QYRA 2H4HA 1IHPA 2X1LA 3Q98A 1WV1A 2CWWA 2DHEA 2G07A 2UXDB 1PDVA 2QZSA 3GAFA 2GZAA 4YP9A 3NJ4A 1L5OA 3I42A 1YB6A 3D3KA 4RH0A 2VSXA 3W9BA 3UICA 3UMRA 1J8VA 4QRIA 5F2EA 1BOFA 1QIJA 3ETCA 4K8OA 2W93A 1NC3A 2PIDA 2WRZA 5CFZA 2WK1A 2GO7A 4IDAA 4ETMA 4B79A 5EKDA 4O8CA 1ULAA 1U8YA 1QF9A 1XCLA 3HKCB 5EJ8A 1I94B 4WZBA 4YCDA 3UXMA 2HJ9A 2CFTA 1DKPA 5HIIA 4CKXA 5K8VA 3TB4A 1NSFA 2BT4A 4NNPA 1PUIA 1T6XA 3NTRA 4MW7A 4NV1A 4TZKA 2NSYA 1B43A 5G4KA 3AI1A 1C0IA 3ORYA 4WQMA 4B7ZA 2W6ID 5A0VA 5CT4A 1EMDA 2OESA 1Z0JA 2OHOA 3A05A 1JAZA 1SC3A 3ESAA 3GVIA 2H1HA 4R4JA 3ULKA 4ARAA 1O57A 1JDBC 5ALMA 3PQ6A 4CT4B 3VX3A 3QNUA 2ZI6A 5JEDA 3MCUA 1G5PA 3G9ZA 5AXBA 3ZIAA 3S2IA 2TMKA 3PGKA 1P9LA 1PVVA 5DCWA 1D9XA 2XGMA 4CMIB 1H2EA 5ECWA 1JJVA 1NQVA 2C0QA 1E2NA 4TS3A 1KZYC 2PQMA 3O3OB 2C2WA 4M1QA 4O2AA 1U0NA 1IAQA 1OFVA 1SVLA 3W3AD 1IG0A 2CF6A 2YMLA 1BC5A 3AR8A 4HV4A 2JB9A 1WTAA 1E4VA 1KVRA 1Q92A 3HRIA 4RACA 1OT5A 3I4LA 2E49A 4Q9JA 3I05A 1QTRA 4NDAA 1MR3F 2EXXA 5DNAA 1G66A 3T5CA 5C37A 1ZM4A 2MSCB 5CGZA 2XE4A 2ZIEA 3UAOA 3KJHA 1IWPB 3F6PA 1QDEA 4NSNA 3VZQA 3CBGA 3H5TA 4BVJA 1DJMA 4PX3A 5A7FA 3W1VA 2F3TA 2ZOSA 3K5IA 3JQPA 3HI6A 3OT4A 2WWTA 3N2EA 1GTRA 3Q5EA 4EMUA 4UHJA 4AULA 3CPHA 3A1DA 2ST1A 3T7EA 4D96A 4R8LA 4DEVA 5BVGB 4MLPA 2HU5A 3ZU4A 2XBMA 2RI0A 2BJVA 5CXSA 4PBTA 2FDXA 2RIRA 3IURA 3P0RA 4ED9A 3HDQA 3BMOA 5JCZA 3ETDA 1LSOA 3DLIA 3TFQA 2CLSA 4BE4A 1ST3A 4A8HA 2I67A 1IMJA 3HU2A 3QUBA 3QWBA 3WWPA 5HIMA 1OZAA 1CE8B 4F71A 3H9QA 3JAKA 3SFTA 3UHAA 3V8VA 2Q3MA 4HQFA 2C9MA 1KY5A 4LBWA 2EJUA 1R0SA 4H2DA 3WK6A 3AUFA 1Q21A 3HYRA 2FLVA 2GEDA 3KUCA 3MJFA 2JFFA 1UINA 1JHXA 3HA5A 3OX2A 4PYNA 4P86A 1Z5WA 1W85A 2JCBA 3IEVA 2YIVX 1KI4A 2IHUA 2BF4A 1SUFA 2Q5EA 3STVA 3SYKA 2PA3A 4YRRA 4D7AA 4NH0A 3EASA 3O3MB 2R8OA 3JQ6A 4GEGA 4MWTA 2CV1A 7MHTA 1XK7A 4OHFA 2Q6LA 1AH2A 3IEIA 4GLFA 4Q7JB 1XTSA 2GVNA 2DSTA 3IEMA 3UA4A 5A0TA 1GSOA 4ITRC 1ULSA 1MCZA 4HCJA 3U5ZB 1ULHA 4LVCA 5FOWA 3EDOA 4EA8A 1SCDA 2QG4A 1W6RA 2QRUA 2VI5A 3IQWA 1FDTA 4I1RA 3PFFA 2XXBA 4KQMA 4Q7MB 1ZRMA 3GT3A 4AZTA 4D92A 1UDRA 2FNAA 5L7TA 4R05A 1WXEA 2C8VA 4IUDS 1T8RA 2I6UA 3W5JA 2WHPA 2QRZA 1E6CA 4ZVMA 4JVMA 3V1YA 1H8ED 2QSZA 4LISA 1YSCA 2ZFUA 3AV0B 3HY4A 5CYOA 3R7BA 3ZH2A 3KB1A 2DPMA 3LC1O 3M1LA 4LI3X 4NCNA 1C8KA 4E5VA 3OHMA 1N0HA 1CTQA 3WB2A 3PSHA 4U8GA 4EAQA 1H2RS 1I33A 1DO2A 4MI6A 1F51E 1AKWA 3E82A 2OBFA 2RAPA 4X3OA 4EGCB 1QANA 1SC1A 2P0AA 2UYOA