3DHNA

Crystal structure of the putative epimerase q89z24_bactn from bacteroides thetaiotaomicron. northeast structural genomics consortium target btr310.
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
222
structure length
216
Chain Sequence
KVKKIVLIGASGFVGSALLNEALNRGFEVTAVVRHPEKIKIENEHLKVKKADVSSLDEVCEVCKGADAVISAFNPIYDETIKVYLTIIDGVKKAGVNRFLMVGGAGSLFIAPGLRLMDSGEVPENILPGVKALGEFYLNFLMKEKEIDWVFFSPAADMRPGVRTGRYRLGKDDMIVDIVGNSHISVEDYAAAMIDELEHPKHHQERFTIGYLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent epimerase/dehydratase
publication title Crystal structure of the putative epimerase Q89Z24_BACTN from Bacteroides thetaiotaomicron.
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Isomerase, lyase
total genus 59
structure length 216
sequence length 222
ec nomenclature
pdb deposition date 2008-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13460 NAD_binding_10 NAD(P)H-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3dhnA00
4WOJA 2C20A 2ZYDA 3L4SO 2DBZA 1H6CA 3VPFA 1G6KA 2I3GA 1NPTO 1GV1A 1LX6A 3MJ4A 3NX4A 4WCFA 2EHDA 2QZ9A 1HDZA 1LUAA 3K31A 3JYOA 4FC6A 2C5AA 2YQ5A 5EERA 3RROA 1OFGA 3E1KA 1KY4A 1YGYA 3QVSA 2HMSA 3FRJA 2QRJA 5EJ2A 3MJEA 1DC4A 4YWJA 4GVLA 2B5VA 4HNGA 5CEFA 2O7QA 3AU8A 5IDWA 3AFNA 3GG2A 1UAGA 4D79A 3AOEC 2NTJA 5A5EA 4ZJUA 1TVEA 1M6HA 2O4UX 3IS3A 4EDFA 2VYNA 4CM1A 4PVDA 3I9JA 1H5QA 4IDFA 5TJ9A 5DP2A 1Z75A 1TT5B 2E6UX 3UH1A 4RO0A 3QQPA 3B70A 5KJ1A 4GPD1 3B6ZA 3FPCA 4J90A 4UVDA 2FZWA 4BO5A 3GDGA 2UUOA 4FFRA 4W82A 2HKIA 3AM4A 2YY7A 4IJKA 2X0RA 3ETEA 1R4NB 2QRLA 2DBVO 1PR9A 2I5PO 4RPKA 4F45A 1WMBA 3ROQA 3KTDA 1T2FA 4ZA2A 3LVFO 2RH4A 2BELA 3G17A 1V35A 3WSVA 4AJPA 1XGKA 3H4VA 3PWSA 1ZK2A 4W9NC 3DBHA 3QW2A 1XQ1A 4XJSA 2WJPA 1E3LA 1G0NA 4ZN6A 2Q99A 3JSAA 4TMFA 3IOYA 2GCGA 3DONA 4GH5A 4R3WA 2VUSA 5BNTA 3DMYA 4RZHA 2X9VA 5KVSA 1OC2A 1RKXA 3BMNA 1UXKA 1Q7GA 1AUPA 2SCUA 3OP4A 2VOEA 4XQCA 4XJTA 3JQ9A 2UDPA 1YBVA 4AJKA 5BSFA 5JAZA 4TZKA 1PZGA 4WECA 3PFWO 2ZIZA 1OMOA 1RYDA 4O63O 3EVNA 3BXXA 3VKVA 3DZBA 1BXGA 4DUPA 1PL8A 1E6UA 4EJMA 1Z6ZA 4E31A 1Z82A 4MVJE 3GGGA 4AG3A 2BFPA 4CLOA 1YB1A 4BNKA 4NJOA 1FK8A 2JCXA 4BHTA 4II2A 1KEUA 1C1DA 4UREA 5JDCA 1K6IA 3WGOA 4IIVA 3CUKA 4FC7A 2JAPA 3BMOA 4BNGA 5A3VA 4HFJA 3LSYA 1DFHA 4J2OA 4TVBA 2POQX 2G17A 2IXBA 3TDKA 2Q46A 3V2UA 1Z74A 4LRSB 3ETDA 3CXRA 4A73A 2VRCD 4ALNA 5L7TA 1NQOA 2NNLD 3RI3A 4KQWA 2CF5A 2J6IA 1ISIA 2ZKLA 2NVWA 4RORA 5GMOA 4C4OA 3TNLA 1YH3A 5H82A 2W98A 3OEWA 1QP8A 1B16A 2FSSA 4R51A 3W1VA 2X58A 4YDRA 4E4YA 5TT0A 1I0ZA 3ST7A 2HU2A 1CWUA 1IB6A 3SC6A 1VJ1A 4J7CA 1YL7A 3DWFA 3A14A 1CETA 1GUZA 3VZRA 4W99A 1EVIA 2IDZA 1BXZA 1VKOA 1YE3A 2ZTMA 3OA0A 4RVHA 1PGPA 4OSOA 4NBUA 2PZMA 1PL6A 4OMUA 5CDTA 1IHXA 4HFMA 5HWSA 3V1UA 1LLQA 4RL6A 4XX0A 4R68A 4O1MA 5L4LA 1O9BA 1B3RA 5F5NA 1A27A 2R00C 3X2FA 2ZYAA 4YAEA 2I67A 2VUTA 2RAFA 2ZB7A 5I9MA 4EEZA 1LBEA 4NHEA 1UZMA 3I23A 3G1UA 4C7KA 1BRMA 1YKFA 4CLOB 4C7JA 5KOIA 1XIVA 4DIOA 4DXHA 4DLLA 1V6AA 4GBJA 3WTCA 3GGOA 1HWYA 3ZU5A 4G2NA 1DC6A 3KSDO 3C1AA 3KEOA 1JW9B 1S6YA 2VYVD 1AHHA 1O6ZA 2Q45A 3GR6A 1DXYA 3OECA 3LF2A 3NT2A 1GR0A 1CYDA 2YJZA 3WBFA 2VZ9A 4E3ZA 4K28A 1N5DA 2O3JA 1A4UA 5BT9A 3P5SA 5AXAA 4IINA 4A5OA 2WYWA 3QWBA 4GWGA 3GVIA 1KETA 1EE2A 1OOEA 3GN2A 3OF2A 3ZWPA 1ZXLA 2JKVA 4OKIA 1T2EA 2OZPA 4R9RA 4BB6A 2I9PA 4D43A 2YDXA 2O2YA 3HB5X 5JDIC 1YL5A 4R1NA 1OZAA 2HK9A 2ZTUA 3V2GA 4DYVA 1X0VA 2H6EA 1PEDA 4FOSA 1PZEA 1DIHA 2BF7A 4QUKA 4YQYA 1U2GA 3PHLA 1A71A 3L4BA 1LU9A 1U4SA 3DB2A 4LW8A 4PLHA 2EKQA 4PG4A 4OH1A 3WGYA 1OAAA 1QLHA 2I99A 3GNSA 4JP2A 5A9TA 4FGWA 3CZRA 3V2HA 5K6AC 3CMMA 1KVUA 1NFRA 3SXPA 4EUFA 1DC3A 4J2HA 4LN1A 1P44A 2EJWA 4NFHA 4TVOA 4Y8VA 4Q3AA 4ZRMA 3NV9A 4OSPA 4ALIA 5L53A 2OBNA 4AJEA 2WE8A 2P5UA 4U6QA 3JQ6A 2VHYA 4OOEA 5EPOA 4ZQFA 3MJVA 1SOVA 3H9EO 1YOVA 1NR7A 4MP6A 4NQZA 4RVGA 1JVBA 1LQUA 1PZHA 2H63A 1MXFA 4KUHA 4OM8A 1GTMA 3JQ9C 4TKLA 4QEDA 1HZZA 3OJ0A 2B4RO 2QHXA 3ROKA 4BKOA 1N7GA 4O0LA 4MVJP 2YZ7A 3L6EA 1X15A 3H3JA 3BTOA 1LNQA 3JQ7A 4L4RA 4LMPA 5CDUA 3TZKA 5KJEA 1EVZA 1U28A 2Y1OA 3LT1A 1XKQA 2CF6A 3ONEA 3ZH2A 2NUAA 4I5FA 3QIVA 4ND4A 1QMGA 3QE3A 3DOOA 3NRCA 3ANMA 3ZNNA 5DCYA 4JBHA 2A92A 2FN7A 3AI2A 1EK5A 4UUPA 3F5QA 3K96A 3P7MA 4AL4A 5T67A 3OBBA 3TZHA 2AG5A 3FBTA 2FMUA 4M8SA 2VWGA 2GYYA 4E6PA 1C0IA 4BNYA 2QZZA 1A5ZA 1X13A 5A02A 2QG4A 5JAQA 5IDYA 1GCUA 2BRUA 3WGQA 3WGZA 4CMKA 5ITWA 4UVGA 1GDHA 3D4OA 1Y9EA 3PRJA 1HSOA 4I5GA 4CM9D 4CMAA 3N58A 2NVUA 4RF2A 5JCXA 3MWEB 1GU7A 5KKAA 1A72A 3H5RA 2D8AA 4CLRA 3VTZA 2VWPA 3M6IA 9LDTA 2JHFA 4I9NA 1X1EA 4E2YA 3D4NA 3GAFA 5JS6A 1ORRA 1F14A 1R0KA 5JBIA 1LDYA 2E4AA 3O26A 1NXQA 5T5QA 1JLLA 1EMDA 2JD2A 4D45A 3W8EA 2OO5A 1FJHA 4Q39A 4YR9A 2GD1O 3VZSA 2DPGA 4Z3DA 2LDBA 3M1AA 2EGGA 4R5MA 1MLDA 1DFIA 3G0OA 3KLPX 1H2HA 2ZCVA 1I2ZA 1SO8A 1XELA 3H7AA 5AVOA 2VQ3A 1YXMA 4ZICA 1AHIA 1UZLA 2TMGA 4LRTB 2X1HA 2P9EA 4A27A 3K2BA 3QWHA 2G1UA 6LDHA 4RF3A 4U0JA 2WD8A 4EZBA 3OJLA 3G49A 3KXDA 2PH3A 2V6MA 5AXBA 2YFQA 3VOSA 1XR3A 3Q9NA 2EW8A 2IZ1A 4XQGA 4AICA 3NGXA 3S1LA 3PJDA 5KKCA 3BTVA 3H9UA 2UYYA 2I3AA 4RGBA 5DF1A 4ZQBA 3V8BA 1KS9A 3EC7A 4PIVA 1DJNA 2VHZA 3ZNPA 1LA2A 4DREA 3KYDA 3KZVA 3WWYA 4DVJA 2RCYA 3DDNA 3EZLA 1RJWA 4WE3A 1HT0A 4HP8A 3GHYA 1KBZA 3NJ8A 1ZMOA 4QT0A 4ZGWA 4NU6A 4U8GA 1H6DA 1LSJA 4JCOA 4RCVA 4WUVA 2NVUB 2WD7A 3IC5A 3IJPA 4XYBA 2A35A 3I9OA 3L4BC 1RWBA 3DXFA 3RBZA 2BGLA 1NP3A 3HQ4O 4B4OA 2C5EA 3IKVA 1KEWA 3K92A 3AM3A 1HYGA 3KM0A 3LC7O 5DNAA 2CFCA 4TROA 5FWNA 1Q0HA 4Y6PA 4PLGA 3VH3A 1T2DA 4OKNA 3JYQA 3E5RA 4BO6A 5L40A 1JU9A 3GVHA 2VNSA 2O3SA 4BO9A 3HZZA 3X2EA 3ZGYA 1E3EA 2W2LD 3RVDA 4WK6A 2ZQYA 1VC2A 2I66A 3D3EA 4B8WA 3KYCB 2YDYA 1CDOA 4B7CA 4RPGA 4E5MA 3GGPA 4N7RA 3GAZA 1BVRA 1H93A 5EL0A 1AE1A 1EEHA 1YQXA 1GYQA 1YO6A 1ZSYA 4CMEC 1E5QA 4NJMA 4HV4A 3RQSA 1U7TA 3AJRA 1IPFA 5LCXA 1QYWA 1NQTA 5CG1A 3AK4A 3PWKA 3V1YA 4M55A 4U7WA 5TRTA 4FQ8A 3ASVA 1Y8QB 3AI3A 4NR0A 4DPKA 3JYNA 2QX7A 4J49A 2HJSA 3U5TA 1DIBA 4IQGA 4ID9A 2FOIA 3D7LA 3WXBA 2UAGA 1T4DA 2JAHA 4B79A 1VSVA 1U4OA 1PGJA 2GGSA 2B37A 3DBVO 5J23A 2E48A 4CQMB 3QWFA 5G4LA 4MINA 4CM4B 4FN4A 1E1KA 3OETA 5IFLA 2W8ZA 1I3NA 2GNAA 4MVJG 3IKTA 2C2YA 3JQDA 2WD7B 3B20A 2IE0A 3WQSB 2OP0A 4H3VA 3ZZNA 1ZCJA 4WPGA 5IF3A 3GFGA 3IUSA 3LDHA 4NDNE 4AJJA 3HHPA 5JY1A 2ZB8A 3D5TA 4M54A 3SX2A 3A9WA 5JO9A 1R4MB 4NG5A 1MC5A 3RUAA 4P22A 4S3MA 3VVBA 1BWSA 4PLYA 1Y81A 5JMPA 1DJQA 4AJIA 5B4TA 3T4XA 2YV1A 3GQVA 2QQ5A 2PR2A 4CODB 3GN1A 4R3NA 1GYRA 3MWDB 1ONNA 3DZFA 1GD1O 1HSZA 2PGDA 4YXFA 4TZTA 1VKNA 2RBEA 2HQ1A 1BXKA 4BGVA 2VOJA 3OIFA 4P8RA 5JLAA 1D1TA 2Y68A 2ILTA 1UP4A 2Y1CA 4OXNA 3UFXA 3ZWNA 1ENZA 2J5KA 2WTBA 1O0SA 2A9FA 5L51A 2JD0A 5HM8A 4CQLA 3ZNOA 1Y5RA 2B4QA 1LDMA 5KVCA 1IYZA 4BMVA 5CEJA 1V0JA 3IIEA 3NT4A 5I7EA 2ZYGA 3TWOA 4KZPA 4B4WA 1JWAB 2NM0A 3FWNA 2EP5A 4EGFA 3AOEA 4FJ2A 1R16A 1LDNA 4GI2A 3RC1A 5TQVA 4PCVA 1LRKA 4CM7A 2WSBA 1U8FO 3AY7A 4FFMA 1CQIA 2D0IA 2Q1TA 2GRAA 2I76A 3WGIA 4G81A 3VC7A 1YS4A 1X7HA 1HLDA 1ZEMA 4DRYA 2XOXA 3LYLA 3F47A 4D0RA 5CDGA 2G76A 2BFAA 3GRKA 3PYLA 2J5QA 3AW9A 1P1FA 1EUDA 4A10A 1IY8A 4RQTA 4IY1A 4ZU3A 4R1UA 1T1SA 1B14A 4NBWA 5B12A 5ITVA 2VTDA 2IRWA 2ZCUA 1N9GA 3H2SA 3ZV6A 3ICPA 4BNIA 1GY8A 3S2IA 3U49A 2Q2WA 1R6DA 2C59A 4W9NA 5IDXA 4PVCA 3SLGA 2AEMA 4E5PA 3ZU2A 5TLSA 3ROPA 3F3SA 5L7WA 2CVZA 5DCWA 4KTTE 2QIOA 4XZ3A 5T6BA 1D1SA 3GMDA 3JV7A 3PLNA 4DC1A 3FI9A 3GEDA 4NBVA 4YJFA 4DGSA 4XEHA 1M76A 1K6JA 1XSEA 2DBRA 5IZ4A 4YT4A 1EBFA 2IXAA 1P1RA 3MOGA 1FDSA 2Q2QA 4FW8A 2XXJA 4RPJA 1N1EA 1JKIA 1KC1A 1TLTA 3PHIA 3S8MA 3JQAD 4HXYA 2JFGA 1CRWG 5HTOA 2ZTLA 5CP8A 2YFHA 1E92A 1PGOA 4G5HA 4IDCA 3F4BA 2XAAA 3VH2A 4WLEA 3PHJA 4JROA 3F46A 1C1XB 1OI7A 4BOYA 2DM6A 3ICCA 4P4GA 4WGGA 5COAA 1E7YA 4O6VA 4I8XA 2DUUA 1VJ0A 1ZH8A 4D3FA 4R01A 1BVUA 5KJCA 4XYGA 5U9CA 2Q1WA 3SBOA 4L9RA 4RPLA 1ENYA 4FD3A 4R69A 3HDQA 1Z45A 3O8QA 2Y0DA 3ENNA 5DOZA 1VL8A 4FBGA 3WYEA 4YB8A 1WXDA 4J1QA 3S2EA 1TT5A 1WWKA 1HDRA 3UCXA 1N9GB 3HNPA 4ALKA 4ND3A 1ISFA 1LDBA 1XQ6A 3TQHA 3UGKA 4BQPA 1I5RA 1R4NA 1XLTA 3ASUA 3RFTA 4ALLA 4E0BA 3WX0A 1CF2O 4CL3A 3DO5A 4KDEA 2WEKA 3UUWA 2NU7A 4RDIA 2AE1A 5KCZA 1RM4A 3ON5A 4PLZA 4IMPA 3TOZA 3JQFC 3C1OA 3QY9A 3E18A 5KVQA 4BKRA 1W4ZA 2Y66A 4IUYA 2R00A 4ND1A 1DAOA 4HBGA 3EHEA 4LGVA 1SC6A 2OGUA 1ENPA 4IMRA 3HDHA 2GUGA 3WS7A 3Q6IA 3GH3A 4UUOA 5HS4A 1KOLA 1BTOA 2DUWA 4U5QA 1LQTA 4BO3A 1ISMA 1P74A 1R0LA 2D3TA 3OA2A 4YT5A 3U09A 1GZ4A 4K6FA 1H2BA 4HUJA 5L7YA 3AM5A 1M67A 1X14A 3EW7A 3ZDFA 4IDGA 3WYBA 3B1JA 5CAEA 3H5NA 2D5AA 3HN7A 3HFSA 2IZZA 3U4HA 2ZQZA 1MX3A 1KVRA 3PJFA 3ZWBA 5L4NA 3AUSA 3MTJA 3O8QB 4L75A 4BKPA 3EAGA 3JYLA 1C0LA 4OIMA 4HWKA 4MVJD 3L9WA 1X1TA 2EWMA 2NTNA 5F3RA 8ADHA 2FPPA 4UEOA 5JDIA 5LDHA 4W7IA 1DBVO 4BGIA 4CJXA 4K9DA 4N18A 1LTHR 2C7VA 3SEFA 1GPJA 4U0KA 4P4LA 1J49A 3WQRA 1LJ8A 2Q2VA 4B7XA 4LCEA 2EGHA 4MPDA 4NFYA 3AI1A 1NPYA 3TL2A 3PGJA 1QYVA 5K6AA 4WLUA 2Q50A 2C07A 1HRDA 1WAMA 2AQIA 1GQ2A 2FWMX 1HZJA 3WIDA 3DFUA 3LT0A 4Q3EA 4FFLA 4LMRA 3Q9UA 1C14A 4J0EA 3HSKA 1SEVA 4ROSA 5JSFA 3GLQA 2J3IA 1I01A 1JWBB 2Z1NA 4XQEA 2CD9A 2Z5LA 3ZWVA 3RKRA 4MIOA 1KC3A 2CY0A 1WDMA 1EFLA 3D3WB 3ETGA 4WKGA 2Y1DA 3N74A 5I9NA 2AXQA 2NU9A 5TC4A 4CLDA 1X7DA 4OO3A 5JCJD 2VZ0A 1SAYA 1ISJA 4FR5A 5FEUA 4Q3DA 5TX7A 4Z0PA 3GZNA 5DBGA 1JVSA 3K5PA 4GX1A 2BMAA 2X4GA 4NBTA 1ZJZA 3FWZA 3PK0A 3MZ0A 1LDGA 3CH6A 1N92A 3KVOA 4MOWA 4YJDA 1IUKA 1YDWA 4AJOA 3U4DA 2XPCA 1FDUA 2GDZA 4ILKA 1GEGA 3ZHYA 3ZWMA 3FNHA 4R4JA 4NZ9A 3D5QA 1MP0A 2FHSA 4MIEA 1T1RA 4CM9A 3PEFA 5JAMA 3GY0A 3ONDA 5FF9A 4BNLA 1QSGA 2A4KA 3MTGA 3CZMA 2GERA 3GF4A 4XGNA 2E82A 3NTRA 1YDEA 1DB3A 1HDGO 2AQHA 2O4CA 4IM7A 4QQRA 5F21A 3H65A 3RU9A 4B3JA 2HRZA 1PIWA 3VZPA 2HK8A 3SC4A 3VDRA 3D4PA 5EINA 1GQQA 3ADOA 3DZJA 4IQ8A 4BO8A 3FNGA 1E1LA 1E7MA 2V6GA 2NSDA 1HLPA 4FPXA 4OGWA 4TKMA 3ZNQA 1MB4A 1V3TA 4XDYA 1P3DA 2LDXA 3IP3A 3JQCA 4FOOA 2BFOA 3IQDB 3KSUA 1PS0A 2PA3A 4ESOA 4RJTA 2X8LA 1SNYA 1NVTA 1I2CA 1QYDA 5IXSA 1T2AA 2YHIB 3H5AA 3TRIA 2RIRA 2YYYA 3GZNB 1IZ0A 1SEPA 2GZ3A 1T4BA 3UCFA 3F6YA 3WMXA 4ONEA 3RUDA 4OJNA 3BAZA 1KVSA 3F4LA 2PD3A 4Y9DA 5L45A 3DTYA 2IEBA 3JQGB 2PLAA 1M6WA 4ALMA 1WW8A 3DOJA 5F1PA 1FXSA 5EQDA 3W8FA 3QLJA 3VZQA 3CIFA 1OBFO 5B1YA 3W4JA 3H3FA 4CV2A 1WP4A 3RD5A 3TZCA 4CM6A 5FI3A 3RAJA 4YAIA 5A4DA 3W4IA 2B4TO 1XU7A 5JPIA 1PL7A 3CSDA 2PTGA 4H16A 4B8ZA 3C8MA 1PJSA 4MIYA 3LZ6A 3MJSA 1D7OA 1BGVA 3UICA 4BNVA 4CM5A 4P4NA 5COQA 1XA0A 3CE6A 4A7PA 1U7HA 4A03A 2CNBA 3DZKA 4NNJA 2O3TA 4AJ4A 3LC1O 1D4FA 3KOUA 2J8ZA 2HCTA 3DHEA 1HTBA 3WWZA 4ZQEA 1G1AA 2B35A 1EDZA 2BKAA 3A28A 3GOHA 1PJ3A 4PZEA 1I3LA 4JQCA 3RC7A 5JXWA 4IIUA 1YJQA 4OQZA 4D0SA 3GPDG 2XXBA 5IDQA 1HE4A 1EBUA 2AG8A 4CMGA 2NLOA 2CVOA 3MJCA 5JE8A 4CPDA 2NQTA 3QA9A 3VKUA 1E6WA 3C3XA 1VPDA 4JBGA 3WJ7A 1R66A 4BNUA 4EEXA 3M2TA 5ICMA 1TI7A 5TSDA 1NFFA 1E7SA 1KIFA 1KY5A 3G1TA 3NJ4A 4J6FA 1PX0A 2VYND 2PZLA 3AUUA 5TF4A 1B2LA 1Z7BA 4J3FA 4CMEA 3QWAA 2PKRA 2BLLA 3FNFA 3GFBA 1NWHA 1J4AA 3OJEA 3U62A 3VHRA 5IAAA 4L73A 3UVEA 4XRGA 5JC8A 2WMDA 1H9BA 5C7OO 3DC2A 3ABIA 3AWDA 1QKIA 2VHWA 1F12A 3PDUA 3IL2A 4BUCA 4BMNA 3E5MA 4E30A 1HDOA 1Y8RB 1LRJA 3Q2KA 4L76A 4MP3A 3F1LA 5K9ZA 4PG6A 1CIVA 2HK7A 4I9UA 3G3EA 4UEJA 4GMGA 3LK7A 4GSLA 1EDOA 1GAEO 2UV8A 4XQ9A 1E7WA 1SBYA 1N1GA 5G4KB 2JL1A 4LISA 2WDZA 1MC4A 3D1LA 2OL4A 3GEMA 2EIHA 4J1SA 1YB4A 2X5JO 1ZK4A 2B5WA 5C7LO 3INGA 2BI8A 3OIGA 1QLJA 4XD2A 4YQZA 1ONPA 1P0CA 1VI2A 4JX8A 1XWFA 3M1LA 1YBAA 4PLTA 4INAA 3MEQA 1ZFNA 4YTEA 2HUNA 2D2IA 4KDFA 1L7EA 3JCZA 4UUMA 3UXYA 3U4IA 2GZ1A 3JD3A 4D42A 1C3VA 1F17A 4MJLA 1IZ9A 5BR7A 4XWYA 2CUKA 3UKOA 2NWQA 1UDCA 3NDIA 3UOGA 4NH4A 4LVUA 1YB5A 3FR7A 3VDQA 4MKXA 5JY6A 3MOIA 2OMEA 3BTSA 3GPIA 3JQ8B 1UAYA 3H9QA 1F8GA 3O38A 1DRWA 4ZQGA 3JYPA 4EJ6A 3C85A 2VZ8A 1VE9A 2W2KB 4X54A 2J3JA 1EZ4A 2E49A 4N5LA 1GV0A 4RQUA 3ITDA 3PPIA 4CMCA 3C1TA 1UDBA 3VH1A 4GWKA 3PHHA 1BSVA 1BW9B 3KYCA 4CMHA 2GPTA 1ZBQA 4B3HA 1I32A 3UHAA 3VPGA 1O5IA 4D7AA 1UXHA 3KSZO 4XR9A 4FIZA 2DPHA 3ZN2A 2RHRA 1TA4A 3I52A 1LI4A 2PGJA 1B0AA 4IDAA 3TFQA 2PD4A 1P31A 2Q1SA 3P2YA 3ZV4A 2PK3A 1R37A 2ZJ0A 4FJ0A 4Y6RA 4Z0HO 4XYLA 5ADHA 1Y8QA 2FPIA 5ER9A 1T24A 2O48X 3JD2A 5THQA 5F1KA 3A1NA 1JDJA 2WYVA 1U3WA 1LC0A 4D41A 2OFPA 1DPGA 4P38A 2AA3A 5BSEA 4JXKA 7ADHA 3ULKA 4F46A 4R9SA 4K26A 4Y6SA 1U5CA 4J9UE 5G0TA 1PQPA 1PWZA 3WFIA 4BNJA 3COSA 4JGBA 3AOGA 3JD0A 4CQMA 3S55A 4CM4A 4DQUA 1ZK1A 3BTUA 1GUFA 1IL0A 1I3MA 2O2SA 3ZW9A 5MDHA 3DL2A 3Q0EA 2AE2A 5AQ1A 4MKZA 3I9KA 1N7HA 4JN6B 1TXGA 3IP1A 4IS3A 4JIGA 1P1JA 1HL3A 4GKBA 4Q3BA 1R4MA 3PGXA 5CDYA 3DMTC 1LC3A 4AJ1A 4M49A 4XA8A 4E5NA 2WWRA 2A94A 2OP1A 1VM6A 4GX5A 3VPSA 2DQ4A 3QJ5A 4ITUA 4PLPA 1TT7A 5BSGA 2DLDA 4BB5A 4QSMA 4B4UA 1ZIDA 5HRUA 5DULA 1GCOA 1K5HA 5DZSA 3L0DA 3NYWA 4PLFA 2C7GA 1YBMA 3ZWYA 2PY6A 3TZ6A 1U2DA 4HKTA 2HAEA 1PR3A 4CLEA 3EZYA 4M87A 4UVEA 4CV0A 2QYSA 4DA9A 1Y7TA 1EQUA 2AMFA 3O03A 1PJTA 3RKUA 2NACA 1DLJA 3PJGA 4OXYA 4M86A 3JQBC 5T8KA 4YT8A 1ZXBA 5C7IO 4BV9A 1Q1NA 4YBZA 4DLBA 1QV6A 3GMSA 5MGBA 3WIEA 1PJ2A 3V5NA 5B4UA 5AYVA 4NBRA 1UUFA 4TRRA 3A06A 3ANLA 3QWIA 3HB4X 3K30A 4B7UA 1NX6A 3JTMA 1E1NA 1VLLA 4OHUA 4EUHA 5KTKA 3EMKA 1PJBA 1ZSNA 3JQAB 3NKLA 3O9ZA 1P1HA 3H2ZA 2PV7A 3Q3CA 4GX2A 5TT1A 4BV8A 3QVXA 3RUFA 4AJNA 1LSOA 3WYCA 2G0TA 4YAKA 2B36A 4IGEA 3U3XA 1I8TA 5F5LA 1UDAA 3AY6A 3QHAA 3NT5A 1Q2XA 3U4CA 2Z1MA 3NGLA 4YACA 2IYOA 4YRBA 3JQFA 2R6JA 2PZJA 1GFSA 2CVQA 1KVQA 2H9IA 5BNFA 1M66A 4BIIA 1FMCA 5TNXA 4DPMA 1V9LA 3GT0A 2Y1FA 5H83A 1NNUA 1I30A 3DQPA 3LLSA 3KEQA 4S1VA 5L3ZA 4BNZA 4CUZA 2FRDA 3WFJA 3RC2A 5I8ZA 4Z0TA 3I6QA 4YA6A 5I9LA 2H1SA 2V7PA 4FFNA 5G0SA 3CINA 5DN9A 4K1LA 1KERA 5KVVA 2JD1A 2W90A 3BMCB 2G5CA 1PJQA 3I6IA 5B4VA 3WB9A 2FPGA 1W8DA 3WQQA 4TWRA 2QW8A 3VVCA 3B1FA 3NDJA 5IXYA 5IN5A 3E03A 1A7AA 1HDYA 1W0CA 3KB6A 3PHGA 4ALJA 1C1XA 4L4XA 1HXHA 4DMMA 4MDHA 3GRPA 5JC1A 3DHYA 2GASA 3FTPA 4WLFA 1MV8A 3VPXA 3FN4A 3IMFA 1NM5A 4CR6A 5LDGA 2C29D 2WM3A 4EITA 3TFOA 2P4HX 2VTEA 2OOSA 4AFNA 1PQWA 5KWEA 1I2BA 3ONFA 1PJ4A 1XYGA 5LC1A 3KO8A 1NHWA 3JQEA 3GHHA 5CHEA 3RU7A 5BQFA 3ITKA 4BO4A 2AEJA 4BNMA 4DMLA 4KMSA 1GADO 3WMWA 4BNHA 1JKJA 3TF5A 3QVOA 4ZVVA 3VTFA 2PH5A 1LLCA 3AFMA 4UAGA 1O95A 4R16A 4DL9A 1WDLA 1YQGA 3UAGA 1LSSA 3Q11A 1Q0QA 4GX0A 1ADGA 1PGNA 3S2GA 4OQYA 1T26A 4DTIA 4QFDA 3FCOA 4L4SA 4OXKA 5ER6A 3WGGA 1MFPA 1UXGA 4J1NA 2GSDA 2VWQA 3GA0A 3TN7A 4RF5A 5ILOA 3GG9A 4I1IA 1ZVMA 3BYZA 5BNIA 1NVMB 5T64A 3ZV5A 1NQ5A 2C54A 3C7AA 3MJTA 3EDMA 4J16A 2X23A 4IBOA 4N54A 2VRCA 4J0FA 3SJUA 4YJHA 3H9GA 1DSSG 3LC2O 1FDTA 2XF8A 1NYTA 5F1OA 4CL8A 4DQXA 4FFOA 4D46A 3U0BA 3ORFA 3BZUA 1AXEA 3C7DB 4FGSA 4EYEA 3TJRA 3NAQA 5CEEA 1Y9AA 2PKQP 1TEHA 2Q3EA 4QO8A 2X0JA 2GLXA 5ENVA 3DBRB 1Q7CA 5T8KC 1HEUA 4N5MA 3I83A 3ZCXA 4NPCA 1LLUA 4TQGA 1ULSA 1EK6A 1DLIA 2YV2A 4XRRA 3OH8A 4BKQA 2F1KA 3DOCA 1FF9A 4J7XA 4YJGB 4RLHA 5GZ3A 3INRA 1J6UA 3PLRA 1WZEA 3B1KA 1HE2A 3TPCA 4RVSA 4D3SA 4JNKA 4K6CA 1PS9A 3KHUA 1E3WA 1YQDA 1ISGA 3BIOA 2FSVA 5DDIP 3NUGA 2DFDA 4FCCA 2HMWA 4M1QA 3OEYA 3PVZA 3W4KA 5A03A 1MFZA 1U9JA 3W6UA 1F0YA 3E9QA 2IYPA 2EEZA 1I24A 4E2WA 4XGIA 1ADBA 2VYVA 1K89A 3FBGA 1E7QA 3WLEA 4R41A 5KJ6A 1A4IA 1UXJA 3I9MA 3UF0A 1A7KA 5A9SA 2JFHA 2FY8A 3OJOA 4ND2A 4ZD6A 1J5PA 3EUWA 3RASA 4YJHB 3D3WA 3GVXA 2D59A 5TGDA 1IPEA 1HETA 2Y67A 4D44A 3WICA 3ZW8A 3PZBA 1R15A 3RWBA 1H6AA 1DC5A 5GZ1A 2NTVA 3R6DA 4KQXA 3WGHA 1E3SA 4GSKA 1DRVA 4MVJI 4WNIA 4DLAA 3IAHA 4O59O 3H8VA 3OIDA 3CMCO 4HFRA 1NASA 4LSMA 2ZB3A 1GZ6A 1P0FA 3KUXA 4KUEA 2HMTA 4UVIA 3PQEA 4W6ZA 1PJLA 2UVDA 7MDHA 4EUEA 4CR8A 2HJRA 1I36A 4IXTA 2BD0A 4NFSA 5CG2A 4CMIB 4NK5A 3BMQA 4CMJA 3S2FA 2DAPA 5TJHA 5CDSA 1DDOA 9LDBA 2P91A 1E3WB 1U8XX 2D5CA 3ADPA 2YV3A 5JAIA 2ZJ1A 4Z3KA 2IZ0A 1QORA 4BNFA 1K2WA 2B69A 1Z7EA 1BMDA 4BNNA 3ANNA 3WG9A 1B26A 1QV7A 4XB2A 3NDRA 3RUHA 3ZI0A 4YEDA 1ENOA 1NAHA 3FHLA 2VHXA 3K9QO 5I8WA 4J9VA 4L8VA 4OL9A 1NTOA 5TS3A 4A0SA 3OSUA 3DZHA 4W7HA 4E32A 5A5FA 4RVFA 3RJ9A 4DBVO 4E21A 4Z9XA 5A9SB 1ZKMA 4RVDA 1SPXA 1ZSVA 5BSHA 3ZHBA 1CEQA 2Y0CA 2BGMA 5THKA 3WTBA 3KETA 4OAQA 4J4BA 2VWHA 3E8XA 4LK3A 3NTOA 4EI2A 3DAFA 3SJ7A 1W73A 2D4AA 2YHIA 2B83A 4CM8A 2O3QA 2EKPA 4KP7A 1DAPA 4MKRA 3TL3A 3P19A 1ZUD1 1L1FA 1B8UA 3DFZA 1YRLA 3W8DA 3PQDA 2WYUA 4AJHA 3IJRA 3GC6A 1AN9A 3JQGA 3RUIA 1V8BA 1LLDA 3JD4A 2X5OA 3VH4A 4WCFB 5IZCC 5JNLA 1ZNQO 4DC0A 1WZIA 4Z9YA 1ZK0A 5JYDA 1O8CA 5KIAA 1JN0A 3BMQB 1F06A 2O23A 3PXXA 1PU2A 3D64A 1B8VA 4JLWA 2JHGA 1GZ3A 4IXWA 4IJVA 3GK3A 3AUTA 4GVXA 1R0SA 2PGLA 3WGTA 1ZMTA 2R2GA 2Q4EA 4E13A 1ZJYA 5DBIA 4KOAA 1O94A 4NIMA 3FD8A 3T4EA 5ICSA 1XU9A 5L4SA 3UW3A 4DPLA 3Q1LA 1EUCA 5ENDA 2EKLA 4NMHA 1P33A 4AJLA 4IDEA 3WBBA 4XIJA 1NBOA 4CV1A 4FS3A 4EBFA 5C37A 1XCBA 2C2XA 4M89A 1RM5A 1PQUA 1RM0A 3L9XA 1PJCA 4BMSA 1HDXA 2JFFA 3BA1A 1CQJA 1DIAA 2VUUA 4CM8B 1H9AA 1ULUA 4QFCA 4XYMA 3DBHB 1ADCA 4H15A 3QV1A 1PWXA 4XYEA 3LT4A 2CDBA 3F9IA 2UUPA 3WSWA 3I9NA 1E0DA 3IUPA 3PZRA 3FTNA 4J7UA 5A3JA 1E3JA 2DFVA 2X9NA 4GLLA 2IEDA 2D1YA 2BH9A 1NR1A 5JYEA 1NAIA 3RUEA 1YWGO 3OICA 4L74A 2H5LA 3BMNB 5G0WA 3R3SA 2PNFA 1TB4A 4JK3A 3I3OA 4XIYA 2HMVA 3AU9A 3PTZA 2AHRA 5CFZA 3PQFA 2X7HA 4XCVA 4WJZA 3HFGA 5A04A 4PLWA 1BXGB 1Y8RA 4W4TA 4WCFC 2DT5A 3C24A 4IS2A 2FR8A 1QXSA 1KEPA 1UR5A 1GYPA 4RLSA 3T7EA 1BDBA 2OORA 1NPDA 1VRWA 4G65A 4CUKA 4DYDA 4BS9A 1C1DB 2EP7A 5G4KA 5ES3A 1UP7A 3NTQA 3BMOB 2YQ4A 1KVTA 3I9LA 4J91A 2W2LA 5KNLA 5EN4A 5T57A 3INTA 4EW6A 4JJGA 3CPSA 1JKFA 1IOLA 4CV3A 1K6XA 3BHJA 3UN1A 3RC9A 3F1KA 3DMTA 5GY7A 1B8PA 1P45A 5JFOA 3UCEA 5A05A 4TRJA 4PFJA 5AXDA 1H0KA 2BGKA 2DVMA 1WDKA 3K73O 4I5EA 3DZIA 2ZB4A 1VSUA 4I9HA 2C82A 4Y67A 3GNQA 1MXHA 1GQYA 2FZEA 1P9LA 4GL4A 2GZ2A 2NV6A 4HFNA 4IGFA 2DTXA 1E1MA 3MCVA 3ZWOA 2Y99A 3KBOA 3V1TC 1GPDG 3JQ8A 2HDHA 3HUDA 4E5YA 1GEEA 1OC4A 5IN4A 3EYWA 1SZJG 2W2KA 1A9ZA 1BHSA 4ZHSA 1BDMA 1E77A 3ZU4A 5FYDA 1BW9A 2AEFA 5DBFA 5B37A 4WLNA 4XDZA 5L95A 2X22A 2X86A 3O4RA 5A06A 3G79A 3LF1A 2X9GA 3JQBA 1U1IA 2BHLA 1LEHA 4GKVA 1ZO8A 3L6DA 2Y1GA 2YUTA 3GEGA 1V3VA 2Y93A 2CZCA 3N7UA 4N5NA 4WLVA 4PZDA 2B0JA 2PWZA 2P9GA 1SMKA 3LU1A 3RJ5A 4Q3NA 3KRTA 3IDSA 3WNVA 3RFXA 2JCVA 1C0PA 3LT2A 5IJZA 5IG2A 4Y98A 4GGPA 4NI5A 5U4QA 2V6FA 2O7SA 3L77A 2W4QA 1P1IA 4IJUA 1ONOA 1F8FA 3OQ6A 3GUCA 2NQ8A 3DHNA 3R1IA 1L7DA 4E12A 5JDCC 3W6ZA 1YJ8A 2EG9A 1QG6A 3RSHA 3QRWA 3GDOA 4PRKA 2DU8A 3I4CA 1PGQA 3E48A 2YW9A 1MA0A 3K6JA 4YVFA 1SB8A 3AUAA 4KUGA 4YAGA 1I10A 1HE3A 1ZW1A 5JO0A 3E9MA 2NU8A 3OQBA 3GNTA 1M75A 4CUJA 1JTVA 4WNCA 1W6UA 3STHA 1Z73A 4IZHA 4PN3A 3PI7A 1ISHA 2JJYA 3K8ZA 4XGKA 2C0CA 1QYXA 4TRMA 2I6TA 3VPHA 4BNTA 4YYZA 2GN8A 3GZ4A 2J5RA 3H9JA 3HDYA 2GN9A 1NFQA 1T2CA 3WJAA 1Y5MA 4F6CA 3Q2IA 1ZZEA 5JMWA 1U3UA 1MUUA 1YL6A 2PKQO 4J4TA 5TIIA 1X0XA 4LCJA 3ZHZA 2VT2A 4E2XA 1YOVB 3P2OA 5AOVA 3PFFA 3TZQA 4D3DA 3OM9A 3KLMX 1IULA 4UVHA 1Y6JA 2TMDA 3KV3O 1HYEA 4MO2A 2Q49A 1CJCA 1IE3A 4FSHA 3JQ7B 4FB5A 4PRLA 5COBA 4BGUA 2E37A 2OHXA 1JA9A 2X0IA 1HDCA 2V65A 3FSRA 4YRDA 1WPQA 3FPLA 4QO7A 3ZV3A 4BGEA 4CMBA 2EV9A 2NU6A 1FDWA 3C7CB 4QX6A 3GDFA 4OYRA 4Q3CA 3WR5A 1IHYA 3BHMA 1EVYA 1XHLA 3JQAA 1DRUA 2O3RA 4PLCA 3F5SA 1U3TA 4A2CA 2P68A 2OUIA 1JQBA 5C3MA 4GQAA 5G0VA 4FDAA 2Y0EA 5H81A 5C5IA 3HWRA 1QR6A 2DKNA 5EQFA 4MVJM 5A9RA 3PYXA 1XEAA 5I7VA 1XG5A 4I08A 6ADHA 4TRNA 4R1SA 4FFPA 3R3JA 4IPTA 1QRRA 1X7GA 3OFSA 3WDSA 4BO0A 1D8AA 4BNXA 2CDCA 2AQKA 4CLRB 4HNHA 5EESA 4WEOA 3H6KA 2EXXA 1MG5A 1SCUA 3RCBA 3LLVA 4BQRA 1HF3A 2Q1UA 4KWIA 4ZQHA 3VAZA 1N8KA 2P5YA 3DZGA 4IDDA 2PD6A 1Q0LA 4PG5A 3RBVA 1NWCA 1H6BA 5GZ6A 3NEPX 3FF4A 1C0KA 1B3BA 2NVBA 3BMCA 4BVAA 1UXIA 1SB9A 2QYTA 1MGOA 2FP4A 4R1TA 4RV9A 8LDHA 4Z9FA 1NQAO 4DQVA 4XB1A 5DOVA 3ZWWA 4DBZA 4QXMA 4YRAA 3DAGA 3WLFA 3RBXA 1EE9A 3HDJA 5HS6A 3HJAA 2AQ8A 2Y05A 3PJEA 4WEQA 3D0OA 5CPFA 1V3UA 2VT3A 3ZWAA 1E3IA 2F00A 2P4QA 3A4VA 2Z95A 4DWVA 1B7GO 2O50A 2Q4BA 5AXCA 2OXIA 5I7FA 1P77A 3EVTA 1LXCA 2YHUA 4UUNA 3L6OO 3EK2A 4CLXA 1GL3A 1G0OA 3OMLA 2PFGA 1A9YA 4WLOA 4PZCA 3PIIA 2EERA 2CSUA 3KYDB 1T25A 3BHIA 4PG7A 5EMHA 4BL5A 2J3KA 4GMFA 1RPNA 1LDEA 4NK4A 4BO7A 2CMDA 1S7CA 2DBQA 1HE5A 4TSKA 1NVGA 1VL6A 3SLKA 5U1PA 1WNTA 3ROMA 3PYMA 1VJTA 5HBRA 1EQ2A 1SOWA 3GVCA 5I7SA 1UP6A 4LSWA 2IODA 4WASA 1MG0A 3JD1A 3LQFA 1EUZA 3E82A 2CDAA 4E2ZA 1DO8A 4RF4A 3K2EA 3CEAA 1KYQA 4F6LA 4MVJA 3PDJA 2VN8A 1YVEI 1RYEA 2EW2A 2FR1A 2HMUA 5DT9A 3R0IA 4R54A 3I5MA 4HX5A 1YONA 1EVJA 5ILGA 2BFMA 4BNWA 4CM3A 3DBLA 1PTJA 1E7RA 2VNAA 1DFGA 2GR9A 4CLHA 1J0XO 4A26A 4IDBA 3GVPA 3ZWXA 3EGOA 4URFA 4GAEA 4JBIA 1HYHA 3CTMA 2Y1EA 1CERA 2FR0A 3PP8A 1PZFA 4NJMB 1JAYA 3AY3A 4QECA 1ML3A 2I65A 2GN4A 4Z6KA 2ZATA 4PLVA 3QVWA 3DR3A 1D3AA 2EF1A 3DBRA 3I4FA 4YPOA 3I1JA 2AW5A 1XDWA 5EIOA 4IZIA 1K0UA 3QSGA 5JCJA 1QYCA 2VCYA 3EY4A 3PWZA 4YJGA 1DIRA 3M2PA 3ENKA 3OQ1A 4L0QA 4FJ1A 2ZK7A 3HG7A 4PG8A 1DHRA 4JJIA 1NHGA 1GUYA 4MVJF 3U9LA 2HO5A 3PIDA 2JCYA 2DTDA 5G0UA 1DHTA 1Q7BA 1FDVA 4RVUA 3DAPA 4YT2A 4E33A 1ADFA 3ZWCA 1PS8A 3KYBA 2ET6A 3TOXA 1I33A 4GGOA 4JP3A 2V6BA 1DEHA 1WVGA 5FFFA 5FI5A 3T7CA 4MP8A 4B4VA 4J1TA 3ZHXA 4BO1A 4Q9NA 2VRBA 3CKYA 5K0ZA 3RUCA 4KWHA 3DBLB 1ARZA 1AGNA 1E5LA 2P2SA 4WCDA 4O5OA 3E6AA 4ND5A 4PGFA 1KEVA 4XR4A 5IZCA 4YCAA 4XKJA 3HN2A 4CQMD 1EFKA 1RM3A 3FNEA 4EJ0A 4CQLB 2J3HA 2VHVA 4J43A 1B15A 4H7PA 4JJFA 4ZRNA 1O89A 2GO1A 1UZNA 3QP9A 1ZEJA 2DC1A 4IJWA 4MVJH 5CPBA 4CR7A 1ID1A 2HLPA 4HY3A 4J4HA 4II3A 4AVYA 4LVCA 4R5HA 3QVTA 4HADA 4YAJA 4CMIA 1AXGA 1DOHA 1K3TA 2O3UA 5G2OA 3TSCA 3HADA 2ZTVA 2BI7A 4RPHA 3DTTA 2X6TA 3WOHA 5HA5A 2P9CA 1U3VA 5DP1A 3ZU3A 4AJ2A 2RHCA 3WNQA 1BG6A 1JAXA 1I3KA 4NU5A 3RFVA 2DTEA 1M2WA 3GUYA 1HKUA 2EJVA 1P1KA 4U6SA 3FR8A 4UEKA 3RIHA 2PZKA 3L07A 2HRBA 1LSUA 4I5DA 4UULA 3OJFA 4GLOA 3HE3A 3E9NA 5L9AA 1DIGA 1WMAA 1E6EA 1U5AA 1LRLA 1ZK3A 1N2SA 5JW6A 2RH8A 1PSDA 1Y1PA 2GF2A 5A1TA 5KJFA 1R12A 4BKUA 2OBYA 4QTZA 3SVTA 2GN6A 2X5KO 4IQ0A 4RZIA 4BO2A 4DIFA 4DIBA 2G82A 4OOFA 1UJMA 4WOKA 4E5KA 2QRKA 2HSDA 2X0NA 5DCUA 4B3IA 4RDHA 1WLYA 2WE7A 4YJFB 4F3YA 1UH5A 3OHSX 1VL0A 1H94A 3DEYX 4KTVE 2NADA
chains in the Genus database with same CATH superfamily
3GRZA 1NRWA 2ZYDA 2ZRMA 1NJFA 1CUJA 3A9VA 3TK1A 4C0XA 1F6DA 3A1FA 3DLHA 1JEDA 1XNQB 1GV1A 1MQAA 4B3DA 2Q8PA 3I05A 2UUBB 2QZ9A 1HDZA 4X5OA 3JYOA 4FC6A 3CRQA 3ZE7A 2B7LA 1QCYA 3KKLA 1F5NA 1KY4A 2IIVA 3QVSA 5EJ2A 4B74A 1Q7TA 5IHPA 4EYSA 1I2AA 2JGMA 4NOLA 1E9EA 4L3OA 4ZDIA 2GUWA 3WZMA 3MQFA 3L0ZA 4YWJA 1WPGA 3HCFA 3SBDA 2HHCA 2ESRA 5IDWA 2O7QA 2WSSA 3AU8A 3QQ5A 5E1OA 1IZZA 2AT1A 1SBNE 1Z22A 4DMUB 2F90A 2O0MA 5IKMA 5HKKA 2VYNA 4UXJA 4CM1A 3PQ6A 1YR3A 2C2MA 4IDFA 5TJ9A 1RDFA 2H1WA 5IJ0A 5IW8A 2P41A 2HTFA 2ZUCA 3SPXA 2Z3WA 1Y6FA 5LA6B 3SX0A 3A3NA 1TK2A 3B70A 3GZTB 1Z6GA 3B6ZA 4GPD1 4QEZA 3TLBA 4UVDA 1II8B 2RHDA 1PBNA 3BJMA 1N34B 5GOTA 2JHCA 1XLVA 3H87A 4L07A 2HKIA 5JISA 3AM4A 1D2NA 3OQJA 1KK0A 1XMPA 2I7XA 3I72A 2LCIA 4XSGA 1PR9A 2I5PO 4L7VA 4MNTA 1JJ7A 4G5OA 2H08A 2PNJA 5LMUB 4I8IA 2P4EA 2XT0A 2D5IA 3SS8A 2FW1A 2P0AA 2NU7B 3PWSA 3Q0IA 4HJRA 2HXGA 1CUDA 1OWLA 2XOEA 2ZT6A 4D9GA 2LVBA 3EIHA 1QWSA 2ZRDA 1E3LA 2VATA 3OCWA 3E3NA 4R0NA 2JIZA 4RGYA 4YLGA 1QWOA 1RJEA 2BM0A 5CMLA 1IWBB 4GH5A 4I1OA 1ZNZA 4BP9A 4CTOA 3AVQA 3CLRC 5A4KA 2FFRA 4ZO7A 5A7GA 1EG2A 4V1CB 3E5HA 1FE8A 2Q2OA 1KR2A 1NTRA 2SCUA 4C2AA 3OP4A 3RSQA 1Z4OA 4TZKA 2VDNB 4WECA 4F85A 1N6KA 1ZCZA 2ZIZA 4KYUA 5C1OA 1RLTA 4IV5A 1IBKB 1WDWB 1JG1A 4HNRA 5BWCA 1GQOA 3UPTA 2J1LA 2XA9A 1E6UA 3BE8A 2EZTA 5JCZA 4IHKA 3RODA 1JDNA 3GO4A 3K9NA 3WYAA 1ZGJA 1EFUA 4CLOA 4US2R 2IS4A 2Q3MA 1POXA 3SNHA 1NOKA 2KJQA 2F62A 1ES9A 1CQXA 2HC9A 3BRQA 2IKSA 1J5EB 1KI1A 2QDXA 2J33A 2V3CC 1ILEA 4IIVA 3BMOA 4BNGA 5A3VA 2FPPB 5DX1A 1DFHA 3KLOA 3FDZA 3P97A 5TQ0A 4L1KA 2A88A 1QGOA 3AL3A 1IC6A 4OQLA 1SD2A 3V2UA 1OFIA 2G9RA 1Z74A 4LRSB 3ETDA 2FMHA 1N33B 5EIXA 2NXCA 1YT5A 3CVWA 2AVDA 2ZRGA 1EFVB 3ZQJA 4DDHA 4BFCA 2J6IA 1ZZGA 1ISIA 2YRWA 3NTLA 5DM4A 1K8YB 2GPWA 4EELA 1Y4DE 2P2ZA 1EXVA 3R0XA 4QU0A 4C4OA 4PHHA 2R84A 1YH3A 2ZUSA 2ZVJA 1E3DA 3DV0A 3OEWA 3K6SB 3SQWA 1QP8A 4BQIA 4GM1A 4H7IA 3FCAA 4K9RA 3QI2A 5KTSA 1QH0A 3GFTA 3I2HA 2DXIA 1JDPA 2HU2A 1CWUA 2C88A 1VJ1A 1YL7A 4HZIA 3WHKA 5D3MB 4B31A 4HQ0A 1CETA 1P1CA 2AFVA 2HEGA 2W2QA 3S68A 4LF7B 2IDZA 3A4NA 3DB1A 3OD1A 4I4TA 4V0ME 1VYUA 1DQSA 3UWKA 4BQEA 3R9KA 2G8LA 2ZTMA 1UBRS 2W2OA 1MOQA 3OA0A 3QBTA 4MK4A 3TR6A 5F4ZA 3BSFA 2I4MA 1PGPA 4XM0A 5E2BA 5CDTA 4DA0A 2WM9B 1GTSA 1IHXA 4IZ6A 3A05A 1LLQA 1X94A 3HP1A 4RL6A 1A5AB 2Y9MB 4XX0A 5CXSA 3UUFA 5DM60 1V11A 3GU3A 5G41A 3L8EA 3HEMA 3TJZA 3PNKA 1TJ3A 5L4LA 1KKUA 2QN3A 4X97A 1AY0A 3GEPA 2VQFB 5AM4A 2RAFA 2ZB7A 3IH5A 5I9MA 4EEZA 2P79A 2YX1A 4UQLA 4NHEA 5CFMA 2JFYA 3C3AA 3I23A 4FM9A 1YKFA 1GILA 4G36A 1LPSA 3HSSA 4DLLA 1PSZA 1ZM2A 4GBJA 1U7XA 3WTCA 4P84A 1GWNA 1VRCA 4V2UA 4AZ0B 5LFAA 5C8YA 4G2NA 1DC6A 1IJKA 3CCFA 4W1PA 1L4UA 3ILHA 3KEOA 1JW9B 1JG7A 1GHTA 2Z9CA 1AHHA 1O6ZA 3NORA 2W0SA 4OREX 1DXYA 5KNDD 2R6ZA 1VHTA 3HXKA 5EJFA 5LU8A 3IVAA 3WBFA 4B3MB 4RTNA 3OQOA 1MO4A 2IEGA 4ZP1A 4W63A 1A4UA 1VHLA 3V7UA 2HNKA 3ZWDA 5AXAA 1GL6A 1NVWQ 2WYWA 3QWBA 4QLAA 2QTTA 4HAYA 3GN2A 4M76B 3RTCA 1LB1B 4FSXA 2JEOA 4OKIA 1UMDA 3FOWA 4D43A 3MGGA 2ZEJA 1UMBB 1YL5A 2JLBA 1T8SA 1FPMA 2GBPA 1PEDA 4FOSA 3DPSA 2NSJA 3LA8A 4NJEA 1TTPB 1DIHA 2Q3LA 3EVBA 4EJSB 3PFBA 5J2TB 3F4KA 1FQJA 1M7GA 2C42A 2W2XA 4PYKA 4YQYA 2IJGX 4EAQA 2I4OA 3HZRA 1I7QB 4MCIA 3RU2A 1CLUA 1YUNA 1HQKA 3L4BA 4UBNA 4WNAB 1LU9A 1U4SA 2LUOA 5CNJA 5KVAA 2GEBA 3ZIDA 5HCIA 1P7PA 2VA9A 1ZUHA 4D9CA 4JP2A 3O8LA 3CZRA 3V2HA 2GCEA 4URZR 3VNUA 3GGJA 1Y6QA 4MAMA 3SXPA 3U7QA 4EUFA 1HYQA 5CR9A 1U6JA 1B8NA 5JCPA 3NKVA 1WPRA 2XRMA 2AB0A 1AB5A 5P8WA 4DCNA 2CEAA 2YNMA 1ZP6A 3AESB 3JVUA 3GARA 4H7KA 1M3SA 4Q9JA 4DDUA 5HZHA 4C2BA 4C3OB 3WIVA 1Y8AA 3H2IA 3JQ6A 1N0UA 1FP1D 2YINC 5G02A 1OTHA 2C9ZA 3MJVA 4A0FA 4NESA 1I5OA 1JVBA 2K4MA 2H63A 1RQLA 4KUHA 3CF6R 5H16A 2ONYA 2G8NA 3IAEA 4TKLA 5IEJA 4QEDA 1KAMA 1FJGB 1YRBA 3E58A 3ND7A 2LR0A 4ZVQA 1K8ZB 3ROKA 4H17A 1ND5A 1N7GA 1XEFA 2FZKA 4O0LA 3WOVA 4BKOA 4K3UA 1E9VA 3H3JA 3TLMA 1JDBC 2CUZA 1GR1A 1U28A 3LT1A 1FMTA 2CF6A 3ONEA 4JB3A 5AM0A 5HGJA 3ROGA 3ZVMA 1PT8A 2AKYA 2NUAA 4R2LA 4K1XA 5FYQA 3DL0A 5THXA 1IY2A 3QIVA 1SUCA 3OZDA 3BQ9A 3G2QA 2Z5FA 3NRCA 3QE3A 5DCYA 4EW2A 1QKKA 2NP6A 3V80A 2Y1LA 1CRPA 4TUYB 4DN6A 4QG3A 1M34A 3WRYC 3G68A 3BIXA 3DE4X 3F7NA 2BW0A 5FBWB 4A2QA 3IOBA 2DPYA 2RJNA 1YI8A 3BHNA 2AG5A 3FBTA 3MBKA 4QPPA 4TL6A 2XMCA 4LGCA 5JSUA 1QGZA 1V7PC 4UQPA 2QN6A 2QZZA 1GTVA 1QO0D 5CXUA 2G83A 4CCWA 2V0CA 1W94A 2PO7A 5IC5A 4BFZA 2TSYB 3P0IA 4ZEMA 1W36C 1GCUA 2BRUA 2IYFA 4CMKA 4P7KA 3C8DA 4YK7A 3T15A 2ZXEA 1MB3A 1M72A 5JWOA 1WZUA 2IUYA 3KELA 1HSOA 4NNOA 3H05A 4RF2A 1U1EA 4M88A 3H5RA 1D6NA 1GZHB 1FBTA 2D8AA 1Z4IA 2VWPA 1EFAA 5B3JC 2KWIA 1UM9B 3SNKA 1FFXB 3D4NA 4D3YA 3FOZA 4MWDA 2HRCA 2J87A 1GAQA 3FYTA 4IDPA 4X64B 1F14A 2R8ZA 3KE9A 1R0KA 1JFRA 2PG3A 1VYVA 3JASB 3KQOA 1DX4A 1KI9A 2QU8A 4GZ6A 4IHJA 1EMDA 2JD2A 2A5GA 3ZDXB 1YJCA 3JALA 2H2DA 1MD9A 1SVOA 2FRVA 5KYWA 4XQ0A 4ETNA 4GNKA 5TGTA 4B6EA 2HSZA 3OWOA 3IUEA 3QXHA 4NU8X 4LF5B 4A16A 5LZ9A 1QPBA 3MAGA 3V9AA 3I92A 2ID4A 4NYIQ 2K6GA 1DFIA 1VECA 3KR1A 1YXMA 1AHIA 5D1HA 4GM0A 2NZYA 5JEEA 1MKYA 1S3FA 2P9EA 1NIPA 5BWNA 1OBOA 2NXWA 3K2BA 1NXXA 1L5LA 4G84A 4RF3A 5FTKA 1NG9A 4QFBA 2VG8A 1JDZA 1EFRA 4K2HA 2VQ6A 4BBAA 4E07A 5FWYB 3ECAA 2PMWB 5EZYB 5E2IA 1GQSA 3D6UA 3K1ZA 5ALEA 3Q9NA 2OC9A 2IZ1A 4XQGA 4AICA 4IR7A 1JHXA 1UBKS 1KTIA 3ZNPA 1Z0SA 1KS9A 3EC7A 4L78A 1W5BA 1GGNA 2VHZA 4GG1A 4FFBB 3RSSA 4ACAA 3GMIA 5GJVC 4RTSA 1KAEA 2ZR8A 3EZLA 4E5SA 1RJWA 2YIJA 4EIWA 4G4GA 3GHYA 3OAAA 1KXZA 3ND5A 4RYLA 1IWOA 2EARA 4OK3A 3DC7A 4JBWA 5KOYA 5AI0A 3HXMA 3A04A 4ZGWA 3DEKA 1H6DA 4JCOA 1V2HE 1EBBA 3IC5A 1ANKA 4XDGA 1T5DX 5F51A 2Q6IA 3OU7A 1U5BA 4LYJA 1LJUA 1RD4A 1YKGA 2TRSB 2P9JA 4MAAA 5FOWA 4PZPA 5J63A 2LPMA 3BXOA 3DXFA 2BGLA 1ABBA 3U44B 4OPMA 3AVWA 2I8LA 3HQ4O 3P9IA 2NAPA 1KEWA 4LF8B 1WMDA 3ISTA 3K92A 1HYGA 5JPDA 1FY2A 2F8LA 3KM0A 3OOWA 5DNAA 5D3KA 4QE3A 2WWVD 3TGPA 5J9FA 1TQ6A 3G2HA 3VTAA 1DTSA 1T2DA 4RHXA 3FFBA 4ASUA 3BORA 2C3YA 2ZSBA 5BSUA 3AIMA 3NPAA 3JARA 3A4YA 4Y2TA 1XDZA 4EYQA 3SC3A 3E5RA 1JR2A 3HR4A 1S1CA 3I5UA 3JQRA 1ATIA 1YNSA 3L40A 4JQOA 3THOA 3PNBA 5IFKA 2O8BB 1ODKA 1E3EA 1DKNA 1Y4AE 2ZQYA 3W5VA 2I66A 4B8WA 3D2BA 1ZRSA 4ZZ2A 4AN4A 3WV5A 3A6KA 4W9MC 1JP7A 1KOGA 1UODA 4HVTA 4JGGA 4WRRA 3HVJA 3C45A 3KFXA 5EL0A 2XT9A 1YQXA 4F4UA 3G9TA 4B6SA 4HV4A 4OFBA 3MW8A 4ENSA 3AJRA 5LD2B 1IPFA 1NL3A 4DCMA 1OZGA 3P4UA 4UPEA 3K4PA 2AJCA 4OGKA 1N75A 1OWOA 4LNAA 2W2PA 4M55A 4U7WA 3V1YA 1DP4A 4G0PA 3KKQA 2QE7A 4FQ8A 5DBHX 3FVWA 2OAGA 3PR2B 5C1IA 1QTRA 3AI3A 1JHDA 2V7QA 2XNJA 1MCZA 2J7KA 4MR9B 5DU2A 5IT5A 3FZQA 4RAOA 4IQGA 4N5DA 2FOIA 4GDMA 5SY4A 4C0BA 3LKVA 5BQXA 4LZWA 4DB2A 1I3OA 4O2LA 1MOZA 4QDKA 3VR1A 1NVKA 1NDUA 1CRZA 2NIPA 3CSUA 4AT1A 4B79A 2NUTA 2BAGA 3ZCSA 5JT1A 3MT0A 4BP3A 2C00A 1A96A 1XMSA 2GGSA 2B37A 1EJ6A 4CQMB 4UTRA 4CM4B 4YY3B 3OETA 4J0IA 1ZI9A 1KI8A 1Y3CE 3I04A 5D5HA 1EGMB 4MVJG 1K8RA 5A0FA 4OYYA 3FWYA 2C2YA 3JQDA 2RGNA 4OHBA 3FVQA 3RYCA 3AKEA 4H3VA 2BR5A 1ZCJA 2EHJA 1I1NA 4NDNE 1GGMA 4OB7A 4R0VA 2P7HA 3R3WA 4F3KA 5SYMA 821PA 5JY1A 4U2CA 3RVQA 1PF7E 3OZTA 3I6ZA 4OB8A 3TSWA 3X44A 2D06A 2V98A 1IUNA 3T9DA 1NIJA 5H59A 2ZROA 3T4XA 3O9VA 3P9KA 3OPNA 3LL4A 1MR3F 2PR2A 4LMAA 4P3NA 5BSWA 1RIIA 2H4HA 1Z88A 1CR0A 2QGNA 3K0HA 3D7NA 3VUEA 1KGDA 1N2ZA 4AYWA 2GQ0A 4KSYA 1XZNA 2VLBA 4G4JA 4YH1A 3WLRA 4ZYUA 5SZIA 3P52A 4BLOA 5ALDA 5FBQB 3CWZA 1BXKA 4MULA 2ZYSA 4J3JA 4RPIA 1ICIA 1XMQB 1IEWA 1YZQA 2X2PA 3ZXUB 4O1HA 4LXIA 3T61A 4MTCA 5K3EA 2XD9A 4CKBA 4GECA 5L51A 2JD0A 5IVHA 5TQ2A 5KAMA 3GXBA 5HM8A 3DMGA 3KB2A 5D6OA 2J85A 1NA5A 1XLUA 3E9CA 1V0JA 2OBBA 2P40A 3OT4A 4F72A 5JQGF 2ZYGA 3DUFA 1OY1A 4KZPA 2NM0A 4EGFA 2EP5A 3FROA 4FIDA 4ZOLB 2Q62A 3AOEA 2P3LA 5LXTB 3EQ8A 1HURA 1LRKA 2WSBA 2G67A 1U8FO 4MKHA 4DTCA 1OUMA 3TSYA 3RS5A 1VCHA 2D0IA 1Z5VA 3G8CA 4HS9A 5B6JA 5AW4A 1AQLA 4QVIA 2I76A 2UYHA 1TW3A 3CX8A 1EHYA 1VL1A 3L0OA 1X7HA 4EL5A 4FN5A 2BGJA 2RD2A 2WIDA 3B8HA 3EXFA 1DWOA 3PYLA 1EUDA 2B4KA 4EGJA 4IZOA 3KKMA 1JHYA 2O2CA 2YR0A 1DS6A 4QJBA 1GNQA 2QVYX 4B85A 3NBKA 1B14A 4PX9A 3RE1A 2O2XA 3W2HA 1QUFA 5B12A 4R8SA 4IILA 3UATA 2AZMA 2P9BA 1OASA 2V6IA 2VTDA 4QBKA 1TZBA 2ZYHA 4ZV9A 4UM7A 1G5IA 1RI5A 3K7EA 3S2IA 1BCRA 3EW9A 3B52X 2X19A 2WB4A 3TAXA 5IDXA 1HG1A 1L8LA 2OXFA 3KQLA 2XMBA 5EEHA 2PX8A 1H3NA 4RACA 4COOA 3ZE8A 4YRQA 3LCVB 3T0IA 5KTRA 1L8QA 1G59A 4JVLA 3O7WA 3A4LA 3NG1A 2ANCA 4LWQA 3ROPA 2DQYA 4F92B 5L7WA 2CVZA 2HHAA 4WQMA 2QIOA 3WGKA 1OI2A 4XZ3A 1L1QA 3A10A 3GMDA 3QFHA 3KWLA 4NLLA 1L5VA 2I7VA 5HDQA 1GG5A 5B58T 5D1NA 4KDCA 4YJFA 1A76A 3B78A 3GRFA 3ZTYA 1QMPA 4N0EA 3TKLA 5AKEA 3K0CC 4YT4A 3UT6A 1P1RA 3MOGA 1VFPA 2Q2QA 2W6NA 2FUG1 1RIFA 1Z4LA 2VKQA 2XXJA 4FW8A 4RPJA 4ZT5A 1M1YB 1RXCA 1T9GS 2VSOA 5HFNA 3SYKA 3S8MA 3PGLA 5AKXA 1VG0B 1EXNA 3TRFA 1RWOA 4HXYA 3FUXA 4JL6A 5LP6B 3T7AA 1A77A 1K08A 2C78A 3B48A 4BUZA 2PUEA 1DUSA 2HA2A 4CDGA 1PGOA 3FCSB 4G5HA 2FPGB 4M99A 3AVYA 3MVEA 4NONA 1XI2A 5CU7A 1TEVA 3THYA 5B1HA 1FP7A 4Y30A 3LD9A 4EZIA 4EGSA 1HNWB 2J3EA 1P91A 2V97A 4P4GA 2QQGA 3HJNA 5JHGB 2HN9A 1VHQA 3CHYA 1U11A 4D3FA 1SBHA 3HMQA 4R01A 1BVUA 1VPLA 1T1IA 4RABA 5KJCA 2BUAA 4XM1A 1HT3A 2PT9A 4FD3A 1N3LA 2E1RA 4V24A 1OTYA 2C8VA 2QL7A 3O8QA 3HMKA 4FGLA 4V3CA 5DOZA 3RTGA 4F86A 1ID8A 4ENVA 4G1CA 1QFJA 2ZIGA 3IMEA 1ZLXA 1QK3A 3VM6A 3TAHA 4H08A 4E5VA 1XQWA 3C6XA 2CHQA 5LA6A 1N9GB 3RARA 4F91B 2DFNA 4HLUA 5JCOA 3W05A 4DABA 2AD5A 2ZE7A 3NVKI 2O2HA 2JJ2D 2Q0QA 3H0CA 4AMGA 4ESHA 4KE7A 1FX0A 1XD8A 2LIPA 4YLEA 4BQOA 1XMJA 5CVEA 4PCAA 4QLOA 1PJZA 3M6UA 2V7WA 3R3VA 4FNGA 1T5LA 4QYSA 5SYNA 2AYXA 4UMFA 2BUCA 3DF9A 4KDEA 5CB4F 3ASZA 4S2UA 2LRHA 4G5SA 1GTZA 1O9HA 1CUCA 2ENWA 2NU7A 2RI0A 2VDKB 5IM5A 1KQGA 4H4EA 5KCZA 4WTOA 4RYDA 4HD8A 4TL8A 4EB8A 3TKAA 4F1KA 2DH6A 2V54A 3D0KA 1PUXA 4L5JA 5J4KA 3CLKA 1RWWA 3Q0TA 3E18A 1YRAA 1Q5PA 3LKDA 3PUJA 2R00A 3A6EA 3D7RA 3EHEA 2BKEA 3V46A 4OKSA 1SC9A 3WS7A 2RKOA 4H0FA 5KWSA 1VMAA 2ZUVA 1TUEA 3GH3A 4LPSA 2XITA 3QLUC 4UUOA 2FRDC 1N57A 1BX1A 2DUWA 4HEA6 4LJSA 3AM1A 3U09A 3E7PA 3OA2A 2VJOA 5AJUA 4O0MA 3WJ2A 1H2BA 4HUJA 1O4WA 2IGBA 4AUEA 3Q7PA 1M67A 5ESRA 2JEYA 2K5UA 3VNBA 1FLNA 5HYVA 5M5BA 1ZH6A 3U4GA 3Q3GE 2X8BA 2CUNA 1VGRA 2NX2A 3PPXA 4FSDA 4FZRA 3WYBA 4DXAA 3B1JA 4LXUA 3DMDA 3H5NA 3C3YA 3HN7A 4NU0A 3V4LA 1QIHA 3TQFA 3U4HA 5IM4A 1WBBA 3EXG1 4EF5A 3ZWBA 5L4NA 3KOYA 4TKZA 4FFSA 3MTJA 3SG0A 3UV6A 5HJ5A 2E4XA 3JYLA 4IKOA 1I7LA 4XM2A 4RFSA 1UC8A 4HWKA 4MVJD 2Q2NA 4AKEA 4GKKB 4DSAA 3EN0A 2FPPA 5CXQA 5JALA 2CCKA 3TM4A 4C6RA 2YCBA 3MXTA 1OCEA 3QTLA 4FNMA 4BGIA 4N18A 4CJXA 3T7KA 2GHIA 2J9FB 1JTFA 1H8HA 1SKBA 2PT5A 4FYWA 1EFVA 4ZTBA 1MO6A 3LVRE 4HZGA 4D8YA 3O0DA 2OCYC 3A6HA 5DNCA 4ZT7A 1Y1SA 2ID8A 3OWXA 1Y3IA 5AOBA 5K6AA 2D1FA 5AKHA 1REQB 5ERYA 2AQIA 3WL3A 1NX9A 4XIIA 1H2AS 4ZZ3A 5AM1A 2VTBB 2QJWA 3LT0A 3RVOA 1O95C 4J0EA 1SEVA 3FUUA 2HXSA 4ROSA 5H5JA 5D3MA 2A78A 3TR5A 4EO9A 1IBLB 4DB4A 4BLTA 3Q15C 4OBEA 3TUJC 4XQEA 2Z5LA 1L5YA 2XKBA 1ZUNB 1EFLA 3RHZA 3N74A 3R7SA 4FYJA 4H1HA 2D2EA 4NFLA 1RPAA 1X7DA 3M4ZA 4OO3A 5DX8A 4WACA 4ANFA 1NF3A 4GPBA 1N6RA 1QQBA 1B23P 1LX7A 1ZMRA 2QN2A 4Z0PA 4JKIA 3HZOA 5DBGA 2IPOA 2XOKD 4JQZA 5KYTA 1DG9A 2X4GA 4NBTA 1ZJZA 3VOTA 1EYZA 2G08A 4LOJA 1GGFA 5ALUA 2XUAA 3IEMA 1LDGA 1KKLA 2MU1A 3KVOA 4IUBS 2FDRA 4M9QA 4YJDA 3VYRB 3IAXA 2XPCA 4TL7A 1LFAA 2HNAA 3WK9A 4UOEA 2GDZA 2RGRA 2ECPA 3A6DA 1GEGA 3M33A 2Q1XA 3ZHYA 4KXNA 3SI7A 1KA9H 4TV9B 4AZ0A 1T0IA 2Z5VA 4MIEA 4NCNA 2O5VA 1M2JA 3KT0A 1IAVA 3PEFA 3GY0A 4CM9A 3V3TA 2P2YA 3NWPA 1OYVA 4PNPA 2ZR9A 3CZMA 3QU5A 5DYNA 4KR0A 4FWBA 5ILQA 1E5XA 3IERA 1IUOA 4HDSB 1DB3A 1HDGO 4EM6A 2AQHA 3BFVA 2O4CA 4KRGA 3LPDA 2YWEA 3KXPA 2FWAA 4AY5A 4QQRA 3VI4B 2R11A 4B3JA 3KQSA 2F4VB 3P4XA 5EQTA 5I45A 1GPNA 3ZV7A 3M4XA 2QW0X 4B2LA 3NHZA 4LA4A 4WESB 2HK8A 5F12A 1M1YE 5G1PA 3SC4A 4RDXA 5CURA 4KIWA 1XOIA 2FA9A 2FFAA 1GCGA 2QN9A 3LXMA 3PNPA 5TPZD 1GQQA 5TY0A 3KZNA 3LGXA 3DZJA 4IQ8A 3R5TA 4JHXA 1RRFA 4KVAA 4BO8A 2JIDA 2JGJA 2PFKA 4URWR 2VNHA 5T4HA 4KXYA 4RK0A 4WHMA 4FPXA 5JS7A 2FSVC 3D3NA 3O8BA 3R09A 2CJXA 2B8NA 4WSOA 4WNAA 4Q1EA 3CZ4A 5EC8A 1M1UA 1W2GA 4JVNA 1K7SN 3ZXSA 3OUZA 3OE5A 2FDCA 1DOAA 2LDXA 1IN8A 1JDSA 3IP3A 3IQDB 1DKMA 1V96A 3EBOA 4ESOA 2C4WA 4IFBA 1AU9A 4PFQA 1I2CA 2CMHA 2XZTA 1T2AA 4LG1A 5LZ7A 5IXSA 2E89A 3CS3A 4EJSA 4U9UA 2FV8A 2YYYA 3OM8A 3CNBA 3WMXA 4F38A 1RRPA 4OJNA 1PFGA 1AIPA 2ERCA 5GP1A 1FA9A 4Y9DA 3DSRA 5EZSA 1RPJA 5FPSA 3VSEA 5EUCA 4NDZA 3VAAA 4C6TB 2WK1A 4GRAA 5BMOA 1OD6A 1USWA 3LUJA 2IUSA 4H7HA 2P4SA 4X3PA 5B7QA 1XTZA 2RC5A 5I4CA 2CL0X 4KGDA 3WLQA 4ENQA 3JX9A 5B1YA 4DR7B 1E9SA 1QFXA 4DY6A 4TSFA 5JAHA 4CKBB 2GEDA 3NHWA 4DHWA 4MRSA 2EQ5A 1RCTE 3G6WA 1S9DA 3ACCA 3IR7A 1WPXA 1H4TA 3AZOA 5JPIA 1JQLB 1Q20A 3IQEA 2PTGA 3AF6A 1CUBA 1AUVA 1IB0A 4X9XA 3IPRA 1CJTC 3L1HA 3SK0A 5LUAA 5HF9A 4MIYA 4ZAWA 1SVSA 1XMXA 3MJSA 1VMKA 4EO4A 4LZOA 1DBWA 4RKWA 3IHWA 5IYZB 1FSFA 4TUYA 3TVDA 2DWQA 1U0GA 3E9YA 5COQA 4O4HF 3ZHSA 1XA0A 1ESEA 1F4LA 3NWEA 3ZJUA 3TFWA 1UXOA 3LC1O 3I4LA 2V7GA 4RPCA 2X1LA 1XVLA 1U7ZA 2HCTA 2Z2IA 2JRCA 2VBGA 4ZQEA 2B35A 2H8KA 1J07A 1QF7A 4Q19A 2YASA 4NE7A 4RENA 4DDWA 2XE4A 1ACLA 3SIXA 1P0QA 3H16A 4LQ4A 1Z0UA 4IIUA 1YJQA 2OG1A 1ZIOA 1MJNA 4B1FA 5J2UB 5IDQA 2WINI 3SE7A 3LFHA 5J47A 2R7LA 2XUFA 3N8IA 4P7FA 3PQ7A 4RANA 3ZS9A 3MJCA 1P18A 4KPFC 1T9GR 3HB7A 4TLAA 4JJKA 3BWXA 4X7BA 4P3PA 3AILA 5IAJA 2C1EA 3A7EA 1UM9A 1E6WA 4BIMA 1ZVQA 2IY7A 4A8HA 5ADUS 2WSSD 4ZALA 2VSYA 7REQB 1IN6A 2FE4A 2NZJA 5K01A 4UNNA 3ND9A 2WWGA 1HDEA 3JASA 3L04A 5ECWA 4EKYA 2XCTB 1AUXA 1L5KA 4JHLA 2VC2B 1FL9A 1KIFA 1J7KA 3KBBA 3QLVA 1KY5A 1W7AA 1PJ8A 3TD6A 5HKKD 2VYND 4NCIA 3AUUA 4NCKA 2VP4A 4AKSA 3QK7A 3NUQA 1YZKA 3UMYA 5LZ8A 4D4HA 4EL0A 1S01A 2PSEA 3GFBA 1J4AA 4EPVA 2FWIA 3LBIA 3KR0A 4L73A 3UVEA 4B48A 1QDEA 3AEXA 1M2EA 2WMDA 4G0NA 5HG0A 1GTG1 2J0UB 3EBLA 1NBHA 3H97A 5C7OO 4LFCB 2CNDA 3AWDA 1QKIA 5EI5A 3PDUA 3VBEA 521PA 1QR2A 2UVPB 3E5MA 5HFAA 4E30A 2IS2A 2W6OA 1Y8RB 1Z0JA 2GZHA 5AW3A 3RYIB 4DRXB 2PE5A 2OXEA 2ZJ4A 1B76A 1DBPA 3SKYA 4DOMA 1P2DA 3OM0A 3CF0A 4I9UA 4UEJA 3DMRA 3AUYA 3H2GA 4ZYWA 3PEYA 4LDPA 1T9KA 3KX2A 2UV8A 4XQ9A 5FWYA 4IYJA 1W0KA 2XUGA 4YIHA 4OTZA 1G6Q1 4PAOA 4LHYA 3VR6A 1JALA 3OP1A 4MI9A 1P3Y1 1G3MA 1RZRA 2JIZD 2EIHA 2F48A 4J1SA 1KQ3A 3FMFA 3HUFA 1GITA 1RC0A 4QU8A 3RRYA 4S04A 5ES4B 2ZRFA 2BI8A 3MLBA 3QU4A 3Q6NA 5B58C 4B35A 1X1SA 1UKCA 2OCIA 5EWJB 4EZEA 4YQZA 1ONPA 1P0CA 1O94C 5F2KA 4HMQA 2O52A 4CCSA 4INAA 3MEQA 4KU4A 3KTAB 3AYXB 5NULA 3CURA 1T8WA 1GNSA 4I4IA 2D2IA 4MYTA 1VHWA 4N49A 3AUJB 1WCIA 2F2TA 1WUKS 3UXYA 3U44A 4BVHA 2NSHA 1C3VA 2HOQA 5T4BA 2M1ZA 2AN4A 1JHPA 1BA2A 1Z4QA 2HQSA 1RAHA 3E7DA 3DEAA 3NDIA 1PZXA 4NH4A 3UOGA 4LVUA 5B1EA 2HCJB 4R2KA 1YE5A 1XT6A 5K8CA 4MUIA 1NRIA 3BFKA 3H5VA 3MOIA 3JQ8B 5CD1A 2FB9A 2JFNA 5CHYA 3O38A 1DRWA 2XUZA 4NS4A 2DJ5A 3I9FA 1VE9A 2W2KB 4X54A 4N5LA 3JR7A 4YLYA 2Q5CA 1G8AA 3C1TA 1ZCAA 3BL6A 3I2GA 1UJNA 3ETNA 3PHHA 3SGLA 1BSVA 4A8PA 3EJWA 2ZT7A 1A9TA 3VR2A 1EHCA 1QQAA 1U8CB 1UKVY 3EGCA 4BTLA 4PGAA 1Y5IA 4PC2A 3UHAA 1GUDA 2DSNA 2O8NA 3VPGA 4DV4B 3R5HA 1OLXA 3KSZO 1Z6TA 2BMWA 2VYFA 1LPOA 4KE6A 1DJPA 3REFA 4YO7A 4AUKA 1LI4A 3EOZA 4WXYB 2GZDA 2VXYA 5FPQA 3AR2A 5K8UA 1V5FA 4QQ8A 1G16A 2PD4A 4C4AA 3P2YA 4YMVA 1QLWA 4A1FA 2FEWB 1R74A 1JFSA 1FTNA 5ER9A 4ZU1X 3WP1B 3JD2A 2CXXA 4IDQA 4MR9A 3C8HA 4FXPA 221PA 1W2WB 2NNWB 3A6JA 1DPGA 4P38A 4D41A 4MV5A 4E1BA 4BX9A 5BSEA 4K26A 1RZVA 3RSLA 3WMRA 4ZO4A 3A1TA 5KYKA 5G0TA 5CA1B 1ZVJA 1TGVA 2RC6A 3COSA 4YECA 3DYVA 1A9QA 4M0DA 1N5IA 3GLUA 4XIFA 2M6LA 4DMFA 4LJKA 1KZ1A 4CQMA 1W4AA 2ZSHA 4CM4A 4DQUA 1ZHOA 2ZCJA 2ZIUB 3BTUA 2I33A 1QCDA 1YGPA 3QYAA 2WWXA 2B1IA 1AMOA 3A4MA 3TBHA 4GDFA 1WETA 3WO1A 5LYJB 5MDHA 3H11B 3K35A 3CCCA 3DL2A 4PQEA 4RIEA 2XQVA 3EUFA 1N7HA 4UCXA 4B76A 1TXGA 2FF7A 3F8SA 3SQOA 3HL4A 2RHLA 4NKRA 1P1JA 1HL3A 1XRNA 2ZBEA 4MDEA 3GCZA 5CDYA 5TV2A 5LLDA 3DMTC 4LPKA 2C4KA 3NHFA 1U90A 2ZJOA 1NR5A 4KXQA 1NJ5A 1UPUA 4AX8A 1COZA 2A94A 2W2VA 4EY3A 3LE8A 4O5AA 2KE5A 5M29A 5BWBA 2FPXA 4HGYA 4X85A 2XNDD 1JJFA 3JWHA 2CLCX 5CT8A 3MERA 4PLPA 4R7GA 2DLDA 4QBTA 2OZKA 1R6BX 1Y37A 4BVFA 1QG4A 4Y6OA 5HRUA 4DKJA 4F2PA 2BDTA 5DXAA 3NO4A 3WSTA 1B6GA 2RKBA 2YV5A 5HZKA 1URPA 1OROA 3PXAA 5D7NA 1YCGA 2YCLA 3PFGA 1JXQA 4KBGA 2VEOA 4LQCA 1BFDA 2D0OB 1Z4KA 1W5EA 3MMSA 4G6ZA 5F73A 3EZYA 4M87A 4UVEA 4CLEA 3KFLA 3O9MA 1MJGM 1FNNA 2NYAA 3ERCA 2E4YA 1Y7TA 4YRNA 1EQUA 3IV9A 1QRSA 4O4LF 1V5WA 3UA4A 1SQSA 1PJTA 1K75A 1Y3FE 2EJBA 1RWKA 2A8YA 1F0KA 1R1DA 5CH5A 1N8TA 3UQYS 4C88A 1S89A 5KYUA 1V26A 1ZIPA 4ZOLA 5T8KA 2N46A 2A30A 3IAFA 3TQQA 2IHJA 1ZXBA 1N4AA 5LXTA 1MEJA 3IELA 3MWGA 2VP5A 2P65A 3AXSA 3E1SA 5MGBA 4D97A 3BCHA 2RHJA 5KZMB 4B4DA 4RTJA 1EGAA 4R6XA 3ZDEA 5B4UA 1AVTA 1NMXA 3NRBA 1C7IA 4C9BA 4TRRA 5FPHA 2AYYA 2CDNA 2YNMD 1NX6A 1VLLA 1SHUX 2C3OA 3OO0A 2CFTA 3EMKA 3JQAB 4JDPA 3ZGZA 1KJWA 5IHXA 3H2ZA 1THZA 4GX2A 4AJNA 2BOVA 3SYRA 3DCYA 2PZ8A 4YROA 2G0TA 1S7GA 3BH7A 3CEHA 1PT7A 1FUIA 3IQIX 3U3XA 3D4BA 3ROEA 2BI4A 2JAOA 4LY6A 3V4ZA 2WHRA 5TXGA 3CY6A 2OFFA 3NT5A 3I2KA 2H17A 4QYIA 5FUMA 1FTGA 2IOYA 4KWCA 2WJJA 4R98A 3EVCA 3FZEA 3QKWA 4BECA 5TARA 4NYJR 1V1MB 4KVZA 1I0LA 1CY4A 5EXSA 1H8EA 1PX2A 1GPAA 1XCLA 3CW9A 4BRZA 1JAHA 4EA6A 3CRVA 1HT1E 2CVQA 2Z6UA 1KVQA 1FYXA 3EZNA 3GT4A 1FMCA 4DPMA 1V9LA 2O0LA 4IH4A 1FLDA 2H3EA 3DQPA 5EQJB 3L6CA 5L3ZA 5L8VA 3PGA1 5LBTA 2JLVA 3ZV6A 1YZLA 1ADYA 4P7BA 5I8ZA 5HQJA 3L93A 4NMMA 2YXLA 3UANA 4YPVA 4ZV7A 2GN1A 2Y2UA 2GXUA 4D6PA 3F3YA 3E2MA 1M1YA 3CEMA 5E95A 3BMCB 4OQEA 3HV2A 5LP6A 5H4HA 1PJQA 4GZLA 3QG5A 4M8KA 4OK6A 1BOFA 2J5XA 5B4VA 1U3DA 1FUEA 1OXKB 2FPGA 1W8DA 3HDVA 4QUGA 4TWRA 3VVCA 4FYPA 3DEFA 5BRJA 3E9RA 3E03A 4YAUA 3C3BA 4D4KA 4UPVA 4ALJA 3ZCUA 2DECA 4LC1A 4GXQA 5CJPA 1ZUIA 2P9QA 1Y5NA 5AI6A 2IL1A 3GRPA 5I7OA 4JYAB 1L1RA 1FQOA 3QX7A 3QXJA 3VPXA 3FN4A 1IHPA 1VJRA 5GWXA 4PSCA 1ZGAA 2C29D 5B1IA 4CG3A 4Y2VA 2AC4A 2P4HX 2ES4A 3UUGA 4OHPA 1H66A 3PUVA 1NYLA 1PJ4A 1XYGA 3UJ7A 3ILVA 3CCBA 4GYYA 2V0NA 2WKPA 1JMVA 1NHWA 2XT6A 3JQEA 2RGWA 1M6NA 3DGFC 4UU0A 1YQEA 1JV2B 2YUIA 3ITKA 3CC8A 4QRIA 4B6OA 3OWHA 3SFZA 1ZGGA 4F97A 1SOAA 3QVJA 3KJNA 2WVJA 3AR8A 4H3HB 3SIRA 4ZVPA 2QV0A 3V4VB 4AP9A 4QTUB 4S0ZA 1G2QA 1KIAA 4ISCA 1L3BA 4NPAA 3LPCA 4QRDA 4XXHA 3TF5A 1ECJA 2JKZA 1KWKA 1WDLA 4B2IA 4BAGA 2IA5A 3CB4A 3NHSA 3D0RA 1LSSA 3IUYA 3Q11A 4M37A 5A1JA 1LBQA 4JVOA 4GX0A 1QFMA 4N65A 3SKXA 3S2GA 4CDNA 2ZP1A 3NPMA 4F96A 3P9XA 4WCVA 2WAXA 3EDOA 4DTIA 4R1OA 5ER6A 2XE6A 1UXGA 1Z62A 4J1NA 2VWQA 4NATA 5ARDA 1RXYA 2UZ1B 4Q4CA 4EVQA 3H4MA 1UWKA 4M0PA 4RFLA 2QLMA 4I1RA 1EFRD 1ZVMA 3K9WA 1V6CA 1NVMB 2YVQA 1E6LA 3PL5A 4I1IA 5T64A 1NQ5A 3EAQA 5HSGA 2Z58A 2WA1A 1XNJA 2X23A 2D2VA 2GETA 3IDOA 2R79A 3EGIA 4HN9A 4IBOA 4XFJA 1JE1A 1I4LD 3H9GA 5J40A 2ODAA 1QU3A 4YONB 1FMJA 5JXJA 2HLDA 1F1BA 1T9BA 1E4VA 5DHQA 5FPPA 5KB3A 2DT8A 4D46A 3O93A 5ANRB 3ORFA 4Q05A 1ABEA 4AKGA 2ZI5A 1OT5A 2QVBA 3DDOA 4FGSA 3I1FA 4L28A 2XCIA 3CWCA 2RGXA 4ODIA 4Z5XA 2Q3EA 2O8EB 1YIDA 1MF7A 4MQ5A 2PVCA 3RRFA 4MW2A 4MPRA 3MRSA 5ENVA 1G5HA 4JBXA 3T1NA 3L4EA 4NECA 1JJVA 3ZZ0A 4N5MA 3VU9A 3B6MA 5AHRA 4V0KA 4F06A 1NULA 4HB3A 4TQGA 3GLGA 2NO0A 4UARA 3A36A 1Z33A 2CFRA 3C6BA 3QKIA 4JP8A 1EK6A 3MUNA 3Q8MA 4W5OA 4ZJYA 2QR3A 1WU7A 4Z3OA 4C1BA 1PT9A 3B3QA 3OH8A 4LZNA 4QOSA 1P7CA 3W7VA 4X6UA 1FF9A 4BKQA 3KQKA 2J09A 1HLGA 3WLSA 1H9CA 2R7NA 4ASUD 3L7CA 3PLRA 9GPBA 2BIFA 3PRHA 4R1MA 4D3SA 5AJHA 2G0AA 1BE6A 3FI0A 2B7CA 2G9QA 2J9FA 1CP2A 1PS9A 2JVIA 4FHGA