3DHNA

Crystal structure of the putative epimerase q89z24_bactn from bacteroides thetaiotaomicron. northeast structural genomics consortium target btr310.
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
222
structure length
216
Chain Sequence
b'KVKKIVLIGASGFVGSALLNEALNRGFEVTAVVRHPEKIKIENEHLKVKKADVSSLDEVCEVCKGADAVISAFNPIYDETIKVYLTIIDGVKKAGVNRFLMVGGAGSLFIAPGLRLMDSGEVPENILPGVKALGEFYLNFLMKEKEIDWVFFSPAADMRPGVRTGRYRLGKDDMIVDIVGNSHISVEDYAAAMIDELEHPKHHQERFTIGYLEHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent epimerase/dehydratase
molecule tags Isomerase, lyase
source organism Bacteroides thetaiotaomicron
publication title Crystal structure of the putative epimerase Q89Z24_BACTN from Bacteroides thetaiotaomicron.
rcsb
total genus 59
structure length 216
sequence length 222
ec nomenclature
pdb deposition date 2008-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13460 NAD_binding_10 NAD(P)H-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3dhnA00
2FSSA 2O7SA 4KUHA 1C0PA 3PYMA 4NBTA 2X7HA 5JCJA 3HADA 4BNZA 3WMWA 4BO6A 1VSUA 1SAYA 1UDAA 3IC5A 5JNLA 1Y7TA 1ZKMA 4O6VA 3UN1A 3AOEC 4CMCA 5B4VA 2VZ8A 5TT1A 1DOHA 1N7GA 1QLJA 4CLHA 4GSLA 3LT4A 3RFTA 4GX2A 1HYEA 2QZZA 5IN5A 3Q11A 1WDMA 1Z73A 3ASUA 3Q1LA 4MVJA 3DAGA 5A9TA 5A03A 4TQGA 4RDHA 3L6EA 4YT8A 2VYVD 2IODA 3BHIA 1S6YA 3DHNA 1XHLA 3SEFA 3DMTA 4CM4B 2NADA 2AW5A 3GN1A 3GY0A 5KVSA 2BLLA 1HDGO 4URFA 1TT7A 3HHPA 2XXBA 4DQVA 2X9GA 1R4NA 1LLCA 1ULSA 1LA2A 2V6FA 4RF3A 4UVEA 4Z3KA 1KVUA 4IJWA 5FF9A 3G1TA 4R16A 5DBIA 2VYND 3NEPX 1M2WA 2QYTA 1UDBA 1DBVO 4NFSA 4RJTA 4OMUA 4CUKA 1N1EA 1T4DA 1I36A 1RPNA 3MJEA 2EV9A 4EI2A 3HB4X 2I76A 1R37A 1F17A 1K5HA 1ZJZA 1QORA 1A5ZA 2RAFA 5B12A 2C2XA 4CQMD 2ZYDA 4RDIA 1Y6JA 4R9SA 3OETA 4ALKA 2WD7B 4NFHA 4UUOA 1QYDA 1F14A 1TVEA 4A73A 3DOCA 4R9RA 3KYDB 4WLOA 4E6PA 4BNJA 3NDIA 5HS6A 2HJSA 5DCYA 5EPOA 3A1NA 1SCUA 1GUFA 1FF9A 4CM9D 4PG7A 1EUDA 4NFYA 2EKPA 5T8KC 3S2FA 1ADGA 3GAFA 3CTMA 4TZTA 2NWQA 3ANLA 2GZ1A 4CM8A 4CV3A 1S7CA 4XYBA 1PJLA 3JQEA 3ZNOA 2WYVA 1B8VA 3ZGYA 4CQMB 2FSVA 4DL9A 4PLPA 3GEMA 5KIAA 1UZMA 1RM4A 2BH9A 2DM6A 4CM4A 4KDEA 4CMAA 4L74A 4IIUA 2CF5A 2FWMX 2POQX 1UR5A 2NTVA 1A7KA 4BO5A 4CLOB 4YTEA 1TT5B 3VZSA 1N1GA 2CFCA 5TGDA 3SXPA 4FQ8A 2DC1A 3OJ0A 1XA0A 2FY8A 2ZB8A 3EAGA 3ROMA 4TKLA 2VUSA 3A4VA 1KVRA 3HFSA 2HAEA 3DFZA 3LDHA 1IHYA 1E1LA 4OL9A 1KC1A 3DAFA 5ES3A 3RFXA 2OBYA 4WEOA 3P5SA 2FZWA 1UXJA 1E7SA 3P19A 3KETA 4TMFA 1DIBA 2GDZA 1YOVB 1A9YA 1VRWA 4IMRA 2AEMA 5BT9A 5CG1A 1NBOA 4BGEA 1NFQA 4XGKA 2IZ1A 4CQLB 3ENNA 3CMCO 2D4AA 2GN8A 2C2YA 2WE8A 1GQ2A 4NJMA 3FNEA 3O8QB 3EYWA 3PI7A 4RF2A 1ZJYA 4KTVE 4DLBA 4A27A 4J7UA 1XG5A 3DONA 3AFNA 2O4CA 4TRRA 1Q0LA 4HNHA 2FPIA 2VRBA 1X1TA 3EY4A 1XLTA 1H9AA 4P8RA 4YRAA 4Z9XA 3ZHZA 4E32A 3LVFO 5EQDA 1UAYA 1XQ1A 4E13A 2RHRA 1HDOA 2PWZA 1YQXA 4FOOA 4IDAA 1J6UA 3AOGA 4WUVA 2GYYA 3JQFA 1BSVA 2P91A 4UAGA 3RUHA 2CDCA 1JW9B 4Q3CA 2EP7A 1SZJG 1I2BA 4UUPA 3KV3O 5TRTA 2BI8A 1G6KA 1RKXA 4ZQHA 5JC1A 4BIIA 4CLRA 3P2OA 3JYLA 4FFNA 4XB1A 3JCZA 4D45A 3DBLA 1HDCA 1SOWA 1LQTA 2OHXA 2C0CA 3D3EA 1BMDA 3PVZA 2EP5A 1MFPA 4XWYA 2GN4A 5KKCA 5TJ9A 3D0OA 1NAHA 1ZNQO 2W2LD 4EUHA 4W82A 4PLGA 4CM9A 3UW3A 3KB6A 3FD8A 1U4SA 2YUTA 4XIYA 3UFXA 1HEUA 1H5QA 1LSOA 1R6DA 1G0OA 3B1JA 1BDBA 4XGNA 1GCUA 1BTOA 4IS3A 3JYOA 2DPGA 3DC2A 3FSRA 2VHVA 4NNJA 1H6DA 3PJEA 4Q9NA 1I3LA 3GG9A 1X15A 1CF2O 3G17A 2Y1FA 1W6UA 1X0VA 1NP3A 1JVSA 3GMDA 3JQCA 3V8BA 5ADHA 4HY3A 2PH3A 2VTEA 4OKIA 5DZSA 4WCFC 1EE2A 1B16A 5CEJA 4CLRB 1E7MA 3B20A 5T57A 4DREA 1H93A 3K30A 1UAGA 3NTOA 3FF4A 2CMDA 2Y67A 5IG2A 3TSCA 4J2OA 3GG2A 4IGFA 2VT2A 2YDXA 4CR6A 2I67A 3ABIA 3JQAA 4DWVA 1KS9A 4IBOA 2FR1A 2X0IA 2CY0A 3A06A 1EEHA 2XXJA 3K73O 1KETA 5C3MA 1X14A 1IE3A 3KSZO 2IYOA 3RUIA 3BMOB 2DUWA 1SNYA 1Y9EA 1Q0QA 4E3ZA 3Q9NA 3GVXA 4IJVA 2Y1CA 4J1SA 5L45A 3PHLA 4J1TA 1QXSA 4M54A 3TNLA 3NJ8A 5JYDA 2VNAA 2ZB7A 2XOXA 4KWHA 4CLOA 2B5VA 4E4YA 3ORFA 1DIAA 4HUJA 4J7CA 2HO5A 4NBVA 1JAXA 3KYCB 1SBYA 4ZHSA 2AG8A 2Q99A 3AUUA 3T4EA 2ZCVA 3S2IA 4WLEA 3W6ZA 2HMUA 2I6TA 4E31A 1N2SA 4W7IA 4LMRA 3ZNPA 3FHLA 4JK3A 3FNGA 5CDTA 2QQ5A 1LNQA 3NGLA 1MC4A 3GRPA 2X23A 5KKAA 4GWGA 3GNTA 2FP4A 2X0RA 1I5RA 4ALNA 3F4BA 5FFFA 4CV2A 5BNIA 1ULUA 1HL3A 2D3TA 2NQ8A 3HUDA 4J90A 3BZUA 2IRWA 4A0SA 1NFRA 2EKQA 3L77A 4M49A 3RUAA 1E7RA 1L7DA 3WOHA 5AXAA 2Q2VA 5G2OA 5JO0A 2E49A 3O9ZA 2WMDA 3H9EO 3UKOA 3ANNA 4CMIA 3QV1A 1MV8A 4BQRA 4YR9A 3LF1A 3VZPA 1ISJA 3H3JA 1HT0A 4KDFA 1I8TA 1NQAO 1YOVA 3QA9A 3OEYA 1RM5A 4NR0A 3JQ8B 4O59O 3ZCXA 1O0SA 4TZKA 1OMOA 3QLJA 3KLMX 4JXKA 4YRDA 3RKUA 1ISGA 1LC3A 5CDSA 1P9LA 3OP4A 3N58A 2WYUA 1UZNA 4TWRA 3GAZA 1U5AA 3G49A 4Q3NA 4CM7A 3EGOA 1H6BA 3LQFA 4W99A 5KTKA 1LSJA 1AXGA 1PTJA 3E9NA 1U2DA 3D7LA 5JAZA 2J5RA 4J6FA 1IZ0A 3S2GA 4BVAA 2QIOA 3WG9A 3WGOA 3GH3A 3RBZA 2UAGA 3GDFA 4BNKA 5K9ZA 3LT0A 4D43A 4MVJM 1I2ZA 4NPCA 4S1VA 3RI3A 1YJ8A 2GD1O 3I3OA 1VKOA 1ENPA 2WDZA 3IIEA 3UICA 3WBBA 4II2A 4DIOA 4RPHA 3NT2A 1ZK0A 3PIIA 2X0JA 4AJKA 2PH5A 2PGJA 4B7CA 1Z6ZA 2Y1EA 1IOLA 2B5WA 3S1LA 1E3SA 5ENDA 5CDUA 1G1AA 5L4LA 3PLNA 4CLDA 1P3DA 4YJDA 5I9NA 1J4AA 4GMGA 1NM5A 3PLRA 4OHUA 3BIOA 4QXMA 3TL2A 1U9JA 4R69A 2VRCD 4YAKA 2DVMA 4Y67A 4II3A 1I01A 2FMUA 5TS3A 3L4BA 1GEGA 5KVQA 2YHIB 3CZMA 1HDZA 4N5LA 1KY5A 2DUUA 1B7GO 1CERA 1GZ3A 2FR8A 4QQRA 1PGNA 1HE2A 4FC6A 1YDEA 4YEDA 3OEWA 1EZ4A 1H0KA 1VI2A 1Y5RA 1P1IA 2B35A 3H9QA 4EZBA 4GH5A 1KYQA 1F8FA 1B26A 1I10A 1WPQA 3WNVA 4FD3A 1HRDA 4TRJA 5CPFA 1NYTA 1QYVA 4RF5A 2YV2A 4CJXA 3EHEA 5DCWA 3VH3A 1YKFA 3PRJA 4N7RA 1U28A 1E7YA 1U8XX 2UV8A 4IUYA 1C1XB 4WE3A 3G3EA 5IJZA 5EINA 2G1UA 3AI3A 3OA0A 3ZNNA 1T2FA 2IZ0A 1BDMA 3DZFA 4NU6A 3BAZA 3W6UA 2WWRA 1LU9A 3DR3A 1JA9A 2JFFA 1KERA 4LRTB 1SOVA 3DAPA 4YXFA 5CDGA 2O3TA 4MP6A 4UEOA 3INRA 3C3XA 1QYWA 4J1NA 1Y1PA 1O9BA 3CZRA 4GVXA 4I5EA 3ENKA 1NQ5A 2D5CA 3ROPA 1GU7A 4GX0A 4QEDA 5I7EA 2BD0A 3ZWPA 1ZXBA 1I3KA 3SJ7A 3U4IA 1E6EA 3DEYX 5A04A 1OAAA 4EYEA 3DMYA 1LDEA 3GPDG 2DLDA 1KEPA 2F1KA 3NDRA 1PQPA 3VVCA 2I3GA 3ZDFA 1P45A 1EMDA 5F5NA 3EVNA 2ZTMA 3LLVA 4FJ0A 4CMEC 2HRBA 3RCBA 3ZU4A 3GGOA 4EITA 1D7OA 1ADFA 1OC4A 1Z82A 3IUSA 4CL8A 1FJHA 3QE3A 1VM6A 1ZSVA 3H5AA 3CKYA 1K6IA 1MC5A 1C3VA 4INAA 3V2HA 1TXGA 1M6HA 3GEDA 2C20A 3Q0EA 1ISIA 3KEOA 5DNAA 4BNFA 4AG3A 1V3TA 1MXFA 5A9SB 2VYNA 4PLZA 3FR7A 3G0OA 4B3IA 2GZ2A 3DBHA 1V9LA 4L9RA 5B37A 3E03A 4NBUA 5DDIP 3DO5A 4BKOA 4B4OA 1OFGA 2C82A 2UUPA 2G17A 3E5RA 1NWHA 5JY1A 1QR6A 4IPTA 2FPPA 4IJUA 1U2GA 4CM1A 4L4RA 5F3RA 4LVUA 3AI1A 2HSDA 5BSFA 3F9IA 2OGUA 1U3VA 5COQA 3Q3CA 1OOEA 4I08A 4JGBA 4DC0A 1MG5A 4DPMA 4UEKA 1HLDA 1SB8A 3GDGA 1F0YA 4M86A 1GAEO 4IDBA 4ND5A 1ZK4A 1E3JA 1AN9A 1U3UA 5DBGA 3RFVA 5A5FA 2Q1TA 3RC7A 3IKTA 1E3WB 4BKUA 1A4IA 2C59A 2CZCA 2HRZA 3ASVA 3PPIA 3PFFA 4G2NA 3PGXA 4IZHA 1W0CA 3DTTA 5FWNA 1FK8A 1ZW1A 4J3FA 2YV3A 4BNNA 3K92A 5BSHA 4RVDA 1ZK2A 1PJ4A 1Y8RA 4FB5A 4MP3A 3QWBA 3MWEB 4EEZA 3C24A 3DHYA 1PGPA 1UDCA 4NH4A 3C1AA 4J91A 2EHDA 4ZQEA 3DZHA 3AM4A 1LRJA 4R51A 4ZD6A 4R1TA 4EJ0A 4D7AA 3NDJA 4YYZA 5C7IO 3EVTA 3ANMA 2GN6A 1LBEA 2GNAA 3WJ7A 1IPEA 1NPYA 1R15A 4GKVA 4WLFA 4Z3DA 4WCFB 2HU2A 5ITWA 3PQEA 3ZW9A 4EJMA 1ENYA 3NV9A 3CE6A 4BO0A 5H83A 3JQ7A 4NBRA 1I3MA 5IXYA 1MUUA 5ER6A 2GO1A 3JQ6A 2CD9A 2Y0DA 4FJ1A 3T4XA 4PZEA 4OXKA 3DOOA 1RJWA 2WEKA 4XR4A 1NXQA 4HKTA 5JDIC 3OIDA 3VKVA 2RH8A 4KZPA 1QG6A 4XRRA 3CUKA 3OFSA 4DBVO 5IZCA 4E5MA 1Z74A 5EMHA 3RASA 3TDKA 3O4RA 1QYCA 5F1OA 2J3JA 3FWZA 4TVOA 3I9KA 3DBRA 3GEGA 2Q1SA 3NAQA 4M1QA 3OHSX 3TRIA 3IKVA 4WCFA 3DXFA 3WQSB 1ISMA 1PZEA 1C1XA 5JDCC 1G0NA 5L95A 4J7XA 3L9XA 2V6GA 3M6IA 3ZV3A 1Z45A 3VZQA 1JU9A 5U1PA 3D3WB 3ICCA 4TRMA 4NMHA 4J16A 1UZLA 3PWSA 2YDYA 2P5YA 3QW2A 4B3HA 3GQVA 3I9MA 3R0IA 2OMEA 5JMPA 1T2EA 5IZCC 2WYWA 2D5AA 2EW8A 4DVJA 1B8PA 1ADBA 1LDBA 2VQ3A 4BMVA 5JDIA 3RIHA 3MJSA 4OQYA 4WOJA 4FJ2A 4QX6A 1X7HA 4RF4A 5AQ1A 1B3RA 2VN8A 4YACA 1V3VA 2Z1NA 4O63O 5EL0A 2QG4A 1PSDA 4J2HA 1OBFO 3VDQA 2HK7A 3X2FA 2E37A 2VZ9A 4RPLA 3VPHA 3QWFA 4CMJA 4EGFA 4J43A 4ESOA 2XF8A 3SX2A 3WFIA 3GNQA 3MWDB 5CHEA 3IDSA 5A3JA 3PTZA 1PGQA 4GBJA 4BOYA 3K8ZA 5LCXA 5JAQA 2PD3A 2Z5LA 3GVHA 2GZ3A 4IIVA 2EWMA 3PJGA 3RUCA 1P1KA 3RUFA 2RBEA 2VYVA 4N5NA 2IZZA 1P0CA 1E5QA 3PYXA 4E30A 3TWOA 1YL7A 3IP3A 4CUJA 3PXXA 3ZV5A 4GVLA 4IINA 4I8XA 1B15A 3TFQA 1ZSYA 2ZTVA 1M67A 4OKNA 3AY6A 1FXSA 3BTOA 1O6ZA 3QWAA 3I5MA 1PWXA 2ZJ0A 5L40A 4HFMA 2C07A 3FBTA 5ILOA 2O4UX 4OSPA 2NQTA 3WTCA 5TT0A 3FPLA 2EGGA 1GADO 3ONFA 4YAJA 5JCXA 4A26A 4E5KA 2EERA 4CMKA 4FSHA 4DA9A 5HRUA 5KNLA 2AQ8A 4AJJA 1P1FA 3MTJA 5CEEA 5KJ1A 1PJTA 3I23A 1HDYA 2PGDA 1T2DA 2DPHA 5EIOA 2DFDA 2V6MA 3NT5A 3KUXA 1UXIA 2GPTA 4DTIA 5BNFA 3LSYA 3GZNB 3TZKA 1XWFA 3K6JA 3UVEA 1U3WA 5HWSA 1YGYA 3TN7A 3GT0A 4QECA 2B4QA 3V1UA 1E3WA 1LC0A 1JVBA 4M87A 3FBGA 4AJIA 1EVYA 1VL6A 3HE3A 3ONEA 2PTGA 3K31A 3OIGA 1PEDA 4Q39A 2E4AA 5JMWA 1K6XA 2NV6A 1VSVA 3RQSA 2SCUA 4PZDA 4KQWA 3OA2A 4PLFA 3JQGA 2O3JA 4BQPA 2VHZA 4BHTA 1V35A 1PL6A 2B36A 2QW8A 1RYDA 4IZIA 3RU7A 2CVZA 4Y6PA 1MA0A 1P74A 5TC4A 4J9UE 5J23A 1DIGA 1E5LA 4YA6A 4K6FA 3P2YA 5FYDA 1WLYA 4B4WA 5KOIA 3GDOA 4IDDA 1K2WA 1UXKA 2PK3A 4WASA 1OZAA 3AUTA 1GUYA 4JJIA 2D1YA 4N54A 2X1HA 3RJ9A 1VPDA 5KJ6A 1DC6A 4UUNA 4I5GA 1PJCA 4LRSB 4BO7A 1NQTA 3KBOA 4NBWA 1JDJA 4O5OA 3WMXA 3BTSA 1TA4A 4U5QA 1GV0A 4Y9DA 2RHCA 1C0IA 2UYYA 3FNFA 2JHGA 4BNWA 3TZ6A 1EUCA 1KEVA 3MOIA 4WLVA 4IQ8A 1CJCA 2O3QA 2P68A 2W4QA 4G81A 4D3DA 1LUAA 4BNMA 1D1TA 4KWIA 3BMCA 1YBMA 4EUFA 4ND3A 1QV6A 4ZRNA 2QRKA 4MVJF 2X9VA 2ZCUA 5IFLA 3KVOA 4BKRA 1DIHA 1NHWA 1AGNA 1DJNA 2HJRA 2YV1A 2JKVA 3L4BC 3F5SA 2GSDA 3SBOA 3RU9A 4B3JA 4AL4A 4OXYA 2C29D 4JLWA 4RGBA 4IDFA 5I9MA 1YB4A 2O48X 5EESA 2AA3A 4PLCA 2PKQP 4GL4A 4NIMA 4YJHB 3AOEA 4BGIA 9LDBA 1HSOA 2DT5A 3E6AA 4JN6B 4HFRA 3WFJA 4MDHA 1P44A 1YO6A 4E12A 4ZJUA 5GZ1A 2I66A 3G1UA 1WZEA 4FCCA 1DPGA 3BHMA 4PGFA 2ZIZA 2G0TA 3VZRA 4U7WA 5DOVA 5FEUA 4ALMA 3K9QO 4BMSA 5THKA 1BHSA 4LMPA 2HMSA 4RO0A 5L7TA 3DMTC 4ILKA 5F1KA 4BNTA 3IOYA 3HG7A 5HS4A 3WNQA 3Q2KA 3JTMA 4YAGA 2PR2A 4UVGA 3V2GA 1GYPA 2GCGA 5KCZA 1PJ2A 2W2LA 3ZWAA 4DMLA 4BO3A 2ZK7A 5C37A 2PY6A 4K28A 1EVZA 4RVUA 5GMOA 4L76A 1ZK3A 4BO8A 3H65A 2I9PA 4HBGA 2AE2A 3WYCA 3P7MA 3VHRA 4E33A 1IUKA 4FS3A 2H9IA 3GGGA 4J0FA 3E5MA 4FPXA 1E1KA 2Q3EA 1MB4A 4UULA 4DIFA 2GGSA 2P2SA 3EC7A 3ZWOA 1CQJA 1FDUA 2JAPA 2I3AA 4BKQA 3MJTA 1UXGA 4JBGA 4BGUA 4D44A 2WD7A 2QYSA 4JJGA 1SPXA 4NK5A 2YFHA 3VPFA 5C5IA 3PZRA 1Y5MA 3BMQA 2W2KB 4OXNA 4RVGA 2CF6A 2EJVA 3H2SA 1PZHA 3PQDA 2NU6A 3UCEA 4E21A 2FHSA 4P22A 4J4HA 1WXDA 2AG5A 3FN4A 1UXHA 4UUMA 3INTA 3I1JA 3CSDA 1YWGO 2J8ZA 4XRGA 2A35A 2JAHA 3VAZA 2PKRA 5A06A 2DBQA 3ZWNA 3L6OO 4Z0PA 1IZ9A 3RBVA 1O5IA 1YDWA 2BRUA 2RCYA 4R1UA 4B8WA 1TEHA 1O95A 4HP8A 4LISA 1JN0A 4HXYA 1LDMA 1F8GA 4IGEA 1XU9A 1DLJA 2X58A 3PHIA 3JYQA 5CAEA 4AJEA 4B7XA 2IXBA 1P1RA 3DWFA 1IULA 4YJFA 1DDOA 2P4QA 4Y6RA 1YVEI 1ZVMA 1PL7A 2UUOA 1NVGA 2FR0A 1U8FO 2D0IA 4WKGA 5F1PA 1U3TA 2BELA 4Q3AA 3I83A 5DP1A 3GF4A 3H8VA 1KY4A 3ON5A 4MIEA 3WBFA 3OQBA 4QO8A 4XZ3A 5THQA 2VWHA 2X22A 2PZMA 5T5QA 4RCVA 5K0ZA 4PRKA 4WOKA 1Z7BA 1YB1A 1T4BA 4ZVVA 5TIIA 3DOJA 3U5TA 1DHRA 3IS3A 1E3EA 1AUPA 4MKRA 2XAAA 2ZJ1A 5G0UA 5AYVA 4CLXA 3PJDA 4CMIB 2Z95A 3ZI0A 1YRLA 1HZJA 1MX3A 4E2YA 4F6LA 4R1SA 3UH1A 1M75A 3VPGA 4GLOA 1DC5A 3EW7A 3WGIA 3KZVA 1DRUA 1W73A 4YVFA 3PJFA 5AXDA 3ZU3A 5JAIA 1ZK1A 4IY1A 4MPDA 1YQDA 4YBZA 1YQGA 3AM3A 2OXIA 4FGWA 2YQ4A 4ZU3A 2BFOA 4FIZA 3RWBA 2VCYA 3F6YA 2B83A 3DQPA 2PKQO 4GX5A 1EFLA 3HB5X 1LRLA 2DTEA 3C7CB 5G4KB 4UREA 3TL3A 4DIBA 2W8ZA 4L8VA 4A2CA 2VHWA 4BMNA 4D79A 4IQ0A 4NG5A 4AICA 5TNXA 1H2BA 2J5QA 3ETDA 6ADHA 4W9NC 4WK6A 1IY8A 2R2GA 3HDJA 1MP0A 2R6JA 3PHHA 2VTDA 3QVOA 3DZBA 2J3KA 4RZHA 1X7GA 2C54A 4BB5A 3TQHA 4OH1A 4BNIA 1VJ1A 2HKIA 2QZ9A 3ULKA 1Q7GA 5L4NA 2JJYA 3ZV4A 4BNGA 1Y81A 4X54A 1PX0A 3X2EA 4Z0HO 1X1EA 3WYEA 1JWAB 4P4GA 1B3BA 1E92A 5IXSA 3L9WA 2G76A 4FDAA 3OJOA 2Q1WA 4PLYA 4FBGA 5L7WA 5C7LO 3HNPA 5TSDA 3QVTA 2A92A 3CINA 4CMBA 4IJKA 4HV4A 3C8MA 3HDQA 5T64A 5DP2A 4XDZA 2HDHA 1NNUA 2H63A 4RPKA 3VOSA 3NGXA 1O94A 4WNCA 8LDHA 1BWSA 3KYBA 2NTNA 1V8BA 1EDOA 2X6TA 4IDGA 4D0SA 2HMVA 1NASA 1H9BA 4MVJH 4YQYA 2B0JA 5KJEA 5G0TA 2GF2A 5IZ4A 1GYRA 4XQCA 1HE3A 3M1AA 1J49A 1GYQA 3KYCA 4L73A 4CM6A 1ZUD1 2PZLA 4KP7A 4CL3A 3PGJA 1SEPA 3WQRA 2VWPA 2X9NA 1W8DA 3HDYA 4RZIA 1D1SA 3MEQA 4KUGA 1HKUA 5HTOA 4L0QA 5G4KA 1LDYA 4C4OA 2ZQYA 4Q3DA 3TZQA 1PIWA 3F3SA 3WICA 2Q45A 3DZKA 4AJOA 3PHGA 1DJQA 3LK7A 2A4KA 3ZN2A 3MOGA 2CDBA 1PZGA 3I52A 2IE0A 5IDYA 3NYWA 3U62A 1VL0A 1LSUA 4ALJA 5CEFA 1I32A 1V6AA 1RWBA 3GUYA 4YDRA 5AXCA 2PLAA 1LRKA 3WGHA 1C0KA 4J0EA 2GERA 3O26A 1CDOA 1BXGB 3IJPA 3I6IA 3WSVA 1PS0A 2HMWA 3WB9A 1SMKA 3IQDB 5H82A 4EDFA 5EQFA 3I4CA 3ROQA 1LXCA 4AVYA 2EEZA 1GD1O 1B8UA 2C5EA 4Z9YA 1P31A 2QRJA 2F00A 4ND4A 4ZQBA 5KVCA 2GUGA 3OQ1A 3FTNA 5JDCA 3BMQB 3Q9UA 2JFGA 4D46A 4ZQGA 2P5UA 2Q4EA 3KYDA 4PG5A 3MJVA 2P9EA 4U0KA 4YJGB 4R4JA 3SC6A 1PL8A 3GC6A 4HNGA 3I9JA 5C7OO 4P38A 2VUTA 1EK5A 4FC7A 2JCYA 4LCJA 4XR9A 3DFUA 1UP6A 4CR8A 1YONA 3GFGA 2HLPA 2D59A 4L4SA 2BGKA 2JCVA 2VNSA 2NTJA 4CV1A 1ISHA 3STHA 3ZWCA 2C7GA 3FI9A 1ZBQA 3SLGA 1IHXA 4RLSA 4E0BA 1XYGA 2R00C 2QX7A 1DEHA 2R00A 4W4TA 3RBXA 1QLHA 4AJLA 5MDHA 4Q3BA 1DXYA 1ARZA 1SC6A 3BTVA 3GVIA 4B4UA 1FDWA 4QFDA 2GASA 4J4TA 4O1MA 5I7SA 4ALIA 4GLLA 2B69A 3L07A 1N9GB 1RM0A 1JKJA 3I9NA 2ZB4A 1ZEMA 5LC1A 1R4MA 4D3SA 1SB9A 4PG8A 1Z75A 2JD2A 4KMSA 3H9JA 4LSMA 5L53A 4XKJA 4AJHA 4KTTE 3GFBA 4I5DA 4DBZA 1C14A 1PGJA 4ZGWA 4J9VA 4N18A 1V0JA 4BO4A 4L4XA 4RQTA 1MFZA 4DGSA 3UGKA 1HSZA 4BNXA 5G0VA 1JWBB 2Y66A 4B79A 4EBFA 5U9CA 3BMOA 1D3AA 1GZ6A 3MJ4A 4R54A 3L0DA 3GLQA 2NU8A 4RLHA 4M89A 1KVSA 2OP1A 2OP0A 1ADCA 1I0ZA 3U0BA 1PWZA 3AY7A 2NVBA 3INGA 3PYLA 1K89A 4OJNA 4R5HA 3UXYA 4Z6KA 1BG6A 2HMTA 4CM5A 2NVWA 2WSBA 5COBA 3U9LA 4MIYA 3LLSA 4RPGA 4WGGA 3NX4A 2JCXA 1NTOA 3UCXA 3GZ4A 4JROA 1R66A 1WP4A 4W9NA 4YCAA 3PWZA 1YXMA 3WX0A 2HUNA 5CP8A 3WQQA 2PZJA 2QHXA 1R0KA 3M2TA 3QP9A 5T6BA 3WDSA 2NUAA 3AJRA 3VH4A 3AWDA 2GRAA 1BVRA 3DDNA 2IYPA 5JFOA 3W4IA 3ICPA 1LTHR 3QIVA 3FRJA 5I7VA 4BB6A 1VKNA 3ADOA 3K5PA 1GPDG 3D4NA 1HYGA 2YZ7A 1C1DA 3O8QA 4WCDA 4YJFB 4ND2A 3RSHA 2YYYA 2UVDA 3EDMA 1DC4A 4OM8A 3WGYA 1AHIA 2BKAA 3T7CA 1PGOA 5MGBA 4CLEA 1NAIA 3HSKA 4K9DA 3IJRA 3ZH2A 1EVJA 1M66A 2HQ1A 4QUKA 1U7TA 1LLUA 4OOFA 4AJNA 2QRLA 5B1YA 1EBUA 5IDWA 2ZB3A 4NI5A 3JQDA 5F5LA 5L3ZA 2ZTLA 4GWKA 3KEQA 1K6JA 4R3NA 1D4FA 4XYLA 3F46A 5JC8A 3MZ0A 2OBNA 3G79A 4CPDA 5CDYA 4DQUA 2V65A 3TFOA 3L6DA 4MOWA 1U5CA 3C85A 3JYPA 2NSDA 2CUKA 7ADHA 1I24A 1PU2A 4UEJA 1JQBA 3HWRA 1A71A 4IXTA 1XQ6A 1ENOA 3W4KA 3UHAA 2VWQA 3GRKA 3MJCA 4ZN6A 3ZWMA 1WW8A 3ZZNA 4R1NA 3PFWO 5TF4A 5COAA 4YJHA 3U4DA 5IN4A 4TRNA 1HXHA 1TLTA 4GQAA 4I9UA 4CQMA 4RV9A 4D42A 3LC7O 4JBHA 4HADA 1N5DA 2CVQA 3F4LA 2O3RA 3C1TA 1EVIA 2Y05A 1OC2A 2FOIA 3K2EA 4OAQA 1R16A 3VPXA 4AJ1A 1HE5A 4MP8A 4FR5A 4XYMA 3BTUA 4E2WA 5JO9A 5JCJD 3CPSA 1L1FA 1TI7A 4WJZA 2Y99A 2DU8A 4AJ2A 1CEQA 1T1SA 2DTDA 1ZCJA 3U4CA 1XKQA 3E1KA 4IDCA 3RKRA 4CMGA 1RM3A 2NU9A 5EN4A 1NWCA 4FFMA 3JQBA 3A14A 4WNIA 3E8XA 4RORA 1YB5A 3MCVA 3AFMA 1BXKA 1GUZA 3RVDA 4QSMA 3UF0A 4E5NA 2W98A 4XIJA 1ID1A 2HK9A 4XCVA 4A10A 4CR7A 2DBRA 4XA8A 4BL5A 4E5PA 1DRVA 5IDQA 2CSUA 4BNUA 2I99A 4TROA 1ZH8A 2FPGA 1MXHA 3JQ9C 3NT4A 1D8AA 3CIFA 4QO7A 3PQFA 4E2ZA 4LSWA 2H6EA 3OICA 5GZ6A 3RUDA 2XPCA 1R4NB 5AXBA 2WTBA 5HBRA 3TOZA 1A72A 4U6SA 4I9HA 4PCVA 5LDGA 3R3SA 1YE3A 1FMCA 3FNHA 4GMFA 4BNYA 1CYDA 4TVBA 5FI3A 4GKBA 5BQFA 3GPIA 3DB2A 2AQKA 3RUEA 4Z9FA 4O0LA 3R1IA 4P4LA 2BHLA 2E48A 2PNFA 4CUZA 2JHFA 3BMCB 3ONDA 3DZIA 4OOEA 4WEQA 2A9FA 1N7HA 4IDEA 4XEHA 3WGQA 3JD1A 5G0WA 2EXXA 1LDNA 2ZQZA 3F1KA 3WTBA 2BI7A 1Y8QA 2X86A 4AJ4A 1T2AA 2EGHA 4RL6A 3COSA 1PJQA 5BSEA 4YQZA 4NU5A 4H3VA 1VL8A 4DUPA 1E0DA 1N92A 2VOJA 1XU7A 2X5OA 3ZWYA 1IL0A 2G82A 1JKFA 4LCEA 4BNHA 1KC3A 4CV0A 5A4DA 2O2SA 4FFPA 2PFGA 1FDTA 1LI4A 3OF2A 3GK3A 1DSSG 4BS9A 1HZZA 1UH5A 4LN1A 5CG2A 4K26A 1FDSA 3WYBA 2VRCA 1LEHA 4MKXA 5DCUA 3SVTA 2AEFA 3D4PA 1SEVA 4H16A 3PDJA 1BW9B 3A9WA 2OZPA 1LQUA 4QTZA 4KQXA 1W4ZA 5DN9A 4YT2A 1H94A 4WLUA 3S55A 3SC4A 5A1TA 2PV7A 3C7AA 5GY7A 2OOSA 4S3MA 4DC1A 2BF7A 2O3SA 4JQCA 1DAPA 3DZGA 4JCOA 5DOZA 1QKIA 3KTDA 2Y1DA 2OO5A 4OSOA 5JW6A 3CH6A 1TT5A 3OJEA 5U4QA 4PFJA 1ZMOA 1NX6A 3H5RA 2W2KA 3O03A 5G0SA 1ISFA 2Y1GA 5HA5A 3ETEA 3UOGA 3GVPA 2AMFA 1VC2A 2E82A 2PA3A 1NPDA 1QRRA 3U3XA 1AXEA 3BA1A 3ZHYA 1NQOA 3GZNA 4ZRMA 1P1JA 3PDUA 3T7EA 5A5EA 4ALLA 4NJOA 3NTRA 2ZKLA 3HN7A 1BVUA 4IM7A 2DBZA 3JQ9A 3AU9A 5ICSA 2Q1UA 5BSGA 2NACA 5ICMA 1UUFA 1EUZA 3OJLA 1CQIA 3CEAA 4MVJD 4PN3A 1MG0A 2JD0A 5ER9A 5TLSA 4M55A 4PVCA 3QJ5A 3LT1A 3I9LA 4G65A 3KSUA 5CFZA 2YY7A 4U6QA 5IDXA 1R12A 2C5AA 2WJPA 3AI2A 3ST7A 3OQ6A 1OI7A 4JP3A 1CIVA 1BRMA 4YJGA 1X13A 1E1MA 5JE8A 4NDNE 1AHHA 3ZNQA 2ILTA 5H81A 2DQ4A 1P77A 5L4SA 2DAPA 3D64A 1ZO8A 1GQQA 2Q50A 1AE1A 2EJWA 1WZIA 2TMGA 4XYEA 3ROKA 2OL4A 2Y93A 3HFGA 3FWNA 3OSUA 1BXGA 3AK4A 1BXZA 3B70A 1ONNA 2VZ0A 4F45A 1LDGA 4DQXA 2Y68A 1IYZA 2Y1OA 1I33A 3HQ4O 2X0NA 4MVJP 1L7EA 2J3HA 3QVSA 4UVDA 5K6AC 1A7AA 1FDVA 2P4HX 4JBIA 1LSSA 3ITDA 3EMKA 5BNTA 2YFQA 3QVXA 3WWZA 1JLLA 2ZATA 3IMFA 3E18A 2WM3A 3JQBC 4J4BA 3RROA 1GV1A 1UP4A 1ML3A 1A4UA 3V5NA 1NHGA 3GHHA 3QRWA 1KBZA 4ZICA 4LK3A 2NVUB 3W8DA 5B4TA 4WPGA 2Q2WA 1EE9A 2PZKA 3R3JA 1O89A 4MINA 3ZWWA 2JL1A 4ROSA 2Q46A 2ZYGA 3NTQA 1RYEA 4XGIA 3TZHA 5DBFA 3JQFC 3WGTA 3WLEA 4R3WA 1EDZA 3GUCA 3IL2A 2X4GA 2AEJA 1V3UA 3PWKA 2VWGA 3BMNB 3RC9A 4MKZA 3UUWA 3K2BA 4XDYA 1SO8A 2ET6A 3KOUA 4G5HA 5ITVA 3LU1A 4BO9A 3GVCA 5TJHA 5JAMA 1NR1A 1HDXA 4E5YA 3DBVO 1DRWA 1KOLA 4ID9A 5CPBA 3V2UA 3M2PA 4MO2A 3HDHA 3DBRB 3F5QA 3GR6A 3WGGA 2GLXA 5AOVA 4DMMA 1GQYA 4FFRA 3GGPA 4PVDA 1ZZEA 1UP7A 2CDAA 2EIHA 2GN9A 4GGOA 1NVTA 3L4SO 3KLPX 2RH4A 4BV9A 1GEEA 2NVUA 3K96A 1HF3A 3U4HA 4BKPA 4OO3A 5IAAA 3VDRA 3OBBA 1YJQA 3UCFA 1KIFA 2CNBA 2ZYAA 3OMLA 3D1LA 1DAOA 9LDTA 3LC1O 1U4OA 4H7PA 3TOXA 3AU8A 1TB4A 3A28A 3AUSA 1M6WA 3IAHA 1LLQA 2NM0A 3ADPA 2NLOA 3WIDA 1QP8A 1LX6A 1WDLA 4H15A 3JQ7B 4U0JA 4XJTA 4A03A 3QY9A 4U8GA 5KJCA 3H3FA 4NHEA 4YB8A 5JBIA 1YS4A 4NQZA 4OQZA 1YBVA 1QSGA 1KVTA 4XQ9A 3M1LA 5L51A 3CMMA 5JY6A 3V1YA 1XIVA 4JP2A 1I2CA 1QV7A 5TX7A 3BXXA 3FR8A 3BMNA 1Y8RB 2AQIA 4K6CA 3GA0A 3KO8A 3JYNA 1HLPA 3JD3A 4EUEA 3FPCA 3KM0A 1QMGA 2AE1A 2BFMA 3JV7A 4ND1A 4D41A 1T1RA 4PIVA 1J0XO 3H9GA 3U09A 3H6KA 3RAJA 1DB3A 3AM5A 4N5MA 5EERA 3QQPA 2VUUA 4AJPA 4DPLA 4EJ6A 3H7AA 4CMEA 4DLAA 4PLWA 4XD2A 4F46A 2AQHA 5KJFA 3GNSA 1VJ0A 5L7YA 4WECA 1C0LA 1ORRA 3PZBA 4B7UA 2C7VA 4DYDA 4YRBA 2BGMA 3D5TA 4DLLA 1GCOA 1E77A 1Q0HA 1Y9AA 3WSWA 1P0FA 2G5CA 3KSDO 3RJ5A 3JQGB 2B37A 1PS9A 2LDBA 2WE7A 3WR5A 4Q3EA 3B1KA 1DFIA 1YL6A 4NZ9A 5GZ3A 4PLHA 4R68A 3F47A 1WNTA 3C7DB 1E6UA 4L75A 3VTFA 1MGOA 1VE9A 1ZIDA 3DBHB 3JD0A 4R41A 3QWHA 1H2HA 1WWKA 3I4FA 1E3IA 5DF1A 3VVBA 3VKUA 4EW6A 1C1DB 3QSGA 1H6CA 4I9NA 1P33A 1YH3A 4YAEA 2DTXA 5BR7A 1I30A 3UAGA 1A27A 1P1HA 4FFLA 1B0AA 1U1IA 4J49A 1F12A 1PJ3A 6LDHA 3JSAA 3N7UA 5AVOA 4ZA2A 2FRDA 4UVIA 4M8SA 1H6AA 4FGSA 4FW8A 1XSEA 2OFPA 2J5KA 1PQWA 3SLKA 3V1TC 1CETA 5TQVA 3LYLA 4IQGA 1WMAA 5K6AA 2PGLA 4BO1A 1BGVA 1XELA 1XGKA 1ZMTA 3B6ZA 1E1NA 1EBFA 3EZLA 1NVMB 1X7DA 4K1LA 8ADHA 5I9LA 1GFSA 1F06A 2IEDA 3NKLA 3PIDA 1R0LA 3U49A 4YT5A 4RPJA 3ETGA 4PZCA 3GMSA 4OIMA 4FN4A 1XCBA 2JD1A 4GGPA 2YHIA 3EK2A 4XB2A 5ENVA 4YAIA 1B14A 4E2XA 3WLFA 3CXRA 4Y8VA 2YW9A 4EEXA 5KVVA 2Q2QA 1LLDA 4PRLA 3WXBA 1JTVA 3LT2A 2GR9A 1PZFA 4QT0A 4I5FA 1Q7BA 4YWJA 5I8ZA 4IXWA 1HYHA 3H4VA 3WJAA 3LC2O 4JJFA 2O23A 1Q2XA 1JAYA 1XDWA 1T24A 4GX1A 4W6ZA 5G4LA 4CM3A 3HN2A 1DC3A 2O3UA 5LDHA 3LZ6A 3NUGA 3AW9A 3OM9A 4XQGA 1JKIA 1GZ4A 3OIFA 5T8KA 3O38A 1DFHA 4B8ZA 4TKMA 2BFAA 1BW9A 4IS2A 1LJ8A 4KOAA 5A02A 3WS7A 1ENZA 3C1OA 3SJUA 3JD2A 3KXDA 3PEFA 1T2CA 4RVHA 1WDKA 5FI5A 4WLNA 5F21A 4LVCA 2EF1A 4OGWA 4UVHA 1ZXLA 1T26A 3MTGA 1WAMA 4RQUA 3N74A 1NPTO 4BV8A 1NR7A 4Z0TA 3EUWA 3VTZA 3ITKA 3KRTA 3ZV6A 1XR3A 4MVJG 2B4TO 2BMAA 2I5PO 4R01A 4BUCA 5A3VA 3ZWBA 2IDZA 3RD5A 5A9RA 5IF3A 1T25A 5HM8A 2VOEA 3JQAD 2EG9A 2X5JO 3PK0A 3ZWXA 5L9AA 4CMHA 1YL5A 1DIRA 1GPJA 2EKLA 3NRCA 1GY8A 3IUPA 3R6DA 2D2IA 3NJ4A 4NK4A 4MIOA 1X0XA 1Z7EA 1PJBA 2O7QA 2TMDA 4J1QA 4JIGA 2VHXA 3I6QA 2IEBA 3D3WA 5JXWA 2VHYA 4LW8A 3H2ZA 4RVSA 7MDHA 3D4OA 3GOHA 1PJSA 1ZSNA 2V7PA 3B1FA 4HX5A 1VLLA 3E48A 4DXHA 4F3YA 1WMBA 3RC2A 3H9UA 2Q49A 2NU7A 4XJSA 2AHRA 3IP1A 3OH8A 1Q7CA 3JD4A 1O8CA 2DBVO 2PD6A 2FN7A 4HFNA 3VH2A 3OJFA 2FZEA 1E7QA 2CVOA 3W4JA 1HWYA 3VC7A 1IPFA 3Q6IA 1ZEJA 2J6IA 3W8EA 5EJ2A 2X5KO 3ZU2A 4DYVA 3LF2A 4PLVA 1GR0A 3DZJA 4W7HA 3EZYA 5A9SA 4HFJA 3FCOA 2VT3A 1WVGA 1ZFNA 5JSFA 2EW2A 4FFOA 4JX8A 3W8FA 1I3NA 2NNLD 3AY3A 4ONEA 3ZU5A 4F6CA 3D5QA 2H5LA 1E7WA 1N9GA 3QVWA 4GPD1 3DTYA 4PG4A 3DBLB 1GDHA 3OECA 1VJTA 1K0UA 1DHTA 2Y0CA 5T67A 4FOSA 3TPCA 1MLDA 2HCTA 4DRYA 5A05A 1EK6A 4CM8B 3W1VA 5KWEA 2Q4BA 1EQUA 4GAEA 4P4NA 3KHUA 3ZW8A 4PLTA 2P9CA 1PR3A 2O2YA 3QHAA 4GSKA 3BHJA 3DL2A 3PHJA 3ZHBA 2HK8A 5I7FA 1EFKA 4C7KA 3TF5A 3WGZA 1PS8A 1YBAA 3GHYA 5ILGA 2O50A 2RIRA 1B2LA 4QFCA 2PD4A 4A5OA 2IXAA 1Y8QB 3BYZA 3GN2A 5DT9A 4CODB 4XYGA 1HE4A 1Q1NA 1DFGA 1PQUA 4KUEA 2E6UX 4I1IA 3TJRA 1K3TA 1A9ZA 1R0SA 2AXQA 3S2EA 4A7PA 2YHUA 5B4UA 2W90A 3I9OA 1DLIA 1XEAA 1CWUA 4CQLA 2B4RO 1KEUA 2D8AA 4C7JA 2BGLA 2DKNA 4R5MA 5DULA 2X8LA 3VPSA 1N8KA 1CRWG 1R4MB 4OYRA 4Y98A 2A94A 2P9GA 4YPOA 4GI2A 4MJLA 1QYXA 2Y0EA 1ONPA 1HDRA 1KVQA 4D0RA 4B4VA 4MVJI 2OUIA 3TZCA 4JNKA 4RVFA 3WIEA 3E9MA 3F1LA 3HJAA 1E3LA 1U7HA 2OORA 4XX0A 4BGVA 4IMPA 3AUAA 1HTBA 3ZWVA 4DPKA 1HETA 1E6WA 5I8WA 1ONOA 2WD8A 2BFPA 1PR9A 4ZQFA 4BO2A 4XQEA 1DO8A 3RC1A 5JS6A 3WWYA 1J5PA 4MVJE 4D3FA 4AFNA 3HZZA 2I65A 1KEWA 5JYEA 3FTPA 4TSKA 2J3IA 2YJZA 2DFVA 1GL3A 3E9QA 3VH1A 4LGVA 4Y6SA 1GTMA 2V6BA 3H5NA 4BNLA 1EQ2A 3QWIA 1IB6A 3S8MA 4YT4A 3JQAB 4BNVA 3E82A 2ZTUA 3JQ8A 4HWKA 3PP8A 4ITUA 1NFFA 2H1SA 4NJMB 5JLAA 2Z1MA 1UJMA 5JPIA 4PG6A 3ZHXA 3DHEA 2UDPA 2YQ5A 1M76A 2LDXA 3Q2IA 2JFHA
chains in the Genus database with same CATH superfamily
2O7SA 3QXJA 5AKXA 1VL1A 2ZW9A 1VG9B 3ITNA 4QZVA 1A9SA 3HADA 3MRXA 4W9RA 4B0OA 1G3QA 4KJZA 2G9RA 3ZQKA 5FRDA 2QBYB 5F77A 1Y7TA 3G88A 4OA5A 1ZKMA 4LDAA 5CU7A 2VBFA 1BKDR 5FDFA 2PUHA 2IIPA 3MLAA 3DE7X 4FMCF 5CM8B 3VJMA 1DBQA 2JFPA 1SCJA 2WHRA 3LQYA 4OB8A 5DSTA 3RGWS 2WBLC 4JJEA 2IPNA 5D6NA 3ZCPA 3LT4A 3RFTA 1XNRB 2VO1A 2WIFA 8ABPA 2QZZA 4N3CA 1X7ZB 3OO1A 4HSEA 4YUXA 5F98A 2VNIA 1DTSA 1XFDA 1M7GA 1ZP6A 3B1ZA 3IE2A 3LXRA 3BGIA 4H7HA 4CKWA 2L82A 4ZV7A 1LPBB 4QNMA 3DAGA 5DNDA 5A03A 4QXOA 1GNSA 3HKDB 5BV1A 2D6FA 9MHTA 3KIPA 3B3AA 3IPAA 1R27A 1RD4A 1S6YA 3SEFA 2BWJA 4CM4B 2AW5A 4Y9TA 3ACDA 5DHRA 4H7KA 2QVGA 3NBMA 1TT7A 3NM5A 5ECWA 3SF8A 4DQVA 2QJRA 3PGLA 4JVMA 2J0SA 2JIZD 2X9GA 4Y2PA 1OZFA 3BULA 3NW9A 4RF3A 3UWDA 4Z3KA 4OHFA 2JA1A 4P4SB 3E22A 5FF9A 1C9YA 3TD6A 2YHSA 4EUHA 5LOVA 5K3DA 4Q7QA 3THYA 1RQ2A 2VYND 1UIMA 3FBWA 1CRLA 1I5EA 1P5HA 1MJFA 1Y3BE 1QIEA 1OX4B 1UDBA 4RJTA 3OZTA 4KACA 3H83A 1QANA 2QTLA 3ESAA 3M5PA 1UOQA 1XK6A 1Z6QA 2XRFA 4CUKA 1I7SB 1NF9A 3AKEA 5IVKA 5HKLA 3DLCA 1WZUA 6CHYA 2YWBA 4IZOA 2M2IA 1QQ6A 2UYGA 5AK4A 2KS6A 3VKHA 2AHOA 3W8NA 2PDAA 3QU4A 2CKDA 1A5ZA 2RAFA 2LGJA 4E14A 4CQMD 2GZAA 1NC3A 2C94A 5F9MA 4F9TA 5IKEA 4R9SA 4H3HB 3H1EA 2WD7B 3OZDA 4R7ZA 1PT9A 1UKYA 1W75A 2XTNA 2UZAA 1X1BA 1TVEA 4F3KA 1QC5A 2V3VA 3MGKA 5JRJA 1R3UA 2PRZA 2FWAA 3DOCA 3FDIA 2C5FA 1H65A 3IVAA 4IAOA 3KSBC 4KO8A 3ABOB 4BNJA 2ZUBA 4RA6B 2BJWA 1V8PA 1I0LA 2QY6A 5DCYA 5EJMA 3R0QA 5EPOA 1SCUA 2GJKA 1GUFA 4IDPA 3A3YA 1E8DA 5HJ2A 1W76A 1EXNA 1EUDA 2AW3A 3EDOA 3S2FA 3GAFA 2I1VB 3OZUA 1OX4A 1NBHA 3AB8A 4D3YA 2DB3A 1QVRA 4CM8A 3QOFA 5AQEA 4KVZA 4ZDWA 5DYGA 4ENPA 2P65A 4KPUB 4UNRA 4DL9A 3CEPB 4WOPA 2Q9BA 1DWPA 2A9OA 3L1VA 4EECA 5FNVA 2MSWA 3SDBA 5KNBH 5KIAA 4KRYA 1A8HA 2PJUA 1V41E 1KDVA 4LJAA 2CJXA 5AKIA 3UPTA 1W0JA 1CHDA 3BORA 4J0JA 1YA4A 4KDEA 4LC0A 5FBLB 5FWYA 1NBWB 4FTWA 2Q6OA 4B31A 2FWMX 2HIMA 1FPQA 5TB5A 4EH1A 2PL9A 3C87A 4UAJA 3U13A 2Z4RA 1TT5B 1SZCA 3FPJA 2RGRA 5JJLA 1Q0UA 4BMCA 3L0CA 5CT4A 1N77A 3E27A 1Q19A 1XA0A 2OO7A 1EI9A 3LW8A 2ZB8A 3AR6A 4M0LA 4MWSA 3VBEA 2PMEA 3ROMA 1Y4ZA 4TKLA 1PT5A 2GXUA 2X2EA 2ZVPX 3OPYI 2X1VA 3NKFA 3P0HA 2HAEA 3DFZA 4PC2A 3LDHA 1IHYA 1KY2A 1FLNA 1KC1A 4OYLA 4H4DA 3CYFA 1ADYA 4Z54A 2PZFA 4NV3A 1TYZA 2OBYA 5G3ZA 4DIMA 1WOYA 4KPUA 4BGDA 2IVZA 1I51A 1E7SA 3VR2D 1PV2A 1A69A 1IMJA 1YOVB 5JNVA 5SZKB 2VA8A 2I2CA 3T61A 1S2MA 5JD4A 4I81A 4Q1CA 5LKAA 4BGEA 4GC5A 3SK0A 3A6ZA 3ZEAA 4DMHA 3RS2A 1YULA 3ENNA 3N2IA 3CMCO 2C2YA 1GQ2A 1JHYA 2XZTA 3HHEA 3QIAA 2D1QA 1K98A 2UUCB 2XODA 2BGIA 3I1YA 2HWYA 5HUHA 3DONA 2QUIA 2VVTA 1T2UA 1MW9X 4D3ZA 4BXOB 1Q0LA 3QMWA 4M0PA 4DLRA 4EHLA 4LAFA 1L1QA 3LSTA 3P0RA 2FPIA 1X1TA 3K1ZA 1HGXA 1PFQA 1H9AA 2M1ZA 2PL5A 1TC2A 3L6CA 1UAYA 4ZGBA 2XI4A 1ZHFA 4E13A 1ONSA 2UZ3A 4IDAA 4FOOA 2J32A 4K8RB 4F93B 1LPNA 4DB2A 4RTOA 1BSVA 3V33A 4C3ZA 4DMRA 5CH8A 4WZAB 2EP7A 4KL8S 3SI7A 4BLUA 1I2BA 4YIKA 3FMFA 4AMVA 1WF3A 1VFPA 4RHTA 2PMKA 3G0GA 3H5VA 3ZTWA 5TRTA 4MQEB 2ZSJA 3LCMA 4GO1A 1DXHA 1Z2OX 3TLAA 5JC1A 4ZGGA 2WUEA 3P2OA 2C9CA 1FVXA 1AS2A 2QUAA 1M0EA 2OYRA 2WVGA 3SOZA 1MQSA 4UM5A 3UHJA 3C3YA 5I9BA 2ZIFA 3BXEA 3UOAB 4LXXA 1YB6A 3JCZA 4C0KA 1Y5LA 4D45A 3HACA 1C9NA 3M6UA 1M72A 1U8CB 5CX1B 1G20B 1I6LA 2G77B 1BMDA 2QV7A 4QM6A 3IIJA 1TYBE 1W52X 5E6RB 3RVLA 1RKVA 3T9DA 3UJPA 4BQSA 1XZDA 1Y33E 3TD2A 5KKCA 2E5LB 1ZNQO 3SIXA 4RHCA 3PFCA 1UM9B 3EQ8A 4IV0A 5DI3B 5NLLA 4CNBA 1E9SA 3UW3A 3U26A 4U7JA 5LZ5A 3UFXA 2OO3A 1H5QA 1ZUNB 4JT9A 3B1JA 2FV8A 2QN3A 1BTOA 3WIUA 4JLKA 1EAYA 3JYOA 4FNAA 1WV1A 2PRJA 3FYUA 4JUAA 4NCJA 2OQVA 5BV2P 1TQ6A 4O4HF 2CLOB 1ZR4A 4CEJB 1MABA 2FKAA 3L6UA 3LCJA 2RGNA 3N6RA 4DLNA 5FAKA 1I3LA 4IIJB 3GG9A 1PW5A 3QU5A 4HF7A 4M7RA 4UMEA 3K6RA 3G17A 2Y1FA 1R9NA 1SRQA 3AIMA 1W6UA 3I8SA 1NP3A 2AYZA 3KVYA 3GMDA 4UXIA 3VR4H 1AZWA 1GA6A 1JJAA 1Z6XA 3FCUB 2JGDA 5K7SA 4HY3A 1JF8A 1GARA 1ORVA 3GLFA 1XVVA 2QLFA 3D5EA 4LC9A 1B16A 3E8MA 2JLBA 4AKGA 5TPWA 5T57A 3U31A 1F9AA 3OPYB 1H93A 2C9ZA 1UAGA 3NTOA 3PDIA 5LXTF 3DNPA 2Y67A 1PTKA 3CZPA 4J2OA 3U62A 3GG2A 3BCHA 2JLZA 2B61A 3V7WA 4CR6A 4TSRA 4GM4A 3BK7A 1GL9B 4B87A 4DWVA 3ZVLA 3S1SA 1SUPA 2H2DA 4EO4A 4A36A 4RKYA 3OZEA 3BD7A 5IKOA 1KYVA 5BW6B 1HBJA 1V8OA 4K2AA 1X14A 1G7SA 1IE3A 2EFJA 1KSGA 4YP7A 5J63A 3RUIA 1CT9A 2DUWA 3R3UA 5JSKA 4M1ZA 2QJOA 3Q9NA 4E3ZA 4G0YA 4DXDA 3GJTA 4J1SA 3NH6A 4IJ5A 5CFQA 2XDAA 3RGGA 3PHCA 1AURA 4HZGA 4OHKA 5JYDA 4EZEA 1AMNA 2ZB7A 2Q4OA 3HCWA 4CLOA 2DJIA 4BBAA 3Q87B 3HB0A 1PFVA 2QVCA 1XF1A 5AKHA 4MH0R 1B0ZA 1WLSA 1DIAA 1DUVG 3V8EA 1GOTA 1X1DA 2NYRA 5IKMA 4HH4A 3W6NA 4AO7A 3GYBA 4HYQA 4P0TA 2OCDA 3OOWA 2Z2XA 4ZHSA 3AUUA 2VDWB 3EXHB 4YLYA 3D6FA 3S2IA 2ZVQX 1U63A 2CMHA 1KZ9A 4WLEA 3EIHA 2QTTA 2HSZA 2R0QC 1BNCA 2A3NA 3LXXA 4M76B 5DTJA 2H92A 3FHLA 1TQ2A 2XTAA 1YBFA 2X76A 3FSEA 3TW8A 3MK31 3KDPA 1MC4A 3LO8A 3NGLA 2I9KA 2JFVA 2V8OA 4PCAA 3SQNA 1XRSB 5EWMB 1BE1A 4KVGA 2WTUA 2JFYA 3GNTA 3GT4A 4C30A 1JNXX 2ZQ5A 3F7MA 1NVKA 2RK6A 1K6EA 4HSGA 3F4BA 4F2HA 3OKAA 2PIAA 4CF4A 1D1QA 2NQ8A 4B5KA 3HUDA 1PG5A 2C5SA 4U4AA 4A0SA 2Q9CA 4MCAA 1C9KA 1OH8A 5H4GA 2EKQA 3AHHA 3GLUA 4MW2A 3O9MA 4DSOA 4IFBA 4NS4A 1ABFA 4E88A 1BFUA 5G2OA 4XSHA 5JAZA 3LTNC 4IFEA 2MYPA 5LNK1 4JYAB 4HS4A 4TMZA 5EP2A 4FUQA 4ND8B 4GPIB 3T7IA 1GG2A 1HURA 5BURA 3VZPA 2ZAIA 4Q47A 3BD8A 1HT0A 4L5YA 4HAOA 2BISA 3QA9A 4LJSA 4O59O 3LL4A 4GXNA 4JT4A 4BZWA 2YC4C 4AO8A 4Z0NA 4TZKA 1OWMA 1Q50A 5B2EA 3STUA 3BJEA 1R00A 1OBVA 1ZI6A 3OP4A 4Q6WA 3N58A 2BFEB 4HB2A 3GAZA 1XZIA 2X13A 3FMVA 4LTDA 5FPSA 2LCQA 3TSZA 4Z99A 2JATA 3ZJ5A 5KTKA 1AXGA 4EJSA 5LZ8A 5EWMA 1ZL2A 1POWA 3GELA 3R44A 5E8RA 2OFFA 5BMVF 2DH5A 1YHYA 1QRAA 4P4TA 3MUOA 4YASA 3SDSA 3SF0A 3FRIA 1T29A 1IG0A 1IZ0A 3LK6A 5HFJA 1CRPA 3JAMA 3UK7A 4CKWB 4BVAA 4URVR 2C4NA 2FMKA 3IPXA 3S6JA 2GNPA 2GFIA 3GDFA 1WD5A 5D7NA 2B8JA 4DQ0A 4G85A 1BD3A 2JS7A 3DBIA 4MVJM 1RJFA 4F4UA 3CLSC 3ABSB 3VOBA 5LYYA 1RJ9A 4DIOA 4UHHA 3WBBA 3TJMA 3IIEA 3H16A 4II2A 3ESCA 3I2FA 3JASB 4KMRA 4RPHA 4Y0AA 3W7AA 4RD1A 1OXMA 1K2VN 1BQ3A 1D2GA 2CD7A 3TW8B 2ECPA 2FGJA 4F21A 2QN8A 3PC7A 2OB2A 2IQ5A 1H1LA 3K0BA 3LCVB 1AN0A 4B7CA 1N6LA 2B2CA 4B3XA 1Z6ZA 2Y1EA 2W6PA 1IOLA 2YXNA 9ABPA 5JCPA 1N5IA 2B5WA 3L1UA 2FMHA 4Z9BA 5CDUA 1VLJA 1II8A 1XZPA 2OD2A 1ZGBA 2VSFA 4CLDA 3MINA 3CJTA 5I9NA 3FTFA 5J2TB 3PLRA 4H35A 1HM5A 2Q8PA 4QXMA 1UFVA 1JHZA 3X2SA 1AGYA 1O7JA 1WA5A 1I01A 3NANA 4ZVUA 1JR3E 5FBHA 3I1IA 2HGZA 3U37A 1X3LA 3PTAA 1EX9A 4AUKA 4EATA 3NRBA 3HB1A 3CZMA 1E4EA 1HDZA 4I4TF 2QN9A 5CIWA 5DHTA 4QVIA 4RHEA 3NTLA 4HEQA 4AMYA 1X77A 4D4MA 4D9CA 4QM7A 2ORYA 4ZCQA 3COYA 1XB2A 4HYTA 1E0SA 3H87A 3H9QA 3EA0A 1FS4A 4GH5A 4GOMD 1IRIA 1E2KA 4MKGA 1ZH4A 3JARA 1KYQA 4JI0B 3KR0A 3VAAA 3WNVA 1EUDB 1FRZA 3HA3A 2FEKA 3MBIA 4KXXA 3TRJA 3VH3A 5J47A 1OCEA 2QV0A 1U28A 2OLJA 2QTRA 3OP1A 3UNXA 1WBDA 1E7YA 1QZZA 1TK2A 2FN3A 4MR9A 4IUYA 1C1XB 4PX9A 5IJZA 1UC9A 2G1UA 4OQMA 3AI3A 3QLVA 3ZJVA 1UBGA 3F96A 3K5IA 4KIWA 5A4JA 5I4IA 4Y2YA 2EATA 5K3FA 4BLQA 3WBJA 4UOZA 2QMOA 1JHXA 1ZONA 3E3OA 1LU9A 3A1WA 4PTLA 1FS5A 1KERA 2HW8A 1G2IA 1T91A 4NSNA 2G4LA 4YRFA 3I92A 1EP2B 4W1SA 4OHZA 2QPLA 2GEVA 3ZCQA 4MP6A 1QONA 2C4MA 5DE3A 3INRA 5CDGA 2WQ6A 4ZHQA 4C05A 1X1AA 3DTVD 3FHJA 1QYWA 1K6MA 2G5GX 3LUDA 1P2FA 4J1NA 2A88A 4GVXA 2EQ5A 2AJTA 1EA5A 3DB1A 4P36A 4NE9A 2ZAOA 3T9FA 1Q84A 2BD0A 3PBKA 2FW7A 5T4HA 1Y98A 4EKDA 1LK0A 5LVAA 2BMDA 4P1ZA 3RIGA 2HHLA 1U0FA 1OAOA 1N4AA 1GITA 1YHNA 1KL7A 4TTSA 3SBDA 2CEAA 3R4CA 2NYVA 4IIFA 2Z5GA 1P9OA 2QMEA 1OPRA 3IXLA 3RS7A 3WLRA 3COJA 1MO5A 3RAPR 4MQUA 4CEHA 4LXTA 4US2R 4Z2YA 4M8IA 1VA5A 1KEPA 2F1KA 5I45A 2A2ZA 5KNDA 1LJUA 3L18A 3ZCTA 1XP5A 3KV1A 4UC0A 2W6QA 5F5NA 1QBKC 3HKDA 3K8QA 2Q9UA 5DYYA 4JZYA 1C30A 4MWTA 3ZU4A 1NKSA 4LX8A 4ZALA 1JDVA 2EX0A 2PS9A 5HJ7A 3GFFA 4O3MA 1GRVA 4Y2GA 1ADFA 1JBKA 2Q2OA 4JDPA 5A0FA 4CF6A 2UUAB 3QKTA 2PUEA 3MJRA 1U3CA 3IUSA 4HHEA 4CL8A 3V8RA 5K4HA 4MLPA 4OH7A 3PDWA 2ST1A 3TTYA 3CJRA 3K1TA 2XUIA 4NLLA 4ZDIA 2BLNA 3L2OB 4ZOEA 1C3VA 4RA9B 1B00A 1UZUA 3DL4A 3OUUA 1N2EA 2BZSA 3HLYA 1V9CA 4DLTA 1F9EA 1AMUA 1XD2B 1IN6A 2QZJA 1Q44A 2J9XB 3Q0EA 4M9QA 4MKHA 4E5SA 4YDSA 4MV8A 3LFHA 1IG3A 1MAHA 1F6BA 1MXFA 5A9SB 5L6MB 2M9MA 3LQQA 4Q02A 3FR7A 1OB5A 1VOTA 3A6LA 3G0OA 3NV7A 5DIZA 2ADMA 1MR3F 1V9LA 1WO8A 3WSTA 4QASA 4B4OA 1OFGA 3KWMA 3KSMA 4BN0A 4MRVA 5SY4A 2OB1A 4DARA 3AETB 3OLZA 4F71A 4OLAA 2UUPA 1HT1E 3BX1A 3KQWA 3P2MA 4MVXA 1TUGA 2G17A 1D07A 1NWHA 2VJLA 4ICIA 3DMDA 4KQEA 4U2KA 4DUGA 5L3VA 2Q3MA 5C0OE 2WFMA 2JDID 1V8ZA 5F3RA 1JDZA 3T5DA 2DSNA 1SU6A 5BSFA 3F9IA 2OLEA 3W3ZB 1U3VA 4Z86A 4ILEA 2A1TR 2CLFB 2VHCA 3RR2A 5ARCA 3STYA 4B40A 2DETA 4I08A 3DPIA 3M4XA 4DLZA 2AT1A 3MMZA 2GN0A 2NU6B 3EDCA 2AXPA 3SHQA 3K70B 1IBCA 1GAQA 1I3CA 3EIFA 3GUHA 3RSFA 2DQKA 2J7PA 1PR0A 5IBPA 4ABYA 5E1BA 1E3JA 4EENA 2I62A 3UAXA 2JIQA 3R3YA 5A5FA 4LE0A 1G3UA 4AYTA 1E3WB 2P75A 1ECFA 4Q21A 4EHKA 3AJ8A 3H04A 3G8BA 1T6ZA 3PFFA 4G2NA 3TQIA 2ZI7A 5HK8A 5FWNA 3HVIA 5AHKA 1LBHA 4I2NA 2R4UA 4N82A 4Y2JA 4H77A 4B82A 3K92A 1YI0A 2HQBA 4ZJYA 3ILYA 1ZK2A 1PJ4A 4RVDA 1JIIA 5E7JA 2D1FA 5AW7A 4JP8A 4MP3A 4ZI7A 4PHFA 5AVQA 4Y0NA 1THMA 3W5VA 3RSQA 2IYVA 2XRYA 3C24A 3SZLA 3BXPA 4J91A 2BP7A 4ZQEA 1NP6A 4WDQA 3DZHA 4R51A 1LRJA 1RWVA 4R1TA 4EJ0A 4LF7B 4DRXA 5CLHA 4HAXA 2GNAA 3WJ7A 1RS0A 1ESEA 3GJ8A 1T1EA 4B9EA 3P27A 2R6HA 4WCFB 2YWDA 2E3JA 3PQEA 4WWHA 1XHEA 3ZW9A 4EAQA 3OOEA 1ENYA 2VEOA 3CE6A 3N0RA 3NV9A 1U0TA 1Z0KA 3BFKA 4NBRA 5H83A 1WEKA 5ARBA 1R8XA 2ZTHA 1YB7A 3D6MA 4J03A 5IXYA 2VAXA 1MUUA 3LIPA 4O08A 5ER6A 5F7XA 4LY6A 5DLQC 5KINB 4FI3C 1GHTA 4AB1A 2KX7A 2Y0DA 4AYXA 1OHHA 1QOZA 4PZEA 4UTZA 2GPYA 2ECFA 5FUXA 5JDIC 1TK3A 1GGMA 4R8KA 4XRRA 3CUKA 3OFSA 2I7XA 1N2ZA 3DD1A 5IRCD 4RTLA 2CFSA 3O74A 5BQOA 1FY2A 4LZLA 3TXXA 4UPEA 3S29A 3O4RA 4NEQA 1OROA 4TVOA 4HUQA 4JC4A 4CTJA 2W2TA 4DMFA 4N47A 4DZRA 3QMMA 3WI7A 3L1IA 3K1YA 1T4CB 1DWUA 2Q1SA 2RIPA 1Q3TA 3HCBA 4M1QA 4P58A 3LPLA 2YOGA 5I9SA 3CTPA 3UB2A 4BVLA 1RYFA 3WQSB 3HU2A 5ESDA 4MV7A 1PNVA 4GE0A 4P84A 2DPYA 5JDCC 3L0YA 4FHCA 3UGQA 4Q9LA 3ER8A 3AR7A 3NCTA 1RQ7A 3VU1A 1W47A 3SEZA 4ECEA 1G3RA 5IDVA 3ICCA 2X15A 4TRMA 4UNPA 3SC2A 3BWEA 3VKGA 1N2XA 5ECDA 4B09A 1BWPA 2I4NA 1Q6YA 3I9MA 1FC0A 1ULHA 2BGRA 2ZTSA 3RPEA 2Q3JA 2C78A 5CBPA 1PQYA 4BVEA 1T2EA 1UEIA 4EKYA 3AWIA 1Q0SA 3OC6A 2AN4A 3DG9A 3S68A 1ADBA 2VQ3A 3LKDA 4ARZA 5JDIA 4FM9A 4EOGA 2IYUA 3HJGA 2VN8A 2Z1NA 4O63O 3CF4G 2FMFA 4JEHA 5HKKA 5AW0A 4Z53A 4C22A 1WMDA 4Z4EA 5E1OA 4DM7A 1KKLA 3VKWA 4YRQA 1W49A 1LW6E 1VJ5A 3BBLA 3OLYA 4DLWA 2XB9A 3MRTA 4CMJA 4EGFA 4G5RA 3OVMA 3ZX4A 1JEQB 3WFIA 5D5HA 4DADA 3CEHA 2VF5X 4RPIA 5KOHA 4NCKA 3IALA 1FX1A 4BOYA 1QLWA 3NBAA 4IG9A 4S1WA 1SBZA 5LCXA 3T1VA 3D3QA 3C74A 1N8TA 1YNOA 2PD3A 1OT5A 3NB0A 2DWCA 4GR9A 1CDDA 1ZM2A 5DIFA 2RARA 4NYMQ 2EWMA 4BEVA 3ICVA 4N5NA 3U7JA 1KZ1A 2F9FA 3WZLA 4DUYB 3P9KA 1Z2CA 2B25A 4FDLA 2VQEB 1QVAA 1QIKA 1MVLA 4GVLA 1FMFA 4DG9A 3EPKA 2DWUA 1X74A 1JBQA 5J2UB 2PUDA 5HE9A 1CHNA 1PFWA 1FTNA 5HGJA 3OWOA 3C3PA 2UUBB 2N3ZA 2BM9A 2WWGA 3NUQA 3O2NA 1JUDA 1A97A 1FXSA 3ICWA 3QWAA 3WJ2A 3C98A 1SH7A 1MRSA 3E0QA 4GF5A 5AH0A 3DUWA 2O4UX 2NQTA 3QENA 3R6GA 4LK2A 4AYWA 5HIAA 5JZBA 5DNYB 2BEUA 2P9QA 4A26A 4E5KA 4IKPA 3KOZA 3B36A 4FSHA 4DA9A 1K68A 3DPUA 5CA0B 2BSQA 3UHOA 3MWEA 3LOPA 1TJ5A 5FUWA 3ZGZA 1HDYA 2PGDA 2DH6A 3NT5A 1UXIA 1MEOA 2GPTA 4DTIA 1IXYA 2IS2A 3LSYA 3GZNB 4GUAA 2CNKA 1C3XA 1NUQA 3TG8A 2VNJA 1OLXA 3JASA 2JHAA 3DOHA 4DZZA 5T3YA 2CLHB 1YA8A 1O95D 3VJRA 1OZ0A 1N34B 3QBEA 1M2JA 4AJIA 4CFZA 3ONEA 4M9ZA 4Q39A 1PEDA 4QHTA 1G19A 1QAQA 2QN7A 2VDQB 3IDZA 3O8DA 1PWYE 4Y1GA 1K6XA 3KALA 1VSVA 3ET5A 2X41A 3FOBA 4BX3A 3QLEA 4INPA 2SCUA 1L5NA 5CFPA 4KQWA 4ZVMA 1QDUA 1SC9A 4PLFA 1J9ZA 2G3YA 2JIRA 5EAIA 4BHTA 1PL6A 2X19A 3I2IA 2PXCA 3E2PA 3LKVA 2QW8A 4IZIA 4U2CA 3T7SA 4I55B 4PE5B 3D4BA 1P74A 3E58A 1X7YA 2OXRA 1Z0JA 3CF6R 3EGDA 4YJ3A 4ZOLA 5B7PA 2FE1A 4K6FA 3S7TA 4BWYA 2PSJA 3P2YA 1RPAA 4LBYA 1LS6A 2BPOA 2XCIA 3QA3E 3BSSA 2PK3A 3R5TA 4WASA 2QRMA 3T5PA 1JJIA 2ZRKA 5CYOA 1GUYA 4V03A 4RZXA 4CL2A 2X1HA 4TKUB 1QQ7A 1XRJA 4D6XA 1FQKA 2CJWB 1VPDA 3VR2A 4ETMA 4MPRA 3ORQA 3X1YA 4UUNA 1JX6A 1SKBA 4US0R 5IC4A 4K2HA 1ACMA 4P3NA 5FWXA 2A7QA 4L6CA 1P5RA 5TGZA 1A4XA 3MGAA 5GTDA 4U6NA 1TCBA 3BTSA 1TA4A 3K0HA 1IHPA 4XLLA 2DRIA 2RGDA 2RHCA 1THTA 5G40A 3FNFA 4MRMB 4F8JA 3I6MA 1RLTA 3PGA1 2C4WA 2I4LA 2O3QA 3FE2A 2W4QA 3PC6A 4WA7A 4IGIA 3LOUA 4B5LA 2YJ3A 1G55A 4TL7A 3KVRA 4EIWA 3LPCA 4B81A 4DABA 5ADWA 1RP1A 1NBME 2JEZA 1QV6A 4G9EA 5LP6F 3ADBA 2JGNA 1BE0A 3CNNA 4MARA 4MVJF 5EXPA 5HIIA 1XMQB 3KVOA 3H3XA 1C30B 1AGNA 1DJNA 5HYVA 1G5IA 5KB3A 3FX2A 1YR6A 3UBMA 2G9UA 4JEIA 2WA2A 3RKSA 4AL4A 2BTQA 4OXYA 5CMLA 4JLWA 1T5LA 4RDCA 3OX4A 5DRYA 5HE8A 4BE4A 3SM3A 1BXRA 1EGVB 1G7CA 2FWIA 3ZEIA 3N39C 4UDYX 1YB4A 2R1ZA 2IH5A 3FYDA 2PKQP 4NIMA 4QUGA 1OHHD 1RE1A 2R7LA 2GHIA 3AOEA 4LMBA 1FVHA 4XSVA 2M6SA 1P6QA 3TE7A 2DT5A 4YBRA 3OZAA 1S96A 3E6AA 3AYXB 4JN6B 4OQFA 4HFRA 3VUFA 1A8IA 5CBPB 4E12A 5GZ1A 5F51A 2ZM6B 4GL2A 1D6SA 2CBZA 2GM9A 3NHLA 1DPGA 2RKWA 3G5AA 4YALA 5KYWB 2BCGY 1D2RA 3D02A 2G0TA 4KXLA 3TCKA 2JIDA 1MEEA 2REQB 1KEEB 4MUIA 3K9QO 1NDQA 3KXPA 3R7DA 5I7AA 2P78A 3JAWA 5H59A 4DIKA 1FJXA 1Y6ZA 5EJIA 1EWVA 2HMSA 3DLPX 4RO0A 2BKLA 5L7TA 2QGZA 4JWTA 1VSQA 1BGWA 3IOYA 1XWIA 3Q2KA 1C50A 3CCBA 3JTMA 4YUZA 4YAUA 1KU6A 1NIJA 1I7DA 821PA 4GRIA 1CCWA 2W2LA 2W8BA 3ZWAA 2YFKA 2JFBA 3IDAA 4I4TA 3STTA 4BO3A 3OEED 2XA1A 2XNJA 4FYMA 1FCJA 2R8YA 1JFLA 1XMXA 4L76A 1LV8A 4BO8A 4DVGA 4URZR 3H65A 2I9PA 3UMGA 5CCEA 3E8SA 3P7MA 3TMAA 1X42A 1LVGA 4FS3A 1TD9A 2H9IA 3GFQA 1X7XB 3MCZA 2XUJA 3DVLA 1E2EA 4L72A 1E1KA 2Q3EA 1MB4A 1NT4A 2C96A 3EC7A 4EJ2A 4JL5A 4MMYB 3H2YA 4UHDA 4XOIA 3ZWOA 1EFRA 3KZ1E 1FDUA 2F8TA 3PNLA 4KQIA 3THWA 4BKQA 4QU9A 1UXGA 1G8JA 1N2GA 5FQOA 4RBNA 3WWPA 4NOKA 4CU2A 2WD7A 2QYSA 1KR5A 1TMKA 2K87A 2XQJA 5GV8A 1K5PA 4TTQA 5JPDA 1C3OB 3VPFA 2H48A 2YVAA 1T4GA 4GI7A 1DQSA 4BIMA 4B6PA 5LNK6 2E18A 4AKHA 1U2SA 1N36B 1YS7A 2PHZA 4G8CA 4HDNA 1DZIA 1PZHA 1N9ZA 3V4VB 2NU6A 2ZRDA 3E7FA 1JLLB 4L8LA 3EQ6A 4MRSA 1M2VA 2ZYSA 4M37A 4PNHA 4DNPA 1YHZA 4TS4A 1U1CA 4C0AC 2HMYB 2OBMA 3SKYA 3INTA 3BILA 3T0GA 1YWGO 4OJTA 1Q1QA 5AKYA 1R0WA 2Q4TA 1T3SA 2ISCA 4ZP1A 3VAZA 5M04A 3RRNA 4AKTA 3OUTA 3L6OO 3RBVA 4B8WA 4HRAA 2XNDA 3ZDBA 2WIKA 1JHDA 4ZRDA 1JN0A 2XJ4A 5CCBA 3N8KA 2IP4A 1DDIA 3LECA 3VR1A 3JYQA 2JBAB 1BU5A 4Q9JA 4AJEA 4B7XA 5EWLB 3DWFA 1IULA 3UJ6A 3U7GA 2JF0A 1B0PA 3HA5A 2PVSA 2YC2C 2R6FA 1PL7A 2AS0A 3HV2A 1NVGA 2FR0A 1RABA 4H1HA 4H6VA 4RTKA 4TYYA 1ES9A 2I8AA 1U3TA 4Q3AA 3I83A 3DZDA 2FW1A 2G4CA 1RWOA 2JDIA 2NU9B 5G02A 5B57C 4RXTA 1ZD9A 2FW9A 2AR9A 4C5AA 4H7JA 3WBFA 1LZKA 2F8MA 3BK2A 3EZ9A 5THQA 2ZE6A 3N6XA 3H42B 4LECA 3VHQA 2PZMA 3ZE7A 5DXJA 1Y1TA 4RCVA 4C4SA 5K0ZA 3LUFA 1S89A 3RVBA 5K0TA 4WOKA 5JIBA 1JYEA 1PG2A 4BMZA 4YRMA 5HQTA 1Z7BA 1YB1A 4YUWA 1T4BA 4ZVVA 1G21A 1GKKA 5HGXA 3DOJA 1CK4A 2H29A 2IOYA 1DHRA 4MKRA 1E3EA 3U5TA 2V7UA 4XIIA 3R3ZA 4CTNA 1FA9A 2ZJ1A 2L18A 5G0UA 3I58A 1V11B 2CXPA 3PJDA 4X60A 3FB1A 3QX9A 4Q4CA 2AFIB 2CJPA 2GF9A 1KYZA 4KX5A 1MX3A 3NHFA 3VYRB 4I3HA 3ZGXA 4HVLA 1H1LB 1M75A 4IYJA 1XO1A 4PINA 1WXIA 1MH9A 1WCIB 1X7WB 1UBHS 5E38A 1S8FA 1DC5A 5JVDB 3WKBA 1E9BA 3WGIA 1C81A 1R88A 4YVFA 3GLIB 1JPVA 4QAJA 4YHBA 3CGGA 4BQFA 3ZD9A 2PLRA 1EVLA 4IY1A 4MPDA 4OUDB 4YBZA 3IMGA 4P80A 3UUGA 1XEXB 2WPDD 3NKVA 2ZSIA 4QLOA 4D5EA 2D7DA 1SWWA 4FIZA 4DR7B 3ZLBA 1YVPA 2AZMA 1VSBA 1CR2A 1XI2A 2F1RA 2PKQO 2DQYA 2WUFA 3HB5X 4N0DA 3CCFA 1J0CA 2X0EA 4ENQA 1I7QB 4X64B 5HG0A 2EU8A 3TL3A 4JI8B 1AKRA 1BX0A 1SQFA 3RVQA 4FILA 5LU8A 4RGQA 4A2CA 4BMNA 3QXXA 5THXA 7GPBA 3WP0A 2RI0A 2H51A 3ZHCA 1LI7A 2COEA 1FZQA 4W9NC 3NXSA 1PLKA 3H5OA 4OA8A 3HXOA 2OFXA 3PHHA 1J8MF 2RBGA 2VTDA 3QEOA 2A1UA 2V5AA 3BE8A 1P7VA 1UJ4A 3IT1A 1KAMA 2J3KA 4Q9KA 5CVUA 2NP6A 1THZA 2C54A 4QJIA 4REQA 1QS0A 5CRIA 4AZTA 3A6FA 3TQHA 1SOMA 1LPMA 4LMAA 1VJ1A 2HKIA 4ZC8A 2NIPA 3QVUA 1E89A 1Q7GA 5L4NA 1TRHA 4WAUA 2FAXA 4E46A 4BNGA 4KC0A 1ZVJA 4YMTA 2VPZA 1JALA 3AC0A 1GTRA 3LO5A 1Q6ZA 4LCBA 4MLCA 1X1EA 4MWGA 3X2EA 2J6CA 3QEMA 3AKZA 5IXSA 1VTKA 4TLDA 2H1HA 4FDAA 3TLMA 1J23A 3AVPA 5U4XA 2QUJA 5C7LO 4LPSA 2B6NA 1E66A 3DH0A 1TL7C 3FYUC 3GLVA 3QVTA 2VJMA 2ATIA 3WDLA 5J58A 1MW8X 1RYHA 1X9GA 4U7DA 3DQZA 5T64A 4D5GA 2ZRAA 1YIAA 2HBZA 2GKSA 1JH8A 5JQGF 1OV4A 3ENZA 1RBQA 2YIVX 4PFSA 3HUUA 3ZHVA 5IYZF 2G9ZA 2IIBA 2ZUCA 3HUEA 2O1XA 4BP8A 4Y2HA 2NZYA 2NTNA 1MQ8B 1E4VA 4IDGA 1NN1A 2WIJA 3FAKA 3K9GA 4JR2A 1OGYA 1NASA 4K8OA 4KAAA 3V4PB 5GADl 1H9BA 4OPMA 2JIMA 2B0JA 2O05A 3FH0A 3OCCA 2GAFA 4H7DA 3KSAC 3CC8A 5G0TA 3FZNA 5IZ4A 3B78A 4YRRA 3EWAA 2PUFA 4CU5A 2O0KA 2GI4A 1I7LA 1J1ZA 3ZIDA 3HLKA 4HDSB 3ZKAA 4B3GA 1XTQA 1HNWB 1RVDA 2EFCB 1JIVA 4PWZA 4L73A 4CM6A 2H0RA 3WQRA 1FYVA 4AY5A 3EDQA 5AVZA 2X9NA 3T9CA 4F38A 1KDYA 4Z7OB 1KAEA 4RZIA 5IH3A 1A1SA 2GZHA 4KHPB 1J99A 2J3QA 4IOJA 5G4KA 1LDYA 2RSLA 2Z09A 4Q3DA 3N0TA 3MQFA 1EKXA 1PDWA 2IXTA 2WU1A 4WK0B 5CM2Z 3DZKA 4AJOA 2W00A 4JQYA 3MCWA 2J0UA 3ZN2A 1V1JA 2I80A 5F7OA 2OXTA 1YK0A 3I52A 4EYOA 1ZNZA 1YCFA 3A04A 1JFSA 1L5SA 4KQ2A 2B4KA 3T5CA 2C83A 1V6AA 3GUYA 2OHIA 4QQNA 4WOBA 4YDRA 3AQ4A 3WGHA 2GCPA 3IJ5A 4HAIA 1TM7E 1ULAA 3VYVA 2FW6A 2FXVA 1BAPA 3O26A 1JLKA 3VO8A 2HFJA 3K1JA 1L8QA 5BSVA 3I6IA 1J06A 1H9CA 5BMVB 4AG6A 2H59A 2ZRGA 3HU3A 2N0SA 3GGCA 5EKXA 4TSFA 1N2OA 1Z5VA 3HVJA 5EQFA 4EDFA 2X1MA 1KI3A 4ZK2A 2DBYA 1YFZA 2ZR7A 3IMCA 4HZUA 4WZAA 1C9JA 4Z9YA 5EJ4A 4WXHA 4KYIB 2HSGA 5KVCA 4QUDA 1PFUA 5F64A 4UM8B 1E5XA 2NO1A 3KZKA 4B3BA 1ZINA 5JDCA 1WVMA 1HC7A 1T3TA 1AA9A 2JFGA 3EVCA 4FKZA 3S1AA 4D46A 2WM2A 4GIBA 1L5MA 4OHPA 1SQ6A 3WLNA 1YZUA 2LPMA 3RHZA 2UZ4A 1DAMA 3PVSA 2Z0MA 2JCYA 4IKOA 2VTBA 1MF7A 4IX1A 3DYVA 1OJ7A 5B53A 4CR8A 3WO0A 3GFGA 1UDWA 3Q15C 3SHVA 3WYAA 2AI2A 3IGFA 2OVFA 3R75A 2VNSA 1JG7A 2HY7A 4AN0A 3FI9A 5KYVA 3T5AA 1I4DD 5EXTA 2GYWA 2JAXA 4F92B 1IHXA 5EE5B 2KW5A 3SIWA 5JAOA 2WLSA 2W6MA 4JLBA 1XYGA 4L57A 5L8VA 1GPUA 3UAOA 1CZOA 4OATA 2WIDA 3BJMA 3K9WA 1DZ3A 5MDHA 4EI8A 1G8HA 4B4UA 1Y7IA 5F2NA 3I4LA 1CR6A 2ECQA 1RMQA 2GASA 1ZN7A 2O1SA 3EXAA 4J4TA 3QE2A 4ALIA 4DSZA 1WY7A 5I7SA 1E5VA 2HHAA 4V2IA 1PFYA 1ICIA 3NIFB 4Q7KA 1XRNA 2RHHA 4UZSA 3UUEA 2A9KA 1ZS9A 1RPJA 4C07A 5K4GA 3ZHOA 3OQMA 3H17A 4K05A 2VHJA 3ONVA 3RTEA 5JQWA 1Z75A 3GCGA 1TTQB 3H9JA 4LSMA 4EP1A 4KYVA 4RSGA 1TVKB 2EIXA 4NXNB 4I5DA 2IHZA 4DBZA 1C14A 1PGJA 5A0VA 2V9PA 3M4ZA 5I4BA 3UUFA 1IN8A 4JFAA 5CH3A 4NPAA 4MJ7A 5G0VA 1DGQA 3ELUA 5AI5A 4QUEA 1KBQA 3AR9A 4B17A 4YPVA 1VIDA 2R6ZA 5CX4A 3MJ4A 4R54A 3C4QA 3L5KA 5F23A 4AP5A 3FOZA 1PR6A 4RLHA 1PNQA 3PPYA 5K3SA 2XBMA 1ADCA 2O07A 1ZJ4A 3DLAA 3HSYA 2YWCA 1GPLA 3AY7A 4OJNA 4GXTA 1XQWA 4R5HA 3IAM1 4A4DA 5KX5A 5DNVA 4MW9A 3THRA 1LPPA 3AZPA 4GM1A 2OA0A 2HF7A 2BUBA 5COBA 1MO6A 3U9LA 5JROA 4MDFA 4MIYA 4WGGA 3FOAA 2Q5LA 3NX4A 4H7FA 4HDCA 2YR0A 5EG5A 3SD7A 3DE6X 2WG1A 3UT5A 3J7AC 4Q1AA 1JZQA 2GEBA 5IHPA 2PZEA 5BMVA 2HUNA 2WU8A 3HKCA 3JW8A 4IH1A 1HOXA 2W6JA 1EFVB 1NJSA 2N42A 2PZJA 3G9QA 4CCYB 2QHXA 1R0KA 4EHHA 3SYKA 1IAQA 2MSLA 5T6BA 3WDSA 5IAGA 3SQMA 3AJRA 4QQ8A 3AWDA 1QC5B 2RHTA 3SM9A 3KWJA 3UM9A 4ER0A 4RTPA 3U7FB 1M8PA 3CA8A 4KQ1A 1MABB 5FO1A 1DU4A 1WQ1R 1LTHR 2Q5QA 4JC5A 2VH2A 4QL3A 4L85A 1L7PA 3ZLTA 5JEDA 1O2DA 1CQJB 3G9TA 3ADOA 4BZXA 5I7VA 1SFRA 1HYGA 4DV2B 4DR3B 3KQKA 1Q1EA 2PT6A 5AK3A 1XXLA 2OKCA 3HGTA 1IATA 2Q0QA 1SXIA 3F98A 4RK4A 4YJFB 5JJIA 1WE2A 2UVDA 2ZDQA 2CJWA 3EDMA 3ZY6A 3T7CA 1H42A 2BKAA 2XGOA 4Q1DA 1PGOA 1H4QA 1CRQA