4Y1RA

Sav1875-cysteinesulfonic acid
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
171
structure length
170
Chain Sequence
TKKVAIILANEFEDIEYSSPKEALENAGFNTVVIGDTANSEVVGKHGEKVTVDVGIAEAKPEDYDALLIPGGFSPDHLRGDTEGRYGTFAKYFTKNDVPTFAIHGPQILIDTDDLKGRTLTAVLNVRKDLSNAGAHVVDESVVVDNNIVTSRVPDDLDDFNREIVKQLQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein SAV1875
publication title Structural and functional insight into the different oxidation states of SAV1875 from Staphylococcus aureus
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus mu50
molecule tags Hydrolase
total genus 59
structure length 170
sequence length 171
ec nomenclature
pdb deposition date 2015-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4y1rA00
3OT1B 2ISSD 2VRNA 1KEEB 3CZAA 4JQSA 4OJYA 5K4AA 4AUEA 3TTSA 1P7ZA 3PQ7A 3OT1A 4K2HA 4I46A 4Y1GA 4R7GA 4BIMA 1I1QB 1Q7RA 1QWSA 3EJ6A 3PQ3A 4L8FA 3TTWA 4B40A 4XLLA 4MNTA 1CE8B 3CZ9A 4ZDKA 1GGHA 4L7QA 1VHQA 4HCJA 3TTTA 4GUDA 3WFZA 4ENQA 2R1TA 2XF2A 2NV2B 5LIRA 4L95C 2RK3A 3B36A 4LRUA 2WJZB 4B31A 2GHRA 4GE0A 5E9AA 3UOWA 3UGJA 4GE3A 2R1VA 3B3AA 3M3PA 1KWGA 3NONA 3R74A 2R1UA 1QVWA 1L9XA 1JVNA 2AB0A 1OX4B 3L3BA 4BFLA 1KWKA 1J42A 1QF7A 1IPHA 2GK3A 1PDVA 2VPIA 3L7NA 4Y1FA 5SY9A 4D1YA 2RK6A 1OX4A 4Y1RB 3BWEA 3BHNA 1P5FA 1P7YA 4OQ4A 5IP5A 3TTXA 3UK7A 4L78A 1M6VB 1KXJA 3EN0A 3L18A 4OGGA 3B38A 4P36A 2YWDA 4P2GA 4Y1RA 4E08A 1GGKA 1PDWA 4ZGGA 4B7AA 1K9VF 2ZUUA 4Y0NA 4ENRA 1PV2A 3R76A 2ZUSA 2VDJA 2D7JA 3RHTA 4WINA 2ABWA 2AD5A 4E5VA 1QVZA 2NV0A 1ONSA 4OFWA 3TTYA 3D54D 5SY6A 4WXYB 2ZUTA 5SYAA 3L4EA 4N12A 1Q2UA 3CY6A 1CS0B 1OI4A 3ZJ4A 1GGEA 1QVVA 1IZZA 4L8YA 1P80A 2A9VA 1I7QB 3EZGA 1VCNA 4Y1EA 1T0BA 3P9RA 3TQIA 4ENUA 4AJ9A 1S1MA 4ZDIA 1GG9A 2V4UA 4B2YA 4I2NA 4AUMA 1C30B 3NOQA 1JDBC 4ENSA 4I4NA 3ZJ5A 4LGYA 2IUFA 3NORA 1FY2A 5SY4A 4MTCA 1A9XB 1T36B 3SF8B 4UNIA 1VCOA 4N0MA 3P9QA 3TTUA 3FSEA 3ER6A 3EFEA 1WL8A 2FEXA 3SF8A 4UZSA 4AUNA 4UOZA 1PE0A 4P35A 1N57A 4L8WB 1SY7A 1KA9H 3FIJA 3MGKA 4QYTA 5DFAA 1GGFA 4ENTA 4BTEA 3ZR4B 3KKLA 4UCFA 1OX6A 2YWCA 3PQ8A 5BV2P 3NOVA 2YWBA 3F5DA 3P9SA 1I7SB 3UMMA 1SOAA 1QDLB 1GPWB 1U9CA 3UJNA 4MGHA 3NVAA 4ENPA 2W7TA 1O1YA 4B5KA 3F71A 1R9GA 1FYEA 2R1TB 3CNEA 1OY1A 5JZMA 1GGJA 4QYXA 4ADSG 1CF9A 4RKYA 1OX5A 1C3OB 2OR3A 1VCMA 3EWNA 3GRAA 4UOQA 3SOZA 4AULA 3MIIA 2H2WA 2YWJA 2ZUWA 4OGFA 1P81A 2R1VB 2VKTA 3P9PA 3N7TA 4PXYA 1GPMA 2VXOA 4RKWA 3TTVA 4S0ZA 4ZDJA 4ENVA 3CYFA 3PQ4A 4P5PA 1UCFA 3PQ2A 3NOOA 3VU3A 5JZOA 2ZUVA 3PQ6A 4P34A 2LXNA 1T3TA 3R75A 4ENWA 1IZYA 1G2IA 3PQ5A 4OIFA 2RK4A 1BXRB
chains in the Genus database with same CATH superfamily
2BC9A 3HO6A 3NHMA 3M89A 1ZW1A 3BF8A 1XXLA 4LJYA 4LDQA 5CT4A 3UB2A 2IA5A 1XZ8A 2IS1A 5JE8A 2VT2A 1UT8A 2AXNA 4OHWA 3F98A 1H6CA 1XL1A 3EIWA 1TT5A 3EJ6A 5JCOA 2GN1A 3JR7A 5YASA 4IAOA 4ZZ2A 4GI7A 3TTTA 4OHRA 5LDHA 2GZSA 4MJ7A 3BFXA 3WAJA 2VLIA 3HKCA 3GFOA 2Q62A 2AK2A 3N8GA 4DEYA 5BXQC 1N7JA 4CL2A 1KZGB 4D98A 4RYDA 3QTTA 4C4YA 1FNMA 4JCCA 1P8AA 3OIGA 3OX1A 4QA9A 3IAS6 4GE3A 2GXSA 4RLQA 4MV1A 4X45A 4D3DA 1XZJA 1YJQA 2ZG6A 3ADBA 5DRTA 1QIJA 1DVRA 3AIIA 5E38A 1A2KC 3AY3A 3ZVNA 2I66A 1BVUA 4RKQA 5CK5A 4OB7A 4GO1A 3VDXA 5KTYA 3OM0A 1JX6A 5KYTA 1ZN2A 3D7SA 1L5KA 3SZOA 2AE2A 4BO3A 1EX9A 3W0LB 5DTQA 1L1QA 3KQMA 3CVOA 4OQPA 2UUBB 2PUHA 3PCXA 1JW9B 2CSUA 3RH0A 4JXZA 4LXGA 1T1GA 1EJ0A 2E4XA 5C3MA 2ZUUA 1XLUA 1ZHFA 4M36A 4PR0A 4RVNA 5A9SA 1D7AA 4CM5A 1YNOA 1NBIA 4QBTA 5E0OA 2BY4A 2WW8A 4AIRA 3G02A 5TLSA 4MGIR 5K7SA 2VF8A 3QI2A 1CS0B 4DSUA 1EM8A 3PRYA 3KYIB 2P90A 5I4IA 1SBQA 3B70A 4OJQA 4TSRA 1JDJA 3UYLA 3BRSA 3QX3A 2ZYHA 4RK4A 4P4UA 2H9AA 1T5DX 1XTJA 3C3KA 3DCNA 2HMYB 4Q19A 5FBZA 3U80A 2EJWA 3VVBA 1S2GA 1KOJA 4U9IS 3WMXA 4I2NA 5CDFA 1XLTA 1YBAA 4PQYA 2CVFA 5CYPA 1T5SA 3RWMB 5C8YF 4JI2B 1VGVA 1I33A 4QVKA 1G41A 3H5TA 1XRSB 3G2KA 4X64B 3WIOA 4L07A 3QV1A 3DDOA 3PPXA 2XUJA 4C6RA 4Q4CA 1TVEA 2F3PA 2VI5A 4AYXA 4CFZA 1YFLA 1D6MA 1GV1A 4PQGA 5AI6A 3SN6A 1IEXA 4MP8A 2IP4A 4WFIA 1R7RA 2ZCUA 5LLTA 2PUAA 2VEDA 1B7GO 1QGYA 2JJQA 3IQZA 5DRYA 1I10A 5FPSA 4R51A 3G8AA 4V0SA 1V6AA 4X1KB 2VLBA 4TYNA 3LYAA 1F0NA 3F90A 2ZIUB 4OY3A 4TM8A 4MJ3A 3EPRA 1RFGE 2X9QA 3CLTC 3SBEA 4GD3Q 1LS1A 1JAYA 3TOVA 1GXSB 1JDUA 1K89A 1X87A 2I99A 4IUDS 4US2R 2HKIA 4RVHA 1S02A 2A67A 3VX3A 3HY3A 1O6BA 5JBIA 5JAUA 3CX6A 1NVVR 3DNFA 2H4WA 2J0UB 3K0AB 3PGMA 3U6KA 1L3CA 2XUFA 3ILYA 2H51A 1BKSB 3PFFA 4R1NA 3UCXA 2VAVA 2XWPA 2QG4A 4RGYA 2QL5A 4INPA 2PKEA 3C3MA 3BAFA 3LBHA 4UEKA 3HY4A 4G1BA 1N6KA 1V71A 2VYCA 4Q34A 1Q3TA 4HAZA 4L9WA 3FZYA 1PBNA 3CISA 1RWOA 1P6XA 2ZCVA 2GASA 1EFTA 3ANSA 4JDPA 1ZD8A 2OCLA 4HFRA 2YICA 1J22A 4J43A 2REOA 3CZAA 3NH9A 2ZT6A 4MQEA 3S1LA 3VU0A 4KITB 2JVJA 5KYKA 1P1FA 2JNWA 4FHCA 2XRZA 2WIKA 5FTNA 1XOIA 2XW6A 4X1YB 1JPUA 1NFFA 3CZ9A 4FYPA 3CZQA 2CD9A 4LJSA 3RFCA 2BIFA 4FDVA 4CG3A 4C7OA 1U3UA 1JI0A 3CX3A 5HQ3B 1II8B 3I76A 1NGSA 5B3JC 2OKGA 2ZAYA 5COBA 4ENWA 2F3UA 4DM4A 1TM1E 1L0BA 1E3SA 5D8DA 3T7TA 2PS1A 1LRKA 2NTYC 3GZ4A 3TIGA 3UGJA 5DNYB 3HTXA 3V32A 4MB6A 3QM1A 3LZDA 2ISCA 4KQ1A 3D5QA 5CW2A 3UV7A 4M1OA 1N5LA 2PXHA 4RJ2A 5EVCA 4BQRA 4YRPA 2B2CA 5EYPA 3ZWWA 1GG5A 3GVCA 3FZGA 5AVOA 1E4YA 1ZU5A 3AJEA 4NBKA 1E7QA 4DG5A 1NFQA 1MH1A 1OX4A 1X1DA 3DKIA 4QUDA 4F4JA 5G0TA 4AKHA 3C7TA 4LVCA 7REQA 2XRFA 3BGVA 4UTOA 1ZOOA 1E66A 1GNTA 2JA1A 1XRJA 3B52X 3FTCA 3R0JA 4FWTA 3IPAA 4XVQA 3GX1A 4RHYA 3AETA 3U1BA 4YCDA 1MORA 3EDYA 4YP1A 5KJ1A 1C8BA 3ROMA 3OOJA 2QAIA 4K6FA 1LLFA 1KGDA 5ALOA 5BMVB 4OLFA 3SQXA 1GAWA 3DUFA 4TRMA 1V8BA 4B17A 2X40A 4UTXA 2O54A 1U7ZA 2HH9A 5FRDA 1IY1A 4G0QA 1EK2A 5C5CA 1B8NA 4OLJA 3U31A 4QLAA 4UTPA 5HPYB 3GGDA 1E2JA 2Z43A 1D1TA 2GA9A 4N5IX 4BNUA 5CEEA 1H0HA 1GT91 3C5VA 3TEJA 4PAWA 2WK1A 2A9FA 2B30A 1Z0IA 1ID8A 3DEKA 5TIIA 4REQA 4IOMA 1X3SA 1NLYA 1EIWA 3CKKA 2C2GA 2IYYA 2V6FA 1Z82A 2NSLA 3IJPA 3SZUA 1A88A 4CI0B 4DCNA 3A4MA 1YD7A 1CB7A 1GV0A 3ZV7A 3I92A 5KDOA 1N34B 2AI1A 8AT1A 2X13A 3WMWA 5IZCA 3FCYA 1VXRA 4RIHA 2CLEB 1X19A 4RTJA 4OYRA 4XJXA 3O38A 1P4HA 4I0WB 1UC4B 3L0ZA 4G4SO 2QN8A 2X0EA 4W9NA 1AGNA 4PG5A 2GZHA 4Q03A 3V80A 3M4XA 1XNGA 1HK7A 4BB6A 2O8FA 5EP1A 4BV3A 4F4FA 1HOTA 4MWSA 3A6ZA 1SKYE 1A96A 4CKEA 1HI9A 1HXHA 4C3ZA 4ZZ3A 1AHIA 1EMDA 1OU0A 1TZMA 2GN2A 2M32A 1Z3CA 2YFKA 4N0QA 2X3UA 2RKBA 3WGGA 4ZZ1A 3UJ6A 3PP8A 2VHVA 3HSYA 3K0FB 3OLZA 2HIAA 4K6HA 1A8HA 2YWJA 1JFFA 1PV1A 4AJNA 5C5EA 3OTOB 4R8VA 2H2IA 4QPNA 1TC1A 5A0FA 1ZUWA 3CPJB 4YJKA 2ZI5A 4ZU1X 4E22A 4EW2A 2YS6A 3I52A 5ALWA 3RJ5A 1AUQA 1E99A 1C3LA 1T6YA 1W94A 2AQHA 3FHJA 2E2WA 1NI3A 3GGOA 1NUPA 4UFNA 2YUTA 3D3JA 1X1SA 2TS1A 3KP1A 3ZH2A 4K5QA 4F5YA 3GJSA 2B8NA 1F8GA 2GBIA 2EBUA 3ELBA 3LOUA 4RL6A 1RR6A 1QH8B 5T4FA 2AJLI 2C58A 4RY0A 4IY1A 2W83A 3M1IA 1USVA 1I3OA 2GO1A 3NAZA 4K6MA 1TJYA 4MQUA 4EFNA 5AUNB 3UG7A 2ZZNA 4GUDA 1EX7A 5AKLA 1NJFA 2NO6A 2P0AA 2LVBA 4A9AA 4L95C 1N2GA 5LIPA 2EC5A 3WRYC 1A9RA 1H3FA 4TSFD 1G1MA 4G67A 4RPCA 3WWDA 4DSAA 1PFVA 4X90A 3TF5A 5COQA 3EQ9A 5JY1A 4UC0A 2RGBA 1D2AA 1M1XB 4PQEA 5K3AA 1TD1A 1QF6A 4WN3A 3V4RA 4WY2A 4DL9A 1T5TA 3I23A 3AK4A 4DSZA 5ES3A 3O2NA 1BNCA 2MJLA 4MQMA 2FZ5A 3RVLA 5I9BA 4CL8A 4Y0AA 3TCXB 4YJFB 2RBKA 5C5IA 1IOLA 1BS9A 3IIMA 2WZQA 2BMEA 1DKPA 2OILA 2EWWA 1JT9A 1K6IA 4UD2A 2GCNA 2DH6A 1JEQB 1XZKA 1ZN9A 1IHUA 2YWEA 4NAHA 4U8HA 5BOVA 3H1PA 5FBQB 3TDMA 3W5VA 5F98A 2ZVPX 4BX0A 4XAQA 3DGEC 5LA6B 3JYHA 3TI9A 1XF9A 5K8IA 4KHZA 2X2FA 4DLBA 4U1RA 1SXJD 2Q21A 2Q45A 1GWNA 4JP1A 4KKVA 5KINB 2GRAA 1CRLA 1O5TA 2B6HA 2FR8C 1RJFA 4LWQA 4R0VA 1Q2UA 1L9KA 4S05A 4MAAA 3QKTA 2OXFA 4H59A 2NO1A 4JWTA 2A5LA 1EWTA 1QP4A 3A32A 4L15A 4E2WA 2WILA 2LWIA 1Z6QA 2VPZA 4LV8B 3FMFA 2WIFA 1C9DB 2OXRA 2DQKA 3CEHA 1LQ2A 1MENA 1YNSA 4NZOA 2BHSA 2QW0X 2G4LA 4E15A 5JH7F 5FFMA 3IELA 4MS3B 1M10A 3PGXA 1E63A 5IAGA 4MGZR 2WU0A 1UJMA 1WMSA 4FE4A 4KRYA 2E21A 1GYRA 3DBLB 3LKVA 4PYJA 1U3VA 2GRUA 4QAQA 4DIBA 1Q11A 3M2PA 4HWGA 4DIOA 5C2JB 4MDEA 2JZCA 2WJGA 1E3IA 1M0EA 2HA4A 4P58A 1WSDA 4PNPA 3WB9A 3NHYA 3WQRA 4IZOA 4C14A 4OFXA 2AV6A 2XB9A 4NESA 3O8QA 6REQB 2I5PO 3I09A 3KEOA 4O4IF 4IJQA 3VZCA 4DIUA 3RC3A 3U44B 2GGSA 2N75A 2YJ6A 1YDWA 1DAMA 2ZETA 1SG0A 4MKIA 1JHAA 1ST2A 2HLNA 4FR0A 1EFUA 4FOSA 2BBOA 4L5YA 4S12A 4ZVUA 5AUPB 1K5HA 1X1RA 3P9YA 3DCYA 1G64A 1PUIA 2J0EA 1YASA 1FXWF 4YQZA 4MUFA 5KTSA 3I1YA 1VRCA 2FSGA 2C7OA 5IMSA 2FQ1A 4C1NA 3CJRA 5J2TB 4MKGA 3HB0A 2JCBA 4MVJA 3GWGA 3CX8A 4DTCA 3DTTA 3G7SA 3CG4A 4KNYA 3JQ8A 3F5FA 2OV4A 2HBZA 4BLUA 3DLTA 2DKNA 5CLQA 1U80A 2C1XA 5CM8B 1D7OA 1T2EA 4KH0A 4DJEC 2WQ7A 3TEMA 1ZMOA 3TIIA 3OSZA 4B40A 1W35A 3NT4A 1DC8A 3A1VA 1DRWA 3I5AA 1Q21A 5IANA 3OF5A 4HGPA 1QPBA 1U7PA 1E2LA 5ICSA 3QNMA 4PSAA 5IKMA 1RWMA 2VCEA 4P81A 1L4FA 1G8FA 3SS9X 1YA4A 3MWEA 4E5SA 3PGLA 1E2KA 2Y71A 3FKQA 3KPVA 3KHUA 3P0RA 3TOSA 3ZWVA 3B3AA 4E21A 4ZQEA 5I9NA 2PS3A 1M1YE 1NJSA 2I2DA 4H1HA 4A8PA 4LISA 1Q95A 3FFBA 3LK6A 4PYRA 2YIMA 5JTUA 4RVUA 2FCAA 1JQDA 1E3LA 1TECE 4CEHA 4LNHA 2GK3A 3P1JA 1ITZA 1Z38A 3LD9A 2MT9A 2XNCA 2ZRAA 1UM9A 3M6IA 3NM5A 4N0EA 3WXMA 4HLDA 5CA0B 1VE9A 2RHWA 2MYNA 3GEMA 1U6KA 5J40A 2QMOA 1WDWB 2MCFA 4ZYLA 4FFNA 1U98A 2GTPA 1CHDA 4JLBA 2GI4A 3PLNA 2BFCA 2CZCA 3W34A 5F77A 2XYHA 1J06A 1VMDA 3NHJA 3SKVA 3I4LA 4DLLA 4IV0A 1O03A 4BMXA 2F3RA 1RJ9B 4UUBA 2V7QD 1ZXXA 3STUA 4R0NA 4DDWA 4JEIA 1X8JA 1U0EA 2VUHB 3KZKA 2FQWA 4AKGA 3U49A 2ZSIA 3GEEA 1OFUA 1GPAA 5JOQA 3IBCA 1PEAA 1MNQA 1WZCA 1GCOA 1U7HA 2DE0X 3SC4A 3SM9A 1EBUA 3IDAA 3KKQA 3NTVA 4OU5A 4RTMA 1C41A 3L40A 1SURA 1Z6XA 1OFTA 2D2VA 3DXXA 4J1TC 4PHHA 2PZEA 1SQSA 2H7CA 2PG3A 2ZKIA 3LVQE 4Q3LA 3RUFA 3B6ZA 3NEPX 4U7FA 1Q3HA 1FJ2A 3KUCA 3A9SA 3B8HA 3K1JA 4G5GA 4Q82A 3SE7A 2X23A 2P91A 1BVRA 3MJCA 2OORA 3D5TA 1H9AA 5AKYA 5GJVC 5B6IA 2XH8A 3PR3A 2W2QA 3JQCA 1ZU4A 3GUZA 1KIMA 2VJYA 3L41A 3W1VA 4BNYA 5G4KB 1P45A 2QM7A 1SUCA 5HZMA 4LJRA 1YI0A 5IJ9B 4B2LA 4HDCA 4RVSA 3ZGNA 3LZ6A 1HDXA 2R8PA 1N7IA 4OLBA 3MQ4A 1XGKA 4B3IA 4GG1A 2CHFA 3G59A 1DTSA 3REQB 5DYTA 4Z2YA 3D8NA 2AK3A 3LC1O 3EY4A 2WR8A 5JAQA 3IQFA 3KFVA 4XA8A 2PN1A 4YACA 4DYVA 4LUCA 4JOQA 2GBLC 2ONKA 1PWHA 2OFPA 2RBEA 1ECLA 4AMBA 3B3FA 3GJ0A 3LUPA 4YI5A 2VTVA 2F6RA 1BIFA 1X7DA 3GH3A 3LQ1A 3DV9A 1RIIA 3WC4A 4RFLA 2WKWA 1GSIA 1TK2A 1W0KD 3AY0A 3HXPA 5AKZA 2Y1XA 3UN1A 2JCYA 4HTFA 1YZVA 2JW5A 4J16C 2PL1A 4LMAA 3R6WA 4HP8A 4ND4A 3KFXA 4O1HA 3G2IA 1IONA 5T3YA 1DO8A 4GI1A 4ZOBA 5C52B 2F64A 3NI2A 1H2EA 3PEUA 5AKKA 4R7TA 1D0IA 1S3GA 1EFAA 2ZQYA 3DAGA 2E4ZA 4ERNA 3TXXA 5ADWA 3FF1A 1BXRB 2NXCA 3I9KA 3JCZA 4IF6A 4MW4A 4OL0A 2WTMA 1R0LA 3NR2A 4XIIA 3H97A 4FMPA 1OFHA 3DJYA 1HYHA 5F7XA 2V7VA 2JHGA 4K9MA 3G0HA 5BNIA 1EK1A 1OXXK 5JSKA 2E5WA 4HWKA 1PW7A 5FDFA 1BGVA 1RYEA 1B76A 1KI2A 4JLWA 4DPMA 4X8MA 1I51A 2LDBA 1YK0A 3DLAA 3PJDA 2B4RO 4JOCA 4FHEA 3F49S 4PFQA 5PGMA 3TLEA 1E9CA 4RZ3A 3IIKA 4EPXA 4NS4A 5C1DA 2BGLA 1JAZA 1ACLA 5DHSA 1Y9EA 2C00A 2CMFA 5AVYA 4I55B 3L3BA 2IBTA 1QP7A 2QTTA 3DW3X 4Q3CA 2P2DA 1YH3A 4XQ9A 5K8UA 4DCUA 1ULSA 1HNZB 1NZDA 1F14A 4G86A 1FDWA 3COWA 4LF4B 3L5OA 4OBBA 3M6FA 2QGNA 2C1EA 4QUJA 5LKRA 1A5SB 3ICOA 3A4YA 3UW3A 4Z51A 2XQVA 1ODJA 2ZJ3A 4HGNA 1N0VC 4ARSA 3FRJA 2PD4A 3H1AA 4ID3A 3OQJA 1Y3CE 4R8MA 5E8RA 4ZI7A 2FEMA 3KKMA 2C57A 5AUOB 3LYLA 4OTZA 2MTBA 4MI3A 4P0TA 4ZQCB 3AFNA 3AKCA 3IYLW 5SYAA 2JCGA 1R0BA 2EKQA 3VQTA 2H63A 3SSOA 3V00A 2OA0A 1FYXA 2R8BA 1YS7A 1FEZA 1JTVA 3DHVA 3IDQA 5HGJA 4E46A 2ZVJA 3RFXA 4DMLA 3R3VA 1K98A 3EVGA 1RP7A 2XBMA 1GEGA 1H2WA 2NPFA 1PSZA 1JIIA 4AN4A 5KEIA 2FETA 1VE1A 3QNUA 4MS1A 1NBMA 1H1DA 3NTXA 2VF7A 5IJZA 3TDKA 1KJYA 4HF7A 3OT5A 3W2HA 1CQIB 1QK5A 1BXGA 3O82A 3QYJA 5DV9A 2ZCJA 4MWBA 4IZ6A 1IZ7A 3GK3A 1ZGGA 2XTAA 3PVSA 1SCBA 4HJRA 1OUMA 3UGKA 4Z0TA 3DO8A 3RVNA 3ZR4B 2XJ4A 1WEKA 1IK4A 2DH5A 3DSRA 4IFTA 4FN4A 3X1WA 5T4EA 1V8ZA 1BEZA 3ZHXA 5FL3A 1Y42X 3HPQA 2ZI4A 2NU8B 1H69A 1BMFA 4TQGA 3LSYA 1E89A 1TM2A 3LC7O 4JJIA 1F4VA 2EJUA 5A6VA 1NVFA 1QYWA 1OVMA 5M29A 4UDNA 3FYTA 4BGDA 3BD7A 1CVLA 4L3OA 3TGWA 3ZNPA 4D1YA 3VR5H 4WLFA 3WYAA 3MIIA 4KYVA 1SCJA 2G5GX 4LWOA 4NDNE 5EWMA 1NUAA 2Q2WA 3EG5A 3KJIA 4GPBA 5J5CA 4L9SA 2GKOA 1GCAA 3AHGA 5KHOC 2OG1A 4K9KA 4LTDA 1TYCA 1U8ZA 4YXWA 1GITA 1H2XA 4NR0A 1Y5RA 1FUKA 5DNAA 3T3MB 3QYFA 1NASA 3I04A 1HE4A 4AECA 5KJCA 3KELA 2O8BA 1ISRA 1SOVA 2RHBA 4BWGA 1F48A 3SEZA 4C3UA 4LXYA 1U02A 5K4AA 1TT5B 3WRXA 4ZAYA 4OQDA 1OLSB 3KPJA 3U2QA 1O8CA 2PPLA 3QWIA 4KOAA 1XK7A 3Q5EA 1N6HA 2OZKA 1KAQA 4KV9A 3V97A 3GT3A 3M6AA 1WXIA 1UDAA 1UPAA 3TLAA 3L7DA 4O4LB 5KO2A 5K05A 3OCUA 4KR2A 3ZV6A 4J2OA 1OT3A 4MO9A 4YCCA 3TIVA 3OQIA 4X9XA 4C3OB 3ZS8A 5KYWB 3MZ0A 1LVUA 1T35A 1PFKA 2HJRA 4HD8A 4JR1A 1L4YA 3ED5A 4MTLA 1NVAA 1IIRA 3ZLTA 3EDRA 2O8CB 2I7TA 4M1SA 4J8PA 5JATA 3H8WA 3SYRA 2ZIAA 3D2AA 2BMDA 3U3JA 3ITKA 1W0JD 5T8KA 5AVXA 1TVKB 3HDHA 1T4CA 4LPKA 1UMDA 3AL2A 2PWZA 4PZ9A 3OCWA 2QK4A 4XQGA 3V4VB 3U7QA 3EK2A 4NOLA 4F3RA 3TD2A 4I50F 3EOAI 1X13A 4JQCA 2R9VA 2I8AA 2ZRFA 3PXCX 2Y0EA 1PZXA 1STOA 5L51A 2WWIA 4IMJB 3LLMA 1QQAA 1KERA 2NVUA 3R8XA 3R0XA 5EEGA 3KKZA 1N2EA 2GEKA 2IXTA 1QQ6A 2RIPA 4HXGA 4N12A 5DSZA 4AX4A 5A0VA 3I9V1 3KCQA 3B9BA 3OMLA 2ZRBA 4B4OA 5IWAB 3H2JA 2AJDA 3NHKA 4ZCQA 3VR6A 2H65A 3ZKWB 1YVUA 2XRYA 1OASA 1WOYA 3GN2A 3MXTA 4RVCA 4GXQA 2F55A 4A2WA 5B4VA 1MEEA 1NAIA 3ROZA 3BS4A 4BVEA 1QIFA 4TV9A 1WTAA 4HOYA 2NW6A 1XAHA 4WFKA 4FFBA 3GLKA 3L6RA 3S7ZA 4YDHB 1V8OA 3T5GA 2GM9A 2CVZA 5JJKA 2PSSA 4X41A 3P4UA 1D1QA 3HV0A 4U6QA 1OIWA 5CYFA 1SU4A 4EKDA 5KNBA 1LS6A 3EFEA 3IMEA 3JQQA 3QBVA 3UJ7A 2UXCB 2CDAA 5K45A 3L0PA 4D9CA 1J2RA 2JFVA 1JB9A 4MO2A 3SBXA 1JSCA 2Q6OA 4BPRA 1G7RA 3NOVA 5CXQA 1CUCA 1JXMA 2A3RA 3S70A 4LGMA 1LD3A 1MXHA 1SOAA 4NBNA 3UMGA 3WDMA 5B6JA 4Z4EA 3DO6A 5LDGA 1OI7A 2O2CA 2XF8A 2ZB7A 4WAUA 3C8MA 5C4GB 4KI7A 2C2OA 2HXSA 4RMGA 2PSJA 1RBMA 2RC6A 1EFKA 3DZ8A 4JU9A 4MPDA 2HDWA 1LLUA 2WI8A 2ZI3A 1QIHA 4ZCLA 3THXA 3L7BA 3UV3A 1GNRA 3HZHA 1YCHA 1MO6A 1AXGA 3Q7TA 4X44A 1WW8A 1PJQA 3RJZA 1KC3A 2VXOA 4NMMA 3CFYA 2EX4A 3FCUB 2XYPA 1PDOA 2FUEA 4QKQA 4INAA 4CETA 2DR2A 4JV5B 1AX9A 4MHOA 3FLMA 4ZXFA 4EZIA 5DULA 2DYKA 4DWJA 5JCPA 1QLWA 4MJXA 2I71A 2WMYA 5ES4B 4AJKA 4JSTA 2Y6VA 3QHQA 1Y48E 3LQQA 4WXMA 2WIJA 3GA7A 4AURA 5IVKA 4IIYA 1JDTA 3PDCA 3IUYA 5D7BA 2JGLA 1P5RA 2PZKA 3ASYA 3H9GA 3ZVLA 1IQRA 1U7OA 1ID1A 2WDZA 5L40A 1R8YA 2B9EA 2HUPA 4ITVA 3BJMA 4GZLA 3E5MA 2C0PA 4FCWA 1ZBDA 4XDGA 3TZQA 3DQZA 5LIRA 3ZK9A 3URKA 1KK2A 2YY6A 2CKDA 1K0FA 4AXXA 5K3DA 3J81k 1GPDG 2CFSA 3H9EO 3L6BA 4GE0A 4P5EA 3SGLA 5LP6A 4FSHA 3AF6A 1ADBA 2FYTA 4BJ1A 4OO3A 1PZMA 2NZ8A 1QYVA 5T7BA 2NP6A 3TK1A 4GLFA 2GPNA 1T0PA 2I54A 1IBRA 1EE9A 1OX4B 1T0HB 2FJPA 3IKLA 3LC2O 4O2BA 1UXJA 2PMEA 1W2WB 1K5GA 5SY9A 3HN2A 2AYYA 2P0YA 3A4VA 3GPCA 1ZRMA 3OQHA 4NECA 1FBNA 3AETB 4YPFA 2BN4A 1KVUA 3G0BA 3KZMA 3OF3A 5L4NA 1AKYA 5JYBA 2O0KA 2EKBA 4ABYA 4LRQA 4I8IA 1II0A 1Q12A 3I5MA 4H3KB 3I5YA 1H4SA 4PX9A 4TT8A 4V3CA 3ZJUA 3A1WA 2O5EA 1YJ8A 2C29D 2OWDA 2GFIA 3EDCA 2YOFA 1U31A 4U63A 3HABA 2H57A 2H31A 1XTUA 2JJMA 3DMTC 3RUDA 2AUMA 2ZI9A 4PNHA 3DDUA 4HWSA 4EG8A 2V03A 2QG6A 4HEHA 3VH1A 3U7GA 1AKTA 1XQXA 4Y2XA 3KQUA 2EW2A 5LNK6 1Y4UA 2VP4A 1WLYA 3KKPA 4GU5A 3VU1A 4RXMA 2Y0BA 1WW2A 4MUHA 5HFAA 5I9TA 3WLFA 1GKYA 3DM9B 1OFGA 1F06A 1Y1PA 1XA3A 3LCMA 3M4NA 4DB2A 3AZQA 2Q3LA 1LSSA 2CB0A 1UP6A 1HTBA 3MS2A 3ZHBA 1Q0PA 4YYEA 2J5KA 4LXQA 4URVR 1H2RS 2FMFA 3V2IA 4MKZA 4YUYA 5I7SA 5K3EA 3FWPA 3K0KA 2YH2A 3LOPA 5JHHB 2O8FB 4IEEA 2BLNA 3LX5A 2WMNB 1CUWA 4NE9A 4ZCPA 3OIFA 2ORVA 3MINA 4RPJA 1WP9A 2XCTB 4P5DA 1UQRA 4FEGA 2K2QB 3DQQA 1WZUA 5CEFA 1CSEE 1BW9B 4OHVA 3IVMA 4GR4A 4EOGA 2ZSAA 3DS8A 3N0XA 1ADYA 4I9FA 3U56A 1JFFB 2G1KA 4E94A 3A3PA 2VBFA 3L7IA 3SOZA 1R5OA 4J4TA 3Q98A 4YHBA 3WGNA 3H83A 2WZCA 2V1UA 3L8CA 4I1IA 2B37A 5FWAA 4KWEA 3Q6NA 2PA0A 2O2XA 4HADA 2IYUA 3CZ4A 2C0QA 2PRJA 1JJFA 2WG0A 3KEQA 4D3ZA 2ODAA 2ZRQA 2GCGA 4Y7DA 3TL2A 1KL7A 3VBCA 4ILEA 1GRRA 1S8OA 2VDMB 1Z6AA 4QASA 1ULUA 2RHTA 5CBKA 3HO8A 1T1IA 4X65B 2FB9A 3OA2A 3C16C 1BHJA 1Y1RA 1BE8A 5E6SB 2GBFA 2YC2C 4DANA 2YHAA 4KFRA 3QIAA 1ULHA 1Z6PA 5IT4A 2GQ0A 1XQ6A 2PR2A 3VPAA 3AB3A 3JWIA 1SD5A 1MA3A 3V4PB 4CODB 4EQZA 2OGUA 1TMKA 4H15A 4LSZA 4JYBA 3VR2D 3WLOA 2BFMA 3AV0B 1C9KA 5IABA 4P0QB 1P3JA 5JDIC 2GNPA 4DMUB 2FWIA 4XM2A 3FMVA 3HU2A 2NO7A 2OXTA 4GLJA 5LXTF 4TMKA 3MJ4A 2QYSA 3OJEA 4PRZA 4W5JA 1L9XA 5LQJA 3SQOA 4KX3A 2KJQA 1K7EB 1Q0TA 4EITA 1PR9A 4FDAA 3AUFA 3LUDA 3D4IA 3D8RA 2HIHA 2PWBA 3H4TA 2DM6A 3VPHA 2ZJ2A 3TIXB 4LYEA 4R3UC 4MPJA 2O2JA 1H94A 2QQGA 4CZ2A 3QVLA 4QGFA 5KREA 3DZFA 5HF8A 4D8VA 1N92A 2AR9A 3II6X 4K9PA 2PKWA 4W7SA 4GW3A 4YDSA 2HXYA 1HRKA 2ODTX 2VZ0A 1O08A 1I3NA 4HVAA 5LLSA 1C7EA 2PX6A 3IO3A 4KX5A 1GIAA 1ONSA 2X2OA 3SMVA 4HAXA 2DBQA 2OAP1 2AFHA 4WIAA 4FBLA 2QQFA 3QGMA 5BR7A 5CX4A 3MJSA 4DJDC 1EX1A 3Q2KA 2CXOA 4TZ0A 2D1YA 3BVPA 5AW8A 4DA7A 1NM5A 4BU0A 1UBKS 3FI9A 3NWOA 3L07A 1G9SA 5KYNA 2Q0HA 3WGJA 5HS4A 2WU8A 2EYUA 3GNQA 5A0TA 2PMKA 3G1TA 1E2IA 5EQDA 5C80A 4LDRA 3TB6A 3ZV5A 2UZ4A 2YVKA 3WGTA 2H5JA 4YUZA 3UZUA 4OSEA 2ZUDA 1N75A 1KJWA 1KI6A 4Y9DA 2SECE 4BNDA 1CEQA 1VPDA 2I3ZA 5EUQB 1UAYA 4QZVA 3A1EA 2XRMA 2ZYGA 3LMKA 3PDHA 4DLKA 3OIWA 1C4OA 1M1NA 3NRCA 4NU5A 3CVWA 2HLDD 4NEGA 1YUBA 3Q72A 4OP2A 3ST7A 4X6XA 1Q0LA 4BFVA 3R7SA 4M2LA 1XZGA 4M8IA 3OTQA 4LJLA 3O8QB 4LDZA 3ESCA 1OC4A 4MWOA 3UAGA 1JDVA 4OXIA 5MFZA 2G82A 2ZB8A 4HDAA 3E81A 4PFJA 3M6WA 4RA6B 1OTYA 3IXQA 3AGQA 1NXSA 4M0KA 4HBGA 4IZIA 3VMMA 1VHJA 1Y37A 1VC2A 2JFBA 4WV3A 4KOEC 1XHLA 4LBZA 4Z9YA 4TL9A 1VL8A 2QVCA 5CGZA 1D2NA 2IZZA 3AFIA 3I72A 4DGSA 3PF8A 3F46A 2GYWA 2HK6A 4MYUA 1L7XA 1QV9A 5BOSA 4QOJA 2CNLA 2MSCB 2XBUA 2HYDA 3HJCA 4LOLA 4H7PA 3RK4A 3HEBA 4WFQA 4KO4S 3M3DA 5C53B 1ZOLA 3AM5A 4HQNA 4MVJI 4JSYA 1CJSA 4K9DA 1Y8ZA 3F7MA 2VOJA 1VDZA 2GDZA 1FBTA 3KJFA 4OJNA 1HL7A 2OCPA 3BHMA 3M3PA 4IW3B 3HYNA 4PICA 1SB8A 5CM9C 2QLJA 1EWQA 2H00A 3KPYA 2C4MA 2BMVA 4OG2A 3ZQ6A 5K3FA 1MU0A 1UFQA 3NYWA 3HCPA 3NDPA 4OF4A 1JE0A 5HA5A 4ALJA 2IOYA 3TTWA 1F6BA 5KNDA 4MGEA 1VHQA 3M70A 2MSEB 2YNMA 1CKEA 2KX7A 3G5LA 3PYLA 5H16A 1IUKA 1PGQA 2EFCB 2YMMA 5IYZB 2D1FA 2Q7OE 3RC2A 2Z5GA 4BO9A 1JIJA 3U7RA 2AW5A 1QK4A 2OHGA 1ISJA 1Y6RA 1CUEA 2YXEA 3GP3A 1SVIA 4L22A 3I2HA 1MG5A 4PIVA 4Y9RA 1EB8A 2RI6A 3WL8A 4YRTA 1PG0A 5U4XA 4CEHB 2O9JA 3UK1A 1J2JA 5FORA 1P17A 3VDNB 4ZTBA 1U2DA 2QTGA 3JQDA 3S27A 1YRWA 4K3UA 3WNVA 4EA7A 4BKUA 1DKLA 1YFZA 4HLUA 3GJ6A 3BMCB 3BRQA 3CW9A 1TM3E 2I6UA 3HWSA 1WUHS 5C1IA 5D86A 3KT6A 2BFCB 4KBGA 1YA8A 3WJ1A 1DBPA 2I2FA 3L8DA 4I1VA 3SSAA 1Z26A 4B5LA 2QYHA 1DFHA 4HH0A 1BROA 5HFJA 3K30A 4GEGA 1YC2A 2Q07A 4NE2A 5CDFE 4P38A 5IHPA 3ZY4A 5ILOA 2WIDA 1M1ZA 1OIXA 2GCPA 3GEPA 4U0JA 3GNSA 2AD5A 4Q4JA 3UT0A 4EGSA 5GONA 2DY0A 5AJZA 1V0JA 4IHQA 4KK3A 1HFKA 1JALA 4PG4A 3SVZA 1KFJB 3BRWA 3KSRA 3R77A 4HRXA 4JUAA 4B9EA 4RY9A 4RDXA 4L8YA 3ZWAA 4NU0A 3OKAA 4M7RA 3KLOA 2LD4A 2FKNA 2EU8A 3OF2A 2G88A 2R60A 5ADVA 2H59A 2R00C 2CBGA 3T7RA 3WQHA 4D74A 1OBOA 1VHWA 5G3YA 3MCZA 2VYVD 3KHSA 1L8OA 2JLRA 5CTJA 1LH0A 3PNQA 2ZTSA 2PVSA 3E22A 4R6WA 3ZQUA 5BV1A 3F7NA 3QKWA 3NORA 5ECGC 4XIFA 1XQYA 2HCFA 2RGAA 4P4GA 2ZYSA 2AFVA 5H5JA 4DBZA 1BOFA 5FJIA 2WRZA 3H05A 1NTOA 2AZDA 4CTJA 1ZM9A 4DC9A 4DE5A 4S04A 4I5GA 5IVDA 2ZT7A 1J21A 3MW8A 3RQIA 2XBLA 3G68A 4AUNA 2JFXA 1E9FA 1JT2A 3JQFA 4O1MA 5CP8A 5C35A 3D6NB 3GV0A 1L4NA 1R6TA 1T8YA 1EHYA 1DRKA 2QR2A 3AP2A 3SP1A 3Q5GA 5HWSA 1NL3A 2FX3A 3G0DA 1P1KA 2LTAA 4DLSA 4JJAA 3OU6A 2B99A 4E0BA 4AT1A 4XCQA 2ZJ4A 4U7JA 3DW1X 4U5QA 5ETJA 4CR7A 4U39A 4JI1B 2G9NA 2YW2A 3MOIA 3U81A 1TI7A 1XP5A 1OLXA 1QFJA 5CVJA 1EG2A 1KF0A 4ZVRA 4QQRA 2NN3C 4W8GA 2YY7A 3HKEA 5TC4A 4GNKA 4HTFB 1H0SA 2ZJBA 4WZBA 2HA7A 3KM0A 3P4XA 4U2DA 1ZCBA 4R9SA 3SEFA 3FDJA 3C5WP 3TSOA 4CMEA 1IRIA 2YX1A 3I5UA 2J7PA 4D57A 1IUPA 3KVVA 5ELMA 3ZWPA 3IDOA 2PX8A 1OW3B 2DT8A 5G1PA 1KQOA 3AW9A 4KUEA 3EVAA 5D6NA 2JI8A 4DF3A 3C14C 1Z68A 3Q40A 3PHIA 2OO5C 4I6EA 1SVMA 3SMQA 4I1PA 5KTNA 4ZVTA 4B8ZA 3WY9A 3DOOA 1KDTA 1ZITA 4W8OA 4OMDA 5KTOA 3AU8A 2Z0MA 4ZC8A 1GPYA 3AH8A 1BS1A 2FHSA 3H2BA 4F5ZA 1U0GA 2I22A 5FLEX 2QSZA 4UBNA 3ZLUA 4K6OA 5JXHA 4FXOA 4MW0A 3ND5A 4LA4A 1KO5A 1NOKA 1ZJZA 2NXWA 1KEVA 1XU9A 3KPUA 4FNOA 3L4JA 1GQQA 5LL6P 2QIPA 1ONPA 3INYA 1HE5A 2WKPA 5CCDA 5DN6D 4OEHA 5BV0A 1QO0D 1SOUA 2WIAA 5INTA 2Q5HA 3TZCA 3MWFA 5KNDH 4KQHA 3VR4A 2HCJB 2PANA 4XKJA 3MLEA 5K20A 2V6BA 3RFUA 2XY4A 4ZD6A 3UV6A 3B6KA 1TU0A 3E2PA 1QUFA 4M9QA 1G21E 2XMRA 3G5TA 2PRZA 4AICA 4B6PA 1RYHA 5AW1A 5JVDA 4OKNA 4QYSA 1CY2A 1FRZA 3WNDA 2Q3CA 1KEEA 3PG5A 1SVOA 2BONA 3RKRA 4EDFA 3FCXA 2YWDA 4O59O 1OBCA 4ZI7B 1SHLA 3D8UA 4ZVKA 4FHDA 5IPFA 4H0NA 5K5EA 1AS2A 1U7XA 2BKXA 3EVFA 3HFGA 2XMCA 5SICE 5AM4A 1Z25A 3OKPA 4K3VA 2J5QA 2KHZA 3V6MA 4R1QA 1IATA 2UUCB 5L45A 4MVWA 2R3SA 1XTQA 3UW1A 5BVHA 1KFBB 5DBIA 2JFZA 2JBWA 3DT6A 1PQPA 1PEYA 3KZNA 4QGAA 4ZAWA 1FNCA 3RDPA 1E98A 2PVPA 4AK9A 3K71B 2COEA 1JR3D 1QE0A 1QG2A 3CW8X 3EAGA 3N2LA 5KTPA 4Y67A 3CUVA 3IUNA 2IPOA 1RIFA 1FCJA 2C84A 2D62A 3RQSA 1O95D 1JJIA 2D8AA 2V4UA 2YN0A 3DE7X 1W73A 3F0TA 3FYUC 3QOYA 2ATXA 1ZK0A 3GNLA 3R6GA 5TS3A 4KEAA 1N3YA 1J8QA 2XHZA 4RCVA 2FSHA 1W5EA 4BDTA 3FOCA 2VT3A 1NVMB 2WWFA 4K6KA 4ETWA 4O3MA 3E5HA 1B6TA 1P4JA 2NUAA 3TQSA 5BURA 3IL2A 4ZQIA 3P7MA 2IHNA 2QOEA 2YJTD 4DIDA 5A2GA 1TK9A 4OP3A 1XCOA 4IDEA 4GSLA 4A3SA 3A0UA 1Z4MA 3LZCA 4DDKA 1OE0A 3VKVA 1GGFA 3EPKA 1A04A 1T5OA 2CXRA 5DGIA 5IW8A 3PTAA 3P9SA 2G5TA 3WOVA 4AQ7A 4LHZA 2A92A 1GPWB 3SXPA 2HA0A 1P7WA 4E70A 1E1CB 1ZNQO 4QDKA 1GCUA 3EA5A 4YJ3B 1ML4A 3CRNA 4OA8A 5GJCA 4Z4QA 3JX9A 3L4BA 4NZPA 4D4GA 3DXZA 4YFVA 5HZKA 2V45A 3HXMA 1W1UA 3H2YA 1C4XA 3TVYA 4Z2AA 2WPDA 2ARKA 3B5EA 3KUUA 4ROTA 4AMZA 5F2KA 3ADCA 2BHRA 5DBOA 4EL0A 3K5WA 2R96A 1PUXA 3FDFA 5I51A 1KVQA 1W88B 4DIFA 5H9VA 3UJPA 4IGAA 1OWMA 2IPLA 2WSBA 4IJUA 1MIOA 1Y4SA 3OJOA 3U09A 3ONEA 3VO1A 2J0SA 3EIHA 5EJEA 4CQMD 1FU7A 2EX0A 2M2IA 3NFYA 2FZWA 4JKOA 1JZSA 4MROA 3GP8A 3OLXA 3C70A 5JALA 1U5CA 2LV8A 3T9CA 3QVGA 1UZNA 3FOZA 4I9HA 5IT9A 3RUHA 3V7NA 1SXHA 1FDRA 1J8VA 4K2HA 1H5NA 3DEIA 2WKQA 3G9UA 1OH7A 4EAQA 1ZRSA 4LZNA 3IEMA 4F60A 5I3CA 1P74A 3OQIB 2CF5A 3UCFA 4GC9A 4OB6A 2D2FA 4TTTS 2O5CA 3B2NA 4TGLA 3V6LA 4GXNA 4BGEA 3CZ5A 1RRPA 1EEHA 2AN3A 2WBLC 3ONWA 4HQ6A 2K4MA 4U3JB 1GO2A 1FU4A 2V0NA 4LCBA 3ZYZA 2XGMA 1P3Y1 2AEFA 4C7JA 1X8KA 1SUEA 2FEWB 2PS0A 1UIMA 2A14A 2Z2ZA 4CRWB 3O7MA 5HOEA 1YZKA 2UVDA 4QUKA 1T4CB 2PKXA 4R7ZA 2OYRA 4R3NA 1PQ4A 3G6KA 2GJAA 1O97C 3MCTA 4GVLA 4HLNA 4LI3X 3DDCA 4LIPD 5JCOC 4BNKA 5LU9A 3HDVA 3O1HB 3EQ2A 1G8GA 1PYGA 2C9BA 2OV1A 3LY7A 1KI9A 1VLQA 5BV8A 2G76A 1JVSA 5IJWA 2HV8A 2HRZA 3VR4H 3F5MA 1C9YA 2BM8A 5E9QA 2L0XA 3QLEA 3C3WA 1ZCZA 2IBSA 1CQZA 2VPYA 2J5RA 1U0RA 1EZ4A 1IXSB 1HH4A 1T4GA 3L7KA 3NXKA 5F1OA 3HXLA 5FNVA 1T8RA 3RABA 5T41A 4DZZA 1CV2A 3HA3A 4QOFA 1ATZA 3MHTA 1FTQA 4X93A 2Q6IA 3MUOA 5LB4A 1TMOA 2CUKA 3NC4A 4FNAA 2FN9A 2R11A 4PCLA 4B46A 4C0QC 3WMFA 5GOZA 4ZMSA 1WXFA 4BFSA 4YN3A 1WKVA 3PXAA 1QB8A 4RKFA 5TPZA 3BCSA 4RSMA 1ACMA 4DEXA 2D5LA 5AM3A 2OXEA 4DYHA 4QFBA 4JP2A 1YQUA 4NC9A 4NNJA 2PWYA 4QO8A 4XVCA 5L95A 4IJKA 4PXSA 1VYHA 3U4CA 1WVGA 2JIPA 3DHNA 3L1UA 3ZN2A 2V9ZA 2VJQA 1EFRA 2WJJA 3ORQA 2DR0A 3AR6A 5ALFA 3GFPA 1A5TA 4LN1A 4Q05A 2AMVA 1MC5A 2O8NA 1OBVA 2VDKB 3LKDA 3V4ZA 3LT1A 3VISA 4BJ6A 2IYTA 5L7YA 3W6UA 2XGGA 4HTAA 4LC9A 3VC3A 1S3IA 1UBHS 1WQ3A 3QHAA 3GEDA 1EFCA 1S7GA 4NZ9A 3FFXA 3NHPA 3REOA 1X1CA 3J7TA 3O9MA 4MVJE 2GEJA 4F3TA 4GFDA 2I76A 4N76A 1YVDA 1RJDA 3ZDEA 4UM7A 1VL6A 1V1JA 4EJ2A 2C8LA 2UYOA 3B85A 2DUUA 4KFCA 2J3KA 3GFSA 4MS4A 5IX8A 3THXB 4QYXA 1MAWA 3FOWA 3W7AA 3AERB 4C08A 1VE5A 2ECQA 4GI2A 4BQOA 2LPMA 2RAFA 3WWZA 4E7OA 3TM4A 1LU9A 3F4BA 5A06A 3WB0A 5CFLA 1QUEA 4HZUA 1USUA 3U3DA 2PLFA 5DNVA 2W4QA 3X1DA 2H4HA 1U4SA 4J07A 1OXMA 4RCYA 1S2LA 1BMQA 1YTLA 3OLYA 3ZGOA 4Y98A 4YRNA 4WD3A 3L84A 3VPFA 2O1WA 5DSTA 3VZDA 5BN3B 2GD0A 3PQEA 4XUCA 4BQQA 1NYQA 4OXNA 5FA5A 4MR7A 2Q3JA 5DNEA 1PR2A 2B69A 2PO7A 2XWSA 3S6JA 4R7GA 2FZVA 2P2ZA 4ES6A 1L5ZA 1EIZA 1NW6A 3DT9A 3EH2A 5EE3A 1DO0A 1N4AA 3HUUA 2AEJA 5LBIA 3GFGA 3TWOA 1EDEA 3ZGYA 4HJXA 4C7VA 4PLGA 5LP6B 1PL7A 2ID7A 4CLHA 5TQVA 1RM5A 3G2OA 4RVDA 4TS9A 3DDWA 2WQ6A 1EFVA 1MGPA 4JP8A 3I83A 5A71A 2WVHA 3DZHA 3K1TA 3L7CA 4BLTA 3VR5D 1KS9A 1CK4A 4HUJA 3UHOA 3TBKA 2G1JA 3DKKA 2AMLA 2QYOA 2XAUA 1C3JA 5T57A 3UMFA 5AVSA 1N9ZA 4LHVA 4TWIA 2CLKB 1U1IA 1D6NA 4FFWA 1FTWA 3DMHA 2CBXA 1XD2A 2ZB3A 3MWYW 1KY5A 1Y3AA 3ZHOA 1M72A 3FNRA 3O4RA 5ALVA 4K1XA 4NATA 2VP0A 4OB8A 3ROEA 3WYBA 3T3NA 2C5AA 1A4UA 5HFNA 4M0DA 5IAEA 5LJLA 2X8JA 3VR0A 4A8HA 1YQWA 2QL9A 4G85A 4JAVC 1YULA 2XNDA 3OY7A 4N41A 4TZ6A 3GN1A 2AI2A 1LJ8A 3E3MA 1Q7BA 5LZ4A 2AZXA 4DA6A 3IH5A 1V11B 2Z8YM 3MSXA 1RTTA 3FPGA 1MO3A 1XZQA 2P9GA 4ZAXA 3HDJA 2NVWA 4KQ9A 3BSWA 3EFOA 3H75A 2WHXA 1FSPA 3LA6A 4Z9BA 5JS1A 3I2YX 4M76B 3B9PA 3UHPA 1T2NA 5JEEA 4IHKA 2VP3A 4GYYA 4C0JA 3R6TA 4MUXA 3R7LA 1SVLA 2AZ4A 3NHLA 4D9KA 5FFFA 1B16A 2HBYA 3EMVA 5IH7A 4BVGA 4NL4H 1DUSA 3E9RA 1N3LA 1UP7A 3QVVA 3GAZA 3CLUD 1NN1A 3L6DA 3N2KA 3RC9A 1C1DA 1WPXA 2XXJA 2EVWX 2REXB 4IIFA 2VZLA 1I2AA 3OJLA 2VBCA 5BN4A 5ITVA 4CKYA 1GCGA 1DIGA 1Z07A 3F96A 3UEOA 4BZXA 2JI9A 1PZNA 2RHJA 3MGKA 3MINB 3MB8A 1MTZA 3PEWA 1UDWA 1XZMA 2SKCA 4O4HF 1K5PA 3SAJA 3W5CA 2R8XA 1A72A 2TMDA 4GX0A 1RPJA 5C37A 4ZN6A 4FYWA 4FKZA 2QTLA 3TLBA 2AWNA 1SKUA 1C2YA 3EAQA 2FX2A 5H0IA 2I65A 3TRJA 3UCEA 4WCVA 3F9IA 4M60A 1Z8FA 3EYAA 1F2TA 2WJYA 4X3CA 3NU1A 4PGGA 4OOFA 4TS1A 5IZCC 1QH0A 3R0IA 1MB3A 1VBNA 1JMVA 3GT7A 3CN7A 4F9TA 2MSKA 1G7TA 3ZHUA 5GZ6A 1RHUA 4K9SA 3D3NA 5CFQA 2LRHA 5AW4A 3AVYA 4RJIA 4WCFA 1I14A 3JD2A 4GPZA 2X4GA 3PEFA 4KV7A 4H3HB 4IJ5A 5EMMA 1P44A 2GD2A 1IB6A 4GP7A 5CDSA 4N82A 5DX0A 3A9TA 4HNGA 4PLHA 2ATIA 2OSVA 4C5BA 1R15A 2R6HA 1GKKA 2Z6QA 2Z56A 3EEFA 4DA0A 4DV2B 2W6CX 1L7RA 3IV9A 1JKIA 1JYFA 2OK8A 5DLPA 3SYTA 4FOPA 1G6OA 2GT1A 2I7CA 4RSRA 1YS2X 4ZIRA 1WMEA 1JLHA 5AW0A 1OAOA 2I4LA 4BMSA 3AEQB 1Y5IA 4JA2A 2FW6A 5AESA 1VPTA 5AVZA 1E2FA 4R9RA 5JV5A 3UUGA 1XMJA 4BNNA 1NUHA 1XZEA 2Z9DA 4D9NA 5U1PA 1LBQA 1H8HD 3BG5A 4NICA 3W78A 3PS9A 3K70C 3B1ZA 4BFLA 1KWKA 2I1VB 3DZCA 5AHXA 3V3KA 1USGA 3DE3X 2IIBA 2X6QA 1KZ1A 3CSSA 3U13A 3BWMA 3H7AA 3FDXA 4KE9A 1A1VA 2YRFA 4DUPA 1G8KA 1T0IA 2JEOA 3D6FA 3UC5A 3OJFA 3DCIA 4X7RA 4KI0A 1Z6GA 2QMYA 3KB1A 1NLUA 5K0FA 1T91A 3G2NA 3PGKA 2VEOA 4FD2A 4Y0NA 2M6RA 1KRWA 3ZY2A 3JPWA 4EGFA 1NBME 3WZLA 3S2GA 3GH1A 3OUUA 2QGFA 2Q1SA 3IMCA 3FSRA 2CK3D 3H1BA 1TYDE 2Q5CA 3HYRA 3K9FC 4NBVA 1NBOA 4DVJA 3HMKA 1TDJA 2VBGA 2VWQA 3C1AA 3NM6B 3UQZA 3GW8A 4GLLA 1G5TA 2Q5FA 1R0YA 3ROFA 4ENUA 5TQ2A 2HMVA 4HWTA 5L9AA 1BXZA 2A9JA 5GOTA 1VRWA 3T5TA 2ZAMA 1OB5A 1KI6B 1HWYA 1X1QA 5BT8A 4G09A 5LZ5A 2ZBUA 5JBNA 3E7WA 5I7FA 1AKUA 1B4DA 1XMSA 4OGLA 1QJCA 1NG1A 3UENA 1J5XA 3E35A 3TSCA 1IAQA 4HFMA 2Y4NA 3TR5A 2HEGA 3G1WA 3ZVKA 1RD4A 4GKVA 1G2QA 3U3ZA 3E5NA 3FUCA 3TPFA 2QRVA 1I4WA 2OV2A 4ER0A 2GHIA 3M5DA 1W36B 3V1NA 3NBMA 1ANKA 1OYVA 2VQDA 2ZJOA 3QLTA 4ICIA 3KJQA 4QJ3A 5FLXA 1XT6A 4J0CA 4KACA 4CM8B 1Z6TA 1PG5A 3D8BA 4I81A 4OPMA 1MJGM 2AVNA 3EFBA 4OFZA 4DQLA 3P5SA 2QPTA 2FEPA 2W2TA 4CM4A 4M21A 1WUJS 1FP6A 5BOSB 4L16A 4BGVA 4HNUA 1T1RA 1NRWA 4QQNA 2OQVA 1PAUA 4GECA 2BV3A 5ICGA 1W1IA 2CT8A 4B7XA 1DQSA 4BLPA 3I5XA 2FMKA 4BGIA 4EY7A 5IN5A 3ANXA 1MOPA 2JJ1D 4V38A 2XMQA 3DLIA 2Y4OA 1OB2A 3L77A 2DKOA 1VA4A 1SN7A 3MRSA 3RU2A 3T3HA 3G2QA 2VK4A 3EXG1 3H5LA 3WLAA 2V4ZA 1ZBQA 4QGHA 4K0RA 2M6SA 5K3FB 4U2CA 4EYEA 3HJTA 4B3BA 3U4QA 1VBMA 2HNAA 4DNQA 1N2JA 2IHKA 3EC2A 3E7DA 3W9BA 3EW7A 2J3LA 4ASUA 4UQLA 1FIUA 1UKBA 1ZIDA 4L74A 4L4ZA 4PQRA 3FNFA 3RYTC 1IJKA 1GQOA 1QMPA 1YQDA 2PYIA 3MJRA 1ISIA 2BCJQ 4CLEA 1C8KA 4F5DA 4IUCS 4BFXA 3FBGA 2J59A 3F3YA 2EFGA 1OZGA 2M98A 4MX8A 1G5HA 1I94B 3H99A 5EI5A 3MGBA 5I7VA 1HYBA 3I1IA 5EIHA 1KWGA 4Z9FA 5HJ5A 2RHCA 2VPPA 1IVYA 3EUEA 3JV7A 3LO5A 5I6DA 4ND1A 1R74A 1DRUA 3T3DA 1PWXA 2BR3A 4AYTA 4W7IA 3PDJA 2WUVA 3LPCA 2C2YA 2J6HA 2KBFA 3DMGA 4NP6A 1S96A 1P7YA 3H5AA 5AXCA 1DBVO 5AK4A 3WKBA 5J4KA 1Y0BA 1U1FA 3KFLA 3TUZC 5AKJA 1RCUA 1SBNE 2OAQ1 1D3AA 5IT5A 1JFRA 1Z0DA 3MEQA 2W2NA 4EPWA 4KSYA 4OI1A 1CPYA 3FMGA 3G5MA 1V1RA 3BWVA 4KFTA 4M1KA 4XPIB 5DJ5A 3U9LA 3H9UA 3X1YA 4Q3KA 4OHZA 5KNCA 5CX1A 3W2FA 2LGJA 5DYYA 4KQ6A 3WFIA 1XTKA 4MIYA 1BJKA 3TIFA 5C8XA 2AFIA 4QXMA 2X1HA 4EIWA 1FP7A 1PI3A 1UODA 3OPNA 4QRHA 5ALZA 4ARAA 4DR2B 3IV7A 4DREA 1B0AA 1XFDA 3QKRA 4CKWA 2YFHA 5BN5B 2OP0A 2DVMA 4KTVE 4BMVA 3N2EA 4PIPA 4D43A 3EPLA 2NACA 1VJTA 1YE5A 3BXEA 2NT3A 4LYFA 3KLPX 1NDHA 4I19A 1CUIA 5GQSA 3T54A 3CINA 4TKVA 1PIWA 4HY3A 2W48A 4TMFA 4FXPA 1K0UA 1M2HA 4HUQA 4GGMX 2CWDA 3AWIA 3RIXA 1NURA 4BVFA 2C5EA 3KOUA 1GG8A 2F1JA 1HF3A 1H5QA 4GPIB 4YV7A 2IH4A 1CNEA 2PFKA 1NVXQ 3IUMA 4KK4A 4CKBB 4EEKA 4PZAA 4L76A 3CVVA 1KDPA 1MAVA 3FUXA 1Q15A 4I8DA 1GUFA 4XDYA 1YKFA 3CVUA 1YGPA 3C8HA 5AOBA 2HWYA 5T64A 5A3QA 4D5EA 3MIZA 3ED1A 4D0SA 2YXDA 3TH5A 3OKCA 1HYGA 3OZXA 1XBTA 1OLXB 2YV5A 5HUJA 3OQMA 3DL7A 3QF7A 4FB5A 2CZQA 1HFWA 1I4OA 2H85A 2PLNA 3C15C 4IYRA 3I9JA 3HKEB 4R83A 4YJ2B 2WWVD 4WZBB 2OORC 8MHTA 4YJGA 2QAGA 4IICA 4IM7A 2R1VB 1ZH8A 1C30A 2BLLA 2ZQZA 1Q3KA 3SJAA 1R0KA 1HZJA 3F97A 2WSSD 1THMA 1OXVA 2WVJA 1PNQA 1A9XA 1UCFA 2FPUA 4PF1A 3ZTWA 1O5OA 2X14A 2H2DA 1RLUA 1Y1LA 4FZJA 4MYTA 4WZ6A 4EMBA 4MVCA 4MUAA 3K7EA 1WMBA 1P4SA 5JZ9A 3QU2A 5HR5A 2B8WA 2XWJI 5CB4A 1OBHA 4IEIA 4DQVA 3FY4A 4DOMA 5HS6A 3JALB 2WYVA 2QU7A 3TKAA 3UH0A 5LZ7A 3K8ZA 4CCYB 3USES 4WBNF 4IWXA 4JI6B 2R1TA 3EW9A 3PXEA 4MVXA 4TM7A 5A5EA 1N5KA 1DPFA 4G3XA 2Z8YA 2XVZA 4GBED 5FUVA 2H1CA 3U1VA 5JD3A 3IBSA 3EUFA 4K1LA 5FX2A 4X71A 2IKQA 1X0XA 2EV9A 3VU9B 3M5PA 5DTJA 3PNMA 4GUAA 1U1CA 3DVRX 5EJ6A 1K97A 1QOQB 1YHNA 2DCUA 4HQKA 1CP3A 4FHZA 3OY2A 3KB2A 1MCZA 2UYCA 3V1MA 4QE3A 5JVDB 5IAKA 3A05A 1QRTA 1XCGB 1G8MA 4FQ5A 1GNQA 1Z0SA 2PJDA 4EHLA 4Z7JA 1PJ3A 3V2GA 3GFQA 4V24A 2C95A 1VYTA 5HTOA 1MAHA 3OAAA 4RBNA 4NK5A 4L0QA 5J4HA 2GB4A 2BF4A 5LN1A 4MUGA 4RQUA 5C7OO 2OC4A 1US8A 3L8YA 4LAFA 2C03A 2JFUA 2PGNA 4K9NA 4O4JA 2Q5LA 4MH0R 2VA8A 4ZANA 4KWIA 4EGCB 3R23A 3PV0A 4DMFA 1N0WA 2VTKA 4TVSA 1NLFA 3GC6A 3L4EA 4B4UA 3IAEA 2AFRA 1G7CA 1P2FA 3G8CA 3PC3A 3BWDD 1QC5A 1T6ZA 3ZZ0A 3ZK7A 4D97A 3KQYA 1KMCA 4C4AA 1FLDA 1WPRA 3U48A 2R4TA 3S1SA 4IUBS 1T0BA 3ZOZA 1L4GA 1ZUHA 4IFBA 2WTBA 2Q6TA 3FFTA 4YMHA 2FZ4A 1WSWA 2VP6A 2ISQA 5KCMA 4F12A 4GMDA 2KYRA 5CNMA 3SZRA 5JSQA 1R3UA 5K0GA 2JIZA 3RS3A 5F51A 4J90A 2VNAA 1GYPA 2JAWA 5ER9A 1Y4ZA 3O4HA 2VRWA 2IJGX 2ACEA 1LVGA 4L75A 1JHPA 4DUGA 3ZCQA 1ZD1A 1QTIA 4F2GA 3NUGA 3H5WA 1IJFA 2RBGA 4IF4A 5F33A 1K5DA 4ZMBA 2PUFA 4PHGA 1GZDA 3OE1A 1MPXA 5LMUB 3LK7A 2C92A 4FYJA 1CJTC 3GUVA 1G8JA 1Y1TA 3TAUA 3W04A 1XTSA 1KPHA 2KWIA 3KV1A 1GAXA 3B48A 3N8KA 4FEEA 5M3BA 3GBSA 2WB2A 2A86A 1OT5A 4AUKA 3EBOA 1ISPA 4Q5IA 5JPCA 5JQGA 4OATA 4PSDA 1LPBB 5DWQA 1MQ9A 4LG1A 2VJLA 2IF2A 5K6AC 2BCEA 5ALHA 2IZOA 4OQYA 3SXJA 3VHXA 5FOTA 4XFKA 3VPBA 1T9DA 4IEFB 1B74A 1PJ8A 5F9FA 5A3RA 1NT4A 1WBDA 4Z3KA 3N5CA 1P4AA 1ZJWA 4DJAA 3LE8A 3WLIA 2VZ8A 2C4WA 2G36A 5HK8A 4RH1A 5FP0A 3ZEIA 1J20A 4JJ7A 4NJOA 5JQWA 1IEVA 5AW2A 3QVGB 2F17A 3PR2B 3ZE1B 1Z4PX 2NZUG 3LRPA 1DTWB 1AKMA 3KALA 4TS4A 3UUFA 1OH6A 4Q15A 4KO2S 3BL6A 1N5OX 3DF7A 1IQ0A 1HGXA 5M04A 1E96A 1EGHA 2PUWA 3D64A 4DDUA 1GAJA 4UUPA 4D4JA 3DE4X 1DQZA 3LDGA 2BJVA 2GWRA 3RJMA 4ZT7A 2OGZA 4CGYA 1N2IA 1VOTA 4LJ5A 4LJ6A 1DCMA 1QBGA 1ZMRA 3WYFA 2OFFA 3NO4A 2HGSA 5HGXA 4WQMA 4HH1A 5G4LA 2V6MA 3K6SA 1P9NA 3O3CA 4H7EA 5AVUA 5JCJD 3B7GA 3H11A 1RRCA 2AFHE 3RHZA 3WRXC 2M6KA 3CZMA 1ZR4A 1W36D 2E89A 5D1NA 4GZ5A 1TKCA 1TZ2A 3I2IA 4FFOA 3QF4A 5IC5A 3RREA 2GBPA 2R65A 4BX8A 2O2EA 1PFYA 3E8MA 4L5IA 2C2MA 2VP9A 3IUPA 2X15A 3QH4A 4Y1RA 1RQNA 3HBLA 3QBTA 4MLCA 6CHYA 2PH7A 3H1TA 5K01A 1YJXA 3GPLA 2MSDB 4HAUA 4O25A 1Z5NA 3A2LA 2Y99A 1E4OA 2HZBA 2PLRA 3KJGA 3BA1A 3FCEA 4LJ7A 3I1JA 4DDMA 1M2EA 1V4BA 1Z4JA 3OLQA 2AN9A 2N47A 1YUNA 3VI4B 3ZZ1A 4QGSA 2AOVA 1SUIA 1VKJA 2Q3FA 5AQ1A 4NCBA 1SGWA 1JECA 1Q0UA 1Z4KA 2PD3A 3IKJA 3R5SA 3QVWA 2J33A 1B2LA 3B6MA 3BTSA 3O3OB 3WLLA 2JDIA 3JTEA 4F04A 5T8KC 3SHOA 3ZDCA 5JLJA 1TFRA 3CG0A 4ISCA 3ZG6A 4MA5A 3GHHA 1XKQA 4UBKA 3I37X 4XWYA 2XCSB 1TA9A 1DEXA 3QXJA 4N5HX 5CDUA 1KEPA 1UKAA 1PQYA 3RASA 1FY2A 5FR2A 3I42A 2JVIA 4Q39A 3D8TA 3T5MA 4UULA 3KR0A 1DEKA 5CA1A 3AIMA 1C3EA 4NCJA 2Q4DA 3ZDFA 4AZTA 1IN8A 1FLNA 4HLCA 1DNPA 5FBRB 5TMEA 1FJXA 4UMVA 3WHPA 2XB6A 1R27A 4EX7A 4JENA 1HDOA 3FETA 4F9FA 2QN3A 3OO0A 1J5PA 2CUNA 5FHRA 4PSCA 4YMIA 5AJVB 3UT5A 2BTEA 1ZSVA 1J97A 5HQJA 2EQ5A 1FVXA 3HCWA 3JAKA 4DFDA 2F9FA 3E0QA 3MJTA 5IK2A 3UFXB 5A2QA 5LVAA 1JEYB 4FDTA 2D0OB 2IXBA 3O21A 4LTNA 2TYSB 4K87A 3FTNA 5LPNA 1C7JA 1HDGO 1M2WA 4F56A 5BNWA 1U9YA 2HQSA 2QUZA 2YIVX 2XTZA 1OA0A 2BFBB 2MINA 3G9QA 3TLJA 3IURA 3FNIA 3FPFA 4QT4A 1Y8QA 3C3DA 1JQ5A 5BSKA 1T8SA 4DMKA 5JIBA 3CLRD 3JD0A 2P5UA 1PZGA 2W4MA 2HDOA 5FA8A 3RKUA 5F12A 1YFKA 3V48A 1JHXA 3DOHA 5HMLA 1V6CA 1QZXA 4WY5A 1R0WA 1THTA 2XADA 1FRNA 2C5GA 3AI3A 1E1NA 4KXWA 4JR0A 3NTRA 4PGHA 3IKTA 2QZSA 2YQ5A 1GZ7A 1R5BA 1P72A 4FMDB 1E4EB 1LRJA 3NGLA 4FFVA 5TQ0A 3NWBA 4ZJYA 3A7EA 1SCUA 2BGWA 4AY6A 2C3MA 4DAOA 4F92B 4V0OA 1QCZA 3GFFA 2ZGVA 1Z0UA 3GXBA 4J0JA 4QNNA 1F60A 1YZLA 3EHEA 4TL6A 4Y9TA 4Y8VA 1YBMA 2G09A 3MERA 3IUJA 4L9RA 3I6BA 4G84A 3RFVA 4WJZA 2NZYA 4NYMQ 2CC2A 2QENA 1FFSA 3ENKA 4M87A 2RE8A 4N9QA 2IH2A 4DCTA 2O14A 4GNRA 1WB5A 1ZK4A 2WTUA 4KAXA 1Z4OA 2DTDA 3PT9A 3P0FA 4IGFA 1OHHA 4F6LA 3IR5A 4A15A 5SV2A 1SCDA 5JO0A 1BEEA 3A4TA 3F6RA 4X63A 3FGOA 2QSYA 3WISA 1XD2B 2OT3B 1JAIA 2Z08A 13PKA 1SXPA 2QM8A 5H83A 3QQ5A 4GZMA 4QYIB 3TSZA 2RK6A 2XSZD 2JLVA 2WTEA 3TLXA 3FYHA 2EJCA 2X8JB 1MQ8B 4PU0A 3DAHA 5DNDA 2BI8A 4RIIA 2AG8A 5E1OA 5TGZA 3RPEA 1RI1A 1Z22A 4XVUA 3EXEA 1HG0A 2GLUA 1TTPB 2ZYUX 3BGIA 3P94A 4JBGA 4QBGB 4RA9A 4WHMA 3AEXA 2OBXA 4KN8A 5IAAA 2PJUA 2YZ7A 1DB3A 2QR3A 4PWZA 5AIBA 1HR0B 2QYTA 4A92A 4ROSA 4WINA 5CNJA 3TO5A 2B21A 4IRUB 4OFWA 5KJEA 1QU2A 4RH0A 1QSGA 2POCA 3EFOB 1W2HA 2FWPA 2P2LA 4JEHA 2VTBA 3MNFA 4M37A 3GLHE 4RE6A 4JA0A 2VH1A 2NTEA 3DL4A 4PSKA 3FB1A 1FS5A 2Y1OA 4XDZA 3K15A 3PNVA 4K6CA 4UBLA 4Y2RA 5EFOA 2DFNA 4L85A 3TW8B 4C2AA 1ZO8A 4KREA 1KMMA 3ADOA 1XPJA 3PNBA 1J7JA 4IJ6A 3HUDA 4CTNA 1KI1A 1U3TA 4YR7A 1EFHA 4JT2A 5B1HA 2QSUA 1QOPB 1YR1A 4OUKX 1CEXA 3BC1A 4BVLA 1JBEA 3K1AB 4WVFA 3RG8A 2I3BA 1HFEL 2QI9F 2HQRA 2Z57A 4CM6A 1U3WA 3LVFO 4IDNA 5AH0A 1UWCA 1VSQA 3SICE 3SEAA 1QE5A 2X86A 5EIXA 4L08A 1ZC4A 2P1RA 4AL4A 1CHNA 1M6NA 1X42A 2Z3ZA 3JZAA 1B0PA 1H6BA 1O94D 5KHAA 5LQKA 4ZV9A 1IZ8A 5FWXB 3BCUA 2QDXA 4OA5A 5LYJA 2CL5A 4YRAA 1IDOA 2G9UA 4AG6A 3HEMA 2OSBA 5HX7A 1A7UA 1RXWA 2E5FA 4A91A 1MTOA 3UKOA 4BB0A 4OH1A 4V0KA 3GEGA 5TF4A 3WKDA 4FBMA 4CEJA 3SU8A 3K9LA 1XU7A 4C01A 1Q22A 4MRRA 5FTLA 5IF9A 4YY3B 5ALRA 1CRPA 1U7TA 4TWBA 4UFOA 1ZI9A 4IHJB 4X6YA 1ZXLA 4YS6A 5KJFA 4HPWA 1GL7A 3TNFA 5CFPA 4FONA 4EUFA 4XRGA 1OLUA 4IQ8A 3CEJA 4IWNA 3OTGA 1JKJA 4UBOA 5DT9A 1NRJB 2X7JA 4J7XA 3NLLA 1YR9A 2WG1A 1WXEA 5AR1A 5EXPA 3TUIC 3J7AC 4ZYWA 1X7YA 4EG4A 5E2IA 2W6NA 1XCJA 1DINA 1BU5A 4X85A 4NV1A 1RZRD 2OECA 2VWHA 3AEKB 4WCFB 2XKKA 1DHTA 2JK1A 4MSUA 5CRIA 1UFVA 1B8UA 2FVXA 2D59A 4BAUA 5KX5B 3F7OA 2OBMA 4KRGA 3CXUA 3WNCA 2W6OA 3GARA 3W5JA 1UKCA 2AR7A 3N70A 5ICMA 4Q3OA 2FFJA 5GM1A 1E1LA 4LVUA 4RZHA 4TT3D 2WTAA 4UEJA 4BNIA 5HM8A 2XMPA 5FHQA 1ZIOA 2E4UA 4G5YA 3B6IA 3AM1A 2J6IA 3WV4A 1QYXA 1XHFA 3ES9A 4OHPA 4P4LA 4TZKA 3TLMA 1N5RA 5AJWA 3O1JC 3AINA 1NVKA 2PRSA 3AFHA 4GOKA 4CL3A 1K6MA 2Q5EA 3NB0A 3ZS9A 3C48A 4EHFA 1Z63A 1Z5OA 1UWVA 2K87A 5CB0A 1TUBA 2YJ5A 1JS1X 1E58A 3EZXA 4BO6A 4NNPA 1NAHA 2OP1A 3AUAA 4D4MA 5LU8A 1MABA 1KORA 4BASA 3R7AA 3T6KA 4HYEA 3DP7A 1EFPB 1AXEA 2ON6A 3W6PA 3MMZA 1YC5A 1C0LA 1QV6A 1RAGA 1X9IA 3JQBA 1Z47A 3R3JA 4KCGA 5AI8A 5AI5A 5LQUA 3OPMA 4ZCMA 4JHXA 3HBAA 3F2VA 2ZTHA 4NBTA 3MTAA 2I29A 1T9HA 2W43A 4ITUA 4FNMA 3RAGA 1WABA 3T5BA 7ADHA 1NI4A 3WGVA 2H29A 1TEXA 1WAMA 3TZLA 2OLEA 3ZIAA 2QB5A 3TZBA 1QZUA 5BSTA 2HMTA 2ORED 1C1YA 3ADPA 2XJ9A 4G0ZA 2JFGA 1TQ8A 2ZBQA 1PRYA 4Y9SA 1QNFA 1KYQA 3LNTA 4EZEA 2HC9A 4LSWA 3EVZA 4D26A 1ULAA 3JVDA 3ZY3A 4EJSA 5EZSA 1RRVA 2DUNA 4U2EA 5M34A 4YX9A 2P3OA 3U16A 5TQ2B 1SUPA 1W87A 2PX3A 2ZEJA 4OYYA 3VR3D 1TD9A 1NYRA 1RXVA 2Q2VA 4FW8A 3GDHA 4G4JA 3IP8A 1E60A 5FULA 2YN2A 2JGFA 2ZYWX 1W47A 3BAZA 1EEXB 3P27A 4GQAA 4Y30A 1M2KA 4FFSA 1TRHA 3MELA 5DEOA 5T4BA 3SHQA 1QG0A 2RGEA 3DONA 1DBQA 3S2SA 2DJIA 2RCYA 2ZYIA 4JBLA 4PAQA 3VH4A 3A37A 5AFSA 3VPCA 3L0BA 1PR3A 1YI1A 2JB9A 3RUIA 4B7UA 2P3LA 4U5XA 4UHBA 2VDVE 3AR9A 4IS2A 1COZA 5A03A 3MTIA 3AU9A 3OPVA 3WQSB 3T38A 5KQSA 2CMHA 1N32B 1BVYF 1TKBA 3UHAA 1M8JA 4KODA 4TTVA 5C8DA 4MP6A 5MDHA 1NM5C 1MO2A 2IUYA 4L2IA 5EZ5A 3HFJA 5BUQA 3O8OB 1R18A 1FU8A 4L73A 4PXAA 3NWPA 2F90A 1FVHA 2ZRHA 4HRAA 5EXSA 3ELUA 4IFIA 2ZIFA 3OHMA 4JXJA 3ZLJA 1D2GA 1YE8A 4F6CA 3FYSA 4EHNA 1Q0QA 2VJAA 1ZZEA 3OBBA 4FZRA 4RUKA 5L3RA 4Q47A 2HO4A 5JNUA 1Z18A 1M66A 2C4KA 2R97A 4BN4A 2FZEA 2I62A 4EI2A 1A0OA 2HWWA 4ZU6X 2JGKA 5TDHA 5FAKA 4IGIA 4MMZB 1T9AA 1ZG3A 2P9BA 2OZLA 4ZP1A 5CXUA 3KWFA 3TE7A 4S0ZA 1I2BA 1L8AA 1S9HA 1UOPA 2P4HX 3MF4A 4Q7QA 3SVLA 4RV4A 1OXBB 4HDQB 2A8YA 4P3XA 3VRHA 4JKYA 2SNIE 1COWD 1R6VA 3HJBA 1ZIYA 3A1DA 3U4QB 1G55A 4FJ1A 1L5OA 2JGJA 4WI1A 1BXKA 2EJBA 2CV0A 1GG2A 4NFSA 1LW7A 2EJTA 4EW6A 3RC8A 3CLSC 5AHWA 5FUYA 1LWOA 3N0RA 2IEZA 3EVNA 4M7PA 3ZWCA 1R5NA 3QHPA 1R1DA 2WTXA 4M9CA 5JAPA 1ZVQA 2SCUA 3A4NA 4DBVO 5A4IS 4RPHA 3EPHA 3EGOA 5DI3A 3ESRA 4GDFA 1M76A 5ESXA 1F0PA 5CURA 4JBWA 1GUDA 3IIEA 5FBWB 3S2FA 2JGAA 2VT6A 3KC2A 4AG5A 4UZFA 4QBIA 2VP2A 3O92A 2HJHA 3JWHA 4AJ2A 3UWSA 5EPEA 4G6ZA 3D6AA 3KYDB 2D1SA 3P2IA 3IAUA 4M1WA 4LZAA 1NW7A 3UM9A 4LSMA 5KPDA 1XN4A 3WK6A 2WJVA 1SCQA 4TLLB 1J70A 2HA5A 4RV5A 5GVRA 4PCUA 1XA4A 5ENVA 5CG2A 4HNAB 2C7RA 4UAJA 2BPOA 2DPHA 1MDBA 4I5DA 4JBIA 4OQ4A 3MTEA 3IDZA 2DUJA 1NU8A 1WRBA 1DGQA 3FE2A 4QO7A 1V1RB 1IY8A 3IT2A 1ULBA 4TUYA 4BC1A 4B80A 1NR7A 4OX9Y 2PMFA 5CX1B 3H3XA 4CXMA 1O3YA 4HXEB 4EABA 2D7JA 1NWHA 2OAGA 1FFHA 4C22A 4GPTA 2BZGA 3P2JA 3O8DA 2QMZA 1U0OC 2IQ5A 2IODA 2J9YB 2BI7A 1SHJA 1TKAA 1MP0A 3QKRB 1U2DC 3QVOA 4Q1FA 5ELLA 1N2ZA 3DFMA 4YASA 1TLTA 4RO0A 5EP2A 3WYEA 4PX5A 2XVAA 4UUAA 1V5FA 1G17A 2OZEA 2R66A 3D0QA 3L6OO 3QJGA 3HA7A 4D9IA 1EFDN 4KXXA 4PRLA 4LZZA 4TKVB 2O1EA 4MQLA 2ZSHA 1SBIA 1T4MA 1KH2A 1RWWA 2O3QA 3FH0A 3GLGE 2Y0CA 4GKAA 2MOKA 4D99A 1UFRA 3SYLA 5CVTA 3JWPA 1FJHA 1VSUA 1U5AA 3SQMA 1Y7IA 1Y89A 4LCJA 5IBCA 5LQRA 2DFPA 4O4LF 1JF8A 1JI3A 3I9MA 3HVRA 1Q1AA 5EKXA 4M6WB 1PJ4A 2YWCA 4EGJA 2WJPA 1OIVA 5G0VA 2YZGA 5IAJA 2GJ8A 2G0AA 3C1OA 2PL5A 4JH0A 4AY4A 5AJUA 2V3CC 5JLAA 4PEVA 1EHIA 1BMTA 1J9GA 1N7HA 1WB9A 3BKXA 1W25A 3KR9A 1PS8A 4N5DA 4YJGB 2QAGB 4KMOA 1E5XA 2ORIA 2R8ZA 1HE8B 2PMCA 2WJ6A 4GSKA 4BL5A 4LGVA 1Z39A 4HGZA 4C4SA 4ZYTA 1G5RA 3MXOA 1AB5A 221PA 3JD4A 1U3GA 4P31A 2B8JA 2GXQA 4B6SA 3O8CA 1GFZA 3DWFA 5FWYA 1TOAA 3JWGA 2FR8A 3PI7A 3VV3A 3HO1A 1A4IA 1UBJS 1JWLA 1ONNA 4M1EA 3G7NA 2J07A 3FROA 2PA3A 3CSDA 2PNJA 2AJBA 2ANBA 5CB4B 5I8PA 2QIOA 5DBHX 1MHPA 4OJKA 3PQ7A 3SBOA 2O2HA 5IT0A 1GGMA 1LPPA 1JLKA 1FS4A 2C96A 4X61A 3SIRA 4GF5A 3SC6A 3DLCA 2XD4A 3KWJA 2FSFA 5DOZA 1SVWA 3NHWA 1FLAA 1EG7A 1PVOA 3C3BA 2C9ZA 1C3OA 2CNWA 4KPFC 1M83A 3UMRA 3H86A 2QRJA 3OM9A 4KIUA 5HK9A 1YR2A 3A6DA 5H8WA 3CA8A 2AI3A 1JSRA 2FU5C 4MAFA 2BH2A 2P77A 4C21A 3D5EA 1U0FA 1Y7TA 1V25A 4G5RA 4DV6B 5FUQA 2CVHA 2VCYA 1GSOA 1I6MA 2BJWA 5KWEA 2IIVA 2FY8A 1EH5A 1RPAA 1YHZA 3LQFA 2NU9A 3ML1A 2NSHA 2YDYA 3SJZA 1MOSA 1FP2A 1Y6JA 1GTG1 3AHIA 4JB8A 4B82A 5BXYA 4M89A 5A5VA 2BGJA 5DIZA 5U4QA 1KQ3A 3W6NA 1JHOA 1HETA 4RPIA 4XX0A 1UBCA 5C8YA 1VHTA 3NTQA 3WOHA 4QPPA 4ZVQA 4O4JB 2CUTA 2UVQA 4E7PA 3HCRA 1E79D 4Z1MD 5IXJA 1GCIA 2IEGA 3GELA 3LP6A 3HHPA 1NW8A 3S40A 5JWHA 4IO1A 3SJUA 5FOUA 3BREA 1WHSA 3JARA 3IX7A 2CFTA 4R4JA 4BX9A 2Y2UA 3HRKA 4IQ4A 3O47A 3M2TA 1WD7A 4ZOLB 2PUGA 1YJCA 4P6VF 1ECGA 1TQHA 5FB3A 1OZFA 1B6GA 3MJHA 7GPBA 2ZXUA 1U0LA 1Z13A 3GR6A 5A1TA 3GDFA 5C5DA 3AONB 5CFNA 5DCYA 2JI4A 1S1MA 4UMEA 5IM4F 3HJNA 3O2SB 4LNUB 3T3IA 5J5VA 1X7ZA 3HUFA 3ANNA 3HGQA 4GOMD 3SR0A 4E4YA 5TY0A 1RAEA 3KQKA 3FPSA 1TA0A 4Q21A 3RHFA 4ZTUB 4ZICA 2QBYA 2B7LA 1M6VA 1ZOIA 1BWRA 3FSGD 2NU7B 5FTJA 5IFLA 3AVTA 1HE2A 2OQIA 1GAEO 1QANA 1MC8A 1O8BA 1U5BA 3P5BA 4JT9A 3OEHD 4QEZA 5I9MA 5U9CA 1G20A 4A8JC 3COJA 3BCHA 4GOOD 3HJGA 3LDUA 5TR9A 2HJ9A 5JUWA 5G0SA 3HXOA 2IUTA 4LGCA 4DDVA 1JQKA 1W5SA 1P31A 2Q7XA 2I4RA 4QL3A 4ZXPA 1SCKA 3E3AA 1S4MA 2FUG1 2ZE7A 1CUBA 1I6KA 1QO9A 2R1ZA 3FAKA 3L05A 1IBCA 1OY1A 2IHBA 4YIKA 2GM5A 2WYHA 3F78A 1V3QE 1H2FA 1Q16A 3CRVA 5D7NA 4ADSG 2EZ4A 1MF7A 3Q7QA 4RH3A 1URPA 1G66A 5JSYA 4KPYA 4ESEA 3B6JA 1BGXT 3K53A 1B15A 4FQ8A 3K2QA 2FPLA 2QV7A 4ZRNA 3P9IA 4LOHA 4QODA 4U2FA 5T3UA 3LKBA 3RSFA 3PL1A 5J2UF 5E7QA 4N49A 1BKDR 5BN1A 3QKSB 5LCXA 1XRPA 2AWOA 1UZLA 1SQ6A 1FSSA 2I33A 4N1AA 1NULA 3WLQA 4FT4A 2YCBA 3G2JA 4UXHA 3EZ7A 3FWHA 1ECCA 2EWVA 2X77A 4CLXA 3OE7A 4RW0A 3PUJA 2PPVA 3PUIA 4JJEA 4M0UA 1QZTA 3LPLA 5TPWA 3SS7X 4AC9A 2QHXA 2YWHA 4BIMA 3L06A 4YLYA 2CSXA 1Q7RA 1A9TA 4ZCTA 1CQWA 4DRXB 1XLVA 1QS0A 4JLVA 2BE9A 3RU9A 3FPAA 2BBTA 2IYAA 4Z6KA 5DTIA 1CZOA 3U62A 5CBPB 4MRNA 4BFCA 3CGWA 3NCHA 4CM8A 2RD2A 4JMPA 3K6SB 4HFNA 3TQOA 3F8WA 3L7YA 5KOHA 4Y6PA 2QTHA 3HM9A 1A9YA 3MLAA 5KMGB 2W2LD 2Z2XA 8OHMA 1ZNXA 1M74A 2XE6A 3GMSA 3PVCA 2VUSA 4PLVA 3JVUA 3LIIA 4QOSA 4DCSA 4G37A 4PWYA 1XMIA 1P9OA 1Y8RA 3RRNA 1EQAA 1WM1A 2QAJA 3QELA 5FUMA 4Y1RB 4UAVA 2CL6X