4Y1RA

Sav1875-cysteinesulfonic acid
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
171
structure length
170
Chain Sequence
TKKVAIILANEFEDIEYSSPKEALENAGFNTVVIGDTANSEVVGKHGEKVTVDVGIAEAKPEDYDALLIPGGFSPDHLRGDTEGRYGTFAKYFTKNDVPTFAIHGPQILIDTDDLKGRTLTAVLNVRKDLSNAGAHVVDESVVVDNNIVTSRVPDDLDDFNREIVKQLQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional insight into the different oxidation states of SAV1875 from Staphylococcus aureus
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus mu50
molecule tags Hydrolase
molecule keywords Uncharacterized protein SAV1875
total genus 59
structure length 170
sequence length 171
ec nomenclature
pdb deposition date 2015-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4y1rA00
4ZDIA 1CS0B 4ENSA 1KWKA 3CYFA 4P35A 1KXJA 4UNIA 5K4AA 4AULA 2AB0A 4RKYA 4B7AA 5SY4A 5SYAA 1GGJA 2YWDA 2WJZB 1JDBC 4P34A 3CNEA 4ENPA 3UJNA 3WFZA 3PQ2A 4Y1RA 4Y1EA 2ZUWA 3SOZA 4D1YA 2XF2A 1IPHA 4UOZA 4OGFA 3M3PA 4P2GA 1OX4B 1N57A 2A9VA 1OX5A 4P36A 4Y1FA 4ZDJA 1GGKA 1CF9A 2R1VA 3P9QA 1G2IA 1P80A 2YWJA 4OQ4A 4E08A 4GE0A 2NV2B 1VCNA 2D7JA 2R1UA 3P9RA 3L3BA 1QVWA 3F71A 2VXOA 3NVAA 4GUDA 4Y1GA 3CZAA 2OR3A 1Q2UA 4AUMA 4UOQA 3KKLA 3NORA 4UCFA 1O1YA 2ZUVA 4ENQA 3EN0A 3EWNA 3P9PA 3F5DA 3UGJA 1C30B 2VDJA 3PQ5A 4WXYB 4B5KA 1M6VB 4QYXA 4ADSG 1GGHA 4L8YA 4MGHA 3N7TA 4I4NA 1IZZA 2V4UA 3TTUA 3UK7A 4B2YA 3FIJA 3L18A 4ZGGA 1ONSA 3SF8B 4OGGA 1CE8B 4ENTA 4ENRA 4MNTA 2GK3A 1T3TA 3PQ8A 3ZJ5A 3BHNA 1OY1A 1GPWB 3R74A 3SF8A 1GGFA 3EJ6A 2RK6A 4OFWA 4N12A 4L8FA 1UCFA 2NV0A 2VKTA 2ZUTA 1I1QB 2ISSD 2YWCA 1PDWA 4Y1RB 3MGKA 4N0MA 1VHQA 1K9VF 4I2NA 4AJ9A 1QDLB 2ABWA 3PQ6A 1GGEA 2ZUUA 4E5VA 1QWSA 4L95C 1J42A 5E9AA 3TTSA 3TTXA 2FEXA 1QVZA 3RHTA 5JZMA 3R75A 1QVVA 1L9XA 2GHRA 3TTYA 5DFAA 4B31A 1KWGA 4OIFA 1GG9A 1JVNA 4GE3A 3TTVA 4P5PA 3P9SA 4PXYA 2AD5A 3B3AA 1WL8A 3PQ7A 2R1VB 1T0BA 2VPIA 3CZ9A 2IUFA 2YWBA 1SOAA 1OX4A 3MIIA 4UZSA 4S0ZA 1PDVA 1PV2A 1FYEA 3NOQA 4WINA 4OJYA 5IP5A 3R76A 3L4EA 1I7SB 1OX6A 4MTCA 1P5FA 5SY9A 1VCMA 2VRNA 3FSEA 4JQSA 3CY6A 5SY6A 3OT1A 3B38A 4QYTA 3UMMA 3OT1B 4ENWA 5BV2P 1P7ZA 4L7QA 4RKWA 4I46A 3PQ4A 1SY7A 1I7QB 3TQIA 3BWEA 4HCJA 4XLLA 1P7YA 2W7TA 1P81A 3EZGA 1OI4A 3EFEA 1Q7RA 3NONA 4Y0NA 3UOWA 3GRAA 3VU3A 2RK3A 3ZR4B 4BFLA 4LGYA 1S1MA 4ZDKA 3ZJ4A 4BTEA 3B36A 3TTWA 4AUNA 1U9CA 2R1TA 5LIRA 2LXNA 1KEEB 4ENUA 1IZYA 2RK4A 4L8WB 3PQ3A 1C3OB 3NOOA 1VCOA 3D54D 4L78A 1A9XB 1QF7A 2R1TB 1FY2A 4LRUA 1KA9H 1PE0A 3NOVA 4AUEA 1BXRB 4B40A 1GPMA 4R7GA 3TTTA 2ZUSA 2H2WA 3ER6A 4ENVA 3L7NA 5JZOA 1R9GA 1T36B 4BIMA 4K2HA
chains in the Genus database with same CATH superfamily
2IDZA 3VOBA 4QYIB 5BNIA 4A0GA 4B4OA 3CISA 3GDGA 3RI3A 5SYAA 2HT6A 1K2VN 4QDKA 3ZZ0A 3ZOZA 3VU1A 1GL9B 1N6HA 2PMCA 1IEXA 2WG1A 3GCGA 5C1OA 4N5HX 4U4AA 4AP9A 1CRPA 5KPJA 4JGBA 4FP9A 5IBPA 1NW8A 2Q5HA 4EGSA 1MXFA 1FUEA 3K35A 1H4QA 2B2NA 3ASYA 4G23A 4J2OA 1XKXA 2CKDA 2XZTA 5AKKA 2C07A 2R65A 3ILXA 1OILA 1N6IA 1OIWA 1TPZA 3L8CA 4HDKA 4UHCA 4A2CA 3ROMA 1GZDA 2P9GA 1ZOIA 1QO7A 2Q29A 2FR8A 2HO4A 3NX4A 3EUFA 1OLOA 2BM0A 1IWOA 4TS3A 3TW8B 1XNJA 3R20A 3UJDA 1Z56C 4JR0A 2VAWA 1NM5A 5IDYA 3RSOA 3WSVA 2I1QA 4L0QA 1UDWA 4O3FA 2JIZD 3BX1A 4HX9A 1R0ZA 4ER5A 1SBQA 4GIBA 4Z2YA 2JJ2D 1J20A 1ZH8A 2VJYA 3EC1A 5FIUA 4WERA 3D6JA 2C4KA 5JG7A 3KQLA 2A5LA 3LV8A 4YJDA 3G0HA 3WNQA 4NJMA 1PUJA 4QDOA 1IY9A 2CHFA 3D5QA 3O4IA 2JLWA 3NI2A 4XDHA 2XRZA 1ZJYA 4ZU3A 5TR9A 2A57A 1C7EA 4XYMA 4KB5A 1CZOA 1DIGA 3O4GA 5D51S 1JG1A 3KEQA 1OGYA 3Q7RA 4YUAA 4RAQA 1X87A 3L6UA 4F4DA 2IIVA 2YMPA 4I08A 4MX8A 3UPTA 4I9HA 3QUAA 3E81A 2V0NA 2JNWA 1T9KA 2OLJA 4WJZA 5HFNA 3ZS8A 2GASA 1OSNA 1QS0A 1TB4A 2QL7A 4CIDA 2PS0A 2QSUA 1JHZA 3CA8A 4Q37A 1KS2A 2BRUA 3KELA 4W5JA 3SDBA 5K8CA 3B6KA 2C4NA 4TTIA 4ZEVA 1VBFA 1Q92A 1Y7TA 2HPHA 5I9LA 4IYJA 2NT3A 2NZ2A 3KEFA 4P4UA 1RIFA 1QIKA 2V6FA 3BE4A 7ABPA 1NWCA 4LEIA 1E2JA 1C7IA 2REBA 2AW5A 3I6ZA 3OM9A 5B58T 3I9FA 4GX1A 4M4SA 3VPBA 1ADYA 4MW1A 2GAOA 4TYWA 1WS6A 2CLEB 5EKDA 5DHPA 2HF8A 2WKSA 3IKMB 1YSCA 4KH0A 4KLCA 3VNUA 1VDMA 2AXQA 1NV9A 1NSTA 4GM1A 4GZLA 1AE1A 4YT8A 3HG7A 4A2QA 4BN0A 1GCAA 3L8GA 2BW0A 1RM5A 4JL8A 3SC2B 4O4JB 2CJPA 4D5EA 2EFYA 2WG2A 3L7LA 4L5JA 3SYLA 4HVTA 1TU3A 3UQZA 2B25A 4YPOA 1OI4A 4DV6B 4TRNA 1PJCA 1IE3A 4J7UA 3PXDA 5GZ3A 1Z5ZA 2ZBPA 5AM0A 3DTVA 4TTQA 5HYVA 1ECJA 3NEYA 2AMYA 4GSLA 5THXA 2FW9A 1VIYA 2X4LA 4UAGA 4D9GA 5JCPA 1QIEA 4MZDA 1UFQA 2AE2A 1QYDA 2YXDA 4DLUA 5AW2A 5H4HA 2XDWA 1UXJA 1DJOA 4LISA 1HDRA 4KNVA 5TPZD 4BJ1A 3FPJA 3T12A 2OHJA 1NRXA 2VNJA 3O4RA 3NANA 1VHLA 2CLHB 2ENWA 4ZDWA 5JO0A 1LK5A 4C0XA 2YWDA 1AF4A 4LGVA 1QRUA 1E3SA 4M37A 3OQBA 3EWSA 3S29A 4D1YA 4AS1A 3UAZA 1YVRA 3JQ7A 3NBYC 2EW1A 1S5PA 4PSKA 4C20A 5CH3A 3QOFA 5AOVA 5FWAA 1OXVA 1H5UA 4CKEA 4TV8F 1CUZA 2GCOB 3BF7A 5JCZA 2XDQA 1GZ7A 5F5NA 1HDGO 5KSWB 1USIA 4HGOA 4IQ4A 4CMGA 3AM1A 2VWGA 1Y1PA 5K6TA 4WADA 5FFNA 1E1CB 1COWD 3HB0A 3TLKA 2FDRA 5JH7B 5DBEX 4UBIA 4X1KA 5K8JB 1ZW6A 3O4VA 4B8ZA 4MO2A 1W0JA 3AETB 4ZTZB 4TN5A 4YXFA 3KLPX 2WSMA 4PO9A 2VZEA 5CYPA 2IHNA 4RY8A 3NHFA 3ZGYA 4YP9A 5GJWC 1MRZA 3KVVA 3NBFA 3WR5A 1CD5A 3ZK9A 4H6WA 4BMXA 2XT0A 4MUHA 1KYYA 1YBMA 5JC8A 5DX1A 1K86A 4IS2A 3FTPA 1KHTA 2G5GX 5U4QA 3ESCA 3H1TA 2B37A 4KRXA 3SDSA 3ID6C 5L51A 3ONEA 2PL3A 4RHTA 3ZWKA 4AJIA 2IBSA 2Y0EA 3A9WA 4P5EA 5BYAA 2I29A 2V58A 1FP6A 1TXGA 2XLCA 5EE1A 1CFJA 1KFJB 1P7VA 1MJGM 4HJXA 2WWHA 4I2NA 3ZQUA 2YOGA 4MKFA 1NBIA 5IJXA 5I47A 1TQDA 1RZ3A 3GLGA 1VKHA 2OVBA 4XWOA 3S1AB 4V1CA 1PG2A 2B2CA 1O6BA 3R0XA 4UFOA 1BW9B 3EFBA 2W70A 4MGZR 2CSXA 3IKTA 3PTLA 2XCTB 1KSGA 2HV9A 3MTAA 2QUAA 1YR7A 3ABIA 3N87A 3IR7A 2WF9A 5DGXA 1YK0A 2ZE5A 3OFSA 4F5DA 5MN6A 3LCCA 5GOZA 2VT2A 4KSCA 2KX7A 1YI0A 4LWOA 1YF3A 1YIOA 4J76A 1LJUA 2WDZA 3EZ6A 3FDFA 1RCFA 4BZQA 3R6TA 2DKFA 3A1NA 3NOQA 4YUWA 1H2BA 2F8SA 2FU5C 5HA5A 4MICA 5L4SA 4G25A 2VSXA 1H0SA 3DHNA 2W6ID 3C74A 3VU9B 3L4KA 4FGJA 2D2IA 1I01A 4HB4A 4NCNA 5FUWA 5P8WA 5EVJA 1YFLA 3BBPA 2J87A 3EA5A 1P7ZA 1HT2E 1KPGA 1VG8A 2VQSA 3GCZA 3PA8A 3HXKA 5DIZA 2WYOA 3W8EA 4DCSA 4XWWA 3KHUA 1Y3DE 1JKIA 3M5PA 5EWLA 4RHUA 3WKDA 5E6RA 1GQRA 3I1YA 4O4LA 4J7AA 1JILA 4RLQA 4Q39A 2BKXA 1RI3A 4BQNA 4EHLA 1UBNA 3M81A 2NVUA 4F2PA 1R88A 1A71A 4GRAA 4O5AA 4YJ3F 1JFLA 1SPXA 3COZA 3NQ41 4WFKA 5JBNA 2PS1A 4GYYA 2XIQA 2ET6A 4F3YA 5AVJA 2YHUA 1UQTA 1ZCFA 2P5TB 3C3JA 3GNLA 4NC9A 4RJ2A 1N8KA 4D9JA 2Q8PA 3H5OA 4H6XA 3ZE2B 4QQ8A 1W4BA 1YNSA 4AECA 5AW1A 5J9FA 2GPNA 4H35A 4PCUA 1S3GA 1V7QA 1M6HA 4FYYA 3RAPR 1ULAA 3ZCUA 1YKGA 2J6HA 4RDXA 4NE9A 3MF4A 4G56A 5CVJA 3M1IA 3HY3A 1F06A 2QL5A 6Q21A 3FTQA 3G9QA 5K03A 4RKQA 1ZD3A 1ORDA 3LL4A 2A4MA 1ICEA 2NN3C 2B20A 4GLLA 4FW9A 3CSDA 4Q4AA 4BQPA 4CM7A 3NYIA 1QJCA 1HUQA 5JS1A 3VJLA 4KO8A 4NVRA 4U02A 3ZW8A 5ALOA 1KTIA 3JCZA 1CZKA 2ZCVA 2OV2A 1U63A 2AEEA 1TA4A 3RHZA 5A6SA 1ZN2A 4K9LA 5BW4A 2VQEB 1T0UA 5KX5B 1N2EA 4HDQB 2HC9A 4PCAA 1IL0A 1EP1B 1U28C 1UJ5A 5EKXA 5J2TB 4S1PA 4N3AA 1EI9A 2F59A 2WD8A 2Q62A 1NPTO 1PT9A 1QYCA 3CE9A 1D2HA 2BKAA 2Q9BA 3P9PA 3PUIA 3Q2KA 4BLUA 3W9YA 1NPYA 2FTKE 1C30B 3KLMX 5LXTF 5KWJA 3I9OA 5IULC 4D3XA 2BEUB 2BTQA 3FVWA 1OUMA 1U7TA 3UENA 1EDOA 3DXFA 3HB4X 3MLAA 2Q1SA 3TSCA 5HPYB 2JH3A 3L7BA 4W6ZA 2X0KA 2XITA 5DBHX 2CK3A 1Z6QA 3WYGA 4CG0A 4DNOA 4GPIB 4EO9A 5JC1A 1A9TA 3KOWA 4L5BA 2RAFA 5FBRB 3LUHA 2VCEA 5CX1B 5BT8A 3VTZA 5JJIA 1GV1A 3CLHA 2F43B 1PWXA 3PS9A 3DBOB 3KB8A 5IYZA 1OBOA 4OEHA 4XCQA 4LF6B 2IEZA 3SIWA 1TGYA 4CKYA 3HWX1 4HN4B 2C8VA 3H5WA 1P5RA 4JT2A 3EG9A 1LPNA 2ZT5A 1KZ1A 2AEMA 2VLBA 2XDAA 2JARA 2E49A 3D2CA 2ZULA 3HHPA 3FX2A 3Q3JB 1C3VA 4OG2A 2BMJA 1ZH2A 2QG6A 2V7XA 2PGXA 5D86A 1LZKA 3GPLA 4HTAA 3T61A 1XF1A 5FV4A 5IX8A 1D7OA 4ESVA 3ZD7A 3ACDA 1Z37A 1P91A 5LDDC 3KQMA 2O4UX 1HM5A 3VKGA 1M33A 1U2RA 1K6EA 1UM8A 2HSEA 5CJPA 1E5VA 3ZX4A 4A9AA 5JT1A 5ICGA 2Q5EA 3KUXA 3RGGA 4I4TA 5DNUA 4JDUA 4FIDA 3UMMA 4YJ2B 3RD5A 4ZC1A 1QZUA 1L8LA 4HV4A 1JH8A 2OCBA 3Q1KA 3LT4A 3IUNA 5JUWA 5KYTA 1Y8QA 2D0OB 2DUNA 3R7AA 3RUPA 3FCXA 2I3AA 1XVLA 3EPRA 4US0R 5CVCA 3U3MA 4QODA 4KEAA 2QY9A 1X1CA 1T2UA 4OYYA 5JSZA 2NAFA 2YUIA 5LIRA 2X1VA 1GGMA 2DF8A 1Q77A 3HCEA 5K8IA 3C97A 2QWXA 4PHFA 5CXSA 2JVJA 1IZYA 2GPWA 2OTCA 3JQ9C 2RONA 1DAPA 1KMMA 2RDMA 3E6AA 4KAXA 1X7WA 3MMZA 1L8XA 1NX9A 2JD1A 2COEA 3FA2A 1E77A 3QYPA 1M2WA 4LVOA 3HXMA 4WFQA 5DM1A 1N2CE 3A06A 1A2KC 2EWMA 2B1IA 1MN6A 3CU5A 2J67A 1JLKA 1XN4A 4UCWA 4Q15A 4G0YA 4ZK2A 2V6MA 4M53A 1XVAA 2F1RA 1NKTA 1PZMA 3C6BA 5EIOA 4ND8A 5L7YA 4G89A 3FNFA 1P2TA 4Y1FA 1J2JA 3WLAA 1DXQA 2ZJ5A 1OIXA 2YMQA 4A8JA 3ZWCA 3TAXA 4C6TA 4CHTA 4F93B 5JXIA 3I58A 3IPCA 4C7JA 1QM5A 1VLQA 3THWA 3IQWA 1JHPA 1SD1A 4UBJA 4ZYYA 2NP7A 3KVNA 2Z09A 4HYTA 4I1UA 3UXYA 4EAAA 3A1DA 4V0OA 1XCJA 3A04A 3HY4A 1QVRA 2O2CA 4QOJA 1ZU4A 1M7GA 4TTJA 3MUOA 4B44A 3VO9A 1TIKA 5KTYA 4OUKX 2HIAA 3ZU5A 4E51A 4WK0B 3TSAA 3GLVA 2GZ3A 4GVLA 5FF9A 4OATA 3I3SR 3KLBA 3OCWA 3PQ8A 1E6KA 4NU5A 1UBEA 1J06A 4K8RB 4QQNA 5E4FA 1RM3A 2WU8A 3ZE1B 2F1IA 2BPOA 3R5FA 1JKFA 3S2YA 3EARA 5EHIA 1OE0A 2BL4A 4TXJA 1EDDA 3RSGA 4JODA 4EZIA 1WZNA 1JG6A 1VC2A 5G0TA 4GZ5A 3BAZA 3CXRA 1BAPA 4Y9UA 3UHJA 4O33A 1R50A 1VHQA 1NFFA 1VYUA 2AG8A 2C04A 2C0PA 1OFVA 2VQDA 3P5BA 3P71T 3GJQA 1X7GA 2QXUA 4M3NA 2GX6A 4Q3AA 5JMPA 4MQFA 1J56A 5EZSA 2W2PA 2GPYA 1L8AA 4DA7A 2VJMB 4JB2A 5EN4A 2VUHB 3O9MA 4G0MA 3ZW9A 1XJWA 2DUJA 3V4FA 5DNCA 1N25A 2VPIA 3DL4A 3OICA 1IG0A 3GG2A 3L8DA 4HGNA 4YMWA 1MX5A 1RHUA 1QMPA 1QO0D 2YJ4A 4M46A 3QFHA 5ALDA 3D3JA 3GJSA 3A9CA 3OMWA 3H99A 1PJZA 3UAVA 1Q0LA 1QTIA 1XVIA 1QYRA 1H3NA 2Y3IA 3K53A 3ZPXA 3NGLA 1JT9A 1S9HA 2D5BA 3M4NA 4KXQA 2O3SA 3I83A 1I24A 4BMSA 1P5HA 3HWWA 4QYSA 4EY4A 4QFBA 5F1OA 4DHWA 1R5BA 5J5VA 1BQEA 2R62A 2QUKA 4BTEA 2WKPA 4BFSA 3OZEA 1CEEA 1B41A 3LC0A 4IF6A 3OJFA 1KH1A 1FXSA 3WGYA 4AAYA 4WEOA 1MU0A 3RRXA 1UDCA 1VCOA 2OKCA 1ZIDA 5IJZA 1GRQA 5CDUA 1Z6GA 5IAAA 4O2LA 5ETJA 3TX2A 1BD4A 1KAEA 4MB0A 4DSOA 3K9BA 2I65A 5LWHA 1DRVA 2GJ8A 1FUKA 2ODWA 2R7AA 2VCHA 1PFWA 4ZVRA 4LE1A 4LV6A 2FLKA 1KDPA 1OBHA 2GJ4A 3VR4A 3C3WA 4KH1A 5GM1A 3ZE6A 3TL6A 2GKGA 1DX4A 4B6SA 4C03A 5F98A 1EK1A 4MP8A 1OWPA 3BVPA 1A1SA 3WGMA 2ORWA 3QBVA 3P19A 2WUWE 4U7FA 4A6DA 4YV7A 1ZOSA 3GFTA 1FSSA 2UZ4A 4E15A 2X8JB 2AFRA 4I4IA 4LF7B 1T0JB 1TI7A 1ZDMA 2GFIA 4URXR 5DHRA 1HG1A 2QV7A 1VL1A 3UICA 1FK8A 1YQQA 4GX2A 4TUYB 4CTKA 2ERYA 4JYPA 5AVQA 3HV2A 3NP7A 4IDFA 4OAPA 4QJIA 2G9VA 3U49A 1ZY2A 2BKEA 3MC1A 2AUTA 4YN3A 2CMHA 3V46A 4UQLA 1XI2A 1DDIA 1QH8A 3LAWA 4BATA 4DZTA 1CYEA 4AVYA 4MUBA 4ZV4A 4I4TF 4LV5B 4RU1A 4CODB 4CL2A 2C7OA 2V3VA 3FGNA 3HDVA 1FXUA 3P9NA 5B6IA 1SC1A 1YMQA 1RZUA 4KMOA 1ZINA 4MGKR 3CG4A 5KKAA 3TZQA 2ZSHA 3EDRA 5KEIA 4RWEA 4KIFA 3Q7QA 2EDCA 3PQDA 1WXIA 2QUIA 4WUTA 5KYYA 1I14A 2NXCA 2D0IA 5ES4B 3DTYA 5KHOC 1Z62A 3I72A 3S2GA 4AKIA 1J8YF 1IBKB 2CL5A 2ZTSA 2F3UA 2QD2A 3DOFA 3GLQA 4P1ZA 2ZUTA 4BECA 5LQKA 1JRLA 2NO5A 4JHXA 5E95A 2W2KA 3IP5A 3ZKAA 1THMA 3W5UA 2A84A 2BEJA 3X2SA 4IY1A 4LMPA 2BRUC 2VR1A 1QTNA 2KHZA 1UKZA 4H17A 3MTJA 5T3UA 2CGEA 2D74A 4NYJR 3GEDA 4DQXA 5BURA 1KVRA 4GKBA 4H1HA 4UDNA 2R5NA 3V00A 1Z22A 1AXRA 1FLDA 2FPGA 2Y9MB 4QTUB 3DWGA 4TKMA 4ITUA 1KK3A 1U6JA 3N3AC 3C7TA 2BI7A 3CLVA 1VPTA 3OKCA 4J90A 4KTTE 4RA6A 4EHBA 1KIAA 4WCFB 2DTEA 3QKSB 1J9GA 3LGXA 3QE9Y 2VEOA 4TOIA 3WVNA 2C7PA 4K9PA 1N9KA 5EXSA 2HRZA 2NTEA 3SBDA 1VCMA 2Y77A 3PDIB 4RIFA 1IHXA 4IFIA 3DBIA 1X7HA 1G8HA 2VF7A 4DLYA 3VR5D 1Y4AE 4RPHA 3V4LA 3Q85A 2UYGA 4J03A 5BN3B 3ENVA 3KOUA 3WJ7A 2Z1DA 4GNRA 3I6BA 3AVXA 5LOVA 4YUZA 3G8AA 1J0CA 4RSHA 1WV0A 1TQ4A 1Z7GA 1LNQA 2WUFA 4KV9A 1A3CA 2M98A 3IXLA 2UZ3A 1R9NA 3GIWA 1JFFA 4DREA 1OJLA 2ORVA 1A9XB 4WV3A 3TJZA 1G8FA 2NVBA 3ASVA 4OHZA 4ERNA 2D1QA 1BMTA 3R6GA 4JMPA 1KH3A 2PQMA 2ID8A 4V24A 3PKJA 1YD7A 3B1YA 4XEHA 2HIMA 2EBFX 2CCGA 1U9IA 4FNOA 1RAHA 1WAMA 2CJWA 1QIGA 1UAGA 2BFDA 1I4LD 2ZBDA 1ZNYA 2ATXA 3RG8A 2BGWA 3OESA 1YBFA 1QV6A 2JAHA 4DSUA 4G4SO 1NJ5A 1TRKA 1FOEB 1YVUA 4REQA 2OZKA 1QAQA 1BIFA 2DC1A 1E32A 2JGDA 2WKQA 5DE3A 1GN8A 5FOUA 5CYFA 1ADBA 4BX3A 5B3KA 3ZG6A 5JATA 3CW9A 2K7FA 3GLIA 2F1KA 1QE0A 3HCRA 5KNBA 2QZ9A 3W8NA 4CKBA 3S2EA 3KB1A 1C7QA 2MSWA 4QM7A 5K6RA 4LY9A 3RC8A 3WAKA 3VH1A 4YY3B 4RC9A 1POXA 1R0LA 4AJ4A 5AHOA 2A5JA 5FB3A 4F60A 3QPBA 5A6VA 3E9NA 4P7GA 3QVXA 3QUTA 1I10A 1PJ8A 4QXOA 4W7IA 3TW0A 3KOYA 1GDHA 1VHDA 1Y6QA 1N0VC 2F67A 3NB0A 4PSVA 4PR3A 3ILSA 1N1EA 3IJ5A 4KXFB 4TSKA 4A16A 4ZI7A 1FMFA 4QYXA 2WHYA 4ADSG 2I55A 4C7OB 1U2GC 3IILA 1EFVA 1T29A 3NHSA 1T15A 5DV9A 3TQFA 4D80A 1NNEA 2I9KA 2IZ6A 4Z6KA 4ZGWA 6REQA 1RWBA 2O0LA 3EUAA 4XD7D 3MJSA 1TF5A 1SB8A 3DAYA 4G5XA 3OIGA 4KXNA 1AU9A 3VGJA 2XOXA 4AJ1A 5C8VA 2ZRQA 2A5YB 3LYHA 4G8JA 2I8LA 4PXSA 2ZM5A 2OP0A 2IQ5A 3AU9A 2DU8A 4LY0A 1UC5B 4MR9B 5HIMA 4DCCA 1LQ2A 1N0UA 4Z9XA 3S3TA 3FPEA 2IGBA 5EE5B 1SVKA 1VE5A 3AJ9A 1DRJA 4P7FA 3GHYA 2I5PO 4NFYA 4KQWA 1JFSA 3DMDA 4M54A 4OQFA 3N2KB 3FWPA 4LRWA 1RMYA 4O4IF 1EUCB 1CS4C 3RJ9A 4CVNA 1QO9A 1KJWA 1TQHA 1GU0A 3F3MA 5DYWA 2WSBA 2P9ZA 3FWNA 1KO1A 5EG5A 2WSSD 5FL7D 2HXYA 3C48A 3E1GA 2QX4A 2PK3A 4GE3A 1N6OA 3A3NA 4G9BA 2LCIA 4DPKA 2ZTVA 2AXPA 1E89A 2ZBGA 4ER7A 3TG2A 2BV3A 1YQTA 4AZ3B 1DBSA 1O8CA 5KPDA 5F64A 4E12A 2WBLC 1ZIYA 4CMJA 5C4GB 3M4YA 3DFMA 1DG1G 5DN6D 5KMGA 4HKTA 2FV8A 4QPJC 2VF8A 4TRMA 1ACMA 1SCBA 3NHJA 2LR0A 4BBAA 2EFJA 5EP3A 2JASA 4C76A 4MKIA 1MZVA 3KQYA 4F3RA 1C0IA 4IXWA 3HB9A 5LYJF 1EK6A 2FW7A 3RV4A 3QVLA 3W7AA 1ZSNA 2WK1A 3PQFA 1A5SB 2D4AA 4PYQA 5HM6A 2YV5A 3SSNA 3V8PA 1NG1A 2A88A 3DC7A 2EQ5A 3E9CA 4PYOA 1HZZA 1F2TA 2LRHA 2XBUA 4BP9A 5CLHA 1J8DA 1RRGA 2ON6A 3NJ4A 1D8TA 4JP2A 1EVJA 1XXHA 1Z5VA 3AT1A 1QGAA 1D6NA 2XRYA 3AHFA 3A1CA 1IOLA 3ORHA 2V65A 3CLTC 1I5RA 1SG0A 1I3LA 2WF5A 5DKFA 4ENUA 4R3UC 2UYCA 3C7CB 5IKMA 4XSHA 2QRJA 1ABBA 1K3FA 4D3DA 1P61B 1G3QA 3JYLA 1Z4MA 3Q9NA 4QECA 3HA7A 4JEIA 5CM8B 3WP0A 2I66A 1ATIA 2R60A 2QNIA 3MK31 1ZH4A 3WP1B 3O3OB 3SYRA 3ST7A 3WL8A 1U2GA 5DGIA 1BG6A 4EW1A 3BCUA 5EIBC 4ECAA 3U6KA 2R84A 4G85A 2X6RA 2EHJA 2AWNA 3ZE7A 1OFIA 4NCBA 1J6UA 1LK0A 3PBKA 2X4IA 1AQJA 2C95A 2V6BA 3K2EA 2RHCA 1CULC 1PQ4A 4QFMA 3PQ2A 3TCNA 2RGEA 4BHTA 1VPDA 1LW6E 2V6JA 3R9KA 4XJXA 2QDKA 1IAVA 1QAOA 1JDZA 1SHJA 4HR7A 3TOXA 3UBMA 3WV4A 5BQ3A 3N6VA 3CVUA 1AZSC 2CUTA 5JMOA 4IQ8A 3VO1A 1KMIY 2R1VA 4XVUA 2D1SA 2PUVA 3DTNA 5EI5A 4UFPA 5CT8A 3KHTA 4FE3A 4II2A 3AEUB 1NMSA 1U28A 2QUZA 2WUVA 3O1IC 2AGVA 2Q6VA 3B1VA 3BN3A 4RDIA 4ZCSA 1Z17A 4DCUA 3TNJA 1XU4A 3BTUA 4JC8A 3ANXA 2RAVA 1M2OB 2ZSIA 4OQNA 5LD2C 3EBOA 4PX2A 4C4YA 1UJ4A 4GT1A 5LD2B 3RU7A 1LD3A 1M8PA 2GF0A 1I0LA 3H0CA 2TMKA 3HKDB 3TR6A 1IN7A 4ZVQA 1KQNA 1VJGA 3NAGA 1NVBA 3PHJA 2J4FA 3IAFA 4H7HA 1EB8A 1QWOA 3SBEA 3VH4A 4BKQA 2KLHA 3OTGA 2WI8A 3ZNQA 4Y6GB 4HVAA 5K3OA 3AEUA 1L6RA 1BRMA 1INLA 2FE1A 5LOVF 2JKYA 4WKGA 1RAFA 3ED1A 4NOLA 2P69A 4I1PA 5IUKC 1ZHOA 3ABOB 5DNVA 2X5XA 3I2YX 1WCWA 2FF7A 3A6ZA 4CLRA 3C41J 2ZBUA 1FSFA 5FFFA 5KNDH 3JQPA 1I9GA 4JROA 3OKFA 1EFVB 4MYDA 1F2UB 1CYDA 1BU5A 4QRDA 1QRTA 1YS1X 1Z5GA 3NNSA 2CUNA 1TEHA 2P6OA 3B3QA 3B13B 3IRUA 4G3XA 4ZI7B 5FWYB 1N5IA 4B33A 2SICE 2GWRA 4CETA 2ZRDA 1A5AB 5EMJA 5JV5A 3E8MA 1Z3CA 3P45A 1AV7A 1EQ2A 2JS7A 3JQCA 4U2BA 4OQQA 4P80A 4QBIA 1JHYA 1LS1A 3MUEA 3REOA 1ECCA 2Q27A 3RHTA 2HRRA 1P0FA 3FYDA 2VDUE 1R0WA 1VHJA 4DQUA 4YRMA 5JPDA 2GZAA 3QBTA 4L5CA 1XDDA 4UDXX 6AT1A 1PS9A 2ZIXA 1L7QA 3FFBA 4AYXA 1DDOA 1CLEA 1NHGA 4WBNA 2QIPA 2BE7A 2YIJA 3CO5A 3MYYA 3DJYA 3I2FA 3VR4D 2CL6X 1NVTA 1VHWA 3K4HA 3STTA 4F0JA 3WZ2A 1WM1A 2CJYA 1XB2A 3IUMA 3WNVA 1RVDA 3UAOA 3GFQA 1XLWA 1S4MA 2HCJB 1SY7A 1P29A 1KE2A 2YFKA 3JWJA 2E5LB 1SUAA 3LRTA 3OO0A 1H9AA 4I8IA 4JJAA 1Y9EA 3SQDA 1XKLA 2WQ6A 1QQ6A 3IP9A 1ESDA 2C57A 1YKFA 3AHHA 3PFWO 4QJ5A 3TUZC 4P38A 3R6WA 1PL0A 2B5WA 2ZIFA 1UQRA 2PMKA 3SS8A 3DBRB 3EMVA 1E2UA 2ZWAA 3A58B 3IIIA 3ONWA 1QIFA 4KWIA 2WF8A 1G3IA 1UK8A 4L5IA 4Q34A 1AF7A 1G291 4CUZA 4ZDIA 5DHFA 3P9QA 1TF2A 4OLFA 1N2CB 2O8DB 1JHMA 1JEJA 1E2MA 2DEUA 1JTEA 3QF7A 4IQ0A 2C7BA 1Z2OX 3H2BA 5ECYA 1EE2A 1RVV1 4UTRA 2DHDA 3DH0A 2C9BA 1O5IA 4LXXA 4C4OA 3PDIA 4UU8A 1WB9A 4Q21A 3E3AA 1W0CA 2C0QA 3G2HA 4BGVA 3LY7A 4A0HA 2WTEA 1F9EA 1FJHA 1QGED 5HIIA 4AJ2A 4D0SA 4W7HA 4L22A 3BWVA 2WMYA 4RORA 4YV0A 1QV9A 3FLAA 5LP6C 3B3GA 3GO4A 1R6UA 5FLYA 1F1JA 4RA6B 1H1TA 2VBCA 4HX2A 1MT0A 5BV1A 3JQGA 2XQIA 2Z2YA 3AH8A 3DEZA 3OT5A 5BUZA 2JG3A 5JFTA 4BDSA 1PG0A 2ECFA 4NZYA 3U3KA 4FGSA 4GGMX 1KJ8A 3OQ6A 3TSWA 4C0SA 3PC2A 5CA1A 3N1UA 2JIPA 2F48A 1OLSA 1UBLS 1PFGA 3P2JA 2NU9A 1E6WA 4FYMA 3DT9A 4QEZA 2YBDA 5LCXA 3UB3A 4CG3A 4CF7A 1SEVA 4NMMA 4Y6RA 5CXQA 5AVYA 4EY8A 1SBNE 4QD3A 4YJKA 4KNYA 4XJVA 4D57A 4Z3OA 1KPIA 2LGJA 2W2KB 4GP6A 1W0JD 2HK9A 1FDUA 4UPDA 4PLYA 5H02A 4XE5A 3I05A 3MILA 4BWVA 5G0VA 4Q9AA 4H7PA 2QJRA 3BG5A 2ZI3A 3O8QA 5TXGA 1G2OA 4G24A 3OCVA 3B1FA 4J3FA 3LW7A 1K1EA 1HDIA 1R4NB 2EKBA 1ICIA 3IS3A 4CT0A 3PPIA 1VRWA 4HQFA 1Q7BA 3RTEA 2QTHA 3RUIA 3VZCA 2AJ8A 1LX6A 1Y63A 1S3SA 4EGFA 3OPYB 1RWOA 2YQZA 3BTOA 1CQIA 4FC6A 1YZLA 1YK1A 1XRQA 2QX9A 3JVIA 4II7A 2B9VA 4G8DA 3RBXA 3FR8A 3T5AA 1CZLA 4UMDA 3S2IA 3DNFA 3SJCA 1TT5B 1ZISA 1DRKA 1NIPA 3ROZA 4DLZA 5K9ZA 5ALIA 2M6SA 1AURA 4RTOA 2EJUA 3CV3A 5I9SA 5CCDA 1A9XA 2AQ8A 1CTQA 3F6CA 4HNSA 4FFVA 2WWTA 2PJDA 3H6GA 3N6XA 3BA1A 2H57A 2OG2A 1GKIA 5HS4A 2UXCB 4WD3A 3SGLA 3ECAA 4JOSA 4BQSA 1GADO 3IOYA 1Q0ZA 3AJ8A 1G98A 4NV0A 3BFXA 1OA1A 3LTNC 4RKEA 2XXJA 3NUQA 1RWKA 3WMFA 1FDVA 2X7JA 2AG1A 3S8YA 2TSYB 2Q8QA 4J9UE 1KQOA 1VE9A 3OIYA 4F7DA 2RGUA 4YXWA 1ABEA 1EVQA 1Y5MA 1TYEB 3MRTA 4PYNA 1GIAA 2VA8A 1M2KA 2FUNB 2WHEA 4PRKA 4YH1A 3WBJA 4MVJP 4JA2A 3HK2A 3A8TA 1FYFA 1EA5A 2E6KA 2Q3CA 1XCLA 2HWUA 1GL6A 4I9NA 2AOXA 3L79A 3P0FA 3GGSA 2PMEA 5CDHA 5KVSA 5EE3A 2P41A 3DQZA 3E1KA 3QKSA 3S8MA 1KK0A 3BK1A 2RHGB 1OYOA 1CG6A 3AVPA 1FUUA 5L40A 3JS5A 4LK2A 4IDBA 4AP6A 5JDIC 4URZR 4RLHA 1J21A 1MD9A 3T0FA 4MIOA 2G82A 2WYWA 2FZVA 3L7NA 3QU7A 5JZOA 3DO8A 1LXCA 4JH0A 1HDOA 2ORIA 4C3OB 1Y5RA 4HFRA 1KNXA 3DC2A 3KUDA 5JAMA 3S2ZA 2QVLA 3IIEA 1SUFA 2VHEA 3JASA 2Z56A 4QYMA 5LWQA 1WBBA 2XD9A 5JECA 1NLUA 1U2ZA 4N6GA 5B7QA 1Q11A 4GI2A 1F12A 1R64A 3BOSA 1ACLA 1K6XA 3SHTA 4ZTUB 3RSFA 1O6FA 1R0CA 3D6HA 4O02B 5M3BA 3VH3A 3BWMA 2O3UA 1IVYA 3MJFA 2Q7OE 2B5VA 4DBLE 4LCJA 4GL2A 3AVWA 421PA 4Q4HA 3UN1A 3D43A 1COWA 5IZCA 4F6RB 2VJMA 4N5DA 4NYMR 3X2EA 4YAKA 4ZPXA 3QPVA 3SICE 2M32A 1GDDA 3VDRA 1E1QD 4GEGA 4UHDA 5FWDA 1MRNA 1BGVA 3OUUA 5JJCA 4E46A 5DZSA 1JEAA 2Z0MA 4YP0A 4Q4LA 4Y2JA 3RYFA 3KJXA 1X70A 3DW1X 1JQJC 4Z53A 2I2WA 3NV7A 4JCCA 4XWAA 2P4UA 3F7MA 2VJBA 5CDFE 3PQ5A 1CIJA 4B5KA 3D4OA 2FR8C 2FLVA 4FBGA 2FUCA 5LA6B 3VVCA 2F90A 4I6EA 1JVSA 2MTBA 4KVFA 1EDEA 4PGMA 5TGTA 4IVPA 3VPCA 3W4IA 2J41A 4IYRA 4HEJA 3D3WA 2M9MA 4TUYA 3A05A 4EJ0A 1QBGA 2F3TA 1WO8A 3O8BA 3NETA 4E2XA 3KXPA 2FSHA 3NP9A 4S12A 2OGZA 4MYSA 4PC1A 5B2EA 2XYRA 2Y0BA 1S7GA 4BNJA 4PLCA 1HKUA 3ZQ4A 1PL8A 2EXXA 2ZJYA 3AEXA 4M9QA 1U0GA 5FO0A 1F8YA 5KOIA 5LA6A 3G2KA 4ZYWA 4YAGA 3CLUD 3KQVA 3H2IA 1OBVA 2EFEB 4H4CA 4MW9A 1HRKA 2GN0A 1T5HX 1KMHA 1FTNA 3GFSA 4WNCA 4AC9A 2X1HA 1JSCA 4NPHA 5DF1A 4YCSA 5LQJA 3MXTA 1S01A 4DCJA 2C4WA 2YDYA 3AJEA 1Q5PA 1P2GA 3N8KA 4KOAA 1T1RA 3HDJA 4MQ6A 1E61A 5CLLA 2V98A 5C8DA 4IS3A 1H3EA 3PFCA 3PQ7A 3IOEA 2F1HA 4JELA 3ZVMA 2G5PA 3D8SA 5CFRA 1VBNA 2C8LA 4CQJA 3I92A 2WT9A 1M76A 3UK2A 1ENPA 3OOEA 4MW7A 2PLFA 4IUYA 2CXUA 4OUDA 4G0VA 2RGYA 4US2R 3I04A 1GPUA 4X64B 5DTEA 2DT5A 5ARCA 2X0RA 1MB2A 3MTGA 4OMFG 4AIIA 3EXEB 5JANA 1DO8A 4P92A 2BH2A 3DCYA 4EIWA 5GIPE 3U3ZA 3EVZA 4PGGA 4IV0A 2J5KA 1RM4A 1FRFS 1T24A 4LSZA 4BB0A 5D5PA 4L7VA 2O0MA 9LDTA 1V16B 1IOVA 3SPXA 1SKYB 2O2DA 3AY0A 3JYNA 4M1YA 4D9BA 2WD7B 1AMOA 2C9YA 4BO7A 4J4BA 4YIHA 2IOHA 3DUFB 1KEEB 3I9JA 3LK7A 3RH0A 2CJFA 1UEXC 1V8PA 1OFGA 4G65A 1Z68A 2VNAA 4Q01A 3W6OA 2DR0A 3QVGB 2IT1A 5L9AA 3MMNA 1T8TA 2CXNA 1LVHA 5BW5A 2X5OA 3URKA 4HZIA 3PEEA 2G6TA 1AUXA 1UOEA 1IQRA 2XUHA 3HB7A 3IUJA 1VBMA 3C5CA 1QONA 5F12A 3O94A 1C3JA 3FBWA 2YHIA 1Y7IA 4Q9IA 3GAFA 2H8GA 5T7BA 4RTSA 4EX6A 4XIFA 4BJ6A 2DQZA 3BSFA 1BDHA 2DWQA 2BONA 4BE4A 3AUTA 1CX9B 1UJCA 4AN0A 1NW5A 3FKSA 1W2WB 1J09A 4TTTS 2FJUA 1K27A 1FPQA 4Z99A 3TH5A 4B7CA 2JFNA 3WAGA 4I36A 1E1YA 2Q5JA 1GLVA 2BFEA 5EVCA 4QKQA 4JBYA 4KUHA 2H0AA 2A59A 3S81A 3HJBA 1RYNA 1HURA 5F21A 4DHEA 3QPCA 3ZI4A 2P2NA 4YQZA 3BDAA 3NAMA 1U2EA 1Z8DA 3FHLA 4Y9DA 1EFPA 4MV6A 3EA4A 4F84A 4BAGA 2Z2XA 4RD4A 5BWNA 3ECCA 3OU2A 5TS2A 3UMYA 3NYRA 1R5OA 4B4KA 4Q7LA 2GK6A 3DB2A 3KT0A 1CNFA 1GGVA 2VQFB 1D1PA 4R2IA 4XUGB 4DJDC 2Y92A 5IDQA 1G2QA 3C3CA 4C5BA 4BC0A 3CVJA 1F3OA 1Q12A 3E9DA 5M7EA 2V7TA 4KO2S 3K5WA 5F51A 3HPQA 1ODIA 1WHSA 4P4NA 1B93A 1EH5A 1X2EA 3I9LA 4B73A 1NVDA 2BEUA 2WE7A 1JJ7A 5CX4A 1NJ8A 1OTXA 3GDFA 3OBBA 3KKEA 3N86A 1MZPA 4BB5A 3DDUA 4AKGA 1RACA 4ZANA 1H2AS 1N77A 2XIJA 4ZAZA 4A91A 3SQXA 221PA 1G6OA 1RI2A 1RQXA 3O91A 3CTPA 5IM5A 5F33A 3WGKA 4QM6A 4Q4JA 3GMIA 2PEZA 4O5OA 2XAUA 1HYHA 3K8ZA 1WXDA 2OMKA 3ND8A 4XI9A 5K1ZA 1VL2A 2BFFB 2X1LA 3CKYA 3VR3A 2Y9PB 1QF6A 4RHYA 4BLOA 2EL9A 2BBWA 2HF7A 3W1EA 2FPMA 2FX3A 4BVKA 4Z51A 3DEAA 4DDTA 5F2NA 3J7AC 4TV9F 4XPZA 1XQ9A 4RF2A 3ZHTA 1AUOA 1MB0A 1C4WA 4BKPA 4FYIA 4YACA 5EUBA 1RHJA 1Y8QB 1OXBB 2QX8A 1TQ8A 2GOYA 1II9A 3ITKA 4D96A 5F35A 1JF8A 4GR5A 3B38A 2JGFA 5AMXA 5ALMA 3ZU2A 4X7MA 2XGJA 3MFYA 3VZRA 1F0YA 2H1IA 2FMTA 1WOMA 2P65A 1VJCA 4MQEA 1ZZGA 2J07A 1I7QB 2ZRCA 3KV3O 2W7TA 3K31A 3QH4A 4BMNA 5JCOC 5JNSA 5LQNA 4MWOA 4FKBA 1E59A 3MUFA 1WCV1 1U7WA 2PKCA 3IBCA 3PHIA 4TV8B 5H83A 3T1HB 4MUAA 3S2SA 2GRJA 1EFUA 2XTJA 3VJKA 3U4CA 1U1DA 3UUEA 4JXXA 2QXYA 4URVR 5ENDA 4I3HA 1NW4A 4TSFA 1TKCA 5L3ZA 4LXIA 1LTQA 2GO7A 4RMHA 2O3JA 4M99A 1Z12A 4G1MB 2VYVA 1DBRA 3L5KA 4RF4A 2A3RA 4KWEA 3I1IA 4QJ4A 2PXCA 3H9EO 1PR9A 3O93A 4BPRA 5CD9A 3UJBA 4V3BA 3DP9A 4D7AA 2ETVA 5CVVA 5FOXA 3M6VA 4DR4B 1WKCA 3Q2OA 4WBNB 5AKJA 1M1YE 3CZCA 2RI0A 3BIXA 5HF8A 1GPDG 3I2IA 3JVDA 2QSYA 4Y98A 1PR0A 3NOXA 1R3UA 2ZIXB 1K7CA 5D6OA 1GPKA 1C50A 1GUBA 3L4BA 1DAGA 3EGCA 4BO6A 1XV5A 1WHTB 1EINA 3A6EA 3W1WA 3SE7A 5B5SA 3FCSB 5ALQA 2AVNA 4FDVA 2YJNA 2IYEA 3PNBA 3E4CA 5IM4F 1WF3A 2BTQB 4MRSA 5AK4A 3GZ4A 1BW9A 4CV1A 1TJ5A 1MG5A 521PA 1T9HA 1G3RA 1YQDA 3CUWA 3VSBA 1JBKA 1HC7A 3S1AA 4AMVA 4V1CB 5HF6A 2PBFA 5T6BA 2Q5CA 2VHYA 4HGYA 2FFHA 2BH9A 1SG6A 5BYBA 3T3GA 5A1TA 3NLLA 1GDTA 2DCUA 1NQTA 1XTVA 4KPFC 3ZWOA 1H2HA 4TTAA 4ZCMA 2ZYGA 3G6KA 4H6PA 1VECA 3BK2A 1A5TA 4EABA 2BGIA 2XWBF 1N0HA 3GRKA 5FPSA 5FOQA 3IXMA 1YUNA 4EBBA 1U90A 2JGKA 2VYCA 3M5CA 5DBGA 4C4ZA 8OHMA 5TV2A 1O0CA 1AK9A 4CKCB 2DETA 4ZHSA 2G0NA 3OPYI 2R751 4N7RA 3SG0A 2OFOA 5FPQA 1EVKA 5EXTA 3V1TC 2P5YA 4HS4A 3LHIA 1YR8A 4X94A 3JX9A 3CUSA 4TPKA 2E5FA 1NYRA 4HEA1 5AQ1A 1UJ6A 3BIJA 2A58A 5C34B 4BB6A 3LI2A 1P0QA 4KVZA 1L0BA 4TS4A 3GBSA 1OHHD 5B1IA 2JK0A 3AFGA 3CPJB 3ZY6A 1E1CA 2IYYA 4RQTA 1T8PA 2PH7A 3GL9A 4GXQA 2QQGA 3LHSA 4DXDA 1ND5A 3ZBUA 2OV8A 3E03A 2VXCA 3AZOA 4FR0A 2MSCB 4PLFA 2FLWA 2GCOA 3SHWA 4TV9A 3A9TA 1BX0A 3JRNA 4CKEB 1UWVA 4NQZA 4A4DA 4PN3A 5JASA 2PZEA 4WHMA 4Y2VA 3V3TA 1GITA 2GB4A 3TZKA 1T8RA 1IUOA 1T2CA 2Q7XA 3LQKA 2WRZA 5FJJA 4F8JA 5K4HA 2DB3A 1AS3A 8GPBA 2V3WA 3AI7A 5KOJA 2RC5A 3CY6A 4UXJA 4GBGA 4X20B 3QBJA 2HHJA 4N49A 4AWAA 3H2ZA 1E9BA 3M6MD 4P33A 2HHCA 4PTYA 4QOGA 3VU9A 3HVIA 2DR3A 4KFSA 2I7VA 5ALHA 3AUAA 1AGPA 2FN3A 4YJHA 1R8QA 2HADA 5KHLB 3DVLA 2VPWA 1Z45A 4DC0A 4CKWA 1RWXA 4JQZA 3ROKA 2MU1A 1SJ9A 1VXRA 2IYQA 4K6HA 1WPGA 1GGNA 5DI9A 1CP3A 3RKRA 2XKAA 3Q6NA 3OHSX 2M2IA 4QC2A 5FI3A 3SAJA 4O4HF 4F8EA 2YWHA 5TJHA 4M8KA 5IBCA 2HSGA 1X86B 3RSZA 2GN2A 4KOEC 2HK7A 1UZLA 4QU5A 1LDEA 3Q3VA 4HDSB 3E84A 1SUDA 3A9UA 3L0SA 3VR0A 3OE4A 3NIBA 4C30A 1K8QA 3MJEA 4JYAB 2QTRA 3L01A 3RVPA 3K3PA 1E7MA 2IXAA 1JT2A 3Q12A 5DHSA 3RJZA 1Z7EA 5HSGA 1QCCA 4AM8A 1KKLA 2ZJ4A 3UV3A 1QGZA 3AQIA 1HORA 1TKRA 3FBTA 2C20A 1KEZA 2V7VA 3U7RA 3UMGA 1BDIA 4PZDA 1K0FA 2OUKA 1F14A 1ODFA 2E4AA 2LCFA 3KU4A 2RE8A 5AW6A 2E4VA 1Q3TA 4LBWA 1VCNA 1X7YA 1YULA 2WYHA 3C70A 2KSQA 3KPUA 4ZI5A 2AFHA 4QARA 1TJYA 2EFDB 1FXWF 2GHQA 3TIIA 3UWMA 2FSVA 1ZGHA 1EUCA 4F1JA 4FFLA 4IUBS 2ZE7A 4D98A 3LPLA 2H5JA 2WE8A 5TT1A 4CGYA 3DKKA 1E94E 2YFHA 4BOYA 2CMKA 1MVOA 1F17A 1W25A 3F9RA 1RQ7A 2WA1A 2Q5LA 5T4EA 1NRIA 1ZGZA 4XYGA 3PZBA 2J31A 4Q5IA 5C8YA 1XJCA 3HJHA 3ZHCA 1ZVVA 1IWPB 4ZZ3A 1O94A 3HZHA 1IIRA 3WO1A 3K1ZA 1XAHA 1XRLA 3QFFA 1QX4A 3GT3A 1GVHA 1A9PA 1ZX1A 2J85A 3ABSB 1PLKA 4GMFA 4ZO4A 1E2IA 3O4HA 4ARUA 3TAHA 4F9TA 4YRNA 1YZQA 3DMHA 4K9KA 4TWZA 4C14A 1R5JA 4FUQA 3DLHA 3B70A 4KQEA 3I32A 5C18A 2C7GA 2J3HA 1TVMA 2A9FA 1MG0A 2GDZA 2ODAA 2G28A 4O2RA 1MO3A 4IO1A 5F4ZA 4Z5XA 5L53A 1WBDA 2GXAA 2G1JA 4LRQA 4FJ2A 1JJVA 2Z2JA 1NV8A 1R18A 2HWWA 3DAFA 2IHBA 2O14A 1ZNWA 4RVOA 2PX3A 3HUEA 1Y3AA 1WVIA 2Q4OA 1KEWA 3K9LA 4X00A 5E9AA 2CHEA 1ONOA 3FSJX 3H2HA 2DSTA 1L4EA 3IE0A 1XJ5A 2FKNA 3FN4A 3P26A 4N40A 1XZLA 4S04A 3AUJB 4IV5A 4MUKA 3BT7A 1CZNA 3EGDB 3UAWA 1E66A 4LPSA 4ES6A 5GV7A 3AINA 4CHGA 2YWGA 3DBHA 4PBTA 1W1IA 2HUPA 3RRFA 3W5HA 1YDGA 1D04A 2R25B 2WIJA 5EAIA 2Q50A 4L5YA 1BROA 2ZS8A 2EWVA 2VC2B 4QGFA 3VZPA 4MB6A 3DFIA 4LHXA 1TYAE 3UTDA 4OXKA 1T5LA 1X1BA 4U7DA 2H0QA 4MUFA 1KK1A 3IDAA 5BV7A 3M6FA 2I1WA 1PDOA 5SY6A 3OLXA 3L6BA 3LXUX 3T38A 5GV8A 1HFWA 1P1BA 2AHOA 3GDOA 1M1NB 4NESA 3I45A 1U6KA 5JZ9A 5H5JA 3HYTA 3OA0A 2PU5A 2QE6A 1KWGA 5DNWA 3PB3A 2OB2A 4XTCS 3T7SA 1N9ZA 4MCJA 2I2BA 4ILEA 4ALKA 5IDWA 3ZYZA 5BVGA 1MGOA 2DLDA 2EW8A 2JJ1A 5L4LA 1TM4E 3U7HB 3E5HA 4PFKA 4KSBA 2BM1A 3WQRA 1BHQ1 3ZU6A 3BWXA 3Q5DA 5HQ3B 1PYDA 3KSRA 5BN3A 5C52B 3D7SA 2PWYA 1BGWA 1DI0A 2FX2A 2H29A 1SVOA 2L17A 1JJIA 2JGAA 1TZCA 3FW1A 2O5VA 2ZP1A 3ZGOA 1TYCA 2BGKA 1DLIA 3EFHA 4CMEA 3KOZA 1RXIA 1COZA 3OIFA 4RZUA 2O2GA 3P0EA 3UG7A 3P0RA 5A2GA 4PZEA 3MAGA 1NMEA 1PEDA 4D79A 1T5TA 4JJ6A 2WOOA 1LNSA 5CK4A 3PK0A 2OL4A 3N0TA 5B7NA 1U0FA 2FNAA 2QUJA 2GBLA 2IUTA 2I6GA 4EWLA 2IF2A 4QPZA 1PQWA 2EJBA 5EIWA 3LY9A 2CXRA 4FGLA 3OZTA 1CPYA 4BCBA 5LA6F 4W63A 5ALFA 3LUPA 1IBCA 1DXHA 1CY7A 1Z07A 3L6OO 2PUTA 2ZR0A 4ARZB 2QYTA 1S8AA 2R00C 2XJ4A 4JI5B 3KXDA 3TW8A 1CUBA 1QIMA 4BO4A 3F6EX 4WN3A 5EJMA 2AS0A 4QEKA 1CETA 3KZNA 4NBVA 3H0KA 3V7YA 4DDHA 4RTRA 1ISPA 3DHYA 2GAAA 4J0GA 3SFVA 4A0RA 2PGNA 5JWHA 5LM3A 2QXTA 3VPDA 4BNTA 3RRBA 5IT5A 3FD8A 1ULUA 1ZG3A 2N3ZA 5GINE 4FILA 4K0KB 1SURA 3KKZA 4EHDA 5FNVF 5K0EA 2O2EA 1JDBB 2WWFA 3N53A 4OFWA 4WXHA 2PS9A 3IVGA 3S99A 1FXWA 4M9SA 1SUWA 3SXPA 1V1MA 2VYQA 2Z9CA 4CZ2A 2GEJA 1CXZA 1S3FA 3B1WA 3O7MA 4DV2B 1NMQA 3I9KA 1WPRA 4D9NA 1BJKA 1NE2A 1ZD9A 1L7OA 1VDZA 2GN4A 2HIGA 2I4RA 2ABWA 2IXDA 2ZB7A 2NVOA 4D46A 3I4FA 1EIWA 5KWVA 1XMXA 4G5GA 3IHWA 4QBGB 3SQNA 4AT1A 1LI4A 2C8KA 2PCJA 1ULBA 2ZJFA 2W2XA 1R6DA 4L0CA 4O2AB 5DYYA 4EUEA 1N4AA 5CYGA 5EESA 1VSTA 3MSXA 3HY6A 1JVNA 2EF0A 3RIHA 4G5SA 4A0FA 5BUSA 3RC1A 1WP4A 2FSSA 1WSAA 2Y4OA 4HNVA 1JDTA 2ZYUX 3MMPA 2DOKA 3DDNA 4XD2A 3VVLA 4MKHA 1ZPDA 4S0ZA 1Y82A 2R6R1 3CEAA 5DX8A 3SNKA 4MYUA 5IP5A 2DUWA 2VJLA 4ZQGA 3DO6A 5CA0A 5GONF 3MINA 3D8NA 4OAOA 3L5OA 1Y42X 2L2QA 2PGLA 1O0SA 4OKSA 3TK1A 5IHPA 5LKAA 3PD7A 2O8DA 4FXOA 4HH3C 4WLFA 4TTVA 4XVHA 5E7IA 2WWWA 2WKRA 3MWLA 4EO4A 3AUXA 4BFLA 4Y2XA 3LH5A 1JIIA 1Z4JA 2JJ2A 3HCNA 4V2IA 4ALMA 3ZDRA 4D8XA 3MVEA 2CNKA 3VZDA 4EBFA 4KG7A 4LQDA 4Y9RA 1SVUA 4EJSB 5C7LO 2QTWB 4RHXA 4D8UA 2VAPA 3CHYA 3AY6A 4G1FA 1ZJWA 4CL0A 4PFQA 5EQFA 2HRDA 4MWEA 4QT0A 1NM5C 3T7KA 4LDQA 4BV2A 4C4SA 1NHWA 1B16A 1FP4B 3VNQA 1FJXA 1MNQA 4EG0A 4I1OA 1XQ1A 5IFKA 1W93A 3W3AD 1NUQA 5DLEA 1ZN8A 4MQ5A 1X80A 3K0KA 4PZ0A 3LPAA 3WLKX 1OZ0A 1Q1QA 4S1TA 1MX3A 4NZOA 2FZCA 3RJTA 1AG9A 2C3YA 3FCOA 2IYWA 3GARA 2OXTA 3STWA 5LXTA 4KFTA 3PXGA 3PD1A 5BW6B 1AGXA 4HSGA 3PJRA 1DHRA 2RGDA 1G9TA 2OBMA 2XECA 2AVDA 4QUJA 1MO5A 3C1OA 3THYA 1Y34E 4DZRA 3OH8A 3TFOA 4FDAA 1JKJA 4MCIA 4R84A 3G0GA 4NXMB 2Q6OA 5T41A 1J1UA 1EHIA 1SIOA 3NHLA 3CEJA 3EDYA 4MP3A 2PMWB 3ELYA 5J47A 1ADCA 4GX0A 1DP4A 1OJ7A 2ZK7A 3DEJA 2PWPA 4G81A 2V0CA 1N3YA 2A0XA 3K0AA 4YMSA 1ZQ1A 4KBYA 3RS4A 3O9ZA 2MSLA 3GRRA 3I34X 3TQTA 3ESBA 2WT8A 4EHIA 5H81A 3NC4A 2P2DA 4BC1A 4I99A 2DULA 1URPA 1O97D 1KO8A 3BXZA 4JQYA 4CLEA 5HQTA 3R3SA 4EY5A 3O3MB 3VC2A 2TMDA 5CPFA 3WGOA 4BVAA 1NFQA 3JQFC 4BQIA 1FFDA 4QO7A 3BKXA 4MI3A 1XDGA 4ENRA 1O95A 1WRBA 3LZ6A 3UWOA 1HBJA 1EM8A 2OPHA 1ZBQA 5BO5A 4ID9A 1EFLA 4M1OA 4OIMA 5K8VA 1C0LA 1XYGA 4PZYA 1OH7A 3RO7A 2IE0A 2Z4TA 3MGKA 2JAQA 3G8DA 1CV2A 2GZSA 3S4YA 1I3OA 3T35A 3WL3A 4EY6A 5M29A 3PTAA 3RYIA 4AY3A 5DN6A 1EX9A 1P2DA 1YR6A 2YRWA 4Q9JA 5DTIA 3ZIAA 1XZ8A 2NO1A 4YHHB 4CQNA 1SC3A 4XW2A 4N41A 2R5WA 2Z9DA 2OV6A 3N58A 4RGYA 5CG2A 3NG1A 5JFOA 1K7SN 2W2NA 3OCZA 4K6OA 2GEBA 2PSFA 5LU8A 3ZE0B 1SUIA 4GBMA 4DL9A 4MVJA 1ZVMA 1XRSB 1EVZA 1XMJA 4DY4A 3KQNA 4K1XA 1N2JA 3K70B 4CG1A 1LPMA 2YL2A 4Q3BA 5FEMA 4II3A 3NFRA 4YUVA 1N6PA 2GA8A 1GNTA 1LPPA 1MB4A 4F2GA 4FR2A 5ERGB 4OO3A 4CDRA 1BN7A 1PWEA 2DJIA 3M4ZA 2IU0A 4RDCA 4YYEA 4M21A 1QBKC 2OK7A 5B2ZA 1IAQA 3UO8B 4UHJA 3DLTA 4L6CA 3ZCXA 2DQSA 2EEPA 3CVVA 2F62A 2GQ0A 2HLDA 3G8YA 4M86A 2G9QA 1TPYA 1QLWA 2NYVA 2YYYA 1YJAA 4GRIA 3ZQ6A 1LDYA 4NMWA 3UMRA 1M72A 2PEYA 3TFWA 3IBSA 4EVIA 1X7WB 1G4HA 3IMFA 5FNZA 2H2HA 4QASA 4KQKA 3THSA 4RFVA 3KSAC 1ML3A 2V03A 3WGJA 5C2JB 1GARA 5AM5A 4L78A 3C15C 2G9RA 1IRIA 1XFAA 4X3OA 4DCPA 1BEZA 1KA9H 5EHNA 4A0SA 1C8BA 3ZY4A 5ALKA 5LQMA 3ZD9A 5GONA 3BZUA 2I91A 2HTEA 4ID3A 4ON9A 1JIUA 2BSXA 4PIPA 3T4EA 3R0QA 5CGZA 1M6EX 2APJA 5E1DA 4YJ2A 4RZQA 1LK7A 2ASEA 2JIMA 4TM7A 1JLMA 3KUCA 3PNOA 4NU6A 4ZOEA 3ZNPA 2JLVA 3GW8A 2ACVA 3SZGA 4DFDA 1JLLA 4YT2A 3LFUA 2OUIA 4Q48A 5HDBB 4LGCA 4E4RA 2P9YA 3LIPA 3LX8A 2IP1A 2C1ZA 1FFBA 4JYMA 1YA6A 4O2BB 2MYPA 2BD0A 2V3CC 1E5TA 1GPBA 3WA7A 4IWXA 4B3FX 2DRIA 4PLWA 3NTLA 1ILWA 1ECFA 1PT5A 2QTFA 2E82A 4LOJA 4HBZA 2CXQA 4DR2B 2AFHE 4NFHA 3BS4A 4K40A 1DPGA 3OZSA 3TGLA 3W2IA 1YZFA 1EUDA 1Z6TA 4J4TA 3IMKA 3QJYA 4W4TA 4DRZA 1YBHA 1QSGA 3EZNA 5EFZA 4ZVKA 3WHKA 2XUQA 1PK7A 3UWSA 2P0YA 2F43A 2LWIA 4WXYB 3UUFA 1A2OA 2QJWA 3NWPA 3F5QA 5KVQA 3RROA 4POOA 5C5DA 2BOVA 1TVEA 1KY2A 1V8BA 4M1MA 5CX1A 4RD6A 5BN5B 1M2VA 5HG0A 5HOEA 5KC8A 1YZNA 3JY6A 4CDNA 2H6EA 3SF8B 3WYBA 3KAPA 4AF8A 1UJNA 1YMVA 2QRVB 3DUWA 4FN4A 4OGWA 3DBVO 4LRTB 4UQPA 1NT2A 3BIOA 1C9MA 2C54A 2XBLA 2J32A 1A8QA 2CN1A 3JYOA 3PT5A 2FPPB 3SR3A 3QKUA 1Z2NX 2WJJA 1U0JA 2IEGA 3PEUA 5KYVA 1J39A 1WMDA 3GGPA 4GMKA 2I6SA 3RTCA 3EIWA 4Q1BA 1M0WA 2QW1A 3D4PA 3BSWA 3F0TA 4MRMB 4S1NA 3ROFA 3TG8A 3GEIA 4G86A 1JFRA 1LF5A 2GKOA 2NOAA 2ODPA 2QUHA 2RJ3A 1XL1A 2EDAA 2R7KA 1WCIA 1X7XA 3GJ0A 3KUUA 4CDMA 1FFAA 1Y5NA 2B7LA 5DYIA 3UH0A 4X84A 3QSYA 4GD3Q 1JE1A 3HN2A 4H0FA 1JQAA 4UPEA 3EHDA 4L72A 1PEAA 2QV0A 3BD8A 2CY0A 1SXJC 3H75A 3KL4A 4HF7A 4JNCA 4R6WA 2XYPA 3RLIA 2ZIVB 1J23A 1TQ6A 4HQLA 3WL5A 1D1TA 4C4TA 2ZR7A 3P27A 3HA2A 1MJFA 1EA7A 1JKXA 4OHFA 1M75A 2ZJ1A 3VV2A 1GD1O 1OT5A 1NQXA 1NN5A 1PDVA 2IF0A 2WHQA 4FBMA 1RBYA 4HVCA 1EP3B 4ZVNA 3RM3A 2GEKA 4GR9A 4TQUS 4KN8A 3NHBA 4BEWA 3CH7A 1HTBA 5K99A 3V8MA 1FFXB 5EIBD 4Q3OA 3RUHA 5CJ2A 2PX4A 4QU9A 1T25A 1B2RA 3D8HA 1XWFA 4PLPA 4B4UA 4RNDB 3X1ZA 1FYWA 2V5UA 5J4LA 3G2OA 4MV5A 3ITDA 3K72B 1S1MA 2XQKA 2ZT8A 1BE6A 3FRHA 3HZRA 1XD8A 4RVHA 4YDQA 3HVRA 2XADA 4W99A 3SQLA 2FEKA 1TYDE 4PWZA 2SCUA 5C81A 4FLEA 1O54A 4IMRA 1MV8A 2C3MA 3WSTA 2AH5A 1LRKA 2FVXA 4FBLA 1ULHA 1AKYA 1RP7A 1Z26A 3IPLA 3M2TA 4KXMA 3CX6A 4B0PA 2I67A 3K0CA 5E6RB 2Q0QA 3C6YA 5GP1A 2ECOA 1CBUA 3LU1A 3P9CA 5DM60 4RZHA 1RWVA 2WM2A 1MC4A 3IP1A 1SHUX 3GOQA 4DT1B 4EGCB 1V6AA 2PBRA 4PG7A 3FOFC 3FDIA 4UARA 1EJBA 2Q99A 2BFPA 5CUQA 4BRSA 1FP1D 1T0HB 2W8BB 1IZ8A 5ICFA 2A0YA 3GGOA 2IP2A 3PX2A 4I0WB 4R7ZA 4L4UA 1QP4A 4FCVA 2EZ4A 2FZEA 3QKRA 3SEZA 1PT8A 2X3YA 2IP4A 3LPMA 1KZ6A 1DKQA 3QK7A 1NSFA 4JUBA 3RG2A 3UK1A 4BYGA 5JOQA 3K15A 1E1NA 3UK6A 2H1WA 5ICMA 3UJPA 2FMIA 2X3UA 3IYLW 3H8SA 2H8KA 4LUCA 4IICA 2CDBA 4X91A 4IGIA 4ZEOA 3T7IA 3ZNNA 3C7AA 3PLRA 2H1OA 1ZUIA 2EX4A 1LBTA 1V6CA 4XSGA 4D8YA 2OBXA 4LPKA 3GEEA 4XRRA 2X7HA 1SXPA 1W36D 3B6ZA 3L7DA 2XB6A 1L4UA 4E14A 3RTAA 3CUYA 1R6BX 2IODA 3UUWA 2LCQA 1QG6A 1RWWA 4ZI2A 1NU6A 3DE1X 3G59A 3H5IA 4B17A 3L7MA 4X3PA 1O9HA 5I4KA 3UBTA 5EWMB 1Q7CA 2YWFA 2HDNB 3KJGA 4DILA 2P0EA 4KYUA 1YCFA 4E5DA 5JU6A 3FZEA 4YLGA 1MO2A 4TKLA 4Q66C 2WAMA 5IDXA 5KC9A 5K01A 1WZIA 3D7KA 3IBGA 4DVJA 1N2IA 1NVGA 4XX0A 2H1FA 2XRMA 3JTEA 2GPBA 4LJ7A 5AOCA 1RIIA 4D3ZA 4RV9A 1PDWA 1UC9A 3GR6A 4CMEC 3BFPA 3OJ0A 3H4IA 3IAS1 1O7JA 1RWPA 2IU6A 2OHXA 4FYKA 3HGTA 4F5YA 4PSCA 1XEFA 3DHWC 3RAJA 3A1WA 3M89A 4OHMA 5SZKB 2QLMA 2YASA 4IW3B 4QGBA 3T0IA 2Y1GA 2CLKB 2R3SA 3HVKA 3R41A 3MEQA 2A9QA 2XJ9A 2ZTMA 1RXUA 4U2GA 4YI5A 3F4LA 3DR5A 4E2FA 1DCKA 1G42A 4ZCLA 2NNLD 4XQEA 5CEEA 3NS7A 2G83A 1JA0A 1SVLA 3JAKB 4NYIR 5EQDA 3RNLA 1KDTA 4Q00A 5J58A 2AR0A 3K0CC 4IMPA 3DZDA 2FH5B 4OREX 4V38A 1HXHA 5DIFA 1E2BA 1KGSA 4NBLA 1V8OA 3UJHA 5F3RA 5KUTA 3AYXB 3ESAA 1ENOA 1XGKA 1JEQA 4KQ9A 1DTEA 1LBQA 3PUKA 4XLTA 2FWNA 4TL8A 5AQEA 1NYLA 2SECE 3STUA 3PU6A 4B3CA 1V8DA 4A36A 2XUGA 1NJFA 1X8JA 3LLCA 1W2GA 1EGAA 1US8B 2P90A 2PKWA 3AHGA 4MS3B 3HBLA 2VRBA 4LS3A 3TPFA 5C4IA 3G1UA 3GJZA 4YJGB 3DS8A 3FHCB 3TXXA 1GLNA 1ISSA 4AXBA 1THTA 4RK7A 2B8TA 2PR2A 3CT4A 2O2HA 3T94A 2FJPA 2ISCA 4DDWA 5F7OA 2YW9A 3H16A 3GJ8A 3VR1A 1V43A 2XX3A 3PWTA 3A0UA 5A05A 1ZYUA 3ZEIA 4C0LA 4EJ2A 5AVZA 1LJLA 2WQ7A 4W5TA 1DRUA 2FFBA 2PV7A 2JBAA 2YBEA 2OGUA 4EF6A 2Y0CA 3HDTA 4HFJA 2EKPA 4J49A 1UF9A 5IC6A 2OC4A 2FEPA 4EOGA 3DLCA 1G6HA 1ORTA 1GNRA 1UBUS 5AHRA 1MABA 3GPDG 2EOAA 1CJUC 2FRDC 3Q2IA 1UK6A 2WTUA 4GWLA 1PV4A 1JHUA 4LNHA 3PEFA 1REQB 1IY0A 2I3GA 3UNXA 5JY6A 2Y1OA 1SZJG 1F9AA 4IHJB 3QVWA 2FEOA 3H9BA 1E2DA 1XU9A 4AKSA 4ABTA 3PV0A 2DR2A 2ID4A 3PQCA 1NOIA 3PFIA 4HDNB 1E7YA 2AYYA 3PWSA 3QE0A 4MJ7A 2QMYA 2P6MA 4MARA 4K9DA 4F91B 2IU4A 2H4JA 1I0IA 4KQXA 3VHRA 3VYUB 1OB5A 4LKRA 4I5IA 4XA8A 3WIDA 3I0ZA 4B3BA 2AN5A 3G2MA 3ZU4A 5I51A 1JPUA 4CUKA 2WJIA 2YY5A 2D7JA 1Y81A 2Y6UA 5DEOA 1N3IA 4IDCA 3QI7A 3BDVA 1U8CB 4RDHA 1H2WA 2QAGA 1J2EA 1SRRA 2WINI 2OV3A 2PKXA 3N76A 4D3YA 4BX2A 3KHKA 4FFBA 4DLAA 1K66A 5DLQC 1E6EA 4CMIB 4AB1A 1ES9A 2CSUA 3LO8A 3GRFA 1Y9ZA 2BEWB 5T5QA 1EDBA 3ZHBA 1RPJA 1UBJS 5D3QA 5IARA 5JMWA 1YCDA 4O4IA 4YASA 3OP1A 2VK1A 1TCUA 1ZC4A 2Z43A 4BNDA 2WWGA 4Z0NA 4FSXA 1KEVA 1SQGA 4M49A 3TSOA 3UW3A 3J80A 1UBRS 1A95A 1YAHA 1MVLA 2HTFA 3X2FA 1IHYA 1K5DA 3GCDA 3KVOA 4G4JA 4CIYA 4WVLA 4MINA 5CJJA 1D8AA 2WOJA 1IN5A 4HYEA 4C0KA 3AEYA 2OGWA 4RIEA 5BSKA 4G01B 1OAOA 1XPUA 3ZBQA 4AIRA 3N5KA 1T43A 1R6AA 1Y48E 4MJXA 4OQYA 2ONJA 1IQUA 4GQIA 1G9XA 1L5SA 3QY0A 5DNDA 2P91A 3X43A 4JI8B 5I9TA 3C3MA 1Z5OA 3KJIA 2I4IA 2WD9A 4FOPA 5JNRA 2RFLA 2WUDA 4KPGA 4CLOB 4CFYA 1GPJA 2XVYA 1VJ5A 2PLAA 2QRGA 5T4FA 1YVDA 2JHPA 3H11A 1D2EA 2RARA 2FPWA 4Y2PA 5DBFA 3WGQA 3OSZA 1JSLA 3NRCA 2P9FA 2PH1A 4CTNA 1NN3A 4EPWA 1OZHA 1R5NA 1IJBA 1I8TA 3I6IA 4Q1DA 2ZZNA 2FCAA 2Y27A 3Q9UA 1T5SA 2ATEA 2IHTA 3CF4G 5A04A 2X9GA 121PA 5B3LA 2AQHA 4XFKA 1U9JA 2G1KA 1SUBA 3COYA 2OB1A 3OFKA 2PT5A 2QORA 1T9ZA 1Q6ZA 2Q0SA 3VX4A 3HS3A 3PQ4A 4AJLA 3LY8A 3KRTA 2KE5A 3ET5A 3OMXA 3W05A 1DUVG 5I3ZA 2YJ3A 4EECA 3C14C 3W9SA 1FRQA 4QGSA 1CQZA 2X19A 1GLGA 1YHZA 1WETA 2VSQA 3HP1A 1YRQA 3HJUA 2PGAA 3H1BA 3L93A 3IJRA 1BS9A 1Q57A 4N48A 2QK4A 1Y3HA 3TI7A 4ARCA 3O82A 3I6QA 5HR5A 1SA0A 4GLFA 4ZQBA 1EFKA 1FY2A 3I76A 2JL1A 5KSOA 1NBHA 2J3DA 1CERA 3VKVA 2O2YA 1DAEA 2R6ZA 1YIAA 2CXSA 1CDEA 2AOTA 2O3QA 3ZDXB 1OT3A 2NIPA 2QR5A 1W46A 4NBSA 1TLLA 3V1MA 1GTVA 4LG1A 2FN9A 3COSA 1PR1A 2E4ZA 3O31A 4PWYA 4DJJA 1W85A 4HNHA 4BGUA 1XRMA 2VAXA 3R7DA 3WWEA 5ALRA 2WPDD 3Q7TA 4FD3A 5TS3A 4Z49A 4JA0A 1DCFA 1J0AA 3CLKA 2H4XA 2X13A 2WICA 1AC5A 2X5JO 2XMPA 3HLYA 5HUHA 4KO1S 1HFKA 1UOPA 4KBFA 4HYYA 3FTEA 3RC2A 1OAOC 1ESNA 1P80A 2V59A 2RHLA 4IDEA 4NCIA 1P2SA 2WF6A 3TQSA 1E3IA 3CMCO 3SS7X 4J1QA 4FDTA 5FXMA 4RH0A 3ZZ1A 4GX5A 1FL9A 3OFVA 2Q2NA 4FWIB 4I7EA 1EGMB 3WGLA 2G1AA 1HE1C 3LOQA 2IXTA 4FFNA 3PF8A 4WW0A 1W30A 3AUYA 3DDHA 4J1NA 5CIQA 5CW2A 4UCFA 5HTKA 3V4ZA 1QZZA 1Y1RA 3E22B 4K1LA 1MVNA 3ZW7A 4U00A 1PNVA 4B46A 1B76A 2R6HA 4JL6A 4R8KA 3C98A 5DPMA 1XCMA 4NBRA 4ZYZA 1BS1A 3BMOB 3H18A 2OPBA 4C2UA 4RK0A 4TLCA 1CF2O 3NVDA 5EMHA 3RUAA 4B3RB 3FSGA 1HNZB 2JGNA 3C8DA 1V1JA 3QLUA 5TF4A 1CF4A 1KU6A 4JLJA 3DZCA 4QAJA 1QGDA 3Q3IA 4G63A 3PR1A 4MVYA 4B80A 2X86A 5AXDA 2YR0A 2ZYWX 4XUCA 2MOKA 5CBPB 3IKJA 3BHNA 1A9QA 1O96A 3PJDA 2DFDA 2KI5A 2W0MA 1W5AA 2QN9A 3QELA 4I66A 4J6FA 5IAEA 3HGQA 1DC5A 3PE3A 3AHCA 1LI5A 2XWSA 4N0QA 5C1BA 1PJLA 2HEIA 2OHHA 1ODJA 1HEYA 1XK7A 2AF4C 3LDHA 2XTZA 1CY8A 3W3AH 5GAJA 3OX3A 3BYZA 1J42A 2P9TA 4OCZA 4C21A 2N42A 4QT4A 2OM6A 5BMVA 5LZ2A 3HVUA 3EFOB 3FOCA 3LYUA 4JLVA 3R3VA 3PR2B 1PD0A 1W4LA 4JIGA 4QSMA 4WZBB 3WFIA 2NZVG 1I1OA 2YIDA 3RSLA 5A5FA 3DHVA 1YFZA 2W2QA 4FLMA 4NICA 3RS7A 4X71A 1BOFA 1RYFA 2A30A 2FGJA 4FCTA 6LDHA 4KE7A 5IVIA 1V5EA 2LD4A 3BH6A 5EHQA 1DC8A 2PZAA 4YFVA 2UXDB 3IQGX 4H0CA 2ZSFA 4F2DA 5DMXA 1P6QA 1ZWLA 2GN8A 2PXAA 3OQIB 3WLSA 4AY6A 1BGXT 3TVDA 3KWLA 2EJCA 3DHEA 3M5DA 4FN5A 2MR6A 4M1KA 4DQVA 1HLDA 2BHRA 4CQMB 3IAM1 1K06A 4IEIA 1GSAA 1O2DA 2OFPA 1WJGA 1WTCA 4FR5A 4JZKA 3TQIA 1SKUA 3ZY2A 5TRTA 1KOFA 1GNPA 2QVYX 3ZEAA 1I6KA 2DWUA 5JXGA 2QN8A 1H4SA 3G79A 5B53A 3VISA 1NVAA 4AX4A 4K03A 3B51X 1YTLA 4DV7B 1CFZA 3JALA 1LPAB 3QVUA 3DM9B 3E3OA 4DCGA 1E6CA 3VJRA 3QKIA 2JFPA 1LW7A 3LBAA 4KAAA 4KRFA 1N2HA 3T3IA 3UJ6A 4UM8B 5HGJA 2CXHA 1FUIA 4CU5A 1RABA 4MW2A 4L57A 4OU4A 3TTTA 2YQ4A 3DPSA 5DCYA 1R9GA 4E1BA 4RY9A 1K5PA 1DEKA 1H2RS 4R1TA 3K05A 4ZYVA 2AXEA 3F5MA 2IDKA 1E9RA 2YX1A 4FW8A 4I81A 4UEJA 4YGYA 2O1WA 1SIWA 4Y0VA 3W5IA 3BMNB 5B55A 5I4IA 5SY4A 1TFUA 4RFSB 2JFYA 2WJZB 3BE5A 2AYXA 2B4KA 1UMBB 3A32A 3K5HA 4I2VA 4Q02A 2C83A 4F3NA 4Z7JA 4H9GA 5J2UB 5JS2A 1P18A 4MEJA 5BRJA 4NCKA 1DL5A 4DABA 5LLDA 4D8TA 5A9TA 3WYCA 1P0PA 5C32A 3JWHA 1RJEA 4L4ZA 4GE0A 4YC7A 5LB2A 1EJ2A 5GQSA 1KMCA 1NC3A 1G5PA 2NUTB 2R6AA 3Q11A 4OHBA 4BEVA 2OAGA 2VXOA 5TQ0B 4BNLA 1VYTA 1A9ZA 1LUAA 2IIQA 2W5UA 2WC1A 4V0MA 5HRUA 5CDTA 4BU1A 2FP4B 1AUQA 1GNLA 3PG5A 1HZJA 3Q1LA 3DV0A 2K4MA 3DMFA 3PIIA 3R0JA 4R2XA 2BFCB 2GN1A 1IB6A 4WK4B 4RO0A 3VNBA 5IVHA 1VG1A 2GYVA 2HJ9A 1MA3A 1JAZA 2MR5A 3I01M 4K3VA 2FMHA 3QLTA 3WDSA 4OH1A 1NI4A 4P93A 5E0KB 2XNDA 2NUTA 3GD7A 3B1XA 3UK7A 5K45A 1O9BA 2PGIA 3L18A 4QGHA 3C1AA 1Z0UA 4R83A 1U5AA 1GTZA 1IJFA 4R2WA 1FTWA 1NBMA 3FFTA 1DX9A 1QG0A 1HDCA 3QTBA 1XJ0A 4GMGA 3V9AA 4EB8A 2P79A 3EIOA 4RPKA 1PJTA 4JLNA 2NW6A 2Z95A 4ZN6A 1K7XB 3G2IA 3K0EA 4B7UA 3L07A 4DRYA 1PSWA 4C2TA 4TROA 1BKYA 2PHZA 1F5SA 4HMPA 4TQGA 3W3ZB 5HKBA 2X9NA 4BV8A 2UUAB 2D8AA 2IEAA 2W48A 1AB5A 1ZK4A 2CB9A 3P20A 3THXA 3VYVA 4DA0A 2I1VB 1T3SA 2HMWA 3LD9A 3OF2A 2ST1A 5A5EA 5LP1A 1QOPB 2WJ6A 1FVXA 4FSDA 1X8LA 4DE5A 1Q0TA 3TUIC 5AKYA 3CGGA 1V26A 1VIVA 1XEAA 4LYJA 2F1OA 2C61A 1FTYA 3DTVD 1N2XA 2O2XA 1GAWA 3OJLA 3TYXA 1HMPA 3AXTA 3JW8A 3LNTA 5ALNA 3MRXA 4NG4A 4LF5B 4R71A 2LE0A 1GUFA 3A3OA 3HR4A 4UEWA 1RHMA 4L3WA 3G7UA 3VDMA 1CW2B 2W2TA 3PYLA 5KQRA 2C98A 3H8VA 5A4DA 1JSZA 1XLVA 4U5XA 1FTGA 1GFZA 1M1YB 3U3JA 2XCRB 1SVSA 2H48A 5I8WA 1T4BA 4AZ0B 5KYWA 2YKGA 4D9FA 1VGQA 2HRQA 1GZ4A 3GQBB 3KYJB 4GPEA 4MH0R 3SOPA 2W11A 3LLMA 4ED9A 2YHSA 3TCXB 1AQUA 5JMTA 1UBOS 5KQGA 2ZSDA 1KS9A 1XZPA 3JATB 3KQSA 5KI6A 3OTWA 2ADOA 5A06A 1T2NA 5ILGA 2JLCA 4LI0A 3FGZA 4BE7B 3FWYA 7YASA 3SEFA 2J0QA 1ORWA 1XQXA 3JRWA 4UDYX 3GRAA 1MEJA 2WR8A 3EWAA 4KBGA 4DB4A 2FQXA 5EXXA 3VSEA 2OXFA 4R81A 1PR4A 2AMJA 2GKSA 5FUQA 2JDID 2FQ1A 4HGRA 2D3WA 2NO6A 1KL7A 3OPQA 2P3QA 1KI8A 2GPSA 3WBKA 5JAZA 4X0EA 4XDYA 2OCYC 3E9EA 3NOOA 5ADHA 4FS8A 4QQRA 1X1AA 1K7FB 3JARB 1XNGA 1UKCA 2NSDA 2GNOA 4B3DA 3LJKA 1U5CA 1KP3A 3D6MA 3CUTA 4J0JA 4L6AA 1R6TA 3HN7A 5D1HA 3TRFA 3WTCA 2GNPA 2GM9A 2A9RA 3STHA 4OOEA 4YRQA 4TVKA 4IBOA 2XUOA 3H86A 3M0EA 3IALA 4HJRA 3T9FA 3U62A 4LJRA 1WXWA 5H1YA 4D0NA 4DBZA 2O07A 2Z8XA 3M34A 4Y6LA 2OZEA 2GT1A 4R40A 4GLJA 1R9MA 3IPYA 1ZFNA 3MWEB 3NVMB 4XDGA 4ZV7A 1KOGA 3HRKA 5ED0A 1N5MA 1WW3A 4P2GA 1DC3A 3EIQA 4NEHB 3OTQA 4QDXA 5C3MA 1NJ2A 5E6SB 3UGKA 5CBPA 2GSWA 1KAOA 3ZCPA 3KXIA 3OSUA 4HRVA 1XD2A 1L7PA 3GA0A 4KXWA 3U7FB 5ANRB 4LECA 3PGMA 2X42A 2R87A 4HN2A 3VHXB 1QORA 1NNI1 5A9RA 4E70A 2OR3A 3JZAA 4AUMA 721PA 3RASA 5L6LB 4P4TA 1O1YA 1JDUA 3H1GA 5B7PA 4H1TA 1PVDA 2Q49A 1MDBA 2FSVC 5IH3A 4ZVTA 4E5MA 3U5TA 1KRWA 3OJOA 4WXPA 4RS3A 4KWCA 3GFBA 1IN1A 3KNZA 3TSZA 2BM9A 4S3MA 4KPEC 1NVKA 4H3HB 5BSRA 3EBPA 3R8XA 2GCNA 2JIQA 1E96A 2ZB8A 3AKZA 1SQFA 1T3TA 1GUYA 4GZ6A 4E3ZA 3PRHA 4JI1B 1CE8A 3P97A 5EZYA 2O50A 4R2KA 2H4ZA 1SQ5A 2EF1A 2FRDA 1EJ6A 1UCFA 3A6DA 3QITA 4NJEB 2D1FA 2C9ZA 5BNWA 3OD1A 2HA0A 1H0KA 3PNQA 4IKPA 3Q7PA 2QZPA 3JQBC 1JQDA 4J9VA 3K1AB 5EXEA 3DNMA 5BQFA 2IOYA 1PYOA 2D2EA 5A7FA 4HDOB 1JBQA 1P3JA 5DYNA 5JJKA 2CXTA 3HCWA 1L5OA 2C2ZA 5ABPA 3SNHA 4EHAA 5T4HA 4BMZA 2QVCA 3ADKA 3KQOA 5JLJA 2A0KA 4JU9A 2AIRA 1P62B 1JDPA 1TTPB 1Z4IA 1JAYA 3ACBA 3L0CA 4AJEA 2H51A 3O8RA 5FUXA 1SA0B 4NF2A 4QDJA 2YDXA 1EAMA 3DVSX 2VPQA 2UVDA 3W5DA 1RADA 4Z4EA 3WAJA 4MI6A 1J8VA 3TRJA 3LQYA 3VHLB 2QRLA 4CF5A 1KY3A 2O8VA 4EL5A 3ZDAA 4N5LA 4BLTA 1T5DX 3JAWA 4TMVA 1IHPA 1AN9A 3HNRA 4O59O 4DC1A 4WINA 4F4UA 3KQHA 3OC6A 2DFPA 2V7GA 1N2BA 4IJWA 2C1XA 3CLRC 3QWIA 1Y8ZA 2E89A 4TL7A 5F77A 4Q3DA 4F06A 4YIKA 2B0CA 1FJ2A 3LBNA 4OA8A 2FFAA 2GTPA 5HZHA 3LMKA 1GEGA 3WIOA 1JIQA 2QN2A 3IP8A 3DZHA 2VDVE 5HBRA 2H17A 3CJRA 3VR6H 1Y3CE 1BQ3A 4ZRNA 3VR2A 5HZKA 5KNLA 1HLFA 3QHAA 3OOYA 2V7QA 4FINA 5EEHA 3UCFA 3RABA 2D0PB 2HMYB 2P2CA 1K8XB 2XMDA 1KVSA 3BDIA 3IL2A<