4R1PA

Crystal structure of thermophilic geobacillus kaustophilus l-arabinose isomerase with mn2+
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
494
structure length
494
Chain Sequence
LSLRPYEFWFVTGSQHLYGEEALKQVEEHSRIMVNEWNRDSVFPFPFVFKSVVTTPEEIRRVCLEANASEQCAGVVTWMHTFSPAKMWIGGLLELRKPLLHLHTQFNRDIPWDSIDMDFMNLNQSAHGDREYGFIGARMGVARKVVVGHWEDPEVRERLAKWMRTAVAFAESRNLKVARFGDNMREVAVTEGDKVGAQIQFGWSVNGYGIGDLVQYIRDVSEQKVNELLDEYEELYDIVPAGRQEGPVRESIREQARIELGLKAFLQDGNFTAFTTTFEDLHGMKQLPGLAVQRLMAEGYGFGGEGDWKTAALVRLMKVMADGKGTSFMEDYTYHFEPGNELILGAHMLEVCPTIAATRPRVEVHPLSIGGKEDPARLVFDGGEGAAVNASLIDLGHRFRLIVNEVDAVKPEHDMPKLPVARILWKPRPSLRDSAEAWILAGGAHHTCFSFAVTTEQLQDFAEMAGIECVVINEHTSVSSFKNELKWNEVFWRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Isomerase
molecule keywords L-arabinose isomerase
publication title Crystal Structure of Thermophilic L-Arabinose with Mn2+ from Geobacillus kaustophilus
rcsb
source organism Geobacillus kaustophilus hta426
total genus 182
structure length 494
sequence length 494
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.3.1.4: L-arabinose isomerase.
pdb deposition date 2014-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02610 Arabinose_Isome L-arabinose isomerase
A PF11762 Arabinose_Iso_C L-arabinose isomerase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10940 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4r1pA01
4LQLA 2HXGA 4F2DA 4R1QA 4R1OA 2AJTA 4R1PA
chains in the Genus database with same CATH superfamily
1QHNA 1Z56C 1W36B 2AC4A 1R8SA 4U8GA 1N6KA 3PGJA 4DLSA 2DQKA 4FCTA 5ICMA 3WYAA 4QKQA 4O5AA 5HUQA 1E3WA 2DPMA 1C9MA 3EIOA 1SXJA 1V45E 2E5FA 2R7NA 1Q0HA 3WX0A 1H2AS 4DXAA 5AVXA 5JBNA 1RAGA 4ZJPA 2O8EA 2RHRA 4FYWA 3CVYA 2O7QA 3SSAA 2XNKA 3AFGA 3SS7X 3EVEA 3QSYA 1J5EB 4OSEA 4B4DA 3ZVMA 2ZBGA 2Q5LA 1RLTA 3NO4A 4OJMX 3A6FA 2NSDA 3L8HA 2HN9A 5B4TA 5LXTA 3V1TC 3DLHA 4FFDA 4L8VA 1E61A 1D6SA 4A2QA 4CF6A 4G84A 5ARCA 3OJOA 4D8WA 2LDBA 3FYUA 5DTIA 4B7CA 4TSKA 5DLQC 5DM60 3F0TA 5AHOA 3ZDFA 4ER0A 3OC0A 1XCBA 2A9OA 4LTNA 2PR2A 1YV9A 3MQ2A 4PLZA 1M34B 2P30A 2DE0X 1BCSB 5AUOB 2W2TA 4ZVVA 3THWA 3F5SA 1SC4A 5B7GA 1W93A 3BDIA 4WJZA 4CN8A 5HZGA 4OBWA 4ZMBA 1GADO 1L1QA 3SNKA 3IQIX 5HCIA 1SCUB 1USGA 3TRKA 1DG9A 1S1MA 1Y9EA 3D6AA 3NBUA 2RI0A 4O4HB 1NBME 4O2BF 1MMFB 4NV3A 3Q7QA 4LV5B 3OQOA 3OAAD 3ZVRA 3NATA 3OZSA 2Q5IA 4PRZA 1V26A 4B81A 5AOBA 3ZHVA 3DBIA 1XDWA 3KYJB 4JDPA 2GRAA 1XE3A 4KXMA 1CFJA 2PDAA 3VDRA 4CG3A 3HV0A 3FROA 5DO9A 4E5SA 2JLBA 2A0UA 3MRVA 1EIZA 1Z13A 4IF4A 1KP2A 5CA0F 1JEQB 1MEEA 5DYGA 1E99A 1R4AA 1UEXC 4P4LA 2GXUA 1EVJA 4X61A 4QU5A 2RE8A 2OMEA 5FI5A 1V95A 1X3SA 4YRJA 3DEAA 1KAQA 4NBNA 5T4BA 4CR6A 3MWJA 4U2GA 1XYVA 3KG2A 1NW6A 2CZGA 2ZR0A 2ZRPA 1M72A 3EY4A 3RRJA 3UMGA 2GX6A 4PSUA 2OV4A 1MJNA 1S7CA 3QHAA 2C8KA 5KX5F 5BUCA 1V7ZA 1P0CA 4FQ8A 1LK7A 1OILA 3ZXYA 1RJGA 4D6PA 4M2LA 2CBZA 3CYFA 3O1HB 3NDBB 1W4RA 4DRXB 1U8XX 1Z16A 1K8QA 2J6HA 3PU6A 4BMNA 3VVBA 4EA9A 3GOQA 4P4NA 1RQNA 4GPZA 1LPBB 2JGLA 1KOLA 5BOSB 4J91A 4LYDA 1WNTA 1VBMA 3AVQA 4AQDA 5KQRA 5A4KA 2DECA 3AHIA 2A88A 3NLLA 4ND8B 3RYIA 2FR8A 3RK1A 1CUFA 1I14A 4P3NA 4DM7A 4R8RA 1OAAA 2WJZB 4UUAA 4P31A 1T29A 1CUYA 4F3CA 3ZK9A 1MEJA 1P5RA 1SUFA 1PZFA 3HVRA 1ZSVA 4EVRA 4O4JB 5BMOA 2FJPA 1J49A 3NIFB 1RXSA 1WXWA 3RSCA 1F1BA 2V9CA 1CEYA 4V02A 1V2HE 1EWQA 4RF4A 2MCFA 2P1DA 5HJEA 1OLXA 2E82A 3RWMB 4MW6A 4GOOD 4WD3A 2FUKA 3RV3A 3ROXA 4E3ZA 1IQUA 3BXPA 2Z1DA 3GGSA 3LP5A 3F8TA 4GLFA 4MUIA 5F77A 5G4LA 4X00A 3Q8WA 2XE6A 4L2IA 4PZEA 3MRTA 5ALYA 1G1MA 1QG2A 1FUKA 4LS3A 5FPKA 4FGWA 1RCUA 4ENQA 1DQRA 821PA 2Q07A 1N4DA 1K92A 1YONA 4KGDA 1AM4D 1YA6A 4C20A 5K20A 4WTOA 1D09A 1ZM3A 2CVFA 2O7RA 5BWNA 1XZ8A 2XCTB 3H5RA 1QO9A 2IPLA 3HFJA 4MQEA 4UM5A 2PMKA 2W6CX 1CUHA 1EGMB 3I2HA 2JIQA 2DHEA 3SVZA 5IBQA 3DNPA 2VZ0A 3R09A 3CH7A 2IEIA 3G2OA 5IWCA 5AXAA 3SHFA 1N6PA 4BNDA 1PQ4A 3LHFA 1S9DA 2Z43A 1C9NA 1TB4A 2NZ2A 4HQNA 2QU7A 4LKRA 2Q3MA 2W8ZA 4HAWA 3BEOA 4I2VA 5LP6B 1JSZA 1IN6A 4Q4HA 2H0QA 4JVNA 4E2WA 2O3QA 4DYVA 3PPWA 3PFHA 4L8FA 1B15A 5EA2A 4M49A 3NOVA 3REFA 2W42A 3WA7A 4GM1A 1ORWA 3PB3A 1NUAA 5KAPA 1DUVG 5ESDA 4E1VA 2PNFA 4MUYA 2EJUA 1K3TA 4L15A 3M4JA 2H1FA 4MPTA 3OQNA 4IXMA 3OKAA 1VL5A 1O4VA 3SYTA 5AKEA 4YCMA 1Q0LA 2VJCA 3EJWA 4M8SA 1ZSNA 1ZM9A 1PYDA 3OCVA 3C7CB 4EELA 2B61A 2F2TA 2R84A 1XZLA 4DADA 5K2OA 4G5HA 2PUJA 4P8RA 1I7DA 3HJTA 1ADJA 3H84A 4MROA 1JDZA 4C4SA 4RF3A 3A37A 3C6MA 3SJCA 4WY5A 2PS0A 3TTTA 2E5LB 3NHMA 2V7QD 3EWSA 5TPZA 1S8OA 2OCKA 4BFSA 1NV9A 3NT5A 2UZ0A 3OZRA 2AZTA 2EEZA 2GK4A 2FP4A 3K2EA 3ZY4A 2H29A 3DHVA 3MG9A 3B2QA 2XZPA 2Y6VA 2VBFA 4I3HA 3T7JA 3ZU2A 2IH4A 4ZP1A 1YDWA 1JHYA 3K31A 2GK3A 3B1JA 2C07A 5ADUS 1D4FA 1VMIA 2BGUA 1VZ2A 3A2LA 3LDGA 2IOFA 4IDAA 1M83A 4PRKA 5BWOA 1Z0UA 4OXRA 2DWCA 4V24A 1YO6A 1QBGA 2Y9MB 2CVZA 2QXTA 3P71T 2D0PB 4TV9B 4BWFB 2ZWAA 4F6CA 5G0TA 5EN4A 3C7KA 4INPA 3GFTA 1XTUA 4I1IA 1Y7HA 2X4GA 2MSWA 2XYGA 2XRFA 4U1RA 4IH1A 4G8DA 4XX0A 4C88A 4CFSA 4P5PA 2WNIA 1F38A 3LPLA 2QRKA 3PKIA 3R4VA 4RD2A 4ZT5A 2D5IA 3R6GA 3TXXA 2C5SA 1CTQA 1T9DA 1XRQA 2YHAA 5TQVA 2ZBUA 4TV8B 3OLCX 4TN5A 4MMZB 4ZOLB 2JGDB 1EDOA 1NOKA 5A4JA 2I65A 3DTVB 1HYEA 2DERA 3FUCA 4AVYA 3HDYA 1VIDA 3VGJA 4BBAA 4BLRA 2P9FA 3CE6A 2G1AA 3QLVA 5C5DA 3EA0A 4BLOA 5DOVA 4GNRA 1Q7GA 4YREA 1DIRA 1U8CB 1VJCA 1YHYA 1DI0A 2QLJA 5KHLB 2ZYVX 3RJ5A 5KOJB 3F3MA 5DHTA 1H9AA 1IBSA 4F46A 2C7QA 4L22A 3PGKA 1BAPA 2DR3A 4CDNA 1GGEA 2NO0A 3E2IA 3FRHA 4LZWA 3KLMX 3AHCA 3E58A 3LUBA 2WVJA 5TDHA 1OXBB 1MOQA 4J0HA 4OQMA 3K0SA 2BLNA 4ML3A 4R0NA 3L93A 1ABBA 4IP0A 2ZZNA 4YQZA 2VDMB 2VHYA 2WF5A 3EXG1 1NIPA 2PZFA 3K8YA 3R0QA 3VGPA 3P0JA 3WAGA 3TZLA 1PL8A 1OFTA 2EX1A 5TMPA 4BRWA 2KLBA 1NOIA 3A26A 3FOCA 2EXXA 3B51X 4N5NA 2CXNA 4KOEC 5AQ1A 4W5NA 2QT9A 3J80A 4FXOA 1L4UA 2VYND 4QDKA 4XJSA 4Q7LA 4R83A 1SHZA 3K8QA 1CIVA 2PM8A 4EHBA 4BOYA 2DHRA 2WHQA 1RBYA 5CYOA 3RTEA 4B6SA 3BIXA 1N2IA 5IVKA 2XDQB 4RWZA 3VAAA 4KQ1A 1Z4NA 4UDXX 4CM4A 2HK9A 4D3XA 1EEXB 2J33A 5I8ZA 1SXIA 3FCCA 1W6UA 4RKQA 4HX9A 4MLDA 1YVUA 2XGGA 2V3VA 3NM5A 5ADWA 4GRDA 4F60A 5MN4A 3FSRA 4NCHA 5IC6A 2A9QA 1WXDA 5A6SA 2DY0A 3W1WA 1MXHA 1H8ED 5TX7A 1R0CA 2WJ3A 3F3KA 1ESDA 3LX5A 2BGMA 4HP8A 4N12A 4ZU1X 5JC1A 3JV7A 1A7KA 2GN4A 3KDAA 4HLDA 4KXVA 4FIDA 3GNLA 1LDGA 1R0XA 3DB1A 3PV0A 4LGYA 5JG7A 1NONA 2NT3A 3UC9A 1XV5A 1JDNA 1F2UB 2C77A 1RLMA 1ZM2A 2NU8A 5I7SA 4DSTA 1E8MA 3JZAA 1CX9B 2VQEB 4B0OA 1P60A 2UVDA 3HY4A 4P9NA 4FNAA 4H7JA 4X6UA 5J3JA 3GFPA 4KLAA 4CM6A 3HKCA 3T94A 4B6EA 4R5MA 3N8NA 2PZGA 2QN9A 3A4VA 5ALZA 4XVUA 4F4FA 2ZAOA 4RK0A 3T5TA 3E9ZA 4IVQA 4HXEB 4V03A 1C4OA 1VJDA 3KQOA 3EPJA 2IHNA 3KKZA 5B12A 3QVKA 3JRXA 5C80A 4J3JA 2BMDA 5DIZA 3VNRA 2VPTA 2N75A 5HG0A 2QQ0A 1TMKA 3VNUA 2MT9A 3QEAZ 2BI8A 2I4NA 1HYHA 4WXHA 1ND5A 4O1MA 4Z9YA 3PYLA 3VXKA 5JDCA 3II6X 2YYAA 1Y63A 2NLOA 1KTVA 4IHJA 4LXTA 3V3TA 4NDAA 4YRIA 1J8MF 2PX4A 3PNSA 5JECA 2AWNA 2Y67A 4U6SA 3V4ZA 2OZLA 4HH3C 1V1RB 2W2XA 5C4MA 3T5MA 4DR3B 2HMSA 1IM2A 3SZOA 2R8EA 3T5GA 1BW9B 1NMYA 2VCYA 3DYIA 3H5OA 1K5PA 4CM5A 5JSZB 4AYTA 2R7MA 2YFYA 5LWQA 4JROA 5AKXA 3LK6A 2A94A 1N2HA 2WD7B 4EKGA 5JZOA 1OW3B 1PFUA 1QQ5A 5EUQB 3QP9A 1DAPA 2YS6A 1XZBA 1L7OA 3ETJA 4NZ9A 4QBGB 4JJZA 2WIKA 4JBHA 3YASA 3CRRA 5H3LA 1GPUA 4I4CA 1YD7A 2WV9A 4JHLA 4B17A 4LAFA 1T8PA 4DJEC 4DCTA 4YXWD 2O8BA 7AT1A 3O8QA 1PK7A 1WB4A 1YFLA 4KWIA 3IT0A 1JMKC 1GLGA 5LBTA 4UHDA 4ZOAA 4HRXA 2Q4TA 4MVJP 3AVTA 4IQ4A 1BVRA 5T67A 4B9EA 1A69A 4BKRA 4DGQA 3CZPA 4KH0A 4H6WA 5IDQA 2YJ4A 3PIIA 1IVNA 2G82A 3O4JA 5JEDA 3KQMA 5CD9A 1YASA 5D5HA 2PEYA 2Y1CA 4TTSA 5CNMA 5F7ZA 4UATA 3KQNA 1DJPA 4MUAA 2V7GA 3C3WA 2WHPA 1GTZA 3HCCA 1N7HA 2H5IA 1M7BA 5B4UA 4LGVA 1GDDA 4GKBA 3EVDA 5H68A 5KJEA 3SC6A 2D6FA 2Q50A 5JNTA 5ENDA 3PL5A 1A8IA 1RC0A 3EPRA 3CZQA 1QXSA 3ND7A 1FEZA 1WO8A 2COUA 3L0PA 3ROMA 3RGGA 4M9QA 4DDKA 2QLTA 1QCYA 2BHLA 2QP4A 1E2UA 1O4WA 2ZTVA 2ZRAA 4OHMA 3CGGA 4MCAA 4PBRA 3JY6A 3LX4A 4L3WA 1LS6A 4D82A 1V1MB 3U4IA 1E1NA 2DR0A 4GM0A 4X66B 1INLA 1U3FA 2Z57A 3Q7IA 3UWSA 4X3CA 1YF3A 4WFKA 3COZA 4NH0A 1PUXA 4EKIA 1O6CA 3G82C 5HF9A 4QJ5A 3USCS 4N49A 3CEPB 1UCFA 2I3GA 5CT8A 2VNJA 1U9CA 3ANYB 4BNVA 2HJSA 5CA0B 5EIWA 1C3EA 1QV6A 2O8VA 4C0SA 1UDBA 2O7SA 1J39A 2YXEA 2B4RO 4XSHA 3RSLA 5EJEA 3JAKB 4L73A 1T2AA 3PNPA 4BB9A 3TS1A 3MERA 4UUQA 5ICGA 1QF9A 1NSTA 1ORRA 2F9FA 1CUZA 1CUIA 1NXSA 1NGSA 1XVUA 2Y1KA 2NM0A 3LC2O 3O3CA 3U62A 1Q50A 2AEEA 1B6GA 3F96A 4FILA 1EXNA 2PS1A 3QU7A 4OP3A 5BNWA 2DQSA 2OKGA 1UEJA 1R0SA 3N86A 2WLTA 3KFLA 5KX5B 3Q7SA 2JIDA 2XZLA 1ZR4A 3DFZA 3K9QO 2BR4A 2H1VA 3QTLA 4MDYA 1C9DB 4OLJA 4TXMA 4BPRA 1FP1D 2B7LA 3EBPA 3Q9UA 4R2XA 4JBLA 5JNWA 1WR8A 2VP4A 4I55F 4R8VA 5LR6A 4YEDA 1GRQA 3AW9A 3RTBA 5C5EA 3KVYA 3G6KA 1DC6A 4FIZA 4Y2TA 3WSWA 5CXQA 2EHDA 5JRJA 4K1XA 4ZIRA 2HPHA 3F8SA 1DT5A 4IJMA 2OCXA 4BO9A 5I7WA 1A50B 3DE4X 3WRYC 5CCBA 3R3XA 3UWOA 4EUKA 3VM6A 4JV5B 2NU7B 1KP3A 4P58A 1O0CA 1XTZA 3EE6A 3G02A 4PVCA 3SYNA 1K97A 3OEHD 5IRCD 1WEHA 3FB4A 4YCCA 2C7RA 2AYYA 4DFDA 1SRRA 1CB7A 3G9ZA 2EFJA 2NXWA 1XDBA 4Z99A 2G0TA 3GEGA 1PR5A 2BKXA 2J09A 4HX5A 3UAYA 3BE4A 3BQ9A 4HGQA 1F6WA 3RVNA 1KSGA 4DNQA 2V0GA 5KNDA 1YI1A 2B37A 4LF5B 3QXSA 2P68A 1W87A 2CXTA 2FLVA 4DLVA 2YINC 3FZYA 2WJGA 2J0QA 1SU7A 3AERB 2PKRA 2WD8A 3HY3A 3GCDA 3FPLA 1WP9A 1KMCA 3UXMA 3EUEA 4EMBA 4AC9A 3NGMA 4ER7A 3ZTTA 5JQGA 5IULC 3IHWA 3RBAA 5CX4A 1N6NA 1P1BA 3BJRA 4MVJF 2NZJA 2I6SA 5TJ9A 1HEUA 2ZJ6A 5A5FA 2O0MA 2FDXA 4RCVA 3RUDA 5IEBA 4CQMD 1I36A 5JJBA 1ZXXA 1L5HB 1N5IA 3QI2A 4YI3A 4PLYA 3P9NA 1ZN8A 2CHUA 3DF7A 1ACMA 1GR1A 1E3DA 1QPBA 3HZOA 3C3XA 2WSSD 3GZJA 3INRA 4DR1B 3V48A 3NCHA 3OJWA 1ABFA 4JOSA 1DIGA 3EIEA 4TTAA 4YFYA 3N76A 4KQXA 1K6MA 2I6XA 1EVZA 1YFZA 3O8DA 3BWYA 1BGXT 5EJ6A 1Y8QA 1N7GA 1WQ1R 2WQ6A 1Z2DA 4LWPA 2IYNA 1T10A 3OPMA 2HIAA 1ZNXA 2HA4A 3A9WA 3KZVA 1JAXA 4KTTE 4O2AF 5IVPA 5KSYA 5LDDC 5IT9A 3X0DA 5LMNB 3BSYA 1N34B 1M1NB 2YIVX 3C6ZA 1O54A 2EQBA 1MZVA 1M54A 5L8VA 1K98A 1C14A 2E49A 3CA8A 4JT9A 2GYUA 2YQZA 3LPDA 5KEIA 3QEJA 1EK1A 4M87A 1KEEB 2NSHA 3OPQA 2WJJA 2OYCA 1JHAA 2NTNA 3AR8A 3L1JA 4HS4A 1T2DA 3CZCA 1XZGA 3QXXA 4FMPA 4KQIA 5T6BA 4B84A 4TYPA 2XOKA 5AVRA 3PPYA 3HLYA 2YZ2A 1UMDB 4QTUB 2HYDA 2ZRCA 4FWIB 1HE4A 1NASA 3BWBA 4QLAA 4EG1A 4K05A 2B1IA 4KPUA 4JYMA 1QVZA 4G0WA 2GTIA 1PGJA 1J90A 1ECLA 4Z0HO 2OFPA 2P4QA 4KTVE 1KRXA 4IIVA 1WDKA 2PD4A 2XCQA 3HB7A 3QQ5A 4A27A 3E9YA 2H11A 3RYFA 5C1OA 4JUFA 1HXHA 2G80A 3LYLA 4V1CA 1ULBA 2V8OA 3DOOA 2QRUA 3H5IA 2JJMA 3ORYA 2EJTA 2PBZA 3ZYZA 2XVXA 1T2VA 1M2GA 3B6JA 2ZRBA 2OHXA 2RH8A 3RC3A 2PXCA 3UJ8A 2JRLA 1N2XA 1PJ4A 3CJTA 5FLKA 1EM6A 2F62A 5AO9A 2P90A 2ORVA 4YIKA 1Q77A 1JEAA 1Y6RA 3CPJB 3AETB 1XP8A 3GWGA 4RETA 1IZ7A 1JXMA 4ZZ2A 4L5JA 5D5QA 3RRNA 3FH0A 3F46A 4TT3D 1IMJA 2J9XB 2YWFA 3SX2A 3ZTWA 1X7XA 4IUYA 2C4UA 2J3EA 3QMPA 3I6QA 3L0ZA 1OROA 1IOVA 3BIJA 4F7WA 4Z86A 1ZD1A 3CLKA 3WDMA 4ARZB 2XVMA 5IT5A 3NHSA 1GO2A 3HP7A 4US1R 1KZ7B 1ECJA 4HI0E 2GEJA 3ZD7A 3A9VA 1GPWB 1SC3A 2A6PA 2VPZA 3HNPA 3SKYA 3ZXSA 3THXA 4WDRA 3N07A 4KLRA 2WFMA 4FDAA 1ZD5A 3VR4H 3TW6A 3X2FA 3ER9A 3ITEA 2HNBA 1P7VA 2J6CA 2ZR9A 3V1UA 1BRTA 1MC1A 1H6AA 4OH1A 3F6CA 1A72A 2J3LA 1LDYA 1JLLA 2Q49A 2Y0EA 2J4FA 5LXTF 1V11A 3RSQA 3R23A 2PZAA 1VE1A 3FDXA 3RADC 2P2SA 1KO7A 4U39A 2AHRA 1E0DA 4HQKA 3RRXA 1CS0A 2IYZA 4EYKA 1U1CA 2GBPA 3CG0A 4G0NA 4GP6A 2R6JA 1E3QA 3IEVA 2F67A 2ISCA 2H3EA 2Z8ZA 4CT5A 2H63A 1X7WA 3OPVA 4WESB 2XUGA 2Y1GA 3ITKA 3ABOB 4HAXA 4OGGA 4RFLA 1VHWA 4KAJA 3VZCA 1GAXA 3G2NA 3F5DA 3TRIA 4XQGA 3WNCA 1ODSA 5LPNA 1JU9A 2F17A 2GEBA 3EZ6A 3F3YA 2J9FA 2I76A 4IGEA 4QATA 5CDYA 1XMQB 3RYCA 2BFCA 1YJXA 1DAMA 2BBSA 3QWIA 3GJRA 2J9GA 1ZITA 3RTCA 3SIXA 2CT8A 4HZUB 1G63A 1OXKB 2RI1A 4KDRA 4X7MA 2PUHA 2DKFA 3GMDA 2PKCA 2W4IA 4JP8A 4HOYA 4K6HA 3RD5A 1G8YA 2CUZA 5C8DA 1QIHA 1Z0KA 1KBOA 4M7RA 3ORRA 4II7A 4B6RA 2F1JA 2QN2A 3ICCA 5CFRA 3DAGA 3GRFA 2VAVA 3EZNA 1YUNA 5BYKA 4UE6A 4F9EA 4AYWA 1PDOA 4DUZB 3BMNA 4Y9RA 1A5SB 2PSJA 1A8UA 5AW8A 5IU6A 4M1KA 4LVNA 3W2EA 5K3SA 2X3YA 1Z17A 1Q84A 2WUGA 3TXYA 1RPNA 1QDLB 1MOZA 2B3DA 1ZAKA 5DW3A 4EX7A 2QTTA 2ZTLA 1NBMA 1QDUA 2AXQA 4DHEA 3EGVA 2O2GA 4X71A 4BX3A 3N5KA 2ZJFA 2IHYA 4EHKA 3TOZA 5BURA 3WL8A 5K0ZA 3KJIA 4GXQA 3FHLA 1RP7A 4H59A 1MVNA 4BDSA 1RE1A 4WRRA 4I7EA 2BGTA 3IVGA 2BHTA 3CLRC 4GOXA 1QCZA 2Q5FA 1ETHA 5AM3A 3RU3A 3VC7A 1NR5A 5D84A 5PNTA 3CIFA 3U81A 4G63A 1M66A 4BO0A 3LLUA 4JI3B 3ICQB 4KR6A 3OOEA 1T5DX 2Q45A 2ZRDA 4LISA 4B9AA 3AJAA 3C7TA 5B55A 5FCDA 2Z1NA 1ICIA 2HMVA 3HYRA 3X43A 2R00A 3STWA 2BKVA 1V0JA 4FOOA 2BJHA 4JUIA 1FZQA 4LMRA 3WYEA 2BGLA 2HEGA 2NO4A 4EZEA 5MFZA 1QJCA 1XVTA 3LXMA 4V2UA 3F6EX 1SXJC 4WOCA 1QC5A 1OR8A 1U3DA 2R2GA 3CX4A 5TLSA 2YVUA 3ID6C 3TOCA 2O2HA 3EN0A 2F64A 2IHJA 3SI7A 4DNOA 3A3PA 5EJ8A 1G5FA 1E1RA 4LZNA 4J6EA 4FHFA 2ZUBA 3UMSA 1Z62A 3DFMA 4LF6B 1D4OA 2WKQA 1R1DA 2ZIFA 1TOAA 4H77A 2B83A 1QKJA 4Q1FA 1BU8A 4RZ3A 2IEBA 3PXBA 4JJAA 4QWWA 4MGKR 4AZWA 2QW8A 3W9YA 3UPDA 1Y9AA 4BB0A 3K5IA 3U9TA 3EWNA 1J09A 1JMVA 1L1RA 3FJ1A 1W85B 1Q0PA 3KEGA 3V7WA 1U0OC 5JS2A 3ZK7A 4CMGA 4ZAVA 4KFRA 3NT2A 4TMZA 4D97A 5IWAB 4CJXA 4I9GA 2HLPA 2OXFA 4UNIA 2FW9A 4QEZA 5EGNA 3WE7A 2GJ8A 1SOWA 3WFJA 2JFBA 5HXAA 4QYSA 1ODLA 2X77A 5IG2A 2HWKA 4NARA 1S3IA 1FDTA 1K7SN 2OWEA 3MUEA 3UC5A 4QOHA 2RHTA 2Q28A 1A95A 4NEQA 3MAGA 4DLKA 1OX4A 3A6LA 1X7YA 2B78A 3ZV7A 2PL3A 1XZDA 3TIXB 1YRQA 4LSGA 4QUIA 1G8GA 2HJGA 3CSSA 3GWZA 1NQOA 1XRJA 2B8EA 3ME5A 2NZWA 4Y2RA 4KXFB 5ALPA 1T1JA 3CKLA 1AZWA 4RGQA 2WG0A 3WLHA 2GS9A 4WZAE 5IN4A 4HQ0A 5PGMA 4IS2A 4YY3B 3KJEA 2JC3A 4IMJB 1PU2A 1NQXA 3M6XA 1GQOA 2VYVD 3KVNA 2X0RA 1Y0BA 5B2ZA 1BDMA 1M2KA 4G67A 3SHOA 2DMRA 4EA7A 3CLHA 2WK1A 1D07A 3DMHA 1PAUA 1HLPA 3L9WA 9ABPA 3OECA 4K28A 1WDTA 5I9BA 2WKSA 2BTOA 2FMFA 4RE6A 4X7BA 1HLDA 4MRMA 4F3YA 2JKYA 1VE6A 2Z2ZA 3ZTYA 3IA7A 1TT5A 4IJUA 5CJ2A 3RAPR 3ROTA 1JKFA 3GRAA 1V8BA 2QVBA 4WPGA 1GZ3A 1MB9A 1AKYA 4OFZA 3TINA 2W2PA 5CYPA 4AROA 1L6IA 4HDRA 3TJZA 4ENUA 3KDPA 4JKYA 1DRKA 2BONA 3UHPA 2CLHB 3ONNA 3FPGA 1HT3A 5IF9A 1F4PA 3U4GA 3GPLA 2OSVA 1WNFA 1SBYA 1PS0A 4HQ6A 3M9WA 4U7FA 4FFVA 1M6HA 1ZMTA 2OV3A 1Z3IX 3F8WA 3DVQX 1R8QA 1IC6A 1NIJA 3CN9A 4OHPA 2FR8C 4ZQGA 1DJQA 2WNHA 3CLTC 3PG5A 1YZLA 4ARIA 1XRRA 2ZE7A 121PA 1A8SA 3BJMA 2C4WA 3PRYA 4M1YA 3IBFA 5B58T 2X1MA 1GTVA 4RKWA 3L4KA 1JEYA 2WJAA 4M1OA 3RFFA 5TIIA 3RYTC 3IBTA 4NYMR 3VI4B 3NJ8A 5ALRA 4GFDA 1A7JA 3SU8A 3AYXB 1F60A 3DC2A 2CE2X 1WAMA 3JAWA 5C7IO 2WU4A 3O2SB 2OR3A 2REOA 1E2DA 1RQRA 1C9YA 3OOWA 5L7WA 2CXXA 2ZOSA 2Q9AA 3EWAA 4LYJA 5DNWA 1YSCA 4RGVA 2GCNA 4I55B 1JL3A 2TSYB 3EH2A 4NJEB 4OHKA 3CNBA 1E64A 3H19A 5IVDA 2PR7A 5HKOA 3S8EA 3QNWA 3S28A 3C3PA 3T7EA 1ZH2A 3TL3A 3RU7A 2Z2YA 1PK8A 3X2EA 2P75A 2GD0A 1CPYA 1EGQA 3D8RA 4Q21A 2O3RA 3IV6A 4LG1A 4GXRA 1AGXA 3RSFA 3I1IA 1Y34E 4NE2A 2IPMA 3AIMA 3OE5A 1V43A 4IIJA 1B4DA 3KKLA 4R2WA 1ZK4A 2DJ5A 2HRQA 3DYVA 4MV1A 2IUTA 3TTVA 4V0ME 1USVA 2RCYA 5GGXA 3ZNPA 2V65A 1GTG1 4OSOA 2YKGA 2UUAB 2EBFX 1ST3A 2F4VB 3C16C 2XI4A 1NFRA 3IELA 4KDEA 1XEWX 3U3XA 3ZG6A 3KYDA 3UMVA 3LCMA 2D2EA 3AUXA 5LWHA 4U7DA 1SXPA 2UYOA 3D54D 3WYGA 3FFXA 2JIZA 3TVDA 2AIRA 2EG9A 1P8AA 3TLBA 1ISJA 3AKEA 3ZWMA 1TUIA 5K3CA 3VU9B 1T24A 1MAWA 2HQ1A 3ZDEA 4X1YB 3OX3A 1YT5A 2DSTA 1KJ8A 2VNSA 3JCZA 2ECOA 3NDIA 4YBRA 4JLDA 3WIVA 4HADA 1V3QE 1X7ZB 5AWFC 1N0HA 1C7EA 5C8YF 3ZOKA 2HRRA 1J97A 3FCOA 1SVOA 3HEBA 2DPLA 4M8KA 3RAJA 5JMTA 2HBZA 3W2FA 2VXOA 2NUTA 2OCGA 3PVSA 1JQLB 5JZSA 1CF4A 4LY0A 2E21A 3SJ7A 4C22A 1FDUA 3PWKA 2ZI7A 3FPSA 3GFBA 4KQCA 4N5DA 1PR2A 2ZAMA 2LE0A 4IJQA 2J0SA 1KH3A 1PD0A 5JNVA 2BUBA 3T3GA 1Y3HA 3D2CA 1UFRA 1U7ZA 3FHJA 3KJXA 4DCNA 3TLJA 1RXEA 5C32A 4JELA 1DC5A 2X13A 2ORIA 2QE7A 3IT3A 1N8KA 2J6IA 4O08A 2LBPA 5BVHA 3U09A 4IV0A 3GGGA 1RRGA 2OY0A 4O8ZA 4O2AB 2CBGA 3OIGA 4YUAA 3BD8A 3AEKB 3TQCA 5BXQC 5T41A 2YN2A 1OT5A 2M1XA 3PNYA 4EFMA 4XVCA 5FDFA 3AWIA 4XGQA 2PZ8A 3DBLA 3LU1A 3RT7A 5FX2A 5JNUA 2RB4A 5IJXA 4DV1B 2EWWA 5IC4A 5HIKA 4BLQA 1VSBA 2VI5A 4WN3A 5AOVA 4B74A 4KQHA 5JW6A 1GT91 4CCYA 1AKVA 3L18A 2C3PA 5DRTA 4I9NA 3HFGA 1U0RA 5F4ZA 3ZHBA 3V8RA 3AP1A 3EZFA 4N5HX 4YMWA 5LUAA 2P6RA 4RY9A 1LFDB 1V7QA 1WZIA 2CGEA 4PTZA 1JLKA 3JVEA 3NFRA 3UY4A 1UDRA 4IZHA 4WMLA 1H5NA 4NENB 5E1OA 2Y71A 1U3WA 2ZPAA 4J0GA 1ZISA 3V3KA 2UZAA 1UF9A 1AD2A 1LDBA 3PL1A 4FHDA 3X1XA 5SZHB 1JIUA 1PV4A 2JFNA 4MAAA 3T7DA 4XIFA 4FNMA 1DX6A 2NAFA 1TAQA 3D8HA 4NOMA 3FRJA 5DTJA 4D5GA 3EA4A 3CH4B 4PNZA 1JG6A 3QLVC 1W19A 3C41J 4BTVA 4EW3A 4OHXA 3A1UA 1L9XA 3OOSA 3RVLA 1LZLA 4BC0A 3QF4B 3JVDA 3GGDA 3KT3A 1P91A 1SEVA 4H7IA 4Z1MD 1GM5A 3G5LA 2O06A 2YHUA 4DPKA 4IHJF 3GP5A 1Z2CA 2VP3A 5I9TA 1X19A 2NV6A 2QF7A 4P1ZA 3O2QB 2VNHA 3ZHCA 1C7IA 4BNMA 1TJ3A 4YNBA 5C46F 4XDHA 1XDDA 2MOKA 3T3DA 4MA0A 1W4ZA 4KN6A 4UAJA 4A5SA 2CXQA 3RFUA 4M8IA 4YJ2F 3V5NA 2OHGA 4E5MA 1A8PA 5BN5A 5FOSA 5H70A 1L2TA 3DEZA 5TS3A 2HMAA 3A6ZA 2GNOA 3W8NA 2IKQA 4M37A 3UG6A 3KQUA 2CWWA 4PWZA 4UTNA 1YUMA 4ZEXA 3D8SA 1PJZA 5ALLA 3RC9A 1GZHB 1WD5A 3WZMA 2O2YA 4CR8A 1VYHA 2HNAA 1CSEE 4MWDA 2FXIA 3D2LA 3LUHA 4Q47A 4C01A 2QGZA 4ZK6A 4N1AA 2XOXA 4O2RA 3L6OO 4B3IA 2XIQA 3Q15C 1C7JA 3QIAA 3U13A 2PVSA 3C8UA 5LBIA 4EG5A 3CT4A 1CK4A 1TPYA 3NHWA 2JGAA 1O03A 2OLJA 3AV3A 2ZJ5A 4HR7A 3TD9A 4DV7B 3SMQA 4CQLA 1HKHA 2HY7A 1P5ZB 3EEBA 1NYTA 2YDYA 3GVPA 4M0MA 5CX1B 3PLAE 2EJCA 4R9RA 5TVGA 3BN3A 3TR0A 3ZW7A 4DIKA 3H83A 1CE8A 4UBMA 2ZULA 4UREA 3LPNA 3HACA 4M76B 3MA0A 4W1PA 4XXHA 1B8NA 1KYXA 2AOWA 3TZBA 1W0JA 5CDFE 4EWLA 4I50F 1BE1A 1LQUA 2UZ3A 2Z3VA 3QELA 3A58B 4A1FA 5DHAA 1H2WA 4D7AA 3ZWOA 3VC3A 5JCZA 3SQXA 2UVPB 2ISQA 5A9TA 3ZU4A 1P0PA 5JCJA 1CQIA 1QIEA 2YQ5A 3QJ5A 3SN6A 3NJ4A 3TLYA 5E4FA 5JH7F 1LCIA 1A96A 2OWDA 5TGTA 2W48A 3CZRA 3MUFA 1E2PA 3CV3A 2O6HA 3GIWA 4B4UA 4ZHQF 2GWHA 3FSJX 1K08A 1NUSA 4LMPA 5EWMA 3PC2A 1JVNA 4EEXA 1TYBE 1SGWA 4IEEA 1HK7A 4G37A 5LFAA 3QY0A 2VYFA 3R74A 2RAUA 4ZDJA 3FI0A 3I28A 5T57A 4NHOA 3W4JA 2H51A 1XWWA 2CDBA 2IZ0A 1VG8A 2XMSA 4OXKA 3ZY5A 3JX9A 1CQXA 1G7RA 4UM9B 1II8B 1ZH8A 2D59A 3LPMA 4MO9A 4PPYA 5L51A 4M89A 1TK9A 5HBGA 1HZZA 4OYLA 5EXDA 2FPSA 5KYVA 3ZE6A 1UINA 4M1WA 5EUCA 2CXUA 1ZCAA 1WUIS 3KAQA 1G66A 5B1HA 3D7KA 4J49A 2ZLBA 4HBGA 1JHRA 1T6NA 4CXMA 2HF9A 4Q4DA 3PFNA 3CQ9A 3GY0A 3SK0A 1AUVA 2YWGA 1GPKA 2IS1A 3AVWA 2AFHA 1MFZA 1XU4A 1F51E 1M1ZA 2EZ8A 2R6FA 3N0WA 4TRNA 3AZQA 5E7MA 4MPJA 5SYNA 3G85A 4OLFA 1E8NA 1VIYA 3KTFA 3BL6A 4ETMA 1CHDA 4BMZA 4UQPA 4ND6A 4DC9A 3K30A 1KBZA 4AM8A 4AJOA 1ZI9A 3C24A 3ILYA 2IPOA 4IWYA 4JJKA 3P20A 4W6ZA 1XL0A 1ZK0A 4J16C 3VU3A 4DSZA 4ODIA 1QORA 1TM2A 3ANSA 1XT6A 3PNLA 5BN1A 3UV6A 3WLAA 3DH0A 4MEJA 2B3TA 2X5OA 4H7FA 4F96A 4WZAB 4A92A 5AXDA 4QGSA 5I9NA 2WU3A 4X1IA 3T41A 4V3BA 1PR4A 4FUTA 1IZ0A 4LOLA 1GGMA 4TZ0A 2IS2A 3VKUA 3PR1A 4MR9B 3O7MA 1KJJA 4D1YA 3TRJA 1I0IA 5AI4A 1TKRA 1Y48E 2LKDA 3SX4A 5JJLA 3JD2A 2IPNA 2VXBA 3DONA 3N7AA 1V5WA 3ZWNA 4HEA6 1IN8A 5BV1A 3H0KA 2CYAA 2A5LA 3BFKA 3I0MA 4LPKA 5DRYA 3AFHA 5JQGF 1QTQA 4K6OA 2CLSA 5LLSA 1FTNA 1S5PA 2W70A 4G1UC 3KEFA 2B98A 5FULA 5FBHA 3K3PA 4Q3EA 5B1EA 3VR6D 4UHKA 4BWVA 2QTNA 1P0FA 2Z30A 4MUHA 1CZRA 1QIKA 5E2IA 2WRZA 1DEKA 4H0NA 4F11A 2Y1XA 2QT0A 1QYXA 1ZSYA 2A1UA 2FY8A 4QJBA 2AFIE 4OXXA 3W9UA 4D2IA 1Y6QA 3RO7A 4NL4H 1JDUA 4L8YA 3ZZTA 1AV6A 4EG6A 4MV4A 4F4CA 1E4YA 1AOXA 1QG0A 1QFMA 2P1ZA 1ZEJA 3COSA 2B8WA 2ODPA 2XAAA 1YK1A 1ZD3A 2RGBA 3IUMA 1AQYA 1L8OA 5SY4A 3DMYA 1NNUA 4LWOA 3BT7A 1EFRD 2CMGA 2A9PA 4BQOA 4XRGA 4OH7A 2Z2KA 5L3SB 2PMEA 3DUWA 1J8YF 3CO0S 3T4EA 1BFKA 4RV4A 1N2ZA 4YAOA 1SQ5A 4C08A 1BKDR 1FFAA 3E9EA 2V74B 1CRPA 4RUKA 1CD5A 4C3ZA 3OZ7A 2G4LA 1TI7A 1VYVA 4WKNA 3BB1A 5T3UA 3ZC3A 2O5CA 3B8EA 4HH4A 1L5YA 2YY6A 2JVIA 4YR9A 4RKFA 1U28A 2AOTA 3E48A 3JSAA 4EG8A 2DBVO 4GH5A 4O4IA 3JQ9A 1D2HA 1NM5A 1A9YA 3KZKA 3R5SA 4IJKA 4KMMA 3IOYA 2FWIA 4PX3A 3TNLA 4R41A 3V1NA 2R8RA 4OGLA 4PX5A 1EG2A 2NGRA 3B48A 2R8ZA 1XU7A 4KYVA 4D9HA 4IOJA 4F6RB 4HSGA 4YQEA 2NADA 3PEFA 3QY9A 1T4BA 2FSPA 3TUJC 1KQPA 1JX6A 2V7UA 3F5QA 3KBBA 3LVRE 2O5RA 3MBKA 2XQIA 4IV5A 2RBKA 1NXOA 3TMKA 4GZMA 1EFUA 2XWPA 3DFKA 5DM1A 2FMUA 1ZUIA 4AZTA 4CEJB 3FOBA 5A2QA 4QU0A 3B6IA 1X1TA 1UBCA 3CF4A 4REOA 3NYIA 3S4YA 3FKQA 3UT6A 3H9JA 4IM7A 1APBA 1DX4A 2ACWA 5CFLA 1L8LA 3P5SA 2N47A 4ES6A 4E22A 2HSJA 3CUYA 1OTXA 5CYFA 3H6KA 1C30A 1OB2A 4IH4A 3E7WA 1JYEA 2BBWA 4BNKA 3CUEF 1P72A 4N8SA 3A1SA 3UJ6A 4GI7A 3I9FA 4N9QA 1QQBA 3EEIA 1OH8A 3H6GA 1U7OA 2B5WA 1UJCA 1V9SA 1YL5A 2PGOA 1PNQA 2ZYDA 3GXOA 4FYPA 4O25A 3VI3B 2YXBA 4KRYA 2I29A 1Q2UA 2B8JA 3FNGA 1R3UA 3OEWA 1WF3A 4UVGA 5HOQA 5BT8A 1US8A 2Y1LA 3Q3CA 4MR8A 5B6PA 1VE3A 2VLIA 2GCGA 3OZXA 1TYEB 2B21A 2KM1A 1FDRA 3DKIA 4IICA 5D3MB 2Q9BA 3DT9A 4S35A 3OPYA 4DXHA 1W75A 4J1TA 4AWXA 4DL9A 1K5GA 2WMYA 3F47A 3UQYS 3RIGA 1Z7GA 2BMJA 2EBHX 3BBPA 3NKLA 3WK5A 2QTVB 5P21A 3RS7A 1TZ2A 1P61B 3FUWA 2XMGA 3ULKA 5LQMA 1E3LA 5HIAA 1UWVA 4MI6A 2V7WA 2JIBA 1ADBA 3D8BA 1U7PA 3TD2A 1RADA 4NZPA 5EIBC 1THMA 1RKUA 3ASVA 3EFOA 2OXIA 3TX2A 3ZWYA 4TZ6A 1FDIA 4JL6A 3EUFA 4BAUA 3GJ0A 5K05A 4YBZA 4PAMA 1TM3E 2AW5A 5KCMA 1EQ2A 3D6UA 3DZJA 1TJ5A 2EGUA 3G0DA 3HE3A 3E9RA 3I2IA 2GWRA 3OWOA 1FFDA 2P4EA 3ONWA 1CWUA 1WB6A 4G5XA 1I7PA 4FE7A 3UJNA 2J5RA 4WEQA 5C8YB 1RWOA 2H59A 1DGQA 2R6AA 1Y4DE 4P92A 4RHTA 4EI7A 2OXRA 3K0FA 4BP1A 2EKDA 1Y7PA 5IH3A 5LZ7A 4RVHA 1OWPA 4HEA1 5FBQB 1DHRA 5YASA 1URPA 2QTHA 1M75A 2H7VA 1A04A 2LVBA 3GJ4A 4JCCA 3U3JA 4H7HA 3UAGA 1HDCA 3BILA 4Y3UA 2Q29A 5LIPA 2XOEA 3NPAA 2A1TR 4KIUA 4XVQA 3AEQB 1UBJS 5K8LA 2UYCA 4GL2A 1AQUA 4MW4A 4PQEA 3BXOA 3BCRA 4GT1A 4X6YA 1T4MA 4Y18A 3U1VA 3V34A 5BRAA 1L4NA 3IESA 4CM4B 4LSZA 4Q3KA 4NZZA 3HUFA 2WQZA 3OEED 1WVIA 3VYSB 5F9FA 2H4XA 3BPSA 1J7JA 4IX9A 2GN9A 3VISA 2C84A 4FBGA 4OMDA 3UCXA 2C61A 4CMEC 3JQFC 1PZNA 3NHAA 5IF3A 3QG5A 3JSXA 4D96A 1KJ9A 3NEYA 5TY0A 2WF8A 3QG1A 2B25A 5I7VA 2FPIA 2O0HA 1Q7TA 1KIAA 1USKA 2UV8A 1OXXK 2ET6A 2P9BA 3EFHA 4FFMA 4HPXB 4YJHA 3R7DA 1Z2AA 1FMLA 1QHYA 3PE4A 5D5PA 1TGVA 3AUSA 3BA1A 3FM9A 4WLOA 1DBRA 3P19A 2NU8B 1ZS9A 4FUQA 4JB8A 1DTWA 1A7AA 4MQLA 2X8AA 5LYJA 2QL5A 2OHJA 4BNFA 2WFLB 3PEWA 4YCSA 2IITA 3A1FA 3S68A 4MRRA 4FN4A 1ZU5A 1JU3A 2ISSD 1ZI8A 2A3NA 1AN0A 3HZHA 3IQWA 4EUNA 4MRSA 2WINI 2XUIA 5EE3A 1DVRA 3PXDA 2GVDC 4M98A 5I9MA 3K5HA 1NQWA 1N7IA 2NZYA 2OENG 3ZU5A 4E4YA 3PJDA 1ISPA 1H65A 4M0PA 2P3SA 4JB2A 1J6UA 5I3CA 1QRTA 3HTXA 2FPUA 4UBOA 3BC1A 4NV1A 4HB2A 2Z04A 5ELXA 1ATZA 5C5CA 2R1VA 3G2HA 2PLRA 4URWR 1FFWA 2V97A 4K3VA 1UXIA 2Z58A 3SOZA 1IDN1 3TNYA 4AJ2A 2AF4C 1U2PA 3Q98A 3U4CA 4X92A 1B1AA 2X0FA 1VMKA 2Y6UA 4A4DA 4C7OA 2ADFA 2R48A 3CX7A 2WTAA 1DBWA 4QE3A 4BU0A 4YJ2B 1N2JA 4ZT3A 3PTAA 4D4KA 1WB9A 1QFYA 4CLRA 2YOHA 3G9UA 1NF2A 3LTNC 4OHBA 4DRYA 3V4OA 3GD7A 5JS8A 3TUZC 1AUXA 3HU1A 4NFSA 4V0KA 3WLRA 1AS2A 5AHXA 3N2KB 1UPCA 1WQ3A 4OA8A 3B53X 2H4FA 5IJ0B 4MH0R 4IOKA 1ZH4A 3T5BA 4KQFA 3UT0A 5A0VA 2PN1A 4RO0A 3DAFA 5FPQA 3O26A 3T7SA 2B1QA 3T9DA 1YBHA 3WYCA 2DU8A 4KSBA 4OQZA 2YWBA 5EE1A 3NNNA 4LYGA 1TUBA 1D4ZA 3AI3A 3ENQA 4DMMA 1Z5WA 3GEHA 3SLRA 1SQSA 2BFAA 3K0HA 1EPUA 3CLVA 3UK2A 2RK4A 2Z4SA 4NNOA 2IX9A 4Q4AA 3FNBA 3IDQA 4FYHA 1N8NA 4KUEA 1WHSB 1QONA 3Q0IA 4R0VA 2YV3A 3BIWA 5B37A 5ITZB 4QYXA 3W05A 3WHLA 4I50B 4RVDA 3ACCA 5JMWA 3IVAA 3K0EA 3R9XB 1CUGA 1CUUA 2BEUA 2E4AA 2VP6A 3DD5A 4RDHA 4MK4A 4L9WA 3LD9A 1M2HA 2MINA 1RQGA 5JH7B 3PA8A 2YJTD 4YECA 3MJCA 3V1YA 2Q2VA 3ANTA 2Q1XA 4YAWA 3AG6A 4AW9A 4DUGD 4RTJA 4R9UC 3L3BA 1Q1GA 1KDYA 2RBEA 3HA3A 1YZVA 4ZHQB 3L6EA 3PDWA 1K8ZB 2V03A 1Z3CA 5ULLA 5L7YA 1O57A 4IO1A 2JLUA 3PEVA 1KY4A 4B32A 5GVRA 3OU7A 4X65B 2BCJQ 3ESXA 4LQLA 1JJIA 3E0QA 4IDDA 4JC4A 6GPBA 4OD0A 1F2VA 3A04A 1GCOA 1YRWA 1OHHA 3LXRA 2NUAB 2RAVA 4DWOA 4J0CA 1E89A 3R3HA 4JVMA 2QY9A 2C1EA 4X94A 5GGYA 2YN4A 3SFTA 2BFBA 2FSHA 4Q12A 2JFOA 5KMGA 5B53A 1LNSA 1O2DA 1Q1NA 1GAEO 2CUTA 3MCAA 3NI2A 3RJZA 1X8JA 3H1AA 1FRFS 3N59A 3MJEA 2GLXA 3L8EA 1WUJS 1T91A 4ACBA 1MAHA 3NBAA 2EFEB 4GUDA 4EG3A 1UJ6A 2AF3C 3O1IC 3OI7A 4EL0A 5DNAA 1AKTA 1TJYA 2O07A 3AP3A 5E6SA 1FTGA 4FZ3A 2D7CA 3EQ9A 1ORVA 4H4EA 4YAEA 3ZVKA 3PC6A 1KI6A 4HVAA 5E3HA 4ZQFA 2ID9A 3HYNA 4R2HA 3GELA 8ABPA 4Y2GA 2A30A 4ZIRB 4ZALA 4UQLA 3AFNA 4LHYA 3KQHA 2DPXA 2HJRA 1M5UA 2NO6A 1G3RA 3AG5A 2FZGA 3DV9A 3I9MA 3T3EA 1WETA 4WZBE 1GFZA 1EUZA 1VKRA 2KMLA 4IIJF 2F55A 2AD1A 1BN6A 1C1XA 2YMPA 3PA6A 2V4UA 2H17A 4D9JA 3PIRA 2VQFB 1P5HA 4G09A 2AFIB 4F72A 3EZ9A 3FCYA 5JROA 3ZJTA 2C5BA 2DLCX 2BZGA 3AI7A 5LOVA 2HA2A 3ROQA 2H16A 2EBUA 3DYBA 3PE3A 4IG4A 1UXOA 3GUHA 2ZE6A 4FEEA 4O5OA 1FX0B 3WLQA 5KNCD 5DI9A 3O1JC 5CLLA 3NUGA 1PJQA 2IZZA 1H1LB 3VO1A 5SZJA 4AB1A 4AMZA 4CMHA 4TKVA 4QM7A 2A9RA 1LRLA 2YY7A 3LH5A 1HNNA 1YZFA 3BCHA 2G67A 4KZPA 1G0OA 1U4OA 1GD1O 2JIMA 5JSYA 4HAZA 4E2XA 4GICA 1V3UA 1AUQA 1QMPA 1IM8A 2PT7A 4OAPA 4W5HA 1PR3A 4HWPA 3KSMA 4M8LA 2B36A 3ED5A 5JI2E 5H9WA 3GBSA 2AN4A 2P2LA 5I51A 4NMWA 1ACJA 1FYVA 3Q5DA 2KLHA 3I9OA 4LHWA 4Q9HA 1O1YA 1SIBE 4PCVA 2ZUDA 2BM9A 2ETXA 3UOGA 2YNMC 3K8OE 4NU8X 4QLBA 4EI8A 1R6XA 2YDXA 1GQYA 3UAZA 2REXB 4Y7CA 5EHXA 4OUDB 2H4YA 3MB5A 1Z38A 2DKNA 4KNYA 4X3OA 3MSCA 2HDHA 3D3NA 3CF0A 4M1SA 5CT6A 4CE6A 5K8IA 5K8VA 2R751 3I2KA 4GQIA 1NVDA 2DTEA 5IDVA 2BFFB 2QW1A 2VOEA 1YJ5A 3OIFA 3RLIA 4HHEA 1JG3A 3QVSA 2P3LA 4G5OA 2CXHA 3ZZ1A 5HRUA 5LQDA 1ENPA 2RK6A 3DDSA 3M8KA 4JU8A 3URKA 4CLHA 3THYB 2ZREA 3NVKI 2GEFA 3ESZA 3RSSA 4DT1B 3DOIA 2V54A 1VDZA 5J2TA 4X93A 1N2CA 1O6BA 1OBVA 3P9QA 3GD5A 1XRNA 4KLZA 2J0UA 2PCLA 4NMXB 1QIFA 3GUVA 1I33A 1XK7A 3HBFA 4PZPA 4D6XA 3EHEA 4DLZA 5LMUB 4RHFA 4TWJA 1EVIA 3OCUA 3A9TA 2FRDA 4Q3OA 3ZY6A 1JJVA 2PRIA 3Q6MA 4UXJA 2ZT6A 3FPAA 4E70A 4UARA 2GHQA 2VWGA 3LWZA 4MI3A 1FP4B 3WK6A 4K0KB 4MKIA 3BSWA 3LYHA 4EVSA 4K6CA 1AQ6A 2LTAA 3N0RA 2XUJA 2JCVA 4NESA 4FJ2A 4YMSA 4HVLA 1EJBA 3GZNB 2X9VA 4DUPA 1JH9A 2A9FA 4JIGA 4BE4A 2WTMA 4JLWA 4DSNA 2DULA 1O94C 2ZSIA 1FFCA 4FFOA 4Z3DA 1XR3A 1OZGA 4ZCIA 4L4XA 4UQOA 1AU9A 1ZRSA 2XDWA 5IC5A 4UDOA 4C4OA 3OQMA 1UJMA 1IK6A 2V0NA 2BFMA 2CKMA 1SU4A 5EG5A 1RJ9B 2XVZA 3RODA 4MVJD 2JI8A 2YYZA 3K35A 1C7FA 1TQ2A 3D3QA 3DDOA 3UPTA 3AR3A 5DYWA 4PVDA 2G9ZA 1E20A 4LCJA 2B0JA 3HXKA 4FLEA 4ANFA 2DKOA 4X0EA 2XNCA 3VJMA 3UPUA 4K9RA 1JKJA 1RU3A 2X7HA 3KKMA 5AYVA 3V1MA 2BOVA 2EW8A 3ZQUA 3GFFA 4OLBA 2PGJA 2X9NA 1OLSA 2X9QA 2P35A 4BUZA 1E2GA 3LYAA 2FX2A 1K3FA 1UMKA 3L0YA 1CY4A 1RT9A 1NL3A 3ZNQA 3K15A 1YB6A 2VSQA 2R66A 2VRBA 1H0SA 3H9UA 3ML1A 4ZFNA 3ZD9A 3GJZA 4X54A 5KO2A 1C4XA 1I3MA 2OTCA 2W71A 5DXFA 2QRHA 1Y5LA 1TIBA 2V7VA 4RC9A 5DLYA 1C1HA 1C8LA 3GJ6A 4IFIA 4IDEA 1M1YA 3IYLW 4JSRA 2GPSA 1XTBA 3BXXA 5FWXA 3HR7A 3SXPA 3UA3A 3NAMA 4Y0NA 3P2YA 2ZI3A 5KNBD 2VH1A 4D3SA 1QH8A 1JR2A 3OF3A 4NCJA 3ZWCA 3MCWA 3KB6A 2BGKA 2IOFK 1I1NA 2PEZA 1UMCB 2RAPA 1MW9X 4LY3A 1I4OA 2K5UA 4RS4A 2HHAA 3U44B 3R9KA 1RMQA 1IY0A 1Q11A 1WVMA 4TYQA 5EJ2A 3VNBA 2GI4A 2R6HA 3O38A 1X14A 3LQ2A 4WLFA 1QGUB 5GIOE 1W4BA 3N0TA 4DOMA 2IP1A 2BCEA 2RC5A 4S1TA 3LUJA 4KUGA 2C5HA 2UAGA 3GYBA 1L1EA 4RU1A 1XQ9A 2WAMA 1QGOA 2C88A 4KO2S 2O3UA 3HWX1 4QL3A 4UTOA 2P9GA 5EY5B 5HYVA 4YHHB 1AIPA 1MBZA 4WKOA 4Q1AA 4RABA 1YRAA 3CLRD 3FX2A 2ANCA 1IVSA 3B89A 1PGNA 5BQPA 4BNZA 4BXOB 1KYYA 1QYIA 4ZPXA 1WPQA 5L6LB 2VATA 3I5XA 1JLRA 2HQBA 5DWQA 4IUCS 4NBVA 2B6NA 1W59A 3AFIA 4DQDA 5JU6A 1X2BA 2XNJA 1VLHA 4GO1A 3ADBA 1B41A 2RFLA 3JYLA 5DK4A 3N0VA 2C3YA 4TL7A 3A05A 4KWHA 2Q8NA 4Q66C 1L7DA 1Z07A 2MR6A 4G97A 3TO5A 1OX6A 1W9MA 4AJNA 5CP8A 4W7SA 2B92A 3QNMA 4IDOA 4ENSA 4PNHA 1O95C 1U0EA 5HTKA 3UICA 1SXJD 1O97C 2QMYA 2ZCVA 4JBNA 1SZDA 4C3OB 1GTSA 3WWOA 5F1KA 1OSNA 1HT2E 4AP5A 3PVCA 1DQNA 2I99A 3I53A 2RH5A 3N9IA 5AKGA 3BGOS 3LC0A 5FUVA 4BNGA 5AP9A 1OZHA 1UZUA 4EYQA 1ODTC 1V4VA 4D79A 4E30A 1IBMB 3U0VA 3ENNA 4DV2B 3JQPA 2KBFA 1JDVA 4KBYA 4NZYA 2HQOA 2PJZA 3E35A 4KCGA 5KOYA 2MSDB 1D8TA 2GCPA 3B3JA 2DHCA 1G21E 5HJ5A 1GY8A 4TWZA 1IY1A 4Y8VA 1UT5A 4H16A 5HGXA 2F7SA 1ZXLA 1WMAA 3OUZA 4IDHA 1ULAA 2NP7A 4W99A 4GLLA 1ESZA 1L3BA 2I3ZA 2FZKA 4KO3S 4F8JA 2VHWA 3U4QB 4JZYA 4L0CA 3SC2A 2QQEA 1GUYA 3TQOA 5JFGA 3L82B 1UJ4A 3FMPB 4PNPA 4UTRA 1YC2A 1Y3IA 1XSEA 2HW8A 1Q21A 5I7RA 2QRMA 3QIVA 4N82A 1R0KA 4DDUA 4ZZ1A 4KO4S 2VSYA 2V96A 3GG9A 1HFJA 1JIXA 3H87A 4LN1A 3WBJA 2PYIA 1DEHA 4F8EA 1AV7A 5CXXA 5IS2A 1AKRA 4EPWA 2W2KB 5EJFA 4NR0A 3GO4A 1JHPA 2C78A 2H2DA 3JZIA 5KSZA 1EKXA 1NQUA 4M3NA 1SD1A 1IYZA 1GSHA 3KKOA 3RFXA 1QVAA 3E7XA 3KV1A 5H80A 4RZSA 4BQIA 4ITVA 2SCUB 1YQQA 4H7KA 3V4SA 5J5AA 3TM4A 2ZSAA 2GN6A 1XAIA 2OV8A 1L8XA 1ZINA 3ZBUA 3W3AD 2FQXA 4BNJA 1E9FA 1R4ZA 2K4MA 3JD3A 4MI1A 2D2VA 4NABA 4CIYA 4UM9D 1BWRA 3DL7A 3WP1B 3SHVA 3RPEA 2L69A 1QHEA 2Q0QA 3MCTA 1CEEA 3NM6B 1M74A 1T25A 2MSKA 1R8XA 4TTRA 1U7TA 4G1FA 1HH4A 1DE0A 1U0TA 3S70A 1J5XA 1RRVA 4JIMA 5KOHA 3EW9A 4A8PA 3O21A 1XQYA 5ECDA 4L75A 3F1LA 4H18A 3DFUA 5AJUA 1J25A 1O0BA 1JZTA 3ICPA 3TLGA 2QTCA 1NLZA 1W4CA 1KAEA 1JWBB 2AI1A 1S01A 1DUSA 1UPTA 1IE3A 2FUEA 3AFMA 3DHWC 3IAHA 4NNJA 3TDKA 3WL4A 4OM8A 1NXVA 3R41A 3CLTD 2C98A 1C9JA 3CC8A 3AI2A 2O1EA 3ZI4A 1B8PA 3VPAA 1UIRA 3D43A 1FFEA 2GVZC 1EMDA 3C1OA 2B7CA 3A4YA 3E7FA 3K92A 1GNQA 1NV8A 4B33A 4EY7A 2NWQA 3HEAA 1J2UA 4WZBB 4Q82A 1Q1ZA 3VAZA 5LMCA 1USWA 1XU9A 1J0EA 2CK3A 2KQUA 1LUAA 4Y6PA 4BQSA 4ECEA 2PA3A 4MYHA 5DLDA 3SR0A 3NBFA 4Z51A 1L7VC 1NXQA 3K1ZA 5I7HA 5LLDA 4RDIA 1VXRA 2O2CA 5CUQA 4B76A 2G9VA 3OQ6A 1MC4A 4HDOB 4MQFB 1CRZA 1SQGA 4LECA 3TZQA 4JEIA 4CL0A 3HBJA 5DYYA 1I3NA 2BEWA 3H2JA 1XYGA 1E9VA 3IUSA 1V8OA 5T8KA 4RZ2A 4C1BA 2YW9A 2B2CA 3G13A 2AMYA 3A70A 3T7RA 2WUVA 1XZEA 1YR1A 4EHFA 2FNAA 4KWCA 4DCSA 5FL3A 2OGZA 5ALHA 2H2IA 1DEOA 1AHPA 1HOXA 1U11A 5CG1A 2QX7A 3T7KA 3M5PA 5A0FA 4TVBA 1KDTA 2ZRQA 4XGNA 3VSAA 2M98A 1L4EA 5BN4B 2NTEA 1AF7A 4IDFA 1L7QA 3ANMA 4HKTA 5F1YA 3SEZA 3BE6A 3ROGA 2R68A 4H1HA 2VT6A 3DLBA 1PSWA 2YMLA 3DZDA 3L1KA 1GL6A 1LLDA 2P69A 2QJTA 5IHPA 3JQBA 1ISHA 1GUFA 3CVWA 5DB4A 3OM8A 4HQRA 1A77A 4NICA 3P96A 4P7BA 2ZWMA 3TLZA 2XECA 4HD8A 1KC1A 3DVAB 5E9QA 5H3HA 2WYOA 4V0LA 3A1VA 1KWGA 2VQDA 3RRYA 5TJHA 2HF2A 1LWNA 2JZOA 2ZAYA 4IVNA 5EZYF 2BV3A 4DA4A 1HQYE 1VIMA 2RONA 3DEFA 4UW9A 2O52A 1TM5E 1K88A 3AB7A 5KYXA 1G6Q1 1C81A 1U5BA 1MPTA 4PGGA 4IINA 5AHKA 2ONJA 2VG8A 4H0FA 2JJ2A 1WJGA 4AG5A 2ERYA 3IPYA 3KYDB 4DNXA 2UUCB 2CFIA 1A2QA 5JXJA 1I2ZA 1GKKA 3KK0A 4YDSA 2UYHA 3CHYA 2WUFA 4RFSB 4DV3B 5J1TB 2AOVA 3KOOA 5BO5A 1ZL2A 2I6UA 2EGHA 2VF2A 3D8TA 4GWLA 4H15A 4HWOA 5EVJA 5IABA 4ZVMA 2WM2A 1J2JA 1JT2A 1R4MB 2QIPA 3ADPA 1RWVA 3QKSB 5FL7A 4MO2A 1W5SA 3BWXA 5FOTA 3ZX5A 3PC8A 4OX9Y 2OZVA 4FM9A 3HJBA 2GKOA 2IWHA 3RNLA 2P6MA 2YXNA 3ND9A 1EX6A 3KYIB 3GCGA 3RJMA 3VPGA 3CM0A 1G7CA 1IHXA 2ABWA 5KTSA 1FVXA 1YNSA 4EKYA 4P54A 5KZMB 1USUA 3OUTA 4NG4A 1Z7BA 1NJ5A 1JFLA 5GTDA 1P2FA 3OSUA 1QX3A 2WE8A 2FA9A 2WT9A 3L02A 5HMLA 3NC4A 1K66A 1BD4A 1SRQA 2PT5A 4A6PA 4OI4A 1EDBA 3QEOA 3JQ9C 1NM5C 5KTOA 1UKBA 2B2XA 4RLQA 3GROA 3ZY2A 2HU2A 4WERA 3AM1A 1R18A 4ZYUA 4QPPA 4AUEA 1E1DA 2HCTA 4P4UA 2HPAA 3MB8A 4ROTA 5BSKA 1E6KA 4RXUA 3PEUA 5KYYA 3E7DA 4US0R 3OWXA 4X63A 4ZQCB 4I36A 1OV6A 3ZI7A 4ER6A 4KO1S 3SDSA 1H1DA 4Z4GA 4Y0VA 1UZLA 5CB4A 1EK2A 2A5DA 1JB1A 1MXFA 1OY1A 3QYFA 5FLEX 4X8LA 3UWKA 1WKBA 3LRXA 5FH9A 2YVQA 3WO1A 4XEHA 5I9LA 1JXOA 2OUKA 1ADGA 1G7SA 4KNWA 7MHTA 5BW4A 3HPQA 1NUTA 5KWIA 1NUQA 3GVCA 4RMJA 3PQFA 4TMYA 3B60A 4BVGA 4JJGA 4DZZA 4ZV4A 2VDQB 1HDEA 5NULA 5AM4A 4P3YA 3EMBA 2RDMA 4HV4A 1X70A 1YR6A 1HDGO 4HN2A 2WEKA 3HA5A 1X1RA 2GETA 3L7MA 1L5VA 3NR2A 1GU7A 1ZGJA 4JZKA 1GZ6A 2ONZA 3QF7A 2VRCA 3ZLTA 5FJIA 4RK5A 1K68A 2CV2A 2PLFA 3L8YA 3HKEA 2IIQA 2BDUA 1H8HA 3HMQA 2ORED 2Q3HA 3OIYA 1PVOA 2PUEA 3E82A 1G5RA 2OEPA 3RUEA 3ZGXA 3F7MA 3PDIB 2BMEA 2BGNA 5CIQA 3G5UA 4OHCA 1YTLA 1ZESA 4BKOA 4LJ4A 4QJ3A 2A8YA 3PI7A 3RSOA 5CD1A 4HT3B 3HCEA 1UH5A 2FEWB 2UZIR 4XDYA 3VPXA 2B1GA 3QPAA 1NLUA 4OV6B 1O6FA 5EXPA 5FNVA 3U3RA 1GITA 1R6VA 2A58A 4PAOA 5KHOC 2YH2A 4F45A 4Z4EA 2EG5A 4EO7A 5CNIA 3G0HA 3B6KA 4N3CA 3L7NA 2D5BA 3QVJA 2PYDA 3DCYA 2FWRA 3H5TA 4JL8A 4U2BA 2JHAA 3CLUD 2CCKA 1EAYA 1SVWA 4CIWA 1G4HA 2JD2A 1Y5IA 3O3NB 3BG5A 3NDPA 4JJFA 521PA 1OYOA 1QZTA 1Y80A 4RY0A 1Q3TA 1A5ZA 2XNDA 5G4KA 3SJBA 3WGQA 1K86A 3AHHA 4JKOA 4RK4A 3V00A 3KSZO 3LA8A 1SBCA 2R86A 3EVZA 5TPWA 4AY2A 2B99A 3BXFA 4TTVA 1IM5A 2IOQA 4TXJA 1OLUB 2ODQA 4RMNA 2FZ5A 5MN5A 1FYXA 1WHTA 5B1IA 1A5AB 2F3SA 5BSRA 3RVSA 5KQMA 2HKIA 3EEQA 4MICA 3RYHA 1T6ZA 5CBKA 4H1VA 3R7AA 5IM4F 2AD5A 2VXYA 3BRWD 1O77A 1NVXQ 3EJ6A 4FC7A 4UD2A 4FK8A 4Q9IA 3W5UA 2E85A 4F38A 4BX2A 3TXAA 4FZJA 5C37A 4YJFB 1WVGA 3H04A 1JZQA 1Z5NA 1UC5B 2C4NA 3PLNA 5IKOA 4UDYX 3A6KA 2BFNA 3H1TA 1Y5MA 1GZUA 1RXYA 2JLSA 2V9ZA 4WKBA 2ST1A 1BYUA 4S1PA 5CM8B 1ZGZA 1REQB 1UXJA 2F48A 4P22A 1E96A 1QLHA 3E9DA 3SE0A 4YO8A 1Q7RA 2HFJA 4AKTA 4CL3A 1OI2A 5KYWB 1J0AA 3LM8A 5CLJA 1SVUA 2XW6A 1CE8B 1I4LD 3KXKA 3QWHA 4BNLA 2G1KA 5CA1F 4RTSA 1U4NA 2XRMA 4UBIA 1Z0IA 2H52A 3QE0A 3ABIA 4BN4A 3OF5A 5LLTA 2ZYUX 3L84A 3H5VA 2F6RA 4DR7B 1GKYA 2ZIAA 5BSTA 1N5OX 4Q02A 2J3KA 5FWNA 4N5MA 1FSPA 5LQRA 1Z37A 1QHHA 4I19A 3EC2A 1RQ2A 4V38A 3VU8A 5IANA 5JV5A 1CQIB 4ME6A 4RA6B 3S2SA 1CYDA 4NBUA 3X1YA 5A4FS 1KHHA 1RJWA 3TB6A 3QVMA 1VI6A 3FJYA 4AJJA 4ZI7F 3PX3A 2C2GA 1HG0A 4D4JA 4MYCA 1Y1QA 5H83A 1AXRA 1F0PA 1E2FA 5EWMB 1QOPB 2HLDA 4XASA 5GJCA 5J4LA 5E0KB 3R6TA 3O94A 2B35A 4HB4A 4ZV9A 3P4YA 1S8NA 1JAIA 1WMSA 3D4PA 2B4YA 3WR5A 3PQ7A 4JI5B 4GZ5A 4R5HA 3B38A 4QXRA 1JVBA 1R6TA 1LK5A 1UQTA 4FKBA 4FC6A 3WKAA 3ZW9A 2QX8A 3DV2A 1COWA 3NV9A 3P2KA 2IHZA 5G1PA 4MJLA 4WASA 5K09A 4GOMD 1M2VA 2P67A 5JYBA 4ETIA 3QYPA 3LDFA 1DSSG 1KYQA 4G8JA 3KPWA 2D06A 3H3JA 3LL7A 4LUCA 2RGXA 3IXLA 2LIPA 3CSDA 1N5KA 2FPWA 2IYYA 2I2XB 4G5QA 2UU9B 2GBGA 2DFVA 2REQA 1RHRA 3IUPA 4XR4A 1M6WA 3STXA 1MHTA 1ZD9A 3EB9A 5B4VA 3BD9A 2WAYA 4H6VA 2EARA 4IHAA 3D3WA 4M0FA 2ZT7A 4CV2A 1UFOA 3D2AA 3MGKA 5IYZF 2MWMA 3NXKA 4ENVA 3LCRA 1F0NA 1P1KA 3VR4A 4CLXA 4UU7A 1Y81A 2ON6A 2Q46A 2Q3EA 3KCQA 4B79A 2A59A 1Y6GA 1L7NA 4B85A 1L4YA 4GBMA 3M5DA 3NBKA 2ECPA 4G36A 2VKQA 1G20A 3HUUA 5B3AA 3RFCA 4B6QA 5EUMA 5LOVF 1G9SA 4FOSA 3WRWA 5FAKA 2H7YA 1CNMA 1U2GA 5EFZA 5BRNA 1J7KA 5A04A 2J31A 2YHIA 3BHIA 3BXHA 4B82A 5B3JC 4ZYWA 2D3TA 2AQHA 2XXAA 1OF1A 4WUTA 5AK0A 4AN0A 3LT5A 5CB6A 1J0DA 1V47A 2IE0A 4JS0A 1PEYA 4WY8A 2DOKA 1W29A 3DZIA 3HABA 3SHWA 3T1NA 3ZS9A 4BMDA 5KSPA 3PGXA 1RWKA 1NW5A 4BMVA 5KJ6A 2F90A 2A4KA 2EZ9A 2R8YA 3EZGA 3H7AA 4KVFA 5H16A 1GQ2A 1I3LA 1NWCA 1QHSA 3M4NA 4XLZA 5EHNA 4Y1RA 2IY8A 3FKSA 1M6NA 4KDFA 4QECA 1WY7A 3TQTA 1GQSA 3SS9X 1G64A 2XQKA 4X7RA 4BLSA 5FTLA 3UN1A 4CIVA 3MRSA 3V2UA 3DAOA 4KDCA 1M0TA 1NY6A 3A0RB 1I6MA 1TM7E 4ONEA 4LNUA 5HPYB 1XAJA 3P94A 4TL8A 3U3DA 5CXUA 2R25B 4OB7A 1I2MA 4OI1A 1RXUA 3W77A 3TI9A 4CF4A 1EINA 4U9UA 1E1YA 4HGOA 4G9BA 5JOQA 1ZVVA 3GLKA 3NKVA 3OT4A 3Q12A 1HNWB 3W04A 3RF7A 3PQ2A 1O9GA 3HLTA 4BV9A 1CVIA 1T36B 1W88B 4XPIA 1KEVA 5LB2A 1O8BA 4HB3A 5AHWA 1N57A 4XQ0A 1ZCJA 3BMCA 3I3SR 4MKGA 4ZODA 3U31A 4QM6A 1M7HA 1R88A 4X24A 3SX0A 4MVWA 3C5WP 4K6MA 5I4BA 3DT8A 5F2KA 3PC4A 3LY5A 5U1PA 4E51A 3LGSA 4EJ6A 4DDVA 5BPFA 1VCMA 3O8OA 2QI9F 1UP6A 4C4YA 5FA6A 4Q0MA 4KR0A 5HJ2A 4GOKA 3AR2A 2F59A 3DTNA 3ZDZB 4MW1A 4Y1GA 2D1YA 1ZQ1A 3KUKA 1KMNA 2ZU6A 2WV7A 3H4IA 3PD7A 4Q7EA 1HQCA 3T5AA 5DWDA 3RK4A 2KHZA 3GAFA 3TEFA 2ZBPA 3U4AA 2AOTB 2BH9A 3KP1A 1P1RA 2PZBA 5AVVA 2OHFA 4G07A 5EQJB 1KQGA 1G60A 2OO3A 5D6OA 2IF2A 4JY7A 4BZWA 3L7LA 1BX3A 3O2NA 4M9UA 3WO0A 4BKMA 1TLTA 3W5CA 5E6RB 4U3JB 2ZUEA 3EOAI 2OG1A 2QM3A 4KBFA 4R31A 1KEPA 3PT9A 2GYVA 2CC2A 3LVFO 3TSYA 1QQAA 4N0EA 4LHZA 2K7ZA 3SYRA 4H7EA 2PKEA 3V8VA 4PLVA 1E79A 1ECCA 2FZWA 4JBXA 2YYYA 4A0HA 3OIDA 2I5PO 4UVEA 1MABB 3G5MA 4WK4B 1UBTS 4QX6A 3FNQA 2XT0A 3E9QA 4LXXA 3U3ZA 4UFNA 2FJUA 4NEGA 1IU9A 2QYTA 3O7WA 1QOQB 4L5CA 1Y6JA 1J0XO 3UUGA 3PWSA 3M6VA 3WP0A 1VKHA 3E84A 3OCCA 4RCYA 5CVVA 1A98A 3HA2A 3QU4A 3ESCA 2EFHB 2GYWA 3DDCA 2Z98A 4I6GA 1NVGA 4AMBA 3P7MA 4P0PB 3VPSA 5EQFA 3H2KA 3FPKA 4HGRA 4RHEA 1W7AA 4FT2A 1Y8ZA 4JXXA 1P7WA 1ETUA 1YAJA 3C1AA 4CU5A 4Y2UA 5AM2A 5EZYB 3IP7A 3OFKA 4WW0A 1CRQA 4OQEA 1FE8A 4LI0A 3TR6A 4B3CA 2WF7A 5CT4A 1EHYA 4RMIA 4ZVLA 1YQEA 2LCFA 3TJRA 5JXGA 2VF4X 2ZCUA 1D7AA 1DLJA 1KI1A 1L4FA 3JARB 4IUDS 4A2WA 4OLHA 3VMFA 2VT3A 2VSFA 3OLQA 4WKCA 3ZCQA 1Q95A 4EECA 3RHZA 3T15A 2ZIVB 1Q3HA 3WIOA 5FNZA 1KK0A 1U4SA 1MU0A 1VHLA 5G0WA 5SY9A 2RHOA 2WI8A 3LVQE 1B0UA 1QWOA 4X7PA 1C9EA 1N6LA 2QTFA 1F0KA 4FYYA 1NLMA 2XOKD 2VAPA 4RZUA 2VJBA 5KJCA 1S2DA 3QPDA 3SHTA 3JWHA 1RKVA 3WGTA 3FAKA 2ZB2A 1LTQA 3JWJA 2RHMA 2VL7A 3D0OA 3ILXA 3HBNA 1QG6A 3EZ7A 4TM7A 4E4RA 1AQJA 3UWPA 3G2IA 5EP4A 4UAGA 3DP9A 4CDGA 3OKPA 3STHA 4YT8A 1OYWA 4J3FA 2QI9C 1ZIXA 1Y33E 3KD2A 4RH0A 5C3UA 4DCJA 3TX6A 5AVTA 2ZVDA 2NZ8A 2WKPA 3ZDQA 1W48A 2E7ZA 4XEUA 4FGKA 4CKCB 2NO9A 4QDJA 3GLGB 4N0DA 2ZM6B 5K0FA 3BXZA 5JASA 1AQLA 1ZUNB 2R87A 2V7BA 4TQGA 4PYIA 1GNRA 2ILVA 2IUYA 4L4UA 4MVJG 1EM8A 3KKNA 1TAUA 1X80A 1GV1A 1P3Y1 3EGWA 3OBBA 3BMQB 1C2YA 1WV0A 1Y4UA 2OCDA 2JANA 3SQOA 3DE1X 4KE6A 5J43A 1NMEA 1ID8A 1SA0B 4NYIQ 2H5JA 4M86A 1LD3A 5DGHA 1XPRA 1OU0A 3KT8A 3PQCA 4YRSA 4F6LA 2IYTA 3LT2A 1CEXA 3UB4A 1CLUA 4BCDA 3SJZA 1Y1PA 3TBHA 4CQNA 4DAEA 3BHNA 3MJHA 4LYYA 3WHPA 1OOEA 2C5FA 2JBAB 3IOEA 4RD6A 3CZ4A 1ZP6A 4AG6A 3W7AA 4FINA 3HY6A 1E6LA 1ML4A 2OZKA 1DAGA 4HMPA 5SYMA 1T5BA 4KIWA 4N0PA 1GAQA 4CFZA 5F98A 5I8WA 3FOAA 2HPVA 3JZMA 2C3MA 5GOZA 2D0OB 1DKUA 1I0LA 1Z73A 4GSKA 5CDTA 3UH0A 1GXSB 2Z83A 3ICVA 1ZY2A 4D4GA 3Q88A 4P81A 1DKOA 2GK6A 3OHMA 1GOTA 5D3QA 4DCOA 2VHXA 2XUKA 3QPBA 4N9WA 4G1BA 4WK2B 1GQFA 3WGGA 5DM70 3QM1A 1IIBA 2A0KA 2HNKA 2ZSJA 5I9SA 5IJ9B 1NA5A 5LU9A 1KWKA 2QLBA 4LBZA 5EIHA 2BC9A 3SIRA 2CLEB 4PO3X 2V45A 3Q87B 5FTNA 2J0EA 5DEOA 4L76A 3KLBA 1VPVA 1ZJYA 1RPAA 3KR9A 2Z5GA 3E3OA 3NRBA 4CDMA 1V71A 3N2GA 4XLLA 1H6CA 2QRJA 4ZQIA 5ELLA 5REQB 3WKCA 5J5VA 1JHXA 2VT7A 4C4AA 5DU2A 1RI3A 3DZGA 4XUEA 5ILOA 1L7BA 2D5CA 3PWTA 1T0UA 4WKPA 1PJCA 4RSMA 3TZKA 3MT9A 3GUCA 4UMEA 4D0NA 1XDZA 5NLLA 1QGDA 3AK4A 3LKDA 3T7IA 4CNBA 1UANA 1HGXA 1XPUA 1EWYA 2H7XA 3IHLA 4QBIA 4TUYB 1IPFA 2JCXA 4OEHA 1YJ8A 3D7MA 3I09A 4I1SA 3VPCA 3INNA 1E63A 1C29B 3E22B 3F7OA 3HKBA 3UAXA 4JVOA 4KKXB 2HSWA 5E6UB 3ESAA 1NRIA 3JQ7A 1XWIA 1ZFNA 2XMPA 1PWYE 1RVV1 3DE3X 2PZMA 3DO5A 3KPVA 3O1LA 4B83A 4CLRB 3OTIA 3ER8A 1H66A 1T9GS 3OQJA 3ZHXA 5KYUB 4ID9A 3UAWA 4PZ0A 5K0LA 4BO3A 2FPLA 4WFJA 4ZC1A 1FRVA 1FTSA 4D4HA 1YCDA 3L8CA 1GKUB 4F06A 1MIOB 4JC8A 5JT1A 4FYVA 1SC6A 4CV3A 1XWFA 3HUEA 4BO2A 4IDBA 13PKA 2QP3A 1IEWA 2C2YA 1L4GA 1TO2E 1YULA 2AEMA 4RVUA 4XCQA 4B6GA 2OFXA 1U1FA 3P9KA 2EERA 2XCLA 2ZB7A 1PRYA 4I0WB 3ZV3A 4Q3BA 1G1AA 3PEEA 4BZQA 3WGVA 2UYGA 1RP1A 4M7WA 4CTKA 3OSZA 5CVJA 4Q93A 1QIMA 5CA1B 3QNUA 5K8TA 4HX2A 3FFWA 3L7AA 1HTTA 2YICA 5EJAA 2O2ZA 5JHGB 1STOA 3HYCA 5HTOA 3NP7A 3TIVA 1O5TA 2X2OA 4BO1A 1DC7A 4A6DA 4E94A 1FXWF 4F3KA 1GA6A 4I1OA 1IMOA 4FS3A 4A16A 2PWPA 3IKVA 3ASYA 4N47A 4MGIR 3ZHZA 3FWPA 2FGKA 2ZW9A 1SKUA 4HFMA 4LOIA 4BVJA 1XEFA 4ZI7B 4PR3A 2AHOA 3JQRA 5EWLB 2D1SA 4X8HA 4IWNA 2XH8A 2YASA 4DVGA 1E1RD 1R6AA 3L8FA 3UW1A 1B8VA 4NH4A 1XXHE 4RA9A 5B2FA 1HR0B 3ROFA 1BH6A 3I2YX 3RVBA 4BTEA 1FJXA 1RHMA 5DVZA 4YRFA 1XL1A 3EGEA 2G08A 3WICA 2R5WA 2D54A 2H4JA 1D5WA 2HZBA 1FQOA 1VI2A 2DC1A 1N75A 3MWEB 3DFFA 3RW9A 4TMKA 3FLAA 3O0TA 3DVRX 1XHFA 1HYBA 3ZHUA 3AEUB 3F73A 2FPPA 3AVYA 1H23A 3F2VA 3HJHA 3H5LA 4YI5A 3PPXA 3DMFA 3LG2A 4WHMA 1JA1A 3COYA 4IIUA 1RD4A 2DTDA 1II9A 2P91A 2Q9UA 3RUFA 1L7EA 1O0SA 3BQMB 4PFKA 2AJBA 4FOPA 3LO8A 1QE5A 3MINB 2ONKA 4Y0AA 5EMJA 1VE7A 2B34A 5DSXA 2JLWA 2CDCA 5T5QA 1XTTA 1G3IA 4UEOA 1V4NA 2IW3A 3QFHA 5ERXA 2XMZA 5IYZB 1HORA 3T3IA 3D31A 1FP2A 1XCOA 4B8ZA 4HLUA 1FUIA 2ODTX 1NHGA 3K1YA 3N87A 3SD7A 4L02A 4Z3KA 1F2DA 2EU8A 1F3OA 3ABRB 3HJCA 4FS8A 4UM7A 4WOKA 2HA0A 4MS3A 1OA1A 2M6SA 3FWNA 1JSRA 3HVHA 1BKSB 1H2FA 3DLTA 1T4CA 1E98A 1XEWY 2PZLA 4OYHA 4IJVA 2BR5A 1LDEA 4UOEA 3GRKA 1E7SA 1T0PA 1XP5A 2YNMD 2OHOA 3VPDA 4C30A 4L85A 4RD0A 2A14A 2NW6A 1EESA 4TKVB 2PFGA 4UUPA 2ATEA 1X0VA 3CJQA 5P8WA 4Q18A 2FW0A 1CDEA 1IWOA 3M3DA 1KPIA 2HJ9A 3EAFA 1CUWA 1B6TA 2X1VA 3VTZA 1EJ2A 3RS3A 2I91A 4QRHA 3TM5A 3N8DA 1VL2A 5E2AA 4OGFA 2K6GA 1DKRA 3I04A 5FUYA 5EJ7A 4CIDA 4QGGA 4MW0A 1FRZA 4A8JC 3KHTA 1SB8A 1TU4A 4UBNA 3GDGA 3ZOZA 4DWVA 2Z6UA 4A91A 2A2ZA 3EWIA 1IZ8A 4HDMA 1V96A 3T1HB 1DP4A 2EFDB 2H8KA 2YN0A 3AF5A 3CXUA 3LZ6A 3SAJA 5AVSA 1MJFA 2E4VA 4FTWA 3TTSA 1Y8RB 1E6MA 1L0BA 1HA3A 4KC0A 5K3DA 3ET5A 1GPBA 2GBCA 3NX4A 4ZMRA 4I5DA 5FWDA 4WA7A 2XT9A 3I6ZA 6CHYA 3O82A 2H57A 4FB5A 4E5PA 3D5TA 2RGNA 3MD0A 3NWPA 1B43A 4BO4A 3W2HA 3F7TA 1O96B 4PC6A 2JGNA 2SKEA 1KAHA 4OQDA 5CEEA 5E38A 4J1NA 2VH5R 4GKAA 1Z6AA 4O63O 5T8KC 1MO5A 4AKHA 3ZLUA 4CMAA 5AIAA 1X1CA 4S12A 1NT2A 1Q20A 4GEGA 3MWFA 2PGNA 1RR6A 4TRJA 7REQA 5KTKA 2QD3A 3FLBA 3QFSA 1HOTA 4E12A 3FWZA 2O8DA 2IHKA 1N78A 4HNAA 2HDWA 4YCNA 5FFMA 3I9V1 1T13A 1NXWA 3E4CA 4KL8S 1FZTA 1B0ZA 4BQQA 1QF6A 4TPKA 1XEXB 1R6BX 3PXCX 1NX9A 4YWHA 5HKLA 4DARA 4GOJA 4DDMA 3DCIA 2DXIA 2J07A 3D02A 3WNQA 4AJ4A 1SBZA 3CTPA 1S7GA 3ZE2B 1QV7A 2ZIZA 3GN1A 2BT4A 1UKVY 1ZMOA 3GRPA 3QLJA 2JFFA 1HY3A 3A3OA 4RIEA 2E1RA 2FWMX 1K3UB 3CLSC 4LBVA 1E6UA 4J94A 1UBNA 3IMFA 4P34A 1L4BA 2WJHA 2A4MA 5FBRB 4CUZA 2JIZD 3HA7A 1VBNA 4DDTA 1LB1B 1NULA 2X8BA 4Q5IA 1T3HA 3HYSA 3SSMA 4KXQA 4US2R 1ZRNA 2B30A 1V8FA 4G0YA 5K0GA 4C0WA 3MIIA 1VI5A 1VE5A 2C0CA 4J0IA 4P7JA 2JI4A 1XNGA 4PYMA 3IAAA 5A1TA 1H0RA 1MTOA 2V8BA 5ALSA 1O6ZA 2OBNA 5TF4A 5C7OO 3HJFA 4TGLA 1PGQA 3VDMA 4V1CI 4FLFA 1PF7E 1S3SA 1E58A 3OUUA 4YFVA 2GCIA 2J5KA 2PH7A 2VP2A 5AVYA 3E70C 1ML3A 1RVDA 3INYA 3TLMA 1ZGAA 4GI1A 3AUAA 2XGOA 3LF2A 3P5BA 2OM2A 4HDSB 4AXXA 3LRTA 2UUOA 2Z2XA 1VL1A 4CLDA 1QE0A 3NVDA 1SJ9A 4R0MA 1NNSA 3KU1A 4FFNA 3I6MA 2HJHA 4PQRA 5A4DA 2AQ8A 4NS4A 2QN7A 2NYRA 2QE7D 3TE7A 2ZR8A 3R40A 3UATA 1OFIA 3NEPX 4P0TA 2ARKA 4LRWA 4U63A 2EZ4A 4A0SA 1HM5A 3F6SA 1Z4PX 3AVPA 4I9FA 3SOPA 2EZTA 1PFKA 2W2MA 1DXHA 4K40A 2AYXA 2XAUA 2XR1A 2YWEA 2HIGA 4NBKA 5TS2A 3U48A 2FQWA 1FDOA 1CKEA 3MWDB 3NZEA 3PQDA 4MS1B 4YRKA 3MBIA 2R1TB 3R24A 2QLLA 4JJ8A 4ZC8A 3UANA 4J0EA 1LK0A 1E59A 3FAZA 5CFQA 4CIBA 4CU2A 1UBLS 5BNTA 3QW4B 4DIBA 1S4MA 1JFRA 1OMOA 2QUHA 5ECGC 3GP8A 5JS6A 1U2DA