4R1PA

Crystal structure of thermophilic geobacillus kaustophilus l-arabinose isomerase with mn2+
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
494
structure length
494
Chain Sequence
b'LSLRPYEFWFVTGSQHLYGEEALKQVEEHSRIMVNEWNRDSVFPFPFVFKSVVTTPEEIRRVCLEANASEQCAGVVTWMHTFSPAKMWIGGLLELRKPLLHLHTQFNRDIPWDSIDMDFMNLNQSAHGDREYGFIGARMGVARKVVVGHWEDPEVRERLAKWMRTAVAFAESRNLKVARFGDNMREVAVTEGDKVGAQIQFGWSVNGYGIGDLVQYIRDVSEQKVNELLDEYEELYDIVPAGRQEGPVRESIREQARIELGLKAFLQDGNFTAFTTTFEDLHGMKQLPGLAVQRLMAEGYGFGGEGDWKTAALVRLMKVMADGKGTSFMEDYTYHFEPGNELILGAHMLEVCPTIAATRPRVEVHPLSIGGKEDPARLVFDGGEGAAVNASLIDLGHRFRLIVNEVDAVKPEHDMPKLPVARILWKPRPSLRDSAEAWILAGGAHHTCFSFAVTTEQLQDFAEMAGIECVVINEHTSVSSFKNELKWNEVFWRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords L-arabinose isomerase
publication title Crystal Structure of Thermophilic L-Arabinose with Mn2+ from Geobacillus kaustophilus
rcsb
source organism Geobacillus kaustophilus hta426
molecule tags Isomerase
total genus 182
structure length 494
sequence length 494
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.3.1.4: L-arabinose isomerase.
pdb deposition date 2014-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02610 Arabinose_Isome L-arabinose isomerase
A PF11762 Arabinose_Iso_C L-arabinose isomerase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10940 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4r1pA01
4F2DA 2HXGA 2AJTA 4LQLA 4R1OA 4R1PA 4R1QA
chains in the Genus database with same CATH superfamily
4JMPA 3H2BA 2B0CA 1PJLA 3G2HA 3IVGA 3LCMA 2IDKA 3PXDA 3TW0A 3V55A 1T9GS 1AHPA 3S55A 1OZAA 3TQIA 2YHUA 3NDRA 4BTLA 1F6DA 3Q0IA 5ED4A 1GPMA 3ZH9B 3DM5A 1UEIA 2PMKA 4UBNA 5KOHB 4W5NA 3VNRA 3WGJA 3CISA 2YINC 3ZWQA 1H05A 1M8GA 1FJHA 2WYOA 2R65A 3D4PA 3R3ZA 4Q82A 3X1DA 1F2TB 1O4VA 1U3VA 2A7XA 2O6LA 2WHPA 3RSHA 2CL0X 2Z2IA 4CG3A 2AH5A 4QU9A 3ZDDA 2VYQA 5EXTA 2H92A 4M7OA 4YLYA 1YFZA 5KQMA 4M9RA 4OMUA 4RNCA 1Z5ZA 4PYKA 3O9ZA 2EFYA 4CG1A 3PJGA 4YP7A 3L8GA 1PL0A 3U9SA 3DMRA 4FU0A 4KXLA 3I2JA 2GEDA 2WM8A 3TYXA 1J00A 1E9SA 1V5IA 3PB3A 1VG1A 4YMTA 5I5EA 4FWTA 1L4MA 4TSRA 4K2HA 1R6VA 1F06A 1LK7A 3CLKA 3EUFA 4ZOQI 3GMTA 2YOFA 5HUJA 3CO0S 4OO3A 4Q9NA 3RV3A 3SBDA 3A9TA 5E8RA 1PU2A 4QLOA 2H5JA 1YRBA 1V2HE 2TRSB 3HR8A 1XWWA 3C5WP 4CF6A 1PQ4A 1JLRA 1G5QA 4LZZA 4WECA 3LNTA 3JZMA 4ER0A 2JCVA 2I2DA 1AA6A 1L1RA 1WXHA 5CXUA 1BHQ1 1TNDA 1G4UR 1X15A 5JZ9A 3B13B 3GO4A 4AJOA 1GIAA 1HH4A 3KS9A 1DZIA 1YTUA 1XWIA 2BLNA 1KJNA 4RZ3A 3SHVA 3NETA 3THXB 5JSFA 1KR5A 2ZAGA 4WNIA 1H6AA 1ZINA 1RWVA 3WE7A 3C70A 3ON5A 4WZAB 3SYKA 2R97A 5G4KB 1YQEA 1WCV1 3DV0B 2BEUB 4U0JA 1Z17A 4XKJA 3UK1A 2NVUA 4TT8A 3D7LA 1RD4A 3I0ZA 3N2NA 4HDRA 4F6CA 2QRKA 5BSUA 1SQ6A 2R6AA 2X9LA 3TPZA 2NO1A 2BM0A 2YDYA 4ISBA 4YRFA 1Y98A 4RZSA 4KIUA 3CF0A 4FCWA 5K6RA 3P27A 1GWNA 4A6DA 1UMDA 2PN1A 2Z09A 3C5HA 2NSLA 2Q27A 3R0JA 2OV2A 1QP0A 4QYMA 1T25A 2NYRA 5JEDA 3IOBA 3H75A 5EN4A 4C07A 1Z0UA 3LRXA 2BUBA 5HFJA 4HXGA 2HMVA 3P9NA 1DFGA 3CHYA 1AV7A 1Y34E 3IEXA 1RC1A 2VP6A 3I0NA 4E51A 1NC1A 3B9PA 3BWEA 3T15A 1YBVA 1CQPA 2E49A 4MQFB 1PIWA 3M6IA 4IJ6A 2H48A 5KVVA 3WKAA 2QJTA 1JXMA 2DPLA 3CB4A 2BZ0A 4ROSA 1F0YA 1Y81A 2GAOA 3WSVA 4IW3B 2VAPA 2WIGA 1UKCA 5JTTA 1KMHB 2G4CA 3VU8A 2MSLA 4A16A 3F8WA 5CBKA 4BYMA 1ISFA 3HSYA 1HE3A 1V95A 5FI3A 4RJKA 3EMDA 1A7AA 5JLAA 1C8VB 4I6EA 3DPIA 5IHPA 2DEUA 2AOVA 5I4CA 1Y7HA 1Y1PA 1GNVA 4NBWA 4LHSA 1UBSB 3SQLA 1FRVA 3QUSA 5CFZA 2CFRA 2EQBA 3DF9A 2HAEA 3R77A 2BVNA 3AI1A 4Q9DA 4AYXA 2E6UX 1GDHA 1Z36A 3PQ8A 4NOMA 4R81A 5A04A 1ZWKA 5FFNA 4JUAA 5LPNA 3TPCA 2IS6A 2PT6A 3OT1A 3THSA 5AKLA 4BMSA 4PNEA 3JZDA 5FYDA 3MOGA 2Z9BA 5H16A 2QKYA 3A1EA 1OH6A 5EJ6A 1HYGA 2HX1A 1ISSA 2Z57A 1QOPB 5AJZA 3SLKA 5FBQB 2VWGA 2VBFA 1H5QA 1O0CA 3LOQA 1UDBA 4YAGA 7REQB 1ILWA 1CWUA 3K72B 1OZHA 1QAQA 4EATA 1UDRA 1VA5A 4J2OA 4GS5A 2UKDA 1BU5A 2FEXA 5IT0A 2VHQA 1AKMA 2G9UA 1XR3A 1YVDA 4KXMA 4OQFA 3VH3A 5IH3A 2QRZA 4TT3A 3ESAA 2EG5A 4ZAYA 1ZOSA 3KJXA 5M34A 2C59A 1S89A 3GHYA 1MMFB 4FUQA 2CZGA 2OKCA 4EM6A 1HDOA 3COZA 1VSVA 2RAVA 4IRMA 4WESA 4OQQA 1ZSVA 2X3FA 4GPAA 3QMVA 1KXJA 1Y6JA 3PRJA 4JLWA 4YAWA 1C1DA 1HFJA 5KEIA 2P7IA 2IHJA 4OUDB 5LQMA 1W6RA 1YUMA 4KR0A 1Q95A 4V1CI 1G5RA 1FSGA 1SQFA 2OVFA 3ANSA 4MLPA 4DY6A 1GPWB 4YRIA 1T0UA 3FKQA 4FGKA 4CEHA 4QXQA 2VF7A 4HQKA 3WK6A 1SVNA 3NGMA 5A9TA 1O94D 3U4HA 1P5FA 2OHIA 2RCNA 2PGJA 1QIEA 3CWQA 5K20A 1W2HA 1OTXA 1A9RA 1CE8A 1J25A 4H60A 2GZMA 1VSQA 3U7QA 3DMGA 2ZG6A 3U1BA 9LDTA 1RCFA 2RAFA 2I5PO 1GTZA 5H59A 1RI1A 3L4BA 1L4UA 1U8YA 1VBFA 1NR5A 1VPDA 2AJBA 3E22A 4JITA 2GAFA 4EHDA 1GZ5A 1LRJA 3DE3X 5L40A 4MVXA 3RANA 4RHTA 3B78A 4JVNA 1XMOB 3K1AA 1J90A 2W5UA 2CVPA 4KLAA 1Y9AA 4LMPA 4OOFA 5HX7A 5DFAA 3K2QA 4I1UA 1WUTA 3V4VB 1F38A 1D2GA 3QYJA 1X3LA 3O2JA 3BHMA 7ADHA 1M6VA 5B58C 1BE6A 4FTWA 5K8TA 1U3UA 3AVTA 2IW3A 2QD1A 1BCSB 3HABA 3KTFA 3KYCA 4YR9A 4RH3A 1Z3IX 1YC2A 1UQRA 3SZMA 3FVWA 2WKRA 5FYQA 4X1KA 1QCDA 3G2PA 3QPBA 1FC0A 2GM9A 3MFQA 1D9XA 2JD0A 4EBFA 4LEIA 1X2EA 1RYZA 4HWKA 2PA3A 2QYOA 3ZK8A 2OMKA 1RNLA 5FL7D 3WL3A 1V7QA 2K5UA 3JARB 3BD6A 3FJ1A 4DLVA 3B9RA 4XQCA 4ZPXA 4ENTA 2QAGB 1F4PA 4AJLA 1LX6A 3O82A 1Y37A 3DO8A 3K30A 3L82B 2OOSA 2PMWB 3QUCA 1QRSA 3O4IA 2BR3A 2YHSA 3FFXA 3DVAB 1NTOA 1OX4B 1SHLA 3L77A 3UT5B 4QQFA 1RMQA 3PRYA 2FR0A 4GXTA 3H17A 5EERA 4BO9A 1V7CA 2BDEA 3L9XA 4L8LA 4HH0A 1OF1A 1QP7A 4G5XA 2IPMA 1WVGA 4G6ZA 4B40A 2A2ZA 3ZWVA 4G24A 4QSHA 1EXDA 4HVAA 5G0UA 4BQEA 3J81k 3A9RA 5LFAA 3TQRA 3E3NA 1I9GA 2YJNA 1E9VA 2JGKA 3VKFA 4D96A 3ICEA 2ZAYA 3L5KA 3F4BA 5JY6A 2P5YA 2WAAA 1ADBA 1C30A 3PQ4A 4OFWA 3ZCRA 1DX4A 4CNBA 5AI0A 1QZUA 3FRJA 2JAOA 4G4SO 2BMFA 4QUHA 3CUKA 1DX9A 1BN6A 2BGIA 2GBFA 3LXRA 3OM8A 4FFPA 4HB3A 4TKUB 1X9GA 3TTYA 4NFLA 4C9BA 3N87A 2O7NA 3Q7IA 4KVFA 4HKTA 3JQFC 3KYDB 4LW8A 4YRBA 3HXLA 1O94C 2JIZA 2R4UA 4QPJC 5CDYA 1H22A 1TYEB 1AGPA 4PPNA 4LRXA 1RPZA 4UUOA 1KRXA 2XUAA 3O84A 3QV1A 4QYSA 1WVMA 2B7LA 1E9AA 1XJCA 4B4KA 2VI5A 3JV7A 5EIWA 2QU7A 4Q3OA 1EJ6A 1QWSA 2G40A 1W94A 3BFPA 2AMVA 3BWDD 4OKIA 4NJEA 1HV8A 3HMKA 2WQ6A 3RTEA 2BEJA 2UVQA 4NS4A 4L6CA 3EG5A 2Z8YM 4B4VA 1AKYA 3YASA 2IDMA 1DEXA 2G1AA 1S1MA 4R8RA 2BKVA 5C53B 5FKJA 4PO9A 4BRZA 1XRRA 1KI8A 4JI8B 4BFTA 3MWEA 1F9AA 3N28A 4XARA 2UXCB 3HJHA 1FBTA 1DZ3A 2X42A 2QQFA 4O5OA 3CX7A 3ZU5A 5DPMA 1NLZA 3OD1A 4YDHB 5EXXA 1JLKA 3C8DA 1NURA 4HGNA 5HJ7A 1GTSA 3TAXA 5ALNA 1E99A 1W0JD 3I6ZA 1YR6A 1WHSA 2FKNA 1TUEA 2GZ2A 4HH3C 1PF7E 2H1HA 3JWJA 4HRXA 3V8NA 1P62B 4DB4A 2FUKA 4IEEA 2R86A 3EFOA 3K1ZA 2AFHE 2O8DB 2PSFA 3P0JA 1PV2A 5LUAA 2GHRA 1ZQ9A 2IPXA 3RTBA 2OQRA 2FPIB 3VZBA 3R7NA 1AS0A 2OFWA 1DI0A 1SXGA 1Z88A 3DMYA 2EFJA 3OHSX 4INZA 1F8UA 2BDUA 1Z39A 2CNWA 2Q41A 3A4IA 4FB5A 4P5PA 4PCLA 4HFRA 2VQSA 3DBIA 4FN4A 2QL5A 3FROA 3BGWA 3LQYA 4JL6A 3ED1A 1DCKA 4JS0A 4YRCA 3CVVA 2JHCA 2I54A 2GKOA 4S0XA 1VE3A 4DC1A 4YJ2A 4LDQA 2DY1A 5FHQA 1RIIA 2J3QA 3IHTA 4ND8A 3SS8A 1P29A 3DYBA 4KUHA 1EFPA 2E2WA 4PX5A 4BIIA 1XAHA 1BMFD 1XTRA 1Z8FA 3UAVA 4CKWB 1XDZA 4UNRA 5IWAB 3U5TA 5JD6A 1TTHA 4GVLA 4IJWA 4GBED 3AC0A 1ODJA 4CLXA 1CUDA 5KAMA 1CQIA 3RHSA 2ALJA 4EJ0A 4ENQA 4NBNA 3DULA 1SURA 2JLAA 3LHIA 2EFCB 3I04A 5E6SB 3ICWA 2CDCA 3RJTA 2FEKA 1LJUA 4CIVA 2IHUA 3CPHA 1W9MA 4RSGA 4IAOA 4OAOA 3RB8A 2DQKA 4MYCA 4Y8VA 4CE6A 4B3DA 1VHLA 5C8XA 3GEMA 5JMOA 1ONBA 2PQ2A 4H6VA 4JDPA 1N6OA 2Z6QA 4PZYA 5LLDA 1NG9A 2ZJ1A 5THQA 2B6HA 3FWKA 4OXRA 2IODA 2GXQA 3ELBA 4JJZA 4KO4S 4JFAA 5E6UB 5KYXA 4ZPJA 2WYVA 1ZA1A 1EGQA 2GN1A 2YCBA 1E7SA 1RAGA 3CLTD 4I4CA 1E2NA 4YRPA 2Y2VA 3EMVA 4P7GA 3S7TA 4RADA 3SHFA 3WNVA 4ZV4A 4WKBA 1K6MA 2QLNA 2VZEA 5F7XA 3KR9A 3PCXA 1DIRA 2CEKA 5A6VA 3UBTA 1FTGA 2OM2A 4C0LA 2PYIA 2CZCA 2PRYA 3R0ZA 3K7EA 4QQRA 2Y1FA 3LT5A 3KRTA 1BOOA 4JR0A 4WY5A 4D80A 3GP3A 1KQFA 3GY0A 1OV4A 5JQGF 3GDGA 1XL0A 1NXOA 1KDRA 2BBSA 3E1KA 3N0RA 4DV5B 1Q7EA 3EVGA 2R5WA 2RKOA 3EMKA 3M0EA 5B58T 5SV2A 1F5SA 1R8JA 1SKQA 3BRCA 3WGZA 4CMIA 1Q44A 2JIPA 3RK1A 1FMFA 4DG8A 3R9WA 2ORED 1FU8A 5TT1A 3U3KA 3ZBPA 4DMKA 5ALGA 4C4XA 4BWYA 1X7GA 1ZGCA 5LMNB 2OXTA 1HNZB 4Y67A 2QRJA 3FGOA 1W88B 3A1FA 3FWPA 2P6RA 2AG0A 1U8ZA 1KORA 4BFCA 2XKAA 1Y3BE 2FKAA 1B8OA 1A7JA 1V3QE 5DM4A 5AVRA 6PFKA 2IE0A 3PI6A 4JZYA 4HDMB 1BAPA 2JATA 3MT8A 1W1UA 4OQXA 4UULA 1ZIDA 1JHAA 1VIYA 2C5LA 3TBHA 3UFXB 3WK5A 1UXOA 3H83A 1Z68A 2B9EA 3LH5A 4B4WA 5BNWA 3KB1A 1MDBA 5JALA 3TZKA 3ZY3A 2PFSA 3BE8A 1PJAA 3PDJA 4NCKA 3A6ZA 2GBPA 3L6UA 4XIGS 4N47A 2CW5A 4HHEA 3K0BA 2FHPA 2IP4A 1WZIA 1V37A 1GDDA 3QVTA 1E63A 1M1NB 1N8NA 1SVMA 3L0IB 3PGXA 1RC8A 4LYJA 1U4SA 2RJNA 3PGA1 4P32A 2WUGA 1FSPA 2OA0A 1OAAA 2ZW9A 1E3EA 1M1YB 1UJBA 2NU9B 5B4UA 4N40A 4KN6A 2B4TO 4QGFA 3RIMA 4EW6A 5AUOB 2FFBA 4Q18A 3PHBE 1YNOA 2HFKA 3R40A 4WCFC 3SIXA 3ROKA 3RRNA 4YMUA 1HT2E 4RE5A 4AQYB 1Z6AA 5EIFA 1W25A 4UQOA 1NFQA 3SG0A 4NG4A 1RAIA 5JSHA 4JI7B 4K7JA 3SJBA 3FNQA 2OQVA 4IV8A 3WL7A 5ALMA 3WB2A 4M7RA 5BNTA 1VI2A 2BTEA 4BLWA 1O77A 4AUMA 2BRUA 3CBGA 1KEWA 2ZIFA 1YO6A 4UVIA 1AE1A 2V97A 3PXAA 4FUTA 1TPZA 4C3ZA 4ZQHA 2ZYUX 3UV6A 5KWIA 4BL5A 4AY4A 1Y5NA 3ZNOA 5LM3A 1ADGA 3CLTC 4Q3LA 2FDCA 1AGYA 1XK6A 3ZDYB 2X13A 2YXPX 2HLDA 3SEFA 1KI3A 4B9EA 4BO5A 1CF2O 9GPBA 4HQ6A 2EKZA 2WG2A 4RU1A 2PX0A 1L9KA 2AR0A 3EZXA 4N5NA 4BFVA 4R3NA 2NUPB 3OOEA 2DR3A 4Y2YA 4F4FA 2H54A 1T1RA 1HORA 3QXGA 4YBRA 4M1EA 1P1JA 5LA6B 3CIFA 4C21A 4CM5A 5T7BA 1TJ3A 1JA1A 1V11B 2ZOSA 4PAGA 4LAFA 4ZYZA 1RWNA 4PRLA 1OH7A 3RT9A 1I7LA 2VEOA 4WL0A 4DCTA 4RPKA 3QKTA 1UBCA 2PCJA 4MKGA 4MRAA 4WCVA 4CU5A 3QLVA 2VTKA 1SKYE 2ZBFA 5AJVB 3JYQA 1K8ZB 2VXBA 4XIYA 3IUBA 5DZSA 4BP3A 2HJGA 4W4TA 2COEA 4RSHA 2RE8A 1UC5B 4QOIA 2JFBA 1SUPA 1YOVA 3AI7A 2GVNA 4U9UA 4ZJYA 5CA0F 2L2QA 1NF2A 2NUBA 5L7TA 4R8LA 1Q0TA 1U4NA 3H1PA 5J4YA 4F5EA 1NMXA 1W5SA 2Q28A 2ZVPX 2CV2A 4J6FA 1SUFA 2ZK7A 5F2EA 1TC2A 3TB6A 2YHIB 3I5UA 2B94A 5EE9A 4D3ZA 4PZZA 4NFHA 3W1WA 3MRVA 4KLNA 4PZLA 5JLJA 3MMPA 3TTTA 3VFDA 5LOVA 2OKGA 1KC3A 1IVYA 2R1VB 1E6MA 3IT1A 3LCJA 3UC5A 3DLAA 3ZE8A 1HURA 1OR8A 4Q5IA 3DMDA 2O5EA 3PGMA 4ENPA 1Z4IA 2KI5A 4Z4CA 5IFLA 1FL9A 1KAHA 2JFGA 1U5AA 5FWDA 1U1DA 2P2GA 2O1SA 2P68A 1M2WA 1UXGA 2APJA 4R41A 1FNMA 3L0OA 4TL6A 1JEDA 4G1FA 1MR3F 1T10A 4X95A 3TTXA 1Z8HA 5DWQA 3FSGD 4QE3A 4RENA 2QN9A 5AESA 1PVOA 3DVLA 3ELUA 1AKVA 3QVLA 4HZIA 3F9CA 5I7VA 1UK7A 4U7DA 1H2FA 1KFEB 4IJMA 4M1WA 4UDOA 3EVEA 3RVSA 5B1YA 2NSHA 3KM0A 4S3MA 2F55A 2QTAA 5EWMB 4WTOA 1ORDA 5PGMA 3P94A 3ICPA 1Q0PA 3GVXA 3ND6A 4QAQA 3RC1A 2BMJA 2JDID 3B6KA 2VT7A 3B1FA 5KVSA 4OB6A 1Q0HA 2DTDA 4W9RA 3PEUA 1HL3A 2ONKA 3Q8XB 4S1VA 5CLHA 5KB3A 1PK9A 1PZNA 2YS6A 3SLGA 1DB3A 5AI9A 3I6QA 3UENA 5JAUA 1G7CA 4YP9A 1PLJA 2NYVA 3BCHA 3ZE6A 4RDIA 1LNZA 1II8B 3TEFA 3VGJA 2X77A 4LHWA 3DXYA 1ZOOA 2ZJ5A 1DAKA 1I4OA 2GBIA 3C3PA 1G21B 4KWIA 2XZOA 5AJWA 1R74A 3NKFA 3HCRA 3JQEA 3KWLA 4CCSA 2EIXA 3PE4A 5FI0B 2GESA 3W8RA 5K4HA 4N7JA 3ZW8A 3HVJA 4ETNA 2FUG6 2YWDA 4B6SA 3STWA 4MW4A 3R4VA 1AV6A 1QIFA 1ATIA 1AS2A 2RHOA 3AHJA 5EL0A 2BIFA 1VLJA 4NPAA 5K8VA 3UXHA 4TQUS 1SZPA 1T6NA 1NXVA 2HQOA 4IO1A 3E8XA 2OORC 2I3AA 2CMHA 3BTVA 4QPZA 1DJMA 1NMQA 2AZMA 4LMBA 1KHHA 5SY9A 2QTZA 3WGYA 4BASA 4HWTA 2HW8A 4RL6A 5CG1A 3AYZB 1QOQB 3M2PA 3DXXA 4EUNA 1A98A 2YWGA 3CC8A 2BLLA 3QLUC 4FVTA 1NPDA 4K8RB 1X74A 3FI0A 4UM8B 1QO9A 4A8JA 4W1PA 4XWGA 2W6CX 3TD2A 1PI3A 2PUGA 1YOBA 4RVCA 1N3IA 5L6MB 4EHIA 1G8KA 4DJTA 5H8WA 3HV2A 2E4AA 2AI2A 4H4EA 2FWBA 2BGMA 1X94A 2OAEA 2IIPA 4II3A 3SU8A 3BK2A 4OHVA 5BSVA 3GMSA 5HBGA 3BZUA 4HUQA 4HX9A 4I50A 4KYTA 4P82A 2WTXA 5K1ZA 3VR3A 5JZSA 2GK7A 3C1OA 2XUFA 2VFAA 2G3YA 5L9AA 3CEPB 3CA8A 1CUGA 1XZKA 3CY6A 3V8MA 1OV6A 4HX2A 4JP5A 1WKVA 1LDYA 1C8BA 4K86A 4TLAA 5FWYB 3E9EA 3LPDA 1AURA 3U0VA 4FHZA 4ZVOA 2BFCB 3OCVA 3LVRE 1HEIA 4YN3A 1C7JA 4IZ6A 1RLMA 3W6ZA 5EE3A 1V6SA 2IZ7A 2XCQA 3AM4A 2EGGA 5EWJB 1VHDA 3TR0A 3K09A 4O4JF 2UYCA 4D44A 4PO1A 4UEJA 4DRXA 1L4BA 4GOKA 3RVQA 2ZRDA 1FMLA 3H0KA 4X6UA 4DZRA 4F9FA 2WZQA 3QF4B 3IMCA 1MNQA 2C4VA 3AFOA 4IIFA 3QPWA 4XPIA 3MA0A 4ALMA 1ESMA 2JC3A 2VJQA 5JCZA 4DQXA 4EO4A 3N5CA 2O4CA 4X84A 4D81A 1CKEA 3HDJA 4RFVA 4YBZA 2CJXA 1JEEA 3WMRA 2PGIA 3U3DA 1LJLA 2FWNA 3ZQJA 1Z2DA 2BKEA 1E89A 4X44A 3B12A 5H1YA 3PSHA 4NP6A 2XMCA 3L4KA 2PLFA 4I9FA 4KQXA 3SICE 4MCJA 2BN4A 3U13A 2IU0A 3MZ0A 3VR5D 3B9QA 2E87A 1J56A 1MB0A 2C0QA 3HWRA 4L4XA 4R1NA 4CKEA 1PHPA 3RUHA 5I7EA 3AETA 4MS1A 2IYVA 2YYZA 1BW9A 4IDDA 1B0ZA 3IP6A 3T54A 2VOJA 4PQGA 3MHTA 5I4IA 1VCHA 5AM0A 2KWIA 4KR3A 3O3MB 2ZI9A 4EJ2A 2YIDA 1VIAA 1Y3CE 1ZNQO 3E82A 1MFPA 3ORFA 4H27A 4D57A 1IBMB 1VGRA 4FHEA 2LDBA 4I2NA 5BWBA 3PWZA 3RUEA 1Z38A 3OZAA 4YI5A 2GHTA 5AK6A 3ZE1B 2OHVA 4DLTA 2H29A 3OQJA 5J58A 5KYYA 4K6MA 5C3UA 1J2JA 2A5GA 1CZRA 2GLUA 2HWXA 2JH9A 3GJSA 5HIJA 5KMGB 2FPLA 1S02A 3LQFA 4RCZA 3NDBB 1ICIA 1B14A 2QRVB 2YMPA 3V8VA 2FFAA 3A1UA 3TB4A 3DBRB 3M83A 4UAGA 2PKCA 5NLLA 5JDIA 2ZPUA 3ISJA 4Y1EA 2F3TA 3CUWA 1DHTA 3ZLTA 4KLZA 2W2VA 4AN4A 4ZO4A 2CKDA 5LQRA 3U4AA 5KVQA 1HEUA 2PLAA 3AOEC 1ISGA 3SOPA 3VNBA 4Q1EA 2I91A 4NHEA 1FLDA 3QFRA 1YL7A 5I7WA 1DQYA 1CJKC 1X8KA 4L2IB 3DKRA 5I9LA 1HE4A 4JD5A 2G4LA 2ZBEA 3AWIA 1WUYA 5KTRA 5AMXA 4C2TA 3R5XA 1U2TA 2J3HA 3B3JA 3HWWA 3V1KA 1NRXA 2Q3MA 4KJXA 5ALDA 3QSGA 2C2HA 1M6EX 1E4YA 3U9TA 3F5FA 1YD7A 2HY7A 2QTCA 4KRFA 1RZVA 2AE1A 4I9NA 5CMLA 1Z4PX 4DQVA 3UYKA 5MGNA 1ST2A 4LX0A 3KJGA 1U7WA 2YXBA 4X3PA 3RFXA 4JA0A 4HJRA 3N05A 5D85A 5H3CA 1QC5B 4MV1A 4EG6A 5HDBB 5AM1A 4XD2A 3FD8A 1UFVA 2KB0A 3LUDA 1YR3A 3B85A 3GZNB 4RZXA 1SIWA 4K9LA 1Y9EA 3OO0A 5EPOA 3R20A 1P33A 4GX0A 1KZYC 4Y98A 3AI3A 4Y2JA 1JYFA 1JZSA 5CM9C 4J07A 2OXIA 1BWSA 3T9BA 1ZCZA 2YFHA 3QUTA 4LHXA 3ADBA 2R6GA 2W6ID 1PWHA 2VSXA 3BVPA 1KY2A 1B3BA 1KDPA 3I04M 3QNWA 4ZOBA 5DBGA 5LBUA 4J94A 4LVUA 5T4EA 1LD3A 5IT4A 4UOZA 5A1JA 5GWXA 1GA4A 1QE3A 1QSGA 2O6HA 3LCRA 4U2FA 4ENWA 3PUZA 2VDVE 1PGNA 5IJWA 5FL3A 1RXWA 4JU9A 1HEYA 2P67A 2PX2A 4YONB 3DZIA 5TQ2B 3KTOA 1ZHOA 4MLDA 3DXZA 5CK5A 3BJRA 3UPDA 3HRKA 3NHBA 1EFKA 3QOFA 3EBPA 5K3FA 5FXMA 2J1LA 2I22A 2Y68A 1U8EA 1T4BA 2NNWB 3K0HA 3PLRA 1KBZA 1KSFX 1YK1A 3VC7A 3FCEA 4QIHA 4NMWA 4D9GA 1JVSA 4JVOA 1TMYA 1Q7BA 5AHXA 4D5GA 1SU4A 1LDNA 3D2BA 3E8SA 2GDZA 3CRZA 4LE2A 1PL8A 4PBSA 3SDSA 1VGQA 4C4YA 5BUCA 3D8UA 1LRLA 1NLFA 3CE6A 1JPUA 5U4XA 3K0AA 3I34X 4RQTA 5CDFE 3I9JA 1MAVA 1CFZA 1AA9A 5HVNA 3U4MA 3WYAA 2H1RA 2CDBA 2BTQA 3ZLJA 1LFDB 2J7PD 3VYVA 1AMNA 5E95A 3HN6A 3OCXA 3ZGOA 3EZYA 1RJ9A 5U4QA 1ISHA 1WXFA 2RAPA 3G2NA 2QVLA 4GYWA 1VMDA 1P2UA 5H9VA 4L1KA 1GV1A 2PUHA 4KMSA 1V1RB 1SAYA 3G8DA 4R4JA 3I6YA 5BOSA 2WKWA 1T34A 5KUTA 3HCPA 1CYDA 1XLTA 4Y6SA 1P9RA 4YROA 3C98A 1YVRA 1C9EA 2PBZA 2V6MA 4FGLA 4RZQA 3STHA 1CDEA 3BF8A 2Z56A 4JYCA 4UFNA 3MCZA 3OESA 4Z9YA 4XDZA 1E2EA 1SD1A 4MTLA 3ZXXA 1EBFA 3HCBA 4LECA 3PYXA 3T9FA 5JS8A 3RVNA 5LL6P 1W7AA 5ALQA 4PX3A 1NM5A 1QIMA 3N74A 4FR5A 4QT0A 5KYVA 5C7LO 2AD1A 2QP4A 4BJHB 1PDWA 4JC5A 1YHZA 4D2IA 3LUGA 3I9OA 3NQ41 4PYOA 4XM2A 4E46A 1DUVG 3V4PB 1N9KA 2XECA 1CY1A 4XX0A 3OF2A 1GUYA 5IARA 1R5BA 2B8NA 3F74A 3GEHA 1RJFA 4RK1A 1VJTA 4YUXA 3A1SA 3QKSA 1SBNE 2RFLA 2GBLC 3IEMA 1MU0A 4UCXA 2R0QC 1QQBA 4Z7NB 4ZN6A 4JP8A 4XJTA 1HE5A 1XQ6A 1O6ZA 1VHJA 2GD6A 2GAIA 4QL3A 4KK3A 1OC4A 2OHOA 2VPPA 1N6KA 1E9CA 2FZKA 2YWCA 2W6MA 2J07A 3WKDA 4NZNA 4O8CA 4PXAA 2G72A 4OQMA 2JZCA 3GG9A 2YWBA 5GVSA 5EZQA 3ZV7A 1FFCA 2QNIA 1E64A 2HMWA 3DHWC 3MMXA 4GO1A 4XDYA 3TUIC 5B5SA 3OJCA 4RKRA 4BKRA 4F96A 3T7RA 3PQDA 1QG0A 1NIJA 4URFA 1JWBB 2Q3EA 2W2LA 5DM2A 5F23A 3W0LB 4TMKA 9ATCA 1KKUA 2C4HA 4J90A 3JTEA 3O7MA 4NMMA 2KLHA 2VZLA 3N8KA 3MOIA 3OKCA 2IX3A 2EJBA 4DYHA 3VPCA 3AFHA 2HNKA 3N9IA 4IGAA 1CJCA 1ZLXA 4Y2RA 4DIDA 2FJPA 1OC2A 4YDRA 2QEQA 1J1IA 1RYBA 3BL6A 1OZFA 1PLLA 3KNZA 4JBGA 3QX9A 2X2FA 2YASA 4V0KA 4NG5A 1XZQA 4LXHA 4TTVA 4G81A 3Q6NA 2KLBA 4N7MA 1GKLA 1L7XA 1N7HA 3T34A 2ZYRA 2O8BB 2F1JA 2PRJA 3SDBA 2Z95A 1DL5A 1OBFO 2BJHA 4TRMA 2J9XB 4HEQA 5K8CA 3KQNA 1VPWA 1HX7A 4LQCA 2RHBA 3NBMA 4ETWA 3X1XA 4B9AA 1CRPA 3ILYA 3OZUA 4EB6A 1N5IA 3PICA 4RSRA 1XTZA 3ZH2A 2AEMA 5JBQA 3O95A 2VDRB 3HM2A 1RJDA 1XJWA 3C6YA 5LLTA 3L49A 1U8AA 1XTBA 2IZOA 3EC1A 2JGEA 4KAFA 4DV1B 2J0QA 1L7MA 1VJGA 3O0DA 1ZC4A 3D2CA 4LXGA 4B71A 4EYGA 5FNZA 5DJ5A 3QVJA 1K0FA 4IXMA 3GLUA 3WMXA 4IS3A 4J9UE 2F3RA 5EC8A 1YACA 5A3RA 4EKNB 3T3GA 3W9BA 1GGJA 4LYGA 2YC2C 2XXAA 4RV4A 4WACA 1BVUA 2H59A 1N6LA 2OVBA 3INGA 1JJ7A 2A3RA 3G9QA 5ICMA 3SYNA 1JR2A 1J7JA 2GRJA 3VX4A 3DLHA 4GKKB 1LWOA 4W99A 3ITDA 2CHFA 3NHYA 4ICIA 5FLKA 4EAQA 4P6VF 2HQ1A 1XQXA 4JJ8A 2J59A 1UBKS 3PDHA 4HBGA 3DQPA 2J6BA 3EVFA 3MOSA 2B4YA 2P9CA 4F2DA 1TJYA 2ZAMA 4DPLA 4QUIA 1Q11A 1K66A 1A4IA 2DQ4A 3PFWO 4MV6A 3WLHA 3JVVA 1W2WB 2A78A 2DT8A 3GFOA 1DRKA 4XJVA 4IX9A 3EX7C 5MHTA 2VCEA 1ZVVA 3VSEA 3BG5A 2A5FA 3JZAA 3PXXA 5DTIA 5F12A 1IYZA 1F12A 2GLTA 2WU1A 3N2IA 3W2TA 4H1WA 3DCJA 3IAFA 1CUWA 3UHJA 2JLZA 4ENVA 5ADUS 2XBUA 1N6IA 1V8ZA 3B20A 3PPIA 1DCFA 1LV7A 1U2DA 2HQRA 2GX6A 3KSMA 3P52A 1Q91A 2Y9PB 1EE2A 1Z33A 1P0QA 2D0OB 4A36A 3IDOA 3QUAA 1T0HB 2PZGA 1PLKA 1BE8A 2IHNA 1UKAA 4PZPA 3T4XA 3O2NA 2QXTA 3L7YA 4IMIB 2ETXA 4XASA 1IULA 1ZEMA 3GLHE 3DEFA 3DZGA 3S5UA 1V47A 4FILA 3VO2A 1C8LA 1WABA 4QQ8A 4N18A 3NC1C 4MS4B 2ACVA 3A1CA 2VDOB 3JCZA 1P73A 4IXWA 5EESA 3WWZA 3HLYA 1FPMA 2EERA 4XEHA 3T95A 4EHHA 2FLWA 2BR4A 1GCOA 4B3JA 1C1HA 4FYMA 4QYWA 5AVKA 2XMSA 2X8BA 5HQTA 2NZVG 5JDIC 2G8NA 4GPBA 3SR4A 4YRQA 2XIJA 3SHOA 4Q03A 3KKQA 2ZRKA 3D3JA 3N0XA 1TZ2A 2ZE8A 4CM7A 2F1KA 2AUTA 2ZTLA 2VUSA 5SYNA 2V6BA 3H1BA 3LUBA 2E89A 5HF8A 3DCIA 2DTEA 3D8BA 1J9EA 4FKMA 4FQ7A 2VRNA 3DOFA 3HKDA 1MRSA 1U0EA 3GNQA 3FNBA 3EN0A 3L0BA 1SCIA 1NOKA 2C8VA 3WSWA 4ONEA 4TL8A 1RKQA 2ZRLA 3GLFE 4CEJA 4TX1A 3REGA 3AILA 5HP4A 4DFDA 3X43A 2IF0A 4G5OA 3LLSA 2ARKA 3DQZA 5DXFA 2NXEA 3ILVA 4BMDA 4X61A 3VQTA 2QHXA 2REQB 4DV0B 3Q87B 1VJ0A 5C4IA 3KWMA 1FS5A 4JX8A 2OYCA 4E5DA 2GDJA 2HMUA 3M6WA 3WYBA 1EWQA 4AMYA 1R5OA 4LYFA 1J5EB 4MHSA 3ZZ0A 1P9WA 1DNPA 4OHMA 3LRTA 2DT5A 4OYHA 5G40A 1SBQA 3O3NB 3IEPA 4EZIA 5AJHA 1EPUA 5GV8A 1OGJA 1E3SA 4EMSA 5F51A 2F3UA 2EFGA 4OGWA 1CTQA 2EFDB 3NLLA 1E2FA 3U4DA 1LBSA 1MGOA 4IRXA 621PA 2CXXA 16PKA 1AN9A 4BEBA 1FTYA 3OQIA 1HO3A 4A2CA 1VGVA 4OMCA 5L53A 1JHDA 1SMKA 2WF8A 1X9IA 5IK2A 2D8MA 4D4LA 4K9PA 1DQRA 4DSUA 4R2KA 1RPAA 5G1NA 3CWCA 3ZHVA 5H02A 2IH5A 5FOSA 2XUGA 4ZAFA 3GDHA 4MA0A 1M3SA 2P90A 5EWLB 3IPRA 3F4KA 2HSGA 4YCLA 1SY7A 3Q7SA 4JYMA 2C42A 4BLRA 2OYSA 2ZB3A 4HDSA 2AJLI 3L6RA 2BBOA 4M89A 4GGOA 4NJMB 1KFBB 1E1CA 1QRTA 2I87A 4OV6B 2NQ8A 4P5EA 2QTBA 4KDCA 1UC9A 2VR1A 2PZMA 4J4BA 1SU6A 1VL8A 3DXFA 1XQYA 1ZMOA 2QT1A 5GJWC 4U7GA 3R3WA 2OBYA 3CTMA 3PYLA 1J5PA 3HWX1 1AVTA 3PQ2A 5JCOC 3H8SA 3CRVA 4KIWA 5DEIA 5E2AA 2BPOA 5TARA 2HU8A 2IHBA 4UTOA 3K9CA 1G18A 2HDHA 3L0PA 4HAYA 3LWNA 8LDHA 2IP2A 4RQAA 1DC5A 1KI6B 4RETA 3TVTA 1N6PA 1GAXA 2Q4DA 3EARA 4EEXA 5CXXA 5GMOA 5AVSA 3DMTA 1FNDA 2A1UB 4EPWA 5LC1A 2QJWA 4OI4A 4OA8A 5AXDA 1JWAB 3E9QA 5EPEA 4RMIA 4F1KA 1ENOA 1MXHA 3R3YA 4IEFB 1L5HB 1YUBA 3ADPA 3FJOA 3IB3A 4U3JB 1E3JA 3OLCX 3HDYA 4KGDA 3TXAA 4CQMD 2FZLA 1ECLA 5GGXA 4OXNA 1NDQA 2CVZA 1YBAA 3GNSA 3GOQA 1SBYA 2Z6VA 3O4VA 4TTSA 5K6TA 2YJ3A 2HGSA 2JFYA 4KMOA 3AVPA 4DSTA 1QIGA 2B1IA 3LUJA 4PG6A 5B6PA 4DC0A 1W6UA 2XCTB 4RK6A 1JFFB 4G0ZA 2X8LA 2JCBA 3V1UA 1V9SA 4MA4A 1NKTA 3TDMA 3KQQA 4WOCA 1G20B 1G63A 1TF7A 3SM9A 5M2QA 2PEZA 4M1SA 4GYYA 1ZCBA 3DDOA 1RBYA 2A4MA 3CLRD 1SCAA 3IPAA 4ND7A 4Q3BA 2CD9A 3P9ZA 2RGDA 3QYPA 4J1QA 3FDIA 3PGJA 3H4MA 3PD0A 5AJYA 2Q6OA 4QG7A 2BELA 5B36A 2VDQB 3IQEA 4PLVA 4Y2UA 3K0SA 2AQHA 3FPHA 2CLFB 2IV2X 5ES4B 1LDBA 3JQ8A 3QVVA 4AF7A 1XMXA 3QGMA 3TXXA 7ABPA 5CT4A 1T1IA 3QA9A 1RI5A 4HLNA 4MWGA 1H4SA 1XQ9A 3COVA 3QXJA 3E58A 3K70B 4JUDX 1VIMA 3T0GA 3FZQA 3RS3A 4BKUA 1GPH1 4Q1VA 5E1DA 5BWCA 2ZKIA 3LUHA 2OP1A 3QW4B 2QN3A 2QVBA 1BXRB 5C18A 1X7ZB 4Q1BA 4L22A 1CY4A 2A5JA 1A95A 3OLYA 4X6LA 4QBFA 3D9QX 3WLEA 3BYZA 3WQHA 4S05A 3TDKA 4AF8A 4BTEA 2V7EA 4DB2A 2JFFA 5EZSA 3M8KA 3SR0A 1H66A 2GCOB 1U3WA 1RAAA 4Z0TA 4AMGA 2FA9A 4ECAA 2XUOA 2C3YA 2IH4A 3MK31 3IQGX 4EDFA 4U2KA 3RSGA 3L6EA 5KTYA 1D7OA 1YMQA 3R7WB 3WICA 4X24A 4I50F 3DTVD 1P2VA 4J4TA 1E4OA 1R9JA 1US8B 2AR9A 2IYZA 2ZSDA 4FYVA 3KC2A 4PLHA 3UN1A 1O95D 2Y05A 4XD7A 4QOGA 2R5FA 3SR3A 1FFYA 2AOTB 1K75A 2NZWA 1N77A 1OYWA 3ZLUA 3CCFA 4LXIA 3AJ9A 3IBSA 4G5HA 4PC2A 2Q0QA 3TLGB 2VQEB 3DTTA 5C52B 2EKLA 1FRZA 2E7ZA 5DCYA 4KI7A 4ATNA 1YB2A 1Y8QA 2EP7A 3MNFA 5BWMA 3O8RA 1Z0IA 2FF7A 3JTMA 1ZVJA 3W06A 4BO6A 5ELMA 3L7MA 4CKCB 5EEGA 4M46A 4C78A 2POQX 1B6SA 2F7SA 4PV7A 3WTCA 4AJNA 4QO8A 4GICA 3SC4A 1ISRA 3DBHA 1OB2A 3Q5EA 2Y66A 5LQJA 4ZTBA 4ETIA 1RLTA 3FDJA 3KQKA 1DFIA 4B82A 2C3PA 3NHAA 5GJBA 1UMBB 4W82A 2VDWA 1YMVA 3P9QA 3BJEA 1W48A 3ZEIA 6ABPA 3CLRC 2J85A 3P32A 4FFBB 3WLMA 2IYUA 5F73A 3AZQA 4FMPA 3A4TA 3PLNA 1HLGA 1SIOA 1OJ7A 1PFWA 5EZ5A 5L6LB 1PT6A 3HKBA 4G63A 3U56A 5A5EA 2O5RA 2QVCA 4MW6A 1BSVA 4AS3A 3BCRA 3MWYW 1EH5A 2OCGA 3A6HA 3NNNA 1TT5B 2BV3A 2NZUG 5AVXA 2QRPA 1G5PA 1NTRA 1UJMA 4WNYA 3F8TA 2XOXA 1ETHA 1JUDA 4OB8A 4F2GA 4AN0A 2ZJ0A 4BX0A 4GQIA 4KDRA 3W77A 4PAQA 2UYOA 5A6SA 1CRWG 2AEFA 3VPGA 2V9CA 1FFHA 1QS0A 2I2FA 2VDKB 4RFLA 2ZIGA 4OY3A 4EA6A 2UZIR 2V9PA 3D6FA 1FXSA 2JJ1D 3JWHA 4BX2A 4IXTA 3M6UA 1KARA 4ROTA 3PXGA 3JWPA 5EUQB 2IYWA 1ORVA 4JMLA 4N3BA 3W4IA 4L6AA 4BLPA 1VMAA 4C6RA 5CBPB 3GLIB 3HYSA 5EP2A 3I9V6 5KX5A 2R8OA 3H7IA 4UD2A 2ZRFA 3N70A 1QYWA 3G88A 3S1AA 1GQSA 2AOXA 2HD4A 2WRZA 3E7FA 1GPKA 3HVUA 5JISA 2F1RA 1G7RA 1DLIA 4QNRA 1RHUA 3TQQA 3ZN2A 3TO5A 1GNRA 4Z1OA 3RUAA 3BL8A 1X7YB 1PNRA 4OLBA 1HE2A 3QFFA 1MEEA 2Q6KA 3MBIA 5DRTA 2JLRA 4HO1X 4BV8A 4NBRA 1F6WA 1X8XA 4DNOA 4F1JA 1NF8A 3VO1A 2JA2A 1VJDA 4RX1A 1O95C 1NONA 2PL3A 4AFNA 1VI6A 5BW4A 1XNGA 3CEAA 3Q4GA 1KEPA 1WXDA 3FX2A 3DVRX 4OHWA 3RRZA 1HT0A 2B8TA 1D6JA 2YWJA 1L4EA 1IQUA 2VZ0A 1RW4A 2WWXA 5D86A 1SZCA 2TS1A 3K73O 4FBMA 4DANA 3IYLW 2HWUA 2KBEA 1H2AS 1P4HA 1T1GA 3MILA 4G1BA 2AK3A 3A6GA 3REQA 1OXUA 3TL3A 3KOUA 4EG1A 3M1AA 3ACBA 5JDCA 2HPZA 3D4BA 4DPKA 3ZK9A 1IBRA 2R3SA 3KXIA 4C4RA 5JNTA 3L7DA 2P7HA 1V16A 2BISA 3LK7A 4EYKA 1EZ1A 2M98A 2CZQA 1HZJA 2BEWA 3UMJA 2F2TA 1U2ZA 4Z7QB 1TI7A 3N7AA 4CQLB 3OOJA 4LYDA 2VJAA 1FS4A 2EF1A 4IGEA 1EVIA 4GL4A 3DBLA 2PGOA 3L0CA 4IOLA 4RV9A 3R74A 2HXGA 2DE0X 3KT8A 1BEUB 2BFOA 5ICSA 4CBVA 1Q15A 3EWNA 4OL9A 5J2TA 2P0EA 3IBYA 3DWEX 4L9SA 2PUFA 4HNGA 3B6IA 4MV0A 1QHHB 2LIPA 4BOYA 3ZNNA 4DADA 3UJBA 2CSUA 3I9KA 2BCEA 1SBZA 1KVUA 2QM0A 4N5IX 3NEYA 3BDVA 2ZQYA 3OIDA 3WJAA 2QSUA 2BBTA 3PK0A 5JCJD 2WHEA 4BIMA 4ZZ0A 5GTDA 5IMSA 5KNCH 4KGVA 3AHHA 2RHDA 1LSJA 1JNXX 5DM0A 3KAKA 1M10A 2XT6A 4DMRA 5A3QA 2BGLA 5E6RA 1ORTA 4ZREA 1AXRA 2QUHA 1J24A 3HKCB 3IJPA 3QU4A 2GN4A 4R8KA 3JS5A 5JV5A 5JO0A 3IIJA 1EG2A 4OP1A 4Q6BA 3EXEB 3OJEA 1C0EA 2QTNA 4HAOA 2AWOA 4KAJA 3RU9A 2FSIA 4KBYA 4MB0A 3TTUA 5E7MA 4I0WB 2BR5A 5C34B 4C0JA 2O2SA 1G16A 4CUJA 3GV0A 4D3YA 2YNMA 5I7FA 2HV9A 3U61B 4X1YB 4F85A 1R0YA 4YP5A 4LV6A 4MR8A 2HZ7A 4B33A 5DYTA 4B6JA 4FKBA 5KYUA 2Z8ZA 1A1SA 4TVOA 3L2OB 4LJ7A 2BMAA 1ZD8A 3DUFB 1BYIA 1V96A 5BMVA 4OCZA 3U5ZB 3FUUA 1W4LA 3KKLA 4IIVA 1YHYA 1V39A 1Y4ZA 2WB4A 3GZTB 4WNAB 5E7JA 4DG9A 1N34B 2QL6A 4FHGA 4N0DA 5CA1B 2QTGA 3LPAA 4Z51A 1QYDA 2WFLB 1FX0B 3ANYB 2P8SA 1EBUA 3TM5A 2BFDA 3D1VA 4FYPA 2HOQA 4B74A 4K9DA 4PZEA 4Q4CA 4ZOCA 4UHDA 2CSXA 5K05A 1E9EA 1D2CA 1IBCA 4DLBA 1T35A 1X86B 1T0BA 4UD6A 3DJFA 4E15A 3KVOA 2JJ2A 3KJEA 5KPJA 4U9IS 5HF5A 3ACDA 1MVLA 3WGIA 2ZIWB 1TLLA 2XIQA 3FWHA 3STTA 3WGOA 1HSZA 2CJWA 2YVQA 4IIUA 2Q4BA 1NNSA 1FYEA 2X8AA 3EAQA 3L7BA 2RHJA 3MTJA 1R6XA 4MV5A 1USVA 2WSIA 1GD1O 3L8ZA 1X7WA 1N3BA 2AZDA 5KNLA 1K4KA 4NV3A 3DOCA 3VAYA 2BFMA 1G8JA 2NO0A 3GK3A 1M2VA 5C8YA 3ZWBA 3TAUA 3KUDA 3C7KA 1I1OA 2VT2A 4QTYA 2HBQA 1GQQA 4PZUA 4O0LA 2JHGA 3B6JA 3ILXA 1E5LA 1D8TA 4YREA 4IFBA 1IHUA 4LPKA 2NM0A 4JJ4A 5H0IA 4ZZ3A 4IJKA 3K16A 4E21A 1DHRA 4C89A 4HXFB 3QWBA 4HNSA 5AXBA 5J2UA 4MHOA 3SZGA 1B2LA 1OXBB 2WHQA 1OLUA 2FSFA 4X41A 5DTJA 2GK6A 3Q1LA 2RGWA 4MGYR 3DMHA 4N5MA 3WIUA 2X22A 3GA7A 3H6KA 4ZAXA 1UAYA 4ZDKA 2KHZA 3PUWA 4N76A 3FUVA 1G3UA 3JRWA 2WDPA 4WN3A 3IJRA 3L6DA 1TVEA 5EIBD 2JBAA 3FZEA 1EFVA 5TVGA 5EVJA 1BH2A 2O8NA 4L8YA 1V8FA 4V3CA 2XVAA 4YK7A 2P9YA 1SXJB 3TXYA 3WYNA 3WXBA 1WB6A 2BTOA 3ZQUA 3D7RA 4JUFA 1YC5A 1RJEA 3SSOA 3THYB 4OHBA 1UOOA 2J09A 1R0XA 2AB0A 4WKPA 3VOTA 5U9CA 3UFBA 3HC7A 1B4DA 3O8BA 1ZMBA 2W6NA 3CUYA 2J6IA 4N3GA 1TM5E 2RK4A 3DFKA 4NV0A 4AO7A 1RQ2A 2BFFB 1I7NA 3D3NA 3P2MA 1WAMA 1E1DA 3TRHA 2DQSA 1A7KA 2DYKA 2REOA 2VP2A 3A6LA 3HFSA 5FAXA 4AZSA 4C3VA 3T9AA 1T8WA 1E7QA 2GF9A 3AESA 2FEPA 4KW7A 5F5LA 2FB9A 4YV1A 1RFGE 1VP3A 3JYLA 1IPHA 4JVLA 1GGFA 3FTPA 3LSTA 5J47A 2GF0A 4YJ3B 2ZUTA 3GL9A 4WBNB 1XQ1A 3WQBA 4ESOA 3ZD7A 2HA0A 5CXQA 4HNAB 1P80A 3PXCX 5KINB 3H5WA 4J2TA 3KYIB 4LRUA 3ZHXA 1ZRNA 1B41A 3G2QA 3KEFA 5CHEA 1H8HD 3N2ZB 4C30A 3HJCA 1PNQA 3EHDA 2DBQA 3LVQE 2GETA 1RU3A 2PM8A 2XDQB 2AFVA 1TUGA 1GAWA 2AW5A 1I30A 3HJUA 5CEFA 2P4EA 4TWZA 1QHFA 4MW2A 4TS1A 1L7DA 3UWKA 1AKNA 4LGMA 2GA8A 3EC2A 2X9VA 3E27A 3FYTA 3H86A 1IONA 2RBKA 4C2AA 4RVFA 4KTTE 1AGRA 5EMMA 1N8SA 1ZPDA 5LQNA 4ZYWA 2ADFA 4YWHA 3P2YA 4XUEA 3THWB 2MSNA 3LBYA 2BFBA 2LR0A 3WLPA 1PQYA 3BDIA 1C41A 3NJ8A 1PS0A 2EV9A 3FHOA 2FUG1 3ROEA 1X9HA 1ND5A 5JAOA 4ENRA 4EJMA 1H1DA 3HMQA 4J1NA 5JTUA 4JI4B 4ZAVA 2C2GA 1CDDA 2RHLA 2W2NA 4ZZIA 4HB4A 4M8KA 1U6JA 3VZSA 4NY1A 2QT9A 1KH1A 1SCQA 2PS9A 2IIQA 3W7AA 1HMYA 5A5DA 3ZW7A 3A0UA 1VPVA 3K0FB 5JXHA 4LNUA 4P0TA 1G42A 3WYEA 1QKIA 4EY5A 1VMKA 4LF7B 3N8HA 3DEYX 3IAM6 2JFUA 3ZS9A 5EIBC 3TGWA 4AULA 1YCHA 2AN1A 3N0VA 1IJFA 1IHOA 1LQTA 2GZ3A 3B2QA 2VO1A 3KHKA 3NBZC 4JN6B 4JLUA 4X90A 1KSGA 3NM6B 4E5NA 1ZU5A 1XA4A 2CHGA 6GPBA 3DZFA 3NIBA 1DTWA 4XB2A 3SNKA 3T0FA 2R6CA 3T5BA 4ARAA 5ITVA 3ETHA 4UHFA 3AYXB 2ZJ7A 1SVOA 3ZJ5A 4L7VA 4EKDA 3HKEB 3RK4A 4OYYA 4EGAA 5BYBA 4YAKA 1ZJ6A 3SM3A 1Q1ZA 4CL8A 2N0SA 5FNVA 4BLSA 2QPLA 3EGVA 4XGKA 1SCDA 2D0PB 3T94A 3EAGA 4GOXA 4AMVA 5IN4A 2NOAA 2IXEA 2GLXA 3E7WA 3EXG2 3GLTA 4FMCF 4W1QA 2YMQA 1TEXA 3EWIA 3JR3A 1FQWA 1NE2A 3O93A 2ODWA 4LJRA 3U7FB 2TECE 4CCYA 3M34A 3UBMA 4YUVA 2QSYA 4QA9A 3ZEAA 3JY6A 4QYXA 3VDXA 4TWAA 2VT6A 2NWQA 3GH3A 3VA7A 2QG4A 1U9YA 5BYJA 1NU6A 1W5TA 2DWPA 2PS3A 1PTJC 4U4AA 5EKDA 1T0JB 5LBIA 4G8CA 2F43A 2G06A 2R60A 3EE6A 3JQ7A 2IV3A 3Q1KA 3WJ2A 3EH2A 4X64B 6REQB 5JSZB 2AOUB 2EAUA 2JAQA 1GRVA 2ZRNA 4MIEA 2AXNA 2IEIA 4LCJA 2BKUA 3VPDA 1XVLA 4IS2A 1NJ6A 1VBMA 4E09A 2BBWA 1N2OA 5G1PA 2ROQA 1VIDA 3EBLA 3OZEA 4O8ZA 2W8BB 2YN2A 2EZUA 1FXWA 2Y1CA 3FZGA 4IDCA 4M1TA 3P96A 2B3TA 3IV6A 2JCSA 1I0IA 4ZI5A 1B8NA 3DFZA 4XYLA 1K92A 3PGKA 2OCYC 3ERCA 4H3SA 2CD7A 1MW9X 2MMCA 4CN9A 1LLQA 5ADHA 1JKJA 4YXWA 1SB8A 2P2LA 2VNAA 1QONA 1COZA 2Y1EA 3DKIA 2R7NA 1LPOA 1XTPA 3KZ1E 4R0NA 4EJSB 1OSNA 1QNLA 4KP7A 5EJ7A 1XJ0A 4CV3A 2VHVA 3KDAA 5FPHA 2FSPA 5NULA 1EESA 2RMKA 3E3OA 1XZJA 3MPUA 4KXVA 3OAAD 2H4XA 1O94A 3GVHA 4OFBA 5DGHA 3RUIA 4EX6A 4EHLA 4PZDA 3SE0A 3W3AD 2VWQA 3BMOA 4CJXA 4ZT3A 1YA6A 1E0AA 1NUTA 2BFPA 2H5EA 5EQTA 2FPSA 1Z4KA 1L1EA 2HRBA 2P9HA 3O03A 4LY9A 3WV4A 3NHFA 1MO2A 3K94A 2ONYA 1F17A 3H42B 3SIPA 2SBTA 3DEHA 5EXSA 1KQ3A 2VJOA 3EPPA 3I4FA 2XQKA 1I0ZA 5JAHA 1V48A 1WXQA 2G6BA 3RRMA 3EAFA 1RQPA 3AWDA 3U48A 2ZJ8A 2VP9A 3P0RA 2C4KA 1C3XA 2G5GX 1PUIA 5LBTA 4GGMX 4PYMA 2O1WA 2PZFA 4R01A 3D7NA 3VR2A 3W34A 4PS0A 1NL3A 1RQGA 1WCWA 3R7DA 5DNDA 3E1SA 1GKKA 2O2EA 3V2HA 1DJNA 2RH5A 2NUTA 1DWOA 1T36B 1T9BA 4TV8B 3Q8MA 5C5CA 1ODFA 3KX2A 1E1QD 1N2XA 2A9OA 2H1WA 5BSEA 2K7FA 2BSQA 3I1YA 3AUSA 3JASB 4H6WA 4JWTA 4N3NA 4RVSA 3SX4A 5BVHB 5CLJA 5IEBA 1XZEA 2ZUWA 4D92A 1K97A 1SQGA 1Z07A 3AIIA 4FONA 4KMRA 1CS4C 4WE3A 4OSPA 3MLAA 7AT1A 4ZVLA 5CB4A 3T4PA 1KKMA 3OJLA 5KQGA 4RF4A 2F8LA 2HIMA 4J7AA 4F4DA 3HQ4O 2OGWA 1P0PA 2CLDX 2JLSA 2D0DA 1N1EA 3BXGA 1WQ3A 3EIXA 1BZYA 3OFND 4D79A 2W2MA 1UXJA 1K86A 1RACA 2VH5R 2FK7A 1VPLA 3VHRA 3VKGA 3GQBA 5HGXA 2PJDA 4KXXA 1JV2B 1X42A 1PL6A 1KH2A 2OO5C 5CVVA 2WJYA 3UEOA 4CKBA 4EPXA 1J2EA 1NYQA 3A4MA 1DDGA 3GLRA 3GEIA 4PCAA 3KTAB 4L75A 2QBYB 1DE0A 1YU6A 4NK5A 4JLJA 4QFBA 1T4DA 4PAMA 2HRDA 3ZCTA 3NT4A 1E6LA 1H2XA 1RAHA 4KU4A 4HDKA 4L4ZA 2ZYVX 4KQ1A 3WBBA 4TMVA 3SPXA 1R12A 1PR6A 1YE3A 3PQ5A 1R66A 4A0FA 4G1MB 3F5MA 4RVDA 3ZCPA 1D0VA 4PWYA 5DSXA 4MJ7A 2QIPA 3EVNA 3G17A 4GMXA 1DIAA 3O5AA 2HA3A 3GAAA 3AG6A 1XCPA 3IPYA 2F9MA 4KV7A 4IMRA 2I55A 3KJNA 4EA9A 4AZ0B 5CLFA 3UJ8A 3EEOA 5BQPA 2ZJ4A 3EJ6A 1OA1A 1TYBE 1K7XB 2R6HA 1MLDA 2QMQA 1FP7A 3G0GA 3ME5A 1E1RD 2V5UA 3DR5A 4D56A 1QTIA 1Z4LA 3FNRA 3R23A 5ALXA 4OQLA 3R8CA 4DR6B 1GYRA 2IVZA 4HN9A 4YA6A 4CMEA 1RWPA 3VKUA 5JQWA 3GFSA 3WX0A 1EGVB 2O7VA 4LVNA 5EE1A 4N5DA 3VU0A 1Q1GA 2OHHA 3UJHA 4E5PA 3KSBC 2W2TA 1SD5A 3RFCA 3WWDA 4IDQA 2CXSA 1JU3A 2EHDA 2UUCB 3I5YA 3JZFA 1XZGA 1IY2A 1FFGA 4FI3C 3BMXA 2ZIXB 4HNRA 4UUBA 2B2XA 3VYTB 2O8CB 2J6CA 1UBMS 1MJ5A 2ZJAA 5FLYA 4AU1A 3BXHA 2XE8A 4Y2QA 4D6XA 2NP6A 2JFWA 1YB5A 3P5SA 3LZ6A 1N5KA 1Q1BA 1M76A 4TKVA 5AKJA 4IHAA 2DFDA 1RPJA 3IODA 4AZ3A 4Z3DA 5DHSA 3GLQA 4ND8B 1A2BA 521PA 4G89A 2H18A 2J0UA 3CM0A 3I2GA 4Q4AA 3I39X 2GERA 4H0CA 4KQIA 4W8OA 5FULA 1K7SN 3SF8A 2OE2A 1JI3A 4XJSA 3TNFA 2YKGA 1UM9A 2XLCA 3B2EA 1NBEA 4HYTA 3UO8B 1QGAA 2YTZA 4JL8A 2CWDA 5LQKA 1EVKA 3GYBA 4L8VA 1T3HA 1IXZA 5B37A 3OICA 1KMCA 4BO1A 4DNFA 3HL4A 1AY0A 1ZRMA 1QFXA 1W85A 1FLNA 2Z04A 2ZBVA 4GVPA 4OBWA 4NABA 2GA9A 5GOZA 4MEAA 3TD9A 1G19A 3NTVA 1GFIA 4EB0A 3TNJA 4NIMA 2UVPA 1GGMA 3BERA 3KR2A 3CR8A 4F5WA 2UUBB 5CVTA 2FV8A 1Y89A 4W6ZA 2Q0HA 1NW5A 2AMYA 4GPEA 1J0AA 3O1IC 3U7EB 2V58A 1UPBA 1FUEA 4RGBA 1C4OA 5JZMA 3OBBA 2ERCA 3TINA 2C58A 1ZI9A 3AEYA 4DDVA 1WJGA 3N0TA 4NEQA 1G59A 4EF5A 1QANA 1PV1A 5BSMA 1G1MA 1XZFA 2FUEA 1SG0A 4XQ9A 4IGFA 3CJTA 3GFVA 1I1NA 2MT9A 3AL3A 3D4OA 4JAVC 4BFXA 2XB6A 3SSAA 5KOIA 1JILA 2YVUA 121PA 3EXHC 3ZJTA 4TZTA 3MAGA 3EGOA 2IHTA 3OLZA 1NT4A 4ZI7A 1ZO8A 1EZZA 1NVTA 1W96A 4BNJA 3UJ3X 4B3RB 5B57C 4MR9A 5DH9A 1XTIA 3BKXA 3GPIA 1OWPA 4ZOAA 1TRKA 2L17A 2Q8PA 5HM8A 5GIPE 2P40A 2VTBB 3QMMA 4A6PA 2A5DA 1W4RA 3LC0A 4J49A 1Z28A 2E55A 1ZEJA 2FFJA 2NT4A 2VPTA 2OLKA 3FA2A 3SEQA 1RDFA 3WQRA 4E5MA 2Y67A 4K9MA 2ST1A 1Z2AA 5TSDA 3VR6D 2C9YA 1AKTA 1R4MB 4R31A 5CA1F 1GCGA 1DFHA 1Z08A 5EJFA 3V1NA 5KTKA 2HZBA 2ORIA 1SUEA 2X5KO 2IITA 3ZYZA 4YHHB 2C2MA 2XF8A 1ADJA 3CH5A 2XMRA 4KH0A 2AFHB 4FXOA 3A2MA 4DF3A 1VZ3A 4R1LA 1DAFA 5FOTA 4DS3A 3OPYB 3FOZA 1GILA 4PLWA 1YJBA 1M6HA 1KYYA 2PH1A 3OMLA 3IR6A 4P22A 4M0KA 3E9RA 3JVEA 4M99A 2X8JA 3HBLA 1L7NA 1KJIA 3HYRA 1GPBA 4MUBA 1P2GA 1N78A 1X0XA 1QGUA 3C39A 3CB2A 4FEEA 5I3CA 4AO8A 4AQ7A 3LC7O 5BT8A 2RARA 1TQHA 3IUYA 1PG2A 2X1LA 1QHEA 1TAHA 3C8HA 3ZDBA 4KXYA 4BEWA 4EG7A 1ZVKA 4O25A 4RS4A 5ECWA 1CK4A 1GT91 3WGQA 1JQAA 4MNTA 1F1BA 5B3JA 4UJ5A 1TCCA 2C7BA 3L1IA 4F3RA 1XTVA 2ZIZA 4D4GA 3AK4A 2QPOA 2RGNA 4OLAA 2LIVA 4NZOA 4PRYA 1AF7A 1ZM4A 4UNNA 2H4JA 4C76A 1COWD 5EIHA 3H5OA 1USWA 4HK4A 1E3QA 4JUBA 3ASYA 3L4SO 3IMFA 1E79A 3T4UA 3X1ZA 4TROA 1G2PA 1MEOA 5HQJA 3U4CA 1JW9B 1R6AA 1ZRSA 2Z9DA 1DO2A 4GMDA 4WA8A 3V3KA 4O59O 3VPFA 1TT7A 4BQNA 2XF2A 4EFMA 3B70A 2W37A 2JPDA 4DA8A 1N6HA 3F90A 4HQ0A 3LP5A 5IHXA 2M6SA 1U99A 4K40A 3BD9A 4BB5A 5C7OO 2PPVA 5FX2A 6AT1A 2AX3A 5GINE 4C0QC 1Z45A 3L07A 4WH0A 3GA5A 1SVUA 3D6AA 5KNDD 4F93B 4ZEMA 2MIIA 4K0RA 2WV7A 4HWGA 3TM4A 4QLBA 1Q14A 4LV8B 3THOA 3FM9A 3K1TA 3NWEA 4DMFA 1U6KA 2P35A 1DBRA 2XEDA 4HXEB 4ZVTA 3U26A 5JD4A 1UZNA 2VJMA 1U1EA 1EDBA 4MYSA 5DYIA 1PW5A 1Z4OA 3U1VA 2AEJA 1C0LA 1BX3A 3GRPA 2IV7A 4H7IA 1XQVA 4DCOA 3AU8A 3CE9A 2PUTA 3UMBA 3AKZA 3KJIA 3O2QB 4OFXA 2I76A 3GPDG 1T2NA 4NCJA 1QZZA 4DQUA 2EZ4A 1XDGA 4XCQA 3BX1A 1R0BA 3TFQA 1J99A 1S8AA 3RYCB 5LP6A 2H7VA 3IT0A 2ZS8A 3ANLA 4PBRA 1SEPA 2XGGA 3OZSA 4HDCA 3WRYA 3IVCA 1PBNA 3O9MA 3ODGA 3F5DA 1J2UA 4WCFB 1CVIA 1WM1A 3CNLA 2WVGA 5BQ5A 2JA1A 3RODA 1IM8A 1EWRA 1PWXA 3EWAA 3RM3A 1YFLA 2J0VA 1M33A 3LBNA 4G4IA 4P36A 2B1QA 3JQDA 3UAXA 5HE8A 2H1IA 4HS4A 5ETJA 3NHMA 3LOUA 4QREA 3CR7A 2J5BA 5DNAA 2YFKA 1GZ4A 4PM4A 5LU9A 5I47A 3G2MA 4IHJB 1KF0A 4I4LA 5DIFA 1OAKA 3RJ9A 1W8DA 1WZNA 4YQFA 3C8MA 2EQ5A 2FDXA 3D7SA 3RCBA 3TLAA 1J0DA 3GGCA 4OP3A 1BRMA 3QWAA 4ZK6A 1DWUA 2CHVA 4DMCA 3SSNA 2Z5GA 1KSHA 1KS2A 1UUFA 3TE7A 2X7XA 4AZTA 5L3RA 1Q7CA 2XNKA 4FDAA 3DP9A 3K4PA 3VDMA 2ZBGA 3O8OB 2D00A 2B8JA 4MGKR 4MWSA 5H70A 1GNTA 1SWVA 3AFIA 5CNMA 4WUTA 3TW6A 3R7LA 4BGUA 2C9ZA 5LP1A 3CVXA 2MSKA 2ENWA 4GM1A 4L8FA 1RVDA 4WK0B 3UAGA 4AX4A 4BO4A 2JLXA 1MJHA 4NVRA 1B2RA 3AF1A 1NFFA 1EK1A 1O58A 2BEVA 4RY0A 2NTEA 5BUZA 3HLKA 3E2PA 4K28A 3EPHA 3BJZA 5IAKA 1WD5A 1LDEA 3MD9A 4PONA 3BT7A 1UINA 3LDHA 5E1OA 2OGTA 3ADCA 3M3PA 4GL2A 1AGNA 4Q48A 1DJLA 2PR2A 3F46A 2X6TA 1K5PA 3GVIA 2W43A 1MVNA 3FMFA 3KKOA 4HQLA 4MUJA 1V4NA 4XTRA 4YJHB 4A5OA 5C8YF 5F9MA 3PUIA 4ZDWA 4V0RA 5CT6A 2I9KA 1Y3AA 2OLEA 2Y0EA 4MVJA 2WTUA 2VYVA 3O83A 1OYOA 3AOGA 1Q20A 3EEFA 2ZKLA 5DNCA 1N3YA 2K7ZA 3IHKA 4KQKA 5LQUA 4CV1A 3AX6A 3G85A 1UC8A 2P9GA 3QVGB 5D5HA 5FPSA 4DLPA 4KWCA 1A5BB 1I5EA 3I8OA 4ALLA 3JYHA 4IGIA 3MJFA 3SK0A 3FPBA 5BWOA 4PF1A 2LW7A 1GG9A 2CLEB 6Q21A 3CEHA 3V8QA 2Q0SA 4GR9A 4FFRA 4K03A 1YKSA 1AB6A 3QUBA 3UJ9A 1SKYB 2FCAA 5F1KA 3LUCA 1L5FA 4KKVA 3B7GA 1D2EA 1ZN7A 5EGNA 5C5DA 2CBGA 5L3QA 4RA9A 4F06A 3OSUA 1U0TA 3C41J 1E3WB 3FTEA 5AK5A 4F72A 4GMGA 2PMBA 2NU6A 3LKVA 2P2CA 2WU4A 3ZNPA 1IN4A 1GYPA 4BO0A 5I7HA 1XMQB 2HF7A 4NYIR 1OBCA 2REXB 4L27A 1SHJA 2WKSA 2PKRA 1U1GA 2FN7A 2FFHA 1E3MA 5FUXA 1Z0FA 4W5JA 4DJ5X 2FRVA 1OD6A 3H2JA 3PGLA 2I65A 1AKQA 3MTBA 5EIEA 4I9HA 1NYRA 2C2KA 3MPOA 1BDJA 3RSQA 1KK3A 4DUGD 4DDUA 5AICA 1GA6A 3A1NA 2E1RA 2LTAA 1EK6A 5P21A 1MPXA 3NTOA 1CIPA 1ZI6A 3L7CA 4MZDA 1ZVMA 3TIXB 4D9KA 1VL0A 1DTSA 3OZCA 4V0MA 3GCZA 1HWYA 4P33A 1T4CB 4Y18A 5JVDB 2LRHA 5KHOC 3GLGA 3AGPA 3B1JA 4IUCS 3SNHA 3HDHA 2OTCA 4WN9B 3LUFA 3AUYA 3P4UA 1Z7YA 1Q0UA 1TVKB 2C54A 2GNOA 4LS3A 3MWKA 3VVLA 1HYHA 1ZGGA 4CIXA 3CUTA 4IDFA 1M1XB 1ML4A 3G0BA 4F6RB 1ZCAA 5EZYB 1OBOA 3RS8A 2X4IA 3PJFA 2PLWA 4PGAA 5E9QA 4NJOA 3VDNB 4OJNA 3VU1A 3ZU4A 3I8XA 2C98A 2FG5A 1FDWA 1VRWA 3WDMA 4DL9A 4AG6A 5J3JA 1QM5A 3AL2A 1XNJA 2AN9A 5AK3A 1B0AA 1H2YA 1SCUA 4CLDA 3D0OA 4X7RA 4GZ5A 1H4QA 1Y9ZA 1Z15A 3GDFA 4C5CA 1EUDA 4QWWA 1Z5WA 5IKOA 4CIAA 1U98A 3D0KA 4GE0A 4TV8F 3VYWA 4CKEB 2R48A 1THZA 3H5LA 3QEMB 4LYYA 4OJTA 3VI3B 4Q7LA 3E9NA 2C84A 1U4OA 3HEAA 1J9ZA 4QXPA 3T1TA 1C9NA 2VHZA 1HG0A 1IAVA 1QGYA 4HRAA 5KTMA 5BQOA 1WEKA 4J16A 2YXNA 3KQTA 4BWFB 3QX3A 4MW1A 2GKSA 1E96A 2NTNA 4Q00A 4LK3A 5KO2A 1GUFA 1FP4A 4DC9A 2RK6A 3WFZA 4JFRA 2NZYA 4CDMA 1ENPA 4LFBB 1D5WA 2C92A 3HBJA 5CAEB 1C9JA 2WWFA 1N7JA 3QBDA 1LDMA 2BP7A 2HI0A 2LD4A 4BAZA 4NCHA 4TMXA 5K0NA 3VKWA 3A2NA 4CN8A 1ZK1A 2V7BA 3KSAC 3QIAA 1NW3A 2X9QA 3AJEA 2ODBA 1XZCA 2CDRA 2INGX 4JJKA 3DZHA 3L04A 2W83A 4U7WA 5BYKA 3S28A 1FVXA 4IUYA 2HGZA 3PEEA 5B6JA 3OIFA 3LK6A 3KTDA 4W63A 5DW0A 1RHJA 2NPFA 2F8TA 2Q2QA 5CVDA 1I0LA 3SQMA 1NN0A 3KCNA 5B12A 1B1AA 1IL0A 3RS2A 4W5TA 1JHYA 3RUDA 1E9BA 1DAMA 4FZ3A 1PS9A 1J0BA 2ZU6A 2X23A 1LRKA 3H99A 3NIGB 4HQOA 3RBZA 3TDNA 3STYA 3CN9A 3KD2A 4BWVA 1QGDA 3WGTA 3TLEA 3DE7X 1V1MB 3E48A 3LAWA 1JDPA 2O2JA 3NTQA 3O31A 3P9PA 4RNDB 3TIIA 3V9AA 3VPAA 2ID4A 1UPFA 2RGEA 4V0LA 3Q7RA 4PNPA 1DQPA 3WRWA 5BN4A 3QWFA 1OFTA 2P2YA 5JNWA 1ZM2A 1Z4NA 2VHYA 3QELB 1CQWA 3WFIA 1EKXA 3CNNA 1H8EA 2PL5A 3BRSA 3IUJA 3M6MD 4BJ6A 3ZXIA 4JQCA 1CS0A 4HN2A 3RABA 4A26A 1CEQA 2C2ZA 2IU3A 2QP9X 2Q1YA 5D3MA 5TPZD 1Y4AE 3C5VA 2CXQA 4C0XA 3EDCA 3FHTA 5IVPA 1O4WA 2BE9A 3FLMA 1CZNA 1PP4A 4X0EA 1XBTA 3PX2A 2IEBA 1GHTA 1ZN2A 3DE4X 1NAHA 3E7PA 3ET5A 3GUZA 1AHNA 3OU2A 5K3AA 4QYTA 2OCAA 5I9IA 2O8FB 2VHTA 2C5EA 2D4HA 4MW0A 2MR6A 4ER6A 4NYIQ 3IKJA 2PKQP 4G5YA 4HTFB 4BJ5A 3EEQA 5CVEA 5EOVA 1QPBA 4TUYB 4ALNA 3CZAA 5J9FA 5E1MA 3S99A 3B6ZA 4X1IA 4KO3S 4M6WA 2CFCA 4LFCB 2VVTA 3UM9A 5AK0A 1YRLA 4Z5XA 1E58A 1IG3A 3K35A 3R0IA 4DSAA 3PNKA 4YCDA 3EUWA 4JSRA 3F5QA 1H65A 2F59A 4M98A 5DBHX 4YAJA 5DM1A 1FMCA 1KERA 4FNAA 1S01A 4GXNA 1A82A 4NE2A 2JFQA 1FZTA 1Y3IA 4UEKA 1U7HA 3GFQA 1NPYA 2ONJA 5JI2E 5AKYA 3X1KA 2VJCA 1XU4A 5AXCA 3RIYA 2O20A 3PHHA 1SQ5A 1XKLA 4QXOA 4W1RA 1UZUA 4GPD1 3BL5A 2CLKB 4J7UA 2KJQA 2AVDA 3F2VA 3B3QA 4NCIA 5HMLA 4EABA 4P0PB 5K3FB 1TIBA 1XVVA 1E0JA 2IJGX 1DCMA 1JPNA 5FH9A 1YRWA 3TRFA 1WTCA 2GBLA 4RCYA 3SXPA 1OLSA 3O8LA 3AVWA 2C4UA 3DQQA 2HUPA 1GT6A 4IQFA 2BMEA 8AT1A 4ACAA 8MHTA 2GUWA 4RDCA 1VB3A 4BQPA 2EZ8A 2DR2A 2LUOA 3SHTA 3DHEA 3LPLA 1TKAA 2ZSUA 2I6XA 2HJRA 2JIBA 2VP3A 1N5OX 1R4NA 1SA0A 2DFVA 3MWDA 2IPOA 4Q3AA 3ZHYA 2WSSA 3S2EA 3U7GA 4IL5A 2WIBA 2PUWA 3H2ZA 1R88A 1GG2A 1D2AA 4FHCA 2FMIA 4XSVA 1U94A 4M0CA 5IJ9A 4F3NA 5JXIA 3W05A 3MFYA 3HV0A 1CQJB 1P2TA 2A0XA 1PT9A 3X1MA 3TZQA 3CLSD 1YL5A 1DPGA 3OOWA 1GGVA 4R05A 1PX2A 2YWFA 4K0KB 3ISVA 1PQPA 5K3SA 1F7UA 4JYAB 3T1NA 4CM1A 3A4VA 1DVRA 2JH8A 3IUMA 2CB9A 2TMGA 3NWOA 3FHCB 4P34A 3W04A 4XR4A 2AG6A 3Q6IA 1L3CA 4FWIB 4Y7CA 1ZGBA 2V8BA 3AR2A 3S5JA 3G7UA 2EJCA 5AIBA 3HK2A 2VDLB 2E21A 1TM1E 4I1OA 4MRVA 2ZZNA 4CUKA 1QVAA 2QYTA 1HYQA 2DTXA 3WRVA 2ORWA 2W11A 5EYPA 3P9CA 3S29A 4BBJA 3Q9LA 4MKXA 4XX0B 1NI4A 2IYSA 5GONA 3S2FA 1GXSB 1FVOA 3MTQA 4DHWA 2D7DA 2HQBA 1JDZA 2AFIA 2VA9A 1U7OA 4XE5A 4HDNB 4HSEA 5KI6A 1K3FA 1UFQA 2J3KA 3UW1A 1E6CA 5EJ9A 2IYLD 1JFTA 2AXQA 3KKKA 2A0UA 3TMKA 3LPMA 3QM1A 4A2PA 2ADOA 1AIPA 3UH0A 3PEVA 2W8ZA 1KPIA 2CHQA 3UJDA 4E08A 3WS7A 1TEVA 2X8WA 2ZSFA 3HCCA 4LE0A 1WMDA 2OMEA 3BTOA 3A4LA 3FTFA 1H9AA 4KDFA 2GXAA 1C5KA 4DIUA 2PMDA 4HWPA 3R5FA 4JJ7A 2Q1UA 4RYDA 4AKHA 3R5HA 4DW8A 2LCQA 1P7VA 1H1TA 4OM7A 1Z82A 1M0WA 4AWAA 4BP8A 2P3OA 5BN1A 3V2UA 5IZCC 3SZLA 3FUTA 5AOVA 2XJ4A 1HG1A 3D6HA 2WQZA 2ZLBA 4MULA 2GYWA 1WKBA 1CUJA 2NSDA 2WG0A 4EJFA 4BCBA 2MSEB 2R25B 1WSAA 3JQ9A 2C9MA 2I6QA 2RK3A 4IQGA 1RBQA 5FTLA 1HK7A 1OI4A 1B00A 3EVZA 1EFRA 1U1IA 1KH3A 2DOKA 3TR6A 1KXZA 4MPPA 1G21E 4XIIA 3V7FA 1E1NA 2HIGA 3PJEA 1UDAA 4E4TA 1OBVA 1OQAA 1ZH2A 3M9WA 2PXCA 3IQXA 5JNUA 3T5PA 1I13A 1VBKA 4LTDA 2BGKA 4NYJR 4IIDA 3T5MA 5JATA 2VAWA 3A32A 4WJZA 1L5ZA 1OHHD 2WMOB 4IDEA 4JC4A 3WK7A 3N75A 4AWXA 1Y0BA 3CLSC 5K0CA 2PA0A 2Q1SA 3RS4A 5LXTB 5IANA 1PVDA 2B3DA 5HW0A 2WWHA 5K9ZA 2D5AA 1EB9A 3G2LA 2I03A 4UREA 2CL7X 5E4TA 3ETDA 2OUKA 4UDXX 1K0UA 1KZ4A 2XUKA 2VSQA 2WQ7A 1JHRA 4KQHA 1X7XB 4PIVA 5D84A 4LSZA 5TGDA 3RRBA 4E13A 5BOVA 4FNMA 3U7HB 4X6XA 5FPQA 3R7SA 3BMNA 1BGWA 4OOEA 3FVVA 1SBHA 3BC1A 4URZR 1CVLA 3DAPA 3FSEA 1ECGA 2C88A 4LDAA 2XSZD 3HR7A 3ROTA 1M8FA 2TMKA 2VF4X 3WB9A 2ORYA 1QCYA 3BGVA 3V7YA 1OU4A 2O0LA 1YZ3A 1WZUA 3P4XA 1L6RA 4TVSA 3N1UA 2QUKA 4MVJH 3LDGA 4B5LA 1CR6A 3E6AA 2G70A 3TOXA 4Z54A 1ONNA 3G8AA 2IUTA 1PR4A 5JZBA 5HRUA 1URPA 1QB7A 4ZI7F 2B8EA 4AUNA 2RHTA 1P0MA 2P2DA 4O2BA 4NL4H 4OU5A 3TD6A 2Z08A 3KQLA 3TFOA 3C7AA 1RXUA 1XPUA 1NBMA 1Q7TA 3ZHTA 3ZIDA 5JC1A 1E2LA 2NU8B 2R6ZA 4BVGA 1E18A 1BNCA 2PUBA 3RQSA 1ZK2A 1CULC 4Z1MA 1JQBA 2O52A 1GQFA 1O3YA 1QIIA 1CPYA 4PYIA 2QN7A 3KUXA 3KSUA 1F0NA 4FN5A 3D64A 1MC8A 4WLVA 2GJ9A 1W87A 1EWKA 1W29A 2HCRA 2IZ6A 2XI4A 3GUHA 3V4FA 4GWGA 3HCNA 4B31A 4CTKA 5P8WA 2F1HA 6LDHA 1KP3A 3NUZA 1X1RA 1NC3A 4EGCB 5U1PA 1NHGA 4JVMA 3OE4A 4IR7A 4WW0A 2Z3VA 4MVJM 4RTMA 2D62A 2ZYGA 1NZDA 2FMUA 3GG2A 4X8MA 3ZTYA 4HNUA 4CF7A 5T3UA 3IIIA 3I5XA 1NVDA 2GWHA 2JHFA 1JIUA 3VU9A 2FPGA 5AT1A 3QOWA 3ECSA 1JDJA 3G13A 4EW2A 2OBBA 1SB9A 1U7TA 3AH8A 1YZUA 1CUFA 1L4HA 1U0JA 3ITNA 1F48A 1BJRE 1ULZA 5SZJA 4Z3OA 4MPTA 2WTEA 4X1OA 3P20A 1LPSA 3RQIA 3H8VA 2RHGB 5LYYA 2P62A 1N9GB 4HAVA 3QUQA 2E4XA 4JZKA 1MAUA 1P2DA 4FMDF 3CLUD 4Q9KA 2X6RA 1F2UB 1WDKA 1TO1E 4PFKA 1KOGA 2WOJA 4ALJA 1IXKA 3HB5X 4LF5B 2QWXA 2YJ6A 1A9XB 1B74A 2FRDC 3DKVA 1XYYA 1Y7IA 1IXSB 2P4HX 3DTNA 3EW7A 1PGQA 2GI4A 1XTUA 2JAWA 1M66A 2P9QA 3K6KA 2WYWA 1CP2A 3P0FA 3QMWA 2QN8A 2Y1LA 1NDUA 2QW8A 4C22A 3EY4A 2H7CA 2VYCA 4CGZA 3FYUA 1CG6A 2WT9A 1X1DA 3L3BA 1AQYA 3GNTA 1BCRB 1UJ5A 2DAPA 3GA0A 1SQ0A 2QNRA 1L5LA 1KDOA 1K98A 2ZITA 3HUTA 5JCOA 4G85A 4UMVA 1XMIA 5HR5A 1E6EA 3FPGA 1ULAA 2PZLA 1L5SA 4M49A 5CIWA 2G8LA 3BSSA 2P9ZA 3VVMA 1F3LA 4DJDC 1RHMA 3ML1A 4RLFA 1VKZA 1VE9A 3K31A 4CL2A 5ICEA 3KP1A 1VYHA 3HFJA 4KHZA 3L41A 4BFWA 4ZIRB 3LQQA 5J4HA 3ZE2B 1GYQA 2DLDA 4HEJA 1SEVA 4L9RA 1RWWA 3FTNA 4S2UA 4U6NA 4RIGA 1AS3A 4OYRA 4ACBA 1K4MA 2A1TS 3VDQA 3DKPA 4UDYX 3N2GB 4EGSA 4GP9A 4ZP1A 1C9KA 3QITA 2IXDA 4N65A 1VLVA 5FWAA 5JJCA 1R6DA 1G5TA 5A4MS 3L7OA 5IDWA 3GPLA 3W5DA 3G5UA 3QEAZ 4NXNB 3Q9NA 4M76B 2ZT8A 3HU1A 4B6GA 4KNYA 1VJ5A 4TXLA 5LP6F 2XKBA 3IELA 4B79A 5KIAA 4MVJG 4B7UA 4UUNA 4NENB 4V02A 5JVDF 4H4CA 1TFUA 1TADA 3OPNA 1TYZA 1TYAE 3AR7A 2GPSA 1QGOA 1ZN9A 1Y9JA 1K68A 1E1CB 1X80B 4MUIA 1OVMA 4RPJA 4BMZA 1KJQA 1O97D 3GLHB 1M75A 5C1OA 1EIZA 5EZYF 1GA1A 2QVZX 3SYMA 2QTMA 2WDZA 3GJ7A 1PHRA 4OYLA 2HK9A 1L1FA 3R7BA 2QI9F 4D4HA 1NG1A 2K4MA 3QVWA 2PPLA 3TVYA 1ZH6A 1BFUA 2XPCA 1JE0A 5LYJA 2II6A 1IN7A 2QN1A 3F6SA 1IZYA 3OOHA 4CM9A 5LOVF 3HUUA 3JWEA 2GXSA 2Y27A 2X0RA 3G1UA 3MWGA 4NMHA 3CW9A 3FTCA 3JQAD 1SIBE 3IQDB 3F71A 3JSAA 1MB2A 1W44A 3CLUC 3DUWA 4G56A 4A91A 1T24A 2C97A 3AHIA 3FLAA 5DB4A 4MKZA 3E81A 1G8PA 4ZAZA 5DGXA 1CZHA 2ZUDA 3H19A 1I4LD 3ER8A 4YRAA 4QHTA 3ZI4A 3EQ9A 1SVSA 1DKUA 1JZQA 3KBOA 1I7QB 1EVEA 1GL6A 1YS4A 2R2GA 3FH0A 4UAUA 4ZKDA 5IRCD 2ZRAA 2QNBA 1BX1A 2IW1A 3RFUA 3NHWA 1TQ4A 1CCWA 3PFCA 5K2OA 1ECCA 2Y1DA 1P3JA 3ETGA 3NM4A 3GLFB 4ZGGA 2BKAA 3NM5A 1XIVA 2CBZA 2PMCA 3ODPA 5ILGA 3PQFA 4RHXA 1UOEA 3EA5A 1YL6A 4BLTA 5HJEA 2PHZA 1A88A 2J0EA 3IAXA 5LNK1 1ZJ5A 1MAAA 4C1NA 1UCFA 1QH8B 4D8VA 5K0FA 4WEQA 4JHXA 2Y9MB 2VXYA 1YBFA 3GUCA 4MVJF 2DBZA 4AIRA 1YZKA 3LX6A 1THGA 3OLWA 3FKJA 4AKIA 4O08A 4QODA 2GPBA 3EVCA 2Q9CA 4GX1A 3R75A 1XKTA 4BMVA 4BBPA 4K6FA 4QYIB 2CGEA 3HVRA 2VKTA 1YJQA 1BGXT 2VHUA 4JLSA 3MT0A 5IABA 3EYWA 2PS0A 4M55A 3WWEA 1EWTA 3LI2A 1LW7A 2VAMA 2Q4TA 3O75A 3W2IA 3E5NA 3ESRA 3V46A 1JEYB 1KVTA 4EW1A 3O90A 4REMA 2AG5A 4YGXB 3ZE9A 1WRBA 4P53A 4TS4A 4MQEA 5IDYA 4ARVA 3NYWA 1L7AA 1U5BA 5B7GA 2QGZA 1YZTA 4G1CA 2DQZA 4OLHA 1YQUA 2YOHA 1JPVA 2D2IA 1WS6A 2HT6A 3PQCA 1O97C 2ODPA 2NO7A 3ESBA 4FOPA 2BM9A 4HS9A 1CUUA 4I55F 3SD7A 4B6PA 3HB0A 4PAOA 2I7XA 2GMWA 3CKYA 3MGGA 3QJYA 5JS7A 1RRPA 2ODQA 1NN5A 3WGUA 4MKHA 2ZB8A 2XMGA 4PYJA 1YZLA 2O3SA 3HVIA 4MAMA