4R1PA

Crystal structure of thermophilic geobacillus kaustophilus l-arabinose isomerase with mn2+
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
494
structure length
494
Chain Sequence
LSLRPYEFWFVTGSQHLYGEEALKQVEEHSRIMVNEWNRDSVFPFPFVFKSVVTTPEEIRRVCLEANASEQCAGVVTWMHTFSPAKMWIGGLLELRKPLLHLHTQFNRDIPWDSIDMDFMNLNQSAHGDREYGFIGARMGVARKVVVGHWEDPEVRERLAKWMRTAVAFAESRNLKVARFGDNMREVAVTEGDKVGAQIQFGWSVNGYGIGDLVQYIRDVSEQKVNELLDEYEELYDIVPAGRQEGPVRESIREQARIELGLKAFLQDGNFTAFTTTFEDLHGMKQLPGLAVQRLMAEGYGFGGEGDWKTAALVRLMKVMADGKGTSFMEDYTYHFEPGNELILGAHMLEVCPTIAATRPRVEVHPLSIGGKEDPARLVFDGGEGAAVNASLIDLGHRFRLIVNEVDAVKPEHDMPKLPVARILWKPRPSLRDSAEAWILAGGAHHTCFSFAVTTEQLQDFAEMAGIECVVINEHTSVSSFKNELKWNEVFWRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords L-arabinose isomerase
publication title Crystal Structure of Thermophilic L-Arabinose with Mn2+ from Geobacillus kaustophilus
rcsb
source organism Geobacillus kaustophilus hta426
molecule tags Isomerase
total genus 182
structure length 494
sequence length 494
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.3.1.4: L-arabinose isomerase.
pdb deposition date 2014-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02610 Arabinose_Isome L-arabinose isomerase
A PF11762 Arabinose_Iso_C L-arabinose isomerase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10940 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4r1pA01
2AJTA 4LQLA 4R1QA 4R1PA 4R1OA 4F2DA 2HXGA
chains in the Genus database with same CATH superfamily
1AQNA 4J90A 4PLGA 1RNLA 5EVCA 3KOUA 1KA9H 4S1NA 4HXGA 4OXNA 5AK3A 5JNUA 3VZBA 1ZM7A 3O6VA 1CUVA 1IMJA 1VLJA 2FG7C 1X1TA 2FG5A 3CWCA 1BC5A 3NVMB 3AMVA 4Y18A 1G7SA 4EX6A 1U99A 3BK1A 3CR3C 1SHZA 3DEHA 3KKQA 5G3YA 3FCAA 4RCYA 4RVUA 3RIXA 3I53A 3OE5A 3GEDA 4A16A 2AWOA 5EJGA 3EPPA 3FGZA 4XGIA 2C82A 3HSSA 3L0ZA 4JMPA 4JI6B 3ETNA 4NESA 4IXWA 2OLJA 4ZAWA 5C4GB 5BUCA 4HR7A 1XCGB 2YZKA 3OQHA 1QUFA 4G97A 1HZJA 2GFHA 1KI6A 5B53A 2O8CB 2H06A 3LQYA 3QU7A 1AX9A 1FZTA 3L7BA 1TM7E 1EXVA 1W0KA 4CQNA 1PJCA 4LRYA 4UUOA 1MRNA 2EP7A 3HKEB 3Q3CA 1LTQA 2QL5A 2V6BA 3PPVA 1P45A 3FY4A 1SQSA 2I80A 4QDXA 3O84A 4FOTA 5K4GA 3CQ9A 1C0LA 1SIBE 4DAEA 1I3NA 2JIZD 3H1GA 2AG5A 4LTDA 5T57A 2IHNA 1LFDB 5IZ4A 1H0HA 3AVVA 2Y2UA 3D7SA 3DUFB 5HIKA 1YQGA 1AK9A 3E22B 5L4LA 3CX7A 5LMCA 1KY4A 5H16A 3T9DA 1E96A 1G41A 1KI1A 1JMYA 1W73A 1OLXB 2XYGA 3HSKA 2NACA 4W8OA 2XRMA 3OM1A 1C9KA 2PKWA 4FBMA 1N6NA 5CYFA 3UAYA 4PLHA 3QPAA 4C2BA 2XMRA 2HXGA 3RIMA 3ZWMA 1JHYA 5CLGA 2O5VA 3H3FA 2D54A 2J4DA 3N7AA 4BKMA 2W90A 4EG6A 2Y8EA 2Q4EA 5L3SB 3TW4A 1QFSA 3U17A 2CL6X 2JKVA 1GZUA 3P2IA 3THXA 1GPWB 1KAOA 2R86A 4OKIA 1QK5A 1YZYA 1EDEA 2QTZA 4GPZA 3ZXYA 1GRRA 2YS6A 3L6EA 4PCVA 1CUEA 2EFYA 2I3ZA 2C1XA 3AI2A 3OLQA 3BJIC 4M55A 1Y37A 1ATZA 4ZPXA 5ITZB 5FORA 4G8BA 4WOBA 3CVXA 1Q2UA 1NNUA 1P3DA 4QGFA 4U5XA 3TD6A 4AF6A 4H16A 3PPWA 5AI6A 3SIWA 3IDFA 4BGIA 2ECKA 2RSLA 5B7QA 3JQCA 1N2HA 1USUA 4CI9A 1CJUC 4DY4A 3FKJA 2FPMA 1JAHA 1OY1A 2PRZA 1ZW6A 3KUDA 1HYEA 4MYDA 1P2DA 1YDEA 3RR2A 5ESWA 5E3HA 1OH6A 1JKJB 3E7WA 1TMGE 4O2RA 5DYTA 3BA1A 2QF7A 1PFQA 4TWRA 2FP4B 1OD6A 2DVMA 4KV7A 2D13A 3FW1A 1F8GA 4RLFA 2DFLA 1T3SA 2YHIA 4X61A 4UZEA 3DLPX 2OE2A 1YCFA 3ROPA 4QX6A 1JGTA 4UEOA 2C7QA 4U8HA 3V9PA 1R37A 1KO4A 1Q1BA 2BHLA 4Z54A 1YZNA 4HL6A 5C8VA 1J0CA 2HSZA 2VUUA 1N9GA 4X95A 1U3VA 3N0WA 1RJ9A 3LHFA 5D86A 3V42A 4HUQB 4BFSA 2LIPA 3DV9A 1H1DA 3HHEA 4O33A 3TLKA 1T91A 5HE9A 1GG8A 4GM1A 3FBWA 4FFOA 1T5TA 1KYXA 2H8KA 2PA3A 2IYQA 4EKEA 1NVFA 5AW5A 5C7IO 2ZRMA 3OF3A 5HUJA 1FVOA 1HOTA 2ZUDA 4CF6A 4R81A 2ZUTA 4TYWA 4KSBA 2XNHA 4GR5A 2BFWA 4RNCA 2Z2ZA 4O2BB 4OMCA 1GL3A 3B9RA 2YN2A 3I8OA 2OP0A 2ZSKA 5EE5B 5K8CA 2HYDA 3O1LA 2I3DA 1AKMA 1JLHA 5KNCD 3L8FA 3N70A 1KVQA 2D8AA 2FWMX 1HNNA 2XIQA 3B5IA 3ILHA 4IL5A 2HU2A 3L6CA 4OXYA 3OZSA 3EWIA 3WGIA 1U9IA 4PE5B 3H8JA 1CW2B 3NBQA 1ZUWA 4KBFA 5TPWB 2GZ2A 2VATA 3VDMA 4F2GA 1A4IA 2GI4A 3P2OA 1OGJA 1QH9A 1FUYB 1YCDA 1N5OX 5B3AA 4CF5A 3ZJUA 3IESA 4QBKA 2VDMB 5C9ZA 2XUOA 4KRXA 3VH2A 3CNLA 4IQ0A 2K7ZA 4HYEA 3RS2A 3V46A 2WYVA 3RSOA 2WNIA 2H52A 2WJ3A 3QTLA 3F3MA 4FUTA 3WC4A 3A4IA 1J0AA 3A4YA 1M0TA 3P5SA 1C4WA 3QYJA 3ZU6A 1J2UA 5F76A 2QMZA 2JASA 4B6OA 1L3IA 1OQAA 4Q6WA 1OX5A 1QGOA 3LUKA 1OIVA 5JNRA 4RMJA 3CLVA 1QRUA 3BULA 3JVDA 4DCOA 1ZN2A 2XUDA 1GXSA 4IMIB 5D7BA 5A3SA 5KOHB 5F77A 1PFGA 4J9UE 3RYIA 2DPLA 2ZREA 4OK3A 4DNOA 1M75A 3RRNA 1MPTA 1USIA 3OQOA 1OFIA 3G5UA 1FFSA 1TQ4A 1CDDA 3VV2A 3BBPA 4YUWA 2G5PA 3VXKA 2HQ1A 3BILA 5I3CA 2RGWA 3EPLA 3VKHA 1NXOA 1WUYA 2AN3A 2V3VA 3ZNQA 1VL1A 4DWOA 1Z4NA 3G0CA 2FUCA 4PLYA 3QX7A 3LGSA 4D82A 1K06A 1TTHA 2JLSA 3JD1A 4G4IA 4QEKA 4QSHA 5CNIA 2JK1A 5HOQA 4HYQA 2IS1A 1A8HA 2ESRA 1G5IA 1ECBA 2G36A 4QBGB 1GPJA 4YMIA 3HYCA 3F3YA 4HSEA 5K1ZA 7GPBA 4WXMA 4R5HA 4R6XA 1Z4IA 3FPHA 1MZVA 2XWQA 4OP1A 3W5AA 4LGVA 4PCAA 5L3QA 2PS3A 3TL6A 1D4AA 1G5QA 4RZQA 5BN4B 5A2GA 2J7PA 4F85A 4P3KA 4ZYLA 4JR2A 2PZFA 4E2ZA 1VDMA 3D2AA 3CVYA 2QLNA 5D6NA 1ZA2A 2WMYA 4M1WA 4BAGA 4D9EA 3D4IA 4H59A 3K2BA 3LLUA 5I8WA 1M8KA 2JEZA 2P4HX 3PC6A 4P9NA 3TTWA 2IYUA 3QWIA 4AKSA 2YH2A 2XVAA 1GDTA 3IEPA 2GEFA 3QVSA 1YR2A 2Z2IA 4FT4A 5ALZA 3TRFA 3VBEA 3UBTA 4MW5A 3RAFC 8ADHA 3IE1A 3JATA 4JUAA 1UT6A 3OJXA 5TXGA 3DEAA 1T4MA 1FLDA 1KU6A 4Q9AA 4DMHA 5F23A 4BZQA 1ZM3A 3BC1A 3ZD9A 4WSOA 2QN2A 1RBQA 1I24A 3BB3A 3QXJA 2W9XA 1SC6A 1K86A 2KX7A 1RYDA 3QKIA 4CKWB 4X1YA 1M1YE 3IXLA 5KVSA 1FRQA 2QGFA 2R5FA 2JJQA 2V4MA 3EVFA 2CVPA 4XJVA 3VZRA 4DM3A 5BR4A 2LW7A 1Z5GA 4LW8A 4YQYA 1EFHA 1JR4A 3DCYA 3F3KA 1EB9A 1NUPA 3NM5A 4M0DA 4OHBA 1Z39A 4WCDA 4XLLA 1GTG1 3ER9A 1F8XA 2H4ZA 4KDEA 5ENVA 5EJ9A 2I2AA 1C9NA 5SYMA 1WBDA 2BKLA 4FMBB 2VJYA 2JI9A 2VCHA 5BN5B 3RWMB 4U2GA 4BQPA 4ZYTA 4Q66C 5F3DA 3O83A 1KYWA 5J3JA 3MBIA 4YMGA 3B89A 1KZ6A 3PXDA 5K3DA 1YC5A 4WX2B 3LXMA 4ZYVA 4EECA 3F78A 1Z4KA 4AJ9A 5JSHA 5DM60 2F3UA 4X63A 2F43B 1P2GA 2VF2A 2YMPA 4XDYA 1EP3B 4XM1A 3DVQX 4C6SA 4N8DA 1CUZA 2W6CX 4BV3A 5GONF 5AUPB 5IM4A 4CODB 3KYCB 3ON5A 5BSGA 4HGQA 3I6IA 1RYMA 2ERCA 2VYVD 1NA5A 1VXOA 4DG9A 3COJA 2BELA 4ND2A 2DHEA 1V3VA 3FLEA 2V96A 3AUAA 3B3JA 1IBRA 3P1JA 3FYUC 1OX6A 3M6VA 2B9EA 2QR2A 3JWJA 5F12A 4ER6A 1AHHA 3UW3A 2Q8PA 2WPDD 4A15A 2Q9CA 2R6JA 4EG1A 2UV8A 2WZBA 2BP7A 3HGMA 1ZSVA 3T35A 2WHRA 3PUIA 4C76A 2IDJA 1Z5VA 2C4VA 4KR7A 2JLWA 4LMPA 2H7VA 4RTMA 2ANCA 2IY8A 2WSLA 4M9UA 3QHAA 3MLEA 4MUMA 3LKDA 5C8ZA 3ZDDA 4JI7B 2YWJA 3I9FA 5INTA 2VP2A 3JALA 1KAQA 2AUMA 3EGIA 3QBDA 4XWAA 1E3IA 1Q20A 4MKIA 2UUAB 4JLSA 2AZMA 2CW5A 5HE8A 1T2CA 2Q50A 1DRWA 1UT5A 4AS1A 4BQRA 4DC1A 4V1CI 5CT8A 4HN2A 1JQBA 3VO9A 1JHUA 1NBEA 5A5VA 3LFHA 2I6SA 4KPYA 1HC7A 3OZEA 4X5OA 2AYXA 1PTJA 2WAMA 2IYYA 5I4KA 4R2KA 1YFKA 3EFOB 4ZVVA 3I8SA 1MOZA 1UJNA 1AZLA 5K6AC 3T9FA 1WM1A 1DS6A 3EJ6A 1O77A 3AY0A 4RY9A 4WZAA 1TL7C 1TPZA 3EE6A 1H5NA 4Z8YA 5WRFA 3ZXSA 1NNSA 5FI1B 2XNDD 1R0ZA 4HB3A 2PWYA 1I6MA 1EFRA 3FPKA 1VP3A 3N2IA 3I2YX 3IAEA 2R97A 4C30A 2WU1A 4ZT2A 1CIVA 4Y98A 1J2EA 2H0AA 4GXRA 4BMNA 1VHQA 3TQCA 2EU8A 3X43A 4HVLA 5FWYB 4R6WA 4EJSA 4RDCA 8LDHA 4L57A 4BIMA 3SYKA 3K0AA 3CW9A 4MP3A 1C1DB 1MR3F 2EW1A 1M5TA 4NZ9A 3RRJA 5DWQA 1K7FB 4TXHA 1ZJZA 4F1JA 4ZT3A 5C4MA 3O4GA 4U5QA 1T9AA 5F5XA 3EWSA 4C0WA 3RU9A 1FCJA 3P4UA 4H0FA 1XZIA 1KZ7B 1Q0ZA 2D2VA 2HIMA 5EJAA 5LZ5A 3GG9A 3RTEA 1NF2A 4G86A 5JSFA 1HDRA 3RJZA 3MK31 4BBJA 1LC0A 4F2WA 1BCRB 4RK7A 1NE7A 2JF0A 3C6BA 2ZJ2A 3NNDA 3NBUA 4RMGA 5JI3E 1W49A 1WCWA 1CJVC 4ECAA 1RAGA 1LLFA 3QA9A 1C4OA 1G3IA 3QX8A 3RW9A 4OQEA 2FNAA 5CEEA 4ALMA 2PKXA 1Q95A 2GX6A 3CCFA 4WADA 1E7QA 4MRMB 1R00A 3OOHA 5ALNA 1PWHA 2XJ4A 4FS8A 4DRYA 5IDYA 2P7HA 3KXKA 3FJ1A 4KLAA 3PGA1 4OMFG 4U2CA 5KHAA 3KWJA 3ZKWA 4K9DA 4IIHA 3I0ZA 4MTCA 1AB5A 2FR1A 5F7ZA 2O2DA 1S7GA 3CEAA 3DZIA 3M6IA 3PCTA 2QEQA 1ZVMA 2JGAA 3GT0A 3HYNA 1XTZA 3ROGA 2Q3MA 2HAEA 1T9GS 1Y3IA 1BHO1 5DM4A 3VR4H 2AK3A 1USWA 2BLNA 3N05A 3BQ9A 3WAJA 4M1YA 3GJXC 3L8HA 3MYRA 1MDBA 4ZEMA 1K27A 1EQUA 1FP7A 3LV8A 3LXUX 3ZPXA 4CL3A 5J43A 4KC0A 4X6LA 2CEAA 1JX6A 2P5TB 2V4ZA 2Q5IA 3UG7A 2BE9A 2Q9UA 3HBFA 3WB0A 1T9HA 2I76A 1IRXA 5I9IA 4TS9A 4B4OA 1KZYC 1LV8A 3VU8A 2B8TA 4NYIQ 4JUIA 3JPYA 2DSTA 4FEEA 1UMCB 4EW3A 4HRXA 4NC9A 1U0BB 1PGOA 4AQDA 3TG8A 1W4RA 2XE8A 1VZ3A 3RVKA 3H9BA 4L3OA 1XOIA 3CRMA 5SY9A 2BTQB 1AHNA 4OKNA 4W6QA 3WK5A 3KUCA 4E03A 1OAAA 3GLRA 3GYGA 2QRHA 4B71A 4PGFA 1UKYA 2QQEA 2WZCA 3MWYW 4WFQA 1FL9A 1KI7A 3AEQB 4IDAA 4PINA 3ZZMA 5HRUA 2UXBB 4AWBA 2O5EA 4LX8A 3WYCA 4DF3A 3GLQA 4D56A 3F8TA 3LKVA 3I30X 4BLWA 4KGZA 3Q8LA 3H13A 1KJ8A 4J0FA 1YRQA 3IVMA 2UYYA 3EIHA 2XMSA 4E09A 3OD1A 1ZGAA 2BHNA 3NHFA 3X1WA 2ZIFA 5F7OA 4J43A 1CRWG 1UFOA 3E6AA 3CXUA 2VVTA 1F3LA 3HO6A 1AO3A 1NN5A 2HIGA 2I7VA 2BH9A 3CUTA 4XCQA 1TZCA 1RDFA 3EVNA 5DTRA 4CKXA 2C1ZA 5DXAA 3VC1A 4EGSA 2F00A 1ZOSA 5IH7A 3STXA 5DOZA 1U3UA 4XR9A 5A71A 5KMGB 1XEAA 3WWDA 3PXUA 3IVGA 2AS0A 2F17A 1KC1A 4DDMA 4FHFA 1F2UA 2QTBA 5AKKA 3QPWA 1DQNA 4KTTE 1P39A 3R6TA 3A0RB 4TXNA 3PG5A 3EW7A 1Y1TA 1MG5A 3RJ5A 1ZG3A 4JZKA 1M2NA 2Y92A 2IHYA 3MT0A 3ELWA 3EIUA 4TVBA 1YZLA 1XNHA 1AXRA 1YR8A 4PC1A 3IDQA 4DLVA 5IH3A 2C2ZA 3AEUB 5BVGA 5CUQA 4YRDA 4B7UA 3E4CA 4AC9A 3R8CA 4LCBA 1O5IA 4M89A 2OVBA 3IBTA 4X8MA 3TEFA 5EQJB 1EWTA 3DBHB 2AZTA 2WIJA 3U7FB 3IBYA 4KUEA 1DUIA 2WLSA 4XD7D 5B3JA 2P6PA 4MB6A 4B8ZA 4EQ6A 2CLIB 3B6KA 2IW1A 4Q4CA 2POCA 4AJKA 3FBGA 3H7IA 4FMCF 1XKXA 4JA0A 3ZBPA 5HW0A 1M8JA 1PS8A 2I2XB 4LJ6A 3FZNA 1Q84A 3KSDO 3PUWA 4A36A 2I54A 3EZYA 4BMXA 4PRZA 2ZOSA 2PT7A 5JE8A 4EPWA 2LD4A 1USGA 2GPWA 2JBAB 2VT2A 2Z4TA 3MEQA 4ARUA 2OG2A 2IK8A 4RWZA 3NHZA 4H6XA 3PXBA 3TB6A 2ONKA 3D4OA 2N46A 2AWNA 3UB4A 1XT6A 2CFRA 1T3LA 1TEVA 3H16A 1CV2A 4Y6LA 1WY5A 4MR7B 2CXTA 3EEBA 3MSCA 2SCUA 3CX3A 5AJTA 5C1OA 2B35A 5ESXA 2VQDA 2DG2A 2YNMA 4U6QA 1WCIA 1MD9A 3F5SA 3JQBC 2A92A 2AKYA 2WZDA 2ZSEA 3O26A 4G5XA 3V4FA 2XITA 5K2OA 1GITA 2OCLA 5EZYF 1R1DA 5LCXA 1QRTA 2G67A 1ZUHA 2KQUA 3RANA 1OAOC 3A9UA 2BF4A 1NE2A 2CF5A 2UYQA 2ZIAA 4LTNA 4BRWA 3OAAA 4H7DA 3AETB 4XW2A 5L45A 2VUSA 1RBMA 2B7LA 3PYXA 2ZJ6A 4I1SA 3SFZA 5EMJA 2FSHA 1P0IA 4Y6QA 1RXEA 2WTUA 1M8PA 2VHTA 3QXXA 4R1SA 4AQ7A 1I4WA 3EVDA 1LTHR 2WSIA 4HYTA 1SAYA 3EVAA 2R66A 2H65A 4P08A 2W0MA 2CGEA 1YB2A 3ESCA 3IVCA 2EJBA 4U7WA 2ADOA 1IYZA 3AM1A 4FSXA 4M7OA 2PX6A 1Z3IX 2IIPA 1D07A 4GF5A 1CZRA 1YJXA 3GQBA 2GNAA 3Q0TA 1NR1A 2JFFA 4C03A 4OLFA 4KVAA 2CWWA 3KEFA 4B3DA 4Q9KA 1E99A 4V39A 1B2LA 1MGOA 1J7JA 2R5WA 1J8VA 3JQ6A 3RSCA 5A6SA 1PCXA 3DAHA 4MROA 2ISSD 2Z56A 4BEJA 2Q1YA 2AQKA 2W22A 2W8BB 1FMCA 3IHWA 4R0MA 5JLJA 1Y3BE 3I5MA 3ETEA 1JHMA 1YDHA 4F9TA 2QWXA 3NW9A 3TMYA 4BLTA 2RAFA 1G5PA 3T5AA 3OQPA 3LUCA 3CG4A 3LCUA 3R09A 5CITA 1T0BA 3M6LA 3TNFA 1PJ3A 2H17A 3MS4A 4EJMA 1JPJA 3H18A 3ZHUA 3KL2A 3H83A 3SIRA 1KO7A 3I28A 4Y0NA 3OFVA 4KPUA 4UM7A 1N78A 2WWXA 3AHIA 5F21A 1E2BA 3UB2A 5KAMA 2Q3CA 3WQBA 2ZYAA 1U5CA 1W44A 1Z0SA 2WMDA 4IHJB 1UXGA 2DBRA 3IAFA 1FFGA 1K8QA 1T1GA 1OT5A 1RE1A 1H2FA 2B98A 2CLMB 5ECYA 2VDQB 3GDOA 3H1AA 2UZ0A 1OKKD 3GGCA 4QT0A 5ALFA 3EZXA 3KKLA 5CNKA 4EFNA 5KHLB 1V7ZA 3EWAA 1AKYA 3KOWA 1SKBA 4WFJA 1TUBB 1FFXA 5FYDA 4Z9FA 3R3VA 3QBEA 4KNWA 3AM4A 2IYXA 3AVPA 1B0PA 1SULA 2BUAA 1K08A 3PHHA 1RCUA 1YF3A 1J6UA 3KL4A 4DDVA 4KKVA 3M2TA 4I4NA 5CB4B 1XZJA 2BFCB 2NLOA 4HUTA 2I1LA 1WU8A 2R6R1 1P9OA 1UUFA 2Q49A 4Y2UA 2OHGA 4TN1A 3L7CA 4J7AA 3A4VA 1N9ZA 5JSYA 1OVMA 1Y8RA 1TCCA 2UVPB 1F4LA 2VPWA 1UK9A 4GHWA 1EXMA 4EM6A 2O7RA 2QZ4A 4FLEA 4RA9B 4RO0A 1LRKA 5MFPA 4TPKA 2BHTA 3VJRA 1HYGA 4FHGA 2QPAA 3L1HA 4XLZA 4H18A 2G5CA 3F9CA 5EIAA 4Z9XA 1TYDE 1P73A 2QV7A 1EK2A 2W2KB 3GFVA 4HD8A 2I4TA 3K1AA 1G6Q1 1H2BA 1ODLA 1C8KA 2YY7A 4N6GA 5CVUA 3W7AA 3ZHOA 3O47A 4PU0A 3ZZNA 2PRKA 3YASA 2C83A 4IJQA 3RUCA 3QPVA 1BVUA 3DXYA 4Z5XA 1QG0A 2ZFUA 4Z9BA 1ZCAA 3CFYA 2Q7XA 3LOUA 4CM9A 1YDMA 4PEVA 4EY8A 3O3MB 1JWBB 1AKRA 1NUUA 4DZTA 5LDHA 4RDIA 5TMDA 4G07A 1Q0UA 1XCOA 4ERNA 2GERA 2GFQA 4U9UA 4XR4A 3ET5A 1FPMA 1I8TA 2NZJA 3QBTA 4FK8A 1IOVA 4AYWA 3SNHA 2CDNA 2RGAA 4JJGA 4XGNA 3JQ8A 2XRYA 2GZSA 4PIPA 5K99A 4KJXA 3REFA 2JATA 1OF1A 1TVKA 2O19A 3VU0A 1OFUX 4P81A 1QSGA 4Y8VA 4AJOA 4HX9A 2SBTA 5TDHA 3IERA 4H6VA 2YV4A 5LYJF 3FN4A 1D4OA 1HDYA 4U7FA 2C07A 2JA2A 2XNJA 1QFMA 2Y1LA 1FSFA 3SGLA 4CJXA 1R15A 3NJ8A 4FYMA 1VGRA 4B3JA 2C5LA 2P9CA 3PL5A 1K6XA 4IFIA 1O95A 4PR0A 1YIOA 1JTVA 3MJVA 5CDHA 1TTPB 4OYLA 1KGSA 1UFVA 4N5MA 4Y2QA 2OO3A 3CYFA 5B3KA 1TGVA 3D7MA 1BYUA 2ILVA 3K5IA 4OP2A 4BO9A 2ZIUB 1VBKA 3CUUA 2A0YA 5L7YA 5LLSA 1D0VA 5AO9A 4A8TA 3RADC 4U2EA 3EVCA 1T0IA 1J9ZA 4RADA 4X9XA 5IKPA 5FL7A 3SZUA 1N8TA 1TJPB 4BFZA 4BDSA 3W9BA 1JJVA 1C1XA 3W4KA 4HZUA 4TZKA 1QS0A 2C2YA 3KQWA 4TV9A 1ECLA 2FW0A 1CQZA 1G6OA 1UBRS 2WJAA 1WMBA 4EHDA 3H05A 3H3JA 5BXQC 5AKXA 3PJFA 4L9SA 1K7YA 3VSCA 1CF9A 2I1QA 2KYRA 4YRMA 1J0DA 1U3WA 2FF7A 3VYUB 1YK0A 2CHQA 4EDFA 1NV9A 2A9FA 4KR6A 1L7XA 4ZCPA 2KB0A 2NU7A 6YASA 5EVJA 1CUHA 1NYLA 2A14A 3B5EA 1RXVA 3H9JA 4GW3A 2DPYA 3WYBA 3CR7A 3VJLA 1UK7A 2H85A 3CB2A 3IAUA 3GARA 2EGGA 3HCFA 2H2AA 5BQFA 3H6KA 3AESA 4JXXA 3JZIA 3PX7A 2NAFA 2NGRA 3I76A 4XPZA 4LJ7A 3NVAA 4HDCA 3N8DA 3GMIA 1K8ZB 1ZISA 2E89A 1YC2A 1I5OA 3OKCA 4H1UA 1QCCA 2ZQYA 1TGYA 4L07A 5CX1B 4RHUA 1TEXA 1AZWA 5IWAB 1XDUA 1L4NA 1SNYA 2YRXA 3KLPX 3O82A 5TV2A 3EBPA 2NU8B 4EA7A 4U39A 1WSAA 2WT4A 4PQRA 4ZP1A 2OXTA 4KR2A 3SZLA 2I6QA 3SD7A 3VDNB 5LWQA 3X0DA 5JXJA 3IQDB 1I4LD 5FUWA 3DE4X 3OZBA 1H9BA 1RWWA 2D1RA 3TZLA 2JI6A 2QP9X 4WL0A 1EGVB 5AW8A 4HH3C 2OZLA 5EPEA 1O2DA 4B35A 3T1VA 2EWWA 4NOKA 3KO8A 3A10A 2CV1A 1U3FA 2R7AA 3SF8A 2DR2A 3TUZC 2R6GA 3KK0A 1DTWB 3GHHA 1OC2A 3OIFA 4BOYA 3TBHA 4F4JA 1DJOA 3NGLA 5LXTF 1FEZA 3OEHA 1JE1A 5DMXA 2ZJ8A 1FC0A 5TIIA 1SBZA 3U3MA 1YS4A 3G9XA 4QE3A 3O1HB 2VJNA 1VP9A 1MORA 1OFUA 3FNBA 3SBXA 1OYYA 4EGJA 1YR7A 4FYHA 5HS6A 1KQ3A 2ZR0A 3BM5A 5K09A 1TW2A 2FFJA 3K0HA 3H86A 1FQKA 2GHIA 1PEYA 3PEUA 3W0LB 1VSBA 5EERA 2BKUA 3HA2A 3W6UA 1OT3A 1WDKA 3K35A 1KHTA 1QCDA 1Z82A 3NZEA 2WKRA 1AGPA 1QP0A 1QP4A 1VBFA 4I19A 4MVJF 3TRIA 4DCNA 1N33B 1B23P 4R54A 1QZTA 3OSZA 4NWIA 1WA5A 4EITA 1V11B 1XO1A 2HNKA 4WKBA 3GGPA 4X6XA 3S2GA 3RIGA 1CFZA 4KQ2A 3TYXA 2UXDB 4N03A 3S5JA 1CIJA 1PRYA 1UJ2A 2G04A 1ZICA 3I62A 3KQVA 2JGIA 4KWEA 4ID9A 1P4RA 2ST1A 4FKMA 5F78A 3ZWBA 4BO0A 1XCBA 3JWPA 1SK9A 1PFKA 2PBLA 5LZ7A 3SJUA 5JZBA 2AVNA 3RAEC 4UEWA 1F0YA 1Y63A 4YCMA 3OQVA 2J0UB 4HWOA 5IC5A 4PGHA 4YV1A 1QH0A 4R01A 5KOJA 3P2MA 2O2IA 2AEMA 3QX9A 4AP5A 4DMMA 4EPVA 3MMSA 1LBTA 2WTBA 2EFEB 3UICA 2PAFA 1E2QA 3OEED 4FDUA 4JMLA 2Q41A 4RPHA 4CM6A 3QUBA 1CY7A 1W2GA 1HE2A 2GF2A 2C8VA 2IOYA 1IWOA 4IJVA 4NZYA 2XEDA 5EINA 3SZMA 3VTZA 4CIAA 3K5PA 2PNFA 2CHGA 3PJGA 5CXXA 4J76A 1PT6A 2M6LA 3RYHB 4C4AA 1DJQA 2PJDA 4HDAA 3RT9A 3E9MA 3B6ZA 5FPTA 1QX3A 1Z6TA 2VI5A 2RGEA 4JD5A 3D8TA 2VHQA 2VZ8A 5E6SA 2Q4TA 4LV5B 2VP0A 3KQHA 2ATCA 2WKPA 2Y1OA 4CMIB 1OXBB 2GHRA 1NLYA 3A9WA 3MJRA 3E27A 3IB6A 2EJCA 4FIZA 2JLQA 2A9PA 2MSDB 3DV2A 3MRVA 4O4HF 3JY6A 2ODPA 2CXPA 4DCPA 2I2DA 2C2GA 3A6KA 2AFHA 4BZWA 3L4SO 4IZ6A 3R6LA 4ZQIA 2YXEA 4LZAA 2VH1A 3T1QA 3TNYA 3B60A 4NEQA 1QMPA 3HL4A 5CGZA 5GP1A 3UAVA 1W4CA 1V8FA 1VDZA 1ARZA 2D2XA 3WMXA 5JJ5A 4FQ5A 3U62A 3JCZA 2VT6A 1RACA 2E1RA 5G4LA 3P9CA 5CW1A 2OHVA 1LY1A 3KJXA 4M0PA 4WAUA 1XXHB 4JC0A 1PS0A 3IR6A 1X7YA 5EIHA 5FNVA 1DBVO 5ERYA 4YRPA 3PD0A 3THSA 4HATA 3ENQA 4DREA 5KTMA 4LNAA 4ADSG 3B1WA 4ES6A 1UFKA 2XECA 4I1VA 2Z08A 2K5UA 1IHOA 1QIMA 2IW3A 1IN6A 1MVNA 4LYHA 3SZOA 3H99A 5I48A 4GL2A 3CWQA 4CQMD 4F72A 3MZ0A 1JEEA 3KIPA 3PLNA 4RXUA 2V7EA 4BGDA 1DXYA 4JX9A 5JD6A 1CJTC 1R0CA 1W5SA 3C8MA 4L7QA 2ZRCA 3RFTA 4D9HA 1MCZA 1SKMA 1NU6A 2GBFA 2Y77A 2I66A 5JHGB 3I5UA 4ZD6A 5FOSA 1GA4A 2C5BA 1SUDA 4D0GA 4EY3A 2QX6A 3PQ3A 1MDFA 2QW8A 3V5NA 4UE6A 2ZJFA 1T5OA 4L3WA 3E05A 4B2PA 2IEAA 1T3ZA 4QRDA 3H04A 2OCKA 3FWNA 1AKQA 1MOSA 3PWKA 3SC3A 2WJHA 2ZKIA 3BYZA 4Y2VA 3R7WB 5YASA 3UW1A 3VPXA 1LUAA 2VRCD 2EDCA 5LQDA 2BT4A 2WJPA 2J08A 1WVGA 2PBRA 3AQIA 2QTFA 5AHOA 3WMWA 2RGXA 4Y6SA 5HA5A 2FWAA 1RXCA 4HNUA 2TSYB 1E62A 4D3SA 4BEWA 4PONA 1M34B 3W2TA 1BGVA 2F59A 3F47A 4G0MA 1NL3A 2XDQB 4JJZA 1CR6A 1DZIA 1E9VA 2VDVE 2QIPA 3GFTA 4AIRA 1E9DA 3GDFA 4D3DA 4QOHA 4XUGB 3JQ9A 4AX8A 2H08A 1EFCA 1L5OA 5L95A 5JJKA 1VB5A 4PVCA 1GG9A 1E2NA 1FTQA 3WIEA 1Z0IA 1YR3A 3F2IA 4YJ3B 3PFNA 5CX4A 5H1YA 2H1FA 3EMVA 2XQKA 2JFBA 3DDHA 4EKDA 4KQXA 5H81A 4S3MA 3L82B 3WNVA 2Z8YM 1NUSA 4YJ2B 1QB7A 4RK4A 3MXTA 1K7CA 1R0YA 1Z7YA 4XYBA 2PJRA 3SZGA 4LDNA 4NG5A 3PNYA 1MO2A 2R47A 3GRKA 4RJIA 3K0FA 2FZLA 4DCGA 3M6XA 3NATA 4OU5A 2EFDB 3ZW9A 4NS1A 4FXOA 4R7TA 1OFHA 1ZCJA 2O8BB 4TTSA 3OZCA 1GZ5A 3MFQA 2YICA 3DMNA 4LE2A 5E7IA 3STWA 1YBAA 3TTXA 4X64B 1TYAE 3W1WA 2OFWA 2ZWOA 5ARCA 1ONOA 2FVXA 4DA6A 3GLGE 3EGVA 4DZZA 4E5DA 5FH9A 5FPPA 2GPNA 5KCMA 5B2ZA 3EFEA 3KTDA 3R4VA 4N3CA 4PHHA 5FOWA 2C7VA 3V8BA 5A4AA 2J0SA 1FF9A 2B1JA 3ZDFA 4CDMA 5HMMA 3LGAA 4JODA 4DIOA 1EDOA 3ZDBA 4JEIA 4MVJG 5J2UF 4PCLA 4RQBA 3BJZA 2ZAMA 3ELDA 1YR1A 1KFKB 3A0UA 4HMQA 1X7WA 5FWNA 4Y7CA 1BWSA 2BFAA 3ZHRA 2FQWA 1E20A 1PQYA 3A4LA 4CM1A 2CFSA 4QXOA 1UWKA 4B84A 1Y7TA 1K0UA 4MRNA 1TQHA 1NW8A 4R2WA 5FUVA 5C31A 4ZYUA 5HZHA 3AR4A 3K30A 4CKCA 2O54A 1J8QA 3WLFA 3L7DA 5IUKC 5BQ5A 4UUQA 4IVNA 2AFIB 3HV2A 4LZJA 1C30A 3FOAA 4AN0A 5AVXA 2CUKA 3DCIA 5CFPA 5EPOA 1UKBA 3HJAA 2HIAA 4B32A 2QE6A 2PFGA 2H07A 1LNZA 1GD1O 3EAFA 4R7ZA 4WOKA 2C9MA 2ENWA 4MKGA 1DELA 3W77A 4CN8A 1RM0A 3ESDA 4KODA 2OHXA 2H7XA 1PS9A 3AEZA 3BXPA 3K15A 1G2IA 3LDGA 2ZRDA 3LO8A 1UEJA 3MINB 3NHMA 4IMJB 3TLJA 3IQZA 3ZK8A 1ZGZA 4EL5A 5AJHA 4MUBA 1ZLXA 4PNZA 2V5UA 3V8PA 4CE6A 2O7NA 4PFQA 4BZZA 1Y48E 4OKSA 1LW7A 3ZGOA 4PFKA 5ICGA 3DAGA 4LWZA 4ZDKA 2JNWA 5ALKA 2GEBA 2BGMA 1I1NA 1K9VF 3KELA 4OEHA 5EIBC 3SYLA 4BNNA 1J2TA 2E1PA 1M6NA 2VDWA 3LO5A 3DYBA 4WK2B 5FKJA 2D06A 3BD8A 3OPQA 6GPBA 2XTAA 4LHVA 1KI9A 1AUVA 1I6WA 1O4WA 4F91B 3KDSE 1TLLA 2VEOA 4P2BA 5FO0A 4B45A 4TM7A 1DE0A 2AMJA 2NO4A 3NT4A 5GIOE 3ZDEA 1KFBB 1RZ3A 3TZQA 3S55A 1BGWA 4EARA 1P72A 3WLRA 1N6PA 4LRQA 2QRPA 1IHYA 3JQ7A 2BFEB 4B48A 3R0VA 5F1PA 4Z53A 1B6TA 1KI2A 5G4KB 3OG9A 3TTTA 4WKNA 3IXMA 5F7JA 3WGHA 3EQZA 5FFNA 4B09A 1JG3A 1J2YA 4PYIA 2Q99A 1JQJC 3EC1A 1R6TA 5JVDF 2OKGA 3K70C 3CZAA 1EFPB 2C8KA 2JBHA 5A9TA 1UR5A 4ND8B 1IBSA 1FRZA 4NG4A 1O4VA 1YS9A 4PN3A 4D5GA 4WN3A 1U9ZA 3P52A 4ESEA 3F6PA 3UH0A 3DAPA 1H1LB 4GX1A 4A0GA 3S7TA 1NW3A 4BX0A 3D6TB 3HS3A 1EK1A 1P7ZA 4UUPA 4LF8B 3GLIE 1TLFA 4GYKA 1W0JA 2XCRB 1B2RA 5AKZA 4KIUA 3E35A 3H9CA 4ZK2A 5FDFA 1TFRA 2OV8A 2IJGX 1EAMA 5BR1A 1E3JA 2ZYDA 3BEDA 1T0HB 3H5NA 5FWDA 3L40A 3B6JA 1JKIA 1U7PA 1HI9A 1Z08A 1A71A 2E49A 3GG2A 3IMEA 1G5RA 2IU0A 5CCEA 1AQUA 2ZBGA 1P0CA 1U02A 2OM2A 3ND9A 1V5GA 3NKVA 4TLCA 5DSXA 4ZT4A 4M99A 3AB3A 4KLCA 4LMBA 2WIDA 4YMWA 1JEYB 3O3NB 1YK1A 2EYQA 3OPYI 4OV6B 1A2BA 3B8EA 3EG9B 3FA2A 3N2NA 4JQYA 3S2FA 2UYCA 3KXIA 4KDRA 5AHWA 2ZR8A 2R1ZA 5LQSA 5E4JA 3DFKA 4UCFA 4RS4A 4YMTA 3FUVA 2ODEA 1KFCB 1G55A 3WDMA 3N5CA 3QG1A 4O2LA 1ZR4A 5HM6A 5JAIA 1FQJA 1GSOA 2QQ5A 2QTNA 1RQLA 3BL8A 3DMHA 4RZIA 1IXZA 1Y3CE 3ZYCA 1LK0A 2PBZA 3REQB 1PJLA 3MQ4A 2VDPB 1XEFA 1WO8A 2DY0A 1HDXA 2GKOA 3KYDA 4IHQA 3TLBA 4Y2RA 4E5MA 4TKVA 5JAMA 1IVYA 5JAQA 3TOVA 3QF4B 5K8VA 4XDHA 2WM3A 2FKAA 4OAQA 2Q6TA 1EVQA 2RBEA 2B99A 3SVLA 5IKXA 4URUR 1YSCA 4J2TA 1D5CA 1NTRA 1XD2A 1WU7A 2E5FA 3FUCA 1PW7A 5K5EA 1ORIA 2DWPA 3GLHE 3GLFB 5AVJA 1P17A 2ZGVA 3SBEA 3NLLA 1N5MA 3T3NA 1BDMA 2CDBA 5LIPA 3OT1B 3C97A 1E5VA 1SC4A 5LB4A 1Z4JA 3GIDA 4EABA 5JANA 1PJ8A 1ZINA 2CNWA 2VC2B 4EHFA 2O2EA 3HKBB 1NURA 4Z4FA 1GTRA 1ZHHA 2V3WA 5E3IA 3UGTA 4TLMB 1L2TA 1QZZA 4R41A 1SXJE 5E2BA 3FRHA 5K3FB 1I2DA 5JZVA 3ZI0A 4WNAA 1W5FA 2HWUA 1RRKA 4EUEA 1VL5A 2D0IA 1E66A 3CEJA 1BO6A 2AYYA 2FLKA 1IJKA 3G8CA 3NFYA 3P9ZA 5TGZA 4D8XA 4BYMA 4KQ6A 1O8BA 5DYYA 3WA6A 1Y3FE 1QTQA 1M1YA 5AM1A 4BJHB 1LFAA 4O2AB 3RVPA 821PA 2IPLA 1V8OA 4J1NA 4ZRNA 3ZIUA 4ENWA 1JEQA 1C9YA 2BKAA 3P7MA 5FHQA 1NTOA 3FDXA 1CJSA 1KL7A 4Q7MB 4L0QA 3GA7A 1JSLA 4GR4A 4DQUA 4DDWA 1XTVA 5LOVA 2FDRA 4MEJA 3PT5A 1DKOA 4R51A 3HB1A 5CYPA 2Z95A 4DKJA 1IL0A 3ZZUA 1QO0A 4ZTUB 3AHEA 4EKYA 3GF4A 4JP2A 4IQGA 1JVNA 2QN9A 4ZZ1A 4RGQA 4I55B 3OTIA 1GRVA 1G7RA 10MHA 2COUA 4NE9A 3CH7A 2J32A 4EI9A 3I64A 7REQB 3K4PA 3NYIA 1H8ED 3TTSA 1LBEA 2FPPA 3CJTA 3DMRA 4JT8A 4Q4LA 5G2OA 3RUDA 4BO6A 5KYYA 1H6CA 1RI4A 4CLRB 2QXYA 2VZLA 3FWYA 4MXDA 2BFDA 1XTPA 2VTVA 4Y6GB 1KDOA 4XRRA 4BWGA 5JISA 1WOYA 1J2RA 2JJ2D 3BHNA 1MC4A 3PUJA 4GZLA 4LAFA 4PAGA 2O07A 1TM1E 3TECE 1S8NA 3F67A 2BOVA 1ULAA 3VDRA 2WKQA 3MWLA 5BV0A 2OVFA 2XMCA 5KYUB 2BZGA 3VR1A 4DW8A 2WICA 4CZ2A 1EWKA 4ZVTA 4XUEA 3FNRA 4KCGA 4LV6A 3M1AA 1ID8A 1WZCA 3BWEA 1WXIA 3TRHA 1LGYA 3UJ9A 2CJFA 2Q2OA 4XWWA 3DFIA 4EG4A 4AU1A 3AF0A 3PJRA 3IALA 5CM9C 1CBUA 4BLPA 4EO9A 1IY2A 4RZSA 2FWPA 2VS1A 2EP8A 5CCXA 2CKMA 2I6XA 2GEDA 3CZQA 5K6AA 4V0KA 5H68A 2CLHB 2LDXA 3LUDA 5ES3A 5KZMB 3L41A 3AFOA 3EF1A 3HLTA 3V3TA 1U31A 1XTUA 3K20A 2RONA 1DDIA 3KOXA 2C0PA 2W5UA 3JQGB 2QTVA 5JJIA 1H4QA 5NLLA 4DLNA 2GPYA 3M81A 2XUJA 1YMVA 2I6TA 1RQXA 3DPSA 3KZOA 4FCTA 1Q91A 4PPYA 3EOAI 5FPSA 5IM5A 1NMEA 1YE8A 4AMUA 3MMNA 5COQA 1PFYA 3S81A 3I3OA 1XEWX 3OHMA 4UUBA 1IDN1 3G02A 3WGNA 3KB8A 4YCJA 4EGQA 1AF7A 4F8YA 5BOSB 4CVNA 3U4AA 3WB1A 3FPEA 4KACA 4DQLA 5KDDA 2BGJA 4TUYB 3NYWA 1BWPA 2M1ZA 1KP3A 2QR5A 3E2IA 3L46A 3F7NA 3JYHA 4UFNA 3TAXA 3VZPA 1PJZA 4P3YA 2NWQA 1D6JA 1SCDA 1EVYA 2QX7A 5D84A 4D0LB 1HYHA 4GDMA 1NVWQ 5KEIA 1PT7A 1C29B 4RESA 5JWOA 4ESHA 4LCEA 4C0BA 3RFVA 2NYRA 4HDOB 1KBZA 3RBZA 1POXA 1DFHA 1KO8A 2NZWA 3G1WA 1D6SA 2DSNA 3UG6A 1NWCA 2ZANA 4WNIA 2PX2A 4D6XA 4B3CA 3UK1A 4MUHA 3MD0A 4GFDA 4AUKA 5JZ9A 3LDHA 4O63O 3PL1A 4KFRA 4DGQA 2AD5A 3S8YA 2Q4RA 5JAHA 3K72B 5FWXA 5DNDA 2WIBA 3N6XA 1W52X 3P9RA 2P9QA 2QAGB 4QASA 3IAS1 4UBJA 1AXGA 3L84A 3PUHA 5D7NA 4Z9AA 3IYLW 4CQMB 3QYAA 2RGRA 1R12A 1TRHA 4EY7A 4B43A 4UHBA 3KT6A 4X00A 5D2CA 5BSUA 4EHIA 5B6IA 1GRCA 3FAZA 1PV4A 1UBJS 1NBME 3HO1A 4QHSA 2XYQA 4C4OA 2XQGA 4TGLA 3ZOZA 3ZU2A 4D4IA 1T8YA 1GTSA 2GVZC 3OH8A 2PY6A 2QVBA 4QDOA 3PHCA 2HFJA 5SICE 2C2BA 3U37A 1R8SA 2H5JA 5CDFE 1A1VA 1QHNA 1YQXA 2BEVB 3P9PA 1BXGA 2OC4A 4F93B 4KREA 3A1NA 4ARVA 2BFFA 4L73A 3N7TA 1B16A 2GJ8A 2VDKB 1XRPA 3DF7A 1NVEA 4BVJA 4DDKA 3ZQUA 5A9SB 4N5IX 1L1QA 1LLDA 2WYWA 3OCVA 3JD2A 4MQBA 1QTNA 3RREA 2VJKA 3BERA 1EFDN 3U4MA 4LXUA 4UPVA 1KQGA 1WX1A 3H2BA 4UAJA 1DT5A 6REQA 5K8IA 3AZPA 3I2HA 1X6VA 4MDHA 5KU7A 1R4NA 2R44A 5C7LO 4H0NA 4F38A 3TZ6A 1OYWA 2B8NA 4HNSA 4MA4A 1QF7A 3UMBA 3ROQA 3GFOA 4YRZA 3C6YA 4H7KA 1WDWB 3DYVA 3R5FA 4KI7A 2C98A 2CMDA 1J06A 2HRDA 1A77A 1X7DA 3IV6A 3RNLA 1AGXA 3FB4A 3QU2A 1JG6A 1I0IA 4MR9A 3QIVA 1BYIA 2JAUA 1YMUA 2JAQA 4D92A 3GFFA 4BASA 4CGZA 3NWPA 3RRBA 4HXFB 2BM1A 3GGDA 5DIFA 1SUFA 2PGXA 2XHZA 2NSLA 3VVMA 3DVAB 3LFUA 4FEYA 2AJCA 2V1XA 3MCUA 1JMVA 1EFAA 1D1TA 2XSZD 2GXSA 4O8CA 1YVPA 2IHBA 1JZTA 3OCCA 2VEDA 4X44A 4BVHA 1WQ1R 4KFUA 2AN9A 3PEWA 4S2EA 4RL6A 2X4GA 1Z0AA 3Q5EA 2PGAA 1KIAA 3NAZA 1I1OA 4KWIA 1WXHA 4R8KA 4V0RA 3TKAA 1P5RA 1GM5A 2NMVA 3K9QO 5FUXA 4LYEA 3TLGA 2UVQA 2V0NA 1PZXA 3QA3E 4CLHA 4JVOA 3TGLA 4GQIA 4I4LA 1QIHA 2C78A 4L8VA 1NN1A 4MGYR 5ILOA 3UPUA 4DPKA 1TZMA 5DGDA 3NO4A 5TRTA 1AA6A 1TMYA 1DJLA 121PA 1I3CA 1A9RA 2A1UA 4EH1A 4WUTA 2A57A 3A3YA 2JD1A 2YJTD 3EGXB 1AH2A 1QH8A 1M2KA 2QB5A 3SX0A 5F1YA 4UCWA 1NV8A 1OTYA 3VPGA 1KQNA 4UVGA 2ZZKA 2HCJB 4DWWA 5HUHA 2EERA 1XVTA 2W58A 5TLSA 3U44B 3E48A 1FNDA 3WYGA 5LVAA 3NWBA 1TVCA 2GUGA 2P40A 1AQYA 4W7HA 1SXPA 1P2BA 2D1FA 4S1WA 2BJVA 2VBGA 4S1TA 3I4CA 1BA3A 4K87A 3SCZA 4IO0A 1JBKA 2YC4C 1DO8A 4P6VF 2Q1WA 4U6SA 5K0JA 4OB8A 2V7QA 4P92A 2WDZA 2CNOA 1JDUA 1DWUA 2YYZA 4C7VA 1PFUA 3DDNA 1UAGA 1L9KA 3KQMA 4GMGA 1STOA 4GGMX 3I01A 1U11A 2QXUA 5CTAA 1G20B 1B8OA 3FE2A 1O5OA 2CMFA 1ZGGA 2JHPA 4FN4A 2PMFA 2HMWA 4D8TA 3NHKA 1EA5A 3QOYA 2X4IA 3LCCA 3ZZ0A 1TM3E 1U2SA 3RF7A 1JA0A 1KYTA 5ADUS 3IOBA 4FFWA 2VAPA 2H4JA 2OB1A 3MIZA 1J49A 2HCRA 3CUWA 1ZXLA 1U8XX 4CMEC 4KITB 3MUNA 2I34A 1A5BB 4MRVA 1RMQA 3WZ2A 1L4GA 3LZCA 2QN6A 4RH3A 1YRYE 3Q3VA 4HTFB 1UJ5A 1Q14A 2CJXA 3THWA 2GD1O 4K5QA 3WGGA 5CVVA 1OV4A 1X19A 2QGZA 1R8JA 4QXRA 3T9AA 3HB0A 1Y4DE 1OAOA 1ESCA 2C04A 3HJCA 2A35A 1OLSB 4TV8A 5DBHX 4B47A 3NHYA 4BFCA 5JS8A 3RI3A 2C7RA 1EFVB 2OBYA 3FNHA 5G1PA 4B46A 1P5FA 3ICPA 3CINA 2ECOA 4WOPA 4OQZA 4HGNA 3SC6A 3UQYS 1SOMA 1H2RS 3I6ZA 4AD8A 1ZCBA 4ZMSA 2IGTA 4YALA 1JHAA 4OMUA 4RV5A 4ZIRA 3DPUA 1TVEA 3IDAA 5D3MA 4DWJA 1V39A 2EWVA 1OLOA 4UEJA 2X8LA 1NHWA 3U3RA 4LGYA 2HREA 3ZV7A 4JFAA 3Q9SA 1UBTS 2EEPA 2NZUG 4PZEA 4CKBA 3T3EA 4IX1A 1WVIA 2D5CA 4LGCA 4RFSA 5ALDA 4GPIB 5DKFA 1YZFA 2MSCB 4JOBA 1E79D 2BMJA 5FF9A 3U3XA 3WL3A 2CKDA 5EHZA 2X7HA 3PGLA 1W46A 5JNLA 1CYEA 2R25B 4X90A 1TJ3A 4WEOA 1S1MA 1TK9A 4WKCA 5MHTA 3NPAA 4B7ZA 3JAWB 4HHEA 4JB0A 4CLOA 3T7AA 3FPJA 1BRTA 2AG8A 1XR3A 3IBFA 3JAKB 2XZLA 4EMUA 5LFAA 3INRA 2JBWA 1QPBA 3LUAA 4PG6A 3NIWA 1Z12A 3RUIA 1P0FA 1HXHA 3UUEA 2FEPA 3TB4A 2A9VA 4RJTA 5E1OA 1H23A 3CVVA 5J23A 4NOMA 4YCSA 2HCTA 4MRPA 2OENG 1E2DA 2XI4A 4IDOA 4JU9A 3A3PA 1NT4A 4NH4A 2NVUB 1T5BA 4AK9A 5BNWA 2W98A 1E5LA 5JYDA 2ZP1A 3OT5A 2VP6A 5J40A 3I8XA 2O8EA 4NJEB 3NBMA 2MINA 3AIIA 4MVJD 4K6CA 4YCDA 3GZJA 1AOXA 1QBGA 4IDNA 2OO5A 1SELA 3FLAA 5IAJA 3GJ3A 1MIOB 1RYBA 1H0SA 5J2TF 4E4TA 4DQVA 2A58A 3QE3A 4ZO6A 1ZJ4A 4GGOA 3F71A 3VPCA 3HI4A 3C6XA 4KBGA 1J1ZA 5T5QA 1W5EA 1GTVA 2RHWA 3BTOA 3K0CC 1AURA 2XDAA 1E2KA 4M9RA 4PIMA 5IM4F 3C3JA 3E1KA 4PO1A 1NW6A 2OP1A 5B57C 3EXG1 1VJDA 3FYHA 4V38A 2PQ2A 3AJ9A 1RQ7A 3ETJA 2WA1A 1O96A 2Q6LA 3MJTA 3PE6A 4KPGA 2CC2A 1PVDA 4WFKA 1QGUA 1J5XA 1T1SA 4QDUA 3TZEA 3DBLB 3LWZA 2Q3JA 4L22A 4RFVA 5EN4A 4WD3A 5H3HA 1EGHA 2D1QA 2IEYA 2Q28A 3PIDA 4IRUB 4KL8S 1RAHA 4RYDA 4CG1A 1BS2A 1RYYA 1MT3A 2X5JO 1UWVA 1CRPA 4QXQA 1JFRA 4P33A 4DCVA 1RWXA 5FBLB 4IOKA 4ZQBA 4MYUA 4UULA 2ZSBA 5JXGA 1JHQA 4DXHA 3TOZA 2UYGA 3R9XA 1FNNA 3AJDA 3N0RA 1QR6A 4S2UA 4K40A 2QPLA 1YR6A 4WY2A 1JHZA 2QXTA 3DZCA 4ZO4A 3ANMA 3L9WA 1MABA 1KY2A 3O4RA 4FWTA 1KBOA 1HGXA 3HVIA 1E60A 2R6HA 4ILKA 3IA7A 3HXLA 5EMHA 2OV2A 4Y6OA 4FTWA 4IEIA 3VAZA 1RM4A 1GUAA 4ASUA 4IQ8A 2LPMA 3AF2A 3OQMA 4KZKA 5KNBH 5C34B 4BS9A 2BGKA 2G71A 1L4HA 1HO3A 1L8QA 2NM0A 2LTAA 1U2QA 3AEKA 1WMDA 3GNTA 3Q1LA 4HXEB 5DLQC 2OPHA 4LHZA 4C4SA 3R7LA 1LWOA 1T8SA 1ULBA 4N0MA 1W2WB 2IDKA 3MWDA 2JCBA 2WJGA 3DHYA 3WLEA 2DLNA 2FPKA 1WPRA 3U0BA 4HCJA 4MV8A 2FJPA 4IFTA 2FKNA 1GY8A 4MSUA 2O57A 4PS0A 2JI4A 3T6KA 2PZBA 4DS3A 1ADJA 4WV3A 1EFLA 4NCXA 5LKRA 1LF0A 2A3NA 3RTGA 3D3WA 2YXLA 3RVSA 3V7NA 1Y81A 5IT5A 1GTMA 1QK3A 1NUTA 3FTQA 5JROA 2IUTA 1SCKA 3HSYA 2ETXA 3ETGA 5K0SA 2FI1A 4BVBA 1D2CA 2FZ5A 3LUFA 2Y0BA 1KETA 3N8IA 2ZR7A 4TL7A 4Y2PA 4ZN6A 3GGSA 4TQUS 1M6HA 1XB2A 2JAXA 2W6JA 2WIFA 5P8WA 2IYSA 3V7YA 4QJBA 5JPCA 1VPEA 1AU9A 1O6ZA 1CZLA 1E6WA 3LC7O 3E0XA 2JIDA 3KZ1E 4N9QA 5CVJA 4ZOAA 1FTSA 3CVOA 1SUAA 1YQDA 1WR8A 4QLBA 4Z7JA 5K2MA 4DCMA 2PO5A 4ZCMA 4KI0A 3GCDA 2EBWA 2M6KA 3ZE7A 4UREA 2R7NA 4EYKA 3NTLA 4O4IB 1E7YA 2GWRA 4JL5A 3UFXA 4RD4A 2DUMA 1JFFA 2WD9A 3EXAA 1UH5A 3D7LA 3ZW8A 4HJRA 1EWQA 1JJIA 3GCZA 3IUMA 1JQ5A 4Z2AA 1GPKA 4L4YA 3S1LA 3CZPA 1TK3A 3TR5A 1IZ8A 3EW9A 4IXMA 4OAPA 1ACLA 1JKFA 1DBWA 1R0SA 1UBLS 2HU8A 2BMEA 2O6HA 2PKEA 2X9GA 2Z57A 3QU9A 3S5UA 4JROA 3ED1A 4H1VA 4JVMA 2PQ6A 3BSWA 3EZNA 4AB1A 3NJ4A 2G7ZA 2V7XA 1OWNA 3GHYA 3I9NA 3Q98A 4M1EA 1KAGA 4TWZA 1KVSA 4JI5B 3KJFA 1TT7A 3UV7A 2LDBA 5HTKA 3WKAA 1P77A 4MVYA 3KFXA 4GVLA 3R76A 6ABPA 4DV4B 4OHKA 4HPJB 3WTBA 2ZVQX 3HZZA 5BN1A 1E7SA 2C3OA 2WP0A 2V6IA 1L5LA 2V74B 1AXEA 3CRVA 2PANA 2QD1A 1JI0A 3HKDA 4ZKEA 4YCAA 1XRMA 3GU3A 2J6HA 1E6UA 2I2WA 2RJ3A 4WXHA 5AIAA 1RHRA 2P6NA 2FRDC 3VOTA 2VQEB 4FSHA 1JSRA 3Q41A 1D04A 1OU4A 1WJGA 4MV4A 2OSVA 4LF7B 1P9NA 3TJZA 3UMJA 2NXNA 2BC9A 4Y67A 1KI8A 3NV7A 2FPIA 1LV7A 5IJ9B 2GN1A 2PHZA 4MQMA 3G2PA 1PLJA 3DCJA 3BWVA 3ICVA 1MEEA 2NTEA 4U9HS 5FPKA 4JI0B 1SZJG 2RGYA 1QQ7A 5BSEA 1Z2PX 1M2JA 2C4UA 3C6ZA 1W93A 3LS2A 1J09A 4GMDA 2HHAA 2VDNB 1G16A 1RMTA 3DZGA 4IZHA 2DWUA 4JGBA 4OH7A 3U48A 5JDIA 1EJ2A 3WJAA 1P4HA 4P53A 4K6HA 4K86A 1LRJA 3BPSA 3F74A 4X92A 4P36A 2WAYA 3TRKA 1V96A 5ESDA 5FUYA 1D2AA 1XQWA 1QH1A 1RP1A 1RRPA 2OCXA 1BX0A 2WU4A 4WZZA 3E03A 5CR9A 5TPZA 2HA5A 3K8OE 3T52A 1E77A 1B6RA 1UZAA 2Q45A 3PYMA 2IPAB 1UFRA 3C3KA 1N77A 1LQTA 3I6MA 4POOA 4Y1EA 4B6EA 3RVOA 1U1IA 3B7GA 3BGVA 1ZSNA 2F4VB 1SVNA 3I04M 3LFTA 4LJ9A 1JHVA 3RS9A 2C94A 5FIUA 1JTFA 3IHLA 4ZJUA 5KSYA 1XEXB 3CIFA 5DGHA 2OWDA 3A9RA 2NXJA 1RKQA 2IIQA 3CKKA 5AM5A 4OFWA 4PPFA 3WB9A 5KWJA 3WMRA 4I2VA 1NN3A 3OQ1A 4L6CA 1VBNA 4EUKA 2AW3A 3IUNA 3GN2A 1NY5A 2J3QA 2D2EA 2QI9C 2EFJA 2VYND 2QBYA 4M1KA 2FUNB 4BO1A 1UAYA 4PYOA 1PWXA 4Q4HB 1DB3A 2LBPA 2NP6A 2CDAA 3EGDB 3HUFA 4NZOA 2WY2D 3U3ZA 3VR4D 4DBZA 4EHJA 1KTVA 4R98A 4OYRA 2XOKD 2HRQA 4TROA 3NIBA 2ZM5A 1PR3A 5BWOA 4ZDWA 1XVLA 1TDJA 3I0MA 3P2KA 3PFFA 2WFLB 4XYMA 4CTJA 2PXHA 4LTMA 2AF4C 5GZ6A 2VWHA 3K2EA 1F9EA 3H9QA 3DFUA 3TNLA 3QBJA 5FEUA 1J9GA 3AO0B 1J0EA 1Y7PA 4JC8A 2AOTB 1KAHA 2HBRA 2JJ1A 2ZQZA 3GH1A 3HCNA 3M4XA 4WA8A 3IB3A 3E61A 4F84A 1QQ5A 2XDYA 1U7TA 4WVFA 2WSSD 3OLWA 3JARB 1PBTA 2PCJA 3EUWA 1V2HE 1Y3AA 3RUPA 1BEUB 5GJVC 1AM4D 4JLMA 4LX0A 4MVXA 5JARA 5JC8A 4Y6RA 3OJOA 2HRCA 3SFTA 2CV0A 4C0XA 4EMSA 2XV1A 3KYIB 1ZUNB 4OO3A 1Z63A 2P4EA 4X91A 1TAGA 4ETIA 5H5JA 4B6PA 3C7TA 2P4QA 1QHHB 1JHPA 4P54A 4LY9A 4Q1BA 5C8XA 4BNMA 3H7AA 5DNCA 2GK4A 3N28A 1PR1A 3U0VA 2HA0A 1O08A 1RSZA 3F49S 3FB1A 4WCFA 1Q15A 4Y9UA 3BSYA 3ZLBA 4G41A 3B6IA 3ORQA 1CR2A 5CJPA 4QBHA 2H0QA 2GGSA 4QPPA 4BNUA 1V6CA 2O0JA 1W36D 1Y8CA 2ODNA 2OG1A 2YCBA 4D1YA 3B7PA 1Z5OA 4F3TA 4CLDA 4OGLA 3V33A 3F9IA 4UMEA 1ZBDA 1G66A 3LP5A 2YX1A 2J5XA 1I0ZA 2XQVA 2PMDA 4HADA 2WBLC 4DCSA 2NO9A 1GAWA 1W35A 1BX3A 4E2FA 1ZEJA 3I58A 3TNJA 1Y4AE 4NMWA 1AKWA 1E0AA 2O2ZA 1W30A 3KV3O 3T7DA 4E13A 3S6JA 1FMFA 1QU2A 2JCXA 3DEYX 3C1AA 4LISA 4PFJA 2F1JA 5LC1A 2FX3A 2GEJA 1WDLA 2XNSA 3B3QA 4CFSA 3OUTA 2OA0A 5FV7A 3MUFA 3GT7A 4UBIA 2O5CA 1VIDA 4LOHA 4MQEB 1TB4A 2V6FA 4MJLA 3SC4A 3O1IC 1XNGA 1AS3A 3RABA 1D2NA 1GA1A 2R8OA 3RE1A 1YT5A 3UXYA 4MW7A 5CM2Z 5MFZA 1NI4B 2Q4BA 2I8CA 2P27A 3B53X 5ALHA 1G3RA 2AR9A 3PQ2A 1T9DA 4BC1A 1ZWLA 2BEUA 4DJTA 3PUYA 1OC4A 3A37A 3ASYA 3CE9A 5ALYA 4EVIA 3TXXA 3IUYA 1N5IA 1P0MA 3QVKA 5L9AA 5EXSA 3ZDYB 3TCXB 1ZVJA 4GP9A 5JZSA 5M5BA 4HF7A 1WNTA 4KMMA 4JT2A 4TSFA 4QGHA 5BWLA 1IXKA 4AZSA 1XGKA 3LYHA 1WUHS 3KTOA 3EAQA 2QX4A 4E30A 4B87A 5EXDA 4OXXA 3TGWA 1REQA 3FKSD 1Z15A 1MGPA 2QVYX 3KM0A 5EWMB 1JN0A 2Q7OE 3UIEA 4LDJA 1UBMS 3KT3A 2EBHX 3V4ZA 1T36B 4JUFA 3ITDA 2GN6A 4KKXB 4ZOBA 2QMOA 3VV3A 2ORVA 1O89A 1YE3A 3AF6A 4OHPA 2JLAA 4BFLA 1UMDA 2C8LA 5CM8B 1EK0A 3EXIA 5EWLA 3AR2A 4M0CA 4ZAGA 4QDKA 4Y2SA 4P84A 1NRIA 4KQWA 3HWX1 1WCYA 2F8TA 1EWVA 4Q4JA 2SKDA 1J8FA 1J1IA 2YXDA 2PT5A 3C3CA 3DMPA 1LEHA 4JJAA 4E3WA 2I91A 1CY2A 3SHOA 1CZOA 2R7KA 1GPLA 3NBXX 1TMOA 1VJGA 2B4RO 4P5DA 5JMTA 2H51A 3IPAA 4FFNA 1X8KA 1IN4A 2QRMA 2NTNA 2BUBA 3ZQKA 3KQYA 1H4SA 3MT9A 2AOUA 3O8QB 4DEXA 1PO7A 5A2QA 1NFRA 5LXTB 4ZHQF 4EF6A 4CIVA 3AX6A 3OECA 4N82A 3T54A 3WRYC 2ZYTX 3DVRX 2PL5A 5HF6A 2DFTA 3LX6A 3MXOA 4JQCA 1DUSA 2B30A 3ZWNA 1OILA 5CH5A 1FX1A 4CUJA 3I5AA 1ETUA 1F48A 1C7JA 2GN0A 1Y1RA 2OY0A 2RH9B 4OSPA 3FGOA 3GLGA 2AOXA 1R8XA 3ER6A 3GDHA 4UMDA 1PZNA 4EMBA 2Z58A 1WZNA 2XB8A 4KAXA 1A9PA 5GIPE 1QMGA 3DV0B 3OZRA 3U4CA 1Y9EA 2NSHA 1HE3A 2DFKB 3FZGA 4PGMA 4CMCA 5JQGA 3IVRA 4CL8A 3H5IA 4IMRA 4HB0A 2YN0A 4GC9A 1YZTA 1TKCA 1DX4A 2DBYA 5FLYA 1A9XA 2WWIA 3OETA 1LJ8A 1VMDA 3PLRA 4LRUA 4CM4A 3Q3GE 5E8JA 1HTWA 3HR4A 1ZNYA 3EMBA 1M2VB 4PQYA 3RDPA 3ITEA 1YVUA 2KMLA 3WXBA 4WBNB 1Z07A 2YUTA 3EXEB 2ODTX 3RS8A 2DP4E 1T4CB 4Z8XA 1FX0B 5K3CA 2CBXA 1NJ5A 2QRVB 3OCZA 2QVXX 1VC2A 2V97A 4RF2A 2R6AA 4QOFA 4C7OB 2XA9A 1NYTA 5MN4A 4DSOA 3CLKA 2CZGA 2VWPA 4IUCS 5DEOA 3TQRA 3WGZA 3I6BA 3PI7A 3A1SA 4D81A 4A2CA 4ZO9A 3ZU5A 1G9XA 4M88A 1HDCA 1QVWA 4QPDA 4PLPA 3HEBA 4UVDA 5ELLA 1ULTA 5I4BA 1NBWB 3RO7A 4CL0A 3HN7A 2DT5A 1ZD4A 3I1FA 3LH5A 4GPBA 1IXYA 3DWIA 4RIIA 2H2GA 4MW1A 2WWWA 3G5MA 1QK4A 1L4FA 3AERA 4C0AC 4RGBA 2RAPA 4MTLA 3OUZA 3ESYA 3RC7A 2OGZA 2NZ2A 2Q8NA 2QRNA 4BMSA 1W47A 1RQPA 1V1RA 4RKEA 4KXWA 4WZ6A 2RAVA 4D9JA 4REQA 4HQNA 3QSGA 5ERGB 1N6HA 4LBYA 4G5RA 4ARCA 2O3RA 1YQTA 3FM9A 3Q72A 3DGEC 4R05A 4NZPA 4XKJA 4EWLA 1NPDA 2K4MA 4XLTA 3OZDA 5BV7A 4GKJB 1XBTA 2HV8A 1G98A 2OT3B 4QFCA 4F4IA 1OGYA 4ZZ2A 3BH0A 3WNDA 2YOFA 1A2OA 1E18A 2QTLA 2UZAA 1X87A 3F7MA 4D98A 4ZV9A 3LUHA 4TWJA 2Q62A 4YUVA 4ND3A 2P2DA 2C4KA 3NNNA 5H0IA 3QTTA 3RYFA 2Z09A 1UBNA 1ZOOA 3T0IA 4IPTA 4DJJA 5HZMA 2BGGA 1VRCA 2R1TA 3FLBA 1YZUA 5DCYA 4QZVA 2GUWA 4G5HA 5DBGA 4GX5A 3WWZA 2R1VA 2PRJA 1B4DA 3G8BA 4QJ5A 1WWKA 3CA8A 2WM8A 4F5YA 3BMXA 2XGJA 5ER6A 3G2JA 3FNGA 5DYWA 2QHXA 1WBBA 4UD6A 4F5ZA 2PKQP 2XUIA 3AUXA 3QJ5A 2PMEA 5DT9A 3L4EA 2Y0CA 1P29A 3WLKX 3ZG6A 3JWHA 5JV5A 1S96A 3PGKA 3GLIA 4FYJA 5JQWA 5AI9A 2P5SA 5JYEA 4TKUA 5FP0A 2ZUFA 4HWPA 3GC6A 3G89A 1KEKA 3B1FA 2HGZA 2JGMA 4MK4A 1DV1A 4AZTA 4ED9A 5ALLA 4KK3A 3QEAZ 4ZU6X 3S68A 3ZV6A 1CEXA 3GOHA 1R4MB 1X80B 2BGNA 1RIFA 1EFKA 2G5TA 2GK7A 2FYTA 2IT1A 2NPOA 1G8PA 3L1UA 4QUAA 4X8LA 2E48A 4XM0A 1GUZA 2Q2QA 1Q57A 2PXCA 4KXMA 1JU4A 3VR3A 3M3HA 1AG9A 1Q3TA 3CJQA 3ONEA 2QTWB 3NTVA 4YIKA 2PLWA 3LRPA 3NOVA 2EOAA 1P18A 4RE6A 2JA1A 1G4UR 2G8NA 3SSAA 5DM70 1ENYA 1X8LA 4JB3A 4G25A 4ZALA 5F3RA 4NCBA 3D9QX 1MAHA 5H7XA 3TQHA 1PJQA 5CA1A 5DISB 3AHGA 5AW0A 1UF9A 2C95A 3CSSA 1FYFA 3FVRA 5AIBA 3IRUA 4JK3A 4X6YA 5BSTA 3FIJA 4CV1A 3KQKA 1ILWA 3J7TA 1RW4A 1C7FA 4UAUA 2X0KA 1I2CA 1P7WA 2VPIA 4R16A 4S1OA 4DLWA 3ADCA 1VPVA 1M0EA 2BGRA 2I6GA 1V37A 5F2EA 3W8FA 2ZDQA 5HDQA 3OBBA 3DAYA 5EIWA 1MQ9A 1QV7A 1DX6A 1NQ5A 4TT3A 5E6UA 1SOAA 4MP6A 2PZAA 4EPTA 3VO2A 1RBYA 4DIFA 2ERXA 2PKYX 3KTAA 3GLHA 4WQMA 4UQLA 1M6WA 5TQ2A 4J7CA 1XRSB 3TW8B 3ESZA 3PRYA 2GM9A 5EAIA 5FUBA 4MJXA 3RU7A 1DIRA 2AA3A 1BRMA 1DKNA 2VYFA 4HNAB 4JYPA 4L9WA 2AC7A 5B36A 2W48A 3CNBA 1QVZA 2FDXA 5DRYA 3ZHTA 4BO5A 4G9EA 1JKMA 5IJ0A 2L0XA 3AF5A 3BXXA 4G2TA 4BMVA 1X38A 5BMVA 1GT91 4R7GA 1SXJA 3ROKA 3D5EA 4KLRA 5JRZA 2JVKA 2X42A 3WNQA 3TQOA 1SWWA 4JLAA 4LOKA 4JX8A 2A6PA 2IU6A 3EH1A 4Q1CA 3S2EA 2FR8C 3AF4A 3GFGA 4JYBA 4UOZA 2JJMA 5K01A 3BVPA 1II9A 2PE5A 1HLFA 1Y1SA 1UXIA 1TYBE 2VUTA 1M33A 3PSHA 5C3UA 2E0IA 3W6NA 1UJCA 1WZEA 1DDGA 2RKWA 3LMKA 1BXRA 4LQDA 4TL8A 3NBKA 4C21A 5JYCA 2MSLA 3OOJA 1SBNE 3S1SA 3AW8A 4DJ5X 4ZOEA 1CETA 1E89A 4TT8A 2EXXA 1W8DA 4P93A 5DI3B 1EUCB 1WD7A 1EVJA 2G17A 2IITA 4DVGA 4M7RA 1W29A 3OU2A 2HSJA 4TLLB 4C3VA 4DGSA 4YGXB 3E58A 3M9XA 5BVHB 1JLKA 1E3TA 3FOFC 1XLUA 4YV0A 4DLPA 2A5GA 3NOQA 5JCJA 3FZEA 3C85A 2D0PB 1V1MB 2PD3A 1L4EA 2HA7A 3GVXA 3KLBA 4CUZA 4FYPA 1RVV1 3AR5A 4TTVA 4XSVA 4UHCA 2WI8A 1E0SA 3GJRA 5KNCH 3W9SA 2XADA 2ZWIA 5DNVA 1ZOPA 5BORA 2R68A 4ZI7A 1KORA 1XJCA 1A4XA 2XQJA 2IV2X 4BZPA 3C7CB 4FFRA 4EENA 5KYXB 5G53C 1E4EB 1FDIA 1LPPA 2J45A 2FK7A 2VSFA 1SUBA 4W6ZA 1E1CB 2PH1A 2G4CA 2WAAA 1ONBA 3Q9NA 5HBGA 4MI1A 1XFDA 4FYWA 3SQWA 4NBSA 2IUUA 2PWZA 4XM2A 4BFWA 1BQ3A 3QUQA 4CFZA 2GZMA 4F06A 2K2WA 2PYIA 3O93A 1L5FA 2YV2A 4A6DA 2ERYA 3LSTA 5JNTA 1EX7A 1UM9B 5FNVF 4HOYA 3TJRA 3DOEA 2VZ0A 1SCBA 4XXHA 5BMOA 5K20A 1UZMA 3O8BA 1CS0A 5IN4A 1V2GA 2ZUBA 5BSHA 1PN3A 1HR0B 4KUGA 2ONZA 1WP9A 2JGDB 2I9KA 1C9MA 1E1YA 2J7PD 3D6HA 3MIIA 3MTGA 4RHXA 1XRNA 3KWMA 2CLDX 1JLLA 5D51S 1HY3A 5TEVA 3B1JA 3AR6A 3UANA 1UXHA 3ENNA 3OMWA 3I0NA 1E92A 1CUGA 2AJDA 2D3WA 1ANKA 2KPOA 4GT1A 5FQNA 4DADA 5L8VA 2QE7D 1FFAA 3LA8A 3RRYA 2OAP1 4AJ2A 1SU4A 1QG4A 3IVAA 3JTMA 3U7QA 3V2HA 3NOOA 3I61A 5M2QA 7AT1A 4MQ4A 4J7XA 2B4TO 3EOBI 3SDSA 3OU6A 1JFVA 1FOEB 5H9WA 1Z8HA 3FCCA 3VYTB 3HEMA 1W36B 3A9SA 1YI0A 4LDRA 4W9NA 2AXNA 1RKXA 3ETLA 3F8WA 5HKOA 4EYQA 1TF5A 1JQKA 1SD5A 3CWZA 4XX0B 2DWQA 4Y1RA 4EHHA 2NTYC 2VH5R 2J3EA 4UASA 4E2XA 4P3OA 2PUVA 4F4DA 2R6FA 1RLIA 3BTUA 3C5CA 3PNOA 3IIJA 5SY6A 3GBVA 4JJ8A 4PG4A 3RJMA 4TMFA 1W4BA 4LWPA 2B92A 3V4LA 4R4JA 1NQOA 1OB5A 2HJ9A 2XHEA 4NICA 2Y27A 2ZIEA 1WE2A 5DB4A 4W63A 4IJMA 1NI5A 3CZRA 4A6PA 1Z25A 3BFJA 2NTJA 1ZK3A 3SY8A 3K8ZA 1JECA 1R64A 3ND7A 1BE1A 1T6ZA 3RVRA 2WFZA 2FOLA 3G5TA 4J4BA 4WEQA 3ABRB 3GCXA 4H60A 5HKKA 4X65B 1O94D 2I2CA 2O52A 3EWNA 3ZGLA 4ER0A 3UFBA 3DOFA 3TAHA 4BX9A 3W7BA 4QYSA 4JI4B 2VHXA 2PTGA 3I32A 2P8SA 2R00A 3M3PA 5CVDA 2AR7A 1POWA 3HABA 4HDKB 3ZY2A 4EKNB 1RJFA 4ZAYA 4E6PA 4GWGA 1TU4A 2VPZA 4R8LA 3JD3A 4IEEA 4TTAA 1N6LA 3KYJB 3SR4A 1WD5A 1NPTO 3B85A 1XJWA 2IUSA 5HF8A 3O1JC 2DETA 3NGXA 1NBMA 4AZ0B 3ANNA 3LPMA 1SEPA 3OM8A 4RCVA 2J5BA 1L7PA 3T1TA 1HTTA 1N2EA 5CGQB 3E9ZA 1VHLA 5J4HA 1GGMA 1MX1A 4FFBB 1RXYA 4J91A 4L16A 4O4JB 3VU3A 5CDFA 5C7YA 2HEGA 2Z6VA 3LZDA 1OIWA 3JTEA 4E6EA 4ZJZA 1V6AA 2G9QA 3DBRA 2XKJE 1EH5A 1CCWA 1KF0A 1L8XA 5FV4A 2Z4SA 3WBJA 1UXOA 1RABA 4C7BA 3TDNA 1ILEA 2DHCA 1X1AA 2XQIA 3KPUA 3OTHA 1VYTA 3IE0A 3QH4A 1NSFA 2F3TA 4I5GA 4UM9D 1W4LA 3J81k 3PPIA 1DKUA 3BL5A 2AQIA 3I83A 1BQ4A 5ANRB 4G5SA 2FRXA 4D9MA 4CPDA 1HX7A 4BEBA 4WZBB 3FTPA 1A5TA 3EISA 1FYVA 1I14A 3OFNA 1JDVA 1OA0A 4Y0VA 3VH1A 5CFZA 3BA6A 5T41A 2AVDA 3FKQA 1ISHA 4QYWA 4CTNA 3GR6A 4OUDB 3QOFA 3S2YA 5JDCC 16PKA 1GTJ1 4RPLA 5U4XA 3ZWPA 1V3QE 5HK8A 3ZWDA 2ZIZA 1YA4A 4IOMA 4LDQA 3WNZA 4RIFA 2QYOA 2PLFA 4HP8A 1DAOA 1SVKA 3NUGA 3OY7A 4BQOA 4MRSA 5CLIA 2VYCA 1ES9A 1YQUA 2X3FA 3AB7A 2DWOA 3C3EA 1EFRD 3UK7A 4AWAA 4E88A 3G2NA 3L0DA 3THYB 1P61B 3BD7A 2FN3A 2RIPA 4OFZA 3JWEA 1J5PA 1DC3A 3SS8A 1QP8A 3WK7A 4ZT6A 4KWHA 2PPLA 2B69A 3ZY4A 3T4UA 3ADKA 3LXRA 2J67A 5DHSA 4GZ3A 2PNJA 3QLTA 1CUCA 5HPYB 1XLTC 3OE1A 3BHIA 4I5IA 2QMEA 3RBVA 9LDTA 2HHLA 5KNDA 1T1JA 4LOIA 3RG2A 3LDUA 1M34E 1UDBA 1VYHA 1NX9A 2PEZA 4CYMA 2F8SA 2A84A 4YASA 3BXOA 3UAWA 4P4TA 2FUEA 3FPGA 1T2EA 1PEAA 3MS2A 4L08A 4U3JB 1RAIA 3NDIA 4INJA 3KR1A 4RJ2A 4ZMBA 1JRLA 1PP4A 4XIYA 2Z6UA 4BQEA 1RE0A 4X45A 3I2GA 4P8RA 1QLWA 2IS2A 4Z1MA 2EKQA 1TC2A 2QUIA 3KOZA 3ZH9B 1KXZA 4B3SB 2Y71A 2OTCA 1T5IA 3NEYA 2NADA 5FI0B 1HT3A 1BE6A 2O20A 3BMCB 4UEQA 5IG2A 3G0HA 4GQBA 4L51A 3HWRA 1GN8A 1RD4A 4GYYA 2JH8A 1VL0A 4WTOA 3U7RA 1UKZA 3OLYA 3ASZA 3L5OA 1A3CA 3LCRA 4I4CA 3U4QA 3I2JA 2O0MA 2Z3ZA 4YJFA 3HCDA 4J0CA 3TD9A 3CZ5A 3FPAA 5L3SA 5IW8A 3MT8A 5MN5A 3G2QA 2PGLA 3MQFA 4CMEA 1E2GA 4UBMA 1R8QA 5BPFA 1D8TA 3F4KA 4D8UA 4R83A 1Z6YA 4LDZA 3FNEA 5CBPA 3QX3A 5GONA 2NQ8A 1SBYA 3E7XA 3GUUA 4F5WA 4YPVA 1G9TA 1T15A 1JHOA 1SU8A 3H97A 1HYBA 4RSRA 2WTAA 5CEJA 5DZSA 5C0OE 1KI6B 3DKRA 2PO7A 2JGEA 4HVTA 2CBGA 3K9LA 3FTNA 1NNLA 1ZIYA 2NXEA 4JHXA 2DOKA 4RXTA 2VA8A 2VNAA 4U0KA 1QM5A 4Q05A 2OK8A 5FR2A 3MUOA 4OJYA 1EQAA 1VSUA 3E1GA 4JLNA 1Z6GA 2FA9A 2QD5A 3AKCA 3NYRA 4S0XA 4LFBB 2AR0A 2Z5GA 2FP4A 1L3BA 3TVYA 3N9IA 5KJFA 2B0JA 2FXVA 4JGIA 3U56A 4KQKA 1WW3A 3MRXA 1D2GA 4CKEA 3UKOA 3FHOA 5E4FA 4O3MA 1SJ9A 3HCAA 4AECA 4Y2HA 3OPXA 1H8HA 3DTTA 4WH0A 2A9QA 2PCLA 3DT6A 3QYPA 2G06A 5G02A 2XXBA 4Q82A 4B6GA 1AV7A 3Q88A 4I3GA 4HEA6 1H4VB 5F51A 4B4DA 4H7JA 3CGWA 1OWMA 3GN1A 1JQAA 1AKEA 3P0JA 3QUSA 3FOEC 1S8OA 5CDYA 1KVRA 3PHGA 5KJEA 5KDOA 3UV3A 1MEOA 2VHEA 2EYUA 4EVQA 4X41A 4MUGA 2QZ9A 4P80A 2YFKA 4JP5A 4MI3A 1QJCA 2IH4A 1DWOA 3AZOA 3MMPA 3O5AA 2W6IA 1CYDA 3K09A 1UCFA 2B6HA 1ZIOA 2BJHA 4WLVA 1TK2A 4Q9IA 1RPNA 1KKMA 4G9GA 3THXB 5DHFA 2VFAA 4FFDA 5L7WA 4EHKA 5AVRA 4UDXX 4I6GA 1WKVA 3DVSX 4N8SA 4EUSA 2LNDA 4C5CA 5AKYA 3IT1A 1GGKA 1YHNA 1RMYA 3WICA 3T9EA 4U7TB 5EY5B 5KVVA 1BFUA 4QRHA 3S0JA 4RXMA 5IJAA 1H05A 5LNK1 1YIDA 4K6GA 1Z73A 5IC6A 2R87A 4M60A 4ZRMA 2DLCX 4JV5B 1JNYA 3CJRA 4PAMA 1D0SA 1CY0A 2IYFA 4DQXA 3W06A 4Z1OA 1JXAA 2AMLA 1E2IA 4MKZA 2DWCA 1GGJA 3ZC3A 1E2JA 3DMDA 1SGWA 2B1IA 2Z9DA 3D7NA 2W6OA 3BDAA 4GGPA 1DXOA 2LCFA 2NT4A 1JHDA 4H77A 2JGKA 4FI3C 2YHIB 4C2AA 5F2OA 3W2HA 4EL0A 5IVKA 2XF8A 2Z5LA 1LQ2A 3P5BA 3CMMA 1IJBA 2A5DA 2VOEA 3H2IA 5KQLA 5I7VA 4M0FA 5SZIA 1RVDA 1D8AA 2K6GA 1I4DD 1H69A 1GAJA 3AUKA 4E12A 1ISJA 1RJ9B 2MSNA 4OHFA 3PJDA 4LJAA 2QT1A 5HDBB 3ZCQA 1MJGM 3IUQA 3S28A 1V45E 2B78A 2H6EA 4P82A 4INOA 2IVZA 1H2HA 1L5VA 1PDOA 1VLLA 3QPUA 4HH1A 2DFDA 2E82A 3EZLA 3MNFA 5ICMA 5KOHA 1LDMA 2BM9A 4I50F 1DVRA 2RJNA 1K1EA 3PDUA 4LXIA 4YGYA 1BMDA 4K0KB 1YR9A 3IAM1 3ETCA 2PKCA 2Q5QA 2GLTA 1XI2A 3O8RA 2HDHA 2J3DA 5HZGA 2QUZA 3T5MA 5LR6A 1KIFA 4OJNA 4XQCA 2QAIA 4OA8A 3TCNA 1NVAA 3KLMX 4QG7A 1UODA 2QM3A 1GL9B 3T41A 1ZN9A 1UKCA 1E3EA 2WHPA 4IIVA 2NUTA 4CU2A 1JR6A 3HA7A 1HSZA 2ZUUA 1QANA 3I3SR 4DG8A 4HEA1 3TZKA 3ZK9A 2CZCA 1WCV1 3SLGA 4BVLA 2YNMD 4YVFA 2QYHA 1Y7HA 1ODTC 5KYTA 3G8YA 4LVUA 1AGRA 3EQ7A 1IXRC 4MYRA 4P35A 2BIFA 3A4TA 1BXKA 3H84A 2GTHA 3WQQA 3EDRA 4Y9RA 2AH5A 2BI8A 4L9RA 4TMKA 3A36A 1Q74A 3T95A 1Y6ZA 2XMPA 3L7AA 3UAGA 1JSZA 2ZUSA 2YVQA 4HFJA 4MZDA 3ZN2A 1QAOA 3Q6MA 3SSOA 2XE7A 2YMMA 3AR7A 3HYLA 4HAXA 3D6FA 3KHKA 3LRTA 1ISGA 2VP3A 2YASA 3ZY3A 1QYVA 1ETHA 3O31A 3K32A 2FWRA 2X5OA 4I1YA 4KYVA 4BN5A 1GVNB 3B8HA 4EG5A 3GMDA 2CXXA 4QEZA 1PG0A 1Z6PA 4FDTA 4FN5A 5D01A 2IUYA 2ZJ1A 1OBFO 4DSAA 1V3TA 3R5HA 3PENA 2XBUA 4UNQA 3QU5A 2EFHB 3RTDA 4UQPA 2DQYA 5FI5A 3LTNC 1BGXT 3PWZA 5CB8A 3PHBE 3RYIB 3CRW1 4QTYA 2PN1A 3GPDG 3O8NA 3DO8A 3HXTA 2NZVG 2O1WA 3VNQA 1C7QA 2P9ZA 4JLVA 4UMFA 4WECA 1SUEA 1OB2A 1O9HA 3H8SA 1B7GO 1DL5A 5D3ZA 3ZWXA 1THTA 3KDPA 3Q2OA 3UCEA 5I7SA 4KPEC 2AQHA 1HE8B 5CCDA 2HBQA 3LX5A 4Z4IA 1HLDA 2YWFA 2SECE 4I8DA 1GILA 5FJIA 5MGBA 2HLDA 4DA7A 4MLZA 1X1RA 4AKIA 3C15C 3JVIA 2D5AA 2W70A 2YKGA 4CEJA 3QW2A 1QIIA 5KYWB 3QM1A 3TSWA 3E5HA 2ZRGA 4UU1A 5KNLA 1JG1A 1PFWA 2DPMA 1KZ4A 2FCRA 3MJCA 1BCSA 5EXTA 4YYEA 2GA8A 2ZE8A 1VJ1A 4HBZA 5MF6A 2ZDGA 3WV5A 1UINA 3K9FC 4Q34A 2NSJA 2H31A 2DKNA 3IPYA 4ZZ3A 3W05A 1E1RA 3GWZA 1GPAA 2FXIA 2J3IA 1BMFA 1TO6A 1XP8A 4CBVA 1Z7WA 4M7PA 4YNBA 4GKKB 2GAOA 3KYCA 1SCJA 2ZRQA 4G0OA 4C05A 5EKSA 1U0SY 2FZEA 1ISPA 2C4NA 4W5RA 2GD2A 4LZPA 1NOIA 3RV4A 3PDIA 6ADHA 5L6MB 2FRDA 1N75A 2DH5A 4TQ9A 4FWIB 1NP3A 2ORYA 4NMLA 3JATB 3DJFA 3V00A 2C61A 2E2WA 4JL8A 4CHGA 3AJ8A 3HZHA 1XZKA 1SQ0A 3A6GA 2C8JA 1NMQA 1VG8A 4JBYA 1QOPB 1KXJA 4F3YA 5DEIA 3P0RA 2L69A 3HH8A 4RX1A 1R6DA 1ZK4A 1TE2A 4AJNA 3UN1A 3ODPA 5G1OA 1TCBA 4X1YB 4ARBA 4LZLA 2I1VB 3BCUA 1MO6A 4F45A 4CEIA 5K6TA 2EZTA 4D8VA 1R9NA 2AC4A 4H0CA 4R8SA 4AY4A 3MELA 3OTQA 2ID9A 5JLAA