2ZTMA

T190s mutant of d-3-hydroxybutyrate dehydrogenase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
255
structure length
255
Chain Sequence
b'VAVVTGSTSGIGLGIATALAAQGADIVLNGFGDAAEIEKVRAGLAAQHGVKVLYDGADLSKGEAVRGLVDNAVRQMGRIDILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASAHGLVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRSPLVEKQISALAEKNGVDQETAARELLSEKQPSLQFVTPEQLGGTAVFLASDAAAQITGTTVSVDGGWTAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D(-)-3-hydroxybutyrate dehydrogenase
molecule tags Oxidoreductase
source organism Pseudomonas fragi
publication title Closed complex of the D-3-hydroxybutyrate dehydrogenase induced by an enantiomeric competitive inhibitor.
pubmed doi rcsb
total genus 99
structure length 255
sequence length 255
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.30: 3-hydroxybutyrate dehydrogenase.
pdb deposition date 2008-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2ztmA00
4DPLA 4M8SA 4U0JA 5IDQA 4ZQHA 3I23A 1WZEA 5HA5A 2I76A 5COQA 2X5OA 4EEXA 2P5YA 4D79A 1F12A 2B4QA 3ENNA 1ULSA 4QSMA 1J4AA 4YRBA 1MC5A 3IP1A 3FBGA 3GAZA 2EKLA 3H65A 2PA3A 4UEOA 2VRCD 3AY3A 3EZYA 4XYLA 3SVTA 2AEMA 4RDIA 5G0SA 4WASA 3DAFA 3QJ5A 3QVWA 4IDFA 3IS3A 2YUTA 1W0CA 3GFGA 4RO0A 3S8MA 4DGSA 3ADOA 3ZWMA 5TLSA 3FBTA 5IFLA 1GEEA 1M6HA 4ZD6A 3TZHA 5A1TA 2VTDA 4FC7A 5DCWA 4WK6A 5G4KA 3G0OA 3LT0A 1Y7TA 1HDGO 3JQ7B 2HCTA 4O5OA 4DIBA 5JC8A 5JPIA 4BUCA 2FN7A 3I9JA 4JP3A 1YB5A 1JN0A 1E7SA 3E1KA 2BKAA 4E2ZA 2I6TA 5DBIA 1K6IA 4R68A 4RQUA 3SLKA 3AY6A 2WD7A 5AXCA 2XPCA 3OSUA 4B3JA 3E9MA 1B26A 3C7CB 5EPOA 2VHXA 4HP8A 2R6JA 1LXCA 2ZB8A 2C07A 1I3LA 2QIOA 4RVGA 1GFSA 5TJ9A 2BD0A 2NM0A 4YT4A 1QP8A 2QX7A 5JBIA 2YJZA 2X0RA 4WPGA 1MX3A 3I52A 1XCBA 5KNLA 4S1VA 1Y8QB 3Q0EA 1PL7A 1VLLA 3Q2KA 3WJ7A 5KWEA 2EEZA 2VOEA 4KWHA 4QO7A 1GZ6A 2ZCVA 4FJ2A 1PJ4A 2VCYA 3PHJA 1U4OA 1BTOA 4B4VA 3LF1A 4BV9A 3NGXA 6LDHA 3IKTA 2P4QA 2C82A 3ZV5A 4B7CA 5IZCC 3RAJA 1LDBA 3C3XA 5HTOA 5JDIC 3GN2A 1SC6A 4NFHA 5JAZA 3U49A 1YGYA 4PLVA 1E7RA 2G1UA 3C7AA 3PFFA 4UVIA 5KCZA 4RZIA 1IZ0A 3IOYA 3K2BA 5TGDA 4CM3A 2AQIA 4Q9NA 4XIYA 4YRAA 1ZEMA 3SEFA 3RQSA 1VJ1A 4H7PA 4BGUA 1YJ8A 4PG4A 3A14A 1DB3A 3PGXA 1NR7A 1U5AA 4NPCA 4Z3KA 1ISJA 2VUTA 2NQTA 4YT5A 5L4NA 4MKZA 3U4CA 3BMCA 4CLHA 2GNAA 4CJXA 1X14A 4D3FA 3CXRA 1B0AA 4K1LA 1CERA 4Z0TA 5A9TA 1U3UA 2DTEA 4OXKA 1EVIA 5C3MA 4FOOA 4QT0A 1VKOA 1E1MA 2NVWA 1YVEI 1EFKA 3WFJA 2CVOA 3QHAA 3OBBA 1ARZA 1EUZA 3FWNA 4NBRA 3WTCA 3FCOA 2NU6A 5FEUA 2CY0A 1P1RA 2PZKA 1HDCA 4HNHA 4FFOA 1V3TA 1I36A 1Q0QA 4YJFB 1HLPA 3F46A 4BNJA 1DHTA 3PFWO 4DIFA 4J2OA 1IOLA 4PG6A 3NX4A 1TVEA 4JBIA 3P5SA 3H3FA 2ZTVA 4YA6A 1DC4A 2IYOA 2AE1A 4E3ZA 4B8WA 1Q7BA 3G3EA 1ZSVA 1KY4A 4IQ8A 2J5QA 4NU5A 3VDQA 2GYYA 2FZWA 4J4BA 5A5EA 1A4UA 4FQ8A 4BO4A 4MKXA 1Y9AA 1PL8A 1XIVA 4JK3A 3JYNA 1T2AA 2DBVO 3S2EA 2GN6A 4XR4A 2FMUA 3E48A 3H2ZA 2DU8A 1UR5A 3T7CA 3DONA 3TSCA 1U1IA 1VE9A 2BFAA 3H3JA 3L9WA 1LU9A 3K92A 5A3VA 3LQFA 2OUIA 3KSUA 2UDPA 2YQ4A 3MTJA 4FFRA 2YV2A 5ICSA 1T2FA 4C7JA 2YYYA 3NJ4A 1HEUA 1VKNA 5JE8A 5JYDA 4YR9A 3WMWA 3JYPA 1H2BA 2GZ3A 3QWBA 3I4FA 2AG8A 3QP9A 2EP5A 3RC2A 3OQBA 3PJDA 1ADBA 3UVEA 1Z74A 4G2NA 4JP2A 2D1YA 1LC0A 3AM4A 2BGKA 3UCXA 1B2LA 1PX0A 1I3NA 4I5FA 4QX6A 4FB5A 2HJSA 3W8DA 3MJTA 3JQBA 1WMAA 5CEJA 1UAYA 1C0KA 4AJHA 4RLHA 4ZGWA 1H93A 1GYRA 4DPMA 1TI7A 3LDHA 2HMUA 3LSYA 3KLMX 5G0TA 5H81A 1Y8QA 3GNSA 4CQLB 2D3TA 3ETGA 4J1QA 2X4GA 1IYZA 7ADHA 1DFGA 3FTPA 4E5YA 1ZCJA 4EEZA 4C7KA 1B3RA 3OEWA 3DWFA 3UOGA 1YQGA 4J1SA 4YBZA 5FF9A 1A5ZA 2HJRA 2GLXA 3DQPA 2CDCA 3NT2A 2HRZA 1CYDA 4NBVA 3NV9A 5TQVA 5IDYA 3UFXA 1H5QA 2FPPA 3TQHA 2UAGA 2GCGA 5CEEA 3DOJA 4P38A 3RKUA 3AU9A 4MPDA 1VL6A 5TF4A 3OFSA 5LC1A 4MP3A 1U7HA 1AXGA 3NDRA 3NT4A 1IPEA 2H63A 5F5NA 1E3SA 1BSVA 3U4HA 2XAAA 3I9MA 3D3WA 5JYEA 1NNUA 3DMYA 3O38A 4CLOA 2PNFA 3G17A 3W4JA 2DUUA 1UZLA 4MOWA 4TVBA 3DR3A 4QECA 4EJMA 1WDKA 2JHGA 3DBHA 3F5SA 4PLGA 1PJCA 2I66A 2Y66A 2OORA 1R37A 4ZQGA 4RORA 2FR0A 3V1YA 4RZHA 1N2SA 2PFGA 5DF1A 4ZICA 1O9BA 1D3AA 5IN4A 5I9MA 1YQXA 2W8ZA 1MP0A 2PH5A 2PKQO 1ZUD1 3EZLA 1PR9A 1P3DA 4JIGA 4UAGA 4WLUA 3RFTA 4XQGA 4CR7A 4DRYA 2CVQA 1C1DA 3BA1A 3AOGA 1UXHA 1ULUA 2Y0DA 2X7HA 5ENDA 4ND4A 2X5JO 4OJNA 2BRUA 4M49A 1CJCA 3H9QA 3QWAA 4BO6A 1TLTA 2ZTMA 4YTEA 3QWFA 5GZ1A 1N7HA 4ZU3A 3DOCA 1E77A 1KEWA 3PZRA 1UJMA 4P22A 4R3WA 4XRRA 1PGQA 1NP3A 4K6FA 1BXGA 1K6JA 3JQGA 3P2YA 2DVMA 2C7VA 2DBRA 4TWRA 5JY6A 3PQDA 3P7MA 4IINA 1E3WA 3P19A 3NT5A 3GHHA 2E37A 3GVCA 4U5QA 4W7IA 1KVQA 2AHRA 1IUKA 3E6AA 1GUYA 3BAZA 3GNTA 1QV6A 4NZ9A 4Q3CA 4BNIA 4E2WA 1PQWA 1ZIDA 1MV8A 1I3MA 3OJ0A 4WNIA 3X2EA 2C59A 2DTDA 3C1AA 1IB6A 4PRLA 4RV9A 4GX5A 5TX7A 4E4YA 4FFLA 5JXWA 2XXJA 3D1LA 3DB2A 3GC6A 3FSRA 3KO8A 4KP7A 2DBZA 1M6WA 4YB8A 3ON5A 1G0NA 4FW8A 1BDBA 1B14A 3DZKA 2GN4A 1EK5A 5KJEA 1XA0A 3BMQA 5JAIA 2POQX 1PQUA 3KRTA 3JD0A 3TFQA 1NHGA 4J4TA 1U28A 2WYUA 4ALKA 4MVJI 2VZ0A 4E21A 3DL2A 4BO2A 4BO1A 1JWAB 3IJPA 5EL0A 1U4SA 1NWCA 4KDEA 1WP4A 1ADGA 2WE8A 1MG5A 4OKNA 1Y9EA 1JTVA 3C7DB 1UXGA 4Y98A 3RUCA 3HE3A 4R54A 4RVHA 4Z9XA 1KVSA 3DEYX 3WGOA 4WLNA 5B4TA 1QORA 3F4BA 1FXSA 1IHYA 1R4MB 4CMEA 3AK4A 3OF2A 1GUFA 2Y93A 3PLRA 2GF2A 4WCFA 3LLSA 4PN3A 2VYND 4A27A 2WDZA 2IZ0A 2Q49A 5JC1A 2WWRA 1DO8A 5DDIP 4YAGA 3H5RA 3BTVA 4CV3A 4BNZA 4PFJA 1E7QA 4KMSA 1E1NA 2CFCA 5TSDA 3H7AA 3ZWXA 4L4SA 4DBZA 3STHA 2OP0A 4UVDA 3IMFA 3DZFA 2FHSA 3H6KA 4TMFA 5T57A 4Q3NA 5K9ZA 1P1FA 3RBVA 4GGOA 2G82A 4ID9A 4OQYA 1A4IA 1E3EA 2FWMX 3BMQB 3GRKA 5HBRA 1CIVA 3A9WA 4Q3EA 3G79A 3U3XA 2JL1A 2QW8A 4GBJA 2Y1GA 1S6YA 5BNFA 4A0SA 2Q50A 5JAMA 1HE2A 5CDGA 4IDDA 5T8KC 3TZKA 2OP1A 1VRWA 2P68A 1PJLA 3PDUA 1GR0A 1I5RA 3KSDO 1A9YA 2IZ1A 4NG5A 3OECA 5BSGA 3O4RA 1YB4A 1T26A 1SOVA 3L77A 2O2YA 3AJRA 4WCFC 1B16A 1Z7BA 2EJVA 3ST7A 4BMVA 1ORRA 3LU1A 2B4RO 4CM4B 1HZZA 5FI5A 1ZK4A 2BFOA 4EJ0A 4MIEA 3LZ6A 4NK4A 4FN4A 1KEPA 2YZ7A 4Y8VA 3VKVA 4OOEA 4PGFA 1H9BA 4QEDA 4AFNA 5A03A 4U6SA 4NI5A 2ET6A 3U0BA 1QMGA 3K2EA 3VH3A 4L74A 4MP8A 3RBZA 5A9RA 2EW8A 3KVOA 3BHJA 4CM4A 1E7WA 3JD1A 4GI2A 1W8DA 4I1IA 1GU7A 2QG4A 4FFMA 3NJ8A 3RKRA 3MCVA 3CZRA 1X7GA 4BB5A 5IAAA 1DLIA 3WGGA 1H6BA 4BNHA 2W4QA 4JQCA 4PCVA 3OHSX 2X58A 3PHLA 1KERA 1RKXA 4IXTA 3S55A 3NUGA 4YYZA 3V1UA 3O8QB 2YDYA 4E5PA 3RC9A 1MGOA 4K28A 3ZNOA 5CG2A 1WNTA 3VVCA 5A02A 2NQ8A 2IODA 2W98A 5G0WA 2PY6A 1ZH8A 3WDSA 1QKIA 4EUFA 4WLVA 1FJHA 5JLAA 4IJKA 1YL6A 4DIOA 4OAQA 3GOHA 3AUSA 4WGGA 2X6TA 1T2DA 5AYVA 3UCEA 2Q3EA 3DAGA 4YVFA 3D4OA 1KVTA 4TRRA 2JAHA 4PZCA 4E5MA 1LLCA 4GAEA 2G0TA 4B7XA 2ZIZA 2CSUA 2JAPA 3A4VA 4LMPA 4CPDA 2EGHA 1EZ4A 1M66A 4U6QA 4YT2A 4OSPA 1Y6JA 3GDGA 1YJQA 3EK2A 2UUOA 3GQVA 4J0EA 3ICCA 4ND1A 5DCUA 3A28A 1BRMA 3ZHXA 2RHRA 2BHLA 2Q4BA 2UV8A 3RJ9A 1H6DA 3WQRA 2C29D 1LSJA 5IN5A 4DYVA 2Y0CA 3MOGA 2PKQP 4R3NA 5T67A 1JU9A 2QRJA 4HFMA 4B7UA 5CPBA 4DTIA 4E6PA 1GL3A 2CDBA 1NASA 1SNYA 1N8KA 3RD5A 5AXAA 4YXFA 2BELA 3ZWVA 1OBFO 1N9GB 1I2BA 3VPGA 1P0CA 3DMTA 3UCFA 3I1JA 3D4NA 4GGPA 1O5IA 4GQAA 3BMNA 1ZMTA 2YW9A 3L6EA 4TQGA 3F1LA 1EK6A 2X0NA 3FTNA 2HO5A 3INRA 1HE4A 3OIFA 2ZQYA 3NDIA 4RVDA 2G5CA 1H94A 4CL8A 4ZJUA 3WLEA 5C7OO 4CMKA 1DEHA 1TT5A 2RBEA 1ZKMA 5A9SB 1DRUA 1GY8A 3G1TA 4J90A 2Q46A 4ZRNA 1P33A 1FDSA 3TF5A 1XU7A 5IZCA 3C1OA 1ML3A 2CMDA 3AM5A 3ASVA 3GZNB 3DZIA 4H3VA 3I9OA 4Z3DA 5KVCA 3FN4A 4NHEA 3UKOA 3CTMA 4NR0A 4PLZA 4LSMA 1QR6A 2VWQA 2EKQA 3ZV6A 1V3VA 5IXYA 3TFOA 5JDIA 1N7GA 3RU7A 1E7YA 4B8ZA 5IZ4A 1IZ9A 2AEJA 3QY9A 4UVGA 5LDGA 5TT1A 3AU8A 1UUFA 1KYQA 1NTOA 2VN8A 5L4LA 5EQDA 4A03A 1E3WB 2GDZA 3C24A 1Z7EA 4G81A 3DBVO 5GZ6A 1MUUA 3I4CA 3FPLA 3W4IA 1U3WA 1SCUA 1DFIA 4D0RA 1D1TA 2VRBA 5ES3A 1NX6A 5F1KA 2QZZA 2FZEA 3TL2A 4BIIA 3D64A 4IPTA 1IE3A 4CQMA 2E4AA 3L07A 3WNQA 1Z82A 2J3JA 3BIOA 1ZMOA 3UGKA 3T7EA 1DIBA 4E31A 3H9UA 4QQRA 4IS2A 1EDOA 4YJGB 3VAZA 1O8CA 1E1KA 4FFNA 4U8GA 4N5LA 3IKVA 3A06A 2JCYA 1EDZA 2D5AA 2WSBA 3AM3A 1LLUA 4QXMA 1LSOA 4P4NA 3RC7A 5KJ1A 1HE5A 2I65A 4EZBA 1C3VA 4BVAA 1YOVA 2W2KB 4XYBA 1QLHA 5AOVA 5C5IA 4WEQA 4CM5A 2R2GA 1MC4A 4IJUA 3JQFC 1DOHA 1YDWA 3B1FA 1C14A 1SMKA 4CM9D 4FGSA 2B4TO 1P44A 1ZEJA 1B7GO 2O3TA 3GY0A 4IBOA 1TT7A 3H5AA 4GX1A 3W6UA 3FNHA 4B4OA 1HLDA 2X0IA 1NQOA 3D3WB 4R41A 4IQ0A 4S3MA 4XGKA 1Y1PA 5TRTA 3TWOA 4DXHA 3ZDFA 5IJZA 1PEDA 1R0KA 1U2DA 4MIOA 5TJHA 3UN1A 3VZPA 4XGIA 3E8XA 3VTZA 4G5HA 5BSFA 1YBMA 4QFCA 2VUUA 4AJJA 3GFBA 5I7FA 1XELA 2ZJ0A 4BO9A 4LRSB 1JKJA 3HNPA 5I9NA 2AW5A 1CF2O 3IL2A 3MJCA 4RVSA 5COAA 4H15A 4DREA 3DZBA 4UVHA 1EUCA 4NMHA 3HWRA 3ULKA 4L4RA 5A3JA 2V6BA 4XYMA 2UVDA 2P2SA 3ZWWA 2HLPA 2FOIA 3MZ0A 4WLFA 4RF3A 3WGZA 3ROKA 4NU6A 3PGJA 3EDMA 1GPJA 1X13A 1OC4A 4BMNA 5KKAA 3PQEA 2VTEA 4HWKA 4RCVA 3VH1A 3UW3A 2J6IA 2BMAA 4ALMA 5KJFA 4XB1A 2A94A 4CV1A 3K8ZA 4J9VA 1QYVA 3B1JA 2Q2WA 2G76A 4E5NA 3T4XA 2DFVA 4BQRA 5JO9A 3VDRA 3JSAA 3JQ8A 4B4UA 4I08A 3L9XA 3PVZA 1LRJA 3GVPA 3K31A 1R4NB 3FWZA 4HKTA 4U7WA 3L6DA 4XQEA 4DMMA 2Q4EA 3JD3A 4J9UE 1SO8A 3NYWA 3JD2A 1XHLA 4GSKA 5EJ2A 2Z5LA 3PZBA 4GX0A 1IULA 1KBZA 1FDWA 2V65A 4PVCA 1LQTA 3KUXA 1G1AA 3FNGA 4ZRMA 4L75A 4R9SA 3KYCA 4IMPA 2CNBA 3CE6A 5KJCA 1OFGA 4BMSA 3PXXA 1ONNA 3ZWNA 4NDNE 3QIVA 3FPCA 3HFGA 3S2FA 3V5NA 5TT0A 3P2OA 4PZDA 4AJ2A 1D1SA 3GLQA 2I3AA 4O6VA 2WTBA 5DOVA 4PIVA 1XGKA 1U5CA 4FD3A 4ALIA 1NAHA 4NNJA 3U4DA 4JNKA 1GV0A 2GRAA 4PLPA 4KQWA 3TZCA 3WFIA 2IXAA 2IEBA 5L53A 2FY8A 1QV7A 4MDHA 1SEPA 4PLHA 4YQZA 5G0UA 4DQUA 4BNGA 1IPFA 1IY8A 4ALLA 1QYDA 1HTBA 2HDHA 1NR1A 3M1AA 4PZEA 3N58A 3JCZA 3U4IA 4J7CA 1QSGA 1PZFA 1GADO 2X1HA 2PTGA 5JDCA 2HMTA 1QYXA 2YHIA 2JCXA 3PWZA 4FSHA 4QUKA 3WTBA 3ZU2A 1PJBA 2WMDA 1XSEA 3DBLA 3KEQA 1U8FO 4OO3A 5L4SA 2VZ9A 3VPXA 1T4BA 3LYLA 1PWZA 1ZK3A 3K73O 5B4VA 5L95A 4R4JA 2P9EA 2OGUA 1PWXA 3SJUA 5A9SA 5CEFA 3Q2IA 2H1SA 2FSSA 2NTVA 2DAPA 1ENZA 4EDFA 4CLEA 1D7OA 4IJWA 2JFFA 1FMCA 2HK8A 3PP8A 3HSKA 4KUGA 2DQ4A 3L0DA 1TEHA 4GKBA 4CR6A 3W4KA 1PU2A 2EJWA 3BMNB 5BR7A 4KTVE 1DXYA 2ZYAA 4JBGA 1EVJA 5F1OA 1NAIA 3LT1A 3CKYA 2NVUA 3WB9A 2OHXA 4CL3A 3D0OA 1WVGA 1PJ2A 3S2GA 4J3FA 3PYMA 1NHWA 2O50A 4PG8A 5I7SA 3RUDA 1MB4A 3DBRA 2IZZA 1G0OA 3PJGA 3K6JA 3PWSA 3DC2A 1QYCA 4N18A 3OIDA 4MVJH 1PQPA 4TVOA 3TPCA 4GSLA 3MJVA 1EBFA 1RJWA 5J23A 4BNYA 2JKVA 1GUZA 4HFNA 5AQ1A 4GPD1 3DOOA 1XDWA 3KXDA 3OJEA 3H8VA 4I5DA 1QRRA 3JQAA 4MINA 4FC6A 2D59A 4XX0A 3HG7A 4ITUA 4W7HA 3GZ4A 4YRDA 1A71A 4UULA 1B15A 4BKPA 1T25A 3KEOA 1PJQA 4MVJP 2FR1A 1RWBA 5B4UA 3DBLB 4BGVA 1Z6ZA 2EGGA 1NM5A 1NXQA 5MDHA 1J0XO 1LDEA 4KDFA 2QYSA 4Z6KA 2PD3A 3T4EA 3GMSA 1WDMA 4CV0A 2VZ8A 3OM9A 1ZVMA 5BNTA 1W73A 2ZTLA 4MVJF 5B12A 4WOJA 2OXIA 3C85A 2PGLA 5EINA 1MFZA 5DT9A 1T2EA 3N74A 5L40A 3GPDG 4DMLA 4E0BA 4UREA 4DLAA 1M67A 2ZTUA 3I9NA 1MXFA 1K5HA 4OHUA 2IE0A 4MVJD 4B3HA 4I5GA 4IDEA 4P4GA 3W6ZA 1HDRA 1O95A 4Y9DA 2XXBA 5MGBA 4ZVVA 3H5NA 3GNQA 2QQ5A 5CDTA 2GSDA 2RH8A 3JQ6A 3L4BA 4M86A 3OQ6A 5KTKA 1J49A 3BTSA 4L76A 5HWSA 2FSVA 3ZHYA 2CF5A 5F21A 3IUPA 1WAMA 1ZJYA 3KTDA 1WMBA 3KYCB 5U9CA 2WE7A 4K26A 3VZSA 2D5CA 4HADA 4JX8A 4W82A 1WPQA 1HE3A 3GUCA 3QVOA 4RJTA 3ZCXA 5B1YA 4KTTE 2EKPA 3Q9NA 5EESA 5AXBA 1B8UA 2RAFA 4KUHA 5DBFA 4BNVA 3AI1A 4F45A 4XQ9A 1UH5A 1R4NA 4K6CA 4J1NA 1SPXA 3JQCA 3JQ8B 4CLRA 1YL5A 3D4PA 3OQ1A 3DBHB 1W6UA 2HQ1A 4YEDA 3JD4A 3ZNNA 1LNQA 1YB1A 1T2CA 3NKLA 4YAJA 4BO5A 3OICA 3GVHA 3WWYA 1P0FA 1PZEA 2NTNA 2ZB4A 3IIEA 2VHZA 3ENKA 3JQEA 2RHCA 2X23A 2EG9A 1HDZA 1KVUA 3R3SA 1OI7A 3JQAB 3BMOA 4AJEA 1YWGO 4RVFA 1A72A 2FPIA 4O1MA 3GG9A 1Y5RA 4LVUA 2NNLD 4XEHA 4NJMB 2Y68A 4Q3AA 4R51A 4BOYA 1PJTA 3IAHA 3NTQA 3ZGYA 1PL6A 3EMKA 2NUAA 2JD1A 4OH1A 3LVFO 4FOSA 1V35A 2IYPA 3L4BC 4L4XA 4D41A 1CEQA 2YHUA 4CLDA 3INGA 2A92A 1I2CA 3SBOA 2EV9A 2PV7A 3KSZO 2Y1FA 1Z45A 2BGLA 4L8VA 4E5KA 2GPTA 4J0FA 2C2YA 1Q0LA 3ZV3A 3RASA 4OMUA 4YPOA 1ZBQA 3G1UA 3NRCA 4WUVA 4NQZA 4BNTA 2AQKA 3M6IA 1XQ6A 1DIHA 3OJLA 3F3SA 1FDVA 4J4HA 1M75A 3VTFA 3WMXA 3OEYA 2C5EA 4RPKA 2DFDA 2P9GA 1BW9B 1LDNA 1OOEA 1AUPA 2DM6A 2VRCA 3H9EO 3QVXA 3MOIA 1K3TA 3O03A 2VHYA 4JXKA 4D3SA 4IY1A 3PEFA 4W4TA 5A4DA 2C7GA 3GR6A 4I9HA 2AQ8A 4DC0A 1LEHA 4YJHB 3QW2A 3UAGA 3GG2A 4CV2A 1O89A 4J7XA 3H9JA 1KETA 3VKUA 2QHXA 5JMWA 4YJGA 3KYDB 1I10A 3W8EA 4KWIA 4TKLA 4FR5A 2OFPA 3B70A 1Z75A 5DULA 5ITVA 4JJFA 4NK5A 3UF0A 3CZMA 5DBGA 4JROA 1L7EA 4RPGA 4KQXA 4TRMA 1KIFA 1PS9A 1PGOA 4UUNA 1EUDA 1PS8A 1VSVA 1R12A 2A9FA 3MJ4A 3SX2A 1X0VA 3R1IA 3JTMA 3I9KA 3HADA 1ZZEA 4EUEA 1E92A 1JAXA 3NGLA 2EXXA 3HJAA 1CWUA 4ZQBA 1LDYA 3RU9A 3GGPA 3GVIA 4FBGA 3JQGB 1PR3A 2PZMA 4FCCA 5LCXA 4FGWA 3HN2A 2EF1A 3FR7A 3E03A 3UXYA 4MJLA 3E5MA 5JO0A 1E6UA 3OA0A 4MVJG 5B37A 2O3RA 1O0SA 2YFQA 1GZ4A 4W9NC 5I8ZA 3ZNPA 3F5QA 1NVMB 2G17A 2GERA 3IDSA 4L9RA 4XKJA 1AE1A 3WYCA 2SCUA 4HFJA 5U4QA 4N54A 5L51A 3GZNA 3KLPX 2HK9A 1EVYA 1HWYA 3WIEA 3B20A 3ICPA 1Y5MA 4WCDA 1ZJZA 1TXGA 2H6EA 2WYWA 2ZQZA 4DQVA 5CFZA 2B83A 5ILGA 1YDEA 1ISMA 5ILOA 1KOLA 3PIIA 2B5WA 4JGBA 1I32A 3PJEA 5A06A 3I5MA 4ZQFA 1ADFA 2ZCUA 4B79A 2Q2VA 2GN8A 5ICMA 3AW9A 4LRTB 2PK3A 2VWPA 4IM7A 1DDOA 1VL0A 1V3UA 3QWHA 2PZJA 3E9NA 3I9LA 1ZK0A 4HNGA 2I9PA 1AXEA 1U9JA 3OJFA 3WJAA 4LISA 1AHIA 4D3DA 4FIZA 5BSHA 1LA2A 2NU9A 4BO0A 1R15A 1ENPA 1I3KA 4BB6A 1VI2A 2W2LD 4EBFA 3ZW9A 2W90A 5DNAA 3GUYA 1N5DA 3CEAA 4DUPA 2NLOA 1P1JA 1XYGA 3Q11A 4D0SA 1F17A 4O0LA 4A7PA 2YY7A 3DAPA 2OBYA 4RPLA 4IIVA 1VJTA 2VWGA 1RM4A 1DC3A 2O3JA 1LDMA 2OMEA 2QRLA 4MVJA 5TNXA 1B8VA 4BGEA 3F4LA 3DXFA 1EVZA 3DZJA 4J91A 1T1SA 3CMCO 3FRJA 1JVBA 3ZWCA 4BNKA 3UH1A 1P31A 2H5LA 5JCXA 1PZHA 3H2SA 4RDHA 3L4SO 5IDWA 4RLSA 5I7EA 4FPXA 1LRKA 1U7TA 5F5LA 3RUAA 3PJFA 4CM6A 1NPYA 2NTJA 3RUEA 5C7IO 2B5VA 1BVRA 1R16A 1WWKA 1YL7A 2PR2A 3DTYA 3WS7A 1YH3A 5H82A 5EQFA 3BZUA 5IDXA 4NJOA 5L9AA 4J43A 4XYEA 3GMDA 4BNLA 1UZMA 1KC1A 4P8RA 1OZAA 1K6XA 4OQZA 4R1SA 4LGVA 2J3IA 4LW8A 4YQYA 4W99A 1U2GA 4M55A 1KVRA 4BNNA 1HDOA 3AUTA 3GGGA 4FDAA 4Y6RA 3ZN2A 4AJNA 5AXDA 1VM6A 3D7LA 1GZ3A 4MKRA 5K6AC 4JN6B 3JQDA 3VPSA 1HF3A 3EUWA 2O3SA 2O7QA 1DC5A 2VUSA 3ZZNA 4JCOA 1DJQA 1UAGA 4IDGA 2VT3A 3ADPA 3VPHA 1PJSA 3PRJA 1BHSA 4R16A 1X15A 4RF4A 1RM0A 1EBUA 2O4CA 1UP6A 3BTUA 3WQSB 3LC7O 2E82A 4AJIA 2ZB7A 5L3ZA 1VL8A 1PTJA 4MP6A 4D43A 3PTZA 1KC3A 4IS3A 2NADA 2PD4A 1HT0A 1UDCA 1BG6A 3PYXA 3ORFA 3RC1A 1Q1NA 3V1TC 2BFPA 2J5RA 4R1UA 5A05A 2AQHA 4YJFA 4DWVA 1YBVA 5ITWA 2HMSA 1NFFA 2V7PA 4IQGA 4C4OA 1SBYA 2BF7A 3W1VA 2OBNA 1XLTA 3QLJA 4AJOA 3FNEA 6ADHA 5IF3A 1H2HA 2A35A 5BT9A 3H4VA 1ZO8A 5DZSA 3TZQA 4RF5A 4CMIA 3DTTA 3RFXA 5FI3A 2QRKA 3CSDA 2DUWA 2Q45A 4YT8A 1NYTA 3JQ9A 1I8TA 1R0LA 4FS3A 3WYEA 4JBHA 3TRIA 3ZHBA 4AJ4A 1WDLA 3LT2A 3SC4A 8LDHA 1NQAO 2J3HA 3WNVA 5DOZA 5HS4A 4CUZA 4PLTA 2DTXA 3GK3A 5AVOA 4BO7A 2VNAA 3PIDA 4RL6A 2AXQA 2JJYA 3IC5A 3KYDA 4AG3A 1E1LA 3ZI0A 4Q3DA 3ZHZA 3DFUA 3TL3A 1MG0A 1JLLA 2F00A 1NPDA 5JDCC 4YJHA 5JSFA 4IXWA 4M87A 4UUMA 2I5PO 2YV1A 3K5PA 4XJTA 3K9QO 1R4MA 4AJKA 3EC7A 4PG7A 5EMHA 1QLJA 4EITA 5CDUA 1LJ8A 1CDOA 4BHTA 4A2CA 3HDQA 3E82A 1GDHA 1ISHA 1GQYA 1KEVA 3HQ4O 1N1EA 1NFQA 3ETEA 1EEHA 4QO8A 3RBXA 4F3YA 2D0IA 3Q3CA 4I9UA 3ZH2A 3F47A 2CD9A 3C1TA 1UP7A 4Y6SA 4NJMA 1A7AA 4R01A 1GYQA 4HFRA 5FFFA 3CH6A 2GD1O 2X22A 1LC3A 4E2XA 1Q7CA 4ND5A 3DZHA 9LDTA 4PLFA 3FR8A 1LDGA 5T64A 3WGTA 4A26A 4PRKA 2JHFA 3PDJA 5BSEA 5HRUA 3TOXA 1H6CA 1JWBB 2C2XA 3ASUA 2PH3A 3WLFA 3ZWOA 3I83A 4OGWA 3AFNA 2B37A 4WJZA 2V6FA 3JYOA 4TZTA 4UEKA 4CMAA 5JW6A 1BMDA 4E13A 2X0JA 1HYHA 3BMOB 3E18A 5TC4A 3VZQA 4CMCA 3SJ7A 4BKUA 4DLLA 5KVSA 4II3A 4XJSA 1ISGA 1BVUA 4CM8B 1DFHA 3WICA 2IEDA 1ZSYA 5JFOA 5G4KB 1PSDA 5THQA 3SLGA 1QG6A 3WQQA 3Q6IA 4BKOA 5I7VA 3R6DA 1L1FA 3CIFA 5G4LA 3JYLA 1P1KA 3ETDA 3B1KA 3B6ZA 2CF6A 4DPKA 4URFA 5GZ3A 3G49A 2CUKA 2PGJA 4YACA 4ESOA 2Y99A 2VQ3A 2O23A 2Z95A 4D45A 2Z1MA 1DIGA 3KZVA 1KS9A 4RPJA 3ZV4A 1DAOA 3D5QA 1E5QA 3OJOA 4PLYA 3DDNA 3N7UA 1C0IA 1CQJA 2DC1A 3AY7A 1RM3A 2VNSA 1B3BA 1PGJA 3CPSA 3HDJA 1OC2A 4FJ0A 3ABIA 2BLLA 3QV1A 2VYNA 3RJ5A 1NVTA 3IP3A 1XR3A 4UVEA 1FDTA 5CAEA 4R9RA 5CP8A 2OO5A 5EERA 4IMRA 2YFHA 3TDKA 2Y1CA 4A5OA 3WBBA 5JCJD 5L7TA 4XA8A 5F3RA 1HYEA 1DC6A 4CM8A 4WE3A 3O9ZA 4GWGA 2YQ5A 1DRWA 4OL9A 4GX2A 4R5HA 1I01A 3RUIA 3GA0A 4OOFA 4TRJA 2NACA 3VH2A 1GTMA 4NBTA 2HRBA 4XD2A 8ADHA 1MLDA 2HU2A 3DHNA 3HFSA 2GASA 2O3QA 4CM9A 5A5FA 2Y05A 3A1NA 3F9IA 3AWDA 4RQTA 3U9LA 3I6IA 4E32A 4EYEA 5KJ6A 2X8LA 1JKIA 2PLAA 4MVJE 3PI7A 3DBRB 4J49A 1LX6A 3OMLA 4XB2A 2PZLA 2X9GA 2ZATA 4J7UA 5F1PA 3GHYA 3ITKA 2BI8A 4O63O 4CQLA 4HX5A 2WD8A 3BXXA 2D2IA 2ZKLA 3PHGA 3MJSA 2WYVA 4FFPA 1E0DA 4IGEA 1VSUA 1LLQA 3DO5A 4XYGA 2ZYGA 1PJ3A 4NFYA 5BNIA 5A04A 3TNLA 1R66A 1VJ0A 2C54A 2AG5A 3HB4X 4HBGA 1E6WA 3QA9A 4YAKA 1E3JA 1P9LA 5HM8A 2AE2A 1U3TA 1X0XA 4N5MA 1MXHA 2WJPA 1X1TA 2C0CA 3U09A 5FYDA 2BGMA 3NAQA 3LT4A 1XQ1A 1F06A 2D8AA 4BNMA 1QXSA 2AA3A 1F0YA 1SAYA 4I5EA 4TRNA 1HETA 2IDZA 1YO6A 3EVNA 4J6FA 1NPTO 3JYQA 1HRDA 3VPFA 4BNWA 2Q1WA 4CMHA 2XOXA 2I3GA 3MWEB 3TZ6A 4DLBA 3H9GA 1HL3A 1RPNA 4X54A 4J16A 1ADCA 4Z0PA 4CMEC 5CG1A 4DC1A 1LBEA 3DFZA 3JQ9C 3ZWAA 3QE3A 3GPIA 1L7DA 4M1QA 1H6AA 4CMIB 4EJ6A 1KEUA 4GH5A 1EE2A 2NVBA 1I30A 3DHEA 1DAPA 1F8FA 3WYBA 4E2YA 1X1EA 4LMRA 3NEPX 1Q0HA 4BKRA 5CDSA 2F1KA 4TSKA 1Q2XA 1U8XX 2X9NA 4NFSA 3S1LA 3CUKA 1XKQA 1AGNA 4QTZA 2NSDA 3S2IA 5H83A 2JFGA 4ROSA 4DYDA 4YJDA 2FP4A 1J6UA 3QVTA 4IUYA 2D4AA 1ONPA 3WSWA 1I33A 1YE3A 4W6ZA 1C1DB 3FF4A 1BWSA 3ONDA 1DLJA 4BO8A 1V6AA 1JW9B 4IDCA 1F8GA 4OXYA 4WNCA 3OETA 1SZJG 2RH4A 3I6QA 5ADHA 1JAYA 1DRVA 4OXNA 3SXPA 3RIHA 4BL5A 2VYVD 1DPGA 4B4WA 1ENOA 3ANMA 1JDJA 3LC2O 1DIAA 5C37A 1ZXLA 3BMCB 3WX0A 1BDMA 2VT2A 2I99A 3O26A 3ONEA 2DLDA 4MO2A 4AL4A 3Q1LA 2X5KO 3RUFA 4E33A 4CLOB 2I67A 1P74A 4AJLA 3MWDB 1ONOA 1OMOA 3RWBA 3HB5X 3PWKA 1RYEA 3PYLA 1JKFA 1BGVA 2J3KA 3EYWA 1ZXBA 1YQDA 1SB8A 1CRWG 4LVCA 3HZZA 2X86A 4UUOA 3CINA 1HKUA 4GVLA 4JJIA 4N5NA 5DN9A 4GVXA 4UEJA 1BXZA 4XIJA 4PLWA 3V2GA 5HS6A 2GZ1A 2NV6A 3HHPA 3ZWBA 3M2PA 1EE9A 4NBWA 2V6GA 4Q3BA 4YAEA 4ONEA 3CMMA 2JD0A 2X9VA 2P91A 3M2TA 4DVJA 4DA9A 3OIGA 3WOHA 3BYZA 4JJGA 5JNLA 1DHRA 1BXKA 1YBAA 5IXSA 2R00C 5GY7A 1ISIA 3HDYA 4BO3A 4F6LA 2TMGA 4UUPA 4LN1A 1HXHA 4F6CA 3SC6A 4LK3A 2QZ9A 2E6UX 1HZJA 2HK7A 2PD6A 3OP4A 5L7YA 3W8FA 1Y8RA 2DBQA 1WW8A 5TIIA 5K0ZA 3IUSA 1UDAA 1C1XA 1XWFA 1YONA 1OAAA 1UXIA 2BH9A 3COSA 3WR5A 1P1HA 1WLYA 4Q39A 2W2KA 3NDJA 4INAA 4RF2A 5L45A 1YOVB 2NU8A 4GMFA 3R0IA 4Z9FA 3ONFA 3ZWYA 4BGIA 4BV8A 3D3EA 3JQAD 1GV1A 2ZB3A 1GPDG 1IL0A 1YRLA 2CZCA 4ZHSA 3PQFA 4M54A 3ZU3A 4CR8A 2GN9A 4TKMA 3FD8A 3UHAA 2CDAA 1DSSG 1M76A 3NTOA 4IDBA 9LDBA 1GAEO 1UZNA 1V9LA 2Z1NA 3KM0A 3QRWA 4NBUA 4GLOA 3VHRA 3KB6A 4CUJA 3MTGA 1UDBA 5TS3A 4HXYA 1LUAA 3ROQA 1PIWA 4N7RA 2EHDA 5KOIA 1E3IA 2NU7A 1KY5A 2DPGA 4M89A 2ZJ1A 5DP2A 4D46A 1T4DA 3WWZA 4Z0HO 1XEAA 1LI4A 2AEFA 4IZHA 2EW2A 1X7DA 4H16A 1ZK2A 4YCAA 3ROPA 1C0LA 1VC2A 1ZK1A 1AN9A 4XRGA 3GEDA 4CQMB 1HSZA 4EW6A 3INTA 2GGSA 3AUUA 1K89A 1NBOA 1VPDA 2O7SA 4GL4A 4WLEA 5C7LO 3IJRA 1G6KA 4DBVO 1NQ5A 4HY3A 4HV4A 1YS4A 2EIHA 3I3OA 5T6BA 4GMGA 3ROMA 3AUAA 3WGHA 3PHHA 2O48X 2UYYA 4GWKA 1IHXA 3JV7A 1P45A 1H9AA 2IXBA 1GEGA 1I2ZA 1N1GA 4D7AA 2EP7A 3GDFA 1R6DA 1CQIA 1GQQA 1GCOA 5K6AA 3WSVA 3OA2A 5JY1A 2AMFA 4XWYA 3PK0A 4CODB 5KIAA 4BKQA 5CHEA 4XZ3A 2GO1A 3RSHA 2BFMA 4XQCA 3TJRA 1O6ZA 2RCYA 3EAGA 4AICA 4PLCA 1J5PA 2FPGA 4K9DA 4DL9A 2JD2A 5JCJA 3DZGA 5CPFA 4PVDA 5FWNA 4TZKA 1U3VA 3QWIA 1D4FA 1EQUA 2E48A 2WM3A 3GVXA 5T8KA 2GUGA 4ALJA 1C0PA 4ALNA 1ID1A 3PLNA 1EFLA 3BHIA 1NVGA 2NWQA 1TT5B 2HAEA 2O4UX 2W2LA 1R0SA 1HDXA 3EY4A 4OIMA 4Y67A 3V2UA 2FR8A 1GQ2A 2OL4A 1SEVA 3D5TA 1T24A 1C1XB 5DCYA 2DKNA 1BW9A 2ILTA 3WG9A 3Q9UA 1DBVO 2HSDA 2JFHA 3KYBA 3WGQA 3FHLA 4DQXA 1Y8RB 3WIDA 3KOUA 1GCUA 4MVJM 3WXBA 3V2HA 2OZPA 1N9GA 4OM8A 2Q99A 2A4KA 1MA0A 4ND3A 4R69A 1DIRA 3VH4A 1PS0A 5KVVA 3ZU4A 3GH3A 1E6EA 2XF8A 5G2OA 2VYVA 1I24A 3KV3O 2JCVA 2Q1TA 4MIYA 3PPIA 3U5TA 2LDBA 5GMOA 3F1KA 4JLWA 4ZN6A 3HUDA 4CMBA 4HUJA 3LC1O 1ENYA 5LDHA 1HDYA 5ER9A 3AI3A 1TB4A 4Z9YA 4Y6PA 2FRDA 1T1RA 4XDYA 3R3JA 3UUWA 7MDHA 2WD7B 2C20A 4IDAA 3VZRA 4J2HA 5COBA 5EN4A 1FF9A 3HN7A 3ANNA 2Y67A 4BQPA 2H9IA 2HMWA 1DJNA 1RM5A 3JQ7A 3C8MA 3VC7A 4CM1A 2Q1UA 1LQUA 2VOJA 3L6OO 1JA9A 1V0JA 2PWZA 2HUNA 1HSOA 1A9ZA 3ZWPA 5KKCA 4U0KA 4W9NA 1K2WA 1HYGA 1LSSA 2E49A 3AI2A 3O8QA 4IJVA 4NH4A 5L7WA 4BS9A 5JAQA 5CDYA 1MFPA 1I0ZA 2B35A 5DP1A 1NFRA 3FI9A 1NWHA 2Y1OA 3EVTA 2V6MA 2VHVA 1N92A 1WZIA 3KBOA 5ENVA 1UP4A 4ILKA 3MEQA 4QFDA 1GYPA 2ZYDA 4R1TA 1V8BA 4EI2A 1E7MA 1A27A 2RIRA 2DPHA 1S7CA 4OSOA 3GEMA 3GF4A 3AOEC 3GGOA 4XR9A 4AVYA 4KZPA 1CETA 1ZW1A 3MJEA 4ZQEA 5T5QA 2YDXA 3ZW8A 4D42A 3TN7A 4L73A 3GN1A 3AFMA 5JS6A 1WXDA 4CM7A 1YKFA 2Y1DA 2Y0EA 3RI3A 4GLLA 4YAIA 4NIMA 2B36A 1EQ2A 2R00A 4GKVA 4II2A 4OYRA 2GR9A 2PGDA 3GRPA 4CQMD 1SOWA 2Q2QA 4LSWA 1YXMA 2EERA 4R1NA 1X7HA 3DMTC 3K96A 2CVZA 4CUKA 2O2SA 5THKA 3IQDB 4CLXA 4TROA 4ZA2A 1TA4A 3ANLA 4ND2A 3RUHA 3FNFA 4O59O 2HMVA 3RCBA 3RROA 4BNFA 4CMJA 1FK8A 2B0JA 5ER6A 1O94A 3OH8A 4RVUA 4A73A 2BI7A 1K0UA 5JMPA 4EGFA 4I9NA 3U62A 4A10A 5I8WA 5IG2A 1JQBA 1AHHA 4D44A 3K30A 4F46A 2Q1SA 3NTRA 1F14A 2OOSA 3HDHA 1XG5A 3EW7A 1A7KA 1UXJA 4YWJA 1B8PA 1LSUA 3X2FA 1ZFNA 3ZNQA 3LF2A 2P9CA 4RGBA 3JQBC 4LCJA 3WGYA 4OKIA 4BNUA 1E5LA 3BHMA 2UUPA 4P4LA 5G0VA 4E12A 1JVSA 4KUEA 3AOEA 2GZ2A 2P4HX 1P77A 1RYDA 3QSGA 1M2WA 1FDUA 1PGPA 4IIUA 3EGOA 3LLVA 4J1TA 3WBFA 4EUHA 4WECA 2O3UA 3RFVA 3ITDA 1D8AA 4WLOA 1ZNQO 4IGFA 1GD1O 1Z73A 4YDRA 5I9LA 2YV3A 2B69A 4G65A 5EIOA 1LLDA 1Y81A 4LCEA 4CMGA 4WCFB 1PZGA 3ZU5A 4I8XA 3TOZA 3VVBA 2C5AA 3E9QA 1EMDA 3PHIA 4AJPA 1SB9A 4RPHA 2NVUB 2PKRA 3BTOA 2J5KA 2VHWA 3GEGA 2QYTA 2EWMA 2ZK7A 1UXKA 3GDOA 4E30A 3VOSA 3LK7A 1ISFA 4PG5A 3KHUA 1P1IA 1Q7GA 3DHYA 2LDXA 4FJ1A 4R5MA 5KVQA 1H0KA 5U1PA 3V8BA 4AJ1A 1W4ZA 1LRLA 2WEKA 4KOAA 3WGIA 1NQTA 3M1LA 4WOKA 1E3LA 4WKGA 1PGNA 1XU9A 4XGNA 3QQPA 3GAFA 3JQFA 5BQFA 3KETA 2DT5A 2VWHA 2HKIA 4L0QA 4BNXA 3RVDA 3F6YA 4XDZA 1LTHR 4WEOA 1QYWA 3EHEA 2IRWA 2P5UA 1BXGB 4B3IA 3GT0A 2TMDA 2YHIB 4CLRB 2J8ZA 2Y1EA 4XCVA 3E5RA 4IZIA 3QVSA 3UICA 1ZSNA
chains in the Genus database with same CATH superfamily
3E3AA 4DPLA 1EA5A 1CZUA 3IURA 5DHUA 5IDQA 1P5RA 1WZEA 1L7QA 2HF9A 1L3BA 3DV0A 3HKEB 3K9WA 3LZCA 4ZI2A 3BL8A 2D2FA 2V7BA 2QTAA 3OE4A 4E14A 2W7TA 5BOVA 3ZE0B 1F6DA 4NH0A 2RHBA 5IKPA 3FBGA 4N9QA 1VRCA 3GAZA 4RHUA 5BXYA 4URWR 4UEOA 1CTQA 3LG2A 4I4LA 1T9CA 3AY3A 3LVQE 3RG2A 5IF9A 2E4ZA 4FOTA 1HURA 4YLGA 4PWYA 3FNIA 1J70A 4S24A 1NE7A 2RGWA 4ZOEA 2F3UA 1K8RA 1P1CA 5ITZA 4KAFA 3QVWA 4KX3A 2M1XA 1OZHA 2WRZA 1D4AA 3EGXB 1EDBA 1C2TA 1XE3A 1W0CA 1UC4B 4YXWD 2WB4A 1I6LA 1JR2A 1GRNA 4HGYA 3ORHA 3MM4A 1RWWA 5D00A 3ZWMA 3I5YA 2F3QA 5IFLA 1MNAA 2VTDA 2HMYB 4XOUA 3WAGA 2AMVA 2ZRFA 4K3VA 4OBEA 5CBPA 1F3OA 1UDRA 1T4CB 3MPUA 2Q0HA 2GVDC 3AINA 3S2YA 1DX9A 1H1LA 2DCUA 3AJ9A 4IMJB 1HDGO 1HBJA 3JQ7B 2Z6UA 1ZH4A 1ULBA 2FVYA 4AYXA 5JPIA 3KBBA 2VDJA 5ESDA 1OAKA 4YMSA 3WIVA 2O8EA 1E7SA 1QCZA 3SDSA 3SLKA 5F1YA 3AY6A 1RWOA 4HN2A 3L7DA 1W76A 3CO5A 2Q07A 1Z18A 4QUGA 4GNRA 3OU7A 4B3JA 3NXKA 3USES 1QX4A 2OXCA 2YINC 2G1PA 4HP8A 4NCHA 1LXCA 4YC7A 5AJVB 1RZUA 2ZB8A 2J3QA 3KKMA 3FCXA 1GA4A 3CZ5A 4KAXA 3RTAA 1ZMBA 4GZLA 3MIIA 3K0CC 4JUDX 1QP8A 2RHWA 1M7BA 3IVRA 1WUTA 1CZOA 4HDNA 3W7VA 1IUOA 2YJZA 2PJDA 3TR0A 5JBIA 5L3SA 721PA 3L49A 2WUEA 3PRYA 3Q0EA 4ZZ2A 1PL7A 3KZ1E 3T1QA 3E15A 5EJEA 1GKIA 2EEZA 4KWHA 5BSMA 1UPFA 2JDIA 4BUJA 3H83A 2IPNA 2OZVA 3PHJA 3OUTA 4MPJA 2XZLA 1MX1A 2BGJA 4F9EA 5BN5A 2A2ZA 2XNCA 4ZPXA 3SFVA 3O73A 4GZMA 4PEVA 4TM8A 5ICFA 1Q1BA 1IXSB 1IHUA 2EZUA 3ZEIA 5DRYA 1M2NA 1BVHA 1THMA 3P32A 2B8EA 2OCKA 4O2BA 2HBZA 3MWGA 3RLIA 4GI7A 3IHKA 3TW4A 5JDIC 5AJUA 1S0UA 2R97A 5DW3A 4O8ZA 4C88A 4F56A 1Z4IA 4MUIA 2FNAA 4GL2A 2G1UA 3C7AA 3DMGA 4RMGA 3IP5A 3ML1A 2V7WA 2ZS8A 3KYJB 4RZIA 1IZ0A 5D6NA 4HQNA 1AQUA 1KR2A 4KFSA 5TGDA 1CR6A 1GQOA 3NKFA 2PZEA 4ZMRA 4YHHB 4Q9NA 4XIYA 3SEFA 3MLAA 1XVIA 1VJ1A 2XVXA 3U26A 1XZ8A 4BGUA 2P65A 1YJ8A 4OMFG 1CHNA 4Z3KA 4NPCA 5CFRA 5L4NA 3N7TA 4FB4A 2A5FA 2QN7A 2ZI5A 3QOYA 2R0QC 1L4GA 3BMCA 4N9WA 3RHZA 1RQLA 4D3FA 4U7DA 1B0AA 2CLCX 4IHJB 4LC1A 1CERA 5C18A 2QD5A 1J24A 4F3KA 2WZQA 2WWWA 5HFJA 3Q5GA 1D9XA 1DWOA 3EEQA 3MBKA 4K3UA 5IBQA 3KR1A 3V7NA 5C3MA 3G89A 2NVWA 1WXGA 1EFKA 3EXHA 5A3SA 1NDHA 2BHRA 2F48A 4OI4A 4FDMA 3SAJA 1E2FA 2CZQA 3HV2A 4BMCA 2BFBB 3GJ0A 3OBBA 1ARZA 1EUZA 1JSCA 1PKXA 5CJJA 4NBRA 2R1UA 4MULA 2NU6A 3T7AA 5LNK1 2PZ8A 1KI8A 2PZKA 1E20A 1Y34E 4FFOA 2PVPA 4LF7B 5K6RA 1ZL0A 3BXZA 4N8DA 1DX6A 2DOKA 5LMUB 2FDCA 3F46A 4AZ3A 4BNJA 3PFWO 4KQMA 4ZPJA 4D4MA 2WFMA 3BFJA 5KQMA 2JJMA 1W0JA 5SZKB 3RWMB 3Q5EA 2GEFA 4BZZA 4ND8A 3E81A 1ID8A 2PE5A 3Q2OA 4JFRA 4E3ZA 4B8WA 1Q7BA 3D4IA 2W2MA 3LBAA 1BEEA 2V1XA 3H7IA 4IQ8A 4TTVA 4UTZA 2Y2VA 3UJ8A 4DW8A 2JPDA 3PGMA 3RNOA 1F5SA 5A5EA 1A4UA 4BFXA 1YZUA 1PFUA 5IP5A 3TYXA 4UHJA 2AH5A 5DJ5A 3E3OA 2D54A 4G5XA 5EZQA 1QF9A 3IQXA 3V80A 3BZWA 1XIVA 2H4WA 3HU5A 2NXWA 4JK3A 4KXYA 3S2EA 2PS1A 2VP4A 3AETA 3NQ41 2EKBA 3BL6A 4IEIA 3E48A 1SD1A 4G1EB 1X7XA 1BMQA 3IPAA 4FI3C 3L9WA 3BIXA 1GZSA 3ACCA 3KB1A 2FSIA 3RSLA 2OUIA 2WU8A 3FFTA 1WHTA 4MITA 4FFRA 4P7GA 1GPAA 1YZKA 2YV2A 5SYNA 2HOQA 2YYYA 4EZIA 4ZK2A 3L0PA 1WU7A 1NVVQ 1VKNA 1EKXA 1PWEA 2BY4A 3E05A 4TXNA 2OWDA 4M8IA 1E2EA 4RKWA 4AX8A 4NBLA 1NUPA 1VBMA 1DNPA 1YUNA 4GR4A 5BYBA 2O8FB 2VP6A 3JYPA 1H2BA 5CVEA 5SYAA 1XZNA 3NNNA 1POWA 4WW0A 3PX7A 4QYMA 2AG8A 4JB3A 2EP5A 5AOBA 4L02A 1NLUA 4S1TA 3SWWA 5I4CA 3UVEA 1ADBA 4OH7A 1XTQA 3S28A 5B55A 1KI2A 1Z74A 2Q2NA 4HEQA 4QU5A 5DHRA 4R71A 5DNUA 1Y7LA 4J29A 3WV5A 1M8KA 2BGKA 1B2LA 2OHJA 1RP7A 2QI9C 2B1RA 1I3NA 2QENA 1Q3HA 2XBUA 4Y2VA 3GA7A 3DZ8A 1KJWA 1UAYA 2DFKB 3VZDA 2Z3WA 4O08A 3I62A 1AK9A 5K0NA 3L4EA 2PMDA 2BPOA 5JZVA 5G0TA 4E70A 2NPOA 1B43A 5C32A 1U9CA 4CQLB 2DWPA 2D3TA 4G4SO 1EG7A 3I2YX 1CRQA 5ILQA 4X1IB 3FTPA 1UADA 3WIOA 4ZT5A 4ENUA 1JXMA 2AXEA 1I4TD 5JVDF 4N40A 3LYHA 4D8VA 1B3RA 1N2ZA 2C9ZA 2HHLA 1ZQ1A 3OEWA 3OEHA 4FE7A 4L27A 4YBRA 1QO0A 4YBZA 3UYKA 3G0BA 4JJ4A 2HJRA 4BFUA 4TUYF 2FAXA 3AV3A 4RH3A 2QLTA 5DYNA 3ZVRA 1FBNA 4B85A 3V4SA 4L6AA 2HGZA 1GG8A 5F3DA 4DLVA 5TQVA 3T7KA 4D9NA 5EIXA 8OHMA 3UFXA 3GIDA 2FPPA 5C5CA 2ZTHA 5IT9A 1RADA 2GCGA 3LUPA 4P38A 1JI3A 3T1HB 2XQGA 2PUJA 3NP9A 3HBFA 1B2RA 4MP3A 1CRPA 1U7HA 1CUUA 2NZ2A 2PMKA 3CY6A 5AKZA 1IPEA 1N2XA 5DBOA 5KPJA 3K0AB 2B61A 4UCFA 2H4ZA 1BA2A 1U0JA 2XVAA 2E5WA 1D7AA 3OAAD 4XDHA 621PA 5ADVA 3FKSA 3WA7A 1G8FA 1W4CA 3GJXC 4MOWA 3TO5A 3CB4A 8GPBA 2VF8A 1NMXA 2WV7A 1FFDA 1T15A 3GLKA 1WDKA 2F62A 2JHGA 3BVPA 2RJNA 5A1JA 5KAMA 4EKEA 1YR9A 3R23A 1HYBA 1M1NB 3LDFA 3QMWA 2XB9A 3ER6A 4PQRA 4TL6A 4F4CA 1KIMA 1R37A 1E2DA 1Z2PX 2B8NA 1T10A 1O2DA 2OTCA 3F8TA 3FCAA 5AKHA 3V1YA 2PS0A 2XDAA 3IHWA 4TVSA 5JU6A 3COJA 1PD0A 1R64A 2BGGA 3PKJA 5IN4A 4BP3A 3TIIA 2W8ZA 1O5TA 1MP0A 4F5EA 1EM6A 3TBHA 3EPJA 3P27A 1TUEA 2HQOA 2AZXA 2AC4A 4TTJA 5ESXA 1QIEA 3EZLA 4BFTA 2H59A 4JIGA 4B46A 4CTNA 3U4QB 4IFBA 3I5UA 1CJBA 2UZIR 4IFIA 1FNDA 3X44A 4D0GA 1WXWA 4RTKA 1P62B 3QPDA 3B13B 3CCBA 2EDAA 3WKCA 4B76A 3JAKB 2HMAA 3ZZ0A 5REQA 1S2DA 2Z3ZA 1N1MA 3OPQA 2VHTA 2Y0DA 1US8A 3RK4A 4KXQA 1OIWA 4YRFA 4OJNA 2BRUA 4M49A 4K81B 2J67A 3H9QA 5B7QA 1VIAA 5KYXA 4QKQA 3QWFA 1N7HA 1RCFA 1TTPB 2NG1A 4MJ7A 4GM4A 4GSYA 4ZCSA 1E9FA 5F98A 3HJFA 1Q7EA 4LKRA 2EFJA 4P22A 1Y1KE 3ENQA 3TGPA 1BZYA 4H1UA 3FE2A 3HTXA 1NP3A 4JB2A 1K6JA 4JOBA 2XY4A 5EFZA 1J56A 1JBQA 1MN6A 1AKMA 3EXFA 1ZOLA 3JWJA 2KPOA 3E70C 2IYAA 3P2YA 3P7MA 4IINA 3RVLA 4I55A 2AJLI 1C3LA 3GHHA 2NIPA 1SOAA 2LIVA 3MMSA 1VFNA 4C0JA 1MO6A 5DLPA 1N33B 3BL5A 2AHRA 3IMKA 3GNTA 3FB4A 2PUWA 2YOHA 4BNIA 1F38A 2ICAA 3MK31 1JIVA 3E2MA 1ZIXA 3OJ0A 4WNIA 3C8HA 3IXQA 3C1AA 4PRLA 4EX7A 1TCBA 3W9BA 4RV9A 4E4YA 2XIQA 3L2OB 2CCKA 2OORC 3T12A 5LQAA 3LQ1A 2ZLBA 3DB2A 1WB4A 2W6CX 3GJ7A 2QUKA 2DBZA 3T34A 5MN6A 5FFMA 3IQZA 3FYHA 4DN6A 1XXHE 4JA0A 1NY5A 3DG9A 2XCIA 1B14A 2O7VA 2GN4A 2N75A 4BEJA 4AY5A 3EQ2A 2QT9A 3UY4A 2POQX 3LX8A 3O4IA 1KEZA 3ERCA 1NU8A 3GEPA 2CXSA 5DBHX 4B0PA 3A6GA 2EX1A 2RMKA 1D03A 4OHXA 3Q3JB 4BO2A 3CLUD 4CQJA 4D3YA 4BO1A 2BFNA 5MN4A 1JWAB 3UPUA 5KTPA 3AKEA 1WSAA 3UJ6A 3RRJA 5SY4A 2FCAA 3DVAB 1WP4A 2AEEA 4PYIA 2G63A 4PX3A 5A4IS 1A9XA 2G4LA 2ECFA 3I6ZA 5KYWB 3THWB 1JTVA 4Q19A 5D85A 1ZWLA 3C7DB 5HDBB 3HKCB 4R54A 2QE7A 4D4GA 5TMDA 4PINA 3UJNA 1LCIA 2UKDA 3F4BA 1ZI8A 1XFAA 2MYPA 5AHWA 1ISSA 1JHQA 1L3IA 2RG1A 5GTDA 1ORDA 1IK4A 1CHDA 2XADA 4P86A 3WYNA 2Y93A 3W78A 3PLRA 3QTBA 3SICE 1MO3A 4WCFA 1VG1A 3LLSA 5A4MS 1QX3A 2GXQA 2PKCA 3F6SA 2VYND 3PXUA 3PWTA 2WDZA 4KJXA 4LXIA 4HNQA 1ZOPA 4L85A 3GCZA 2C9OA 3NALA 3DE2X 3UV3A 3VV3A 2TMYA 1Z37A 5JC1A 1JTEA 1QAQA 2Q21A 1PJRA 4L5BA 3TI9A 4YP9A 1L7OA 1B1AA 3BTVA 4NARA 5HZGA 1YI0A 3QHPA 2ONJA 3MCWA 1IVYA 1ODIA 2K2QB 3AHFA 3LKVA 4EB0A 2JZCA 3LXXA 3H7AA 4IQFA 4R8RA 2AVDA 2JFPA 2PSHA 3W3AH 4O4IB 2GJSA 3PDIA 3PEWA 2FHSA 4TMFA 1G20B 1R8YA 1DKOA 1PNVA 3EASA 3N76A 4Q3NA 1I1HA 3T4UA 2W6JD 3VAYA 1EX6A 2FOXA 3SX4A 1KDYA 1P1FA 2I2XB 2WSIA 1L4YA 1UM9B 2MJLA 1FXWF 3FOAA 3MVEA 1XZLA 1A4IA 3M6WA 4CIAA 1JAHA 2DR0A 1Y4ZA 5F4BA 4PSCA 1Z6TA 4FS8A 4L5JA 3NHBA 3Q8WA 4FHCA 5I01A 4DR3B 3U3XA 2JL1A 2QW8A 1M1YE 4PAMA 1J39A 1Q91A 2Y1GA 3EE6A 5TMPA 2A1UB 1UJCA 2H1FA 2H1WA 1ULTA 1HE2A 1M2GA 5CDGA 1YU6A 5KJFA 2BMJA 3BJIC 2XJ9A 1SXJE 4FR0A 5H3HA 3DOFA 3RKSA 1VRWA 5AJZA 5BWOA 1PJLA 3D2LA 3ORRA 4BFVA 2XKAA 3AUXA 3KKPA 4NG5A 1AV7A 1RVDA 1K68A 5B1HA 1YB4A 1Z88A 1GWNA 3L77A 4L8WB 5TE9A 2O2YA 1RR6A 3TSAA 2FJ0A 2R6GA 1O6BA 3BILA 3QX7A 4BMVA 2ZDGA 4DQDA 4UNSA 2RGGA 4MMXB 5EHXA 1JP7A 4MKHA 1USWA 4BDSA 2QMEA 3HXMA 5F64A 4PNZA 1EK1A 4XIGS 3OWOA 3JTEA 3VMMA 4BX8A 4KU4A 5EJ9A 4QICA 1ILEA 1RI1A 2IYNA 4NK4A 2O8CA 4WNAA 4Y8VA 4OOEA 3A4NA 2H1HA 4CN9A 3IHLA 5A03A 1A8UA 1UBKS 3ABRB 3AIMA 2BDEA 3UAYA 1G6Q1 4LZZA 1D6NA 3G0DA 2C0PA 4KNVA 3WOVA 1BHO1 1MENA 1MRNA 2QPLA 3K2EA 4XWTA 3VH3A 1MNQA 5JWRA 1NI3A 3DE4X 3P2EA 3ZY6A 2XXAB 5JISA 4CM4A 5FCDA 1PR1A 3UWOA 3SYNA 3H13A 1JMYA 1GNPA 4J76A 4M0EA 4QXPA 2YJTD 4PQFA 3RKRA 2ZRLA 4JAVC 2V7TA 2YJ5A 1RC8A 4BB5A 1DQNA 5IAAA 1XTRA 4XM2A 4LF9B 1TZ2A 5GGYA 1XMIA 4D4HA 3FHOA 3GRRA 2XNJA 3EBLA 5C80A 3MELA 4YMVA 4UEKA 1BWRA 3DLAA 4GOMD 1D07A 4MQFB 3SBXA 1U0NA 1KERA 1RKXA 2A1TR 4IXTA 5LXTA 3T5DA 3O8OA 1Z5UA 4U2EA 1PD1A 4FDLA 1AMUA 2O52A 4DNXA 5DGXA 1MGOA 4O1IA 4PX2A 4XPIA 3ZNOA 1WNTA 4X91A 5A02A 3UG6A 3NBMA 2W98A 3OJWA 4MMZB 4X90A 1U2RA 2XNDA 5CA0F 1JYFA 1QGZA 2HRRA 4WFIA 1KL7A 4RIHA 4YMGA 4H7KA 5K7SA 5KIAA 3V4FA 3UW1A 3HJGA 1W49A 4OAQA 1SUEA 1XEWY 1W5BA 1BROA 4A6PA 1NSYA 1P5JA 1T2DA 1DMRA 1WUHS 1BS2A 2D2VA 3GLTA 2IPMA 4TSRA 4X84A 1KE1A 1W36B 2VPTA 4I4NA 3D4OA 3N8DA 2JAHA 4QYSA 2CXTA 2XUOA 5K0FA 4V0LA 4P08A 1L9XA 1SHLA 2CSUA 2JAPA 2VTVA 3LLUA 4LMPA 4XWGA 4CPDA 3QEAZ 4LWQA 1EZ4A 4R2HA 2IUSA 3FXAA 1M66A 3BWEA 2G4CA 5JNVA 3VU0A 3CNEA 4OSPA 3BD9A 3GDGA 5H4GA 1DCTA 3EK2A 4JNCA 4OLAA 3ICCA 1BRMA 3ZHXA 1Y4DE 2RHRA 1T3GA 2Q4BA 1W36C 2UV8A 4ABTA 1VIMA 3LLCA 5IN5A 2GZAA 5T67A 3TZLA 1USVA 2ZSJA 5D3MA 3W5IA 4HFMA 4DTIA 4E6PA 5BW4A 2HRDA 1QOZA 2FK8A 1NASA 4WOCA 1N8KA 1C7FA 4BP9A 3IA2A 4DOMA 1GPH1 1IBSA 4GGMX 4FN5A 4M1OA 3FOEC 1QV9A 1PT5A 2VVTA 3I1JA 3C3JA 3D4NA 3D4LA 3DHWC 1DBPA 2ZS9A 3CLRC 3IIIA 1EK6A 2J08A 2M6RA 4MA4A 3T3IA 1NZDA 1SBHA 2FSVC 1HE4A 3C39A 1BD4A 1MT3A 5KSOA 3NDIA 4UBIA 3GIWA 4ZJUA 4MK4A 1DEHA 2XEDA 2Z8XA 3MUFA 2IU6A 1TT5A 2Z09A 5I6DA 4EVIA 2ZAIA 3KS9A 5CA1F 1EUYA 3G1TA 4J90A 1Q0ZA 2CL5A 2Q46A 3I2GA 2G40A 1FDSA 4ZRNA 3RFCA 1SKAA 3TSZA 4OAOA 4M1TA 3C1OA 1A88A 2AN9A 1VPVA 1NXSA 3AM5A 4ISCA 3TQQA 3RNLA 3MJRA 2XVYA 3K8OE 1W47A 1ODTC 4DANA 1MV5A 1K7EB 3CSSA 2VF2A 3QU9A 2WHPB 2XZTA 4NR0A 4OI2A 5EJIA 2NTEA 4LSMA 1C9JA 1QR6A 2JARA 2VWQA 1V3VA 4RD1A 1XMPA 1GZ7A 1N0WA 4JQOA 2O05A 1E7YA 1JE0A 2EARA 4UVGA 2ZVQX 3BWXA 3TVTA 1KR5A 1IZ7A 5TT1A 1FRVA 4G4SP 3A3YA 4LRWA 1RJEA 1KYQA 1M0WA 3JRNA 4W1QA 3OFNA 4A03A 4P4SA 2IUEA 2WWHA 4G81A 1E0JA 3EBOA 1PFVA 1VYHA 1U0EA 2KHZA 3I4CA 5IYZF 3ZY3A 5ALMA 1Z4QA 4BFWA 3FPLA 5KSYA 4ZAVA 2WICA 2ZUVA 4LBWA 4FYKA 4HR7A 1GVHA 1SCUA 1TGVA 1ZN9A 1D1TA 2JEZA 4FYWA 4MX8A 4F04A 3QVMA 5KQLA 1NXTA 3UMJA 1NX6A 4GXTA 5AHXA 1OFIA 3ESZA 4IPTA 4DZZA 3HA3A 1AXRA 1F6BA 2WUVA 3AHGA 1OXBB 3HCEA 5LIPA 2J3JA 4D2IA 3O84A 3T7EA 1DIBA 4E31A 1K63A 1CUEA 2F9MA 4ZJYA 2GSWA 2EVWX 4YJGB 4M6WA 3AGPA 2D1TA 4RELA 1E1KA 1ETUA 1F8XA 2AUMA 4K9OA 4YQEA 3U4QA 2WUFA 1VL5A 3L0YA 3LKBA 3TR5A 2JCYA 3A9RA 1UBUS 3UJDA 2D5AA 4GP6A 2KMLA 5A4JA 5I51A 3COPA 2OAGA 4M1KA 4DUYB 1CG6A 3KJXA 4QXMA 1GAXA 1MGPA 3UV7A 3CLSC 1G60A 2PEYA 3D54D 5KNDH 4LDAA 3UKDA 3CW8X 2R2GA 5FLKA 1MC4A 2EEPA 2PWAA 4IJUA 4CM5A 4DAOA 3DKVA 3BD6A 4PAQA 4XH9B 3BRQA 2JZNA 4CM9D 1EVLA 1L5NA 2BEKA 5EHNA 2QGZA 2BJWA 5BV2P 2B7LA 2OPBA 3GY0A 3V34A 3AVUA 1AF7A 4IHAA 4I46A 2HRCA 3A05A 4DXHA 2QMQA 3JR7A 4R41A 5TRTA 4UTVA 2IS2A 5G1PA 3ZDFA 1CS0B 1PEDA 3N59A 4MR7B 5IJZA 3HR4A 1IBRA 1IXKA 3AEKA 3E8XA 3A7DA 3ET4A 4EAQA 2HHAA 1ZCAA 1KMNA 5D3MB 4HG2A 2VUUA 4R2JA 4AJJA 1OLUB 1XELA 3CEHA 4M9UA 4QD3A 5B1DA 3ZUGA 2IITA 3MRVA 3N5KA 1JKJA 2R6DA 1CF2O 4LV8B 1BCRB 2OFFA 4BMYA 4DREA 3DZBA 2YWEA 2P69A 1IEWA 1M0TA 1UKZA 2OV2A 1EUCA 4RFLA 4UVHA 1M0EA 3QXSA 1T8PA 3HWRA 1CY0A 3O2JA 1QDEA 3AJ8A 4XYMA 3ZE7A 1N32B 2UVDA 4DR6B 5FPPA 5CFLA 1T34A 1V26A 4IIBA 3UXEA 2CBXA 1CUYA 2YHBA 3CF6R 2HLPA 4RXMA 3ZWWA 5KTSA 5IVIA 1Q3KA 1HR0B 1IBMB 4DB2A 5CK5A 4WZBA 1WBBA 3F73A 3RTDA 3ROKA 3DEKA 4CKWB 2RGEA 3L0OA 3K1TA 1GPJA 1X13A 2ZB2A 1PLKA 2BOVA 3PQEA 5DM70 2VTEA 3OUZA 1DG3A 4KBYA 3QLTA 4RCVA 1PL0A 1QQAA 2ZI4A 2CMHA 5CJPA 3A9VA 2JGIA 2V55B 3PPWA 1FSSA 1A77A 2VAMA 5AW1A 1P8JA 1SBIA 1JHMA 1M34E 1KFCB 3HGMA 3K8ZA 2G9RA 3NC1C 1FPQA 2Q2WA 4J9VA 2R3SA 4LXQA 4NHOA 3WSTA 4DLKA 5JO9A 3VDRA 2QN1A 5AM3A 5JRJA 4Y3UA 4BXOB 2A78A 4XOIA 3WGJA 3CQ9A 1R4NB 1WEHA 1HMYA 2Q3HA 3K31A 1R88A 4DMMA 4RY0A 4Z7OB 3QNWA 1G3RA 2LVBA 1XCPA 1G8PA 4BTEA 2PGXA 2RGAA 4IZ6A 3TGLA 1E2HA 5B3KA 2FUKA 5AKEA 2GB4A 3UNXA 1B23P 3T1VA 2BHTA 1IULA 2YV5A 1VKHA 1J00A 1H42A 2BGIA 3I4LA 1TF2A 1N3IA 3KYCA 4IMPA 2JAQA 1FFEA 1NUSA 1RAGA 4ARIA 2H1OA 1XEXA 3PXXA 2GCIA 1UWLA 3ZWNA 1FTYA 5LP6A 4DV3B 1FNBA 5J4HA 1PW7A 1D2EA 2ZI7A 4AJ2A 1D1SA 3GLQA 3HKDA 5HKLA 3KXPA 3WLJA 3QK7A 4JJAA 4UMEA 4KLNA 5IM4F 2ZETA 4J03A 1SCUB 1YVPA 1U5CA 2RGXA 4HUQA 3BQNB 3V2IA 1NAHA 2DLCX 5F7ZA 2P9FA 2XE6A 2IPOA 2BSXA 4M1SA 4XFJA 4JNKA 1NSTA 4HDMA 3UAOA 1UL1X 4PLPA 4RD6A 3TZCA 3WFIA 1ZR2A 1A76A 3OCXA 5EE3A 5HZHA 5L53A 2FY8A 4YQZA 5G0UA 4ND6A 4P3NA 2CVPA 1AT1A 1XHEA 2W4IA 4C4PA 1KYIA 2CXXA 5F51A 3Q8XB 2QN8A 4PZEA 2I4OA 3JCZA 4J7CA 1W2HA 3KOZA 3ZZMA 4E4TA 4R1LA 1VRVA 1J9ZA 1Z4NA 3OO1A 4E3WA 2DUJA 3JWGA 2B6NA 3U3OA 2MYNA 3P4XA 3SKVA 1QVVA 1MB0A 3GYGA 3OCYA 4IICA 1PJBA 5KHAA 5KSZA 1IM2A 2C57A 2WMDA 3C3DA 5AI0A 1Q0TA 1UFVA 3R7BA 4KRFA 1I7NA 1Z8FA 2VH2A 1L7NA 2XA1A 5DSXA 1MW8X 4FEAA 5CLGA 4QDUA 3AFHA 2B25A 4JR1A 4OO3A 3O3MB 1W34A 4KIFA 2VJQA 3CNLA 5ARCA 3GJ6A 5I45A 1PWZA 1ZK3A 3IUYA 3K73O 2A4MA 4QA9A 2P9EA 2Q8PA 4R4JA 3SJUA 1RRVA 1W29A 3CPHA 2XLCA 1XDUA 3MQ4A 1YK0A 1WKVA 3PDIB 4O4IA 2COKA 2XYGA 4D9HA 2C2KA 1S89A 2NTVA 1U1DA 3E0QA 3NTUA 3GT3A 4LNUB 4IJWA 2ZJZA 5AESA 5JXGA 2G9UA 1AK2A 2AFHE 1I13A 1LH0A 2FFJA 4KUGA 4D9BA 4GR9A 4ZGBA 3BMNB 5EPUA 3KWMA 1THGA 2HCFA 3MHTA 1NAIA 3U6KA 3ZOZA 1DAKA 3LT1A 3CKYA 3HEBA 5JNWA 2EZTA 4B0OA 1PRYA 1UAAA 2HF2A 3D81A 4TUYA 4Y9SA 2VK4A 3C6MA 3I2KA 3UAVA 1VHLA 2DHCA 4J3FA 3KPWA 4PIMA 4D97A 1Q92A 3DBRA 1QG4A 4PIPA 2BFFA 2IZZA 3VOTA 1R8SA 3IEUA 1E4EB 4FCVA 3K6JA 3DC2A 2HWKA 3G0IA 5GIPE 3PNPA 3FIJA 5F5XA 4E22A 1S8FA 2ACVA 3TQSA 1OXMA 2P2LA 1A9XB 4F1KA 2MSLA 3FGPA 2ZRGA 1Y8AA 4Y2GA 1R0XA 4LJ6A 5FOUA 4ZVTA 4ZFNA 5AQ1A 3THXB 1BKSB 4KLAA 3DOOA 3OJEA 3KXDA 4G09A 3H8VA 4K9NA 3S4YA 4EHKA 1XHFA 1ZG3A 2ALJA 1JR3E 4MWOA 4I6JA 2DQKA 4J0IA 2JJQA 2VJKA 4WH0A 2QI9F 4DCSA 3RVNA 4JA2A 2AV6A 4Q15A 1KFBB 2WAMA 1SA0B 3GZ4A 4YRDA 4BKPA 1B15A 1DAIA 4QJ4A 1T25A 4RGQA 4IDQA 2CMFA 5AVRA 4UHFA 1XTPA 4I2NA 2R65A 1KBOA 2W6NA 4EGAA 2HREA 2DPYA 1LDEA 3R7DA 5HIKA 2WHRA 1A4XA 3DP7A 2OV8A 3CB2A 1BGXT 4JKYA 5HYVA 3L8HA 2VNHA 5SY6A 2ZTLA 3NR2A 2C4NA 2R85A 1WVMA 3C3WA 3QX9A 1AH2A 1UQUA 1ST2A 3KPJA 3C85A 1D2MA 3S81A 2GTPA 2PZFA 3V8EA 5DT9A 4OJMX 1K9VF 4MQBA 1GSAA 4I55B 3H8SA 4UREA 2E87A 3TRHA 3I9NA 1MXFA 3OPMA 4G25A 1GSHA 2Q62A 4JBYA 1XDGA 4B3HA 4CYMA 4UNNA 1XDZA 2Q8QA 4DZRA 1P61B 3UT6A 1O95A 4AZSA 3H5NA 2R86A 1TQ6A 2II6A 2QB5A 3HHEA 2GSDA 4QYWA 3F8WA 2GPNA 3AVWA 2H00A 4PO8A 1VPTA 4M86A 1K7YA 4AYTA 4KRXA 2OKCA 2XF2A 5HWSA 2FSVA 2AZ4A 1LPSA 1QFZA 2O57A 1NVAA 2W0SA 3BXPA 1GCIA 1CVRA 1JEDA 1QGDA 2ZAGA 4M0LA 2G3YA 2I22A 2ZAMA 1WVIA 3GA5A 1Z9BA 3CKMA 3GH1A 2FPSA 3IBCA 3B1XA 3VZSA 2EZ4A 3EH2A 4W82A 1WPQA 4UD2A 2I1VB 4K6OA 1T5LA 3GXBA 3K6SA 4DLYA 1HE3A 1GQFA 1QGAA 2FX3A 3DD5A 3M5PA 1BOOA 3I8XA 5DGIA 1R3DA 2FFAA 3AUJB 1OZFA 3HM9A 4TWBA 1JFTA 4HDSB 1R2QA 4HX2A 1B8UA 1YMQA 1FRFS 1XD2A 2QZPA 3KP1A 5C3UA 1JHPA 1YC2A 4I1VA 4J1NA 3LCVB 3TNYA 1MRZA 4YK7A 1SPXA 5F35A 4BXOA 1YL5A 1ZJ6A 1QC5B 1GRRA 3CNHA 1MT0A 4D25A 2FZ5A 3ZNNA 3K5WA 1LNQA 5HRAA 1T2CA 3RF7A 1R18A 3HYRA 4PR3A 3OICA 4BO5A 1U31A 2AD1A 3A1SA 3WWYA 1P0FA 2NTNA 3R7FA 1GIAA 2ZB4A 3B78A 2VHZA 3IIEA 4MEAA 2WWIA 4JLVA 4ZCRA 1HDZA 2Z2IA 1Y33E 3AEUA 4PYJA 2ZPTX 2WG2A 3NDPA 3R3SA 4LQCA 5IRCD 3ESQA 3JQAB 1SXPA 2EFGA 2RK3A 1YZTA 3WLKX 4DB4A 9MHTA 1VB3A 2FPIA 1JT9A 2CYAA 2A5GA 1ONBA 4MUKA 5CDFA 1NJ6A 4XEHA 3ISTA 4FLEA 4IGKA 1DT5A 4HDRB 2OV6A 4KQGA 4R51A 2WHXA 3EXG2 3JX9A 3HBLA 2QDKA 4LXYA 4QL3A 3IAHA 4YCMA 1XZIA 3F7OA 1VJ5A 5ALTA 1DS6A 2H51A 3ZC3A 2ID4A 3NO4A 1FU8A 4K9PA 1PVOA 3LVFO 5FPQA 3L4BC 2IYPA 4L4XA 3KJFA 3OD5A 3PC8C 3RAEC 3MXTA 2R11A 2WHYA 1YZ3A 2C99A 1I2CA 3ZZ1A 4BVBA 4UM9B 1NJ5A 1AQYA 5K0JA 2HHJA 3DFFA 3KFXA 4XXHA 3SSMA 1RC1A 1NVKA 1IEQA 1Z2OX 5CRIA 1E94E 1Z45A 2Z8YA 2NO6A 3C8UA 4L8VA 3A9SA 4M1EA 4HSGA 4NBSA 1TD1A 4ZIRA 5HKAA 3VSDA 1QANA 4YPOA 4OMUA 5FA5A 2LR0A 2DH6A 3NRCA 4INZA 4NQZA 2FJUA 4JI4B 4RGYA 3M6IA 4F84A 2J0VA 2CL0X 3F3SA 2C9CA 4KIUA 2KM1A 3P9NA 4H7EA 4CKEA 1KORA 1Z6AA 1FDVA 1S2LA 3LUKA 5HSGA 3VTFA 4XWKA 3NBXX 1KJIA 1EE1A 1RABA 2DFDA 2I7DA 4H18A 4EKNB 3K05A 3C6BA 2WF5A 3PR1A 3AVYA 4LI0A 4XTCS 1L5ZA 4F4DA 1FYDA 1UBRS 2RI6A 4YCBA 1K3TA 3DUWA 3F5FA 3GRYA 3MQ2A 4HB3A 2GNOA 4JHXA 1E60A 4R6WA 2WQ7A 4Y1FA 4IY1A 1S3GA 1CY1A 1B93A 4OUKX 5MFPA 4W4TA 5ALXA 1LW7A 2AQ8A 5HUJA 1LEHA 2OXRA 4YJHB 1RE0A 4FNMA 3TL6A 4ZK6A 2CLHB 2BVNA 3UAGA 2XQFA 5C8XA 4NQRA 3AIOA 3I53A 1NLYA 1Z08A 2CFSA 4YJGA 3LOPA 4MH0R 4N03A 4QWMA 4KWIA 4TKLA 1NW5A 3HXTA 1WULS 4WD3A 3CW9A 5D51S 1Z75A 2Y76A 1RBQA 3G2NA 5ITVA 3UF0A 2WVGA 2IH5A 2WW8A 3L5KA 4EVQA 5CB6A 1RP1A 1UEIA 2F90A 2NZ8A 4INJA 4BJ5A 5FWYB 4EI9A 4F38A 3GD7A 3DLHA 3B8EA 1X1AA 1GRCA 1PS8A 4Y9TA 4B3TB 2A9FA 2GCNA 3I72A 1N77A 1TUBB 4UM8B 2JLYA 4DR2B 3DAYA 4H27A 1E92A 1JAXA 1QCYA 4Q24A 3W79A 3ZIUA 1KPGA 2B7CA 4MGYR 4QDJA 3HB0A 5M5BA 5LQDA 1LDYA 1EEXB 1VCHA 3ZZUA 4C0KA 4BKMA 3C4JA 3K32A 4HLQB 5FPSA 3QFRA 4PTLA 3WNDA 3QVUA 4RTNA 1D1QA 1UMDA 4FGWA 5AJXA 1TMGE 5LD2B 1C9KA 3EZ2A 4UCQA 2TMKA 3IEKA 2F43A 5I47A 3NGMA 2EF1A 2VTBA 3IT0A 5KQRA 4YJ2A 1RRKA 4UE6A 2ATEA 3VR3A 3W5UA 2NSJA 4PONA 4X6YA 5C1IA 2ORIA 3WGVA 2J7KA 4UTRA 4EM6A 4MQ4A 3ZS9A 4UEQA 4AZ3B 2CUZA 2MINA 3EZ7A 3ZJTA 3OTWA 3RFFA 2GERA 4IWYA 1AE1A 2X3FA 4UU7A 4XLLA 2UYCA 3Q87B 5JANA 4K9SA 3JQRA 4L15A 3OPYA 4LKOA 2Q4OA 3EDCA 5B3LA 4OHVA 2AF3C 4NP6A 1HWYA 1WQ1R 3B20A 3TDMA 4WCDA 1ZJZA 2ZQZA 4DQVA 2WYWA 1TVKA 1YDEA 1ISMA 1DAFA 2QVLA 2Z43A 4HWSA 1H8HD 4JGBA 1KOLA 2VHCA 2GM3A 5A4FS 4OQPA 4BBZA 4BU0A 2MU1A 3FPSA 2H9YA 4D4IA 4FSXA 1ADFA 3PXCX 4ZQFA 4GOJA 4H6XA 3BFPA 1E2BA 2Q2VA 1OXTA 3P4UA 4CCYA 4GYJA 4LRTB 3SZMA 1L5VA 1CC1S 1TO1E 4GDMA 1M1NA 4HS9A 3E9NA 3SHTA 3ZG6A 3CCFA 3UHOA 4HNGA 4HGZA 2Q7DA 1AS0A 4KYUA 1AXEA 4LISA 1Q21A 4B74A 4D3DA 1MABB 2ZRMA 4K9LA 5KYUA 3EISA 1X6VA 4ARBA 1CFJA 5CX1B 1GVNB 3AVPA 2W2LD 1CUDA 4EBFA 2QZJA 1JJFA 4G1FA 1Z0SA 2A7QA 1CLUA 3SMVA 3L0ZA 3GUYA 4OREX 1YQTA 1P1JA 4MW2A 2PX0A 1MAWA 1XYGA 1AQNA 4PNHA 3T7DA 2YY7A 2W43A 3BIWA 2ZRDA 3D8HA 3DAPA 5FUWA 1JYEA 3EJWA 4RPLA 2ZBGA 1MAUA 4BVFA 1KZHA 3AVTA 3K9CA 2O3JA 4BGEA 4H35A 3PXGA 1XO1A 4C3ZA 1B8VA 4AQDA 1DTSA 4LF4B 2ECQA 2VBGA 4BNKA 3CMCO 1CUSA 1JVBA 4KPUA 1TW2A 5FBKA 4OEHA 5AKIA 2ZJ6A 4Q03A 1SHUX 4MRSA 1VGQA 3L4SO 1DG9A 5I7EA 4FPXA 1LRKA 3FPBA 4C6SA 4YV7A 2UYQA 3JVIA 3STYA 3K71B 5F5LA 2WAAA 1LQ2A 1IVNA 1XWWA 2NOAA 4JXJA 1X1DA 5KNDD 3U5ZB 1RJDA 3U7FB 3H8JA 2J41A 4UUBA 1RAEA 1U0SY 3ZE6A 4XIFA 2F1IA 1PFWA 1Z22A 3ILYA 3PFCA 1ZUWA 2BGRA 3HBNA 5ALDA 1R16A 4PGHA 4XFDA 3UPDA 4B09A 1PBTA 2BYTA 3ILVA 5H82A 1YS1X 4KXVA 3BZUA 3L7IA 4NJOA 2ZUEA 1RWKA 4CIVA 3ILXA 2K5UA 4PXSA 2DUMA 4A82A 1J06A 1OZAA 4R1SA 5ALUA 1LBTA 2H7XA 4YRLA 3OWXA 2E2WA 4FYYA 4HPXB 5FOTA 4C4AA 4E1VA 1CUBA 2NXJA 1JAIA 1C4OA 3WAKA 2A88A 3QENA 4BNNA 4UMVA 2P30A 3AUTA 2TYSB 3KT6A 3QTTA 5GONB 3F6EX 4Y6RA 1G38A 4PU0A 4AJNA 4DARA 1H4VB 1VM6A 5AXDA 2Y1WA 3D7LA 2R7AA 3M9WA 3QE2A 3H2YA 3IV6A 4JN6B 3VPSA 4CF5A 5EC8A 3SK0A 1HF3A 4AIIA 1R6UA 1G5PA 5D6OA 3Q7IA 3ITEA 2R1TA 2WOOA 1DJQA 2W6OA 1OPRA 1U0TA 1YZGA 3KXKA 3IR5A 1EP1B 2J7PA 2VT3A 4P7BA 2PQ6A 2I34A 5M3BA 5K4HA 3ADPA 1HDEA 2MYUA 2DF8A 4JVSB 4KQHA 2JG3A 4RF4A 1RM0A 2C4MA 2O4CA 4IIEA 1QR2A 1UBNA 2ZB7A 5L3ZA 3WDMA 2P90A 2A9KA 1V1MB 2ADFA 4AJ9A 1AZTA 2QPOA 3DEFA 4WSOA 3IE1A 3PTZA 4IS3A 2L19A 3H4MA 4EKYA 3GCXA 1M6EX 2QXYA 4BATA 2H2GA 2ZI6A 3D0KA 3QELA 1QRAA 3KR0A 3V8QA 4D9MA 5HPYB 1EUDB 5A5VA 1E1QA 2BFPA 3KXIA 3N6RA 1Q7TA 3ORQA 4Y1RB 5A05A 3IVXA 1YBVA 2V3WA 2HMSA 3E4CA 1NFFA 4FGKA 4K88A 4IQGA 4EHAA 5DGDA 3BFVA 2OBNA 3DMNA 3K9NA 3QLJA 5FPKA 4