2ZTMA

T190s mutant of d-3-hydroxybutyrate dehydrogenase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
255
structure length
255
Chain Sequence
VAVVTGSTSGIGLGIATALAAQGADIVLNGFGDAAEIEKVRAGLAAQHGVKVLYDGADLSKGEAVRGLVDNAVRQMGRIDILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASAHGLVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRSPLVEKQISALAEKNGVDQETAARELLSEKQPSLQFVTPEQLGGTAVFLASDAAAQITGTTVSVDGGWTAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D(-)-3-hydroxybutyrate dehydrogenase
publication title Closed complex of the D-3-hydroxybutyrate dehydrogenase induced by an enantiomeric competitive inhibitor.
pubmed doi rcsb
source organism Pseudomonas fragi
molecule tags Oxidoreductase
total genus 99
structure length 255
sequence length 255
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.30: 3-hydroxybutyrate dehydrogenase.
pdb deposition date 2008-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2ztmA00
4IJWA 2A94A 1XQ6A 4GMGA 4BNKA 4D43A 2OZPA 2SCUA 5K6AC 2CFCA 2EW8A 2UDPA 4GX0A 1P0FA 1PQPA 2Y1EA 3QWFA 4ND1A 4CQLA 1EUDA 4IZIA 5KNLA 3H3JA 3X2EA 1UP7A 1T4DA 3JD1A 4RCVA 2PGJA 1P0CA 5TJ9A 1QV7A 4J4TA 4BKOA 4BNVA 2NTJA 5AXAA 2I6TA 4KUGA 4PVDA 1E5LA 2YDXA 4K6CA 5KVVA 4B3IA 2OHXA 5BNFA 5MGBA 5JBIA 3VPXA 4XB1A 3AY3A 1WW8A 4ZQEA 2GERA 4UVHA 4AJOA 5JO0A 1B26A 3RJ5A 5GZ3A 4OOFA 1VE9A 4XQCA 1KY4A 4CODB 2HJSA 1DRVA 4YT5A 3JQAB 2HK8A 3OSUA 5K6AA 3W8FA 3WMXA 5HTOA 3GOHA 7ADHA 1EUCA 3D4OA 4CMGA 2IRWA 2WYWA 3MCVA 4NNJA 2IZZA 2P5YA 2FSVA 2DTEA 2HMTA 4IGEA 3LLVA 1HE3A 3WJAA 2X8LA 4NK4A 4FIZA 4B4WA 4YJHB 3IP1A 1K3TA 4ZVVA 2DBZA 4TRMA 3AW9A 1RM0A 3BYZA 3JYNA 4YAKA 4XJSA 3OJOA 1PGOA 4AFNA 3AFMA 2H5LA 3F46A 3MOGA 2OFPA 3BMNA 4DC0A 3HB4X 4UREA 5JNLA 5CEFA 1U2DA 2FR1A 1X1TA 4H15A 3QE3A 4LGVA 1D8AA 2Y05A 3K2EA 3DC2A 5DCUA 2Q4BA 1YGYA 2RHRA 3JQEA 1N2SA 3RU9A 1YL5A 3KO8A 1BHSA 4B7UA 3GVHA 5LDHA 5JMWA 2X0JA 3JTMA 4IBOA 4CQMB 1MUUA 1U7HA 1VLLA 3RJ9A 1L7DA 3NDRA 2Q1SA 2W2LA 1VKNA 3BMCB 4L76A 3PRJA 4CLOB 4XQ9A 5JAMA 1PSDA 3VPGA 1DPGA 4J9VA 2ZTMA 1ENOA 3JQ8B 1FXSA 1P74A 2VWHA 2VT2A 3KSDO 3KYCB 1BDBA 2FN7A 3PFWO 1PU2A 1MFPA 3ONDA 4O0LA 3K30A 2D2IA 4FQ8A 3AI3A 2GLXA 1XELA 1KVQA 3OIGA 2O7QA 3VZQA 4WCFA 3VAZA 1E92A 4Q3AA 1FDTA 3JQ6A 4GKBA 4A2CA 1K2WA 2HMSA 4FCCA 3DZBA 3K92A 2B69A 4GKVA 4XZ3A 3OEWA 3GGGA 4OQZA 5ENDA 3JSAA 2EEZA 4XDZA 4BNTA 4JROA 4QECA 3M1LA 3WLEA 3IKTA 2CY0A 4FN4A 1M76A 1Z82A 3H8VA 4CV3A 3ZDFA 2PD6A 1NFRA 1NQAO 3DOJA 4C4OA 2I3GA 3B1KA 4TQGA 4AJEA 1I0ZA 4GX1A 2Y1DA 3ZWMA 3WFIA 4PGFA 3JQDA 3NT2A 3KTDA 1KEUA 4BV8A 4KWIA 1EK6A 1ZXBA 4P4GA 3LC2O 4BO2A 5DDIP 4ALJA 1R4NA 2WTBA 2HRZA 4QO7A 2PLAA 4EZBA 1C1DB 3V5NA 1WMBA 4CLXA 1EVIA 1MLDA 4J1TA 1BSVA 5BSHA 3OJ0A 3PJEA 3CEAA 1GYPA 3ZW8A 4JBGA 1N5DA 4IZHA 1KVTA 4HNGA 3OFSA 1PZHA 2W90A 2NWQA 4TZKA 4GPD1 2GSDA 5BQFA 4E13A 4M54A 3D4PA 1ZKMA 2YJZA 4RVGA 2EHDA 1P44A 1TEHA 3KM0A 5A05A 1QV6A 3WYBA 1LSSA 3KSUA 4FOOA 5H82A 1A72A 1OC4A 2X58A 8LDHA 3ICCA 4ALIA 3D3WA 3RKUA 2POQX 1M6WA 2X23A 3PHIA 4MVJI 4YYZA 1NQ5A 3FRJA 2CMDA 2D4AA 4Z0TA 1E3EA 2PH5A 3M6IA 4XEHA 1ZZEA 2I5PO 2Z1NA 5DCYA 1EDOA 3GG2A 1GUYA 3GK3A 4CM9A 2VWQA 5EQFA 2VHZA 2IYPA 3UAGA 3WICA 3OIDA 1F14A 3DQPA 3WSVA 1K6IA 1U8XX 2JCYA 4UUPA 4YCAA 3K31A 2ZATA 4MVJH 4IQ8A 1G0OA 1Q2XA 1FMCA 2R00C 1QXSA 2XXBA 1H6CA 5B4VA 3DB2A 2J6IA 2O2YA 2RAFA 3I9OA 4EYEA 1V9LA 3NTRA 1DLJA 4R68A 4E21A 2W2KA 4IDAA 4QEDA 3PHGA 3O4RA 1ML3A 4BVAA 3U5TA 4KWHA 3EW7A 4CM8A 5DBGA 3GNQA 3RC1A 1PWZA 3I9JA 4BNGA 1NQTA 2GPTA 5C5IA 3BMQA 2WD8A 4NJOA 1BW9A 4GGOA 2UVDA 5K9ZA 3ZU2A 4FFNA 2I76A 4CUJA 1WMAA 4BNUA 3WMWA 2D3TA 1Z74A 3ONEA 2OMEA 2EGHA 2PV7A 4KDEA 3C7AA 2CF6A 4UUNA 1V35A 1LRLA 1OI7A 1ZUD1 2FRDA 3N58A 4RQUA 1NASA 3LK7A 1DJQA 1WDKA 2R00A 4BKQA 2UAGA 3CPSA 1EMDA 1KIFA 3CZRA 5IN4A 2FZEA 4IS2A 4PRLA 3VH1A 3ASVA 5MDHA 1LDMA 1LDGA 3WBFA 3MOIA 3ZWAA 2DPGA 2HO5A 5HRUA 1HXHA 2ZIZA 2QRKA 4DYVA 3RIHA 5BNTA 5CFZA 3QVWA 2QX7A 4AJLA 3NAQA 3DR3A 2ZB4A 3MJTA 3WXBA 1P1KA 3WJ7A 1XU7A 2VOEA 4DC1A 2HJRA 2DFDA 1I32A 1LBEA 3RSHA 1MV8A 4J7UA 1HSOA 1RPNA 4PVCA 4CMHA 4GVXA 4PG7A 3H2SA 3LC7O 3WGOA 3FN4A 4PCVA 1Y9AA 2ZYDA 3VOSA 2EKLA 3D5QA 1YO6A 3LT2A 3QWBA 2EW2A 3OICA 4DRYA 1H5QA 4FSHA 4E4YA 4NBWA 1ADGA 5G0VA 2XF8A 3LVFO 3TQHA 4OYRA 2O48X 4FR5A 1EUZA 1Y81A 1O95A 4Z0PA 3ZWVA 4B7XA 2D5AA 1NNUA 2OO5A 4XYMA 3JQGB 1CWUA 3G3EA 3K9QO 3ANNA 1ZIDA 1EE2A 2P4HX 2WEKA 5IDXA 4DQVA 3SJ7A 4OHUA 1UZNA 1H6BA 1L7EA 4NFHA 1GZ6A 1N92A 4WLEA 3TZQA 2PKQP 5EIOA 4BNXA 1XSEA 4M55A 2PD4A 2YHIB 3VZSA 3F6YA 5DCWA 1C14A 4E5KA 3B6ZA 3NJ8A 1U28A 2EWMA 3PWZA 3R6DA 4U0JA 1HEUA 4GH5A 3LT1A 1HE2A 1E7SA 3CXRA 2NACA 5KVQA 3K8ZA 1Z7BA 3AOEC 1B3BA 4CPDA 1B14A 5CG1A 4E2YA 4Z3KA 4GSKA 1M66A 4R54A 1OZAA 2O50A 4YQZA 4EEXA 4IXWA 1YVEI 3KXDA 2BELA 3ON5A 3HWRA 4K1LA 2X22A 3EK2A 5JC8A 1QYWA 4RV9A 1Z45A 4TROA 4JN6B 5HWSA 5IDYA 2DUWA 5L51A 4IIUA 2YV1A 3OECA 4GLLA 2X0RA 4BS9A 1ZO8A 1MXHA 2CD9A 5L40A 5TIIA 4HBGA 3AY7A 3CZMA 2ZYAA 5TC4A 5CDSA 2RHCA 1NHGA 3EZLA 4NPCA 5CDYA 2VTDA 3R1IA 1V3UA 1JDJA 3TSCA 1O94A 3CSDA 3ITDA 1RM5A 3JYQA 4TSKA 3V2UA 2CSUA 4CLRA 2E82A 3BMNB 4D3FA 3KLMX 1NR1A 1HZJA 2YDYA 3W8EA 1I2ZA 1EVYA 2O4UX 4RPKA 4BL5A 3QQPA 1D4FA 2VUSA 2VUTA 2DLDA 2GYYA 5DOZA 2G0TA 4WLVA 3PYMA 3R0IA 4DPKA 4R41A 2GZ1A 4M89A 4FC6A 3RC9A 2AQKA 3BMCA 5KKCA 4CLOA 1X0VA 4O5OA 3BIOA 2EKQA 1ONOA 1VI2A 3ZH2A 1PJ3A 3ROQA 4R3WA 2H9IA 5F21A 3T7EA 2C82A 2PTGA 4YRDA 3O38A 4MVJG 1QYCA 1E3JA 3GC6A 4OSPA 3JD3A 4J2HA 2X5KO 5TNXA 4CLEA 3UOGA 2OP0A 2J3HA 4J49A 3PTZA 2VT3A 1ADFA 5ILOA 2VYND 1P77A 3G0OA 5T57A 4R16A 3LYLA 1UJMA 3SC4A 1VJ0A 2O7SA 1AXGA 2P9EA 4ND4A 4WLOA 1TI7A 1KEPA 1B16A 4E2ZA 4E0BA 2VRCD 4CL3A 2C20A 2XXJA 4UEKA 4CM6A 1WP4A 3HN2A 4WCFB 2E37A 2BF7A 1HE5A 4MP6A 4IM7A 1ISHA 5F1PA 3GFBA 5DBIA 2B4TO 3ZU5A 4I8XA 1V3VA 2BGMA 3IJPA 1PIWA 4YEDA 1GY8A 3ETGA 4RPHA 3WGGA 2HU2A 3L77A 4O1MA 4E31A 5HM8A 3TL3A 4ND3A 3B20A 4LN1A 1IPEA 3LU1A 4L75A 2PZJA 1E3IA 4QUKA 2AE2A 1B15A 4DL9A 1WVGA 1DDOA 1BGVA 4WASA 1WDLA 3PLRA 3UH1A 3G79A 3TZKA 5KIAA 3D1LA 1U1IA 1C1DA 4Z9FA 1GZ4A 3GUCA 3TL2A 4HADA 4S3MA 5I8ZA 1J49A 1VC2A 1DIRA 1Y9EA 3I9NA 2B36A 3H7AA 4JP3A 2IZ0A 5JE8A 2ZQYA 1I33A 5FYDA 1WPQA 3UW3A 4AJHA 1AHIA 4IJKA 1QR6A 4NHEA 5I7VA 3RASA 1H2BA 4DXHA 3KSZO 1U5AA 1O9BA 4FW8A 1LSJA 2Q2VA 5TJHA 2I67A 3ANMA 4XIJA 3AY6A 2CUKA 5CPBA 3EZYA 3PZBA 3JYPA 3I9KA 3AWDA 5EERA 4BNZA 5KJ1A 2I99A 3FNHA 4CMIA 4RL6A 1PS8A 4GBJA 5ICSA 1P9LA 4MVJA 2V6FA 4PIVA 3LQFA 3P7MA 1Y5RA 1JA9A 5IN5A 1HYHA 4GWGA 3ZNPA 1GDHA 3ZNQA 4ZQBA 2D59A 1CERA 3QY9A 3WNVA 3AI1A 1SMKA 2QZZA 3D3WB 5AQ1A 1ZEJA 4KTVE 4LW8A 3S2GA 4M8SA 2WE8A 5CPFA 3KRTA 1GQYA 1HRDA 3L9XA 3INRA 1SO8A 4FD3A 3GZNA 5KCZA 3GG9A 2B4QA 3HNPA 3OBBA 1HKUA 2QRJA 1PZEA 5C7IO 1W73A 5U9CA 4FGSA 5KJFA 2VYVD 2H6EA 4UAGA 2Q45A 2ZCUA 4QFCA 1YWGO 2J5QA 1YB5A 4LRTB 3Q2KA 3QVSA 1I36A 4NZ9A 1D3AA 3WGZA 2AEMA 4RORA 4WGGA 4BO6A 4DQXA 4W82A 1YE3A 4UVDA 1LSUA 3H4VA 4DLLA 1GPDG 2DC1A 2DQ4A 3L6OO 1DEHA 1AXEA 1LXCA 1MA0A 3W6ZA 1NVGA 4GLOA 4RF5A 3H9UA 2BD0A 5TS3A 4F6CA 4DPMA 1PGPA 1T2FA 4CMJA 3HFGA 2OXIA 2W2KB 3GF4A 3VDRA 3WYEA 2AQIA 2JCXA 4OOEA 1NAHA 1PJQA 4YT8A 4D42A 3IJRA 4J91A 1NAIA 4BNHA 4CM8B 4YAIA 2V6MA 2NU8A 4YAJA 4UUOA 3BMQB 3BHJA 3SJUA 3I4FA 1D1SA 4AICA 1DFIA 1SPXA 3KOUA 1E1LA 1EK5A 4YWJA 3SLKA 4E2XA 6LDHA 3DFZA 3F47A 1C0LA 1HYEA 3JCZA 5CP8A 4NG5A 3VH4A 2VHWA 2CZCA 2IXBA 1LRKA 5T5QA 3UGKA 1R6DA 1OMOA 2VUUA 4I5DA 1QYDA 3ENKA 4P8RA 2ZJ1A 2WYUA 4MVJE 1Y1PA 1HLDA 2BRUA 5ILGA 3UCXA 5A5FA 4B3HA 3Q2IA 4H16A 2XAAA 4R1SA 2JFGA 5BR7A 4I9UA 5JAZA 3E03A 1NXQA 2E49A 3S2EA 4E3ZA 3FTNA 4PRKA 5EQDA 1BXKA 3RFXA 1H2HA 1T2EA 4ALLA 1JWBB 2NSDA 1JAXA 1N1EA 3JQGA 5C7OO 4ILKA 3AJRA 1NR7A 4RVHA 3PXXA 1OAAA 5I9LA 4DWVA 4GX5A 4RQTA 3R3JA 1E6WA 1ZSVA 5ITWA 4FFRA 5KJ6A 4BNMA 3W1VA 2YHIA 4INAA 1I5RA 5G0SA 1WZEA 4C7JA 3TN7A 2RH8A 2GGSA 1BXZA 4RZHA 4DUPA 2PK3A 3ADOA 1G6KA 3TJRA 5THKA 1LA2A 1TLTA 3LDHA 2DBQA 1DC6A 3GEDA 3QV1A 3TWOA 1AE1A 1FK8A 2NUAA 1U4OA 1TT7A 4CM3A 4IUYA 4FFOA 5DOVA 1KERA 3IKVA 1SEVA 5JFOA 2F00A 1I3MA 3F5QA 3AI2A 1R4MA 5A03A 4OL9A 3ABIA 2V7PA 3NT4A 5L4SA 3U4IA 1Z6ZA 4XYBA 3RROA 4AJJA 4ZGWA 1BMDA 5F5NA 4Q3BA 4DTIA 4E12A 3JD2A 4D3SA 4U6QA 5H81A 3KETA 2FOIA 5EESA 3JD4A 4TVBA 4ZQGA 3GA0A 2NTNA 3QHAA 1X15A 2WSBA 5ENVA 1NYTA 4HP8A 3TZ6A 2Y93A 3D3EA 2BFAA 1PQUA 4XA8A 1U2GA 4M86A 4F6LA 3KZVA 4PLZA 4WE3A 3PI7A 3OF2A 3ULKA 1DRWA 3NT5A 2IYOA 2EKPA 1PS9A 1ZVMA 3QRWA 1HWYA 1A9YA 3GN2A 3I83A 4B79A 1RM4A 4WCFC 1SB8A 5DULA 3WFJA 4MIEA 1LRJA 5JPIA 1XR3A 2OP1A 4B4OA 3BTUA 4CLRB 1DLIA 2EGGA 3VH2A 2DBVO 1E7RA 1U3WA 5JY6A 1RYEA 2W4QA 4RVDA 3PQEA 1YKFA 1FDSA 4YT4A 1Y5MA 1EBUA 2GRAA 2Y1GA 3MEQA 5JCJD 4G2NA 5ES3A 5AVOA 1ZK3A 3IUSA 2D5CA 1P1FA 1YRLA 3ROKA 1I24A 2FY8A 4BNIA 4NBVA 4OXYA 4NJMA 4W7HA 5DP2A 1BXGA 2O3SA 3A14A 5T6BA 2Y99A 1B8UA 4G5HA 1P1RA 5COBA 3E9QA 3ROMA 3QLJA 4CMCA 3W4KA 5CAEA 3RCBA 4R01A 3GVXA 3RFTA 4NBRA 3AUTA 3DBLA 4XQGA 1CETA 3DTTA 2YV2A 3ZWCA 1PTJA 4CJXA 2J3IA 3FBTA 4A7PA 1ZEMA 4DLBA 1VSVA 2VOJA 1UXKA 3O03A 3UICA 5AXCA 4BO9A 5BSEA 3U4CA 5EINA 4PLGA 4LSMA 1VL0A 5IDQA 4CM7A 2WMDA 4WLNA 4GAEA 4IPTA 1DHRA 3GRKA 4O63O 4U7WA 3H9QA 4FC7A 4D41A 1HETA 3GN1A 1G1AA 4TRJA 5CHEA 1DAPA 2X9GA 3GHYA 3I52A 4URFA 1NPYA 1NFQA 2X4GA 3INTA 1WWKA 2GDZA 1G0NA 3AK4A 3SC6A 1ZBQA 3P19A 3FR7A 1GCUA 3BZUA 1GYRA 1MG0A 1Q7CA 3DBHA 3F9IA 1NP3A 3IIEA 4AJIA 2VZ0A 2I9PA 2FWMX 3HJAA 4BMVA 3AOGA 4AJKA 3HFSA 1DFHA 2JFFA 3PHJA 3V1UA 1Q0HA 1U4SA 4GI2A 4M49A 4XD2A 1ADBA 2UYYA 3K73O 1T4BA 4KOAA 2YY7A 3H5AA 1LEHA 1LLQA 1GFSA 1H9BA 4HNHA 2D8AA 3KVOA 3NJ4A 4JBHA 4NBTA 4BNJA 5CDGA 3ZWXA 4KMSA 3QWAA 1JVSA 3PLNA 3ZU4A 2PD3A 3DO5A 4CMIB 3WB9A 4BO7A 1KC1A 4BOYA 3B1FA 1Z7EA 4MINA 4WECA 1P45A 3WGYA 4BO3A 4A5OA 1JKJA 3PGXA 4MIYA 1J0XO 1R66A 4Q3CA 4RLSA 2CVZA 5A3JA 4QXMA 3L4BC 4PLPA 3WOHA 1LI4A 2QW8A 1F0YA 3OQ6A 5CEEA 1XGKA 2Q1TA 5ICMA 3QA9A 3RC2A 3EVTA 1PEDA 2RBEA 2HSDA 3GZNB 2OGUA 5L53A 4YBZA 4TRNA 3RWBA 4YXFA 3WNQA 1GUFA 3H2ZA 2VQ3A 3JQ9C 3GNTA 4WNIA 3VPFA 2X5JO 4YRBA 1BDMA 2C59A 3M2TA 4NIMA 1BVRA 4PLTA 4ZRNA 4HFNA 4RF4A 2LDXA 1DOHA 3V2GA 5A9TA 1R12A 5A4DA 3HZZA 4FJ2A 4RDHA 3VPSA 1YBAA 1K5HA 1K89A 3U0BA 5FEUA 3OJEA 1JLLA 2BH9A 4KUEA 1R16A 1GADO 1R0LA 1T24A 2Y1OA 4NBUA 3WWYA 3W6UA 2X7HA 3L4BA 1T1SA 5JY1A 4BHTA 2JD0A 1JKFA 3LF2A 4MDHA 2FPPA 2A4KA 4KQXA 2YW9A 1J5PA 2Q4EA 2WJPA 3HG7A 4YT2A 4DBVO 4A73A 2Y67A 3DOOA 2VWGA 5DN9A 3E48A 3GVCA 4J0FA 4AJ2A 1LQTA 2HRBA 3JQCA 3Q0EA 3JQ9A 5F3RA 3BMOA 4KQWA 1VJTA 4R9SA 3FI9A 1A9ZA 4MKZA 1F8GA 2HAEA 3UKOA 4CUZA 2UUPA 3ADPA 2PH3A 1NQOA 4WPGA 3ZV3A 1Q7GA 2OORA 4NH4A 1IHXA 2VYVA 2GO1A 1DC4A 1ZMOA 4PLFA 3I3OA 1UXIA 4D45A 3NRCA 4IIVA 4WLUA 5FF9A 4LK3A 4X54A 3HHPA 4IS3A 1PJCA 4PG8A 4HUJA 4XGNA 3S2FA 7MDHA 1GTMA 3LZ6A 4U8GA 1UXJA 3PWKA 2NM0A 4J1NA 3E6AA 1KY5A 4YRAA 4J43A 4Y67A 1S7CA 3OJFA 3K2BA 3GDOA 3WLFA 3TOZA 1M67A 5HS4A 3AM3A 4DIFA 5IAAA 4J1QA 1N8KA 4E32A 1EVZA 2BFPA 3E9NA 4BMSA 3PYLA 3N74A 4FJ1A 2Q1WA 1DC5A 5THQA 3F4BA 1D1TA 5A5EA 3ASUA 2VTEA 1DAOA 3AM5A 3ANLA 3U3XA 2LDBA 3KB6A 3I4CA 3N7UA 3PHLA 1E77A 3BHIA 4EJMA 2ZQZA 3BAZA 4DIBA 3KEOA 5L7YA 1X7HA 5IF3A 3OJLA 5AXBA 4ZHSA 2CDBA 3QW2A 1X13A 2EF1A 4ALKA 4MIOA 4J2OA 4D0RA 1GAEO 4NDNE 5A02A 2FP4A 2YYYA 2OUIA 3NDJA 3NKLA 3T4XA 3DL2A 1FJHA 1ZK0A 1YB4A 2GN8A 5F5LA 5G0TA 3RUAA 3VZRA 2DBRA 2WYVA 3DBVO 3OP4A 3PPIA 3A06A 2BMAA 4ND5A 1U3UA 4TZTA 3C7CB 2DTDA 3QP9A 3S55A 3ZHBA 1IZ9A 4K28A 3EYWA 3JD0A 3UHAA 3DONA 1IHYA 2VZ8A 1EFLA 1R4MB 1ZMTA 1HDGO 4WOKA 5J23A 1H9AA 2E48A 1CRWG 1LJ8A 2Y0DA 4CLHA 1QKIA 3VTFA 4EUHA 4A26A 2QYSA 4QT0A 1XIVA 3D5TA 3ZCXA 1QORA 4LMRA 3W4IA 3D7LA 3TZCA 5L9AA 3PDJA 2X1HA 3ZWPA 1U8FO 3AUUA 1C0PA 3DHEA 2GZ2A 3GHHA 2E6UX 4RVSA 3E1KA 1ULSA 1NWHA 1DFGA 2GD1O 3PQDA 1E6UA 5COAA 3RAJA 3PJDA 4F46A 3MWDB 3A9WA 2PKQO 1E0DA 1SNYA 1CQIA 2G17A 4LVUA 5IJZA 3G1TA 4MP3A 1K6JA 1NVMB 3Q9UA 2NV6A 1YB1A 3GEMA 1XLTA 1U3TA 5KTKA 4ZN6A 5B12A 3ROPA 2ZKLA 1U3VA 1JAYA 2P9GA 1U9JA 1W4ZA 2DT5A 3BTOA 3QVTA 1CDOA 3ZZNA 3IS3A 1KOLA 1UP6A 3HUDA 3M2PA 1IOLA 2WD7A 3EGOA 4BGIA 4ZQHA 4DYDA 4MOWA 2BI7A 1P1HA 1QRRA 1A7KA 2RH4A 4R1UA 3ZWBA 2FR0A 2JHFA 1F12A 2ET6A 2IEDA 5A9RA 4NJMB 1YBVA 4XKJA 2I3AA 1UP4A 1BXGB 2XPCA 5DBFA 1B8PA 3UUWA 1ONPA 3SX2A 3I23A 4NK5A 1CIVA 1YH3A 2YHUA 5JS6A 1E1KA 1I3NA 1GR0A 1LLDA 4LISA 3E5MA 1IL0A 1VKOA 4RO0A 3DBLB 3O26A 4EDFA 4U0KA 4ALMA 4N5NA 1X7GA 2H63A 3OEYA 5ITVA 1VL6A 1GEEA 1NWCA 3KHUA 4Q3EA 2ZTVA 3VTZA 2HMVA 3C8MA 2Y66A 5EL0A 3ZWOA 3RUCA 2C5AA 1YJQA 3H5NA 4JIGA 1M2WA 1PL6A 2PA3A 3U9LA 1B8VA 3CIFA 1R0SA 1GV0A 4RVUA 3WX0A 5CDUA 4L4RA 1GPJA 2VNAA 4YDRA 3VHRA 1B7GO 1HSZA 2DPHA 4W4TA 3ZHZA 4R69A 4JJGA 3CUKA 4JX8A 3OQBA 4YJDA 3OIFA 3PVZA 4EI2A 2BKAA 5CDTA 4BV9A 3QWIA 3BHMA 3DZKA 2JAPA 5JCJA 2RCYA 2NVUB 3VC7A 1UXGA 3RD5A 1QG6A 1UZMA 4CM1A 2QG4A 3DDNA 3QJ5A 3R3SA 2O3TA 3RUDA 2PGDA 3HE3A 3DBHB 1EVJA 2PNFA 2P9CA 1ID1A 4BO1A 2NU9A 4CR6A 4CM9D 2HQ1A 3RU7A 1V0JA 3UFXA 3AM4A 4D0SA 1RM3A 1N7GA 4YJFB 4B3JA 5JYDA 1JU9A 4B4VA 1S6YA 3F1LA 4PLCA 4BO0A 4R3NA 1GQ2A 4Y98A 4GQAA 4XX0A 1N7HA 3FPCA 1VM6A 5B1YA 3VPHA 2ILTA 1IY8A 4IJVA 4FFPA 4BIIA 3L07A 4R5MA 2BGLA 1QYVA 4FGWA 5A9SA 3F5SA 4Q9NA 1SBYA 1SC6A 1FF9A 1XA0A 1DSSG 1MP0A 3DMYA 4RPJA 4XR4A 3TPCA 3I9MA 2W98A 3INGA 3KYDA 4BNLA 4OO3A 2J5KA 4E5MA 3K96A 4J1SA 1PGJA 1LDBA 5G2OA 5JAIA 3HDHA 4ESOA 1DO8A 1LU9A 3GY0A 3DBRA 4CMEC 2Q99A 3PIIA 2EJWA 3U62A 2NADA 4HFMA 5FI3A 2P2SA 4W99A 4CM4B 5G4KA 1AHHA 5HS6A 5ER9A 4HFJA 3JV7A 4XCVA 2GN9A 1N9GA 1OFGA 2GASA 2HK7A 3RBZA 4KDFA 2Q46A 4AVYA 1A71A 3GRPA 3H9GA 3WQQA 4NFYA 5F1KA 3WTCA 1CQJA 1B0AA 3OMLA 1Z75A 1LNQA 5K0ZA 1L1FA 2WE7A 4WOJA 2Z1MA 1BG6A 5T64A 1PJBA 2JL1A 3E5RA 4BKUA 3BXXA 2Z95A 1YOVA 1DBVO 3ZGYA 3JQ7A 2NVWA 1LDEA 4L9RA 1ZSYA 3QVXA 2IE0A 2VRBA 2Z5LA 1SB9A 4IGFA 5TLSA 1HZZA 4PG4A 5A3VA 1E5QA 3H65A 4N5LA 2C2XA 4NU6A 2VNSA 4CMEA 2G1UA 5T67A 1I3KA 3H6KA 4TKMA 4IXTA 2HCTA 3MTJA 3VH3A 5IXSA 2HMUA 4O6VA 5L4NA 1ZCJA 1NVTA 2AQHA 3OHSX 1AUPA 5TRTA 2C5EA 3O9ZA 4GVLA 4IINA 4FFMA 4L4SA 3WR5A 4OKNA 3C24A 2B83A 4HY3A 4YACA 4Z9YA 5DZSA 5B4TA 3NEPX 4HXYA 4TRRA 5B4UA 2C0CA 3DHNA 4IJUA 1XU9A 2VHXA 2C7GA 2BI8A 3BMOB 4QFDA 4ID9A 5L7TA 4B7CA 1F06A 2Q2QA 3AUSA 5HBRA 2DAPA 2B35A 1KVSA 4MVJF 3GPDG 5I9MA 4DVJA 3ZNNA 4D44A 1UR5A 4PG6A 1CYDA 1EZ4A 4LCEA 2ZK7A 4HFRA 3GLQA 1YL7A 4XB2A 2Q49A 1RJWA 2X9VA 5H83A 1H6AA 1QLJA 1H6DA 2FPIA 1PL8A 3D64A 1PGQA 3UXYA 3U49A 4YPOA 3AU9A 3JQAD 5TX7A 1Y8QA 3GMSA 4PZEA 3AUAA 4K6FA 1E7WA 1E3LA 1PX0A 2JCVA 4LRSB 3NGLA 2OL4A 2EXXA 3AFNA 3SVTA 4HX5A 1V3TA 1GEGA 1T1RA 5L45A 1PR9A 5JMPA 3GUYA 3NGXA 5KKAA 2H1SA 2ZYGA 2GN6A 4JNKA 3RFVA 2QQ5A 1QYXA 2PZMA 1O89A 1WZIA 1ZK4A 1ZSNA 1DRUA 2C2YA 3GNSA 3P2YA 4HWKA 4U5QA 3V1TC 1ISGA 2J3JA 2G76A 3F3SA 3PEFA 3LLSA 1NPDA 4O59O 1ZH8A 3H9EO 3QSGA 2Q50A 3KUXA 3GDGA 2CF5A 3DOCA 2CVOA 1IE3A 5DP1A 1ORRA 4CV1A 1J4AA 4AJNA 1WDMA 3JQBC 1OOEA 3ZV6A 4RF2A 4YQYA 5F1OA 1ZJYA 4C7KA 2AHRA 3EUWA 2D0IA 1W8DA 2EIHA 3O8QB 4Z9XA 4D7AA 2YFHA 2JHGA 4CQMD 2PY6A 3RUFA 1TT5A 4BNWA 4J0EA 3UVEA 1F17A 4DGSA 3NYWA 4EBFA 1AN9A 3Q3CA 3DFUA 1LUAA 3G17A 2B37A 3WG9A 4QSMA 2NNLD 1EEHA 2O3JA 2PFGA 3CE6A 2NTVA 2Q3EA 3WDSA 1QP8A 1T2CA 1MC4A 4H3VA 4BGVA 1BTOA 1LQUA 1PWXA 4CV2A 3FSRA 3WGTA 3B1JA 3ZWWA 4OIMA 5GY7A 3OM9A 4FDAA 4IMPA 4XR9A 3ST7A 5JLAA 4RVFA 4FBGA 3JQFC 4M1QA 2JD2A 3H9JA 4XDYA 4BO5A 1JQBA 4DQUA 3JQBA 3WQRA 2DU8A 4WLFA 1NHWA 4JP2A 1ENYA 2Y0CA 5TT1A 1MC5A 1U7TA 2VCYA 3V1YA 2W8ZA 4J4HA 2HUNA 1T26A 4UUMA 4XQEA 4NQZA 3L0DA 4XJTA 2P5UA 1ZK1A 1PGNA 5LC1A 1E3SA 1DXYA 4NFSA 1LX6A 1ZXLA 1DIAA 4P4NA 1M6HA 3C1AA 1UH5A 3ZV5A 4ZQFA 1K0UA 1T25A 3RBVA 3RUIA 2FHSA 1EBFA 4XYEA 3DAGA 5I9NA 4A0SA 1I2CA 2NU6A 2J8ZA 1Y8RA 4RJTA 4J90A 1A4IA 2WD7B 1HDOA 4R1TA 1SZJG 3IUPA 1UDAA 3GGOA 3RQSA 4N5MA 3ZHYA 5ER6A 3JQFA 4GX2A 2OBNA 1GYQA 1UAYA 3A4VA 4H7PA 5A06A 1QSGA 4R4JA 2AE1A 3JYLA 4R5HA 2AEFA 4XGIA 4DMLA 1MFZA 2FSSA 3WQSB 1XCBA 2YQ4A 4PN3A 2WM3A 4FB5A 2UV8A 3IP3A 1J6UA 2EERA 2Q1UA 3KYBA 5I7FA 4UVGA 2QRLA 3T4EA 1VL8A 1P31A 3MJ4A 3D0OA 3JYOA 1GD1O 2WWRA 3LT0A 3RUEA 3PDUA 5JW6A 1I10A 2C7VA 4RDIA 2YQ5A 1U5CA 2X9NA 5LCXA 5L4LA 1B2LA 4HKTA 1KETA 3DWFA 2BHLA 4PFJA 3E8XA 2ZJ0A 4OKIA 1XQ1A 3DEYX 2G5CA 3TF5A 1LC0A 1E3WA 3C3XA 2PWZA 2UUOA 4MVJD 1ZFNA 1A7AA 1RYDA 2DTXA 2DUUA 2NVUA 4Y6RA 4RGBA 4AJ4A 2NQTA 5KVSA 4Q3DA 1ISIA 3RUHA 1CJCA 4YAEA 4N54A 4E5PA 3I5MA 5IZ4A 4P4LA 1GUZA 2DFVA 5AYVA 3VVCA 1VSUA 3MTGA 4PZCA 3H5RA 2YUTA 1BWSA 1BRMA 1IPFA 5G0UA 4JXKA 4AL4A 4YJFA 2FPGA 4WJZA 3GGPA 1JKIA 4J16A 2VYNA 1ZK2A 4Q39A 2J5RA 1GV1A 2EP7A 1ENPA 3VKVA 5L7WA 3ZHXA 3FD8A 3GQVA 2AEJA 4WEQA 3WGIA 4J3FA 2IODA 3WYCA 5JDCC 3ZNOA 4A03A 1HE4A 3WIDA 1X0XA 3CMCO 4CMKA 2VRCA 3DXFA 4MVJP 3TFQA 1O5IA 4N7RA 1O0SA 3PYXA 4UVEA 4MPDA 4DA9A 3GFGA 1JVBA 3S8MA 5A9SB 5ADHA 5I8WA 1HDCA 3HADA 1WXDA 4UEOA 1NX6A 3NDIA 2X6TA 2ZB7A 4CM5A 2C29D 9LDTA 1LLCA 1NM5A 3COSA 3KYDB 1P3DA 3FWNA 3LC1O 4RLHA 3DTYA 2DM6A 4QQRA 4BO8A 1TA4A 3UF0A 2QZ9A 4EJ6A 4G65A 4CM4A 4Z0HO 1R15A 1EDZA 1HLPA 3IAHA 3DBRB 3NTOA 3P5SA 3OA2A 4XRRA 4P38A 4I5GA 2HDHA 4JBIA 4K26A 3AU8A 1HT0A 3WS7A 1LDYA 1ISMA 1C1XA 2NQ8A 3CINA 2OBYA 3VZPA 4A10A 5JCXA 4D3DA 5DT9A 5G4KB 2AMFA 1I01A 1LLUA 3SBOA 3FNEA 4DLAA 5JDCA 4EEZA 1N9GB 2P68A 2IEBA 4XYLA 4DIOA 4NMHA 1HF3A 1Q0LA 2X0NA 5FFFA 1FDWA 2FMUA 4FFLA 3ZU3A 4J7CA 5JO9A 4GL4A 5FWNA 4QTZA 5G4LA 3OQ1A 3FNFA 2AG5A 3V2HA 4DBZA 1SCUA 5U1PA 3ICPA 3Q11A 4L0QA 3VVBA 3K6JA 3VKUA 4L73A 1ENZA 1GCOA 1SOVA 1YOVB 2AG8A 3JQ7B 4DREA 3ITKA 3C7DB 3SEFA 5A1TA 1E7QA 3U09A 1YL6A 3Q1LA 2ZB8A 3IMFA 1XHLA 4CR7A 5CEJA 5BT9A 3PGJA 2B5VA 2ZTUA 3C1TA 3S1LA 1RWBA 1JW9B 1IYZA 3IC5A 4ZJUA 5G0WA 4I08A 1OC2A 1TXGA 1E1NA 1Q1NA 1HYGA 2Y0EA 5TF4A 4KTTE 4W9NC 3H3FA 3I6IA 5GMOA 2EV9A 3EY4A 2V6GA 4YJGA 5EPOA 4BKRA 3ZV4A 4ZU3A 2HMWA 2PZLA 1H93A 4II2A 3GR6A 4EGFA 1KVUA 1NFFA 3ONFA 1E7MA 3A28A 4OJNA 3DZGA 4MJLA 3ETDA 4Y6PA 1A4UA 1YBMA 4OMUA 1XEAA 2VHYA 3PFFA 1R37A 1V6AA 1HDXA 4TMFA 3IL2A 8ADHA 4BNFA 3GT0A 3CMMA 4ONEA 3IDSA 2AW5A 1HDRA 2GR9A 1E7YA 1I2BA 4UVIA 4FOSA 3CTMA 3GAFA 4AJ1A 1BVUA 4CV0A 1ZJZA 1FDVA 1ISJA 1NPTO 2QHXA 3G49A 1ULUA 2GF2A 3M1AA 5TGDA 3TZHA 3ZWNA 2VHVA 3RKRA 2RIRA 1Z73A 2Y1CA 4PLHA 3TFOA 2CVQA 2V6BA 4W9NA 1Y8QB 3BA1A 4XYGA 1T2DA 5DNAA 3FBGA 2F1KA 1VJ1A 1ZNQO 1HL3A 2HKIA 2GCGA 1PJ2A 1PR3A 4JK3A 3SXPA 4WUVA 3TNLA 4E5NA 4UEJA 3WBBA 3MJVA 2O4CA 3BTSA 4E5YA 5KWEA 3PJFA 1VRWA 1KBZA 5T8KC 4BGEA 4YR9A 2ZTLA 2FZWA 2B4RO 4AJPA 4JQCA 1K6XA 2X0IA 2IZ1A 3MZ0A 4WCDA 4YVFA 1V8BA 2CDCA 1DC3A 1ADCA 1QMGA 1EQ2A 3FR8A 4I5FA 1PZGA 3DZHA 4RF3A 5GZ1A 2NVBA 1YDEA 2X86A 3KLPX 1X1EA 3L9WA 4GSLA 3GVPA 3ZW9A 2PKRA 4GWKA 2E4AA 1MX3A 4CQLB 1W0CA 3TOXA 3QIVA 4E6PA 3S2IA 5JYEA 5EMHA 3Q6IA 2BFOA 4A27A 5C3MA 3DHYA 3O8QA 4M87A 4ROSA 2TMDA 3ZI0A 1UZLA 3KEQA 4HV4A 1A27A 1XWFA 4LSWA 5L3ZA 4B8WA 4BNYA 4PZDA 3B70A 5COQA 1MGOA 2V65A 3HB5X 4MO2A 4XGKA 1YS4A 3PIDA 4I9HA 4DPLA 5EJ2A 3T7CA 3P2OA 4YB8A 3KV3O 3MJCA 3WGHA 4CR8A 2EP5A 4E33A 3OA0A 1X14A 3HN7A 3JQAA 3PZRA 1TT5B 5T8KA 3ZN2A 3RI3A 2B5WA 3DZJA 3HDQA 3HSKA 3EAGA 3PQFA 4IMRA 3EC7A 4LCJA 5KOIA 1LTHR 1CF2O 2HLPA 5A04A 3E82A 3DAFA 2IXAA 2W2LD 4D79A 4I5EA 3QVOA 2HK9A 2O23A 4EITA 1FDUA 3EDMA 3FCOA 4BO4A 3E18A 1I30A 2GUGA 1F8FA 3FHLA 4I1IA 3TDKA 1UDCA 5C7LO 1QLHA 2ZB3A 1DJNA 1Q0QA 4TVOA 3LF1A 1NBOA 3RBXA 1YDWA 1PQWA 1A5ZA 1WLYA 3FNGA 4KUHA 1PJTA 1PL7A 4EW6A 1HTBA 4YJHA 1IZ0A 2I66A 3TRIA 5TQVA 1LDNA 1Q7BA 5B37A 3QWHA 2A92A 2P91A 1CEQA 3PHHA 1KC3A 1C0KA 4B8ZA 1XKQA 3F4LA 4NR0A 4OXNA 3UCFA 4KP7A 3GAZA 1OBFO 2A9FA 2YZ7A 3WGQA 1I3LA 3Q9NA 1MG5A 2C07A 3STHA 3EMKA 3DZFA 3NX4A 1P1JA 1JTVA 1KS9A 2FR8A 3GVIA 1HDZA 1DB3A 4E2WA 1EE9A 1UXHA 3AOEA 4LVCA 1DIBA 3I1JA 3G1UA 3NTQA 4MP8A 5FI5A 4F45A 5CG2A 6ADHA 3PJGA 3MJSA 4D46A 2P4QA 4BNNA 1Y8RB 4PLYA 3UN1A 2OOSA 1JN0A 1XYGA 4CQMA 1YQDA 2CNBA 4R1NA 2PZKA 5DF1A 1DHTA 3VDQA 1ARZA 4BQPA 2D1YA 2PGLA 5IZCC 5KVCA 4F3YA 4OH1A 3JQ8A 3FWZA 4G81A 1O6ZA 2Y68A 1AGNA 4IDDA 3KYCA 4IDCA 4FPXA 1KVRA 1PZFA 1RKXA 4IY1A 4KZPA 4YA6A 4BB5A 2J3KA 1EFKA 4OSOA 4Y6SA 1Y6JA 4FS3A 5I7EA 4J7XA 1XDWA 1XG5A 4L8VA 1HDYA 2O3UA 3NV9A 4PLWA 1ONNA 5JC1A 3CKYA 2B0JA 4ALNA 4FJ0A 4R9RA 4AG3A 1SOWA 3PK0A 4ND2A 4QO8A 4E30A 4ZRMA 4W6ZA 3GPIA 1R0KA 3HDYA 2R2GA 5AOVA 3L6EA 4B4UA 4CMBA 2QYTA 1E3WB 1PJLA 5LDGA 3I6QA 4PLVA 2CDAA 4CMAA 1D7OA 4QX6A 2Y1FA 4XWYA 5IZCA 2R6JA 3GEGA 3PWSA 3HDJA 4OM8A 2EJVA 4ZD6A 1B3RA 2A35A 3WIEA 4IDBA 2AXQA 1IB6A 2DVMA 2WDZA 3GH3A 1NTOA 5JAQA 3KBOA 4ZICA 3ZWYA 5EN4A 4LMPA 2JKVA 3F1KA 4OGWA 3U4HA 2JD1A 3ETEA 4Z6KA 1P33A 3E9MA 5TT0A 3LT4A 4PG5A 4CLDA 1M75A 4WK6A 2NU7A 2BGKA 4IDEA 4BUCA 4ITUA 1KEVA 5IDWA 9LDBA 1T2AA 1UUFA 3A1NA 4OQYA 5IXYA 4GGPA 4P22A 3SLGA 4WEOA 1R4NB 2C54A 1IUKA 3MJEA 2X5OA 4IQGA 4DMMA 5JXWA 3EHEA 1KYQA 3OETA 3L6DA 3C1OA 1ISFA 1DIGA 1H94A 4IDFA 1N1GA 1TVEA 4TKLA 4IDGA 1YQGA 2PR2A 2JJYA 1YXMA 3W8DA 4JGBA 1PJSA 5TSDA 3U4DA 2VN8A 1MXFA 4UULA 1H0KA 3I9LA 1WNTA 4Y8VA 2GN4A 2NLOA 3W4JA 1O8CA 3RC7A 4S1VA 4N18A 3OH8A 4MVJM 4BGUA 1W6UA 1X7DA 3DMTC 4MKXA 4JLWA 2EG9A 4GMFA 3LSYA 4R51A 3X2FA 1C1XB 1P1IA 4OXKA 4W7IA 5I7SA 4EUEA 3IQDB 5U4QA 5JDIC 4MKRA 1C0IA 2YFQA 4XIYA 4II3A 5BSGA 3V8BA 1SAYA 1PJ4A 2O2SA 3DAPA 4BB6A 5AXDA 4CL8A 4BQRA 1LC3A 3CH6A 1VPDA 2AA3A 4YTEA 1E1MA 3C85A 2VZ9A 4YAGA 4EJ0A 2BLLA 4BKPA 4TWRA 4JJFA 4WKGA 3WSWA 5C37A 2GZ3A 1WAMA 4K9DA 3BTVA 4J9UE 2JFHA 2YV3A 1EQUA 1YJ8A 4XRGA 1YONA 4RPLA 2DKNA 1MB4A 3HQ4O 2GNAA 1TB4A 1GU7A 4EUFA 5IFLA 4JCOA 4U6SA 4BMNA 3DMTA 2BFMA 1SEPA 3PP8A 2JAHA 4WNCA 1Y7TA 5KJEA 5HA5A 1E6EA 5GZ6A 3GDFA 4NI5A 2XOXA 3FPLA 5BSFA 2O3QA 2O3RA 5JDIA 4NU5A 3FF4A 4L4XA 4YJGB 4L74A 2ZCVA 3MWEB 5L95A 4RZIA 5BNIA 1IULA 1JWAB 3ORFA 4J6FA 3IOYA 3K5PA 5KJCA 1GL3A 1BW9B 1LSOA 1YQXA 2Q2WA 2TMGA 4ZA2A 1GZ3A 3GMDA 3NUGA 1DIHA 1UDBA 1ZW1A 4IQ0A 4Y9DA 4Z3DA 3WWZA 1PS0A 2I65A 3EVNA 3FTPA 2AQ8A 2G82A 3RVDA 2IDZA 3DZIA 4CUKA 5IG2A 1I8TA 4J4BA 4JJIA 3GZ4A 2QIOA 4I9NA 4OAQA 1UAGA 3D4NA 4RPGA 3WTBA 1KEWA 4Q3NA 2VWPA 1GQQA 3L4SO 3ENNA 5JSFA 3UCEA 1C3VA
chains in the Genus database with same CATH superfamily
3HRHA 4IJWA 1FTQA 1OAOA 1W4RA 4BXOB 1CEXA 2A94A 3C6QA 3AJ8A 4QFBA 1W1IA 4BNKA 4B7ZA 3HPQA 3IEKA 5ESDA 4F04A 3GYBA 4TS9A 3NALA 4GECA 4AYXA 5IBPA 4RFSB 5IMSA 2HZ7A 2EW8A 2M6SA 3LPDA 1DEKA 1SQGA 1XRQA 1XZGA 3NTXA 1VL5A 3QWFA 4ND1A 2I8AA 4ZVRA 3PUYA 4Q9IA 3P0FA 4CQLA 3P5BA 4YGXB 4IZIA 3RSSA 3H3JA 2IYEA 3DXXA 2AJDA 1T4DA 5IKEA 1P0CA 4MV8A 1QV7A 5HF6A 2BTEA 3CUSA 2ODQA 3D2AA 3R5XA 4J4TA 2M2IA 3PG5A 3SEQA 4BAZA 1PYDA 3HXKA 4BNVA 5IKMA 2P9QA 2DB3A 1D1PA 3A9VA 4EY8A 3ELWA 1JR4A 3NOOA 4E46A 2H3EA 1KO1A 1LB1B 5C5DA 3LBAA 3U7HB 5BNFA 4KN5A 2BKLA 3OE7D 4LQCA 4M7PA 1L5YA 1BJRE 3TPFA 3VPXA 3QVMA 5JBIA 1W36D 2NZ2A 1N5RA 1WW8A 3AY3A 3VYSB 4XWAA 4F11A 3A2NA 4I3HA 3EIOA 3PCTA 4PAOA 2QV0A 3H4MA 1CZNA 3L8FA 1SVKA 3A3YA 4XQCA 3WL6A 1G20B 4Z8XA 1S96A 1TVMA 4U2FA 4HX9A 2C5GA 4DADA 3JQAB 3R3ZA 3WGMA 2HFJA 2M6RA 4KG7A 3A8TA 3QF4A 5AHOA 3GMTA 4GHWA 1H4QA 7ADHA 4QM6A 1R9MA 2ECPA 1GT91 1SCJA 2ATEA 4PYIA 4IFTA 3WSTA 4EQ6B 2CNWA 1IMOA 13PKA 2DTEA 2HMTA 4PHCA 4HQKA 5F3WB 5H59A 3LLVA 5C52B 4ZODA 4BCBA 3F5FA 2OD2A 1XRPA 2X8LA 5EZYB 3RSLA 3WJAA 2JLBA 4C05A 4B6QA 5HRCA 1QZTA 4NK4A 3DCIA 5F1YA 5EFZA 2J6HA 1AS3A 1P7PA 1Z83A 3SJBA 3KOWA 1SVNA 4MUBA 1ZVQA 4YJHB 4BWFB 2H2FA 4I7EA 3RVLA 3S3TA 4QXRA 4Y1GA 5E2BA 4B82A 4LSGA 2VJAA 3AW9A 2QKYA 4PHFA 4UUQA 3JYNA 3NAMA 4S1PA 4UOQA 2G1KA 3Q88A 2JATA 3OJOA 1KRHA 4LHSA 5E7MA 5IEBA 5CT9A 2ZROA 5EHNA 3MLBA 4RHEA 1KORA 4EFMA 2HA6A 1EM8A 2COUA 2OFPA 3F46A 2XSZA 2EFEB 4UREA 4GKJB 2DJIA 4Y6LA 5JNLA 1IXYA 1VCNA 4GIBA 1U2DA 4KX3A 2HQRA 3JY6A 2BR5A 2HA3A 5CB4F 3QE3A 1YFLA 4LGVA 4X71A 2B5OA 3SYMA 1XHFA 3F7MA 1PDVA 2OZVA 5DCUA 2RHRA 3V2IA 3JQEA 4OCZA 1N2SA 4FE7A 3TQQA 3VJKA 4RTSA 5K20A 4A15A 2IXEA 4B7UA 2VP2A 4Z4GA 3ABRB 3TIIA 1CUSA 2O6LA 5BWBA 3JTMA 1EAYA 1TJ3A 4NMLA 3WV5A 1BKDR 4HYYA 2OBLA 1CU1A 1MHPA 3NC1C 5DLEA 5MN4A 3N2KB 4KBYA 4PQRA 3H1BA 5EQJB 2QT0A 2F43B 1SRRA 3EZ7A 3PRJA 4AZWA 4CLOB 5JAMA 1BE6A 1TJNA 4X8MA 4BJ5A 4J9VA 7ABPA 4TQUS 1W5SA 4DV2B 5ALQA 4QAQA 1DDGA 4GRDA 4IH1A 2PT7A 3K1TA 3IV7A 4Q4JA 2R1UA 2GLTA 5IS2A 2C03A 3PFWO 2CLDX 1KXZA 1DUIA 1MFPA 2HSWA 2XDQB 5BV2P 1WV0A 2M32A 1OZFA 3EBLA 4B87A 3TRDA 3AI3A 1K8QA 3JU3A 4UHFA 1XELA 3WMEA 1BRTA 1UFRA 5AI0A 1FDTA 5FQOA 2JZCA 2X42A 1URPA 2BY4A 1SQFA 4GKBA 3G9ZA 4KE8A 2HMSA 2G7ZA 3K92A 2X4IA 4ARAA 5CA0A 2XBUA 1T4GA 3EE6A 5K0LA 3OTGA 3KEMA 1ZL2A 3CS3A 4OQZA 4DUYB 1EGAA 2HV9A 2YVLA 3QBDA 4S1OA 3HL0A 1QHNA 3GFVA 3GLUA 2J85A 1WOMA 1M76A 1W9MA 3ZGZA 1SHLA 2QP3A 2IE8A 3KB1A 1OHHA 4R8LA 3VRHA 3ZDFA 1NQAO 2HSGA 1N2XA 3DOJA 4DM4A 1Z0AA 1FP1D 4QUDA 2I3GA 3ZKWB 3T1YB 3L6RA 4H0CA 1J42A 1B76A 4RENA 1PL0A 4GX1A 3LQ1A 1GARA 3ETHA 1LPPA 3K7EA 1WA5A 3WFIA 4OLFA 2WV9A 1MT0A 4TL8A 1KEUA 2CLHB 2O07A 1EYZA 4AZ3A 4M2LA 4P32A 4CDGA 1MVNA 3VV3A 2OBXA 4EG3A 5JS7A 1EK6A 3HVUA 3DHWC 3A3KA 1SIBE 1Z62A 2J07A 2HRZA 3C3EA 3R7WA 4PHHA 3REOA 5J2TB 1QS0B 1TL7C 3FLAA 4QRDA 3PSHA 3O8LA 3ORQA 4U7FA 1U1DA 3LC0A 2CYCA 3OJ0A 3OPVA 1K9VF 1T6YA 2P9YA 2RG1A 1J2JA 1JIXA 3KWLA 3QE2A 4JBGA 1NXVA 4BZWA 3FKJA 3BWDD 121PA 3ZOZA 3BH6A 4HNGA 3E1GA 1DAMA 4QHSA 1KK3A 3OZIA 1NN1A 2I54A 1QZ3A 2XHEA 1IUPA 1E1YA 1UC8A 3TD2A 1Q3KA 1N0WA 1RDFA 4PC2A 5J58A 1HUQA 3LECA 4LZAA 4ZO4A 4IHJA 4ECEA 5FV4A 3K9FC 1P44A 2WUEA 3BRSA 5A05A 4EA9A 2OZKA 1CY2A 3ZX5A 2ENUA 3RQIA 1PR0A 2A6PA 2J59A 2O0KA 3ICCA 3UKDA 1E89A 2CL0X 1M6WA 1R88A 3E2MA 3VX4A 4PQGA 1TYBE 4B47A 2JG3A 1F51E 3FRJA 4M98A 3LUPA 3VC3A 3A37A 3FYTA 3SZOA 4GI3A 4AF7A 3RS3A 3R7LA 1PKEA 2PWAA 1SKQA 2ZOSA 3SDBA 1XTSA 3DMGA 1GZUA 5EQFA 4S1TA 2B2XA 2Q3CA 1PW7A 5DK4A 3HZOA 4MB6A 4BY9E 1F14A 4RS4A 4W9RA 1Y3FE 1NIJA 3HEAA 4MWBA 3ZK7A 1N6HA 5BW4A 2ZWMA 2G5GX 4YCAA 3AEKB 3RLFA 2F2TA 3N0VA 2I7CA 4F1JA 2EWWA 5HKAA 5LQSA 2QSUA 1L4NA 1XCPA 3SPXA 4LYYA 1EIWA 5KQGA 1FMCA 4LI3X 5EZQA 4CG1A 1WDTA 1OCEA 2FWPA 4LJ7A 2PSJA 1XRLA 2D6FA 1DTWA 2OQ2A 1H6CA 3L79A 1K08A 2WV7A 3IOCA 2J6IA 2RAFA 4LXYA 3WHLA 4N40A 5JROA 3E70C 4HEHA 1BE1A 2YYSA 1VYTA 2JIOA 1NN0A 2R6DA 3VR6D 4M0CA 1SUAA 4HAXA 1WZCA 3WLLA 3FVTA 4O4HF 4IDAA 3AW8A 2JCSA 3PHGA 1PWEA 3TLJA 1ML3A 3EUAA 3RRNA 2R96A 4FB4A 4Y9SA 3TLGA 4UHCA 3N8DA 4EJSA 3OT5A 3BE8A 1BJKA 5DBGA 1EI9A 1PWZA 4TLDA 1ZNWA 1UC4B 3KQSA 3BMQA 2WD8A 4MRPA 4QDJA 4XUGB 2WIDA 2E85A 5C5IA 4DLVA 3P9SA 1E58A 1W87A 5HFJA 4DR7B 4CTKA 4DDWA 4EG7A 3QU4A 2UVQA 3QFRA 3UB2A 4M1SA 3X2FA 3U37A 1OTHA 5K8LA 2ZQ5A 3OZGA 4E09A 1RLTA 4Q1VA 4M36A 4MAMA 1ITZA 1OI7A 2H1VA 4IHKA 5FDFA 1NASA 1DJQA 3GFPA 1SCAA 1MT3A 1R0WA 1X3LA 1R8YA 4BKQA 1KIFA 2QTVA 5IN4A 3NWBA 2CLMB 2FZEA 4LY3A 4XTCS 1DJPA 2DUJA 2R8YA 2YIJA 1CUZA 1SUPA 4FYIA 2WJ4A 1K6EA 2H2DA 4IQ4A 1LDGA 3WBFA 3MOIA 1G8HA 2C2WA 5K0BA 2DPGA 3CRRA 1M6EX 4O2BB 4X7RA 3L7IA 2PO5A 5BNTA 4KYTA 4AJLA 3NAQA 2ZB4A 3ISJA 3NTLA 1RQ7A 3HKDA 4BE9A 2ZSHA 1P1KA 1EDDA 1XU7A 3DA8A 4B6EA 4DC1A 1N25A 5EHZA 3HR4A 5L3VA 1I32A 1C4KA 5JWOA 3EF3A 4FSXA 2Q62A 3A3NA 4GXNA 1HSOA 5TPWB 3L0ZA 1NF8A 1L7NA 4GVXA 3H2SA 1QG0A 1JB9A 2A9OA 3LUHA 4PAGA 3NIWA 2QX9A 2K4MA 2QPAA 2ZYDA 3SR4A 2OSVA 1YO6A 2G4LA 6CHYA 2WJ3A 3OICA 1PT5A 2VHQA 3HCCA 4DRYA 1CUDA 1H5QA 4ZDJA 3O4VA 5CT4A 1XVUA 2AT1A 4KWTA 1FLVA 4URYR 5CJ2A 1UBMS 2XF8A 4DBLC 4OYRA 1BHJA 4YP9A 1ZGHA 2IGTA 4CE6A 2E87A 2HFKA 1PX2A 1Y81A 1DV1A 3PC8C 4DLUA 1TGVA 2BCJQ 2X15A 1ZH0A 4X60A 4Z0PA 4B7XA 2SNIE 2R5WA 1NNUA 2OO5A 3MS4A 3QI2A 1ADJA 1CWUA 1E0KA 3AIKA 3JQGB 4JLBA 4A2WA 1X39A 1Y48E 1EE2A 1ZIDA 2WEKA 5FHQA 1N2JA 4PSCA 4UDNA 2FTKE 2UYOA 3M3DA 3UAVA 4POOA 4Q82A 4IVQA 1UK7A 2PL5A 3WLKX 1Z6TA 2YWRA 2DFKB 4J0IA 3CRNA 4MX8A 4NFHA 2O8NA 1EJ2A 4BNXA 1ORIA 1EFDN 1Y4UA 1U9YA 3IEVA 3ELDA 4Y0NA 4EM6A 4KGXA 4IGAA 1U28A 4QGSA 5JJCA 2BUBA 3TB6A 3A1SA 2G5PA 4GP6A 4GH5A 1MAVA 1QH1A 1HE2A 4WZAE 1NBMD 1R7RA 2VATA 3CXRA 4GMKA 1E2JA 1O94C 4D25A 3CBQA 1G4UR 3N39C 2A9VA 1Z7BA 3AOEC 3A6DA 1SXIA 4IJ5A 3PFNA 3T7AA 2OG2A 1E2HA 3T9EA 1B3BA 3JQRA 1B14A 2GCEA 3FHOA 1H2FA 4Z3KA 3C39A 4QLAA 3F3YA 3C15C 3HGQA 1ST2A 4YQZA 4D4KA 4IXWA 1KR5A 2P9FA 3UMFA 3NVAA 4BFZA 5JHGB 1RRVA 5LNK6 2JEOA 2BELA 1UF9A 4X62B 3H5LA 4K1LA 2X22A 5H4GA 5K5EA 2DHCA 4B80A 1Y1LA 1TTHA 1Z45A 3OO1A 1CR1A 2Q3BA 2DUWA 1NI3A 5DPMA 1X8JA 2XY4A 1CIJA 3BRCA 1I7LA 1E69A 4H60A 2WWGA 4ZC1A 4A8PA 1BN7A 1YRWA 2GXSA 1MJNA 4BS9A 4PHGA 3PNLA 5L40A 3I9FA 2CHFA 3EIXA 3IVAA 3K09C 1KEEB 3EXHA 5IJWA 1NHGA 3LDFA 1U1CA 3Q2OA 4NPCA 2VTDA 3RIXA 5CDYA 4RIEA 1YNOA 2YJ3A 1CG6A 2FSUA 3AKDA 3GA5A 3G89A 3N3AC 3S4YA 3CSDA 1G7SA 1U9CA 4GBED 4TSKA 1K6MA 4ER3A 1B93A 1OVGA 2BM0A 2P65A 4ED9A 2C2ZA 3SOZA 1NR1A 1IPHA 1ZGBA 1I2ZA 2W7TA 2MSEB 4IAOA 3QQPA 2A0FA 3OZ7A 4M6WA 3FUTA 2NNWB 5IUNC 3R0IA 1SHKA 2GSWA 2GZ1A 1ESNA 3DEZA 3N9IA 3RVBA 4DY6A 3LUCA 1IUNA 1ONOA 3ZH2A 4RTPA 3IKMB 3OWXA 4CKBB 3ABZA 2C82A 3MS7A 5LM3A 1GM5A 1AT1A 4RPIA 3GRZA 5IK2A 5FOWA 621PA 4KXXA 2DH6A 3F6SA 1B8NA 1AGYA 4OSPA 1R50A 1X42A 2OC4A 2X5KO 3JD3A 3OPNA 4DJAA 3QX3A 3TXAA 2J08A 5ALWA 2J3HA 3WYNA 5IX8A 3R5KA 4WKBA 1FFCA 4UNPA 5T57A 4ZAVA 1U8CB 4R16A 1VJCA 4Q4JB 2R9VA 1UJMA 4B4OA 3ACBA 1VJ0A 3SC4A 4ISCA 4JWKA 3ZWQA 1JR2A 2WVGA 4YRZA 4K05A 2P9EA 4N5IX 1TI7A 3DH0A 3PRHA 1NJ2A 1FUIA 5HW0A 1B16A 1GILA 2YBDA 1VG9B 4CL3A 4P5DA 3W2EA 1V1JA 2WMNB 3O47A 3X3HA 1SGWA 2G9UA 1GGHA 2HLDD 4I4IA 3EGWA 3DCNA 3M89A 1ZUIA 5ALIA 5GINE 3UENA 1R0RE 4J6EA 5F1PA 3C1UA 3LGAA 4G89A 2W70A 4DMFA 1V4NA 5DBIA 3HM2A 1KOJA 2XQKA 2BGMA 2OCDA 4R2XA 4TL7A 4YEDA 1A7JA 2UXBB 4S0ZA 2C57A 2JAOA 3L77A 4KO2S 5HM8A 2V3CC 3KJNA 1YDFA 3NVDA 4ND3A 4YRLA 4DBLE 5BRNA 3HCNA 2IXTA 3B20A 4MQMA 2ZE8A 1IPEA 2J3MA 2ZUVA 4QDXA 4L75A 1CDDA 5CU7A 5I9TA 3WAJA 4ATNA 1YR7A 4C4XA 3NHMA 1KPGA 1BGVA 4LHWA 3GCGA 5DRTA 2QLLA 3PLRA 3V6LA 3FKSA 1GNQA 1QO7A 4GYKA 2H7YA 3JZFA 4GYJA 4DQLA 4ARBA 5HJ5A 2AX3A 3GJ3A 4ZMRA 1C9MA 1U1IA 4JGGA 1GZ4A 3V48A 2LRHA 3OCZA 4MVXA 1SUSA 1FRNA 3E4CA 4S3MA 3GWZA 5I8ZA 3WBJA 4AZ3B 4AY6A 4LJ4A 3R8FA 3I9NA 1S3FA 3H7AA 2RC6A 3NAGA 1YDHA 2ZSFA 2IZ0A 1SBNE 2UZ3A 4BLTA 1U0FA 3UW3A 1XT6A 5C4GB 4UNQA 4IJKA 1QR6A 1KPHA 4EKEA 1JDUA 2BBOA 2DQKA 2EDCA 1EB9A 2Q5LA 5E3JA 3G2HA 1EX9A 3DBIA 1U5AA 2ZBFA 1LSJA 1K97A 3F5MA 5TJHA 1ZMBA 4X5OA 4XIJA 3Q9SA 5E9QA 5CPBA 3TMYA 3LL4A 4QDUA 3PZBA 4JUIA 5DM1A 1KTIA 4ZTZB 3I9KA 5JU6A 1UBUS 3U7FB 1POXA 3AWDA 4MHTA 4D81A 4AF8A 4BNDB 4QVIA 2DFPA 1JPVA 3MD0A 1P9LA 4F5EA 2V6FA 5ICSA 3LQFA 4WOCA 2HBRA 3P7MA 4QUBA 1Y5RA 1JA9A 1CUGA 1HYHA 3HY4A 4FNMA 4ZXPA 5IN5A 1JJAA 2QMUA 3ZNPA 3ZNQA 4TV8B 4CBVA 2PSDA 3H19A 5IYZF 2IYXA 2SHKA 3A6GA 3PU6A 3CLSC 1WS6A 2BKEA 4GR5A 2PUAA 1L8OA 3S2GA 5MFZA 3W5DA 3ZHTA 3KV1A 1CUEA 1JEQA 1ZHOA 5LOVF 2W11A 3FOWA 3HVIA 1KMNA 4TTQA 1U8UA 3I1YA 3HNPA 1HKUA 3CUTA 1PZEA 5C7IO 1R3DA 4BUZA 5KJFA 1OLUA 4G0YA 2VK1A 2OK8A 1N6RA 2O59A 2ZGVA 2XDYA 4KK3A 3QUBA 1MABA 1Q0SA 4FHEA 4QFCA 4AN4A 3OFKA 3CTPA 2LZ0A 3L3BA 2LPMA 4EMSA 3VSCA 1RBQA 3IGFA 3HC7A 3ZY4A 4R8MA 3TAUA 3C3DA 4KAAA 4KXNA 2AEMA 4Q21A 4DCMA 4KIJA 2DWQA 3OMWA 3NHAA 2WTNA 4UJ3A 3SSNA 4QASA 3A9UA 1GG8A 1Y3BE 3ICWA 3LP5A 4UVDA 3H4VA 4LTNA 5SV2A 5KHLB 3CGGA 3W5VA 3PC3A 1GPDG 1WTCA 1DTWB 1NX9A 4ZYLA 3IVRA 1KZ9A 1K7SN 2WMOB 1AXEA 1MA0A 1G38A 3W6ZA 2YN0A 1XV5A 3AUFA 1ANKA 3DLAA 3T35A 2GYWA 4RF5A 5E7QA 3U1VA 4IUCS 2IELA 2GARA 1PGPA 1T9CA 3LUFA 3GF4A 2COEA 1P5FA 2RK4A 1SXHA 4N65A 1D6JA 2IHZA 4BLUA 4RKEA 2WAYA 5JADA 4YO7A 3TLGB 3ZVKA 3IJRA 4J91A 4EJSB 2I3BA 1NLUA 3QLUA 3ZS8A 3Q8WA 2NU8A 2QMEA 4FQ7A 1RXCA 1Y4SA 2NUPA 4UUOA 4NU8X 4ZCPA 1EK2A 3BMQB 2DBYA 3I42A 1NF2A 4ZP1A 2FMXA 5F9MA 1YI0A 3I4FA 3OJCA 3T1VA 5BUCA 2O5VA 1CVRA 4MQ5A 4G5OA 2FW8A 3HCEA 3COVA 3CVVA 5ALSA 3PKZA 1EK5A 4G5QA 2YINC 1UPBA 1CFJA 3A27A 1P75A 3RGWS 3SLKA 4E2XA 1RWPA 5ICCA 3EPKA 3F47A 3THOA 1C0LA 4G0QA 1F4PA 4RTOA 3BHNA 5HK9A 3O4FA 2CZCA 2GX6A 1Q0TA 2W6ZA 5CFOA 5T5QA 1I13A 1R6DA 3EVEA 3H2JA 5H1YA 2QTVB 1IHUA 3VZBA 3W9UA 2VUUA 1YR8A 2AOUA 3AH8A 1QYDA 1A3CA 5J2UF 3DE4X 4HDOB 2QJTA 1ZN8A 3X1ZA 1S2GA 1H2XA 2V7QA 4U9HS 5BPFA 4LVOA 2HGSA 3H2YA 1D0VA 1A9XA 2BRUA 2CFIA 1P62B 1P4JA 4DKXA 4JJ8A 3Q2IA 3VR5H 3KLBA 4H16A 3IODA 2N42A 1CUCA 5AVYA 1KK2A 3ZIDA 4WT7A 1ZJ4A 4QC2A 5JAZA 2J5XA 1QJ4A 2YYAA 3S6JA 5FOVA 2B94A 4C14A 1MMFB 1NXQA 2VXOA 3OTWA 4X20A 4B6JA 2E49A 2X8AA 3AIIA 4PRKA 3RTAA 1CR4A 4OHXA 3LHFA 4XE5A 2HRCA 4YRGA 5KS2A 3OLVA 1JWBB 2FPSA 3RSOA 4KFSA 2Q27A 5CVJA 1JL3A 1ZG3A 2KPOA 3MINB 2VO1A 2B2NA 3AJRA 5C7OO 4RVHA 2DCMA 4JZKA 3PXXA 5CB4A 4FTWA 2JI9A 4OFWA 1GPNA 5T3YA 1P39A 2Z9DA 4QUHA 2J3DA 4AZ0B 5ITWA 1GL6A 3MA0A 4FFRA 4BNMA 5G40A 3W1VA 3GLKA 1I5RA 5G0SA 3D0KA 2Q4RA 2QJWA 1WZEA 5CCBA 1LWOA 1BXZA 2DSNA 4JKOA 4DUPA 2CUNA 3SU8A 2EIXA 3SAJA 2RIPA 2FJ0A 1DC6A 1R6TA 1Y9JA 2P6NA 2RAUA 3GEDA 3QV1A 4KAJA 3IA2A 5EXEA 3WA6A 2GPWA 4BBPA 4DV6B 4CM3A 1QO0D 1NC3A 1TCCA 2AFVA 1VLMA 1QH1B 1XCLA 2ZR0A 3F9RA 3OQPA 2FN4A 1G59A 3IKVA 2QUKA 2NSHA 4RV5A 3V32A 1ADYA 3EJ6A 4MQUA 1YAHA 1LW7A 5A03A 4OL9A 1T3LA 1WPGA 1V45E 2MYUA 3AKYA 3M6WA 4YRPA 1UBEA 2R3SA 4EWLA 1RWNA 2V98A 3UAXA 3IIMA 4NWIA 3GLIE 1T9ZA 3D59A 4HN9A 4ZGWA 2J0SA 4C6TA 2OV4A 3KL4A 4J3NA 4DTIA 4HDNA 1N75A 4Q3BA 4D3SA 4E12A 1G8FA 2OENG 2HF7A 2JJ8A 2R97A 5H81A 2FCRA 3TI7A 4TMXA 4MPPA 2ZU6A 4S0XA 2FOIA 5FKJA 2BYTA 2WW8A 3NETA 1KU6A 4KXWA 2NTNA 1KDOA 1RPAA 4JC5A 4NZPA 1U3FA 1FSSA 1EXDA 4LBVA 4NNOA 4R1LA 5H4HA 2ZT5A 4FGUA 2ODAA 3TZ6A 2VA8A 4PLZA 4WE3A 3PI7A 2HB6A 4ZT6A 3ULKA 3EXHB 1ZVMA 3PF9A 1O3YA 1UJ2A 1HWYA 1VL1A 3FWKA 2OHVA 3I83A 3QPWA 4K2HA 2IYSA 1LLFA 4WCFC 1RZRD 3OHMA 1BX1A 2A1IA 2CJPA 2V1XA 4C4ZA 1E8DA 1V26A 1XR3A 1QQBA 5IKOA 4ZI7B 1S8NA 3I1FA 3VH2A 1E7RA 2Z2YA 1LK0A 4W63A 3B12A 4NZMA 1ZD2P 4RVDA 4TLEA 1YKFA 4HZUA 4YT4A 1A1VA 4M6WB 4PSDA 3TTVA 4YMUA 1Y5MA 2Y1GA 2XOKA 1QQ5A 3RSCA 3A4TA 3RIEA 1WU7A 1NNI1 1P1FA 4W8OA 3IO5A 1YRLA 2OBMA 4BJ3A 2B6NA 3TSYA 3ROKA 2IOHA 5IUJC 4Q5IA 2ATXA 4OX9Y 2FFQA 3S1AB 2CMFA 1KR2A 2IHKA 4W7HA 1BS1A 4NOKA 4G07A 5B53A 3F6BX 3TLCA 5JASA 3IEIA 4I2NA 4L50A 1B8UA 4G5HA 3LIPA 3E9QA 4XDHA 5LMCA 3NC4A 3GI1A 4CMCA 4G09A 4LRYA 4H4DA 3GVXA 3NXKA 1HA3A 1VIMA 3DTTA 2EFYA 3K5HA 3SS9X 4CTMA 4YROA 2J3IA 4B31A 5B30A 3WRWA 1MQ9A 1T2UA 1V41E 4J03A 1VSVA 2VSOA 1ZHHA 2VOJA 2QTBA 4L57A 5AJWA 3C2QA 3UC9A 5DM4A 1NXPA 5CFLA 4GOOD 2G04A 1JJVA 3O4JA 1B0ZA 4WY8A 1PFYA 3SG0A 5AVUA 1TMYA 1E2IA 4TXNA 3SZUA 1FC0A 3TEJA 1ZY2A 1CNEA 2VP6A 4UBNA 1FA9A 3BGSA 4X66B 2NQ2C 4C3UA 2GHTA 2ZJ6A 4L02A 5B1HA 1AUOA 4ZCRA 4WLNA 2OILA 4GKKB 3P9NA 3GRKA 3RSZA 1SKYE 4O63O 1GFIA 2EBWA 3A6HA 3H9QA 3H2BA 1G1AA 1B43A 1E8MA 1T6ZA 4EG0A 1DAPA 1HQDA 1K5PA 1WMEA 3OTQA 3PDWA 1ZM4A 3WFZA 2PG3A 3AK4A 1N57A 2H0AA 2ID9A 3OT1A 1KI2A 1NXXA 4UBIA 3UV6A 5FWAA 1B6GA 1DWQA 4X95A 4UDOA 3ZDXB 1DBRA 1GCUA 5JMTA 2V03A 1Q7CA 3DBHA 4JEHA 4NBNA 3RR2A 3TCXB 4B7AA 3HO6A 4YCJA 4AJIA 1FFXA 2VZ0A 2I9PA 4BMVA 2C2GA 4BZZA 3CF2A 3AG5A 1B1AA 3K0FA 1ZU5A 3OIVA 3QUQA 2FCAA 4O4HA 1POWA 3IR7A 3PHJA 4MW4A 3U3JA 1U4SA 3VXKA 4FM9A 2IY7A 4UTXA 1T4BA 4JVOA 3N2ZB 3REQA 3K0CA 1ZONA 1LEHA 2JJ2D 4JSYA 1HH4A 3LVRE 2PL3A 2OC9A 2WK1A 4HNHA 3F73A 5DYIA 5JJKA 2D8AA 5FPPA 4C03A 3IP6A 1H0HA 4FUQA 1NVEA 4QPCA 4H59A 4JOBA 3OE1A 3AESA 4KMSA 3QWAA 5D1HA 5KAPA 2G36A 1JVSA 4XPZA 3N2GA 4RDCA 4JLDA 4RYLA 3DO5A 5IAGA 2IOYA 2MSNA 4J0GA 2N47A 1BXRA 1L7AA 1AQLA 3WDKA 4Z7NB 2FFHA 2CEAA 1TFRA 2PKWA 2X13A 1HR0B 1QCCA 2H4XA 4D0NA 3VNVA 1P45A 3UQZA 3WGYA 4A5OA 4BO3A 1BDIA 3CX8A 3PGXA 4MIYA 2AYXA 4RGVA 3WYAA 1R66A 3ZH9B 5AVSA 3M6XA 4N03A 1CUUA 2V5VA 3CNQS 3D8RA 4TTVA 3ZG6A 4PLPA 4HGQA 5A3JA 4AX8A 3VR4A 3WOHA 2QW8A 1BS2A 1F0YA 3OQ6A 3QKSA 4KZKA 1JEQB 3ESRA 1XCGB 1XGKA 5CEEA 3CW8X 4J0DA 4E94A 3IT3A 1TGYA 3Q15C 4JLOA 3VJMA 2HSDA 2OGUA 5L53A 4YBZA 2HLNA 4FYYA 4DLNA 4QDZA 1TK2A 1ZNZA 2DCUA 2JRCA 3A3OA 1OLUB 1ZCAA 3CX4A 4H31A 4RK5A 2OFFA 3LL7A 4UBLA 1JE0A 1HTWA 1MABB 2GBFA 3L93A 3M2TA 4PAQA 1FNDA 3DV2A 2G1PA 1SQ0A 1JIUA 1ACMA 4HFNA 4I1UA 3OZDA 2LDXA 4XQ0A 3W5SA 5A9TA 1R12A 1X38A 2JA2A 2OORC 2IGBA 3VPSA 1K5HA 1E61A 1THMA 1FW6A 2ZRIA 3OTIA 3HP4A 2JCGA 3BCUA 3U0BA 1YR3A 1U0NA 4Q15A 1JLLA 2BH9A 1X19A 4WXYB 2YWHA 1R16A 3G13A 1RHQA 1CX9B 1T24A 2HWKA 2Y1OA 4NBUA 1COWA 1GTZA 3W6UA 5BORA 4QPDA 1T1SA 5ENZA 2GCOA 2DR0A 1SG0A 3HVJA 1JKFA 4W8GA 5JY1A 3CLVA 5BUSA 1DBIA 3ER9A 2A4KA 3KKPA 3W6NA 4L4UA 2EP8A 3HG7A 3A0UA 2G6TA 3KAKA 5GVSA 4JOQA 1RD4A 4QODA 3RTGA 3GFOA 2NU8B 3TZLA 3WL4A 2NUPB 1SBIA 3ACCA 3PV0A 4TGLA 5IVPA 4J0FA 5IVKA 4F3TA 3E3NA 3L7JA 1U94A 2B99A 1RAEA 5F3RA 4MI6A 4ISBA 2P2ZA 4Q4AA 4EB8A 4JENA 3HVRA 4MKZA 2J41A 1VDZA 1PT8A 4HDMB 5BN4A 5K0FA 2H4WA 5D7BA 4DV1B 2EKZA 2J4DA 4U8HA 3R7FA 5JSHA 4K1XA 3EPPA 1N5OX 2C00A 4XPIA 2X4DA 3OLZA 3I5UA 2GO1A 1ZMOA 4PLFA 3LDAA 2XNKA 4EIWA 1P72A 3I3OA 1UXIA 2ZXEA 4IZ6A 2GA9A 2ZUUA 3DT8A 2AOUB 3O1JC 3B8EA 4IIVA 4D0LB 4D45A 5ARBA 2FWAA 1JBEA 5JSZA 6REQA 3LW7A 2QUHA 1NRIA 4IS3A 4NNPA 5FJIA 1MC1A 4HUJA 3I58A 3S2YA 1A9XB 3VKHA 3S99A 4JZYA 7MDHA 1SM4A 1N5IA 4FCVA 2DKFA 2RHMA 3HJHA 5HFNA 3WLOA 1Z68A 2QN8A 5F7XA 3AXSA 1SOAA 4MS4A 4U8GA 4J1NA 1G8YA 2CLEB 2NM0A 2ZSKA 4QULA 1ZWKA 4J43A 4Y67A 4YRAA 3UGTA 1ZIPA 2DGDA 2V54A 3OJFA 4BCDA 1YS1X 3L7LA 4GMHA 2IUFA 4BIMA 5KC9A 4AKSA 3TOZA 1FSPA 1RRPA 1T91A 4AS2A 4X20B 4YFYA 3VNRA 4RD1A 3P96A 4J29A 4DIFA 4I66A 1Z0SA 3UXEA 5CVEA 1EVZA 1Z0UA 3C6ZA 3E9NA 4G5XA 4Q00A 2MSLA 3S2UA 2Q1WA 1DC5A 2OEPA 3ETCA 1LPSA 3GNLA 3N70A 5A5EA 1M2FA 3ASUA 3UHPA 1DAOA 4Y1RA 4PO8A 1AQYA 2KMLA 4PO3X 3U3XA 3MT0A 5ED4A 3N7UA 1V16A 2WIGA 5CB4B 3B6EA 4FGJA 5AT1A 3THSA 2PVCA 4K9PA 3MFYA 4DIBA 1XC7A 3LLUA 3MWFA 1M2GA 1X7HA 3FFAA 3MGKA 1LJUA 5L7YA 4R0NA 1G8SA 1SH7A 4OPMA 5IF3A 2ZSEA 1X13A 3WXMA 1BX3A 1TQ8A 4NCKA 3AHGA 2I4LA 3AO0B 4NMWA 2PYDA 3F98A 2WJGA 4D0RA 1VB3A 4F8JA 3R9XA 3HEMA 1ZBDA 4WD3A 3ZJVA 1BOOA 3T4XA 4AZ0A 3HBNA 3TLEA 1FJHA 1YB4A 2GN8A 5F5LA 1T43A 5I4CA 3RUAA 5JJIA 2A9JA 3O2JA 1K7XB 1QMPA 3DBVO 2FDRA 3A06A 3G82C 3BEDA 3OP4A 4X8HA 4ZVQA 4ESHA 2FPMA 4GLFA 1Y9DA 2WG0A 4TZTA 3C7CB 2QE7D 1G2QA 2PXCA 4HH4A 4I8DA 3CX3A 5E1DA 3ZHBA 5I47A 2WI8A 3D7NA 5HMLA 1GSIA 1IHYA 3OCJA 4UMFA 4DNOA 2VZ8A 3QEAZ 1I1QB 3AVPA 1ZI9A 3G9QA 1H9AA 1GNPA 1QGUA 2E48A 2ZJAA 3BMXA 3KFVA 1XZIA 3OSZA 2Y0DA 3P26A 2JFNA 5KHAA 1PYGA 2PVPA 3KPYA 2FUG6 1U0RA 4OHOA 1YIDA 4YCDA 4A26A 5C2JB 2QYSA 1XP5A 1O6CA 4L6AA 3RK0A 1BROA 1E1QA 3D5TA 1FVFA 4C6TB 5IWAB 2RONA 4HWRA 4HDNB 4OUDB 1QORA 5L9AA 4DZRA 3TZCA 2JKZA 1LBHA 4DDHA 2X1HA 2CCGA 4K9QA 2BJHA 3ZWPA 1E59A 1WTAA 5TGZA 5HIIA 2HEIA 4YI3A 1JHPA 2BBWA 4MB2A 2OBFA 3M1YA 2E6UX 5JXJA 1DKMA 3E1KA 1FQKA 2ATCA 1QR2A 1ULSA 1NWHA 2PBZA 4NY1A 3SSOA 4AKTA 1DFGA 3EVDA 1UEXC 1E6UA 3RAJA 3AC0A 5IBQA 3DT6A 4F46A 6NULA 5NULA 5DYGA 2PKQO 3F49S 1GTL1 1WABA 2G17A 5DBEX 3N6VA 3MJDA 5K1ZA 3G1TA 3I05A 2HCRA 5EE5B 2G4CA 3OE7A 2NV6A 1YB1A 3RT9A 1U3TA 4NCXA 1G9TA 2XF2A 4ZN6A 1MPXA 2ISSD 3C41J 2R11A 1JXOA 1U9JA 4D57A 1ORDA 4ITRC 5EJ8A 2XODA 5I9IA 1CDOA 3QTLA 4BVFA 3VOTA 3ZZNA 1VJGA 2OD9A 1QPGA 1RI3A 1U4NA 3ENQA 4HZUB 1OGYA 3M2PA 2RHHA 1L6RA 2CNKA 4YUZA 1Y3DE 4GW3A 1XE3A 4HGNA 4GPTA 2FW9A 1R8SA 4MOWA 1SXJD 4UZEA 2RH4A 4PBRA 2AMYA 1ZRNA 1LFAA 1NXWA 1LY1A 2PQMA 4GPAA 2JHFA 4EPWA 4NS1A 5LZ4A 3EQ2A 5IHPA 4G1CA 4LXHA 1KFCB 2XWPA 4XKJA 5F77A 2I3AA 1HFJA 2XPCA 1YT5A 1KY2A 1VGQA 2QQEA 4FCWA 4LJ5A 1F2VA 2W2OA 3L1IA 1ONPA 3UUWA 2W8BA 3E9RA 5LQRA 1CIVA 1YH3A 1GKYA 2YHUA 2VHUA 3NS7A 3T5BA 1GR0A 3B8HA 3SX4A 2B82A 3BGOS 3IURA 4ITVA 2I4MA 3L7KA 1RIFA 2ZE7A 4U0KA 4B8YA 1JNXX 4N5NA 5JNUA 3OEYA 1V48A 5IYZA 4EPRA 1SIUA 5BV0A 4A2QA 3C6XA 4INPA 1XPUA 3IRVA 1LK5A 5EL0A 3CCFA 2QNIA 2XR1A 4H7KA 3RUCA 3VSDA 1NC1A 1SHUX 2BFEA 5LOVA 2XUGA 1PL6A 2PA3A 3CIFA 1GGNA 1R0SA 4ZWNA 1QUFA 4RVUA 2F90A 1J0CA 2WAOA 3LZDA 1GPJA 2D1TA 2H2IA 4GKAA 4Z86A 4HCJA 1O77A 1V5GA 4W4TA 2DQSA 3CUKA 1ZUWA 4JX8A 2A1TS 2WSYB 4DRXB 3PVZA 2HGZA 1XZBA 3IQEA 1E9FA 4HSEA 4KXFB 4Y2PA 3QWIA 3BL8A 2P6RA 4A36A 4LJSA 2FFRA 4L07A 5FPTA 2JAPA 3ZEAA 4ZDIA 3SHWA 1BMFD 3OT1B 3REFA 3TSOA 4XI9A 2WKPA 4IDPA 4FT2A 4U7DA 1CP2A 2C3MA 1E6MA 3R24A 3E15A 4K2AA 3E1SA 3VKWA 2O3TA 3SS8A 4AM8A 3B5EA 1JG7A 1JIVA 2PGDA 1ECJA 2JRLA 3V4OA 5C46F 5AKJA 3DBHB 4HQOA 4A82A 1ZR2A 2E55A 3K9LA 2NU9A 4BO1A 4K86A 1FFXB 2HQ1A 4KPEC 3UFXA 4D0SA 5DM2A 1RM3A 3K0FB 3IHKA 1N7GA 3BD7A 4UFNA 1ZVJA 3KAPA 2QRMA 4KRXA 5EMMA 4O4HB 1S6YA 4Y98A 1UC9A 3REQB 1TCBA 5B3JA 3VUEA 2F8SA 3TAXA 1IHDA 1QCYA 2AZDA 3H17A 3NBZC 4BIIA 4RBNA 2IH5A 1W0KD 4DF3A 5KPDA 3F5SA 3UMBA 4QIHA 3AESB 4JUFA 2IBMA 4TL9A 3BB3A 4RY8A 3N2GB 1A7UA 3I9MA 5AM4A 1M2VB 1TKRA 4NKRA 3KYDA 2J0VA 2V3VA 5KNBA 1BXRB 1XZFA 3A4LA 1EP1B 4NBLA 1HZZC 1PGJA 2QROA 2BWJA 3OOWA 3UK2A 1O0BA 1G9XA 5G2OA 1SN7A 1JQEA 3HDHA 3D3JA 2QK4A 1DO8A 2R7MA 2YVUA 3HZHA 3V8MA 4CRWB 4DDVA 5CFQA 1NLYA 4KIFA 3PVCA 1U99A 3PIIA 2CLSA 3U62A 4F21A 3B48A 1O5OA 1AXRA 4HFMA 2P2SA 5J2UA 2RHDA 2JW5A 2OXRA 4MGHA 1WOYA 5DKFA 3AHCA 5BPHA 5J4HA 5G4KA 1PR5A 3QKSB 5ER9A 5HS6A 3S81A 1H9CA 4ZZIA 3JV7A 3M6AA 2QL7A 4DJDC 1OFGA 3AF3A 2QJRA 3R7SA 1XZHA 5AUOB 4KRYA 1VJRA 4L7QA 3U4QA 3RBZA 2Q46A 1WZNA 4AVYA 3SWWA 2ORED 3HCFA 5F1KA 4JT2A 1CQJA 3QBEA 1PQYA 5HGJA 1Z75A 3ICQB 1GAXA 5E95A 3FYCA 1HFEL 5DV9A 3T5AA 2H7CA 1Z2PX 4GBMA 1T9HA 2JL1A 1HG0A 2QW0X 1RC8A 1X86B 3BGVA 3BXXA 1YOVA 2PZBA 3SJZA 4YMHA 4Q3LA 5E6RA 1LDEA 1L9KA 2X19A 3ABQB 3CLKA 2IE0A 2XB2A 4HAYA 3DOIA 3RKSA 4PYOA 1E5QA 4HNVA 2TECE 3BFVA 3V1LA 3JWEA 1JLLB 1NF3A 3IEUA 3RARA 1C9KA 4PWZA 2WC1A 5TQJA 4BWVA 4JQSA 4EHLA 3IAS1 3GGDA 6ABPA 521PA 3Q10A 1Y1KE 1T3TA 4TKMA 2FB9A 3GJ0A 2GCOB 4GD3Q 5IXSA 4YP5A 1XVAA 2M98A 5C1DA 3JVDA 1NW8A 2AQHA 2HK6A 3IIIA 1GVHA 3ZWKA 1Y33E 4IINA 1YE8A 3R7DA 1KZ7B 3V42A 3C24A 2PCLA 3W3AH 4ZQCB 1XMXA