2ZTMA

T190s mutant of d-3-hydroxybutyrate dehydrogenase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
255
structure length
255
Chain Sequence
VAVVTGSTSGIGLGIATALAAQGADIVLNGFGDAAEIEKVRAGLAAQHGVKVLYDGADLSKGEAVRGLVDNAVRQMGRIDILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASAHGLVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRSPLVEKQISALAEKNGVDQETAARELLSEKQPSLQFVTPEQLGGTAVFLASDAAAQITGTTVSVDGGWTAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords D(-)-3-hydroxybutyrate dehydrogenase
publication title Closed complex of the D-3-hydroxybutyrate dehydrogenase induced by an enantiomeric competitive inhibitor.
pubmed doi rcsb
source organism Pseudomonas fragi
total genus 99
structure length 255
sequence length 255
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.30: 3-hydroxybutyrate dehydrogenase.
pdb deposition date 2008-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2ztmA00
4H15A 3FBTA 3ASUA 4J0FA 5TT1A 4D43A 3KYDA 2WYWA 4UVEA 3JQBC 3ZNOA 1B3RA 2Q4EA 3BIOA 3CZMA 3OF2A 3SJUA 1GCUA 2IZ1A 2VHZA 4KTVE 3NX4A 3C7DB 1AUPA 1NHGA 3TJRA 1YQDA 3ZV4A 4U7WA 3QWBA 3EUWA 4GGPA 4CM6A 2I3AA 3DMTA 2JHFA 4II2A 3JCZA 1PGPA 1UP4A 2VQ3A 3D4NA 4R1NA 3PHIA 5FI3A 3UGKA 1Z45A 1PZFA 4QUKA 1M66A 2ZYAA 4W6ZA 5EPOA 5T67A 2PY6A 1GFSA 1X1TA 2WE7A 2Y0CA 1HWYA 2V6BA 1ONOA 4BV9A 1U28A 2DBZA 2JD2A 4YAJA 1B7GO 1BXGA 4IDCA 4WLFA 5FFFA 4NG5A 1GYPA 1YL7A 2EF1A 3PYMA 1QXSA 3I4CA 3PQDA 2AEMA 4U0JA 5DBFA 1ONNA 1OAAA 2VT3A 5F1KA 3S2GA 1N1GA 1IE3A 5C7LO 1B2LA 2B5WA 4FC6A 4GSLA 3DFUA 3WG9A 2C54A 2YDYA 1ADBA 4CM9A 2BGKA 3BMOB 2GERA 1EBFA 1U7TA 5DOZA 4N5NA 3FWZA 4NBVA 1Q0QA 5JYEA 1TT5A 1NAIA 1W8DA 2JL1A 4HFNA 3GEGA 3CSDA 1MP0A 1SOWA 5B4VA 4B79A 4DPLA 3C7AA 1ZKMA 4CV2A 5U9CA 1X7DA 4IDFA 4BUCA 1OI7A 3VDRA 3GVXA 4LW8A 1NFQA 4EBFA 3GMSA 1B14A 2DT5A 1AHHA 2VN8A 1ZH8A 4RF3A 3VZPA 5CEEA 1P1KA 7ADHA 4XDYA 5JCXA 1HYGA 1FDVA 5DOVA 2Q1SA 1HE2A 5G0VA 4XZ3A 4P22A 4MKXA 3RI3A 3LT4A 3GN2A 3NT4A 3ZWMA 4F6CA 2Z1NA 4JBIA 2VZ8A 1YXMA 1KIFA 4RVUA 4R1SA 4CM3A 1E1NA 4N5MA 1LU9A 3TOZA 3WQSB 4DYDA 1QMGA 3ENKA 2H1SA 4O0LA 4XJTA 2CF5A 5I8WA 1BRMA 6LDHA 3BHIA 3GLQA 2GASA 3GPIA 4DLBA 4W99A 2GUGA 3HFSA 3FSRA 1H2BA 1PL6A 3H9JA 3PYLA 4J9VA 3VZQA 3QY9A 4CMHA 1ZCJA 2EW2A 3UFXA 2FR1A 5MDHA 3PK0A 2NQ8A 2Q4BA 5H83A 5DP1A 3EW7A 3H5RA 1N1EA 3H7AA 3ZWYA 4ZHSA 3O8QA 4HWKA 1JQBA 1WP4A 3N7UA 3TFOA 2EXXA 1V3TA 4P4NA 4XQ9A 4CV0A 5DDIP 3NAQA 1VPDA 2WD7A 2Y0EA 1LSUA 1J0XO 4EW6A 3B20A 5B37A 3DBRA 3I23A 4KP7A 3IC5A 4YRDA 3H4VA 2WE8A 3H9UA 3K31A 2YUTA 5JC1A 1KEVA 4E33A 4R1UA 4E6PA 1E3WA 3BTUA 4J3FA 4MIYA 4NNJA 2J3KA 5AYVA 4CMIB 1I2ZA 2FRDA 2VUUA 1AXGA 1PTJA 3WMWA 3RUAA 3DAPA 3HDJA 4AFNA 1PU2A 3RUIA 3WBFA 3UF0A 1C3VA 1YWGO 4Y6PA 2I67A 4K6CA 3C1OA 3R1IA 1PJ2A 2VHWA 3BYZA 4DQVA 1MC5A 3QWAA 4FCCA 1IYZA 4BNMA 3O8QB 3NGXA 2ZATA 4BGUA 1ARZA 3CMMA 1GV1A 1GDHA 3AM3A 4HFMA 4RGBA 3I9MA 3QRWA 5T64A 3CMCO 1RPNA 2VHXA 3Q0EA 1VM6A 3JQ9A 3RBVA 1PGNA 4BNXA 3A4VA 1JWBB 3PI7A 4U8GA 1YJQA 1PGJA 3BMCB 4OIMA 1YBMA 4L9RA 1DAOA 1TT7A 4ROSA 4J91A 3IKVA 3INTA 3T7EA 4YRBA 4GMFA 2FPIA 3W4KA 4B7XA 2B36A 2DFVA 3PGXA 1YDWA 3OFSA 4WCFC 1HLPA 5HWSA 2JD0A 1Y7TA 2QX7A 2GLXA 4TKLA 4YAIA 5DNAA 4Y67A 3ROMA 1PJ4A 5EESA 2Q1TA 1NTOA 4IMRA 1M6HA 3GDOA 2XAAA 4DMMA 3QWFA 4OL9A 1O89A 2FZWA 3VTFA 3Q1LA 3ZW9A 1XU9A 3I83A 4DTIA 4EUFA 4CR6A 1LX6A 4PRLA 4I5DA 2NVUB 4XGNA 3RAJA 3KVOA 2PK3A 4BNJA 2VUTA 4OSOA 3W8EA 5COAA 5A04A 3WGGA 4UREA 2W2LA 2YV2A 1HSZA 1D1TA 1U5AA 2E48A 4NU6A 4Q3DA 3KB6A 3I9NA 4AJEA 4NQZA 3U49A 4CJXA 4GI2A 1EBUA 3KBOA 4J2HA 3DOJA 3HJAA 5AXAA 3SBOA 1D4FA 2PKQP 3SEFA 3UXYA 3W4JA 1C0LA 3TL2A 1GZ4A 5DF1A 3OICA 2CNBA 2P4QA 4QX6A 2VOJA 4F3YA 2EKPA 3P7MA 4G65A 1OC2A 1YQGA 3HFGA 3C1AA 3V1YA 3ZHXA 1NQTA 1SBYA 3D4PA 3H2ZA 1NHWA 3L0DA 3B1KA 2DKNA 1SZJG 1ORRA 3GNTA 4YB8A 8ADHA 4GX2A 3DONA 1R16A 3OECA 3PQEA 1KBZA 4GVXA 4JBHA 4PG5A 3V1UA 4FJ0A 3A1NA 3D1LA 4P4LA 1XELA 3U4HA 5ER9A 1RWBA 4NU5A 5COQA 4CR8A 2DAPA 2PH3A 4WASA 2B5VA 3PLNA 4A27A 3LLVA 3TZQA 4E4YA 2AEFA 2FSVA 4ZA2A 3ZWNA 5L9AA 5T8KC 1MGOA 1M6WA 1E3IA 3PJDA 1SB8A 1ZVMA 1QG6A 2C7GA 1SAYA 1ZFNA 1U3TA 1CDOA 4R5MA 2GZ2A 3DO5A 2H9IA 3MEQA 1GU7A 3OIFA 2C20A 1HE5A 1ZEJA 4NZ9A 1R4NA 1X7GA 1HDOA 4GPD1 4WK6A 2VOEA 3U9LA 1UH5A 2AMFA 4ONEA 3ZWPA 4MVJM 2OOSA 3DQPA 3ADOA 3AU9A 1MFPA 2VTDA 1GUZA 4QO7A 5LCXA 3ETDA 1NWCA 1BG6A 4IJUA 5IN5A 3G49A 1EE2A 1ZK0A 5G0SA 2C82A 4N18A 2YHIA 3ZWCA 3WLEA 1B8VA 3TPCA 5EERA 2PH5A 3RJ5A 1AHIA 3AI2A 5EQDA 2V6FA 1K6IA 4AG3A 4IZIA 4CLOB 1LNQA 4H3VA 3WWZA 4UUNA 1XLTA 1QYVA 2Q49A 3I9KA 3DTYA 1B26A 4JJIA 4NFYA 4UEOA 4J1NA 3S8MA 3DBLB 3UICA 4BV8A 4CMAA 4R01A 1E3LA 1GTMA 1ZW1A 4A10A 3NTQA 4LVCA 2Y05A 1H6BA 1A7AA 3ANMA 2GCGA 3OHSX 5G0TA 2ZJ1A 1B16A 1U3UA 2VZ0A 4WEOA 3G17A 3QE3A 4CQMD 3EC7A 5JAIA 4XD2A 2FHSA 4W9NC 3P2OA 1X7HA 2IZZA 2NVWA 3LF1A 5TF4A 4NBWA 1VKNA 5IDYA 2AHRA 5KJ6A 4YBZA 1PZEA 4IXWA 1XU7A 1PQUA 1IHXA 2FR0A 1IZ0A 5L7TA 4HXYA 4PLHA 2OBYA 1UAYA 5JDIA 4E5KA 1BDBA 1I8TA 4YVFA 1UUFA 2JAHA 2LDXA 4EITA 3PZBA 5CHEA 3MJEA 3N58A 3BAZA 3RU9A 4WGGA 3L6EA 1B0AA 1ZSYA 3EMKA 4MP3A 2DUUA 4XRRA 4IQ0A 1JW9B 4HX5A 4B4VA 3PJEA 4OXNA 4QEDA 3F1LA 1N7HA 4RF5A 4DQXA 1DC3A 3FNEA 3DZKA 5IZCA 4WOJA 1HRDA 1YB4A 1RM5A 1HF3A 2JD1A 2AEJA 2IZ0A 4XB1A 2CFCA 5GZ1A 4HNGA 4GVLA 5L4NA 4R41A 2B4QA 1G1AA 2NQTA 5JW6A 2CMDA 5K9ZA 1S6YA 3QVSA 1XHLA 4UVGA 4OMUA 3NTRA 3C85A 4AJHA 1C1XB 4BO0A 4GLOA 3TDKA 1A9ZA 4DPKA 1PWXA 3KYCB 4AJ4A 1JU9A 3W6ZA 3K2BA 1NNUA 4BMSA 3L6DA 5CAEA 1H0KA 4UUPA 2H63A 4EUEA 3EYWA 1PJCA 4ESOA 1DHRA 1KY4A 1O0SA 2CY0A 3MTJA 2NADA 3K73O 1C0IA 1Y9EA 2I5PO 2IE0A 3ZH2A 4JJFA 5JAZA 1DEHA 3D4OA 1ZSVA 1YVEI 5TGDA 3PRJA 4PN3A 4RVGA 1EMDA 2J3HA 4R5HA 1DB3A 3V8BA 3PTZA 1UDAA 5BSHA 3WOHA 2TMDA 5A06A 1GQQA 4NFHA 2X9NA 1G6KA 5K6AA 4ND4A 1OOEA 2X9GA 4JBGA 3GZ4A 3NTOA 1LRJA 2VT2A 5IZCC 3MJVA 2PV7A 5A3JA 4BNZA 5JY1A 2AG8A 2HK7A 3NDIA 4U6SA 1WMBA 5JE8A 4GGOA 1P0CA 2GN4A 3WJAA 1PJ3A 1DFIA 3TQHA 2EERA 4Q39A 4CUZA 1Y8QB 4YPOA 4ITUA 1KVUA 1MV8A 3ZU4A 1SOVA 4O5OA 3AY3A 5IDQA 1HDYA 5CFZA 4IZHA 3MOIA 4XRGA 3L6OO 2JAPA 3TNLA 1SO8A 4RF2A 3OJOA 2AQ8A 2UYYA 4O63O 3WQQA 3ZDFA 3H2SA 2AE2A 1C0PA 3E48A 4TVBA 2C29D 2VHYA 3LSYA 4XGKA 1U9JA 1D1SA 2PD6A 3ROKA 1WXDA 3W1VA 2X9VA 1NPYA 2RHRA 1NYTA 2ZTUA 2ZQYA 1P0FA 3PVZA 4XKJA 4B3HA 4BMVA 4GLLA 5IN4A 4A26A 3AFMA 3O38A 3PDJA 4F46A 2ZKLA 4Z3KA 4FGSA 1Z73A 4II3A 5L4LA 1XG5A 1FDWA 4Y6RA 2GRAA 2AQIA 1PJBA 3DBHA 3F4BA 3HDQA 3RBZA 1K0UA 4FFLA 2CZCA 4RORA 2QG4A 1U4SA 1ZNQO 2W2KB 2YJZA 3LYLA 2I9PA 1ISFA 4K6FA 1F14A 1UXGA 1SNYA 4ZGWA 4IGFA 4A73A 4E30A 3WGTA 3KLMX 4I5GA 4CUKA 2WYUA 5H82A 1LI4A 3IJRA 3WICA 1P33A 1IZ9A 4O6VA 2BFMA 3ZWOA 1LA2A 1Q7CA 4OH1A 2VWGA 3QVWA 2YQ4A 4IBOA 4G2NA 1HKUA 2NU7A 1JWAB 2G17A 1PSDA 3DXFA 4R16A 1JA9A 2HJRA 4NIMA 4YRAA 1JLLA 2IEDA 2X6TA 3PJFA 4CM4A 1ULSA 4JROA 4N5LA 4BNYA 4BQPA 1ISIA 4RPGA 1JKIA 4DIFA 5HA5A 3VOSA 4AVYA 3I9JA 4YJGA 1A4IA 1E5LA 4BVAA 4C4OA 4NJOA 1U4OA 1R66A 2A9FA 4ND5A 4WLEA 2AG5A 1V3VA 1VRWA 3PHHA 5JAMA 3ROPA 1DC4A 2J5KA 2X23A 1XSEA 2HO5A 1CETA 1UXIA 2PKRA 3DBHB 4RF4A 1A71A 3ZWVA 1Q2XA 1WWKA 4M89A 3WXBA 4PG4A 1UDBA 3GK3A 1ADGA 1C1DA 1BW9A 4RJTA 1H94A 4KUHA 4AICA 2ZIZA 1ZIDA 1E6EA 2XXBA 3JD2A 3KZVA 1DJQA 3QSGA 2HMSA 1LLDA 3A28A 4LMPA 3DZHA 5IAAA 4NI5A 5BNFA 3WBBA 1VI2A 3DBVO 5A02A 3RKRA 1SPXA 1GL3A 4J4TA 2PZJA 2H6EA 3AU8A 4B7CA 1FXSA 1DIBA 3DAGA 3NKLA 5KKAA 1UAGA 3V2UA 3STHA 3GVIA 1HDRA 3DOCA 1CIVA 3ORFA 4CM8B 4GL4A 5EN4A 1DC6A 4FOOA 4E5MA 4K1LA 4YACA 3PIIA 4ALMA 4PRKA 4Y6SA 4CQMA 2VWQA 5F5NA 1H6AA 3GH3A 2IDZA 4TSKA 2YQ5A 3ONEA 2EEZA 3TZKA 4ZN6A 3RC7A 1W6UA 3I6IA 3AK4A 1CERA 5DCUA 3FPLA 5F3RA 3EDMA 4FS3A 1BXZA 1C0KA 3GC6A 2OHXA 4E32A 1PZHA 3GAZA 5BNTA 3M6IA 3WIEA 1PJLA 3AW9A 4KTTE 1GUFA 2YZ7A 1BW9B 4MIEA 5T5QA 3VH3A 2D5CA 1ZBQA 2G76A 4B8ZA 3ZNPA 1MC4A 1VSVA 3JQEA 1DAPA 2O2SA 3BMOA 3ENNA 4M1QA 4E2YA 4C7JA 4HKTA 1R4MA 1WLYA 1QYDA 2UUPA 4KDFA 5FEUA 4UULA 4BO7A 1O9BA 3K2EA 2Q2WA 3JQAB 3GFGA 3L07A 2J5RA 3X2EA 3UOGA 1I3MA 4K28A 3WLFA 5JMWA 1MX3A 2I3GA 3OEWA 4IY1A 1YL6A 2IODA 3G79A 4JJGA 2B4RO 3ZI0A 4CLEA 4EUHA 2IYOA 4CQMB 5G0WA 4PFJA 4IJVA 4E5NA 1QV7A 1V9LA 1E7WA 4MVJP 3RUEA 4PG6A 2HK8A 2FOIA 2RHCA 4EEZA 2AA3A 1I30A 4JK3A 4CLXA 2E6UX 5KCZA 3GVHA 3G3EA 1EDOA 4FW8A 1Z7BA 3VZRA 4EZBA 3WTBA 1V3UA 4BMNA 1P1JA 2FN7A 2ET6A 3SC6A 1X1EA 4MP8A 1E5QA 2Y67A 2ZB3A 2AW5A 3NRCA 2PLAA 1P1RA 2IEBA 3I9LA 4BO8A 1T26A 4BO2A 4URFA 4WLOA 3JYOA 3LC2O 1R4MB 3MJCA 2POQX 1HEUA 3DB2A 1KY5A 2O7QA 4LK3A 2P9GA 1S7CA 1OBFO 2DUWA 5H81A 1EVZA 2YV3A 3GRPA 3AUAA 3IKTA 3C24A 5DBGA 1NFRA 2RIRA 5C3MA 2C2XA 1XYGA 4IDDA 2VYNA 1ISMA 1EK5A 3DMTC 3H9GA 2Y1FA 1U5CA 2NSDA 3DWFA 3E6AA 4KUEA 1T24A 4IIVA 3ITDA 4J7XA 2P5UA 1R37A 5IZ4A 4BNWA 1WW8A 4KZPA 2DTEA 1LQUA 4XX0A 4D42A 3TZHA 3KSDO 4D3DA 2OORA 2HSDA 3Q9NA 4XYGA 5JMPA 3UCFA 1HXHA 1PJSA 4Z9XA 3ZHYA 1QYCA 3UHAA 3NT5A 3MWEB 3O9ZA 3FBGA 4GMGA 4RPKA 3TZ6A 5C7IO 4CMIA 1BTOA 3VKVA 1X13A 4RVHA 3KO8A 1YS4A 4NPCA 3NDRA 3OH8A 2ZQZA 4EEXA 2R00A 3LLSA 3WQRA 2Z5LA 3WTCA 3CKYA 3H3FA 3HDHA 3WS7A 4FFRA 4FOSA 2OUIA 1LXCA 4DMLA 4J1QA 4YYZA 1GQ2A 4RO0A 1J49A 4FIZA 3R3SA 1Z74A 2HRZA 3EAGA 3PPIA 1YONA 2JFFA 1NP3A 2QHXA 4S3MA 2BI8A 4BNHA 3PWKA 1BVUA 2ZB4A 3IAHA 1C14A 2NM0A 4WJZA 1NVGA 4PLPA 5GZ3A 2QRLA 3BMCA 3RUDA 4BNVA 4YAGA 4UVIA 5KIAA 2HQ1A 1B8PA 1YQXA 2VUSA 3I5MA 4HNHA 5A4DA 2GN9A 3OA0A 4CMEA 5ADHA 1DPGA 1K2WA 1YGYA 1HT0A 4JP2A 2QYTA 3H8VA 2RH4A 2D59A 2EG9A 3KSUA 3ZN2A 3JQ6A 1LDBA 3JD1A 4IDBA 3LT2A 3HSKA 2P5YA 2PZLA 4KQXA 2A4KA 3SXPA 4IDGA 5DZSA 4ZD6A 3DL2A 4PCVA 1A7KA 4Q3AA 1IY8A 2VNSA 4BNKA 2QQ5A 1BWSA 2NVUA 3EVNA 1HZJA 1MXHA 1I01A 4QO8A 5I9MA 2HCTA 4OGWA 5JPIA 1I5RA 4CQLB 4CLHA 2ZB7A 3JQ8B 4GWGA 4TRJA 5ES3A 4NK5A 3WNQA 1NWHA 4D3SA 5CEFA 1DXYA 1ISGA 5U1PA 3EVTA 2GPTA 4MVJD 3KOUA 1VL6A 4XYEA 1FMCA 1P44A 2PWZA 4CLRB 3FNGA 2DPGA 4JXKA 1ZXBA 1KC3A 1DHTA 4NR0A 3AY7A 3HDYA 1YB1A 1JTVA 1P77A 2CD9A 2QYSA 3CPSA 3FHLA 1M76A 1NPDA 3MCVA 1ULUA 1GYQA 3NV9A 5GZ6A 1L7DA 3BHJA 3PYXA 3HHPA 4BKUA 4JLWA 4F45A 2WYVA 3BMNB 4N54A 4J7UA 1CJCA 5CDGA 3ETEA 1F12A 2YW9A 1A4UA 3GDGA 1JKJA 4ALKA 1GADO 1LRKA 2CF6A 4B3IA 5JAQA 2AQHA 1UZMA 2F1KA 3B6ZA 1BSVA 1PR9A 3KLPX 4NBTA 4WECA 3V2HA 2Q2QA 1UDCA 1LBEA 3PZRA 3UCEA 1XQ6A 3ZU5A 4BO4A 2BFPA 2OO5A 3FN4A 4NHEA 5B4TA 4WLVA 3GUYA 4NBUA 3JQ9C 1EVYA 4QT0A 3EGOA 4QXMA 4TRNA 4IS2A 1MG5A 3RFTA 4RVFA 4DPMA 4E3ZA 1NQOA 2WSBA 5IDXA 1FF9A 1DIAA 5ICMA 5KVQA 1WPQA 2O48X 3GNQA 5LDGA 2GF2A 1HSOA 2UAGA 3F5QA 4TVOA 1WNTA 2EGHA 1LC0A 2X4GA 1PQPA 4M55A 2ZTMA 4FD3A 2VYVD 4RZIA 3VTZA 4BNUA 4ZICA 3H6KA 1Y5MA 4XYBA 2VWHA 5DCYA 4A5OA 2CUKA 5J23A 1XGKA 4EI2A 4O59O 1T2CA 4YTEA 4FGWA 3LU1A 2GZ1A 2QZ9A 1DDOA 2O3JA 3S2EA 4AJ2A 3D3WB 3CEAA 4PG8A 2FWMX 2NLOA 3UKOA 2JKVA 1VJ1A 4UVDA 3E03A 3NDJA 3WSVA 3DOOA 2VNAA 1I36A 3F5SA 5A3VA 3INGA 2NTNA 3ZCXA 3GF4A 3TSCA 4BGEA 5TC4A 3W8DA 3U5TA 5JCJD 5HRUA 3ZU2A 1HDXA 3GEMA 3ZNNA 1YBAA 1TI7A 2G82A 4OOFA 3RC1A 4HV4A 5AQ1A 4OQZA 4CLOA 5L53A 1XEAA 2GO1A 5CPBA 1CF2O 2WTBA 2HK9A 3ON5A 5THKA 5C5IA 1W73A 4J6FA 3R0IA 4YQYA 4P38A 5IXYA 1Y8RA 1H9AA 2B35A 1E77A 2IRWA 5TJHA 1YJ8A 3AM4A 3DBLA 2D5AA 4RCVA 3WMXA 2E37A 3ZU3A 4CMJA 2W90A 2I6TA 1NPTO 4PLYA 2P68A 3WYBA 3AWDA 3IUPA 1ZK4A 4IGEA 2YY7A 4ZJUA 2Z1MA 1WDLA 3NJ8A 4A03A 1UP6A 5B1YA 5ITWA 4WNCA 3WGHA 4YT8A 4IPTA 4ID9A 1R0KA 4P8RA 5DBIA 3RUHA 5EMHA 1SCUA 5TT0A 1W0CA 3JQGA 4GKVA 4W4TA 3DC2A 4JP3A 4YQZA 4X54A 3EY4A 3S2IA 4ZQFA 2OFPA 4RVSA 1J6UA 1QYXA 1U3VA 3IIEA 3TL3A 4FN4A 3ZW8A 5KVCA 4DGSA 1KEUA 2HMTA 1KC1A 4PLTA 5DCWA 3W6UA 4CM5A 4XR9A 1E7YA 1YB5A 2Q2VA 3U4IA 3FD8A 3F46A 1WMAA 2V7PA 3LK7A 4B4WA 1Y8RB 4Z9YA 2X58A 1ZSNA 3AI3A 4XDZA 3U0BA 4CMBA 2X1HA 3M1AA 1LDEA 4FSHA 2NUAA 3JQAD 6ADHA 4UEJA 2EIHA 4BNIA 4L0QA 5IG2A 3TF5A 5IF3A 1HE3A 1ONPA 1HYEA 1JDJA 3RFVA 1KVTA 1VLLA 3F9IA 4CUJA 4DUPA 1QSGA 3HB4X 5G0UA 4IQ8A 2DU8A 2Y1DA 2QRKA 2V65A 3K9QO 5L45A 1C1XA 2FZEA 2GR9A 2WMDA 3JQGB 3F6YA 4B8WA 3KYCA 4DL9A 4E5YA 3DZJA 1LUAA 4RV9A 5DT9A 5A03A 1KVRA 1R15A 3U4CA 4DWVA 3PLRA 5BSGA 4NDNE 4E2XA 2Y93A 3AOEA 3RC9A 3NYWA 5EINA 4D41A 4FFMA 3GRKA 4KQWA 1PS9A 3ICPA 3U3XA 2QRJA 3E9MA 2J3JA 1DFHA 1U2GA 4OKIA 4OHUA 3WFJA 1GPJA 2X8LA 5KTKA 3D64A 4OKNA 2PD3A 1O6ZA 3PGJA 4M8SA 1T1RA 1VSUA 3GDFA 8LDHA 3GEDA 4HBGA 1LLUA 4TMFA 4DXHA 1MB4A 1IUKA 1NQAO 2VWPA 4NK4A 1EDZA 1NBOA 3MZ0A 3OIDA 3MTGA 4R1TA 3U62A 3FPCA 4L73A 2FY8A 3K5PA 1E7MA 1ENYA 4S1VA 5DP2A 1QP8A 1EEHA 4KMSA 1Y8QA 1LC3A 1YO6A 1KOLA 2NU9A 4KDEA 1H6DA 2Z95A 1E1LA 1N8KA 4PGFA 1EVJA 2YV1A 4TZKA 1GEGA 1Z75A 3DTTA 3LT0A 5LDHA 3JQDA 3OSUA 4M87A 1NASA 1ADFA 1F8FA 3FWNA 1PZGA 2E82A 5JDIC 2UDPA 1ZJZA 3AOEC 4U0KA 1KVSA 2X0RA 1EUDA 2PGLA 1LQTA 5KVSA 1DBVO 3ZV5A 3ZHBA 4D7AA 5C7OO 1I33A 1YE3A 4D0SA 1DIHA 5L7YA 4DIOA 3ONFA 1KETA 3L9WA 4IUYA 1E6UA 1T25A 2LDBA 3AI1A 3AJRA 1DSSG 4OSPA 4W82A 1U7HA 1U8XX 4YR9A 5G4LA 2FSSA 1EZ4A 5L7WA 2D4AA 3K6JA 1O94A 3I52A 3K92A 2W2KA 5IFLA 1ZO8A 1O5IA 1ML3A 1Q7GA 1XKQA 2EW8A 3VHRA 3P19A 4DC0A 4I08A 1V0JA 3Q6IA 5ENVA 3JD4A 4YJHB 1QORA 1DO8A 1HL3A 1ZMTA 2PD4A 3RD5A 4YXFA 4JGBA 3A9WA 1K3TA 1IPFA 5A5FA 3IMFA 1U3WA 4WE3A 1WZEA 2XXJA 4ALLA 1I2CA 1E92A 2HUNA 1E7QA 4RQUA 2X0NA 3DFZA 4J2OA 3H5AA 4QQRA 3WFIA 5BSFA 5TLSA 2C07A 1TA4A 4M54A 3UH1A 1KEWA 3JYQA 3LC7O 4MVJI 2WM3A 5MGBA 3L4BA 3BA1A 1P3DA 3FTPA 4YA6A 4INAA 1MG0A 2BF7A 9LDTA 3VPHA 3RKUA 2Y66A 2NV6A 5K6AC 1FJHA 5I7FA 1TXGA 3F47A 2BI7A 4I5FA 4E5PA 2BLLA 5JCJA 2BGLA 1KYQA 3MJ4A 5TX7A 1TVEA 1O8CA 2W98A 5L3ZA 5A9SA 2O3SA 3CH6A 5U4QA 2TMGA 3ADPA 1PIWA 2ZK7A 3JQ7B 4D3FA 4R9RA 4XQEA 1Q0LA 3VAZA 3V2GA 5F1PA 4BNNA 1NM5A 1ZJYA 2B83A 5DN9A 3G0OA 4RPLA 1Z7EA 2DFDA 1EFKA 5TS3A 3WB9A 1HE4A 1W4ZA 1XR3A 1MLDA 2QZZA 1G0OA 4R54A 4L4RA 5AXBA 2WWRA 4CM8A 1ENOA 1R0LA 3DHNA 3L4BC 5TRTA 4Z0TA 3QLJA 1ZXLA 4Y98A 3KETA 4L4SA 3FR7A 4FB5A 3QHAA 4YEDA 3WGQA 3ZV6A 5EL0A 4PZEA 3WYCA 3ULKA 2Y0DA 3HB5X 4GKBA 5KJFA 1AGNA 5ITVA 5CPFA 3WNVA 4IJKA 5JBIA 1MA0A 1UXHA 4DC1A 3O03A 1BHSA 4MDHA 4JN6B 1ID1A 3GZNB 1GUYA 4ZQEA 3HZZA 4LSWA 5A9SB 4PLWA 4TQGA 1IB6A 4XEHA 1DRVA 1QLJA 1SB9A 3IUSA 5FF9A 1HETA 4CL8A 4MPDA 3E82A 1R0SA 4DIBA 4E13A 3RROA 2JCXA 2P9CA 3JQFA 2EKQA 5L4SA 2HRBA 3JQAA 4FJ1A 1X0VA 1GY8A 2PZMA 5JY6A 3PDUA 4IM7A 1ISHA 2NU8A 2V6MA 3I1JA 2BRUA 4LCEA 5I7EA 1LDGA 2E4AA 3E9QA 5JSFA 2NU6A 3LT1A 2EGGA 4YT4A 3BZUA 3E9NA 5I9LA 1K89A 3GGPA 3RBXA 2Y68A 4NMHA 4BO9A 4IMPA 1UZNA 3T4XA 2O3UA 1ZUD1 4Q3BA 5AOVA 5DULA 3KV3O 4UAGA 3I6QA 3E18A 2EV9A 3QWIA 4BNFA 3GMDA 1ENPA 3HE3A 3MWDB 4RPHA 1WAMA 4QECA 5KJEA 2Y1CA 4YAEA 4AJOA 2EP7A 1CQJA 3JQFC 3UW3A 4HUJA 3ZHZA 3WDSA 4Y8VA 3MJTA 3E8XA 3KEOA 3CINA 3RQSA 5A5EA 2P2SA 3FNHA 2ZTLA 4BKOA 4RLHA 3H9QA 1T4DA 1NQ5A 4XB2A 4XIYA 2W2LD 1TEHA 3EHEA 4IDAA 3ZWBA 4XYLA 1ZK1A 2C5EA 4YJFB 3ZWWA 1A27A 4XR4A 2O2YA 4B4OA 4LN1A 4A0SA 2A94A 4MJLA 3RVDA 3GG9A 4OYRA 2PGJA 1EFLA 2R2GA 3U4DA 2Q1UA 4ILKA 5ILOA 4UEKA 1LDYA 2DBRA 3VVCA 3R6DA 3Q9UA 4MIOA 2DQ4A 3WGOA 2EWMA 3AM5A 4OM8A 1X15A 2C5AA 4K9DA 2IYPA 1V8BA 4KUGA 2BFOA 3C1TA 4QTZA 4Q3NA 3BTVA 3F1KA 1BVRA 3OETA 4NJMB 4FFPA 1U2DA 2FPGA 2CDCA 1IL0A 3OJLA 3VKUA 1N7GA 3K30A 4IQGA 1TB4A 1RJWA 3M2PA 3OBBA 3FR8A 1ISJA 4MO2A 1X14A 1XWFA 2BELA 2G0TA 4H7PA 1ADCA 5F5LA 4LGVA 1HDGO 1UJMA 3OQBA 1T4BA 1V6AA 5L40A 4L74A 3QW2A 2CVOA 4E0BA 3KYDB 4YAKA 5ENDA 1JAXA 1MUUA 3Q2KA 5A9RA 5HS4A 4B7UA 3NUGA 3HWRA 3SJ7A 5FI5A 4BKPA 1DRUA 2O50A 3JTMA 4NBRA 3QWHA 5JS6A 4IJWA 4R3WA 3GHYA 2X86A 4GSKA 4E2ZA 3HG7A 1M67A 4MP6A 3OIGA 4U6QA 1VC2A 1LJ8A 2OXIA 2D2IA 3BHMA 1BMDA 4DRYA 5CDSA 2VRCD 2FMUA 5ILGA 3DR3A 1ZMOA 4GX0A 5HTOA 3FTNA 4ALNA 2AQKA 4KWHA 3ZV3A 4BHTA 3C3XA 4FFOA 3AUSA 3BTOA 5KJ1A 1CWUA 1NR7A 3VPFA 2OZPA 1G0NA 4MKRA 2D1YA 2C59A 3S55A 3WGYA 1T2DA 5BT9A 4ALIA 1N5DA 5A05A 1UP7A 1HDZA 4BKRA 1OC4A 1BXGB 5IJZA 4JCOA 1QR6A 4MVJF 4XYMA 3VDQA 3R3JA 2A35A 4M86A 3QA9A 4ND3A 4C7KA 3IJPA 4LMRA 3WWYA 1HDCA 3CXRA 1GV0A 1I3KA 3Q3CA 2X5JO 1LDMA 2XF8A 2G1UA 2JHGA 4CQLA 1J4AA 1TT5B 1ZEMA 4WNIA 2BH9A 2YDXA 3JQ8A 4RLSA 1N2SA 2GSDA 1WVGA 3WJ7A 4UUMA 2XOXA 2UV8A 2GGSA 4Z9FA 3RFXA 2NVBA 1PJQA 3HN2A 4I1IA 2FP4A 1IULA 3MOGA 3QIVA 4B3JA 1QYWA 4PLCA 2EP5A 3JQCA 4R9SA 3F3SA 4XJSA 2GNAA 2J8ZA 3CUKA 4CLRA 5JYDA 3NEPX 4UUOA 3ANLA 3IS3A 3KHUA 3PQFA 4R3NA 4I9HA 2HKIA 4AJKA 4DBVO 1AXEA 2DLDA 5AVOA 3FCOA 2PNFA 4BIIA 5BQFA 5KNLA 1NAHA 4I9NA 1UXJA 1H5QA 5A1TA 4IINA 2PTGA 4CMGA 1E3SA 5LC1A 1LLCA 2R00C 2O7SA 1AE1A 2P91A 3BMNA 2D0IA 4MVJG 1JVBA 4FQ8A 4OXKA 5AXCA 1V35A 4W7IA 5BSEA 1P45A 2HU2A 1NVMB 3GVPA 1E1KA 4AJJA 3DHYA 4WCFA 4R69A 1ZK3A 5T6BA 3RWBA 1YRLA 4CV3A 3ZGYA 3WGZA 3U09A 1HYHA 2Y1EA 1QLHA 1T2EA 2I65A 3TZCA 5TIIA 4Y9DA 3JSAA 3QP9A 3SLKA 4W7HA 4IDEA 4RDIA 2YHUA 1DC5A 4R4JA 4DVJA 3GNSA 3VH4A 2W4QA 3WR5A 2WDZA 3H3JA 5FWNA 2OL4A 4J9UE 5BNIA 1LSSA 5IDWA 2ZCUA 3JD3A 1F8GA 5JFOA 4WCDA 3IDSA 4A2CA 2NACA 4XWYA 3PP8A 4CMEC 3SX2A 1L1FA 5G4KA 1P1FA 1GD1O 1P31A 5B4UA 5JDCA 5GMOA 1EVIA 1H93A 1HZZA 1N9GA 1XIVA 3FI9A 2JCVA 3M1LA 1L7EA 4TRMA 3UVEA 2WD7B 1R12A 2DM6A 3VPXA 1O95A 3BMQA 4E2WA 4EDFA 1GQYA 3DBRB 4HFRA 3VC7A 1DIGA 2EHDA 3OQ6A 3SVTA 2RCYA 3LVFO 3D3WA 3PHLA 2HLPA 3WSWA 1I0ZA 4WCFB 2Q46A 1CRWG 3VVBA 1FDTA 1E3WB 3KUXA 3E5MA 3RUFA 4DREA 1JKFA 1I3LA 2BFAA 1QKIA 3VZSA 3OA2A 3LC1O 2ZB8A 2X22A 4PLVA 1KEPA 4AJPA 3K8ZA 4HP8A 3PXXA 3V1TC 5F21A 3QV1A 2SCUA 2O3RA 1A5ZA 3SC4A 2NWQA 4BNTA 3DEYX 2FR8A 4PLZA 2Y1OA 3L4SO 5G2OA 3OQ1A 5THQA 3AOGA 5KVVA 1LEHA 1LLQA 3OEYA 3Q2IA 4YCAA 1ENZA 1Q0HA 3DMYA 2WJPA 3WX0A 1E1MA 5CDYA 2D8AA 3QJ5A 2X5KO 1GAEO 2J5QA 1PQWA 1FDUA 1F17A 5G4KB 4U5QA 2CDAA 3PHGA 3RCBA 3T4EA 3E5RA 3PEFA 2ZTVA 4I5EA 5AXDA 3KTDA 2O4CA 4BGVA 1XDWA 4XQCA 1N9GB 4L75A 5C37A 5JDCC 3BMQB 5JXWA 5T8KA 3NJ4A 3UCXA 1VJ0A 5KJCA 2HMVA 1KS9A 2R6JA 1EK6A 1K6XA 1E3JA 3IOYA 4WLUA 4IXTA 1DOHA 1B15A 3GUCA 5I8ZA 3ETGA 4AJIA 4E21A 5B12A 3ASVA 3COSA 4IIUA 4YDRA 4MINA 4BS9A 4D79A 3ROQA 5HS6A 2GDZA 2Q45A 4BGIA 2Y1GA 3V5NA 2J6IA 1LRLA 2RAFA 2FPPA 2OBNA 2PKQO 4F6LA 4G81A 5L51A 4GWKA 2PA3A 1I3NA 2DPHA 1PGOA 4H16A 2QW8A 3B70A 5I7SA 4J0EA 3INRA 1T2AA 4GX1A 3PFWO 4TKMA 1IHYA 4ZRMA 3RUCA 4OAQA 3D7LA 3VPGA 2GN6A 1YKFA 3DAFA 5CEJA 1GYRA 4J4BA 3C7CB 2DTDA 3CTMA 2B37A 1NFFA 2Q3EA 4BO3A 3GN1A 2YFHA 4AJ1A 5JC8A 2JFHA 3OM9A 4PIVA 1DRWA 3DZGA 2C7VA 4IS3A 4J1SA 1Y1PA 1Y6JA 4N7RA 5JO9A 1NXQA 1U1IA 5I9NA 2HJSA 2PZKA 2EJVA 4DLLA 3GPDG 1GR0A 1AN9A 1Y5RA 2C2YA 4MVJH 4EYEA 3BTSA 3SLGA 2DTXA 4GBJA 2V6GA 1SC6A 1NX6A 4CM7A 4EJMA 4MVJE 2VRBA 4Q3EA 4LVUA 1A72A 3FF4A 3GY0A 3KSZO 4DA9A 1LSOA 1E7SA 2VRCA 3Q11A 3ZWXA 2BD0A 2JFGA 4L8VA 3PHJA 1OFGA 4W9NA 3EZYA 3JYLA 2UVDA 1B8UA 3MJSA 5EQFA 4LRTB 1M2WA 4WKGA 4E31A 4M49A 4ZRNA 1PJTA 3WGIA 2WEKA 1P9LA 2C0CA 1SMKA 2EKLA 2B69A 3I3OA 5F1OA 3M2TA 4TWRA 3RSHA 5KOIA 4J90A 3O26A 2GN8A 1T1SA 4NFSA 3GGOA 4RL6A 1LSJA 2UUOA 3K96A 4LCJA 2ZCVA 1RYDA 2BKAA 2X0JA 3A14A 3PWZA 3D3EA 3F4LA 3H65A 4PVDA 2HMWA 4I8XA 4JNKA 3PIDA 4MOWA 4I9UA 2Q99A 2B4TO 3GA0A 4K26A 3JD0A 3B1JA 2Y99A 1Z6ZA 3HQ4O 1CQIA 1EQUA 3ICCA 4BNGA 1Z82A 1CEQA 3C8MA 4TRRA 1WDMA 3OJ0A 4QFDA 3T7CA 2DC1A 3GGGA 3IP1A 4FDAA 3A06A 1R4NB 2H5LA 4CR7A 1D7OA 1QV6A 1SEVA 7MDHA 4WEQA 3IL2A 1VL8A 1IPEA 1A9YA 1JVSA 2NNLD 3P2YA 3ST7A 4FR5A 1RKXA 1Q1NA 1FDSA 1RYEA 2GD1O 2WD8A 4LRSB 4MKZA 3RC2A 1EE9A 2VTEA 2YHIB 3TFQA 4BO1A 2BGMA 3GHHA 1BXKA 2W8ZA 4A7PA 3TOXA 4RPJA 1PX0A 4J7CA 3OMLA 4BQRA 5BR7A 2OP0A 3AFNA 3DZBA 1OMOA 2GZ3A 4HADA 1Y9AA 3GG2A 4ZQHA 1TLTA 1HTBA 5JO0A 4YT5A 4JIGA 4YWJA 3S1LA 1DLJA 4Z6KA 1UZLA 1VL0A 4JX8A 3ZWAA 5KWEA 3TWOA 2EJWA 5ER6A 4AJLA 4J1TA 3PWSA 3W4IA 3WIDA 3N74A 1I24A 3TRIA 1LTHR 3NT2A 4YJHA 4ND2A 4CMKA 3VPSA 1OZAA 2O3TA 4KWIA 2O23A 3G1TA 3VH2A 4OXYA 3GQVA 4MVJA 5GY7A 5KKCA 5IXSA 4D46A 1F0YA 1YBVA 1YH3A 5JLAA 4PLFA 4QFCA 4TZTA 3JYPA 4D45A 2IXAA 5A9TA 4XCVA 4R68A 3HN7A 1T2FA 2P4HX 1YOVA 5TJ9A 1N92A 1DLIA 2NTVA 3ONDA 2QIOA 4Q9NA 4BO6A 1GZ6A 1I10A 3LQFA 3OP4A 4HY3A 3IQDB 5HBRA 2Q1WA 4OOEA 1M75A 2O4UX 4ZVVA 5CG2A 4FJ2A 4EGFA 4G5HA 2B0JA 2ILTA 2O3QA 5JNLA 4ZQBA 4YT2A 1E6WA 1D3AA 1EUZA 4J4HA 3W8FA 4OQYA 1PS8A 3P5SA 4BB5A 3L77A 2VZ9A 1JN0A 4FC7A 2P9EA 1PS0A 1KVQA 4R51A 4CM9D 1PEDA 4BNLA 2IXBA 4BO5A 1VKOA 3EK2A 4PG7A 9LDBA 3KYBA 2BMAA 5EIOA 2YYYA 4RZHA 3JQ7A 4B4UA 4D0RA 3ZZNA 4DYVA 3UAGA 1K5HA 3CIFA 3O4RA 3LDHA 1D8AA 5CP8A 3L9XA 4AJNA 1R6DA 1GZ3A 1U8FO 2F00A 4CL3A 2PR2A 1J5PA 1RM4A 4J49A 1NR1A 3BXXA 1Q7BA 4RVDA 4BOYA 2VYND 2VYVA 1YOVB 2RH8A 1P1IA 2CDBA 1P74A 2X0IA 1GPDG 3OJFA 4ZQGA 3GVCA 1E0DA 3KM0A 1WDKA 2ZYGA 3KRTA 2JCYA 4WPGA 1BDMA 1PL8A 1ZZEA 3UUWA 2DBVO 2Q50A 3B1FA 3HADA 3LF2A 4PLGA 4TROA 4UVHA 4XQGA 4ZU3A 1PWZA 1DIRA 1MFZA 2J3IA 4HFJA 2GYYA 5EJ2A 1PR3A 3D5TA 5K0ZA 2ZJ0A 1F06A 3RJ9A 4DLAA 1B3BA 3ABIA 2PFGA 4CV1A 1SEPA 4CMCA 3JV7A 4BKQA 3GZNA 4Z0PA 4WUVA 5I7VA 1PL7A 4NH4A 1BGVA 3S2FA 5COBA 4Z3DA 4XGIA 2CSUA 2HMUA 3ITKA 2HDHA 4CPDA 5HM8A 3D5QA 3HUDA 4P4GA 4WLNA 1ZK2A 4EJ0A 1PGQA 3AUTA 1I2BA 3GFBA 2OMEA 5CDUA 2DBQA 3AY6A 4DQUA 3DZIA 5TSDA 3VH1A 4PZCA 1UR5A 4Q3CA 1YL5A 4XA8A 5CDTA 3DDNA 3DZFA 5CG1A 2AXQA 2X7HA 1FK8A 4FBGA 3X2FA 1K6JA 5TQVA 2OP1A 2PGDA 4CODB 3LZ6A 3QQPA 4XIJA 1EUCA 1GCOA 3EZLA 4L4XA 5TNXA 2DVMA 2VHVA 3CE6A 3PJGA 4CM1A 2OGUA 4FPXA 2AE1A 3CZRA 1NVTA 1X0XA 5ICSA 2E49A 3AUUA 4LSMA 4OJNA 3GT0A 1YDEA 1DJNA 3QVOA 3QVXA 3I4FA 5T57A 1H2HA 3ANNA 2BHLA 3QVTA 1I32A 3OJEA 2I66A 4RDHA 2ZYDA 2I99A 1QRRA 2XPCA 3NGLA 3RIHA 3HNPA 4PZDA 1CYDA 1JAYA 4EJ6A 1GEEA 2I76A 3GR6A 3KXDA 4LISA 4RQTA 4DBZA 3FRJA 1LDNA 4GAEA 2CVQA 4J43A 1H9BA 3H5NA 3ZNQA 2D3TA 1MXFA 4GX5A 3FNFA 3E1KA 2YFQA 3RASA 1XQ1A 4BB6A 3JQBA 1KERA 4ND1A 4YJFA 3UN1A 4Z0HO 3G1UA 1HLDA 2NTJA 4BL5A 3JYNA 1H6CA 2G5CA 4FFNA 3WYEA 4KOAA 1Y81A 4ALJA 4JQCA 4L76A 1UXKA 4CM4B 4CLDA 1EQ2A 1VE9A 3GAFA 5L95A 1WZIA 2RBEA 3IP3A 3DHEA 4GH5A 4PVCA 1VJTA 2JJYA 3TN7A 3H9EO 4GQAA 4WOKA 4YJGB 1P1HA 4YJDA 1RM0A 4AL4A 3PFFA 5FYDA 1DFGA 4NJMA 1XCBA 1E7RA 2X5OA 1XA0A 4O1MA 4J16A 4QSMA 1E3EA 1RM3A 2HAEA 1IOLA 3I9OA 3GOHA 3KEQA 4E12A 1C1DB 4OO3A 4D44A 2VCYA 3D0OA 3RU7A 2CVZA 2A92A
chains in the Genus database with same CATH superfamily
3B9BA 3DVSX 4INZA 5IUKC 4YYEA 5DM60 3SZRA 3O2JA 4Q48A 4FW9A 4G86A 3U48A 2OPHA 2WYWA 2ST1A 4UVEA 3IP7A 2O5EA 1WTCA 1VLMA 2H29A 4L6IA 2W4MA 2Q0SA 3V7FA 1B3RA 4HYQA 1V41E 1IY1A 2M32A 3BIOA 4X7PA 1GCUA 4EF5A 3FMGA 3NX4A 4GYWA 1GT6A 3A6GA 3K7EA 1RJGA 1Z5PA 3C7DB 1V1MB 3GEBA 3TJRA 2QQEA 4QIHA 3HBAA 3I9V6 3BAFA 4GGPA 4HRYA 4CM6A 2IX3A 1NUHA 4QDUA 3FAZA 3FOWA 3LUHA 4II7A 4A5SA 2JG3A 1XWIA 1Y9JA 4RSRA 1TK3A 3KXLA 1KO1A 3JCZA 5FBHA 1UP4A 2AC7A 2X77A 4PX3A 5F9MA 1KZHA 2D2XA 1PZFA 1EUYA 1FW6A 1VE6A 3GU3A 5EPOA 2V7TA 4YO8A 3EWNA 2PY6A 1X1TA 3QU4A 2BM0A 2DFLA 3G9UA 3CCBA 3L04A 3DJFA 2COKA 3N59A 3B3JA 3JAKA 1G291 2VBCA 1ES9A 1A9TA 1ONOA 3KZNA 4P1ZA 1U28A 4DUYB 4XVRA 4WZBB 4GP9A 4YAJA 4IF4A 2GK3A 1AQNA 1X7YB 5TR9A 3WGLA 4BRUA 1E1YA 3FWHA 4TV9A 1ANKA 3BDVA 3D59A 3I4CA 5F1KA 5HMLA 4UTRA 4N7JA 2JGMA 2Z6VA 3TEJA 5C7LO 2YXEA 3JALB 3R5JA 4L50A 2P2CA 3FZEA 3DFUA 3WG9A 5EE1A 1HY3A 2YDYA 5K4HA 2B1RA 4OHXA 3BMOB 2GERA 1U7TA 1J00A 1V6CA 1ZP6A 5B2EA 4N5NA 1DO0A 2ZXUA 3LFHA 4U7GA 3TJZA 5EZ6B 3TLCA 3SBXA 5G53C 2E3JA 2JL1A 4Y1EA 3GH1A 2XUOA 4IGIA 5CIYA 2BZSA 1VA5A 3NCHA 5B4VA 1V5IA 3E7PA 4D4HA 3K5HA 4B79A 5AIAA 4KXXA 1RC1A 4JYBA 3QGMA 4IWYA 1ZKMA 2CK3D 2NPOA 2QPOA 3C45A 4CV2A 1C9MA 4UMVA 5JFGA 2GD2A 1X7DA 2JANA 4IDFA 3RS7A 2ZUFA 5EKDA 4LW8A 4Q4JB 3UB3A 2OHFA 3IAM1 3FB4A 3ELDA 4DWWA 2ACVA 4EBFA 4YXWD 2QZPA 1I51A 1OX4B 1YVUA 2ISCA 3D81A 3PWTA 4I5IA 4YRTA 5DLEA 1AHHA 5DTIA 5EXDA 5IVPA 2Q1YA 2WTEA 4PX9A 4WNYA 1FDVA 3OM0A 3X1YA 4NESA 5DOVA 3VTKA 1YIAA 3LT4A 5H59A 4XVUA 5CX1A 1KIFA 4RVUA 5IMSA 1VCOA 1G66A 4TV9B 1VA4A 1F8XA 1PP4A 5FBKA 2AKEA 1E1NA 1T35A 2Q0XA 1ZOOA 3TOZA 3WQSB 3A04A 1QMGA 2H1SA 4XJTA 2CF5A 1Q83A 1RXYA 1X2EA 2CKDA 2Z3ZA 4BRZA 4EPXA 5HX7A 3U80A 1KIMA 2GASA 2MCFA 5DIZA 1Y3DE 2OHOA 3FSRA 5CT5A 4KQKA 3L05A 1PL6A 1YZUA 4HD8A 4M2LA 3FSGA 1ZMRA 2AFIA 4I4TA 1HM5A 1T15A 3IPRA 1AB5A 4DEVA 1GPH1 3UFXA 2FR1A 4D9MA 1MW8X 3C8DA 3IDQA 4L5CA 1J2TA 2QRZA 3PK0A 2NQ8A 4XUCA 2XDAA 3SICE 4QHTA 5DHPA 3DMRA 1IUPA 3KD2A 1JF8A 3GEPA 4IGKA 3KP1A 4ZK2A 4Z7OB 1XTTA 2JAUA 3A3NA 3EW7A 1E5XA 3U3JA 1KU6A 1N6NA 4O4IF 3VR6D 3DGEC 4HWKA 1JQBA 1QWOA 1OFUX 2J6BA 3JWIA 4LYFA 3HU2A 1CUWA 2BFWA 2CUNA 3E2MA 3KHTA 3CN9A 3OLVA 3OTHA 1V3TA 3FFBA 2LZ0A 2G8NA 3CRVA 1KI7A 4XQ9A 5LZ4A 1UJ5A 1NXXA 1GZHB 1YFZA 2QXUA 5GV7A 5JVDB 1J0XO 5FOSA 4DZTA 3B20A 2NMVA 4IFBA 1O9GA 3DBRA 3VOTA 1R8QA 2O5VA 4KP7A 5ISMA 1TJYA 4YRDA 3H4VA 4BJ5A 2R25B 3IB6A 3MQ4A 3G0BA 1K4KA 3EFEA 2YUTA 3RKSA 2K87A 2AN4A 4KO2S 5IJ9A 4C7OA 5MN4A 4E33A 3VVMA 4E6PA 4QYMA 3KJNA 3PFGA 5A5VA 3BTUA 1CNMA 4AY4A 1JAZA 4OGGA 2J3KA 4H18A 3THWB 4DR4B 2CD7A 3SSAA 5FV4A 1E2GA 1UM9B 1KZ7B 1MB2A 4KK4A 4QRIA 3AVVA 3O92A 1NVFA 2CB9A 3DAPA 4B71A 3HDJA 4I4TB 3K1ZA 1IK4A 4QGHA 3KAPA 1N36B 3RUIA 3VKHA 3NHWA 3B6MA 3KOYA 2Q07A 4J0DA 2BMEA 5E6UA 2C2GA 5A4AA 1GZVA 2I67A 3COZA 4X20B 1P81A 3I05A 3NC1C 1C7QA 1OX5A 1IEWA 1PJ2A 2VHWA 3BFKA 3GRVA 4GXRA 4YY3B 1XMQB 4HJXA 5LZ9A 3LECA 1SHZA 1U2EA 5JD3A 3L84A 2JFWA 1KL7A 3P0HA 5HYVA 2CZQA 3IIMA 2B9VA 3U4GA 3ZKWA 4TKUB 2O7NA 4DIDA 4I50A 1II8B 4HFMA 3IBTA 1P0IA 2B1GA 4G0VA 3A2MA 5D3KA 5DGCA 1JPJA 3ECCA 4FTWA 4Q4LA 5T64A 1RPNA 2VHXA 3KZXA 1GUAA 1VM6A 4IUCS 4RKEA 2BEUA 4LXHA 4LS3A 1GQOA 1TFUA 3DT9A 3B9RA 1PGJA 3BMCB 3N5CA 3NWJA 3R23A 4OIMA 4WVFA 3ZD7A 1OGYA 1DAOA 1OFUA 1TT7A 3NLLA 4J91A 3SQDA 4PYJA 3IKVA 1VLVA 1WVMA 3INTA 3Q7TA 1QCZA 2W43A 2LCIA 2Y8EA 3NV7A 2VDRB 4NYJQ 4QYXA 3QEAZ 2ADOA 2Y9MB 2DFVA 3JARA 3PGXA 3CZPA 1L4EA 3G5UA 4O8ZA 2JD0A 4PC6A 3EVDA 1L5RA 4N5DA 2NZXA 5GIOE 2GLXA 2B25A 1XDBA 4NULA 2Q8QA 4I3FA 2B21A 2QTBA 4Y67A 3HGQA 4MSUA 5FPYA 3ROMA 5M29A 1GG9A 3RT9A 2WTAA 2Q1TA 4F4HA 4H6VA 4Z51A 1KS2A 3CPJB 4IMRA 1U8UA 4P36A 3N8HA 4I14A 1SZCA 5EPUA 3VRHA 3SIXA 3M3DA 5HKAA 1VIAA 3QWFA 3CPEA 1O89A 1TX4B 4FP9A 2YH2A 1DBSA 5J1SB 3ZW9A 4Y18A 4UJ3A 1AIPA 1LFAA 4DTIA 1YAHA 2HI0A 4F9GA 1DARA 3KCNA 3L7KA 3IXQA 4YDSA 4UAUA 3OFJA 1LX6A 1WQ4A 2VH2A 3UMCA 2XMSA 3P9SA 1RQXA 2AI3A 3RAJA 3KVOA 2BUAA 1O94D 3ZOZA 2VUTA 1ETUA 5A04A 1XJ5A 1GP2A 3WP1B 1DBIA 2W2LA 2YV2A 4G4GA 4NU6A 4LXTA 2E48A 1KJ8A 2BF4A 4WN3A 3KB6A 5B7PA 4AKIA 3EIUA 3I9NA 3NHPA 4AJEA 4GR4A 2IHJA 4QQ8A 4JEIA 2W2VA 2XMCA 1LBSA 1UMDA 1W5SA 4WZAB 1QLWA 2ATXA 3KBOA 4V38A 1YVPA 3DOJA 1Y7HA 2G70A 2ODNA 5AXAA 3SEFA 1G8KA 5LYJF 2I6UA 1R00A 2Z98A 3LNTA 3JARB 1GZ4A 3I37X 3QJGA 1DJLA 4D57A 2CLDX 3EISA 4EPTA 3X1ZA 2IJGX 2CNBA 2P4QA 1TAHA 4KN6A 1JDUA 2XE6A 1OZGA 4G65A 2ZUTA 1OC2A 5FR2A 3W8NA 1YJXA 1L8LA 3T5MA 3EC1A 2E55A 4B3CA 3D3KA 5BN3A 5C8ZA 2YWFA 4X1OA 1KMCA 3RRNA 1NQTA 3P9ZA 2YZNA 3NRBA 4YS6A 3VNQA 1FPQA 2NPIA 3H2ZA 3R0XA 4GZLA 2D00A 3L0DA 1ZD5A 2IOHA 2DKNA 3R5FA 2FMFA 8ADHA 1VRVA 4ZOLF 1ZG3A 1Z5GA 1JKJB 1R16A 3OECA 5ALMA 2Z2YA 3PQEA 3TIFA 4EB6B 5J2TA 1KBZA 2RD2A 3CRRA 3UWOA 4GVXA 2QM8A 4PG5A 4CFYA 4CIBA 4NAUA 3CNBA 4P4LA 1EG7A 1XELA 4CR8A 5COQA 1Q1BA 5DMHA 2IU3A 1G4UR 4WASA 5AJVB 3LLCA 1XTVA 2RHDA 2MSEB 4FDLA 4DUZB 1WXXA 1M1NA 4FMDF 4IFEA 4NMWA 3G2OA 1Z0AA 1QVAA 1VKHA 1WU8A 4ZA2A 1XZFA 4IV5A 4MGKR 4PYLA 1A9PA 1F20A 1PUIA 2VTBA 5JNVA 2YXDA 5FUVA 1NXPA 2C7GA 3L1HA 4B4KA 3DFIA 3I5XA 1JR6A 1SAYA 1I4OA 1NV9A 1MAHA 3TH5A 3TRKA 1W9HA 1U3TA 4IX1A 2YXNA 4RYDA 5E2BA 4QXOA 4IJQA 1XVLA 3DO5A 4Q15A 3HU3A 5BOSB 1JFLA 3AUFA 4JP1A 4DBLE 5AFSA 5DM2A 3AM1A 1ISSA 2MSDB 4AZ0A 3H16A 2GKOA 2H18A 4GPD1 3UHPA 2ZSBA 5FOQA 5IHXA 1XTUA 2VOEA 1Z16A 3SYRA 2O1WA 4REMA 3U9LA 5AVZA 2OQ2A 3UV7A 3DQPA 4YQFA 3ADOA 2DKFA 1MFPA 2PA0A 3WE7A 1T5TA 2EAUA 3IMGA 4DLTA 1IY9A 1GTZA 5EJ9A 1Y4AE 2CVHA 5E3IA 3JRNA 4ZVQA 1EE2A 4C6TA 2HDWA 1ZK0A 3DLPX 4UE6A 5G02A 2O8FA 3QNMA 3WLEA 2OBMA 4MCIA 2UUAB 2V5VA 1G2PA 2WIAA 4CN9A 5E6SB 4RIGA 1J7JA 1FYEA 4TV8A 1ZM9A 1SXJE 5EQDA 3RJ5A 2OCIA 3EMDA 4IKOA 1SKUA 4CLOB 3HXMA 4IO0A 4IRUB 3RVPA 1GPLA 1ID8A 1R6BX 3N87A 4H3VA 4I8IA 3WWZA 4MUEA 2GTPA 3OPXA 3WWCA 1DQNA 1FUKA 2GLUA 3JZDA 4YRNA 1SR8A 2GBCA 1O58A 5BWOA 2QRGA 4NFYA 4UDYX 1MB3A 4TTTS 1PZMA 1RP7A 4LGYA 2ZAGA 3DBLB 3GUVA 3H0KA 3QFTA 4Y0NA 4KPFC 4F91B 2Q7DA 3A4NA 3S5JA 3T9BA 1Z4JA 4EK9A 1ZW1A 1E62A 4V2UA 3VR6A 2EYUA 4AZ0B 1IM2A 2ZRMA 4BC0A 2ZWPA 2EZTA 1K9VF 5L3QB 5AW4A 4WEOA 1JR4A 4IH9A 2LKCA 4ZAZA 3NAGA 2RARA 1H69A 2M6SA 3OWXA 1KI1A 2AEEA 2FHSA 4W9NC 5BYBA 2PNJA 1LNSA 3OZ7A 3LF1A 3WAJA 4C6TB 2GHTA 3S8EA 2PFSA 4YBZA 4Q9HA 1PZEA 2UVPB 4P4SA 5CA0B 3PITA 4JU8A 1IHXA 2FR0A 3OPYB 4HXYA 3TMKA 6Q21A 4PLHA 3H9CA 2H7CA 5JDIA 2BGIA 1V3QE 1VG0B 3K0KA 3K0HA 3UEOA 1DAKA 2HHCA 3WLHA 4E5KA 3JWGA 5ALSA 1YDGA 2LDXA 4KE9A 2QROA 2C8VA 1UBNA 5CHEA 3ZCRA 2YY6A 3BAZA 4XIGS 1JJBA 3L6EA 5HQ3B 1ZSYA 4MP3A 2O8EA 1UIRA 4J0HA 3VR0A 2O2HA 1QS0B 3EXIB 4JJAA 1SQGA 1JW9B 3DL4A 1YC2A 1GKLA 1PKEA 3DYIA 3F1LA 4FHEA 1DC3A 2B34A 2ZEJA 3EUEA 3MIZA 4K6HA 1RWXA 2QD3A 2NUAB 1YB4A 4ZIRA 2AEJA 3LHSA 4EHDA 2IZ0A 3WKAA 2ZXEA 7REQB 2LCFA 3QI2A 3VNRA 1TYDE 1JLKA 5CLGA 1XLUA 5BSWA 3IT0A 2CMDA 5K9ZA 4E94A 1VCHA 1W4LA 1Q3TA 1TZBA 2GCOA 4H3SA 4NEQA 4Z4EA 2ZIFA 3C85A 4F2PA 3CF0A 4IRMA 2Z30A 1PQ4A 1MPXA 3MSCA 1A9ZA 1V11A 1PWXA 2IYVA 4KIGA 4BVJA 4AJ4A 2XZTA 5A4FS 2PYDA 2X41A 1NNUA 2UZ4A 4RY8A 1YCFA 3PC8A 5IBCA 1T2VA 5LLTA 3EUAA 3QUSA 1V9SA 4PC7A 4UUPA 3FJOA 1O0SA 3IHWA 5J59A 4DG8A 2E21A 2CY0A 3MTJA 3VSAA 4FD2A 1Y42X 2NTYC 3IVRA 4DWJA 3R5KA 3PNBA 3I01M 1XKLA 3T99A 4Q47A 4BV3A 3LKDA 3ZCQA 1BRTA 2W2OA 2FCAA 4DAEA 4DIMA 3RABA 5LQMA 5B3LA 3QKIA 4O4LA 5A06A 4J1TC 1GQQA 3IOEA 5K6AA 3OIWA 2OM2A 3UJHA 3V9AA 4EUKA 4JBGA 3Q1KA 4OUDA 4Q7EA 3DDSA 2VT2A 5IZCC 1AV6A 3PFIA 2ZRGA 1VPWA 3BDIA 4Q82A 5A3JA 3SZMA 1C3LA 3BXHA 1SHKA 2HK7A 1QIGA 2ZSFA 1P5FA 3OT4A 4HDMA 1ZPDA 5JE8A 3UQZA 1P0CA 2O57A 4FGUA 3L7OA 4BC1A 1ECLA 2MJLA 4OXIA 2ERXA 2CSXA 2AS0A 4Y6QA 2A2ZA 3GGDA 3SE7A 1CW2B 1PDVA 3HZHA 4C2BA 1ZCBA 4R71A 5HR5A 1WETA 4N3AA 1C7EA 1RACA 2VKTA 1KVUA 4ITUA 5LQNA 3BD7A 4M3NA 1CUCA 1TCVA 2F3TA 3BH0A 4B0OA 1KSFX 1D8TA 2RGYA 3ET4A 4DSUA 1A76A 3T3HA 2VJQA 1IEVA 2PZGA 4WX2B 2FX2A 4DJTA 4LQLA 2JDID 2XE7A 3ORSA 4XRGA 3EXHC 2J9FA 3TR6A 2JAPA 3OJOA 3V6MA 5H16A 1GPYA 1EHCA 3H2SA 4JJ4A 2ZPAA 4M0UA 1ZL2A 3U2QA 2VHYA 4YJKA 5CT6A 1U9JA 3BOSA 3W90A 5SZIA 2GRUA 3N3AC 4MUBA 2N42A 1ZYUA 2PPVA 2RHRA 3LW8A 4C1NA 1I7PA 3A6KA 2ZTUA 2X2OA 4KXYA 4R0MA 4ILEA 1J97A 4GUDA 2CV0A 4XKJA 4B3HA 4BMVA 3NBKA 4GLLA 5LD2B 4A26A 3KKPA 2OAGA 3MAJA 4C7XA 2IOFK 4LRUA 4FYYA 3DVRX 4LMAA 1XAGA 3IXLA 4BASA 3HVHA 1Z7WA 4Z3KA 4L8YA 4YFVA 1FDWA 2BPOA 4Y6RA 5HOEA 3RBZA 4RORA 4PWZA 1WB6A 1W25A 4V3BA 5AKXA 3HJTA 1ZNQO 2W9XA 1M5TA 2YJZA 3H11A 3KLNA 4O33A 4OHMA 2I9PA 2ZUVA 1L9KA 3QF7A 4K6FA 4ZDJA 2Z6UA 4EYGA 1SNYA 2DUJA 4IGFA 3HJUA 3WA6A 4UHFA 1RABA 1E0JA 2WDPA 3FNIA 4RVCA 3S8YA 4C7MA 5H82A 3PI6A 3SX4A 3EAFA 4A23A 1NONA 3IJRA 5TVGA 5K99A 1P33A 1SHTX 3WWEA 1IZ9A 4IGAA 2QTGA 1QGAA 2OQIA 1J2YA 3NHRA 1FEZA 3KEMA 4I36A 4MVYA 2DKOA 4W6QA 3UPTA 1EAMA 10MHA 5MHTA 2ORYA 2Z2ZA 3O21A 5KNBD 5A1JA 3EZ9A 2G17A 2J9FB 3ND6A 1AJEA 2HBYA 3K1AA 1TTPB 2Y1WA 1PSDA 2J3MA 1IWBB 1U04A 3COVA 3DXFA 4L6AA 4R16A 4C2TA 2HJRA 4ETWA 1JLLA 2WICA 3QYFA 4MYCA 3E9DA 3PRHA 3OCYA 3PJFA 4PZAA 1OB2A 3QU7A 4JROA 4DJFC 5F3WB 1V9CA 3TVYA 4RPGA 2YASA 5M5BA 3AG6A 1TW3A 4EUSA 1LW6E 2BTOA 1DRJA 3ZOKA 4AVYA 1XU4A 4XB6B 1J2EA 1E5LA 1RLJA 2R65A 4G1FA 1BQ3A 2XSZD 4TYPA 3EVCA 2QL6A 4I4IA 3F6PA 1XT6A 1N5LA 1SA0B 1VRWA 2CZGA 2ZWMA 3DCJA 3PHHA 4LQCA 4QJ4A 1DC4A 2J5KA 1XZKA 1XSEA 2HO5A 3RYFA 1UXIA 2PKRA 4KGXA 4RF4A 1LLFA 3O73A 1A71A 3ZWVA 1KBQA 4HVLA 4BZZA 4PG4A 3C3CA 3GK3A 2W00A 3QVKA 2OVBA 2NO7A 4LHYA 1R0ZA 1BW9A 5KTOA 3ZGXA 1H94A 1F0KA 3DMFA 3EH1A 3ZWKA 2ZIZA 1ZIDA 1E6EA 2XXBA 4Q12A 2CFOA 2XODA 3HGMA 4L5AA 5JARA 2HMSA 1LLDA 2YHBA 3LDUA 3QE0A 4M53A 2QNBA 3V42A 2ZVQX 4NI5A 4OFZA 5FI1B 5A02A 3RKRA 5A0VA 4BBAA 3OU7A 4X61A 1GL3A 3AU8A 4IUDS 5DNUA 1MCZA 2XCIA 1DIBA 3NHYA 2OG1A 5AKEA 2J1LA 5AM3A 3UKJA 3N76A 4EY5A 3V2UA 4F85A 4HGZA 2X40A 3STHA 3ZI7A 1KYTA 2TRSB 3MNFA 3ORFA 3E7DA 3QFCA 4HOYA 1N5OX 2YN0A 1MRSA 1WB4A 3FETA 3X2SA 4E5MA 3B7PA 3T5AA 2X3FA 1E4EB 4FHCA 5F52A 3T7TA 4E70A 1J70A 2OD7A 4HXEB 4P4UA 4V0OA 2Z2KA 1SVOA 1G20B 2EEZA 3HV0A 3LG2A 1CUZA 2RHTA 3NIDB 3Q85A 1O4VA 4GO1A 1JEQA 1ZU5A 5A3QA 4F2GA 1CERA 3NH9A 5DCUA 1D09A 1ZOSA 3GGSA 4FGJA 1ZU4A 1C0KA 3FJ1A 4FS3A 2XLCA 4FU0A 3ZV7A 5BVGB 6NULA 4JUDX 1D2GA 5HUHA 3GAZA 3P26A 5BNTA 221PA 5B3JA 4NYMR 1W48A 4MWGA 3W5BA 1N9ZA 2YZ7A 1BW9B 3L4EA 4MIEA 4G37A 5CVJA 5T5QA 2G76A 4D0NA 5A4IS 3UZUA 3FHTA 1DL5A 1XCPA 2QE7D 3FYCA 1LW7A 1Y82A 5BRJA 1BS9A 2XYPA 4HKTA 4IHAA 3OZVA 2CNWD 4MUMA 4TLDA 4AD8A 2JRCA 3EIEA 2UUPA 1QE3A 4OHKA 2G1AA 1H2RS 3INYA 3T52A 4C20A 4BO7A 1O9BA 2J3LA 3K2EA 3TBKA 3ZHQA 1RYYA 2QSZA 3GFGA 4PX2A 4YUWA 1Z22A 1TVMA 1I3MA 2YKGA 1QOPB 3GT7A 4BTVA 3JWPA 5FL7A 2I3GA 2J32A 3OEWA 4X24A 3WLRA 4DANA 4W5OA 2MHCA 3UWDA 3T9FA 3DNMA 3G0CA 3MLAA 2IYOA 4G5FA 3C39A 3SWWA 2PIAA 4G09A 2HSEA 1WVIA 3UJNA 4V0LA 1R6AA 4XE5A 4RTOA 5DM4A 3OPVA 1M83A 1DWUA 4MVJP 3NXSA 3G2NA 5CDHA 2HK8A 4O2AF 2RHCA 1ISPA 4B85A 5HCIA 3M0EA 1UC5B 5TMBA 4CI0B 1EDOA 1W88A 2BR3A 3X1JA 5E4FA 3RTEA 2MTBA 5IWAB 1ILEA 4CG1A 4G07A 2PZ8A 1G63A 3BRSA 3WTBA 1LS1A 4HG2A 3IULA 2AOUA 4CDMA 1P1JA 4LJLA 5DM70 1B8OA 1TU4A 2ET6A 2FPLA 5LYYA 3UT0A 2ISQA 1Z2AA 4MP8A 1E5QA 1MNAA 4EENA 1SC1A 4WY5A 2AW5A 2QMYA 1JJIA 2ZU6A 4QC2A 1P1RA 2X15A 3JXEA 2GAAA 1T26A 3UMRA 3WSTA 2A9JA 2B5OA 1KKLA 4URFA 4BO2A 1HNWB 3PUYA 3BGDA 1X70A 5LMCA 3D6JA 2V7WA 2JBWA 5LA6B 1RFLA 2RI6A 2ZUEA 2CHQA 1FU8A 4G89A 1HUQA 1JKMA 2POQX 4ICIA 3RNLA 3DB2A 4UBNA 1CQJB 3SF8A 1Z39A 1UWLA 3IHLA 5B36A 3I72A 1OBFO 3UIEA 4G5SA 3OPMA 1P7CA 1ADYA 1YHYA 2BBWA 4QNMA 2C2XA 2VSYA 2FI1A 1FPMA 2IUUA 4IDDA 1GPAA 5CH5A 1U2RA 2E5WA 3H19A 5TXGA 3VZBA 2Y1FA 2DFPA 4ISBA 1E0AA 3KKZA 4B6SA 1T24A 2Z5FA 1L7NA 3MTQA 1QGED 1WZCA 3ITDA 4OP1A 4J7XA 3H5VA 1PFWA 5FTKA 1KF0A 2OTCA 2VDPB 3MERA 3A4TA 3DYBA 3KAKA 2BKXA 2G08A 2BBOA 4JOQA 4KZPA 4DFDA 4NTZA 2V54A 2BGWA 1PYDA 3G9QA 2Q9BA 4ZJYA 5J4HA 1GGMA 1M2GA 2HSDA 4XYGA 1X9HA 2AOUB 1XTPA 2PUHA 1CG6A 3N75A 4DUGD 1DWPA 4Q4CA 3M6AA 2WVAA 4HNVA 2C7PA 1YNOA 2BCGY 3WIBA 3VAAA 1UODA 3SQWA 3GLFE 1GAQA 4Q6WA 2QM3A 3ZD9A 1TE2A 2FJPA 5F2NA 5E7MA 5C7IO 3RSGA 4CNBA 4X7BA 1SCBA 3LWDA 1XDDA 4RH0A 5GJVC 5FOUA 3NNNA 3KO8A 2LVBA 4RVHA 3AUKA 1V8OA 2LRHA 3ZBQA 3OH8A 2ZBDA 3LK6A 2QL7A 2ZQZA 3M1YA 2P69A 1Q1QA 3CR3C 1EJBA 5CGZA 4C6HA 4B76A 2DPLA 2NO1A 1U6JA 3WS7A 1TEZA 2DUNA 2ECPA 2P2DA 1LXCA 3BFPA 3I58A 3OFND 5ECDA 1WXWA 4J1QA 2XTJA 4CCSA 4X8HA 3CNHA 4UNNA 1GQ2A 3WKCA 4UM9B 2GJAA 1J49A 4D3YA 1PR5A 3QV2A 4ARIA 3VI3B 3WAKA 3U37A 5CCXA 2AOVA 5JROA 1Z74A 2HRZA 3MHTA 1F48A 2AR7A 1NP3A 1YU6A 2GEDA 5LBIA 3QELA 3NUQA 4B7ZA 1VZ2A 1RHUA 3IAHA 4O0MA 2NM0A 1OV6A 3C5HA 4OQMA 1BWPA 2JJMA 3BBPA 2VSOA 4KVAA 1EFPA 2FFHA 1G5IA 3U6BA 3KKQA 4UVIA 4B46A 2IIQA 2HQ1A 5SYAA 1B8PA 3P0IA 4ZVSA 2H7VA 2VUSA 4HNHA 4F71A 4DDWA 3BIJA 5A4DA 4A9AA 5ADHA 4LF6B 2NUBA 1FQOA 4FXPA 2NAFA 3C87A 3ZCPA 1YGYA 2Z56A 3GLGB 1IHDA 2BY4A 4IEIA 1TK9A 1VHTA 3EIQA 4M38A 4I8DA 2PVCA 3EVAA 1V7PC 2D59A 3K0BA 1YA4A 3ZN2A 2GZMA 5F7OA 5F5XA 4NU0A 1M2JA 3EQZA 2FJUA 4QOHA 3AB3A 1LDBA 4I1VA 1JX6A 4NOJA 1O57A 3KWFA 1JDSA 4X8OA 2XSZA 4HEQA 3CX8A 1DE0A 5FYQA 3SXPA 1P7ZA 3I1FA 2KLBA 3COJA 2ETVA 5JMOA 4JZKA 1SU4A 3V32A 4LF5B 1JNXX 4PTYA 1RWPA 4Q3AA 5TT0A 4CXMA 2MYPA 1XX6A 1W5EA 4M9UA 3VUFA 2DPXA 3G7NA 2ZREA 1HZJA 1B73A 1MXHA 2B7BA 3LQRA 4IYJA 4LAFA 4QO8A 1RFGE 2JHPA 1U1EA 5JPIA 5C8YA 4CQLB 2COUA 2ZB7A 3JQ8B 3MRVA 1UBGA 5DH9A 4AN4A 4JD5A 1O0BA 1A1VA 2C1ZA 4EQ6B 1FY2A 4MUKA 2QGFA 1ULBA 4ER0A 4BZQA 1NWHA 1XVUA 1ZHFA 3OE4A 5F76A 1DNPA 3HVUA 1A2KC 4PPYA 4YMHA 2F1HA 1IJFA 2PJZA 2EFYA 1YASA 4XYEA 3H2GA 1BD3A 4HAOA 1FMCA 3W2GA 2R8PA 3JWJA 1E9CA 6AT1A 2WB2A 4PO9A 2Y2VA 5AO9A 2GETA 3VR5D 4TZ0A 1C5KA 2ZS7A 3T95A 3W5VA 1DHTA 1XMJA 3U7QB 1FA9A 1TQDA 3SSOA 2CD9A 3QITA 4UDNA 3ELUA 3QA3E 1RHRA 1TUEA 5FOWA 4MS4B 1PYGA 4G1UC 4HDSA 4POOA 5H4GA 5HZKA 5GZ6A 4HC4A 1UF9A 3AF5A 1H05A 5IP5A 4BKUA 4ER7A 5AUOB 2ORIA 4H0NA 2VSXA 2WYVA 2H2AA 5K8LA 1CJCA 1BJTA 2FLKA 5CDGA 3IKLA 2G4CA 1E2KA 1UFOA 3GDGA 4HR7A 4NARA 2IWRA 4IP0A 5G1PA 4L6CA 5JAQA 2BKVA 2AQHA 5ECWA 1BSVA 4NBTA 1N2ZA 8GPBA 3G5TA 1R6UA 2ASEA 1RRFA 1UDCA 3UCEA 1AB6A 2G04A 3PZRA 4JL6A 3ZU5A 2RDMA 1T0JB 2QE7A 5IM5A 5CYFA 1D5CA 3IQXA 4FKMA 5FH9A 1DQYA 2CNWA 4GZ3A 4NBUA 5FPQA 1EVYA 4ERNA 1ZD3A 2BMFA 4QXMA 2P9ZA 1K8ZB 3BCHA 2CC2A 2Y71A 3CKKA 2WTNA 4DZZA 4IS2A 1MG5A 1T0IA 1XO1A 4LRYA 2PU7A 2YVUA 5REQA 1OXVA 5AUPB 1OREA 2ZRFA 4NZOA 1SKYE 4HWGA 5KYUA 5IT5A 1DIAA 4RDCA 4LZNA 1D6MA 3CLUC 4TWIA 4BN0A 2BGGA 2A0UA 1QAMA 1AQUA 1WNTA 3V97A 1JL3A 1JQ5A 1MQ8B 2ANBA 2X4GA 4K46A 4RZIA 4KRFA 3WYAA 1E8DA 5JH7B 4NPHA 1ZL0A 4R1LA 5J23A 4M1TA 2Y76A 1FLDA 4IG4A 1XGKA 4R81A 4ZEWA 4EI2A 2IK8A 3BH6A 1NN5A 2D3WA 3PUXA 3SEQA 3G1WA 2O0HA 1OXTA 1RZRD 3KAJA 1U99A 4RTRA 4W5JA 1UM8A 4OHWA 2QUJA 1P6XA 2FWMX 3GLIE 3EPHA 1MX9A 1ZH4A 3NIBA 3NDJA 3DOOA 1NDQA 3I12A 5HZMA 3KDAA 5A3VA 3F5SA 3ZCXA 3INGA 4RWZA 2XDQA 2GAJA 3DDUA 2QGNA 3DT8A 3V4OA 5MF6A 5HRUA 1G2IA 2PPLA 3RC1A 3JRWA 2V4ZA 2AD5A 2XMBA 3JQQA 4LIPD 1O08A 2ZI3A 4OQZA 1JSLA 5AQ1A 1JE1A 3G88A 1XP8A 1NMSA 4XLTA 2WWIA 5TF0A 3RRJA 2GO1A 3UMMA 5JS1A 4PPFA 4J6FA 1BN6A 3A2KA 3BILA 3P9RA 2HW8A 4YQYA 4JJEA 4P38A 4S1WA 4D4IA 2XUPA 1Y8RA 3A05A 3G8DA 1H9AA 1NBHA 2IRWA 1E77A 4GBED 5TJHA 4TLCA 1N78A 1SC4A 4PTZA 1GFWA 1OV4A 2HCFA 4WY2A 4RCVA 3IAFA 2BHTA 3N28A 2QRMA 4NRDA 4MI3A 4Q18A 4ZVKA 3WMXA 3OZCA 3ZU3A 5BUQA 4BBZA 5ECGC 5BYJA 2GN2A 3AWDA 4Y1RA 1NBAA 2R5WA 3KIPA 5EXSA 4R40A 2YY7A 4CIXA 2VPYA 1DG9A 2NOAA 1EYZA 1CJMA 1F6DA 1EU1A 2BDEA 4H7FA 4J0CA 4Q7JB 4YT8A 5A5DA 4AY6A 4IPTA 4ID9A 5IC5A 4F86A 5KTSA 1R0KA 5DBIA 3SP1A 4M83A 5FQNA 4HQOA 3DR5A 3PQ6A 3HO8A 2J3DA 4H59A 4ER5A 4BLOA 4GKVA 4CCAA 2C9CA 3BBLA 1Q19A 4JP3A 4TTVA 1XBTA 2E4UA 4QOEA 2WJAA 3M81A 4IVRA 4DUGA 3T0GA 4B3MB 1YI1A 4EA6A 3Q8WA 4ME6A 1FFYA 1RT9A 1BYIA 4LNUB 3HCCA 3SMQA 3OU2A 1KHTA 3ICWA 4PYOA 3A26A 4HTFA 1KC1A 3G23A 3QE9Y 1XRMA 3HDGA 4CQNA 1E7YA 3MCUA 5HE8A 2VUHB 4NYMQ 4BFWA 2Q2VA 2PKEA 5D5QA 4OQ4A 4I4NA 4DF3A 3FHCB 3R75A 2YHAA 4XARA 4IFIA 3LK7A 2NT4A 1VZ3A 4B4WA 1BKSB 1Y8RB 2DHQA 4Z9YA 2X58A 4PIMA 2GM4A 1WXIA 3EZ6A 1I6WA 3L1KA 3M1AA 1TZKA 3DUWA 3S2SA 2WT4A 3JQAD 4YV1A 1QTQA 1YTLA 4V0MA 4UASA 2IPOA 4L0QA 5IG2A 3TF5A 2DR2A 3DULA 2HDOA 1ONPA 3P32A 1HYEA 1JDJA 5AI8A 3RFVA 2FMHA 1Q21A 2IEZA 4QDJA 3BD8A 1EFDN 1YQWA 3F9IA 4MICA 3T54A 1GARA 1UADA 3EGIA 1XD8A 3P20A 4NZNA 4ZU1X 4RIFA 5KNDH 2Y1DA 5CIQA 2QRKA 3AF6A 4QT4A 1EUQA 5EWLA 1C1XA 3DEHA 3U0BA 1NKSA 1B0PA 2WMDA 2VCHA 2WZQA 4KQJA 4OJMX 3R7DA 1LUAA 2JGKA 4NLLA 1XALA 5DT9A 3UWPA 1IUOA 4OK3A 2WMYA 1RJ9B 5KOHA 3CVUA 2B3TA 4FS8A 3QBEA 2VQDA 2C2WA 3KVYA 3AOEA 2GPSA 3B1YA 4HTFB 2G80A 2J3JA 4KH0A 4K9PA 2O2CA 2NYAA 5I7WA 1J56A 2FRVA 4Q66C 3HKEB 3IVAA 1ND6A 2GCEA 3O8LA 2CUTA 2FN8A 5HGJA 1MHTA 3G2LA 2PO7A 4YH1A 3KFVA 4DJ5X 3WC4A 1QO0A 2ZI7A 1VSUA 3IUEA 1JJFA 3GEDA 4X3OA 3LX6A 1GO2A 4F4IA 1NULA 1CRLA 2GPYA 3K0CC 3M70A 1NMEA 1GLVA 2QF7A 3AF3A 1K4MA 1O77A 2VWPA 5EP3A 5K01A 2FXIA 1BDHA 4UAJA 4ZAGA 2C96A 5DHQA 4PYNA 4WK4B 3RB8A 3VYVA 5AQEA 3LPDA 3Q7EA 4KLAA 1ETHA 2EBUA 3M9LA 4MMZB 4RAOA 4DCNA 5FFMA 1ENYA 3EXAA 3G8CA 2JFOA 3NQ41 2GVNA 1THTA 2JLUA 3IOMA 1EEHA 4EVIA 2XD4A 3R3WA 4JXJA 2PRJA 4D4JA 5EWLB 5F1YA 1CR4A 1T1EA 1KOLA 2CDRA 4KDEA 5EGSA 2Z95A 1G6HA 1N8KA 1IRXA 1CY0A 1Z8NA 3SDZA 1KI9A 2YV1A 3H3XA 4LRXA 4A82A 4EJFA 5KO2A 1GEGA 1I4DD 3BC1A 1UXOA 1WEKA 3JQDA 5A0FA 1ULAA 3HC7A 3OZUA 3FWNA 4N41A 4MW9A 5DU2A 3VR5A 5GJCA 1TRKA 2CLIB 1ECFA 1JHDA 1G9TA 2ZE6A 4CEJA 2UDPA 1ZJZA 1VGQA 2IIBA 2V45A 2X0RA 3D6FA 3ROEA 4BUJA 5KVSA 4OFWA 3G8AA 1DBVO 2F3RA 5FBRB 1VHLA 2FX5A 1PK8A 1TIPA 3K9BA 3QX7A 3W9SA 3V8QA 3ZHBA 5C7OO 4GXNA 4KW7A 3T3NA 3PV0A 5DYYA 4EATA 2IVZA 2L42A 3ITNA 3L9WA 3NGMA 1XEXA 3QH4A 4KIJA 5IHPA 3AI1A 1MORA 5ELXA 1F2TB 3D2CA 3HR4A 4MYHA 4OSPA 2L18A 4PGAA 4W82A 3C3AA 2IZ7A 4JDPA 2I6QA 4QODA 1U8XX 4B6PA 1GQFA 5HKBA 4MITA 1RPTA 4MW5A 3RS5A 4OLHA 4JY7A 2GESA 2FSSA 1EZ4A 2W4IA 5G4LA 5IAOA 2O0KA 3T5BA 3G82C 5L7WA 3K92A 4H1TA 4F2DA 1MC8A 1HLGA 2F62A 2GVZC 2WIKA 4LV5B 3P19A 5DEIA 4R2JA 4G5QA 1QFXA 4LY3A 4I08A 3DLBA 3VU8A 2ONYA 2YYAA 3JD4A 2HZ7A 3QPWA 1FX1A 3OG9A 4LOAA 1PN3A 4QPDA 5JZSA 2UYGA 4L7VA 1ZMTA 1NNEA 2PD4A 2RGGA 4IX9A 4JGBA 1K3TA 2I6GA 4WE3A 4DDMA 1Y1SA 2WC1A 1E2PA 1DC8A 4R1MA 1QDUA 2KS6A 5H3LA 5AVRA 5LLSA 2X0NA 3DFZA 3TQRA 4MV6A 4G4SO 3AR5A 2C07A 1PV1A 2R6DA 1FX0A 3EJWA 4M54A 4MGIR 3REQA 1SXJC 4MVJI 1IG3A 4JXXA 1AZTA 2XXAA 1HKHA 1HYQA 3L7BA 2HBQA 4EHIA 2AN5A 3D8NA 1P3DA 2OYRA 4QWMA 2WILA 5I47A 3V9PA 2QP4A 4F6RA 4G5YA 4YA6A 1E9SA 3EGDA 1VDMA 2BFFB 5KINB 1XZAA 1TZCA 3MT9A 2I2XB 4H0FA 1XFDA 3L7YA 1U0LA 3PRYA 5I7FA 1TXGA 3F47A 1DXOA 2BI7A 3K8YA 4AF8A 1Q15A 4DR1B 1DS6A 1V6SA 1H4QA 2QR2A 4LWZA 1D5WA 1EFUA 4M8IA 4QJBA 1KDPA 5CLIA 4DV6B 1OYWA 3H1EA 5JD5A 3LOUA 5CJPA 4KNYA 1ZQ9A 4Y2PA 1KYQA 1TYEB 3T1OA 4Q37A 1TVEA 2XT9A 1OF1A 4GQIA 5U4QA 5KDOA 4D4LA 1A2QA 2YINC 4D3FA 4GPIB 4MRSA 5FA8A 3WA7A 4R9RA 1C1YA 1Y3HA 1XROA 3B5EA 2WU3A 3IAUA 4FE7A 5DLQC 4PR0A 1PFVA 3LS2A 4FE4A 2B83A 5DNVA 4N3BA 1TADA 1TGYA 2A33A 3G0OA 3P9NA 1FYDA 5CLHA 6PFKA 4O2BB 2DFDA 1TDJA 4NZZA 1FSFA 3VMMA 4OMFG 1J1IA 2O1EA 3SR4A 4WBNA 1HE4A 1W4ZA 2P4UA 1XR3A 3L8FA 3REQB 4B6EA 1G0OA 2GEFA 4Q9AA 4BQQA 4BEBA 4D4MA 3PUKA 3B7GA 4X94A 3AGPA 1ISRA 3AVTA 1H5NA 3VJKA 2WWRA 3RTAA 4CM8A 3GCWA 1AGYA 5FUMA 1WF3A 3AZPA 3GJQA 3KS9A 2YN2A 4WXEA 3I62A 3ADKA 3FLMA 4GOKA 2PBRA 4Y98A 1UDXA 3KETA 4L4SA 4FB5A 3QE2A 2MYTA 2Z2XA