3CWZA

Structure of rab6(gtp)-r6ip1 complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
166
structure length
166
Chain Sequence
RKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGLERFRSLIPSYIRDSTVAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-6A
publication title Structural basis for recruitment of Rab6-interacting protein 1 to Golgi via a RUN domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 41
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2008-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3cwzA00
2VEDA 1XEWX 2Q21A 3GLIA 3BFXA 2AWOA 3DMDA 4Q4AB 1L4YA 1VYVA 4OK3A 3ZD6A 4FWIB 2P5SA 1OKKA 3C7KA 3I4LA 3L0PA 1DAMA 3IPYA 5FUWA 5EXSA 4C7OA 2QT0A 3RLFA 4A2PA 5JEEA 3QPVA 3VTKA 1E96A 2J9RA 5TV2A 5TVKA 1T0HB 1UFQA 5IDVA 1YR9A 2AFHE 3AUYA 4FXPA 3GJ7A 3EZ9A 1ANKA 2CE7A 2GJAA 4RD6A 2FEMA 3P4YA 4LYFA 4DIDA 4Q66C 4TMZA 1T9HA 1CRQA 5EJEA 4BE7B 1T3LA 2ERXA 3VFDA 1YHNA 3ZQJA 4B48A 2XTMA 1RFLA 2UZ3A 3U3OA 3GLFE 3SFZA 3K0EA 3PUXA 1VTKA 2X1VA 2GKSA 1XJCA 1NL3A 4YQFA 5F98A 2G0NA 1E9BA 3SE0A 1QVRA 3C5CA 3T5DA 4G01B 2A7QA 1ZNXA 1MT0A 4JVSB 5G3ZA 4JBWA 4NYJQ 4US0R 4A9AA 4ESVA 2QNRA 3BJIC 5CYOA 1FMLA 1TQ6A 1A7JA 1XFAA 4OQNA 4KVGA 1D6JA 1U94A 2BV3A 2WAYA 1NKTA 4Q1CA 4QM6A 4MA4A 2WJIA 5L3VA 2ZJAA 1NVUQ 4V0KA 5M04A 3DMNA 3RC3A 1T4GA 3F8TA 5EZ6B 1TL7C 1KKLA 2ORIA 2R44A 3FMIA 2C99A 2YV5A 2ZYVX 5FOSA 3T1TA 1SQ5A 5FOWA 4A8JA 1P5ZB 2V8OA 4GP7A 5JWRA 2WJYA 5CM8B 3THYA 2O8DA 1UBCA 4MKHA 4XSHA 5LDDC 1AS0A 2QUZA 1RKBA 2ZI9A 3QI2A 2R6AA 1IXZA 2QN6A 3KJIA 2V4ZA 2KJQA 1YRAA 2HXYA 5KSOA 2XTNA 4HAVA 2XNDA 1Z3IX 4Q1AA 1ZUNB 1VHTA 2HF9A 1KIMA 2PLRA 4YONB 2XB4A 1EESA 3QEJA 3GLIB 4I1SA 1KNXA 3FWYA 5ELXA 3VR4A 3RRZA 2JLVA 2WKRA 2ZYUX 3U7FB 4UQOA 4DDVA 4IOLA 1XCPA 5LBIA 1ZM2A 2ZITA 2HJVA 4C7OB 3BERA 1N6HA 4WOPA 2JJ1A 3LRPA 4QNRA 4GRAA 3RRYA 3P1JA 1G6HA 1X8LA 3EZFA 3K09C 1S1CA 2CBZA 2GILA 4X8OA 1Z0JA 4H9GA 5FPKA 4M2LA 1P6XA 2AFIE 1IN8A 2IT1A 3D3QA 5JSZA 1QRAA 4OI4A 1KO1A 1SVOA 2J0VA 2XNSA 4TLAA 4ASUD 3F5FA 2V6IA 4RSGA 4Q21A 3K0CC 4PHFA 2WSMA 3OAAD 4NE2A 3VR1A 1DADA 4V03A 1DPFA 5SZHB 1SVMA 3K70D 1JXOA 5LD2B 1UJ2A 1XCMA 1E2IA 3RRNA 2PX0A 4CVNA 2YOFA 4DT1A 1NBMD 1SXJA 3AF2A 5TDHA 5KDDA 4UNRA 4CEIA 1R0ZA 2X2EA 1UKVY 2XTZA 3CWZA 2HYIC 1J8YF 2ATVA 2D7CA 1OE0A 4HAXA 5GADl 3U61B 2D06A 1ZD9A 1G4AE 4PHGA 4ZDJA 2OUKA 4LJ5A 4TYYA 1NKSA 2VP4A 1S3SA 2P65A 5HE8A 1CR0A 2FPLA 3I61A 3OHMA 1OFHA 4DLTA 3Q8XB 1KSJA 2ZE7A 4JYBA 4M9SA 5CM9C 5K8TA 1ZCAA 4GL2A 1P72A 4TSFA 2PEYA 1GAJA 3WMFA 2D74A 4OQMA 1MO3A 1ZYUA 3BAFA 4QG7A 1NLYA 3M4YA 3BFVA 3BK7A 1X1RA 2Q0HA 1TAGA 1G7TA 4IRUB 1E2MA 4BEJA 4HLUC 2O8DB 3VR5A 1W36C 4WIAA 4QJ3A 4JLNA 2QGNA 2YC4C 1FTNA 3TBKA 2CE2X 3KQKA 5HTKA 3U5ZB 3VKGA 3KXKA 1XTJA 4P4UA 4QHYA 2O52A 5FTKA 3C15C 3CW2A 3MUFA 2JJ2A 4I81A 1VYTA 3B78A 3MJHA 2OM2A 1E6CA 4K46A 2IYXA 2C03A 2CMKA 4KU4A 5FBLB 3AF4A 3U4QA 2F43A 4A2WA 3MJRA 1WMSA 1E2GA 4UXHA 1W0JA 4BLTA 1X8KA 1LY1A 4WZBE 1E4YA 3FFAA 1Z63A 4BZPA 2VO1A 3KKMA 1S4QA 1PUJA 2AKYA 2H8KA 5JRZA 4DC9A 1GIAA 4XH9B 1IY1A 2QI9C 1OB2A 1N5LA 3TW4A 2YZ2A 4E22A 1HYQA 4XJXA 5JECA 2R6GA 1FL9A 3GJ6A 3MWLA 4LBZA 1LVGA 2NPFA 3TVDA 3TSOA 1OH5A 3L2OB 4Q48A 4KLZA 3O8CA 1T8UA 4RD1A 3SEAA 2ZRFA 4C3ZA 1FMJA 4EPTA 2XOKD 3I5XA 5JSZB 4YXWA 1LB1B 3UMFA 1E2HA 2EFDB 1AZSC 3ETLA 1OYWA 3IILA 2VP0A 3ZJYA 2ZS9A 4J0QA 4NBSA 4DT1B 1SXJB 3RS0A 3VR3A 1G7RA 1H8EA 2H5EA 4UKDA 5KSYA 1Z0KA 3IIJA 5E7MA 4CEIB 3IDQA 3IUYA 5AUOB 3QENA 1P9RA 3VU9B 2W2XA 1N6NA 3KFXA 1KJZA 3QKTA 4JLMA 2BC9A 4E09A 2DB3A 2ZUBA 1W49A 5KYKA 4WXPA 3DZDA 3NHBA 1OKKD 1T5IA 5DNYB 1Z47A 1Z28A 1LFDB 5DN6A 3GQBA 3K0SA 2IXGA 1VDZA 4IVPA 1KKMA 1H8HA 5CYPA 2NO0A 2OCPA 2JLWA 1P7CA 4O2RA 3WP0A 2J45A 3HR7A 4DB2A 1EWQA 4IVQA 4TWZA 5DIFA 1RJ9A 1G7SA 1UDWA 4M1WA 3FFBA 3UG7A 3RC8A 3MAAC 5EP4A 1T5LA 2ZAOA 1ELOA 1YU9A 2IYWA 4GI7A 4TTQA 4RZXA 1CIPA 3ADCA 3AVPA 4IVRA 4JLBA 4DIEA 3U60B 1J7KA 2LWIA 2FFHA 4TMWA 2ZJ2A 4U02A 3TNFA 3P32A 4BRWA 4HUTA 4V0OA 2VSFA 3E2IA 3O8BA 2EWWA 1G3MA 5AJWA 1ZNZA 3ZVLA 4W7SA 3EWSA 1NLZA 4O25A 2OLKA 1XMVA 2GTPA 4QGAA 4BZXA 2R6DA 5AUNB 5JFGA 1CJVC 1F5NA 4IOKA 2J5XA 4GMDA 1DAHA 3U4QB 2F43B 4URUR 2NMVA 2FPMA 2XX3A 2ZRKA 3X1ZA 4GSYA 5HZHA 5GVRA 3SS8A 1KMHA 4KVAA 4DSTA 1F60A 4QGHA 2QAGA 4IFBA 3DKPA 3RS2A 3SJAA 3W6NA 4B43A 3WXMA 2GDJA 1YQTA 2WJHA 4EIWA 4BLOA 2GJSA 3RRMA 4B2IA 4ACBA 4OI1A 1US8A 3TKLA 3LNCA 4D0NA 4NP6A 1R0YA 4Z51A 1W5SA 1FX0B 2J46A 4NCHA 1W36B 1P2SA 2GRJA 4TN1A 2OESA 5FTNA 4A2QA 3W6PA 4R71A 3S1AA 2YHSA 3VNUA 2FZ4A 5EUQB 3SQWA 3NKVA 3QXSA 4DLSA 2ZRHA 2FF7A 1G8YA 3LQQA 2JGNA 4TMVA 3A4LA 2XNDD 1BO6A 4MRVA 2F3RA 5EXXA 1MABA 1EFRA 3EA0A 3R9IA 2GESA 2CHVA 2Q3HA 3FMOB 5FFMA 1NVVR 2ZRCA 3BH0A 3IHLA 4NH0A 4I1VA 1KY2A 2L0XA 3HWSA 4FI3C 2WWGA 1SKYB 1CEEA 3SQXA 1NVWQ 2H16A 4NCNA 2V54A 1PLJA 1RZ3A 3FPAA 1D2EA 3UXMA 1VCOA 4OK5A 1PJRA 2V9PA 4M4SA 5L3SA 1QHSA 3Q5DA 1AN0A 5C4GB 2CLSA 1TADA 2JJ1D 3KQNA 2ORVA 1T6NA 4PZYA 1F6BA 3CKLA 2FSIA 5HCNA 1W2GA 2ORWA 2BJWA 2DFTA 2CL7X 3QOFA 4FMCF 1W46A 3CNLA 4KFTA 4RZ3A 4BECA 4AIIA 5TMPA 1AKYA 1GWNA 2WWXA 4JL8A 4A15A 3QPUA 4QBFA 1ZCBA 3Q85A 4V02A 3GJ3A 3PR1A 2NO1A 1DAGA 3SC3A 1HH4A 3THWA 1E1RA 1NN3A 4QC2A 2J7KA 2SHKA 1GNRA 4YDSA 1XTRA 2ZSDA 2G1JA 1SXJD 1ZM4A 4BQSA 4NMMA 1NBME 1Z06A 1XJ0A 2CHQA 2JDIA 3AQ4A 2A5GA 1DG3A 4RJLA 4XD7A 4LJ6A 2RAPA 2FE4A 2HV8A 3Q7QA 3RNLA 3T1QA 2N1BA 1Q3TA 4LHYA 2AD5A 5FTLA 1YR7A 2AX4A 2WV9A 1AKEA 3I5YA 1KI6A 2QAGB 4KFRA 4HDQB 1YZKA 2WWIA 4HUQB 4YC7A 4F91B 4C2TA 4OKSA 4F92B 3B1YA 1N6IA 2DFNA 1XRJA 3IIKA 5JRJA 3QUSA 2WM9B 4BASA 2ZYTX 3AV0B 4LUCA 4OK6A 4TSFD 1RVDA 3LXRA 3GEIA 3ICEA 4D80A 2IA5A 4LBYA 1XTQA 2ZS8A 2XB2A 4AKIA 3T34A 3H86A 3NDBB 4JSYA 2JIZA 1XF9A 1HTWA 4KLNA 3EZ2A 4Q9IA 1P2VA 1UDXA 1UEJA 2ZR9A 4PO8A 3PEYA 2A78A 3I72A 3WBJA 1Q1ZA 1X86B 4V0ME 3WNDA 1EFHA 3K9GA 4NCIA 1L2TA 1WQ1R 5EE5B 1G21E 1I2DA 4HDCA 1G41A 4URVR 3SN6A 4KBGA 1DO0A 4LSGA 3WRXC 2WJVA 4YMTA 4WXRA 2ZRAA 2JJ2D 3TJZA 2IYSA 4TT3A 4GOKA 4LPKA 1TQ2A 2ZSBA 1OIVA 4PSVA 1FOEB 1Z6AA 2RGEA 1EX6A 4D4MA 2ERYA 2QGZA 4XWOA 1KO4A 2EFHB 2IYYA 3K1JA 1W0JD 4D82A 3CRVA 2HCBA 4RD4A 4WW0A 4D4JA 5L3SB 3K53A 2XZLA 1JI0A 1A82A 1N5JA 2VH5R 2NZ8A 1W0KA 4ZDWA 4AYTA 1OFIA 2ASEA 3N5CA 3DM9B 4MQBA 4XTRA 2R6FA 2F1JA 1ZP6A 3UG6A 1M6NA 2GJ8A 2IYUA 1G3UA 1DG1G 3C16C 4Q18A 4LV5B 4YXWD 5JMTA 3KJHA 2RGNC 3MWJA 4DKXA 2PL3A 2QSZA 4ASUA 4BLPA 1CR4A 3THWB 1JJVA 3OAAA 1GL7A 2ZRNA 1CP2A 2JLYA 3AKEA 1AZTA 3MFYA 3NEYA 3TQFA 3BB4A 3IQXA 1LW7A 4B75A 2QY9A 2RGCA 1H8ED 3RYTC 2G77B 2B6HA 4RY2A 2DFKB 1I4DD 4Q7MB 1FW6A 1KGDA 5IT5A 2CLCX 1VIYA 3BS4A 3BE4A 3GFTA 3GLIE 3B9QA 5DHFA 1KMQA 2FH5B 2VIIA 2BKUA 2W83A 3A1TA 1I2MA 3P20A 4IOJA 3GFPA 5DN6D 1R7RA 2H57A 2WSSA 1KI6B 3K8YA 3QXCA 2BDTA 1H8HD 1OIWA 4D4KA 3B7GA 1RPZA 3RS3A 4ZO4A 4P3YA 5JEDA 5C2JB 3O8RA 1Z0DA 1O87A 3LV8A 4QKQA 3CX7A 1LNZA 2XEXA 4LJ9A 3ASZA 3QXXA 2K5UA 1DS6A 5CJ2A 2N46A 3EPJA 3VNVA 3KFVA 2ZM5A 4BFUA 4DDUA 4QOSA 2VHUA 1OH7A 2Y8EA 1CJKC 1R5BA 4AYWA 5LPNA 2WJGA 1G5PA 3TMKA 3NC1C 4KITB 1OLOA 1ZW6A 4FCVA 1X6VA 4Q4HB 1Q1EA 1CF4A 1GL6A 1Z83A 3HDTA 3HPRA 3IGFA 4I1UA 1T3HA 4M9XA 1SVIA 3HU2A 3GCGA 3R7WA 3TIFA 1XTSA 1T0JB 1JECA 5JJLA 1VG1A 1XPRA 2C77A 3B13B 3PQCA 3GFOA 4LOAA 2W2VA 4TMKA 1CRPA 4BPBA 4LJYA 4DVGA 1G7CA 1R5NA 2G1KA 5FUYA 2PCJA 5H68A 5FPTA 3UMSA 2V1XA 4AC9A 2QEQA 2QMHA 3T06B 2ZTSA 3KB1A 3KX2A 4PTLA 5CK4A 5EP1A 4Q19A 3EPHA 1HT2E 3FE2A 1T8TA 4IJMA 3NTUA 1QHNA 2IUUA 3U2QA 2A2ZA 2DY1A 1IY2A 3SU8A 1XMIA 2OBLA 2ZJZA 4NHOA 1II8A 4LC1A 3THOA 3EIHA 2CL6X 1J8MF 3MRSA 5FOUA 4CZ2A 4B2LA 1W4AA 2FFBA 2X8AA 4ZIRA 4EKDA 1K5GA 1ZJ6A 3K70B 4FIDA 2IS6A 3CZQA 4JYCA 1MKYA 4ABYA 1J99A 2ATXA 2GZDA 4EAQA 1QG4A 2OXRA 1HUQA 4U7DA 4OHZA 1CTQA 1EFRD 1N3BA 2ZR0A 5B30A 2BCGY 1K8RA 1R6BX 3IO5A 3K09A 3BBPA 1TX4B 2UKDA 3MCAA 4US1R 1R0WA 5BYJA 4FMDF 4E5UA 5JJKA 1Z07A 3OIUA 4PC2A 4V0LA 4D26A 2W6JA 3TQCA 2CHGA 3N2EA 4B74A 1AIPA 1P2TA 4F4CA 3MSXA 2J0SA 3AGQA 3GD7A 1TNDA 2C96A 2IS1A 5CIQA 2ZJBA 4BFVA 2OXCA 3MMPA 1PVOA 5TB5A 3U44A 4HATA 1GRNA 4JLVA 2RGBA 4NKRA 4NYJR 4Q1EA 5B64A 1JPJA 4MUAA 1XMJA 4X8LA 2IWHA 2FSGA 1SHKA 1TEXA 2ODWA 3NH6A 1E1RD 3QG5A 4TL7A 2HYDA 3FMPB 2XXAA 1C9KA 4CDGA 4PC7A 4OI2A 1ZNYA 4N0EA 2QTHA 1DVRA 1NN0A 1NN1A 3ZDQA 5HE9A 2IBMA 2XGJA 1TQ4A 2OBNA 5HCIA 4A6PA 1SXJE 2E87A 3OEHA 4Q4JA 3R7WB 4BFTA 2JDID 2OILA 4XD7D 4Q1DA 2EQBA 4G5SA 2LKCA 2G6BA 2ZVPX 1ZD8A 3BIFA 1QDEA 2VPPA 2CCGA 1X1SA 5FI0B 4C0BA 4C0SA 1QHIA 1GZSA 4UNNA 2F1IA 6Q21A 2VF8A 4B3BA 2NG1A 3GLHA 1GITA 2YVUA 4OQXA 4BUJA 4HLUA 2F1HA 3FKQA 1HY3A 2Q9AA 3U7EB 4RD0A 4DHEA 1E9FA 4OHVA 2FA9A 3ZVRA 2PCLA 4HSEA 1KO5A 3KKQA 3WHKA 3QF7A 2BM0A 2R9VA 1IONA 1CS4C 2JIZD 4EUNA 1II8B 4PO9A 1DAIA 2AK2A 1WDTA 2ZJ5A 1FUUA 2ZU6A 1ZNWA 2EFGA 3DKVA 1ZU4A 4GDFA 3I62A 3TR5A 1G8GA 4ILEA 2IUTA 4ZIRB 3K0AA 1E0AA 2J0UB 2OV2A 5DLQC 2NGRA 5EE9A 1NN5A 5G53C 2IS2A 2F6RA 1PV4A 2WZQA 2NTYC 4KO8A 3ZIAA 4HAUA 1RRGA 2QP3A 3PVSA 4JBYA 2NO7A 4TT3D 2QBYA 2J41A 1HE8B 4OHWA 3AVYA 1S0UA 3A6PC 1TPZA 3CX8A 1L8QA 5L8VA 1WA5A 1A4RA 3OE7A 2REOA 3QVUA 1NG1A 4KHZA 1R2QA 3B82A 4O0MA 3LBNA 5B57C 1JQJC 1GKUB 4LGMA 5FPYA 1W0KD 4JJKA 5FUXA 1E0SA 4P4SA 1OXSC 4B35A 4F4IA 3U44B 3DM5A 2YWGA 2MSCB 4ZKEA 2JLQA 4MITA 1VMAA 1E9EA 2XITA 3EXAA 5IK2A 3HYRA 4LC0A 4TMXA 1OXVA 3KL4A 1N6KA 1GRQA 3AF0A 2XXAB 3UANA 4LCBA 3ADKA 3AVVA 2VQSA 1S8FA 1G291 2FMXA 5DSZA 5G41A 1MRNA 2LKDA 3LLMA 4UNPA 4TLCA 4U5XA 5FBVB 4Q9JA 4MGKR 3RWMB 4B32A 4FCTA 1YRBA 2IHYA 5CLQA 4Q4JB 2RKOA 3QG1A 3OEEA 4L9WA 1W4CA 1XEXA 2D62A 1JEEA 3FMFA 4JVLA 1XX6A 2ZJYA 4G5QA 1JR3A 1SKYE 2W2TA 3SI7A 2O0HA 3FOZA 1KI9A 2HF8A 2PMDA 2B7BA 2WSSD 3AF3A 4ARZA 3ZZTA 4ERNA 1DELA 4MYTA 2YYZA 1RIFA 3EARA 4V0NA 1Z0AA 1E2KA 2OEPA 1U8AA 1F2TA 3PEUA 4DJTA 3I3SR 1F3OA 5KDLA 1BIFA 3LA6A 4PHHA 3PXGA 2RGXA 2IYRA 1R8QA 4JJZA 3QXHA 4MKGA 4YMSA 4MGZR 1GRRA 1OFTA 4A8JB 4DLYA 2WIBA 3SYKA 4XIGS 2WWFA 3P27A 4RCYA 2OG2A 3SJBA 1E94E 1BS1A 5IF9A 3THYB 5J4VA 3N2IA 1E0JA 2AKAB 2C5LA 3MG9A 4KFUA 4AK9A 2JLUA 2GEDA 3KQLA 4OBEA 2WTUA 4RKEA 3TAUA 3EZ7A 4D2IA 3K0AB 5AK0A 4Z1MA 4TTPA 2V1UA 2HT1A 3ZZUA 3B1ZA 3I32A 3HJNA 3UKDA 3ADBA 2CJWA 3WYAA 4AKGA 1KHTA 2QBYB 5DH9A 4HLDA 1KJYA 1FP6A 3B60A 3JZAA 3TSWA 4EPVA 1TTTA 4JVNA 5EXPA 4H1UA 4URYR 1LS1A 1MO4A 4DUGA 5C46F 5JS7A 2O0KA 5CDFA 1E4VA 3VX4A 4B3FX 2P3SA 4TZ0A 1B23P 1EWRA 3CR8A 4MYCA 1QG2A 2X2FA 4HB2A 3OZXA 4EJSC 2WPDA 4PFSA 5F9HA 2Z0MA 1C1YA 4KODA 4P4SB 1BYIA 4QGFA 1D2MA 2ZJ8A 2CCKA 3ZYCA 1XPOA 1QBKC 2ZRDA 1ZU5A 4LWZA 5FH9A 1NIPA 5FOXA 3KTAA 1W4BA 5L3QA 3B6EA 3PENA 2ZI6A 3OIVA 3W34A 1KZ7B 3RABA 5F3WB 1UBEA 2NIPA 3BXZA 4M9QA 1P4SA 2ZI4A 3QBTA 2JLSA 3KKNA 5LB2A 2KE5A 1KI2A 4JT4A 3RSLA 4NONA 5DISB 3SYNA 4QBHA 1NF3A 1NNEA 1G6OA 1P2UA 2PT7A 3AEZA 4TYNA 4GZLA 4BEBA 2GZAA 3E1SA 2QAJA 3QBVA 1XEXB 1EFCA 2QPTA 2ZRPA 4FMCB 4JSTA 3RHFA 4Q1FA 5A4JA 3ZVNA 4AURA 4B44A 4BZQA 2W6JD 2GEVA 3LD9A 4TYPA 2Q3MA 2GHIA 5DGXA 4ARZB 1KDOA 2FN4A 4YDHB 1M74A 2V6JA 4M1TA 1F2TB 3VR6A 4BLQA 4KJZA 5DI3A 1AM4D 1ZM3A 4LRWA 1FTSA 1ESMA 2DWOA 2R6CA 3EPLA 1FZQA 1PZNA 4A36A 2O8BA 2YKGA 1VYUA 2D4HA 5FBWB 2VHCA 3SFVA 4C0LA 2OAP1 2PZGA 2IUSA 1SXJC 3OIWA 4BFYA 2WMNB 2QSYA 4LJ7A 4P33A 3FGNA 2GCOA 1GSIA 5JLJA 2FG5A 4DWJA 1VECA 2ZRBA 3LX8A 4BFWA 2CJWB 1E98A 3AB3A 4LYAA 2Z43A 3ZD7A 2WWHA 4JS0A 3L43A 3OEHD 3SJZA 3ZQ6A 4QRHA 4K8OA 2QRZA 1SVLA 1P75A 3NC0C 1AQYA 3A1SA 3BH6A 2IK8A 4LV6A 2D7DA 2RHMA 2BBOA 2P6RA 3FVQA 4BGDA 3DL0A 3EASA 3I73A 2QP4A 1GUAA 1BH2A 5FOTA 1DAEA 1S1MA 1ONBA 4ZPXA 1W36D 2BKEA 5FI1B 3VAAA 2FGKA 4NL4H 1MO5A 5J47A 2BOVA 4XWAA 4XTCS 2F55A 2A5JA 3ZH9B 1F48A 3W5JA 2C04A 3T5GA 4IDHA 3W6OA 4AD8A 4D25A 1IAQA 5FTMA 1FP7A 2V7QA 3GLGA 1IHUA 2QZ4A 1YKSA 2CL0X 3AP1A 1E2LA 1RYFA 1W5TA 1Y63A 3KTAB 5L3QB 5B2ZA 1KSGA 2IXFA 3FDIA 2D2EA 3NG1A 3PITA 3FB4A 4IDPA 1UKYA 1LF5A 2G0TA 2PLFA 4PHTA 4PZLA 5H8WA 4F4JA 5EP3A 4BLSA 2WKPA 4JLAA 1WXQA 3H0KA 4F93B 1AS3A 1XZQA 3VKHA 4Q9HA 4I4LA 1M34E 1QHHA 2ZROA 2I3BA 3IBGA 4LYJA 4GP6A 3RAPR 4CW7A 2VF7A 4O3MA 3PIRA 2AN9A 1Q12A 3ZIAD 2QTVB 2XJ4A 3EG5A 4AKHA 2PJRA 3BWDD 3QF4A 4CEJA 2JJ8A 1KTVA 2ZE5A 4HLQB 4OQFA 2NO6A 1P60A 2ANBA 1D9XA 2CXXA 2Q9CA 4ON9A 2VTKA 3A4MA 1DE0A 3CH4B 3GJXC 3OE7D 3Q3JB 3TE6A 4JBXA 1DBSA 3N70A 5HZKA 2GBLC 1XD9A 2YOHA 4XSGA 1P61B 1UBGA 3RS7A 2HJGA 1ZBDA 2QRNA 5DI3B 4ZKDA 4GNKA 2RMKA 5DE3A 1RJ9B 1CKEA 4S35A 4NDZA 3MGCA 2O8BB 3WP1B 4OYHA 4CF7A 3EPKA 3UK6A 4MGIR 5IK2D 2QPOA 2AWNA 2FSHA 4C0AC 2H92A 4PQRA 4OI0A 2PJZA 4M1SA 1IOZA 2OLJA 2C78A 2GCOB 4B2PA 3MWKA 2VYFA 3H2YA 4IEEA 4XVQA 4D81A 1G9XA 1KY3A 1E2PA 1XJQA 3W8NA 1G8FA 5H1YA 3OEED 1GNPA 1GVNB 3L0IB 3OESA 4GPTA 3TVTA 1KI8A 2B8WA 3SHFA 1SULA 4MRRA 2BHRA 4DRZA 2ZU0C 3ZS8A 2BVNA 3LW7A 4QM7A 2IEZA 1GP2A 1KK2A 1DAFA 4M53A 1JR3D 1D9ZA 3T15A 4NYMR 1KMHB 1R4AA 4TMTA 3SOPA 1FQJA 3M6AA 1KK1A 2VHTA 5JWOA 4URWR 3P26A 4Y0AA 1DAKA 2DPXA 3QXJA 4NYIQ 2KBEA 1Q3HA 4LHVA 2ODBA 2C9YA 3PCRB 2QU8A 1JAHA 3PJRA 1US8B 5IHPA 3V4FA 1D8TA 2ZI7A 1G5RA 1Z08A 2ZE8A 3EC2A 3L0OA 5TY0A 2YNMA 3S1AB 4B3XA 2EYQA 2RGAA 2W0MA 2F9LA 1V5WA 1U9IA 4MRPA 4NTZA 4HI0E 4NYMQ 1VIAA 4OL0A 2BEKA 4Z1MD 1OB5A 2ZRJA 5FOVA 1QHHB 4TQUS 1UADA 1W2HA 1M7HA 4N0DA 4M0LA 3KUDA 4O2LA 1J90A 3NWJA 1E9AA 3FYHA 2GA8A 3A1WA 1MABB 1GG2A 4X8MA 4ZI3A 821PA 3QF4B 1V43A 4PC1A 2CLDX 2IYVA 4TL9A 4CEJB 4TYWA 1N0VC 1OPXA 4DCVA 2QAGC 1E1QA 3LWNA 1E2FA 3EA5A 1E79D 4RZUA 2ZRMA 4DUGD 4FW9A 4NCJA 3LVQE 4B3CA 1R8SA 1E2DA 3RWOA 2ODNA 2GF9A 4FINA 2P2LA 1ZIOA 4B34A 1W1WA 5GJWC 3RVBA 1VG9B 1KSFX 1GDDA 4A82A 1RE0A 2WPDD 4E07A 1KDPA 1IN4A 1G8PA 1G17A 1KO8A 2A30A 3T61A 3KB2A 2BEJA 1Q57A 2FEOA 3WMGA 3U3JA 2OCBA 2GXSA 4PC6A 4DCTA 4IW3B 2OFXA 4TTRA 2R8RA 2BMDA 2IF0A 3RSOA 3PFIA 5C1BA 2QQ0A 3B85A 3ZVMA 4B33A 1LTQA 1W44A 3EW9A 1NY5A 4BFXA 4A92A 1YR8A 3OIYA 2P0EA 2EFCB 2ZREA 3D8BA 3D7MA 1U2RA 4RD2A 4FMDB 3AKYA 3B5JA 4MYHA 1LS6A 2C9CA 4II7A 4OHYA 1OF1A 2CCJA 5J4KA 3BFKA 4RFVA 1E9DA 1VPLA 3TUJC 2VA8A 3HR8A 2WWWA 4MDFA 4R98A 1KDRA 1OV4A 4B6EA 2VP2A 1M8PA 1MH1A 1S96A 1WP9A 3DVLA 3OFNA 2FPKA 4I1OA 2Q6TA 3BC1A 4JZKA 4DB4A 2VLIA 3IO3A 4WAUA 1JQLB 1JALA 1NJFA 2R65A 3GEEA 3HYTA 2A5DA 1ZUHA 2CDNA 2JA1A 2Q9BA 3I8XA 2RB4A 4QL3A 1RRPA 1KI1A 1JBKA 2P6NA 3H4MA 4QNMA 4UNSA 2GK6A 2PBRA 4BLRA 3WYGA 1O3YA 2KWIA 1OXXK 2EW1A 1A5TA 4PO1A 5EE1A 2WOOA 1XD2A 1COWA 2GNOA 1F2UA 1LV7A 2PEZA 4JLPA 521PA 1JB1A 1Q22A 4Q9LA 4D0GA 1CR2A 1E99A 3A37A 4CYMA 3LX5A 1TU3A 2FGJA 1KYIA 4C0HA 1GTVA 2ZI5A 2BIFA 3BH7A 4TYQA 4AYXA 3AVQA 1SHZA 1G5TA 2Z83A 1M7GA 2BJVA 3LLUA 4PPQA 4TL8A 4M8NE 1IN7A 5G40A 4QBGB 3KKOA 2ZJOA 1XCGB 2ZRLA 3ADDA 2C2HA 5FPSA 2QT1A 1WB9A 3KXIA 5KO2A 3W8RA 2NOAA 3L82B 3NEJA 3EIEA 1BOFA 1KI7A 1Q0UA 1FPMA 2H1LA 4GBMA 3AVXA 2B8TA 5KOYA 2MSEB 1OH8A 2V7QD 1N2CE 5A0FA 1JNYA 4JLKA 2BMEA 3NXSA 1MRSA 3LW8A 2MSDB 3AM1A 4KSBA 2GJ9A 4JL5A 3R8FA 4D0LB 3F0TA 1NMYA 1BYUA 2P6UA 4HYYA 4DLRA 5FL3A 4CT5A 4YLGA 3ZGXA 3X1DA 1UM8A 2JATA 5HPYB 3GP8A 3KXLA 1XEFA 5P21A 1NI3A 1J70A 1Q44A 3DZ8A 1EK0A 5HR5A 1ZAKA 3E70C 1R5OA 4LK2A 1E9CA 5EXTA 2PMKA 3U7GA 3CONA 1BKDR 4B3DA 3WNCA 1XU4A 1N5KA 1IM2A 2GXQA 4A1FA 4LBVA 4WBSA 5KTYA 1VG0B 2OE2A 4IOMA 3AVOA 1HQYE 2VBCA 2OT3B 1AQUA 5BWMA 1KJWA 1OXTA 3B8HA 5F9FA 3A1UA 1NMXA 3CLVA 3K0CA 4KV9A 2WHXA 3LH5A 1G20E 2I1QA 1IJFA 2I1VB 4D6PA 2RGGA 2E1RA 2EWVA 3OF5A 4PQYA 4HEJA 3SJCA 4A0HA 1HV8A 3CIOA 5SZJA 1MR3F 1UKEA 3KJEA 2D2FA 2QMUA 3M0EA 1NSFA 3K70C 2A9KA 2R62A 3IQWA 3QKSA 2TMKA 1IN6A 3WBKA 5JCZA 2ZE6A 4LJ4A 4MRSA 4N3NA 4XWKA 2XZPA 1T3SA 1XD2B 3QEOA 3TR0A 1F2UB 4OJQA 3CRW1 4DLZA 1YE8A 4HZUA 2GCPA 2ZSAA 1G64A 4OQLA 1QHXA 1FQKA 2OFWA 4H1VA 3CR7A 121PA 3M1IA 1I4TD 2QP9X 3K9NA 1WE2A 2HUPA 1E69A 1VCNA 1E2NA 2J3EA 5FR1A 4G0NA 3F3YA 4YMVA 2ZETA 2OBMA 4UJ3A 2IS4A 1JJ7A 3CF6R 2QL6A 2F1RA 4PZZA 3NVAA 4L15A 4D4LA 1EGAA 3U7HB 1U0JA 2EYUA 3LDAA 1AS2A 3GEHA 3KZ1E 4KI0A 2REBA 3IEUA 3ZZ0A 1JR3E 3PG5A 1JPNA 3ND8A 1YZQA 2C9OA 4TQAA 4DLXA 2B92A 5LB4A 3QIAA 4XOIA 3DEFA 3ASYA 4HDOB 3UMRA 3WRYC 1ZC3A 3FHCB 3GMTA 4QJ5A 3LO5A 1WF3A 2J59A 2JAQA 2ZR7A 1XXHA 3A36A 2CEAA 2N42A 4RKFA 3CNNA 3R8CA 1YZNA 4DZZA 2QMEA 5DO9A 2G88A 4G5GA 4M1OA 2ZYWX 2O0JA 4M22A 3QSYA 1VHLA 1S9DA 2IYZA 3KKPA 5BN4A 5FBRB 3SHWA 1P62B 1U0HC 3DPUA 3JZMA 3H1TA 3QKUA 4IHQA 1UBFA 3X1WA 4FCWA 2XJ9A 2BBTA 3C4JA 5BW8A 4Z54A 3AF1A 2IF2A 2O8EA 3TUIC 4LJAA 4LI0A 3K9LA 4EJSA 4LBWA 2ECKA 3HU1A 1E1QD 1SVSA 5BXQC 5DYGA 1Z6XA 2O8CA 1G3IA 2WMOB 4W5HA 5E7JA 5G3YA 3LVRE 5UKDA 5CDFE 2FX3A 3AKDA 2IW3A 3K0FA 4QXAA 1NG9A 2ZQ5A 5JWHA 2AXPA 2QE7A 2QROA 1Z8FA 4ZDIA 5KU1A 1UAAA 1YZLA 1OIXA 3IKJA 4UXJA 1YR6A 4LHWA 3CRRA 4URZR 4GMXA 3VX3A 1R0XA 4S2EA 3HU3A 1X8JA 4IDOA 3DOFA 2FWRA 2MMGA 4R7ZA 5ANRB 3QKSB 1A2KC 1VCIA 3KUCA 3REFA 2VHJA 3UWKA 4BFZA 2AK3A 1XMSA 1M1YE 1Q20A 1ZINA 3RDPA 1U98A 2DCUA 4P4TA 4HZUB 3DHWC 3J81k 2QMOA 1ZUIA 3EC1A 5E95A 1HT1E 3AVTA 1YZUA 4B6FA 3CH5A 4L9SA 3LBHA 2H17A 1NP6A 4B47A 1RYHA 2AL7A 1QZXA 2HLDA 5B58C 4R2HA 4LY6A 2X19A 4L16A 4QGGA 3NBFA 1KZGB 3TH5A 2OAQ1 621PA 3C14C 2J1LA 4Z8XA 3GLFA 1H65A 1N6PA 1CU1A 1TUIA 3C8UA 4LYHA 2YWFA 4W5JA 2GWHA 4WZAE 1W47A 2YWEA 2CVFA 1NJGA 1P3JA 2PH1A 3EIQA 3RS5A 3SNHA 3JVUA 3GLHB 3OFND 2BMJA 5KPDA 4JLJA 1Z22A 1GM5A 4C2UA 2AXNA 2F7SA 2BWJA 2UVQA 2PZFA 4LHZA 1MOZA 5GJVC 1WRBA 5K8UA 3VHLB 4CEHA 1Y3AA 5FL7A 2GVZC 1TF5A 3MD0A 5EQTA 1XXHB 4UXIA 3VU9A 3V00A 1MV5A 2CK3D 2ZXUA 2ANCA 4NCKA 4Q02A 5LD2C 2GZHA 2JEOA 3UWOA 1XBTA 2MMCA 2QORA 1DOAA 1G3QA 2VL7A 2DFLA 4HAZA 4Q7KA 1Q1BA 4A4DA 4B73A 3CNOA 4JKIA 1QHGA 3NBXX 1CLUA 2F9MA 1COWD 4HAYA 1VCMA 3KDSE 4GOXA 4KYIB 5BYKA 4M1MA 3A4NA 3THXA 1IXRC 4IEIA 1KSHA 3QPWA 2IYQA 3U6BA 1JAIA 4LDJA 3V9PA 1N6RA 2ZIAA 1FUKA 1GNQA 3MWYW 5FR2A 4C30A 2ZSEA 2GEUA 4M9ZA 3GJ5A 4LX0A 5EE0A 5AUPB 4MUBA 3SR0A 4F38A 2O8EB 4RZ2A 4EJSB 4DSNA 3W9YA 5FBQB 3PUZA 1E79A 5KDOA 2X77A 4OJKA 5JI2E 221PA 4M1KA 1GILA 3I92A 1NY6A 5DYIA 2KI5A 2O8CB 3GJ0A 1EXMA 3VR2A 3U3MA 3EX7C 1CBUA 1KI4A 4MRNA 1E2EA 1N6OA 2ZS7A 3K0FB 4NPHA 1AJEA 2R2AA 1OFUX 1UPTA 4A8JC 1KK3A 5TXGA 4EFLA 1D2NA 3CRQA 4HZIA 5SZKB 2EVWX 4QJ4A 1N25A 1P9NA 3VQTA 1G18A 1FNNA 1U8ZA 3TLXA 2DWPA 3I8SA 1Z0IA 2C95A 2WAXA 3GLGE 4BFSA 5DHAA 4CIDA 3BD9A 3C41J 2CNWA 3ONWA 5CJPA 5C18A 4C9BA 4TLEA 3PEVA 3W90A 4JT2A 4Z8YA 1KK0A 1Z5ZA 4EFNA 3FHTA 4ZI2A 2BCJQ 2OCAA 2W0SA 3CPHA 1M2OB 2HDNB 2OHFA 1KDTA 3BOSA 4BRUA 3GJ8A 4N1AA 2WKQA 1HURA 1A2BA 2GBLA 1FX0A 1LF0A 1PUIA 4KXFB 2VP9A 2G9NA 4UJ5A 5HKKA 4PR0A 2QQEA 4K81B 2A3RA 3CRMA 3GLFB 1OHHA 4DBLC 5AJZA 1Q21A 3BB1A 3SDZA 4AG6A 4A0GA 2NO9A 3GJ4A 1N0WA 3A58B 5KSZA 1L7VC 421PA 4B76A 4ZCMA 4PANA 5JZVA 4PQFA 4GT1A 3H84A 4CEHB 4PX9A 4CRWB 5E3HA 1K5DA 1KAOA 1Z2CA 3B1XA 3B1WA 2J7PA 5CK5A 4L8GA 4IDNA 1HQCA 2Q3FA 3CWQA 2IC5A 721PA 4GZMA 3ZS9A 3IEVA 2E9SA 4DLWA 4I99A 1U8YA 2BM1A 2W6IA 3GPLA 1G4UR 2XSZA 4KYUA 3PUYA 2JLRA 2Z6VA 3TRFA 5F2EA 5SZIA 5BN3A 2HXSA 2G83A 3X1XA 1VG8A 1G1MA 2ZUDA 2QM7A 1J2JA 3THXB 5JCPA 3WMEA 5FTJA 3PUVA 4RVCA 1Z6YA 3TK1A 4PXAA 3ICQB 4YMWA 3T12A 4AI6A 2BMFA 4MKFA 5CIWA 1UKZA 4PAQA 1CJTC 4TLBA 4ITRC 3Q5EA 4DLVA 1ZRHA 1DO2A 1KO7A 1N0UA 2WIAA 1S3GA 2ZVQX 2UZIR 1Z29A 1RRFA 3NBYC 5DI9A 5KSPA 4DLUA 4JLDA 1U81A 2DHRA 1U99A 4MKIA 2YJTD 4M1YA 2HCJB 4POAA 3Q9LA 1TEVA 4BWYA 2JASA 1OT3A 2C98A 5EUMA 1OSNA 3SYLA 1JXMA 3E5HA 2RHDA 1IJEA 4W9MC 1XTKA 4JKYA 1ZMXA 3UIEA 3NHAA 4GFDA 4QBIA 3SBDA 4EPXA 1CJMA 1DTSA 3L8YA 2GF0A 4IXNA 1II9A 1GKIA 2VHQA 3X1YA 1YVDA 1Z6TA 2BBWA 3AP2A 5CB8A 1OYYA 1RW4A 3FKSA 4HUQA 1W4RA 2G3YA 1IXSB 2GCNA 2RGDA 5JJIA 1SVWA 2GETA 3ZLJA 5KNCA 1BMFA 1DEKA 1XB2A 2FJUA 3IHWA 3KJGA 4US2R 2FZLA 1SVKA 5A5GA 1SZPA 4L5BA 4C0JA 1YZGA 2IEYA 2Z4RA 1PLKA 1MO6A 2OCYC 4PAMA 3QE0A 2WICA 2FSFA 1A1VA 3LFUA 2V3CC 4IKEA 1RRCA 3TAHA 2C8VA 1NMZA 3NH9A 4NU0A 2W58A 4LZZA 2NPIA 3QQ5A 2RGNA 4Q03A 4LJ8A 4PPNA 5FPHA 4AY2A 1ESNA 2OSBA 2WBLC 1E2QA 4PC3A 4DCNA 1AA9A 4KSCA 4EPWA 5GVSA 4Y0VA 2QE7D 4MGYR 4EFMA 1NVXQ 3CX6A 1G3RA 1E9SA 2IL1A 1E9RA 1CULC 4E03A 4PAOA 3A1VA 4DEXA 3CUEF 2XZOA 4HB4A 5E7IA 4AG5A 1VKJA 3AKCA 3EAQA 3PEWA 1EFTA 3LXXA 1TF2A 2FDCA 2QG6A 1KAGA 4RD3A 4JVMA 4NYIR 1AK2A 2WWYA 5KPJA 5J40A 5EE3A 1YZTA 2GAAA 5AJXA 4M21A 1JR6A 3CO5A 2XAUA 2Z4SA 5AJVB 4IDQA 3T1VA 3W3ZB 2HLDD 3REGA 1RC8A 1U0LA 4PSAA 1NVVQ 3G5UA 4MDEA 1OXUA 3CB4A 2VSXA 3FTQA 3T35A 4A0RA 4KFSA 3G0HA 2W00A 1Q1QA 3EWAA 1NIJA 1E3MA 2IXEA 1X3SA 4A6XA 1IN5A 5KUTA 2OFOA 3Q7PA 5CLLA 3U3RA 2F3TA 5GJBA 2ZRIA 3B2EA 2WOJA 4XVUA 2KSQA 2H18A 5FL7D 5JHGB 2PX3A 3LBIA 4C0KA 2Z5FA 4JL6A 4Q5IA 2EFEB 4EPYA 2GVDC 3GLGB 3P4XA 4B3GA 1YJ5A 1IY0A 1N6LA 3CBQA 1CJUC 5D3MA 5AJYA 1I4LD 1B0UA 4PSKA 4Q01A 3CPJB 4C0QC 1EFUA 2O5VA 1CR1A 4WVFA 1XTIA 4QFMA 1UEIA 3BRWD 4FWTA 4P31A 4DCUA 3FHOA 5KHOC 3VMFA 2P5TB 3NIBA 3WYFA 5J4YA 3HPQA 2VP5A 4DEYA 3WNBA 2VRWA 3D6TB 5JS8A 1WBDA 3IPXA 2HT6A 5K8IA 3BB3A 5KNDA 2FU5C 1HEIA 5CB6A 3NDPA 3QVVA 4RCZA 2P67A 2ZEJA 4GOJA 1S9HA 4C4PA 4URXR 3U6KA 2NQ2C 3QJYA 5E4FA 4DCSA 4ZDKA 1ZD1A 1WBBA 2RH5A 1IQPA 1XP8A 5AUQA 5FUVA 3A8TA 5J5CA 4Q4HA 2JLZA 1ZM9A 4LHXA 4CGZA 1GKYA 3KQHA 1XPUA 2IYTA 3U3KA 1ZIPA 1SGWA 3PV0A 5EZ5A 2J0QA 4WA7A 2B7CA 4R2IA 1NSTA 3UATA 3VKWA 2BBSA 3CF2A 4A0FA 3SZRA 3RANA 1G16A 3QNUA 1WCV1 4F7WA 2GK7A 3QY0A 3W3AA 4TZ6A 2LCFA 2V55B 3PUWA 3HP1A 3RS4A 4EQ6A 2CNWD 2QTFA 2O8FA 4EPRA 2FFAA 2AHOA 5EP2A 4DXAA 4KCGA 4TL6A 2DR3A 4EDHA 3ND9A 1KNQA 3TGPA 3CM0A 2VSOA 2FNAA 1DARA 3AVWA 4QHSA 1ZVQA 4OHXA 3BGWA 4X8HA 1TMKA 2J87A 2ZI3A 2PT5A 2B21A 1NRJB 2GAOA 4ZCIA 3TW8B 3SBEA 4AKEA 5C4MA 3TUZC 5HKKD 3AH8A 4U00A 2A5YB 3ECCA 3LY5A 3DDCA 4XVRA 2ONKA 1FNMA 4RFSA 1E2JA 1OHHD 4FD2A 4FN5A 1P9WA 2DBYA 2YINC 4HB0A 4PPGA 1GFIA 1K6MA 1KOFA 1C4OA 2DYKA 3CZPA 3QKRA 4DSUA 2IHBA 3W5IA 8OHMA 1IBRA 2ZRGA 1NBMA 1XNJA 1QF9A 1GOTA 5J4LA 1TU4A 1S2MA 2GJKA 4Q1BA 1G8HA 2HEIA 3K9HA 1R10A 1SKQA 1AGPA 3AVUA 1FFHA 1GL9B 2WVJA 4L4UA 4Q4AA 4TQ9A 2CK3A 2REXB 2J7PD 3T1OA 4ESHA 2IWRA 1II0A 5BN5A 2KBFA 1ODFA 4JMPA 5D3MB 1TQDA 1EG7A 3KQUA 3L8ZA 1W48A 1P73A 1ZM7A 1JEDA 2W6ID 2XSZD 3NBZC 1N5IA 2YOGA 4LV8B 4MYUA 5IRCD 3G82C 2YWHA 3AGPA 5JBQA 4ZCLA 2PZEA 5KNBA 2QM8A 3WY9A 4P32A 3O8DA 5K8LA 3UPUA 4G3XA 2KB0A 4KAXA 4PPFA 5JI3E 4FMBB 3VHXA 1NLFA 3V4RA 5TARA 4QHTA 4V0MA 4ACAA 4DDTA 5JHHB 1UF9A 4NZYA 3LQRA 3EZ6A 1HE1C 1QHYA 2I4IA 4Q7LA 5H70A 3MLEA 4YMUA 4DDWA 4JIMA 2CVHA 1CXZA 2QENA 1T91A 2AD1A 2QPAA 1U90A 3LAWA 4Q9KA 2DWQA 1OH6A 3GLHE 3L0SA 2JCSA 2ZPTX 4G1UC 2D3WA 4HLCA 2IX3A 1D5CA 1HA3A 4HB3A 4P0TA 3I1FA 1XZPA 1U9IC 2JLXA 1Z6GA 1XXHE 4Q7JB 5D3QA 4G5RA 1KI3A 2NZJA 3AP3A 4CT4B 2ODEA 2QA5A 3C5HA 3WHLA 3FKSD 4EQ6B 4IXMA 1OW3B 1PLLA 3B9PA 2FV8A 2RCNA 2A5FA 2FFQA 2WJJA 2O8FB 2H7VA 3CPEA 3Q72A 4IFEA 5GJCA 5L3RA 3JVVA 1E32A 1BMFD 2EU8A 4W5WA 4AWXA 1OJLA 4Q4LA 2VP6A 2ZSFA 3CF0A 3R9XA 4Q00A 1G19A 3R20A 3AUXA 4G5OA 5BQ5A 2AR7A 2IYLD 5AWFC 3X2SA 2ZANA 3D31A 5AR1A 1XWIA 2OZEA 1TF7A 4B71A 1XEWY 4TLDA 2XOKA 1QVAA 2ONJA 2ZAMA 3DO6A 2OO7A 4JLOA 4RFSB 1ZC4A 4LPSA 4WZ6A 1Z2AA 2FOLA 4MH0R 1XDBA 1Z0FA 5CITA 2GXAA 2J0UA 4KBFA 4Q47A 4ZV4A 3QKRB 3B1VA 4DSOA 1XD8A 1AGRA 2GXUA 3BORA 3O47A 4UNQA 1L4UA 3IIMA 1EX7A 4HAWA 4R9UC 1E0KA 1M7BA 5J4HA 3DOEA 3IBYA 3R9WA 2ZUCA 1TUEA 1ETUA 3TSZA 2YC2C 1W7AA
chains in the Genus database with same CATH superfamily
1P91A 2VEDA 2IVZA 1NR5A 2Q21A 2P30A 3PPWA 1K4MA 3TLJA 5HSGA 3FDXA 4Q4AB 1L4YA 3ZE2B 4BN4A 5EJ9A 1VYVA 4OK3A 1AVTA 2VPYA 3TOVA 3CGWA 1V4BA 1EAMA 4DILA 1YZVA 4YJ3A 3L0PA 1HO3A 3WSVA 1CJCA 1K5PA 1EXWA 2CFCA 2MYUA 3GU3A 5EXSA 3G1UA 3ILYA 4QRIA 3GJZA 3VTKA 4RTKA 3TCKA 4PZCA 1NTRA 2NN3C 1KS9A 5TVKA 5TRTA 4BTVA 2WZCA 2ZIZA 3MJCA 4RPHA 4HNUA 5FT9A 4WMLA 2BTQB 3EZ9A 3V4OA 3DD5A 1WDLA 1T9HA 5GONF 1CRQA 5EJEA 4N5LA 2AI3A 4H1HA 3T54A 5DV9A 3VZPA 2OCGA 3TWOA 3VFDA 4AQYB 3ZQJA 1YKGA 3MT8A 1N9GB 1XTPA 4MPTA 4LY3A 1OX6A 3U3OA 3W05A 4OX9B 1LBQA 2CB9A 1LSUA 4N8SA 3OICA 4IHJA 4RPIA 1Z4QA 3HA5A 1NL3A 4JOBA 4RGYA 4E08A 1P7ZA 5A6SB 2W71A 2I0FA 2IH2A 2E18A 1QVRA 4ZO6A 2WA2A 3U4MA 2OHHA 3MOIA 1GN9A 3QYAA 5HKOA 5G3ZA 1DKMA 3WL8A 1RJWA 4US0R 1E8DA 4MVJA 2HK8A 4IMRA 2P3OA 4RGVA 1XQ6A 3V8PA 2QMYA 5LJLA 1W5AA 1JE0A 1GD1O 1M2EA 1ZL2A 3QLTA 5KB3A 3O3CA 4YAOA 5LMZA 1D6JA 2XVZA 4GE0A 1YCGA 1NKTA 4MV8A 4Q1CA 4TRMA 5AI8A 2IZ0A 1B2RA 2B98A 1D2AA 4EI9A 2MOKA 1NVUQ 2Q5OA 3WGVA 5JZMA 2C4NA 4LSZA 1A9ZA 3F8TA 5CA1A 5EZ6B 4KX5A 4HQOA 1KKLA 3OSUA 3VDXA 3O8LA 2BFEA 1EFDN 1EFAA 6ADHA 2ZYVX 5FOSA 4E5DA 3EVTA 4EEKA 3FD8A 5FOWA 4A8JA 3DE5X 2X0FA 2V8OA 1A4IA 1RXEA 3EUAA 4FOPA 4GP7A 2WJYA 1H4QA 5CM8B 5B4TA 1Q7CA 2H4XA 4GD3Q 1U2TA 1UBCA 4MKHA 4QOIA 4UOEA 4PFQA 2OBYA 4A8PA 3PSHA 1SU8A 4YWJA 3U31A 3BMQA 1V25A 1XZLA 4R84A 5C0OE 3UMGA 1AF7A 1RKBA 3OIDA 5L6LB 2R6AA 3F78A 1WP4A 3KV3O 1MQSA 4M87A 3LKBA 3BIWA 1YRAA 4L57A 1EE9A 2XTNA 4YCJA 1UP6A 2O6LA 1HQDA 2HHLA 2IEGA 2OAEA 3NB0A 2XNDA 1NZFA 4HAVA 3ZWQA 4C5BA 1QO9A 1VHTA 2HF9A 1KIMA 3HJCA 4OBXA 5BXYA 2BY4A 3G79A 4YONB 3TXYA 3U7QA 5L7TA 4YRKA 4I1SA 1H2WA 4EMUA 3LOQA 4JQZA 2BR5A 1QS0A 4W4TA 2JLVA 2XHEA 5B1DA 1ND5A 3T9EA 4UQOA 4DDVA 4NEQA 5B1SA 5JPCA 4YHHB 1ZK0A 3SHVA 3UCEA 2ZITA 5JCJA 2CUTA 3MELA 2GPTA 2R6JA 1LDMA 2ILVA 2R4QA 3BERA 3E53A 2WSYB 4FMPA 3HKDA 5KJEA 3ZQ4A 3ZX4A 3RRYA 3P1JA 3O94A 1XP5A 2PMWB 1XEAA 4AMGA 2CBZA 3HO6A 5FJIA 4GOOD 4FT2A 4M2LA 4XZ3A 1TM7E 1C80A 2AFIE 3SSNA 2DTDA 4G8BA 1IZZA 1L3BA 3D3QA 3KD3A 4BP8A 1P5FA 5JSZA 5CCDA 4G1CA 3CT4A 2FW9A 3DAFA 4RZSA 3AUAA 4IKPA 2RK4A 2V6IA 1T8PA 3ZDRA 2WSMA 1L7PA 1SD2A 2NU9B 3OAAD 1L5HA 2CLHB 4GUDA 1L7DA 4ES6A 5SZHB 3K70D 4XEUA 1XCMA 1E2IA 1YFLA 4LVCA 2YOFA 1NBMD 3O9VA 3O2SB 3TB6A 5ITSA 2FPIA 5KVAA 3AF2A 5TDHA 4R1PA 4W6ZA 5HKBA 2HCTA 4UNRA 4CEIA 1IQUA 1JIVA 2XTZA 1TA9A 1YBHA 1J8YF 2ATVA 2HO4A 2PLWA 4GXTA 4KC0A 4F2PA 3QHAA 2ILTA 4QQKA 4PTYA 3TB4A 4D97A 5IH3A 4OX9Y 1A7UA 2PQMA 4ZRMA 3VMMA 4CM7A 1ZD9A 5AKKA 1RFGE 2X7HA 4ZYVA 2XT9A 4AU1A 2A4MA 3C70A 5IH7A 4Q6WA 3X1KA 5P8WA 5HYVA 1BWPA 4CL3A 1CR0A 4JODA 4R54A 5EJ8A 4ENVA 3I61A 1P29A 2PG3A 3GYBA 5CM9C 2CNOA 2D5CA 3KO8A 4BKOA 4RQAA 4WFKA 1TFRA 2PEYA 4B7ZA 3WMFA 1ZUWA 2BFEB 4OQMA 3K6RA 5LZ7A 5AHRA 1U6KA 3AL2A 3M4YA 1H9CA 3K0BA 1TZMA 1ZQ1A 2R4TA 2PU7A 3DQZA 2AF3C 1G7TA 5IJ9B 2VPTA 2ZB4A 3GFRA 3PJGA 4BEJA 4HLUC 3VR5A 1QO7A 1W36C 4JP8A 3UFBA 4J1TA 3BMQB 5CGQB 1NXOA 3EYWA 5FHQA 5JOQA 2CE2X 3HR4A 3OPYI 5HTKA 5ICMA 2CV0A 1XTJA 4V2UA 3D2CA 2P4QA 5J5AA 1LVUA 2JAOA 5FTKA 3C15C 5B36A 5JU6A 2FN9A 3CW2A 1TM2A 3B78A 3U7QB 3W5SA 1H2FA 1PR5A 4KU4A 5CPFA 5ER9A 1Z4LA 4Z9AA 4O4JB 2O1XA 5FBKA 3MJRA 5JZBA 1WMSA 4Z4FA 1E2GA 1P5HA 1Y9JA 4BLTA 5F1YA 4WTOA 2NZYA 3FFAA 1QLJA 4R69A 4UEJA 5HF9A 2VO1A 1FRQA 5EGNA 2HWYA 1TU0A 4ALIA 4RV9A 1ISMA 2Z2YA 2YWJA 3HKDB 5FWXA 4RPKA 5ARCA 2Y1EA 3HXOA 1A2OA 2X6RA 2W4IA 2H11A 3C24A 3TW4A 4KGXA 3IT1A 2EG9A 4XJXA 4E22A 3WB0A 2R6GA 1FL9A 1IWOA 3GJ6A 2X9VA 4OH7A 4OXKA 2NPFA 4LOHA 2V7GA 3B52X 3L4BC 1I51A 1GPJA 2ZRFA 1FMJA 4BE4A 4GQBA 2Z08A 3KQUA 5JSZB 4QDZA 4YXWA 2IPAB 2V9ZA 1ODKA 4HN4B 2PXAA 2HK7A 5HDQA 4ARCA 3UMFA 2EFDB 2NUTB 3LDHA 2IYNA 4QODA 3ETLA 1BJKA 4JQYA 1D4AA 3IILA 3DG9A 3KJXA 3MILA 1U0SY 1A27A 3CY6A 5JYEA 2PZBA 5TSDA 3GJTA 2HSEA 5DX1A 3RS0A 3VR3A 1G7RA 2DCMA 2H5EA 1WUIS 4ZAGA 3IIJA 4CEIB 3OO0A 4KQ6A 4Y1EA 1Q11A 3HSKA 5AUOB 2QTTA 3VU9B 1NT2A 2W2XA 4UU7A 3AU9A 2P4UA 1W5FA 5CDGA 2IHZA 3R5TA 5KYKA 3HBFA 1OKKD 5DNYB 1EQ2A 4MZXA 1Z47A 2WTNA 3PDHA 1Y98A 4H1TA 2XDAA 5I9MA 1LFDB 1XGKA 3DL4A 3RU9A 1QZ3A 1VDZA 2ZR8A 3F9CA 4BE9A 5FB3A 4G63A 1IIBA 3INYA 4L02A 1G59A 2JLWA 1YIAA 2RH9B 5D7BA 1J2EA 3ZU4A 3LQYA 1SRQA 3LS2A 4DB2A 1BJTA 4E3ZA 1M1XB 3ENKA 2AC4A 1G7SA 3DMTC 3E1GA 1UDWA 3DKIA 2D0DA 3D3KA 5LQJA 1MC4A 3FFBA 1EMDA 5F78A 4NZ9A 1QR2A 3MHTA 2R3SA 1YU9A 1YBFA 4R51A 3L7OA 4GI7A 2Q4OA 2YDXA 3VSEA 1WF6A 1JT2A 1CIPA 1TO2E 3H9CA 3UWPA 3I05A 3ICVA 4JLBA 3U60B 1USWA 2FFHA 3OT1A 4U02A 1P3Y1 2AN1A 2C9MA 2RHRA 1KZHA 3Q8KA 3BE6A 4HUTA 2VSFA 1AZWA 1L7XA 3E2IA 3O8BA 3ZVLA 1GKLA 3GJRA 5HRAA 3BCRA 1SOUA 1F2VA 1NLZA 3KJZA 2WNIA 4GOLD 3KR0A 4O25A 2GTPA 1NUQA 2GHTA 1DCKA 3HRIA 1X38A 5AUNB 1YZYA 4JI8B 4TXNA 2RGUA 2WILA 3C1AA 1N92A 3GWGA 4ZOAA 5ALSA 2HQBA 1F5NA 1RACA 1RZUA 4MPRA 3ZBUA 5AD1A 3BQMB 4HJRA 4URUR 1DSSG 1HQKA 4YRQA 3VKFA 4BNXA 4GSYA 5HZHA 3FDZA 3BKXA 3OCWA 5GVRA 3U17A 4KH0A 5CEEA 1F60A 3CZ4A 2QAGA 4IFBA 1BC5A 3PGJA 1UPFA 4X41A 3AR4A 3PEFA 3HVUA 5KQPA 3QH4A 5FWXB 3L6UA 1XYVA 1JA0A 3CU5A 3IR7A 1Y4AE 4BLOA 4XUGB 3NRJA 2LV8A 3GDHA 5BOVA 2PPVA 4Y98A 4ACBA 3PGLA 4BVGA 4V3CA 1GQOA 1LBHA 4MINA 1QNFA 2IU3A 3R1IA 3IAS1 4PG7A 4NP6A 4I55A 4Z51A 4NCHA 3VV2A 1WEHA 4R6WA 2GRJA 4TN1A 5FTNA 3MAGA 5AXAA 1VE7A 1IG0A 2AMFA 3H5AA 1AKWA 3VNSA 5DTQA 2J0EA 1KBZA 3TOXA 1V96A 1ZSVA 5EUQB 1AD2A 4OXQA 3NKVA 2VQDA 1LC0A 5EMNA 5LNK1 3GNTA 4DLSA 4R81A 3IULA 4UTOA 3LQQA 2JGNA 3KOOA 5DXFA 4TMVA 1EG2A 1NRWA 4K9SA 2F3RA 4BFZA 3CXUA 3R9IA 4EY4A 4D79A 4EG7A 3C43A 4B3TB 1I94B 1ABFA 4HQRA 2QTMA 1QQBA 4I1VA 2WUDA 5BQPA 4QOEA 4UDNA 1ZIDA 3VR4D 1UIRA 2JIDA 3P9ZA 4P7KA 1VIVA 2X76A 4JLWA 3TXXA 3QUAA 5G2OA 1GTL1 3TNJA 1YUMA 3Q5DA 4HMQA 3G68A 3O93A 3SR3A 4ED9A 5K45A 2CLSA 2FFJA 1RLTA 4N3CA 3F5DA 1D4ZA 4GVLA 4MS4A 3CKLA 2FW7A 4NS4A 4BQEA 5L4SA 2IBSA 1XZKA 2JA2A 2DFTA 2AV6A 2CL7X 3QOFA 4FMCF 5KMGA 5DWVA 4TLLB 1B73A 1T5OA 1RWWA 4AIIA 1ULBA 2W42A 3AZOA 2GGSA 3R0JA 2WNHA 3W4IA 2I2BA 3GPIA 1E2BA 4WDQA 3FYDA 3MUOA 5FA6A 4A15A 2Z8YA 3QPUA 4QAQA 5AXCA 4D0SA 1EI9A 4G41A 4OEHA 4PLPA 3AY7A 4L07A 4F6RA 2BI7A 4JUDX 2AG8A 2J7KA 1CDOA 5K7SA 3OT1B 4ADSG 5A04A 4YDSA 4LVNA 3QMVA 1ZGJA 3OZ7A 1Q7TA 3NGXA 3P2KA 3QA3E 4M83A 4RXTA 4NCBA 3JR3A 4OAPA 3IEPA 1SXJD 4BAZA 2F17A 2I3ZA 3F4BA 3FWNA 3BFJA 5EJ7A 1EWKA 2EJTA 3FNHA 3DFKA 4NMMA 4ZTBA 3LUAA 4B3HA 5A9SA 5CFZA 4UBKA 5TMPA 2CHQA 2WFAA 4OGFA 5KQRA 1R37A 2WZBA 3WYDA 1JLKA 4LJ6A 3RNLA 4B3IA 2N1BA 1Q3TA 1MX3A 3FNEA 2WV9A 4UBIA 3BMOA 4XGKA 1ES9A 2O5EA 4CV3A 1I4OA 4RTQA 3U1BA 2QAGB 4RZQA 1ZW1A 3PQ8A 4RHYA 4YC7A 5AKYA 1Q5PA 3IAXA 4DA4A 4F92B 1PRYA 2DFNA 3IIKA 3IKVA 4QOHA 5JRJA 2X14A 1O0SA 3DZBA 4EZIA 1UDBA 5CH8A 2J3MA 1T9BA 1AG9A 4JI6B 4OK6A 1HLPA 3GNSA 3LXRA 3FDJA 5A05A 5JJCA 2O5CA 3OKAA 5DBFA 2I4NA 4D80A 4M7PA 3ICEA 4RK1A 4I55B 4ZO9A 4FGUA 2BGKA 3KZXA 3KQVA 5EPOA 1MMFB 3H86A 4BLWA 1W88A 1XYGA 4QT4A 5D3KA 1CVIA 4KLNA 1HE5A 1J23A 3DBVO 3V33A 1UBNA 1T9GR 2L82A 1P19A 3C3XA 1MQ9A 1P2VA 2ZR9A 3RVPA 4I1PA 1U7HA 1DV2A 1X86B 2FKAA 3WNDA 1EFHA 2GFHA 5EOVA 1AQJA 1N33B 1M0WA 2B25A 4NCIA 4TKZA 2MR6A 1WQ1R 4LXIA 1SM4A 5EE5B 5GP1A 1EJ0A 1I2DA 1N57A 3OO1A 4IQ4A 3G1TA 1JDVA 3A0RB 1JZQA 4IEFB 4LSGA 1DO0A 3SN6A 1MTZA 1T8WA 4OB7A 1L5GB 2JGRA 2BI4A 2JJ2D 5A4FS 2CNKA 4HV4A 2I7CA 2ZSBA 2J5KA 5HM6A 1OIVA 2FOIA 4G0ZA 4IQGA 1AMNA 3EB9A 4XWOA 1WCYA 1QK4A 4GWLA 4Y6LA 3RT9A 2HMUA 1NRXA 1QYVA 2WP8J 4JJ7A 1NYTA 1ZGBA 3SD7A 2OXIA 1I6WA 1N5JA 2Q8PA 1ISFA 4MS4B 3QJ5A 1P18A 4YAGA 3PLRA 1UC9A 1YASA 2X9QA 3VUFA 2VKTA 5AESA 4AYTA 5EIEA 1FYDA 5L53A 1SO8A 5AW9A 2XNKA 4PYMA 1RXVA 5BSGA 2ZWOA 4MQBA 2C1ZA 2R6FA 2F8MA 1ZP6A 4WKPA 3L5OA 2GD1O 3O1LA 2Q99A 4ZXPA 3ZHQA 2IYUA 1G3UA 3C16C 4ZO8A 3VYVA 2RGNC 1Z26A 1IE3A 3AR8A 4JP3A 3WL4A 2P40A 4BLPA 4BO0A 1EUYA 4WKGA 1JJVA 1LPAB 4O33A 3CCBA 2E5LB 1KYXA 3DZFA 1XHEA 3G13A 3OKPA 2XAAA 3PXXA 4H31A 1CP2A 1LLQA 4B9EA 3AKEA 3MFYA 5IXSA 1EVKA 3M9WA 5B3AA 2OYRA 3RE1A 3DBIA 2RJ3A 3IQXA 5BWCA 2QY9A 2O7SA 3ZWYA 1TDJA 1DHRA 4RY2A 3UMBA 7REQB 1UWLA 3DTTA 5FUQA 2CVQA 5A9SB 1I4DD 3FOCA 4B4UA 2L17A 1DMSA 5K4AA 3OPQA 1SAYA 1VIYA 1XVIA 3LHSA 3ZLVA 4CFZA 3BS4A 4MVJM 3BE4A 3Q2OA 3GLIE 1S89A 1KMQA 2FH5B 4JEUA 4KGZA 4QPJC 1HZZA 3IP6A 3P20A 4AUKA 3QV1A 3BMOB 4IOJA 3GFPA 2PX6A 3PGMA 4RK5A 2ODQA 2WSSA 2H57A 3V1LA 3QXCA 2BLLA 1WDMA 1ZSYA 4NARA 4XVHA 2QYSA 3RS3A 1O1YA 2BSAA 4ZO4A 2EAUA 4NJOA 3D2BA 2R7KA 3DYBA 3DOUA 3MWDA 1KEWA 4AF8A 1Z0DA 1O87A 3PUKA 2QN7A 4ZICA 3R8XA 2VNJA 1DC4A 4BDTA 1B74A 1LNZA 2GTIA 2XEXA 4LJ9A 2COEA 3ASZA 4UM5A 5CJ2A 5THXA 3SSAA 2N46A 4DXDA 5CDSA 3SYMA 3GP5A 4EH1A 1W88B 1BVHA 5BW4A 2CDAA 2WJAA 3DA8A 1Y9EA 3QRWA 3VVCA 1UR5A 1LX6A 3OC6A 1FFCA 1OMOA 1MAVA 1CJKC 2DWUA 1R5BA 2OAGA 3VC2A 3BHNA 2F00A 2ZIUB 2VYCA 5GV7A 5A9TA 1G5PA 3TMKA 3TMAA 1XKTA 3J7TA 3WK7A 4JY7A 3GXBA 1Y82A 4MW9A 4WJZA 1HOTA 1T0PA 3TGWA 2COUA 4OG2A 3U80A 1Z83A 1KH2A 3DLTA 3EAFA 1I30A 2QQGA 4Z7OB 1YQ9A 2ENWA 3TFQA 1SEVA 3TIFA 2ZG6A 3TTYA 5BRNA 3QU5A 1EHYA 1QOZA 4TMKA 1GNSA 3OF3A 3T95A 1YQGA 4LJYA 1ODLA 2UVDA 3KHKA 2JW5A 2PUJA 3IEIA 3PCXA 3PF8A 4DS3A 2RJOA 3WXBA 1V5FA 4CIWA 1NI4B 4Y2QA 3PXBA 2PM8A 1MD9A 3KB1A 3I4CA 5D7NA 5EP1A 4IDDA 3W8EA 4D8YA 2D59A 4LXYA 2I6UA 1J42A 3EPHA 4H0CA 1A9OA 3B7PA 2Y1DA 5EHNA 1CRWG 1Y3BE 3WBBA 4ZJZA 2JIQA 5KTNA 3IELA 4CG1A 1GZDA 2P0YA 3H3FA 1U8EA 3BN3A 1K9VF 4KTVE 4LC1A 3ZHYA 4D96A 1GFZA 4F9FA 5CDHA 1R9JA 3G5AA 3G8YA 3SX2A 2C7OA 1YS1X 3MRSA 4L5IA 1VIDA 3S2UA 1ISHA 2FFBA 3LRXA 4RVOA 2X8AA 4KR7A 2WWTA 1K5GA 2R1TA 1PFWA 2NV6A 2YHAA 4ZJPA 2IS6A 3CZQA 2FJPA 4R8SA 4X24A 5K6AC 4M89A 1J99A 2ATXA 2GZDA 1L5OA 4FDAA 4FFNA 1DIGA 1HUQA 2QR2A 4GO1A 4U7DA 4S04A 2IU6A 1YCDA 2CXRA 4OQ4A 5F64A 2AJTA 5E3IA 5B30A 821PA 1X15A 3K09A 3U4HA 2HB6A 2A9FA 2UKDA 2XOEA 2DTEA 3SHTA 2ZSIA 3WSTA 2DAPA 1NF2A 1J5XA 2YXPX 4PLHA 5BYJA 2XRMA 4QQ8A 3WOVA 4YRLA 4F72A 1N34B 4V0LA 2H1OA 1QE3A 1RLMA 2QTNA 4C4ZA 5IM5A 1RZRD 1MF7A 3PA6A 2JH3A 3ZLBA 4FEYA 4QD3A 1K6XA 2W90A 1P2TA 4MUMA 1ZCZA 4FZRA 2J0SA 5E6UA 5K0SA 1NW3A 1Y3FE 1KDYA 2AB0A 2IPLA 3EEYA 3EGEA 4I9FA 4KQ2A 5IF3A 5A5VA 2VJLA 2VJYA 1N9ZA 2O07A 1UJ6A 3M34A 3LWBA 5CIQA 5D1HA 2OC9A 3MWDB 4D92A 3W8FA 2HH9A 5DMXA 3N1UA 5TB5A 3DDUA 2AEEA 3U44A 2ZPUA 5B64A 4RTSA 3PXEA 1JPJA 4DY4A 2AMYA 2JIBA 2ZT8A 3E82A 4P36A 5SY9A 3D3EA 1C3EA 4C89A 2X2OA 4QDXA 1C1XA 2A57A 3K3PA 2HYDA 3FMPB 2XT6A 3PNPA 4GLOA 1I7LA 1QFJA 3CS3A 4MV7A 1C7EA 4WJKB 4N0EA 1JKJA 2GF2A 1NN0A 3ID6C 3QI7A 2IBMA 2WK1A 3NDIA 2FPWA 1EGQA 1K92A 3SY8A 5EWLA 1VLLA 4F0JA 4L9AA 2E87A 1F7VA 3OEHA 3S2EA 1CQIB 2PS1A 5LP6A 5IDWA 2XXJA 4FS3A 3FI0A 4Q1DA 2EQBA 2G06A 5EHXA 1VXOA 5LC1A 1I6KA 1U2EA 1I3NA 1B8NA 1QDEA 2IGTA 2WV7A 1O94D 2O20A 4AZSA 2XQIA 2JBAA 2CJYA 1BMTA 3QMWA 4BQPA 2F1IA 1YB1A 4B3BA 1YQDA 3WGNA 3Q5GA 1GITA 2X22A 4L5JA 2F1HA 1BXRB 1HY3A 2R8OA 2WHEA 3W1VA 1X92A 2OV3A 2VOJA 3AJEA 4PZAA 2HNAA 1P17A 4OHVA 4U39A 3A1EA 3HCNA 1FSZA 2PCLA 4XLLA 1MN6A 5B6JA 1FPQA 3K4HA 1U7TA 1SB9A 4KEAA 1TO1E 4DZTA 2R9VA 2N9UA 5H0IA 1CS4C 1ZJJA 2JI9A 3B36A 5HX7A 3DZCA 5DMHA 4QARA 1FUUA 4AO7A 2I2WA 1JAYA 4R1TA 3ZHZA 1ZU4A 2GN4A 3TR5A 5DHTA 5FPQA 1G8GA 3U4GA 3TZ6A 1E0AA 1E4EB 2E37A 2KLHA 2OV2A 2R1TB 1M0TA 1RJEA 5BSRA 4ZTZB 5JQGA 2IS2A 3G9TA 4K28A 1QZTA 2F6RA 5MN5A 2W4QA 1DUVG 3A9SA 3KAPA 2P0AA 4QEZA 2NTYC 3CMMA 1NR1A 1R88A 2CVZA 3DQPA 1XO1A 4N3AA 3X44A 1Y6ZA 3G59A 1ZSNA 4G2NA 5E1BA 3E0XA 2J41A 1J1UA 1HFKA 3BQNB 3HLYA 3V8VA 3CX8A 4LG1A 2WYWA 5M7EA 4W5OA 1GYPA 1WKVA 3OFVA 5LXTA 2QN8A 3B2NA 3Q98A 3E9MA 3OE7A 3V1YA 4H7HA 4FYHA 3VXKA 4CIXA 5HZMA 3DPIA 4HQKA 1M2KA 4Q9NA 5E6UB 3GXOA 1YQEA 4D8VA 2PAFA 4K0RA 4EY7A 3GCDA 3AT1A 2VRCA 1E0SA 4F9EA 1SBIA 1B3BA 2KQUA 4ZVRA 4ZHSA 3U44B 1K4KA 1YGYA 3E03A 2CW5A 3CCFA 5EHZA 4U1RA 3RYIB 3CW9A 4A0QA 3WWOA 2CMFA 2KW5A 4QDOA 4ZKEA 1V8PA 4UOQA 3N28A 1JZTA 2HNBA 2XITA 3V8QA 5IK2A 2HQSA 3ECSA 4LC0A 2IODA 3OA0A 4GYWA 2K2WA 3V4PB 3BRCA 4ECAA 1C1XB 4J4HA 3IP9A 4WE3A 1M6HA 2FZGA 4B45A 1GRQA 3AF0A 4YCCA 4PAGA 5A7GA 3VYUB 1XRMA 3KETA 5D5HA 2I5PO 2QLFA 4LCBA 1DQNA 1GT6A 1M8FA 3D4NA 2WYVA 2ZKIA 1QB7A 1S8FA 1G291 1JN0A 1JKJB 1YS2X 1MRNA 2FMXA 2JFFA 2VQSA 2BT4A 2C8LA 3ABQB 1QIMA 3NTRA 4NK5A 1WNFA 4TLCA 2WE7A 3RK0A 1YQWA 4U2CA 3KPWA 1IK6A 1N5RA 1ONPA 1S8NA 4IGEA 2RHLA 4PX3A 3ZUPA 5EWLB 1BD3A 2NADA 4U2EA 3O4VA 5LP6B 4ZANA 2Q5HA 3NOVA 4YUAA 3QMPA 3OEEA 4JJ8A 1B1CA 1NYRA 1SUEA 3FMFA 1H4SA 2PSFA 5FRDA 3RBXA 2ZJYA 16PKA 1FMCA 1SKYE 3B9BA 2JBAB 4FE7A 3FZYA 2CV2A 4DQXA 2PMDA 3MGKA 4CUZA 5A0TA 2AC2A 4ERNA 5CLFA 1LQUA 4KRGA 3H2HA 4MYTA 1WU7A 3U7IA 1RYDA 2HA4A 1MFPA 3JQBA 1E2KA 4DPLA 1UBLS 1J0BA 3PEUA 2ZZNA 1N8NA 3BIJA 3NTVA 3LA6A 4PHHA 4M7OA 2BZ1A 3GUVA 2FF5A 1A96A 3K0HA 4X7RA 4YJ2F 1OFTA 2W2LA 1X1DA 4C4TA 5IC4A 4ZQIA 2OK7A 3OY7A 4HWKA 2OV4A 5IF9A 1XQYA 3ZH2A 2IH5A 4BO8A 4D45A 2DMRA 1RHUA 2PMBA 3WHPA 4RKEA 2OCKA 3EZ7A 4RDCA 4RKQA 3UKJA 2VF5X 4X7MA 4ARSA 2V1UA 2HT1A 3AJAA 1BS2A 3M1LA 3UKDA 4MARA 3R75A 4C01A 5JNSA 5JQGB 2RHCA 1M33A 3RU2A 1XHFA 4H60A 3LC2O 4FS8A 4FJ0A 2P9FA 4Y9DA 5L7YA 5JAHA 1GGKA 1OBFO 3PI7A 3RS9A 5DH9A 3MWEA 3GJYA 3TSWA 1FP6A 3BSWA 4PQGA 3USCS 1JJIA 1H42A 3A10A 3NXKA 4I8XA 4KXMA 2G82A 1Z17A 2JFXA 2Y4NA 3PQ2A 4GX5A 4MPDA 4QUJA 5EFOA 5LXTB 4URYR 1TAQA 2FP3A 2P5YA 4J6EA 1MO4A 3RVNA 1H3EA 3E81A 1GN8A 2O0KA 5CDFA 4S1PA 5IJZA 3VX4A 3MQ4A 1XVTA 2RDMA 3KTDA 3R0IA 1NVBA 4GLJA 4JC5A 5HXAA 1JFFA 1U7XA 3BMNA 2G1AA 4DDMA 4F96A 2C59A 2G09A 3WYEA 3AB8A 2JCBA 4EHNA 1B26A 4RZIA 3AJ8A 2IEIA 1JHMA 1PNRA 1D2MA 2ZJ8A 4D41A 4L0DA 3ZYCA 3HN7A 4EYEA 1Q1AA 2BF4A 3AU8A 4G23A 4WERA 1XPOA 5FH9A 2Z8YM 4FOTA 3KTAA 4XGQA 4ONEA 3RABA 1JG7A 1OU4A 1UBEA 4Q1VA 5F3WB 4LAFA 4C2AA 4RPLA 3EVEA 4M9QA 2OECA 2BUBA 4UW9A 1BU8A 7ABPA 4U7WA 1P7YA 2A3NA 2C4KA 2JLSA 3F4KA 3ROTA 3WK6A 2ZBGA 3LUKA 4AZ3B 5C8ZA 4JT4A 4UUPA 3HL0A 2J33A 3RSLA 4QBHA 3TNDA 1X9GA 4CG3A 3JX9A 5AI6A 1AX9A 2WF9A 2ZTUA 5F3DA 3AEZA 4TYNA 1NNEA 4F9GA 5LKRA 5GJCA 4DBZA 4R68A 2O2CA 3CQ9A 4HDRA 5IAEA 1NTOA 3N75A 1VL1A 1TJ5A 4JSTA 2XUPA 3PFBA 1JHOA 1CRZA 1A8QA 4HPXB 2JFPA 4HDAA 4DIOA 2W6JD 3AUSA 5EVCA 3LF1A 1ULSA 1FUYB 2Q3MA 2GHIA 5DGXA 4PNEA 3IBSA 3JWGA 2GBCA 1CB0A 2HJWA 2WR8A 4B3JA 2E1PA 1VBKA 3I76A 4R9RA 1TLTA 2FN4A 2QD2A 5EIAA 3W2FA 2FXVA 1XZNA 3WBFA 4NCAA 2P2GA 5MDHA 4IQFA 1M74A 3PFNA 2O7VA 3FVTA 2Y1KA 4N18A 1GGEA 1FBTA 4Q4DA 4G0PA 2FQQA 3OZUA 1L9XA 4BU0A 5B3JC 1PZNA 2PZJA 3EPLA 4GVXA 1WOYA 3LP8A 3FCEA 1A8HA 3HM9A 4DJEC 2NTEA 1VYHA 3AFOA 1X1EA 4C0LA 2IUSA 1PVDA 2P2DA 1YB4A 4JENA 2WMNB 3UHOA 4P33A 3DQQA 1HEUA 3FGNA 3LO8A 3Q4GA 2YZKA 1GFSA 1VBFA 1L7AA 4WNIA 3AKZA 2W93A 4PYIA 4B7CA 4D9IA 2ZTHA 2ZRBA 1H5UA 1ZHOA 1QV7A 3GZTB 1E98A 2Z2JA 3WLLA 2WWHA 3F5MA 4JS0A 1PG0A 2QDXA 4QXRA 5A71A 4HNHA 4QPDA 4QRHA 3SJZA 3WHIA 5CFRA 5KZMB 3KD2A 3EXHA 3EGVA 1XLTA 3MWEB 2NM0A 5E4TA 3TL2A 1AQYA 1C8LA 3BH6A 2PVCA 4GPD1 4CCYB 1JR2A 1BRMA 3FOWA 5H83A 5ADHA 1M3SA 3AHJA 4LV6A 2I54A 1BX0A 3FIUA 3D6NB 4BGDA 1Z12A 2HPHA 3I73A 3TQOA 1H05A 1GUAA 4MV5A 1FS6A 4LF4B 1YK0A 1IHXA 1L5SA 4C21A 1PJLA 3BMNB 5DULA 5FBZA 5JALA 3RF7A 1W36D 3RV3A 1YNSA 5CA0F 3VAAA 2FGKA 2X4LA 1MO5A 2ZDHA 3PNBA 1TJNA 4XWAA 5T6MA 4BAGA 3DYIA 4PRLA 3W5JA 2GN6A 4KMSA 3ZH9B 4CF3A 3NHPA 5FEMA 4D25A 5IT0A 4R0NA 1WG8A 4LXHA 4R2JA 1FP7A 1R0BA 1MJGA 1IHUA 2W22A 4NCXA 5KNDH 3GLGA 1YKSA 4K86A 1RYFA 3KTAB 2OP1A 1MFZA 1KSGA 2IXFA 4YV2A 4YUYA 3MD9A 3FB4A 1U80A 2G0TA 3AR5A 2CYBA 4WY2A 4N39A 1Z8NA 1ZUD1 4F4JA 3FCOA 4BLSA 3I09A 3ZEAA 4D9KA 1AS3A 1GGMA 1XZQA 3IP7A 1DX6A 2E4AA 4FDTA 1OI2A 1PL0A 2W2MA 3RAPR 2N3ZA 2VXBA 4AECA 1PNVA 3LVFO 1AY0A 1ETHA 1Q12A 4P54A 4BVHA 2UUAB 3QE3A 1VDMA 1VMDA 3U7JA 1IVYA 4U4AA 1RM3A 2LW7A 2PGAA 4CEJA 1AHPA 4AY5A 1I2BA 4HDRB 4NFSA 4EG4A 4Z7QB 1IIRA 1MRZA 1JEJA 1DCMA 1D9XA 3MRTA 4G07A 2Q9CA 3EFHA 3AETA 2VTKA 1C1DA 3A4MA 2HMAA 3ROMA 3G0CA 1V1JA 1OA1A 2AXQA 4G5XA 4XI9A 1RWBA 4N5DA 4G4SP 3ZHUA 3G7UA 2R66A 2C1XA 4HX9A 5HZKA 2YOHA 2XUIA 2F62A 3QU2A 3VDMA 4DV1B 1P1CA 1E8NA 3ZY5A 3KK0A 1JLLA 1UBGA 3EGDA 3M6XA 5DNAA 3V4ZA 3P7MA 4MVWA 1M10A 4ZKDA 4FFVA 2YRFA 1ZHHA 4UMFA 1RJ9B 4U3JB 3QWFA 4GX1A 4TV8A 4BNHA 3HSSA 4ZCSA 2N75A 4IGKA 2YW9A 4LMRA 3SHOA 4MGIR 1VB3A 1B6TA 1VJDA 2AWNA 2X8JB 3RIHA 3ZWVA 4JUFA 4RHEA 1P1RA 1JDSA 2H92A 3EIXA 3H8WA 4W8HA 1FZTA 2PGIA 4Z0PA 3CSSA 2IE0A 3CX3A 3OKCA 3TRIA 4P35A 2NSHA 2O2HA 3PI6A 5T6BA 3VKUA 4BGIA 2C78A 2ON6A 3LVBA 1CQXA 1DINA 1MEEA 2A0KA 5TGTA 3T7JA 4B2PA 3TI7A 2N1MA 3A9RA 1Y8CA 5E2BA 5FF9A 1RHRA 5KYXA 1G9XA 3LYAA 4EYQA 1XJQA 1M8KA 3E2PA 1QIIA 1SBQA 1G8FA 1X7HA 2R6HA 4BX8A 3OOHA 3TCNA 4IZOA 4BKQA 1GNPA 3EXHB 3OESA 5HIIA 1VE9A 1KI8A 2CGEA 2SBTA 2GASA 3E0QA 4KNVA 4MRRA 4OD0A 5BNZA 4FDLA 3N2YA 1T2CA 3FW1A 3ZS8A 1V5GA 4PU0A 1QU3A 3VNQA 3KSZO 1PJ3A 4CL0A 1KK2A 5AKEA 1DAFA 4M53A 3QFHA 3GY0A 3KTOA 1QUFA 1I7PA 3K94A 1I7DA 4EG5A 1KK1A 1M1UA 1NMSA 1PJQA 2JKZA 2VHTA 3PUHA 2DVMA 4HEHA 4XE5A 1YB6A 2DPXA 1J21A 3ESAA 3QXJA 1RHJA 4ZU6X 3NYQA 3RVRA 2KPOA 2H54A 3HCBA 3PCRB 2JCXA 1JAHA 4HL6A 3RVKA 5KNBH 5IHPA 1NC1A 4RMIA 5H9VA 1SA0A 2HAEA 2XD4A 4B3MB 1J1ZA 1D8TA 4DR3B 1XRLA 4M8KA 1FP1D 4RELA 3OPVA 1Z08A 3T9DA 4INJA 3T94A 1Q15A 5I4IA 1C2TA 2HU2A 3LKDA 2GJ4A 3QUQA 5T67A 2F1KA 3S1AB 4CE6A 2RGAA 1EK2A 2PRJA 1U9IA 3LGAA 1ZEJA 4MRPA 4IVNA 4OA8A 3VH4A 2OV6A 4EA9A 4EI7A 2WQ6A 1ML4A 4Z1MD 1XAHA 1TO6A 4W5TA 2YZMA 4IQ0A 5FOVA 4E0BA 2G40A 3CRNA 1Y42X 4L3WA 3C1TA 2PKCA 5D01A 4O2LA 2EGHA 1CY4A 1J90A 1TT7A 4YMGA 1E9AA 2GA8A 5DGDA 5KBYA 3UWSA 1IZ9A 3KTFA 4CEJB 2CLDX 4TYWA 2YW2A 4OUDB 2ZDGA 1GXSA 2FEWB 2BZ0A 5K3AA 1E64A 3BG5A 2LZ0A 3EA5A 1G4HA 1OGIA 5L51A 4NJEA 3LUBA 3KS9A 3VJKA 3FLEA 1M72A 2ZRMA 1W75A 1C1DB 3AETB 3W04A 4FW9A 4B3CA 3LVQE 1R8SA 1SUAA 2ODNA 4JJIA 3JWJA 4RACA 3TDKA 3KUXA 3Q3IA 3NUGA 1JDPA 4J7CA 1WL8A 1MA0A 1NNSA 1VG9B 2XDQA 4W1QA 2QVYX 2YYSA 5BSFA 1KDPA 1JLLB 3ABSB 3EGDB 4OB8A 3RWBA 4FLMA 4JQSA 1G8PA 4AMYA 4F4HA 5TX7A 1VPTA 2FEOA 5G1NA 5B2EA 4TV8B 2M2IA 4FUQA 4HDMA 4J91A 3C6BA 1JHAA 2I22A 2FFRA 3UYKA 4BP1A 2IF0A 2EWMA 5I7SA 2KYRA 3LWZA 3A2KA 4MVCA 4B33A 4ZGBA 1KARA 4UE6A