3CWZA

Structure of rab6(gtp)-r6ip1 complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
166
structure length
166
Chain Sequence
RKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGLERFRSLIPSYIRDSTVAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Ras-related protein Rab-6A
publication title Structural basis for recruitment of Rab6-interacting protein 1 to Golgi via a RUN domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2008-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3cwzA00
3LBIA 5JEDA 1OYYA 2ZJ5A 1COWA 2J0QA 4A8JB 2H57A 3IEUA 2GZDA 4OI4A 4HB3A 1FTSA 4LYHA 2W0MA 3H1TA 1G8GA 2IF0A 3GLIB 1JECA 3ND8A 5EP4A 2AD5A 1H8HD 3UKDA 4B3FX 4NPHA 4A8JA 4D4JA 2DB3A 1NSFA 2A5YB 2IXEA 4BRWA 3AF3A 4JJKA 1IN5A 1GRRA 2F9MA 2ZR9A 1WDTA 2R6GA 2YWEA 5KDLA 2AK2A 2CXXA 3B2EA 4MRNA 1P4SA 2A5GA 2BMJA 3K0AB 3L0OA 4Q1CA 4BEJA 8OHMA 2BMEA 3SU8A 1R5BA 2F43B 3B1YA 2PJZA 3BB4A 2IK8A 2EFDB 4PANA 4TZ6A 1S3SA 1QHXA 4V0OA 2C03A 4U7DA 2IYLD 4GI7A 1W2HA 4DWJA 5HKKA 4M4SA 5B64A 3MRSA 4DJTA 2YVUA 2ZU0C 4HAUA 3K0AA 2BVNA 2W58A 3TAUA 2F43A 3T61A 3LAWA 1HUQA 3PG5A 2J7PD 4G0NA 5FOUA 4EFLA 2VP6A 4O2RA 1XWIA 3QY0A 2ZJAA 3IDQA 4OQFA 1OH7A 1Z0FA 3L0PA 3PR1A 5B58C 1GSIA 4PZYA 2A5DA 1Z07A 1YZKA 3JVUA 3LA6A 2JJ8A 1UKYA 4IVRA 3NEYA 2OUKA 2YJTD 1GL9B 2WOOA 3LDAA 4KSBA 3BK7A 3ADKA 4RZUA 2AX4A 3R20A 4URWR 1N0VC 1QHNA 3BC1A 3QJYA 4KLNA 3IIKA 3T1OA 1IXSB 3BXZA 3RDPA 3A37A 1SHKA 3HPQA 4GOKA 1US8B 2FFHA 1UADA 3RC3A 3ZVRA 4DLRA 4C2TA 3FE2A 4HLCA 4BLOA 4JLVA 4QHSA 1F6BA 2OAP1 4TT3D 5SZJA 3Q7QA 2A5FA 1W5TA 2JIZA 4YXWD 1NKTA 3TSOA 5JEEA 1G8YA 4V0LA 4RKFA 4TMWA 1US8A 3THYB 2QY9A 2ZUBA 4DIDA 2CLCX 2IT1A 2XTMA 1ZNXA 4DLXA 1QDEA 2LCFA 5EE3A 1E2JA 3D6TB 4O25A 4AKGA 3SJBA 4L8GA 3RRYA 2GJAA 1EK0A 4C7OB 2KE5A 1GKYA 4Q01A 3V00A 4KLZA 2XZPA 3MG9A 1DAFA 1T3SA 4BFSA 3Q5EA 3THYA 4DT1B 1UBEA 1WE2A 4AKEA 2DWPA 3Q5DA 4I1VA 3C7KA 2QRNA 1RRCA 4C7OA 1XMSA 4IXMA 1DAKA 4GOJA 2FN4A 3QXJA 3K9NA 3FMIA 4HDCA 1LTQA 4YC7A 2BCJQ 5DI9A 4DT1A 2NO7A 3NBYC 4PAOA 5CIWA 1DAHA 5FBRB 1G6OA 3NKVA 4PC7A 4I99A 2OV2A 2BBOA 5EXSA 1Z5ZA 1QBKC 3T1VA 4JLJA 4MRVA 4IDHA 1HY3A 4IDPA 2RMKA 3QKUA 3A1SA 3PEUA 1SULA 1FL9A 1IN7A 1S2MA 5CB8A 4TYNA 1TU4A 2AKYA 1JBKA 1OHHD 1EFRD 1XTJA 4FMCF 1EWQA 1SGWA 1SXJB 2C99A 4GNKA 1U9IA 1HE8B 4PO8A 1CBUA 1GIAA 4NYJQ 4DLTA 5TY0A 2G88A 5FUWA 1T3LA 2B92A 4OQNA 2P0EA 4KHZA 4MQBA 1RJ9B 2C04A 1EX6A 1G6HA 2O0KA 5EXTA 1XZQA 3K70B 3RABA 2PX3A 1VCMA 3P1JA 2ZUCA 3KKQA 1SXJA 4C0HA 4D81A 3O8BA 3QXCA 1VMAA 4JVSB 2OILA 3IPXA 2JJ2D 2W2TA 3CR8A 1TU3A 4BLPA 2V1XA 1DO0A 2J3EA 2ZRGA 3I1FA 4JBYA 3U4QB 4WXRA 1K5DA 4DB2A 3CWZA 1P9NA 5TXGA 1E0AA 4B33A 1E9DA 2RGEA 3IQWA 2IUUA 4LHWA 3KKMA 1SVWA 3B8HA 5BN4A 3GD7A 1MO6A 1W5SA 1FTNA 3T5GA 2BKEA 1X3SA 4OL0A 3U4QA 5FPKA 3K8YA 3CF2A 3H0KA 1G8PA 2XTZA 3AGPA 2ZYUX 1Z0KA 1E1QA 2XX3A 2X2FA 2AHOA 4LRWA 4M1OA 3C15C 4M9XA 1K5GA 4RZ2A 3SYNA 1Q0UA 1R8QA 2R65A 1R8SA 1YHNA 2RH5A 3DZDA 3KKOA 2V7QA 2ZYWX 1ESMA 4PHFA 3VR5A 1ZNWA 1E4VA 1A5TA 1NN0A 5TV2A 4US2R 5EZ5A 3I73A 1YR6A 1OW3B 3WY9A 2WVJA 5E7JA 5AJZA 3TR0A 4ZKEA 3GCGA 4URXR 1XB2A 2OLKA 3RWMB 3VHXA 1M1YE 3V4FA 2ZRKA 3W6OA 4YMTA 3KB2A 3GFPA 4TL8A 5G53C 4QKQA 4ZCMA 4JS0A 4A92A 1CR0A 2MSCB 4WZBE 1E94E 1M34E 1E98A 2ZXUA 2R6FA 2G0NA 4DLZA 4HSEA 4TYQA 1AS3A 1A4RA 1Z0AA 3I72A 3ZZTA 4M22A 2IWHA 2W83A 3PVSA 4KFUA 4NDZA 3U6BA 2FGKA 2AK3A 2H16A 3CWQA 2GHIA 2ZJYA 4LHYA 2Z5FA 1JPJA 1ZUIA 5AR1A 1OF1A 1W0JD 4HAXA 2OM2A 1W4BA 3W9YA 2VP4A 3GJ3A 3L0IB 3K0EA 3QXHA 3X1ZA 2ODBA 1G4UR 4PC6A 4TN1A 2FF7A 1GKUB 1PUIA 2JEOA 2WAYA 1OFHA 3P20A 2NO9A 4F4IA 3OF5A 2C2HA 2WWWA 2OCAA 2XB4A 4WW0A 4E03A 3IGFA 1S96A 3AH8A 3GP8A 4ZDWA 2X77A 4MITA 1FMLA 2I1QA 1I2MA 3GJ6A 3TUIC 4Q4JA 1GP2A 4PAMA 2H1LA 3CO5A 3F3YA 5CJ2A 1QG4A 1GDDA 3WRYC 5CM8B 3DKVA 1R4AA 4Z54A 1IXZA 5KNDA 1F5NA 2XJ4A 2CL6X 1E4YA 3ZIAD 2ORWA 3EASA 4D6PA 2F55A 4P0TA 1JB1A 3N2IA 2OE2A 5E7IA 1RRPA 1U90A 2WV9A 3U7HB 4B34A 3ZVNA 3V4RA 1TUEA 2R6DA 2UVQA 4BFXA 2OG2A 3FB4A 1QG2A 1XD2B 1CLUA 2N46A 1S4QA 3QKRB 1AQUA 1WCV1 1QZXA 2GEDA 1II9A 5F3WB 2ODEA 1ZM4A 1NMZA 3KQKA 1IOZA 2ZJ8A 1NVUQ 4R7ZA 1CRQA 3LVRE 4A0HA 2ZI7A 4QBFA 1JAHA 2OXCA 4XWOA 1BOFA 3IILA 2QT0A 3QKRA 2YWHA 2XJ9A 1CJUC 3BB3A 4Q1EA 1KKLA 3OFND 4RD4A 2ZJBA 1KI4A 3AF4A 3QPVA 2ODNA 2D2FA 1L8QA 2BM1A 2GZHA 3BD9A 2O8DB 4KO8A 2GEVA 4DLVA 1OYWA 2HJGA 3VU9B 2GEUA 4MRSA 1XPRA 3WP0A 1NSTA 2B7CA 4NCHA 5FBWB 3MFYA 4RFVA 3IO5A 3A1UA 5FH9A 3KUCA 3E5HA 2DWOA 4IXNA 5C2JB 2JLQA 1CF4A 2SHKA 4PX9A 2O8DA 4OHVA 3VU9A 3PEVA 1G19A 2ZRMA 4JSTA 3BJIC 4URUR 2D62A 3ASYA 4TT3A 3EPJA 3R7WB 3X2SA 1XNJA 2QORA 3EIHA 2WJJA 4BE7B 4NKRA 3TE6A 2GVDC 3Q72A 1COWD 2Q3MA 2QN6A 2QT1A 4Y0VA 3BS4A 1U8ZA 2EFEB 3OHMA 4DCSA 1LW7A 2JAQA 2GCOB 3W6NA 4DSNA 1KSHA 1T5IA 4US0R 2O8CB 1XEXB 4BFVA 1F2TB 1YKSA 4BASA 2VL7A 1GWNA 1Z28A 5KOYA 3C4JA 1KJZA 1T91A 3R7WA 3I92A 4PFSA 1T8UA 3SJZA 4KFTA 5HZHA 2DYKA 4QJ3A 1T8TA 3W3AA 2ORVA 3MWYW 4PHTA 4LJ7A 4LK2A 2YOGA 2ZRBA 2WKQA 5EXPA 2GF9A 2GCOA 3GEHA 4Q7KA 1XEXA 4B2LA 2OFXA 4NMMA 4Q66C 3BIFA 2WICA 5EXXA 2VSOA 4QM7A 1F2UB 2FEOA 2IYQA 3GLHB 3W3ZB 3KFVA 1GOTA 1TF2A 5HKKD 2PJRA 3NDBB 2J7KA 4OQMA 3NHBA 4MH0R 2J46A 3CNNA 4DEXA 1W0KA 5FOXA 1MR3F 5KDOA 1II8B 1I4TD 4IDQA 3THWB 4CGZA 1J90A 2UZIR 1SQ5A 3DOEA 3QQ5A 5CYOA 721PA 2V8OA 2WWHA 1ODFA 1XPUA 1Z6GA 1AKYA 1TEXA 4Q03A 1NJGA 1A82A 3GLHA 4FINA 5H70A 1G7TA 3OZXA 4P4TA 4CEHB 3CLVA 4PPGA 3LD9A 1XZPA 2I1VB 3AP1A 2WIAA 5EP2A 3SFZA 4IEEA 1Z0IA 1FP6A 2NO0A 2J5XA 1BYUA 1II8A 1G7CA 3REFA 3THWA 4U5XA 1OHHA 2B21A 1NJFA 4BGDA 3MJHA 2O8BB 2HV8A 1OH5A 1DVRA 2GKSA 4CEHA 4XTRA 1SVIA 3HU2A 1G21E 2EU8A 4DLYA 4KSCA 2IS4A 2CL7X 4OHXA 4H1UA 1UAAA 1KI8A 2IA5A 4IVPA 2WHXA 1VG1A 4MUBA 4A0RA 1R0YA 2H17A 2O8BA 4A82A 4F7WA 1I4DD 3B85A 3CX7A 3L0SA 2BHRA 2AFHE 2JJ2A 2CLDX 3B78A 3GLIE 5FL3A 2JIZD 2WJIA 3TJZA 2GCNA 1KSJA 2F1HA 1P61B 4AURA 3EZ7A 4FD2A 1G3QA 2GESA 2RGGA 3VTKA 4JL6A 3RSLA 2IYZA 1G291 1MOZA 2XOKA 2ZE5A 3GJ7A 3MLEA 4QFMA 3ZS9A 5C4GB 3SQXA 4JL8A 3LW8A 4TTPA 4C0AC 2JLVA 3VNVA 4D4MA 2BCGY 5AK0A 1MRSA 4CZ2A 4PXAA 4S35A 4DSOA 4ZI2A 2R6CA 4OJQA 1X8LA 4JBXA 4A36A 3SBDA 4HB4A 4QNMA 2XZLA 3M1IA 2R62A 1KDTA 2FSGA 2ZVPX 3DM5A 4NZYA 5EZ6B 3T06B 2XNDD 4EFNA 1TF7A 1E3MA 3REGA 4CT4B 5IRCD 4M2LA 2VPPA 4B76A 1AGRA 4NP6A 1AS2A 2QGNA 3RRZA 1O3YA 3OIUA 1XEFA 3HJNA 5JWOA 4J0QA 2XITA 3EW9A 2FX3A 2K5UA 2VBCA 4L9WA 3VMFA 2G3YA 1EFCA 3BERA 1G7RA 5CK4A 4B3GA 2D7DA 1TX4B 2F6RA 2HUPA 4BFWA 4BUJA 2N1BA 2A9KA 4JVMA 4HLDA 2CEAA 1Z0DA 5CYPA 2CL0X 1VIYA 4XD7A 1LV7A 1SZPA 1N6HA 4BFUA 1MV5A 1NNEA 1SVMA 3FOZA 2PZEA 2MMGA 5FOVA 2VF7A 4YDSA 3R9XA 4M1WA 1ZVQA 2AD1A 2CHQA 3OIWA 5AUQA 1EGAA 1HEIA 1W0JA 1AM4D 2RCNA 3KJHA 4WZAE 1Q57A 1SXJD 2QE7A 2CHGA 2J0VA 2QM7A 1P73A 4L4UA 2HYIC 3QSYA 3W8RA 3MAAC 3F5FA 4LC1A 3VNUA 1T5LA 1XCPA 2FOLA 3K70D 1XDBA 2FFAA 4JYBA 4U02A 2Q9AA 5JCPA 1N6NA 5FPYA 3TR5A 5JMTA 1G3UA 1TNDA 4A2WA 1OXVA 4LSGA 1JQLB 2G83A 5HTKA 1P2UA 1SVOA 3B1ZA 3SC3A 4O3MA 1S3GA 3A1TA 2QP3A 3BRWD 3X1WA 1NMYA 4YMVA 2DFLA 3EIEA 1N0UA 4TQUS 1NL3A 4ABYA 2DHRA 3K0FB 3TAHA 1N0WA 2ZI4A 1ZD8A 2ZTSA 1CIPA 3P4YA 4X8HA 4KYIB 1V43A 2B6HA 1LFDB 3BBPA 3WYFA 2QM8A 4A15A 3FFBA 1W36C 2NG1A 4JBWA 4ACAA 2PT7A 5F98A 1JEEA 3ZQJA 2QPAA 3KKPA 3K0FA 1UEJA 1XP8A 2ZYVX 5BYKA 3BE4A 2I4IA 3K0CA 4Q9IA 4MDFA 5LD2B 1T3HA 1N6KA 5JECA 1MKYA 2WMNB 1FX0B 2R6AA 3LLMA 1S8FA 1Z83A 4M1YA 2NPFA 2WWGA 3OIYA 2G1JA 2WSSA 4JT2A 2FSFA 4GDFA 1ETUA 1SXJE 4GZMA 4DRZA 1TQ4A 1YRBA 3IUYA 3ZVLA 2CJWA 1E1RD 3ZLJA 2QTHA 1FX0A 2RGNA 4YQFA 2QBYA 4JVNA 1EFTA 2QPOA 3VQTA 4Q4AB 3R8CA 4QHTA 1CRPA 2G9NA 2BOVA 4O2LA 2LKCA 4JLAA 3FGNA 1XPOA 4B3XA 3AV0B 1JALA 4TYYA 3NEJA 4QNRA 1XTRA 2EWVA 1Q1BA 1U8AA 2WWXA 2A2ZA 5L3SB 3KXKA 4OK5A 2FGJA 5KPJA 2JLSA 2CVHA 2PZFA 3AKYA 4HZUA 4Q4AA 5JHGB 4TQ9A 1OB5A 2QMOA 1A2BA 1G5RA 2QZ4A 3EC2A 4PSKA 1ZRHA 2WPDD 1Q1QA 4V0KA 2XNSA 4I1SA 4GFDA 1W4RA 1U8YA 2A5JA 2GXQA 3EARA 4MUAA 4ON9A 4PC2A 3T5DA 4D0LB 5AUNB 5L3SA 2WWYA 1ZNYA 5FOSA 1E79A 1AQYA 1G8HA 1ZU4A 4M9ZA 3U3JA 2F7SA 3WYGA 2ERYA 4LJ8A 4BFTA 521PA 4UNNA 4QGFA 3UATA 2EWWA 4CF7A 1Z22A 1AS0A 2HCBA 4GMXA 4BECA 2GJ9A 2GWHA 1JR3A 3GJXC 2PMDA 4KFSA 4F4JA 2OFOA 2NIPA 1MT0A 1T4GA 1A2KC 3QUSA 4HDOB 5C18A 2BBWA 1RRGA 2QGZA 1G8FA 1G18A 3QKTA 5CIQA 2C9YA 1HYQA 2VO1A 2ZAOA 4LX0A 2IHBA 3GLIA 2GXUA 1Z2CA 1G3IA 3FMPB 4TZ0A 2GRJA 4DSUA 5FUYA 2YV5A 3SJAA 4FN5A 4BFYA 1NVVQ 2BIFA 5CDFA 3MWLA 1YRAA 3LX5A 4IOMA 5F2EA 3SHFA 1KK0A 3TW4A 3BGWA 1E69A 2Z0MA 3I32A 1CR1A 2O8FB 3ZJYA 3L8ZA 4PZLA 1LS6A 2LWIA 4KITB 4DC9A 5H68A 4KBFA 4IVQA 2NZ8A 1G17A 3A4NA 1QVRA 1KAGA 3PFIA 4CVNA 3V9PA 5FBQB 1GUAA 4B73A 4MKIA 1YZTA 4QBHA 5JI3E 1H8EA 5TVKA 2O8FA 4LI0A 3KQUA 2CCKA 4B3BA 4EPTA 1YZQA 3GLGB 1Y63A 2EFHB 1HV8A 3CBQA 4ZPXA 5F9FA 5FI0B 5FR2A 4JJZA 3IIJA 5H1YA 2BMFA 4D26A 2BKUA 4PTLA 3CZPA 1KO1A 1OXXK 4O0MA 3RS5A 3WP1B 4V03A 1R10A 3EZ9A 2DFTA 4TMKA 1W48A 4XH9B 3SS8A 1E9RA 4JLDA 5IDVA 4F93B 2ZSDA 4M8NE 2BJVA 3WNDA 3ZZUA 1OXSC 4NYIR 2CCGA 1L7VC 1ZM2A 2FEMA 3HR7A 3L8YA 1TAGA 4W5JA 1A7JA 3SI7A 4E22A 5GADl 3D8BA 4R2HA 4LY6A 1OB2A 4M1TA 2JLWA 3WBJA 5K8LA 1VG9B 1TPZA 3MWKA 1YR7A 4IFEA 2H7VA 4I4LA 1XFAA 2REXB 1E9EA 4HYYA 1GVNB 2XSZA 4TSFD 1YQTA 2IC5A 2JGNA 2ZU6A 4JL5A 4EJSC 1E32A 1YZNA 1VHTA 5M04A 3T34A 1KSFX 2P3SA 3RS3A 3RS0A 1AN0A 1KTVA 2B7BA 4JYCA 1SVKA 4DSTA 2A7QA 3EPLA 1P9WA 1AJEA 1NMXA 3CR7A 2V1UA 4URVR 2C96A 2EFCB 3PQCA 2ZS7A 2ZQ5A 1KK3A 5IHPA 1WF3A 2Q0HA 4G5RA 4URZR 2XNDA 3OESA 1OLOA 2GZAA 3EAQA 4KV9A 2H5EA 4P4UA 1F48A 1GL6A 5DIFA 5EJEA 1W0KD 3BFKA 2HXSA 3P26A 5G3YA 4LPSA 2WKRA 5J5CA 2MSDB 2ZE6A 3ZYCA 1IAQA 2PX0A 1FMJA 4CRWB 2QENA 3AKCA 2ZI6A 3NWJA 2ZI9A 3HPRA 1OKKA 1G1MA 1Z0JA 4KFRA 4MKFA 2J0SA 3GJ8A 4YLGA 4NYIQ 3G5UA 4NCKA 4QHYA 4QJ4A 2BV3A 4FMDB 2EQBA 2F1IA 1XD8A 1KO7A 2R9VA 3A1VA 4JKYA 4M1SA 3UK6A 4BPBA 1WMSA 3N70A 3UMFA 4CEJB 3CNOA 5DYIA 4TMZA 1ZMXA 1HE1C 2QROA 4TLAA 1GZSA 1XJQA 2OAQ1 3SE0A 5AJWA 3QEOA 2ZANA 4G1UC 4GMDA 4CEJA 1ELOA 4L16A 4QGHA 1N6LA 3RHFA 1L4YA 1RJ9A 4HLUA 2V55B 2R44A 3MD0A 4RD2A 2ORIA 3AGQA 2PL3A 3P4XA 4Z1MA 4ZDKA 1RPZA 2VSXA 1DBSA 1XTQA 1IY0A 3B1XA 1QF9A 1X8JA 1ZJ6A 2O52A 1CULC 2XOKD 5G41A 5L8VA 3K53A 3O8CA 2KBEA 1NBMD 2O0HA 2IXGA 3N5CA 1P5ZB 2XAUA 3DOFA 2F3RA 3SYKA 1NVXQ 4XWKA 1VTKA 1JPNA 2CLSA 3NTUA 3VKWA 3PUYA 1E2HA 1G5TA 1QHYA 1W4CA 1J2JA 2KWIA 3GLHE 1GNRA 1KO4A 4DDVA 2WTUA 4LUCA 3M6AA 3W6PA 2GJSA 1VG0B 1UBFA 3B9PA 2OBMA 2P6NA 3C16C 3ZQ6A 2RGNC 4MYCA 5CLQA 5FTMA 4XIGS 2VQSA 1G4AE 3PUXA 3U60B 2GVZC 2PLFA 3P32A 1JXOA 1DADA 1KY2A 1YZLA 4IOKA 1CJTC 1UKVY 5FPTA 2GJKA 1KMHB 1S9HA 3CIOA 4QJ5A 4Y0AA 2IF2A 2EVWX 4Z8XA 5FTJA 1WBDA 1KY3A 4GP6A 3TIFA 2BEKA 4MKGA 2EYUA 4M0LA 1JAIA 5J4KA 3RYTC 3ZZ0A 3QF7A 4B35A 4DKXA 3RS7A 2FWRA 2DFNA 1VYUA 3DHWC 4C4PA 1KMHA 4E5UA 1E1RA 2QAGC 3PEYA 1GITA 1WA5A 2ZJZA 5C1BA 1ZW6A 2IYRA 4OJKA 2GCPA 1KI6B 1IN6A 4LYJA 2V54A 2HF9A 4ASUA 1X86B 2RHMA 2ASEA 4PHGA 4XD7D 3EWSA 4QXAA 2X1VA 3QXXA 3DMNA 1Q3HA 1NBME 1YE8A 1M7GA 3TLXA 4Q4HB 2YHSA 5K8UA 1ZAKA 2ZSFA 2JLZA 3SOPA 4GSYA 3WMEA 5J40A 1KI6A 3NBXX 3BORA 1KK2A 2QE7D 1P62B 3BH7A 4A8JC 4KVAA 2HT6A 3CF0A 1XX6A 2G77B 1NN5A 1MABB 3QKSB 2WPDA 3FPAA 3SYLA 4JSYA 5JS7A 4Q4HA 1UDXA 3NDPA 4ZI3A 1BO6A 5FOWA 5C46F 2XXAB 2IYSA 1EFHA 4B3DA 4TLBA 2QQ0A 1BMFD 1CR4A 4PPNA 3X1DA 3BH0A 3MJRA 4ZO4A 3W5IA 2WM9B 1JNYA 2KSQA 1HURA 1VIAA 5LDDC 1MABA 3QKSA 2F1RA 4MA4A 4WZ6A 4TYPA 3UPUA 4JLPA 4BLQA 1KDOA 1I4LD 3LXRA 1G41A 4II7A 3K9HA 1NI3A 4DXAA 2REOA 2FV8A 3EPHA 2C98A 2IYUA 4DCUA 1OV4A 3PIRA 2BDTA 2B8WA 2BJWA 4Q1FA 4U00A 1FZQA 4QL3A 2OLJA 2WOJA 3IBGA 4FXPA 1OH8A 3TSZA 3H2YA 3VR3A 4LJ4A 3C5CA 2ODWA 2Y8EA 5J4HA 4ZKDA 1GAJA 5JI2E 4LJAA 4NCIA 3B13B 4TLDA 2ZRFA 3CH5A 5HE9A 4NL4H 1RFLA 1VCNA 2WSSD 1OJLA 2IYWA 4HAVA 4K8OA 1QHGA 1PJRA 3SZRA 3U6KA 1XD2A 5DNYB 4V0NA 4C0QC 1V5WA 4D4LA 4UNSA 5DGXA 3A4LA 3GLFE 4Q9KA 1QVAA 4NYMR 4DDUA 4B44A 2NQ2C 2RGAA 1XMIA 5AJXA 4NBSA 1U94A 3VKGA 5E7MA 1W36B 2QL6A 5L3RA 5BW8A 4K46A 5IT5A 1P6XA 5TB5A 2GAOA 1OFIA 1VDZA 2ONKA 4D80A 1P2VA 1NLFA 3EWAA 2ZITA 3LRPA 3CUEF 4P3YA 1DPFA 1BH2A 4LWZA 1GKIA 4XSGA 2JLRA 3O8DA 3MMPA 4Q00A 4YDHB 3A4MA 5FTNA 4N1AA 4OI0A 1XTKA 1KDPA 3D31A 4C0LA 3NC0C 1I2DA 1W1WA 4YMSA 5ANRB 1E2LA 1E79D 1YR8A 4YMWA 1G5PA 1U0HC 2RHDA 3CRVA 4MYTA 4DDTA 2P2LA 1AZTA 3NHAA 3LVQE 2IYTA 5FPHA 5FPSA 5L3VA 4QGAA 4FMBB 1EG7A 2IXFA 3GJ5A 3H4MA 1QHIA 4MYHA 1DAIA 3TK1A 1DAMA 1JR3D 4TSFA 2RKOA 4F38A 2QQEA 4RY2A 5AUPB 3AVUA 2FU5C 1RZ3A 5JS8A 2CVFA 2KI5A 4EUNA 2AXNA 3HR8A 1Z6TA 1NP6A 2BEJA 4AKHA 5HZKA 2OT3B 3DL0A 5CLLA 3LY5A 1FFHA 2GXSA 2O8CA 1F2TA 2ECKA 1ZYUA 4AD8A 1XXHB 4C0SA 1QRAA 4Q7JB 2Z4SA 4H1VA 5KO2A 2CE7A 1Y3AA 2QG6A 3KFXA 3VR6A 1U9IC 1KO5A 1QHHB 1T6NA 4FWTA 2V6JA 3PEWA 2H92A 3AUYA 1ZP6A 2IUSA 4LYFA 4UJ3A 3K09A 1TUIA 2VH5R 2I3BA 1XXHA 3ASZA 1S0UA 1ZIOA 1XTSA 1E99A 5JBQA 1F2UA 2ANCA 1SXJC 1J8MF 3T15A 1QHHA 1UKZA 4Q5IA 1MO3A 1CEEA 3P27A 1AA9A 1H8ED 2OBNA 3JZMA 3VAAA 1L4UA 3K70C 1IXRC 2FPMA 3JVVA 5GJVC 1GRNA 1T0HB 4GPTA 5AWFC 4CIDA 2FSIA 5KNBA 4P33A 2KBFA 2P5TB 5KUTA 4HAYA 2OSBA 3QF4B 1BS1A 2N42A 2ZSEA 1HT2E 1Q44A 3H84A 1FOEB 3KJIA 2ZETA 4RJLA 1JR3E 4W9MC 3D7MA 3L2OB 2VP2A 5JJLA 3U7FB 1E9SA 3KXIA 2JA1A 2QMEA 5UKDA 2FH5B 3EA0A 4ILEA 5HCNA 3K0SA 2CDNA 3U2QA 3QF4A 4LJ9A 1D9XA 2D3WA 1HQYE 3AUXA 1D2EA 3TQFA 5G40A 4GL2A 5DHAA 5P21A 3QOFA 5KU1A 2QMHA 1E2QA 1XTIA 1W4AA 1XU4A 4ZCLA 5BN5A 5CDFE 2X19A 3KKNA 4LBYA 2PEZA 2X8AA 3C14C 1C9KA 1Q1EA 2HCJB 1RW4A 2XSZD 1NBMA 3DO6A 3LXXA 5DE3A 2ZS9A 1D9ZA 2C78A 2Q3FA 3Q7PA 3QE0A 1UBCA 1JI0A 3EIQA 1CJMA 1CU1A 3B82A 4PSVA 1M7BA 4L9SA 1FNMA 2ERXA 3IHWA 1OSNA 5BWMA 1RVDA 2GXAA 2F3TA 3I3SR 4C0JA 4Q9HA 2F1JA 1NY6A 3NIBA 3MSXA 3Q8XB 3HP1A 3ND9A 1XMVA 4C0BA 2ZJOA 2CK3A 4JVLA 5HR5A 1C4OA 1U0LA 1XCGB 2IEYA 3B1WA 4TTQA 4Q4LA 3MUFA 2W6ID 4LHZA 2FZLA 4LBWA 3GLGE 2J0UB 2EW1A 4OKSA 4B6EA 1U0JA 1NN1A 4CDGA 4M53A 5KSPA 5FUXA 3VR1A 1NVWQ 1G3RA 2OBLA 3E1SA 1Q3TA 3OEEA 1KIMA 1OKKD 2JLXA 1J70A 2O8EB 1KI3A 1SVLA 3PENA 4OHZA 1FP7A 3QG5A 2YOFA 1NLZA 2MSEB 2A3RA 3EC1A 2J0UA 2YZ2A 3RANA 3UWOA 2VHJA 4AYTA 1AIPA 1BYIA 1ZUHA 3VFDA 2XEXA 1LNZA 4LC0A 4L5BA 2IL1A 2IUTA 4HDQB 1UM8A 1XBTA 1VCIA 4W5WA 1N2CE 2RGBA 3GLFB 2PZGA 4DBLC 1TL7C 4XTCS 4Q9JA 1R0WA 5BXQC 4D0GA 1NIPA 4UNQA 4V02A 3KQNA 2VA8A 4FWIB 3IPYA 5JRZA 1E2PA 2IS2A 1KO8A 3PCRB 1FQKA 4Q18A 2YWGA 3SQWA 3HWSA 3GLFA 3IKJA 4QRHA 2FNAA 1E9BA 3CW2A 3CM0A 4X8LA 1PUJA 5DN6D 4D2IA 1BMFA 4XVUA 4Z1MD 5FBVB 3THOA 4HAZA 2D4HA 4TMXA 1F3OA 1II0A 1WBBA 2QPTA 1KI9A 3KJGA 3BB1A 4Z8YA 4DUGA 3LBNA 4DLSA 3IHLA 1X8KA 2PLRA 4LZZA 3SBEA 2JLYA 4KYUA 3TGPA 3CPEA 4FMCB 2ZRIA 5A4JA 1MH1A 2REBA 3LO5A 3NC1C 1YZGA 1KZ7B 4C30A 1W44A 2GNOA 1TADA 3AP3A 3LNCA 3RVBA 3WMGA 1VECA 3A58B 4RCZA 4ZDIA 4CYMA 3CPHA 1GNPA 3FYHA 4ARZB 2HYDA 4DCNA 5DO9A 3ZD6A 5TMPA 4LHXA 2QUZA 1Q20A 2VTKA 5EE9A 2P6RA 1XEWY 2ZIAA 3M4YA 3AVYA 2H18A 4BZXA 1P2TA 4G3XA 3S1AB 4ARZA 4GBMA 2C9CA 4TMTA 4OQLA 2QSZA 4OI1A 4RVCA 4B48A 1E9AA 1KGDA 1IN4A 2GA8A 2ZRAA 2IW3A 2DPXA 4LYAA 4M9SA 3FWYA 1KZGB 3I8XA 1E2NA 4ASUD 2IBMA 5JCZA 1W2GA 2D2EA 2PCLA 3S1AA 3R9WA 2RAPA 1ESNA 4UXJA 3QEJA 4LBZA 3G82C 4B71A 4PQYA 3AQ4A 4US1R 4AKIA 4Q47A 1OFTA 3CX6A 4NTZA 3EA5A 4V0ME 4A2PA 1E2EA 3TQCA 1KMQA 4MRPA 2WIBA 3HU3A 2ATVA 5GJWC 1E9CA 5B57C 5E3HA 5SZKB 1GTVA 1ZC3A 5A5GA 2JJ1A 4D0NA 1E0SA 1NG1A 1M8PA 2GBLA 3BOSA 4E09A 3R8FA 4M1MA 2VP5A 3UANA 2ZRLA 1TTTA 3AKEA 2JLUA 1TF5A 4LCBA 4PC3A 1RIFA 4BLRA 1CJVC 3SHWA 3RNLA 2ZUDA 2GJ8A 2YC4C 3CH4B 2OCBA 4KJZA 3U3OA 2GTPA 3RWOA 4G5OA 3OAAA 2ZSAA 4X8OA 2ONJA 2VEDA 5GVSA 3CB4A 3U61B 2ATXA 3GJ4A 3KZ1E 1G20E 3T12A 2ZE8A 1IJEA 1ZNZA 2V6IA 3QVUA 3CX8A 1UPTA 4A4DA 1FUUA 2P6UA 3EXAA 3LV8A 1N5IA 4NU0A 3ADBA 4I1OA 3HYRA 4NE2A 1N6RA 4IJMA 3EZ2A 5G3ZA 1UEIA 1KI7A 2CBZA 3DKPA 1ZM7A 2IS6A 1J99A 1KSGA 4AYWA 3IO3A 1IBRA 1S1MA 2ZAMA 4FIDA 1G9XA 4DZZA 1HT1E 1ZD9A 4G5SA 3ICQB 1TQ2A 2OCYC 4HZIA 1P72A 3PITA 2VSFA 3WXMA 1N6OA 1ZBDA 2WZQA 4QOSA 2A30A 3MCAA 1D6JA 4HUQB 4X8MA 1DG1G 1KNXA 3T1QA 3KQHA 4URYR 1R2QA 4KVGA 1E2DA 3LFUA 5EP1A 4MGIR 1OXUA 4ESHA 3A8TA 1XMJA 2J41A 3SNHA 2BWJA 5CITA 1SKQA 1ZIPA 3TVDA 2OHFA 1O87A 2J59A 1OIVA 2CMKA 4Q7LA 1CR2A 1Q22A 1XF9A 2WKPA 5LB2A 3WHLA 4HUQA 2VP0A 2PCJA 2WWIA 5AJYA 2ZPTX 1EX7A 1LVGA 1ZINA 2CE2X 4DCTA 5E4FA 1EXMA 4OK6A 1HH4A 4BZQA 2O5VA 2Z6VA 2ZJ2A 4OI2A 4F92B 3GLGA 1RKBA 3CONA 1PV4A 2RGXA 1W36D 4ITRC 1IY1A 3G0HA 2C5LA 1JQJC 2XB2A 5K8TA 4PQRA 1YJ5A 4XWAA 2VF8A 4UKDA 4KODA 4A0FA 1B23P 2OEPA 4GOXA 1ZU5A 1WB9A 4UJ5A 3ZS8A 4IDOA 1NRJB 4Q9LA 1CJKC 2Q9BA 5KNCA 2ZE7A 1CKEA 4BZPA 2VIIA 4FCVA 4A0GA 4AWXA 1YZUA 3UWKA 4HUTA 3Q85A 2ZS8A 1DOAA 4IKEA 3PV0A 4LV5B 2DCUA 4IFBA 5FOTA 3E70C 1KI2A 4LV8B 2ZROA 1GNQA 2VHCA 1D5CA 3FDIA 4ZIRB 4JMPA 4PQFA 4JLKA 4UNPA 4WOPA 3B1VA 5JRJA 1CXZA 3ONWA 1KNQA 4HI0E 5DHFA 3TUJC 4ERNA 1E2IA 4NCNA 1SVSA 1OFUX 2EYQA 1NIJA 2LKDA 2UZ3A 3C8UA 5EE0A 3TVTA 4EPYA 4NYJR 1XCMA 4XJXA 4LDJA 4LPKA 2AKAB 1B0UA 1PZNA 4ZIRA 1E6CA 4TWZA 3B5JA 2WSMA 3AB3A 2R2AA 2FPKA 4XOIA 4Q19A 1E2KA 3FVQA 4DEYA 4M9QA 3AKDA 2W6IA 2XZOA 2OESA 1YU9A 2QI9C 2JDID 1SKYE 5SZIA 4R9UC 2J45A 4ZV4A 1XD9A 1HQCA 2C77A 2CCJA 2JASA 3TKLA 1N6PA 2ZRJA 1T9HA 3NBFA 3WNBA 4OHYA 2ZM5A 2J1LA 3CRW1 2NO6A 4I81A 5J4YA 1LF0A 2WJYA 1Z29A 2D06A 1R0XA 4W5HA 5FL7A 5CB6A 3AVOA 3T1TA 5TARA 4EPXA 4FCWA 3PUWA 5JZVA 2IHYA 3GPLA 1DELA 5C4MA 3ICEA 1MO5A 1YVDA 3QBTA 1D2NA 3AF1A 3RSOA 4CT5A 5JJIA 4RSGA 4AYXA 1BKDR 3GEIA 1M2OB 2FG5A 4PZZA 4RD3A 2ZRCA 3OIVA 3IBYA 5BN3A 3QPWA 3ZD7A 3ADDA 3M0EA 1IONA 2VHQA 3D3QA 1Z6AA 3KB1A 4GRAA 2GK6A 3SJCA 3W8NA 4HB2A 4DHEA 2FDCA 1ZD1A 3OEHD 2C95A 3X1YA 1LF5A 1VYTA 1Z3IX 2AL7A 2BBTA 2WJVA 5DN6A 4EPWA 5KYKA 1J7KA 1FPMA 3K0CC 1DEKA 4YMUA 4JLNA 1TQDA 2HLDA 1U2RA 2AFIE 2VP9A 4DDWA 2W6JA 1XXHE 1IM2A 3UXMA 1OH6A 3AVWA 1ZM3A 3SN6A 4IEIA 1FUKA 4AIIA 1VYVA 1NG9A 1E2GA 2E9SA 5JSZB 4NH0A 4L15A 2FJUA 3LX8A 4GP7A 4V0MA 3FKQA 1G7SA 1OIWA 4AY2A 5LD2C 2ZRNA 1ANKA 221PA 3VX4A 4BWYA 2HT1A 2W0SA 3I5YA 2P67A 5EQTA 1P7CA 2H8KA 3F8TA 3DM9B 3FHTA 3TMKA 2CK3D 5JSZA 1NF3A 4MYUA 2HDNB 1CS4C 3DZ8A 3THXB 3TW8B 4Q21A 3WYAA 3U44B 2V9PA 1GL7A 3F0TA 4Q02A 4A9AA 4RD0A 3Q9LA 1TMKA 2O0JA 3I8SA 5FTKA 3GJ0A 3HU1A 2Q3HA 4GT1A 3EG5A 3J81k 1G3MA 4TLEA 4LGMA 4R98A 1N5KA 1Q12A 5HCIA 3RRMA 3THXA 2VYFA 3AM1A 4DLUA 5CM9C 1IQPA 1L2TA 3U44A 4KBGA 4B47A 5K8IA 3FHOA 3L82B 3EPKA 2EFGA 3OEED 3ETLA 1IY2A 2IX3A 5IK2A 3B6EA 4G5GA 3C41J 1DARA 2FFBA 4MGKR 2J87A 2VHTA 3QNUA 4BLTA 2YNMA 4EDHA 1Z6XA 2GBLC 1P3JA 2C8VA 3AVTA 2NTYC 5KTYA 3IQXA 3OE7A 3QENA 4LOAA 2G1KA 3LQRA 5FR1A 3CF6R 3QXSA 1NLYA 1YR9A 1P2SA 2KB0A 3ZH9B 2IYVA 5J4VA 4JT4A 1MRNA 4C9BA 2FPLA 4K81B 4LBVA 3NG1A 1PVOA 5EP3A 2AWNA 4QM6A 3SEAA 2NGRA 3RS2A 3I61A 2PMKA 4Q1DA 1D2MA 4N0DA 2NMVA 3KJEA 1HA3A 2YINC 4MGYR 3CZQA 4IRUB 3W34A 3U3RA 1LS1A 1KAOA 4RZ3A 2VLIA 1RYHA 3AEZA 1XJ0A 4Q1AA 3DDCA 1GFIA 3FKSA 2ZRDA 1HTWA 2FZ4A 3TNFA 4TL9A 2QSYA 3LW7A 4PAQA 1T0JB 2V3CC 1VG8A 1JEDA 4B75A 4DUGD 2YKGA 4XVRA 2IS1A 2XXAA 4P32A 4PR0A 1E2FA 1X1SA 4Q4JB 4XSHA 3AP2A 2L0XA 1KJWA 3I62A 2CNWA 1Q21A 1AK2A 3TUZC 621PA 5FUVA 4AG5A 4NHOA 1EESA 3UMSA 2E87A 4WA7A 3BFVA 4N0EA 4JZKA 1PLKA 3NH9A 3TBKA 2XGJA 3R9IA 4EIWA 3AVQA 4C0KA 2FSHA 5BYJA 3A6PC 2P5SA 1H8HA 2TMKA 5DLQC 2OO7A 1R0ZA 2A78A 1CP2A 421PA 4UNRA 1P9RA 3L43A 4MDEA 4WIAA 4FI3C 1UKEA 4ZDJA 3EZFA 3TH5A 4B74A 3GFTA 4EPRA 2QAJA 5L3QB 4EFMA 3K9LA 4JKIA 4XVQA 2D74A 3TRFA 2YYZA 3X1XA 2ZI3A 1SKYB 4QBIA 5JFGA 1ZCAA 1KHTA 3I4LA 4BRUA 3NXSA 3TSWA 3IEVA 5AUOB 4HEJA 4WVFA 4TLCA 821PA 5L3QA 4WBSA 4JLMA 4P31A 5KSYA 5J47A 2BM0A 3NBZC 2J7PA 2ZRHA 4OBEA 5DISB 1FQJA 3A36A 5EE1A 4KXFB 2AXPA 1K6MA 1A1VA 3N2EA 3K9GA 2ZREA 2IYXA 3CRRA 1Z63A 3GEEA 3BH6A 3BWDD 2JJ1D 5AJVB 5E95A 3U7GA 1LY1A 1NY5A 2HXYA 5TDHA 2QU8A 3U3MA 4RCYA 2HF8A 3FFAA 5KSOA 4M1KA 4C3ZA 2Z43A 2Z83A 2ZR7A 1XEWX 4TMVA 2F9LA 3VX3A 5HE8A 5DYGA 1UDWA 1UJ2A 5FFMA 3RS4A 4AC9A 3WRXC 5FTLA 2W2VA 4Q48A 2DFKB 2DY1A 2P65A 3OAAD 3GMTA 4RD1A 3B7GA 2AWOA 3NH6A 4NCJA 2WJHA 4YXWA 4B32A 3AVXA 3U5ZB 3PUZA 4HLQB 2CHVA 3BFXA 4LHVA 4NYMQ 4HAWA 4TL6A 1E2MA 3WBKA 4EAQA 5GJBA 2Z4RA 2GETA 4PC1A 2RB4A 5KHOC 1S9DA 1X1RA 1RC8A 5D3QA 1K8RA 4EKDA 2ANBA 3O8RA 4FMDF 3QPUA 3ADCA 3PUVA 5ELXA 4D82A 1KJYA 2JDIA 1GM5A 2PBRA 3U7EB 2IYYA 2BBSA 3KTAB 3A1WA 2PEYA 3E2IA 4OQXA 1P60A 1W46A 2UKDA 5B30A 3DMDA 1P75A 4F4CA 5JHHB 1KI1A 3VR2A 4QBGB 4MGZR 4HLUC 2RGCA 3KUDA 1KDRA 1SHZA 2QP4A 2FFQA 2QNRA 3B9QA 1E96A 3DPUA 1U99A 1X6VA 1Z06A 3PJRA 3KTAA 2Q6TA 1N3BA 2ZYTX 4N3NA 5EE5B 2GILA 1DAGA 1RE0A 3LQQA 1Z47A 3UG6A 2YOHA 5JWRA 3VKHA 5LB4A 1CTQA 4G5QA 3AF2A 3CPJB 3DVLA 3KL4A 2J9RA 3FTQA 2GK7A 1E9FA 5DH9A 3KX2A 1WQ1R 1RYFA 2FE4A 2NPIA 1JJ7A 4F91B 1EFRA 5B2ZA 2D7CA 2OXRA 4LJ6A 3UMRA 1DO2A 1OPXA 3OEHA 5GVRA 3MWJA 1OIXA 1Z08A 5EUMA 3CNLA 4C2UA 1VPLA 1MO4A 1UF9A 2ZSBA 2QMUA 3CRQA 3I5XA 1JR6A 4RFSB 2WBLC 2OFWA 1NN3A 1F60A 3QI2A 4MKHA 4LJYA 4ESVA 1DTSA 5J4LA 4PSAA 3IIMA 5SZHB 4QC2A 4KU4A 1BIFA 1E0JA 4B2IA 2KJQA 5JJKA 1KOFA 4IW3B 1M74A 4NONA 3QBVA 4WXPA 3HDTA 4RFSA 2DWQA 2Q21A 4UXHA 1IJFA 2NO1A 2QEQA 4R2IA 2IEZA 1WP9A 2YWFA 3UG7A 4EQ6B 4D25A 1EFUA 1DAEA 1FW6A 1RRFA 5KPDA 1AKEA 1AGPA 4KI0A 4A2QA 5EUQB 4EPVA 4QG7A 4DIEA 5FBLB 1VKJA 2WMOB 2YC2C 3QIAA 2WAXA 2ZI5A 1G64A 1IHUA 4EQ6A 1ZC4A 4FW9A 4RZXA 2Q9CA 1VCOA 1W47A 4EJSB 2NOAA 1OXTA 3HYTA 4CEIB 2XTNA 3Q3JB 2PT5A 4GZLA 3NVAA 4M21A 2W00A 5JWHA 2FMXA 5FL7D 1DS6A 1KKMA 1XJCA 1J8YF 2QP9X 4I1UA 4JLOA 4Z51A 1UFQA 3KQLA 1Z6YA 1R5OA 2ZRPA 4EJSA 4QGGA 6Q21A 4AI6A 4CEIA 2O8EA 1GILA 2GF0A 1Q1ZA 1U81A 4G01B 2QTFA 3FMFA 4OYHA 4POAA 5KSZA 4S2EA 3T35A 2C9OA 3RC8A 4LJ5A 4PHHA 1NKSA 2BMDA 2NZJA 5DI3B 4AK9A 2ZEJA 4KCGA 3C5HA 3AVPA 4KAXA 4Q7MB 4AG6A 4HB0A 4TYWA 2B8TA 3ECCA 3AF0A 4PPFA 1D8TA 2PH1A 3DEFA 3W5JA 3W90A 1ONBA 2JATA 3ZVMA 2BC9A 5CJPA 1M7HA 1IN8A 1KK1A 1N5JA 4IDNA 4TQAA 2G6BA 4IOLA 5DI3A 4B6FA 2HLDD 4IHQA 1S1CA 4HATA 2W6JD 3JZAA 4W7SA 1XRJA 1U98A 4IOJA 3WHKA 4OHWA 4JLBA 4WAUA 3EX7C 4UQOA 1W7AA 3QG1A 3GFOA 2FA9A 3BAFA 5H8WA 3FHCB 5LBIA 5CK5A 2OCPA 3CRMA 4ZCIA 1WRBA 1TEVA 3K1JA 4RKEA 1R5NA 1AZSC 1DE0A 1TQ6A 3SFVA 4BFZA 5JLJA 4FCTA 5DSZA 2V4ZA 4B43A 2HEIA 5D3MB 1LB1B 4MRRA 4UXIA 4YONB 1QHSA 3ZDQA 1W49A 4E07A 1H65A 4PO1A 4Q1BA 121PA 3LLUA 4DCVA 1UBGA 2X2EA 4CW7A 3VR4A 1PLLA 4JIMA 4ACBA 5D3MA 3GQBA 3LH5A 2HJVA 2QRZA 3ZIAA 4DVGA 3SDZA 5F9HA 1E1QD 1N5LA 2ZR0A 3WMFA 2E1RA 5IF9A 1ZCBA 2WJGA 2RGDA 5BQ5A 2ZVQX 1GRQA 4H9GA 2G0TA 1M6NA 3B60A 1N6IA 1G16A 5A0FA 4BEBA 4RD6A 2V7QD 5IK2D 4PO9A 4B2PA 3CKLA 4B3CA 4BLSA 3EZ6A 4A1FA 3SR0A 2CJWB 5GJCA 3UIEA 4BQSA 5HPYB 3LWNA 3RLFA 1R6BX 2QBYB 1Z8FA 1OE0A 1PLJA 1Z2AA 3OE7D 2QA5A 1OT3A 4TL7A 1JJVA 1JXMA 1GG2A 2AN9A 3ZGXA 4P4SB 2VRWA 1KYIA 4D4KA 3PXGA 3OFNA 5KDDA 4OK3A 1FNNA 4TTRA 1N25A 4HZUB 3RRNA 2JCSA 4A6PA 4A6XA 4DLWA 2WWFA 1NVVR 1DG3A 1EWRA 2GDJA 2AR7A 4DB4A 1E0KA 4P4SA 1WXQA 2IWRA 3H86A 2MMCA 2QAGB 2VHUA 2GAAA 3LBHA 3RAPR 3U3KA 3O47A 2R8RA 3FKSD 5LPNA 4LV6A 1C1YA 3WNCA 1ZM9A 3K09C 3VHLB 3AVVA 2W2XA 3FMOB 2OZEA 3KDSE 3QVVA 1ZUNB 3MGCA 4PPQA 5FI1B 2QTVB 4R71A 2DR3A 2QAGA 1VHLA 1R7RA 2CNWD 3KXLA 2DBYA
chains in the Genus database with same CATH superfamily
4KGZA 1WJGA 3LBIA 2HA7A 3H9QA 5CG2A 3VYTB 2PUCA 2R00A 3H99A 5DX8A 4A8JB 3PT9A 2R1VA 2VQDA 4D97A 5JANA 2QUKA 3IEUA 4F3YA 1WCXA 4NDAA 1V96A 2OG1A 4HPWA 1FTSA 1N4AA 4C87A 1Z26A 3TECE 3N8GA 2JHCA 1JDTA 2DLNA 3ZGNA 5EP4A 4Y1FA 2AD5A 2FW8A 1H8HD 3MRXA 4B3FX 4RK6A 4NPHA 2O5RA 4XZ3A 1C9EA 1GVHA 2F9MA 5B7GA 1JEQB 1MD9A 5KBYA 2AK2A 2AFHA 3R44A 5EVJA 1VE3A 4D45A 1A50B 2BMEA 3ENNA 3B1YA 3ZU6A 3OF3A 4IHKA 2WA2A 2V5AA 2IK8A 3BB4A 4WINA 2EFDB 2H5IA 4TZ6A 4HNSA 1E62A 4URFA 3A3YA 2IYLD 1LU9A 4HBZA 4MHOA 1W2HA 4XIIA 3E53A 3G6KA 4EM6A 2H00A 5AM1A 4IWYA 3UGQA 2YVUA 3O8LA 3HVJA 3K0AA 4UAJA 2BVNA 2I5PO 4CQJA 4JHLA 3MRVA 4WFKA 2F43A 2C31A 5BUZA 1LC0A 4ZHSA 3RYFB 4G0NA 2J7PD 4ZTUB 1O4WA 1I3OA 4N41A 3MVEA 5LU9A 2QTZA 1ZI9A 5ECGC 3L0PA 1WWKA 5T4FA 2ZWAA 5D2CA 1I1NA 5AI5A 2A5DA 1SXHA 2CV2A 4GX1A 1Z07A 1YZKA 2EKLA 3IRUA 3O7WA 5IVPA 2ZLBA 1KEEB 4MPDA 2XCSB 4IVRA 1UPUA 2OUKA 1GL9B 4KG7A 5HUJA 3WB9A 1ZLXA 1P1JA 5KCZA 3M6LA 1SXIA 3LDAA 4C7VA 1JKJB 4DR3B 5A4FS 5L4LA 3QSGA 2X14A 3ADKA 4KGVA 2AX4A 5FQOA 1ZITA 4L0DA 4K9PA 1W4ZA 4URWR 1N0VC 1BH6A 3BC1A 3GLUA 3GNTA 3MHPA 3QJYA 4CF3A 1W0CA 4KN5A 4KLNA 5KOJA 3FDZB 3BXZA 4K3VA 3KSAC 1JEJA 1LC3A 2JGDB 3UWSA 1EE2A 4W8GA 1Y1PA 1HYEA 3OOYA 4JEHA 2XUGA 3Q0EA 3ZVRA 1O96B 4FEEA 4DLRA 3ABRB 3QRWA 3M4XA 3BFJA 1B6GA 1V39A 1YRWA 2GM4A 1RJFA 3HNPA 3KJZA 4NENA 5K0EA 3Q7QA 3Q6NA 2A5FA 3T4PA 2PMFA 1RAHA 1G8YA 4N6NA 4MOWA 5K9ZA 4RKFA 4ZU6X 2IEAA 3RYHB 2IT1A 2PVSA 3H0CA 4DLXA 1EWTA 2E89A 3LUJA 4P0PB 4RKWA 3RRYA 2GJAA 2X6RA 2KE5A 4DLAA 2XKJE 3RYIA 4I5EA 3V00A 1F2DA 5CBKA 3GGOA 1DBVO 3M81A 1T3SA 4WJLA 2DQSA 1X19A 1XVUA 1K1EA 1O5TA 2WK1A 1UBEA 3O7MA 3WX0A 2DWPA 2JKZA 5K6AA 2YJ3A 3C7KA 4QA9A 1IE3A 4YJ3A 3U1TA 4BMZA 4FDUA 4YFYA 3NTVA 4C7OA 4ZTZB 4GOJA 4CM8B 3DZCA 4AJIA 1YL6A 3K9NA 3FMIA 4HDCA 3ZX5A 1PSDA 4HDSA 3HCBA 3G9ZA 1NE7A 3CURA 5CLHA 4XOUA 1I4OA 2YFKA 1IK4A 5KTSA 3PNVA 3NFRA 2VTVA 5CIWA 2GAIA 5IARA 2B7LA 1HORA 1G6OA 3S2GA 3KVYA 1WL8A 1RQLA 3DT9A 4NNPA 4WK4B 3RFTA 1QPZA 3DZJA 1YQUA 1R0LA 1Y9DA 1VL1A 2FHPA 2OR3A 3ET5A 5EJAA 1UC9A 3F6YA 4MJ3A 3NJRA 4IDPA 4EY6A 3E7WA 3QKUA 1ZPDA 3KZKA 1AA6A 2GARA 1Q3KA 2HFJA 1OBFO 2IX9A 3F2VA 4J7AA 5JD3A 2GHRA 4B4DA 5CB8A 3M6IA 3HNRA 4OGGA 1Q83A 1XTJA 1EWQA 1HT3A 1SXJB 3C4QA 4ZCPA 1DC5A 2IIBA 4PO8A 2O5CA 4KQHA 5TY0A 4OQNA 2B92A 5J2TB 1M2OA 1TU0A 3Q10A 2C04A 3CHYA 2JJYA 4IICA 3GVHA 4QEZA 1XZQA 5EXTA 3M1YA 1R0SA 4IF4A 3X3HA 5ADUS 3FR8A 3KKQA 1P3DA 4D81A 3NGLA 2YUIA 3O8BA 4FP9A 3QXCA 1NFQA 1UOPA 4ZXPA 2FW1A 1EM8A 3IEPA 1XVVA 3IPXA 3JQAD 5AVYA 5K51A 2V1XA 2ZRGA 3FNHA 4DNFA 4MWOA 4MYSA 4O4LF 5CRIA 2QAIA 2YIJA 1P9NA 5TEVA 3V8MA 1ADFA 3UJNA 1RVV1 1TK9A 5BN1A 4S1PA 3DB2A 2P8SA 4ZMBA 1QAOA 5BN4A 4L74A 3GD7A 1M8FA 3CLTC 1AX9A 1FTNA 1T25A 4TXMA 5IKPA 3K0BA 3FTPA 4KW7A 4OL0A 4UUAA 3U4QA 2QLJA 1RAIA 1JLHA 4U9IS 1LPNA 2L17A 3AGPA 2QD2A 2HMTA 4FNOA 3I2JA 2A0FA 1JIJA 2PIAA 3H1PA 4OJMX 3I9V1 3MMXA 2Z8YM 1LSSA 1R8QA 2GO7A 2P9GA 2ZB8A 3C87A 4NBWA 1QONA 1R8SA 1YHNA 2NU8B 1UODA 3EQ6A 2DQZA 2D13A 1XG5A 2C7BA 1X7HA 4IMPA 1Z7YA 3W8DA 4H0CA 3RH0A 3OX3A 4FYPA 1RI3A 1RT9A 4OHRA 3VHXB 3WNVA 5JARA 3EULA 4LXXA 4TWAA 1OILA 3Q3IA 4J0DA 4XLZA 4US2R 1DJNA 2Q5IA 4YRLA 5CFRA 4LDZA 1GFWA 3P94A 3PJFA 4BV8A 5MHTA 5K6TA 2XKAA 1EP2B 4BNJA 3QE3A 2HCTA 5AJZA 5F1PA 3TR0A 1MP0A 7MHTA 1XB2A 3IAM1 3GO4A 3K1TA 5D86A 2ZRKA 2WFAA 1ARZA 3HZOA 5A4KA 5C52B 3T9EA 3KB2A 1G8JA 3GFPA 3OPXA 2CYCA 3PJEA 4OBBA 4Q6WA 5G53C 4LQ4A 2FUNB 2FDXA 3IALA 2R97A 1EWVA 4JS0A 1OFUA 1WU7A 3BE6A 5FA5A 3TQSA 4A0QA 2NXEA 1E94E 1UC4B 2YW2A 4WZBE 1NBWB 2R6FA 3MMSA 3IT2A 4Q3OA 4TYQA 3ND6A 3E2MA 1AS3A 2PX2A 3NHLA 1KQNA 1EYZA 4M22A 4NDZA 1EB8A 4LN1A 4EG7A 2OO5A 4HQ6A 5HQJA 1B6RA 4OD0A 3IKVA 4I50A 5EY5B 3P52A 4L07A 1ZUIA 1XFDA 3Q3HA 4FBLA 2OM2A 4C76A 4D4IA 3LCUA 4KJXA 4L8WB 2PWZA 4GMGA 3M3HA 1DBWA 3QXHA 4KAFA 5MDHA 1Y7PA 3QVMA 2ODBA 4PC6A 1DQNA 4GEKA 2DFDA 1EDOA 2JRLA 4TN1A 1OFHA 4IH4A 2PZLA 3C5WP 3MT9A 4M0FA 2PIDA 4R1TA 2WWWA 2OCAA 1Y8RA 3O4RA 1S96A 3PWKA 4ZOLA 2M32A 2X77A 1NF9A 4MITA 3HXOA 1XZ8A 4DQVA 2PSFA 1QGUA 3DBLA 3TUIC 1DHTA 4Q4JA 3UXHA 1K7FB 1JQAA 5CJ2A 3ZXSA 1BFDA 4ZRDA 1J2EA 3O1HB 1GDDA 3DTVB 2Q45A 4JBIA 4D9KA 1G5FA 4Z54A 2Q1TA 1P19A 3PUIA 3TZHA 3AJ8A 1ZXLA 2ZBRA 2YZKA 1E4YA 1FB5A 3Q87B 5KHAA 4HNTA 1IBSA 2O2CA 4I8IA 4GG1A 3OOHA 4DCCA 3TMYA 1UQTA 1BEUB 2AC4A 1JA9A 1L8OA 2JBWA 3H3JA 3GBPA 4G1FA 3UF0A 2YW9A 3ZVNA 3VTFA 3MS7A 3V4RA 2R6DA 2UVQA 2VYNA 4BFXA 1H1LB 4ZZ1A 5G0VA 4WN3A 4HDRB 1NPYA 4MLZA 3PQFA 4H1TA 5AI4A 4X90A 5M34A 2ABWA 4DJJA 2X6QA 1QZXA 3H5NA 1II9A 1QF6A 5TQ2B 2Y1GA 2R3SA 3RQSA 1S8OA 1ZJJA 1IOZA 4P9NA 1PD1A 4NESA 1NVUQ 1S3FA 2B30A 4LYEA 4N48A 4KNWA 3LVRE 1NFFA 3P9XA 4KX3A 4PSCA 5ESWA 3B53X 5DOZA 4QYTA 4RXMA 3DBVO 1BOFA 2IBSA 1M2KA 2TMDA 4Z4CA 2YWHA 3GZTB 4WCFB 1KKLA 2Z6QA 5JS1A 4DRYA 3IERA 1NASA 2H48A 1TCCA 1M8KA 2GQ0A 2ODNA 2X5JO 4HADA 2WABA 1QX4A 1T10A 2O48X 2O8DB 3DFUA 4QAQA 4MRSA 1V3TA 1RWVA 4KWIA 2NUPB 2VF4X 2Z9BA 2C2WA 2NNWB 2PQ0A 2RHOA 3H5TA 4QUEA 5FH9A 3K1AA 3FOCA 3V4PB 5C2JB 3ONFA 1Q17A 1I6WA 4Y2QA 4GI1A 4Q4DA 1CY8A 1CF4A 2I62A 3MFQA 1QTRA 3IODA 5M3BA 2P91A 3DGFC 3OTIA 1UT5A 3PEVA 2ZRMA 4AMBA 5DGTA 1BU8A 4R2MA 4URUR 5TNXA 4CMIB 4EEZA 4O4IB 3ZD9A 2D62A 1NF8A 1YWGO 3W1VA 3X2SA 2QORA 3IJEB 2WIJA 3PXUA 4LZAA 3TE6A 2W42A 2GVDC 2ZBDA 3Q72A 1COWD 3G2IA 3BHJA 3UH0A 3DMYA 3OO0A 2JAQA 1KQFA 3HMKA 4J6FA 2YCLA 3BM5A 2AOTA 4I5FA 3U9SA 1M76A 1H22A 2EKZA 1XEXB 3L06A 4US0R 4BFVA 3K32A 3A11A 1Z28A 4FUQA 5JD5A 3ZHXA 3C4JA 5HQ3B 1AKNA 2FXIA 3I92A 5ESDA 2WU8A 1F2VA 2DRIA 1CT9A 2PWAA 2YHUA 2YVLA 3ETCA 3FSGA 4QECA 5CAEB 2X0DA 4QJ3A 3VC2A 2JH8A 3LGSA 2YOGA 2OORA 5EXPA 2GCOA 3CIFA 1AKQA 5FQNA 1FSPA 1TAQA 3DBOB 2PMBA 2G5GX 4L3OA 5K0CA 4QYIA 3O82A 2WC1A 4GP9A 3BIFA 3LGAA 1DCMA 3AJ9A 4NBTA 5EXXA 4QM7A 4WLOA 1TUBB 2DKOA 3A6LA 3LL4A 3ANTA 2IBTA 3PFKA 3PHLA 1TEHA 3ZN2A 4BKQA 2OTCA 1BDIA 3CPSA 3NHBA 2PWPA 2J5RA 2J46A 1W0KA 5KDOA 1C9NA 1I4TD 4JEIA 1J90A 3F3SA 2R68A 1C7JA 2ZSJA 4P80A 4BQIA 1AKYA 1H42A 1PBTA 1S8NA 1TZJA 3DWIA 4FINA 4JX8A 4E13A 3OZXA 1F38A 5WRFA 2CLEB 2Q4EA 3LKDA 3PE3A 3LZDA 1V47A 2WIAA 2PT6A 3PC8C 1UMDB 1U3VA 1BXRA 4IEEA 4YI5A 2PD4A 2NO0A 4DSAA 4PLGA 2I66A 1II8A 3C48A 4PO3X 5JVDB 1Y8QA 3SF0A 2AN1A 3F5SA 1ISMA 2B21A 2C3UA 1NNUA 3IAUA 4U5XA 5H4HA 4D4HA 4EHDA 2O8BB 2HV8A 2HDOA 1OBHA 1BQ4A 4D9NA 4RBNA 3V2GA 2Y1EA 1MF7A 1UC5B 1EZZA 2CNDA 2GKSA 1RM0A 4WLVA 4ZCSA 5IYZF 1DC8A 1P81A 2E55A 1A97A 2PJDA 4WKBA 5HF6A 1G21E 2H1IA 3AOEC 4YYZA 1Y48E 2IS4A 2CL7X 2X40A 4HFRA 1KI8A 3LOQA 2IA5A 2PR2A 2QRMA 4IVPA 2DECA 3JALB 4YUVA 4A0RA 4BQOA 8AT1A 2H17A 4PLVA 2JJMA 1MQSA 1Z0SA 4LOJA 4MDYA 4JQYA 1ULZA 3MJFA 2A8YA 2AFHE 1UOEA 2JJ2A 2CLDX 4WVLA 1JIQA 2WJIA 3IP7A 2GCNA 1RM4A 5JTTA 4QPDA 1M34A 2H7YA 4FZVA 1TT7A 4OLFA 1Q2XA 5BW6B 5C5EA 4FD2A 4RM2A 1G3QA 2C7GA 2CYAA 4XRGA 2RGGA 3C3PA 4RGBA 3ER8A 2XOKA 2IY9A 1EJ2A 2YMLA 4UZFA 1NVKA 5AVRA 3LX6A 4HY3A 4QTXA 4TTPA 2G5CA 3GMIA 4UW9A 2CXRA 2PSSA 5AK0A 3K96A 5JTUA 3VNVA 3QPCA 2ZFUA 2ZTVA 4CZ2A 1QK3A 1OY1A 2IIQA 2RHCA 2R96A 3DKIA 3OJEA 5G4KB 4C6TA 4ZI2A 4DQXA 4RK7A 4AL4A 4E1AA 1X8LA 4DV7B 3HA7A 4JBXA 5G0WA 3SBDA 4ARSA 2BGIA 5E6UB 4J03A 1KQGA 4EG1A 1KDTA 3DM5A 4I2VA 4NZYA 1U9CA 5FYDA 4JI1B 4CVNA 1KY5A 3O1JC 4F96A 1ECFA 1NM5A 3REGA 2W6OA 2DLDA 3C6QA 4M2LA 5ESXA 3LKZA 4NP6A 3B6KA 3E7XA 3ESZA 4RIHA 3RRZA 1JSXA 1Z4JA 5IDYA 2J9GA 2G67A 1VJRA 2QTTA 4H7DA 3UJDA 1H9BA 1Y3DE 3HJNA 4RQAA 5ER9A 5JWOA 4YUXA 2Z04A 4CM9A 4M87A 3EW9A 4CT0A 1EFVA 1LDMA 2K5UA 3FHJA 2WJPA 4G0XA 4L9WA 5P8WA 1N7IA 2XOEA 3CO0S 4KIWA 4TYMA 2V7GA 3UICA 5CD9A 5I7HA 2Z2XA 3K9QO 2GFQA 4RSMA 1SUCA 1NQUA 4G8DA 4IR7A 1W87A 5AUPB 3HKCB 2N1BA 2IYOA 3LBAA 2RHJA 4RADA 3NJ4A 4MVXA 4TV9F 5J63A 5CFLA 3OU2A 3BF7A 1ZJ4A 2O7NA 1BCSA 4HNAA 3G1TA 2DERA 3D4BA 2FW7A 3QV1A 4D56A 3UQYS 1SZPA 3VO2A 1OZFA 3LUKA 4H1HA 1SVMA 1WNTA 1RXSA 1ISSA 3PKZA 1WKCA 5FOVA 3TINA 4IUDS 1RKQA 3R9XA 2AD1A 3AHGA 1MIOA 3JWEA 3EVNA 4K9SA 4KWCA 3GLSA 5HEKA 3VZBA 1Q57A 1QHEA 4EATA 5I3CA 2QE7A 4L4UA 2HYIC 3W8RA 4LC1A 3RWBA 4UBLA 1T5LA 1EUDB 4TXLA 5DK6A 3FBGA 3R5HA 1M1XB 1XCPA 2RBEA 1XZCA 1NW8A 2EJTA 5ARCA 3RC9A 4ZO7A 2YMQA 1OTYA 5AM3A 2Q9AA 1CF2O 1N6NA 3Q7EA 1HF3A 1D2RA 1G3UA 1T2DA 3KQQA 3GUVA 4A2WA 2HLPA 4BZZA 2EAUA 2FN8A 7ABPA 4GM1A 1P2UA 1YACA 1N75A 1DKLA 2N9UA 1L5VA 3A1TA 3B1ZA 4YAWA 3I2KA 4GXQA 1ZNQO 3D4LA 1E1MA 3ORRA 3JARB 3BSSA 1WOYA 4ABYA 1N0UA 1D8AA 3K0FB 3OZFA 1N0WA 2ZTSA 1ZD8A 4X8HA 1CIPA 3O4FA 1TA0A 4RTPA 3EVAA 3HCDA 4HRYA 3R6LA 3A6JA 3ZV7A 1RI1A 5C8YB 3A0UA 1ZK4A 2PMEA 5GPBA 3WWYA 4OQPA 4M46A 3T3OA 2VAMA 2LR0A 1CY1A 1H2FA 3ZQJA 4DQLA 3CVVA 3KKPA 1UEJA 2W4IA 5L3QB 4HEA6 3VR5D 4D3DA 1JEAA 4P35A 1FFEA 1VA4A 4NATA 1T3HA 5LA6B 3SIWA 1R4ZA 1QTQA 1QGYA 1Z83A 2B0JA 3A05A 2WJZB 1KRWA 4GECA 2D1RA 3BL5A 2G1JA 3K73O 3EXHC 3OSUA 5BNWA 4ROTA 2WZCA 1Y1SA 2BHSA 3TDMA 3IUYA 3ZVLA 3CZ4A 5DNAA 2BP7B 4ZT2A 4EB3A 2R7AA 1FX0A 1QK4A 1ODCA 1A76A 2UV8A 3QU2A 4FWBA 1FCJA 1X1TA 3D3NA 4O1MA 2I6UA 3VQTA 1H9CA 1I6LA 4QHTA 3E3MA 3N2KB 1FQOA 4C7BA 2LKCA 3F3MA 5JAZA 3K5HA 2Z2IA 2I7XA 1B4DA 1ZR2A 1S2IA 4LDQA 3HUUA 3NEJA 2VZ0A 2FWIA 5L3SB 2A2ZA 3GBVA 2H08A 1P29A 5JALA 4LECA 4KDRA 5EJ5A 3AKYA 9MHTA 5AD1A 4YPVA 1K63A 1KMIY 2XD9A 3S99A 3UJ9A 2NZ2A 1G5RA 2Y68A 3EC2A 4F8EA 1V26A 3O03A 1EDZA 3RVQA 3S28A 1V1MA 4MI3A 4YROA 1T6YA 1X94A 3RYCB 3LIPA 1J49A 1WVMA 2A5JA 2A0XA 1RWQA 2P4HX 3K8QA 4L5JA 2IIPA 1FBTA 5FA8A 2DBRA 1IPFA 3NR2A 4EYGA 2IP1A 1ZU4A 3U3JA 3WQQA 2AI2A 2PYDA 5DM60 5JXGA 2NP6A 1CVLA 4KNVA 3PLNA 2MYPA 4R6WA 4QGFA 4UNNA 4BFTA 4G0WA 2P2GA 1KZHA 2PVCA 2EWWA 4CF7A 1EK2A 3F6BX 5EGSA 1AS0A 3OURA 1KTIA 2POQX 4GMXA 5KMGA 5M2QA 5KU7A 1JR3A 3JQ9A 2EJCA 3EK2A 5KNDD 2C4VA 1JDSA 1A1SA 1YTLA 2PMDA 4RMHA 4YT4A 4PBSA 1CERA 1GT6A 3LHKA 4I55F 5I7VA 1T4GA 1MC4A 2HJWA 1A2KC 2VKQA 2BL4A 3HCFA 3QUSA 2BBWA 4HDOB 4B87A 2QGZA 1LSUA 2X76A 5GAJA 3QKTA 5FNVB 4DJEC 2XF8A 3FCOA 4BX3A 1VMEA 1USIA 1YDMA 2IHBA 5E8RA 3IE1A 3FOEC 1M8JA 3GLIA 1G3IA 4TZ0A 4DSUA 2PRIA 2YV5A 4BFYA 4L8LA 1BRMA 6REQA 3WIBA 3GZJA 3JATA 1WXDA 3MWLA 5EYPB 4TX1A 3D3EA 5CDFA 5FWYA 4O63O 4C1NA 3I32A 1CR1A 3H1EA 3L7NA 3UFBA 5ICSA 2GD0A 2I55A 2WTMA 1QRUA 3H5WA 3SMQA 1V45E 2BTOA 2PU5A 2RHRA 4JBLA 3VHQA 4P0QB 3UAWA 2LWIA 1JIUA 1K4KA 1VSUA 2FSVC 1M72A 3DE1X 1N2GA 1VKOA 5H68A 4KBFA 1E7WA 4R1MA 2ZUFA 2C9DA 2C8JA 3DGEC 3PNLA 4JITA 2ACWA 1VLQA 4QTZA 5DM2A 3AY0A 3V9PA 3TGWA 2Y92A 4B73A 3EF1A 2GN4A 4MKIA 4MQFB 1YZTA 3QYJA 4OYLA 5JI3E 1HXHA 2FAXA 2O8FA 5I9IA 4PFJA 2C4WA 3GRFA 2B2XA 5ALXA 5E1OA 2FUG1 2J32A 2OUIA 2QXTA 4UHFA 5FI0B 4JJZA 5BPHA 3E7DA 5D1NA 1B73A 1LSOA 3IIJA 4ZHQA 2J3QA 2VK2A 2XT0A 5T41A 2HI0A 1QYDA 1K6EA 1ZGJA 4PYMA 4DBLE 5KOHB 4O4JB 2MSNA 1XMOB 2VDMB 3ZBQA 4AKTA 1N7JA 4V03A 3KQMA 3RSZA 4CDNA 1YC2A 1JDNA 1R10A 4J9VA 1P4GA 3F74A 1DKNA 3D0KA 3MTJA 3AJEA 2JKVA 3DSRA 4IDCA 5EWMB 4XYLA 2ZIEA 4YLEA 3W4KA 1NGSA 3U1BA 2G9ZA 3HYNA 3OOJA 3FYTA 2B5WA 4M36A 5SY9A 2LCQA 3DONA 2BJVA 4Q39A 2O6LA 2XNHA 1Q7BA 4YP1A 1K2WA 4KO3S 5F1YA 1N2JA 1OXSC 4NYIR 2YY6A 4PG4A 1ZMRA 2FEMA 3VJLA 3H8WA 4E22A 1A7JA 2XNKA 4FYWA 2NU9A 3D8BA 3SI7A 1CZOA 4UBNA 4BMSA 3JAMA 5K8LA 2Q6KA 3QBEA 3T7KA 1ISFA 4I4LA 3LCJA 1I0ZA 1YQDA 2UXDB 4MVJH 1QH9A 1N2CA 1DLJA 1U04A 4RVSA 3BMQA 4JL5A 4R31A 3R4VA 1G8AA 4QG3A 3HO1A 4GR5A 3H17A 1YZNA 2OECA 4YJ2F 4CF6A 1N3IA 3FKJA 3C3AA 1PIWA 1QZ3A 1DUVG 3RS3A 1X8XA 5KAPA 3RS0A 2HGSA 1KTVA 4JYCA 5JQWA 3DQZA 2BTQB 1DOZA 3Q0IA 4MR7A 3SPXA 1NHWA 2ZS7A 3T7DA 3WYDA 5KYYB 5F12A 2HU7A 1KK3A 4RCVA 1R0RE 3FCYA 4IJUA 2ADOA 5KVSA 1E3QA 4XASA 1XZKA 2O7QA 3EAQA 4KV9A 1D1QA 2H5EA 4P4UA 2BPOA 3OQHA 3MNFA 3EDOA 2WPNA 1UM9A 4JOCA 5EJEA 4ZXFA 1GY8A 2PXAA 4G9GA 4EGSA 5ALWA 5TQ0A 5G3YA 3M49A 2O2IA 4LPSA 3WRXA 2WKRA 2D0PB 4BY9E 5J5CA 3QTLA 2MSDB 4PSUA 2JGAA 4UMFA 4X85A 3TXXA 3ZGOA 1YJBA 2AF4C 4L6AA 4HTFA 4EHAA 3KV1A 2QENA 1FDIA 2NUAA 2ZI9A 3HPRA 1E1NA 4U8HA 1KZ4A 5ELMA 1WKVA 4UE2A 3VM6A 4MKFA 4R9VA 3OOWA 4NYIQ 1L6IA 1DI0A 1MNQA 4NCKA 4QHYA 4E5KA 4QJ4A 2BV3A 4TKVB 4JJFA 3ROGA 2EQBA 4BBJA 3HZHA 1Q1AA 2UAGA 4JKYA 5K3CA 4BPBA 3UK6A 1WMSA 3GEGA 3UMFA 1N2EA 5AXAA 2SECE 3IPLA 5LBUA 3THWA 4TMZA 1BWQA 3G0GA 5KNBH 3ZHOA 1WULS 1YUNA 3WGIA 5I8WA 4BJ1A 2QROA 2XYQA 3GD5A 1C3XA 3DV9A 1GZSA 3ZHBA 1XJQA 5LCXA 1AG9A 4N7BA 3SE0A 1NJ2A 4COOA 5JOQA 4S3MA 5LWQA 2BHLA 1AUXA 4GMDA 4KXMA 2OPHA 5MFZA 4CEJA 4L16A 3M4ZA 4WBXC 3T95A 3WGTA 2VK4A 5JNWA 4HLUA 4HWRA 4JP5A 2R44A 3MD0A 2XHEA 4KI7A 3UYLA 2VPIA 2ORIA 3DS8A 1LRJA 3AGQA 2EX4A 4JUAA 2NVOA 1RPZA 4LQLA 1DBSA 2QR3A 1IY0A 1EMDA 1ZJ6A 1CULC 1U1EA 1H94A 2SNIE 3PVZA 4M55A 5KTPA 3A2LA 3D6NB 4W1PA 3SQDA 2XAUA 4DMRA 1KEUA 1NVXQ 4YBZA 3VKWA 4DDHA 3COSA 5AVUA 3T3PB 3KBBA 1Y7TA 4DDVA 1KO4A 1K6XA 1K7EB 2GJSA 3L6RA 3SDBA 2P6NA 3ZQ6A 3P0HA 3DP9A 4Y3UA 3R0VA 2HSEA 3WL8A 3L7BA 1T1IA 1JIIA 1XRMA 1XVTA 1ZRSA 2VQSA 4GXTA 5AHKA 3WLAA 4BEWA 3BJMA 1E5QA 2C0QA 4X00A 4RMGA 2PZJA 2JFQA 5CXUA 2PLFA 1JXOA 5FAXA 4KXVA 4EY8A 1DADA 3GUUA 4IOKA 3CIOA 3L77A 4RVFA 5K3BA 4Y0AA 2WUEA 2EVWX 1TVCA 1G20B 1PGOA 3EFOA 5AKXA 1KY3A 4LWPA 1TCVA 1EGMB 3TIFA 3MYYA 3TZBA 5A0VA 1U3WA 5DTMA 3QWAA 3VH2A 1LUAA 3ORQA 4Y2RA 2J3IA 4DKXA 1KU0A 1I30A 2DFNA 5B1DA 4IZOA 1N7GA 3WKEA 1CF9A 3DHWC 3L04A 1E6LA 3AHFA 4MR8A 4V39A 3WYEA 3PEYA 1WA5A 1L5MA 2ZJZA 4OP2A 4WECA 4MCJA 3TRIA 5JYEA 1I3MA 4D8TA 3AM5A 5IDWA 3O2NA 5IHXA 4CL8A 2EC5A 2GCPA 2Q5CA 1IN6A 2XA1A 4OB6A 2HF9A 1ENYA 1LNQA 5ECYA 2Q5OA 4PHGA 3BJZA 1VLHA 4XX1A 5SICE 5LP1A 4QXAA 4XWYA 1IEWA 3IV6A 4KO2S 3FPLA 3DMNA 3QFFA 4IIDA 5E9WA 5HCUA 3LECA 1T2UA 4E7OA 3T1HB 1M7GA 2C7RA 3TLXA 3K2QA 4DR1B 5HMMA 2B4QA 1NAHA 3P2YA 1A98A 1KI6A 5JBNA 4U9HS 2GJ4A 1PT9A 3I6QA 3W1WA 4A8JC 2HT6A 3D7RA 1GPNA 2G77B 1IB0A 2ZCVA 4PNZA 4QPCA 3E2PA 2HDHA 3TOZA 4MSUA 3JQBC 1T29A 3RUIA 1TYBE 3BRQA 3WFJA 2B5OA 1YIOA 2CW5A 4JGBA 5HRAA 2XYGA 1C9DB 3R9KA 1F4VA 3RK0A 3SE7A 4ZI3A 1DPGA 3CVXA 1GEGA 1ORVA 4TLBA 2QQ0A 1DL5A 1BMFD 1IHPA 1W1UA 2ST1A 1SKUA 2OP1A 4PPNA 3NX4A 1KA9H 5EMNA 2WM9B 1JNYA 4HDAA 1HURA 3WQHA 3HSSA 2YHAA 5LDDC 2AW5A 2YQ5A 4J0HA 2FYTA 3H9UA 1V1RB 2ZYAA 2OBXA 1K3TA 4IIFA 3EUWA 4KXQA 3I2IA 4PONA 3IBFA 4BYMA 3FYSA 1VZ2A 1NI3A 5ENVA 2O9JA 3SYTA 3EPHA 2GN2A 1PJAA 1VZ3A 3OU7A 2C98A 4PZEA 3KELA 1QVWA 3K20A 3ZPXA 2REQA 4H6VA 4U00A 1FZQA 1DV1A 3OUUA 2VDOB 4HH0A 1E5LA 1RXCA 5C3UA 2G7MC 2DUMA 3IBGA 4FXPA 2I7DA 4RHYA 5EVCA 1X7WA 3T3IA 3VR3A 4MWBA 1W93A 4YIKA 4CLOA 2Q29A 1X92A 4D46A 2VT3A 1FVOA 3NT4A 5FIUA 4PGHA 4ZKDA 3WI7A 1U7UA 1DAOA 3FVTA 4LJAA 4NCIA 3B13B 3NRJA 3CH5A 1U8FO 3I6YA 4NL4H 1RFLA 1VCNA 4ETIA 1A88A 1OJLA 2FSSA 2IYWA 1XP5A 5GWXA 1QHGA 1PJRA 4Y6OA 5KTNA 4EI8A 1PF7E 4DL9A 3U6KA 5C34B 4QU5A 1CQIB 4P7JA 3Q4GA 3EEQA 2DZDA 5TVGA 4D4LA 1H5QA 1FVHA 2WRZA 3W06A 4XYGA 2X1MA 3U0VA 5IULC 4JI6B 4NYMR 2ACKA 1YVRA 3KHTA 1XCBA 4X61A 3FTCA 4B44A 1XMIA 4NBSA 1CZNA 3RIHA 1PHPA 3V2HA 4X95A 3VNSA 5L3RA 3EXIA 3U4IA 4JUBA 1PR3A 2BE9A 2VH2A 4D96A 4OX9B 1P6XA 2VJAA 3OMWA 1VDZA 4PLYA 3TZLA 3X1JA 2JIPA 4KXLA 1G2QA 4P3YA 1CQZA 1J2TA 1DPFA 3DUWA 4H08A 4X45A 2WTEA 4BBAA 5LMNB 1H1DA 2QW1A 4KUGA 1WUKS 1AUVA 3MMPA 3A4MA 3AZOA 7MDHA 1KDPA 1H6AA 2WDPA 4F1JA 2QJOA 4I4IA 1L5GB 3LP8A 1I2DA 5KYXA 1BVRA 1E2LA 4DVJA 1BMQA 4YMWA 2PQMA 3R0JA 4MVJA 3LC0A 1U0HC 4HVAA 2QIPA 5CTJA 3HBNA 3SLRA 5AKGA 2P2LA 2WHPB 3JQ7A 4WZZA 2GVNA 2QIOA 5EXDA 5FPSA 5B1SA 3T5AA 1EG7A 3GJ5A 4M0PA 1QHIA 1R3UA 3PLRA 1FSZA 2YJ5A 3QFTA 4A23A 4D9HA 2QQEA 1GFSA 1F4PA 3LQ4A 4OQEA 4RY2A 2EATA 5C31A 2FU5C 1U2DA 5IEBA 3V42A 1RZ3A 3IJ5A 4YV2A 4JYMA 5JS8A 1KP2A 2C83A 2KI5A 3L7AA 3HR8A 3KXDA 1Z6TA 1C3VA 2BEJA 3IJRA 3O1IC 2K87A 1GQFA 4YCLA 3QMMA 3R0ZA 2E6KA 3DL0A 3EEOA 4Q3BA 2AFIB 3C43A 4ZPJA 3WLNA 3OUZA 2OGUA 1T24A 4I2NA 1QHFA 1UZMA 1C7ZA 2G7ZA 4AD8A 4O2BA 1JFTA 2XDQB 5KO2A 2QTWB 3JQFA 2GM3A 2WQZA 3V1YA 3PT5A 4EG6A 4F6CA 3SZUA 2QRVA 3FHLA 1V2GA 2WHQA 3GELA 1QHHB 1T6NA 3G7NA 2V6JA 1KE1A 3FCEA 4D41A 3OZSA 3PEWA 1ENPA 4MEBA 4UJ3A 4LK3A 4LYFA 4PG5A 1BXZA 1CE8B 1HM5A 1TUIA 1WXWA 3DF7A 1XXHA 3INNA 3P4UA 4O2AA 2IKQA 4TTVA 3RJZA 4F5EA 1FPQA 2C00A 2KMLA 4BO0A 4DLPA 1E99A 1XL0A 5J2TF 2QN8A 1F2UA 3SHOA 3NEPX 1SXJC 1X7XB 3UWPA 3T15A 1D4ZA 4ND2A 3OCVA 4M0KA 4QULA 4BO1A 1RQGA 2Q8NA 1FDWA 1H8ED 2YY7A 3KOWA 4L95C 2YMMA 5ILQA 1ZAYA 5D5QA 2QUIA 3VAAA 3ZW9A 3ZX4A 1GRNA 2WYIA 4GPTA 3L7YA 1ST3A 1A8QA 3HUEA 3AESA 5KNBA 3RSQA 4KKVA 2KBFA 5CDTA 3I0ZA 1T2VA 4M89A 3HDGA 1C0EA 3NWEA 1DCTA 3HK2A 1J2UA 3H84A 3OQIB 1FOEB 2XB9A 3E82A 1JR3E 6CHYA 4OU5A 2ISSD 2VP2A 4CGYA 2XGOA 1E9SA 2OZPA 3KXIA 4X64B 1TW2A 2WDZA 3EA0A 1ZA1A 4ILEA 3K0SA 2VBIA 2FRXA 3I04A 3O3MB 4BTVA 1Y1RA 4RA9B 4AMUA 2P4UA 3U2QA 3CLUD 3QF4A 1D9XA 1UXIA 5AVKA 4BV9A 4YDQA 1J5XA 1D6MA 2XMCA 3FUVA 3N53A 5JMOA 5LZ7A 4GL2A 3R3SA 5P21A 3ZWCA 1FJHA 1W4AA 1EVYA 1R6UA 1YL5A 2Q1WA 3CX3A 2X19A 3RVNA 5BMVA 5CDFE 2AMYA 2CEKA 1PSZA 2PEZA 3UA4A 1L6RA 5I7EA 5EQDA 2HCJB 2XSZD 2J0EA 1LX6A 1NBMA 2C20A 3TKYA 1BE6A 1D9ZA 4B5LA 2C78A 3QE0A 3GZ4A 5D3ZA 5FRDA 3VKUA 2CKDA 1CU1A 2O2DA 3DF9A 1NI4B 2JGKA 3T7CA 5KNCH 1M7BA 4FDAA 3U39A 1OZ0A 4QFBA 1RVDA 3WGNA 5BWMA 3NS7A 1KWGA 4X93A 3R3ZA 3QE9Y 1MW8X 4C0JA 4JI7B 2R8ZA 1L7DA 2I2FA 3BQMB 4E5DA 2PBLA 3MSXA 3EG9A 1QLJA 1XMVA 3C7CB 3ND9A 1ULAA 1RYDA 4HDKA 3QUAA 4TS1A 3V1MA 1U0LA 2UUPA 1W1IA 4WT7A 2R60A 2GBGA 2WTAA 2ZIXB 2IEYA 2WF9A 3GCXA 1Z45A 1YNSA 2XQVA 4R8SA 3EFBA 1EDBA 3MUFA 3N0WA 3OE1A 2QUJA 1PD0A 1D5WA 4OGFA 3GLGE 2XV1A 2NZWA 3EGIA 1E8MA 1AKWA 2JD0A 1KAQA 4M53A 2V7EA 3GJZA 4MYDA 3ANSA 1GDTA 2BRUC 1H2EA 3U5TA 3TZQA 2XYRA 9ABPA 4NDNE 4KH1A 3AY7A 2OBLA 1DCFA 3AO0B 3PE6A 4V38A 1MB9A 4PQGA 2PS1A 4M8IA 3OEEA 4NJMB 2HRRA 4CWAA 2O8EB 1DJMA 3TQRA 4LMAA 4NE7A 2IPNA 1V8OA 2YOFA 2A3RA 4UEWA 2J0UA 2YZ2A 4BX8A 5CFOA 4JELA 1NJSA 1SM4A 1PWEA 2H2AA 4TWRA 4UU7A 3ICOA 3VI3B 1YS2X 1ZUHA 3DFFA 1YMQA 1HDOA 2GEKA 2XEXA 4F86A 1XELA 3H1GA 5KC9A 4HDQB 1FF9A 3JZDA 3WJ2A 4ZVPA 1S2DA 1N2CE 2P4SA 4W5WA 3UCFA 2GF2A 2M6SA 4LYGA 4MS3B 5CM2Z 1TL7C 2PXCA 4ESEA 1T35A 5BXQC 3MM4A 5HS6A 4V02A 5GIOE 3C7TA 3MJVA 5KI6A 4W5OA 1ZH6A 2XODA