1Z17A

Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound ligand isoleucine
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
344
structure length
344
Chain Sequence
EDIKVAVVGAMSGPVAQYGDQEFTGAEQAVADINAKGGIKGNKLQIVKYDDACDPKQAVAVANKVVNDGIKYVIGHLCSSSTQPASDIYEDEGILMITPAATAPELTARGYQLILRTTGLDSDQGPTAAKYILEKVKPQRIAIVHDKQQYGEGLARAVQDGLKKGNANVVFFDGITAGEKDFSTLVARLKKENIDFVYYGGYHPEMGQILRQARAAGLKTQFMGPEGVANVSLSNIAGESAEGLLVTKPKNYDQVPANKPIVDAIKAKKQDPSGAFVWTTYAALQSLQAGLNQSDDPAEIAKYLKANSVDTVMGPLTWDEKGDLKGFEFGVFDWHANGTATDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand-free and -bound structures of the binding protein (LivJ) of the Escherichia coli ABC leucine/isoleucine/valine transport system: trajectory and dynamics of the interdomain rotation and ligand specificity.
pubmed doi rcsb
molecule tags Transport protein
molecule keywords Leu/Ile/Val-binding protein
total genus 135
structure length 344
sequence length 344
ec nomenclature
pdb deposition date 2005-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1z17A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1z17A01
2R48A 3CLKA 2VYCA 1I3CA 1GCAA 2IYNA 4PICA 5HQJA 4G86A 3MM4A 4Z4FA 4HNQA 1E2BA 3DGEC 2JVJA 5HKOA 3H5IA 1TVMA 3Q7RA 4JB2A 4RXTA 3UKJA 4N41A 3CZCA 5D2CA 3KKEA 3MIZA 4YS6A 5IUJC 1MIHA 1BDIA 4YGXB 3GA5A 1QQBA 4H60A 4F3TA 2W42A 3CRNA 1MVOA 1ZDMA 4JAVC 2QXYA 1U2PA 3O21A 3I09A 3VNAA 3QEMB 2MYPA 3FFWA 3N8IA 3E61A 3H75A 5TE9A 1NXTA 2HQOA 2MYNA 2QW1A 3GWGA 3D8UA 3HDGA 3M6MD 1RPJA 1Z2EA 2QU7A 2QVCA 5ED4A 4W5RA 4EVRA 3KS9A 1QP7A 3EULA 1YIOA 3H5VA 3HJFA 2OQRA 4KZKA 4JB0A 1L5YA 5I4CA 3B2NA 4GNRA 5BRJA 5KI6A 1BVHA 3S99A 4RK1A 4MLCA 2MYTA 1P8AA 4OLAA 1E6KA 1YMVA 3QEMA 5PNTA 4RV5A 1JLKA 2GBPA 3I5AA 1VLZA 3IP6A 1QO0A 5FWXA 1QNLA 1PNTA 4XAQA 2CWDA 3MQ4A 2PUFA 2AYXA 3T8YA 2JBAA 3Q41A 1SXIA 2LUOA 4B09A 1NTRA 3HDVA 1JYFA 4YP9A 5KC9A 1Z25A 2FEPA 2QSJA 2FLWA 2ZAYA 3RVNA 4O5AA 1URPA 4LDZA 4ZMRA 1U04A 5CNJA 5JNSA 4CBVA 3IP9A 1PUXA 3T38A 2IPMA 3C6QA 1ZY2A 4W5QA 1DC8A 4KREA 4TLLB 1IIBA 2FQXA 3OLWA 2A9PA 4PYRA 4Z4GA 2RDMA 3ILHA 3JS5A 3O2QB 4XXHA 3HS3A 3CTPA 4RZSA 1LBHA 4DN6A 1L5ZA 3HM9A 1JFVA 2JBAB 1EWVA 1FQWA 1QMPA 3EJWA 1JBEA 3LUAA 3M9XA 3GBPA 4KRFA 1R8JA 3N0WA 3NHMA 1DCKA 2E4YA 5IX8A 2MYUA 3GRCA 3LFTA 3HCWA 3T6KA 4W5OA 3OLXA 3CKMA 1ISRA 5IBQA 3HK2A 1KMIY 3RVPA 2FN8A 3LUCA 1LJUA 4G0MA 4W5NA 2PLNA 1D2AA 4RK4A 4Q7EA 3LMKA 4NV3A 5GQSA 4Z4CA 5EWJA 8ABPA 2YHBA 3LUDA 7ABPA 3M9WA 2J48A 4L4UA 1YMUA 5KQPA 3KYIB 1U8TA 4H3KB 1NXXA 4KQCA 5FBHA 1HEYA 2RJNA 4MS3B 1CYEA 3OM0A 1Y1LA 4KPYA 2VK2A 4L85A 5BQ3A 2NUBA 1ZHHA 3OMWA 5JNRA 1XWWA 3LUJA 4HNSA 5CNMA 5BR1A 2XDYA 5DCLA 5FWXB 1M2FA 2A9QA 5TQJA 3H6GA 5T3YA 4EUKA 2MSWA 2PUEA 1BDJA 3OLVA 2NT4A 1DCMA 2PUAA 4OATA 1BDHA 3TX6A 2HJ9A 1QQAA 3ROFA 3OMXA 3KTOA 3NNDA 1C4WA 4RKRA 5FBKA 1KGSA 3Q7SA 4MS1A 3NNNA 4RY0A 3RVKA 3OQNA 1JFTA 1ZAYA 3OQMA 3C97A 2GWRA 2DRIA 1JDNA 3KSMA 1DJMA 3MF4A 4PZ0A 2WB4A 2WRZA 3K4HA 3LKVA 3LUHA 1RZRA 2N9UA 2PUCA 1NXOA 2PUGA 2R4QA 3GV0A 1A2OA 1PEAA 1D1QA 1LBIA 1YVUA 4P98A 4F11A 2WJWA 3H5OA 1D4ZA 2WJAA 3IP5A 2H0AA 4LX8A 5EWMB 1QPZA 3RVRA 4MRMA 3JPYA 3JVDA 1KRWA 1M5UA 2FMIA 5KQLA 2E4UA 3QX8A 3N0XA 1DG9A 4OBBA 2L18A 4XARA 4MQFB 4XLTA 4MPTA 5JNUA 3P9YA 2BGGA 1NATA 3SNKA 1QKKA 4MGEA 4FE4A 2VUHB 4RWEA 4F06A 2JB9A 4NCAA 4G0ZA 2JVKA 3KHTA 2JRLA 4NICA 1YK0A 2FEWB 4RSMA 4FE7A 2CHFA 4N0PA 1ZGGA 4MS3A 4XASA 1DP4A 6ABPA 3D02A 1ZH4A 4LDAA 3TO5A 3HEBA 1DRJA 4UHKA 3DLHA 3OO1A 3IPCA 2CHEA 4WUTA 2VUIB 4MS4A 2X7XA 3QEKA 3FDFA 3H6HA 3KYJB 4KV7A 4HNRA 4MQFA 5IEBA 3QLVC 1EWTA 2FEKA 4G0XA 1ZN2A 4W5TA 4RXMA 3Q7TA 5CHYA 4KK4A 3JTEA 5IEJA 3UUGA 3T95A 2L17A 3A10A 2B1JA 3HUUA 5C5CA 3SG0A 2V0NA 5KC8A 1ZVVA 2KYRA 1VKRA 3TB6A 4KK3A 4QYWA 3BILA 2AYZA 5DTEA 1D5WA 1K68A 4RY8A 2YHAA 3CG0A 3MA0A 1P6QA 3HXMA 2PUDA 1S8NA 3GBVA 4WZZA 2WMYA 4RY9A 4P1ZA 4Z4IA 1LJLA 3CS3A 2LIVA 5CNIA 4Y9TA 3LUKA 5GOTA 5FWYA 3SM9A 5DLEA 3QX9A 4MQEA 4RK5A 4LE1A 5HSGA 1W9HA 1DC7A 3FGZA 1USIA 3SAJA 4OG2A 4YLEA 2JCGA 4IILA 1FFSA 1JDPA 2R25B 3NHZA 1FFGA 1OXKB 1ZGZA 2O20A 3I42A 1Z13A 3KJXA 4RK0A 3SQNA 2FXIA 5JNTA 4EYOA 1JX6A 1PHRA 4E7OA 3QLUC 2MSLA 2FQYA 3FFXA 3QLTA 2NT3A 3EQZA 3EODA 3H1FA 1CEYA 4EYQA 4ZMSA 4KNYA 4Z4EA 4MQEB 3OM1A 4RK6A 2TMYA 4XFKA 1DZ3A 2R47A 1W25A 1JHZA 3KCNA 3SY8A 1JWLA 3IDOA 3IP7A 2E4ZA 4FB4A 4RS3A 3KG2A 4LRQA 4D6YA 4YR7A 2IDMA 3BRSA 3O75A 2QVGA 5EWLA 4IRXA 3IPAA 1E6MA 3OLZA 2FN9A 4S05A 3A3KA 5HM6A 3RH0A 2M1ZA 2FMFA 1K66A 2PMCA 3G85A 4UHJA 5EWJB 2LPMA 1VRVA 1M2EA 1JL3A 4N76A 3CG4A 5KWSA 2PE5A 5TPWB 3JPWA 4Q6WA 1OXBB 3H1GA 1MB0A 5E3JA 4Z4HA 3EGCA 3C3KA 4MR7B 5T7BA 5EWLB 2GX6A 1P2FA 3OLYA 1B00A 5BRAA 4MR8A 4PEVA 5F64A 4YWHA 3HUTA 5KQMA 1YTUA 3DGFC 5JS2A 9ABPA 1AB6A 1F4VA 1SXHA 1SRRA 3K9CA 3MYYA 2OENG 3KLNA 5TPWA 2F8TA 3QLUA 1AB5A 1PNRA 1TLFA 1KRXA 3O1JC 1A0OA 3GL9A 2P9HA 3H5WA 2E4VA 2FSPA 2P4UA 3L49A 3W9SA 4OLBA 3A0RB 4WXMA 1BAPA 3FFTA 3QK7A 2HPHA 4O1IA 4PE5B 4YRZA 2PJUA 2F8SA 2L2QA 2FLKA 1USKA 2RGYA 5ABPA 2E4XA 1NXPA 1TMYA 5TQ0B 1M5TA 2M98A 1QP0A 3BBLA 3TD9A 2LBPA 4E7PA 2JVIA 1SXGA 4G0YA 2LP4Y 1JF8A 2ZWMA 4MR9A 2IPLA 3H5LA 4GPAA 4RKQA 4O1HA 2FVYA 3NBMA 2PL9A 1ZH2A 1JYEA 4KMRA 3HO1A 4OTZA 4WXEA 1Z15A 3JY6A 3DZDA 4IMIB 1EAYA 1USGA 2MSKA 1Z2DA 1J56A 3Q9SA 4QICA 5B3JA 5TQ0A 3RVQA 4DQDA 2QV0A 1D1PA 4RK7A 3QELB 2Q5CA 1U2QA 5TQ2A 3DBIA 1FFWA 4MR7A 4LE0A 1VPWA 2PAFA 4KFCA 3LUFA 4KVFA 2FQWA 5IUKC 5IC5A 3HVRA 1SD5A 4IF4A 3E3MA 4MS4B 4F8JA 2FMHA 1RXIA 4LZLA 5JS1A 1JFSA 1NXSA 4JOQA 1ABFA 3OO0A 4MR8B 4EYKA 3DLBA 2CD7A 1XHFA 4JP1A 4QPJC 1FSPA 3C3MA 3G1WA 1TM2A 2I6FA 2ID7A 3QLVA 4EGSA 1LK0A 3BRQA 4ETNA 2GI4A 4MAAA 3UK0A 4YO7A 3F6CA 3A0UA 5EWMA 3VNBA 1DBPA 2FW0A 2PKXA 1C0EA 3RVLA 4EY3A 1EFAA 4MRMB 1RZRD 1ZITA 4M88A 4ZPJA 1MB3A 3CFYA 1U0SY 3CNBA 3FMVA 1APBA 2GKGA 4WWHA 1XHEA 4TMYA 1GUBA 4NCBA 3CU5A 3Q15C 4NQRA 4ZJPA 3EDCA 4DADA 2WWVD 1H9CA 1DBWA 1Z26A 3LKBA 4LE2A 1EHCA 4QYMA 3HSYA 4ZYLA 5DGCA 2PL1A 1UDRA 1MAVA 3TMYA 1QP4A 3RVJA 1WETA 3LUGA 4RXUA 1RNLA 2JK1A 1ZESA 4RU1A 3O1HB 5TPZD 5JNVA 4ETMA 2RJOA 4MR9B 3N6VA 3EQ2A 4TLMB 3C3WA 3LTEA 1P6UA 3LOPA 3N75A 4ML3A 3BREA 4Z9BA 5CNKA 5IULC 5IUNC 1EWKA 1GUDA 3URMA 3F7NA 1PEYA 3HZHA 4JA2A 2IKSA 5TPZA 1JH9A 1Z18A 3H1EA 3N0RA 3I45A 2QZJA 4D74A 3F73A 3CHYA 1QO0D 2IPNA 3ILYA 4N0QA 2E4WA 3O74A 4Z9AA 2IOYA 1DBQA 3CZ5A 1GLGA 3QELA 1CHNA 5TQ2B 4YCSA 4JASB 1TJYA 4Z0NA 1E6LA 4G97A 4IGAA 4HYEA 4RDCA 4EYGA 4MYRA 3OQOA 4ETIA 4N47A 4F12A 1Z12A 2FKAA 3GT7A 4G0OA 1DCFA 2HQBA 4Z99A 1DRKA 2FTKE 3GYBA 4IMJB 3N53A 4MLDA 5FWYB 2NZUG 5KQGA 1GCGA 3O2JA 2A9RA 1YS6A 2IPAB 3KLOA 3O2SB 2QR3A 5JNWA 3MMNA 4TN5A 4D6XA 4MS1B 3O1IC 3NNSA 2FMKA 4WT7A 1NY5A 4YV7A 2WY2D 4EVSA 4H3HB 1YS7A 1RXEA 1Z17A 4G0PA 1A04A 1NXWA 2H3HA 3ROTA 5C5EA 2PUBA 2NZVG 4G0QA 3RVOA 2A9OA 4KQ9A 3RVMA 3JVIA 4Q6BA 1BA2A 1YK1A 2B4AA 3H5TA 2HQRA 1NXVA 6CHYA 3L6UA 5B3JC 1Z16A 1ISSA 3F6PA 4S04A 2HSGA 3RVSA 4EVQA 1T34A 2ID9A 1ABEA 3RQIA 3EAFA 2L19A 5DKFA 3HV2A 3R0JA 1F51E 4N03A
chains in the Genus database with same CATH superfamily
3CKLA 4BRWA 1NMSA 4TYPA 3K5WA 4EUNA 1O94A 4OI4A 1U1GA 2IFTA 3BWBA 5JXHA 1FBTA 4LW8A 4Y2JA 3GPBA 4BNWA 1GZHB 1MRSA 1R3UA 3VU9A 4M7RA 3A8TA 4Q18A 1ZZEA 4JVSB 2RGEA 1PT7A 2QXYA 1ECGA 5JALA 3SC4A 3WBKA 3OJLA 3EIQA 4OQZA 1WWKA 3DOUA 4QASA 4KJZA 4HEA6 3BA6A 4I1PA 1P1FA 5E3HA 3QEBZ 1F5NA 2MMGA 4I99A 4EW6A 4YXWA 1GRVA 2WA1A 2GA8A 1TO6A 2A9KA 2ZYHA 3AF1A 3KS9A 2OXTA 3TSYA 4KLAA 3WLRA 1UJNA 1WSWA 4QT0A 1A9XA 1WS6A 2WVAA 3BGDA 4A6EA 4ZVLA 1PDOA 5ICSA 1IM8A 2C2XA 2Y77A 4HEQA 3ONDA 1T6ZA 2IU0A 5JU6A 2BSAA 4CTOA 6REQA 1MT0A 1UBNA 4OSEA 1E6KA 4QXPA 2BW0A 1FFDA 2XCIA 4LJAA 4P38A 5ITVA 2UZ4A 4DC1A 2O05A 3DDCA 2BD0A 1SKAA 4C22A 4YMTA 5KSZA 3DJFA 4P36A 4TTSA 1JQDA 3NRBA 4XDGA 4ZO6A 3WLMA 1RAEA 3QPBA 5K8VA 2QTFA 1EFVB 1W30A 1LK7A 4CMEA 1ENPA 3C7DB 4XAQA 1XQVA 1VGRA 2AYXA 4K9KA 2OHJA 5KCZA 4B82A 1I7DA 2IXFA 2LUOA 2QNIA 4BVBA 4JZKA 1HI9A 5JAIA 3HGQA 1D6JA 3O8NA 2GNAA 2OCGA 4Q21A 3TRHA 1G2PA 1VL2A 3RVNA 1KKLA 5G0WA 1NP7A 3HH8A 5GP1A 2Q0XA 2PLAA 1AGRA 4BUZA 1JXMA 1TMGE 3E27A 4I4LA 4R7GA 1VMEA 4X6UA 3FPFA 4QXRA 3RBVA 1DB3A 2FSVC 3L4SO 4YRSA 1BDMA 3TNJA 5EJGA 5IJ9A 2J0UB 1C3EA 4Z4GA 2ZYUX 1QFYA 1PK9A 4IUCS 2CLCX 4M0FA 4X3CA 1ULTA 1FEZA 5EZYF 1UJ4A 4WZ6A 5CVJA 3NHFA 3C2QA 1EVJA 1P7WA 5H8WA 3HUEA 2NO1A 3MWDB 1WUTA 3EJWA 1GZ4A 2VDVE 1ZONA 5FLYA 3JQBC 4I55A 3ZJYA 3N0WA 2EU8A 4LCBA 1DCKA 3VKUA 1TIBA 1KE1A 4PVCA 4EMUA 1CJBA 1OREA 3QPVA 1TGYA 4BMDA 1ZOIA 4H0FA 4CEJA 1KH1A 2CC2A 1Z68A 1JHYA 1V8OA 3PDIB 2EQAA 2VJOA 1X3SA 3L7CA 1L7XA 3L1HA 4B3TB 2X77A 2YHIA 3JAWB 1Z7BA 4LNUB 2VBIA 1U0FA 4OHPA 4PYKA 4KN5A 2ECFA 5L3QA 3QLJA 1N0WA 3BHIA 1DWUA 1O89A 2W2LD 5KQPA 1R7RA 4IDOA 3B89A 2IDJA 4D9IA 4HLUA 4D5EA 2XGOA 3QFTA 1PL0A 1U3VA 2FZ5A 2H1FA 4KPYA 5EJ7A 5CT4A 2IXBA 2OYCA 1YZLA 1SELA 1PFKA 3C3JA 4TSFD 3IV9A 5HE8A 1C3JA 2ZJ8A 4B7ZA 3VC1A 5K3FB 3GH1A 1VLJA 4MH0R 3KX2A 4ZZ3A 1RXUA 1L4FA 2BBWA 5KDDA 1HH4A 4HGPA 3DV0A 1VZ3A 5CEFA 4X7PA 3HY6A 1LQTA 2WKQA 2UVPA 2VZEA 4QECA 1Y3IA 4QAQA 3FX2A 2PBLA 2PUWA 1GLVA 3AWDA 1BMDA 4PTLA 1TEZA 2VRWA 3FNBA 2OHXA 2W6OA 1X7XA 3P2IA 5DULA 4X61A 4CLOA 3THWA 3AESA 4PGFA 4Z53A 1YZ3A 4JLPA 3GJ6A 3L41A 4RAQA 1LBQA 1MRNA 2IP4A 2WAOA 2W7TA 4IF6A 4X92A 3R6TA 3K4HA 1JAZA 2PT6A 2QX4A 3WI7A 4E1BA 2YDYA 2R8PA 3HL4A 5FIUA 5EP3A 4AY3A 5JD3A 5KNDH 4G01B 4INAA 2R4QA 1QUEA 4XJSA 1M74A 3FIJA 1PVOA 1RQRA 3LWDA 4I1UA 1TD1A 4HRVA 1JZQA 3RFCA 2QJOA 2P6PA 2XWSA 1GKIA 2P4SA 4G67A 3H9QA 3EFOA 8ADHA 5JI2E 3F97A 2LKDA 4G63A 4BQRA 1SHZA 2P40A 2PS1A 3FGNA 3I0MA 1RRKA 2QN2A 3E05A 2PD4A 4JUCA 3TLJA 1SRQA 1N0HA 3B1VA 3PL5A 4GXQA 5K6TA 2QQ0A 4NCJA 5JD5A 5LKAA 1E2PA 1X8JA 2VRBA 4O29A 3H2JA 4WKNA 4F06A 3EZFA 4DA4A 4EECA 1YK0A 2EJCA 3DE3X 2BGTA 2I99A 4RSMA 1LU9A 4ZYYA 4DB4A 2Z4RA 2UYGA 3PX2A 5TNXA 3D8SA 5KJ6A 5FI5A 1G8AA 1TU4A 1TPYA 2P5YA 3BIXA 1OWOA 4LDAA 3E2MA 3GZNA 3R6DA 2BJVA 3OHSX 3ZD9A 3DHYA 3DMYA 2QRHA 1GN9A 3K6KA 2PRJA 4R2JA 4BO8A 3V2GA 4DV0B 1MTZA 2H1VA 1V7ZA 4J7AA 1KS9A 1KEEA 4H6XA 1B76A 2IZOA 5J9FA 1MQ9A 4HDMA 4QHYA 1F4PA 1FSFA 3E9EA 3AUKA 2EEPA 3KUKA 3MHPA 4ENRA 1CXZA 5JAZA 4F9GA 2W00A 4S1WA 2C57A 2ORYA 4P3KA 2GVZC 4P5DA 4TWJA 2P11A 4AJ9A 2QU8A 4AI6A 5JO0A 3VTKA 2NMVA 3ODPA 2N42A 4M60A 2XE7A 5D51S 4O8CA 3Q5EA 4ZCRA 2V7BA 4X1OA 1FQKA 3BFKA 3BGIA 1M6VB 1LLCA 2F48A 5TGTA 4XCQA 2Z6UA 4YUYA 3RT9A 1L6RA 2ZE5A 1L0BA 3F6BX 4I0WB 1N2EA 1QIJA 2FSHA 1TM5E 3ET5A 4EKNB 4R5MA 5CNIA 3PUZA 4W1RA 4AIIA 5F9FA 1UDXA 4HOYA 3RWOA 3SM9A 2HMVA 4N7BA 1LDYA 3BVPA 1M7HA 5LLSA 5EVJA 3ZTWA 1K7SN 1KI9A 2ZZMA 4YONB 4AZVA 2R68A 5JDIA 1GFIA 4QUKA 5C37A 1Y3CE 2ZJ2A 4U7GA 3ZGYA 1U7ZA 1JR3A 3SD7A 3OEEA 4DCGA 2X5KO 4QU9A 1ID1A 2NUPB 1GUFA 5JSUA 1L7EA 1FX0A 1VI2A 3NM6B 1OU0A 3L40A 2ETVA 2O20A 4RK0A 4UXIA 4BLUA 3KEFA 5DPMA 4KR3A 3W8FA 4CM5A 2Q3JA 5H9WA 3ZW9A 3B1YA 4NMXB 5J63A 2XRMA 3RS8A 5ALPA 4QOGA 2M6LA 2BONA 3WMWA 4Y2TA 5IFKA 1AUPA 1GQYA 1XA0A 5IDQA 3T3GA 4FMBB 1KFBB 3R3ZA 1LBTA 3FSRA 4OGWA 3N6RA 3LY7A 1EBUA 4L6AA 4M1ZA 3C8UA 4NIMA 1U2GC 2RH4A 3IDOA 3WP1B 4BQPA 4HGYA 3LT5A 4UBNA 3CNOA 4DVGA 1ZYUA 2PMBA 3JYNA 4NHEA 5DT9A 2E37A 4YR7A 1B3BA 1PR6A 5DI3B 3X1JA 5HIKA 1JPNA 2UYHA 3PYLA 3UWMA 1O87A 1QLWA 4OK5A 1NRJB 1T9BA 4HFNA 1Q0ZA 3PDCA 3ZCQA 2FVXA 1D4AA 2A92A 3KJEA 4UUNA 5CFLA 4LQCA 3R24A 1GGHA 1DHRA 2FW1A 2VBCA 4WV3A 5DNEA 3PEWA 4BNJA 4D9GA 4GZLA 4XEHA 4F60A 2QTBA 5DBEX 5JBQA 2FPOA 3RARA 1TTQB 3H4VA 1H85A 4IM7A 1ZICA 3WGKA 4CM6A 2Q7XA 2VDOB 3S5JA 2DQSA 3SR3A 4U2EA 3ZPXA 2VQFB 2VF7A 5IAAA 3AR9A 2WZDA 1J0CA 3AQ4A 1DO2A 2Q5HA 3H9JA 5EWLB 2H5EA 1A2BA 2YV1A 3KWMA 4YJHB 1J21A 1VJ0A 5C52B 5DOZA 3A27A 1L5FA 3H04A 3PPIA 4RHFA 1OGIA 2R6HA 3U5ZB 4YWHA 1AB6A 3G89A 4A8TA 2JHGA 2SECE 3U4HA 1EFKA 1G8SA 2GBLC 5C8XA 2K2WA 1GKKA 2GASA 1TLFA 3B9RA 3EVNA 4WZBE 5LXTF 5K8TA 4X8OA 1YZFA 2BEUB 1MDBA 2P9HA 3NUZA 1P44A 3H5WA 3KJQA 1EH5A 3E81A 2E4VA 3IBFA 2QUHA 2GCGA 1XN4A 3OCYA 5DV9A 2X2OA 3DEIA 2YUIA 4JLMA 3RV3A 1FFHA 2OFXA 1OD6A 1V4NA 3QKTA 4PV7A 1BAPA 1C9JA 1SXJB 3IAEA 4YRZA 4TUYF 5JANA 4JJ6A 4WNAB 3UJPA 5KJFA 2AJDA 4G26A 3ZCSA 3ETEA 1WD7A 4E6PA 2QPLA 3LIIA 2WMDA 1TMYA 4OLHA 2G9NA 4MPRA 4B4UA 4FW9A 3K3PA 4UM5A 1M8GA 4HP8A 1XDZA 1O54A 4LWOA 2HGZA 2O1XA 4OVKA 4QIHA 2E55A 3YASA 5C8ZA 4DV4B 4L0MA 5BW6B 2X5JO 4G0NA 5C4GB 1J1UA 1WXHA 3BGSA 4RKQA 1EPUA 4B3HA 4ZCIA 2CXPA 1C8BA 5CLGA 1CY0A 2HYIC 2V74B 4CQMA 3WRXA 2FRDA 4FKBA 3ZWBA 1XQ1A 4MJ3A 3S5UA 1XZEA 5KTYA 3ETNA 3PLRA 1AUVA 3ZIAD 2OHVA 4BNXA 4WEOA 4C3UA 2QV0A 4RK7A 3QELB 4MWTA 5JCPA 3QY9A 4CLRA 3QVGA 2QUJA 4ZT5A 4H0CA 2QW0X 4QO7A 2YC4C 4WUVA 3ZNQA 4JLJA 5FPKA 3FYHA 1QYRA 2FQWA 1J0DA 3CR7A 3JATA 3BD6A 3QITA 2G9UA 1UZMA 2PMFA 4IEIA 3OPYA 1ZO8A 1N3IA 1Y4SA 3S7TA 2PL5A 3UPDA 5AJTA 3Q72A 4PZ9A 3DLBA 3IAHA 4BL5A 1O9GA 1YL7A 2FEOA 3H9GA 1YMQA 4QVKA 2FE1A 1IQ0A 1QH1B 2D4AA 2V6IA 4ETNA 1V4BA 1EK5A 2F4NA 2Q0HA 2D59A 3OIDA 4JBXA 2QENA 2AWOA 4FEGA 1FQOA 1EFAA 3OCJA 3QG5A 4ZOLF 2VHZA 1KQFA 1IPFA 1KMHA 3UH0A 2H0QA 5AVQA 5ERGB 1V8FA 1E3JA 5AI4A 4OREX 1GR0A 4OD0A 1M33A 5CXQA 3SM3A 3RADC 1QF9A 1RHQA 1L4KA 3P0EA 3L0CA 3MMSA 5D01A 1DBWA 2O1EA 2ZOSA 1PL6A 2DT5A 3VKHA 5DGCA 3LBNA 2O8DB 4A4DA 1RYFA 4OKIA 4G41A 4PHGA 4ROTA 2EYQA 5DP1A 3W6ZA 2J9FA 3KR0A 2PS9A 2XSZD 2J85A 3PF8A 3VSBA 5D3MA 5GWXA 1S2DA 3HHEA 4ZREA 1RWKA 3V8VA 5CFRA 4B0OA 3CUUA 2PMWB 2QRNA 1CX9B 2ZKIA 3GY0A 2B20A 2B37A 2B5WA 3M5CA 4HLCA 4XVHA 4F21A 2P8SA 1XTBA 4KBFA 1C3OB 1CQJB 5EPEA 2HN9A 4NZYA 3TRJA 1BEZA 1CHDA 1G16A 2JGLA 3N0RA 5A06A 5JH7A 4LFAB 2OZVA 2C1XA 1YA6A 4CIVA 1H05A 3MB5A 2X0FA 4EGFA 5B5SA 3IOEA 1BW9A 5TQ2B 2NYUA 3OCVA 3RSSA 1MQAA 1DEHA 4RD2A 4JI5B 6YASA 5GZ3A 3U49A 4TKMA 3HEAA 3HJRA 1XBTA 4EYGA 5AM3A 3QMWA 4XD2A 4B0PA 2R4UA 4UQPA 1M3SA 2AOTA 2QGFA 1U1CA 2ZYAA 3Q0EA 1R4NA 2INGX 1THGA 4C4SA 2P9BA 1P0QA 3CLRD 2HHLA 2FTKE 3I64A 4DSOA 2XWBF 2RD2A 4NABA 1IIRA 4YQYA 4UNQA 4DLSA 3QVWA 4FD2A 1XELA 4HN9A 3IKTA 1INLA 1GGKA 2FZKA 5DCYA 2NVOA 2BR5A 2G5TA 3NEAA 3O8OB 1T1IA 1KY5A 1LTHR 2B6HA 3DR3A 1BE8A 2V9CA 3KSRA 1SK8A 2VWGA 1VB3A 1VIMA 3BWDD 5BV0A 2HHHB 2DLCX 4FXOA 4NQZA 1EESA 1RXEA 2AX4A 1Z17A 2W6IA 1IM2A 2ZRLA 3D3NA 3TKLA 4QTUB 4UARA 3FOFC 3PJRA 2VF2A 3N8DA 2WE8A 4RHUA 1CLUA 1OJ7A 1Z6TA 2AJBA 4M9SA 1B6RA 2YW2A 3AKCA 5K3AA 1NRXA 2I03A 4D3DA 5CXUA 2G1PA 2HNKA 2Q5FA 3J7TA 1Z16A 5COAA 2GF9A 5HUQA 4S04A 3A6HA 1TM3E 2WQ6A 1VTKA 2WHYA 1K6JA 2ZSEA 3S2YA 1KAEA 1I9CA 4TKLA 1JDJA 1C3LA 1S2OA 3FGOA 3IJRA 1CIVA 3HU2A 1VIYA 1X8LA 1E2UA 4ALKA 2XCLA 3F7MA 4C0BA 4C5BA 2YQ5A 5ERXA 3UN1A 4BFZA 3ZWAA 3EUFA 3VR1A 1F3LA 4DG8A 1T24A 1T10A 3GLGE 3B1WA 1H2ZA 2R96A 1O6BA 2XOXA 4HEJA 1TQ2A 5C31A 4DJAA 4EY8A 1XEAA 3VVCA 5DGIA 1RYMA 3QPAA 4J7XA 2H1LA 1Z33A 2BGJA 2FG6C 4XRGA 5KIAA 4EG3A 2R8XA 3ZY4A 3OF2A 2R65A 2FF7A 1A71A 2GM3A 1ZEJA 2DWCA 2EZ8A 4HNTA 5KBYA 5JVDA 2DMRA 3NH6A 1CUEA 3IUPA 3Q6MA 2VXOA 1XWIA 1YOVB 3D9QX 1Y6RA 2XVZA 3D8UA 2GPAA 3W4JA 2C04A 4LGCA 5JQGA 1H3FA 2GEDA 2J9ZB 4XPIA 4L6IA 1G8JA 3M4JA 1DKRA 1RYHA 1RRVA 4FHFA 1CNFA 2B30A 2BUBA 2WF5A 2YRXA 4AKSA 1Q0TA 1G66A 3EFEA 3H8WA 5AOBA 1G42A 4PXSA 1MLDA 3BWMA 3WLQA 2EJUA 2IOFK 2PRZA 4PS0A 3E1KA 4Z9YA 1K8RA 1VXOA 2NU9B 3VPBA 4JI8B 3KWJA 4QEZA 5K8LA 5CHEA 2DETA 5LB4A 4DCTA 1YMVA 4M53A 4HUTA 1USVA 3TJRA 1JLLB 1TJ4A 4YAJA 4QYXA 2XYGA 1CFJA 3E3LA 5ANRB 1HG0A 1UBOS 3G49A 1A7UA 3A11A 1QHEA 2I6XA 5DNVA 4ZC1A 2IV7A 4DMMA 1C1YA 1ML3A 4F91B 2ODWA 2VAVA 3QVVA 3PDJA 5AXAA 5A3SA 3UENA 5B6IA 3BCSA 5K0FA 3T8YA 2VRNA 2JBAA 3KJZA 3EQ7A 3G3EA 4CUZA 1WDTA 4BKPA 1LPBB 2VA8A 3HZOA 3LP6A 1BTOA 4WKBA 3IO3A 4HG2A 2FGJA 2PUHA 1URPA 4KEAA 5HDQA 5KSWB 3NW9A 3SJZA 1T8PA 1YS1X 3GNSA 2BGNA 3R3XA 4X93A 5E6SB 4FT4A 4CBVA 1Z63A 1VL8A 4LDRA 1KQPA 4QLBA 4RJTA 3PVZA 3IP1A 3O4FA 3OLWA 4FWIB 4OHVA 3OSUA 4PYRA 4GGPA 3U3JA 2A6PA 2C97A 4DCMA 1JAYA 4NZ9A 4PLTA 4X0EA 1KDPA 3WDMA 3K05A 4C78A 1I1OA 2QRLA 1JIKA 2UAGA 4S1TA 1WMBA 4ZZIA 1OXMA 2NN3C 5C3MA 1PFWA 1Y42X 4X66B 2I65A 4MIOA 1W85B 3GBPA 3I28A 1N5MA 2ZBQA 2WP0A 1BFDA 4WNCA 4RTNA 4MLZA 2OB2A 3K09C 1E2QA 2GHQA 4YJFB 1KOFA 4HS9A 4QDXA 4YAKA 2ZDGA 5LDGA 5CCEA 3R3WA 3T6KA 4EUFA 4U9IS 1IAVA 3MTBA 4X3PA 1F38A 2D2XA 2P3LA 3L0YA 3G5LA 4WLUA 3G7NA 5B1YA 5B58T 3I2GA 1GPJA 4M7PA 4UHHA 3VKGA 1MX1A 1N6HA 1CUFA 3MCWA 5GJBA 2VUUA 2QP9X 3UK2A 4YLGA 2ZRIA 1H2XA 4L7QA 1RJ9A 5CT9A 5DM4A 3MPOA 2PGDA 1FDIA 1QH1A 1VB5A 3N0TA 3CX3A 3ZDEA 4IV0A 4XGIA 3KQQA 1ZWLA 4MKHA 5LBUA 3UXYA 4DMHA 1T3TA 5DX8A 1TZJA 5HDBB 1KJQA 3OM0A 4QYTA 3OOYA 1IEVA 1N9GA 4UJ3A 4COKA 2GM5A 2WWHA 2AI2A 1SOWA 1PNOA 2P6OA 1RHJA 3H0CA 4A5SA 7REQA 5H70A 1FMCA 1GSIA 1Z37A 2IHYA 5DCLA 4UUQA 4DLLA 1Y3FE 3SR0A 3UG7A 2TS1A 1ZK3A 4ISBA 1G5RA 1UT5A 1PJQA 4ZODA 2APJA 4WX2B 4A2QA 1NZJA 3W5SA 1F2DA 2P9FA 2VHQA 4Y2UA 5C8YF 1E9AA 2JFXA 4KQ1A 3BHMA 4AL4A 3PFHA 3I30X 1SAYA 5AJWA 5IDVA 2X8JB 5TF4A 2ZBGA 5JAUA 1NBEA 4PG8A 1KBOA 3EHDA 2BGWA 1X94A 1KGSA 2FJ0A 2HHCA 3BD9A 3Q7SA 4LC1A 4XWYA 5FL7A 1E4YA 1NONA 2GPWA 3O03A 2OESA 4OF4A 3A2MA 3CW9A 4CM8B 2CHGA 1SIBE 2YJGA 4FGSA 3A9UA 4TL8A 1QIGA 1YHZA 1ZZGA 2DY0A 2GS9A 3LUHA 3QV1A 3TLZA 3D6AA 2GJ9A 3FH0A 3NP9A 3OVMA 2PLWA 1G7RA 1GL9B 2QRGA 5ARDA 1R8YA 3H9CA 4ZQFA 5KWVA 4OQLA 1YVUA 2RKOA 1PX2A 3AOGA 3ID6C 1U0BB 4GLOA 4YA6A 2JAQA 3JQPA 3EH1A 2H0AA 3UY4A 4UU7A 3CF4A 1ENOA 3M82A 3WO1A 3CURA 4OQEA 1KZHA 2OUIA 3JPYA 4MRPA 4UNRA 5IKXA 1P31A 1QS0B 2XWJI 4KAAA 3OETA 3JU3A 4NMHA 2XCQA 1NSFA 3F71A 3C74A 2P77A 5E8RA 2UYYA 2EERA 2VUHB 4JUDX 4PZPA 3TZCA 2FJPA 2X2EA 1ODFA 3KHTA 3Q1KA 4NBKA 4ZI2A 2FWJA 4CG1A 2R97A 2BR4A 3LK7A 4N0EA 3OPQA 4N0PA 1JR6A 5CLJA 4H7IA 5HF8A 5EFOA 1XZNA 2JEOA 1CG6A 1DC4A 1SN7A 1CUAA 2WC1A 1F2VA 3HEBA 1X80B 4G84A 2MMCA 3NVKI 3QEKA 2Q5LA 3DZCA 3QUSA 3TG8A 2R1ZA 1JRLA 1I4LD 2P27A 1U7HA 3LVFO 4OA8A 2FHPA 5C8VA 3TMAA 2HXYA 3K0HA 4RL6A 2RAPA 3H11A 1K8YB 2O0MA 3KE9A 1WVIA 2OO7A 2P62A 3JTEA 3QMMA 4BY9E 2RGRA 5F3RA 4B4DA 1Y8CA 2I1WA 4A03A 2XBLA 3N28A 5H7XA 3RSLA 3UJ7A 4LSMA 1XU9A 3ROPA 3F2IA 3OTGA 1OC2A 4LDNA 4Q16A 5CJJA 2YHAA 3CG0A 4NESA 4BJ1A 9ATCA 5HZKA 3PQDA 5E8JA 1MT3A 2W6ZA 3MS4A 4D82A 1YC5A 3CUEF 1CK4A 1CLEA 2FRDC 1WEKA 1YGYA 3CUSA 2XT9A 3OCXA 4RHCA 1FUUA 1KU6A 4Q4HB 1JHVA 1CEEA 3WWPA 4PG7A 1FDWA 4DC0A 2PV0A 1NKVA 1OXUA 3IRUA 4PANA 3ZCVA 4RYDA 4UOZA 3ZI7A 1XALA 1L4HA 4PZCA 4MUYA 4C4OA 1ELOA 1NV8A 2YBEA 3AETB 2OE2A 2B82A 1FLNA 1JT2A 2Q62A 1HT1E 1F8XA 1RI1A 4BPRA 1Z13A 2ROQA 4DR1B 5AVVA 1NFRA 4UXJA 3C85A 3MK31 5AKZA 5EE9A 1X7HA 1UXOA 2D5IA 2GZ2A 1EXDA 5JDCA 1ZM7A 1GZVA 3AT1A 3IQWA 4U7TB 1E7QA 2H31A 3COZA 2V4UA 1PJ2A 5EEGA 2HYDA 1MEJA 3QOXA 1JG4A 3LLSA 1MKYA 2DP4E 4IDNA 1MAWA 1AKUA 2XQKA 3TIGA 1KP9A 5J4KA 3K6SA 2J67A 4L5CA 2Q3BA 1FVFA 4UMFA 1HSOA 2PX0A 3ZV6A 4DIOA 1TYAE 2JLBA 2BEJA 5FOWA 5TF0A 2PWPA 2F1RA 2QG6A 4E22A 2PRKA 1U1DA 2DCUA 1ZVMA 5AVRA 4RADA 1E6MA 3N2GA 4DEYA 4S05A 2CNWA 5I01A 2O6HA 3PQ4A 1Z9BA 1ZD4A 3U4IA 4FX2A 1L4NA 1VRVA 3AXSA 3UWOA 2QTGA 2OORC 3AUSA 3MJHA 5CYGA 5JQWA 1T5SA 3GLGB 1TT5A 3OOSA 5NULA 3U6BA 3OTIA 4C89A 2RHDA 2VZLA 2QTAA 1X1TA 3K0AB 4G2NA 1UDWA 2I78A 3A9RA 3PQ2A 4M6WB 2OY0A 5EQFA 1MV8A 3BDAA 4HB0A 4K9RA 1OQAA 4WOKA 2C9OA 4Q3OA 4CKCB 1LV7A 1GPBA 3NAMA 4XSVA 4Z0HO 4K1LA 4XM1A 1UOOA 5EUBA 1RPZA 1BHO1 3MXTA 3SLKA 1IY8A 3AH8A 5AI0A 3OIFA 5KVVA 4TRNA 2CLDX 4MV4A 4JOBA 1YQEA 4UOQA 4X90A 3WZMA 1RYDA 1UFRA 3INRA 2J7PA 3QLUA 2AFHB 1PNRA 4ZEXA 4PLZA 2B35A 1JLRA 3V2IA 2OHGA 2Q29A 4UULA 1NC3A 2XJ9A 3L49A 1J5PA 1ZJ5A 1JAIA 4PBSA 4YRQA 1MB4A 2FG7C 2CFTA 4BCBA 3VO9A 3S29A 3TZQA 2Z8ZA 1Y7TA 4Y6PA 3QNWA 1VPDA 4DJJA 5KYTA 1BRTA 3BCRA 4O4HA 1RIIA 1J90A 2PPLA 3NEPX 2A0YA 4DBLE 5LZ2A 2M98A 3G17A 2JPDA 4U2GA 5I5GA 2YS6A 4BO9A 3MC1A 2WLTA 1X77A 1DC3A 2IUTA 1QOZA 5BN5A 1UZAA 5LP6C 1EX1A 1R4AA 2AH5A 5AVSA 1TUGA 2I87A 5B4TA 1E2LA 2NZXA 1SCJA 4M49A 1XXHE 1F3OA 2EQ5A 2Z6VA 1HY3A 1DG1G 1E5QA 2FFAA 2WU1A 3EXHB 5KKAA 3V9PA 2FEAA 4NTZA 4WJLA 4CEIA 2RKWA 1U8YA 1SXJA 1JYEA 1UJBA 2AL7A 2YBDA 3BMOA 3JWPA 3MGGA 2R8BA 1HQCA 4L0CA 1QRUA 4IMIB 4Y0NA 1C9MA 3K70B 3TPZA 1NBME 1Z2DA 5AHOA 1EIZA 3P19A 1DDGA 2IP2A 3OQBA 3ND6A 2PG3A 4GXTA 5CB4A 2FSUA 2YH2A 3QV2A 5FJJA 2BKEA 3ZWWA 2WFLA 4FOSA 2QRPA 2IXTA 4R2MA 1T0IA 3EOBI 1YV9A 4E5YA 5EXPA 2PAFA 1I8TA 1UMKA 5ELLA 1TKRA 3HU5A 1EJBA 4JT2A 3GAFA 3K8ZA 1MO6A 5LU9A 4ISCA 4BFYA 3F7TA 1Z75A 4W5WA 5J23A 3I52A 3G0DA 5EHXA 1N2BA 2N0SA 2QBYB 2QI9C 3OU6A 3RAJA 3MLEA 5FA6A 1TF2A 1SD1A 3CCFA 1WKVA 3ABSB 5AP9A 3D1VA 3Q7IA 3EGEA 3VO8A 4XCVA 1JEAA 1A9YA 3VR4A 3QVKA 4TMTA 3E84A 3CNBA 3V33A 1U0SY 4NBWA 5LQNA 3N2IA 4N3GA 2GKGA 2BMVA 1Y7IA 1ORHA 2WV7A 3IHKA 4YCLA 1TVKB 1I94B 2CDCA 1N5RA 3SCZA 1UJ2A 3VR4D 2GJSA 3JWHA 3RAPR 1WXQA 3ZKWA 3N74A 3WIVA 4Z9XA 3FUVA 3TMYA 3KB2A 1XEXB 3IKMB 5I9BA 4V1CB 1A9PA 2RK6A 3LUGA 1W2WB 4UM7A 2CV2A 2GBFA 1JIXA 1VCOA 4UEKA 2J3JA 2REXB 1FFBA 3HN6A 4ZHQB 3TWOA 1YIDA 3R5XA 1ZLXA 4NK4A 4QLAA 4EJSB 3D54D 4TZ0A 1ACMA 1GD1O 4TMVA 2XE6A 3AJ9A 5BSVA 3ZDCA 1EVIA 2VPQA 1TU0A 2HNBA 1YB1A 2HMTA 3IALA 4NP6A 2IKSA 4XUEA 4BZWA 1RPTA 2IZZA 4PZLA 1YJ8A 2OOSA 1ODSA 3O4JA 1Q22A 1QO0D 3C70A 4BN4A 3ILYA 4N0QA 2WWXA 2E4WA 2Z1NA 3QKRB 1NQWA 2DHDA 4UNNA 4F11A 4R51A 4DQKA 3HB5X 3NWPA 3HVUA 4AJNA 4Y1FA 4DPKA 1SGWA 3K1ZA 2VWHA 3RYHA 4C01A 3A9TA 3W2HA 1TC2A 5ICEA 3GLHE 4ZOLA 4OMDA 4FJ1A 1SCUB 1VBKA 2PGIA 1RMQA 1FRNA 1E4EA 1WF6A 3ICQB 3CX7A 3PK0A 4RFLA 4RPKA 4DIUA 1R6UA 4HUQA 2ZULA 5KVQA 4D98A 5CLIA 4ZO9A 1NBHA 1RKBA 2ZTMA 1Z2AA 2CMHA 4XH9B 1N25A 1LSUA 5JC1A 1O5OA 1QP8A 1E59A 3M6WA 3LAWA 3RF6A 3O2SB 2HX1A 1UIRA 3ZDAA 3PX7A 4R40A 2XWQA 4GMDA 2FMKA 2QN9A 3RYFB 3GUZA 3PP8A 2WY2D 4QOFA 1OX6A 1RWXA 2Z3VA 4H3HB 5DNUA 5GZ1A 1ULZA 1SOAA 4N3BA 5DOVA 2FPGB 2REBA 5CA1B 3GA0A 3R6LA 4X6LA 4ES6A 3DEZA 3TD6A 1DLJA 1XCGB 4G0QA 4RKYA 4JMLA 3RVOA 3L04A 4D57A 1XVAA 1KQGA 2ECKA 2A84A 2VSXA 3JVIA 5C7YA 1CKEA 2TMKA 3DDWA 5E6RA 1Z45A 3ETHA 5KHOC 4RABA 4IGEA 3OZAA 1DJQA 4JQZA 3DO5A 4E5MA 5CVUA 4WBNA 1D3AA 5FWDA 3ZE6A 1JLSA 2MR5A 3QF4B 1NLFA 4OP2A 4ZT3A 2ZS9A 2B5VA 4PSDA 2BKLA 1OV4A 3W9YA 4IVRA 4KX5A 5DW0A 1CVRA 5LA6A 3FNEA 5B4VA 2QWXA 2P9ZA 4L51A 4U7DA 3AVOA 3J80A 4PGAA 3C5VA 1HDZA 3GIWA 4TMXA 4X7MA 4A2WA 4EX6A 1FJGB 1JW9B 3M81A 3K1AB 1FJXA 3D5EA 1E4OA 1XMSA 3D0KA 4GHWA 4JV5B 2YYYA 5K3BA 1KP3A 1NVVQ 3VNVA 3JD2A 1L4EA 2YZMA 4G86A 4HBGA 5HQJA 4I2VA 3GF4A 3PTZA 1XO1A 4D3SA 3TLYA 4R0MA 3DXZA 4RXTA 1GZSA 4BWVA 2YWJA 2YYZA 4LGMA 1I9GA 1RP7A 1QYIA 1W6RA 1R4MB 4HVAA 1TT5B 4QOIA 2Y1XA 2YWFA 3AXTA 4Z1MD 3RU3A 2WE7A 5FF9A 2QVLA 3CPHA 4CEHB 3ROXA 4RENA 2Q4OA 1VE1A 2MYPA 3E2IA 1XF1A 4P32A 4RH0A 1WZ2A 2A5DA 3GRUA 3N7TA 2P2GA 2HEIA 3UB4A 3RNOA 4P5EA 4BV2A 1XXHA 1YJXA 5ED4A 3C98A 3BTUA 3TXAA 1S1MA 3FOBA 3HBLA 3SYRA 3WWCA 1P0MA 2WWWA 1MJHA 3KAJA 4R81A 4UCFA 3U39A 4BGVA 3H5VA 4XWAA 1ENYA 2H00A 4CCWA 1FIUA 4QHTA 4ZI3A 4A0FA 4WN9B 1QRDA 3MS2A 2COUA 3SSMA 2R6AA 3SIWA 3U09A 4NONA 3S2GA 2B4YA 2BFFB 3WVNA 3RPEA 4DQXA 3CNHA 2X2FA 4YALA 4LOHA 3RBAA 2FUEA 1ZSVA 2ZYDA 3PDHA 5E1BA 1ZNYA 4M0PA 5M2QA 3B38A 1N7HA 3RTAA 3EGWA 3DMGA 4NK5A 1UOQA 1AKMA 1RWMA 1TCVA 3CV3A 1NVFA 4C21A 1QO0A 1VHLA 2FEMA 3B5EA 4GL2A 1CD5A 4WXHA 2Q4RA 2D1FA 4MCAA 1HDIA 4U6NA 4ZEOA 4QVGA 3TLXA 2AN3A 3HDVA 1PNQA 2Q28A 2XVXA 3K7EA 3KZVA 3KYCB 4MVJM 3UATA 3QBDA 1K7EB 3K53A 1RJWA 3QF7A 5YASA 4KBGA 3KJNA 1N34B 4UCQA 3CUKA 2VHCA 1SQSA 1Z28A 4KU4A 4JN6B 3L4KA 1F4LA 1U3TA 3HB0A 2RAUA 4GGMX 2GUGA 4KQHA 4F72A 5L6LB 5F3WB 2RCYA 3H2YA 4PVDA 4W5HA 1UXHA 4TLLB 1YI0A 2WPDD 1EA5A 2V59A 4V1CI 1VLQA 3GFRA 3WLIA 2RDMA 2IA5A 1AO3A 3KFVA 3UXMA 3ADCA 4MNTA 4FWTA 1XTTA 2B8TA 4PO3X 2ZR7A 4FFOA 1K98A 2A14A 2PFSA 1THTA 4C06A 4WN3A 4M7WA 1H22A 1UBHS 5DMHA 1RADA 1Y8ZA 1EXVA 4R8VA 2NQTA 2PFGA 3KTAA 4TKZA 4R6XA 5AD1A 1E9EA 2JAUA 1E2JA 2CLIB 2ECQA 2P9YA 4KR0A 2H06A 4MQBA 3LHFA 2ONJA 4F3NA 3EC7A 2O23A 2I3DA 4B8ZA 1J24A 1ISIA 5T6MA 3N8GA 1BCRA 2XRFA 1HDOA 4OP1A 1MABA 2J4CA 3H3JA 4RLFA 2GF2A 4L5JA 4G0MA 4FWBA 5FBLB 1RMTA 3B9PA 2FLVA 1FFAA 1FLVA 2VTVA 2H48A 4LJ5A 4JSYA 2Z5LA 4Q7EA 1ZIXA 3S2ZA 2FA9A 2WNIA 1P4RA 4HNUA 2J48A 4XRRA 1W85A 4RH1A 4L8WB 4AJHA 2ZUFA 2POCA 1R0SA 4R05A 5DTJA 3WGMA 1NXXA 4BQIA 3BWCA 3MTEA 4YJFA 1SBYA 2ANBA 2OLKA 3WB1A 5IH7A 2IH4A 2A2ZA 5DU2A 3ZWMA 4QARA 3C4QA 4G8DA 2AI1A 4DLAA 3DA8A 5IKOA 2VRCD 5B4UA 4M1SA 4FOPA 3VH3A 5G1NA 4NJMB 4RHEA 4FSXA 3L07A 3W7AA 4B3XA 4PC1A 3LV8A 2HK6A 1C81A 5TQJA 2X13A 4ACAA 5ADHA 3DHEA 3L82B 3F90A 4EUKA 5A04A 1EM6A 2ZJ4A 1OTXA 4K9QA 2G7MC 3PSHA 5AM0A 4PRZA 4IDDA 3STXA 2IHBA 3DFZA 3FSEA 3BJIC 4DM3A 2JJ2D 5FV7A 5H81A 2BCJQ 2IVZA 4FR5A 1CR4A 1C4WA 2G5GX 1QG2A 4YEDA 5I7HA 3PI6A 4P7JA 1H6AA 2IJGX 3EGDA 2O57A 4X6XA 1YAHA 4F5EA 5BN3B 4M9RA 3OQMA 2WRZA 3C6BA 2ZRJA 1JH8A 4ILKA 1R9MA 2CJXA 1XJ0A 4KUGA 3OECA 2CYCA 3W90A 5KUTA 1H1DA 3GHHA 2Q9AA 1PEAA 3ESBA 1D1QA 1PI3A 5JMTA 1P62B 2HA3A 2EG5A 3H5OA 1Y1SA 4FILA 2JA1A 1V9CA 1RDFA 1Z2NX 4J4HA 3DZ8A 5EE0A 3T4XA 4ZT7A 5HGJA 1R2QA 3PQ3A 2HWWA 2QD4A 4MRMA 3JZFA 1X15A 2DFNA 4XE5A 1A50B 3D8BA 4Z2AA 1U7WA 2E4UA 4ZRNA 5HRAA 3CN7A 4WE3A 2LKCA 4LY6A 1E9BA 4XLTA 3DUWA 4ND7A 3HYNA 3KM0A 3VKVA 3IQEA 4TSKA 4NCNA 9GPBA 4OUDA 2RGGA 5D3ZA 2GD1O 4PYJA 1NIPA 4BP1A 4H17A 5LVAA 1RKQA 4HI0E 2A0WA 2QGZA 4RIHA 1XPOA 3VSEA 1IY9A 3E9MA 4LYDA 1IN6A 4MS3A 2VCEA 4QATA 4GX5A 5DCWA 1DBRA 1PFGA 4C43A 1WDLA 5MF6A 3QYJA 3GWZA 3VC7A 1ZH4A 3BORA 1Z4LA 3Q3IA 4KE7A 3L9WA 5DWQA 3IPCA 4LPKA 3E0XA 1BC5A 3LW7A 3KPUA 2KPOA 3UWPA 5IYZF 2Y71A 5JTTA 4IR7A 5FULA 4PO9A 1R0YA 3ZGXA 1YRWA 4DOMA 4QSMA 3D6UA 2AMVA 1KY2A 4M37A 2PNFA 4OQNA 2OFWA 5CVDA 2QX9A 4QPDA 4IDCA 4EHFA 1N5LA 3UYKA 2PKWA 1GGMA 3HCEA 5BVGB 1FA9A 2PX5A 1J5XA 2UUCB 1T5IA 4PRKA 1YR9A 2A5LA 1TK2A 4DIEA 1ZVVA 1CJSA 3ZHQA 4KK3A 3WNQA 5IKPA 1ZD3A 3ZVMA 2QTVA 1P1JA 3W3AA 3KUDA 3NTUA 2FPIB 1D0VA 3IR6A 3NBAA 3D8TA 3BOSA 5JV5A 3K1AA 3AERA 4KRYA 2PUDA 2VQEB 2OQIA 2WSLA 1BQEA 2WMYA 2O2SA 1SCAA 4PAGA 2PS0A 1LJLA 1BGXT 1XMPA 2OVFA 3PXCX 2Q7OE 1WCIB 5LP6A 1GTSA 3M3HA 5K0EA 3IUMA 3ZNOA 1M0EA 1JHMA 4OXQA 1QJCA 2BL4A 4IJ6A 2X0NA 3ZDFA 4Q15A 3QENA 3QP9A 4LE1A 1NY6A 3QEOA 1GPLA 1NUUA 2PSHA 3N2KB 4G65A 4D9NA 4OG2A 2ZP1A 3HXLA 4AUKA 3TQCA 3EXHC 3Q98A 3HLYA 3EA5A 3VUEA 1A9TA 4WERA 3I42A 5TV2A 3OZEA 3P71T 1GPWB 1RYEA 2RI6A 1LB1B 4I3FA 4IWNA 3M3PA 2B8EA 1RWBA 3V48A 5DHQA 2NQ8A 1OJLA 3QLUC 4YHBA 3S1AB 1L7DA 2NT3A 4ID3A 4R3NA 4EB8A 1K5PA 1SXPA 4EYEA 1ARZA 3J81k 2NXEA 3G2QA 4KNYA 5ESDA 2Q8NA 1ZI9A 2G71A 1MVNA 1R74A 2C88A 2WYOA 4KB5A 4BFSA 1CS0A 2GYYA 3MUNA 4ESEA 2HWKA 1EA7A 4R2IA 3IP7A 3OEYA 2OCBA 3RK0A 5B64A 4LRQA 4GBGA 5AUOB 3FR8A 2Z0MA 2PWZA 4WZAA 3SEFA 3G2PA 2WKRA 7ADHA 4MWZA 5FNVA 2AVDA 2VOJA 3JRWA 3OF5A 2GN2A 4G1MB 1O6FA 4PC3A 4Z0PA 4L5AA 4ZXPA 3RH0A 2PS3A 3GT4A 1Z2CA 1CJCA 1Q12A 2JFWA 2YHSA 4IZHA 3TTXA 3VSAA 3WISA 1R88A 3VRHA 3ILVA 4S2UA 4D92A 4QJ4A 3MGKA 4MPPA 4M21A 3DM5A 2O8VA 1CY8A 4GPTA 1X1RA 3LA6A 3KU1A 4B81A 3JPWA 2GYVA 4UMDA 1GTJ1 3H1GA 1I3LA 1EAMA 2GF0A 3QGMA 3W5HA 4D79A 4XTRA 3TF5A 2G9QA 1Y37A 3D3WB 3ACBA 5A4JA 1XB2A 4D8VA 4Q1BA 5AKHA 1Z4IA 2YFQA 3QX7A 1KH2A 1B00A 1OCEA 1W47A 4FCWA 4AJKA 2CL5A 1XZDA 1ODJA 2AG5A 2JGFA 1WY7A 1G8PA 1X8KA 1U7TA 3CF0A 1H2FA 1ZI8A 2ACEA 1TYBE 2RHJA 3N2LA 4L0DA 1M72A 4PQYA 2IS6A 5FI1B 5I4BA 2Z4SA 4EJSC 2XGGA 5K0SA 3K9CA 4ZOEA 5CB4F 2IEIA 2D8MA 3A6LA 3O94A 1U8FO 1KFEB 1RWVA 3LRPA 1Y7HA 4IGFA 5CEEA 5JFOA 4UM8B 5DRTA 1QZTA 2QE7D 2Z43A 4WXMA 3QK7A 5JWOA 2CBGA 4CMBA 3K9QO 1ZWKA 2E5FA 1PZFA 4FHCA 3CXUA 1Y4UA 4X24A 4OX9B 1KO5A 2XE8A 3UJ6A 3WLSA 1PJTA 1XDDA 2QX7A 3NDIA 4KHZA 4QKQA 1PFUA 3KL4A 2BHNA 4M9QA 4A0SA 4F6RB 4KFTA 2R6GA 4L08A 2QP3A 4PC6A 2IP1A 5DE3A 1L5KA 3HWSA 3LJKA 4EJFA 3U7QA 3WIDA 4ND2A 5JIBA 3EQ9A 2OXFA 3VJMA 5HUHA 2AOUB 4HDSA 1GU1A 3FVRA 4KP7A 2OLEA 3CEPB 2H4ZA 1C3OA 5LQSA 3EUWA 5ALLA 4BNVA 4ARZB 1MF7A 3PGVA 5IWAB 5DZSA 4HT3B 2GJAA 2WSYB 2MSKA 3LBHA 3S2UA 3SP1A 3OWXA 1BGVA 1PJCA 1J7KA 3QSGA 5TQ0A 2MU1A 1YZGA 5IP5A 3HB9A 1LXCA 4JEIA 4P58A 1Z06A 2ZW9A 5BSGA 3SZRA 1CR1A 1T5LA 4MR7A 1PW5A 1VPWA 1R10A 2C5SA 4M86A 3EX7C 3AL2A 1IG0A 2XTJA 3R9IA 4MQLA 2OP0A 2XMCA 5IC5A 1N0VC 4FEYA 4QQFA 2E1RA 3IUEA 4LZLA 3OUUA 3SF0A 1NG1A 3SE7A 3EEBA 3DZFA 3IT3A 1JFSA 5K6RA 3EXG1 2PO7A 4QPJC 1V41E 2VT3A 2X4GA 3AUAA 3KVVA 4FYMA 4EI7A 2F3UA 3RJTA 4W9RA 4HMPA 3QLVA 3NTQA 1IBCA 1RBZA 1O96B 4X1IA 1M7BA 3A1VA 1OY1A 2BMEA 3OZSA 4I1YA 4MAAA 1TEHA 2FUCA 3BFPA 3BJZA 1JGTA 3OFND 4FHEA 4MXDA 1V9LA 3SFZA 2AFIE 4AY5A 3MBOA 4MRMB 2ZBVA 3RRXA 1HL3A 2I2WA 2QE6A 2Y6UA 3BSWA 1P1CA 3FDZA 3IEUA 1T2UA 4KODA 4XVRA 3TSOA 2GK4A 4NBLA 1U3GA 3DT6A 1SUBA 3H1TA 1QF7A 1QRSA 7MDHA 1UKCA 3PPVA 3CINA 4GBMA 2C5HA 4P92A 5HR5A 1J09A 3OTOB 1ZCAA 3N8KA 2XUQA 4JUIA 1VSTA 2IU6A 4DZRA 4V39A 1BYIA 3FHOA 1HO3A 1IE3A 4UVIA 1V3UA 1E7YA 3DPUA 3R8XA 3V9AA 2J87A 3RD5A 1PT5A 3C3DA 3VTFA 4DUGD 2VNJA 4JD5A 1XRLA 1E77A 1F6WA 2PL3A 1ONSA 3AGQA 4QBHA 3RYIA 1X3LA 2YFYA 4OYRA 3WICA 1NFFA 2AN9A 5IMBA 1WG8A 2FW7A 4XB6B 4CKBA 4FIZA 1XDGA 4G6ZA 1AK9A 4CM8A 1RWOA 3CX6A 4FDTA 3WQSB 1HYGA 4JZYA 1NJ2A 1Z18A 4Q3KA 4TV8F 2F90A 3I1YA 4TLAA 4KSYA 1V25A 4R84A 4XQEA 1HNNA 4MAFA 5PGMA 4A2CA 1V6AA 2QA5A 3U0VA 3PVSA 4CM1A 3FHCB 3CYFA 4JEUA 5LYYA 1FFCA 2OGUA 3JVUA 1F2TB 2Z5FA 3BRCA 4WLNA 1SKYE 4QUEA 2ZB7A 4HPXB 1Z88A 1K3FA 5EJ9A 1HXHA 3NVAA 4P7FA 5JVDB 4H7DA 1BX0A 1MJFA 1EUDA 1Z47A 2FKAA 5IDWA 5REQB 1PQ4A 2IDKA 3CVYA 1H2BA 1V45E 3CLHA 2NZUG 3V7FA 4D0SA 3QUCA 3BULA 1UCFA 4MK4A 2R6CA 4DLTA 1EJ2A 4CT4B 5KX5F 1EZZA 1MPTA 1PR3A 1ZJYA 1ILWA 2K6GA 3K9NA 2MR6A 3ND9A 3U31A 1ECCA 3U7JA 5BV8A 3RNLA 4GMXA 4QPCA 2CFCA 4C6SA 3HUDA 2NZYA 3R0VA 4EY7A 4Q3NA 3VHXB 2H1OA 2GSWA 3KSBC 3S2EA 2WAXA 1SEVA 2ODBA 5M29A 2NZVG 3B51X 2AZTA 2F9LA 3V3TA 2BFPA 2DG2A 1C3XA 4BMOB 1SWWA 2YUTA 5IJAA 3H5TA 4WDQA 3CQ9A 3F5MA 3IMEA 4CPDA 5HXAA 3TFOA 2BLNA 3R0IA 4M8IA 2D06A 2WJHA 3WLFA 5BQFA 5JEDA 4NCBA 1QSGA 2AMFA 3MOIA 4O0LA 4AF7A 2DBVO 4LZNA 3D3QA 1BS1A 1U7XA 3KDSE 1OLXA 2HIHA 4U2FA 2ZKLA 5K03A 2L19A 1LSJA 1WUYA 4ONEA 4WFJA 1GT91 3Q87B 3PDWA 1RR6A 4IIVA 4YDRA 1YT5A 4MIYA 2IYUA 2G36A 3O90A 3QPCA 1UM9B 3OQ1A 4XR9A 3PTLA 3HJUA 1ADGA 5KNBH 2V6GA 2QLTA 3I01A 4HNQA 2FN7A 2W2KA 3A9CA 1ACJA 1CZUA 1U80A 4TQ9A 2R6DA 1YZTA 4UBMA 1LVUA 3D8HA 2Z9BA 3MGBA 3DMPA 3LPNA 1XOIA 2HAEA 2CLKB 3K9LA 3UJHA 4N0DA 3GPLA 1NE7A 1XR3A 5F1KA 4PNZA 1NWCA 1PDWA 4LY0A 4XEUA 3O21A 3MLBA 1NKSA 4MV6A 2ZZKA 2ZVDA 3IEVA 3FFWA 3P0HA 1TCAA 4HNHA 1I3NA 4PGHA 2GVNA 2B8JA 4M1EA 4KSBA 2ZT7A 4WFIA 2YMQA 3EGXA 2GD0A 2BY4A 4G4SO 4NXNB 1RPJA 4LEIA 1E2EA 2GPJA 4LMPA 3BMCA 3E18A 3L93A 5TJHA 3HJFA 2OQRA 4GBJA 1TF5A 5IVPA 4XJVA 1L5YA 2RGNC 2FP4B 1HGXA 2PH1A 4WXYB 4OQQA 3I4CA 5JO9A 3RSFA 4RTLA 3B78A 5F1OA 3ANSA 3NM4A 4YAWA 4I3HA 4IP0A 4ND3A 3RIMA 2ORVA 3GLRA 3I9OA 1SHJA 1TE2A 2DWUA 2HTFA 2IYFA 2VDMB 3TINA 5C80A 5I4IA 3L46A 2X14A 1IBMB 3DOEA 1LLFA 3AVQA 3DVQX 3UA4A 4IHQA 4QC2A 3GD7A 1G3IA 1XXHB 2QF7A 3MSCA 4MRRA 1YI8A 4P86A 5GV8A 2WUWE 1DWPA 1K6EA 1WY5A 3RLIA 3UH1A 1A9XB 1SXIA 1DXYA 5COBA 2QTTA 1JYFA 3FNRA 2V55B 3UV7A 3FCOA 1TLLA 3IT2A 3L7BA 2IYPA 4ZMRA 4ESOA 3UAVA 5FTKA 5I7RA 1Y8QA 2LXNA 5BNFA 3T38A 2CWWA 3IC5A 5DHUA 1PJ3A 3BFJA 4KN8A 4DR2B 1YZKA 2XMDA 3WNCA 3LUBA 2FOLA 3JSAA 4FBLA 1DC8A 5CFMA 1TAGA 3ZJ4A 1FTNA 2H52A 1T4DA 3L01A 2I33A 5K8UA 5I9NA 1DAFA 3J81A 1Y9EA 4IDPA 2OVBA 2XMBA 1GCIA 2BEWB 2LNDA 1N2HA 3RBXA 1IHDA 1AKRA 1QMPA 4WVLA 1AD2A 2O2DA 2PD3A 3M9XA 1EX6A 1EVQA 5T4BA 2CE2X 2QSZA 1IZ8A 4NPCA 3AEXA 4MOWA 4V0ME 1G5FA 1U98A 1V35A 2WU8A 2ERYA 3D4LA 3GA7A 1Q7BA 1KPGA 2WYWA 1A27A 3HCWA 3NIWA 5CH8A 4B43A 1FJHA 1P7YA 5DFAA 4DSTA 3GRRA 3ZIDA 1GM5A 3P9SA 3IQGX 4C76A 1C9EA 3L05A 4QTXA 2FN8A 1VBFA 1YOBA 3LUPA 3P8ZA 5GIOE 3CRVA 4Q82A 5H5JA 4F4CA 4PR0A 2IU3A 4A0QA 4NAUA 5KU7A 8MHTA 5KAPA 1E1QD 3PXUA 1K7XB 1NBAA 2N75A 3GVCA 1E3TA 1B43A 3L9XA 3G8BA 3I0ZA 1O96A 4X1IB 4RE6A 3VJRA 2JC3A 1RZUA 4D43A 3A7EA 3VDNB 1E1RD 1KHHA 1V16B 4H3KB 4L8YA 2E6KA 1Q16A 3FOZA 4WGGA 1XL1A 3GELA 3HRHA 3PA6A 3OEHA 5LR6A 2OAP1 2OGSA 4HC4A 4JOSA 4C0XA 2FY8A 1U8CB 4P33A 4X6YA 4IICA 2H16A 2PKEA 1M2FA 1WRBA 1WTCA 1ZCZA 5IU6A 2YC2C 2ZK7A 1L5RA 3BMOB 4G24A 1KEWA 2D00A 3H6GA 1RYZA 1LW6E 2MSWA 2R6FA 4J1TA 4X8HA 4LNHA 3RS7A 3T0GA 4XUGB 1AVTA 1EJ6A 4R3WA 4B8WA 1G291 1YRQA 3FM9A 3T7AA 3K8YA 4GP6A 2W2PA 3BIOA 3ESQA 1DJLA 1H8EA 2BBSA 3ECAA 3WK4A 4YQFA 4QPNA 2LCQA 5KHLB 2NM0A 3RYIB 2JAOA 2FZCA 4MWCA 4CODB 3F8TA 3ANXA 1ZAYA 2QMEA 4C3ZA 5IKEA 4YYEA 3DSRA 1EE9A 4NU5A 3CMMA 3GCDA 3NHLA 3NT4A 1J8VA 4N49A 5K3FA 3DBLB 4L4SA 2ZT5A 3WOHA 5BQXA 1QF6A 2B7CA 2GNPA 2OBLA 3IR5A 1YJAA 4DXDA 5KSPA 2UV8A 5SZIA 3U4GA 3V8RA 4C6RA 5BR7A 5F2NA 2Q5IA 1G64A 1P4AA 1E5XA 4EI8A 2G08A 4CU2A 3LIPA 1THMA 2F1IA 3IHWA 1G21E 4X3OA 3KLPX 4MUIA 5CX1A 2BFOA 5TS2A 4BDTA 5BUSA 4UUOA 2BP7A 1V3VA 1WR8A 2GSDA 3FNIA 3HCBA 5A2GA 3WL3A 3T3IA 3PQEA 2BFNA 2J5XA 3TFWA 5KYYA 1TVKA 3DH0A 4AMBA 3PPYA 1SXQA 1TO1E 2JIMA 1R6XA 4FE4A 3DWGA 3NBYC 2R11A 1DWOA 2J07A 1KOLA 2JATA 3HI4A 4NICA 1COZA 1XQXA 2FEWB 4ZAZA 3FDIA 1QH9A 4B3RB 1OIVA 4F46A 5CBKA 4F93B 1ZGGA 4RX1A 2PZAA 2GCOA 2RH9B 2O3RA 3D02A 3HB1A 1II9A 3PC2A 5DNYB 1EQ2A 1RYNA 3WZ2A 1XAHA 4ZQEA 3RRZA 3ZQJA 4MI9A 1GQSA 3RDPA 1D8TA 4CTKA 3V7WA 4D4MA 2ZVQX 4TKUB 5DBIA 4FP9A 3VA7A 3CNLA 1DOAA 4IVNA 3FOWA 3WHKA 1FBNA 1W4ZA 3FPCA 3R09A 4DMFA 5FUQA 4OUDB 1L5MA 1QPBA 4J0HA 1ZS9A 2UXDB 1Y7LA 3U3DA 3SJBA 1T1SA 3T4EA 3SS9X 1R37A 1NT2A 1MNQA 1HMYA 4CCYB 1M1NB 2ZAMA 2QQFA 2Q1WA 2REQA 4XWGA 5I4KA 5F7JA 2Z2JA 2WTNA 3QTTA 1UWKA 1IBRA 1G5TA 2C5EA 2ILTA 3U3KA 5CDHA 4L8FA 2UZ1B 1U6IA 1JQBA 3OM8A 4JQCA 5ENDA 4YAUA 3A6PC 1W8DA 4QRDA 1FXWA 4BDSA 3C8DA 4RY9A 4Z4IA 1CS4C 2NTJA 3X0DA 2H7XA 4XYEA 2XUAA 4MQ5A 1J25A 3DL0A 4TLCA 4CU5A 1OI7A 2JLQA 5KYNA 1AQJA 1CFZA 1L5OA 4RIGA 4Z4QA 4U8GA 3SC6A 5DLEA 4GP7A 3L7AA 3VR6H 2H2HA 2XGMA 3QQPA 1JHDA 3ICVA 4YREA 1AK1A 2HHJA 1T0HB 2PZGA 1DC7A 1E3WB 3BA1A 3I92A 4J75A 1S8OA 2KE5A 3P45A 1AQIA 4Q3LA 4QBGB 1QRAA 1G6KA 4UPEA 2NOAA 1ISGA 1CB7A 1I2MA 1KL7A 2RIPA 3F67A 3G2OA 4H31A 2IOQA 3GBSA 3Q6IA 4OMFG 1O03A 4NG4A 3UB3A 3NHZA 1QHYA 3GJ3A 4IZ6A 1GCUA 1BEEA 3S4YA 2OV2A 3QE4A 3T7CA 4QFCA 4XGQA 4JI0B 3O6VA 4IVQA 2EAUA 2JIZD 3FBWA 3UPTA 2EGUA 3MTDA 1XVLA 4F9TA 3BJEA 2WF8A 1NI4B 3EQZA 4L15A 3UFBA 4FW8A 3PZRA 2PKQP 1XPJA 1XA3A 3AHFA 3OKAA 4ZVTA 5IDYA 5J2UF 2FP4A 1JPVA 3H05A 3TDKA 1RQXA 1YIAA 1EFUA 3E7DA 5LWHA 2NIPA 2XX3A 2C9DA 3RC3A 3AFOA 4B80A 3OX3A 5JECA 2E4ZA 2WIJA 2EKQA 1M2HA 1VRCA 2AFHE 4J6EA 4CEJB 4KQWA 5KPJA 3PCRB 3BRSA 4CN8A 1FDOA 3OTQA 4IIEA 5ALMA 3I6BA 3EDOA 3VQTA 3MN1A 4E5SA 4KKXB 3V1NA 1G2IA 4HDNB 1JKJB 2G5CA 1SH7A 4JYMA 3TH5A 4LNUA 3AF0A 4C0AC 4U8HA 4KGZA 2H1HA 2HHAA 4LV5B 4FIDA 2FPWA 2Y68A 3GFBA 1T4BA 3VPHA 4KREA 2XBUA 1SBNE 1GQQA 1R6BX 3CH5A 1ZK4A 2PK3A 4KIWA 2QVXX 2VDLB 1XZFA 4HAXA 1JIIA 1DEKA 1HT2E 4QT4A 3G5UA 4P4NA 1J5EB 3E9ZA 2WUVA 3C3KA 3N86A 4JC4A 1D07A 1OZGA 1WHSA 3TOXA 1S2NA 3TGLA 3ZH9B 4QGFA 1P2FA 3SZUA 2WWRA 2QT0A 3T5CA 4AZ3B 1R6DA 3PPWA 4U3JB 2Y66A 3W8RA 1BHJA 4E51A 3EVEA 4MR8A 5EE5B 4DY4A 1Z7EA 1E98A 4HNVA 2O2XA 1EFCA 3HJGA 4FJ0A 3T34A 4DA9A 1AQ6A 9ABPA 4XSHA 4D6PA 2LVBA 3T3EA 3KQWA 5EAIA 4DIDA 2F8TA 2FX3A 5D8DA 2V6MA 3BH0A 4MVJP 1EFTA 1OXXK 4M2LA 5FO1A 4CL8A 4NBVA 4TTPA 1GSOA 1S8FA 2ZPUA 2R84A 3JQ8A 5FUMA 1L5HB 1W0CA 1QHSA 3TKAA 5JFGA 2UZAA 4QQKA 2VCHA 5JZOA 1XLTA 2CHVA 2F8SA 4J3JA 4QGAA 3U19A 1U2RA 2E4XA 1UUFA 3E1SA 3VNUA 2IXAA 2P1RA 3ABIA 3HBAA 4L72A 1PWYE 3GJYA 4HQFA 4PY2A 2EKPA 4BUCA 2GEUA 3EK2A 2TECE 2QN3A 4ZYUA 1L9XA 1G5PA 1HFKA 1YVRA 4IHJB 3K92A 1R5OA 3MERA 4WAUA 2QLBA 4FYJA 4WK6A 4C5CA 2CMDA 4EKEA 1H23A 1SUFA 1X39A 3MWYW 1EK0A 1UJMA 2WHPB 3KSDO 4G4IA 4N5NA 1YZUA 4O1HA 3ZU4A 3L8HA 2F3SA 4Y6QA 3IESA 1NQAO 2BJHA 2CXQA 3CISA 4IWXA 1TKBA 2W6PA 4L78A 4WXEA 4B75A 2AQKA 3MWEB 4DR7B 4NXMB 2AZDA 1S3FA 3FJOA 1J0BA 1EB9A 2CVPA 1PQUA 2R1TB 2X6RA 4QICA 3E58A 1H94A 4Y6LA 5B3JA 3ZW7A 4F4DA 4F0JA 2OC9A 2ZRBA 4OMCA 3DZJA 1E79D 1R27A 1TUEA 2Q5CA 1O2DA 3LBFA 3A1FA 1FFWA 1HZJA 1C3VA 1T2EA 3IV7A 4YK7A 4UU1A 4IWYA 4GR9A 1VLVA 1W0JA 5CFPA 4K2AA 4ZRDA 4J0JA 4X8LA 1H0KA 3DE2X 3M0EA 4YAEA 4A82A 3A04A 1AQLA 1HNZB 2C92A 3ZDDA 1UEIA 4PG5A 4OHZA 1P18A 4JLNA 2I2AA 3WQBA 3RUPA 1XU4A 5CXSA 4X64B 4E1AA 4NMWA 2BCEA 2WTXA 3MD0A 3ONFA 4JJAA 5TS3A 2JIQA 2DLNA 3GQBA 4IOKA 2O52A 4UUMA 3T1YB 1XZBA 2XDWA 4U00A 3F96A 2WT4A 3RKRA 1MG0A 3N2ZB 4QBKA 4IO0A 5DM0A 3X1XA 1XMOB 2H17A 1H0RA 2IT1A 2I8CA 3F0TA 1UBUS 3FMVA 1C1DA 2VJBA 4F97A 4H1UA 1TB4A 2Q41A 3UZUA 5JXJA 5CA1A 2JCSA 2BYTA 1I2BA 3OZ7A 1XAIA 3PHIA 3CA8A 1MZVA 3EDCA 3MYRA 4OM7A 5JMPA 1IZYA 3JD3A 5L8VA 3FYUB 3PUIA 3T35A 3BL5A 1NGSA 1NBMA 3LFUA 4ZI7A 5ALXA 1XZ8A 2GCPA 2W58A 2H3EA 4CM9D 3S68A 4EJ6A 2R3SA 2JK1A 3TBFA 1KAHA 3HPQA 1TADA 3PE4A 5ECYA 5TPZD 1IAQA 4YR9A 1NU6A 2YJ5A 1JFRA 3ZU5A 3ZVNA 4MR9B 4MX8A 1Z62A 4GRAA 3TW8A 3VKWA 3AVWA 1V2GA 2HA6A 3GP8A 1M6EX 5B1IA 1PEYA 2HJVA 3HZHA 4W4TA 3THYB 4LJRA 1I6KA 1NW6A 5HJEA 5JJ5A 3CHYA 4IFEA 1KH3A 2ISQA 2IOYA 4S24A 5TRTA 1T8UA 2X7HA 3R20A 2PT5A 5JZBA 2WAAA 5HIAA 3U81A 1ZR4A 2YMLA 3CCBA 7REQB 2Y9PB 2YL2A 4E15A 1ZU4A 3C6MA 3ZLUA 4ZI5A 3I73A 3N2NA 4L07A 4EHIA 4POOA 4LHWA 4CIDA 2I29A 3UG6A 1DCFA 2HQBA 2N47A 3JTMA 4AMYA 1M1YE 4OQFA 1QGUA 2XNDA 3WHLA 4CKYA 2MSEB 4JU8A 3QPWA 1EK1A 2O5VA 4OBXA 3C7KA 2W6JD 2G4CA 2Q45A 5K3DA 4ACBA 3GEIA 3B82A 2CZQA 3H19A 1E8DA 3A70A 1EX9A 4V0NA 1CV2A 2W6CX 4GSKA 4BPBA 4IW3B 1EGHA 4DMGA 4KLZA 4EVSA 1KZYC 1O0SA 1GZDA 2ZATA 4H0NA 1E89A 4PX9A 3V5NA 3FZGA 2H3HA 5C5DA 3QOFA 3WNBA 1UBSB 1Z74A 2W71A 2FCRA 3MJEA 1VPTA 2EF1A 2WD8A 2DKNA 5IAEA 1ZGJA 4LNAA 3ZOKA 3NMUF 4IDEA 1NXVA 2RH5A 3R5SA 3STHA 3RUCA 1KGDA 5KTKA 4MUXA 3VJKA 3EMKA 5JPCA 5JJCA 5KOIA 2PHZA 1FRZA 4PBTA 1QIEA 1M2WA 5IC6A 3TE6A 3ABOB 3PT5A 3ZDBA 2O59A 2X0JA 3FWYA 3I53A 1IXRC 2R751 4K9NA 4OLFA 3GFQA 4YVFA 5HX7A 2IYAA 2PCLA 2CEKA 1VI5A 1Z0KA 2UVQA 5EYPB 5I51A 2J08A 2B4TO 3IULA 2CF5A 3NONA 4IAOA 3COYA 3DMTC 4RANA 4JOCA 3ZHSA 1RC8A 1P75A 1GU0A 1XSEA 3HACA 4Q1EA 2CBXA 1I6LA 3SIPA 3Q8KA 1SIWA 1MOPA 2WJGA 1X7ZB 1HDRA 1FB5A 1RJFA 2GWHA 4Q4AA 2IXDA 4UMEA 4N41A 3MIZA 1FP2A 3GVXA 4ZOCA 4KO4S 3QYPA 2BFWA 5HFAA 3P9QA 3VGPA 4Q47A 3Q3VA 1Z0IA 3DHWC 1S7GA 5DEIA 4QM7A 4RPIA 3IVCA 5A7HA 2ZGVA 3R0ZA 1A8IA 4C2TA 1TQ8A 2XDQA 3QEMB 1EE2A 4YRTA 2BUAA 1UOEA 5IPFA 3H75A 2VLIA 1OHHD 5I7OA 4URXR 4BVEA 4AKGA 3GWGA 2F1KA 3BE8A 2AMJA 4MRNA 3FPBA 2XH8A 3TLEA 5AW4A 1CSEE 4BATA 4W5RA 5AKEA 4EKDA 1YDHA 3EULA 4JJFA 3F6SA 1Z07A 4B76A 1X74A 3SXPA 3GOQA 4GWKA 2G80A 3RGGA 1KK0A 1KZ6A 3QVJA 5JBIA 4JB0A 1RFLA 1RHRA 4PO8A 4M99A 4IXTA 2Z95A 4WKPA 1T43A 4C7MA 4BMPB 3EUAA 1W4AA 1YJBA 1JI3A 2P3SA 4MLCA 4Q4DA 1E1MA 2QP4A 3P20A 2WUDA 4RV5A 2BKUA 2HK7A 3D6HA 5EJIA 4BZPA 4WZAB 4WVFA 2X0DA 4UJ5A 1BJTA 2YMPA 3REFA 4D25A 2GH1A 3BL8A 1Z6XA 3UGJA 2LTAA 3IP6A 2HPVA 3M33A 3RF7A 2IS2A 1NG9A 2DJ5A 2GYUA 3A05A 2NZ2A 3AHDA 3QXJA 3TCNA 3KT0A 4DCNA 2XMRA 4HDRA 1AMNA 1BMTA 4UZSA 2FEPA 1QONA 1TCCA 3H16A 4NRDA 2JASA 3UTDA 5JISA 1Z6GA 4IIYA 1UWLA 2AVNA 2EW1A 1BJRE 4H2DA 4FGUA 5J4HA 2DWPA 5LNK6 4P5PA 1O4VA 3GJ8A 3D64A 5FFFA 1QDLB 3RS2A 3UMVA 1HE3A 1RXVA 2F62A 4DDKA 3CGWA 1L5ZA 3GRFA 5KYVA 4Q19A 1X9GA 3HM9A 1U9JA 3QNMA 1QPGA 2QKYA 3NIDB 1DBSA 2Y05A 3HZRA 3ZV4A 1I5RA 4EG7A 4HAUA 2G5PA 1QLHA 1X1QA 3DNPA 4ZZ0A 4O4JB 4J9UE 4Y6RA 3BMQB 5AVXA 1BXRB 4P54A 1ND5A 1TW2A 4LDJA 2ZB3A 3A26A 1CQIB 3IV6A 4IYJA 5JCOC 4N12A 5CT5A 2A3NA 3UWKA 1R66A 3RHTA 4U7PB 1KJIA 3H97A 3W6NA 4ENUA 1B8OA 5CTJA 3VZRA 1H2WA 3D43A 4YYZA 1WXDA 2R00A 4AY6A 1NQUA 3IOBA 1ZXXA 3WMEA 4ITVA 2ZR8A 3TUIC 3EF1A 4MS3B 3UUWA 1E2HA 1BEUB 1QM5A 1VIVA 1WHTB 2FMXA 2DBQA 2ZDHA 1OBOA 3HYLA 2Q50A 4LWZA 4PIPA 4EG4A 1W35A 1XKLA 2WFMA 4B8YA 1YFJA 3JZIA 1IK4A 1KJWA 4LVCA 5K7SA 1XWWA 5GONA 3E5HA 3DG9A 4YC7A 1QVRA 5FWXB 4WK2B 1W5AA 2PVSA 2VJQA 4CG2A 5TT1A 3PHCA 3TLKA 4D4HA 5K01A 1GYRA 4G8BA 2WT8A 2A4MA 4KMOA 3UWSA 1N78A 2IEDA 4BGIA 2NUAB 2V1UA 4E03A 4G1FA 1E3LA 3IODA 2BGMA 5EA2A 2JZOA 2VDWB 3BD7A 1MRZA 2O0JA 3JWGA 3BXEA 1OTYA 3D81A 2FX5A 1QB8A 4UD2A 1UXJA 3Q40A 1M1UA 4RY0A 3M6AA 3Q7QA 2XAAA 3QXSA 5IJ9B 1ZMTA 2A7QA 2FPPB 2GWRA 3MTQA 3O95A 1UC5B 621PA 1FU4A 3NHPA 1XTVA 4FGZA 4H18A 3THYA 4NMMA 2VBGA 5GVSA 1WB9A 4F4UA 4DL9A 1I0ZA 2X5NA 8ATCA 3RYCB 1H8ED 1YB7A 2WJWA 5CLQA 4E46A 3SSAA 2G40A 3K2BA 1G6Q1 3PJGA 1IXKA 4WLEA 4MP3A 3GCGA 5G3ZA 5CAEB 3ZXSA 4BC0A 1ST2A 2IOFA 2ZU0C 1L7NA 3NOQA 1C30A 4Z6KA 3PDIA 1I3KA 3C16C 3X1ZA 5DHRA 5BSEA 2ORIA 3TNFA 1F8GA 4N8EA 1FSZA 2Y1FA 3DLIA 1QQ7A 1Y6QA 1GYQA 3F6RA 4C7VA 2G0NA 3ZH2A 3G8YA 2YHIB 2GQ0A 3LQQA 1J2RA 4UREA 5AICA 1WDWB 3N7AA 1GYPA 3L8ZA 4LZPA 5J40A 4Q66C 2JB9A 2WP8J 4A5OA 2JVKA 2AE2A 2QYHA 4RETA 2RHGB 3OY2A 4YI3A 3ZHCA 2CHFA 3ETDA 1I0IA 3MRVA 2XHEA 3OJEA 4IO1A 5JC8A 2YJ4A 5AVUA 1T4MA 2ZWPA 4RZ2A 5AJYA 5B1DA 1RRMA 2D5CA 3VMFA 4DARA 1PQPA 4QQ8A 2C2OA 4CVNA 1XF9A 2DWQA 3AJRA 4WK0B 2F59A 1ZCJA 5HIIA 4GPIB 4P31A 1J0EA 2V9ZA 4BV8A 2WVJA 1DAKA 4JBNA 4FDVA 2AFRA 2UDPA 4LYYA 1K7FB 2DU8A 4HQNA 3VR2A 3H99A 3RTCA 1FP7A 1L7OA 4OBEA 4FHZA 5A6VA 3LDGA 1ECFA 1RQNA 1TZMA 3GI1A 5AW3A 3KXDA 1IVNA 5T57A 3GUYA 3LQ4A 2GZ1A 2MINA 4UUBA 5KC8A 4QNMA 1C0PA 4FN4A 4TKVA 1KSFX 5FBRB 1KYZA 1WMAA 3NGMA 4DDHA 3ZE9A 2XYVA 3IE0A 2IYEA 4GI7A 3H3FA 4OHUA 4RDHA 5E7MA 2F64A 1W9MA 2IPOA 2ZJZA 1GAJA 2C2MA 4C0QC 4XJXA 5LPNA 3D5QA 2PZLA 1QFXA 1YDWA 2XODA 1DUIA 2ES4A 5G41A 4ZDKA 4V1CA 3KZ1E 3OF3A 3PUXA 1J20A 5EHQA 3ILXA 2GYWA 3IHTA 1J1ZA 2JD2A 2VZ9A 1HYQA 3UBMA 1RFGE 1ZNWA 5GIPE 3C6YA 2JK0A 1USIA 3U6KA 1PQYA 3W2TA 2JCVA 2BR3A 5I3ZA 4CLHA 3QYFA 4M46A 3FVQA 1GWNA 3GHYA 3KXIA 5DWDA 1TYZA 5K0CA 5KU1A 3REGA 3DBRB 3SYMA 4HV4A 1HSZA 4D9HA 2HK9A 2NU6A 1LJ8A 2CSXA 3QLTA 4MEBA 1UR5A 1GU7A 4MW5A 5IW8A 4L16A 5CB8A 4Q4HA 1NJ6A 1NM5A 1SO8A 4MQEB 4HATA 5CDFE 3SJAA 4RQAA 3U5TA 1G5QA 3ANMA 1DZ3A 5KTSA 4N65A 3S81A 2IV3A 5CA0A 3RRYA 1QU2A 3HKCB 2ZJYA 2ZRDA 3WB9A 1UK8A 2OFOA 3M2TA 4PQEA 4QX6A 2J33A 4FI3F 4OK3A 3RSQA 3ZG6A 3CLSD