1Z17A

Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound ligand isoleucine
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
344
structure length
344
Chain Sequence
b'EDIKVAVVGAMSGPVAQYGDQEFTGAEQAVADINAKGGIKGNKLQIVKYDDACDPKQAVAVANKVVNDGIKYVIGHLCSSSTQPASDIYEDEGILMITPAATAPELTARGYQLILRTTGLDSDQGPTAAKYILEKVKPQRIAIVHDKQQYGEGLARAVQDGLKKGNANVVFFDGITAGEKDFSTLVARLKKENIDFVYYGGYHPEMGQILRQARAAGLKTQFMGPEGVANVSLSNIAGESAEGLLVTKPKNYDQVPANKPIVDAIKAKKQDPSGAFVWTTYAALQSLQAGLNQSDDPAEIAKYLKANSVDTVMGPLTWDEKGDLKGFEFGVFDWHANGTATDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leu/Ile/Val-binding protein
molecule tags Transport protein
publication title Ligand-free and -bound structures of the binding protein (LivJ) of the Escherichia coli ABC leucine/isoleucine/valine transport system: trajectory and dynamics of the interdomain rotation and ligand specificity.
pubmed doi rcsb
total genus 135
structure length 344
sequence length 344
ec nomenclature
pdb deposition date 2005-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1z17A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1z17A01
1NXTA 4KQ9A 4QYWA 2QVCA 1ZAYA 3EQZA 1FFWA 4MS1B 1AB6A 2XDYA 5D2CA 2WWVD 1I3CA 3KHTA 2PMCA 1FQWA 1BAPA 3LTEA 1L5YA 1M5UA 4G0XA 2FMFA 2GX6A 2MSLA 4N0QA 2MSWA 4W5NA 1SXIA 5HSGA 5JS1A 1DP4A 2PUFA 2FEKA 3EJWA 3OO0A 3P9YA 4KK3A 1P8AA 4RK7A 2VK2A 1L5ZA 5HQJA 2H0AA 2WMYA 3QLVC 2JCGA 3H5OA 4YLEA 2YHBA 3IP6A 4FE4A 5JNVA 1RZRD 4Z9AA 3LUGA 4G0OA 9ABPA 4LE1A 1Y1LA 4P1ZA 4XAQA 2RGYA 5FWYB 1LBIA 2F8TA 4EUKA 2QZJA 1OXBB 4Q7EA 2E4WA 4KQCA 1JWLA 1NXWA 1MB3A 1SD5A 2QR3A 3C3KA 4N0PA 4YS6A 3GA5A 3Q7RA 4Z0NA 2E4YA 3N75A 2FLWA 1Z16A 3E3MA 5JNUA 4MQFB 7ABPA 3LKVA 4RY0A 4WUTA 1NY5A 2LPMA 4LE0A 2QW1A 4MR9B 4MR7B 3Q15C 1XHEA 1S8NA 2WY2D 2N9UA 2QXYA 4IMIB 4MR9A 3IP9A 1FFSA 1HEYA 1QQBA 3DLHA 3KCNA 4UHKA 4LZLA 1M2EA 4WWHA 4WZZA 5KQGA 4YCSA 3C6QA 5B3JA 3H1GA 3M6MD 1PEAA 3KG2A 2P9HA 2A9QA 3IPAA 1JFVA 2FQXA 2R48A 3GL9A 3K4HA 5DTEA 3JS5A 5IEBA 1F51E 3HDVA 4Q6WA 5IULC 2MYPA 4N76A 4ZMSA 3F73A 5TPZD 4Z4HA 3DLBA 1TMYA 1URPA 3SY8A 3LOPA 5KI6A 2L2QA 4QICA 3RVKA 3SM9A 3T6KA 1DC7A 3TMYA 3OMXA 3GYBA 3FFTA 5IBQA 2FQWA 2GBPA 4MS4A 1TM2A 4G97A 1FSPA 2J48A 3NNNA 3OLXA 4Q6BA 4EVRA 4S04A 3NHZA 3T95A 1ZN2A 3ROTA 4MR8A 4MAAA 3QX8A 4MLDA 3HM9A 2IPNA 3QLUA 3N53A 3BRSA 1PHRA 2E4VA 4EGSA 4LE2A 5ED4A 2NUBA 3M9WA 4YV7A 3CRNA 4MR8B 3CFYA 2R4QA 3OM1A 2V0NA 2O20A 3O75A 4HNQA 5DLEA 2FEWB 2RJOA 1NXSA 3NBMA 2CHEA 3JVIA 3RVRA 4Z4FA 3L6UA 2RDMA 4QYMA 5DGCA 5FBKA 1YK0A 2FXIA 4G0QA 2HJ9A 1EAYA 3G1WA 4MGEA 2FVYA 3GV0A 4JOQA 3EQ2A 3JPYA 1DC8A 1DZ3A 4N47A 2IOYA 3DZDA 3QLVA 1GLGA 4EYKA 2ID7A 4ZPJA 4JP1A 1ZHHA 5I4CA 4RK1A 2FN8A 4F11A 2F8SA 5BRJA 1DCKA 1Z26A 4PICA 2HQRA 1PUXA 4G0MA 3MQ4A 3T8YA 3UK0A 4Z9BA 4TLLB 4ZJPA 5BQ3A 3F7NA 3JTEA 3LUFA 3O2JA 3JVDA 4RSMA 3KJXA 4NCAA 1NXXA 1CEYA 1DBQA 1P2FA 2M98A 1JX6A 1D1PA 1P6QA 3N0XA 4W5OA 1JHZA 4OLAA 3JY6A 1OXKB 4OBBA 1USIA 1ZH4A 2LIVA 3SG0A 1A0OA 2PL9A 3RVMA 2FMKA 4EVSA 8ABPA 1E6MA 5CNIA 4XARA 2DRIA 3VNAA 3SQNA 3D8UA 4OATA 5DKFA 4L4UA 2PUGA 1ABFA 2M1ZA 1YS7A 1NXVA 2I6FA 3M9XA 3VNBA 3OQNA 3LUDA 4KMRA 2IPMA 3CKMA 4S05A 1QMPA 3FFWA 3OLYA 4MQEB 4DN6A 2QU7A 4DQDA 1EWVA 1U04A 4JB0A 3H5IA 4JB2A 4RY9A 2R47A 2FMHA 4MQFA 2PKXA 6CHYA 5EWMA 5TQJA 4Z4CA 4ZYLA 5IC5A 3BRQA 1ZH2A 2Q5CA 1EWTA 4PZ0A 3FMVA 1Z18A 2LP4Y 4NQRA 4EYQA 3CG4A 3R0JA 3DBIA 4O5AA 4ETIA 1ZESA 4F3TA 3OM0A 1Z2DA 4EYOA 3QEMB 3TO5A 3O74A 5T7BA 4JASB 3HXMA 1M2FA 4B09A 4CBVA 4H3KB 1JDPA 3CZCA 2QVGA 3FGZA 1BDJA 2GWRA 3SNKA 4RXUA 1QP0A 3HJFA 3BBLA 3QLTA 4FE7A 3RQIA 3O2SB 1KRXA 4NICA 5JS2A 1YMUA 4KNYA 3LUJA 3C3MA 2E4ZA 5BR1A 2A9RA 4RXMA 1NXPA 1YVUA 2MYUA 4RKRA 4HNRA 3OLWA 1JH9A 4YR7A 2R25B 3HK2A 3N8IA 4W5RA 2LBPA 2MYTA 3HUUA 4OG2A 3H75A 1YTUA 1U2PA 3LFTA 3CTPA 5CNMA 4F8JA 3GT7A 4OTZA 1E6KA 1C4WA 3H6GA 1JYEA 1Z15A 3EULA 3GBVA 3H5LA 4MR7A 1NTRA 5HM6A 2B1JA 1QO0D 2CHFA 2P4UA 3QELB 4KK4A 4LX8A 4L85A 3W9SA 4W5QA 3KKEA 3ILYA 2FEPA 3DGFC 3A3KA 3KYJB 1R8JA 2JRLA 4IILA 3TD9A 3GRCA 4KPYA 1NXOA 4XLTA 2WJWA 3E61A 3CLKA 3HEBA 4KRFA 1NATA 3BILA 3H5TA 3I5AA 3NHMA 4MRMB 4E7OA 1RXEA 4WXEA 3EODA 4GPAA 2IYNA 1ZITA 2E4UA 3I45A 3IP5A 1JL3A 2A9PA 3IDOA 1JFTA 3FDFA 1C0EA 1CYEA 3TX6A 4PEVA 3RVLA 2HQBA 2YHAA 3F6CA 1IIBA 4MS3B 4ML3A 3EDCA 1TVMA 4HNSA 2JVJA 4ETNA 2B4AA 3Q7SA 3QLUC 1DG9A 5F64A 1Z17A 3H6HA 4MPTA 2ZAYA 4RS3A 1GUBA 3BREA 1GCGA 1ABEA 5EWMB 5JNTA 3GWGA 4RDCA 5ABPA 4O1IA 4EY3A 5FWXB 5TQ0A 4YGXB 3HVRA 3LUHA 1BVHA 1QO0A 4WT7A 3CNBA 2OENG 5TQ0B 4WXMA 2JB9A 4MLCA 2L18A 4PYRA 1B00A 1YK1A 2IDMA 2FTKE 5IUJC 4G86A 5IX8A 1TJYA 1Z25A 2H3HA 4JAVC 4MS4B 1D2AA 4NCBA 1EFAA 2KYRA 4LRQA 1A04A 3MMNA 4RK0A 5TPWA 4RK4A 1W25A 5TE9A 5CHYA 1YS6A 2PAFA 4MS1A 4QPJC 4E7PA 1ISRA 3GBPA 1GCAA 2E4XA 2FMIA 1PEYA 2FLKA 2L19A 3KSMA 3MF4A 4KVFA 2IKSA 3HDGA 3B2NA 3RVOA 2PUDA 1LJLA 3RVSA 5KQPA 1DCFA 1ZGZA 3CHYA 2ID9A 3MIZA 1Z13A 4TN5A 3ROFA 1BDHA 1QPZA 1AB5A 4RU1A 3EAFA 3RVNA 2MSKA 4H60A 3RVJA 3QK7A 2VUIB 1GUDA 3JPWA 1U0SY 2NZVG 2PJUA 3SAJA 5TQ2B 5FWYA 2FW0A 1DRKA 1F4VA 5KQMA 4Z4GA 3ILHA 2QSJA 2WJAA 1KRWA 4IMJB 1ZY2A 1YMVA 5IUKC 1FFGA 5C5EA 5KQLA 5KC9A 1H9CA 5EWJB 3CG0A 4RK6A 3O1HB 1LJUA 4G0ZA 2W42A 1JLKA 1VPWA 3HUTA 5JNWA 1MAVA 2QV0A 4KREA 1JDNA 3NNDA 1JYFA 1TLFA 3T38A 1EWKA 5GQSA 5IEJA 2FQYA 3Q7TA 5GOTA 3D02A 4TMYA 2LUOA 3I09A 3RVQA 4HYEA 4LDZA 1DCMA 3MM4A 4M88A 4F06A 4IGAA 5CNJA 1MVOA 4MYRA 4MQEA 5CNKA 4RXTA 3H5VA 3S99A 1K68A 1DBWA 3KLNA 4D6YA 3Q41A 1JBEA 4GNRA 2FKAA 1MIHA 1SRRA 3C3WA 4IRXA 4IF4A 3H5WA 3A0RB 3O2QB 4F12A 5IUNC 4MS3A 2PE5A 1DRJA 3A10A 4JA2A 4EVQA 1U2QA 1D5WA 5EWJA 4OLBA 3OQMA 2NZUG 4XXHA 2A9OA 1BDIA 2MYNA 2IPAB 4G0YA 2GI4A 5E3JA 2FN9A 3OMWA 4O1HA 1P6UA 1LBHA 2TMYA 4NV3A 1ZVVA 3IP7A 3HSYA 5JNSA 1A2OA 3H1EA 1JF8A 1D4ZA 3F6PA 4YRZA 4W5TA 3N0WA 1CHNA 3KTOA 3K9CA 2JVIA 2PUEA 2BGGA 3N0RA 1PNTA 3LUKA 4PE5B 5FBHA 1K66A 4Y9TA 3I42A 1XHFA 3L49A 5C5CA 1VKRA 4LDAA 3LMKA 1WETA 1PNRA 1UDRA 1USKA 1KGSA 1QNLA 4XASA 4N03A 1ZDMA 1E6LA 4RWEA 5FWXA 3UUGA 2ZWMA 5DCLA 1USGA 3LUCA 3TB6A 5BRAA 3O21A 1QP4A 4D74A 2HQOA 1W9HA 4RKQA 2OQRA 2VYCA 4Z99A 1M5TA 3N6VA 1RPJA 3OLVA 2PUBA 2AYZA 1JFSA 3LUAA 4KFCA 3IPCA 5HKOA 4RY8A 1RNLA 3MA0A 2JK1A 3RH0A 2RJNA 3NNSA 2PUAA 2L17A 5PNTA 4RZSA 1Z12A 4RK5A 3EGCA 2NT3A 4DADA 1QP7A 4G0PA 4Z4EA 2X7XA 3O1JC 3RVPA 1KMIY 3LKBA 1J56A 2NT4A 4FB4A 2IPLA 2WRZA 4D6XA 3HS3A 4N41A 2JVKA 5KC8A 1U8TA 2HSGA 1LK0A 1MB0A 3OO1A 3HV2A 4ETMA 4TLMB 2GKGA 3MYYA 3QX9A 3QELA 1E2BA 1RZRA 2AYXA 3HCWA 2FSPA 5TPZA 5TQ2A 1T34A 3FFXA 5B3JC 1DJMA 1VLZA 3KYIB 3KS9A 1RXIA 3KLOA 1D1QA 4ZMRA 5JNRA 1QKKA 1SXGA 1XWWA 4KV7A 4UHJA 4MRMA 3OLZA 1BA2A 4RV5A 1QQAA 3A0UA 2VUHB 4KZKA 3UKJA 3OQOA 4EYGA 3Q9SA 2JBAB 1YIOA 3C97A 3DGEC 1ZGGA 2CD7A 3CZ5A 5EWLA 1EHCA 4Z4IA 1VRVA 3HO1A 3O1IC 2HPHA 2PL1A 5EWLB 1APBA 2JBAA 4YWHA 3CS3A 1SXHA 4YP9A 2PUCA 1Z2EA 5TPWB 6ABPA 3G85A 2WB4A 2PLNA 3QEKA 4P98A 3CU5A 3H1FA 4YO7A 5KWSA 1ISSA 2CWDA 3QEMA 5T3YA 1DBPA 3URMA 3HZHA 4XFKA 4H3HB
chains in the Genus database with same CATH superfamily
4KQ9A 3WRYA 2DTXA 2ZBUA 3B1FA 2CNLA 1RAFA 3DO8A 4ZOAA 3ZIAD 5EXPA 2QENA 5JS7A 1CUFA 3GRUA 3V33A 3F3KA 1G21B 2JHFA 2XDYA 3A36A 1DOAA 3OOSA 8MHTA 1S3SA 1KTVA 1YR7A 1E2FA 4HEHA 3IV7A 3JYQA 1Z5UA 3FPCA 2W70A 2Q3JA 5EHNA 4WCFC 3FYUB 4WZAE 3STVA 3TJZA 2Z2JA 1DP4A 5FL7D 1NN1A 4BUJA 1CEEA 2XNHA 3QXCA 3IOEA 2H4JA 3BTUA 4NJMA 1TTPB 1J9GA 1BYUA 2QTHA 3KB6A 3TM4A 4B2PA 1UT6A 3BIXA 2UVPB 2K5UA 3TRJA 4BVAA 1UXIA 4ZYTA 5E9QA 4KQ1A 2ZFUA 3GRKA 3QE4A 4F4UA 4NXNB 1N1EA 2IF0A 3FCAA 5THQA 2XBUA 1N2EA 4F1WA 1AKTA 1V11B 4OQLA 1G6Q1 3OE5A 3IVRA 3QI2A 4L0QA 3SKXA 1LLFA 1V5GA 3NJ4A 1KQOA 2C4WA 2NQ8A 1UBLS 1K7EB 1Z45A 1X9GA 1A27A 1U28A 3G2KA 2GO1A 2IEZA 1S8FA 4N7JA 4W6QA 5B58T 1BHSA 3VR4H 1VI5A 4KJZA 4B6FA 1IHXA 3NUGA 5FA6A 4AZWA 4RJLA 3EEYA 3GCDA 1H2BA 3GEIA 2I8LA 1IK4A 2NUAB 3DEJA 3EZLA 5IS2A 4F1JA 3K31A 3PNQA 2YTZA 1S8NA 2ZU6A 1GQSA 1K7FB 4YUVA 4UXJA 2VIIA 1C50A 3WO1A 4A6PA 4J0CA 1OWPA 1FUYB 1M2GA 1Z74A 2GXAA 2E1RA 3PD7A 1T9CA 3FB4A 3FFBA 3UMSA 4CMHA 2VJCA 4AMGA 1PF7E 2V9ZA 4E5NA 2C3UA 1QKJA 2I4OA 3AGQA 4W5JA 4ZIRB 3DAOA 5LQUA 4AP6A 1Q0ZA 1NVGA 3N2GA 4XSHA 5I7UA 3U3RA 3PX7A 2R8XA 2NPIA 3AUTA 4MA5A 4A0GA 1Q1QA 3BWMA 2NTVA 3W4IA 4YHHB 3HB7A 1T1GA 3O91A 4I5GA 5IMBA 5FWNA 4R41A 2ZSIA 3IESA 3H9EO 3PWZA 1IRXA 3RVKA 1GN8A 5LBTA 4ZKDA 2ONYA 3TMYA 3LWDA 3OMXA 2E87A 5IBQA 5TGDA 1CY8A 3ZE2B 3NEPX 1JQLB 4PIMA 1XF9A 2XUHA 3QFTA 1UQUA 3FI0A 1I3MA 4G97A 2CUKA 4GRAA 4LZPA 4RABA 4TVSA 4JEIA 4W9NA 3A9UA 5DEOA 4EVRA 5EE3A 5J2TF 4K3VA 2HNBA 4G0NA 3PFNA 4ZU6X 2E7ZA 3QX8A 1Y8ZA 1H2WA 1HA3A 3N53A 1UOQA 3JU3A 5B5SA 1L3CA 4K9MA 5BSRA 3W78A 4D98A 1MO4A 1UJCA 3D43A 3II6X 3ZXUB 4H7FA 1EJ2A 3AVUA 4A0SA 1B6SA 1EE9A 5I9BA 1UEXC 1QZZA 3AZQA 4MUJA 3FAZA 2YQ4A 3UK2A 1LBTA 2OCYC 1GZ5A 3MYRA 4JKOA 4JLJA 4NRDA 4O2BB 4PHFA 2CVZA 4AJKA 3PD1A 4EHKA 4Z4FA 4PYLA 4H1UA 1ONBA 5FBKA 1P2DA 3UH0A 4BEBA 1Q0HA 5LOVA 4DJDC 3IAHA 1NW4A 4EPTA 1VBKA 4RD4A 3NP9A 4LV5B 1G3QA 2I1WA 2VSXA 2H9YA 2QQEA 1OXXK 1X13A 2IOYA 1A4UA 2WJJA 3PBKA 4MYHA 1XVLA 1L5HA 2AMVA 2P9QA 1OLSB 3AUFA 3I4LA 2AUMA 1ZHHA 5KTOA 2VCEA 4KBFA 3GLUA 4BWVA 1SA0A 3C3BA 2HIHA 1IB0A 1WZEA 4WGGA 4R83A 4CL3A 4EBBA 1BX0A 3W3AH 1PUXA 3AP2A 3N2KB 3PC8A 3UK0A 3R3VA 4AJJA 2GXUA 1KMNA 2NG1A 3PWSA 1XD9A 1FLAA 5A9TA 3YASA 4XYEA 4BZQA 4COOA 2A33A 3LE8A 4RY2A 5K3CA 4QVIA 2NQ2C 4GM1A 4RGQA 3WO0A 3COJA 1FSZA 5D5QA 1BXRB 1EXNA 2PL9A 4ZREA 2FMKA 3VR6A 5LR6A 2WTAA 1QRSA 1VMAA 1HY3A 2QUAA 1QMGA 1V48A 2C58A 2ZSHA 2V97A 1ZD9A 2RHOA 2WU4A 4WDRA 4DJTA 2AZDA 4TPKA 5DM70 4KWTA 2HIAA 1XKTA 1QRRA 4TUYF 3T3EA 3G8DA 2DJIA 3PGLA 1FNNA 1WWKA 5J5CA 1F4LA 1W44A 2D0IA 2F1RA 2P40A 3V2UA 2BJWA 1KI2A 3GIWA 4UUNA 2AXPA 2BIFA 4Y9SA 1U04A 3KQWA 4TT8A 3H5IA 4X20A 5SYAA 2XUFA 4BLRA 3UT6A 4BNMA 3ZDCA 1J49A 2WF8A 3K5IA 5H83A 3UK7A 3A1FA 4QGHA 1G5TA 3D8BA 4Z4CA 5LZ7A 5KNCA 1RXSA 5CVCA 2F7SA 1OLOA 3ENNA 2IIPA 2HQSA 3MAJA 3VZDA 4BWYA 2NADA 4TV8A 1B0AA 2G4LA 1X0VA 1P74A 2Q27A 5M2QA 2OAP1 3BWVA 4UNQA 3EOZA 1XD2B 1QYXA 1XROA 3GVXA 3SQLA 2PGIA 4AB1A 1RHMA 3MUOA 2YNMD 1PL0A 2NTYC 3Q6MA 2E37A 3R3WA 4A8HA 1AQNA 1E2LA 4AP9A 4CG2A 2QWXA 5A6SA 4I46A 3Q12A 3KR0A 2HHAA 4OHMA 3AHGA 1AD2A 1TB4A 4UBOA 4DLWA 4CKWA 1E0AA 4NV1A 1BYIA 3FLMA 1XRRA 1PIWA 3FTQA 3R2JA 3FD8A 4WIAA 4BQEA 1JW9B 1JEYA 4FFRA 4A6XA 1XB2A 2MYUA 2XMSA 1J42A 1UDCA 3AI1A 4RF4A 2WD7B 3ZGOA 4B3FX 2FZCA 2VJOA 1JH9A 3GEDA 5AKYA 1R74A 2F3TA 3BD8A 1GRVA 4OG2A 3RVJA 3ZW8A 1YVDA 3T7AA 4C4PA 1RAGA 1BWRA 4AL4A 3AF2A 4HOYA 1N3YA 3L7AA 4FZ3A 3SQWA 2DFVA 1GG2A 4JXKA 3STYA 1QO0D 2FW7A 4GBMA 1NWCA 1IUPA 4YJHA 2DECA 5JJLA 3R7SA 1HV8A 3V1MA 1ENZA 2AW5A 2JRLA 2P1ZA 3TD9A 2YV3A 4KV9A 5M5BA 2X4GA 3OOYA 2OO5A 4QQ8A 1NATA 3H5TA 1G9SA 2FP3A 2Y0CA 1W9MA 3FUTA 5CXSA 1SCKA 4LI0A 2I33A 1HDYA 4FNMA 4GPAA 4HB0A 3TKAA 5KSZA 3DQZA 3WFZA 3I45A 5CFOA 3E1SA 3ENVA 3SLGA 2C1ZA 3S27A 1XWIA 4J29A 4DGQA 1KETA 2YMMA 5C8ZA 1SO8A 1V4VA 3PUKA 4NNJA 4WLNA 4D57A 2IT1A 1DV1A 4C7VA 4KYUA 3H04A 1SCQA 3DE4X 2XZOA 4Y9RA 2PSEA 2VA8A 1DQPA 1NNLA 3PNLA 3PPXA 2K7ZA 2ATXA 3A4MA 4LC1A 3JQRA 5I5EA 4OGGA 2WF9A 1YBFA 3KX2A 4DDHA 5J2TB 3KQNA 1TVMA 1YUBA 1QHHB 3INRA 2GZMA 4NBKA 2VNJA 4KVGA 3P0EA 5F64A 2ZAYA 1CC1S 2WVGA 3W7VA 4AG6A 2PUWA 1C7RA 4YMUA 1V3UA 1WDMA 3CV3A 2UXCB 3FLBA 4EY3A 2F9LA 2ZKLA 1RT9A 1ADGA 1AZLA 4E2FA 4IIGA 5DVZA 4BEVA 5L51A 1VJ0A 3UZUA 2CYAA 1BG6A 2NO9A 2PUHA 3NYRA 3IQZA 1N3BA 2ID4A 4YXWD 3PFIA 2REQA 4JA0A 1X94A 2BFOA 4KE7A 4PYRA 4ZCLA 1NQ5A 2YOFA 5EKDA 2VJLA 1PYGA 3IDQA 4TTSA 5G41A 4BGIA 3UV7A 1Z0SA 1ZIPA 3AM4A 3UJ8A 5DNDA 2IZ1A 1JYSA 3GVHA 4UREA 5H3CA 5HXAA 3S81A 5H3HA 1Z0ZA 1BRMA 3VPDA 2NO1A 4E11A 3C8ZA 4JWKA 4XUCA 3X1ZA 4TTAA 4TROA 4X71A 2E4XA 2ZRIA 3MLAA 5E3IA 3GLGE 5FJJA 4I0WB 3DBLB 2AN1A 2FLKA 3H2YA 4GS5A 4OHVA 3PTLA 2Y77A 1T4BA 4PGMA 4Q1BA 4QBIA 4DLSA 1HYGA 3NT2A 2PCLA 4LN1A 3IXQA 3DDSA 3PP8A 4IOKA 4OXKA 3OEED 1LGYA 1TJ3A 3L0BA 3EZYA 2PX6A 3EAFA 4HLNA 2P9CA 2BZ0A 3A9WA 5SV2A 2GCOA 3FNFA 3WGNA 3UMFA 1Q0RA 2QAGA 4S1PA 4UMVA 4A03A 4NX2A 1I94B 4EPXA 5JSZB 3JZAA 1G55A 1G20A 1WF6A 4MDYA 1A76A 1DC3A 1P3DA 4E12A 2JFZA 2QI9F 3DP7A 5LYJA 1KRWA 4XW2A 1H0HA 1Z8DA 1OVMA 1GNPA 3PUYA 1MXHA 3UAGA 1SM4A 3IDAA 1E2IA 3DZ8A 4LBWA 5AW9A 5DT9A 5ALRA 2DQKA 1WZUA 2WR8A 1Z6XA 1AK1A 2OAQ1 2DQSA 1QOPB 2XOKA 2XT6A 2FQYA 4NFLA 4Q7LA 3DVQX 1YBHA 3BGIA 4CCAA 1DIOB 3P2IA 5CT6A 1NSTA 3HB4X 1ECLA 3TLAA 4JODA 3VR3A 1EP1B 4F2HA 1RZVA 4B76A 2IYSA 4ZVPA 3PQCA 2ZUFA 2VAMA 2ZKIA 4KU4A 1IBCA 4N0MA 1CR1A 4EKNB 2B8WA 2D7CA 4FOTA 1U0BB 2XPCA 4HX2A 3DM5A 3Q41A 1F7UA 1K6JA 2JJ1D 2ZIWB 3LF1A 1JIUA 1NL3A 5CP8A 3SS7X 2FFJA 3LK7A 1HM5A 5EVCA 3U7JA 1P4SA 3ICVA 5KNBA 5JEDA 5DP1A 3O8NA 4OLBA 1KSFX 1L7PA 4HGQA 4KC0A 4RVOA 4WZBB 4ABYA 4CMIB 3GLFB 2EWMA 3CZMA 4FILA 3AESA 1DB3A 4HAXA 2FN9A 1YA8A 1Y48E 5A3JA 2PVCA 4EA8A 1FNBA 3M81A 4Q15A 1X7HA 3LCVB 3OUUA 5JAQA 5KYWA 1D4ZA 2DMRA 1XKXA 4LBVA 4UEKA 4ALMA 3IQIX 2WU8A 1LTQA 2BM9A 5DI3A 2FHSA 3H2SA 1Z8HA 4Q4LA 1KOGA 1E3MA 1SPXA 3HN7A 4JVNA 1ID8A 3IP3A 3T7RA 4ZGGA 4ZN6A 4IGKA 3LJKA 2DVMA 3EA5A 3ZNQA 1VHDA 3WIBA 3M0EA 1CZRA 3KLMX 4CTJA 5L4LA 2HDWA 2R6AA 1TM3E 3I42A 5C5CA 1XTBA 1Z3CA 1T3GA 3NT4A 1JXAA 3QRWA 4LBYA 1K86A 1Y34E 2WF5A 1ZIOA 4HLUC 3X43A 2P2NA 3I8XA 5KYUB 4OQPA 2C2ZA 4H08A 4KYIB 1FJ2A 2JFFA 2R7AA 3NTVA 4FZJA 4JKYA 4NYJQ 2AW3A 4X1KB 3Q3HA 3K0FA 1P4RA 3U7RA 4DV2B 2R97A 4RKQA 2ZSJA 1N8TA 2JIOA 1V1RB 2Q7XA 3PC3A 4LXTA 2UYHA 1BH6A 2D6FA 5BPHA 2I29A 2GA8A 1F4PA 3KAKA 2R5WA 2GJ4A 4KLAA 2AB0A 2X5NA 3C6XA 4M60A 4Q16A 3GDHA 4C78A 5A4MS 2PIAA 2RJNA 3VISA 2DFPA 4UDYX 3V8QA 1BS9A 5PNTA 4RZSA 1W0JD 4AF8A 4EKEA 2D5IA 1N7JA 3M6IA 3OD1A 1KNQA 3ZNNA 2BCGY 1J0XO 3G68A 3L1UA 1A9PA 4ZAWA 5JAOA 4XTCS 2IV3A 5JHHB 1ATZA 1QX4A 4W8GA 1DQYA 2I3DA 2KSQA 2O2YA 2GZSA 4IVPA 1EVKA 4PAGA 2YHIA 4D6XA 1NQUA 1M6YA 2A88A 3WGGA 4E14A 2I9KA 3D5TA 5JDIC 2I4MA 1KPHA 4B6QA 2HJRA 3JZDA 3KSAC 2HLDA 2Y1EA 4KYTA 3WK8A 5JPDA 3K2EA 2PBFA 1NASA 3V8VA 1T9GR 1FFXB 3BSSA 3USCS 4ZCPA 1JN0A 5JVDF 1FS4A 5FFMA 3G23A 2G1AA 4C21A 5KO2A 1B3BA 4B81A 5IHPA 3C7DB 1VLZA 5J23A 1VDMA 2X3YA 4FDAA 5HPYB 4X66B 1ZW1A 4AS1A 5K3FA 3COPA 2PMEA 2V1UA 3I72A 2IXBA 4Z49A 4XQGA 3LC7O 4EG8A 3G9TA 4K3UA 1ES9A 3B12A 3P0FA 4I66A 1WU8A 4B45A 3BF7A 2OHHA 1VP9A 2AI1A 3AETB 5KOJB 2IUFA 1SU8A 5SYNA 1BWPA 4RAOA 5HUQA 1UZNA 1Y6QA 1IHPA 2IUUA 1GL3A 3LQRA 1ELOA 1S2MA 2R00A 3DHNA 4K86A 4ZRDA 3G3EA 4HDMB 5HDBB 2XUJA 1CHDA 2WB4A 4RF2A 1U2ZA 1V8DA 1Z2CA 4QIHA 4K81B 2HYIC 4X95A 4PYKA 5K3FB 2AX4A 1WHTA 2I2CA 4O29A 2Z6QA 1PWYE 2G9QA 2ZR7A 2V7EA 5JATA 1X39A 2ZJZA 2O1EA 2YWHA 3WL8A 1M1NA 3PB3A 4PBSA 1W0JA 5JD4A 3SX4A 3EWNA 3K5HA 3E9QA 3U4AA 2O8BA 3AHJA 2P8JA 3VC1A 4WZBA 1OQAA 1ZX1A 4ALKA 3QUBA 1I51A 1AKYA 4D6PA 4EHLA 1TIBA 3V8PA 2NU6B 3R9XA 3CUUA 4W5NA 2IYFA 1C3OB 4LGVA 2ESRA 2IOFA 1ORWA 5CX1B 1AMOA 2PUFA 5JS1A 1SVUA 2WUFA 2YQ5A 1I3KA 3DVAB 1LPBB 1T4CA 5IJZA 4Z0PA 2H0AA 2OLKA 3D7MA 3W79A 2BUBA 1AE1A 4ZC1A 4U1RA 4DZRA 1Z47A 1Y1LA 3A28A 4ZVQA 4NABA 4PC7A 2RGYA 3ZY3A 5I8PA 1XMIA 5G0TA 2QZJA 3RFUA 2WBLC 4ZT2A 5HZGA 2HUNA 2H18A 3QF7A 2PZKA 3KV3O 3KQHA 5LUBA 2PH5A 4Z0NA 3QBVA 5F5LA 5I4KA 4K9KA 1VYHA 2C9YA 1NZDA 2QUKA 3DZIA 4YAOA 2HRBA 1X7DA 4KE8A 4YHBA 1NJFA 1J1IA 3K8OE 2ON6A 3QVGB 1FTSA 2EBWA 2XMRA 4YIKA 1U63A 1X7XA 1BXZA 4EFKA 1TYDE 1CNMA 2GCIA 1AIPA 4WNYA 1IMOA 3QWAA 4IJ6A 5LDGA 4IIHA 4N5DA 1CU1A 3EN0A 2ZJFA 4EY6A 1U4SA 4CV0A 3Q9UA 5JNLA 1ZVMA 3DLPX 1HEYA 2F59A 3DLHA 1TRHA 2VF8A 3ROKA 5CR9A 1QOZA 4LYHA 1BFDA 1I6WA 2CJXA 3GVIA 3GJ3A 4C2BA 4RTPA 2E55A 1P1IA 2JLCA 4F97A 3C6MA 4LA4A 1GXSB 4E0BA 2PNFA 2BFWA 1E59A 4FFLA 4IBOA 2XCTB 3ZW7A 2HA4A 1GWNA 1OLSA 3F5QA 1R0CA 5BR8B 1ZI8A 2DKFA 2JGLA 2HM7A 4GKAA 1J2JA 2WSSD 4AM8A 4RYLA 4DUPA 3HXQA 3AFHA 2X8LA 5KMGB 3I3OA 4R9VA 4EH1A 2OM2A 3EFBA 4X90A 3VNUA 1HDIA 4ATNA 4DJFC 4TKVA 3SI7A 1EXMA 1THMA 3L04A 3R3XA 4E4TA 3ND9A 4EB0A 2Z1MA 1OYYA 5LB2A 1ND6A 5T6BA 3NASA 3RTDA 3ZHBA 5I7EA 1TC2A 4XA8A 1ZOOA 1H4TA 3DFIA 3NHZA 1XEWX 4QX6A 2Q6OA 5BV1A 4MR8A 1QG0A 2BLNA 3OY2A 1BMQA 3U3KA 3HJNA 4MULA 3BWCA 2G82A 5K01A 3BRSA 4U7HA 2GBFA 1T9BA 4LE2A 2AN9A 4P31A 5YASA 3W5UA 1IOLA 1KBQA 3ASZA 4IYRA 2VK1A 3P2MA 3KVRA 4LPSA 1ZS9A 4E5UA 4R01A 1XPRA 3CFYA 2HBQA 3GB9A 5AFSA 1FNMA 4MKRA 4KI7A 4NEQA 4UBKA 1JTFA 3NBMA 1JECA 3EGXB 1PTKA 4A23A 3OCVA 1R0LA 3GQVA 5AIBA 2WQ6A 1SB8A 1FL9A 5HIKA 2PANA 3ZH2A 1RC8A 1ZCZA 4B34A 4FSDA 2H3EA 4MVWA 2X0DA 5EJ5A 2YIMA 5ICFA 2XDAA 3DE0X 1UK9A 2A78A 3L7BA 3BXXA 4BKMA 4GWLA 2RHBA 5K0ZA 4PTYA 1CZHA 4ZPJA 5A3VA 1KTIA 5DLQC 1FIUA 1XYYA 3R3YA 4B82A 1MH1A 4OMDA 3DTYA 5LA6B 1YJXA 2ZYSA 1U5BB 2IA5A 2OUIA 3KAJA 4XIYA 5FLEX 3PYLA 4RA9A 4M9UA 3SHVA 4AMBA 4ZJPA 1J5XA 4RSMA 4XGQA 3GLGA 1JU3A 4XSVA 3KJXA 2H9IA 2OFOA 2AC4A 2PZGA 2AK2A 1OKKA 2ASEA 2ONJA 1FCJA 1OXKB 4AMYA 4DIFA 3PE4A 1RJDA 1RM4A 2R11A 3OZIA 2HWYA 2CLOB 2B61A 1IY1A 1U2DA 1CULC 1JXQA 3OTQA 1U0GA 2GXQA 3D6HA 5KDOA 2JIQA 1ZEJA 3BMCB 1JKJA 7AT1A 4WH0A 5ETJA 1UM8A 3D8UA 1TF7A 1ZM9A 2Z8XA 4QWWA 1GZDA 2HMSA 3SLRA 1PJLA 3MWGA 4I81A 4L0CA 3V1YA 4EYSA 5ITWA 5KPJA 1GUZA 2DWOA 1WHSA 2W0MA 4QNNA 9MHTA 4FE3A 1HRKA 4ND8A 3QYJA 2KWIA 4ZI7F 5HOQA 3VKWA 2A1TR 5LXTB 3OJXA 4O4IA 1KP3A 1BJRE 5AI4A 5B4UA 5C1DA 2YJ6A 3HQ4O 1EWVA 3GUVA 1TMOA 4I6JA 3TPFA 4XVUA 1PGPA 2ZZNA 4RY9A 3THRA 1PR2A 4R8RA 1OGIA 3OKAA 3P4YA 5EEHA 3QKUA 4HNUA 5HKKA 4BB6A 3ETCA 4LECA 2BI7A 2OLEA 3MGAA 2G25A 1ZESA 1II0A 2RIPA 1BX3A 2XYRA 1UANA 5GWXA 3PQ6A 1GL6A 3OFNA 3RSQA 1M8KA 5IAEA 3EFEA 1U3DA 2IHTA 3ANNA 3ZXIA 3NR2A 4HRVA 4Q21A 1NWHA 3FCXA 4MDHA 4QBHA 5ALLA 4BX2A 1K6IA 3RSZA 4AWXA 1GPYA 3IBSA 1MQAA 3HO6A 3OOWA 4IIJB 5BW5A 1SNYA 1QHIA 4K6GA 4NICA 1KJ9A 2YXBA 5CM2Z 3X2EA 4Q3DA 1ZUNB 1DQZA 1NXPA 2VAXA 4K6CA 4B6GA 5J5AA 5KYTA 3TJRA 4BE9A 4DWWA 2HA0A 1RMTA 1M1YA 1NVVR 1V43A 2VP9A 1C3JA 3C3PA 3FPEA 3PJFA 3ZKAA 5KTNA 3AF6A 2VWPA 3H75A 3RS2A 2IY7A 3L4BA 4H4EA 4DLPA 5HZKA 5M29A 3LA6A 2FPGB 1K3UB 5EQFA 1DT3A 3K0AA 3DMPA 1H4QA 2HKIA 2PTGA 1DIGA 1YZ3A 2QRJA 3UYLA 2ZSEA 2V1XA 1OXMA 1JB9A 3PE6A 3OAAD 5LQSA 4W5QA 3M1AA 4HYQA 1LQTA 2NMVA 2P11A 4FD2A 5EPEA 2Y9MB 1CT9A 1R8JA 2IFTA 5AKZA 4YJDA 1XDWA 2CBZA 3X2FA 4F93B 3HEBA 4RH1A 3WKDA 5JDCC 3UHFA 1U9IA 1UZAA 1NY6A 2GPSA 4WXEA 5LP6B 1GV0A 4LEIA 3DR3A 2VP4A 1DKRA 4RLHA 1G2OA 2DY0A 2PMBA 3B85A 5FV4A 5BSWA 3ZCPA 2VDWB 1Q7EA 2J32A 2PLAA 1VG9B 2ZBGA 3GUHA 1IQ0A 3B2QA 2IXFA 2XAAA 1ZBQA 2FDRA 2IEIA 3LCRA 4MS3B 4UFNA 3OF2A 5BR7A 3QMMA 1FYWA 2J3EA 3IDFA 4WXHA 5TMPA 1E92A 4LYGA 3SVTA 4HP8A 2IOQA 1U1EA 1NU8A 2HMUA 1UMBA 4QU8A 4CIDA 2O19A 1ISFA 2J4FA 1O54A 1FBTA 2GVDC 1R8SA 4O02B 1BFUA 3RE1A 4KYVA 5AW4A 1VL1A 3HKEB 2P8SA 2OECA 2A35A 1VYUA 3NIGB 3OEHD 4Q3NA 2HHLA 4A7PA 5CPBA 2UXBB 1T8WA 4LZZA 2XVMA 2YJ4A 1CUCA 1GNTA 3IB3A 1XJ5A 1SC6A 1XZFA 2CL6X 2V0CA 3QPBA 3KU1A 1E18A 3A6KA 1DS6A 3BIFA 3QQ5A 4MW2A 1TO6A 2YZNA 5EQDA 3VMFA 2EHJA 4H1VA 3WSVA 3ZBQA 3CWCA 2IWRA 4HQRA 2GNOA 1PT9A 3GFBA 2YCBA 3LBIA 3CRMA 4B2YA 3U5ZB 3EIWA 4I1UA 4LNHA 3C3EA 2VDVE 1D2AA 3CQ9A 1Z63A 2BONA 4OI4A 4FHCA 3H4TA 4HRXA 1O94D 1OZFA 4RK0A 2FFHA 3CLRD 4RMJA 4X7RA 1Z4PX 3ESRA 4GPD1 2C5BA 2VH2A 3V6LA 4TX1A 1RTTA 2GHTA 5HCIA 3M6LA 4OAPA 3ERCA 2OYCA 4H4CA 1ISRA 4Q12A 1Y6ZA 1LW7A 4JSRA 5A4FS 4RIEA 2ZWOA 2L19A 4ZQFA 4UJ5A 2XOKD 4QVGA 4MI1A 3QIVA 2CKMA 4U2FA 1IJEA 1L5FA 2RGWA 1E1MA 1SKAA 3E9DA 3K94A 1GUFA 4J6FA 2FSSA 4JD5A 1NBOA 3DQPA 1H8EA 3AHIA 1FX0A 1ZUNA 3HFRA 1JT9A 3SFZA 3CVVA 4EYEA 3LLCA 1QYCA 4HB3A 3I32A 3JPWA 4R0NA 1U0SY 4TWBA 1EFTA 2R5FA 3A1SA 1SBNE 4P3NA 1JEQB 4PLWA 4N5HX 1WY7A 2QB5A 1ZCAA 1O3YA 4WNIA 4P0QB 4TS3A 1IZ0A 3HVUA 1QIMA 3VAYA 3LPAA 2Q0HA 4BMSA 4TYMA 4IKPA 3WL3A 1QGOA 2V7QA 3D3KA 4IDBA 3ZI4A 4QUIA 4AJ9A 5J2UA 3V7YA 4C20A 5IXJA 3AR7A 5DMXA 3H2GA 1TA4A 3C5EA 1HURA 3Q7TA 4WESB 1JIQA 4A36A 3ELYA 2DXIA 3GLVA 2R1UA 4S2EA 4Z53A 4DMLA 3UIEA 1L6IA 2WMNB 2Q7DA 3B38A 4ZCSA 4B6RA 4Y1GA 3NDJA 1ACMA 2QSZA 1PJ2A 4CKZA 3IQHX 2WV9A 4DKJA 1IZ9A 1N9KA 3QUSA 4LJ9A 1G5QA 3GGSA 3RRXA 2G9VA 4BQNA 2D1QA 3AF4A 4EHJA 4OHXA 3ZWAA 5JHGB 3K5WA 4DZTA 3DWEX 1DRJA 1V39A 2GT1A 1Q21A 3C2QA 3FRIA 3C8DA 4HMPA 1C0LA 4HSEA 4LWZA 2YDXA 3AWDA 3NT5A 5EWJA 1J07A 1V25A 3NPAA 3ONDA 3CUKA 4QU5A 5KMGA 2WJHA 2GI4A 2SKEA 3RTCA 2PKWA 4PX3A 4NHEA 1G7CA 2VDOB 2VVTA 4Q4DA 3PNYA 3UPDA 3JQAB 1OH5A 2HU7A 3SQOA 4M1ZA 1JWAB 3BGSA 3DE7X 3P7MA 4KLNA 4TXLA 2C9CA 1J8VA 1QDEA 1T5DX 3AYZB 3CIOA 3L84A 1I2DA 1PQWA 2FW6A 3H7AA 5J4KA 4Z5XA 4BKPA 5T8KA 1F3OA 3DV2A 1FRFS 1KZ4A 3MRTA 4ARBA 4L08A 1U3FA 5DYYA 4B6SA 4LXGA 5E9AA 2PUEA 5H59A 3E35A 4Q7JB 2BGGA 1M33A 4AKGA 1T8RA 1FF9A 2XUZA 3VJMA 4LDAA 1G291 2JFYA 5FYQA 1GUAA 3LX8A 1UCFA 2Y27A 3KWJA 3I5UA 2ZJ3A 2GOYA 1THTA 1RKBA 3WB9A 2ZE7A 4KQFA 4QHSA 3FHLA 1USGA 3CF0A 3LUCA 4JP2A 3UAVA 3EGXA 1PI3A 2BFDA 3LRPA 4FHZA 4OFWA 2P9FA 1HNWB 3JYLA 1KU6A 1N33B 1C7JA 1E77A 2CDBA 3QIAA 4HMOA 2HF9A 1EX6A 4TWRA 3GLIB 10MHA 2A30A 4AY3A 1HEIA 3L8ZA 4ZVRA 2O7VA 3DF9A 4B79A 2NYAA 3EZ9A 4XB1A 1YUNA 4A5SA 1RWBA 1GCIA 5JR3A 2UVQA 4R2KA 1SCAA 4C4TA 3IB6A 3B3QA 4DBLE 1E3TA 3BERA 1B8VA 2HK7A 4P36A 1PJ8A 1U4NA 4NBNA 1EFCA 5B1HA 1EUDA 1G60A 2FE4A 3NXKA 1A88A 1O94C 1ODFA 3DTVA 2JCSA 3GD5A 4UASA 4ADSG 4P4SB 1JPVA 3IQGX 1PVOA 1PEKE 2JVKA 4HQLA 4QD3A 1JA1A 2RMKA 3LW7A 2JLSA 5KU7A 3IALA 5F12A 1FW8A 3DYVA 5HDQA 4EARA 3UBMA 4F21A 1ZBDA 2I1LA 5IKPA 2PFSA 4N5LA 2AVNA 5TQ2A 3E8XA 2GBIA 1R7RA 3KHSA 4OF4A 2C78A 1Y7LA 2YN0A 3DDHA 4B2LA 4ZZ2A 1VLHA 3IVXA 1BH2A 1SD2A 2JGEA 2HDOA 4JB8A 3V32A 1TXGA 4Y6OA 3QI7A 4FP9A 1S1MA 4FK8A 3EOAI 4Z9YA 3TDKA 3WNDA 1Z7GA 3FOWA 3I6BA 3BICA 3NH6A 3Q9SA 4LSMA 4YCDA 2I1QA 1G1MA 1P2TA 2V45A 4R1MA 4XR9A 2Q1WA 2BN4A 2OBBA 3UATA 4LISA 5BUCA 4IHAA 3V1KA 1VRVA 1B26A 1O5OA 4QBFA 2OXEA 3B70A 4G89A 5HA5A 2FR1A 3WJ1A 4YT5A 4PZCA 1MQ8B 4AQYB 1N0IA 4E32A 2GD0A 3ZCRA 1SCIA 4X7PA 5CT5A 4XE5A 3UQZA 2PSSA 2PGNA 3D5QA 4R3NA 2BEKA 4J1SA 3X1YA 1LC0A 1S96A 1WXEA 4UATA 4E1BA 1D9ZA 2ZB4A 4M0DA 2G67A 3FFAA 4K1XA 2HTEA 3VX3A 4QOFA 2P9GA 2CHVA 4A8JA 4UOEA 1XZMA 4H3HB 1GG9A 4HBZA 4MJLA 3ECAA 1U99A 3RRYA 4V1CB 3OX3A 1U11A 5KJFA 2JFPA 2KHZA 3RUPA 4KPFC 3KKNA 5DB4A 3WSTA 4BLVA 4TTRA 2X6RA 4GPZA 3DCYA 4Q4AB 1SVIA 4M0FA 1QHGA 3WADA 4P5DA 2QS9A 4PCUA 4OXQA 3SJCA 1A9TA 1E6UA 2PMCA 3JWGA 4OSEA 2B8NA 1QH1A 3G59A 3MCVA 4UVHA 4AY6A 3GLIA 4P0PB 2G7MC 1M10A 2R6FA 4AS2A 2AJTA 2LVBA 2NU8A 1OJLA 1XLTA 3CW8X 1AS3A 4X62B 4UBLA 1XXLA 5KDDA 1ESDA 2GLUA 2RJ3A 2YVAA 4G07A 4AP5A 1Q3HA 4N3GA 4M8LA 3J81k 4HCJA 1E7MA 2VFAA 2ZRDA 4XGKA 3U9SA 3HBFA 4EGAA 4LJ7A 4MWTA 2BDTA 2CFIA 2YY7A 1E3IA 1QQTA 1Y5MA 5FUVA 2HZ7A 4D3XA 1G20B 2DFTA 1KZ9A 1HO3A 4X1IA 4LFAB 1ZIXA 1ZD8A 3M2PA 1XU4A 1BDMA 1P4HA 5D00A 3RFTA 3PZRA 1VG8A 1TPZA 4RDXA 5D85A 1DQSA 1FDSA 3WE7A 1PWXA 1J7KA 3P4XA 4DMCA 3GUCA 5ALSA 3HABA 4OH7A 4QG7A 2SHKA 2PR2A 5AXAA 4MQFB 4ANFA 3WL5A 2AWNA 4M7OA 1YF3A 3GGCA 4FNGA 4MWSA 1WBBA 4C2TA 3PTZA 3QVLA 1MAHA 1UBCA 3HJUA 1JZSA 4GI2A 4ND4A 3OWOA 4LE0A 4NV0A 4UAVA 4ZOLA 1R6TA 3C8HA 4JC0A 1PN3A 3NCTA 4XJVA 5CB8A 2Y92A 4ZQGA 3I92A 3RBZA 1B93A 2EFHB 3A25A 5HBGA 3UUEA 4BYGA 4EEZA 5D8DA 3K15A 2XUIA 4WWHA 2XQVA 1D0IA 3PDIB 5BUZA 3EG9A 2IITA 2NO0A 4MB0A 1FFDA 4OO3A 3RVBA 5C46F 5F33A 1JFVA 1L5SA 2WZBA 2I7XA 2CUZA 1A8UA 4L07A 5IT4A 5FDFA 2ONKA 1W35A 2BY4A 2YUTA 2EL9A 4PO9A 2I2XB 1QORA 3LRXA 3LXUX 3UYKA 2VI5A 3PKZA 3V7FA 1Q22A 3ZHZA 3EPJA 3R5JA 1BWSA 4G41A 1RAAA 1UKEA 3T7CA 1ODIA 3WLRA 1Y3HA 1V26A 5JY6A 1NG9A 2OXTA 3V4PB 1YTLA 4EL0A 3PGVA 3PDUA 1GYPA 2Q8QA 1JA9A 1VG1A 4GX5A 4B3IA 5JJCA 4WOJA 1RC0A 5JAUA 4DCPA 5A71A 1GGMA 1IAQA 4MQ6A 4IEEA 1HE4A 2WYOA 3O83A 3RAGA 4PAOA 1KOFA 2OKCA 2BJHA 3TTVA 2J48A 2W7TA 1Q14A 2HWXA 1P1CA 3ZV3A 4CM8B 2GF0A 3ENWA 2TRSB 1GPBA 1UBGA 5EFOA 3ROTA 3ONNA 3D2LA 3H42B 4PX2A 2VC2B 1YZKA 1EG7A 2YY6A 3TNDA 1R0YA 1VKHA 4RKYA 4X41A 3RIEA 1SQFA 1KF0A 4JQOA 3WGQA 1AH2A 1W4RA 2QA5A 2VH5R 1KO7A 1TUIA 5G02A 4DA0A 4UZFA 1XQYA 2WYIA 1A3CA 4BLOA 1JNYA 2PXHA 3ZIUA 4ZI2A 4F4CA 1R5OA 2GGSA 4U00A 4TWZA 5DFAA 3AEKB 3ZQKA 1DNPA 2PN1A 1UJMA 1AZWA 3BL8A 1JZQA 3DV9A 1W96A 1TUGA 5BYKA 3KQOA 1DINA 3L6RA 1U0EA 1SOVA 2HNAA 4RVCA 1V16A 2CJWB 2BF7A 1IBMB 3IIIA 1VJRA 3A2NA 3V8EA 3PHJA 1M1YE 2R751 1IQRA 2NNWB 4CM6A 3CT4A 3D9QX 5E4TA 1QSGA 1Z3IX 4CM9D 4NFYA 3IE0A 2GF2A 3NTXA 4LRUA 4YYZA 4B83A 5E4JA 3GN2A 4KRGA 4P7BA 4CKXA 1RPTA 1QO9A 4X5OA 3T8YA 3W5HA 1TE2A 2JHAA 3I6IA 2C2WA 4YP7A 3OURA 4KODA 4PNEA 5JOQA 5AVVA 1NYLA 1WCWA 3GZTB 1QG2A 3QY9A 1U3WA 4KO8A 4LI3X 4P22A 4AUMA 5AW7A 4MQUA 4C2AA 1JHZA 4LHYA 2XRZA 1L1EA 3OOJA 1QK3A 3G5TA 3JY6A 4PRKA 4GLLA 2CE2X 1YASA 4LG1A 4LHWA 1OUMA 1Q1ZA 1W93A 2AJBA 2YNMA 3AL3A 2VF2A 4OHUA 3IOCA 2GN0A 3P9QA 3H5AA 3PITA 5DW3A 5I7AA 1EAMA 1HOXA 1O7JA 4TYQA 4J3NA 4E22A 2XEXA 3K3PA 4US2R 3GEEA 2W4IA 3S5JA 1OA1A 4ZCTA 3ITNA 1K9SA 3IAM1 3WRVA 4U9HS 4E5KA 2HLPA 3BX1A 2PQ2A 4B6PA 1UMBB 2PT5A 2CLEB 4PIVA 4C4ZA 5CXUA 5AP9A 4V39A 2E18A 1D6SA 4EJ0A 2FSUA 2PXCA 1RBMA 2RAPA 4OQYA 3K73O 1XP8A 4PSUA 1K3TA 1QMPA 1LDNA 3OLYA 1OTXA 1OWMA 4WVFA 1IHYA 5L7TA 1UJ5A 2XZTA 4JB0A 4OHFA 3BTSA 3GYGA 1N77A 4MRAA 2OHJA 3KTAA 4LNAA 821PA 3IAFA 4AKIA 1R27A 3DXXA 4DJ5X 3FMVA 3A32A 5FTWA 5HW0A 1PNOA 5FUBA 1EX7A 3AG6A 2C94A 3DPIA 4HAVA 1RC1A 5IK2A 4HRAA 1J9ZA 4F3TA 3JRWA 3EHEA 1T5IA 1I4OA 1PK7A 4BVKA 3HXMA 4ZYYA 1RJ9B 3WJAA 3KVOA 4R0VA 3QLEA 2EKZA 1ZXBA 3CRW1 5B6PA 1P75A 1Q20A 5JYDA 3HJFA 1SXQA 1M1ZA 4S35A 4Z8XA 2WU1A 1E6WA 3ET4A 2C9MA 4G2TA 3RROA 4B7ZA 1N5DA 1NQAO 3T12A 4D8WA 2CXNA 1LBQA 3HKDA 2QL6A 4BECA 4DQXA 1OT3A 3WYDA 4XFDA 4RXMA 3K9GA 4LF9B 1NFQA 1QO7A 3D6TB 4H59A 1KDZA 1NULA 3IJRA 2V6BA 2VXBA 4OFZA 5LUAA 3OJWA 1WOMA 3OZBA 5TJHA 2J31A 4IXDA 4E13A 2C5EA 2AA3A 3N2KA 2BFMA 4IRUB 3CVUA 5HCUA 1RBYA 1EGAA 1O95C 2NSJA 4I1YA 3WFJA 3TZBA 1XEFA 1XA4A 3L0PA 4GZLA 4QLAA 3BORA 4RA6A 3UKOA 2QMYA 3U4QA 2LE0A 4L95C 2AMFA 5SZHB 1RVV1 1PS8A 2B1JA 2PG3A 3QOWA 1U2TA 3HDJA 2OZLA 4JDUA 4JJ6A 4LX8A 5CW2A 3M9LA 4BO3A 1ULZA 3S2YA 3K09C 1ZA2A 4ZO6A 4DUZB 2R7LA 2RK4A 3BM5A 4WBNF 1T0PA 3TLGA 3I5AA 1Z39A 4GI7A 2I4LA 1BW9A 1YFKA 4G5OA 5DNUA 2XVZA 2V03A 5DYWA 4LYYA 4F4FA 1HYBA 2P69A 4QDKA 2W6NA 3IPLA 4MAFA 4XRRA 2WWWA 4KO2S 4BJHB 1AF7A 4XTRA 4M0UA 4DL9A 2VXYA 4ER7A 2YC4C 4RGYA 3VYSB 4PEVA 3F6BX 2C84A 1TYEB 1PGJA 5EJ2A 1XPOA 3FWHA 5CVUA 3L0YA 1QLWA 5BWNA 2DE0X 3MG9A 1EBFA 4FEYA 6LDHA 4V0SA 3LAWA 4ROTA 2HJHA 2YZ7A 2R2GA 3H17A 3F49S 3R1IA 4U39A 1QIIA 3SHOA 1OE0A 4LK3A 5JTTA 1PJZA 4HDSB 5AVSA 3M7IA 2WHYA 1IN6A 5FWXB 3WLQA 1Y9JA 4LY0A 4P54A 5EKSA 2LCQA 4PPNA 2OG2A 4BV2A 5C8VA 1EM8B 3OKCA 1WY5A 1ULHA 2XQJA 3H9UA 1YJQA 3KOYA 3WZLA 1W87A 2C92A 3AVWA 3Q0EA 5JZBA 1CUAA 1TZMA 4PC1A 1DLJA 1X42A 2Q5IA 2TMGA 4II3A 2Q46A 3L0SA 3LX4A 3TNFA 4DSTA 1SU6A 2CMDA 5FOXA 2WU0A 2JAOA 2WJ4A 5KVAA 2HTFA 1W5AA 1TK3A 4II7A 3I61A 2KYRA 4JROA 5C5IA 4LXQA 1I4EB 3B60A 5AH0A 5DGIA 4Z54A 4BQSA 1P0IA 4MS1A 2I6SA 4DMRA 1EFDN 2CY0A 4E7PA 2UZ1B 3WK4A 2AF3C 1BMFD 3RFFA 5GIOE 1GCAA 3VKHA 1NXQA 3MUNA 3BGVA 3KXPA 3MJSA 3NC0C 2FX2A 2ODNA 3LOUA 4FDVA 1GVHA 3D3NA 2EDCA 3FZQA 3TLBA 1TAHA 4BP9A 6GPBA 5A2QA 1WUHS 2HADA 1O1YA 1B15A 3KT6A 2A67A 3PS9A 4NOKA 1OTYA 5JD6A 2KW5A 5LMCA 2AK3A 3F6RA 3UHJA 4DDKA 3GZJA 1J24A 1JEYB 1YQEA 2Q3DA 1U1GA 2ODTX 2OYRA 3BMXA 4BMNA 1P1KA 1DMRA 1TM4E 2AD1A 2RH9B 4OJTA 1XT6A 2YZKA 3L1KA 1DRKA 4M1TA 3UJ7A 4D26A 3K53A 4KBYA 4ZDKA 5DIZA 2O1SA 3IAEA 4JYPA 3T3DA 1P2GA 3FM9A 4IMJB 4CJXA 4K9DA 3RJ5A 4CODB 5K3AA 3QZUA 4MK4A 4RM3A 3P9IA 2A7XA 4IV0A 1SXJA 1L5LA 2XYPA 4QLOA 4G8JA 1MAVA 2H1LA 1IXSB 1KVUA 3HSSA 3NWOA 4WY8A 5BSMA 1E1QA 2QTVA 4G26A 2AFIB 5FTMA 2BKAA 4TV8B 1JYFA 3FYUA 4D4MA 1ZUHA 3ZJVA 3HE3A 3LVRE 1G8FA 2O0MA 2GB4A 3D7RA 4GYYA 4TMYA 4YJGA 3HZRA 4F06A 3ZIAA 1DC6A 1FFBA 1LFAA 1SC1A 2OV4A 4LYFA 3WQBA 1NVDA 5FIUA 1YR2A 1Q84A 3UJBA 2G5PA 4R1SA 4AU1A 1PDWA 1I36A 2JGDB 2WYHA 1CCWA 4RXTA 1T9GS 1TYZA 1MVLA 2IBTA 4DG5A 2JAHA 3V8MA 3TH5A 1GZVA 1DOHA 1ADBA 5HMMA 1TAGA 2FPWA 3PI7A 3IBFA 4O1MA 5EKTA 3T7TA 2PE5A 3PEYA 4EVQA 2HEGA 2NZUG 4XXHA 3PHHA 2QVLA 3P9PA 5EZ5A 5AICA 3WDSA 5IJWA 2E5WA 1RHRA 3C3JA 1BKSB 5IT0A 4OUKX 2XD9A 4IY1A 3U7FB 4CL0A 4IJQA 1F2TB 3BCRA 3MJFA 3BJMA 4BC0A 2VQ3A 1MG5A 3JRNA 2J85A 2ODEA 1GPLA 3HL4A 2M6LA 4D82A 1GARA 4B0OA 3AJEA 2NV0A 5G40A 1G18A 4OJKA 3KSDO 2CB9A 3S2GA 2Z4TA 4G3XA 4U2KA 3EW9A 1YU9A 5BNWA 1KVQA 1ND5A 5ARBA 3N0RA 2ZE8A 4HZUB 4LDRA 3OCUA 4YY3B 2B2NA 1WMEA 2HUPA 3UXMA 4EG3A 2PX2A 3L49A 1J0DA 4OI1A 1PNRA 1ZC3A 4NYMQ 2GUGA 3IUEA 2X0JA 1ZDMA 4N03A 1W52X 5ALUA 1JAYA 1OX6A 1I80A 1Q1GA 2HSWA 1RFGE 1VB3A 2ZWMA 3E2MA 1LI7A 3MCWA 4UUMA 1MQ9A 2O0LA 3BMOA 1B8PA 1OIWA 1NUPA 3JW8A 5DCLA 3SBXA 3VHXB 1T4CB 3DPUA 2BEWA 3PNVA 1RMYA 4EQZA 1IN4A 1LDYA 4LK2A 1CUWA 4RSGA 5C34B 3RG8A 3RYCB 2QZ4A 2EW8A 1E61A 1JSLA 4NULA 3DP9A 3PE3A 5BQOA 1PL8A 3T5AA 1P0CA 1U8XX 2IYYA 2PX4A 3ESXA 5GV7A 3RH0A 3HV0A 2PUAA 3B9PA 1FY2A 1YFLA 1YRHA 1VL8A 1WPGA 3B7GA 4R1PA 1OB2A 1YR8A 3BH7A 2DB3A 1G2IA 1YWGO 2CHGA 2UZAA 1J06A 2HX1A 2CL5A 3L01A 4P3KA 2GCPA 4PTLA 4UOQA 3JASB 3LKBA 5LYJF 4LMPA 4C01A 4UMDA 4AWBA 1YH3A 2A9FA 1ZQ9A 5AKIA 4MI3A 1RWMA 4HDQB 1TU4A 1DOZA 3N3BC 3KQYA 6AT1A 2XF8A 4BE4A 1G16A 2H63A 1P9NA 1MZVA 3K9WA 3MYYA 3B1VA 4I9GA 2H51A 1L5KA 3IAS6 1IPFA 1RZRA 1HKUA 3NB0A 4K8OA 2EQAA 1SBCA 1PZFA 1IJBA 1ZM3A 1OPXA 2HLNA 2J8ZA 3FFXA 5BMVB 5A3RA 5JI3E 3MWDB 3GW8A 2WSBA 4PCVA 1UJ2A 2OGWA 1RXIA 3PGA1 3PRJA 3U1BA 5B1SA 1N9GB 2WJ3A 1SXGA 1H9AA 3ND7A 2SBTA 3KJZA 3CGGA 3LLUA 4ZOLF 4BGEA 1SU4A 2JIRA 3A0UA 3CNQS 4KZKA 1QQAA 4JZKA 2BBWA 1U3TA 3IKJA 4X00A 4OYRA 5GONF 3O03A 3C97A 1ZIYA 3UO8B 3DGEC 2GZAA 3W8EA 1N0UA 1TZCA 3G5MA 2G4CA 4A10A 3PUVA 1XTJA 1ACLA 1N5MA 4GOXA 2EAUA 2WSLA 5ES4B 1B0PA 4R68A 1KS9A 1GT6A 5TPWB 2EFGA 4PS1A 3ISJA 4W1QA 3RLIA 4IS2A 3OC0A 4MIEA 3FWZA 5KHOC 4C0QC 5KWSA 1CF4A 4YCJA 3KUCA 3HEAA 1GFZA 3LYUA 4KZPA 4AURA 3G79A 5J4HA 2A0WA 2W22A 2P7IA 1VBFA 2XCSB 1C4KA 2JA1A 1C9YA 2Q5FA 3F2IA 4QUAA 3CX8A 1D5CA 5HGJA 3ZU4A 4O2LA 1NE7A 1AB6A 2ZTSA 4ISBA 5CB4F 6YASA 4F6LA 2AWOA 1HFWA 1NBEA 3OT4A 1BCSB 2JKVA 2ZIFA 1CLEA 2X0KA 3PDJA 4Y98A 4ZHSA 1MO3A 1ZN7A 1VCHA 3SS8A 2BW0A 3HDTA 3CF4A 2PPLA 3RANA 3D3WB 4XWGA 4URHA 2O2SA 4BFTA 1O57A 2JJ1A 4FGWA 3TB4A 3SZGA 3DFKA 1F60A 3PSAA 5AUNB 4FBMA 2Y1XA 4YLEA 5JNVA 4ZDWA 4NXMB 1MB2A 1IQPA 4HVTA 4RMIA 2I6XA 2XY4A 3TSAA 2BKXA 4HVAA 3O4HA 2G9NA 3G2JA 3L9XA 1HT0A 1K9VF 3KOMA 2XXAB 1V1JA 2OWEA 3AR3A 3BN3A 4JY7A 3QOYA 2E4WA 4M7WA 5CPFA 3D64A 5K3EA 4UE3S 2XUPA 1MB3A 3SYMA 5BNTA 4QODA 5IK2D 2XB2A 1C7EA 3OE7A 3O93A 5LDDC 1P44A 5A06A 3D8NA 3P45A 3L0DA 3KJNA 5D86A 5F1KA 3ZJUA 1JAHA 3RUIA 1BEEA 3T1TA 3EWIA 3E8SA 3JV7A 3QFRA 4M36A 3EGVA 4WUTA 4IOJA 4OI0A 3P0RA 1GO2A 1XHEA 3CX4A 1T2CA 4LZNA 4MEAA 2OBMA 2VP3A 2FDXA 2YWEA 3OA0A 1I6MA 4QL3A 2A9VA 4NPCA 1A9SA 3FTFA 3KYCB 3HRKA 2DPXA 3N3AC 3GMSA 4RV9A 4BO8A 4YCSA 1JDTA 1WPXA 5GADl 3K70D 2FQXA 1WLSA 1QS0B 1V96A 1WUKS 3DYBA 3KEMA 3ZWDA 2MU1A 3SZLA 1GV1A 5TPZD 5FP0A 1GNVA 1RW4A 4BY9E 4OBEA 4Z4HA 1DWPA 5HQ3B 3KQTA 2BMFA 2IS1A 1DKOA 5IN5A 1VE5A 1UXGA 2ZLBA 4KXMA 2J87A 4V3CA 2AN3A 5EN4A 5B57C 1PFUA 5AHOA 4WLOA 4F8YA 2DTDA 2GEVA 4ZQBA 8LDHA 1B76A 1E3QA 4GUAA 4N7MA 1XZIA 3EFOB 5DTIA 3WRYC 4F2GA 4IGIA 1R0BA 1WDLA 1HG0A 4RPLA 3WWCA 3ZGVA 1U3UA 2BHRA 3RLFA 2CC2A 2NU6A 1GAJA 5TXGA 4AZ3B 3R9XB 4WKBA 3BCSA 1A9ZA 1XLTC 2ZBFA 2AH5A 2AD5A 1Y8QA 5J9FA 1DTWA 4RE6A 4YCMA 5B2EA 5LYJB 1M67A 1DTEA 3CX6A 1M73E 6REQB 3BD6A 3D8TA 5AJYA 4YDSA 3CRNA 5EZYF 4A26A 2APJA 4H6VA 2W2LD 1DXOA 2GZ3A 1GPDG 1VE3A 1Z88A 2CWWA 1RKQA 2XYHA 1NF2A 1EFRA 1QKIA 3U1VA 1MHTA 2VWQA 4UUAA 1XNQB 5FOTA 1W4AA 1XIVA 2ATEA 3BH6A 4RJKA 2RJOA 3VVLA 3ZZUA 3RVRA 5J58A 2E5FA 2RDMA 3K0KA 5DGCA 2WTMA 4G1VA 3ME5A 4GKVA 3Q11A 1NSFA 4HWOA 4H1WA 4XDHA 2H1OA 1FQKA 3FJ1A 3Q87B 1HTBA 5LBIA 1GSIA 3JQ6A 4WV3A 2DT5A 4D80A 2G1PA 3IEVA 3QWIA 4MA0A 1DZ3A 3K9BA 2TMDA 2HA7A 1GLGA 1OFGA 2Q3EA 4EYKA 5KNDH 4GBGA 4LKOA 1K7XB 3H2BA 3RIXA 1NBWB 3D7SA 2HJGA 2FN8A 3FUUA 4L5AA 1XTTA 1P0MA 3BFVA 3D4OA 1ZJWA 3TIFA 4XWKA 1UPUA 2AUNA 1XNGA 2VNAA 2CXPA 5HF9A 5LZ2A 3AUUA 2WIKA 2X0RA 2INGX 3DL4A 4ZDJA 4DAOA 3QEBZ 3SICE 3PUJA 1P2FA 4D0RA 1K6MA 2Z9DA 2VPPA 1PUJA 2RAVA 2VBFA 4RS4A 1ZH0A 5C3UA 2XXJA 4CTOA 4X8LA 2BGTA 2BPOA 3OCWA 5FBVB 1AF4A 1YQGA 2XCLA 2GTHA 2P7HA 3E15A 4Q00A 4BNWA 4MCHA 1KHHA 2E1PA 4OB6A 5ENZA 3RVMA 2O8EB 2V9PA 1E79A 4EVSA 1WKCA 3B48A 3ZV6A 5FADA 1E6MA 3LQQA 2IXTA 3UXHA 3U3ZA 4OATA 2ZDQA 3S2EA 4L4UA 3TW8B 3M6VA 2QD5A 5M04A 3VNBA 3RAPR 1XI2A 4N1AA 4B74A 1H69A 2OBNA 3DEHA 4DLRA 1J2TA 4WZBE 5J2TA 2F62A 4LX0A 2Q50A 1DRUA 4JFAA 3BS4A 1O77A 3Q9LA 5KDLA 1A5SB 3AV0B 4F72A 3IR5A 4JJGA 3MMSA 4IWXA 3VHLB 2FMHA 3HR8A 4DIUA 2P4HX 1VYTA 2AEFA 4WLFA 4XQCA 4AG3A 1G63A 4CR7A 4XLZA 3MGKA 4U2CA 1H94A 1QG4A 5AW3A 3VO2A 3CR8A 3H1AA 1EH5A 1KMMA 5COQA 1PHPA 1KQNA 3R9KA 2Y99A 2DBQA 4KXQA 3W3AD 5EJEA 3K1AB 1QF6A 1VA4A 4PHGA 3NGMA 1K1EA 4TL7A 1YDEA 2DPGA 3CLHA 3FGZA 1N2BA 4MSUA 3DO5A 1PE0A 2X8AA 2XTMA 3RWBA 4P7KA 4BE7B 2Z2ZA 4EW6A 1P0FA 4PGHA 4DNPA 4QU9A 1GJRA 4FEAA 3DAGA 4Z2YA 2V7VA 2WWXA 2EWWA 2W2OA 5CIYA 2RC5A 2ZETA 3I0MA 2ISCA 2EEZA 3OSUA 4FVTA 3LO8A 4HAWA 1NQVA 4Q9LA 5DN6A 4TMZA 4EW1A 1QPGA 2I8AA 2XITA 1JHPA 4R31A 4RM2A 5KS2A 3GCGA 5KYVA 5LIPA 1MX9A 3EJ6A 2G71A 4TLAA 8ATCA 4GQBA 3MTDA 3HUUA 3R44A 4QDOA 1H23A 3ZEAA 1M74A 4F8JA 2Q1XA 3BMNB 4AY5A 4HWPA 4R9UC 3MMPA 4RD6A 3EXHB 3H9JA 4TS4A 1NQTA 2DHRA 3JQ7B 3CSSA 3SXUA 3VZCA 3TUZC 2QLLA 3ITKA 1LNQA 3P5SA 4ZAFA 1YV9A 3B9QA 2C3YA 2HF8A 2ZBPA 3RC9A 3WLIA 3LZDA 3QELB 4V0OA 4NU8X 5HNKA 5F76A 1XQ1A 2NVOA 1N5IA 4KPYA 1N2HA 2ST1A 1DX6A 4OK6A 4WUVA 3FNQA 2D3TA 1TL7C 4KRFA 1WU7A 3HI4A 1T3TA 3LC0A 3OFVA 5D1NA 3CGWA 3GLFE 2ZE6A 2I9PA 2VRBA 2IYNA 4RC9A 5LZ8A 1S2IA 2B7CA 2GNAA 3AGPA 1FW6A 1XZEA 4TSKA 4RCVA 1J0CA 2WM9B 5FOSA 3FDFA 1CE8B 4AQDA 5DPMA 3G02A 1CUJA 3T7SA 3A4YA 4AO8A 2RE8A 3GO4A 5E6SB 2ARKA 4G5QA 3TI9A 2HQBA 5CG1A 5AKEA 4WLVA 4B8YA 5AJUA 2I62A 3QF4A 1RYEA 2BGRA 2I34A 4HLCA 3LBHA 2D3WA 4RHFA 4RTNA 3O95A 4UDXX 2FPUA 1NMSA 2B4AA 3FMGA 3ZNOA 3R74A 4BL5A 3K92A 4UKDA 1KMHB 1GUBA 5COBA 3MWKA 4TSFA 2G36A 2FSGA 4KCGA 4KLZA 4TVOA 5DSZA 2QRQA 5DOZA 3S8EA 3U16A 4JH0A 1C1HA 3D8SA 5LU9A 5E1OA 2JB9A 4M7RA 5I9LA 1NU6A 4MGZR 4UHBA 5ICMA 1RHKA 3RB8A 3ANXA 4TTJA 2FLVA 1EM6A 1VHWA 1Y98A 2QNIA 2OO7A 4XCVA 1MDBA 5IX8A 7GPBA 4CKCB 1QHSA 1KH1A 2O06A 4BMZA 1GEGA 4D3DA 1JTEA 3BFXA 3X1KA 3OOEA 2B4TO 1LH0A 3I4CA 2YASA 3UBTA 4OP3A 2IUEA 3QOFA 3ZDBA 2ZR8A 5JALA 2OEPA 2BGLA 4XDZA 4C1NA 1PJQA 4NZYA 5DZSA 2YVKA 1II9A 3OPYA 2JI4A 3GQBA 9GPBA 4GAEA 2QN6A 1Y3FE 1O5IA 1K2WA 1NYQA 2BFCB 5DXJA 2BP7B 3QKSB 4AC9A 1ZD3A 4QUJA 5AKGA 3AIOA 4BLUA 4CLHA 5I7WA 5IFKA 1Z75A 1PSZA 4URYR 5E6UB 4KDRA 2W5UA 4ZVMA 3ZXYA 3FPFA 4EI9A 1CVLA 5LYYA 3K9QO 2HRDA 4PWZA 1SJ9A 1W1UA 3HO8A 4I1VA 4JLDA 4D0GA 1VPLA 1KR5A 3VM6A 3ZD6A 2IX9A 4M4SA 1G3IA 3F6YA 2C2KA 1D09A 4JGBA 1VZ3A 2WVHA 2OO5C 4KXYA 4JLKA 3PF8A 1JG7A 1FFGA 4V2IA 1WB9A 1H8HA 2D8MA 3DMTC 3MS4A 4H27A 4RHTA 5BN5A 3GCXA 2WMOB 2C2OA 1Q19A 3CZ4A 3Q4GA 2C4NA 3LT0A 4FGZA 5AVWA 3NMUF 3UCXA 3ML1A 3RC2A 2SKCA 2PU7A 3LRTA 1GKKA 2WM3A 3T38A 3W9UA 4X85A 5GQSA 4RZHA 4PNHA 4M9CA 4RFSA 2GH1A 3I09A 1XCOA 1IDOA 3HU5A 5KQSA 1ZN9A 1DCMA 2ZTUA 3JD1A 4L27A 1YZFA 3NHAA 2B9VA 2CNWD 5ALWA 5CITA 1QPBA 1D1TA 5IKMA 1K8RA 2CNBA 5FBRB 3WP1B 3PSHA 4P4GA 4RZUA 4O4HB 4Q82A 2D62A 3S99A 1BXGB 4OSOA 1YC2A 4O4LA 1KEZA 4WNCA 5EJGA 3GRAA 1OROA 1ZZEA 5FL7A 1VJ5A 3IUPA 2WNSA 1NFFA 1Q57A 2QMZA 1LWNA 1D5WA 2BZGA 1G4UR 3U4IA 5DXAA 4EBFA 4YLYA 4NKRA 2PGDA 3WLSA 2A9OA 2HWWA 2EU8A 1NQOA 3W2EA 3IA2A 1SAYA 2GN6A 4EJSC 3CB4A 5CVVA 5HWSA 3V55A 4ZZ3A 2ZCJA 2BJVA 1ACJA 1JR3E 2HCTA 2Q1YA 2WSYB 3JWJA 3KZCA 3HSYA 3PQ4A 1KMQA 3T9DA 1TCVA 4AECA 4ENWA 1UDWA 2MMGA 2XCOA 1XFAA 3NVAA 2B4QA 2A3RA 4FBLA 1YRQA 3ELDA 2EF1A 4NBLA 5FOVA 3IGFA 4PNZA 5CEEA 4JEUA 1KDVA 5JMOA 1P62B 3VYUB 3S70A 1UJ6A 1JAZA 1T9KA 1MJNA 1QGAA 1R9NA 2FZ4A 1K66A 4FB5A 2JASA 3RUEA 1NURA 2JIZA 3DDZX 4EHIA 2FUNB 3AY7A 3C1OA 1SEVA 3TOXA 2VJQA 3UFXB 5E8RA 4AY4A 4AKHA 2Z98A 4XASA 1XUOA 2FCRA 3M4YA 1EFPB 1N78A 4BJ3A 3RW9A 3TB6A 1M2OB 5IT5A 1MTOA 1UT8A 3O94A 3ONWA 1EQUA 4ZC8A 2BMAA 3GP3A 3L0IB 4RORA 5E6RB 3FNIA 4DCTA 2OMKA 2YJNA 4K9LA 2VDPB 3LUAA 2C42A 5DTMA 2DBVO 1J97A 4URXR 1YB6A 2CNNA 4HC4A 1RNLA 2IHUA 2JK1A 2W2NA 5JANA 1RYHA 4K28A 2Z0MA 5MGBA 4WZAA 5KTPA 3LSTA 5FB3A 3WL6A 1XJCA 4ZANA 1ESCA 2ZJ5A 1ZI9A 3WVNA 5I8WA 2KM1A 4WEOA 1ATIA 1B2RA 1PCXA 2HIMA 2HNKA 2WJGA 1L7QA 1RWKA 5HBRA 1PVVA 2GJKA 1K63A 2QN8A 2W83A 4HN9A 3TEMA 5AKHA 1C4XA 3LX5A 1I6KA 1I13A 1X1RA 2FY8A 4R8KA 3RU2A 2IPLA 4IH9A 2NO4A 4ALNA 5HHTA 2HR1A 4MGHA 5B3KA 2RH4A 1R4MB 1WCIA 3EUWA 1W0KD 3HV2A 3JQGB 3P9RA 1BQ4A 2QMHA 3Q1LA 4ESOA 2AEMA 3E3NA 3QYAA 4J7CA 1SIWA 1WZIA 4L8LA 5JSYA 2H4HA 3QX7A 2KX7A 3NM4A 3OUZA 5BPFA 3JQFA 1ZD4A 3FDZB 3HCWA 4KE9A 2WWHA 2ILVA 1Z9BA 3CF4G 4LDPA 1P1RA 2HN9A 3G5LA 2RK3A 4XCQA 4AUEA 1OV4A 3SPXA 3W9YA 3V4RA 4BQFA 1P19A 4R3WA 3VR6D 1TFUA 3H0KA 2XQKA 2AFHA 2CUNA 3MTEA 3OWXA 4NESA 3UKJA 4D96A 2EEPA 2J7PA 3LPNA 3CYFA 4KBGA 1D04A 2YIJA 1B23P 4J2HA 4Y1RA 4K9SA 3DWFA 3QVWA 3OBIA 1W48A 4URUR 4G0WA 2Q1SA 2A59A 3GJYA 3ABRB 3PNPA 3WWEA 4YWHA 1DX4A 3DAYA 5LVAA 1SXHA 5DN6D 6ABPA 1KIFA 2ECKA 3NHUA 2Y1DA 3HXTA 4I3GA 1SOWA 1Y6RA 1CUSA 3H3XA 1XZPA 2EDAA 4PR3A 1ISJA 2QLNA 4RL4A 4WNAA 4Y1FA 3QG5A 3DZFA 1BGVA 1YJBA 4GMDA 3ES9A 2JFQA 2HXYA 3VJKA 1H2RS 2PH3A 1YQUA 2H5IA 1X1QA 3VDMA 4JNCA 3D1JA 2C5HA 2VHQA 3QEOA 2BEUB 3RPEA 3FDIA 1SBZA 2ENUA 4O8ZA 5EEGA 4UPDA 3U5TA 3FPSA 3KHTA 3HR4A 3OX4A 1SVKA 1G4HA 2R8EA 2ZVPX 1E7QA 4NK5A 4XWYA 3DDUA 3CH4B 5CLLA 4B48A 1QGZA 2YVQA 4ZK6A 1QC5A 4YMIA 5BORA 5FPTA 1TEHA 1VSTA 3E1GA 4AUKA 4LGCA 1NLYA 4P34A 1P33A 4RK7A 4LC9A 4R98A 5HQJA 2VJMB 2ACEA 2JAQA 5CT4A 4MCJA 4CTMA 2GM3A 3MAGA 3NBUA 1XTSA 3D7LA 5EQTA 4LE1A 1AGPA 3R7LA 5T4FA 4L74A 2WUDA 1XCPA 4I6EA 3GP8A 1X1SA 1CW2B 2NX2A 3R5TA 4QJIA 1HH4A 1HZJA 5KNCD 2MHCA 3I1JA 1JP7A 1OAOA 4RBNA 4I4TA 2I7CA 2QR3A 1GD1O 3DWIA 2O8DB 1JG4A 3K96A 4HAUA 4BO0A 3HKCB 4NBWA 1T1SA 2XDQA 1O9HA 3QVMA 2P2DA 4RQUA 1ZK1A 4W7SA 3DXZA 5DRTA 3EXEA 5BWBA 2AQ8A 2QN9A 3EVZA 1Z16A 1X7YB 1USUA 2NM0A 4RY0A 4JBLA 3W2FA 4ZI7A 3I2IA 1NBHA 4HB2A 1WXGA 2VLBA 1TGVA 2LPMA 4MR9B 5JH7B 4MR7B 3N8GA 5CFPA 4IX9A 4LF7B 2WY2D 5EC8A 1FSSA 1VCNA 3CJQA 3CO5A 3NW9A 1AKWA 3SKVA 3DBVO 4K9PA 1EFKA 1DV2A 2Y1GA 1TD9A 1TEVA 1N75A 1OF1A 3NG1A 1IE3A 1KVTA 4R8SA 1PEAA 5EOVA 4DWOA 2WUGA 4RTJA 1T6BY 4H0NA 5DTEA 4EB3A 3F2VA 3FNGA 5B37A 3LLMA 2MYPA 4MUNA 4N18A 2BV3A 1SVMA 2NYVA 3GA0A 2ZQYA 4RTMA 3M3DA 3JWIA 5LN1A 2YXNA 5H9VA 3TQTA 5U9CA 5H7XA 5THKA 4A2CA 4CUZA 2I65A 3VH4A 4LJAA 3JQ8A 5AVXA 1DC7A 2GDZA 4N5NA 2KLHA 3LX6A 3TIGA 1DDGA 1ADJA 1JG1A 1FXWA 3RRNA 1N4DA 1JDJA 1REQB 1ZR4A 2GBPA 4EB8A 3SSNA 2NN3C 4RZ3A 1S8AA 2HBYA 2V98A 1TM2A 3BSWA 3K2QA 2NXJA 3PQFA 3PQ2A 5EHXA 1T36A 3SWWA 1U7DA 3IPYA 1IWOA 3KJGA 3OC6A 2AEJA 2B3DA 3C7CB 3C39A 4KRYA 4V24A 3T95A 3ZHRA 2JLXA 4G24A 4H2DA 4Q4HB 5FPHA 2GFHA 1FB5A 1IXZA 4INZA 3H87A 1DEOA 1XX6A 4PC2A 2IYZA 1Q0SA 1POWA 1XCMA 2QRLA 2FKNA 5L3SA 3ZD7A 4TMKA 5HJ5A 4TXHA 1O03A 1YI0A 4NARA 2QVXX 2R4QA 4JBYA 5I7HA 1TF5A 4B3TB 4OGFA 5IZCC 1II8B 1M83A 2B0JA 4DFDA 1KR2A 2V3WA 3TFQA 4HNQA 4P4UA 4XX0A 3U7IA 1UR5A 1IYZA 4JU9A 1Q6ZA 5IN4A 2O2CA 3ZS9A 4KW7A 1MDFA 1N6NA 1TKAA 1L7OA 4N49A 5B12A 2AJCA 3V4SA 4MGEA 1ZM7A 4DWJA 4LRSB 3QV1A 4KH1A 2ZJ1A 5CLJA 3EZNA 5P8WA 3WDKA 2WIAA 5ITZA 2D5BA 3DZDA 1E9RA 4WY5A 4IDFA 4W5HA 5C1IA 1KZ6A 1O8CA 3IODA 1FXWF 3A1EA 5DWQA 4TL6A 1FVHA 1UDBA 3GDFA 4V0ME 4IG4A 5JAHA 4EW3A 2HQRA 4QJ5A 5KYXA 1WW8A 4KXUA 1U7XA 2PFGA 4LJ4A 4UZEA 3ZV7A 5CXQA 1B74A 2R6JA 2WNIA 3JVDA 2BEVB 2ZRBA 3HH8A 4IDEA 2C2XA 2H4WA 1PT5A 3FRHA 4KWCA 4IIDA 2Z30A 4WBSA 3OETA 4LCJA 1QU3A 2WSSA 3OM9A 3O4FA 4TXNA 1IBLB 3TW6A 1P61B 1FJGB 2QJRA 1FS6A 1U8UA 4M6WA 1FS5A 4PZPA 4IVQA 3KZNA 3QVKA 3M6AA 4JJAA 3TLYA 4J0IA 2G5TA 2XD4A 3IMGA 3ZY6A 8GPBA 1FZTA 3EF0A 4TQ9A 1Z2OX 4Y2TA 1VI6A 1FLVA 3KKLA 4N12A 5IAOA 4X6XA 2M1ZA 3EQ7A 4AKTA 3TTYA 5ALDA 1XTZA 3EB9A 2I6FA 5FFNA 3H6KA 2ZSFA 3TIXB 3VMMA 5FO0A 5DCYA 2X42A 4B7AA 5GGYA 3TOCA 3I53A 3PGKA 3VQTA 3KXKA 3ZLBA 4J90A 3B8HA 1Y42X 4BTLA 4D8UA 5J2UF 2PSFA 4H4DA 4DJJA 4FWBA 3WICA 1JIXA 3BQNB 4D9FA 1BZYA 1E98A 2AUTA 4K0KB 1M1NB 2J5QA 4RJ2A 4N8EA 5BMOA 2A5GA 2WLTA 3DOUA 5B7QA 1XAJA 4D4KA 3U48A 5HKKD 1VMDA 2W90A 3DMRA 2PSHA 3H8JA 4JUDX 1CUHA 4PGFA 4CKCA 3CF2A 4EHAA 3ZCSA 4BO5A 2BL4A 1T0HB 2IODA 2Z83A 3IUJA 4AXBA 2AFRA 1T13A 1WXHA 1Z2DA 3MD9A 4M46A 3TO5A 1W36D 1E5XA 1X1AA 3MTBA 3EPLA 2OCIA 4DUYB 2QTRA 2CKDA 3A6HA 4FQ5A 1A72A 2ZQZA 3QFFA 3ROMA 4OL0A 4CQLA 1U7WA 2C7VA 3VV3A 1QP0A 3SNKA 1IZZA 3B78A 3OZTA 1V8OA 4ITRC 2ZCVA 2QAGC 5ALKA 4EA9A 4Y2QA 5KU1A 3WLTA 4MRVA 1XP5A 4BHTA 2NXWA 3DEKA 3ETLA 4LKRA 3HMQA 4RTSA 4A2WA 1YA4A 2Z09A 2K2QB 3U60B 2ZW9A 3T35A 2FRVA 1T9ZA 4HDKB 1EEXB 2JGFA 4N0EA 4YRAA 1V4NA 2RHWA 2XYQA 2B8JA 4U6NA 4ZEWA 1E1CA 2LBPA 2J6IA 3EVFA 1U98A 3I9MA 4G5YA 3CTPA 1RRFA 2JCBA 3P52A 5FPYA 1F6WA 4B80A 4MUAA 4ZU3A 3C4VA 4P83A 4U2EA 3VTAA 3WTBA 1QANA 4ZT6A 1D9XA 4HDNB 2X9VA 4PSAA 4QDTA 521PA 5A1JA 4DR3B 2DLCX 5T4EA 1ZGHA 3KOOA 4J6EA 5ESWA 1K08A 5KBYA 3WXBA 4GL2A 3QH4A 3NDPA 1TLLA 2FU5C 3NHPA 4L85A 3JQ9C 4X1OA 4ZYXA 1KQFA 1FDOA 4WRRA 1IHUA 2ZJ2A 3DC2A 4FYXA 4MKZA 3AW9A 2CDAA 2YHIB 1Y1QA 1M54A 4DWVA 1UKYA 3AEYA 2G1JA 2I8CA 3C3XA 4WX2B 4ZTBA 1JLLB 2ZVDA 4LCBA 4NG5A 1D6JA 4AROA 1I2AA 5C4IA 1QPZA 5A62A 1FMCA 3QKIA 1K6EA 1JFTA 4U6QA 2WJIA 3X0DA 1PP4A 5K8JB 3IBYA 1VJ1A 1DG1G 2VSOA 3DMYA 1R0SA 1UT5A 3L0ZA 1CDOA 1Q1AA 1VHLA 3TX6A 4B3XA 2ETVA 2OSBA 1QGDA 2CXTA 3UT5B 2ZXUA 4HYYA 1XGKA 1HE5A 2I2FA 3NGXA 1RXYA 3B7PA 2WWRA 3EDCA 2PX3A 2VRCA 3KTFA 4HNSA 5GM2A 3FWKA 1U7PA 2D59A 4GM0A 1PW7A 2AN5A 4YAJA 5FCDA 3NBQA 2FPOA 2HA6A 1VMKA 2VJBA 1GCGA 1ABEA 1DEAA 2NVUB 5K3BA 5JUWA 4G37A 1G5FA 3EK2A