1Z17A

Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound ligand isoleucine
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
344
structure length
344
Chain Sequence
EDIKVAVVGAMSGPVAQYGDQEFTGAEQAVADINAKGGIKGNKLQIVKYDDACDPKQAVAVANKVVNDGIKYVIGHLCSSSTQPASDIYEDEGILMITPAATAPELTARGYQLILRTTGLDSDQGPTAAKYILEKVKPQRIAIVHDKQQYGEGLARAVQDGLKKGNANVVFFDGITAGEKDFSTLVARLKKENIDFVYYGGYHPEMGQILRQARAAGLKTQFMGPEGVANVSLSNIAGESAEGLLVTKPKNYDQVPANKPIVDAIKAKKQDPSGAFVWTTYAALQSLQAGLNQSDDPAEIAKYLKANSVDTVMGPLTWDEKGDLKGFEFGVFDWHANGTATDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Leu/Ile/Val-binding protein
publication title Ligand-free and -bound structures of the binding protein (LivJ) of the Escherichia coli ABC leucine/isoleucine/valine transport system: trajectory and dynamics of the interdomain rotation and ligand specificity.
pubmed doi rcsb
total genus 135
structure length 344
sequence length 344
ec nomenclature
pdb deposition date 2005-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1z17A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1z17A01
3O2SB 3RVOA 4N0PA 1B00A 3H5IA 3JPYA 3GRCA 3H5OA 3QX9A 1ZITA 4NICA 4XARA 4XAQA 5JNRA 3KYIB 2JBAB 5ED4A 1KRWA 4G0PA 4WXMA 3HEBA 3CZ5A 4IILA 1FFWA 4ETIA 3T6KA 4H3HB 1LBIA 2IYNA 1PHRA 1LK0A 5IBQA 1ZN2A 3CFYA 3QEKA 1YIOA 1DC8A 4WZZA 3SQNA 4W5NA 3LMKA 4PE5B 2W42A 4TMYA 3A0UA 3NNNA 2FEPA 1RXIA 1JH9A 1AB5A 3F6CA 3QELB 5DKFA 1QKKA 4ETNA 1W25A 3C3KA 5IEJA 3H6HA 3RVPA 3SG0A 5ABPA 5KWSA 3GBPA 4Z99A 1DJMA 2N9UA 4XASA 2E4UA 3HDVA 5C5CA 4NQRA 4KQ9A 1U2PA 4LDAA 4RS3A 3KHTA 4OLAA 2IKSA 2B1JA 3KKEA 1Z13A 1BA2A 2QVGA 3LOPA 2H0AA 5GOTA 5BR1A 5JNTA 1QPZA 3A0RB 2F8TA 4F12A 1Z2EA 2E4VA 4PICA 3H1GA 2ZAYA 3EJWA 4EVRA 3OLZA 5IULC 1MVOA 1RXEA 1M5UA 4GPAA 2IPNA 4EYGA 5TE9A 1FQWA 3NBMA 3KYJB 1ZHHA 4G97A 5FWXB 1JWLA 1E2BA 3FFTA 4XLTA 1U2QA 5T3YA 4JP1A 2QZJA 2FLWA 2AYZA 2FN8A 4JAVC 1E6LA 3CS3A 4RY8A 2AYXA 2M1ZA 2RGYA 5KI6A 1JFVA 3GYBA 4JOQA 2I6FA 1NY5A 3DGEC 4Q6BA 3M9XA 3HM9A 4TN5A 4Z4GA 3GBVA 3BRSA 3Q7RA 1JHZA 5JS1A 1JFSA 3H75A 2R25B 3CLKA 1ISRA 1JDPA 4N41A 4EUKA 1ZH4A 4YGXB 1YK1A 2FQXA 4S04A 5JS2A 4Q7EA 3L49A 4XFKA 2XDYA 1FSPA 2MSWA 1M2FA 1USIA 3LUGA 3HCWA 2PL9A 1U8TA 4EYQA 2JB9A 3D02A 2L17A 3VNBA 4RXUA 1Z25A 3H6GA 3DZDA 1Z17A 2WRZA 4OTZA 2PUGA 3FMVA 1URPA 3CG0A 1ZGZA 3O1HB 5CNJA 3EAFA 3RH0A 2QXYA 2MSLA 4N76A 1T34A 4RKRA 1DCKA 3EODA 3KLOA 3EQ2A 5PNTA 1NXTA 1Z26A 3FDFA 1D4ZA 1QNLA 4FE4A 2GWRA 4G0YA 3RVSA 3A10A 3IPAA 4IRXA 5CNKA 3MYYA 3GT7A 4MQEA 2MYNA 4MS3A 2X7XA 6ABPA 3DLBA 1P6UA 2QSJA 4MYRA 3CG4A 5TQ2B 1P8AA 1UDRA 1P2FA 1FFSA 1QMPA 1YMUA 2IOYA 2PUEA 1GUDA 1QP0A 3C6QA 1RZRD 1M2EA 4HNRA 4Q6WA 4YV7A 3LKBA 4LZLA 5CHYA 4ZYLA 3EDCA 1CYEA 2IPMA 3OM1A 3QK7A 4RK5A 4Z4HA 4LDZA 4ZJPA 4MS1A 2FEKA 4HYEA 3LTEA 1JLKA 4JB0A 3T8YA 5KQLA 1APBA 3HJFA 1BVHA 4W5TA 1JBEA 2CHFA 3CKMA 2VUHB 4W5OA 3RVJA 3OM0A 4QYWA 1JYEA 1XHFA 2Q5CA 3JTEA 4G0ZA 4PZ0A 2JVIA 1JDNA 4F3TA 1SRRA 4Y9TA 2E4YA 4UHKA 3I42A 1JX6A 1VPWA 1KMIY 4MS4B 1OXKB 2JBAA 1WETA 2R4QA 4KMRA 4DN6A 1MB0A 3S99A 3CZCA 1AB6A 1NTRA 3E3MA 5IX8A 3SY8A 3MA0A 2L19A 1MAVA 3HO1A 1A04A 4RXMA 4RSMA 1RZRA 5DCLA 3JS5A 1NXWA 3K9CA 1E6MA 2O20A 3N0XA 3SAJA 1C4WA 3QELA 2PJUA 3GL9A 3LUHA 3Q7TA 1D2AA 3MM4A 4KFCA 4ML3A 2H3HA 5TPZD 3VNAA 3RVKA 1J56A 1A2OA 2A9RA 3K4HA 3LUDA 3M9WA 4MRMB 3Q7SA 2P4UA 4XXHA 5E3JA 1FFGA 2FMIA 2E4ZA 4EGSA 5DTEA 4YO7A 1OXBB 3O2JA 2FEWB 1NXSA 1KGSA 1JL3A 3I45A 1QP7A 2JVKA 3E61A 2PMCA 5DGCA 2CWDA 2QV0A 3CRNA 3FGZA 2WJWA 5FWXA 3O75A 1LJLA 3RVNA 3L6UA 3UKJA 1C0EA 2IPAB 1M5TA 1YK0A 1MIHA 1PEAA 1TM2A 3QEMA 4G0QA 8ABPA 1RPJA 2JVJA 4HNSA 2IPLA 5JNUA 1BDIA 3OQMA 3O21A 2A9QA 1EHCA 3N75A 5TQJA 1CEYA 1QO0D 1EFAA 2ZWMA 1CHNA 1PEYA 1ZDMA 3GV0A 5TQ0B 4F06A 3RVRA 3IP5A 1Z16A 2HPHA 1DG9A 1YVUA 4MPTA 1MB3A 3OO0A 1NATA 4D6XA 5BRAA 5KQMA 1D1PA 4N03A 1I3CA 3LUKA 1PNTA 2PUCA 3O2QB 5TPZA 1D5WA 3KLNA 4G0XA 5DLEA 3DLHA 2HQRA 1L5YA 4F11A 4YLEA 1ZVVA 3LUFA 2ID7A 4OBBA 4H60A 4Z9AA 4E7OA 3H5LA 3LUJA 4RY9A 4TLMB 4MQFB 4IF4A 4P98A 4KK3A 1QQBA 4O1IA 2PUBA 3I09A 4WWHA 3SM9A 1S8NA 1SD5A 1NXOA 1W9HA 1QP4A 3QLTA 1TLFA 4HNQA 3B2NA 4DQDA 3HK2A 2GBPA 4IMJB 5EWLB 4EYOA 3HDGA 2WB4A 3W9SA 2VYCA 3H1EA 1HEYA 1SXHA 3HUUA 3OLYA 5JNWA 1TVMA 4H3KB 1D1QA 2TMYA 4KNYA 2WWVD 4EY3A 4ETMA 3H5VA 1XWWA 1Z12A 4RV5A 4JA2A 3CHYA 4YS6A 5B3JC 4W5QA 2FMKA 4N47A 4B09A 1Y1LA 2IDMA 1VKRA 1NXVA 5TQ2A 1VLZA 3H5WA 3ROTA 3KJXA 4WT7A 5KQPA 3HZHA 4UHJA 1K68A 3OMXA 1ZESA 1TJYA 3GA5A 5BRJA 4OG2A 5JNSA 2F8SA 3BILA 4RWEA 1ABEA 4P1ZA 4Z4FA 4D74A 3JVIA 4LE1A 1DBQA 5IUKC 3MF4A 3N53A 4GNRA 1DC7A 5EWJB 3TB6A 1DCMA 5B3JA 1YS6A 4QICA 4EYKA 3F6PA 4LE2A 1NXXA 2FMFA 4RK7A 4EVQA 2QVCA 3FFXA 2L18A 4JB2A 4Z9BA 1U0SY 4LRQA 1ZY2A 5HSGA 4EVSA 2LIVA 3MIZA 5GQSA 4KQCA 1E6KA 2HSGA 3EULA 4O1HA 1A0OA 3IP7A 2PKXA 2HQOA 3DBIA 2OENG 5IC5A 3HS3A 4Z0NA 3JPWA 4E7PA 4MS4A 4RDCA 4MGEA 1USGA 3C3WA 1BDJA 1USKA 3KG2A 1DCFA 4MLDA 4YWHA 2B4AA 2WMYA 1Z15A 2LP4Y 3H1FA 3ROFA 4S05A 2QU7A 4FE7A 1GCGA 4TLLB 3Q9SA 3Q15C 1F51E 3RVMA 2YHBA 2FSPA 4MR9B 4MR7B 1ZGGA 3G1WA 9ABPA 4IMIB 3I5AA 4MR8B 3DGFC 3OLXA 4RK0A 3T95A 4QYMA 3MMNA 5TPWB 5BQ3A 5I4CA 3JY6A 4N0QA 1P6QA 2FN9A 3BREA 5FWYB 4RK1A 2GX6A 4MRMA 2CHEA 2R48A 2A9OA 2R47A 3UK0A 1EWTA 4QPJC 3TMYA 4L85A 2JK1A 3LFTA 4YRZA 2RJNA 1LBHA 3KSMA 5EWMB 3URMA 5JNVA 2GI4A 3NHMA 4MAAA 2VK2A 3JVDA 2NT3A 3EQZA 1DP4A 3UUGA 3IDOA 3OLVA 2LUOA 4JASB 3GWGA 3RQIA 5KQGA 5TQ0A 3T38A 2LBPA 4KZKA 4L4UA 4KREA 1GUBA 3MQ4A 1JYFA 4IGAA 1EAYA 3LUAA 1QQAA 3KCNA 5CNIA 3CNBA 3QLUC 2V0NA 1LJUA 2OQRA 1K66A 4NCBA 2GKGA 2FW0A 2MYTA 6CHYA 2PAFA 4KK4A 4WUTA 2WY2D 3D8UA 1SXIA 1VRVA 2LPMA 2QR3A 4Z4IA 3EGCA 3TD9A 3FFWA 5HM6A 1GCAA 2FQYA 1BAPA 3M6MD 1YMVA 3P9YA 2NZVG 4MQFA 4RY0A 2E4XA 3C97A 1Z2DA 4LE0A 4PEVA 4D6YA 2JCGA 3N8IA 3O1JC 2FLKA 3CTPA 2BGGA 3TX6A 2FTKE 3ILHA 4LX8A 5F64A 2MYPA 3QEMB 3NNDA 3G85A 3O1IC 3QLUA 4OATA 5EWLA 4YR7A 4F8JA 3N0WA 5KC9A 2FQWA 3OLWA 3KTOA 2NZUG 1U04A 1RNLA 3KS9A 3OQOA 3OQNA 2E4WA 2P9HA 1L5ZA 2M98A 4G0OA 4RZSA 3H5TA 1QO0A 1ISSA 4KPYA 1YTUA 2KYRA 2NUBA 3BBLA 4NCAA 3Q41A 1PNRA 1DZ3A 4KRFA 2FMHA 1TMYA 4YP9A 2MYUA 4RKQA 2WJAA 2DRIA 2PLNA 2FVYA 1XHEA 2RJOA 1JF8A 2L2QA 5EWJA 3CU5A 1DRJA 3IP9A 5HQJA 5FBKA 4FB4A 3F7NA 4WXEA 5IUNC 1R8JA 3HVRA 3O74A 1NXPA 3QLVC 3SNKA 4M88A 4RXTA 4MLCA 5KC8A 2VUIB 1ZH2A 2NT4A 3HSYA 3NNSA 4RU1A 5D2CA 5FBHA 4OLBA 5IUJC 1KRXA 1DBWA 1SXGA 2HJ9A 3OO1A 4CBVA 4W5RA 3QX8A 5T7BA 3LKVA 4YCSA 3TO5A 5IEBA 7ABPA 3HXMA 3R0JA 2MSKA 4MQEB 3IP6A 1EWKA 3N6VA 4G86A 4MS3B 3BRQA 1F4VA 2FXIA 2ID9A 4O5AA 4Z4CA 5HKOA 3F73A 1GLGA 2PL1A 2QW1A 2PUAA 2JRLA 3RVLA 4MR9A 4PYRA 3QLVA 1PUXA 4MR7A 2A9PA 5CNMA 2PUFA 2CD7A 1EWVA 1ZAYA 1IIBA 3OMWA 1YS7A 4MR8A 4DADA 2J48A 3C3MA 4KV7A 4RK6A 5TPWA 3NHZA 1DBPA 1Z18A 2PE5A 2YHAA 3RVQA 4Z4EA 5FWYA 1H9CA 2HQBA 1DRKA 3HUTA 3A3KA 4MS1B 4ZPJA 1BDHA 2PUDA 1JFTA 2RDMA 4RK4A 4ZMRA 3IPCA 3HV2A 4KVFA 3N0RA 2FKAA 3LUCA 3ILYA 5EWMA 5C5EA 4ZMSA 4G0MA 1ABFA 4NV3A
chains in the Genus database with same CATH superfamily
5C3UA 4GM4A 3IBGA 2CBZA 4M8KA 2OE2A 3TBHA 3ASUA 3QSYA 3LVQE 4N1AA 5ESRA 4XARA 2O8NA 1XCMA 3DEJA 4UEQA 1KBQA 3GUCA 3PS9A 4NATA 4L2IA 4BVJA 4B46A 4RULA 5L53A 4INPA 3RLIA 2QR2A 2GJKA 1FFWA 1SQ5A 2PV7A 4LUCA 4FIZA 1G3UA 1GUAA 4M22A 4FXOA 4UOQA 2VPPA 3Q6MA 4JOCA 4UEWA 2WINI 3RU7A 4WZZA 3O8QB 4DBZA 3THWA 2E85A 2NU9A 3A31A 3EVFA 4MEJA 5TC4A 1ZM9A 1QLJA 5CA1A 1V3TA 3ZHSA 4GLFA 5I9SA 1DRVA 1CFZA 4TKLA 4PS0A 2O2GA 5ABPA 4C29A 3RQSA 3K30A 4XYEA 4CG0A 2F2TA 2GH1A 3PQ6A 4HYTA 4KXUA 1JXMA 4MUFA 1U2PA 3CPJB 1YR1A 2HF8A 4YFYA 1QH0A 1SC6A 4TUYB 4C9BA 3INYA 3BXOA 1QZ3A 1XEXA 1BGWA 3I3SR 3ABSB 4JSYA 3A37A 1CJTC 3I4LA 3V4VB 4OI2A 4AP5A 5C1BA 3QF7A 2DX7A 1MX3A 2H4WA 2MR6A 2FWMX 1KEEA 2WM9B 3K9HA 1AMOA 4CV0A 4KYIB 2RBKA 3AJAA 4O2AF 4PFQA 4NBWA 1OH6A 4DRXB 1JWLA 1N92A 2Q6KA 1SIWA 1T35A 3NEJA 4EB6A 5BMVA 1N6OA 4OHWA 3NW9A 2E2WA 4JP1A 4MRRA 1Z9BA 1Z4KA 1TYCA 1WEHA 2AEMA 3RHSA 2UVQA 1UMKA 5L7WA 5H8WA 1JEYB 2X6TA 2A6PA 2P9GA 3MSXA 4L8FA 4U39A 4PLPA 1Y89A 4LSZA 4MWSA 5IK2A 1UC8A 1FC0A 1UK8A 3OZCA 1NY5A 4Q6BA 1HRDA 1P4AA 4REMA 3HM9A 4OAQA 2KLBA 1Z3CA 1G7CA 1P9WA 3LPDA 4EF5A 3BZWA 1SPBS 1SU4A 5AW2A 5DW0A 1UC9A 3DHEA 3ZV3A 1G7RA 5F77A 2EZ9A 3L84A 3MJSA 1B6SA 2Z4TA 4K1XA 4Q9IA 2G25A 3HA5A 3PU6A 5AJWA 2Z2YA 5JS2A 2XCRB 4OHPA 2ATCA 4G8BA 1USIA 5AKYA 3W7BA 3T7DA 4CHTA 2J08A 2IXDA 1Z6YA 1I6LA 2C2OA 1ZMXA 3WL7A 1P73A 3DDWA 2WRZA 1LDMA 2FCAA 3QYFA 2GPNA 4IDCA 5FI0B 3ZLBA 1B2LA 4W8HA 2CXPA 5K0GA 3HVUA 4LOHA 3S8YA 2C2YA 4G4IA 5MF6A 1NVVR 2QXYA 3IT1A 1T34A 4RKRA 1P2TA 4MW7A 5IJ0A 2FW8A 3PWKA 4L3WA 4D45A 4U2FA 1DJLA 4POAA 5FWNA 3ZE0B 5JANA 3KYCA 4A0SA 5AQEA 5HM8A 2H4FA 4R68A 1TAGA 3KLMX 3VX4A 4FINA 3UICA 1BMFA 3BMQB 4FZJA 4M2LA 2Z2KA 5H9VA 4ZV7A 5EIAA 4E5UA 2AN9A 2FF5A 2J07A 4CMCA 1Q57A 1E2NA 1Q83A 2ZE8A 2PUEA 2ANBA 4AXXA 1MG5A 4XR4A 1UDXA 1XZPA 3SC2A 3WZLA 1J24A 2PIAA 2QN6A 4PSKA 1RZRD 3W9UA 4UTRA 3FHTA 1UEIA 2TSYB 1SKUA 3OOJA 4IDDA 3KRTA 2Y1WA 5I7EA 3AIKA 1BS2A 1QWOA 3HFGA 4MS1A 3ZV5A 3GGPA 5IAOA 1BVHA 1BW9A 4DOMA 1IN5A 1JBEA 4C6SA 4NZMA 3C4QA 3O4RA 3HDQA 1MC5A 1WMAA 1X1DA 2BSAA 1DADA 2NO9A 3IAXA 2G9NA 3DP9A 4RTOA 3HU2A 3L43A 2I4MA 3TG8A 5ILQA 3SEQA 4HN4B 2H7YA 1XZIA 4IHJA 2YYYA 4CM5A 2GAJA 3DBLB 3JZDA 2H57A 5LP1A 2WVGA 5F76A 5JO0A 2AQHA 2MMCA 4R31A 1QIMA 1XTVA 1D8AA 2XA9A 2YV5A 2W2LA 3D4IA 2EFHB 1OGIA 3M1YA 3WLFA 1CEEA 2C2MA 4DHEA 2YW2A 1W4LA 3U7RA 5IF3A 1HC7A 1BS1A 2OCAA 2ONYA 1NW8A 3UJHA 2E48A 5CMLA 4GBGA 4MUNA 1XQXA 1ODKA 1VIMA 3HCFA 3LHSA 1MV8A 3RGGA 4BNDA 1KHHA 4F1KA 1N3LA 4EBFA 5HUJA 1ZKMA 1N9GB 3Q3CA 4D0LB 4M0EA 2IPOA 4Q39A 1PFUA 3MM4A 3C6KA 4Q00A 3G49A 3CUTA 2VHYA 1N8TA 2FOLA 2XNCA 3BK7A 3GH3A 1F6DA 5MDHA 1OTHA 3F6RA 3Q7SA 4OK3A 5DCWA 3S1AA 2XXBA 2GHIA 2RHGB 4KE8A 1CRZA 4EGSA 1KYQA 4WH0A 3QUBA 3HP1A 3ZS9A 3QPVA 1GA4A 1KGSA 1V3QE 4LXUA 4AMUA 2J33A 4V2IA 2VP4A 4LMAA 3RRFA 1CUYA 5I01A 3K8QA 4KHPB 3SJUA 1Y8QB 4FHFA 2VZEA 4XCQA 3O75A 3P27A 3UKJA 1KARA 3EBLA 4LJLA 3NTOA 3G0CA 1M1YB 2ZJ7A 4J7CA 2GHQA 1NR7A 2QWXA 3B53X 3SX0A 4HLQB 3A1SA 3L07A 5KBYA 1JE1A 3LY7A 1P1IA 2Y1LA 3OPQA 1ZIYA 1KMHA 3BYZA 4HZUB 1N6PA 3I9OA 4ZK6A 2QB5A 3H0KA 3HYRA 1EFAA 2POQX 4D56A 2AH5A 3WGYA 4L1KA 3LCVB 5KS2A 3HO6A 4MPTA 3O4JA 4CIAA 1V8DA 5FPPA 3T9BA 2AR9A 5I4IA 3OPXA 4URWR 1P61B 3DMPA 3GRVA 4ON9A 5J2TA 2LDXA 4IO1A 1DAKA 3PYMA 4N03A 2QJRA 5DWDA 1PNTA 5D86A 4IIBA 2PUVA 4AF6A 3ABRB 3WSVA 4G0XA 1W49A 3K31A 3GJ4A 3KLNA 4MMYB 3EFOB 3ON5A 4Q24A 4HNTA 1P44A 2XD9A 4TRMA 1O94D 2IYQA 4ESHA 4UASA 1I2MA 4MW4A 4J6EA 5KTPA 2QG4A 4UKDA 3IBCA 4Q9LA 4TLMB 3CF4A 5C3MA 1VJ1A 3V6LA 3ERCA 4YONB 4NRDA 4LF7B 3RNOA 2PUBA 3I09A 1A4RA 4WWHA 4ZANA 1L5VA 2Q9BA 3WKAA 1NXOA 2XTNA 3NO4A 4MAFA 1QF7A 4IDHA 3CUWA 4NH0A 4GKBA 2ZRNA 3IQWA 1TD1A 2FPOA 2AQKA 2ZWAA 1HEYA 1MORA 3EGVA 4UCXA 1KO8A 1TVMA 5CT8A 5EZYB 3SJCA 4FLFA 3T3HA 2YN2A 3P45A 1EAMA 2ZQ5A 3NALA 4Q3NA 1DQPA 3FY4A 3W8NA 1EUCA 2GM9A 2GUGA 4I6EA 4XX0A 4B5KA 4EQ6A 2EBHX 2O8BA 1K7FB 1YUNA 2G9VA 3C7AA 4DPLA 4ZI7A 5M5BA 1KXZA 1Z34A 4C43A 4BNYA 3HZHA 3R5XA 1ZD4A 4JSTA 2OMKA 1F8XA 3CXRA 4N8EA 4YUAA 1H05A 3KD3A 1I0ZA 2XLCA 1CZKA 4OG2A 1G8YA 2EZ4A 5T3UA 5EFOA 2ZGVA 5ICGA 2PA3A 2VDQB 5KYXA 3JWHA 1OJ7A 1DEOA 1Y7IA 4MB0A 4D8XA 1BGVA 3G13A 1QYXA 3RU2A 1KZ7B 1S8OA 4CIXA 1CUIA 2XEXA 5JSQA 1RBZA 1CNFA 3N5CA 1AZTA 1ST2A 4ER5A 2HZ7A 4JDPA 2QVCA 5KYKA 2C83A 4UAGA 1PK7A 3A58B 2A9FA 2N3ZA 3N0VA 3OZEA 3MTEA 3GFGA 4A8JB 4BECA 2JHGA 2I7VA 2WU1A 1F17A 3OIGA 3PJDA 5AP9A 5FPTA 4ZXFA 3MINB 4Z2AA 4LMBA 5HRAA 4BQQA 3EXG2 1AT1A 4KI7A 3UV7A 1DS6A 3MWDB 3IOCA 2G1KA 3L5OA 2QQ5A 3C3WA 5CCXA 2A1UB 1C4OA 1JFRA 4A9AA 4C22A 2PZGA 2FDCA 1XYGA 3B2QA 4BNGA 4ACBA 1M8PA 4L3VA 1T9KA 3NORA 5YASA 1OA1A 2QU7A 3PFWO 1J9GA 1N2BA 2GD2A 1RU3A 2MDTA 3AEKA 3IPYA 1IUPA 3KSZO 1I2AA 2FMTA 3LT2A 1MJ5A 2OBMA 3DB2A 2BMVA 2IHTA 2J67A 2GA8A 3COVA 1HDOA 2FK8A 1Z4IA 3DGFC 4EY6A 2WD7A 2I78A 3EMVA 2WR8A 3ZHCA 4F2GA 2Q1TA 2YYSA 3I2JA 4JWKA 4P4NA 2WTMA 4MV3A 4QSHA 3GFBA 3RC3A 3WY9A 4CMHA 5LIPA 4N5DA 1TK9A 3AW9A 3H16A 1JZSA 1WZEA 3KYDA 3GFRA 4FGLA 3RGWS 3FVVA 4I19A 4R2WA 2KBFA 1AZSC 4L85A 4LGMA 1R0RE 3OIUA 4A0FA 1CEQA 1EESA 2J9GA 2CNOA 3PL5A 1CIVA 3K0AB 4GGMX 4TUYA 1NWHA 1T8YA 2HNBA 3R3WA 2EFCB 1UFKA 1T1IA 1EQ2A 4WESA 1FDIA 1H2RS 1XWIA 4ALLA 2P6PA 3OBIA 4BPBA 2P7HA 2PGLA 4H59A 4HI0E 3HUEA 3GLFE 1NONA 3W04A 1DSSG 3L6OO 3F6EX 2VDVE 2HTEA 3OLVA 4DT1B 1C0PA 4XQGA 4LF5B 3K8ZA 2V7TA 1PJQA 4CMKA 2XRYA 5CA0B 3PCTA 3LT0A 3CNNA 5GIPE 1J0CA 1PO7A 3G02A 4QUJA 4YVFA 3W2FA 4HRAA 3FWHA 2XD4A 5I9LA 3LUAA 5B37A 5DT9A 4H4CA 5BW4A 4U0KA 5FLEX 5AJHA 1QCYA 1LK7A 2ZBDA 4PV7A 3JD1A 3BC1A 4BQEA 4YUWA 3P4UA 2WVJA 3BFPA 5A3RA 1ULTA 2PAFA 4DG5A 4XEHA 1KQGA 1UF9A 3LQ1A 1VHTA 2C59A 4IQGA 2PS3A 4J0EA 2H31A 4NPHA 3TD9A 3EIFA 1O95C 2KI5A 1QE5A 2QP9X 1E9DA 2UKDA 3HUFA 3SZOA 2BKAA 1NW3A 2LZ0A 4UXIA 2IX3A 5K03A 3RU9A 3FMOB 5LBUA 1EE2A 1YHYA 1V2GA 2WD9A 2CLHB 3ELUA 3MUFA 4I55F 4N0DA 2FTKE 2OD7A 2FUG6 4LFCB 1Q1AA 3ZV6A 1T2NA 4LMPA 4OJKA 4B45A 1UJ4A 1USUA 2VLIA 4QFMA 3CEAA 4YAWA 3NNDA 3G85A 2D0DA 2X14A 2YQ5A 2WM8A 2HJRA 4Y30A 4YB8A 2V4UA 2Y66A 4PGHA 5H3LA 1LRJA 3Q3VA 5AKZA 3T5TA 5KNCA 5KYGA 4LJ4A 3IIMA 2J7KA 3KZCA 1F2VA 2HAEA 2HLHA 1XRSB 2NZUG 1J42A 3RWOA 1QO7A 1Y1TA 3AC0A 1MHTA 5E7JA 2VDUE 1YL6A 1YRLA 1C3OB 2ZS7A 1JJVA 1WBJB 2XRMA 4PHTA 4QVKA 4UUAA 3R8CA 3DAGA 3R0VA 1CVRA 3GJRA 3BAZA 3PYLA 4A5SA 5C0OE 1I7LA 1J0EA 4RVSA 5KCMA 2CFIA 1H1DA 4ZT5A 4QPNA 2R6AA 3ZC3A 4C3VA 4YYZA 5CBPB 1ZJWA 4GSKA 5AM5A 1VCHA 4NMLA 4ZHQF 2OCLA 1OAOC 3ORQA 3F46A 1WVGA 1MDFA 4ZRDA 4F3RA 4CIYA 1ATZA 1S3IA 3P71T 1AUOA 4RESA 1I5RA 1E4EB 3O95A 3PUJA 4YJFB 4BC0A 2XZLA 3UFXA 4BB6A 4JYCA 2IYLD 2HXGA 3DVAB 1VLLA 2PDAA 3KQYA 3QENA 4FB4A 4M1OA 1YU9A 2OVBA 4UVGA 3QE0A 3QP9A 4M0MA 2V6MA 3QLVC 4EHJA 1ZH2A 3E22A 2OHIA 4AUEA 4EZEA 2JLVA 5BUZA 4KEAA 3ABQB 5HKKA 4URFA 1GPKA 1BFUA 3NONA 4QIHA 2A4KA 3PTLA 1RKUA 3UF0A 4B83A 4IIFA 3I01M 4PYIA 5ADHA 4WD3A 4TM7A 4KQWA 2Y0PA 2BTQA 3MGKA 2CSUA 4F1WA 1VPTA 2EV9A 3DBLA 3WMWA 3V1YA 2RK4A 3AB8A 3JSXA 5BQFA 1J0AA 1DPFA 1C9YA 5CVTA 4LSGA 5BV2P 3I5XA 3AX6A 4KKVA 3MCUA 1E3IA 4PYRA 4AFNA 4FDLA 4IDOA 4R3NA 3DCJA 4U7GA 3UJBA 5FV4A 1NI4A 1UXIA 1OKKD 1P17A 2GPJA 5E9QA 2A1TR 1U4OA 2FPLA 2Q6OA 4BKUA 4Z7JA 4YRAA 2VQSA 4FHEA 4AQDA 4IYRA 5HNKA 1SNYA 1RI5A 2DBYA 3BE5A 1T0JB 4GM0A 2XCLA 1N9GA 2YV3A 1VGQA 2Z1MA 3NAQA 2PEYA 1BDHA 1OF1A 1ONBA 1JFTA 3MMXA 4IOMA 4WBNF 5LXTF 3HGTA 5F7JA 1MB4A 3PV0A 2PL3A 2P27A 1LF5A 3JVEA 5KX5B 3N0RA 3PVZA 4Z51A 3LYHA 2BFDB 4ZMSA 3JQAB 1YA8A 1NLFA 4V0NA 1QVZA 2BI7A 2VHTA 4LF8B 1FSFA 5HJ7A 4GBJA 4YUXA 4XSVA 1W5TA 3H5IA 3N7UA 3OIDA 3UAGA 4FB5A 5ALUA 1ZITA 1EFKA 4I9UA 4DLZA 4FM9A 3LVBA 1HM5A 1OBFO 4Q15A 3EY9A 1U11A 1UM9B 1XZAA 3FN4A 3KOZA 4KW7A 1QU2A 1GTSA 4Z5XA 2GLXA 3HI6A 2XJ4A 2UVPA 2ZSBA 2ZYRA 3O8OA 1VG8A 2XUAA 3LX5A 2I5PO 1PJ2A 2QR5A 2WHYA 5T8KC 2PWYA 3VV2A 1SVLA 2A5DA 4D97A 1WP9A 3GLUA 4EEXA 3GT3A 4JL5A 4KR7A 1TTQB 3A32A 2GCIA 2R97A 3B7PA 4NDAA 4EI7A 4CCWA 1RKVA 1QOZA 4G5GA 4NHEA 4C2AA 3OZAA 4R8LA 1A50B 5D5HA 5C5CA 3ZNQA 1FTSA 1OI2A 1R16A 2B2CA 3MCZA 2QUKA 3EFOA 3TQSA 2X23A 4CMBA 3LY9A 1EP3B 3IAS1 3GJXC 3K0CC 1SBNE 4TYQA 2C9MA 4RGVA 3EIHA 1KU6A 1UL1X 1VE5A 3H1GA 3SFVA 4Y2XA 3O3NB 3ZHQA 3BMNB 1QRDA 4UBIA 3TI9A 1WXIA 2Z30A 3OLZA 2I6GA 3AFHA 3H05A 3C1OA 3E1GA 4JN6B 1NKTA 4G1CA 4O0LA 3WNVA 4JLKA 1QKJA 3NGXA 3WYAA 3ICEA 2Q6VA 5DPMA 2VTEA 1JVSA 3GJQA 1U2QA 2FV8A 4BB9A 3M4JA 2FLWA 4CDRA 2Y6VA 4JAVC 3VHXB 4DLVA 2IEYA 5ALMA 1XJ5A 2AYXA 3RS2A 5D5PA 1JKMA 2B34A 5I7HA 2RGNA 4IG9A 4WZ6A 4Z1MA 3W77A 1M0WA 1ZI6A 2D2EA 2DFNA 3GJ6A 4N48A 1CB0A 3QXHA 3P32A 1RPNA 4MB2A 4D44A 1BKSB 1ZIPA 3L0ZA 1ZG3A 4Q4JA 5DHQA 3QKSA 4FTWA 4EUNA 1XDGA 3GPIA 4EKEA 5KU7A 1W36C 3GUHA 3H75A 3L02A 1I6WA 1YB7A 2VTKA 3K0FA 4NYMR 3AU8A 5JD4A 4KVGA 4CDNA 1M2HA 4BHTA 3ZLUA 1W5FA 2H7VA 3O94A 4OHCA 2QRKA 2ZR8A 3CUEF 4LCEA 5ICSA 3GC6A 2WKWA 4HOYA 5L3QA 3ETLA 5CK4A 1K06A 5A62A 4U9IS 4XFDA 4DKXA 4NXMB 3NDBB 1YBHA 3DXYA 1QGAA 4J0IA 4W6ZA 1RM4A 1QIHA 2L17A 2ZUSA 1YO6A 2TS1A 2HUNA 3ITEA 3Q5EA 3EXFA 3I72A 3RYFA 3QU7A 1KS2A 5JVDF 1SQ0A 3W9BA 4N65A 3EZ6A 4HKTA 1GTL1 3F8TA 4HSEA 4G9GA 3SX4A 2YNMD 1NNEA 4HDOB 3SXJA 4CQLA 4UUNA 5ARBA 1G21E 3FIUA 2W6JD 3B3AA 4JIMA 4L4YA 1GSOA 3LWZA 3W6NA 1DC4A 3BN3A 4KR9A 3NHLA 1LPMA 5A5EA 3K32A 3I3OA 5CX4A 3MEQA 5LU8A 3OD1A 1E3SA 4XDHA 1SBCA 4IJQA 1Z5OA 3KSRA 3UC5A 2WHQA 4M0KA 1QH8A 3DR3A 2X86A 4UBJA 1GZ3A 1OH5A 1WKBA 1OI3A 2CKDA 4FFSA 2FRDC 1U1EA 3N58A 1QKIA 5D8DA 1KDZA 3X0DA 1XTQA 5M2QA 5CVEA 3AI3A 3PQ5A 3JVUA 1J2RA 1A9RA 1OLOA 1NOJA 1XJQA 1Y9ZA 2D1YA 3CKKA 4HXEB 3UW3A 4AY4A 1DV2A 1GAQA 3CUSA 3KPJA 4JLBA 4RJLA 3TGLA 3BXFA 5LSAA 3C8UA 3JR3A 3QKWA 2HWWA 3M49A 1D5CA 2PLWA 3QEAZ 1LPSA 5B2EA 1KJJA 3GEDA 1Z7GA 3PRJA 3FYHA 1QFXA 1PDWA 1C7RA 1JWBB 4LDZA 4MV9A 3SEZA 2G1AA 1LU9A 2EERA 4JQYA 4QATA 4BLVA 2DWUA 1JSZA 1CP3A 1LRKA 2CNBA 2H4HA 2HLNA 1VG9B 2DZDA 2OO3A 2GZSA 3IJPA 4NPCA 1U0FA 2KM1A 2ZAOA 5F9MA 4A1FA 4ADSG 1K4KA 1EVEA 3TFQA 2IX9A 1PR3A 1LBEA 5AVOA 5LC1A 4EJ6A 1J00A 1IVYA 4X6XA 3SSMA 1DAEA 4L0DA 1L7NA 3DBHA 4LRYA 2OWEA 5ALZA 1KZHA 1K2WA 2W2QA 2ZT8A 4NEHB 1W581 1IZZA 2NU7A 1R66A 1RAEA 3AILA 3S99A 1P19A 4C21A 4NG4A 4DDHA 5KKCA 3WAGA 1H66A 1H8EA 1JALA 5E95A 3R7AA 1Q15A 5FRDA 4ZZ0A 4B6JA 4DT1A 2UZ1B 1ZOIA 4RJKA 2X8BA 5I5EA 2ZRGA 2VZ0A 3WTBA 3SEAA 1V5FA 2PGDA 1Y4ZA 3G2LA 5IDYA 5L7YA 5BNWA 3ESYA 1Q12A 4YAGA 4LBYA 4NEQA 5FHRA 2RGCA 3FPLA 2VWQA 3ZYZA 2B5WA 2QNRA 4WZBB 2VDRB 1YACA 4I1UA 3TECE 1VSUA 1J56A 3UPTA 2NPIA 1L5QA 4H7PA 1P29A 5LDDC 1C41A 1LB1B 1ZOLA 2DH6A 2G09A 4FR0A 2P1ZA 5FQOA 1SCQA 5KQRA 3IMCA 2A9KA 3WWDA 3FD8A 4JLVA 4GVLA 2DFDA 4HH4A 3AVTA 5LR6A 1IY1A 1YB2A 1KBZA 4N0MA 4WZAE 2D6FA 4L0MA 1GTMA 2G0TA 2JEYA 5LJLA 1YR6A 1G20B 3G9UA 4NWIA 1AGXA 3ZXSA 1MGOA 1NMEA 2WD8A 3BWMA 4BDSA 3C24A 3DMFA 1AKRA 2IE0A 1MBZA 1DEXA 1XX6A 2VHWA 2IPLA 1Z0KA 2Q9UA 3ER6A 3JYPA 3TRIA 4ENTA 2QE7D 5A9RA 1E32A 2A9QA 3OCZA 4RA6A 2HWXA 1L9XA 3Q7IA 1PEYA 3C8DA 1GYQA 3N76A 4QO8A 4ZVMA 3X2SA 5HXAA 4YUVA 3NEAA 1Z38A 1B74A 3OO0A 1C3OA 3H4MA 4UU1A 3X1DA 2FZ5A 2CLIB 1U7PA 4K6MA 1NWCA 3DMNA 1KIAA 3LUKA 4AMZA 1ESMA 2PT5A 3SFZA 1WXEA 4CV2A 1BTOA 2VIIA 5B5SA 1PD0A 4AYXA 2O05A 1EIWA 4PFKA 3DDSA 4U2DA 2IHYA 2O57A 2I3DA 1R0KA 1ITZA 1FFXB 1ZJ4A 2IYEA 2RCYA 4MQFB 4C4OA 2XMGA 5EMNA 3D2LA 3I4CA 4U9UA 3EG5A 1OYOA 2AGVA 2OHGA 2NMVA 2VK4A 1P62B 4H0FA 5A2GA 4BO4A 3P9IA 3BL5A 3IIJA 1W87A 1R0WA 2F1OA 5K0TA 1NYRA 1VHDA 2QN9A 1JIKA 5LQUA 3OCXA 3W5IA 1N7GA 1SXHA 4EARA 2QM7A 1R1DA 3AUYA 3DJFA 4QUBA 5LL6P 1WBDA 1C3XA 1AN9A 4GWLA 5A4JA 1YGPA 1HKHA 1XDZA 3NBKA 2CDNA 4QDXA 4AVYA 3K0BA 2HOQA 4W5QA 1RKXA 4II2A 3VTZA 1ZC4A 4OQMA 1XHLA 1NXVA 4MEAA 1NAHA 2R5WA 1PG0A 3H8VA 4K81B 1J70A 5HK8A 1EK5A 4B35A 1Z4LA 2BDEA 2HMSA 3GEBA 1R12A 4K2HA 2O14A 3DO8A 3GLHB 3SS8A 4DIOA 4QBIA 1Z37A 4RJJA 1F2UA 1OCEA 3AR5A 3Q8XB 4FDUA 2D1QA 1IE3A 3TLGB 1WHSA 1E5QA 5ED0A 4F2WA 1ADBA 5G0WA 3JAMA 2I55A 1II0A 1VI5A 2Q99A 5LVAA 4QEDA 3FBGA 3HYLA 1YS1X 2R6ZA 1EXWA 5FL7A 4NYJQ 4BP8A 2CXRA 3AR3A 3ETDA 4FNMA 4FYVA 3ZQUA 3UMGA 3RWMB 1ZR4A 3F6PA 3H19A 1NQOA 5FWDA 3CBQA 3K5WA 4NOMA 3VC7A 1E2JA 1X7ZB 1DO0A 3ZBTA 2GN9A 4CPDA 3U7GA 2PZMA 3QX7A 3OU7A 3GJ3A 3QYPA 1E6KA 1XLTC 2Q3DA 3AESB 4O4JB 5ALEA 4XCVA 4JVSB 5G0UA 3CUYA 2GZ3A 3FLBA 1FFEA 3FZGA 3IVAA 5EE9A 4XGKA 4Y2SA 5FT9A 1B0PA 5ISMA 5EJMA 4LJ7A 1MAUA 1SU8A 1HRKA 2C2XA 4HFJA 3ZIAD 2B8WA 1U0OC 2BWJA 3WNCA 1KYZA 3TDNA 1RYYA 2XODA 1NVDA 2QVLA 1PQUA 2AR7A 2YZKA 3V34A 1I3KA 2OORC 3G9ZA 5F1KA 3UH0A 3O1LA 1XTBA 2QSYA 2WDZA 3BWCA 1E9EA 1F51E 4J03A 3PHBE 4PR0A 3P5BA 4IY1A 4PZPA 3UOAB 4EG4A 1Z82A 1OILA 5EJ6A 4ZT7A 2GYUA 3IQIX 3RREA 5JCZA 3NB0A 3LY5A 2CUTA 4X00A 1XCOA 2ZRAA 3PD0A 5MN6A 1YDEA 1G0OA 4IUYA 3WQHA 4KQFA 4HYQA 5TPWB 3TZQA 3L5KA 2BH9A 1IHPA 3I1FA 4JGIA 2IY9A 2OTCA 3R3SA 4WQMA 2OFFA 4BFWA 4QLBA 1JTVA 3BGDA 1C2TA 4CODB 3Q88A 3T3MB 3W5JA 5FWAA 4KLNA 2QPAA 1FFBA 1MA0A 4K05A 2A9OA 5AW9A 3IOEA 1VPDA 2MIIA 5BSVA 3FI0A 4NMHA 5CH5A 1R6VA 4KIFA 3WBFA 5AW7A 4P53A 3OCVA 1YNSA 2Y0CA 3N59A 3PQ2A 2DJ5A 3A05A 4C5AA 1NU8A 1IWPB 3WK8A 4MAAA 2WSMA 4PWZA 4BE9A 3AEUB 5BWLA 2DFKB 4Q7LA 2XT9A 4MRNA 4PIMA 2I6TA 3OLCX 1EK6A 1DP4A 4O0MA 2A5FA 3V9PA 2WYVA 4AC9A 3KT8A 4PG5A 4CETA 1WLYA 4U8HA 2C2BA 1WU8A 3CNEA 3I39X 1XR3A 1T6BY 1XVUA 3PI7A 5HWSA 3O82A 1JG6A 4FDAA 3OQIB 2W8ZA 4IVQA 4FS8A 3WLMA 2NP6A 1XB2A 2LIPA 4FHGA 1Z8FA 2FLVA 4QBFA 3RSGA 2H1FA 2VUUA 3RUFA 3URKA 3WWCA 5AXAA 3QLUC 5JZBA 1TYEB 1XVLA 3A1FA 1RMYA 3HLTA 4FGZA 4ZC8A 4WUTA 2C4NA 2JGDA 5LQSA 3RSHA 1EVJA 3SC4A 1UPAA 3D8UA 1DLIA 1FJ2A 5FBQB 1T0BA 5HJ5A 2IV2X 5FKJA 2RH8A 1H4TA 3G8DA 2ZSUA 3ZGOA 2ZVQX 3AUUA 3UUFA 3ZZ0A 4DNQA 2E4XA 4MTCA 5H02A 5JIBA 1I3NA 1JMKC 1VLJA 3D8TA 2O8FB 4BUJA 1JQJC 2FP4A 2RGEA 1XRRA 2CXXA 2YMMA 2BGGA 3FMPB 3W1WA 3ILHA 4A0GA 2KS6A 3L7NA 3IOYA 1HY3A 2XKAA 1SM4A 4RO0A 3TW0A 4US2R 1GSAA 1I7DA 1CY2A 1XLUA 2JAOA 5ECYA 1XZNA 4MV4A 1E9FA 1IVSA 1FX1A 1NVKA 4ZAFA 2DR0A 1IN6A 3BH6A 4TKVA 1SK8A 1PWZA 5CFRA 1GQQA 2F43A 4C04A 2XXJA 1G8MA 1H2WA 3TBFA 5KHLB 4M21A 5JAIA 1X87A 5B36A 4G0OA 1ICIA 4PS1A 3EPPA 4KE6A 4KJXA 4MYTA 1XXHA 3H5TA 3LGAA 1QO0A 2CLMB 1A9TA 3BF8A 8GPBA 3DDOA 5CW2A 2Z3ZA 3ICPA 1L8AA 1ZNWA 3QVMA 1HE3A 3D7KA 3SHFA 3IH5A 3H3FA 1DKLA 4MROA 3R7SA 4YRLA 5EPEA 4DR7B 3VISA 3SZ3A 3F3KA 2PS1A 2VXYA 3NTLA 4IIHA 4DCVA 1TMGE 1GG8A 2BFBB 2C7BA 2C7OA 1XHEA 5DM60 2ZR0A 4UM8B 4AO8A 1NQAO 3UUWA 2GBGA 4F4UA 5DXAA 3BB3A 2XRFA 3SDSA 2E3JA 4J1TA 1G63A 1QO9A 4CMIA 1PL0A 1ORRA 3AF0A 1F12A 1W76A 1ZN8A 1L4UA 4D3DA 2OK8A 4RXTA 1M54A 1BOFA 1T4MA 3LNTA 3NNSA 3O4HA 4FD3A 5HBGA 5JTUA 3U5ZB 4G41A 3TRKA 3IQXA 1SN7A 4A03A 3RYCB 5KJ6A 3PTAA 1USWA 3EZ9A 4JFAA 2IVZA 1ULHA 3EFHA 1UDCA 3E8SA 4H7JA 3UMBA 4BE7B 3K9QO 4IMIB 4X66B 4JLSA 4B40A 4J75A 1T2CA 4UAUA 4EHLA 4Y1RA 4R4JA 2VA9A 3HR7A 3QSGA 4XQCA 4DSAA 3F73A 3WKBA 2QW1A 1GADO 1CUCA 1WSAA 1XCGB 2RJ3A 4I4NA 4RFVA 4QFDA 4Z3KA 5KNDA 1NZFA 1QGYA 3KUCA 1NVEA 1EDZA 2R6FA 3TEMA 1VCNA 2JCSA 1U8EA 3NGMA 2CWWA 2PR2A 2C3MA 3OMWA 4JMLA 1XGKA 4JC4A 4EZBA 3DT9A 3NHZA 3UG6A 2UXCB 1I5EA 1LSJA 4IGKA 3JSAA 1WY7A 3OM8A 4GP7A 3RTAA 1W4AA 1H9CA 1VSTA 4M3NA 4U2BA 2IYAA 1LFAA 2JFFA 1LQUA 3IPCA 1NF8A 1J8DA 2HKIA 3CR8A 1M2OB 1T3ZA 4GPZA 3CLTC 3DT8A 5HCNA 3T41A 1SUCA 2IITA 3NV9A 1L2TA 2CN1A 2XVMA 4FWIB 2NWQA 2EBWA 3WGKA 4QWMA 5TS3A 1GAWA 2Z4SA 1N3BA 2D8MA 1ETUA 5DNAA 3IRUA 1AA6A 1MJFA 3GRCA 4FYXA 1B3BA 4HUTA 2O1EA 2JJQA 4Y6QA 1BMDA 1RLMA 2XNDD 2ZIFA 4WXMA 1Z4PX 2PRZA 4OA5A 2IXGA 1C14A 2CJWA 3ZHRA 2IY7A 4Z7NB 3MAJA 3JZIA 1ZWLA 5CXXA 2I9PA 3DD1A 1MC4A 1HLPA 1GU0A 3ULKA 1I4TD 1WQ1R 2Q1WA 3NNNA 2UUBB 1EVKA 2B37A 3WE7A 4C5BA 3ETGA 3G2IA 3QKTA 5F1OA 3EX7C 4RH3A 1DKPA 4JI4B 2JI4A 3SHVA 7MDHA 5CXQA 5H1YA 2IYZA 2XDQA 3RIYA 4X1KB 4V0QA 5KSYA 3G17A 3WA7A 4ZOBA 2ADFA 2KSQA 3K9NA 1YZQA 1L4LA 1XTPA 2H4YA 2X1VA 2Z6VA 4KQJA 4RW0A 3WP1B 5A4DA 5JZ9A 3J81k 5KJCA 1Y7PA 1F38A 3LOPA 4M1ZA 1GARA 2VTBA 2IDKA 3GAZA 3BAFA 3DDUA 1GITA 4JBWA 4B3RB 2APJA 1A9YA 1XZBA 4AJIA 2DLDA 1G5IA 6PFKA 3FDJA 4JP8A 5AK6A 1L7RA 4EYGA 5IULC 5KTNA 3HXOA 3BTSA 1W0JD 2G0NA 1B0AA 3C7DB 1XVIA 5KAMA 2XUQA 5TXGA 1CIPA 5B53A 3I83A 1CE8B 1MB9A 1V8OA 1J0DA 4TV8B 5T3YA 4CKBA 4KRYA 7ADHA 4XW2A 4KRXA 2WE8A 1JG4A 1VE6A 2G63A 3L3BA 2WTAA 4RY8A 1C1YA 1DMRA 2A92A 4CUJA 1PQPA 4FLEA 4DDKA 1RI3A 2YASA 1JLLB 1TA0A 3KAJA 1Z7BA 3GYBA 1BXRB 3VNQA 3JQRA 2I6FA 3WIVA 3ZYCA 4X6YA 5EPUA 2AHOA 3VOBA 4C89A 4EB8A 5J3JA 1YVRA 4TV9F 4EJ2A 1WHTA 2GEBA 4BWVA 3BRSA 4F38A 1Q2XA 5DBIA 1NJGA 3TZHA 2M2IA 3RANA 4WKOA 3WJ2A 2V7WA 5EIHA 1YJAA 1WD7A 4YPOA 1YSCA 3K4QA 2SCUB 4JGGA 1TKCA 3NIDB 3OTIA 4B6QA 1FXUA 3GELA 5K6TA 1EUDB 1GNQA 1NG1A 1Z7YA 5KUTA 2WQ6A 5A05A 1DG1G 1P5RA 4PLZA 4EYQA 1YGYA 4F6RB 4RDXA 4RENA 5KTRA 4HX2A 4WRRA 2EX4A 2R60A 3M3HA 4LNHA 4O8CA 3O1HB 2F1JA 3OETA 2GAFA 3ZJTA 2WV9A 4MA4A 3AR9A 1FLVA 4D8TA 2MSLA 4X1YB 1WSDA 2GZ1A 4AWXA 5DE3A 4A10A 4GE3A 3T1VA 1KC3A 3EQ2A 4MVJI 4WCDA 1VMEA 1TW3A 1Z26A 1NUSA 2JS7A 1BRMA 2HD4A 2OO7A 3KKPA 1VMKA 1D2CA 4NK5A 4G0YA 3CVUA 1E1RA 3ROGA 1KKMA 5DYGA 2MINA 2XQKA 3RFXA 1Y3IA 4DSZA 2QTLA 2VHCA 1MX5A 5JE8A 4ZQIA 4FGWA 4C06A 4KR3A 1RJWA 2AI2A 2X5XA 1YB5A 3UWMA 3DZGA 2QSUA 3KZMA 3NHSA 1MH9A 5JCPA 1FTGA 3DTVA 3QVJA 4JJ4A 3BWVA 5JCOA 4BAGA 1K8YB 2G17A 3SQXA 2ORYA 5C53B 1EFVB 4B84A 3RRJA 1RKBA 4QGGA 3PGVA 4KLZA 1P2DA 2A3RA 1OTYA 2ZU6A 3AJRA 4CMEC 1JB1A 3KV1A 3QUTA 2E5WA 1QCZA 4RM3A 3WDKA 5KREA 1CUZA 2W6IA 4P08A 3L8MA 2IYPA 4YJDA 4GP6A 4DR1B 3E5HA 1P45A 1DAFA 2IPMA 3F78A 4P82A 3EUEA 5E6UA 3UGJA 1ZMBA 4I3HA 4C0JA 4HYEA 4W9RA 3AUSA 2C84A 4YV1A 5EE0A 5M29A 1KEKA 5FOUA 5JV5A 4HX9A 4MPJA 5BT9A 3GUVA 3QBJA 4ZO4A 2VUHB 2B8EA 1UBGA 5LD2B 3UW1A 4HT3B 5DX0A 1QF9A 1FOEB 5G4KA 4XCXA 3GRZA 2Q5CA 3PNVA 4RF3A 5EGSA 1DEHA 3L82B 5KOJA 2ZBFA 3HMKA 1L5RA 4IQ8A 4M9QA 5TY0A 4INOA 1KKLA 1EGMB 1H8HD 2FWIA 4MS4B 4C4TA 5NULA 3MBIA 3ZEAA 4L8VA 1NVMB 5DSTA 1J1IA 4R1LA 1OGJA 1VSVA 4BV8A 4UVIA 5KO2A 2VBIA 2Z5VA 3RUDA 3X3HA 2TYSB 3D43A 2R87A 2RKBA 3V80A 2QGFA 4XE5A 3JS5A 3WGZA 3N2LA 2P3OA 2O20A 5BYAA 2YXLA 1UPUA 4KPUA 2O8CB 2ZR7A 3U49A 3NJ8A 3P2EA 2WT8A 2IYYA 5FTLA 3FOCA 2ZT5A 3ORHA 4HRXA 3OQVA 1AKVA 4RHEA 1GPLA 3K4HA 1GPJA 3AXTA 1X1RA 1QC5B 3D7MA 2ENWA 3GJ5A 1AN0A 3LRTA 4GBED 4RPHA 5IMSA 1X7HA 1IWOA 2B36A 2QW0X 3ASVA 4PG7A 3A4LA 4R5HA 3BJMA 4JJ7A 3TWOA 3UWSA 5CDTA 2AC7A 2WJHA 3IQHX 2C2HA 3LC2O 1JP7A 2XTJA 3UBTA 4M53A 2VPXA 2Z98A 2DCUA 2XZPA 3F5SA 1RR6A 4OAPA 4TT3A 2VUSA 3RVNA 2YWRA 4L4RA 4H16A 3K1TA 3VBEA 5LMZA 1E2FA 4YQEA 5F9HA 3D3WB 1GAXA 1PJCA 5IFLA 8ABPA 4WA8A 3ZVLA 1NW7A 5IAJA 1DT3A 4XUGB 4K6OA 3OQMA 1PR1A 5JSUA 1JIVA 4OHYA 1TM3E 2IJGX 1Q2UA 2Q21A 3VO1A 1I0IA 5FUMA 3HJNA 1ND6A 1JR3E 2HUPA 3I6ZA 3TAUA 3GD7A 3C3EA 1NBOA 5AUNB 5A7FA 4L72A 5IDXA 4JUDX 2OV8A 1XU9A 3DNFA 1FSSA 2BKEA 1O9BA 1U2GC 4OCZA 2PUJA 2LCQA 4LWQA 1TC2A 5SY4A 2OGZA 3VKWA 1BMTA 1YRYE 1F8UA 3F6SA 3ELYA 2PVSA 3KTAB 4TTTS 4ZT3A 1Z5PA 2J59A 3WL3A 4BNIA 3NT5A 3OICA 5C37A 4P98A 3U0BA 3DVQX 1WW3A 1RBQA 2BF4A 2D5CA 1A9QA 2PWPA 4HVTA 3WLSA 1U4NA 3L7YA 3N2YA 2YHUA 4RANA 3MUOA 4EYOA 5HKKD 1UUFA 2ZJ8A 3IKTA 4BEJA 1QZUA 1FFAA 4NE7A 3OLYA 3MGGA 4XUEA 2G88A 5K0CA 4BL5A 2FY8A 1PYGA 1WX1A 1VP3A 4URXR 2PYDA 2VRNA 1B41A 1S1CA 4FDTA 4PQEA 3VOSA 1UCFA 3IHWA 3WLOA 2FSVC 1VGRA 2GD0A 2YS7A 1K6IA 2FEOA 3CINA 3FWPA 3IUSA 4XPIB 1CF2O 5D3MA 1ZD8A 4JZYA 4RA9B 4WV3A 5E1BA 2Z8XA 1B15A 1X42A 5K09A 4AKIA 1L4BA 3BTUA 4Q48A 3R6TA 3TSOA 2XGJA 1Z3IX 2JIOA 4X0EA 2ZM5A 3F96A 2JLQA 5KDOA 3KQOA 2W6PA 4REQB 4YJ3A 1PFVA 2N42A 4IW3B 5CR9A 4D5GA 2QUAA 4RTSA 4I9GA 1OROA 3EVNA 4ICIA 3M6IA 5LYJA 3N53A 1X7YB 2E87A 3BH0A 2L69A 1UOEA 1G3MA 2ANCA 5ALDA 4FMPA 3KSBC 3QEJA 3SBXA 3DR5A 1Q0QA 2ZZMA 4QBHA 2O5VA 2ZJOA 3I73A 3QBTA 4BZXA 1TEVA 2UZ4A 1GDHA 2NTVA 2IPXA 2O2EA 5CG2A 2JIQA 2IU4A 3EMKA 3M81A 1PP4A 2J7PA 4I6GA 1FFHA 1TTHA 2SHKA 5FNZA 3FPKA 4IIYA 3SZRA 1IC6A 4EVSA 5KNBA 1XRMA 2I3AA 1KGDA 2PKXA 4MYSA 5CA1F 4AUKA 2OENG 4LK3A 4ARZA 5LQRA 2Q1SA 4QQ8A 4M0CA 3TSZA 1WTCA 4CM8B 2LV8A 4DMGA 1LV8A 3C39A 1LBTA 2AUNA 1KY5A 2FP3A 3ER8A 4BO2A 2UUCB 1SA0B 2FDRA 3QUAA 1JPJA 2BONA 3KUKA 1D2MA 3M1AA 3OQBA 2R11A 4IIEA 5K0EA 1TT5A 2E5LB 2Z9DA 1Q74A 4FE7A 1N8NA 1X80B 2GK6A 3KKMA 3CNLA 4RBNA 3KIPA 4D9GA 2QX6A 4YMTA 2Q07A 2ZATA 5B7NA 4B4KA 3U3OA 2Z08A 1ZGGA 2JAWA 1P2BA 2O7SA 3UJ3X 3G1WA 3E05A 3ZD8A 5IHPA 1Q77A 1T0PA 1Y9JA 1XCBA 1KFJB 3T95A 1P7VA 3AF2A 4BXOB 1GZUA 2VSXA 3JASA 5BMVF 5DHTA 1YQQA 2RH9B 1F20A 1MG0A 1CTQA 1CY7A 3HY6A 4Q1BA 4LPKA 1L7MA 3TZBA 3GLIE 1RYHA 2XJ9A 2BE9A 4ZU3A 1PW5A 2CV0A 3KB2A 1TW2A 2C0CA 2R47A 3PE4A 3GCDA 1NMSA 3DDNA 4CU2A 5F3WB 4J1QA 3WLQA 3QA3E 1OU4A 5ICEA 2ZZKA 3CEPB 3KNZA 5FP0A 1GLNA 4L76A 4V3CA 2DCMA 2Q5EA 1YB1A 2XOKD 2AV6A 3ETHA 1CS0A 5JYCA 3G9XA 3V4SA 2G1PA 4R54A 1SULA 2N0SA 5FTMA 4ER0A 2CYAA 1ULAA 3AETA 3GF4A 4GI1A 1NLYA 1SXJA 3H2BA 1J6UA 1U2DC 3OZGA 3QWHA 2JGMA 2O2DA 4QQKA 4S1NA 1KDYA 3C6MA 3TZCA 5KQGA 1Y6RA 1CE8A 4KG7A 1FS5A 1ZOSA 2D5LA 4XSHA 3DEKA 3SS7X 1PJLA 2P6UA 5B3KA 3GCZA 4D9MA 1N6NA 1IN7A 1CF9A 1EB9A 1GWNA 2DR3A 2WF7A 5H81A 5JROA 1PK8A 4KXYA 1SRQA 2DUJA 4ZCLA 4JCOA 3LSTA 4WLUA 4EPXA 3A2NA 3KPUA 3F1KA 1IZ0A 4GSYA 1MABA 4BO5A 4JL6A 1RXWA 5M04A 1WA5A 4R81A 3VSEA 3GFQA 3FSGA 4FFBA 2V54A 4UDXX 1CQIB 2GZMA 4D43A 3MK31 2QRVB 3ABIA 4NEGA 4MGZR 2J0VA 5KSOA 2AW5A 1J9ZA 3P0HA 4MW0A 4Y9DA 2HNAA 4FP9A 1I33A 3ROZA 1PJTA 4AY5A 5EKXA 4ZDWA 3EVCA 3QEOA 3CT4A 3LHIA 3EEBA 4PYQA 1YQXA 2J0EA 4FS3A 2XOEA 4F6RA 1ZRNA 2X0JA 5AVKA 4KNYA 4P0PB 1JQDA 3HXPA 3QEMB 4RL6A 5KYWA 1IY8A 4HDQB 2EGUA 1UWKA 3I9V1 3OZIA 3L7MA 3QVKA 5KC9A 2UUPA 3THXA 2GXAA 1EQAA 3NYIA 3OLWA 3CJRA 2YJZA 1XFAA 4EL0A 2G9RA 1GFZA 3OFJA 2QMYA 4A6DA 5LUAA 3QJ5A 1P1CA 1IMJA 2XTMA 2XUKA 3UPDA 3VMMA 4DXHA 1ADJA 2Y68A 1M6EX 2D2VA 1PHPA 2IZ0A 3A2LA 3IBYA 2ISQA 3PPXA 2IOHA 2UYYA 3K1JA 4FEAA 2HV9A 1P7ZA 1W1WA 4UU7A 1JT2A 3GEEA 4JI6B 2AWNA 5HTKA 3VR6D 2AW3A 3ZDEA 1U8XX 3FYUA 2WJAA 2FWJA 1N2GA 2IZ7A 1P2UA 2NAPA 4CFSA 1U65A 2F8MA 3CEMA 1P1RA 1AV7A 3EUFA 4IHJF 1U7XA 4KWHA 4DRZA 4D9FA 3WQSB 3PK0A 4TSFA 4UAVA 3DMTA 1QK3A 1WZUA 3GLGE 3ZWCA 1MAHA 4LHEA 1DRJA 4G0WA 4OXNA 4B3IA 4G85A 4RZ2A 3IP9A 2BFCA 3NJRA 1Q11A 4Y3UA 5HQJA 2XCTB 3H9BA 1EXDA 3KZKA 1Q0SA 3RAJA 2REXB 4HSGA 2BEVB 4H0CA 4H7HA 2YWCA 2DPMA 1QP8A 3B1ZA 3IAEA 4RFLA 2VBCA 4HQ6A 4RV9A 1ZR2A 4R1SA 4A2PA 1V4NA 1QDLB 1Y6ZA 3H0EA 4C6TA 1LW6E 3CE6A 3PFFA 5EQDA 2K4MA 4FQ5A 3ZQ4A 1XI2A 4UHEA 3R3VA 1OBVA 2OHFA 1OUMA 2PGJA 4HGOA 4TN1A 4ACAA 4XD7D 2BGWA 4TVKA 2XQIA 1R4MB 3EY4A 1HLGA 2OBNA 1DI0A 3QKIA 3CNHA 4I4LA 1SXQA 3O0DA 5JMWA 3G9TA 2X2EA 4D4LA 4HUJA 3AM4A 3GFOA 2G5CA 3NOOA 3OSUA 2D7JA 1MOPA 3JQFA 1H6DA 1RWVA 3QMMA 4FE3A 3D3QA 4BV9A 4DW8A 5DCYA 2WBLC 3RF7A 4TL8A 1BE8A 4P7JA 1JXQA 5A6SA 4MGKR 3BVPA 2C4HA 4RK6A 4CKEB 1S6YA 2H00A 4KHZA 8MHTA 2HEGA 3G2PA 3ONNA 4WKGA 3A04A 4J3NA 3AFNA 4EHIA 1R8SA 3J7TA 4FCWA 4RMGA 2O8CA 5CBKA 1EJ2A 2YJTD 3VQTA 1DEKA 4CMEA 3CC8A 3C15C 4TGLA 1O6BA 1ABFA 1MVLA 3GD5A 5DBOA 1TUIA 2X1HA 4O4IA 4JQCA 4H6PA 4J16A 3NDJA 3R1IA 1QBGA 2B99A 2I8LA 1G55A 1XAIA 3LUCA 4G0MA 4KMSA 2ONCA 3LPMA 4W7HA 5J2TF 4ESEA 1WUIS 2X0IA 1NJ2A 2V9ZA 1KP2A 2HX1A 2NU6B 1FF9A 3ICCA 4WXHA 4CNBA 1QS0B 4GLJA 1HK7A 2Q27A 3EXIB 3IEPA 1KY4A 4D26A 2ETVA 3I5UA 1JEEA 3QX9A 4GR5A 1I51A 2O5CA 3IDZA 4B3DA 2W2NA 4RZHA 4ND5A 2RIPA 3OFNA 2CVFA 5CD1A 2I03A 1JHVA 1G6KA 2K5UA 5LQJA 3UVEA 1X7DA 4BNXA 3BHMA 3CFYA 2X77A 3TLYA 4EB3A 1DC8A 3L8CA 5IKOA 2GBFA 2IFTA 3DE3X 2H1SA 3KVRA 1NTOA 3F6CA 2AS0A 1X1BA 2ZUBA 2OYRA 5JW6A 2W2KB 3EN0A 1I2DA 2G6TA 5AVJA 3S29A 3C3KA 2XA1A 3R6WA 3QPAA 2W6OA 3CVVA 2Z57A 4NULA 1AQIA 2AOUB 4QUDA 5IF9A 1NRXA 4M7OA 3KKEA 3U37A 4AZWA 3FHLA 1C1XA 1CUAA 4KAFA 3RG8A 4ZI7F 1NF9A 5HEKA 3BORA 4OXXA 1VM6A 4UHHA 1EUZA 4I8XA 4XA8A 2JD0A 4ASUD 3IL2A 5E3HA 4N6GA 5FWXB 2HSJA 1ZO8A 1QGUB 1A7JA 2BMEA 4GUDA 1P3JA 1RZ3A 2I4LA 4YHBA 4CLXA 2CNWA 4HDAA 4U2KA 1RM3A 2ORED 3QKRA 3AEXA 2QX4A 2DHDA 5AUPB 4NBVA 4G23A 3ADBA 4PC1A 2A0WA 4ZQCB 3ISVA 3OQPA 4Q4AB 5A9SA 4LDPA 4IGIA 4AULA 2WABA 1WPXA 4JJ6A 1N8SA 3I1IA 1Q91A 1V5WA 3NUGA 4S12A 3SHQA 5DLDA 5BN3B 1H22A 2F4NA 3ZKWA 2RHTA 1BD3A 1Z68A 1Y63A 4YJ2F 3G8CA 3UKDA 1H65A 2Q7DA 3V48A 4BMPB 6AT1A 2KB0A 1NW9B 5EEHA 3KE8A 5CYPA 2GF0A 4DQ0A 2D4AA 3GMIA 4DIFA 1OLUA 4ZTZB 1L3CA 3EGEA 3G2QA 1UMBB 3HKEB 3HCWA 2PL9A 3JAWA 3ZOKA 3COPA 5IKPA 3EAQA 1Z17A 1L8LA 1QV9A 5JC1A 4N7MA 3PWTA 2ZBUA 1V8ZA 2XMQA 1NYLA 2FR1A 1L7DA 1PUIA 2JFPA 4HFMA 1O0CA 4YXWA 5IVIA 4Q1CA 3KLOA 1WPRA 3JQAD 3W8RA 3S5JA 4ZOAA 1IJKA 2YZMA 2VJBA 2AN4A 2WOOA 3S2EA 4H6VA 3W4JA 5ALPA 1GCOA 2ZITA 2V6GA 1II8B 2CHGA 4L9SA 5AICA 4GLBA 3RRBA 5E6SB 3WFIA 4IS3A 4BP9A 3T1HB 2X6QA 2JARA 1Y1RA 4YAJA 2JA2A 4R0NA 3MJVA 2OQIA 4DV6B 3BM5A 4MS3A 1NQ5A 2WSIA 2BCGY 2YUIA 2ERCA 3FPGA 3ZY5A 4QU0A 5EMJA 3CNOA 5TQ2B 3X1ZA 2VXOA 3MTGA 1HV8A 3NHWA 3R3ZA 4G07A 4FDMA 4M8IA 3EGWA 1FFSA 4TUYF 1SWVA 4YRKA 1GRCA 4TLBA 3L0OA 4HGQA 4X6LA 3TJMA 3BMXA 3KHKA 1PIWA 3OQHA 4DG9A 1RC8A 5TMEA 4LZLA 2QQGA 5CHYA 1G7SA 1JHOA 4FONA 4GZ3A 1HYQA 4V38A 1NM5C 2BDUA 3I8XA 3NHYA 5DWVA 1C4KA 4AQYB 1UKVY 1V41E 3JWJA 3OE7A 2BELA 5K0FA 4K9MA 2C1ZA 2VDWA 2HK8A 2IXEA 1RQRA 3S2SA 2VDMB 2C92A 3ZDQA 1UK6A 4YRSA 3EGDB 2GQ0A 3ADKA 4XLZA 3G2HA 1YOVB 4QYWA 2A0KA 1CYDA 2WDPA 2XVXA 1CY0A 1XZKA 4XTRA 2X76A 4DCOA 3ED5A 1ISHA 2VF2A 1MRSA 4QWWA 5LBIA 5GVSA 3AF1A 1U1IA 4HBZA 1MZPA 5GPBA 4BFXA 1AHNA 3TLJA 4CF5A 1X13A 2JBAA 5I4KA 1ODSA 4Z2YA 4KMRA 3H11B 4BZWA 4H08A 5JJBA 3LIIA 2XBLA 2OUKA 4YPFA 3OJWA 5IKEA 2QTCA 1PNQA 1EHYA 2GERA 2JFNA 5EP3A 1MAVA 1KEPA 2XCUA 3HO1A 4MCIA 2QAGC 3PDJA 1Y6FA 1KQ3A 2DFPA 2H1HA 1V4BA 2B82A 2Q29A 1Y8RB 5AHRA 3BJRA 4ZFNA 4AZ0A 3UTCA 3BZUA 3K9CA 4LS3A 3SAJA 5E4TA 2PJUA 2GAOA 3DOUA 2ZBGA 1KOJA 2PZKA 3B6KA 4NLLA 4KFCA 4KP7A 1DKOA 5JISA 1E1QA 3ANXA 4R8KA 1JT9A 4BKOA 1PD1A 4QJ5A 1P9OA 3V4PB 4BOYA 5JXJA 2HMTA 4OFWA 4EEKA 1FFGA 2HHHB 4G84A 3KVYA 3OF2A 1WDKA 4X6UA 5FAKA 1X94A 3HJBA 5FBRB 2FEWB 5HF6A 1NXSA 3RIEA 4UC0A 1CERA 4W9MC 1ZCBA 1QVVA 1ZCAA 2JVKA 2GK7A 3OAAA 4QPCA 1DQYA 2VYVA 1FZQA 5DNCA 3ZDAA 1AKEA 3L41A 2C5BA 1ZXBA 3L6UA 4R40A 1YI8A 3O31A 1GYPA 3QEMA 5SY9A 3SXUA 4C14A 2LVBA 2QLJA 1XZQA 3ANSA 1XZLA 2JVJA 3HA2A 5CLIA 4BFLA 5CB6A 4X71A 1DJPA 3O21A 1U4SA 1P18A 1QO0D 1R5NA 1RHUA 4LC1A 1CHNA 4Q3EA 4F06A 1JPUA 4OQZA 4QHTA 1Z16A 3IPLA 2D1RA 1C7QA 1NP7A 1XAGA 1CDOA 4UARA 5CAEA 1CJMA 1C8KA 1KEVA 1YDFA 2ZUFA 2J4CA 2B1QA 1YS4A 2DKNA 4WNIA 4RTLA 2I76A 5ANRB 1EHIA 3QY9A 2PUCA 3NFYA 5C8YA 2F1KA 5ITZA 4DUYB 2IXBA 3H2ZA 3U09A 4LEIA 3RVBA 1QTQA 4H7IA 1M72A 3FZNA 3DT6A 3SF0A 4Z9AA 2YBEA 3EF3A 4HR7A 3EXEB 4BMVA 1FP7A 1I6KA 2GKOA 1IM8A 3CF6R 1SCBA 1PFWA 5CFNA 2GAAA 3WWZA 1G66A 4TYPA 1QQBA 3N87A 3DD5A 3SZLA 3OWOA 2A67A 2IXAA 3DE0X 1B8OA 1AE1A 5HCUA 3SNHA 1HXHA 3NHBA 1J9EA 3DOEA 1RSZA 2RK6A 2X8AA 4RD4A 2G0AA 1FX0B 5K4HA 3ZHZA 2Q5IA 4CM1A 5EWLB 4L5YA 1NVTA 1GTVA 3FNGA 2DECA 4P7BA 5JTTA 4JP5A 3E1KA 5J4YA 1VDMA 5DZSA 2CUNA 4CF3A 4V0LA 3NIBA 5FNVB 2AC4A 3SS9X 1A8UA 1NMXA 5CT5A 5DM70 3VTFA 4HPWA 1N2HA 3ELWA 1QGDA 1XOIA 4H4DA 4QECA 2Q45A 1GPWB 1P31A 3D1VA 3PTZA 1FMCA 1CRPA 1LDEA 4DQXA 4GP9A 3SZGA 2IS4A 5FA8A 3V3TA 3BT7A 4DAEA 3T5CA 1R4MA 2HTFA 2QLNA 1OWMA 3VTAA 3U4QB 3WGMA 1JXOA 3U4HA 1A9SA 1BA3A 2IF2A 4A8TA 1MO3A 4MWZA 5HIAA 5E8RA 4WUVA 2OAGA 4Z4FA 3QFCA 1OLSB 1RQXA 1NLUA 1HTWA 4U2EA 4X1OA 1O8BA 1M8FA 3KBBA 1J2EA 4RD6A 1OOEA 3B6ZA 2HRRA 4GOMD 3FRIA 1Q6ZA 2I33A 2YRWA 5KYYB 1T3LA 4INZA 3L4JA 4RZIA 2YVAA 4DBLC 2REOA 4WZBE 3UWOA 5FLYA 2FSSA 2Q9CA 1TF7A 4FFWA 4UTOA 4BVAA 1T5DX 2LIVA 5A03A 4HP8A 4KQCA 3T1QA 1X38A 1O97D 2D13A 4I1YA 4U9HS 3KJGA 5GONB 2WP8J 3ZE8A 4DANA 1IBMB 2O8EA 3CMCO 3IXMA 5IC5A 2P62A 4Z0NA 3G7NA 4POOA 3T1NA 1CDDA 4WFQA 2PEZA 2FJ0A 1HO3A 1P9NA 1TEZA 2GLTA 2D2IA 3QQ5A 4I8DA 3TNYA 5EAIA 1QS0A 1VIVA 4J0FA 5CT4A 2PMWB 5ES4B 3COYA 2A78A 1KVTA 2PBLA 3UHPA 3U7QA 4O2RA 1ODFA 1WOYA 2AFHA 3RVMA 1LTHR 1M67A 1NZDA 2PMBA 3LKDA 5P21A 1RHKA 1RWQA 1UK7A 3B5EA 1KAOA 3BA1A 3LWDA 2ZETA 4MR7B 3UQYS 5HOQA 2KLHA 3Q7EA 4MUBA 2NO7A 4K1LA 3M2PA 2P11A 1V16A 4XWYA 4CF4A 4OQXA 3DULA 3E9MA 4J7XA 4TRNA 1W35A 1M34E 2HGZA 2ILTA 2XW6A 1P6QA 4OMDA 1GZ7A 3DVLA 4FOLA 3BWYA 2Q2VA 4AN4A 1X14A 3GVCA 3E9QA 1JIXA 3VFDA 5EZYF 2BGRA 1L9KA 2P2GA 4C7OB 1MAWA 3Q1LA 3CH6A 3SYRA 2DBQA 4DDTA 3K71B 1LQ2A 1US8A 4KXLA 1WUHS 3LQKA 2J3DA 2DERA 4KLCA 2YFKA 2P68A 4UQPA 3DVRX 3Q0EA 4LC9A 3CURA 4YP0A 4FMDF 4MVJH 3RIHA 1T26A 1W4RA 5BSGA 5F98A 2XYPA 5F7OA 1V1RB 1K75A 1MXFA 3LQYA 5A0TA 3CQ9A 3AKDA 4HZIA 1KDRA 5E1OA 3UUGA 2IUEA 3WLJA 2XHEA 2O6LA 2WSSD 3NDPA 2PLAA 2VSFA 1KOGA 1GAEO 2E4AA 3OUUA 4M86A 5ELMA 2WA2A 5DULA 4EF4A 3HL0A 2D59A 4HHEA 1HTBA 3R7DA 3E58A 3ZX5A 2TMDA 3CNBA 3VU9B 3PENA 1ZW6A 3RS7A 1Z6TA 4JELA 4MQUA 2PGNA 3DB1A 3CUVA 3ONVA 4OHVA 2XTAA 2WKPA 5FXMA 4BNZA 2C9YA 2BHLA 3K20A 3P1JA 3MOSA 3IAFA 3ZWPA 4BLTA 2QR3A 4ME6A 4WE3A 4KQXA 3TZLA 5ITSA 1YZHA 4QGSA 2WUWE 1D07A 4KQEA 3ZHOA 2FRVA 5F5NA 2WWTA 4D0SA 2IH2A 3ZJYA 4FCTA 3STXA 2WMNB 4D4HA 2HHAA 3D0RA 3PIIA 4IJ5A 4J1SA 4K9QA 5D3KA 2VTDA 3HKDB 3S8MA 3D2AA 4D3SA 4D4IA 3B7WA 2HRZA 3PDUA 1U8CB 2ZUEA 1K1EA 3A36A 4F21A 3Q5GA 2IWHA 4P2GA 3OEED 4R2HA 1NBAA 4N3BA 2B6NA 2JKVA 3E6AA 2ZBRA 1UMCB 5FOTA 3WLKX 3FPFA 3I0NA 5E2BA 2BFWA 3SCZA 2W2XA 4ND8B 2R4UA 4BVGA 3LFHA 2G67A 1N36B 1UXGA 3K0CA 3GDOA 3WO1A 3WYGA 5I3ZA 1RNLA 4YIKA 4L5AA 1XNHA 4RLSA 2ZB8A 5IAKA 1HORA 3OQOA 2G76A 1XMQB 5AQ1A 4UUBA 1PX0A 2C57A 2V74B 2JLRA 4EHAA 4WCFC 5JY1A 3DNPA 3KQQA 4HGPA 2I8AA 4O29A 4QQRA 4DABA 5ENVA 4WXYB 5P8WA 1RYMA 2BGNA 4U7PB 1JKJB 2P78A 2J9YB 4BQOA 2QLBA 4CCYA 2H52A 3RC1A 3PEUA 1E96A 2WTBA 521PA 1V39A 2FI1A 3IA2A 5JO9A 1T8SA 5C81A 4OOEA 3RS0A 1KAQA 4N7RA 4DAOA 1PL7A 3USES 2FFBA 3A6JA 2VQ6A 3ONFA 4IIVA 3AYXB 1KK3A 3CPHA 4OXKA 4UEJA 3VHLB 4EPVA 5L4NA 1G6HA 3UAVA 2KBEA 2Y71A 3LCRA 4L16A 2IXTA 2DULA 4YEDA 4F0JA 3I0MA 4KR6A 5IKMA 3QMPA 1MCZA 3M6VA 4IZIA 4DA7A 3BA6A 4JJGA 1W9MA 2M6LA 4CWAA 3F5DA 4TKMA 5TVKA 1TAQA 2SKCA 1NXPA 1IVNA 2JIZD 2PX2A 4YMSA 2V59A 3CUUA 3MJEA 5SYAA 2CLKB 1J5EB 3W6PA 4DA6A 3HBAA 5D2CA 3TVDA 1S3SA 1ODCA 2FUCA 2VF7A 2ZREA 2ZYTX 3NXSA 4OGWA 3DKPA 3F6YA 3PDWA 4QODA 4QYXA 1K3UB 4D42A 1LQTA 2HRQA 5CVUA 4R3WA 2VCYA 1MP0A 1U3CA 4XIYA 1AMNA 5AKLA 4BFCA 3L6BA 2O19A 3RUAA 1CF4A 4MCAA 3S70A 5HDBB 1O03A 1WKVA 3CIOA 5DYIA 5JWRA 4ZRNA 5FI3A 3WIOA 1JJAA 4G86A 5KZMB 1GA1A 2FXIA 2ID9A 5JMOA 1SHUX 2O3RA 2XYVA 5L6LB 1LW7A 3IIEA 1H6BA 1MJHA 1J21A 2O2CA 2C04A 1JHMA 3IT3A 1NC3A 1U5AA 3F7OA 5EFZA 4H17A 4NOKA 4NZYA 4PHCA 4JNCA 2F3PA 4JXJA 4PC2A 2Y1GA 3ROEA 2ZUVA 4TRRA 1IIBA 1C3EA 3AR2A 4KV7A 5BUCA 2B30A 3KAPA 1Y8RA 3A06A 4RF5A 4UMVA 1E0DA 1BN7A 1EGQA 4BKQA 4ZVTA 3AVXA 1I2ZA 3PSAA 3DPIA 3A4NA 1VYTA 2HQBA 3HUTA 3LC0A 4GR9A 4OHOA 4EG5A 4TWIA 4LAFA 3LBAA 3EPKA 2FU5C 1B0UA 1L8QA 5IJWA 2V6FA 4PLGA 5EP2A 3OZ7A 4IIXA 4UVEA 5LLTA 1N2CA 1ZU5A 2GBLA 4S0XA 4ZQFA 2YJ3A 3SF8A 2BAGA 1JDBB 4HUQB 4JNKA 2LE0A 1A5SB 4MVJP 1PR5A 4NV3A 3FNHA 3Q5DA 2PMKA 1P2SA 5ADWA 2RI6A 2BEUB 3H5OA 1ICEA 4D4MA 2P90A 2ZIWB 4FYYA 3QLJA 5E4YA 1YVEI 3BXXA 2AVNA 3UHAA 3CZ5A 3D3EA 3JQGB 1GPH1 1YFJA 2JI8A 3CF2A 4N5IX 5HOEA 2QN1A 2FHSA 4CRWB 1LBIA 2JAPA 4P3OA 2FNAA 3UMRA 1M5RA 4OAOA 4ZO9A 4OHBA 5DASA 4JBLA 4O2BB 4Z8YA 5HKAA 4FEEA 1R10A 2YQ4A 1MFPA 3KR9A 3LCJA 2EIXA 3PPVA 4Q19A 5CUQA 1Z39A 5EERA 3UWPA 3KQPA 3RYHA 2WK1A 3OURA 1M2GA 1PLJA 4P33A 3JQ8B 4PANA 2VP9A 1EFPA 3ANMA 5LB4A 1G8SA 2O7RA 2ISCA 5CVCA 2V0CA 1ORIA 3STUA 1DIRA 3TF5A 4OXQA 2DPXA 5DM0A 2IV7A 1KJNA 1O1YA 4MITA 5JRJA 5B1DA 4UAJA 4R2MA 1Z13A 2NYRA 1Q3KA 4XGQA 2YW9A 2VP3A 5BUQA 2F8TA 2ONZA 3VDRA 5IVHA 4CR8A 4MUEA 3EXEA 1HA3A 2M1XA 2ES4A 3PDIA 1PJZA 1NF3A 3EJWA 3SKVA 1P7CA 1P1BA 3OHPA 1T6NA 4CM9D 2P2DA 3M34A 1TQ4A 3OA0A 5IT5A 2NG1A 4G97A 1L7PA 1W0KA 3M7IA 4Q3KA 3WTCA 1WCIA 2Z6UA 1FDSA 1B3RA 5HVNA 1KPIA 6Q21A 1E6LA 3CS3A 1S3FA 5CK5A 1R0ZA 5LM3A 1ETHA 1I9GA 3C1TA 4BRSA 1XTKA 4L02A 2BMDA 2C3OA 1K5PA 2BGUA 2INGX 1VOTA 2EKBA 2JL1A 4JOQA 4Q66C 2AR0A 3PCRB 2O7NA 2NU8B 3WNQA 3IE1A 2CKMA 4NCNA 3S2FA 1GTG1 1XC7A 2HN9A 1T2EA 3V8MA 3DM5A 4HWSA 3GBVA 4I66A 4OK5A 4P86A 4CM4B 1MRNA 2FUKA 1VYVA 4EKYA 4E1BA 1MOZA 2BKUA 4G9BA 1CV2A 1EXNA 2VDJA 3TL6A 3U4QA 2VZ8A 1GGHA 4FYKA 1SVSA 1GEGA 1OI7A 2NIPA 2C03A 2JA1A 1MC1A 3H87A 3JR7A 4V0KA 1YL7A 5E6RB 3DG9A 1Q3HA 2B3DA 3WYEA 1RKQA 1OLSA 2Q3JA 4OGLA 5JAZA 1H0HA 1V95A 1NUTA 4FT4A 4MVYA 5B1EA 1ODIA 5JALA 1SG9A 3M4NA 3U56A 1TEHA 2AE2A 4ZYTA 1LF0A 1WQ3A 3FMVA 5F3DA 4ZGGA 5KNBD 2ZSDA 1FPMA 5TS2A 3EAFA 3K0EA 2DHEA 2JI6A 1QYRA 2GXSA 2P4HX 5HF5A 1IULA 2PQ2A 5KYYA 2QSZA 1W2HA 2X42A 4LRTB 3PZRA 4PG6A 4DM3A 5BVHB 1YF3A 1SOAA 3IDAA 3RASA 2POCA 3WGLA 4V0SA 3W5CA 2B9VA 2I2AA 3VKHA 5B55A 4XRRA 3T12A 3TQOA 1NBMD 1W59A 3NATA 4B2PA 3OP1A 4M9CA 3W5UA 2R8ZA 3JD4A 4K9OA 5JCJA 3BTOA 3ZY6A 4DBVO 5F78A 4ENVA 5GGXA 5K6AA 1WCV1 2BW0A 3JVVA 4G1MB 4FZ5A 4G5OA 2RFLA 3GFFA 4RH0A 2G1UA 1RYNA 1WCYA 3BIXA 4TZTA 5L3SA 4KITB 4ONEA 3GY0A 2IOYA 5LPNA 2QTBA 4ZT4A 2A7QA 1XEWX 2FUG1 2JFBA 3DFKA 4DA9A 1XK6A 1N4DA 2C4TA 2VP5A 1DBIA 3DQPA 1WZ2A 3LKBA 4MICA 1UJ2A 4C1BA 4US1R 4ZVRA 2PLRA 3L0BA 2YWJA 4CQMA 2C58A 1DJOA 4Z4HA 2AXQA 4UU8A 1P1KA 2VJLA 4P4LA 2YHIB 3IR6A 1SG6A 5CB8A 3R0IA 5JD3A 1Z6GA 1ML4A 1L5OA 5KTOA 2XUOA 5CCBA 1JSCA 4YDHB 1W8DA 2CCKA 4QE3A 3DZIA 5IM5A 5THKA 1JDNA 4PGGA 4IDFA 1IK6A 4HEHA 2ASEA 1IN4A 1QLWA 1I2BA 1YKFA 3JXEA 1OXKB 4JUCA 4PZCA 3ML1A 4Q3CA 4LYHA 3JYQA 4CW7A 3SC6A 1GL6A 3VOAA 1NASA 1RS0A 2PZAA 4D6PA 3WGTA 2BP7A 3MA0A 5C46F 3MGBA 2WQ7A 2JJ1D 2B8TA 2BBTA 3GJ0A 3MXTA 5DF1A 5HRCA 3EGXA 3GJ8A 4ZOEA 1UOOA 1W19A 2DHCA 2B4RO 1Y3BE 5DSZA 4GW3A 1E6MA 2AD1A 3B7GA 2O5EA 1C4WA 3GL9A 5IC4A 1W2WB 3LU1A 3IAHA 4K6FA 3U4DA 2C0PA 1YC5A 1FE8A 3BGOS 2PSFA 2OR3A 2L42A 4RTKA 1MW9X 3RVKA 4CTMA 1WXWA 4CTJA 1IXSB 4MI3A 4B32A 4DMCA 1ABBA 1F7UA 1BE1A 2P4UA 2F1HA 4TYMA 1V3UA 3NIFB 5F4ZA 5F12A 4S24A 2WZBA 2ZJ2A 5DTEA 4BVBA 2XXAB 1MW8X 3WLHA 1QYVA 2CYCA 4G2NA 1T3SA 2PMCA 1T3TA 4WK6A 4WNYA 3L1IA 1A88A 2OV6A 5GM2A 3Q0TA 1FNNA 4MX8A 2Z5FA 3RYIB 1SXPA 1YK0A 2E1PA 4TSRA 3HA3A 5T57A 3GRUA 2F1RA 4G0QA 4F7DA 2DLCX 4OB7A 1CHDA 1TYBE 1RC0A 1U9ZA 1G2QA 2XE8A 3IDSA 1S3GA 3IP3A 5TQJA 1EXVA 4CXMA 1M10A 2PHZA 5TQ0B 3E5MA 5IYZB 3R2JA 3IULA 1LDNA 1YC2A 5I9TA 1CUHA 2R6GA 2RGDA 221PA 4IXNA 5IBPA 2Q49A 3WGUA 3N2EA 4G1EB 1POXA 3AZQA 5JMPA 1H2YA 5J4KA 4F92B 4LY0A 1I3CA 3SHTA 2ZCUA 4NZNA 3TINA 5DLEA 4QYTA 2HQRA 1L5YA 2CF6A 4QGAA 2WM3A 4B3SB 5C5IA 2P7IA 3UMVA 2HIAA 1X86B 2CF5A 3M1LA 2AFIA 3QFHA 4DZTA 3IKJA 5J5AA 1PSWA 5K2OA 1CRWG 4I4TB 3OX1A 1WO8A 3G79A 4RHCA 4X45A 2P9JA 2FZGA 2I71A 1NVFA 3PJGA 4KXXA 1RXVA 3GCXA 2PX6A 2ZUDA 3JWPA 2ZB7A 4K40A 1KI9A 1NI5A 2FA9A 1VFPA 4HNAB 4PIPA 4QOGA 5DISB 2LCFA 3REGA 4FJ2A 2ATIA 3KZOA