3GJ5A

Crystal structure of human rangdp-nup153znf4 complex
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
201
structure length
201
Chain Sequence
QVQFKLVLVGDGGTGKTTFVKRHLTGESEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Crystallographic and Biochemical Analysis of the Ran-binding Zinc Finger Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 69
structure length 201
sequence length 201
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3gj5A00
3DZDA 4JYCA 1HQCA 1KJZA 2GXSA 3E70C 1OH5A 1TU3A 1Q1BA 1NBMD 5CYOA 1W49A 3CR8A 3TQFA 1ZD8A 5IHPA 2OCAA 2F7SA 2C98A 2C04A 1XMVA 4Q03A 2R6AA 3EW9A 2F1JA 3RYTC 1DG3A 2CVHA 4LI0A 3OFND 3RRZA 2XJ9A 2AHOA 1NNEA 3K0CA 4OHWA 1XTIA 1TQ2A 2NOAA 2ORVA 4C0JA 1OXXK 4WOPA 4D6PA 1Q1QA 5FL7D 4LJAA 4KVAA 1NBMA 3LBNA 2J1LA 3MFYA 2HEIA 2OT3B 3ZQJA 3TW4A 4DXAA 3OFNA 4DLZA 2ZJAA 3QNUA 4OHVA 2HCBA 2B92A 2JIZD 5KDOA 1XJCA 2VPPA 2GRJA 2PT7A 5FL7A 3UPUA 1Y63A 4IW3B 2BCJQ 1M7BA 1S1CA 4OBEA 5TXGA 1UEJA 2PH1A 1NJFA 5DN6A 1T6NA 4L9WA 2ODWA 4DCUA 2NO7A 1HUQA 2A2ZA 3LD9A 5B30A 2AR7A 1XCMA 2CDNA 2ZANA 4IRUB 4PHHA 5CIWA 1SVLA 2CEAA 2JIZA 3AEZA 5GVRA 3NDPA 4JL8A 2C9CA 3LBHA 1ZCBA 2OEPA 4C0AC 1VG9B 2YWGA 3AKDA 4HAVA 3TAUA 1G3QA 3KXLA 5DYIA 5EXPA 2YWEA 4DLXA 4DRZA 4ZDJA 5CJPA 4S2EA 3ETLA 1NLZA 2OXRA 1WCV1 4LDJA 4PQYA 4OHYA 2O0HA 1TX4B 1IJFA 2CNWD 1P61B 3BAFA 1JAHA 3PFIA 3OEHD 3Q9LA 4K8OA 1GOTA 5AR1A 4BFZA 4ZDKA 2WM9B 3PEVA 4MKGA 3PJRA 1N6OA 5FPTA 2WOJA 1NMYA 2ZRPA 2FPMA 2ZJBA 2OFWA 3C8UA 3I73A 3SE0A 3FFAA 3T1VA 1UDWA 5LDDC 2JLSA 2ZRJA 4GBMA 4P32A 1EWQA 3ECCA 2CNWA 1G7TA 5DI3A 2VF7A 1OT3A 5EXSA 3I8XA 1E0JA 3K9GA 3OEHA 1ANKA 1ETUA 3HPRA 1FUUA 2CK3D 3HWSA 4CVNA 4CEIB 5CM8B 1FMJA 2GETA 2R6GA 4L15A 5D3MA 1SULA 3T61A 4M8NE 3QKRB 1DAHA 3TSWA 4AIIA 1XCGB 4S35A 2QENA 5C46F 4JZKA 1X3SA 1J8MF 3TVTA 2QE7D 2CK3A 2WIAA 4PC7A 4RFSA 4ABYA 4DLSA 3VNUA 2GEDA 4HAYA 2ZI7A 3CX6A 4DSOA 2EU8A 2FSFA 4IDQA 4U7DA 3TR5A 4JLDA 4KLNA 3TUZC 1XRJA 5K8UA 1EFCA 3B85A 4B74A 1IAQA 2QE7A 4E22A 3B7GA 2ZSAA 5BXQC 2ZS8A 2VH5R 1G8HA 4P4UA 4KBFA 2DB3A 3R9IA 4GP6A 3ZDQA 1JJ7A 4WZAE 1P62B 1BYUA 4AKGA 5L3RA 1UBFA 3KJIA 4DEYA 3QKSA 5JSZB 4L8GA 3AF1A 4EQ6A 2HLDD 4W5WA 3AVUA 2XTNA 2GK6A 1F2UB 1KI6A 3NHAA 4DUGD 3ZYCA 2QTHA 4DB4A 1YZTA 4Q4AB 1Z6AA 5G53C 3K0EA 1ZIOA 5HTKA 5LB2A 5CDFE 2GCPA 1KO4A 1QVRA 2PLFA 3L0PA 4CEHB 1SVOA 4URYR 2QRZA 4C0KA 3SBDA 2X1VA 4G1UC 4B3CA 4DUGA 4GI7A 2A7QA 2IYZA 1NI3A 3SJBA 5AJWA 5BW8A 1ZNXA 2JLYA 2KBEA 4FMCB 1QVAA 4KSBA 2YJTD 2PCLA 4B43A 5JBQA 1IJEA 2O8BA 2JLRA 1CTQA 3CF2A 2G77B 1AZSC 3SN6A 1RIFA 4IOMA 4A0RA 2DCUA 4Q1DA 2YKGA 1IXSB 3AKYA 1KY2A 1KI4A 2Q9BA 5DE3A 2ZTSA 3UMSA 1QRAA 1WXQA 1XMJA 3UMFA 1E2FA 3B1WA 1Y3AA 2PJRA 3PIRA 2OBMA 1BYIA 1E0SA 1W47A 3L43A 5FFMA 1IN7A 4WIAA 1VIYA 4B73A 5FTLA 3RS2A 5A4JA 1X8KA 3Q7PA 2GILA 4TQUS 2C95A 3E5HA 3IIMA 2VTKA 1SVSA 1VG0B 3THYA 3QUSA 3EASA 3KJGA 3UIEA 4M1TA 1Z28A 121PA 4PZZA 3N2IA 4HAXA 4TYQA 1I2DA 1JPNA 2GCOA 4II7A 4Q1CA 1E4YA 2EFEB 1PJRA 4TZ0A 3DDCA 4DDUA 2IYYA 1UDXA 2W58A 2P5TB 1YR8A 1G20E 5CLQA 2GZDA 4IVQA 2ZU6A 3THWA 1J7KA 2F1HA 4K81B 4MRNA 3FE2A 4EPYA 5KSZA 5HE9A 5AUQA 2HXSA 2VYFA 2VLIA 2WWGA 2F1RA 3NKVA 2V4ZA 3Q85A 4P4SA 3UG7A 5GJWC 4NYMQ 4LV8B 3MAAC 3QEJA 3LRPA 1OKKA 4AURA 2NTYC 2AX4A 4C7OA 4WXRA 4AYTA 5JJLA 1MO4A 1ZNZA 2IXFA 2ZE8A 5KDLA 3PEUA 1F2TA 4MA4A 2BIFA 1IQPA 2V55B 2ZAMA 3REFA 1D9ZA 1XU4A 1W0KD 5JI3E 2ATVA 4W5HA 3AP1A 2ZS9A 3A1SA 4JLKA 4M4SA 1TUIA 2NO9A 2OAP1 2ZYUX 2ZJ8A 5AUOB 1YRAA 2GKSA 3AKEA 1S4QA 1MO3A 3K0FB 2J0UB 2RH5A 1G291 1OFUX 2DY1A 2XTZA 5L3QA 1Q3HA 1KAOA 2VHQA 1W0KA 2H8KA 5J4KA 1GUAA 4PPGA 4GSYA 4F38A 1U98A 1RJ9A 3TRFA 4CEJA 3SHFA 3KTAA 4NYIQ 4U02A 3EC2A 2BWJA 1XEXB 2EVWX 4UNSA 3SYKA 3SZRA 1E9RA 4XSGA 4Q9KA 4V0LA 2ZITA 4PZLA 4PPQA 4BE7B 3EXAA 2C2HA 1G21E 1E9DA 4B35A 1WBDA 3ZVNA 1TQDA 2BKUA 4M1MA 4B44A 1G4AE 1GWNA 3EZ2A 3NDBB 2XNDD 2R2AA 2GEUA 2XJ4A 4YLGA 4A15A 1IXRC 4G0NA 1Z6XA 1NVUQ 2QNRA 3A58B 4M2LA 4R2IA 4ILEA 1EX6A 2PT5A 4Q4JB 3ASZA 2JJ2D 4Q4HA 3FPAA 2V1UA 4DEXA 2HCJB 4KFTA 2Y8EA 2C5LA 2UVQA 2XNDA 3GJ8A 2ZI3A 2QN6A 5CIQA 2F43B 4BEJA 3LLMA 4AG5A 1F5NA 1Z06A 3PCRB 2JLXA 4Q21A 2JLVA 5K8TA 4PO1A 3PXGA 4DWJA 2IYTA 3MMPA 1IONA 3JVVA 2X8AA 2FU5C 5FBVB 2IL1A 4D4KA 1R5OA 2XNSA 1W36B 2LKDA 2VP4A 1MKYA 3LH5A 1NN1A 4DLRA 2B8WA 2GJKA 3QPUA 3O8BA 4RJLA 1U0HC 3QPVA 2ZRBA 1Q22A 3I3SR 1T5IA 2ORWA 3BXZA 4UXHA 4BWYA 3ADBA 4P33A 1GRQA 1OXVA 3GJ4A 5C4GB 2A5FA 2AWOA 1AN0A 1JQLB 4M9QA 2VHCA 3LV8A 4Q9JA 1HEIA 5TMPA 1CJKC 4TMVA 1YR7A 3QVVA 1E9BA 3X1ZA 2OCYC 3KQNA 4JLVA 5EXXA 1YZNA 1OYWA 2GK7A 3K8YA 3WXMA 4AKEA 4TTQA 2BKEA 1CF4A 4HATA 1KO8A 3TH5A 4TYPA 1XPRA 1WB9A 5HPYB 2Z0MA 1E2JA 4HLUC 2VSFA 2QTVB 2A5YB 4N0EA 5HE8A 3X2SA 3OIYA 3W8RA 4ZKDA 2NIPA 3KB2A 1G5RA 3FHTA 4PAMA 4C0QC 1SVWA 5GADl 1KI1A 1P75A 1W4RA 5CB8A 4LJ7A 5GJCA 3TGPA 5FL3A 2O8DA 5JWOA 3B1YA 3GLFB 4GPTA 3RSLA 1P3JA 5CJ2A 1DARA 3UANA 1GFIA 2KI5A 4DLTA 4PQFA 4A0FA 1G5PA 4FD2A 3GEHA 4BFVA 4GZLA 4TLCA 3QKUA 1OXUA 3LBIA 4EPRA 4XWAA 1S0UA 4DSNA 2V54A 3EZ9A 3CR7A 4ESVA 1AQUA 1PV4A 3IO3A 4LC0A 1UPTA 4KYIB 2VP6A 4D0LB 2G88A 1GL6A 3ZVRA 1G4UR 1NN3A 1CP2A 3WMGA 221PA 1XD2A 1H8HD 4WZ6A 2FE4A 4F4CA 1CJUC 2AN9A 1W44A 2FH5B 2RGNC 4CZ2A 2GVZC 1P9NA 2FA9A 2Z4SA 4B3FX 3EA0A 1XZQA 2OCPA 3IBYA 3SC3A 3BORA 5AWFC 1G64A 3OIVA 3BFVA 4Q1BA 2IWRA 2CL0X 3BBPA 3U3RA 3VU9A 2P6NA 1H8HA 4FWIB 1ESMA 2WTUA 4TMZA 5FUVA 2PX0A 1WQ1R 1N0UA 1R0XA 2AXPA 3NTUA 3T1QA 4GFDA 3LQQA 5EP3A 4IVRA 2FF7A 1KKMA 2YOFA 5SZIA 5JS8A 3RHFA 2OZEA 421PA 3AM1A 2FG5A 1FMLA 1Q1ZA 1T5LA 4XSHA 3VQTA 3VR5A 1MRNA 3PEYA 4I4LA 3B8HA 3B6EA 4EUNA 2QMUA 1OHHD 1KMHA 3AF2A 3H84A 3VR3A 5JI2E 4M1KA 2EWWA 1KZGB 4D4JA 3P1JA 1QHIA 1RRCA 1ZD1A 3A4LA 5JFGA 4QBGB 5JHGB 3K0AB 1CJMA 1L4UA 2QM8A 3NH6A 1CR4A 4TQAA 3W6OA 2JGNA 3EZ7A 4HZIA 2BJVA 1GDDA 4MYCA 4Q00A 4F93B 2QAGB 4BZQA 1OHHA 2OILA 4O25A 4NTZA 4FMDB 1Z08A 3AVYA 1S96A 1QHHA 1FTSA 3CB4A 4JVNA 4ERNA 1KDRA 2ZSEA 4MUAA 2KBFA 2GVDC 2REXB 4HLCA 1KKLA 1JPJA 3FMIA 4Z54A 1VPLA 4JLJA 3ZS8A 2JEOA 4OI2A 3E1SA 3NBFA 1CKEA 2ZPTX 3DMDA 1ZD9A 3AKCA 2BBOA 3A4NA 2AL7A 5H70A 2RCNA 1G9XA 3UXMA 4AK9A 3RS3A 4TL6A 1BMFD 3I62A 4QNRA 4V02A 3FB4A 2EFCB 4QXAA 1II8B 3VKHA 2ZI9A 1I4DD 3IEVA 4HEJA 1LNZA 1XPUA 3AUYA 4LJYA 2D62A 1VG8A 3MLEA 2FJUA 1BMFA 3Q5DA 1HURA 3FWYA 1COWD 3QY0A 4NCJA 4U5XA 3W9YA 3WYGA 3DO6A 5JCPA 3L0SA 1QHYA 3ASYA 4X8MA 1FPMA 3PG5A 4LC1A 2PL3A 3EG5A 1IN6A 4AD8A 5J5CA 1KI9A 2QMHA 5KNBA 5IF9A 3TMKA 3GJ7A 3M1IA 2ZUDA 1COWA 4KODA 4Y0VA 3U7EB 2FFQA 3OEED 4JBXA 2A30A 2NO0A 4HLDA 1G7CA 4OHXA 4Q66C 2ZVPX 4JJZA 3I72A 4I99A 3QBTA 1MOZA 3BS4A 4A6PA 3W3AA 3NC0C 1G41A 2GF0A 1KDTA 4YXWD 4QRHA 5HCNA 4KAXA 2YNMA 3OEEA 4OL0A 2JATA 4TTRA 5B64A 3FMPB 1RPZA 4CF7A 1ZBDA 2OESA 4FN5A 4M0LA 1NKSA 5JS7A 3MRSA 1MABA 1XP8A 1WRBA 2IBMA 4NYJQ 4YXWA 3WYFA 1E9CA 4TSFD 3EIQA 1SVIA 2IT1A 2ZM5A 4BGDA 1KNQA 3LQRA 2IX3A 3L8YA 1NP6A 3WHKA 2DFKB 1NIPA 2QTFA 4YDHB 1TF5A 4DLWA 4QKQA 1N5LA 3AUXA 1GG2A 4F91B 3T5DA 2LWIA 1IY1A 3RSOA 2VP0A 2DYKA 4TSFA 3P4XA 3A1VA 1VG1A 2XXAA 4DBLC 1ZJ6A 1L2TA 2WWFA 4DCNA 1IXZA 3UMRA 2J46A 2A5JA 3IQXA 2G0NA 3HDTA 4AY2A 3H2YA 3AF3A 2C8VA 3P26A 4JLNA 1VECA 1CXZA 4TQ9A 3HYRA 1XB2A 4GP7A 4XWOA 1GILA 3GLFE 2FDCA 1ONBA 3IUYA 4GL2A 4Q18A 1RRFA 3IBGA 3NVAA 1S2MA 4NDZA 3LVQE 2J87A 5G3ZA 2H1LA 3QEOA 4Q4LA 3QXSA 4HUTA 2FSHA 4LK2A 4DJTA 4RVCA 2EFDB 4L4UA 3KFXA 2XZOA 1H8ED 2J59A 4CT5A 3R8FA 1W36C 1VHLA 3CNLA 4AWXA 2J7KA 1OFHA 2BEJA 2NZ8A 1P9WA 1Z22A 3GFPA 4L16A 1OIXA 4LGMA 4IDNA 5JHHB 1X8LA 3K09C 5K8IA 1J90A 4JLAA 3A8TA 1T0JB 1H8EA 1ZNWA 5D3MB 2QQEA 5IK2D 4IFEA 4P3YA 3O8RA 2IK8A 2XTMA 5EP2A 5FH9A 1OB2A 2AXNA 2P3SA 2ZJYA 3TUJC 1FNMA 4FI3C 4B3GA 5A0FA 1Q20A 4RFVA 4F4JA 1GRRA 4KI0A 2C03A 3QXCA 1VCOA 2GNOA 4DCSA 4RFSB 1LB1B 4H1UA 4HLQB 4RD1A 3PENA 5IK2A 1DS6A 5KPJA 3K53A 2W83A 4OQMA 3BH0A 4ON9A 3QPWA 3TLXA 4PSAA 5DN6D 1OJLA 2DR3A 4KSCA 1Z0JA 3VAAA 1E32A 4QM6A 4PX9A 3U61B 2VRWA 1VIAA 3TK1A 1KOFA 1T8TA 2GBLC 2XX3A 3IQWA 4Y0AA 5TV2A 3C15C 2JJ1D 1WF3A 3WP0A 2OHFA 4NCKA 3Q72A 4D81A 1DAMA 5FTNA 4B3BA 3ZGXA 3K9NA 1R6BX 3I61A 821PA 4DT1B 3QKSB 2EFHB 3LO5A 3TIFA 2WJHA 4EQ6B 4EFNA 4PAQA 4NZYA 5IDVA 3ZZ0A 2XGJA 1FX0A 1GIAA 1NSFA 1UEIA 2PZGA 1Q57A 2P5SA 4EPWA 4H9GA 3IKJA 1T9HA 2HUPA 3CRRA 4C0HA 2F6RA 2JJ1A 1JECA 4PHGA 4LHZA 2GF9A 4PC2A 2IYRA 2F9LA 4ZO4A 3RC3A 5KNDA 4JYBA 3VX4A 2G1KA 4YQFA 1Q1EA 3LY5A 5F2EA 1E1RD 3THXB 3WMEA 4QGHA 4B71A 3K9LA 4DIDA 1KJYA 4V0OA 4TMWA 2OFXA 4B32A 3GP8A 4TTPA 2RB4A 2HYIC 2O8BB 1NLYA 3HYTA 2P6RA 1NSTA 4ARZA 1KDOA 3BC1A 4LY6A 4URWR 5JEEA 1T3LA 3QQ5A 1E1RA 2J0VA 3JZAA 4Q7KA 2BHRA 4BZXA 5KDDA 1BIFA 2OM2A 1G7SA 3OZXA 2JASA 2UKDA 3CX8A 2IA5A 3GJ3A 2QGNA 1YZKA 1MH1A 1CRPA 3BOSA 1S8FA 3TAHA 4TWZA 2QAJA 3ZZUA 5BN5A 3U4QA 5SZKB 3ADDA 2F3RA 4I1SA 2Z4RA 1T4GA 5GJVC 1KTVA 1K5DA 3AP3A 1EFRD 2VO1A 3AVXA 4JIMA 1MR3F 1SZPA 3THYB 2BMDA 4DZZA 5KU1A 1RYHA 1P60A 1D9XA 3KL4A 3BGWA 3OE7D 3SNHA 4PAOA 5EZ5A 1SXJD 1NMZA 2GCOB 1UADA 3B78A 4OI4A 3A6PC 5F9FA 2D3WA 4G5RA 3CNNA 2QAGC 1MO5A 2Q9AA 1EFRA 3CZPA 4Q02A 2O0JA 2C99A 2IS1A 2OSBA 2QT0A 2YINC 4EDHA 2Q3MA 4EPVA 1NBME 2CLCX 3QBVA 2GDJA 2FX3A 3DVLA 3OE7A 2WHXA 1SXJA 1G7RA 2IYWA 1R8SA 2Q21A 3IGFA 2CL7X 2ODNA 4MGIR 3QOFA 4KFSA 1A82A 4C7OB 1X86B 3PUZA 4FIDA 4TYYA 3B1XA 3KJHA 2J7PD 2BCGY 2UZIR 3RS7A 2Z83A 3EAQA 5JECA 4D25A 1F2TB 2HF8A 4JVMA 3RLFA 1KK3A 3HR7A 4GRAA 2CMKA 2YC4C 1E0KA 1XEFA 4MUBA 5TB5A 1I4TD 3FVQA 3SS8A 1HE1C 5J4LA 4LYHA 1T8UA 3VHXA 3ADCA 4NBSA 3A1TA 1G3RA 2C96A 2J7PA 5FPKA 2FV8A 2WICA 1LV7A 1E2HA 2IYQA 4R7ZA 2ZYTX 3W5IA 5L3QB 1TTTA 1XF9A 4AKIA 3WNDA 2AWNA 3I5XA 5FTKA 1D5CA 1VYTA 1RJ9B 4A2WA 2ZRCA 3MG9A 4AYWA 3KTAB 4RSGA 2CHVA 2G83A 5UKDA 1S9HA 1B0UA 1NL3A 2R62A 4ZCMA 5DSZA 1T91A 5CK5A 1LFDB 1AA9A 5JMTA 5A5GA 2YC2C 3I5YA 4DDTA 2WBLC 2F9MA 1Q0UA 1R8QA 3NBXX 1DBSA 2O8CA 2BBWA 3QXJA 2IEZA 3K0CC 3FOZA 2W0MA 3DZ8A 1Z0FA 5D3QA 1QDEA 4GT1A 3IIJA 5G3YA 4JLMA 5DGXA 1KY3A 2FMXA 4EJSA 3GD7A 1GKUB 3F8TA 4PANA 5HZKA 3KQKA 1R10A 4KFRA 1UKVY 5KSYA 2PBRA 3QI2A 4Q4HB 4OYHA 2Z43A 4QHSA 1YZUA 1GNRA 1KK0A 2CE7A 2JLUA 2MSDB 4PR0A 4HLUA 2ZU0C 3BERA 3HP1A 4M1OA 4YONB 2XSZD 1R0YA 2W2TA 1YKSA 4JLPA 5AJXA 1KAGA 4R98A 3FFBA 3GFTA 3LWNA 2O5VA 4R9UC 5SZHB 2IUSA 4NYMR 3TVDA 1DO0A 1HYQA 1OKKD 1FOEB 3B1ZA 3TE6A 2ZROA 4LPKA 1G5TA 1K5GA 1Z07A 1ZM4A 2I1VB 4OQLA 5AK0A 2G9NA 4R2HA 2ZE5A 1JXMA 5EE0A 2WJGA 4DLVA 4V0MA 2WAYA 4IOLA 4TLDA 2CL6X 3CONA 2XSZA 3PR1A 1E2EA 3K70D 3IPXA 4A4DA 3U6BA 3SQWA 2BMEA 2DFLA 3AVOA 4MITA 4UJ3A 3BIFA 1ZM9A 1E2NA 3LX8A 5FBRB 4M1WA 1HT2E 4Q47A 2JLQA 3GMTA 5KHOC 3CRQA 2JLWA 2BC9A 4LWZA 1A7JA 1R0ZA 4RY2A 2ZQ5A 3ZD6A 2DWQA 2IS4A 1KDPA 5FTMA 5B2ZA 5F98A 1HV8A 1CS4C 4KO8A 1F6BA 1KNXA 1XD8A 3UATA 1IN5A 1ELOA 3O8DA 4LJ6A 4URXR 3HU3A 4FCWA 1WMSA 1OIWA 1KI7A 1CU1A 3AVQA 4IVPA 3NBYC 1OW3B 621PA 4NYIR 3BB3A 2P0EA 1OE0A 1OB5A 4E09A 4AKHA 3CPHA 1YR6A 1PLKA 2PEZA 4QL3A 4BZPA 2FNAA 3KKQA 5TARA 1TEVA 3TJZA 2O8DB 3EPJA 4E07A 1US8B 1XXHA 4HDQB 2GAOA 521PA 1II9A 3CPEA 2ATXA 3L2OB 4QC2A 1P2SA 4URZR 1TMKA 3I92A 3VMFA 4PXAA 1C9KA 4ZIRB 1DAFA 1Z0DA 2BBTA 3C16C 4PPNA 1QBKC 3U44A 2G1JA 4UKDA 2GEVA 3B1VA 4F7WA 4C0SA 4JL5A 4BFTA 2RGBA 4H1VA 2A3RA 3FKQA 2P65A 3U7FB 5FR1A 2BBSA 4OK6A 3W90A 3DL0A 1XCPA 2WKQA 1XD2B 2WMOB 4ITRC 1FNNA 3VKWA 2ANBA 1OFTA 3DHWC 2R44A 2I1QA 3EZFA 3IDQA 2D7CA 3P27A 5KSPA 3EPKA 3VR6A 4B33A 1JR6A 3HPQA 4W9MC 4TMKA 2V6IA 3AV0B 3WYAA 4J0QA 5K8LA 4IXMA 2EFGA 5KUTA 5E7MA 1BKDR 1W5SA 1GRNA 2GWHA 1G18A 3VU9B 3HU2A 2ERXA 4TZ6A 4XTCS 4EFLA 2ZRHA 3UWOA 4D4LA 1U8ZA 2XITA 1BS1A 2XEXA 3VR4A 3P32A 5EUMA 3CNOA 5CM9C 2AKYA 1P73A 3B82A 4JL6A 1L8QA 3KUDA 3A1UA 4MKHA 5E7JA 1IN4A 2ZJOA 3WP1B 4US2R 2BM1A 1Z6YA 1ZAKA 1Z0AA 2QG6A 2WWHA 4BUJA 4MRRA 3T12A 1E9FA 1NY6A 1XMSA 4HSEA 1DG1G 1KMHB 5JRJA 5JZVA 3U3OA 4DLUA 1KMQA 1QG2A 2ZRGA 3EIEA 3MJRA 4MYHA 2P6UA 4QGFA 4B3DA 4CYMA 1EXMA 1E94E 2R8RA 3DOFA 1C4OA 4Q19A 3W34A 4IJMA 2QPAA 1JALA 3DEFA 1NG9A 1OYYA 4LJ4A 3CWQA 2CJWA 4A8JA 2ZAOA 2N42A 3N2EA 1RRPA 3IEUA 4M9ZA 1VMAA 2ORIA 2RGEA 2NZJA 5FI1B 4I1OA 2WOOA 2YVUA 4UXIA 5FPYA 4WBSA 1ZCAA 3I32A 2QT1A 1ZM2A 3U7GA 2ZUBA 1JXOA 4WVFA 2D2FA 1D2MA 4QNMA 2OLKA 1I2MA 5LD2B 5FOWA 1GNPA 5SZJA 3SYLA 4FWTA 1TADA 4IEEA 5DNYB 3EIHA 4TLBA 1RZ3A 3SFVA 1Z5ZA 2Z5FA 1UAAA 1FTNA 5FBWB 4OK5A 1ZU4A 3LNCA 3WMFA 4Q9LA 4BFSA 3KQUA 2Q3FA 2QP9X 4KITB 1K8RA 1P2UA 2L0XA 1OSNA 3RS0A 3X1XA 2QORA 3BD9A 4OJQA 3K0FA 1GKIA 2PMDA 3AP2A 3TKLA 1YVDA 4RCZA 1FP7A 1S1MA 1VCMA 1YZQA 3NG1A 4D80A 4OK3A 4EKDA 2OFOA 2YZ2A 2F1IA 1HE8B 3ICEA 1KI2A 1VCIA 3PITA 4XVQA 5KOYA 1E2IA 1E6CA 2C9OA 2I3BA 2Z6VA 4QOSA 4QBFA 4DCTA 4HZUA 2CLDX 3FTQA 3PEWA 4B6FA 2ECKA 4EIWA 1KSJA 4UJ5A 2GHIA 2BDTA 2J3EA 4RZUA 2DBYA 1SHKA 3AF4A 3QF4B 2OAQ1 1AZTA 1YHNA 5AJYA 1OH8A 1XTKA 5BYKA 2QPOA 1XNJA 2QPTA 3VFDA 2D06A 2ODEA 1W4BA 1L7VC 1OF1A 4ESHA 2A78A 4UNNA 2ZR7A 3AB3A 4PTLA 4IOJA 4C2TA 1IY2A 2QA5A 1TL7C 3H0KA 4JVLA 3UKDA 1Q3TA 2ZSFA 3W8NA 4G5QA 2GESA 1GL7A 1LY1A 2CE2X 2V8OA 2LKCA 5G41A 1FP6A 1NRJB 2GJSA 1J70A 4X8OA 4LOAA 2A9KA 1JR3D 2WWXA 3FMOB 4BRWA 1VTKA 4GMDA 1MV5A 3MWKA 2PEYA 3GEIA 2IXGA 3D6TB 5FOXA 4JSYA 2QM7A 2ASEA 2WJYA 1Z3IX 5FOSA 1HH4A 1PZNA 1HY3A 3FHCB 5L3SA 3UWKA 1EGAA 1JR3A 4RCYA 4XWKA 1WBBA 4OJKA 1OXTA 4Q48A 2PCJA 4TT3D 1NJGA 2G0TA 1E2DA 3CZQA 4HAZA 2AK3A 1M2OB 1AKYA 1LW7A 1YQTA 1N6NA 2GZHA 2VIIA 2ZR9A 5BN3A 4QM7A 4JT4A 2JAQA 4TLEA 1TAGA 3OIUA 2XXAB 2VA8A 1AGRA 3GCGA 4US0R 1E9AA 2NQ2C 1PVOA 3GPLA 2CCKA 3LFUA 2ZJ2A 4UXJA 1QZXA 2WSMA 4TT3A 5E4FA 4GOXA 5IT5A 1ZM3A 1R2QA 1QHGA 1ZMXA 4O3MA 4G5GA 3MWYW 3GLGA 1YU9A 4NHOA 1V5WA 2QQ0A 1W48A 1TQ6A 4F92B 5F9HA 1E69A 2V6JA 3R7WA 2G6BA 4HUQA 1R7RA 5J4VA 1XEWY 4YMUA 2WJVA 1M1YE 1RFLA 4FINA 4BLPA 4EAQA 2D7DA 1XTJA 2Q6TA 4M9XA 3HR8A 3B13B 2WZQA 1KSHA 3GJ0A 3PVSA 4JS0A 3GLIA 1Z0KA 4GMXA 3DM9B 1UBGA 2R6CA 1LTQA 3KB1A 4OI0A 4NL4H 1XTQA 5E7IA 4FW9A 3T06B 4WA7A 4CDGA 3W6PA 1G3MA 1G3IA 2RMKA 3AQ4A 4FCTA 4V0NA 2MMGA 1ZIPA 3LXXA 3DOEA 3GJXC 1G17A 3REGA 4YC7A 4NH0A 1U9IC 4E5UA 4RKEA 4V0KA 4LUCA 4ACAA 1D2NA 4YMTA 2Q3HA 5AJZA 1DADA 5TDHA 2FSGA 1S3SA 1NVWQ 1Z2CA 1ZC3A 2FN4A 4PC1A 3GLHA 1Q21A 3KZ1E 2ZREA 1S3GA 1E96A 2J45A 3GQBA 3PUYA 5EE1A 5JWHA 4QJ5A 4NYJR 3VR2A 3AVTA 2WWIA 4ACBA 4Z8YA 4PFSA 5BYJA 4TL8A 5DLQC 5JJKA 1H65A 4AI6A 2RGXA 4NCIA 2YOGA 4YDSA 2ONKA 6Q21A 2REBA 4HYYA 1AS2A 3MCAA 2FGKA 2EYQA 1ZP6A 1ZUIA 2QRNA 3P4YA 4OQNA 4CIDA 2IHYA 1KSGA 3KXKA 2H7VA 1OH6A 3SJCA 2IC5A 4G5OA 1FX0B 5JEDA 4LYAA 1CULC 3D3QA 1XTRA 4ZDWA 3W6NA 3WNCA 5AUNB 1YRBA 2E87A 2WVJA 1JJVA 5J4HA 3M4YA 4OQFA 3BWDD 3CLVA 4BASA 5KNCA 1DE0A 3SI7A 2ZRFA 2CVFA 2KE5A 2VF8A 3AGPA 4JSTA 5JJIA 3AVPA 3EPLA 1FFHA 2QL6A 3A4MA 1A1VA 3CRVA 2NMVA 1CRQA 4BLQA 5C1BA 2P67A 2WKPA 2R6DA 4DLYA 1N6PA 1XDBA 2TMKA 1N3BA 3L0OA 1YJ5A 4PSKA 2A5GA 4XVRA 2RAPA 4ARZB 3U6KA 3MWLA 1G3UA 4KFUA 2JDID 5C18A 4TL9A 1LS6A 1XFAA 1X1SA 2CXXA 1PLJA 2V9PA 4RD0A 3S1AA 3UG6A 4BFWA 4BQSA 1QHXA 1DOAA 2OBNA 3BB1A 3H4MA 3R9XA 2ZJ5A 4JVSB 5DI3B 5DYGA 2B7BA 4RZ2A 2XZPA 2QGZA 3KX2A 5KO2A 2FEOA 5DI9A 2OG2A 1E9SA 5FPHA 1E98A 3IHWA 3U4QB 4NCNA 1ZUNB 5EE5B 5CITA 2JDIA 5FOTA 4ZI2A 4B3XA 2P2LA 4GZMA 4GNKA 1N25A 3T35A 3J81k 2HXYA 1XJQA 2H92A 2IWHA 4B6EA 2ZI6A 2ZETA 1NVVQ 2IHBA 1RVDA 1YE8A 1N0WA 2YWHA 2GJ8A 5EE3A 2DHRA 3DMNA 1FL9A 3KQHA 1XD9A 4XD7D 4G5SA 5C2JB 4PSVA 3I1FA 2IW3A 2BEKA 3B9QA 3B60A 4PHFA 3NEJA 1NN5A 2YOHA 1KZ7B 3TQCA 1N6LA 3T1OA 2RGAA 1U2RA 2CCJA 3I4LA 3AGQA 2O8FA 3N70A 2J0SA 4KV9A 4MDFA 4XD7A 1SXJB 3MSXA 3U3JA 1N5JA 1ZC4A 4D0GA 3KXIA 3QVUA 2PLRA 4BFXA 1E2PA 5LD2C 1E3MA 3T34A 1Q12A 3DM5A 3CUEF 3SQXA 2IYUA 1HT1E 3FDIA 3C4JA 4KU4A 1JI0A 1RYFA 2QROA 3NEYA 3GFOA 1KI6B 2WWWA 4JMPA 1U0LA 1FW6A 2VHUA 1JNYA 1ZM7A 4MDEA 2J0QA 4U00A 3RS4A 1NMXA 2H5EA 1GVNB 4IDHA 5FR2A 3Q5EA 3FGNA 4KBGA 4RZXA 2ZRMA 3BRWD 4EPXA 4Q9IA 2V7QD 4ZCLA 3QSYA 5JRZA 2WKRA 3AVVA 1M7HA 3CIOA 3GJ6A 3QE0A 3RABA 2X19A 1IM2A 1GKYA 1OIVA 1GAJA 2B8TA 3ICQB 4QG7A 2EYUA 2JCSA 2UZ3A 3NBZC 3DKPA 2QY9A 5CDFA 5DH9A 3H86A 3CM0A 3TR0A 4M1SA 5CYPA 2V7QA 5HKKD 1G1MA 3RWOA 1YR9A 2C9YA 3IILA 3SU8A 5GJBA 1Z6GA 3HJNA 2DPXA 1DAGA 4L9SA 4UQOA 2JLZA 1OLOA 1CJVC 2QBYA 2O8CB 2AK2A 5EE9A 1AJEA 1G8GA 1GITA 2J5XA 2O8EA 4B2PA 8OHMA 5F3WB 2MSCB 1T3HA 4Z8XA 1N2CE 3GJ5A 4EJSB 3G0HA 5HKKA 1A2BA 2YV5A 4CT4B 2YHSA 1LF0A 4DIEA 1O3YA 3CRMA 1XEWX 1AS0A 2IYLD 2VSOA 5EXTA 4PC3A 1TUEA 1P2TA 3DPUA 4IHQA 3CBQA 4NKRA 4HB0A 4QJ3A 4C0BA 2FFHA 1OXSC 4DB2A 3SFZA 4B76A 4XTRA 2ZEJA 2GJ9A 1UKZA 3OAAD 4MGYR 2IF2A 3FHOA 1C1YA 3THWB 1G19A 3LLUA 1IBRA 2AFIE 2PX3A 3CO5A 1A4RA 2FPKA 1GL9B 5LBIA 3WRYC 3KJEA 1TEXA 4P4SB 3KDSE 3SBEA 4QBHA 4URUR 1UFQA 1DTSA 4WZBE 2HV8A 3OAAA 4ZI3A 1ZNYA 4MRSA 2W00A 2YWFA 1UKYA 1AQYA 2J9RA 5DIFA 1ODFA 2XOKD 5BWMA 4LZZA 3SYNA 1G6OA 4ASUD 2N46A 4PZYA 5FPSA 4A1FA 3V4RA 2VP2A 4UNRA 3K70B 3EWSA 1Q44A 3A36A 1U81A 4QHYA 4TL7A 3NHBA 3WRXC 3ZVLA 1OH7A 3C14C 1DO2A 3PUXA 4UNPA 3G5UA 3SR0A 1KK2A 5L3VA 5TVKA 4Z1MD 1GZSA 2OV2A 4KHZA 4A92A 2XOKA 1EESA 4ASUA 1P7CA 2X2FA 4DT1A 3PQCA 3N5CA 5EJEA 4GOKA 2WAXA 4R71A 5BQ5A 3SJAA 1VHTA 2QI9C 1N6IA 4Q5IA 2AD5A 4CEJB 4Z1MA 1XXHB 4GOJA 3SHWA 1NN0A 3BFXA 5JCZA 4MRPA 2GJAA 3EA5A 3MGCA 3VTKA 3CF0A 1IHUA 1FQJA 1KSFX 1R4AA 4JKYA 5J4YA 1W46A 2HLDA 3ZQ6A 2XB2A 1ZUHA 3THXA 3U44B 1Z83A 4QJ4A 3M0EA 2FZ4A 3RS5A 4D26A 3SDZA 4C4PA 2N1BA 4XJXA 1I4LD 4M22A 1KJWA 2OO7A 2IYSA 1E4VA 4TMXA 3ADKA 5L8VA 3RWMB 3TBKA 2NO6A 4LV6A 2D4HA 2JJ8A 1E2QA 1FUKA 2VP9A 4NE2A 1T3SA 1WA5A 4POAA 3EPHA 3UK6A 2X2EA 4B47A 5CB6A 2B7CA 1CBUA 1W2GA 3OF5A 4Q9HA 3KKPA 5ANRB 1VKJA 5G40A 2WJJA 1TNDA 3NXSA 4P31A 3T15A 4QGAA 3A1WA 2W2XA 3RRMA 2ONJA 5GVSA 2CCGA 3IHLA 3C5HA 1NKTA 4HI0E 4ZCIA 1CR2A 3TSZA 3CX7A 3HU1A 3L0IB 3RANA 4CEIA 4DSUA 1N6KA 1EFTA 3L8ZA 4JT2A 5KTYA 3QKRA 4YMVA 2FFAA 4AG6A 1KO1A 1SXJE 4BLTA 4DDVA 2GCNA 4FMCF 1F60A 4X8HA 3U60B 2H17A 2GXUA 2EW1A 4P4TA 2IYXA 4JKIA 1Z29A 2YYZA 4B2IA 1DAEA 2HJGA 4YMSA 4RD6A 1KO5A 4OQXA 3CW2A 3VX3A 4HDOB 4BFUA 4DKXA 1QHNA 1RW4A 2XAUA 1AS3A 1T0HB 2A5DA 1TU4A 3CF6R 2C78A 3O47A 3OIWA 2CJWB 4WW0A 4A8JB 4KVGA 2IEYA 5KPDA 1EX7A 2DFTA 2SHKA 2RKOA 4MQBA 4O2RA 5DHAA 5DISB 4BEBA 2AFHE 2PZEA 2RGNA 2BJWA 4MH0R 1XX6A 1II0A 3CH4B 5P21A 3LVRE 1WE2A 4XIGS 3SJZA 3EWAA 5JSZA 1HTWA 2HDNB 2QU8A 4I1UA 4ZPXA 1E9EA 2OUKA 4BRUA 1Z6TA 3BH6A 1F2UA 1ZYUA 1IY0A 3NIBA 4B48A 1X6VA 1ZVQA 3FKSD 4Q4AA 4D0NA 1ZRHA 2QZ4A 4HAUA 4M53A 5EP4A 1FQKA 4RD4A 3D31A 4TYNA 1VCNA 3ZVMA 1E79D 5FI0B 4W7SA 1NF3A 2KB0A 4HDCA 3TNFA 4CEHA 4IOKA 2QP3A 3U3KA 4US1R 2REOA 1Z47A 1W7AA 4IDPA 4ZKEA 1DELA 3BFKA 4OI1A 2NPFA 5HCIA 2FEMA 1R0WA 1HA3A 3FKSA 1XZPA 2AKAB 3QXHA 4Q01A 3E2IA 1E2GA 4D2IA 2QSZA 2RGCA 2W2VA 2BM0A 5DO9A 4IKEA 1LF5A 1W4AA 4NCHA 5FBQB 1K6MA 3B2EA 3K1JA 4OKSA 4X8LA 4HZUB 1E79A 3KQLA 5E3HA 1G8YA 2GZAA 4M1YA 3U2QA 4Q1EA 3LXRA 2XB4A 4RD3A 4MYTA 4K46A 4C2UA 1D2EA 1SXJC 3A37A 1JBKA 2WWYA 1RKBA 5C4MA 4GDFA 1SHZA 2WMNB 2IXEA 1U99A 1BO6A 1G8FA 3CRW1 4B2LA 3U5ZB 5JLJA 1FZQA 4QBIA 4DVGA 4JLOA 3O8CA 1YZGA 1CLUA 5EUQB 4B34A 2IS2A 4LHVA 1LVGA 2Q9CA 4E03A 3D7MA 2FFBA 2QEQA 1U90A 2NGRA 3QJYA 2KSQA 3ZH9B 1IOZA 1P9RA 4W5JA 4I81A 3CWZA 3R8CA 3T5GA 4DDWA 4A36A 2D2EA 2H57A 2FWRA 2QMOA 4V0ME 2GA8A 4LX0A 5TY0A 1ZU5A 3TUIC 2ZRKA 1KO7A 1NIJA 1QG4A 1UBCA 4BPBA 4QGGA 2HT1A 2GAAA 4N3NA 4MGKR 3ONWA 3TW8B 2K5UA 3WY9A 4PPFA 1GSIA 3P20A 3K9HA 2CLSA 1XJ0A 5FOUA 4FXPA 3OESA 3AH8A 4Q7JB 3ZS9A 3FYHA 5L3SB 2JJ2A 3NC1C 4M9SA 1Z2AA 2ZVQX 4HB4A 2ZRAA 3BB4A 1E1QD 5IRCD 3MUFA 2OLJA 2HYDA 1CJTC 2ODBA 3SEAA 3EX7C 2Q0HA 1JAIA 3PV0A 721PA 3ND9A 1BH2A 1SVMA 4KYUA 1X1RA 3X1DA 2ZXUA 1QHHB 1QHSA 5FUYA 1E2KA 1M7GA 1U9IA 4IXNA 5FUWA 1CEEA 2WV9A 3G82C 3JZMA 3NWJA 4XH9B 1GNQA 3Q3JB 4V03A 1EK0A 2HF9A 4BFYA 4C0LA 2F55A 1DVRA 1E1QA 3BJIC 3QIAA 4WXPA 3M6AA 4LJ8A 4RZ3A 3RDPA 1W0JD 4LHYA 1RE0A 3GLGB 1XPOA 3W5JA 4JBWA 1P5ZB 1N5KA 1M8PA 4EJSC 2D74A 1XXHE 3MD0A 5CLLA 3KFVA 3KKNA 3KUCA 3R7WB 4HUQB 3LAWA 1WP9A 4NPHA 1B23P 1UBEA 2DWPA 4D4MA 2VBCA 2ZE6A 5H68A 1CR0A 3U3MA 1YZLA 1GM5A 4LHWA 5EP1A 2ZSDA 2E1RA 4HB3A 4HAWA 2J0UA 2ZYWX 2R65A 1W0JA 2E9SA 4DC9A 2BOVA 3THOA 3K0SA 3GLIB 1RRGA 2B6HA 1SKYB 2KWIA 1E0AA 1S9DA 4MKFA 1XWIA 3EZ6A 4URVR 1CIPA 2FGJA 4LJ9A 1J99A 4QFMA 5JWRA 4LBYA 1US8A 5M04A 3IIKA 2ERYA 3ND8A 1XEXA 4A2QA 4KJZA 4NU0A 4BLSA 2W0SA 2W6ID 1JEEA 1TPZA 1PUIA 3L82B 2J41A 2ZJZA 2IUTA 3EC1A 4ZIRA 2V3CC 3LW7A 1W2HA 1R5BA 3B5JA 3GEEA 1E99A 4FCVA 4DHEA 2ZI5A 2VQSA 3EARA 3GLHB 3WHLA 2RHDA 1P72A 1KIMA 2MSEB 1W5TA 3QG5A 3PUVA 1J2JA 3RVBA 2NG1A 2W6IA 1F48A 4LRWA 2O52A 1EWRA 3IPYA 4NP6A 3K70C 4Q4JA 2QUZA 4LHXA 1W36D 2H18A 2ZRIA 5B58C 2H16A 3X1YA 2ZUCA 4LPSA 4YMWA 1O87A 4LV5B 2RGGA 1MO6A 2VEDA 3Q8XB 2F43A 1MABB 4O2LA 1AGPA 1XBTA 4G3XA 1EFUA 2ZSBA 4PQRA 5H1YA 2ANCA 1U94A 4L5BA 4LBZA 2WPDD 1J8YF 2ZYVX 5H8WA 4LCBA 3VHLB 2IF0A 1G8PA 4TYWA 1P6XA 1PLLA 1OFIA 3QXXA 1BOFA 4N0DA 1W4CA 2WSSD 3K09A 2BMFA 3KKMA 1F3OA 4Q1AA 3U7HB 2BV3A 1E2MA 2QSYA 4Z51A 1UF9A 2ZE7A 3F5FA 1TF7A 3ZIAD 4C9BA 1MRSA 3BH7A 2WPDA 2ZRNA 1DAIA 5EQTA 1U8AA 5AUPB 4PHTA 3TSOA 2OXCA 4KCGA 4A0GA 4OHZA 4WAUA 3CKLA 4MKIA 5BN4A 2IUUA 2XZLA 2WSSA 4MGZR 2BVNA 3ZLJA 3MWJA 3R20A 2DFNA 3PUWA 2LCFA 1P4SA 2VSXA 5FUXA 3ZIAA 4ZV4A 1OPXA 2ZI4A 1V43A 3FMFA 4RKFA 3DKVA 3OHMA 4LJ5A 2NO1A 5FBLB 3V4FA 4BLRA 4EPTA 1SVKA 3LDAA 2AD1A 1P2VA 4BLOA 4C3ZA 1PUJA 3WBJA 2RHMA 4A6XA 3V9PA 2C77A 2PZFA 1DPFA 1GTVA 4KLZA 1IN8A 4CGZA 2GXQA 2QP4A 2GBLA 1EG7A 3S1AB 3QENA 1AIPA 2EWVA 2ZS7A 4LBWA 1M34E 2RGDA 2G3YA 2OE2A 3GLFA 1D8TA 4DSTA 1M6NA 2JA1A 2VL7A 4QHTA 1M74A 2PJZA 4JBYA 4HB2A 1VYVA 1Z8FA 4P0TA 3B9PA 1N5IA 2VHJA 5EZ6B 1L4YA 2F3TA 3IO5A 3LW8A 4A9AA 1KYIA 1HQYE 3VNVA 3AF0A 3AVWA 2HJVA 1ZW6A 4IEIA 4FMDF 2QMEA 4TLAA 5J40A 4D82A 4A8JC 1G16A 4I1VA 1OV4A 2PMKA 2KJQA 4CW7A 1G6HA 2CBZA 2OBLA 2ZRDA 4IFBA 3RRYA 4ZDIA 2R9VA 2CHQA 4Q7LA 4AYXA 4MYUA 3QF4A 3QKTA 3BK7A 1RC8A 4M21A 2GXAA 4MRVA 2O8FB 3ZJYA 1XMIA 5ELXA 1A5TA 1UKEA 3C5CA 1Z63A 1AKEA 1JB1A 4O0MA 1TF2A 2FZLA 1JR3E 2W6JD 1NLFA 5HR5A 4AC9A 1WDTA 1EFHA 1U8YA 4F4IA 2V1XA 1DAKA 1SQ5A 3T1TA 1D6JA 3WBKA 1GP2A 4XVUA 4A2PA 5AJVB 3CPJB 4G01B 5FTJA 4NONA 3NH9A 5KYKA 4Q7MB 3ZZTA 1ESNA 2W6JA 3RAPR 5J47A 5DHFA 3W3ZB 1KI3A 4LSGA 3RRNA 3K0AA 1JEDA 3GLGE 2BMJA 3LA6A 4NMMA 2IYVA 2B21A 4EFMA 3JVUA 1NY5A 1AM4D 3KKOA 1TQ4A 3Q7QA 1QF9A 2QAGA 3CH5A 3VR1A 4DCVA 1UJ2A 5E95A 2I4IA 4TMTA 4LYJA 2R6FA 1N0VC 3QG1A 1CR1A 3LX5A 1ZINA 2FOLA 3BE4A 4B75A 4Q1FA 3ZD7A 1VDZA 2ZR0A 1AK2A 3GLIE 1N6RA 1SKYE 2OCBA 2X77A 2MMCA 3F0TA 3MJHA 3RC8A 2IS6A 2ZRLA 1LS1A 4XOIA 2QBYB 3V00A 1NVVR 1X8JA 1SGWA 2WIBA 4LBVA 4TN1A 3SOPA 3VKGA 1Z0IA 4PO9A 3F3YA 1II8A 1NG1A 2HT6A 2EQBA 1JQJC 2GTPA 4KXFB 1XTSA 2O8EB 3R9WA 1NVXQ 5KSOA 5B57C 5LB4A 4A0HA 4A82A 1DEKA 2DWOA 1KI8A 1W1WA 4N1AA 1U0JA 2O0KA 4PO8A 4IDOA 2FPLA 3C7KA 5LPNA 1A2KC 1UM8A 1VYUA 4PC6A 3I8SA 2ZIAA 1KHTA 2NPIA 1E2LA 4C30A 1KK1A 1R5NA 2FSIA 3D8BA 3GLHE 3H1TA 5CK4A 3RNLA 5HZHA 1MT0A 4CRWB 4FMBB 4LYFA 4JJKA 4RD2A 3X1WA 2VHTA 2WJIA 1KGDA 2VP5A 4JLBA 4BECA 4UNQA 3QF7A 3WNBA 2CHGA 1SKQA 3C41J 5FOVA 1N6HA
chains in the Genus database with same CATH superfamily
1KVSA 2HDWA 4JYCA 3HA2A 2GXSA 4Q0MA 4YBRA 1TU3A 1A9QA 4OQPA 5SYNA 1WW8A 5TRTA 1WZCA 2H7CA 3E23A 1WVGA 3GNTA 3F6CA 1P4AA 1YV9A 2NVWA 1ECBA 2F1JA 5HM8A 1FFXB 4R01A 5LMCA 3OZIA 2OQIA 2PA0A 2R60A 1HRKA 1TQ2A 4YMLA 2CYAA 1LBTA 2NOAA 5T4BA 3BVPA 1G20B 1RI2A 2XXJA 3EE6A 4KQKA 1PR3A 3K3PA 2H6EA 2QRJA 3AW9A 4BVKA 1LBIA 1U4OA 2FZKA 3NRJA 5AT1A 3TW4A 1R64A 2CW5A 1KZHA 5EC8A 1QANA 2UXBB 3CVVA 4AP9A 2WHQA 3A28A 1K1EA 4UEOA 1UBLS 2VT6A 2UYOA 3ZHZA 2WW8A 4U2GA 2XKKA 2IE8A 4BX2A 1D0VA 3EG9A 1Y63A 4HT3B 5B6PA 1S1CA 3PWTA 3P9RA 5DN6A 1T6NA 2QZJA 4F7DA 3DDNA 4DCUA 3U4DA 2NO7A 1HUQA 1JT2A 2A2ZA 3BILA 3QVWA 2QW8A 4J4HA 4EF5A 2NTEA 3R44A 1CNMA 3ZC3A 1JJBA 5JI3E 1DBIA 1SVLA 3GDOA 1ZK0A 1AQLA 1NYRA 3NDPA 4N0PA 2C9CA 3LBHA 4F4HA 1QHEA 2OEPA 2UYQA 4PICA 4LF7B 2ZFUA 1U2GC 1TZKA 3DDOA 2OHOA 3TJRA 1XDZA 1QWOA 5H82A 4AXXA 2FCRA 3HDGA 5F4ZA 1OCEA 3TOVA 1C1XA 1ICEA 3VH3A 3PFGA 4YRCA 1X2BA 5HCUA 2M1XA 3FCYA 2YNMC 1RE1A 1GYPA 4MIEA 4LDJA 3K32A 3DZFA 3LPAA 4OHYA 4XXHA 1TCUA 1TX4B 3KOOA 3IUPA 3BAFA 3L4EA 3PFIA 4INZA 2VYVD 1NW7A 3OEHD 4N01A 4NIMA 1GOTA 1LZLA 1VKOA 4U9HS 4PGGA 5AR1A 4AXBA 4BFZA 4EW6A 3PJRA 4D8WA 1N6OA 4W8GA 3ZY4A 1PI3A 3R77A 2DPYA 2BHLA 1NMYA 2XGMA 5CXSA 2D5LA 1S6YA 3D81A 3ECSA 5K3CA 3FFAA 3PQ2A 2Q9UA 4CIXA 1HDCA 4R1NA 5JG7A 4FFVA 3TNYA 5LDDC 1EWQA 5DI3A 4ZT2A 2CXOA 3AESA 3JQAD 4MR7B 4HFJA 4J0GA 1ZJJA 2VYVA 1IY9A 3OEHA 1B42A 1ANKA 4P34A 3HWSA 5IARA 4CEIB 5CM8B 4ZOQI 3HO1A 3IIIA 2ISQA 5D3MA 3TLMA 4M8NE 4YRZA 3HACA 1D2AA 3QKRB 5BR8B 3QLVA 4MCIA 1Y1LA 4K9PA 1XCGB 4O1HA 4G84A 1L7MA 4S35A 4YRGA 3JQAA 5JUWA 4G97A 1X3SA 1ML4A 2Q4EA 3KBBA 2C5FA 4K9RA 4P86A 3T4EA 3TVTA 2WIAA 3KQMA 4RFSA 5HJ2A 4X64B 1B15A 2PWZA 2GEDA 5H3HA 1SUCA 2ZI7A 3KCNA 4H7DA 1VGQA 1UZNA 3C85A 3OX3A 4IDQA 2P6MA 4P7FA 3RHSA 3TR5A 4KLNA 1E3WB 2BFDA 2CUTA 2WA2A 1XRJA 4E3ZA 5AVUA 3B85A 1D07A 1MU0A 2HSGA 1CY1A 1X7XB 1OUMA 3B7GA 5LZ7A 5BXQC 4MULA 3NTOA 1QG0A 2H54A 3VNBA 4TKVA 4RZIA 5C35A 4J94A 4MINA 1P62B 1LDNA 1RBYA 1MTZA 5ED0A 1WUKS 1SPBS 3V7WA 1AMUA 2O54A 5K0EA 1YCFA 1DZIA 1LD3A 3QKSA 3RVLA 3WMXA 1BD3A 1R8XA 2HLDD 2XTNA 3MWDA 2R5WA 4OHBA 2GK6A 1F2UB 1KI6A 2ZZKA 3K1ZA 3NHAA 4TWBA 4WFIA 5FT9A 3ZYCA 8ADHA 1JDBC 3PQEA 3B7PA 4G4GA 4H1HA 1Z6AA 3AETB 2VZ9A 1OWNA 4KJXA 4D3YA 3W9BA 2OB1A 2XVZA 1IBLB 3F96A 4UAUA 1RC1A 4CTOA 4QYXA 1KO4A 2XMZA 1X0XA 3HL4A 4HH4A 1SVOA 3GCDA 4WNIA 4ZYUA 4NOMA 5LN1A 1HETA 4R6WA 5NULA 4Y6PA 4L0CA 4TVOA 2BUAA 1MX9A 4WFJA 4G09A 5HF8A 3SBDA 2IW1A 3ZCSA 1J5XA 4GI7A 5LUAA 1XZDA 5KCZA 1W6RA 5BW8A 4X7BA 4ZQEA 2KBEA 2C8JA 4C88A 4UOZA 2BFBB 4RF3A 4FMCB 4YP7A 1QVAA 5E7QA 2PCLA 1L5KA 4EX7A 3HDJA 2ID9A 4GEKA 1AKQA 2O8BA 1CTQA 2J5KA 2OC4A 3K0KA 4OOFA 1AZSC 4XQCA 1RXWA 3I01A 3SN6A 1SUFA 4IOMA 4D4GA 1NTRA 4JI3B 3BIWA 2DCUA 1J07A 2V7XA 3PQDA 4U0KA 4XPZA 1R6VA 5BO5A 4ZTBA 1PK9A 2YHAA 4P7GA 5B6IA 2V9CA 4PZ9A 4OM7A 1F0PA 1WTAA 2C84A 3OZUA 1WXQA 3VH4A 1XMJA 1JJFA 5J23A 1UXHA 3UMFA 1SIUA 3C24A 1SAYA 4O2AA 5AO9A 3PIRA 4L0MA 2RJOA 4DM3A 1IN7A 4I8XA 3HB5X 5FTLA 1N0IA 4JP5A 1KBQA 4TQUS 1M33A 4ZGBA 2QXTA 2B82A 3WKBA 4AY3A 1SVSA 2HV9A 3QUSA 4FHZA 2I71A 4RE5A 3X3HA 1Z4KA 3VOBA 4E6EA 3A9RA 3DMFA 3PD1A 5AHWA 2EZ9A 1MENA 2DPLA 4BMCA 3ZYZA 4HAXA 4II7A 4PX3A 4I9UA 4Q1CA 5GZ3A 4TZ0A 2X5XA 1V5GA 5JPDA 5TGDA 4XARA 4CG3A 2C7PA 3LIIA 3K0BA 3O74A 4EW2A 3L7KA 4JITA 1H6BA 1GU7A 2W58A 3JQDA 3VC7A 2GR9A 1GSOA 2GAJA 3ZXXA 1G20E 5CLQA 3ULKA 2GZDA 4IVQA 3C3CA 3THWA 1V1MA 5HUHA 1J7KA 1N8KA 2QHXA 1V4BA 4K81B 2FEWB 2X76A 3WRVA 1M6YA 2J4CA 5KSZA 1NQUA 3BQNB 5HE9A 3G8BA 2WWGA 1B2LA 3H9GA 3Q8WA 3GELA 1WVIA 2JGEA 3ORRA 4G67A 1EFLA 2PO5A 3UJ8A 3EOAI 3F9IA 2IV7A 3EFBA 3QEJA 3RVRA 2XBLA 1SHTX 1YB7A 1G59A 2RKWA 4I4IA 4L57A 1CLEA 4C7OA 2P30A 4HVTA 2HCTA 1IIBA 2TMGA 3R4CA 4KGXA 4KAAA 4YMHA 4KH0A 3WKEA 3ZW8A 1MO4A 1W52X 3R3ZA 5IW8A 1Y5MA 4P38A 5DBOA 1LRKA 5KDLA 3MTQA 4DY4A 5IX8A 5KVCA 4PN3A 1ZRNA 3SZOA 1ML3A 1Z15A 3TMYA 2V55B 5AI6A 4F5DA 1QH8B 1XU4A 3IV9A 5EJGA 3SKVA 3FIUA 2ATVA 3L46A 4PG4A 3S27A 2ALJA 3UHFA 2NO9A 1Y1PA 1NQVA 1HT3A 5F7OA 4FK8A 2A0YA 2QRVA 5JH7B 4BC1A 3OA2A 1Z13A 2J0UB 4KQCA 3PPWA 4W6ZA 2JGDB 1G291 1OFUX 4FJ2A 4HR7A 2K87A 4AICA 1KAOA 3OOSA 4C07A 2DKNA 3OICA 5J4KA 4FGWA 1M10A 3R3HA 4GSYA 1GA4A 5DW3A 4MS3A 4DIUA 2D1SA 1TYZA 3TOZA 3QFCA 4U2BA 2E5WA 5U9CA 3ELWA 3NIFB 4WASA 1ZK4A 4NV1A 3KTAA 4U02A 1OREA 2VHYA 4X84A 4S24A 1QRRA 2MU1A 1UC8A 2BWJA 2EVWX 3F7MA 4WTOA 5M3BA 1H2EA 1J4AA 1NQOA 2VHWA 2WYVA 3C87A 4F56A 5FX2A 4MOWA 3PIDA 4PZLA 4PPQA 4EG1A 2C2HA 4B6PA 2DECA 4DJJA 2R79A 1VLJA 3IPCA 1A4IA 3QELA 3DE4X 1DMRA 4JJ8A 3MF4A 1WNFA 1TQDA 1VJTA 1HF3A 3AB8A 3LUJA 3R7NA 3AOGA 5IDQA 1GWNA 2QT9A 3ED1A 4FHEA 4OB8A 4D9GA 3NDBB 4MWEA 1ZCFA 1R0RE 2BFEA 4DC0A 4FR5A 5H81A 4XDYA 4A15A 3A25A 2VI5A 4D9NA 1Z6XA 1EHCA 2A35A 3SICE 4MLPA 1Q2UA 4RENA 5FAKA 2XVXA 1YKFA 1UJBA 1UK7A 2HK8A 4EB3A 1Z4NA 3ZGNA 4C89A 3ASZA 4HS9A 1OWPA 2OV3A 2QJRA 4CUJA 3FPAA 6CHYA 3LUCA 1TVMA 1JKFA 3BJZA 4RIFA 2HCJB 2BDUA 4KFTA 4L6IA 2Y8EA 4ER0A 1Z4MA 3GZNA 3C7DB 4KRYA 5CIQA 2F43B 2C9BA 5F3DA 4AQ7A 3GLRA 1Z06A 3MJ4A 1MXFA 4MO2A 4BMNA 4Q21A 5K8TA 3C3KA 4PO1A 4DWJA 3ERCA 3JVVA 1QZTA 4OIMA 5FBVB 1WR8A 3E84A 1W581 2B99A 1V8FA 2H2AA 2YWXA 4D4KA 3GMDA 3AL3A 2GZSA 3SXPA 1LC0A 3I42A 1NN1A 2FPUA 2EG9A 1PJBA 3GGSA 4DLRA 2B8WA 1GNLA 1Y7PA 2GEBA 2GJKA 3E2MA 4CLOB 4RU1A 3ESCA 4RJLA 3L4JA 3QPVA 6YASA 2FSPA 3MINB 1JHAA 2VJMB 3W79A 1Q22A 1I1OA 1T5IA 2ORWA 3I3SR 3V4OA 3NHRA 1G2QA 3ZHUA 4BWYA 4DR4B 3HO8A 1XZEA 1L8LA 1AKVA 3GJ4A 2EEZA 4QVIA 2ZDHA 2RCYA 2PFSA 2JCBA 3DLPX 4AUKA 1JQLB 4M9QA 4ZOLB 4OGGA 3BTOA 3EXHB 5JCOA 3W77A 4Q9JA 4NZ9A 5TMPA 1CJKC 4TMVA 1Z18A 3K9BA 1DDOA 4OLJA 1Z0ZA 4FNAA 5I7AA 1VB3A 4J3FA 1BWSA 3K9WA 4K86A 4U0JA 2OCYC 3GXBA 4HYTA 4JLVA 5EXXA 4PLYA 3W1WA 2R8BA 4Q3CA 5A5FA 4JU8A 4KK3A 4IJVA 2BKEA 4TTQA 1CF4A 1TD1A 1WBJB 2HQRA 3PHJA 4OG2A 3RGGA 3H5LA 3V1NA 3T1HB 1J1IA 3EY4A 3R6DA 1VKNA 1KO8A 4MAFA 1JLLB 1PSWA 4TYPA 3TH5A 3H05A 4P6VF 3SBOA 4G9BA 1XPRA 3WB2A 3DBVO 1RKXA 2IEGA 3JQQA 1R3UA 3U1VA 2BGGA 2RHWA 5IJAA 2PZMA 3OIYA 3L06A 1SUEA 2AG8A 2APJA 2QTRA 2WDZA 1T8SA 1G5RA 2DJIA 3E7WA 3KB2A 3FHTA 3LDUA 4UBNA 1V16B 4LE1A 4PAMA 4C0QC 1SVWA 1XTZA 4CG0A 3WAGA 1P75A 1W4RA 3VZRA 1PL8A 4LJ7A 1GCGA 5JWOA 3H6GA 5DSTA 3I9LA 4N49A 4GPTA 4W9RA 4L6AA 3RSLA 4BV2A 1DARA 3UANA 3WI7A 4E46A 2HL6A 4Z5XA 1DCMA 1GYRA 3NEAA 4PQFA 4ZVMA 4A0FA 4KP7A 4FD2A 1H2ZA 4M8SA 1YQEA 4TLCA 2PX5A 1OXUA 1AB5A 4A0SA 2VWHA 3AINA 3EZ9A 3N2LA 2PKYX 3IO3A 1QIHA 1SN7A 2YICA 1TTQB 1O08A 1UPTA 3HN7A 1GCOA 3GZ4A 2DLDA 4TTAA 2VYQA 1W1IA 4C08A 4YRMA 2ZWIA 4UHBA 2PDAA 3T5PA 1K97A 1ZISA 3JQ9A 1WL8A 2V7UA 5DTMA 5JD5A 3BXFA 4DMCA 1CJUC 2X15A 3UYKA 2FH5B 2Q6KA 2RGNC 2GVZC 3KWFA 2Z4SA 2A0XA 3EA0A 1Z25A 1JU9A 3P19A 2IH2A 1MHTA 1M72A 4JV5B 5EJ6A 1DBRA 5AWFC 4N82A 4V3BA 3S44A 3WC4A 2R7KA 4L7VA 1BE6A 1ESMA 2WTUA 1PGQA 1VE6A 3VR3D 1Q0HA 3EVNA 1HO3A 3NTUA 4WDQA 4Z0HO 2Y1XA 1Z36A 4GFDA 1QV7A 4UEWA 2H5LA 1NLUA 2FW6A 3LQQA 1W94A 4MHSA 421PA 5BMVB 3AM1A 1T5LA 2FG5A 3VQTA 3EVDA 1MRNA 5HMLA 4HNUA 4AZ3A 1WCYA 3GVHA 5K8JB 3KQTA 2F17A 4JK3A 4EUNA 2XBMA 5KINB 1DQSA 1ADCA 2RHJA 5FIUA 1WMBA 1SK9A 2FW9A 3VR3A 1RWPA 1THZA 2AC4A 1DUIA 2WTMA 1SQFA 3OJFA 3R5SA 1ZD1A 3DAFA 4UHHA 1RCFA 1O6CA 1XP5A 3A4LA 3AHJA 1ZGHA 1K08A 3CC8A 3HWWA 4QBGB 4DVJA 3K0AB 2QD1A 1CJMA 3X1KA 3PL5A 2OPHA 1EQAA 1XLVA 5KC8A 4HZIA 3AM5A 1J97A 2BJVA 1U1IA 3DNMA 3JQGA 4HQRA 1F38A 2ERCA 4RJJA 5L6MB 2OILA 5CLFA 4MP3A 4BN5A 2W2MA 4NTZA 3CB4A 4JVNA 1TM4E 4WXEA 4ZN6A 3A6HA 1W6UA 4MUEA 4BP9A 4YUZA 3MGKA 1JTFA 1ZR4A 2GVDC 1FDIA 1YVRA 4WLVA 4EA9A 4PNEA 4CL2A 2J08A 5HK9A 1A50B 5EGNA 2XQJA 3A4NA 4HRXA 4MV7A 5H70A 2BZSA 4DANA 2O06A 3QUTA 3RS3A 4GLOA 4XKJA 1JIIA 1ND6A 2GEKA 3R7DA 2Q27A 4NENB 3AERA 4V02A 3RYFB 1RJGA 4ALNA 4EW3A 5K99A 1WU7A 3HXMA 1ARZA 4HF7A 1I4DD 1PT6A 4ZZ1A 3HYNA 2D8AA 2C9ZA 1BQEA 1DP4A 4OAPA 2Y9MB 4XIYA 4WX2B 3Q98A 4NY1A 2ZUSA 3DVQX 1E63A 3RT1A 2DX7A 3W4JA 1E9VA 3H4TA 3MLEA 4HKTA 2OGZA 3VPCA 4J0FA 1COWD 1XZLA 4FZ5A 3ASYA 2BR4A 2CXUA 1RLOA 1QNLA 2GPWA 3PG5A 1TM7E 3Q6NA 2PL3A 4CM8A 3EG5A 3MLBA 1XFDA 4PTZA 2Y1GA 4ZJUA 2GPSA 1DB3A 2AC7A 3G2JA 4Z6KA 2QTZA 1PN3A 1M76A 4RV4A 1YSCA 3GJ7A 5ETJA 3OIFA 4BXOA 3M1IA 3H97A 4E1AA 1COWA 3UJHA 4EHDA 3WIVA 1C9EA 1KVTA 2NO0A 4HQLA 2C4HA 4Y2YA 2PUDA 3F4KA 1UEXC 4JJZA 1FSZA 4I99A 2GFQA 1P1HA 4HVCA 1YASA 4E5PA 3CXUA 5AHKA 3DLCA 1EIZA 3ET5A 5F52A 1WP4A 4NF2A 5C1IA 3WL4A 4OSEA 1EU1A 2GYWA 1U3TA 3ICCA 2WK1A 1KL7A 2WT9A 4NMXB 4LX8A 4XZ3A 3UUFA 3NV7A 4QGBA 5DYTA 4QOFA 3LHSA 4KAXA 2Z57A 4CIYA 1QK3A 1M2VB 1QDLB 3PDWA 4EKNB 2ECQA 2UYYA 4REQB 5DHRA 3S3TA 1VPWA 5JS7A 2EWMA 5F2KA 3QOWA 3MCWA 4CL8A 3V7YA 1XP8A 3PDCA 1WRBA 4O4IA 4CCYB 4W5NA 1Y7TA 3M3HA 5FYDA 2IBMA 2HY7A 1VHJA 3JATB 1VI5A 3ND6A 2QG9A 3GZJA 3FPKA 2UZ1A 3T41A 3LHKA 4B79A 5JV5A 3V8VA 5HRUA 1ISMA 1NP6A 1OAOA 1V4NA 4NZZA 2C3UA 4WNAA 1OX4A 3LQFA 4MMZB 4C01A 2PUVA 1TF5A 4QKQA 2R8XA 2YVAA 3TPZA 2C2WA 1GG2A 4F91B 1M2OA 2GRUA 2J3MA 4XUGB 4GUAA 3STWA 1FTYA 1L5ZA 4WK6A 1VMEA 2LWIA 4LF5B 3P4XA 3A1VA 1VG1A 4B7XA 1L2TA 1ZHHA 2RHTA 2PQMA 4MKRA 4U6QA 5LM3A 4MS1B 1YRWA 1ISFA 3KYDA 1H3NA 1DAPA 2I9PA 2FK8A 5ILOA 1Y3BE 4AY2A 3NGXA 3CLRC 3IQFA 2WLTA 3AF3A 2C8VA 3W5BA 4WJLA 4JLNA 1E6UA 1CXZA 3EGXA 4FYYA 5AOCA 4JP3A 3V1YA 2C29D 1XB2A 3SX4A 2IHVA 1GILA 1U0FA 4WCVA 5LLTA 3QMPA 5KJCA 2HKIA 5ILQA 5KREA 2PD4A 1RRFA 4DWOA 3PKZA 4OVKA 4NDZA 5EIHA 2J87A 2VNJA 3QEOA 2D0IA 4URFA 1GV1A 3QXSA 1ZJWA 1TVCA 3RU3A 4DV3B 5E6RA 3OM1A 2FSHA 2ZB2A 4DJTA 4RVCA 4L4UA 1PR2A 4BB6A 3LOPA 3R8FA 2B5WA 3AJEA 1VHLA 3CNLA 3EBLA 2HH9A 3N2KA 2NU6B 1XZJA 2NLOA 2OBXA 1JI3A 2IZ0A 5CTJA 1ID1A 4L16A 5JNWA 2G8LA 4TVKA 2VXBA 3WWCA 5C5DA 3K09C 1TUGA 1YR2A 3M4ZA 4Q7QA 3U7JA 5JXHA 4JLAA 5D6OA 2Q5OA 1F2VA 3A8TA 4CL3A 2FZEA 3KC2A 2HJRA 4GC5A 2QQEA 5D3ZA 5IK2D 2XTMA 4RGVA 5JNTA 2VRBA 3EXHC 3II6X 4JU9A 4ER7A 2P90A 3GN1A 3TUJC 2EX0A 4OMCA 4FI3C 4Y2PA 2AQHA 3Q6IA 1GL3A 2JCGA 4ZTUB 3IPAA 3SDBA 3OQ1A 4IYJA 1VGRA 4RFVA 1TQHA 1J2TA 5BQFA 1VCOA 2GNOA 4C4OA 1DO8A 4TMFA 4MV6A 4P98A 5IK2A 4B4VA 1Z38A 2OCLA 2ZYIA 4CTNA 1I9GA 3J7TA 3QPWA 3W5UA 2P91A 2Q4BA 2I6FA 1Z0JA 3DS8A 3QIVA 4XD2A 2WG0A 4A91A 3KAKA 3ZUGA 4MVYA 5BNFA 2WJ4A 3ROMA 4HN9A 4BLVA 3HZOA 1VIAA 2I2FA 2FQYA 1KOFA 1T8TA 5TV2A 4P5EA 2JJ1D 1WF3A 2A1UA 3B6IA 2J3QA 3HJBA 1KYYA 3Q72A 4D81A 1DAMA 2VATA 4MW5A 1GDHA 2ZTMA 3I61A 2O7NA 1RYMA 3QHQA 3QW4B 3OCCA 3LO5A 4XPIB 4MMYB 4RACA 1WMDA 3WNZA 4MARA 3CEAA 4C6TA 4DMRA 4F4DA 3MMXA 1V37A 4UPDA 2R6ZA 5K6AA 2UYHA 1NP7A 2R85A 4BAGA 5KOJA 4C0HA 1PVDA 2F6RA 3NTRA 3R6TA 2NP7A 2JJ1A 1XNQB 4DPMA 4KK4A 4DQKA 1FUIA 5C80A 2Y05A 3HWX1 2O2XA 4YHBA 4B6GA 3ACDA 3KAPA 3RC3A 1BXGB 4UE3S 2V6GA 4BNGA 2WIGA 4YQFA 4RESA 2Q5HA 5F2EA 1M5TA 3O95A 2PRKA 3WMEA 5JDIC 4G2TA 2V4MA 4EH1A 3ZWVA 3RVMA 4JOBA 2NUPB 3CLSC 3HKEA 3L0ZA 4BX9A 4DIDA 1JHZA 1KDZA 1KJYA 5AXCA 2H51A 2ZJ1A 2IZ6A 2QIPA 4I0WB 2CBXA 4Z86A 3GP8A 1UZAA 3FJOA 2MYTA 1XQ9A 3CEJA 3FHJA 1NLYA 4J0JA 4OH1A 4UM9D 1JSXA 4K6HA 4X97A 5JSFA 4ARZA 1KDOA 4LY6A 4P80A 4Y1EA 5B5SA 5KPDA 4BY9E 3TPFA 1SQSA 2P27A 3DEAA 2RBGA 2B37A 1NC3A 2J0VA 3DNPA 3M1YA 2BHRA 3QXGA 2O2SA 4P4NA 1LBQA 3T9AA 1X3LA 1BIFA 4LRXA 2VA9A 4YTEA 1G7SA 3K2IA 4ZZ3A 2JASA 1T5BA 1H4SA 2JAWA 3E0XA 1T1GA 4NBWA 1YA8A 2UKDA 3CX8A 4PQEA 3WGYA 2QGNA 3SM3A 3GEBA 1AXEA 1YZKA 2C4MA 3G68A 1CRPA 1NUPA 1S8FA 1XJ5A 2YWBA 3Q9UA 2B5VA 5DULA 2NSLA 2ZT7A 1NF2A 4LZAA 4TWZA 1ZRSA 5BN5A 4YP0A 5SZKB 3ADDA 3VV3A 3WGTA 2FYTA 2Z4RA 1T4GA 2Q2WA 1GUZA 4ITVA 4TKZA 3QU7A 5GJVC 1KTVA 1K5DA 2VO1A 1K4KA 2RDMA 3IP1A 4K6OA 2A84A 1XZCA 3RYIA 4LZLA 3P9ZA 3UMGA 5KU1A 1YD7A 1E5VA 2JHAA 4BN4A 4H6WA 2X0RA 4M7OA 4YGYA 4FDVA 1OQAA 3LX6A 3OE7D 4U2EA 1T9KA 4PAOA 1KTIA 2DTEA 1RWOA 2E18A 5EZ5A 2GCOB 4U39A 3B78A 2M6KA 5CBKA 5DOZA 1MGPA 5DW0A 1YU6A 2GPAA 3BE5A 3X43A 1L7OA 5F9FA 2GZ1A 3LY9A 1BS2A 2Q9AA 1PWXA 3CZPA 2AOUA 3NFYA 1MVOA 4ZXFA 2QT0A 2YINC 4HDRB 2VQEB 2SECE 3IMFA 3TLJA 1E62A 3ISJA 1NBME 2GLTA 4EPVA 5JSHA 5LVAA 1KAQA 1XOIA 2PUGA 3OE7A 3WADA 2I91A 2QUKA 4BJ1A 2OC9A 2ARKA 4BX0A 2PGDA 3E9ZA 3OCVA 3GIDA 4M9UA 4N5LA 2OV4A 1S2OA 1Z5WA 1ESZA 5ENZA 3QOFA 4TV9B 4KFSA 1Z16A 2A59A 3COSA 2CN1A 4YVFA 4I55F 3EHDA 2ZJ4A 3DFMA 3IVRA 4FIDA 5TQ0B 4EJ2A 1K8ZB 4TYYA 3KJHA 2J7PD 2B9EA 3L8GA 4D25A 3NATA 3EIWA 4QFDA 2Q2NA 1SBZA 1T9BA 1BKSB 2NM0A 2EOAA 4GRAA 5IAEA 3HM9A 2WTXA 3MWEA 4Y1RB 5AXAA 1Z2EA 3M70A 2L19A 3NI2A 4MUBA 2GZ3A 1XVUA 3C6MA 2AFHA 3ND7A 3DAOA 3L92A 3IUNA 3JW8A 4O08A 5COAA 4AS2A 3VHXA 3W5DA 3ADCA 4ZEXA 4CNQA 1YQXA 3JYQA 2Q5JA 4HX9A 3A1TA 1U2ZA 2C96A 2J7PA 3KYJB 3W04A 1NE7A 5FPKA 4YH1A 3T0FA 4FFDA 4K6CA 2IYQA 4R84A 1E2BA 4AKIA 4DXHA 2G72A 2ZWPA 3NNSA 2AWNA 1FU4A 2ZULA 1LNQA 3R5KA 4H1TA 3X44A 1F20A 5AKHA 4C5AA 1V26A 1YFKA 2ZRCA 1MIHA 3VPFA 4CKBB 1D04A 1I6LA 1GFZA 1VE5A 1CK4A 1XALA 2R1TA 5CA0B 2CHVA 1YDFA 5KQRA 4IXDA 5HW0A 4NMHA 1LFDB 1AA9A 2CYCA 1XLWA 1M8KA 3QJ5A 5DHSA 5ELMA 4WY2A 3BD8A 3TL6A 3BSFA 3WGOA 1C9MA 1U63A 3D4IA 4QUGA 4R2MA 4XR9A 3PGMA 2BRUC 4AN0A 1DBSA 1C5KA 1QBGA 3GLSA 2O8CA 2PKQP 2X13A 3RSHA 3DZ8A 4ZK2A 5EINA 1IFXA 3TZCA 5K0BA 3LDHA 3UOAB 2ZPAA 2WINI 2B3TA 2M98A 3GK3A 5JDCC 4EZEA 4GP9A 2OA0A 1BDHA 4RBNA 2IJGX 3AR4A 3A7EA 2OHVA 1GQYA 1HE5A 4QT0A 3RE1A 4GKVA 5KSYA 1U28C 2IXBA 1L5OA 4CIWA 2P9EA 2IVZA 4OYHA 4UTVA 3IB6A 5IJXA 2JI8A 4G07A 3S28A 2CE7A 3USZA 3KG2A 4PR0A 4HLUA 1DAOA 5EJ8A 3BERA 3HFSA 2FPGA 8GPBA 5CDHA 1EHIA 3P9QA 1KAGA 1RHQA 3SIPA 3FFBA 4EHJA 3GFTA 4MIKA 3PA8A 3QNWA 3CG4A 5I9BA 5CU7A 4BVLA 1DO0A 4UHCA 1OKKD 2V74B 4C78A 4PYMA 5AI4A 2ZROA 2LDBA 4OQLA 4TXMA 1YVUA 2PLAA 5CEJA 2VF5X 4HBZA 4FJ1A 1XYYA 4V0MA 4F6RB 13PKA 1DX9A 4IOLA 4OJNA 2FEKA 3O3CA 1YQQA 2J09A 2XHZA 3CONA 5GONB 2P0AA 2QQFA 3SQWA 1LX7A 4A4DA 3U6BA 4EGSA 4IO0A 4UJ3A 3AVOA 2EQ5A 1PQPA 1XRSB 4R2XA 1B6SA 3LX8A 3ENNA 3PBKA 5AKYA 2YZMA 4AJ2A 1SXQA 3EB9A 3ZVKA 2EX4A 1KQ3A 4WEOA 5DWQA 4CMEA 3EYAA 1MA3A 1Y8RB 2QTCA 5EPUA 2JLWA 1VMKA 1U6JA 2Z6UA 4LWZA 1A7JA 1R0ZA 4TZ6A 3EGVA 2NX2A 2NU7B 5FTMA 3TQSA 2QAIA 3L7AA 3L6UA 1RXEA 4KO8A 1SY7A 3Q3IA 1I6KA 1F5SA 1KNXA 1XA3A 1OYOA 1SIWA 4NVRA 2HHCA 4Y2TA 2OFFA 2Q46A 1WMSA 1HPLA 3C5WP 1YK1A 1V8DA 4IRXA 4OA8A 9ATCA 2VDLB 4IVPA 1C41A 2AA3A 2X9QA 3HZZA 1OAKA 1JG1A 621PA 2G80A 1FRQA 1I7NA 4EKGA 4JI8B 1J8FA 1OB5A 1PJZA 2YY6A 1OBFO 1NI5A 1NSYA 5LQMA 3SWWA 1PLKA 1B76A 1WG8A 3FI0A 3WAKA 2FNAA 2P4QA 3KKQA 1TEVA 3K6SB 2O8DB 3H5IA 4E07A 3DMTA 1U8FO 2YN0A 2J6BA 4C03A 2JD1A 1JFLA 1Z5PA 5JJBA 521PA 4J76A 1HYGA 1II9A 4EHFA 4PLCA 4W5RA 1YVEI 4E21A 5FLYA 3I92A 4F2WA 5AVWA 4JJAA 3VU0A 1Z0DA 2BBTA 5ITVA 4G37A 2JJQA 3NBMA 5K3OA 3L6DA 3FUTA 1DMSA 3P0IA 4GGOA 3E35A 3WB9A 1CZUA 1WY7A 3DB2A 4IDFA 3I9KA 4F7WA 3SHOA 3UGKA 1OV6A 5LYJF 3PFCA 4DNQA 3FKQA 2P65A 1IULA 3I2FA 5FR1A 3KHUA 2LUOA 4BP3A 2D0OB 3NIGB 2VC2B 4F71A 5J9FA 4IUBS 3H13A 4NZOA 4JJ6A 2LNDA 1FY2A 2C5SA 4D3DA 4YAEA 4ITRC 4ZARA 5BRNA 1FNNA 1RPJA 2AMVA 5G2OA 3EZFA 1BFKA 1Z8HA 4Z4QA 3CRZA 3PZRA 1JR6A 5IAJA 2EJBA 4WPGA 3BCRA 3C4QA 1SUWA 3C1TA 4TMKA 3WYAA 2Y76A 4IXMA 5AM0A 2OGUA 3HKBA 2ZM6B 2GA9A 2P9HA 1G18A 1XL0A 3OLCX 3T9EA 2ERXA 4FWBA 3VU9B 2W2OA 4XOUA 4HEA6 1EDEA 4D4LA 4H16A 4M7PA 5T41A 1EM8A 1EBFA 2JAHA 3A4VA 4NU6A 4DUYB 3WA7A 3DP9A 5AW4A 1TJNA 1H2BA 2BFNA 1EUYA 1BRMA 5EUMA 1TRHA 3CNOA 5CM9C 2AKYA 1P73A 3B82A 2WTBA 3KUDA 4CJXA 3LQ2A 1C4KA 2Z30A 3BMOA 2QG6A 1ZAKA 2WWHA 1P5FA 4BNNA 2VAXA 4RORA 4MRRA 4H4EA 2IOFA 4AP5A 1AMOA 5CM2Z 1T8YA 5ER6A 4D8YA 1DG1G 1KMHB 2R11A 1CUXA 3V8NA 2R6R1 5JZVA 3U3OA 5JZSA 1R1DA 2MSNA 3HHEA 3MJRA 1KYQA 2P6UA 1MAVA 2I3ZA 5L7YA 4MWTA 3RU9A 4B3DA 1VP9A 1NR7A 3F2VA 4YCMA 1PZHA 2XYRA 2PJDA 4N5IX 4UM7A 1DEAA 2DSNA 3EGDB 2VDKB 4FZJA 2XOXA 4A8JA 5LZ4A 3O3MB 1RRPA 1UJNA 1Z33A 4G8BA 3V8QA 1RFGE 3QY9A 4BO8A 1MTOA 2I2CA 4MV3A 1Z5OA 4J0EA 5KC9A 1VPTA 5LYJA 4KN5A 1FZTA 5KZMB 3H5OA 3W5SA 2R86A 5DM60 4PZAA 4BQFA 1IRIA 1SUSA 1AB6A 3BWBA 4QO7A 4DCJA 3KJZA 3M7IA 4BV8A 4DR7B 5HMMA 1ZM2A 3FYTA 3OZTA 2ZUBA 2P1ZA 1JXOA 4WVFA 5AKZA 2D2FA 5IJ0A 1D2MA 4H7HA 3TIVA 3TKAA 4YJDA 2WHRA 2VEOA 1PT9A 4YXFA 3UWSA 1C7QA 3SYLA 1DBVO 1V96A 1Z39A 2AGVA 1X9GA 5LNK1 3RAGA 1Z5ZA 5TMDA 1UAAA 1I0IA 1YNSA 1ZU4A 3BSSA 5DBIA 1PS0A 1PL6A 3WMFA 4BFSA 2Q3FA 5I7EA 3KQUA 5KI6A 1P2UA 1ZK1A 2D1QA 1OSNA 4TXLA 4KITB 3X1XA 3BD9A 3KZOA 2XV1A 2JW5A 1NOJA 4A10A 5L4LA 1GKIA 1XQYA 5I4IA 3AWIA 2QG4A 1VCMA 2BFOA 2VJLA 3BGOS 4RCZA 4YWHA 5L51A 1XWWA 5IBCA 4G0PA 4E7OA 1IZYA 5KWEA 3I04M 1GQFA 3WZLA 1HE8B 3GBSA 1Z12A 1N9GA 4XVQA 4BQQA 1QXSA 3ZV5A 2FQXA 1J9EA 3OCWA 3OTQA 1QP0A 1HI9A 1M34A 3FYUA 4IJ5A 4QOSA 4XAQA 1SOVA 3ET4A 4HZUA 4DCTA 2XGGA 4EJMA 2M6RA 3LCCA 3N1UA 4B6FA 2BMVA 4W7HA 2VWQA 1RWQA 1XTTA 2HM7A 3KELA 3P7MA 4ZAVA 3V6MA 3VH2A 4EIWA 2WP8J 1RHJA 1XU7A 3RCBA 3VZCA 1WQ4A 1TUBB 2H8GA 4F60A 2PBFA 2OAQ1 1TTPB 3D8HA 4MVXA 2CHFA 5AJYA 1XTKA 1DCTA 4IUDS 2OV6A 3UM9A 4EJFA 3VFDA 2D06A 3ILXA 1UT6A 1L7VC 1OF1A 4ESHA 1PNRA 2A78A 4PTLA 1T4CA 2NZXA 1P1FA 3A1EA 1IY8A 3AYXB 4UAJA 1EE9A 1POWA 2B4QA 4EI8A 3PFHA 3GGJA 3PXUA 3H0KA 1Y80A 3N7TA 5IC6A 2VCYA 3BL5A 5K9ZA 5K05A 1HBJA 4DA4A 2VF2A 5J2UB 2PGAA 2R87A 4E3WA 3PNVA 4FR0A 3VJLA 3L07A 1VTKA 2I0FA 4OHMA 3LCVB 1H23A 1MQ9A 2PEYA 2IXGA 4CWAA 3D6TB 4Q3EA 5FOXA 2V65A 1G6KA 2NZUG 3OLZA 5HS6A 2XUAA 2PQ0A 5TPWB 4C7MA 4DIFA 2WJYA 3EUWA 1QORA 2CKMA 3ELBA 3JQ7A 1Z3IX 2D1RA 5CVEA 3MVEA 1HH4A 4NFHA 3L77A 3FYDA 3L6OO 5FPPA 1K89A 4BGUA 2G76A 3TVYA 1QRDA 4XWKA 1OXTA 4JP8A 2DUMA 2PCJA 4NJMA 4TT3D 3AZPA 1NJGA 1U7ZA 3TLZA 3QMVA 1E2DA 5ALMA 1S02A 3IQDB 3ZY2A 2AK3A 6REQB 3GVCA 1EJ2A 5JATA 5D5QA 1YQTA 1LW7A 2ZR9A 5A3SA 9ABPA 2FEXA 4PSCA 1QIGA 4JT4A 3IC5A 1QGDA 1TAGA 1L8OA 2VA8A 4GOMD 4BVBA 2JGRA 3DTNA 3NIWA 4UXJA 5G4KB 5SYMA 3L40A 5H7XA 1QZXA 3TZBA 5H9WA 4TT3A 1MVLA 3FGOA 5E4FA 2P69A 4OXNA 1ZM3A 3D3WB 4O3MA 3O84A 1GPH1 3A6EA 4HFNA 4OV6B 5L40A 5JZOA 3QYFA 5LYYA 3TB6A 5F9HA 4LECA 5K3FB 1UODA 2GNAA 3R7WA 3NB0A 4HUQA 4C21A 2ZAYA 3GH1A 4WUTA 1K27A 3BJRA 4YMUA 2WJVA 1KS2A 4BJ6A 1RFLA 4FINA 3ROKA 3PXDA 3WZMA 3ZHSA 4BLPA 5IG2A <