3GJ5A

Crystal structure of human rangdp-nup153znf4 complex
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
201
structure length
201
Chain Sequence
b'QVQFKLVLVGDGGTGKTTFVKRHLTGESEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Crystallographic and Biochemical Analysis of the Ran-binding Zinc Finger Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 69
structure length 201
sequence length 201
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3gj5A00
1CJKC 3UXMA 4C3ZA 4C0HA 1IAQA 2EWVA 3EC1A 1OSNA 4QGHA 1JPNA 5BWMA 2GJSA 5DN6D 1E9RA 4UNRA 2FWRA 4IDQA 4LV5B 1ZM3A 4PANA 1KMQA 1AZTA 2KSQA 1IJFA 3AF2A 4NL4H 1P62B 4GOJA 2YOGA 2AR7A 2JJ2A 3ZZUA 1G3QA 4V0LA 3DZ8A 4BZQA 1SVOA 5DI9A 1MKYA 1GL6A 1ZUNB 1H65A 5LB4A 1E2FA 2GCPA 3KTAB 4LBVA 5TB5A 4XD7D 1XX6A 1AJEA 3RAPR 1GVNB 4CEIB 4UXHA 1VIAA 4WBSA 3WNBA 1LS1A 1TNDA 4L5BA 3Q5DA 2Q0HA 1XJCA 3LDAA 4OQLA 4IRUB 4BFSA 2NQ2C 5BN5A 1OB5A 2RGNA 2KB0A 2E87A 4D0NA 3TSWA 2V3CC 2A5DA 2Q9AA 1ZAKA 5FBQB 2QBYB 4B73A 2CHVA 3WBJA 5EE5B 3IDQA 4GP6A 4RFSA 3BH7A 4YMVA 1N25A 3U44A 4Z8XA 2F6RA 3MLEA 3QF7A 3EA0A 2X2FA 4KHZA 3RWOA 2WBLC 1D9XA 3VX3A 1HA3A 2WAXA 2QQEA 2RHDA 4IDHA 4NDZA 1LF0A 3F3YA 3FGNA 4NMMA 3GJ7A 5CB6A 4I1VA 4LSGA 1SGWA 3W5JA 2W0MA 3TSZA 3U60B 5EQTA 3V4FA 2BJVA 3PJRA 2FSHA 4U7DA 3B6EA 3KQUA 2FZLA 1AGRA 1YR7A 2OBNA 1N0WA 1FFHA 3I92A 3WNCA 5IT5A 2P67A 4DLYA 3BXZA 3EW9A 4URYR 1Z29A 4P4UA 4BLTA 4XJXA 3SQWA 4B3FX 3ADDA 2BDTA 1L8QA 1RYHA 2RH5A 4LYHA 4DCNA 1US8A 4U5XA 5EP3A 2FH5B 4B48A 5DE3A 3TKLA 5A0FA 3WRXC 1GWNA 2X8AA 5EXXA 4DUGD 2HDNB 5CK4A 4LHWA 3G5UA 1OH8A 2WMOB 1BOFA 4GMXA 2IK8A 721PA 1W44A 1VIYA 1ZU4A 1SXJC 5CITA 4OHXA 4B2IA 3E70C 1KK0A 4K46A 1XTIA 2DPXA 1U99A 4D81A 1YHNA 2VLIA 3VHXA 3LNCA 3F5FA 2NO1A 2QBYA 2C9YA 4H1VA 1QHIA 2JLYA 4QM7A 1U8YA 2KE5A 2EFEB 4BLRA 4IEEA 3LW8A 4JT2A 2ATXA 1COWA 3T12A 3VR1A 1EFUA 1ZCAA 3VR3A 2VHUA 5JS7A 1E9SA 1JPJA 3W34A 4DIDA 2ZQ5A 3QVUA 1XMSA 3VKGA 4PAOA 4EJSB 5DLQC 2D62A 3NH6A 2HJGA 2FPMA 2W83A 3SN6A 1A7JA 2JLXA 4RD1A 2WPDA 4X8HA 1M7GA 1W48A 3TAUA 3AQ4A 2C96A 2ONKA 4Q48A 2NO7A 1J99A 5JI3E 1XF9A 2OE2A 2YZ2A 4JJKA 5FOXA 4URVR 4LHYA 5CIQA 4YONB 2OHFA 2G1KA 5GJWC 1R6BX 1G18A 2CVFA 3OEEA 1RW4A 2CBZA 3WYGA 5EZ6B 1VMAA 4FXPA 1G21E 2ZRAA 2W6IA 2XXAB 3K9HA 1AZSC 2BM0A 3CRW1 2FDCA 2GESA 4IW3B 3RSLA 1KO1A 3O8RA 2ASEA 3QKUA 1VG0B 3CH5A 4KSBA 4GDFA 3L0IB 1P7CA 3AGPA 2ECKA 4DLVA 2D7CA 4Q1CA 1XWIA 1GZSA 1ZIPA 2UZIR 4NCNA 5KDDA 3LLUA 4BQSA 3QKRB 4BFVA 2VYFA 4LHZA 4UJ5A 3AVQA 5EUQB 3RWMB 4IDNA 4DRZA 2HJVA 5UKDA 1DTSA 2C2HA 2AN9A 3CX7A 2EVWX 4JT4A 4I1OA 5HCNA 1GP2A 1F2TA 1G6OA 2IL1A 4NCJA 1RPZA 1RKBA 3B9PA 2OFXA 5FPSA 5FTJA 3GP8A 3CPHA 3ONWA 4YXWD 4DCVA 1P72A 4EJSA 1LFDB 1N0UA 2ZU0C 3AKCA 4A15A 1TEXA 1ZRHA 3AB3A 1YR8A 1F2UA 4LJ5A 5AJVB 4EPRA 2ORVA 1T9HA 1YJ5A 2P5SA 4GOXA 3Q3JB 2HCJB 4YMWA 3W90A 1G3MA 4AKIA 3VR5A 3SU8A 2GBLA 1XJ0A 3SJCA 5KOYA 1Q12A 2BCGY 1T6NA 1OYYA 3DVLA 3KJEA 2PEZA 1EX6A 2KBEA 4U02A 3CF0A 4AD8A 5AUQA 1GNPA 1M34E 2EFHB 2AWOA 2FEOA 2IUTA 3NDPA 4BFUA 1PUIA 1VCIA 4N3NA 2H57A 2ZAMA 1YZUA 1D2NA 1DO0A 4BLQA 1OKKD 1JJVA 3PENA 4NE2A 3A1WA 4BLPA 4BRWA 1GL7A 1JI0A 4TLDA 4W5JA 3RANA 1F3OA 4I99A 1RRCA 1ZYUA 4KXFB 1IXSB 3SR0A 5FPTA 1KJZA 3B82A 1K5GA 1XD8A 2ZPTX 1G16A 1TADA 1A2KC 1IBRA 4M0LA 4A0HA 1MT0A 1DARA 2W6JA 1V5WA 4TMTA 2FGJA 1JR3A 221PA 4QBIA 1DAMA 3D6TB 4OK3A 1MO4A 2FX3A 4QJ5A 1FP6A 1IN4A 2JGNA 2CCKA 3K8YA 4H9GA 5EZ5A 1NJFA 2O0JA 2RCNA 2ZRFA 1S2MA 2DBYA 4MYCA 1KDTA 2IEZA 3Q72A 3QKSB 4YC7A 4TYQA 3U3RA 4JMPA 2QMEA 4QFMA 4FCVA 4QGAA 1KKMA 3QG5A 2XZLA 4DJTA 4AYXA 4AY2A 2V7QD 1NY6A 1Q21A 1T5LA 2ZYTX 3VHLB 4BUJA 3A1UA 2RGDA 2O52A 4HAUA 4ZI2A 1Z3IX 1YVDA 3CZPA 3ADCA 1SULA 2CHGA 5CM9C 4ERNA 3EPLA 4CYMA 2ZRPA 1FTSA 1C1YA 1YZKA 3K09A 4Q7KA 2ZYUX 2NG1A 1W36C 3GJ6A 2GVDC 2ZVQX 3CF2A 2ZRMA 1IN8A 2IYZA 3VQTA 1N2CE 1XB2A 2ZRIA 4LV6A 3U7HB 5DYGA 5CLQA 5D3MB 4GPTA 2YWHA 4RFVA 3IO5A 2E1RA 2ZUCA 4B3CA 3AV0B 1HYQA 4JVSB 2C04A 3TUIC 4LHVA 1XPOA 4KO8A 1XMIA 2DB3A 5GJVC 4U00A 1HT1E 2JDIA 4FMCF 5BYKA 5LDDC 1OB2A 2PT5A 5FTNA 4FMCB 4BZXA 2CLCX 3TW8B 5FI0B 4TMKA 1LNZA 1IY1A 1UBEA 3CB4A 3FFAA 1E2PA 1NF3A 1QDEA 1ZM7A 1Q20A 3FPAA 3L8ZA 4QBHA 1TQ6A 1KZGB 2IYUA 1E0KA 4BPBA 3BBPA 3VNVA 1MABB 2HXSA 1IJEA 3R8CA 4G5RA 2FSIA 2ORWA 3CZQA 1UBFA 3RC3A 2G83A 1N0VC 4NCIA 3CIOA 1ZMXA 3QQ5A 4X8LA 1JXOA 1G8HA 1OFIA 4AYWA 1N6LA 2CMKA 3MWYW 3OIUA 1AQYA 5AJWA 2IYTA 5K8LA 3SQXA 2XX3A 4TYNA 3PG5A 5BYJA 3BFKA 1P2UA 4TLEA 4X8MA 2WWGA 5GJCA 1KI6A 3SYNA 4NYJQ 1SXJD 4B6EA 2Z5FA 4GSYA 1Z0DA 1SXJB 3VMFA 3QIAA 2I1VB 4NPHA 3EWSA 3NBYC 1X8LA 5H70A 1P5ZB 4OK5A 3L0OA 1FQJA 1NIJA 3LX8A 4M1MA 5D3MA 1NVVQ 4RCYA 4E5UA 4YMUA 4AI6A 1IXZA 1XZPA 3LW7A 1F6BA 1M8PA 4CEHB 2IUUA 2ZE5A 4WZBE 4Q1DA 2QROA 1E2LA 1YZQA 1VYTA 2QAJA 3B60A 1CJVC 1ZU5A 4LJ4A 1UJ2A 1ZNXA 4HZUB 3DHWC 2PMKA 4G5GA 1MH1A 2A3RA 2ZJAA 1E2GA 1HQYE 4KBGA 4TL9A 2MSCB 4J0QA 3THYB 1EFHA 1QZXA 2CJWB 2GXSA 3KUDA 4DSOA 4FWTA 1XEXB 2WHXA 4M1KA 2GWHA 1XCGB 3ETLA 3DKVA 4IHQA 5AK0A 4D4LA 4RZXA 3R20A 4WZ6A 4AIIA 1L7VC 2GRJA 3JVVA 4G5QA 3OE7D 1WXQA 3U3MA 3REFA 1ZP6A 1HE1C 3EA5A 4O2RA 4OK6A 4Q19A 3ZJYA 3VU9B 2VEDA 1W47A 2GKSA 3SJZA 3NDBB 3IEUA 4KVGA 1W0JD 3QKTA 2G88A 4E03A 4M1TA 2F1RA 4LV8B 4OQNA 2NPFA 5E7IA 2REBA 5FBWB 3IIMA 1E2QA 2GXUA 2NZJA 4TQ9A 1FQKA 2GK6A 1U0LA 2QM8A 2QY9A 1N6HA 5C2JB 4JL6A 2QN6A 3LBIA 5CYPA 2BBOA 3MUFA 5EXPA 2WJVA 2CNWA 1R0XA 3KKNA 1ETUA 3TQFA 2GK7A 3T1QA 4LZZA 2XOKD 2OO7A 5JSZA 1E2DA 2BMFA 4XIGS 4D0LB 2PT7A 4IOMA 3K0SA 4NBSA 1PV4A 1JXMA 5FOVA 2VP0A 3U4QB 1M1YE 5CDFE 5KHOC 4LYAA 2FFHA 2NMVA 4W5HA 2PX0A 3VX4A 3WP0A 2O8FA 3CUEF 1Q1BA 2N46A 2IHBA 5FR2A 5FUYA 3ZIAA 1OFHA 4LJ9A 4Q1BA 2W0SA 3IUYA 3ZZ0A 1IY0A 3DEFA 3BE4A 1DG1G 2CJWA 3SI7A 2AD5A 1KK1A 3QE0A 3JZMA 3E1SA 3SZRA 1A82A 3MWLA 2HEIA 1OYWA 3NC1C 4HB3A 1T8TA 2XGJA 3DMNA 2WMNB 4PO8A 3E5HA 3TLXA 5FR1A 1HV8A 4KI0A 2ZYVX 5SZKB 4HDCA 5AJXA 3M4YA 3VU9A 1QG2A 1E1RA 3WHLA 1N5KA 3IIJA 2VHQA 1KI7A 3X1WA 3A1SA 1HE8B 4PO9A 1UKEA 5F98A 4TZ0A 2D3WA 4HUQB 2WM9B 2ZR9A 2JLVA 2HF8A 4OJKA 2R6GA 3ICEA 4M9XA 1NBMA 2XAUA 3AP3A 2JLSA 3I8XA 3AVWA 1XTQA 2H1LA 4RCZA 4TTRA 5IDVA 3DPUA 4RD4A 1GFIA 1DAIA 2VP6A 2IWHA 1UDXA 3SE0A 3TE6A 2BKEA 2IEYA 4RD3A 2QQ0A 2ZXUA 2DWPA 3W3AA 1L2TA 3RRMA 1SVWA 2BBTA 1KDRA 1CU1A 2RMKA 2XITA 4EPYA 2ANCA 5HPYB 1E2HA 2G0NA 2QPTA 2HYDA 1WBBA 1E9BA 4L4UA 4MUAA 4RZUA 5FOUA 5BN3A 2J0UA 3QOFA 1KI9A 2O8BB 1GOTA 2RGXA 2C03A 3K0FB 4PHFA 1VHLA 3PITA 3LH5A 4TSFA 5DI3B 2ODNA 3WMFA 2XTZA 1WQ1R 2DWOA 2ZR0A 4KJZA 1DPFA 5DNYB 4JBWA 3ZQ6A 2O8DA 1DAKA 1Z6GA 2HUPA 3AGQA 3VNUA 1W36B 2P0EA 3GLIE 1Z8FA 4C2TA 1AIPA 1ZM4A 2ZJOA 1EFRA 2FN4A 3A4LA 4CRWB 1EX7A 1G5RA 1N3BA 3BFVA 1ZINA 4L16A 3Q9LA 1DAHA 2O0HA 2C98A 3KXKA 4ZDJA 3ZQJA 1HEIA 1Z6TA 2MMCA 5DHFA 1KO8A 4AURA 1VCMA 2YC4C 4I1SA 2A2ZA 2ZS8A 1XXHA 3DKPA 1ANKA 2PLRA 1JBKA 1R8SA 2Q9CA 1OW3B 1BS1A 1KY2A 3BGWA 1LS6A 2AKYA 3WYAA 1CIPA 521PA 2ZTSA 4G5OA 1P73A 1NVXQ 4M4SA 2GZAA 3EARA 2G77B 1CJTC 3GLHB 4XVRA 1VCNA 3T61A 1CJUC 1GG2A 1M74A 1R4AA 4TLAA 2HYIC 3AVYA 1E9DA 3TNFA 4OQMA 3AM1A 1EK0A 2WKRA 3W8NA 3ZVMA 1E9CA 1Z83A 4HB4A 1YZGA 2KJQA 2G3YA 3ICQB 3QEJA 1WA5A 2R9VA 1TU4A 2QTHA 2GEDA 1SVIA 2PJZA 3NWJA 3BC1A 1OIWA 4RZ2A 3I73A 4WIAA 2GNOA 1XEWX 1KAOA 1PUJA 2C5LA 3JZAA 5EXSA 2ZSEA 1S0UA 1DADA 3KXIA 2QMHA 1VKJA 4M1OA 1QVRA 4LYJA 2IS1A 5FTLA 1XTSA 3K0FA 5DI3A 4DSUA 2O8BA 3GJ0A 2YWFA 4ZKDA 3KKPA 4F93B 4TMWA 4MDEA 2UVQA 4M22A 2XNDD 4JL8A 3IGFA 4IKEA 3CX6A 4R2HA 4YDHB 3DOEA 3K9NA 4LYFA 2ZROA 1E99A 3NEYA 4DSTA 4ZCMA 4P4TA 2YV5A 3QBVA 1U8AA 3FTQA 1KMHA 3CKLA 4ZDKA 1CTQA 1NLFA 5FH9A 1FMLA 4AC9A 4DEXA 3U7FB 4DDTA 1QRAA 3BORA 4OI2A 3VR2A 1W4AA 3KB2A 5KNBA 3HU1A 3EX7C 4Q4HB 2WTUA 1XMVA 3N2IA 4ZDWA 2CK3A 2A5GA 4E22A 1TF5A 1RZ3A 821PA 3PR1A 4A2WA 2IC5A 3DO6A 2ZE8A 4TL6A 2PX3A 5FTKA 1TMKA 1Q3HA 3P26A 4PR0A 3ZS9A 1U9IA 1OXVA 1XD2A 2EQBA 1W49A 2HT6A 4JSTA 4DLTA 1XTRA 4E07A 1WMSA 2HF9A 4CZ2A 2A78A 2VIIA 3UANA 3GLGE 1QF9A 1G6HA 2DWQA 1NKTA 2EFCB 2QNRA 3I4LA 5EE0A 3B2EA 1PVOA 1WBDA 3SHFA 5J4LA 1QHYA 2ZSDA 1JB1A 4F91B 5HKKA 2PJRA 3B1VA 1AK2A 2QAGC 3MCAA 1H8HA 4S2EA 1AGPA 4JS0A 3AKDA 3WRYC 1GNQA 2FFQA 4ZKEA 1CS4C 4KFSA 3V00A 4F4IA 4OI0A 2P3SA 4NU0A 3VTKA 5JEEA 4C4PA 4EKDA 3FMOB 3FE2A 3OFNA 1HTWA 4IOKA 3GLFA 4Q9HA 2Z43A 4C0KA 1VDZA 1X86B 1IHUA 4NCHA 1PLLA 3RS5A 4ABYA 4ESVA 1Q44A 3FHTA 4Y0AA 1R5BA 4MRNA 3LQRA 1BH2A 3QI2A 3FWYA 3NHAA 4C9BA 2P2LA 3EIEA 4BE7B 3FKSA 1Z0JA 2IBMA 2P6UA 2QMOA 4DWJA 2J9RA 2AWNA 4TT3D 1G41A 2JIZD 2GILA 2PBRA 2Q3FA 2ZJBA 3KXLA 5DN6A 3X1ZA 3X1XA 3U5ZB 1KI8A 3UG6A 2VHJA 3A37A 2D06A 3X1DA 4BECA 4GT1A 1G4UR 2BKUA 2HLDD 4PQRA 4BFXA 1U0HC 2DY1A 1G7CA 2ZRLA 3VR6A 3K0CA 1G19A 2ZE7A 3PUXA 4OBEA 4ZCIA 4Z8YA 1HUQA 5FI1B 4PO1A 1MR3F 3ZS8A 4AYTA 1E4YA 4A92A 3Q5EA 1QHSA 1Z22A 4B2LA 2P6RA 5KNDA 4AKGA 3KTAA 4QXAA 3KQLA 4PC6A 1KI4A 1P2VA 3FB4A 4JLBA 2VHCA 4QHTA 4XD7A 4ACBA 1E9FA 4Q21A 5FFMA 4CEIA 1OHHD 4K81B 2IYQA 3QNUA 4HLUC 1Y3AA 4JLNA 2ZRNA 3PQCA 1JAHA 3B78A 4IJMA 4ZO4A 3HJNA 3QPUA 3UMFA 2V4ZA 1E0JA 2W2TA 5E4FA 2ZJZA 3AKEA 1CP2A 2GF0A 4DKXA 4QJ3A 2W58A 3PUVA 3NVAA 1UBCA 2GEVA 2GJKA 3PEVA 4XSHA 1FP7A 3H1TA 3UIEA 2QL6A 2NZ8A 4QOSA 5J40A 2Q21A 2ZJYA 1ZD9A 3AUXA 1BMFD 1UKVY 3KJHA 3KX2A 3GFOA 3B85A 2BEJA 1G291 5KPJA 4Q03A 2JJ1D 2GEUA 2OCYC 2QPOA 4XH9B 4B35A 2IYWA 1IXRC 2WWWA 1OF1A 4OHZA 3KKMA 4PAMA 4CT4B 2C78A 2ODBA 2CHQA 4L9SA 1IN7A 2WIAA 3LA6A 4GZLA 5EE3A 2R6DA 5L3QB 2IS6A 1HT2E 4EAQA 3B1ZA 4A6XA 2VP9A 4UNPA 5JEDA 3ZD6A 3OHMA 1NN3A 4MRSA 3RS3A 4X8OA 2Z4SA 1KZ7B 121PA 1S3SA 3AP2A 3W6OA 3R7WB 1GILA 1QHGA 3AEZA 4S35A 2J1LA 3NXSA 3GMTA 2CL7X 3O8BA 3OIVA 4PSVA 1EFCA 2ZVPX 3MG9A 5AJYA 1KJWA 3EZFA 2ZRJA 4A8JC 1IN6A 1Z47A 1VYUA 2WJHA 2YJTD 3ZVLA 1LV7A 4DUGA 4B33A 1H8ED 2YC2C 5BXQC 4V0OA 2QE7D 4FCWA 4NONA 1YRBA 2BV3A 2F1JA 2J7KA 4O25A 2UKDA 3KL4A 4UKDA 4JL5A 3VAAA 1R0WA 3EC2A 3KZ1E 2OFWA 4NHOA 1MO3A 4MKFA 3P4XA 4MITA 2W00A 3VKHA 2FPLA 3TJZA 3O8CA 4Z1MD 3EZ9A 3GD7A 2AK2A 3AF1A 2FG5A 1NKSA 4US0R 3C8UA 4IVPA 3GEEA 1TAGA 4AKHA 1E69A 1U2RA 3PV0A 1TU3A 3CM0A 5JS8A 3TUJC 1G8YA 4Q9JA 4R71A 2O8CB 5B64A 4Q02A 1AQUA 2XSZD 3IHWA 4AKEA 4D25A 3HWSA 1M2OB 2J7PD 2MSEB 1FNNA 5AWFC 1II9A 4KODA 3OAAD 4WOPA 2GETA 3H4MA 5G3YA 1QG4A 4ZV4A 2F43B 2GJ8A 1OXTA 4CVNA 4QL3A 1XFAA 4GI7A 5GVSA 2DCUA 4QRHA 2F7SA 1E0SA 2RB4A 3K0AB 4TMVA 5JJIA 1DEKA 4HB0A 2TMKA 2AL7A 2XXAA 3RLFA 1DBSA 4M53A 4GL2A 4QNRA 1Q22A 1R0YA 5C4GB 2C8VA 5L3SB 3W9YA 1IY2A 1T0HB 1Z07A 2V1XA 5G3ZA 1G3RA 1R0ZA 1G4AE 2QM7A 3MFYA 1A4RA 2BJWA 1ZVQA 2EFGA 3T15A 4P32A 4TWZA 1NLYA 3PXGA 3CX8A 4PQYA 3QKRA 4MDFA 3KQHA 3MJRA 4G3XA 4Q4JB 4RD0A 2IYLD 4ASUD 2OG2A 3PIRA 4PZZA 5L8VA 4TMZA 4V0MA 4HEJA 4MRPA 1YKSA 1S9DA 1KHTA 3D8BA 3DMDA 4W9MC 2DFNA 4EPVA 1N6KA 1W2HA 3WNDA 3U6KA 5AUOB 3DOFA 2WV9A 2WSSD 2ERXA 3TVDA 3WY9A 3ZLJA 3BH6A 4YXWA 2JDID 1J2JA 1P3JA 1XZQA 3I1FA 3WYFA 4Q9LA 1OXXK 2FEMA 4MQBA 2NO0A 3FKQA 3T5DA 5HZHA 1KO4A 1YU9A 2B92A 1SZPA 3ASZA 3AF4A 4LJ7A 1OIXA 2QAGB 3AVTA 5TDHA 1ZNWA 1OLOA 1EFTA 5TY0A 3IQXA 1P61B 5A5GA 4FINA 3UKDA 4V0NA 4B34A 3P27A 1R2QA 1L4UA 4BFWA 2VHTA 1MV5A 4I4LA 1JQJC 2H17A 1SVSA 5C1BA 1JNYA 1W5TA 2ZRHA 1FX0B 2YVUA 3P20A 1QHNA 3QG1A 5ANRB 2ZR7A 2QP3A 1LF5A 4PPFA 1Z06A 2OAP1 2QG6A 4OJQA 1OKKA 3RDPA 4Q00A 1EG7A 1BYUA 3UMSA 2WJIA 4Q4LA 1UEIA 3QEOA 4A0FA 1R5OA 1NSTA 1MOZA 2Y8EA 4NH0A 2GVZC 4GFDA 3LQQA 5LBIA 3MSXA 3THWB 2ZS7A 3MAAC 3UWKA 1ZW6A 2ZI6A 4HAZA 2OCBA 1N5IA 3LXRA 2HCBA 3RS2A 4B6FA 1RYFA 5HTKA 4G1UC 3T5GA 1M7HA 4D6PA 5JCZA 2VSXA 1I4DD 4FMDF 3RSOA 4OYHA 1KY3A 4FMDB 4US2R 4NYIQ 4QBFA 1Q1ZA 3SFVA 2CL0X 1XD9A 3QKSA 4TL7A 1RFLA 2Z83A 2EFDB 2ZI4A 4BFYA 1ONBA 4BRUA 1R10A 2MSDB 3N70A 1W2GA 3R9IA 3NBXX 5IK2D 1P2SA 4ZCLA 3FMPB 2PZEA 3EZ7A 3PUWA 2B21A 1VECA 2NIPA 1HY3A 2JJ8A 4PAQA 2GXAA 2V7QA 1CXZA 4B71A 4KV9A 1KTVA 1JALA 4RY2A 5CLLA 1EXMA 1UEJA 1GAJA 1NG1A 2NGRA 2QAGA 2WJYA 2Z6VA 5K8UA 4B3DA 1A2BA 1E0AA 2WOJA 2V8OA 2R2AA 1D9ZA 3ADBA 4MRRA 2GZDA 1Z08A 3TBKA 4OI4A 3WBKA 1FX0A 3QXJA 4QKQA 3EASA 1II8B 4IOJA 1JJ7A 3I32A 4JYBA 2RGNC 5FPYA 4F4JA 1KSGA 3QSYA 1ZM2A 1O87A 1XPUA 1X3SA 4PC1A 4HDOB 3FHCB 1QHXA 1Z5ZA 4ZDIA 5DISB 1C9KA 1DS6A 2SHKA 3LBHA 1G5PA 2D2EA 3THWA 2FJUA 2GCNA 4A2QA 5JWOA 2A5FA 2FFAA 3RS7A 4RD6A 3KKOA 4Z51A 1D2EA 2QUZA 4KCGA 3C5HA 4HUTA 4TL8A 1HH4A 4M1WA 1KDOA 1OPXA 4V02A 2F3RA 5JHHB 2IYYA 1SHKA 2REXB 2WKQA 4ON9A 2PMDA 5F9HA 2OM2A 2O5VA 1G8PA 1MABA 1Z28A 4Z54A 2ZM5A 4PSAA 3Q8XB 4EFMA 4URZR 4BLOA 1E1QD 2OUKA 2WSMA 1E79D 5JHGB 5LD2C 4A36A 2A30A 3KJIA 5LB2A 1DO2A 2F3TA 2J41A 3UWOA 4GRAA 2IXFA 4LJYA 4PXAA 4AG6A 4POAA 4HAXA 4B2PA 5FOSA 1N5LA 2FPKA 4A8JB 4JKYA 1GKYA 1TQ4A 2IF2A 5P21A 4C0AC 1S1MA 1XTKA 6Q21A 1WE2A 2QGZA 4Q9KA 2ERYA 2RGAA 3A1VA 2IWRA 4B43A 5C46F 8OHMA 5L3VA 2OBLA 3EPJA 4LJAA 1JR3E 4IOLA 1FNMA 3PEWA 5AUNB 3GLGB 4D26A 1SXJA 3CWQA 1KKLA 4KFUA 2XEXA 4TYWA 1RJ9B 4DEYA 1CBUA 2LKCA 1RE0A 3UG7A 2BMJA 3W3ZB 1B0UA 3U3OA 4MRVA 2R6CA 2ZUBA 4LGMA 4D2IA 3K53A 1EWQA 4CEHA 2B6HA 2DFTA 2QTFA 4MGYR 4C0JA 1ZD8A 1DAEA 4URWR 3IPXA 3THOA 3QBTA 4LC0A 3LO5A 2YOHA 3QY0A 2F9MA 4HZUA 4XTCS 1VYVA 3Q85A 5J5CA 4OHVA 5F2EA 2WJGA 4HLDA 3QENA 2ZI9A 4DSNA 4A0RA 2BMDA 1UPTA 2GAOA 3IIKA 5FBLB 3THYA 4C7OB 4FCTA 1U94A 4IVRA 3SC3A 1XEXA 4JYCA 3LXXA 5FL7D 1GUAA 5KNCA 4PQFA 1W0KD 2OXRA 4MGIR 1A1VA 5JCPA 3AVUA 3OE7A 1KJYA 4DB2A 2JEOA 4F92B 4ZPXA 3U2QA 4BZPA 3LAWA 4CGZA 1KI3A 2OCAA 1ZJ6A 4WXPA 2B7BA 3IQWA 1AM4D 1W0JA 3ZDQA 2RAPA 3OEHD 4DDWA 4XSGA 4A8JA 3T1TA 1CR1A 1W4RA 2OCPA 2WWHA 4A0GA 1T3LA 1UF9A 5JFGA 2F1IA 4QJ4A 4D0GA 4ZI3A 3I61A 4MA4A 3BB4A 4A9AA 4WVFA 1T5IA 3CWZA 3PUYA 2ZRKA 4LRWA 2V54A 1B23P 1NG9A 1RIFA 4LJ6A 1PZNA 4QNMA 1OJLA 5F9FA 1RJ9A 3RRNA 4M9QA 3TK1A 4QGGA 2WOOA 3UPUA 2H16A 1AN0A 3NKVA 4TZ6A 2GJAA 2XOKA 3QXXA 1GRNA 4EDHA 3UMRA 3IILA 5EP1A 2VP5A 1J7KA 4LPSA 3U4QA 1ODFA 1II0A 2PLFA 2ZANA 5JZVA 1LVGA 2R6FA 2CCGA 1KSHA 4BEJA 1BIFA 5CM8B 1XNJA 2JCSA 3A1TA 4XTRA 4C7OA 2HXYA 4TTQA 2UZ3A 5C18A 1GRQA 1FTNA 1P60A 3H84A 5FUVA 3WXMA 1G20E 4C0BA 1G64A 4KFTA 1OH7A 4PC2A 3BJIC 4V0KA 4URUR 1RVDA 1NL3A 3SHWA 1S4QA 3LVQE 2WKPA 3MWJA 1OT3A 3HDTA 2I3BA 1KSJA 2PL3A 5FBVB 4IVQA 2WZQA 4HUQA 3EIQA 5F3WB 4NYIR 3OZXA 1LB1B 4BASA 5LPNA 2XB2A 1CRPA 2C9OA 2ZIAA 4PTLA 1T8UA 1SVLA 1GKIA 4LDJA 4Q7MB 4C0LA 1F48A 3MRSA 4HI0E 2C95A 3Q7PA 1GSIA 2ATVA 2X19A 4C30A 3A6PC 2ODEA 2AXNA 3NH9A 4ZIRB 4HLQB 3R9WA 1YZTA 2DYKA 4GP7A 2C77A 2OILA 2D4HA 3ND8A 1FUUA 4XWAA 4KVAA 3WMGA 4TLBA 1DE0A 3LRPA 2H7VA 4F38A 3FYHA 3RYTC 3C16C 4MKHA 1I4LD 1KK2A 1TUIA 3IO3A 5IHPA 3FOZA 4OKSA 1SKYE 3CLVA 3MMPA 5KDOA 3AVPA 3L2OB 3B1YA 2AHOA 3OESA 4LC1A 1E2IA 1CR2A 1E4VA 3L0PA 4D4JA 4MYUA 2HV8A 4Q7JB 1MO5A 3BK7A 2ZITA 3CPJB 2EWWA 3B8HA 2JJ2D 2BEKA 3FHOA 2J59A 1NN1A 2YINC 4LX0A 4KBFA 1IONA 4CF7A 1OV4A 4Q1FA 4LI0A 1KK3A 2IF0A 1S96A 1S9HA 2ZE6A 1BO6A 3C7KA 3CR8A 4YLGA 2GTPA 3A4NA 3QXSA 4O2LA 2G1JA 2PCLA 2NO6A 2GHIA 1ZUHA 3K9LA 2ZU6A 4PSKA 5H1YA 3CNOA 3NHBA 2O0KA 1AS0A 3QUSA 4M9SA 2WWXA 1KNXA 4HSEA 4XVQA 3ZVNA 4IDPA 3WMEA 3EXAA 1OXUA 4DLZA 5EE1A 2RKOA 4DBLC 3ND9A 3AVXA 4CT5A 1Z6XA 4KLZA 2ZSAA 5E95A 2YYZA 2R62A 3H2YA 3R9XA 3TMKA 1XEFA 2IS2A 5G53C 1D8TA 3H0KA 3U7EB 4ZIRA 1NLZA 2NTYC 1E9EA 2BBWA 3QF4B 2XTNA 3F8TA 3NG1A 4KLNA 3GLHA 3PFIA 4WAUA 2ZI3A 3L43A 1U0JA 5TXGA 3KB1A 4JJZA 3SJBA 3U44B 4CEJB 4M8NE 2AKAB 3TVTA 1GIAA 4IXMA 2OV2A 5L3RA 2QENA 4N0DA 1NVWQ 2ZUDA 3SFZA 4MH0R 3U3JA 2QPAA 1NJGA 4GOKA 2BOVA 4KAXA 3LD9A 1SVMA 4JLVA 2O8EB 3QVVA 4M1SA 2A5YB 4C0QC 2YWGA 1SQ5A 5G40A 2QU8A 5LD2B 1DAFA 3IPYA 2QP9X 1E2NA 3VR4A 1N5JA 1Z0FA 1AKEA 3TSOA 1WF3A 1UDWA 1XMJA 1TTTA 2A5JA 2XJ4A 1NBME 2BC9A 4LCBA 4Q01A 4DCUA 4BFZA 3VFDA 3O47A 2N42A 3U3KA 4I81A 2BMEA 2XNDA 3TAHA 5FL3A 4HB2A 3THXB 1CF4A 5G41A 3SS8A 1US8B 5CK5A 5BN4A 5B57C 1NN5A 2ANBA 1W4CA 1Z2AA 5C4MA 2AX4A 1KO7A 4RKEA 1MRSA 5KUTA 4RKFA 1CRQA 4WZAE 5JECA 3U6BA 5GADl 1J90A 3P4YA 4W5WA 4WA7A 4PZYA 3BOSA 3ECCA 4Q4HA 3TUZC 3SYLA 1NP6A 3EPHA 3T34A 1YE8A 2H18A 2OBMA 5L3QA 2IX3A 3TIFA 1YR9A 3JVUA 3A8TA 1NMZA 2B8TA 2V6IA 3QF4A 1PLJA 3FVQA 3M1IA 4CW7A 4MGZR 4YQFA 4EPWA 4GMDA 1COWD 1W5SA 1GNRA 1E32A 4P31A 4ACAA 3CRVA 3SYKA 1CR0A 2ODWA 4CEJA 1XU4A 2BVNA 4B3GA 1VCOA 1GDDA 3GPLA 2P6NA 3CBQA 4IFEA 3GJXC 5AR1A 3K0EA 3CRQA 4QM6A 1OFTA 1CULC 2XTMA 5FOTA 3BIFA 4LWZA 5HE8A 2G9NA 1D5CA 2WPDD 3B5JA 3KUCA 4AK9A 2O8EA 3TH5A 5EUMA 5JRZA 5DHAA 1RRGA 4Y0VA 3NTUA 4YDSA 3NEJA 3RNLA 4HLCA 4JVLA 1XXHE 2PCJA 3ZH9B 1FW6A 4A6PA 2VF8A 5J4HA 4PC3A 3BH0A 5FTMA 3OEED 1N6RA 3FMIA 4JZKA 1BYIA 5KPDA 4RD2A 4P0TA 2W6ID 3SBEA 1N6IA 3GJ3A 3KQNA 3THXA 1ZC4A 3AUYA 4Q47A 2QEQA 4AG5A 1WCV1 4KFRA 2EYQA 5GVRA 4DLSA 4FN5A 1G1MA 3CRRA 3LBNA 1OH5A 2OAQ1 3SBDA 4PHHA 1KIMA 3TR5A 1G7RA 4O3MA 2REOA 4JLOA 3SNHA 2FGKA 3AVOA 1AS2A 2QRNA 4TT3A 1U90A 3TQCA 2RGBA 4BWYA 3C41J 2JIZA 3L0SA 2J46A 3KJGA 1Z2CA 1Y63A 2QORA 2V55B 4NKRA 2ONJA 1OH6A 5JWHA 1P9RA 2W2XA 3P1JA 4DLWA 1E2JA 5GJBA 1OXSC 4LPKA 4PFSA 2KI5A 4YMTA 1TPZA 2QSYA 2V6JA 3I3SR 1R7RA 3I62A 2HLDA 5DIFA 1ZIOA 4DCSA 1ZC3A 1ZM9A 1F2TB 3HU3A 2WWIA 4EPXA 2EU8A 2IT1A 4JIMA 4RSGA 1UFQA 2JA1A 1E3MA 3L8YA 1JEEA 2VL7A 2WIBA 1JECA 3A4MA 3CNLA 2JLZA 1G7SA 4FI3C 2NO9A 2IUSA 3NIBA 1Q1QA 4JBXA 3DM9B 4DT1B 1X8KA 2J5XA 2ZAOA 1F2UB 4P4SB 1HQCA 4D4MA 4I1UA 3BAFA 2YKGA 3I8SA 3KDSE 2ZS9A 2L0XA 1OHHA 4QC2A 2JAQA 4D4KA 2OZEA 1XTJA 4Q9IA 4KYUA 3G0HA 5J47A 3C14C 3B1WA 4JLDA 4DHEA 3IBYA 4TMXA 1IOZA 3A36A 4NCKA 4ITRC 5SZJA 2DFKB 2VA8A 3ADKA 3DM5A 2QSZA 3QJYA 1Z63A 2J0QA 4R98A 1KO5A 1GTVA 3LFUA 2ZRGA 3GLHE 1X6VA 5D3QA 1XRJA 2YHSA 3HR7A 5CJ2A 1BMFA 5J4KA 1DELA 3GFPA 1GRRA 4K8OA 1CKEA 2OEPA 2FSGA 3BERA 2JJ1A 3D7MA 1FMJA 1SHZA 1BKDR 1FL9A 2JLWA 2W6JD 4WW0A 1JR3D 3RC8A 2F9LA 3MGCA 4NYMR 1F60A 1VG1A 2ZSFA 4DIEA 1NVUQ 2QRZA 1VPLA 2CE2X 2G6BA 2VSOA 3K9GA 3D3QA 5CYOA 3VKWA 4A1FA 5KTYA 2XNSA 3HP1A 4RVCA 3CPEA 4M2LA 5KSOA 5JJLA 1YZNA 2QT0A 1ZNZA 3GLFE 4L9WA 4M9ZA 3R7WA 3SDZA 1TUEA 3LX5A 1S1CA 2IW3A 2VF7A 3GFTA 1QVAA 1G3IA 1E94E 2A9KA 2RHMA 3IHLA 2PH1A 5KSPA 4A2PA 5BW8A 4B44A 5TVKA 4DT1A 4P4SA 3GEHA 2D2FA 2J87A 3DDCA 1OFUX 4DLRA 2JLQA 1L4YA 2IYRA 3BWDD 3EZ6A 4MYHA 4OQXA 3I72A 2QA5A 3GJ5A 1G8GA 3AKYA 1T3SA 1H8EA 3IBGA 4Q4AB 2ZEJA 2XB4A 4XVUA 1G9XA 2FSFA 2QMUA 1XP8A 3WP1B 1KAGA 2QE7A 4H1UA 2ZREA 4JVNA 1NN0A 2A7QA 3WHKA 4US1R 1Z6YA 3O8DA 1M7BA 3FFBA 3B9QA 2W2VA 1ESMA 2I4IA 4BFTA 1UAAA 3CRMA 3T1VA 2VH5R 4MGKR 3PEYA 2CDNA 1UM8A 4N0EA 1P9WA 3BB3A 4Z1MA 3CR7A 1WP9A 4JKIA 3CO5A 1U8ZA 4UNNA 1A5TA 3E2IA 2X77A 1EWRA 2XZOA 2J0VA 2O8CA 2DR3A 3X2SA 3MJHA 3SOPA 2GJ9A 1E2EA 2ZSBA 5FOWA 4KITB 2XSZA 4W7SA 3SEAA 3X1YA 1Q57A 2BHRA 1DG3A 5SZIA 1N6PA 4Q7LA 2H8KA 2J7PA 2P5TB 2AD1A 4XWKA 4OI1A 3C15C 3B13B 2KBFA 4DDUA 1R8QA 1VTKA 3OAAA 1G5TA 1YQTA 5JLJA 4DB4A 5CJPA 3MWKA 2F43A 2GF9A 1KSFX 4TYYA 3K0AA 4NP6A 4B75A 5CDFA 5JBQA 1W46A 3ZD7A 4IEIA 3PEUA 4GBMA 2DHRA 1UKZA 3S1AB 5L3SA 5FPKA 4KYIB 3ZGXA 3ASYA 2QT1A 4UJ3A 4MUBA 5KU1A 4DVGA 4EFLA 2DFLA 4FMBB 5JRJA 4Q4AA 5CIWA 1DOAA 2QTVB 1KI6B 4II7A 3UK6A 3UATA 3KFXA 3NC0C 3ZVRA 1ZCBA 1JAIA 2QGNA 2VP4A 1MO6A 1Q1EA 3F0TA 4Q4JA 4UNSA 1E9AA 2E9SA 4ASUA 1AS3A 1W1WA 1Q0UA 2N1BA 2IYVA 2VSFA 2JLRA 1GITA 3C5CA 3QXHA 1OIVA 3RRYA 1OE0A 4HZIA 2ZJ2A 4IXNA 4BGDA 3GLIB 2AXPA 1X1SA 2VPPA 2RGGA 1G7TA 2FZ4A 4B74A 4UNQA 5BQ5A 2VP2A 1ESNA 1E2MA 4V03A 1NMXA 1O3YA 1PLKA 4B32A 2WSSA 1IN5A 1D6JA 1VG8A 3V9PA 5EP4A 1AA9A 4M21A 1E98A 1EGAA 1U9IC 2ZI5A 1TQDA 4MYTA 2WVJA 3GJ8A 1JQLB 4LJ8A 3LWNA 4JLJA 2R6AA 2P65A 3U61B 5KYKA 5EXTA 2G0TA 3R8FA 2K5UA 3DL0A 3RABA 3KQKA 4Q18A 1T0JB 3CNNA 5SZHB 5J4VA 2ZETA 4DZZA 1CJMA 4LK2A 5E7JA 4P3YA 1XCPA 1IQPA 1G8FA 2OFOA 2KWIA 4TQAA 4HAVA 2PZFA 5JWRA 4B76A 2J0SA 1KGDA 4UXJA 3K70C 2CL6X 1LTQA 4O0MA 5B2ZA 3EPKA 2YOFA 1KYIA 1SKYB 4Q5IA 3GEIA 1P9NA 3S1AA 3J81k 1X8JA 2CLSA 1K8RA 3B7GA 3BS4A 2FU5C 3B1XA 2FE4A 1KDPA 5DGXA 2OLJA 2GCOB 2PEYA 3EWAA 2XZPA 5J4YA 3T06B 2IYXA 3LVRE 4BEBA 2MMGA 1R5NA 3G82C 1WRBA 2VTKA 1VG9B 3PUZA 4ARZB 1E96A 4TYPA 1G17A 1UBGA 4FD2A 1NI3A 5HR5A 2WJJA 2NOAA 3T35A 2CNWD 3HR8A 3GLIA 4PZLA 5AJZA 1KNQA 5JSZB 2FMXA 3AP1A 5KSYA 4IDOA 3OIYA 3ZYCA 1ELOA 4DDVA 2C99A 2ZJ8A 5M04A 1S8FA 1TEVA 4MKGA 2VBCA 2AFHE 4L8GA 2BWJA 5KSZA 2AFIE 4TTPA 2O8FB 3ZIAD 3HYRA 5IK2A 2LKDA 3PCRB 4Q1AA 421PA 3KFVA 5H68A 3KKQA 3N5CA 1RRPA 4RJLA 3K0CC 1NSFA 1PJRA 1Q3TA 1ZUIA 4FIDA 4LBWA 2LWIA 4QHSA 4P33A 4HLUA 1LW7A 2Q3MA 4UXIA 2RGEA 2AK3A 2OXCA 4OHWA 4V0ME 5TARA 3CF6R 1E1RD 4EIWA 2XJ9A 1TQ2A 5E3HA 2CCJA 3EAQA 5FPHA 2R65A 1I4TD 1V43A 2ZRBA 1P4SA 3D31A 1II8A 2J3EA 4YMSA 4XWOA 3RHFA 5K8TA 5IF9A 1FUKA 2IXEA 2ZI7A 3H86A 3QXCA 4DC9A 3W5IA 5JJKA 1P2TA 2YNMA 5ELXA 2GCOA 2H5EA 3EG5A 4TLCA 1N6NA 1IM2A 4JLPA 2GXQA 1NY5A 2Z0MA 2CEAA 3LLMA 3PVSA 1CEEA 3EZ2A 4HYYA 4B3XA 1NBMD 1XEWY 1Z0KA 4ARZA 3RS4A 1D2MA 2FNAA 2ORIA 2IXGA 4EQ6B 1QBKC 2BIFA 4PPNA 4EPTA 3CONA 3W6NA 4WXRA 3ZZTA 4G5SA 5JI2E 2IS4A 2FV8A 1YR6A 3A58B 1GKUB 2D7DA 2BM1A 2H92A 4JLAA 1DVRA 2FA9A 1G3UA 3CH4B 4UQOA 4HATA 2GAAA 1E1QA 1E79A 3TW4A 1J8MF 1W4BA 1T4GA 4MKIA 2EYUA 5HCIA 1WDTA 2VRWA 3CW2A 2IA5A 5HZKA 4C2UA 2J0UB 3REGA 4RZ3A 4GNKA 4DLXA 4TSFD 4L15A 2CXXA 3QPWA 4QHYA 4AWXA 5DSZA 4GZMA 2D74A 3SJAA 5EJEA 2O8DB 4EUNA 4OL0A 3GLGA 1XJQA 1K6MA 1XCMA 3BFXA 621PA 3IKJA 4R2IA 1XPRA 1EFRD 1FZQA 1T91A 3M6AA 4BLSA 1NRJB 4C0SA 4HDQB 1T3HA 2OESA 1QHHB 4QGFA 3AF3A 2I1QA 3GCGA 5IRCD 5EE9A 3RRZA 5JMTA 2QI9C 4FWIB 1XXHB 2QP4A 2Q3HA 2R8RA 2HT1A 1DAGA 4G01B 5DYIA 5FUXA 1UADA 3BB1A 4PHTA 2JASA 2VQSA 3AF0A 4EQ6A 5FUWA 2LCFA 1N6OA 1P75A 2BBSA 4KU4A 3HPQA 4TQUS 5TMPA 2EW1A 3HPRA 4M1YA 3N2EA 4CDGA 4HAWA 2OLKA 4R7ZA 4LY6A 4DCTA 3V4RA 1ZNYA 1YZLA 2CLDX 3T1OA 3W8RA 2ZJ5A 3AH8A 4Q66C 2V1UA 5FL7A 4N1AA 4EJSC 1W0KA 1KI2A 1YRAA 3RVBA 1XBTA 5TV2A 5A4JA 4JSYA 4PX9A 1RC8A 3GQBA 4QBGB 4LUCA 1NIPA 3EIHA 3W6PA 2Q9BA 3LY5A 4F7WA 3C4JA 2Q6TA 1TF2A 4JVMA 1Z0IA 2ZYWX 5B58C 2GBLC 5KO2A 3MD0A 5CB8A 3TGPA 4PC7A 1W7AA 3L82B 1WB9A 2WWFA 3OEHA 1MRNA 3NBFA 4A4DA 2OSBA 2X2EA 2J45A 1U98A 1CR4A 2R44A 3I5YA 2FFBA 3OF5A 4JBYA 2FF7A 2QZ4A 3HU2A 4R9UC 2BCJQ 4OHYA 4JLKA 1W36D 2ZRDA 3LV8A 2VO1A 4B47A 2JLUA 1LY1A 4EFNA 4F4CA 4ESHA 2CE7A 3OIWA 3P32A 4E09A 1GL9B 1K5DA 5E7MA 1KMHB 1F5NA 3BRWD 4HAYA 1UKYA 2NPIA 3QPVA 4XOIA 1TL7C 5DH9A 1X1RA 1QHHA 4D82A 2WWYA 1JEDA 1EESA 4LHXA 5FBRB 2OT3B 4NZYA 1I2DA 4FW9A 2X1VA 1XDBA 2CK3D 1ZD1A 2IYSA 2JATA 1J70A 2RGCA 3DZDA 1P6XA 1SVKA 1M6NA 1U81A 3HYTA 4QG7A 1KOFA 4KSCA 4NTZA 5DO9A 3RS0A 5H8WA 1E6CA 3IEVA 1C4OA 1NMYA 1XD2B 4LOAA 2IHYA 4OQFA 1NNEA 2B8WA 3K1JA 3TR0A 1SKQA 3NBZC 1SXJE 2B7CA 1TX4B 1Z6AA 5K8IA 4LBYA 4Q1EA 2YWEA 4D80A 1ZBDA 1TF7A 4LBZA 4NYMQ 3FMFA 4JLMA 4DXAA 1CLUA 1Z0AA 2ZRCA 4G0NA 4NYJR 5HKKD 4PPGA 2FOLA 3M0EA 1AKYA 4PPQA 3FDIA 3Q7QA 3K70D 1H8HD 2F55A 3K70B 1FOEB 2Z4RA 5AUPB 4URXR 3K09C 2CVHA 2PZGA 1NVVR 2GDJA 2V9PA 4A82A 4PHGA 3U7GA 3BD9A 1VHTA 3GJ4A 4DLUA 4ILEA 3AVVA 3OFND 2WAYA 2F1HA 2C9CA 1KI1A 3GLFB 3I5XA 1JR6A 5HE9A 5KDLA 2GA8A 4TN1A 1E2KA 5B30A 1S3GA 5EP2A 1HURA 1FPMA 1I2MA 1J8YF 1RRFA 4IFBA 4B3BA 1GM5A 4RFSB 2GZHA 3FKSD 3TRFA 2WICA 4CIDA
chains in the Genus database with same CATH superfamily
4LQLA 5C7YA 4BP9A 1GT91 1MLDA 1NXWA 2Z04A 3DPSA 4MQ4A 3VO1A 4C3ZA 4CLEA 3X44A 5AW5A 1OSNA 2PKQO 1I13A 2NYRA 2XB9A 4CM8B 5BWMA 5KQMA 5IJXA 3GRFA 1BDIA 5B7QA 3IQIX 1FK8A 1LD3A 4I1YA 1ZM3A 1T8YA 2NVBA 5B4TA 4B3TB 1ZO8A 3FW1A 1HC7A 4D9MA 2DFDA 1MEEA 1ECJA 2X6QA 5T4BA 2X0NA 1J97A 1WY5A 3FBTA 3GZ4A 1OWMA 4TZTA 2POQX 3DZ8A 3I9LA 2BZGA 5K1ZA 5IEJA 4R5MA 1MKYA 1OCEA 1CUHA 1P6UA 1YIOA 3HC7A 5LB4A 2QOEA 2GCPA 2BTOA 3KTAB 2VBFA 5TB5A 3ZXIA 1XX6A 3CZ4A 3IUJA 3ZWCA 3RAPR 2AZMA 2LIVA 1ISGA 1E3TA 1E6WA 1VIAA 4UXHA 1PFUA 1TYBE 2ACKA 2YWDA 3D3WA 3ELDA 3IOYA 1YRQA 2Q0HA 3BCUA 3LDAA 2PX5A 1N2IA 1L5QA 3Q5DA 1XCJA 2Q1TA 3HJAA 4O4JA 5T3UA 2NQ2C 3CPSA 4F06A 2DLCX 1A5SB 4MQ5A 1F6DA 1KIFA 1EWTA 3GARA 1SEPA 3RKUA 2ZTHA 4E5YA 2DPLA 4I3GA 2YASA 4XX0A 4UARA 2Q9AA 5EEGA 3P2OA 4NNOA 1N75A 5DW3A 3B3AA 4MWCA 3DQPA 1ZAKA 4TTTS 2V6BA 1FRNA 5FBQB 3V1KA 4EHKA 4QDOA 1ZKMA 4H27A 5D7BA 4UM9B 1EXNA 1ZSNA 4I6JA 2J3IA 3NJRA 2GLTA 1FFSA 1Y6RA 5G1NA 3SYMA 4XW2A 3O26A 3U16A 3KR1A 3A3NA 3IBTA 1FF9A 4U7TB 5DEIA 5BWLA 3U44A 2E4AA 5TEVA 2JHFA 3EA0A 1GZVA 2UUPA 4KHZA 3RWOA 1P8AA 2JHPA 3VX3A 2FSVA 1I7LA 5ER9A 3IJPA 4BVHA 1GL3A 4IDHA 1JIJA 1KQGA 1NMSA 4C7KA 1DKUA 3F3YA 2VK2A 3AY0A 3GJ7A 5CB6A 1QE5A 2PXHA 1ECBA 1RAEA 1SGWA 3OU2A 4Q37A 2XCSB 1JVNA 2GLXA 3PKZA 4U6QA 5EQTA 2CL5A 2YFHA 3JZFA 2FSHA 4HDMA 5LZ9A 3E81A 2FZLA 3F74A 1A7KA 5BSKA 1JJBA 2DTEA 3BTVA 5DSTA 1FXWF 1XMOB 1JSCA 2C58A 3WVNA 1ZH2A 1O94C 3F3KA 4P4UA 1FCJA 2LBPA 4URYR 1OI3A 2ZBVA 2Z58A 4G4SP 3FBGA 1NJ8A 2LV8A 3HXQA 1T36B 1RYHA 5CFOA 3ZGZA 4O8ZA 5GV8A 1L1QA 2PBLA 3PCXA 3TKLA 3AI7A 3DFFA 2N0SA 3DT6A 1KEEA 1N7JA 2EFYA 2HDNB 3E1GA 3G5UA 1GKKA 1KYWA 1BOFA 4HNAA 3D5TA 4C5BA 5JCJD 2PD6A 3IQGX 3OSZA 1W44A 1VIYA 2GFQA 5EMNA 3A4YA 5IZCC 4IXWA 3ZTYA 5K01A 2P6OA 4B2IA 1C7ZA 4ZHQA 1NVDA 3PT9A 4K46A 2O6LA 4KXLA 1JH9A 4UTPA 3L8GA 1FMCA 1JXAA 1RKUA 3OCXA 5TPZA 3V33A 3PI6A 4LKRA 1E6UA 3RFFA 2CXSA 3W5HA 5IBPA 2QBYA 2HK8A 4H1VA 1M8JA 1SZCA 3OO0A 4HRAA 1BX1A 4BCDA 1U3DA 4YJGA 1U8YA 3CSSA 3GD5A 3VYTB 2GLUA 2TRSB 3HI4A 1OAAA 3JQAD 4IEEA 2QTAA 5AHKA 3MLAA 3UHFA 3J81A 3VDQA 2R97A 2XCIA 3T12A 3VR3A 5G1OA 3W34A 4WCFA 1SD2A 1YTUA 4JQYA 3P0EA 3BA6A 4QUGA 3UT0A 3TRDA 4EJSB 4IZIA 4IHKA 1SXHA 3SX4A 1D7OA 2W83A 4Q9DA 5FIUA 3DCIA 2NUTB 5JSYA 3AIIA 4C6TA 3ORSA 5CLFA 3FWNA 3SY8A 1W48A 2FEWB 3BREA 4CG3A 1HZZC 2XQIA 5J2UA 1EU1A 3UJ7A 1J99A 1OWLA 3ONNA 1XF9A 2OE2A 1TT7A 3GOQA 4IH4A 4URVR 2N3ZA 1JHOA 4ALMA 5T4EA 4KQ2A 1MX5A 3ENZA 2Z56A 2NXEA 2O57A 2OHFA 3LYUA 4I1IA 4YONB 3ROMA 1YDGA 5AFSA 2JFXA 3ZVKA 4C7MA 3OEEA 2JBHA 1FYEA 1Z4IA 5KOJA 1ENZA 4FXPA 3C1OA 2ZRAA 3VSCA 3O94A 1SH7A 2BM0A 3CRW1 3LUHA 3NAMA 2ZCJA 3QU4A 2GESA 1ODJA 3FJYA 1GQOA 4IW3B 3C6YA 3RSLA 4D3SA 1XWFA 4NEGA 3HNRA 4WUVA 4OGGA 1VG0B 3RIYA 4RJKA 3P2YA 5F33A 4XJVA 3BF7A 3AGPA 4KAFA 4DLVA 1IIBA 4PYMA 6GPBA 4K6KA 3HSKA 4P4NA 2XNJA 1QV7A 3MZ0A 2Q7XA 3DHNA 1VYHA 3DE1X 3F6SA 3LLUA 4MUHA 3OY2A 4NCNA 4BQPA 4HS9A 1FTYA 5CXXA 3TM4A 3CLSC 2C3UA 1PJ3A 3TXXA 1T34A 3AVQA 3K20A 4LZOA 5DNVA 5EUQB 5KYTA 3NBKA 4CDRA 4DCCA 4D44A 4DRZA 3H7AA 1TYAE 3V80A 1WR8A 4ZT5A 1EUCA 1ZXLA 1K8XB 1VPDA 2Y3IA 4S1TA 1PG5A 1OBOA 2XVAA 2FN3A 3B9PA 3GP8A 5HQ3B 4YXWD 4OQ4A 4ZANA 4YHHB 2ZU0C 3IHKA 4AJNA 1H2EA 4BE4A 5F4ZA 1YJ5A 4GOXA 3D43A 3Q3JB 2XOEA 3JAKB 1PT6A 3EYAA 1NE7A 3VPDA 1D4FA 1QZZA 2BCGY 4QUIA 4WI1A 2PEZA 4L3OA 1EX6A 3TEFA 3GELA 4U02A 4F8YA 3EGEA 5KYWB 4F5WA 4PF1A 4AD8A 1GNPA 4KO4S 5IUJC 1M34E 3L9WA 2H8GA 2R5WA 4XR9A 2BDUA 2AWOA 2OMEA 2PKCA 1LH0A 1Y1RA 1DRKA 3NONA 3FLBA 5D1HA 3JQEA 3IEMA 2BTEA 4HX9A 5A9SB 1R6DA 3NVKI 3K1AA 4GDMA 2P30A 3QK7A 1FZTA 1AUOA 2G82A 2VJYA 1Q0HA 1D2NA 3GAAA 4G1MB 3PENA 1JJVA 3EUWA 1NFRA 2HA5A 2J9ZB 4BRWA 2I9PA 3PC8A 2R3SA 2BW0A 2AMVA 2HRQA 5K0BA 2JCVA 1IXSB 4GLLA 3SKVA 1WPGA 2JAPA 1KS9A 4F72A 1PJSA 4NE9A 3RRFA 1IBRA 4DMHA 1MN6A 1FRQA 2W6JA 4YCLA 3RSZA 5J9FA 221PA 4QBIA 4DG8A 4AJPA 2FAXA 1XVLA 2JJYA 3AZOA 5JZOA 1NVFA 1FY2A 3GN2A 4QJ5A 4EX6A 3DS8A 1LSOA 2CCKA 3K8YA 1W9HA 4J0JA 1UBKS 3O4FA 5CT6A 4H0FA 2O0JA 2ZRFA 2C94A 3HGMA 4QWMA 4MYCA 4Z4EA 2DFPA 3JQRA 4R1PA 3Q72A 4TKMA 3QKSB 4H3VA 3N59A 1G59A 1LI7A 3WYBA 2ECQA 4FDVA 2ZIFA 2Q3EA 1M0SA 4HDNB 2CXRA 4DFDA 2Q28A 5TF0A 3WK6A 1FJHA 2AS0A 1PV2A 1YHYA 4DJTA 1R15A 2PFSA 1YJCA 2NO4A 2V7QD 3KWJA 3L4KA 3VHLB 1T5LA 4AY2A 5BN1A 5BO5A 2RJ3A 4BUJA 2ZBUA 1G5HA 5J2TB 2IPLA 2Y67A 1YVDA 1GN9A 2CHGA 4GSLA 2WD7B 4P93A 1YB1A 1B73A 2FP4B 5CM9C 4AJLA 3Q1KA 4CYMA 5E6SA 1VL2A 4UDXX 1W36C 1NLUA 2Z57A 4P08A 2AE1A 3LLSA 4PY2A 2GVDC 1BAPA 2ZVQX 3LPCA 3CZ9A 1CQIA 5LM3A 1MG0A 1IUPA 1N8KA 1WZNA 2ZRMA 3FOAA 3LS2A 4KAAA 4EY5A 1Z74A 2Z8YA 3CSUA 3U7HB 2JBWA 2CBXA 2NVWA 3ETEA 1T4MA 3T3HA 2KHZA 2NU8A 4WNYA 4TGLA 4B3CA 5JYDA 4X9XA 3FN4A 4U00A 3IRVA 1RAAA 1GEGA 4FMCF 1HM5A 4YT5A 1UDAA 3AZPA 3V97A 1VFPA 4G0ZA 4J9VA 1U0RA 3HQ4O 5FI0B 5LXTF 2D0OB 2I6TA 2VZ0A 6REQB 3T6KA 3CB4A 3M6FA 4ID3A 1QDEA 1T1JA 4IIDA 3RAEC 2VRNA 1H2FA 3CINA 3SS7X 1KZGB 3JQ7A 4YMIA 3TTYA 1QIIA 1BJRE 5CFNA 1JQ3A 1TC2A 4G0QA 4BVJA 3BBPA 2JLAA 1V4VA 4GPIB 1IDN1 1RPNA 5T8KA 3IOBA 4G5RA 3R5TA 1N8TA 1YJXA 3JY6A 2EARA 3RROA 3VKVA 1BN6A 5IFKA 4AZSA 5JYCA 4CLXA 2HMVA 4KUHA 3PX7A 1M72A 2C20A 2G83A 1OWOA 3LWZA 1ZMXA 3FNQA 1G8HA 4AYWA 5AW9A 1Y3FE 4ML3A 1AQYA 5ADVA 3SQXA 3BGDA 4C78A 3PG5A 3WGJA 3H97A 1PWHA 4U2DA 4F2WA 3VPBA 4ZXFA 5GJCA 1KI6A 2E55A 3AESA 3N28A 4WESB 3ASUA 3NBMA 3U31A 1R0LA 3LZ6A 1SXJB 1Z36A 1G20A 1NTRA 2O0LA 1P0QA 5IYZB 1T10A 1XZDA 4YJKA 4EG7A 4OJNA 4LSWA 4MVCA 2PL9A 3KZVA 3LC2O 1DQZA 1QO9A 1E62A 1EUYA 4OK5A 1PS0A 3LX8A 1K8YB 1EK6A 4OOEA 1TT5B 4QUHA 2PKXA 1WUJS 5LUBA 4FT2A 2JW5A 1W5FA 2ZE5A 4WZBE 1H2HA 4HWGA 2EW2A 4L73A 1KQNA 1E2LA 1FSSA 2O23A 1X1BA 2BP7B 1X7DA 1YZQA 1TD9A 5K0CA 4UBJA 4WERA 4FB4A 5HDQA 3CB2A 4G5GA 4PBRA 4UREA 4TL9A 2VJMB 1OFUA 1H5QA 2GXSA 2HIGA 2R751 4ZYYA 5HVNA 2WF6A 3O2SB 2WHXA 2H4ZA 5HGJA 1QB7A 4M1KA 1DMRA 2H3EA 5AOBA 2QYHA 3DKVA 1AXEA 2GM4A 4D4LA 1JLLA 2R7KA 3R20A 4GXQA 4WZ6A 2GRJA 3JVVA 2ZJ0A 1QORA 1WXQA 3UWSA 4E5KA 2RHLA 2QRGA 2X7XA 1WKVA 1NVTA 1ZP6A 2I29A 4YJ2B 4Q19A 3T7DA 4M98A 4AP6A 3D6HA 5K7SA 2HW8A 3G85A 2B6NA 2OD9A 1W47A 2GKSA 3R0XA 3SJZA 2QLMA 3ZBPA 3QPBA 1Y9EA 3WHPA 5IANA 2FPUA 3CZRA 2D6FA 4QIHA 1EIZA 1NNI1 3GZNA 5C1IA 2NPFA 4ZZIA 4S24A 1DZ3A 2REBA 3C3WA 1V3VA 3COZA 1J56A 3IIMA 5E7IA 5FBWB 4OQPA 1MW8X 1T25A 3H0EA 1E2QA 2GXUA 1MVOA 1EVQA 1FEZA 2YZ7A 4MLCA 3T8YA 2GK6A 4L5YA 1U0LA 1JHDA 4COKA 1SCUB 4Q93A 4JL6A 2QZSA 2J9FB 2BHTA 1CYDA 1KAHA 2AN4A 2FSUA 2R7LA 3MUFA 5EXDA 3MBKA 1UQUA 1GN8A 1R0XA 2I33A 2AJDA 3L6EA 1YL7A 2BMFA 4XIGS 4KIWA 5BV0A 5HZMA 5ALOA 4NBSA 3W4KA 4BHTA 3K0SA 3I9JA 3N5KA 3QOXA 4GPD1 3DD1A 3K1ZA 3CR3C 1QFMA 1UIMA 3PDUA 2VZ9A 1C7QA 1K75A 1M1YE 2C5EA 2XD9A 3DGFC 3N2NA 5HF9A 5I7AA 4QUJA 4QQNA 3O3NB 4LXQA 2RAFA 4G5XA 5AXBA 5TF4A 3O75A 2BDEA 1I6WA 3EXIB 2GCGA 1RAIA 3VC3A 4ER7A 2O8FA 1M10A 3BDAA 3CUEF 4GX5A 1ADJA 4YS6A 1RAFA 4LJ9A 4ZYXA 3SZUA 3DEFA 5BVHA 2CJWA 3ETDA 3N2GA 2AD5A 3SI7A 2ZPUA 3EQZA 4HD8A 3ZN2A 4QGSA 1U2GC 2XMPA 4MS3B 2EF0A 3L7MA 1Y9DA 2CMDA 2PGAA 1ESDA 1YJQA 3MWLA 3RIXA 4FYMA 2QVLA 1OYWA 4HB3A 4KTTE 3SX2A 1HFWA 1UDCA 4RWEA 3ZCUA 5FR1A 2ZM6B 4G85A 1ZCJA 3L18A 2EZ8A 1EKXA 2W22A 4WA8A 4DQUA 5K0GA 4OGLA 2I78A 1ETHA 1WL8A 3ENQA 4YRIA 2V98A 3H87A 1RLIA 5T4FA 3IEPA 2FHPA 2P4EA 4AJOA 4RY9A 1MNAA 1UKEA 5JIBA 3HKBB 4AWBA 3MA0A 1ZVVA 4Y3UA 3S0JA 3UEOA 4D7AA 1J9ZA 1RP1A 3A14A 1FJ2A 1MJGA 2V65A 3DMYA 2XECA 3ICEA 2ZFUA 4MUXA 4ZAGA 3GH1A 3JASB 3E2PA 3AP3A 2VT2A 2W48A 2UAGA 1UJ6A 1XXLA 4P82A 1R8JA 2DULA 3H2SA 4YV0A 3ITEA 1QGUA 1PJAA 1XRNA 2CD9A 1JJFA 2VKQA 3PRJA 2PWAA 2OO5A 3UWMA 1IDOA 4N5NA 1M0EA 3NUZA 2Q1WA 3E48A 3UH0A 1GFZA 2J0EA 2A6PA 2I66A 3D7RA 4S0XA 5ECGC 1GFIA 3TS1A 5KNDH 4IQGA 3U5TA 1X7ZB 1U3TA 2QVCA 2J9YB 3TE6A 821PA 2H9IA 4WZAA 2IEYA 3RTAA 2C4VA 3MAGA 2QQ0A 3FZEA 1CYEA 1L2TA 1XZAA 3FNIA 5BR8B 4RXMA 4C0XA 5D86A 2ZW9A 3ROEA 1QP8A 2F00A 1KDRA 1CU1A 2RMKA 4PLGA 3WAKA 4D9HA 4DCPA 5BSVA 2JPDA 2QPTA 3WDSA 5C8YB 5DU2A 4HNVA 5FPPA 4MUAA 1IWPB 1KI9A 5CFRA 1GOTA 4HH4A 3KNZA 3JQ8B 2CXTA 3LH5A 3PITA 4L27A 4TSFA 2B1IA 3UC9A 3G8AA 5BRAA 4MMXB 1WQ1R 5CFQA 5ADHA 1UC9A 4JBWA 5DSXA 2PFKA 3LP6A 5ED0A 2O8DA 1Z6GA 3ID6C 1BVUA 4CNQA 5A6SA 1P1KA 2WZDA 3CEJA 2Y92A 5ETJA 1T6YA 4ND8A 2P0EA 3RRBA 4YRJA 4F2DA 4PSUA 1ILWA 1CPYA 3H7IA 1O97D 2D1RA 2G09A 2HHJA 3OFVA 4WE3A 1SQ0A 5I4IA 3ZHBA 3AF6A 3A4LA 4MCHA 3S55A 1QUFA 1ZGZA 3KR2A 3Q9LA 4KLAA 2P9ZA 4L16A 4NQRA 1UBJS 3W1WA 7AT1A 2KQUA 3H9UA 3N0RA 1DDOA 1HEIA 2NQ8A 2WF7A 4BB6A 1NM5A 4LW8A 2WT8A 2Q2VA 3HXKA 4I1SA 2A2ZA 2CNNA 3TNJA 1XXHA 4B7UA 4BNXA 3R74A 4PYLA 1YRWA 5FBKA 4DA0A 1DIAA 1JBKA 2Y9MB 3K8OE 1GXSB 2NYVA 4F3KA 4LHSA 5I7SA 1TUBA 1Y7PA 1JUDA 3WYAA 3KZXA 2ZTSA 3PB3A 1DC7A 1MP0A 2CFOA 4QQRA 3KHUA 4LGVA 3BL8A 4DRYA 3BSWA 1KP9A 3EARA 5TPWB 2OC9A 1BRTA 1VCNA 5AD1A 2CUZA 1CJUC 4LVOA 4BRSA 4TLAA 2HYIC 4DUPA 3TFOA 4RJTA 3FFTA 3BN3A 4OQMA 2WKRA 3W8NA 3PHJA 3II6X 2VSNA 1IQUA 1YZGA 3RSHA 3ICQB 2IODA 1CZLA 3RUHA 2ODQA 1YZYA 3PT5A 3IJEB 1TU4A 4KQKA 1FVFA 4OBWA 2OENG 1JEJA 3I73A 2IHZA 4RZ2A 4WIAA 1JJAA 3K6KA 3IIIA 4OXYA 4EEXA 5H59A 2ZSEA 1UH5A 2G36A 4FJ0A 1VSBA 5DYTA 5IBRA 5FUQA 1XMPA 4ZYZA 2QTCA 2A0KA 3RQIA 4F46A 2J6BA 1Y9AA 4LYJA 2IS1A 2RI0A 4OMUA 4DSUA 3ZWWA 1UJ4A 5JS2A 1S2GA 4L9AA 4B8YA 5CD9A 4WINA 2ZZNA 4F93B 2IHJA 3G2IA 4RJ2A 3FY4A 2OD7A 4JUAA 4KH0A 2ZT5A 3IXLA 4JL8A 5G0UA 3TRJA 1NJ1A 4YJ3B 5DKFA 5TMBA 4IKEA 2WKSA 1EWYA 4IO1A 3TLGA 2W11A 5JLAA 4R2HA 4Z9YA 4YDHB 2Q3BA 4D4IA 4HYEA 3ANXA 1V35A 3NASA 2OWEA 4TTSA 3LG2A 3SZMA 2HWKA 4P4TA 3V8MA 2B8NA 3CKLA 5CA1A 1LWNA 5FH9A 1B2LA 1GNVA 5AVXA 1FMLA 3BRWA 3EVCA 2VDNB 2VK1A 4DYDA 3VR2A 1YU6A 3KB2A 2XGOA 4RVGA 3HU1A 1KZ9A 4Q4HB 1R6AA 3N2IA 3O1JC 1GAQA 3SQDA 4BBZA 2CK3A 2A5GA 4JI1B 1Z62A 3ZK9A 4IIXA 2WVAA 4ARSA 1RWBA 1JHPA 3DO6A 5FTKA 2P9YA 3UF0A 3QVTA 1Q3HA 3P26A 4M8KA 4NRDA 4GQAA 3ZS9A 3L6RA 3IB3A 1XD2A 4PRKA 1W49A 2HT6A 4DLTA 4BO6A 1XTRA 3HUDA 1ENYA 1Q7EA 1T1SA 1M5TA 2EL9A 5C5DA 1OXKB 1LV8A 1MUUA 1SU4A 5DWVA 4AB1A 1HL3A 3A0UA 2A1IA 3OM1A 4M37A 3T4PA 4FZJA 2EFCB 2MWMA 1NBOA 1UC4B 1KZHA 1IHDA 3PRYA 4GX2A 1QHYA 2GS9A 1NW9B 4F91B 1HLGA 1Q7BA 3L7OA 4KREA 4LXHA 3WS7A 5A5VA 3W7VA 1VBMA 1WBJB 1GO2A 1W581 2V7TA 3C39A 3OPYA 2JFGA 1AK2A 2Z09A 3MCAA 4OSPA 2OG1A 2Y05A 2Y0EA 3HBNA 3HN2A 4KFSA 2QR5A 5TX7A 4ZZ1A 1TMGE 1X7XB 2PHZA 2ZBGA 4R8LA 4RSMA 3FTEA 2M32A 2Z9BA 3PHHA 3VTKA 3OKAA 4FE4A 4MZDA 5JEEA 4RTNA 5DM60 3ONVA 2OWDA 3FE2A 1XDDA 4LISA 3UB3A 3IMEA 4L8FA 4AY5A 1L4MA 4XYLA 3GLFA 2D3TA 2OO3A 3K94A 3S27A 4NCHA 2P9BA 4ESVA 1ABEA 2G9ZA 3PQ8A 1MX9A 1QQ7A 4AF6A 3LQRA 3QI2A 4CIBA 3KV3O 3FWYA 4C9BA 3EIEA 2QUHA 2ZSUA 1L1EA 4D74A 2VK8A 1WB5A 1Z0JA 1GUDA 2P6UA 3QP9A 3KLOA 4IH1A 2I4TA 4TT3D 2QUJA 2BYTA 4ZPJA 4JY7A 5FV4A 2I4OA 3T3NA 1C9NA 3EAFA 4FS8A 1E1DA 2GILA 3OTWA 4HRVA 2ZJBA 4LXTA 4ENSA 3EQ6A 5H3HA 3GJRA 3X1XA 5KX5B 3U5ZB 1YACA 2B4YA 2D06A 3X1DA 2PSJA 4IDFA 1X39A 4HT3B 4HNGA 2A1TR 4YRNA 4QELA 1S7GA 3USES 5AMXA 4ZT4A 3L02A 1GFWA 1NHGA 3MJTA 1DU4A 3BMCB 2H6EA 4PN7A 5KIAA 1VMDA 2OTCA 1MV8A 2IITA 1MR3F 4PO1A 5EG5A 3PKIA 1ZUNA 4FNMA 4B2LA 5EJ4A 1KFCB 2OXIA 1CVRA 1NR7A 4JLWA 1JB9A 4PC6A 3P9ZA 5E2BA 1JAZA 1GA1A 1P2VA 2PRSA 2ZYIA 5EMHA 4JLBA 4M0CA 5KWVA 4DR1B 2XRMA 4G23A 1NBAA 4D45A 5TE9A 1NTOA 1P4AA 3EC7A 3E82A 3JQFC 4W8OA 4YRQA 5LP6C 3PPVA 3UJ6A 5ES4B 4JI8B 4WLEA 3HWRA 4X1IB 1UMDB 4BO8A 5JXHA 4MK4A 4AJ1A 3HJNA 4MDYA 5D7NA 1R4MB 1HG0A 1E0JA 1SN7A 1U11A 2X86A 1YVUA 2X42A 3BRSA 3WO0A 2CSXA 2H4FA 4W82A 2AC2A 2W58A 2XCTB 1KH3A 3WLIA 3E4CA 2OV6A 4X1OA 2JKVA 4DMGA 4X54A 2O2IA 2WUDA 4XSHA 5DM70 3H1TA 1GQRA 4QOSA 2C7PA 4AP9A 1ZD9A 3P45A 1BMFD 3KJHA 4RKQA 3WYCA 2E5WA 2RI6A 4OQQA 3W06A 3GZJA 4GMFA 2BEJA 3GFRA 3LPAA 1ZK0A 3SQOA 3V2IA 2Q07A 2GEUA 2L42A 2OCYC 3PDCA 3BIOA 2E18A 2CLIB 2IYWA 3GT3A 2WWWA 4B35A 4DIFA 2WIJA 1E1NA 3L01A 3PXAA 1KJ8A 1GYQA 4RPJA 4OHZA 2PMEA 3V8PA 4CN8A 1P1FA 4CT4B 4UTXA 1VKRA 2NZ2A 2CHQA 1PR1A 2ODBA 4L9SA 5EE3A 4PLHA 4WH0A 1TZJA 3EUEA 3DF7A 4FMPA 3VNAA 3J80A 1GCOA 4YJHA 2ZYSA 1RYMA 3HY4A 2BMAA 3EZYA 4UNPA 5JEDA 3JATA 3ZD6A 2E4VA 3FVVA 3GAFA 1DT3A 3VA7A 3QGMA 1TO1E 1KZ7B 4N8EA 2P9TA 1K4MA 1XYGA 3W6OA 1NUAA 3CJRA 3A26A 4FVTA 2HQSA 1E63A 3I12A 2CL7X 5CVUA 4IDEA 5E8RA 4M7RA 4BVGA 4Q24A 1F51E 4OHFA 4BMDA 3A3YA 3ESBA 4P7JA 4EA9A 1EFVB 1R66A 3IUNA 3L1UA 4QYXA 1RLMA 2PMWB 2ZRJA 1IN6A 3KQVA 4DBVO 1Z47A 3UY4A 4UHBA 3MD9A 4C3UA 2G6TA 4RLSA 3DF9A 2GERA 2WJHA 3VU8A 2E5LB 3TGWA 4HMQA 1CUEA 2ZBEA 3R24A 3ZVLA 4C3VA 1VZ3A 3TMYA 3IURA 5JCJA 3JVIA 1ULAA 1OZ0A 3FYUC 1LBEA 3ZKWB 4JU9A 5LQCA 2DWUA 1QRDA 4LZNA 5FKJA 1QAQA 2KW5A 2UKDA 2XE7A 1NQOA 4JL5A 4UKDA 1EBFA 1PR4A 5CNMA 1VP9A 1PSWA 3E03A 4MKFA 1U9JA 2BRUA 3G23A 4JJAA 3P4XA 4WD3A 4Y7DA 3LPDA 1PJ4A 3TJZA 1GAEO 4C4XA 2QYOA 3ILVA 3JQAA 5EQFA 4ZVOA 4O1HA 3X2FA 4K9LA 4U9HS 1KXJA 4D0RA 5REQB 4US0R 4WFIA 2Q3DA 4AKHA 5F4BA 2BFBB 1E69A 1U2RA 1K6EA 5BSEA 2XXJA 5JS8A 3K5WA 1G8YA 4J4TA 4R71A 4OTZA 3Q8MA 3IP3A 4Q02A 3E35A 1AQUA 2BLLA 2CJPA 3IHWA 4BMNA 4D25A 2DVMA 1PYGA 5ESXA 3ONEA 5KTKA 4IICA 5ALGA 5E3JA 4BLVA 5F7JA 3N39C 4EI9A 3DAYA 4QTUB 4C1BA 1Y1LA 3FAZA 4AX8A 3BWVA 1DX6A 3CVOA 4ZMSA 3F3MA 1EPUA 2AJCA 1MB9A 1OR8A 4WOPA 4PXYA 1FSZA 5G3YA 1CUUA 1QG4A 1K63A 2GJ8A 3QUCA 4DLPA 1LPMA 1Y3IA 5GVSA 2JGJA 4QRHA 1VLHA 4RHEA 3FX2A 3DHYA 1G38A 3PGKA 2P2CA 2AL7A 3GEDA 3I5UA 2WM8A 3RLFA 3KU4A 3NHKA 4M53A 4MQMA 4GL2A 3ADOA 2FUEA 5E0KB 3N0XA 5L3SB 3F1KA 3FKJA 1P1IA 1KP2A 1T0HB 2GEKA 1Z07A 4P38A 5AKXA 3FOEC 2AOVA 5G3ZA 4CDNA 4G07A 3EH1A 4XASA 5T41A 2BJWA 1M2EA 1QK3A 2H1OA 4KQJA 3TZEA 1FLAA 1L5OA 4PQYA 1OAOC 1XKLA 4O4LA 1JHVA 2O05A 1ESZA 3IPLA 4RD0A 3U3DA 2PYIA 1AV6A 5DP1A 3ESYA 4GR4A 2B82A 4ER0A 3CMCO 4KPUA 4V0MA 1VMEA 1D3AA 2EATA 4MI1A 1AF7A 3EEYA 4KWCA 2C3PA 4UPEA 1YUMA 2FQQA 5EJMA 1YS4A 1W9MA 2YR0A 3H2BA 3TNYA 3OFSA 2YWBA 3DB2A 3KVRA 2WSSD 3LVFO 2ERXA 4FDUA 3TVDA 4X92A 4YXWA 4DF3A 3IODA 2XW6A 3ZI7A 1ZS9A 2E3JA 4GBED 4CMGA 4YPVA 5BV2P 3I1FA 4ZEXA 4HTFB 1E77A 4OEHA 1Z7BA 1OX4B 1XAGA 1VKHA 2NSLA 2UVPB 3NAQA 4FCCA 4F11A 3ASZA 3AVTA 4ETMA 3GEPA 2P79A 2VTBB 1W8DA 4ZFNA 4RAQA 3SC4A 1OA1A 4JBNA 4Q16A 3TYXA 1U2TA 4V0NA 3UKDA 5A5GA 5C1OA 1FDUA 4ZCQA 1R2QA 3VZRA 1N5OX 1PFYA 2PR2A 3SK0A 3T52A 4UHFA 5C1BA 1PI3A 1DXHA 4ZRMA 1GQFA 4E70A 3HYSA 4TKVA 5AIAA 3HVJA 3P20A 3QG1A 4DZTA 2PZBA 3E0XA 2WJ3A 1LF5A 1EXWA 1SBHA 1VSVA 4C6HA 5KJFA 4OLFA 1V26A 2OGSA 4IZOA 2WIDA 3O8QB 4Q00A 3RBVA 4JJ7A 4Q4LA 1CHNA 3BKXA 1EX9A 4NH0A 2Y8EA 1SCQA 5TQ2A 3GQVA 4RZIA 5LBIA 1RZVA 1VB3A 5GMOA 3W8EA 2HO5A 2DHCA 3EWNA 1N2ZA 3MS4A 1K7FB 1J07A 2OCBA 3K35A 4LG1A 3KPWA 1MMFB 2XUZA 3HXPA 3SC6A 2V7UA 2Y77A 1V1RA 4ZYUA 3IUPA 3RC7A 4D6PA 1ID1A 1EK2A 2XLBA 4MS1A 2QRKA 1O6FA 4QPZA 1HMPA 4US2R 5JQWA 4ATNA 4QXMA 3FA2A 4HC4A 5F2OA 4P2BA 1XD9A 5EINA 4KPEC 4BFYA 5K0EA 1E6EA 2EFDB 2R8YA 1B8VA 3INRA 2DUUA 3KAPA 3M3HA 4TM7A 3KLPX 3VOBA 3HB4X 5JARA 1ADGA 1UM9B 4HXFB 4J0KA 3L0BA 4JC4A 2FW9A 4P86A 1P2SA 4ZCLA 5BQFA 1LDGA 3OUUA 1XKQA 5L53A 1YVPA 2ZBFA 3EZ7A 2JJ8A 3UJDA 3GUCA 2V7QA 1K0UA 4BGIA 4BXOA 4L78A 1LBHA 1LPNA 3D0QA 3P9CA 1EXMA 2QAGA 1GAJA 4J3FA 3TLJA 4RS3A 3PJFA 3A6EA 1A2BA 5ALMA 1E0AA 1PNOA 2WOJA 2K7ZA 1WZEA 4OA8A 3Q10A 4TX1A 1RIIA 3W5SA 4FNOA 5TSDA 2JIMA 5JXWA 1YC5A 4MQFA 4BIMA 1SOAA 3LCRA 4YUAA 1J09A 2LDXA 1U9YA 3BL5A 3PZBA 4N9QA 5TNXA 4UCFA 3LF2A 1Y3CE 3WNZA 1II8B 4EUKA 4F4FA 1Y7TA 3A6GA 2RGNC 4CIAA 5AVVA 2O7SA 1U6JA 1RYNA 4TV8B 1OXMA 3QSYA 1ZM2A 4ZOAA 5AW8A 1B93A 2DBZA 4PC1A 4HDOB 1NU6A 5J3JA 2AZTA 4AJKA 1Z5ZA 1OA0A 3L5KA 1W94A 3UB2A 4ZJPA 1C9KA 3GNQA 3LBHA 2JFWA 2CYCA 5A02A 1BDJA 2D2EA 2WTMA 2ZYRA 3KOZA 3BEDA 4LGCA 4ZT6A 4A5OA 1FJGB 3RS7A 5A4MS 3L04A 4RKYA 1Y82A 3IAXA 4Z51A 1G98A 2XR1A 2QUZA 2ZKIA 3ND7A 4MPRA 3WGTA 4HUTA 5AVUA 4FR2A 4BKUA 3FOFC 1UMBA 2HADA 1OPXA 1Y8ZA 4V02A 1BQ3A 4K03A 1BKYA 1LX7A 2MT9A 1KBOA 4EVSA 2OBXA 2DSTA 3UUWA 3S29A 2FPGB 4JHLA 1A1SA 4Y6RA 3U40A 2PMDA 5F9HA 2RFLA 5IAJA 1G8PA 1SCBA 1RWKA 4M49A 1SCNE 3Q8XB 3VTFA 3SVLA 2ZSKA 5FO1A 4URZR 2XTAA 1URPA 4BLOA 1TEZA 2ID4A 4WDQA 1E79D 2X9VA 2QD2A 3KJIA 2B98A 4IG4A 1CDDA 5AKHA 4YWJA 5CA0A 1YBFA 2PH3A 4PXAA 2FQXA 2I34A 4HAXA 4C6SA 5DHUA 1N5LA 1TQ4A 1JHZA 4R0VA 4AMGA 6Q21A 2UZAA 2XRFA 4J2HA 3VPSA 5C46F 2ZXEA 2HWWA 3H05A 2IWRA 4B43A 5L3VA 3FYTA 1Z8NA 1IZ8A 4LSMA 1VXRA 3VZDA 5A4KA 1FNMA 5AUNB 4RESA 3KAKA 5IZCA 2XBLA 1M2GA 2R4QA 2I62A 1KKLA 2C1EA 4P3OA 2ZRQA 3AFMA 4TYWA 3KKKA 2A94A 5L51A 3O93A 7ADHA 1UBOS 4FHFA 5DYYA 4MR9A 1UXIA 2FETA 4UBLA 3VU1A 3BX1A 1B0UA 1A9RA 3PQ4A 4MRVA 1B8NA 1P77A 1RBYA 2ZUBA 3D8TA 4UFNA 3DA8A 1JEQA 1FTGA 2BFDB 2WU3A 4UD6A 1DEAA 3HRKA 2C2OA 1UOPA 1Y1PA 4C0JA 1ZD8A 1FDWA 5IKPA 3RV3A 1H9CA 1USIA 4URWR 1DI0A 1NJ5A 3IA2A 3LO5A 4M99A 3RYFA 2F9MA 3W5CA 1E3MA 2P9QA 2GN0A 2WJGA 3VR4H 3JTMA 4HLDA 1ULUA 3EGXB 2R11A 4FFBA 4NFLA 4BP3A 1C2YA 3THYA 3E6AA 1DIBA 1U2ZA 1RP7A 2QX4A 2VYVD 3NGXA 2HSZA 4JJEA 4OMCA 5B7GA 1G8MA 1RCFA 4BVFA 4I3FA 4EBBA 1DQYA 1W0KD 2J6IA 4UBNA 2A4KA 1A1VA 5JDCC 3WA7A 3KZOA 2P7IA 3P97A 1V6CA 4XARA 4RTJA 3GQBB 4N5LA 4PXSA 1Y1SA 2JANA 4QDZA 3E0QA 3MM4A 3U2QA 5HM6A 2FP3A 1SXPA 1N3YA 3T7CA 1FFCA 2QKYA 1FP1D 4XSVA 1LLDA 2XDQB 3KTOA 4YDRA 3ZDQA 2FEPA 1A9TA 3KUKA 1SC4A 2I4MA 4XSGA 4A8JA 2UXCB 2R8ZA 3ICVA 4A0GA 3H83A 1EUDA 1T3LA 1UF9A 3KYDA 4ZALA 1BXRA 4BBJA 2RAUA 3EDMA 1YRHA 1U7HA 1T5IA 2ADOA 2QQGA 3UT5B 2PD3A 4R1SA 4FYKA 4IIGA 1TKBA 4TKLA 1PZNA 4LAFA 5H9VA 3SSMA 1U3WA 3I9OA 2VQFB 1MCZA 4M9QA 2PZMA 2XMGA 3CTMA 4QGGA 3WGMA 4Y2TA 2H16A 1NFQA 4PPYA 5SV2A 3EODA 1KY4A 1T13A 3DLTA 3SZGA 2W98A 4CUZA 4HNRA 5CB4B 2AI3A 3IILA 3HKEA 1WMAA 3MJSA 1XQVA 3ICPA 4ZK2A 5ALNA 3O84A 3ILYA 1I51A 2J3MA 1RM0A 2MSNA 2ZANA 3JQBA 4ZVLA 4BTVA 5JZVA 4YI5A 2CCGA 3TW6A 2V58A 3PPYA 5T5QA 5LSAA 1R8XA 4CV1A 1OXBB 3C3EA 4JITA 3Q15C 2FOIA 4QA9A 2J6HA 1QOPB 1GLVA 1P0PA 3FPLA 4ENPA 2FZ5A 4TTQA 1N2BA 4QTTB 3I09A 4HNHA 1WTAA 3TIGA 3ZWQA 3BXGA 5C18A 3HDJA 1NPTO 5FUVA 1CUVA 3K0HA 1EHCA 1IUNA 2F1OA 2RHGB 1YOBA 4PC2A 3BJIC 4Q7EA 4URUR