3GJ5A

Crystal structure of human rangdp-nup153znf4 complex
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
201
structure length
201
Chain Sequence
QVQFKLVLVGDGGTGKTTFVKRHLTGESEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords GTP-binding nuclear protein Ran
publication title Crystallographic and Biochemical Analysis of the Ran-binding Zinc Finger Domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 69
structure length 201
sequence length 201
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3gj5A00
1KMQA 1GWNA 2CK3A 2BCJQ 4Q5IA 4EJSA 1P2TA 4JLPA 5JHGB 1T5LA 4WW0A 2PLFA 2YOFA 3VQTA 2KB0A 1OFTA 1GNQA 1XTKA 3PIRA 4ZIRB 3DDCA 2OBMA 2FFBA 2GZDA 3MCAA 1JEEA 1IXRC 1UKYA 1X86B 3BWDD 3A36A 3HYRA 4OL0A 3RS5A 2TMKA 4MDEA 3HJNA 1D9XA 1TMKA 2NZJA 2BDTA 1SKYE 1Q3HA 4BZPA 2IHBA 3WMGA 4QGFA 1OB5A 1E1RA 1JR3D 1OIVA 3SU8A 2ONKA 2YV5A 2JEOA 5D3QA 2PBRA 1RYHA 2FG5A 1U0JA 3BC1A 4M1SA 4NTZA 4W7SA 2HYDA 2PL3A 3QF4A 1US8A 3Q9LA 2FF7A 4C3ZA 4CT4B 2ORWA 4PPFA 2OT3B 4IW3B 3KUDA 2WWWA 3LA6A 5AWFC 4B3FX 1AK2A 3QVUA 2GJ9A 2MSEB 1W47A 1XMSA 4M9SA 1DADA 4AURA 1NBMA 1RRGA 2RCNA 4N3NA 2DWPA 1Y63A 3OEHA 4LOAA 4HAXA 4N0DA 2REXB 5GJBA 4YDSA 1VPLA 2ECKA 2GHIA 2V4ZA 4H9GA 5EP2A 4TYNA 1IHUA 4B2IA 1TL7C 2Z4RA 4L9SA 2O8BB 2RKOA 2ODEA 1QVAA 4JLBA 4A8JC 2QAJA 1C4OA 3RVBA 2Q0HA 3DO6A 1IN7A 4OQMA 4LX0A 4V0LA 4I1UA 1DTSA 2VYFA 2FJUA 2IEZA 4B47A 4DDWA 3EPLA 3THWB 5EZ6B 4RD3A 1E2EA 4NONA 2FSHA 5JLJA 2G1JA 1Q1QA 3MJRA 4C0QC 1X8KA 1XDBA 1OIXA 1Z0FA 3K0AA 1N0VC 2D74A 1LTQA 1W46A 5EZ5A 1FNNA 4V0ME 3GPLA 2RGEA 5KPJA 2A78A 1VG8A 2IUTA 4NYMQ 4A6PA 2NMVA 1LV7A 2QRZA 3A6PC 1G7SA 2QMEA 3DOEA 5EP3A 1W0JA 1XTRA 4XWAA 4ITRC 2J0VA 2QAGC 1IY0A 1FFHA 2F1JA 4FXPA 1VTKA 4GRAA 4JKIA 4EQ6B 2PZFA 1G5PA 2OBNA 2B21A 3VAAA 2NPIA 2QQEA 2WPDA 5J4LA 3K70B 4V0KA 1JR3E 4HAVA 1DAHA 1DAEA 3K09A 5JWHA 3EXAA 4GMDA 2QP4A 1X8JA 2GCOB 4MGKR 4TMXA 2D06A 3QKRA 3RABA 2IBMA 1U8ZA 1XEWX 3LRPA 1WBBA 2PCJA 1Q0UA 1X3SA 2ZEJA 2BC9A 1ZW6A 1DAIA 1OSNA 1WXQA 1BYUA 1L2TA 1KJYA 1N2CE 2A5JA 4D4KA 4HAZA 2ZJBA 4ZKDA 4CF7A 3UATA 2REBA 5FUXA 2OEPA 2AFIE 4CYMA 5AUQA 4DCTA 1JALA 1L4YA 2OG2A 3SHFA 4PC3A 2H1LA 4OQLA 3CX8A 1XMVA 4QG7A 2QZ4A 2A5GA 2RB4A 3BB3A 5GJWC 2JDID 1E9RA 2QEQA 4HATA 1Q57A 1RFLA 1ZCAA 3QEJA 2CJWB 1QHHA 1FUKA 3R7WB 3MWKA 3S1AA 4JL8A 1SHKA 3FKSD 5JJKA 3QPVA 4KFSA 3QBVA 5TDHA 1VKJA 3U7GA 5TARA 3QQ5A 2G3YA 4G01B 3VX3A 1M2OB 1VIYA 1ZC3A 4EKDA 4TMTA 5SZHB 5BN4A 4M1WA 2VF8A 4F7WA 1MH1A 2ZU0C 4K8OA 2ZS7A 1PJRA 2OV2A 2RMKA 2C2HA 1LW7A 4D80A 5J4YA 4HB0A 5LD2B 5F98A 4UXHA 3T5GA 2GJKA 2JLWA 1XNJA 2QRNA 2V7QA 3K9LA 3MWLA 4PSKA 2PH1A 2ZSDA 2VHUA 1G3UA 2FN4A 2N1BA 4RD2A 3WRXC 2O8CB 1LVGA 2D7DA 5CYPA 2ZJAA 4EUNA 4JIMA 5LB4A 1P72A 4NP6A 1BO6A 4FW9A 3A4NA 2OUKA 3AVXA 2QT0A 3QOFA 3UMRA 2R6DA 2W6ID 1DELA 4EFMA 1Z6AA 3FTQA 5FOUA 1XXHA 2W2TA 2EW1A 2XNSA 4MITA 1X1RA 1XFAA 3CNOA 2YOHA 3PUXA 1P60A 3A58B 5H1YA 3UMSA 5KDLA 4DSUA 5G3ZA 4A0FA 1ZD8A 1G20E 4C0LA 3FFBA 3SZRA 3ASYA 1ONBA 3L2OB 3DEFA 1N6PA 3CUEF 4LJYA 4TZ0A 2FFQA 3AGQA 1G1MA 1OIWA 4Q03A 1W0KA 5KSZA 1ANKA 2NO7A 4JZKA 3GMTA 1FP6A 2CMKA 1SKYB 4H1VA 2XJ4A 3GJ4A 5JFGA 3AF4A 3VR6A 1F5NA 4C7OB 2O8EB 3AKDA 4N1AA 4U7DA 2QBYA 1KI1A 3PEVA 1DAKA 2OCBA 1Q1ZA 4W5JA 1KZ7B 1RVDA 3D31A 3LD9A 2FFHA 1XPOA 3R9XA 1KJZA 2XB2A 5FL7D 3DVLA 2B8WA 4BFXA 3DKVA 4HSEA 5EQTA 2XEXA 3GLHE 4PC6A 3K0FA 4B3BA 2XOKD 2BVNA 1S8FA 1VG1A 4A2QA 3H84A 3KL4A 3Q3JB 1KMHA 3NBXX 3RANA 1OFUX 2C95A 4M1MA 2WHXA 1DOAA 2DWOA 3ADBA 3IKJA 5FTNA 5J5CA 2CE7A 3BBPA 4B3DA 3AF3A 4LV5B 4MQBA 1E32A 2GXUA 4UNSA 2X8AA 2IYTA 2IF2A 1OKKD 4CEJB 2CLSA 4CZ2A 1YZTA 5TMPA 1P9WA 1TTTA 1YE8A 1ZM2A 1R6BX 3I32A 3HWSA 3OEEA 2OXCA 5E3HA 1GKYA 2P67A 4DLSA 2CLCX 2D2EA 2J45A 2ZJOA 4TTQA 2QGZA 1EWQA 3PENA 4PSVA 4U00A 4Q19A 2IYRA 4IEIA 2C77A 3TAHA 1U0LA 3CONA 3PEYA 1DAGA 2HJGA 2ZUDA 2YINC 2IUUA 3VFDA 2I1VB 4LJAA 2AK2A 2Z6VA 2NO6A 1JXMA 3Q7QA 1XMJA 3T15A 3GLFE 1M7HA 3ONWA 4TQ9A 2IA5A 3LX8A 4TLBA 4XIGS 1UBEA 3F3YA 4B2PA 2GXAA 4YMWA 1G3MA 1P62B 4QKQA 3VKHA 1OFHA 3LO5A 3ZLJA 4LJ7A 2LCFA 2ZS9A 4KFTA 4OHXA 5L3RA 2F43A 4L9WA 1OXXK 2PMDA 1KSFX 3X1YA 1O87A 3KDSE 4R98A 1YVDA 4TTRA 2R2AA 3LVQE 3QIAA 3PUYA 4DLUA 3N70A 4BRWA 4P4UA 2IYYA 4IXMA 1IM2A 1NLZA 2C96A 3CF2A 3EC2A 2J0UA 4MKGA 4DDUA 1EFUA 1RE0A 4LYHA 4Q9LA 3BFXA 1Z6TA 4EDHA 1GL6A 1VCMA 2VQSA 1IAQA 1SXJA 1T3HA 1II8A 2C5LA 1X6VA 5F2EA 4QM7A 1WB9A 1MABA 2A2ZA 3FE2A 3TSWA 1T3SA 1XTJA 3JVVA 4EJSC 2NQ2C 4YDHB 1XRJA 2WAYA 5HZHA 1I2MA 1E2JA 3NBFA 4ZCLA 1BIFA 4Q01A 4MYUA 2LKCA 2VHQA 5JRJA 1S3GA 1P2SA 3DZ8A 2WSMA 4OI0A 3IIKA 1PLLA 3TVTA 1NRJB 3SQWA 3ZVRA 4TL8A 3ZYCA 4BLPA 1R2QA 4MYTA 5BN3A 1RRCA 2ZSEA 2VF7A 2OM2A 2AKAB 4Z1MD 2RGXA 3EPHA 2QL6A 1OYYA 1ZNZA 4M8NE 3WNDA 5EE1A 2VRWA 2KE5A 2YWEA 5DI3A 2EWWA 3VR3A 2ZRHA 1TQ6A 4NL4H 4RFSA 3VHXA 3FGNA 1GKIA 2NPFA 1E9AA 4A0RA 5JEDA 4LRWA 1TQ4A 1PUIA 1OLOA 4GP6A 4QBHA 1XD8A 5CJPA 1H8HA 2J5XA 4LV8B 2VLIA 2IXGA 3MAAC 2ZRCA 1KK3A 5CM9C 2J9RA 2WTUA 3X1WA 1G64A 1EFRD 1JBKA 2ERYA 1NSFA 2RAPA 4KYIB 2AR7A 3L43A 4D0GA 2EVWX 2F55A 1QF9A 4BFZA 4GI7A 3I5XA 2W2VA 5E7IA 2CHQA 2EQBA 3AUYA 4A6XA 4B43A 3ND8A 1JAHA 2CL7X 1U8YA 3WYGA 4BRUA 2HXSA 1JPJA 1VDZA 2CVFA 1W5SA 2P2LA 2C9OA 2HJVA 3IIJA 2QQ0A 4D81A 2CDNA 5JSZB 1KO4A 2ZRIA 5B58C 1LNZA 2FU5C 2IYWA 3D3QA 1IONA 4LHYA 2IYUA 4DXAA 2QN6A 4L15A 1J90A 3UG6A 1VCIA 1UF9A 2ZYTX 4M4SA 4Q7JB 5JI3E 2AK3A 4WOPA 3ZZ0A 2ZUCA 4JLAA 3IEUA 2WJIA 4URXR 3B7GA 1XF9A 3P1JA 4BUJA 3R9WA 5AJWA 3EX7C 4V0NA 3U4QA 2BJWA 4ABYA 2FPLA 2ZU6A 4M0LA 3EG5A 2W0SA 3ASZA 3CPJB 1E2HA 2ERXA 1FPMA 2O8FA 1E9FA 4D0NA 3WMEA 5IT5A 1IOZA 1G9XA 1P2UA 1FMLA 1G5TA 2JA1A 2J1LA 5FBLB 1R10A 1UBGA 4DT1B 1EWRA 1Q1EA 4B71A 3B1ZA 2QROA 1FW6A 1CR1A 5ELXA 4QGHA 1Q12A 2WZQA 5IDVA 4PZYA 3TVDA 3AGPA 4HLDA 4NCJA 1SZPA 4YQFA 4A2WA 1P3JA 3GLGB 4Q9KA 2IWRA 3TW8B 1CR2A 4M1OA 3GJ3A 4OHWA 3IQXA 1ZBDA 1Q44A 2GNOA 3T1QA 3GLHB 3PXGA 4Q4HA 4BLRA 4MKHA 5EE5B 1TF5A 3EA5A 4L8GA 5FR1A 4AWXA 4BLTA 5GVRA 4IOJA 1VYVA 2A3RA 5GVSA 2D4HA 4D4MA 2FSGA 2OZEA 1NVVR 4TLCA 5FTMA 1RZ3A 3UWOA 1BMFA 1AGPA 4HZIA 5BYKA 3VTKA 3FOZA 4NCIA 2FZLA 4O2RA 5E95A 4MGZR 2ZSAA 5E4FA 2JATA 2VP4A 4RZXA 1YKSA 3FFAA 1SVOA 1M7GA 1S1MA 3HDTA 1Y3AA 2F1RA 3B13B 2JLYA 4JSYA 2OFOA 2F3RA 2G0NA 3EIQA 3G82C 4RD0A 2XSZD 4XSGA 3AVQA 5CIWA 1H65A 2RGBA 3NVAA 5K8LA 1XTQA 3I4LA 4FN5A 3AQ4A 3ADDA 4ON9A 5GADl 4HEJA 2O8DB 2QPOA 4C4PA 4IRUB 2NOAA 3PFIA 5FOVA 1A5TA 3IBGA 3T06B 3AM1A 4M2LA 2CK3D 3RSOA 3GLFB 2J0UB 4KYUA 1G21E 3RWOA 3IUYA 1A7JA 1HQYE 3ZS8A 1QHIA 5CDFE 1XD9A 3UKDA 2ZYUX 3AF0A 1KK2A 1AGRA 4EPXA 2F6RA 2J41A 3SYLA 1CR4A 2P6NA 3V4RA 1YZKA 4A8JB 1ZRHA 3THYA 1E1RD 1QG4A 4CRWB 5CK4A 1DO0A 1NKTA 3IPXA 3RC8A 2ZJ5A 4PPNA 3T1OA 1XTSA 4Q4JA 2GBLA 521PA 4QGAA 1NI3A 4B2LA 1N6RA 3C5CA 5GJVC 2JJ2A 1A2BA 3BFVA 1GM5A 4P3YA 3K0CC 5FPTA 2ODNA 3D8BA 1ZIPA 3REFA 3RS2A 2A5YB 1NBMD 3OE7A 1XEXA 4KAXA 2DR3A 4XJXA 1DS6A 4JSTA 5KHOC 4GP7A 2N46A 4WAUA 4Q9HA 1I2DA 4XSHA 2GF9A 5AJXA 3W8RA 3PJRA 4PPQA 3QI2A 2QNRA 3AVWA 3DZDA 2QAGB 4Z54A 3KFXA 1FP7A 3X1XA 2BCGY 2IYQA 2JJ8A 1E2LA 3LXRA 3M1IA 2JLZA 4DBLC 1FUUA 1RKBA 5LBIA 3NDPA 1ZUIA 3GD7A 1NSTA 1XPUA 1IY1A 4URYR 1G7TA 3U6BA 1MT0A 1ZYUA 2PT7A 2Z4SA 3W3AA 1Z29A 4QNMA 3MRSA 3X1ZA 2BMDA 2P0EA 2YOGA 4BLQA 821PA 3FMPB 4E07A 4JL5A 2QTVB 1T91A 3WHLA 3WYAA 2YWGA 4BEJA 4ARZA 1N25A 3PUWA 3QENA 3JVUA 2DBYA 2YNMA 3R8FA 1CULC 2VP5A 1VCNA 2WWHA 1G3RA 1E9SA 1IN8A 1QHYA 2P3SA 2QT1A 1N5LA 1RRFA 2ZI3A 3C4JA 4Q1EA 5EE0A 4PO9A 3EW9A 2GZHA 2H5EA 2QI9C 4CEHA 2OLKA 3FMFA 5LPNA 2ZYWX 4H1UA 4A9AA 2Q3MA 1ELOA 4FWTA 4IHQA 4MRVA 1W0JD 5DI9A 2CL0X 1KDTA 1MV5A 2QSYA 4DSTA 3L0SA 3W6OA 2HCBA 1NN3A 4JVNA 2WPDD 4Q66C 1F48A 1IBRA 3U7FB 1E0AA 2FEMA 2AD5A 3W8NA 2CNWA 4DSNA 3RC3A 3TUIC 1YZQA 1U81A 2ZRNA 3KJEA 4D2IA 4UKDA 4KHZA 1I4DD 3TQFA 1BOFA 1J7KA 3K8YA 4JT4A 2GZAA 2CLDX 1HY3A 1V5WA 4PAMA 4UNPA 1CS4C 2O0JA 3EARA 5HCNA 3CF6R 2ZSBA 1U99A 5FUWA 5BWMA 4DB4A 5EE9A 1NBME 2GAAA 1G8PA 1VMAA 2H7VA 5GJCA 5AUOB 4JKYA 3TGPA 1UEIA 1DO2A 4CEIB 5E7JA 2BMEA 3N5CA 4B32A 5G40A 1FQKA 4PZZA 2OCAA 1AJEA 2HF8A 2WWGA 4PZLA 2WIAA 1SVWA 2RGDA 1NMZA 4RKFA 2FFAA 3M6AA 5JCZA 3BH7A 4LBZA 1DG1G 1SVMA 4B76A 2W00A 4PQFA 4MKIA 3PV0A 4S2EA 2V1XA 4IOLA 4FINA 3R20A 3THXA 4NBSA 3Q5EA 3REGA 5HKKA 3WNCA 2JJ1A 4TLDA 3C14C 2AWNA 1G3IA 1Z47A 3KJIA 1SXJC 2ZRJA 1R8QA 3NIBA 5ANRB 4JLJA 4LJ6A 5BQ5A 3G0HA 4XTRA 4DCSA 1HQCA 4LHXA 3KQUA 3K9HA 1E96A 4YXWD 2O52A 1ZM7A 2ZUBA 2CCKA 3ZVMA 2EFDB 2V7QD 2J46A 2JLRA 1LS1A 2I3BA 1OXSC 4KODA 4Q4LA 5KTYA 2FPMA 3RRYA 3R8CA 2F9LA 4OKSA 2PT5A 4GOJA 3KQLA 3ICQB 5G41A 1GDDA 2GKSA 2WICA 4LHWA 2E9SA 3G5UA 1KOFA 5BW8A 4PO8A 3U44B 1U9IA 5KNCA 5L3SB 5DNYB 4TYYA 2ZRFA 4POAA 2R6FA 1NY6A 1HH4A 3KQHA 2YWFA 2DY1A 4NH0A 1E99A 4DRZA 2WJJA 2IS6A 1E79D 3FPAA 1FX0B 4Z8XA 3DL0A 1WQ1R 1R0ZA 3IILA 4MGIR 4NYIQ 2NO0A 4URZR 3A1SA 2DFLA 1GG2A 2PX3A 4WBSA 1CJUC 1R5OA 3SNHA 1Q20A 2WWIA 3TRFA 3SEAA 4QNRA 1RJ9A 1KI6A 2BOVA 5C46F 5DSZA 4O0MA 1KO7A 3AVYA 5EP1A 2FOLA 3OFNA 3KB2A 1NF3A 4Q7MB 5FPSA 4I1VA 2LKDA 5CJ2A 2ZI4A 2AWOA 1I4TD 5EJEA 4HDCA 1T9HA 3TKLA 2GXQA 1P61B 3L8YA 5F9HA 5EXPA 2ORIA 3NKVA 4B33A 3QKSA 2VPPA 3LBIA 1IN5A 1UDWA 2OE2A 3CM0A 3QVVA 4MRSA 2J0QA 2HF9A 1MRNA 3TSZA 2HV8A 2VP2A 4K46A 4DIEA 2HEIA 1YQTA 2X2EA 1OYWA 3IHWA 4DVGA 2WIBA 1QVRA 3IPYA 1H8EA 3I5YA 4B3GA 3PUVA 1XMIA 4UNRA 4GPTA 5C4MA 1KKMA 3QG1A 2BV3A 3BE4A 1TU4A 4W5HA 4Q4AB 3LDAA 1XJ0A 5D3MA 3SFZA 2H8KA 3LBHA 4WZAE 1AN0A 4PQYA 3U3MA 4PC2A 1Z06A 4DUGD 2IUSA 1RC8A 1VYTA 2GTPA 3EIEA 1MOZA 4IOMA 1N6NA 1VG0B 3A1VA 3THOA 4C0JA 1F60A 4UXIA 1SQ5A 3W6NA 4D0LB 2QP3A 1WE2A 2OAQ1 1N0WA 1OT3A 1V43A 2AKYA 3BK7A 4KO8A 3BRWD 2KBFA 1AZSC 3OEED 5FI0B 3K9NA 1S4QA 3IO3A 4CVNA 1TNDA 1Z6XA 5F3WB 5HE8A 4F4CA 1YZUA 4A82A 2OAP1 4RCYA 4K81B 2LWIA 1Z0DA 2OESA 1XCPA 4URUR 4YLGA 1XXHE 1YZGA 2QY9A 3TLXA 3VNVA 4TYWA 2W6JA 3TK1A 5JWRA 3AVTA 3LLUA 1XZQA 1KI3A 1Z0JA 2QGNA 4BASA 1I4LD 1T3LA 4HAWA 2G1KA 4EJSB 5FBRB 2X2FA 4C0BA 3P20A 4DLWA 4ZCIA 3T1TA 3LQQA 4IFEA 1TQDA 2XGJA 5AK0A 3QPUA 1W5TA 2ZYVX 5EXXA 5B57C 2GDJA 4TQUS 1MO4A 2VHCA 2FV8A 3K0CA 5JCPA 1NKSA 4BFVA 3W3ZB 2G88A 1P2VA 3D6TB 4EPYA 2OSBA 3N2EA 5DE3A 4YONB 1W4BA 3QF4B 1US8B 1AS0A 1Z28A 4I4LA 1W36C 1HYQA 3B9PA 4RY2A 1KO1A 3L8ZA 2X77A 4BLSA 4Z51A 1OB2A 1G18A 4BQSA 1F2TA 4BZQA 3O8RA 2IWHA 3SN6A 1P75A 4RJLA 3HR7A 2ZQ5A 4D6PA 3KZ1E 2VTKA 4LJ4A 4BECA 2VH5R 1JAIA 3NWJA 3WXMA 4ASUD 2GK7A 5KYKA 1E1QA 1KO5A 4B73A 2ZVPX 1E2FA 1NVXQ 2OILA 1XJQA 1Q22A 1GOTA 1ZM4A 4YMSA 1DG3A 1HTWA 3A1UA 1TEVA 1OV4A 1YR8A 1Z0AA 2C9CA 3CNLA 4N0EA 3TJZA 3TSOA 2XXAA 2ZPTX 2IYSA 4MKFA 3GLGE 2JIZA 1KHTA 2WBLC 1KSHA 2JLSA 3DPUA 2GF0A 3SE0A 2J87A 2V9PA 3KTAA 1KIMA 3A8TA 2XX3A 3LWNA 2ZITA 4C0KA 2GAOA 2P6UA 3QXSA 2BEKA 4TSFA 1S3SA 2GBLC 2ODBA 1TPZA 4DCVA 5JJIA 2XZPA 4I99A 1S9DA 1P6XA 5FH9A 3A4MA 1S2MA 2C9YA 3P26A 2DHRA 2GRJA 1EFHA 2HXYA 5JRZA 3KKMA 3K0AB 2Q3HA 2ZS8A 3DM9B 3QG5A 1F2UA 4DC9A 5J40A 3UXMA 1RYFA 4G3XA 4PSAA 3L0OA 1PVOA 3WBKA 3CX7A 4DDTA 1IY2A 5BYJA 4ZDJA 2XZOA 2JDIA 3WHKA 1Z2CA 3CO5A 3TMKA 1U98A 1SULA 4ZDIA 5L8VA 3B5JA 3KX2A 4QHYA 2C8VA 3DMDA 3FKSA 1COWD 2VSXA 2FGJA 4KI0A 1M1YE 4B74A 3KKNA 5HE9A 3I1FA 4F4JA 1ZUHA 2F1IA 2H18A 4G1UC 2V6IA 1KKLA 2CHVA 1TF2A 3QKRB 4ERNA 4PC1A 4PHFA 1M74A 4B75A 3H1TA 4OK5A 3B78A 4V0OA 1ODFA 1SXJE 2DYKA 1RIFA 2VP6A 5DN6A 2WM9B 1SKQA 1U2RA 1AQUA 1WMSA 4RD4A 1YZNA 3BD9A 4OQNA 4X8HA 4EPVA 5CYOA 4BFWA 3B82A 1AS3A 4EFLA 3GJ7A 3MSXA 1JXOA 2YC4C 4MRRA 2O0KA 2A5DA 1ZAKA 2ZR9A 2YKGA 5KUTA 3SJAA 2WWXA 2V8OA 2X1VA 3CF0A 5FR2A 621PA 3U2QA 1EESA 4E09A 1AM4D 1QHHB 1G8FA 1GNRA 4IKEA 4A92A 4DWJA 4QHTA 3S1AB 1OHHD 2WOOA 2IL1A 1NJFA 3GJ8A 4EIWA 4EPRA 2MMGA 5JI2E 3AVPA 2W6IA 3CH4B 1UDXA 3QKTA 4HUQA 4DCNA 4C0SA 3U60B 2ZANA 2G0TA 4Y0AA 2CEAA 3SFVA 3UWKA 3ZVLA 3LVRE 4QGGA 3GJXC 1JECA 4NZYA 5KDDA 3BGWA 3RHFA 3GLIA 3CRRA 4TQAA 4NYJR 2W58A 2W0MA 2ZSFA 1D2NA 2J7PA 3RS7A 2KI5A 4M1KA 4JLNA 4L5BA 3LXXA 3B8HA 2ZVQX 1G16A 5HCIA 5K8TA 221PA 4PHGA 3GFPA 3PQCA 4LI0A 2ZRGA 3EWSA 2WWYA 3NC0C 3NHBA 4ACBA 3KFVA 3LLMA 1E2PA 3D7MA 1JI0A 3KKPA 4Q1AA 2FMXA 3T61A 2QMUA 1GTVA 1KGDA 4OBEA 1XTIA 1LF0A 3GQBA 1P9RA 1CR0A 4I1OA 4L16A 2GEVA 1FNMA 4DIDA 2J7KA 1NJGA 1IJFA 4OQXA 1KI2A 4RZ2A 5FL7A 2BIFA 5FUVA 1XXHB 3O8BA 4LYAA 3SBDA 4DEYA 1QDEA 4ZI2A 1ZMXA 4P32A 3NEYA 4MYHA 4FMDB 4KU4A 3TBKA 4P4TA 2XAUA 5HZKA 4B6EA 4TT3D 4AY2A 3U6KA 2Q9BA 1G19A 5EXTA 1CJVC 4EPTA 4PO1A 1JJ7A 2HT1A 3CWZA 1LY1A 2YYZA 4UNNA 4C30A 4Q00A 2EFEB 2OO7A 1NMYA 2KSQA 1OW3B 1TEXA 2R62A 4AIIA 4R71A 3BAFA 5AUNB 1OH7A 1M6NA 2IXEA 2J59A 4ILEA 3TUZC 2REOA 1D5CA 3B1VA 1ZU4A 2XTNA 2QBYB 4G5OA 2BM1A 3P4XA 4P4SA 4DLYA 2V3CC 3B1YA 1GL7A 3K0SA 4X8OA 4LSGA 1U9IC 3H4MA 4LBVA 1NVWQ 4HZUA 1A82A 3CPHA 3AKYA 1JQJC 1DVRA 4WIAA 3CPEA 3KUCA 4US2R 2JJ2D 3ICEA 3DM5A 3TW4A 4KSCA 3SDZA 1Z22A 4ZDKA 1A2KC 1WRBA 3K0FB 3VR2A 2R6AA 5BXQC 4KITB 5FBVB 1E4YA 3OE7D 3ZIAA 2AXPA 1KMHB 3QNUA 1E2IA 1KDRA 1WA5A 5EUMA 4E03A 4F38A 2NO9A 3E2IA 2Z83A 3ZDQA 4X8MA 4QJ5A 1W48A 3PUZA 4V02A 4C0AC 4NMMA 5FOXA 3NEJA 5DH9A 3UPUA 2A5FA 1IJEA 2YWHA 5A5GA 3FB4A 4TZ6A 1UADA 2FX3A 4ZI3A 2EFCB 3E1SA 2DPXA 3VU9A 1FQJA 3TUJC 3PVSA 1L7VC 1BH2A 1NIJA 1AS2A 1GVNB 2R6GA 2RGNA 3GEIA 4Q21A 5JHHB 1R0WA 4AC9A 2XNDD 3GJ5A 2JASA 1P7CA 2PLRA 2GCPA 2BJVA 2BHRA 2GJ8A 3BJIC 2WSSA 2ZE6A 1ZD9A 3Q5DA 3CRQA 2AX4A 3LQRA 4P31A 4MYCA 2JCSA 3P27A 1CBUA 4ZIRA 4II7A 1UM8A 4BGDA 4A15A 4HAYA 4GNKA 4OI4A 4LPKA 1DPFA 2D3WA 4IOKA 1XZPA 4TMWA 2OFWA 2GESA 2FSIA 4C9BA 3L0PA 5BN5A 2GETA 4A1FA 1MKYA 2P65A 1YR6A 3NC1C 4XTCS 1M7BA 1OF1A 2CBZA 5KOYA 5G3YA 5KDOA 4DDVA 1T8TA 4AKEA 421PA 4BFUA 1MO5A 3TH5A 2ZJZA 1O3YA 3B9QA 3GEEA 3LX5A 4IDQA 1ESNA 2ZE7A 5FPKA 2F43B 4Y0VA 1B0UA 1OH5A 1T6NA 4Z1MA 4HDOB 3H86A 2QMOA 4FMBB 5JJLA 2A9KA 2CNWD 4NKRA 3SYKA 1BS1A 3UIEA 2QE7A 3LFUA 4GT1A 4QXAA 2NTYC 1E2DA 3C8UA 4MRPA 5CM8B 2ATVA 4LBYA 2BM0A 4MA4A 3ZH9B 2JLUA 2GK6A 2ZETA 2UVQA 1SXJB 1N5JA 1XP8A 2ODWA 2RGGA 2QTHA 1QHXA 1II8B 2ZI7A 2FA9A 4LZZA 4OYHA 2O8BA 1MABB 1EFRA 2H16A 3M0EA 2UZ3A 2VA8A 1SVIA 4NYMR 3RNLA 1HUQA 4KSBA 5CLQA 1ESMA 2Y8EA 4JMPA 3KQKA 4FMDF 3MD0A 1GILA 3BB1A 2VL7A 3RWMB 1E2QA 4NYIR 3THWA 2VO1A 4TWZA 2CVHA 4F4IA 1PZNA 2FWRA 3TQCA 2ZREA 3U3RA 2OCPA 2BKUA 1NLFA 4RKEA 2CE2X 5KNBA 4XWOA 3A4LA 1ZJ6A 4WZBE 4F91B 1QRAA 1NIPA 1S1CA 2YHSA 5DI3B 2Q9AA 1VYUA 5LB2A 1NG9A 2ZR0A 4XVUA 1EFTA 4RSGA 3QXCA 3OEHD 1AKEA 1P73A 2HLDA 3EZ6A 4RFSB 4WXRA 4QHSA 2JJ1D 1W2HA 4I81A 3ZD7A 3F8TA 3NDBB 3LW8A 5FTJA 2EYUA 4EQ6A 1UBCA 1IQPA 1UBFA 1W4AA 3KJHA 1EX7A 4WVFA 1QBKC 2IYLD 2EWVA 3LW7A 2IT1A 3C5HA 3IDQA 1F6BA 3NH6A 2QORA 3CIOA 4IVRA 3RS4A 3SOPA 3LNCA 3I92A 4IVPA 5KO2A 3EPKA 2PX0A 2GCOA 2B92A 3TNFA 4G5SA 3CKLA 3EC1A 4Q9IA 4DKXA 1GKUB 3WP0A 1S9HA 3KXIA 2R9VA 2DCUA 2DWQA 1W4CA 3EWAA 4KV9A 3RLFA 2NGRA 4A4DA 3BS4A 2B7BA 3MMPA 5A4JA 4M21A 3CNNA 2F9MA 3WP1B 1VIAA 3ZS9A 4ZCMA 5DGXA 1G8GA 5A0FA 4WXPA 4HAUA 5DLQC 1CU1A 1UFQA 1N6HA 1XPRA 6Q21A 1G6HA 2QUZA 1LFDB 2X19A 2YC2C 3QUSA 3PEUA 2ZROA 1QG2A 1AA9A 3FWYA 3R7WA 1G4AE 2ASEA 1K6MA 2YJTD 1EG7A 3MGCA 4LDJA 3U4QB 4M22A 2HYIC 1KY3A 1E3MA 4W9MC 1E2MA 2ZXUA 1YR9A 3SBEA 5IHPA 5FPHA 2O8FB 4RZUA 2I4IA 4OHZA 4V03A 3CLVA 3MFYA 3OFND 1TU3A 3WYFA 2ZJ8A 3CRVA 3NH9A 3KB1A 1Z6YA 4G5GA 1XB2A 2ZIAA 1E9EA 1FTNA 2PZGA 3EA0A 5K8UA 2BEJA 4BZXA 1QHNA 2VBCA 3BXZA 2GWHA 1J8YF 5AJYA 3BOSA 1PUJA 4LC0A 3W34A 4JBYA 3GJ6A 2WVJA 1M34E 4A0HA 1ETUA 4JS0A 4KFUA 3CR7A 4Q4HB 1Z3IX 4O25A 121PA 4Q1FA 4JLKA 1OFIA 4RZ3A 1E2KA 4UXJA 2O8CA 3I3SR 1QZXA 4KJZA 1H8ED 3GJ0A 1KAGA 3UK6A 1Z07A 3W9YA 3I61A 3CBQA 3QXXA 4B6FA 1JB1A 1NY5A 4AYXA 4LBWA 1GFIA 4URWR 3GFOA 3RSLA 4OHYA 3K1JA 5FOWA 2ZI9A 1A4RA 4ZO4A 3I72A 3HPQA 1YU9A 1FMJA 2RGCA 1GITA 1IN4A 4DLZA 4BLOA 1E98A 4TLEA 4TYPA 1U8AA 2P6RA 1II0A 1ZM9A 2JGNA 3CZPA 5DISB 4PPGA 4B34A 1HEIA 3A1WA 1IXZA 1CEEA 2QP9X 3ADCA 4QM6A 1R7RA 2IYXA 3OIUA 1OPXA 4GMXA 5TV2A 3LAWA 1W36B 4LY6A 4DEXA 1EFCA 4JVLA 4Q18A 1CJMA 3RRNA 1KK1A 1NVVQ 2IHYA 2GXSA 4JT2A 5C4GB 2W6JD 5J4VA 5CB8A 3Q72A 4US0R 4HLQB 2R44A 4LHVA 2UZIR 4LUCA 3QKUA 4HB3A 5FI1B 1D9ZA 4C7OA 2O8EA 2GJSA 3J81k 1W1WA 1DAMA 2K5UA 5DYGA 3OAAA 1BKDR 4MH0R 3I8SA 4LPSA 2WMNB 4OJKA 3UMFA 1UEJA 5M04A 5JS8A 3RDPA 4LCBA 1ZIOA 2PMKA 3FKQA 3AF2A 3FMOB 3OESA 4A36A 2H57A 4GFDA 2FSFA 3RS3A 4RCZA 3THYB 4NCHA 4TMKA 3CW2A 3VNUA 3NHAA 4IXNA 1YHNA 4UJ5A 3LBNA 3IBYA 5IK2A 3MWJA 4AKHA 3HR8A 1ZU5A 4Q4JB 3JZMA 2BBWA 2BBOA 2F7SA 1ZP6A 1RW4A 3BB4A 4B35A 1MR3F 3FYHA 1QHGA 4NU0A 2XJ9A 2WV9A 5L3QA 1NG1A 2ZI5A 5G53C 4QC2A 1W0KD 4IDPA 2DFKB 4F92B 5TB5A 2NZ8A 1NNEA 1NLYA 1XEXB 4CEJA 2PCLA 1YRAA 4R2IA 1PLJA 3FMIA 1B23P 4HLUA 2IS2A 4UQOA 1G7RA 1E1QD 1G8HA 5FUYA 4D4JA 2FH5B 5KPDA 2SHKA 2WMOB 4HB2A 1VHLA 4XD7A 4AKIA 2B7CA 4EAQA 3F5FA 4PHHA 1KAOA 2ZAMA 1E69A 4FIDA 5FOTA 5SZKB 2JIZD 1N6IA 5DHFA 1KTVA 2JLVA 5EP4A 4BFSA 2FEOA 3CH5A 4E5UA 3IGFA 3HP1A 2IYVA 4GOKA 3EZ9A 3ZD6A 1GRNA 2EYQA 1NMXA 2ANBA 4DLVA 3ECCA 1Z08A 3M4YA 2RHMA 4HYYA 1L4UA 4KVGA 4TSFD 4V0MA 4ZPXA 1SVKA 1KDPA 3H0KA 3VHLB 1II9A 3ZGXA 3ZZTA 3SI7A 4ARZB 1VG9B 1EX6A 1Z63A 2FDCA 3K0EA 3U61B 1GP2A 5EE3A 4OJQA 3SS8A 2D7CA 1W4RA 4TLAA 3VR5A 3DMNA 3AB3A 1CJKC 1IXSB 4DLRA 1JR3A 2QA5A 3CRMA 1DARA 3W6PA 1MO3A 1OXUA 4B44A 3OZXA 4PR0A 4CEHB 4R2HA 1C9KA 5C2JB 5IRCD 5JBQA 1P9NA 721PA 1E9CA 1CIPA 2RGAA 5KU1A 1IN6A 4CT5A 1HV8A 1WBDA 1XD2A 5HR5A 3NBYC 2RGNC 3VR1A 1GSIA 5CLLA 3AP3A 2V6JA 3IO5A 1R0XA 2XITA 2H92A 4RD6A 3WNBA 1KI8A 4FD2A 1R8SA 4PQRA 5DHAA 1EXMA 1ZUNB 1K5DA 1MRSA 1K5GA 2P5SA 4HI0E 1DAFA 2OHFA 2WJYA 3AKCA 3TAUA 5SZIA 4LYJA 4DZZA 4YXWA 5DN6D 2ANCA 3U5ZB 3VKGA 2KBEA 3FVQA 5FTLA 3A1TA 3RAPR 1A1VA 2DFNA 2XB4A 2FZ4A 3IHLA 4AYWA 4O2LA 1UPTA 4JBWA 3VMFA 3B85A 3EIHA 4FCWA 4LHZA 2BWJA 2JLXA 3PG5A 4ESHA 1HURA 1G17A 4NE2A 5EUQB 3CZQA 2ZRBA 1OE0A 1Z83A 2QPAA 2Z43A 2B6HA 2MSDB 2MSCB 4Q7LA 4RVCA 3PITA 3VR4A 4MRNA 4US1R 4E22A 1D2MA 2WJHA 2W2XA 1SXJD 1XX6A 4LGMA 4FI3C 1C1YA 4D25A 3AP2A 3ZQJA 4QJ4A 5AJVB 2G6BA 2WJGA 1ZNWA 1N6OA 4KXFB 5K8IA 1SHZA 3THXB 2ORVA 3UG7A 5J4HA 1K8RA 1ZNYA 1E79A 1TUEA 3WY9A 3O8DA 5H68A 5HTKA 4DCUA 3IEVA 4YMVA 2XTZA 2C78A 1LB1B 1T8UA 2L0XA 1SVLA 2A7QA 2C98A 1W49A 2J7PD 1TQ2A 5CITA 5JSZA 3L0IB 1YR7A 3SC3A 2WOJA 1GRRA 1Z2AA 2WWFA 2H17A 3MJHA 3QSYA 1R5BA 5J47A 4JLDA 4OI2A 1Z0KA 4R9UC 1BYIA 1KI9A 4Q1CA 3VKWA 4GZMA 3SQXA 4Q7KA 4PX9A 1ZM3A 3GFTA 1E0KA 2UKDA 5B30A 2VP0A 1H8HD 3KXKA 2KJQA 1S96A 4FCTA 4XWKA 4YMTA 1JJVA 5FTKA 4C0HA 2AD1A 3QY0A 5DIFA 3T1VA 2J3EA 3MWYW 1G41A 3DHWC 3EAQA 4WZ6A 2WKPA 5FL3A 1HE1C 2R65A 1J2JA 4JLMA 4GOXA 3C15C 3HU1A 3B6EA 4O3MA 4IEEA 3TR5A 2JLQA 1N3BA 1U94A 4LK2A 4PHTA 1KNXA 1MO6A 3SJBA 3WMFA 4DT1A 4TL9A 3OIYA 3BERA 3O8CA 1Q21A 2ONJA 1FL9A 3X1DA 3OHMA 4JLOA 3K70C 4TL6A 2F1HA 3BORA 4DUGA 1L8QA 5LDDC 5L3QB 1OXVA 2IW3A 2BBTA 3B1WA 3PCRB 2RHDA 3GLGA 1RJ9B 1KI6B 4L4UA 4PANA 5FFMA 2QM7A 3N2IA 1E0SA 4YC7A 1G6OA 3GLHA 3OIVA 4GSYA 5B64A 2IX3A 4QBIA 4XVQA 4FMCB 4MUAA 2E1RA 1KY2A 4BFTA 4GZLA 3FHOA 3QKSB 3GCGA 3ETLA 1KI4A 3P4YA 1XEWY 3KKQA 1XBTA 3V00A 5TXGA 4TYQA 1WDTA 3AVOA 2EFGA 3UANA 4KLZA 5JMTA 3QPWA 4KFRA 1KDOA 5JWOA 4CW7A 3CB4A 2BMFA 2ZTSA 1G8YA 2ZRPA 4PFSA 3B60A 3LY5A 4OK6A 3ZIAD 1ZCBA 4HDQB 4KVAA 3GLIE 3AEZA 2IS4A 3CR8A 5FOSA 2G83A 2CXXA 4URVR 3U3OA 4G5RA 2QSZA 5KNDA 4WA7A 5D3MB 4HUTA 4Q48A 1M8PA 4XOIA 1PLKA 2PEYA 2ZJ2A 4DLXA 3V4FA 2D2FA 5KSOA 1OH8A 2IEYA 4M53A 4B48A 1RPZA 1G3QA 2GCNA 2PJZA 2O8DA 2FE4A 2VP9A 4U02A 4D4LA 3QXHA 1YZLA 3A37A 2CCJA 2YVUA 2ZE5A 1U90A 4U5XA 3PR1A 2GJAA 3GLFA 5LD2C 1CLUA 2IK8A 1J70A 2WSSD 1VHTA 3DKPA 4KCGA 2C03A 1Q1BA 2VHTA 4IDHA 2PEZA 3U3KA 5J4KA 3NBZC 1XD2B 2A30A 1XEFA 2D62A 8OHMA 4DHEA 2CL6X 3C7KA 3HYTA 4M1YA 2R6CA 2VIIA 1D6JA 1BMFD 1E9BA 3OF5A 2F3TA 1N5IA 2OLJA 2QENA 3K53A 3MUFA 2AL7A 3QEOA 4JLVA 3Q85A 4A2PA 1UAAA 1NN1A 4ASUA 1X8LA 3HU2A 1SVSA 4A8JA 1HE8B 4CDGA 3TE6A 4Q1DA 4Q02A 2G9NA 1S0UA 1E0JA 1KI7A 1KSGA 2DB3A 5CIQA 4BPBA 3IIMA 1P4SA 1D8TA 1Q3TA 4IDOA 1XJCA 4DB2A 2J0SA 4X8LA 3W5JA 4LC1A 2FNAA 1W36D 4OQFA 3NXSA 4DJTA 1CJTC 2ZRLA 4G5QA 4C2UA 2XOKA 4EPWA 2GILA 2HUPA 4IVQA 4FCVA 1GNPA 3BH6A 4IDNA 1XCGB 3DOFA 3F0TA 3RS0A 2QE7D 4MGYR 3V9PA 1N5KA 1XCMA 2O5VA 5DO9A 1N6LA 4KLNA 1GRQA 1KNQA 2ZRDA 3T12A 2QPTA 1F2TB 1NN5A 3NTUA 4PAOA 3X2SA 4D82A 2E87A 1XWIA 3TR0A 1GAJA 2QAGA 4IJMA 4KBFA 4FWIB 2ZRMA 4UNQA 5P21A 3AVVA 1KO8A 1UKEA 1OKKA 2ATXA 2GEDA 2OFXA 4NCNA 2NIPA 4B3CA 4JVMA 4PXAA 3JZAA 2DFTA 2ZRKA 5FPYA 3I8XA 1FZQA 2ZI6A 1J99A 4IFBA 4M9ZA 3QBTA 4Q1BA 4OI1A 4PC7A 1ZVQA 4A0GA 3E5HA 4QBGB 3B2EA 4G0NA 2QMHA 1W2GA 1W44A 2XXAB 1COWA 2N42A 2VSFA 4JBXA 3VX4A 4CGZA 1D2EA 1ZC4A 1E9DA 3E70C 4JJKA 3W5IA 4QRHA 2R8RA 3KTAB 4F93B 1VECA 1DE0A 2O0HA 1CRQA 3SJZA 1NVUQ 3BFKA 4FMCF 5TVKA 5KSPA 4AK9A 2HLDD 3CX6A 1JR6A 3KKOA 1G4UR 2V55B 5AUPB 1T0JB 4LV6A 2V54A 5AR1A 4B3XA 3ZVNA 2WJVA 1E4VA 2AHOA 1F2UB 2Z5FA 3PEWA 1E2GA 4M9XA 1WCV1 1T4GA 4HLUC 1PV4A 1R4AA 4QJ3A 3BIFA 3K70D 2VEDA 4TN1A 4YMUA 2GVZC 4P0TA 2Q6TA 1OXTA 5C1BA 1Z0IA 2HDNB 2MMCA 5JECA 3MG9A 1TUIA 2IC5A 3ZJYA 1JEDA 1OHHA 2FGKA 1EK0A 2Q9CA 2RH5A 3AKEA 4Q47A 3QXJA 5CB6A 3U7HB 2QTFA 3K09C 3SYNA 1FOEB 3QE0A 3K9GA 4M1TA 4GDFA 4ZKEA 4LJ8A 2AN9A 1T5IA 2ZM5A 4S35A 4LWZA 4C2TA 3MLEA 4EFNA 4Z8YA 4CEIA 1P5ZB 3EPJA 3SHWA 4NCKA 1CRPA 3T35A 2EU8A 1CTQA 3RRZA 3WBJA 1G291 3Q7PA 3SR0A 2Q21A 5E7MA 1KSJA 4NHOA 4MDFA 2IF0A 2XTMA 3P32A 5AJZA 1OJLA 2GVDC 2JAQA 1E2NA 3O47A 1G5RA 4TTPA 3WRYC 4QBFA 3LH5A 5L3VA 2I1QA 2CCGA 4BFYA 4RFVA 4LJ5A 3ZQ6A 5SZJA 1LS6A 4D26A 3NG1A 1E6CA 4JYBA 4NPHA 2NO1A 4CIDA 4BEBA 4I1SA 2OCYC 2WKRA 2QM8A 4JVSB 1W7AA 1JNYA 1KJWA 2XZLA 4BWYA 3CRW1 2PJRA 1NL3A 3T34A 1TF7A 4HLCA 4GBMA 4ESVA 1HT2E 1AKYA 3B1XA 1DBSA 4HUQB 1UJ2A 5TY0A 1ZD1A 2WAXA 4QOSA 4GL2A 5JEEA 3EZ7A 1QHSA 2ZAOA 1N6KA 5KSYA 2OBLA 3GLIB 2ZE8A 4TT3A 1GL9B 5DYIA 4XVRA 3U3JA 1R0YA 4PAQA 3I73A 4AG6A 3EASA 1T0HB 1ZINA 1KK0A 4JYCA 4AI6A 1AZTA 2QU8A 2VSOA 1CKEA 5HPYB 3U44A 1XU4A 2C04A 4R7ZA 4XH9B 5L3SA 1OH6A 2BMJA 4W5WA 3L82B 4TMVA 1GUAA 4TL7A 5FBWB 4J0QA 5CK5A 4HB4A 4AKGA 3AH8A 4OK3A 2AFHE 5HKKD 3RYTC 1CF4A 2ZR7A 1R5NA 1JQLB 1NN0A 2C99A 3T5DA 1CP2A 2ZRAA 1E94E 1FX0A 2FPKA 2VHJA 4OHVA 1EGAA 3W90A 4QL3A 1UKZA 5CDFA 4NYJQ 1KYIA 4UJ3A 3ZZUA 5UKDA 1KZGB 4AG5A 1Z5ZA 2G77B 3LV8A 3I62A 1GIAA 3AUXA 4Q9JA 1ZNXA 3SJCA 5EXSA 4ZV4A 3ND9A 3H2YA 3C16C 1SGWA 3AP1A 1NP6A 2Z0MA 3BH0A 2YZ2A 4LJ9A 2GA8A 5JZVA 3GP8A 1RRPA 3FHCB 3RRMA 4NDZA 1Z8FA 3ADKA 2OXRA 1WF3A 3OAAD 5H8WA 4LYFA 5C18A 1J8MF 4KBGA 3FHTA 1AQYA 5B2ZA 5IF9A 3EZ2A 3C41J 1F3OA 4JJZA 4AYTA 1N0UA 1UKVY 4RD1A 4AD8A 2PZEA 3KQNA 2NG1A 2XNDA 1U0HC 2B8TA 4QFMA 1YRBA 1G7CA 4P4SB 4DLTA 5IK2D 3CWQA 3R9IA 5JS7A 3KJGA 2CJWA 2ZJYA 3Q8XB 1CXZA 1FTSA 2IXFA 3U7EB 4HZUB 1TX4B 1GZSA 2AXNA 4Q4AA 2IYZA 3HPRA 3OIWA 4DSOA 2V1UA 2W83A 1X1SA 4P33A 1TAGA 1Z6GA 4ACAA 1HT1E 2EFHB 2QG6A 2P5TB 4JL6A 4TMZA 3GEHA 2IS1A 4M9QA 3HU3A 3TIFA 1TADA 2HCJB 5FBQB 2GEUA 3QJYA 4MUBA 3KXLA 1JPNA 4BE7B 1AIPA 5H70A 5F9FA 2XSZA 4XD7D 1LF5A 4ZDWA 3AF1A 2Q3FA 3AV0B 1WP9A 3FDIA 3QF7A 1DEKA 2CHGA 4PTLA 2HT6A 2BKEA 1YJ5A 3VU9B 3EZFA 2WKQA 3AVUA 2BBSA 2KWIA 3IQWA 1VCOA 1HA3A
chains in the Genus database with same CATH superfamily
3F5SA 3LCVB 1RBMA 2HBRA 5DWDA 2BCJQ 5J1SB 1HR0B 4Q5IA 2X0DA 1FNCA 5FA8A 4C3UA 5T64A 3ZYZA 2EG5A 2PLFA 2YXDA 2KB0A 2QLLA 1Z37A 2QTGA 4DKJA 1WVMA 3PFBA 4MLCA 4XGKA 4WXEA 1IATA 5L7YA 4FZVA 5H3HA 4ZXFA 5JXGA 1X19A 2MINA 1I0ZA 4BO1A 1CVIA 4J91A 4GBJA 3A36A 4FFSA 3RS5A 1AXRA 2TMKA 4MDEA 3HJNA 3QZUA 3ZWKA 4Z7OB 2Z8YA 4BMSA 1FS6A 1V6SA 2CLLB 4CIXA 3NDRA 2HKIA 1M54A 2G5CA 2I03A 2FG5A 5A9TA 3E48A 3GVHA 3LCRA 4J2OA 4M1SA 1HG0A 5EEGA 4UULA 3QF4A 3WIBA 4C3ZA 2YXPX 5J4VA 2J4FA 2ORWA 2BD0A 3BWCA 4PPFA 2ZR8A 3LA6A 4Q6WA 3V9AA 1WIWA 3DV0B 3O93A 3CCFA 2RIPA 1FQOA 7ABPA 2MSEB 1GCAA 4M9SA 3WLNA 1SUAA 4F9GA 1R8XA 3MB5A 1XKLA 3BM5A 1ZOSA 4EHDA 2ZWPA 5JD3A 2FUKA 1B2LA 4G36A 3UMMA 1OBHA 5IC5A 4N0DA 1PJBA 2REXB 4DXDA 1VJ5A 1VPLA 2ECKA 1J2UA 1ZD5A 1NSYA 3O2SB 4MMYB 1IHUA 4WTOA 4DMLA 5LVAA 1PD0A 2O8BB 4U9HS 5A5VA 4KC0A 4EKGA 3JZIA 4EY8A 5CA1B 3H8WA 5FA5A 1QVAA 2FZCA 2J9ZB 2FSUA 1O4WA 2JZNA 3KYJB 2FPGB 4HQ0A 4MDHA 1ZGAA 1C4OA 2QAJA 4X54A 4ZCSA 2Q0HA 2NSHA 4OP3A 4E88A 4LX0A 4V0LA 1LI4A 2GYVA 1Y6ZA 4I1UA 3V1UA 1H2EA 1DTSA 3CLHA 4BCBA 4AM8A 1C3JA 4LKRA 2H4ZA 4RD3A 1B3RA 1QS0A 3DLIA 4NONA 3T3HA 3GARA 4CM1A 4HHEA 1IHYA 5JMWA 4FP9A 4HWTA 3VR4D 3MJRA 3GJZA 1PZFA 3PXDA 1KWKA 4JBHA 2YJ4A 1XDBA 2D74A 4CQLB 4QFCA 2JIRA 3H9JA 1QE3A 2Y92A 2CXRA 4RV5A 2V0CA 2FN7A 3UA4A 3F6EX 4H3KB 4V0ME 3W5HA 2PIAA 4UPVA 1WW3A 4A2CA 3DZJA 2HU8A 4GKVA 3A6PC 1G7SA 3DOEA 5EPUA 2QUJA 3TZKA 1ZOPA 5JSZA 4EQ6B 1M6HA 1XI2A 2NYRA 4RTOA 5F5LA 2YRWA 3SWWA 2B21A 2ZIUB 1THMA 2WPDA 3WK8A 2F48A 2B8JA 1DAHA 3HLKA 2FCRA 5JWHA 2P4EA 2PXAA 1BA2A 3M1LA 3MJEA 2C5BA 2QP4A 4GMDA 1DIRA 1X8JA 2VYNA 4I5DA 3U7RA 1EXDA 2Y0CA 5IVIA 1Z15A 3PNSA 4A8PA 1KWGA 2D06A 1U0BB 3JZDA 1B16A 3RABA 3RIGA 1U8ZA 1XEWX 4I5IA 1N1GA 3SSAA 1IZYA 1G98A 3WVNA 1X3SA 4BB5A 4COKA 2JHAA 1CUUA 2XUHA 1YDWA 1OSNA 1WXQA 3KD2A 4YCNA 3ISJA 1L2TA 4OX9B 5KAMA 2A5JA 1P91A 2VNJA 3FNEA 1FYVA 3PVZA 3WDSA 1PZHA 2ZJBA 4KNVA 1NYQA 4MQMA 4TRJA 4ZKDA 1XRMA 1JPVA 5C1PA 5I4CA 3DGEC 3OZDA 4DCTA 2C2XA 3DTVA 4ZWNA 5AUQA 3V2UA 4CYMA 3DE5X 4PC3A 3SX4A 1P0FA 4WEOA 5CH3A 2QYHA 4TM7A 1EQUA 2PWAA 4FXOA 2QZ4A 2C7GA 4UVDA 1UINA 3BYZA 2QEQA 4HATA 3JYNA 1Q57A 3CE9A 3Q6IA 2C61A 1T3GA 1TYBE 1NNUA 1AURA 2YIVX 3WFJA 4ZZIA 3FKSD 3LDFA 3LT4A 5DYWA 5CYGA 5JJKA 3CHYA 3IXQA 1VE9A 2FSPA 4JYMA 3VOTA 3HJRA 4E46A 2OG1A 1PQUA 1UXHA 2AQKA 3OSZA 3QQ5A 4DQUA 2VLBA 3FDXA 1UZNA 4G01B 4FT2A 1A69A 2YZKA 3TFWA 3QVKA 3OKFA 3PR3A 4EA7A 1KEEA 3GROA 2Y1LA 4B81A 2HI0A 2X3UA 3ABIA 2HQOA 4TMTA 1RHJA 3TRJA 3WLHA 2H1WA 2VJYA 2XMPA 4CV0A 1FYWA 3B48A 1T9BA 4UMFA 4MARA 3OQ6A 2P75A 4A3SA 1EJ2A 1GTMA 1XRLA 1LW7A 4HQFA 2C5GA 4QTTB 4Y6PA 4HB0A 4JBIA 5LD2B 2GJKA 4MHTA 3HM2A 4RK4A 5IC4A 5C5EA 1KRXA 1E89A 2AG1A 4WZAA 2RK6A 4BB0A 2BFDA 4HLNA 3MWLA 4PSKA 1DRJA 1WUJS 1GKKA 4RK0A 4P7BA 1U7WA 2Q5HA 4E4TA 2ZIWB 1ZK2A 5CYPA 2GLUA 1W35A 2FP3A 2ZJAA 2PNJA 2C1ZA 1P72A 4NP6A 4JNCA 1BO6A 3HJTA 2ZDQA 2JFUA 5K6AC 2OUKA 4TWRA 1S01A 5HS6A 3QOFA 4I66A 4JP3A 1GV0A 2VYVA 2R6DA 2DBVO 1ZHHA 1ZZEA 2GGSA 2OPBA 3A05A 2FPSA 2W6ID 1QNLA 3MBIA 2UUCB 4O29A 3OT1B 5FOUA 5HFNA 1IB0A 1X0XA 2G28A 1VJGA 3B38A 5GQSA 2P6MA 3KCNA 1ULTA 4P4NA 3CNOA 5DP1A 4IH9A 2GYUA 4OIMA 5C1IA 3UMSA 5KDLA 4AY3A 4DSUA 2IEDA 5G3ZA 4ED9A 1BXGA 2JANA 3RFXA 5I7RA 1C0PA 2FMKA 1I7DA 2HO4A 4FDLA 3FFBA 4PM4A 1EQAA 4DLBA 4MS1B 3L2OB 3DEFA 3TBFA 3CUEF 4E4YA 2EX1A 3AY6A 3R3JA 4JDUA 3A3YA 5EJ2A 4Z9FA 3IUPA 3MS7A 3AGQA 4AIRA 4Q03A 2D5BA 2C8KA 3A2NA 4I9NA 4JROA 4JJIA 4OFBA 5DB4A 3ZCUA 4KHPB 1U0EA 2CMKA 4RVDA 3WYDA 5JFGA 1KS2A 1F4VA 3HGTA 1F5NA 4C7OB 2YVLA 2O8EB 5HA5A 3AKDA 5GOZA 5DCLA 2RSLA 1B0ZA 5REQA 5JPCA 2OCBA 1Q1ZA 3FBGA 4PEVA 4W5JA 2YHUA 3UMVA 1V48A 2FFHA 2QQ5A 4AP9A 2BLNA 2AGVA 2XB2A 1O0CA 3EEFA 1GYQA 1Y7TA 1TO2E 5EESA 2W6QA 1R0BA 1PYDA 1TYDE 3NAMA 2XEXA 4KUHA 3TKYA 5IJ0B 3GLHE 4PWZA 1K9VF 3IAS1 1UMCA 2I78A 3KL4A 3KTFA 3HYLA 2WMYA 4L2IA 3I09A 3EDRA 2P62A 3ZCRA 1T2CA 4FR2A 1DBPA 2NSDA 1T4MA 2C95A 3BXHA 3GYBA 4J16C 1KJQA 1SCIA 1D4ZA 4M1MA 4YH1A 2VXOA 3ZD8A 1J8VA 1GPMA 1Y4UA 2E5FA 2A1UA 1JEQB 3T9EA 3A14A 5I7OA 1RMYA 3FKJA 5AJUA 2GXUA 4UNSA 3LDUA 2C3UA 4RNDB 1HT3A 2IYTA 2VWHA 1Y1QA 3EZYA 4KN8A 1JPUA 3AXTA 4XLLA 3G8DA 1Y7IA 2I2CA 5JISA 4CZ2A 2BFWA 3TCNA 1TTTA 4MW4A 4L1KA 3TTYA 5KOIA 4YX9A 2OYCA 2V0NA 2ZWOA 3HWSA 2I8LA 4X3CA 3KLOA 3GT7A 1I3NA 1W29A 2P67A 4R1UA 1L8XA 4FZJA 4WHMA 4E5MA 2D2EA 3KQVA 4TTQA 1JFVA 2HRZA 4ES6A 3X3HA 5ICSA 3QHAA 1XVTA 4U00A 3GXBA 1GGMA 1K86A 2IYRA 3FTCA 2AEEA 3A4VA 3H6GA 4IEIA 4U39A 2JPDA 3PEYA 4DJDC 1RLUA 2ZUDA 1NUSA 3ZWDA 2IUUA 3VR2D 2PYZA 2YJNA 5DSXA 4FOLA 2CV2A 2VPTA 2RH8A 2XUKA 3FPLA 3T15A 2DUJA 1XMJA 1WUTA 4B3IA 4DWWA 4E94A 3GLFE 3ILHA 2AR9A 2IA5A 3WHIA 2G7MC 1K97A 1IM5A 4L51A 1P62B 3MN1A 4UREA 3UUFA 2GPWA 4U7JA 2YNMC 5DTEA 4M54A 1MEEA 2AUMA 1B1AA 3ANXA 4ZO9A 3RVOA 1UT8A 1DX4A 4L9WA 4F3KA 2AUNA 1VCHA 1YC5A 1V1RB 3H2HA 1FX1A 1OXXK 4DV7B 4B6JA 4BWFB 4H6XA 1AKNA 3VPFA 2N9UA 3X1YA 5IANA 4OBBA 1CUDA 3KDSE 4KXLA 3HDVA 4V24A 2OC4A 4EEZA 2R2AA 4DLUA 1G2OA 3PUYA 4BRWA 1JDPA 3C8HA 4OPMA 4P4UA 2BMAA 4IXMA 1JQEA 1T5DX 1XC7A 4KQ1A 4PE5B 3WKBA 3N8IA 2C7RA 1VIDA 1G2QA 4LYHA 4Q9LA 3BFXA 1EFVB 1NF8A 5GV7A 2CUNA 2MCFA 4EDHA 3ZDFA 1VCMA 1B8VA 4JA2A 3P9ZA 1M6YA 5DXJA 1T3HA 3O74A 2ZULA 2C5LA 1X6VA 1PUXA 3FAZA 4EKNB 1XMQB 1YNOA 3TSWA 4K7JA 1XTJA 4G07A 4EJSC 3GPIA 1XZKA 1GU7A 3L46A 4OVKA 1XRJA 1YB6A 2NSLA 2D13A 1P5RA 1TA4A 2WVGA 3NR2A 4JUCA 1YZFA 3NBFA 4MYRA 4NAUA 4ZCLA 5CBPB 1JFFA 1P2SA 2GEJA 1YGPA 2WSMA 3FPSA 1EEXB 1IOLA 3TW6A 2ZIEA 1PLLA 3TVTA 1HFJA 1JHPA 2WM3A 3ZVRA 2YFQA 5AK3A 1RRCA 2UDPA 2VF7A 1UFOA 3EPHA 4OAQA 4FFNA 5CCDA 1YU6A 1QYDA 3S1LA 1ZNZA 2IQ5A 3IH5A 3ENZA 3PHCA 4KYTA 1ISRA 4P98A 5DNAA 3UJ7A 3E8XA 3G1WA 2EWWA 5F7OA 1XZGA 2G72A 2I4LA 4G1VA 2ZRHA 3FZYA 3G5TA 1NDUA 1TQ6A 1N57A 4RFSA 2CXNA 3A1FA 2NPFA 3WE7A 4UATA 3BJMA 2CMDA 1XD8A 3EAGA 1MOSA 2ZZNA 1VIMA 3ILSA 4LZWA 5EMLA 3AFGA 3OFKA 1WS6A 3GEPA 4F2GA 2R6JA 4GVLA 3GGPA 1EFRD 2RK4A 2CBXA 4Q16A 4GC5A 4MPDA 4RF4A 1XLTA 1OGJA 4CL2A 2AR7A 1G59A 1H42A 4UM9B 2F1KA 1Q0HA 4DMFA 3S8MA 1UPAA 1D4OA 1L9XA 3BIOA 4BFZA 3I5XA 2PUBA 5EY5B 3KCQA 4YIHA 3CYFA 1U8YA 3WYGA 3GLTA 1JPJA 1MUUA 1VDZA 2PZBA 3AJDA 3JQ7B 4XLZA 2P2LA 5ALNA 4Y2HA 5K3DA 1JFRA 1T24A 1K3UB 2HCRA 4AJEA 5HQ3A 1IBLB 4M0MA 4ENWA 1KO4A 3LP5A 3V7NA 3C3DA 5ESXA 3MB8A 4DRYA 2X41A 4RVOA 1RZRD 5LYYA 4R8KA 1WW8A 3O4GA 3ERCA 2QR2A 4IMPA 2XPCA 3C6QA 4BNJA 5K9ZA 2IYUA 4DXAA 4QTUB 1J90A 1GPBA 1LPSA 1QB7A 2O2EA 1VCIA 3HB0A 2D1FA 4IP0A 3V55A 1J5EB 4L4SA 1NJ1A 3IP9A 4MMZB 3EISA 4IH1A 1I3KA 5GPBA 4Z4HA 5T4BA 3GPBA 3KALA 2POQX 1FRFS 1U8UA 1DG9A 3IEUA 3QVTA 4DOMA 2NZVG 1XF9A 3PJFA 4YUAA 4BUJA 1TCUA 5EJ6A 3O6VA 1LI7A 2W2KA 2FUG1 3LUDA 1HK7A 4MW5A 4V0NA 5AJWA 4MXDA 2BJWA 2VNAA 3IVMA 2ZU6A 2JD2A 4ABYA 2ZKIA 1ECFA 3QLTA 3RYIA 1NYTA 4MEJA 1E2HA 1SCDA 3QPCA 2R11A 4GYJA 3WZMA 2G5PA 4HNAB 1YQWA 2VPIA 4D96A 2HLHA 3PL5A 5AI0A 3WMEA 1DBQA 3NJ8A 1P2UA 1WZ2A 1G5TA 3DMTC 2GN0A 4L2IB 2J1LA 1H23A 2CLOB 3NASA 2HX1A 2XDAA 3IAHA 1T2UA 4B71A 4MWSA 3OA0A 2N47A 2PV7A 1CR1A 4LZLA 3VU1A 4QGHA 5ELXA 4MIOA 3NHFA 3TVDA 4AS3A 1S3FA 4JB2A 5MGBA 3QPAA 1I7QB 1CIJA 3EH1A 1V6AA 4J7CA 5TPWB 2IWRA 2F8MA 3TW8B 3LYUA 1CR2A 4OO3A 4DTCA 3MCTA 1GUDA 2AE2A 4NXNB 3I9V6 4LA4A 3VBEA 2X22A 3T1QA 3TQHA 3WS7A 4B4VA 4Q4HA 1SB9A 4MKHA 3B7WA 4C7BA 5FR1A 5AVQA 2H1FA 4HMOA 3JYHA 1E3SA 3PWKA 3FNQA 3OD5A 3RBXA 3OFJA 3T5CA 1K68A 1XNQB 1K89A 1VE7A 2Q1UA 2FSGA 4I08A 4PZDA 2UXBB 2ACVA 3QSGA 4ND1A 3MCZA 5BQPA 4F56A 5FTMA 1RZ3A 5BSVA 1LTHR 2VT3A 3QITA 4KXMA 5BYAA 1NR5A 3A9WA 5K0GA 4HZIA 1RZUA 5BYKA 2VSQA 2AF3C 4LK3A 1J5XA 1TM1E 2ZUFA 3FOZA 1WHSB 4RMNA 4BMCA 1DHTA 2QRUA 4G4JA 4QUAA 5E95A 1EG2A 3RG2A 2ZSAA 1T2EA 2JATA 4QWMA 4UE2A 3U5TA 4O4IF 3FFAA 1SVOA 1D1SA 3WL8A 5HQTA 3DXZA 5BSGA 3COSA 3DE0X 4H08A 3OP4A 4FN4A 5I5EA 1M2WA 1NDQA 3BMOA 2MJLA 5MN5A 2B1GA 1Z4PX 4NJMA 4CLOB 2YFYA 1SA0A 2YWCA 3HDQA 3PQ5A 2XQVA 2XSZD 3OCZA 4PWYA 4XSGA 5TX7A 1VI5A 3OM1A 2O14A 2WIKA 4Q3LA 5K8LA 1RXCA 4ITUA 3H1AA 4BU0A 1M1ZA 4IJWA 4O8ZA 3ADDA 4HEJA 2O8DB 4IRUB 2NOAA 4EYSA 5I7FA 5FOVA 2G9QA 3GFFA 2ZAYA 3T06B 1J25A 1L5ZA 3NLLA 3NV9A 3U39A 5LUBA 3LQ1A 3WYNA 3AM1A 1Q11A 2J4DA 4DFDA 5FNVF 5E6SB 3RWOA 1SBHA 3G8BA 1QHIA 1DGQA 3WLKX 2E4WA 3WJ7A 2IYNA 4BQPA 1KZ6A 3C3PA 3UKDA 3X2EA 5AQEA 3EUAA 3Q0TA 3ZUPA 1KK2A 2F6RA 4WACA 3SYLA 1JWBB 1ABFA 1YL6A 4RDCA 1OTXA 1AU9A 1Q5PA 2ZB4A 3EZGA 4YO7A 4AVYA 5KJ1A 4CRWB 3LT2A 4KGZA 1DO0A 1NKTA 5D6NA 4DR1B 3K5WA 3RC8A 3H11B 4PPNA 4BOYA 1XDUA 1XTSA 3BXXA 2NM0A 1XIVA 5BNIA 1U0NA 3OTQA 2QJWA 1A2BA 3G2PA 4Y2QA 4C7KA 4WNYA 1GA1A 4P3YA 6REQB 1QRTA 1E8DA 2WSIA 2I34A 2JCGA 4MVCA 3REFA 4AW9A 5F7ZA 2HDOA 2ZOSA 4HX2A 3VISA 2X4LA 5KQPA 5EXEA 1DHRA 4KAXA 1E6KA 4PFJA 5CMLA 1FBNA 4ZICA 4D9CA 1N9GA 5JD6A 1N7GA 1DUIA 1T6BY 1JDVA 4QTZA 2B1IA 1Q17A 3K5PA 5AJXA 2XUFA 2IE8A 4AMUA 4FMPA 3I1IA 2C58A 1TYZA 2VRNA 1LW6E 2R1ZA 5EUBA 5HBGA 1ONSA 3B52X 1C80A 3DZDA 4OF4A 3RR2A 1FP7A 2H52A 3PPIA 1MGPA 3N5KA 3BJEA 2IYQA 3SZOA 2VHYA 5ESWA 4DBLC 2XADA 4ALNA 3PD1A 4NECA 4Y7DA 3BIXA 1RKBA 4M0DA 3HZZA 3OTOB 1PFKA 2X9VA 4MB0A 1FYDA 2FPRA 2DSTA 3GDGA 5ISMA 1ZYUA 2PT7A 3RTDA 1I6MA 4QNMA 5A3SA 4KMOA 3KOXA 3CLTC 3X1ZA 2BMDA 2P0EA 5D3KA 3GOHA 4E07A 2ZM6B 1CDEA 1T91A 1VDMA 2C07A 1V8ZA 2YWGA 1NX9A 1Q6YA 5BO5A 2QLFA 1EWYA 1N25A 3RI3A 4ARZA 2HR1A 2WK1A 2WA1A 3D5EA 3D64A 3MRVA 4PS0A 3R8FA 2ZI3A 5FWXB 4EATA 3QEMB 1RRFA 3OCJA 3TTUA 4HGQA 4ZEMA 5BV1A 5CURA 5JJCA 1X7WB 1N3LA 1XHEA 3UW3A 4I0WB 2OLKA 1QFZA 3FMFA 4HF7A 1QWOA 3ZHUA 4A9AA 1ELOA 2KM1A 2TRSB 4R1SA 4FWTA 4Q12A 2XGMA 1O6CA 1KETA 4NBUA 3T4PA 5DI9A 4ALKA 3NIWA 4X1IA 1YRQA 1MV5A 1XRSB 3HE3A 3R3SA 4PLCA 5IJAA 4DSTA 4F7DA 1GGEA 4JBLA 2CNLA 3D59A 4LZJA 2HCBA 1NN3A 4JVNA 2WPDD 1A50B 4AS1A 1F7VA 1TUGA 1X7HA 3E82A 2O7QA 3B3AA 4WKPA 3W8NA 4DSNA 2IYPA 1PJ8A 3JQQA 1PS0A 5LKRA 4P92A 1XRPA 3KJEA 2VYCA 5FB3A 1X38A 4J1SA 3QE2A 4ZVVA 3DHNA 2GPYA 1JN0A 4D2IA 4E70A 2YQ5A 5IABA 1AKWA 4ZCPA 1CUVA 4KHZA 5HFJA 3O95A 1KMMA 5HZMA 2B35A 2CLDX 5IJXA 1VBFA 5H81A 3JYOA 4PAMA 4UNPA 3OQHA 4R8SA 3CF6R 3ZNNA 5A1JA 1M0TA 1S7GA 3RVJA 3DP7A 1NBME 5CGZA 1OX4B 4GGPA 4OHUA 3IULA 1FP4A 1TVKB 3DTVD 2LPMA 4FDAA 3UWPA 2GASA 2WSYB 2BMEA 4YR7A 3EPPA 4IS2A 1NBOA 4B32A 3FETA 4PZZA 3IDFA 3MWEA 2P1DA 1ZNQO 4H7IA 2VF2A 2Z8YM 1O95A 1BMQA 1GT6A 1CZKA 1L0BA 2WINI 4UHCA 1JIUA 3CW8X 1NMZA 3IOEA 3TIGA 2FHSA 4HBZA 5FO0A 4N6GA 1CPYA 1SUFA 2WFZA 3AONB 5E0KB 3QEAZ 2OD2A 5FLYA 2AYYA 4CV2A 4YMIA 1ADGA 5B4VA 4BV9A 4X7RA 2LIVA 3R44A 4F4FA 4I19A 3G68A 4FINA 4TWAA 1EBFA 3DCNA 3Q5EA 5HKKA 3WNCA 1EGVB 2BFNA 2OHXA 2JJ1A 3WHPA 4TLDA 1FFCA 3BMOB 1MO2A 3G1TA 1G3IA 4NJMB 5CXXA 3TWOA 2PUWA 1HO3A 2G8LA 3OIGA 2OD7A 4MHSA 4WKGA 1X7XB 2Z2YA 4XR4A 1JIVA 4ZJUA 2O2HA 3D8HA 4LSZA 1HQCA 3INTA 4LHXA 3K9HA 1VXRA 5G4KB 1E96A 3ZK8A 5DHSA 3SM3A 5H3LA 2FRVA 3IUSA 5B4UA 2GT1A 1X74A 2I99A 3GGGA 1NATA 3MEQA 3MTQA 3HKEA 4I2VA 3UK1A 2JLRA 3LY9A 1V25A 2PRYA 2F00A 3Q9NA 4M9UA 2F3QA 3O7MA 4JY7A 1ZMOA 2FI1A 3OZTA 4D3XA 4ETWA 2XXJA 1SG0A 3TOXA 4EJ2A 1K3FA 3RRYA 1SC3A 2F9LA 3PFNA 4OKSA 1VKZA 1I1OA 2CF6A 3JQRA 3NDJA 4GOJA 4BX3A 1S2IA 3A1CA 5AP9A 3R0ZA 3ZWXA 2IE0A 4A10A 1MFZA 1PZXA 4QYMA 4L28A 4BKRA 3I39X 5BW8A 5HOQA 9LDTA 5EZYB 4PYNA 3GLSA 4RXUA 3V1YA 1Z4KA 3Q6NA 2BONA 5FBHA 2HK7A 4BP9A 2R6FA 3ROZA 1NY6A 2EF1A 5H02A 4W5NA 2LRHA 3KSBC 4S2UA 3URKA 4H27A 4EKIA 1NVFA 2FK8A 3F49S 3O21A 1W581 2Q7DA 5ERXA 3RHSA 5FWDA 4PHCA 4QT4A 5HXAA 2BAGA 5IZCA 1RBYA 4MW9A 4H4CA 4BV8A 1FX0B 1WQ1R 2BM8A 5AFSA 4LECA 1TUBA 1E1CB 2HXGA 3A1SA 3F2VA 4U0KA 5FEUA 1O6GA 1A72A 1QAOA 2CD9A 5C7IO 5KZMB 3GNLA 5AKHA 1TJYA 3TRFA 5E1BA 3SEAA 2PL9A 5C46F 4L07A 2X8JB 4EMBA 2AVDA 1YKFA 1YS7A 3ZGOA 2Q2OA 1SC6A 3NTOA 4BNNA 1SNYA 3F5DA 4Q7MB 2JJYA 2LKDA 4I1VA 4LNHA 5CJ2A 5FPSA 3O2NA 1QQAA 4B87A 1P61B 5CLFA 3FOFC 5F9HA 2YS7A 1CUSA 2ORIA 4B33A 4XRGA 4QUIA 3KFLA 1IN5A 1B42A 1UDWA 2R85A 1FPQA 1PJ2A 3CM0A 3E9EA 3GUYA 4M9CA 3ZD9A 1MEJA 2HF7A 1Z7BA 1OI4A 2QRPA 2HV8A 1FDUA 3T5TA 4AG3A 1YJCA 4N4AA 4F96A 4X95A 4RM3A 1AOXA 2PGOA 4IIJB 1I6KA 4QFBA 4E2YA 5DSTA 1WVIA 3L41A 5LZ4A 2HSGA 3R24A 5IAAA 2OGSA 5IP5A 2OCDA 3OQOA 1A7UA 3TRHA 2OC9A 3GL9A 4Q3NA 3PCTA 3V7WA 3FYUB 3IPYA 3IPAA 2R0QC 4DR2B 1EA7A 4FZRA 4L95C 3GRUA 3O38A 1LBQA 4HGZA 2BV3A 2XWQA 4BO9A 1C8KA 4Q4AB 3RTBA 3CLSC 4YCLA 5KYWB 1ZH2A 2H5LA 4W99A 2P30A 5D3MA 1I6LA 4RSRA 2C5AA 4PC2A 1JXAA 2IUSA 3GUZA 3PR2B 3D0KA 4MHOA 4FC6A 3TOCA 2RBGA 5TJHA 4FDMA 5MF6A 4IOMA 3BREA 3VO1A 4V1CB 1C1DA 1F60A 5I48A 3FOAA 2R1TB 3W6NA 3B7PA 2PLWA 2VT7A 1PR4A 4DQDA 3RTEA 3D3WB 1WE2A 2OHIA 3F71A 3ZPXA 1V43A 4HAIA 1HX7A 3K20A 5HFAA 3PEFA 2JCXA 2XYHA 1RYZA 2Q5JA 3M8KA 5FI0B 3F9RA 3UJDA 4Q37A 1TNDA 2CY0A 2ZKLA 5THQA 3S28A 2CNBA 1AZLA 4AFNA 2IZ6A 3NRBA 5HE8A 3AL3A 1XQYA 2OMKA 5TS3A 1QO0D 4JCCA 4PNHA 1ZJYA 4A82A 1T36B 3LA8A 1ECGA 1SIOA 2BFEB 4LQCA 1Z0DA 4RCYA 4TKUB 5EIBD 2WD7A 3TLXA 2WVAA 2OK8A 4B3MB 5B4TA 2V7GA 3GT3A 4AZWA 4KQ2A 3ZXUB 3FN4A 4HFMA 4ZI5A 5LYJB 4HAWA 1GT91 3H4VA 2G1KA 3U4GA 4YJKA 2YWXA 2O2ZA 2IDKA 5A5EA 1FRZA 3WWDA 3IX7A 1TIBA 4LY3A 2CYCA 4INAA 5G0TA 2UZ4A 3AHFA 3OF2A 4JLSA 2AZXA 4KDFA 2PYDA 3ES9A 2UUBB 1FXWF 1OASA 2GWRA 5IBRA 1MLDA 4BO7A 1BCSA 5EXXA 1Z7WA 2WEKA 4RQUA 2AOXA 2EC5A 3L4SO 1UJCA 4CBVA 5EIEA 2R6R1 3NHLA 3RVRA 1ZIDA 5B57C 1MO4A 1X94A 3HA3A 1Y3FE 3K0CA 2E4AA 3H3FA 3ORSA 4BJ1A 2JK0A 3ZU6A 4BFVA 2JGFA 1SHJA 3TZ6A 4DLAA 4EPYA 3NTXA 2PHZA 4PX3A 3NGXA 2PU5A 4AAYA 1US8B 1Z28A 3FRIA 4I4LA 4RY2A 2E3JA 3LUAA 3TXXA 2AX3A 3L8ZA 4BLSA 2HWYA 4EG6A 1G18A 4L3WA 3O8RA 4DJJA 4RJLA 3HR7A 2ZQ5A 3TINA 2VTKA 4DY6A 2Q41A 4I6EA 3F6CA 2ZYGA 3SSMA 1JAIA 3UHPA 2DUNA 4G5YA 2BI4A 4ASUD 4G8CA 3NHYA 2HA6A 2OILA 1NVXQ 2I67A 3VVBA 1Q22A 3JQCA 4LDPA 5LZ2A 4RXMA 1TEVA 2OBYA 4H59A 3CNLA 3BEOA 2QZSA 1GR0A 3WGMA 4KLRA 3UAYA 4WKNA 1R8JA 2ZPTX 4EG1A 4CDRA 3GLGE 2Z04A 3PXEA 3PGVA 2A9PA 5HJEA 5AMXA 4RK7A 4XFDA 2HA7A 3HKEB 4C22A 1KH2A 2NV0A 4JQCA 2EW2A 5A7GA 5K0LA 2V9PA 1A7AA 1SOVA 4MVJD 5EWJA 2OORA 1FTGA 2XTJA 2XX3A 3LWNA 4WA8A 5E1DA 2XB8A 2J5QA 4TSFA 2ODBA 5FP0A 1TPZA 5I45A 5FH9A 1I2ZA 1YQUA 2C9YA 1R3UA 3ODPA 4F6CA 4G09A 3P26A 2ZPUA 3GCWA 1EFHA 4GPAA 1IEWA 2I80A 4LI3X 4B6RA 1LBSA 1HT0A 5ICFA 4FU0A 3Q1KA 4M49A 1IUNA 1WXGA 3KUUA 2P77A 5K6TA 5EQJB 3EEYA 5JNUA 4G3XA 2E6KA 3L0OA 4C6TB 1PVOA 4DDTA 1YO6A 1V11B 3RB8A 2XZOA 1QQBA 1YIAA 2JDIA 3JAKA 3WHKA 1UXKA 3QLJA 1U98A 1SULA 4CQMB 4GI5A 3KX2A 4D9EA 1V0JA 1DKUA 5K0TA 2XKKA 3AO0B 3DMDA 3HB9A 5ERYA 3HUTA 4IQ0A 3E15A 3JR7A 3NONA 4KI0A 4B4WA 2LE0A 5JH7B 4KFCA 5F64A 3A6DA 1OY1A 2Y71A 3AF5A 3KKNA 4P7JA 3I1FA 5HE9A 4DGSA 4F4JA 3OM9A 1M2VA 1NDHA 2H18A 1N5MA 3PQ3A 4RKWA 3NP7A 5JNTA 3BDIA 3F8WA 1GPDG 3CY6A 3L1HA 1P7PA 4ERNA 1QIFA 2CFTA 2F64A 3KEMA 1M74A 5ALJA 3H1TA 3W78A 2O2GA 4B75A 3DTTA 4OK5A 1HRDA 2AOTA 3B78A 4IEFB 2P4QA 4IQ4A 1ODFA 4XVHA 2P9FA 3USES 1AUXA 1C7RA 1RIFA 3BXEA 4UTZA 2RGRA 1WMSA 3DZKA 1AQUA 2ERCA 1ZXXA 3CZ4A 1YZNA 2PWBA 3QVXA 1J2RA 2CB9A 4GLOA 1W5EA 4K6GA 3CO0S 4M6WB 4W82A 3S2GA 3VZQA 2Q5CA 4BFWA 2Q1TA 2Q46A 3FOBA 4XYLA 3KVVA 3P0IA 1YUNA 1Z2NX 1ZN9A 1BGVA 2W2OA 1ZPDA 4G89A 1NM5A 3WLJA 5HVNA 5JBIA 3ZWYA 1Q0ZA 2REQB 3U2QA 1EESA 3UF0A 5E9WA 1AM4D 1EDBA 3HCPA 4IKEA 4TS3A 4JNKA 4MP8A 4ZODA 3WLMA 1NJFA 4EIWA 2H48A 1O03A 2BEWB 2ZT7A 5DMHA 2M6SA 1OWMA 3D1JA 4Q1VA 4BRSA 1JBQA 3O9VA 1UDXA 1T9CA 1ID1A 5ALSA 3CV3A 3OLVA 1XTVA 1HNNA 3EQ8A 3VR5A 1QIHA 2YMPA 4HWPA 1F06A 3UWKA 1BH6A 1CD5A 1D6NA 2P9YA 2WILA 4PSUA 5A7HA 5J2UF 2P9BA 4X9XA 2P9EA 4QARA 2B3TA 2ZSHA 4NZYA 3GLIA 4IJQA 5CPFA 1MEOA 2ZSFA 1LKZA 3GN1A 4UE3S 2KI5A 4EGSA 4NBWA 4L5BA 3DAHA 2VH2A 1GG9A 3T94A 1BXRB 3VYRB 2YRFA 4KGDA 4JENA 1WB6A 1H1TA 1TCAA 3AFOA 4DM4A 2UZAA 3AILA 2WWYA 3PQCA 1NNSA 1AKQA 2ZRGA 3DAGA 4GXQA 1FLAA 3H5RA 3H7IA 3LLMA 3NHBA 3PD7A 5DNUA 3TSCA 5D3ZA 3X44A 3I0ZA 3EVZA 3C2QA 5EJFA 3QOXA 3SE7A 4X85A 2H00A 2OCLA 1KGDA 1Y80A 1V8BA 1VLMA 1YR2A 1JZTA 1SUDA 1EI9A 4LZOA 3STHA 2X1LA 2J7KA 3G2HA 4XGQA 1Q6ZA 5JVDF 1FFWA 4YV2A 5AVJA 5FL7A 2BIFA 4DA8A 2GPSA 4D44A 1XXHB 1MP0A 3O8BA 3IVAA 4LYAA 1CNFA 3S2ZA 4XDHA 1DBWA 1DKOA 2BFMA 1SBTA 2GN4A 1C30B 1N9ZA 2YHIB 2PT9A 4W9NA 2XAUA 4QE3A 4BPRA 16PKA 4CFYA 1YVPA 3U6KA 1NVTA 1TLLA 1EWKA 5EXTA 2CF5A 3DCYA 4YAIA 4RO0A 1PD1A 3LE8A 3CWZA 4DJFC 2HT1A 3EEOA 1LY1A 1IBSA 3NBAA 4B46A 1NOIA 4YUXA 2GUGA 4K26A 2EFEB 4Q00A 4WN9B 3W8DA 5K0CA 1U3WA 1EBUA 2R62A 1JMYA 5E9AA 1M6NA 3TUZC 5I3CA 4CR7A 4XJSA 3UJ9A 2IZ0A 4FR5A 4G5OA 2HQSA 3Q2OA 4P4SA 3VC7A 2V3CC 2M6LA 1YOVA 4LSGA 5BQXA 1U9IC 2Z9BA 1P8JA 1X1QA 4P2BA 3R9XB 2R8XA 3CPHA 5HMLA 1JQJC 4WY8A 3WJ1A 3CPEA 2YVAA 1YL5A 4NDAA 5B36A 1JH8A 4KACA 2XV1A 4X0EA 4ZDKA 4ZALA 1S8AA 4LVOA 3UPDA 1VBMA 2BDEA 4ZVKA 3EF0A 3WIOA 5BXQC 1JEYB 2IY8A 1TRHA 1ORTA 2XF2A 3WO1A 4JI1B 2D6FA 2QTLA 1KDRA 2EJTA 5EUMA 2XKJE 5EMJA 3PX7A 3ZDQA 1PG0A 1W85B 2MWMA 3M2PA 4U7WA 5JY1A 4NMMA 3M5PA 4QYIB 3UPUA 2IY9A 3U0BA 4NC9A 4HXEB 5AOBA 2BUAA 4G4SP 1IJEA 3E7XA 4BP1A 4XM0A 4C7MA 3FB4A 5A5GA 4ZI3A 2ZJ6A 1B43A 1W88A 1QX3A 3RU7A 3USZA 2EFCB 1CJSA 3E1SA 4V38A 3WISA 1QE0A 4EMUA 5K0SA 2O7VA 5MGNA 3N6XA 1L7VC 1NIJA 4QNNA 5JHHB 5K05A 2A14A 5KWEA 1VE1A 5KYUB 2EQAA 4CV1A 2BHRA 4X00A 2ZE6A 3P2MA 1ZD9A 1OBCA 1PJ3A 2Q0SA 3CEMA 3Q5DA 4L8LA 1UEXC 2ODQA 4P31A 4R83A 4AUNA 5CEEA 5ED4A 1DDOA 3AEKA 2FPUA 4PSDA 2GPJA 2X9NA 4U7FA 4BGDA 4FOOA 4GNKA 3K4PA 3IVRA 5ICEA 1DPFA 2GS9A 3EDQA 3WC4A 4KPFC 5BN5A 1TEHA 3L0PA 3UHAA 4R5HA 3IXMA 1M8GA 3U49A 4A1FA 1I8TA 5AESA 2I8CA 4XTCS 2WYUA 4D3ZA 1YRHA 4IO0A 5FQOA 3OM8A 2D1SA 1UM9A 1T8TA 3MT8A 1RM4A 3FTPA 3LG2A 3B9QA 3K2IA 3FCXA 3JYQA 3LX5A 4C4AA 2P8SA 2KS6A 3SM9A 1ESNA 3AEQA 3KHSA 2XUAA 2ZE7A 3JQPA 3CZ5A 4Y0VA 1UJ5A 1T6NA 1P74A 4HDOB 4GYWA 4B2YA 2ACWA 4EF4A 3ZJ4A 1FFXB 4LMPA 4N3AA 4PQGA 2A9KA 2BY4A 3ZCPA 4DAEA 1OAOC 4ER7A 1YMQA 4OXQA 4NNOA 1BS1A 4GR9A 5B7PA 2VQDA 1ML4A 2QAIA 1H5UA 2EL7A 4XZ3A 3RRXA 1JHOA 3VPBA 1SKMA 2D8AA 3FVWA 4FEAA 1CUZA 3SGLA 2GBFA 1GPNA 4REQA 4MQ6A 1TD1A 2UVQA 1SXJB 2YQZA 3YASA 3EQ9A 1II8B 2ZJFA 1MABB