1CYDA

Carbonyl reductase complexed with nadph and 2-propanol
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
242
structure length
242
Chain Sequence
LNFSGLRALVTGAGKGIGRDTVKALHASGAKVVAVTRTNSDLVSLAKECPGIEPVCVDLGDWDATEKALGGIGPVDLLVNNAALVIMQPFLEVTKEAFDRSFSVNLRSVFQVSQMVARDMINRGVPGSIVNVSSMVAHVTFPNLITYSSTKGAMTMLTKAMAMELGPHKIRVNSVNPTVVLTDMGKKVSADPEFARKLKERHPLRKFAEVEDVVNSILFLLSDRSASTSGGGILVDAGYLAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the ternary complex of mouse lung carbonyl reductase at 1.8 A resolution: the structural origin of coenzyme specificity in the short-chain dehydrogenase/reductase family.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords CARBONYL REDUCTASE
total genus 94
structure length 242
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.184: Carbonyl reductase (NADPH).
pdb deposition date 1995-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1cydA00
3V1UA 4IDBA 3W8DA 3KSUA 4KUGA 3HJAA 3PDUA 1E3JA 2AXQA 3ZWCA 3DOJA 4S1VA 4XQ9A 4DQVA 3EZYA 4YJDA 1HEUA 4GPD1 5A9SB 1A9YA 2NQ8A 4I9UA 4JBHA 2Q1UA 1N92A 4BOYA 3WGQA 1EK5A 4WNIA 3H9EO 4OOFA 3PFFA 4WOJA 1Q0HA 2EJVA 3TZ6A 3ZWXA 5B4TA 1Y5RA 4RPKA 3NJ4A 2QIOA 4I9NA 2OP0A 2R00C 4YJFB 4IJKA 5B1YA 5IZCA 4Y8VA 3ZU5A 2HJSA 5JC1A 3P2OA 4W4TA 2Z1NA 2WYWA 1HLPA 1E3WB 4KWIA 4E6PA 4WCFC 1W73A 3RC7A 4EUHA 1VC2A 1CIVA 1R4MB 3K92A 4AJPA 3R3SA 3BHJA 4EI2A 5B4VA 5AVOA 5KVSA 4HNHA 1HDGO 1HL3A 1PS0A 4XX0A 2GASA 4GAEA 2AEMA 3OP4A 4WKGA 4Y6RA 5T5QA 1F0YA 1LJ8A 3A4VA 4B7CA 1K0UA 1LLQA 4H7PA 4RQUA 5THQA 1I36A 2I9PA 5JAZA 2BFPA 2LDXA 1PJ3A 3L6DA 4XR9A 3X2EA 2HQ1A 3PWKA 2PLAA 4CR7A 3BAZA 1JKIA 3H6KA 3OQ6A 3WX0A 2HO5A 3E5RA 2DBQA 2IRWA 1WLYA 3PJFA 4N5MA 1Y8QA 1KVRA 2WWRA 3PZBA 3RD5A 1I5RA 4QFDA 5BSEA 3SBOA 5ILGA 1PS9A 3JTMA 1DRWA 4XQCA 2VZ8A 4IM7A 1VM6A 2D8AA 3C1AA 3GEDA 3BYZA 4EZBA 4FB5A 4XRGA 1ZSVA 4EDFA 4URFA 1BSVA 1QRRA 1E7WA 1X7DA 5HS6A 4LGVA 3F1LA 4XB2A 4ZQFA 3ULKA 3MJEA 5L7WA 4K1LA 4BO5A 4TMFA 2FY8A 2GN9A 4L73A 5LDHA 1NQ5A 2VRCD 4DREA 3Q2IA 2W2KB 1NP3A 4UEJA 5K6AC 5BQFA 3PQFA 1ZEJA 3WYEA 3TOXA 1NVGA 2J6IA 3EAGA 3GUCA 4G81A 3UOGA 3MWDB 4N5NA 3UCEA 1SPXA 1OBFO 1WXDA 3MJCA 4WNCA 4JK3A 2BGMA 4CMBA 1NPDA 3I9MA 3NDJA 2ZYGA 1A7KA 4IGEA 4CMEA 3OQBA 3D64A 2Q99A 3H8VA 2ZATA 3Q3CA 1P31A 1N7GA 5JW6A 4E5PA 5I7EA 4XJSA 4E5NA 1DHTA 4AJLA 4P8RA 4OO3A 3FTPA 3EMKA 4KP7A 3F3SA 1YJQA 4GMFA 3GC6A 3CINA 1R16A 4CMIA 3K2BA 1ENOA 3KHUA 1QKIA 4LK3A 3GZNB 1Y6JA 3G49A 4RF3A 3EUWA 2V6MA 4JROA 3RUCA 2P2SA 4XD2A 2JFFA 1YRLA 3B1JA 1TXGA 1A4IA 1DRVA 1EBFA 1ENPA 4Q3EA 3TJRA 5IN4A 5JCJA 2CVOA 1V35A 1K89A 3WQSB 3C7CB 2Y1OA 4B79A 3GY0A 5FYDA 1LTHR 3AI1A 4WJZA 1BDBA 2C7GA 4DBVO 3ZU4A 1KS9A 1HKUA 4U8GA 4DIFA 2GSDA 1ISMA 1YO6A 3GZNA 3LLSA 1YDWA 1LU9A 4CLOB 3C85A 5DOVA 4E31A 3NYWA 4M8SA 4ZHSA 3AUSA 5DULA 5TJ9A 5IJZA 1MC5A 2WYVA 3RKRA 1KEPA 5HM8A 1HZJA 1LSSA 2JD1A 3LYLA 4YJFA 4DMMA 3NGLA 1YBMA 2PV7A 1UDBA 2C2XA 2Q4EA 1ADCA 1GADO 2J3JA 3FR8A 3WTCA 3ZNNA 2AEFA 5EQFA 3OIFA 4MDHA 1RM0A 1ISHA 3BMNA 4XB1A 5A3VA 4EEXA 1GV1A 2RHRA 2VZ9A 4CPDA 2F1KA 5ITWA 2ZB8A 3ON5A 2X0IA 5I7FA 5GZ3A 3KEQA 3JD0A 1HETA 4E3ZA 4YT4A 3D0OA 5A1TA 1KEVA 4O5OA 5F1KA 1XQ1A 2J5KA 5G0TA 3WYCA 1ZXBA 4CLEA 2EF1A 4R16A 4B3JA 3EYWA 1DFGA 4NBUA 1HE3A 2I3GA 2P9GA 3NGXA 3H9QA 3GG9A 2HU2A 4MJLA 3GHHA 2Z1MA 1PZHA 2E82A 4RLSA 1T1RA 4BQRA 3HN7A 5JMWA 4KQXA 5JFOA 1IY8A 3VHRA 1LRKA 4W9NA 4DUPA 2W2LD 2GN6A 5TIIA 3ITKA 5TF4A 2JL1A 3WG9A 4A03A 2OMEA 3GFBA 2X86A 3AM5A 3KLPX 5DP1A 4PG8A 1GD1O 3KB6A 5JC8A 3AY6A 1V3VA 5KIAA 1DIGA 4NMHA 4P38A 3ZU2A 1GEEA 3KEOA 5JAMA 3CMMA 4LN1A 3OETA 2Q2QA 4IDFA 3KM0A 4QX6A 1AE1A 3HWRA 1NNUA 2WDZA 4IDGA 1SC6A 1BGVA 4UREA 4CM1A 3HB5X 1BW9A 2RCYA 3IKTA 4BNLA 3LVFO 4AJ4A 4Q3CA 2VHVA 3G1TA 2JAHA 1U3UA 4R1TA 1BXZA 1ZMTA 1W6UA 2C7VA 4Y6PA 3D7LA 2BFOA 2OHXA 4LMPA 2ZB4A 3U09A 5DBGA 1DXYA 3ABIA 1BVUA 4FIZA 1PWZA 3GVPA 3KYDB 3LZ6A 2YJZA 1GQYA 3IMFA 4KUEA 3U5TA 6LDHA 2GZ1A 2GPTA 4INAA 2X4GA 4J9UE 4UVDA 3ZV3A 3VKUA 1IHYA 4R69A 2VZ0A 1KEUA 3SJUA 1B8VA 1PGPA 1W8DA 1A9ZA 1LQUA 2DPHA 1ENZA 5CEJA 5L95A 4R1SA 5CHEA 1SZJG 3NTQA 5JYEA 2FZWA 4FOSA 3KLMX 1DSSG 2VOJA 3ENNA 4CUJA 3KRTA 1ONOA 2DTEA 4D43A 2NWQA 2X1HA 1Z75A 4L4XA 1Z73A 2QYSA 1TLTA 1TI7A 4AL4A 3ASVA 5JPIA 3I1JA 1R4NB 2YV3A 3VZSA 3WIDA 4DTIA 1QYXA 1P1KA 6ADHA 2PR2A 1QG6A 5LDGA 5THKA 4MP3A 2FR0A 1K5HA 4I5GA 4WCFB 2Y1EA 2JFHA 2E48A 1PSDA 1U2GA 3QV1A 1NQOA 4B4VA 4NBTA 2G17A 1E7MA 3NUGA 1MUUA 3QY9A 4M86A 4GLOA 1BDMA 3S2EA 3EW7A 1GV0A 5KVQA 1KERA 2BKAA 3OECA 3LT4A 2X9GA 4MO2A 3HE3A 3GEGA 4N18A 2GNAA 5DP2A 2C07A 1JKJA 4PVCA 3E9QA 3AY7A 1C1XA 4YAGA 2JCYA 4NIMA 2I66A 3RBXA 1QXSA 1MFZA 1RWBA 2DTXA 3BMCA 2P5UA 4YAJA 2C5EA 2FPGA 2IEBA 5CEFA 1ADBA 1DOHA 3VZRA 4F46A 3KVOA 1BW9B 4K28A 1KVTA 5HA5A 3KYBA 2ZTLA 1CQJA 1PJQA 5ER6A 4E2ZA 1O89A 5F5LA 1FDWA 5TT0A 3MJ4A 2JD0A 1Q2XA 1ZKMA 3O4RA 1LI4A 3F5SA 3AUUA 4CM3A 3DHNA 2AA3A 3WWZA 1UR5A 1LRLA 4HNGA 4Y98A 4CV0A 4HV4A 1DJNA 3Q0EA 2B4RO 3PVZA 3S8MA 1MFPA 3WGOA 3JQBC 3TF5A 3PHJA 1DFHA 2J3HA 3ZWAA 4Z3KA 1VL6A 4YB8A 4YT5A 3E18A 3I9KA 1Q7GA 4R41A 3FNEA 1Y8RA 3M6IA 2VYVD 3KYCA 4XYEA 4PLCA 5H83A 1QP8A 4ND1A 4ONEA 1JU9A 5HS4A 2X0RA 2EP7A 2I6TA 3GRKA 2C59A 3W4JA 3F6YA 4F6LA 4BHTA 4CLOA 1D4FA 1P9LA 4CM5A 5JY6A 4HFRA 3TNLA 4GX5A 3IAHA 5DDIP 2OXIA 4R51A 3EK2A 2PH5A 2D5AA 4YDRA 1PIWA 1P44A 3PWZA 4GX1A 1B8UA 3JYOA 2AQHA 2CDAA 3ZNOA 1WMBA 1WWKA 3WMXA 3I9LA 3KSDO 3HADA 1OC2A 1I2CA 3WYBA 1M76A 2IE0A 3AWDA 4Q3DA 4P4NA 4D3SA 3JYLA 2EKPA 1YB4A 4NR0A 4FJ2A 1FMCA 2ZCVA 4XJTA 3JQGA 1NASA 3FI9A 3ZW9A 4YQZA 1D7OA 3FSRA 1X15A 3KTDA 3U4DA 1P1JA 1YS4A 5CG2A 1D3AA 1CEQA 1PU2A 1H9AA 3ADPA 1AXEA 1HDCA 2EW8A 2FPPA 3CMCO 5HTOA 4OQYA 3UCXA 3UHAA 1DPGA 5T67A 2YQ4A 4LSMA 4GLLA 4K9DA 5A05A 2W98A 3PLRA 2OBNA 3H2SA 3UH1A 1XGKA 1N1EA 1XHLA 1Y9AA 2YFQA 1WAMA 4CLDA 5TNXA 1G0OA 1QYCA 1ZIDA 4GKVA 2RAFA 4YYZA 1NR7A 1ID1A 4DL9A 5A9RA 3U4CA 3LU1A 3X2FA 1QYDA 1E92A 4BNFA 4XKJA 4PFJA 1DC4A 1M66A 1NFRA 3LT0A 1F8FA 2VYVA 3O8QB 4TKLA 3W4IA 3I4CA 3FCOA 4QUKA 3RCBA 1E5LA 3LC2O 4GWGA 1PS8A 4BKRA 4MINA 1XELA 3S1LA 4OXYA 1UXJA 3W4KA 1LDEA 1H2BA 1ZSNA 3QHAA 4PVDA 2E37A 4YA6A 2Y0CA 4JQCA 4YCAA 4YPOA 1XYGA 1GY8A 4TRNA 2YW9A 1DIBA 2G82A 4QTZA 2P9EA 1T1SA 4CLRB 1LNQA 4IDEA 3VZQA 4ZRMA 2PA3A 3I4FA 5KJEA 5TGDA 3SC6A 4R54A 4ZICA 5T57A 1CQIA 2AMFA 3ZGYA 1RJWA 1RM3A 2O3RA 2TMGA 2ZIZA 2RH4A 4IGFA 4N7RA 4FSHA 1U3WA 2ZYAA 1E6UA 1PL8A 3VTZA 4AICA 4W7IA 3L6OO 3GAZA 4U7WA 4QT0A 1DRUA 2D1YA 2PZKA 5TX7A 4ZQEA 4XWYA 5MDHA 1DBVO 1PGOA 2IZ0A 4LRSB 4NJOA 4P4GA 1AHIA 3ANNA 3QWIA 2WE8A 3WJAA 3D1LA 5ICMA 3A28A 4FC6A 5A5FA 2X9VA 1EVIA 5JLAA 4BNVA 3GMDA 3PGXA 5L4LA 5L40A 2VYND 3UW3A 3GGGA 2Z5LA 4BNJA 4W99A 2C54A 2QX7A 1LSOA 3V2UA 3CTMA 3F1KA 1ZH8A 4ALLA 2BGLA 1YQXA 5J23A 4IBOA 4WLEA 3VPXA 1Q7BA 3ETGA 1MC4A 1WNTA 3KZVA 1P1FA 3BTOA 4IMRA 1XCBA 4NI5A 1PJTA 3Q2KA 4R9SA 1Y5MA 4RO0A 2UDPA 5I9LA 5KKCA 4JP2A 4YVFA 1PZEA 4Q39A 4NQZA 4BMVA 2WSBA 1VSVA 1KVUA 3BMQA 4MVJH 3DB2A 3GG2A 3INTA 2OZPA 1HYHA 1MXFA 5T6BA 3ZHXA 3BHMA 1WZEA 4PZDA 3IS3A 4KWHA 5ENDA 4BNIA 5U1PA 1A5ZA 5KTKA 1V6AA 4JBGA 4PLTA 2VHYA 2GR9A 2NNLD 3JQCA 4MVJD 3BMCB 3PZRA 3TL2A 5FI3A 3IP3A 5JE8A 4NFYA 4XYBA 2NVUB 5CEEA 5U9CA 3TZQA 4IPTA 4CLRA 3L6EA 1EEHA 3RSHA 2BFAA 5C3MA 3RC1A 1PX0A 1T26A 2W2LA 4IMPA 4JCOA 1CJCA 5I8WA 3B70A 1IUKA 4TRMA 3V1YA 1YVEI 1NTOA 2Q2WA 3JQAA 4JJGA 1RPNA 1U4OA 2HDHA 2QRLA 1YH3A 5KJFA 4B4UA 1PL7A 1ISJA 3FTNA 1P0CA 1EUZA 3F4LA 3W6UA 5A02A 1HYGA 4BNXA 4ND2A 4RLHA 1GCOA 3UICA 1YONA 1GZ3A 1UAYA 5GMOA 5A04A 2BI8A 4EW6A 4OSOA 3L77A 4D7AA 4ALKA 1B26A 5T8KC 1O6ZA 4YAEA 4PCVA 1QYWA 4L0QA 3DMTC 4R1NA 2WMDA 3PHGA 1JTVA 1A27A 3ETEA 4J9VA 3GRPA 2V6BA 4RL6A 5BT9A 3WGGA 4YTEA 2PH3A 4WLFA 2PD3A 2WTBA 3U3XA 5KJ1A 5BNIA 3ETDA 3ICCA 3AFNA 3H5RA 1OFGA 3QVTA 1EE2A 4YAKA 1YE3A 4HX5A 1NXQA 3ZHZA 2H9IA 1S7CA 4BL5A 2PKQO 1K6JA 2ZQZA 3D3WA 4E5KA 3PIIA 3VVBA 3PQDA 3PTZA 3H3JA 3ZH2A 3DXFA 3TZKA 5IDQA 2O2SA 1ZK3A 3GDGA 1E3WA 4W82A 1C0KA 1BHSA 1M75A 2E49A 1N7HA 2C29D 2IEDA 3OM9A 4L74A 4RVUA 5DCWA 3AJRA 3V2GA 3V5NA 3GLQA 4E2YA 2Q46A 1DAPA 4CUZA 1P33A 1E0DA 1UJMA 2BH9A 2GD1O 4MKRA 4RVGA 3E03A 4ZRNA 4HFMA 5CAEA 5IAAA 3BTVA 1X7GA 1Q0QA 4DPMA 4OHUA 4A26A 5C37A 2IYOA 3W1VA 2OO5A 2DT5A 1SMKA 3LC1O 2DTDA 2VNAA 1C1DA 2EKLA 1I3NA 5A9SA 1HE4A 3LDHA 3M1AA 1D1SA 1G0NA 3VPGA 3TOZA 3BMNB 2NADA 3AOGA 3E9MA 1NWCA 3DZGA 3P5SA 4M49A 3RUEA 1U8XX 2C2YA 1TA4A 3DDNA 4O6VA 3PWSA 1GPDG 1U9JA 3CE6A 3IUPA 1VE9A 1E7QA 3DAFA 4E13A 1UZNA 2JFGA 2X22A 4P4LA 4W7HA 3DFZA 3TDKA 3WQQA 4BV8A 3F9IA 3VH2A 3H5NA 5HRUA 2A9FA 3QRWA 4HADA 1IOLA 4J0FA 1CYDA 2DC1A 4OJNA 1NVMB 2VTDA 3WWYA 1P3DA 4U5QA 2VRBA 1ZK4A 3JD2A 1EDOA 1U28A 4GH5A 2A35A 4ZQBA 1FK8A 2E4AA 1FDTA 1J49A 3I23A 5I7SA 1Q0LA 3D4NA 2O50A 4RF4A 1YL7A 2EWMA 2ZKLA 5CPFA 4ALMA 4W6ZA 3WNQA 2X5JO 4I5FA 4Z3DA 2I76A 2O7QA 1QSGA 3OJ0A 4PG5A 4LCJA 4BKOA 2NVUA 1E7YA 3EVTA 1VJ1A 1U3VA 2GERA 3FN4A 5F3RA 2Z95A 5TRTA 2FR8A 1O95A 1LX6A 4BIIA 3QJ5A 4Z0PA 4PN3A 3NDRA 3RUIA 1PL6A 2W4QA 4WEOA 3L9WA 1DIRA 3H2ZA 4EBFA 3H65A 1U5CA 2I5PO 2WD7A 4KQWA 5DCUA 3MOGA 5FEUA 1NHGA 4XA8A 1SEVA 5JDIA 4ZA2A 4B4WA 1IB6A 3GVIA 2YUTA 1E3LA 3INRA 5DF1A 8LDHA 3QA9A 4UAGA 2PNFA 2P4QA 2YV2A 3C1TA 4OXNA 2P4HX 4HXYA 5C7IO 4WEQA 2JAPA 1ISGA 3GN1A 2O3JA 1PQUA 1ZSYA 4NFHA 4AJIA 2R00A 4ND4A 2FP4A 2YY7A 2VOEA 5EMHA 1TT5A 4DGSA 1EMDA 3JQBA 3ZHYA 3PLNA 4BGIA 4NZ9A 3BMOA 5COQA 1HF3A 1HTBA 3AI2A 3JD4A 3DBRA 2AE1A 4DBZA 1HRDA 3H7AA 3ONFA 1Z7EA 3AOEC 3GQVA 2EXXA 3P7MA 1EVYA 2DLDA 2FPIA 2J3KA 4ZQHA 3KBOA 4EGFA 4UUOA 3PIDA 1I3MA 2JCVA 1F06A 1U3TA 3DL2A 4ROSA 3JQ9A 1V3TA 1LUAA 1N9GB 1UXGA 3Q11A 2WD8A 2Y68A 4J91A 1N1GA 3F47A 4DC1A 3RFXA 5JAQA 1DHRA 4PLZA 4DXHA 3I9NA 3D3WB 1GYRA 4UEKA 5HWSA 3HFGA 3KOUA 3VVCA 4LRTB 5LC1A 3ITDA 3A14A 4DPKA 4IS3A 5COAA 1LRJA 1EZ4A 3OA2A 1ZCJA 4TKMA 1LSUA 4R9RA 1SNYA 1L7EA 1I10A 4XGIA 1WMAA 4RVFA 2DQ4A 4YWJA 2GUGA 5GY7A 4BNKA 1MA0A 4F6CA 4A2CA 3OEYA 3EY4A 2VUTA 4RDIA 4YRDA 1F17A 1R12A 5AXAA 4DIOA 2CUKA 4PGFA 1P1IA 2NU9A 3VKVA 1M6WA 4BGVA 3ZWPA 2B36A 4CMGA 2NACA 1UZLA 3SC4A 4AG3A 5KKAA 2UUOA 3OH8A 3L4BC 3HSKA 4AJOA 2WEKA 4K6CA 3H3FA 3ICPA 5AXDA 4BS9A 1YOVA 4HY3A 3C8MA 2R6JA 1ZMOA 2PTGA 4FC7A 3ORFA 4KOAA 4CQLB 4DIBA 4GX2A 3DHEA 4BNNA 1YL5A 3DEYX 1QLJA 3KO8A 1E6WA 2X9NA 1GQ2A 4B7UA 2DVMA 1ZK0A 1R4MA 2XXJA 4MVJM 4XR4A 4YQYA 4CUKA 4RPLA 1QV6A 1FDVA 4FFLA 1BG6A 1GYPA 2VCYA 3DONA 3RWBA 3GAFA 1PJBA 2NU8A 4EJ0A 4OKNA 4I5EA 5EINA 5K0ZA 1H6DA 3GNQA 4IXWA 5A3JA 2VUUA 3JQ7B 1PEDA 1TT5B 2X5KO 4A7PA 4E2XA 1UP6A 3HDHA 2V6GA 4N54A 4NDNE 4ND5A 2PKRA 2JD2A 1YQGA 1B16A 1SB9A 1U1IA 1T2DA 3E1KA 2DUUA 4RZIA 1EUDA 2B4QA 4ND3A 3GGPA 3GFGA 1HDRA 2D4AA 1EUCA 1R66A 4BO0A 3SXPA 2ZCUA 2XF8A 3MEQA 1HDYA 3D3EA 7MDHA 3QWBA 5FFFA 3WFJA 2O2YA 7ADHA 3BA1A 4XYLA 4BKUA 3AUAA 3ZV4A 4CM8B 2RIRA 5A4DA 4IINA 3V1TC 4WGGA 4NJMB 5CDYA 2EIHA 3I6IA 4BGEA 1ZVMA 3RC2A 2PY6A 3OSUA 1W0CA 2W90A 3UCFA 4UVGA 4GBJA 5ADHA 4YAIA 4ESOA 3Q1LA 2DAPA 2NLOA 1VJ0A 2HMUA 4OIMA 4CMCA 3L07A 4LCEA 4J1SA 1ISIA 1T24A 2EGGA 1M67A 3G3EA 3W8EA 4HP8A 2P5YA 3D4OA 3AFMA 1QLHA 3AW9A 4R68A 3I83A 3L0DA 2EERA 4NBVA 4D3DA 1I8TA 4IJUA 1BVRA 1R0KA 1SOVA 3VPHA 4FJ1A 4J7CA 4ALJA 1LDGA 1B14A 4PIVA 1YQDA 4OOEA 4WCDA 4E4YA 2NTNA 4FPXA 4BO3A 2YFHA 4YEDA 5G2OA 5H82A 5B37A 2W8ZA 4CMIB 1AUPA 1P1HA 1R15A 4BV9A 3JQ7A 3CZMA 3TPCA 3R0IA 2D2IA 4CODB 4WK6A 1P77A 4CM9D 4G65A 2QRKA 2X23A 3HHPA 5DNAA 5FWNA 3GNSA 1TEHA 4JN6B 1GTMA 3NKLA 1E7SA 3WDSA 1CERA 1H2HA 3M1LA 3W6ZA 2BHLA 2POQX 4AJNA 1PJSA 1VKOA 2BLLA 2GZ2A 3GN2A 4IZIA 4WLNA 2ZK7A 2OFPA 3I6QA 3GR6A 1Y1PA 3V2HA 3AU8A 3ENKA 3A9WA 3N74A 2J5RA 4PLPA 4C7JA 5CDUA 4J4HA 1ZUD1 1JA9A 2VQ3A 3DTYA 1J5PA 3RFVA 2W2KA 3TQHA 2QQ5A 4RQTA 1LQTA 3NT2A 3JD1A 3C7AA 2JCXA 1X13A 2I3AA 4QFCA 1YKFA 3TN7A 1GU7A 2EW2A 4IDDA 2NU7A 1NQAO 3GGOA 3DBHB 3DBLB 3FWNA 4IQ8A 4M87A 4RPGA 3PHHA 3VH1A 1IULA 3FBTA 3NT5A 3F4BA 3LF1A 1VRWA 4J1NA 4BO8A 1DLIA 1DJQA 4J49A 1E77A 2YDYA 1IYZA 3D5TA 3LT2A 3O38A 1JQBA 2WYUA 3PHIA 1ISFA 4ZN6A 1QR6A 3VDRA 5G0UA 1WPQA 1DB3A 2DBRA 5BNFA 4BNHA 3S2FA 3Q9UA 1J0XO 2A94A 2OUIA 3JQGB 5LCXA 2VN8A 5EERA 1N8KA 1DC3A 5CG1A 2B37A 1GUFA 3DZHA 4CM4B 3DOOA 1Y9EA 4LVUA 3WGYA 4B3IA 4ID9A 4YRBA 5JAIA 3IC5A 3WJ7A 3AM3A 3QWHA 3DZBA 2AG5A 2NUAA 2VNSA 3WS7A 3NTRA 5TQVA 1EBUA 5C7LO 1NBOA 3E8XA 3PK0A 1HT0A 1K6XA 1YWGO 4Q3BA 4AFNA 5A06A 3C24A 4Z0HO 3ZV5A 1H93A 4GGOA 4OKIA 4I08A 1WDLA 5B12A 3U4IA 2AQ8A 1IHXA 3QVWA 2FSVA 3O26A 1X1TA 3INGA 2CF5A 4O0LA 1KIFA 4UVEA 1JKFA 1JVSA 3U49A 2FR1A 3QVOA 1A4UA 4GMGA 1PJLA 3NX4A 3QP9A 1WZIA 2HRBA 1LDMA 2Y67A 4JP3A 1I24A 4IY1A 5IFLA 3R3JA 1XR3A 3PJDA 2PFGA 2GN4A 3WXBA 1P45A 1YB5A 1O9BA 1X14A 4YACA 3R6DA 4R01A 3ZU3A 4IDAA 4BB5A 3L4BA 5L3ZA 2HMWA 3FR7A 2FRDA 4RGBA 2QG4A 2O23A 3DZFA 3I52A 4TWRA 3T7CA 1P74A 5G0WA 1U4SA 4NU6A 1H6CA 3H9GA 3LC7O 4D46A 2I65A 1GFSA 3HN2A 4CMJA 1HE5A 3LSYA 4MKXA 4YBZA 1VI2A 3TSCA 3GVCA 1LA2A 3JYPA 5EL0A 2D3TA 4PRKA 5L7YA 4BNZA 2O3SA 4NK4A 4GSLA 1DEHA 3GZ4A 4CLHA 4CMHA 4AJEA 3WSWA 2D59A 3ZDFA 2Y93A 5L9AA 2VHXA 1E1LA 2G0TA 3DQPA 4Z9YA 2NTJA 1ZEMA 4XQEA 4YJGA 1LLCA 1M2WA 2CMDA 4NNJA 5DBFA 5L7TA 3SLGA 1MP0A 4BO4A 3E6AA 1VPDA 2EHDA 2IZ1A 3WLFA 4TQGA 2YDXA 1R4NA 3ST7A 4WECA 1AHHA 4O1MA 5CDGA 4FGWA 3GVHA 4BO1A 3MJSA 1FXSA 1U7TA 3ZI0A 2OBYA 4L76A 3F5QA 5JCXA 4M55A 1LBEA 1HWYA 3RIHA 4C7KA 4LW8A 1SAYA 3OIGA 2EEZA 4OQZA 2XAAA 1X7HA 3FPLA 4A73A 5FI5A 2IODA 2AW5A 3GPDG 2PK3A 3WGHA 2H63A 4YT2A 4PLGA 1F8GA 1XG5A 4PRLA 1NPTO 4YJGB 1LDNA 3RQSA 1NQTA 1V0JA 1OC4A 4J1TA 2RHCA 4PLVA 4UUMA 4E0BA 1MXHA 3UAGA 4J6FA 1C0IA 2BI7A 1DAOA 2QW8A 4QEDA 3JQ6A 2J8ZA 1GDHA 5ER9A 4EEZA 1X0VA 1EQUA 2GZ3A 2IYPA 2X0JA 4FBGA 5I9MA 3WMWA 4CM4A 3BHIA 1GR0A 4DLBA 3SJ7A 1UUFA 4B8ZA 3L9XA 5I8ZA 1HDZA 3Q9NA 1GL3A 1B2LA 5TS3A 5DZSA 4FFPA 4IQ0A 4RVHA 1C0PA 2NTVA 2PGDA 3N58A 3ZWWA 1M6HA 4A10A 3WGIA 3GK3A 3RBVA 5JNLA 3NTOA 4CL8A 3HNPA 4J7XA 3ROQA 3PYMA 1BXKA 4QO7A 1NM5A 4M54A 1CDOA 3MZ0A 1ZK1A 2VWPA 2WE7A 2CY0A 1I2ZA 2PKQP 3QQPA 5T64A 2G1UA 4CQMD 1ADFA 3RUAA 4J2OA 4EITA 5L51A 4NBWA 5BSGA 4HFJA 3WR5A 1RYEA 1U2DA 3T4XA 2Y05A 3FNHA 3WQRA 5G0SA 4S3MA 1YJ8A 3HG7A 1DLJA 4FFMA 4Q9NA 3FNFA 5IDYA 5JDCC 4DWVA 5CPBA 1PQPA 1KBZA 2O3UA 4OL9A 3DR3A 2VTEA 4MIYA 1GUZA 5K6AA 2BELA 1LC3A 2SCUA 2Y0EA 2P91A 4BUCA 2I99A 3CH6A 3H4VA 2EKQA 3K96A 5JBIA 2VWQA 3DZIA 3G17A 1K2WA 5TJHA 2HMTA 1QV7A 3JQFA 3HB4X 3JV7A 3NAQA 3OHSX 2YHUA 4K26A 1W4ZA 1F12A 3OJFA 5AXCA 1X0XA 1X1EA 2GO1A 3EGOA 2PD4A 5F5NA 4KTVE 3WIEA 1NFQA 3MJTA 1PTJA 5JCJD 3B20A 1J4AA 2HUNA 1XA0A 3PP8A 4XIJA 3K73O 2DBZA 3DO5A 2O7SA 4FQ8A 3OQ1A 4EUFA 1ZZEA 3FD8A 3PJGA 1XDWA 2FWMX 2D5CA 4PG6A 3HQ4O 4BNYA 4Z9FA 8ADHA 5IDXA 2YYYA 4F3YA 4XQGA 3MJVA 4J16A 1K6IA 1V9LA 2BGKA 4RORA 5IZ4A 1JAXA 3AUTA 4RJTA 1TVEA 3ONEA 4JLWA 3NJ8A 4ZVVA 4NK5A 1GYQA 2Y66A 4ZU3A 3UKOA 4IXTA 2PZJA 1FDSA 1GEGA 1D1TA 1D8AA 1OAAA 2X7HA 4DPLA 1IL0A 4CM8A 1JN0A 4DQXA 4Y67A 3WOHA 4FJ0A 2C20A 2Q49A 4U0KA 4CQLA 2OL4A 1VL8A 4AJHA 5ICSA 3ZW8A 4BMNA 5JDCA 4RDHA 3VPFA 5B4UA 4IDCA 4OAQA 5JYDA 5L45A 4BB6A 4IQGA 3CIFA 4U6QA 2VHWA 1HDOA 2ET6A 1B0AA 3RBZA 1UAGA 3IP1A 1YBVA 4RZHA 4BNUA 1C1DB 4GSKA 1LXCA 3OFSA 3S2IA 3IUSA 1ORRA 1P1RA 4R1UA 2B0JA 1NWHA 4UVHA 2A92A 4I8XA 3RROA 4D44A 1U7HA 3GH3A 3OF2A 4DLLA 4Y9DA 5EN4A 3U9LA 2CSUA 3ONDA 4K6FA 1NVTA 4XCVA 3DHYA 1ULSA 2X58A 3T4EA 2D0IA 3FNGA 3A06A 4X54A 2H5LA 4C4OA 2CNBA 1HDXA 2JHGA 3O8QA 2H6EA 4E5MA 1R0LA 1DO8A 3KUXA 1B3RA 1JWBB 4CLXA 3M2PA 3P2YA 1FJHA 4XGNA 1OI7A 1VL0A 3QLJA 1EQ2A 4FS3A 4L75A 2ZB7A 1NAHA 4Q3AA 3FPCA 4L9RA 5JMPA 3K31A 5GZ6A 3RUHA 5BSHA 2BD0A 1RYDA 3WBFA 2V6FA 5G4KB 5JO0A 2HK9A 3CZRA 3HUDA 4UUNA 1EVJA 1HXHA 3SX2A 3LF2A 4P22A 1YXMA 4CMAA 2GDZA 3EC7A 4OM8A 3UN1A 2PZLA 2EP5A 3PPIA 3VOSA 4I9HA 3PYLA 4WLUA 5TT1A 5U4QA 1WVGA 2Y0DA 1KY4A 4WE3A 1R37A 4RVSA 4YR9A 1PJ2A 1JVBA 3PYXA 4PG7A 1UXKA 4PLYA 1IPEA 3TRIA 1F14A 4D41A 3ADOA 1B8PA 5DBIA 4B8WA 2O4UX 2HMVA 1KETA 4EYEA 4DVJA 4HWKA 1H94A 1E3IA 2EG9A 1XSEA 3EHEA 4CM7A 1I2BA 5JDIC 1PZFA 1PR3A 3JQ8B 1UP7A 2WM3A 4FDAA 4FR5A 3WTBA 1I30A 2CZCA 4MVJG 5IF3A 4D0RA 5EESA 3GPIA 3AY3A 3UGKA 1XIVA 2C82A 3MCVA 1VLLA 2IDZA 1OZAA 3ZWYA 4OH1A 2AQKA 2CVZA 2V65A 1KVQA 3OJOA 1KEWA 3Q6IA 1T25A 4LSWA 1NX6A 2X6TA 4N5LA 1KC3A 1ZFNA 1MG5A 2IZZA 4WPGA 3V8BA 2XOXA 2ZJ0A 3K6JA 3PDJA 3B1FA 2ZTUA 3STHA 1MV8A 1XLTA 5K9ZA 1IE3A 3OJEA 2ZTMA 3WFIA 4Z9XA 3BMQB 3HDJA 2OOSA 2QZZA 5KNLA 1LDYA 5CFZA 1EFLA 4J1QA 4R3WA 4MVJF 1ZO8A 3E9NA 4IIVA 4BGUA 2OGUA 4GI2A 3GMSA 4JXKA 3ROKA 5EPOA 2HMSA 3PFWO 2B4TO 4WASA 2FSSA 5AYVA 9LDBA 5KJCA 4U6SA 3K5PA 4JX8A 3DBRB 5JO9A 5JXWA 2NU6A 2FZEA 1KOLA 4E32A 2GCGA 3RC9A 4DQUA 4NG5A 2ZB3A 1AGNA 1O5IA 1XWFA 3WB9A 4PLHA 3KETA 4CV1A 2GF2A 1HSOA 4U0JA 4ITUA 4PG4A 5DOZA 3ZWBA 3IKVA 3PJEA 4KZPA 3JQ9C 5I9NA 4QO8A 3ZNQA 1UXHA 3D5QA 3GDOA 3B1KA 1Y7TA 1Z74A 4WCFA 4BKQA 4A5OA 4PZEA 2AEJA 5KOIA 1R6DA 4JBIA 1HYEA 1PGJA 4MKZA 3RAJA 3TZHA 2HSDA 2HRZA 3H5AA 2ZQYA 2YV1A 3G0OA 2AG8A 3GUYA 3MOIA 3P19A 4JNKA 1ARZA 4HUJA 4MP6A 3TFOA 2PD6A 2Y1GA 1PQWA 4UVIA 4QQRA 1PGNA 2FN7A 2PWZA 3BXXA 1RM5A 4PLWA 3RU9A 2DM6A 5I7VA 2B35A 4GGPA 2GGSA 3NDIA 3ANLA 5ENVA 5IXSA 3WLEA 4BNWA 5GZ1A 4XIYA 4DLAA 1XU9A 1I3KA 3PXXA 3QWAA 3IDSA 4LMRA 1WW8A 2V7PA 1IZ0A 1TB4A 1E1KA 5DCYA 4CJXA 4RVDA 4DYDA 3VAZA 3IQDB 2EV9A 2C0CA 3AK4A 2B69A 3U0BA 2X5OA 3OMLA 4H15A 4ALNA 2ILTA 4MIOA 2UV8A 2VRCA 3K8ZA 2DFDA 4OMUA 4DC0A 2BMAA 3DMTA 1I3LA 1UDAA 2GRAA 2CFCA 2DPGA 3E48A 3JYQA 4J43A 1ENYA 3LQFA 4OGWA 4B3HA 1XU7A 3SVTA 4FD3A 3R1IA 4AVYA 4XDZA 5EQDA 2I67A 1I33A 1L7DA 1GPJA 1GCUA 4LISA 3ASUA 4E30A 4R5HA 5A03A 4L4SA 4BO9A 4ALIA 2YHIA 3AU9A 3WICA 3T7EA 3BTSA 1OMOA 1BRMA 2QRJA 3KYCB 3TL3A 1E7RA 4GKBA 1KYQA 2WD7B 1C3VA 1I0ZA 3DFUA 4Q3NA 1ZNQO 4IUYA 4D0SA 1Y81A 2XPCA 4ZD6A 3DBLA 3DBHA 4J7UA 1DFIA 1HE2A 2VT2A 4CQMA 4E12A 1C14A 1Z7BA 1GZ4A 3IJRA 4JIGA 4CL3A 2RH8A 1EVZA 4EUEA 4TZKA 4CR8A 3JQEA 4XYMA 4MVJP 5ES3A 2NSDA 3ZZNA 4YJHA 1CWUA 3O9ZA 3ZWOA 1PR9A 5TLSA 1HZZA 1BMDA 1O0SA 1ZBQA 2CVQA 1ZJYA 1OOEA 3JSAA 1G1AA 3KYDA 1BWSA 1P0FA 4L8VA 2TMDA 3BMOB 4NJMA 2CDCA 3VPSA 4J90A 3K9QO 2HLPA 3DWFA 4XGKA 1T2AA 4FN4A 3OICA 5H81A 2JJYA 4Z0TA 1DIHA 3PI7A 2HK8A 1ADGA 4M89A 5KJ6A 5HBRA 3VH4A 4F45A 3JQ8A 4D42A 2Q1WA 1ULUA 4TRRA 2Q4BA 2DU8A 1XKQA 3HDYA 4G2NA 4OSPA 4RPHA 1Y8QB 4XRRA 3D4PA 3NRCA 4FFRA 4FCCA 1NHWA 3G1UA 1BXGA 4CQMB 3HFSA 3N7UA 4FFOA 1ONNA 5IN5A 4D45A 3K30A 4A0SA 2RBEA 4JGBA 3ZV6A 4GVLA 5BSFA 4O59O 4NPCA 3ZWNA 4CV2A 3CUKA 3OIDA 4FOOA 3UVEA 1PGQA 3ZHBA 2B5WA 2UVDA 3FBGA 2P9CA 3SLKA 5IG2A 3QE3A 3WBBA 2Y1FA 2X8LA 5BNTA 1T4BA 4RF2A 3I3OA 4BVAA 3AI3A 3AOEA 2YZ7A 2IXAA 2HCTA 4D3FA 4GQAA 4QECA 3GT0A 3FWZA 1MX3A 1E6EA 2HK7A 3RFTA 5JS6A 1SB8A 3UUWA 4AJJA 1YDEA 1ZW1A 3KSZO 1LEHA 3NV9A 3PHLA 1PJCA 4J4TA 4O63O 1ZK2A 1E1NA 5KCZA 1IPFA 1C1XB 1H5QA 2J5QA 3JQDA 1T2FA 1S6YA 3JQFC 3WNVA 4D79A 3RKUA 5F21A 2C5AA 1PJ4A 1T2CA 1UZMA 2NQTA 1YOVB 3BZUA 3VDQA 4CMEC 3TWOA 1LDBA 2HKIA 1AN9A 3EVNA 3RI3A 2VWHA 4GL4A 4BO2A 3IL2A 3PEFA 4KUHA 1RKXA 3GNTA 4FGSA 3DAPA 1YGYA 1Q1NA 3GA0A 1B3BA 2JHFA 3KXDA 5AOVA 4XZ3A 2ZTVA 3PGJA 4GVXA 1MLDA 3QVXA 1NAIA 2QYTA 2HJRA 3DOCA 2Q50A 2IXBA 4TVOA 4A27A 2VWGA 3JYNA 3AM4A 2DUWA 2P68A 4TRJA 1DC6A 1DC5A 5EJ2A 5MGBA 2R2GA 4MP8A 3EDMA 3I9JA 1YBAA 1CETA 4JJFA 4IS2A 3EZLA 5L4NA 2WJPA 5C7OO 5G4KA 3HDQA 1UXIA 3BTUA 4HBGA 2AE2A 4WLOA 4E2WA 1U8FO 2OORA 3HZZA 3DZJA 2YHIB 2UUPA 5A5EA 1EDZA 4WLVA 5A9TA 4Z6KA 1RM4A 2A4KA 3CEAA 3VC7A 5CDSA 1BXGB 3E5MA 4YXFA 3JQAD 5FF9A 3S55A 3IOYA 3PRJA 3JD3A 1N9GA 3FHLA 3WGZA 3GF4A 4ILKA 1GUYA 2J3IA 3W8FA 9LDTA 2ZJ1A 4MVJA 2NM0A 2UYYA 4E33A 3GDFA 3FF4A 4XDYA 4HKTA 3H9UA 2Y1DA 4L4RA 4ZJUA 1WDMA 3UF0A 1DIAA 4CM6A 2O3QA 3M2TA 3MTJA 4NBRA 3RJ9A 3QW2A 2ZYDA 3G79A 2Q1TA 1VJTA 2E6UX 3BIOA 3GHYA 1H9BA 1NR1A 2QHXA 3GEMA 2FOIA 4FFNA 1JLLA 1H0KA 4H16A 3UFXA 4CR6A 4IZHA 1EE9A 1MB4A 3VH3A 2FMUA 1NYTA 1Z82A 1FF9A 4DRYA 4AJ2A 1EK6A 5AQ1A 5CP8A 3ANMA 1L1FA 4UEOA 3RU7A 5G4LA 2PGLA 1UDCA 5TSDA 4B4OA 1I01A 4KTTE 4MPDA 3LK7A 4TVBA 3NT4A 1ML3A 3U62A 4CM9A 5ITVA 1HLDA 1V3UA 3K2EA 4MVJI 3TFQA 1UH5A 1I32A 2CDBA 4KDFA 1SO8A 4II3A 4II2A 4FW8A 1JWAB 4MVJE 4DA9A 4R5MA 3ZWVA 4GWKA 5F1OA 3IIEA 5L53A 4CV3A 3QVSA 4XEHA 1YL6A 4R4JA 5KVCA 5IZCC 5CDTA 2AQIA 4RV9A 2B83A 4GX0A 1V8BA 1UP4A 1XEAA 4BNTA 3E82A 1SBYA 1YB1A 4BO7A 3TZCA 1WDKA 4CMKA 4I5DA 4G5HA 1GQQA 1FDUA 3GVXA 3RUFA 5COBA 3DZKA 4I1IA 3F46A 1J6UA 3OJLA 1R0SA 3C1OA 2NVBA 1ONPA 3ZN2A 4YJHB 2Q3EA 3GOHA 4QXMA 1E3SA 1QORA 3VTFA 1Q7CA 4OYRA 4QSMA 3LT1A 4IIUA 4NFSA 1E3EA 3ZWMA 1SCUA 1KC1A 2O4CA 3PQEA 2GLXA 3WGTA 4Y6SA 1GAEO 1EFKA 3LLVA 2XXBA 1Y8RB 4RCVA 1QMGA 2VYNA 4J0EA 1DDOA 5G0VA 4YT8A 3QIVA 4JJIA 2CD9A 4WOKA 3WSVA 1QYVA 3ZCXA 4YRAA 4E21A 1CRWG 1A72A 1O94A 1VKNA 2NVWA 2Y99A 5KVVA 3RASA 3CSDA 2DKNA 1U5AA 2Y1CA 3DBVO 3DC2A 3O03A 4E5YA 3I9OA 2HAEA 4EJMA 2O3TA 4AJ1A 1ZXLA 4R3NA 2F00A 3IJPA 2DBVO 1AXGA 2BFMA 3U4HA 1SOWA 3DAGA 4HFNA 3UXYA 2AHRA 2GYYA 1K3TA 2Q45A 1VSUA 1LSJA 3OEWA 3OA0A 4OXKA 1A71A 4BKPA 2H1SA 1G6KA 1TT7A 3A1NA 1LLDA 4EJ6A 2Q1SA 2BRUA 1KVSA 4J4BA 1XQ6A 3RJ5A 4XYGA 2FHSA 4MOWA 4DMLA 1N5DA 2EJWA 3COSA 4W9NC 3C3XA 3MTGA 4BMSA 1E5QA 2LDBA 1LC0A 4M1QA 1GZ6A 1SEPA 3H9JA 4UUPA 3ROPA 4H3VA 4BNGA 1C0LA 4DYVA 5DT9A 3QWFA 3SEFA 3MWEB 2Q2VA 5IDWA 1HSZA 4RPJA 4RF5A 4UULA 1B15A 3I5MA 2EGHA 2B5VA 2JKVA 1BTOA 3FRJA 3RUDA 1H6AA 1KY5A 2PZMA 1NPYA 4NHEA 2VHZA 5AXBA 1JW9B 2QZ9A 1A7AA 4TSKA 1PWXA 4BO6A 1NFFA 4LVCA 3CXRA 5BR7A 4J2HA 1Z6ZA 3DTTA 5C5IA 1JAYA 3NEPX 4IJVA 2VUSA 5F1PA 2CF6A 1WP4A 3ROMA 5L4SA 3VZPA 2UAGA 3CPSA 2X0NA 2G5CA 4PLFA 3DMYA 1JDJA 2VT3A 2G76A 4PZCA 3S2GA 2GN8A 5ILOA 1B7GO 3JQAB 4WUVA 5DN9A 1Z45A 1IZ9A 4B7XA 2YQ5A 4AJKA 1N2SA 5EIOA 5TC4A 3RVDA 5T8KA 5JSFA 2DFVA 2O48X 3ZNPA 1T2EA 1MGOA 4NH4A 5IXYA 3CKYA 3KV3O 1ZJZA 4ZGWA 4KDEA 4BNMA 5JY1A 3JCZA 1H6BA 1PZGA 1LLUA 1T4DA 4KMSA 1O8CA 2PGJA 1CF2O 1E1MA 2BF7A 2NV6A 4TROA 5KWEA 1MG0A 4NU5A 4MIEA 4BQPA 4J3FA 2OP1A 3L4SO 4ZQGA 3OBBA 3B6ZA 4TZTA 3QSGA 4IJWA 3C7DB
chains in the Genus database with same CATH superfamily
2B1QA 2O6LA 2JIBA 3EBOA 1JG6A 3CW9A 4KUGA 2NV2B 3D54D 3IB6A 3I12A 2CUZA 2AXQA 4DR1B 5KVAA 1QFSA 1ECCA 1IM8A 3DOJA 2B8WA 3GOQA 2VZEA 4YJDA 4D99A 2JLZA 4HNSA 5BRNA 5C8XA 5JBQA 3ICQB 2CE2X 2VATA 2R8PA 2WILA 2XYRA 1WB6A 3PC7A 3R5JA 1Z62A 4JBHA 2YWXA 4M3NA 4HHEA 4BOYA 4MICA 4WNIA 3FSJX 4A82A 3M1YA 2CL0X 1SIUA 4D96A 1Q0HA 3ZY3A 5IWAB 4JXXA 5EZSA 1OZFA 2D0PB 1UM8A 1MMFB 2RI0A 3FKJA 3NJ4A 5DN6D 4HDCA 1HM5A 4Y9RA 4UMEA 3KQMA 2D13A 1UPBA 5DGHA 4A8PA 3CR8A 4FMPA 1M6YA 3BF7A 3IAM1 3WSTA 5FLEX 3KE8A 2QRNA 4Q37A 1U9CA 1Z06A 3L06A 4CT0A 1ZN9A 1Z5WA 1JQ3A 3DMGA 4K8RB 5JC1A 4W4TA 3WGUA 1G8SA 3J7AC 1M2NA 4KXQA 1X86B 1WCYA 1X8JA 4DV7B 1T1JA 3LHDA 1CIVA 1HC7A 1R4MB 3N3BC 2XYQA 1YI1A 2WSMA 2REQA 5BSWA 3GD5A 4QRHA 2BTQA 4AZWA 2JDIA 1H0RA 4ROTA 4MCIA 1UBCA 2FZ5A 1G8AA 4Q4CA 2C57A 3RRMA 1ULZA 1HOXA 3ZDEA 1NT4A 4NVRA 4DRXA 3K05A 5LZ5A 1QV9A 2GPBA 5CLGA 4AK9A 3IELA 1F5SA 4ZWNA 3AVOA 3ZOZA 4H7PA 3D31A 3MYRA 4BECA 3RS7A 1FTYA 1D7AA 4TN1A 4X60A 3WLTA 3CCFA 3NTXA 5EA2A 5J2TB 2C2GA 2BRUC 2FWIA 3N0XA 2D0OB 4FHDA 3BAZA 4AMZA 4CR7A 2F3TA 4G0MA 2Z57A 1DT3A 4L07A 2IRWA 2B92A 3PJFA 1N75A 1QIDA 2PAAA 4N5MA 3QYFA 4Z0NA 3PZBA 3EF3A 3PF9A 4MS3B 4ZV9A 2FQWA 1T9ZA 2H4HA 3TCNA 1NYRA 3X44A 1I1QB 2WJ6A 4QUBA 5KI6A 4E70A 1VE6A 1DRWA 3K8OE 4DCOA 4Z1MD 2PMFA 3V7UA 1DZIA 1PV2A 5K3SA 4KN6A 3WGNA 2QEQA 2ZSDA 3GRUA 4NEQA 4ZAVA 5KYVA 2C5LA 4OTZA 2J30A 2F6RA 3USZA 5B7PA 5HS6A 1G7TA 2GFIA 1KAGA 4LGVA 1QHXA 4MW1A 2FAXA 2ZUUA 4K1LA 1H22A 2FLKA 3CWZA 1Q1AA 3LOUA 1A9RA 2YQZA 5F3DA 5EFZA 3EVCA 4UMFA 2GN9A 2R4TA 1OXBB 4DWOA 1B6RA 2WG0A 3WYAA 1BD4A 3R7DA 3WK9A 1K9SA 1E2UA 2QTNA 4UEJA 4AWBA 3WYEA 2ZE8A 3MJ4A 2J6IA 1KORA 3KQTA 4G81A 1KMCA 3NAZA 1SPXA 4RJJA 3RWMB 1OBFO 1GO2A 3JAKB 3MJCA 1DI0A 4WNCA 3DLCA 3P0IA 3SZ3A 1NPDA 5AIBA 2XTNA 1PV1A 1DWUA 2EX1A 1OQAA 2J9ZB 2GWRA 2XUPA 3BEOA 4IGEA 3OQBA 2YTZA 1OVMA 1ZCBA 4PRZA 2Q99A 3VJLA 3RTCA 1K97A 5K8CA 4C2TA 4DS3A 2BWJA 3Q3CA 3VR3D 1WOMA 4YO7A 1L8XA 1G5TA 4C0SA 4O4JF 3MMPA 4GU5A 4E5PA 4XJSA 5I7EA 1KSGA 1DHTA 1YJBA 3AR7A 4JL8A 4LBVA 3EOAI 4QXRA 4OO3A 3KS9A 3I6YA 5DM70 2ZR0A 1KF0A 1KJYA 1S2OA 5B1HA 2JK1A 3VOTA 5FBVB 2WUEA 3LIIA 5F9FA 3NRBA 1S8OA 2VG8A 3C39A 1Y6JA 2PYIA 1U2SA 5LIPA 1R8YA 2V6MA 5LQJA 5LPNA 3K72B 3LUCA 1SC4A 1FYXA 4C30A 3LYHA 2F4VB 1QBKC 2C8VA 1DAGA 2ZRHA 2FQYA 3LBHA 3FYUB 1U1CA 1YRLA 2ZUWA 2BR5A 1M0EA 1DRVA 1QHSA 1EBFA 1ENPA 4WNYA 2DERA 4KLZA 1R00A 5AVUA 2O0JA 1QG4A 2I80A 1NU6A 1ZGZA 1CJTC 4P83A 3QELA 4TUYF 3ZLTA 2Y1OA 3DEIA 3EUEA 4B32A 3CF4A 3IEIA 4KWEA 4LBZA 2XTZA 3MJHA 2VBIA 4H3SA 5FYDA 4YI3A 4WJZA 1TX4B 5F35A 1ULHA 1XDBA 4M8NE 4DNXA 3ZU4A 3QXHA 4DIFA 3REOA 3USES 1SUCA 1YDWA 3OZDA 4QPJC 2GK6A 5DOVA 2X5XA 1J5XA 4BP3A 4E31A 2IK8A 3HR7A 4FX5A 4TMXA 4PM4A 1RWQA 2XBLA 5HM8A 3TAUA 1HZJA 3IULA 3TI7A 3OCZA 3MLEA 3NGLA 4FEAA 1Z6XA 2P27A 1TM5E 2PV7A 2YIVX 3SXUA 1EWVA 4CIWA 2OFFA 4NBKA 2Q4EA 3WTCA 2QDKA 1RJ9A 1WS6A 1B4DA 4FEEA 1TC2A 2P2NA 3ITNA 3DTVD 3B9QA 4NYIR 4E5VA 3K1YA 1YZTA 1WMEA 3KTOA 1L5GB 5CFMA 2BW0A 4MDHA 1RM0A 1K88A 2W43A 3MMNA 3Q7QA 1KI1A 1K75A 1KDRA 2QIPA 5TEVA 1BCRB 3BMNA 2ZZMA 2XYVA 1E66A 3PUKA 1GV1A 3HP1A 4H31A 1G20E 1VKJA 4CPDA 2F1KA 1VJCA 4OF4A 1IBSA 5ITWA 1AURA 1GTG1 1SFRA 3IPXA 5IULC 2BGTA 2P65A 3AL2A 2Q6IA 4KB5A 3TPZA 5I7FA 3FCCA 4B2YA 4YCCA 2BE9A 2XE6A 3D0OA 4TWZA 3BWCA 4XM1A 4V1CA 5F1KA 1XQ1A 4HN2A 2HPAA 3RLIA 3DT9A 4RKRA 2RI1A 3VNRA 4RTJA 1HQKA 1RXCA 4R16A 1UINA 2XD9A 4ZI7A 3EYWA 3OIUA 1DFGA 1G5HA 1MDFA 2B2XA 1U1EA 2H7XA 1K63A 2P9GA 3MJFA 3SN6A 3GG9A 2HU2A 6NULA 1A77A 2WUWE 5CT8A 3GHHA 2CVFA 4A6DA 4RWZA 1LW6E 1PLJA 2GN1A 3R0QA 2WVJA 5KWSA 5IKXA 5CVVA 4QEKA 2JFXA 2ROQA 1C7EA 3U4QB 1MQ9A 1WCIA 1ANKA 1IY8A 1PYDA 2H07A 1ZGAA 2GK4A 1PAUA 4BE9A 3LDGA 3GFBA 3V2IA 1N0HA 1P0IA 3SC2A 4GOMD 1KO4A 5ANRB 4ZI7F 1SXIA 1OWPA 4BQIA 4H35A 4PTLA 1P4SA 4PG8A 2F8SA 2XE8A 4GYJA 4P3XA 4FSDA 4X84A 4P86A 1ZGBA 3ZS8A 5JC8A 3D6FA 1IHOA 1TA9A 1V3VA 1G8MA 1KR5A 4AQ7A 2HTEA 2FG7C 3ZU2A 4AW9A 3PV0A 2I4NA 3CMMA 4ZAWA 5BQOA 3M89A 5EXXA 3FVQA 4RA6B 4QX6A 1RBMA 3KPYA 4PZAA 4FHFA 4BJ1A 4R2JA 1CQJB 2F3UA 3MD0A 4UREA 4CM1A 2ACWA 2ZANA 4EYKA 3BRWA 4ODIA 1BW9A 1YR2A 2OR3A 2QZJA 2OB2A 4GEGA 3JAMA 3R23A 1C4KA 5I47A 4X95A 4EVQA 3GH1A 2ZAMA 3CF0A 2ZUBA 3AHJA 4LFCB 1TUIA 4HS9A 5ICEA 2RKWA 4DNPA 1A2QA 1KJ8A 4LOAA 4WESB 1GPBA 2CJXA 4JB2A 1HEYA 5TB5A 3AEKB 4P1ZA 1XRRA 2WHEA 4LMPA 1IUNA 5E95A 1DXYA 3ABIA 1BVUA 4FIZA 4O4HF 3QKSB 1PWZA 2BFFB 2H59A 4L0CA 4Z7NB 1G17A 4RZ2A 3OPYA 3L7IA 3G23A 2AD1A 1J2JA 4UNNA 2JFBA 3HJNA 3FLEA 4RY0A 4J9UE 3ZV3A 3N2KB 3IPAA 1IHYA 1J00A 5REQA 1USUA 5KU7A 1ZOPA 2IIBA 2WJGA 3SJUA 1DQYA 1PGPA 3DCNA 1G21B 3OUTA 1EUDB 1ENZA 3UYLA 3STUA 5CEJA 2XB4A 1ODLA 2QWXA 2CLMB 2P1ZA 3L7KA 5K8JB 4PQEA 2J46A 2PX4A 4ZEWA 3UB3A 2VOJA 3ENNA 1GVNB 3KRTA 1ONOA 3ECAA 4NZNA 4OQNA 2NWQA 2X8JB 4YV7A 1HNXB 1Q15A 1W47A 3WRYA 3C8UA 4QUGA 3CEJA 2BFBB 1Z73A 3DEZA 2D0DA 5E4YA 1C2YA 3WMRA 4REMA 1XZIA 2H18A 1VKHA 3NNNA 4Q1CA 2JGNA 1FCJA 1XE3A 2G8LA 3H0EA 4BBPA 1AF7A 3KKLA 3WIDA 4DTIA 2GM4A 2FG6C 2YWEA 6ADHA 1QIKA 2CFTA 1XEXA 4ZT5A 5H16A 4U2EA 2QL7A 4Y2VA 1RQLA 5U4XA 3CTPA 2FR0A 4LF6B 2ECPA 4TXLA 4IYRA 3AYXB 4F5EA 4P4TA 1NQOA 2GHQA 2P7IA 2G17A 1XZPA 3AIMA 1BDMA 3S2EA 1Q1QA 3G59A 3RTAA 5LR6A 1GV0A 4GEKA 1KERA 2WHXA 2RHBA 2ZIAA 3OECA 2DPYA 4CWAA 2IOQA 1CB0A 1R5OA 2JFPA 2VJQA 2X9GA 4L22A 3NBZC 3A9TA 2V5AA 4WXMA 3HE3A 3FTDA 3KOMA 4Q01A 5AJZA 5D5PA 4NRDA 1XEWX 3Q9SA 1YS9A 5TQ2B 2LR0A 2JFUA 2QL5A 2BBWA 2HL6A 4CG1A 5KNBD 2L17A 2XHZA 1FNSA 2G1JA 3I6BA 2HSGA 1L7NA 5LM3A 3AY7A 3CNNA 1S5PA 3ZU6A 3ZGNA 4NIMA 2I66A 3QMVA 5CJJA 1MFZA 1RWBA 1JE1A 3BMCA 5CEFA 2C5EA 2ZJFA 4Q3LA 1G4UR 1DOHA 2ZAGA 2AN1A 1XA4A 2R1TB 3QXCA 2D6FA 4P7BA 1R8XA 2CV1A 4JC5A 1QHNA 2ANBA 2ZTLA 1AOXA 1PJQA 2JIOA 2ZJ6A 3KL2A 4GNKA 4G23A 4US0R 2QMEA 1D6NA 1WABA 1FZTA 1QH1B 4IHJF 3WC4A 1C9YA 1YJXA 2Z3WA 2C2MA 3BZWA 3AUUA 5E3IA 3WWZA 2XDQB 4U6NA 1EB8A 2JIQA 4QTXA 2AUTA 4L3OA 4PWYA 3WHIA 3L4EA 1L4KA 3PUVA 3Q0EA 3DGFC 1I6WA 1EFTA 2R5FA 4RELA 1T9CA 2K6GA 1E5VA 3HB9A 1VOTA 4FT2A 2YVKA 4RK6A 5H80A 5TPWA 1I6MA 2W2MA 3NB0A 4IXNA 3ZQJA 2R8YA 1DFHA 3GJ4A 4YT5A 2V1UA 1HG0A 4AD8A 1XN1A 1FPMA 4IIYA 4IMIB 2LNDA 1TEZA 2VYVD 4HZIA 4ZK6A 3HJBA 1T15A 3MCWA 4ND1A 1BKYA 3BJZA 3JU3A 3U0VA 3BCSA 1FFHA 1IN1A 4P7JA 2B3TA 1K1EA 1JHXA 5KTNA 1JFSA 1KRWA 4F6LA 3F6YA 3LOPA 3FDJA 4LA4A 1K8XB 1OA0A 3BQNB 3EVBA 4KFRA 4CM5A 4GX5A 3MTIA 3AMVA 3FROA 4HPJB 3EK2A 1WHTA 4N3GA 2O9JA 5D3ZA 4YDRA 5BV8A 5K6RA 5CFLA 2BGWA 2Q27A 3PWZA 4UW9A 3T4UA 3DLTA 3WLNA 4HZUB 1NKVA 5EE5B 3UA4A 1GPAA 2G9UA 2POCA 4GE3A 3R41A 4ZYXA 2AQHA 4NCHA 1FSFA 1Y1KE 3PQ7A 4XIIA 3WZ2A 4CT4B 1ICEA 1QBGA 3OG9A 5B1DA 2ZCJA 2H7CA 4JI4B 1OC2A 1U0FA 4PZZA 4OHCA 3SSAA 2Q4OA 4L51A 1MO4A 1M1YA 2EHJA 2H4XA 2KYRA 4Z1OA 3QYAA 4C4SA 2VJOA 1MJHA 1VZ3A 1FYEA 2ATXA 2PX8A 2FZKA 3K5WA 4XJTA 5DHUA 4WTOA 3TQTA 4DZRA 1AK9A 2V9PA 3FPGA 3ZW9A 4DDUA 1D7OA 1YBHA 3X2SA 3A1DA 1NQWA 3KTDA 4QDJA 1P1JA 3X1ZA 4FK8A 1JBKA 4RETA 1UFRA 1CEQA 1ELOA 1VPTA 5E38A 4B4KA 3PEWA 3NVDA 1UBLS 1L5MA 2AUMA 2W6NA 2XMGA 2FPPA 4MKHA 4CU2A 1LK0A 2WV9A 3EC1A 2NSJA 3IIIA 3GYGA 3L8HA 4OQYA 1ORDA 4FGUA 4C08A 3VR4D 2JPDA 3TO5A 4HVAA 6GPBA 5JJIA 2CYAA 3HY3A 4BMPB 5LXTB 4GLLA 1UEXC 2ZSUA 3F8TA 2W98A 4DG9A 4G0WA 1W2HA 1D2EA 4LDNA 4PR3A 3UH1A 4H6PA 2XCQA 4YUXA 2WTXA 3KQLA 1CR4A 1WAMA 4MGIR 2C4TA 4CLDA 2IYZA 1G6HA 4IQFA 3TIIA 1XRLA 3EX7C 1NR7A 1ID1A 4AY3A 2GXSA 4UM7A 1DC7A 3LU1A 2FZVA 2BI4A 4N3NA 1QYDA 4NOJA 1E92A 1VHJA 1U63A 2CYCA 4W8OA 4XKJA 3T15A 2CT8A 1F8FA 1ZWLA 3L7NA 4GBMA 3X3HA 4D8UA 3UO8B 5AJYA 3HXTA 2CVPA 3HEAA 4M22A 4HLDA 3RCBA 4LQLA 3LC2O 3H8WA 3LK6A 1FFBA 2EKZA 1C2TA 2GSWA 1C9KA 1PTKA 3IH5A 5DM1A 1FS5A 3K1JA 4IOKA 4EYOA 3HR4A 5G3YA 1ODFA 3W4KA 1W2WB 1H2BA 3HJGA 1OI2A 4QHSA 3A3YA 3R75A 2WNSA 3P9RA 4IEIA 3G88A 2Y0CA 1QC5B 4YCAA 2VP0A 3S5JA 4YPOA 3W9UA 4AY2A 2YW9A 4JJZA 1TTQB 1UEIA 2GEVA 4U7TB 4ZRMA 3NNSA 4FMDF 3OF5A 1OIXA 3W6NA 2YNMD 1I4TD 4R54A 3L49A 5T57A 4GBGA 3WA6A 2AMFA 3I32A 1LPSA 2MSLA 4G01B 3HA5A 5HF6A 4B1FA 2BYTA 1VMEA 2ZIZA 1MEEA 1FQKA 1WNFA 2RH4A 3LCUA 2PS3A 1U3WA 4FSHA 4N7RA 4WOPA 3NM6B 1ADYA 1RU3A 3LYAA 3ICOA 4CTOA 5F7OA 5FBZA 4EW2A 2SHKA 2WHPB 3C3EA 5BWCA 3L79A 5EXTA 5JDCA 3H1TA 3ILSA 3GAZA 4N0PA 4B73A 4YPVA 2GCEA 2Q7XA 1T29A 1DRUA 2D1YA 2PGIA 4FOPA 1EFDN 3VNQA 4DLPA 4EK9A 3EH2A 1PGOA 3OQMA 2IZ0A 4LRSB 5DBHX 4R0NA 4RJKA 1BXRB 3P4YA 1QH1A 1Q0SA 1RTKA 2AWNA 2JAWA 3OZRA 4NICA 1WUTA 4UHHA 4EW1A 1Z38A 2R44A 1KP3A 2WE8A 1ONSA 3QWIA 4IEEA 1FNCA 2QYHA 2VJDA 3IT0A 3KXLA 2H2HA 3M4ZA 3THOA 1XK6A 4I9GA 5AOBA 1P39A 3F9CA 5AWFC 3WRXC 2QM3A 4AKTA 2QBYA 4N48A 3SQXA 2OCPA 1UBMS 1EBBA 3KWLA 4FP9A 1BA3A 4OV6B 5GV8A 3F2IA 1BDJA 4CCAA 2ZPAA 4D56A 2VDWB 4ZGBA 2X4LA 4XXHA 3GGGA 2C54A 2QX7A 1LSOA 2YVQA 2Z2XA 1XD2A 3IYLW 3F1KA 5TQ2A 1ZH8A 2JLXA 1WW3A 4ALLA 4UPEA 5AKKA 3SHQA 4I36A 5E9WA 5J23A 5D87A 1ORWA 3TX2A 2J6CA 3VPXA 3ETGA 1MC4A 1WNTA 2PXXA 1OFHA 5JARA 4I4IA 2M32A 3EVFA 3KZVA 1P1FA 3S7ZA 4NI5A 5AOAA 4EWLA 2DWUA 4R9SA 4RO0A 1Y5MA 1YR7A 1Z5PA 4EFDA 4JI1B 3K20A 3ZLJA 4NQZA 1GSAA 4BFLA 2WSBA 1MPTA 2P2LA 4NZMA 4EENA 5CDFA 3ZZMA 3ZDAA 1Q50A 3INTA 2OZPA 1NVWQ 2RJNA 1MXFA 5T6BA 3BHMA 2VF5X 1OFVA 2QQGA 1GTVA 1RABA 5AKIA 2PR7A 2IEAA 1A5ZA 1RW4A 3I30X 4XX0B 3SFTA 4KZKA 4PLTA 4MR7A 2BMDA 3PA8A 3RVKA 1ND6A 2GR9A 2NNLD 4MVJD 3BMCB 3PZRA 3TL2A 1P7WA 2QS9A 4NFYA 1TZ2A 1A96A 2JASA 4XYBA 1NBHA 5CEEA 2R62A 1C3JA 1P61B 2JJMA 4KR9A 4EB6A 4ZYLA 5DGTA 5U9CA 4CLRA 5EXSA 4OD0A 1EEHA 4YDQA 3EEBA 2BFAA 1T26A 1BHO1 5H9VA 2VDMB 1V8FA 2FI1A 3AVPA 5IH3A 1CJCA 4G9EA 4IIHA 1Q17A 1NDHA 4A0FA 1OBCA 3P96A 4NP6A 2G09A 3IHWA 4FVTA 3JQAA 4JJGA 2BN4A 3HHEA 4HLUC 4F9FA 3VX4A 1U4OA 5EJFA 2NO9A 3TH5A 1GKLA 3F7NA 3MWYW 4HN4B 4I46A 1I51A 3WV5A 2HH9A 4KQGA 1JXMA 2YASA 1P0CA 3F4LA 1S8AA 2F3QA 2QX8A 3LUBA 4ND2A 2E4ZA 9MHTA 4TS9A 1GZ3A 5SZHB 3JWIA 5A04A 3SHTA 1B26A 1JPVA 3PQ3A 2FPUA 2FSFA 3LDAA 4YAEA 3DKKA 1QYWA 1SBTA 3N6VA 2RGNC 3ODGA 4JLKA 3RODA 4BX0A 2RHJA 3PHGA 2BFNA 2XZPA 4FTWA 2ZJYA 4KRGA 5DVZA 3M9XA 4TTSA 1JEYB 2HNAA 3JARB 3PNMA 1II8A 1BD3A 2VLBA 1Q1ZA 1YZYA 3MG9A 4KO3S 4FT4A 4ZC8A 2C0PA 3TD6A 2V6BA 3TR5A 1FC0A 2B4YA 3AHGA 3IERA 4QYTA 2R96A 1Q0PA 2WTBA 3BWMA 4X41A 1WSWA 5SV2A 3NVMB 3Q3JB 3E2IA 2JVJA 1L7XA 3AFNA 4UHBA 3C15C 1EE2A 3GPCA 2ZJ2A 1F3LA 4PCAA 4DF3A 1ETUA 1NY5A 1S7CA 2H9IA 1CUHA 3A6LA 2NZJA 2AD5A 3RVRA 3GJRA 3OIWA 3WB0A 1IK4A 3ZY6A 1ZIOA 5LWHA 1Z4JA 4LHSA 3ZH2A 3DXFA 2IT1A 3TZKA 4KITB 4NYIQ 5IDQA 3P2KA 1SD5A 1XD8A 4ZVUA 5E4JA 2BTEA 1ZK3A 3AVYA 1CDZA 2V5VA 4D0LB 3GDGA 5DBIA 1C0KA 3PQ5A 1M75A 3O73A 2C29D 2RG1A 1QRDA 1UFQA 1K7FB 2OWDA 2GPAA 1KFKB 1W88A 3TOCA 4IIEA 4CUZA 1P33A 1ZHHA 2FJPA 3CLTC 1ATZA 3EMVA 4LXHA 4ZRNA 1WRBA 2X2FA 2WP8J 1H2FA 2VAXA 1L5KA 3RYTC 1C3EA 4E46A 4PICA 1AKNA 1WV1A 1QS0B 4PSCA 2FP4B 3RWOA 4YDSA 3WLOA 1Q0QA 4JR2A 5DTJA 3FCXA 1RRFA 4OHUA 4A26A 2FX5A 4OSEA 5FTMA 1H2ZA 1DAEA 3RIMA 4F4UA 2I4LA 1SHKA 1NN0A 3BH7A 4HMOA 4KXMA 3C3AA 1JT2A 1JAHA 2R7AA 3PEUA 1NJ5A 2QTVB 2VCEA 4TTIA 4LHVA 4O2BB 1VMKA 2J32A 5CIQA 5BT8A 4JSTA 3GDWA 4Z99A 4MQFA 5KYUA 3TQCA 1QO9A 4ARUA 2X76A 5K2MA 3PX3A 2B8TA 2Z08A 5FFMA 3OCWA 1ZOLA 3TOZA 3V8NA 1ZUNB 4MQ5A 4X3PA 3OURA 2CHUA 2OHFA 2DT8A 2Z9DA 3DZGA 1M6VA 3E9MA 3RUEA 1OB2A 4WZBB 1U9ZA 2R7KA 1U9JA 3KZCA 1U0RA 2M1XA 1PZNA 3HVRA 3IUPA 4J16C 1ZD8A 3D7KA 4JLDA 3H5WA 4W1RA 4X91A 5FWXA 1G2OA 5H70A 1FFXA 4E13A 4B76A 1UZNA 2JFGA 3VUEA 3WQQA 4BV8A 3O91A 3RTBA 3AF3A 2H1RA 1MT3A 3IBSA 2I6FA 1QUFA 4FE3A 4HADA 1L5FA 1NOJA 1E2GA 3RYHB 3UJHA 1XMPA 4M8LA 1XTRA 4P6VF 1Q83A 1JT9A 4GH5A 4TLBA 5KTOA 3HSSA 4ZQBA 4XOIA 5GINE 5SICE 4CKCB 1Q0LA 1Z4QA 2ACVA 1QFZA 1U1GA 4KQEA 5CPFA 2EWMA 1P0QA 4ZU6X 3U3KA 5B7NA 3M9WA 3WNQA 2ASEA 3U7EB 5IKEA 5AVVA 1W1IA 3OJ0A 4OPMA 5HM6A 1QP7A 1S8NA 3SZUA 4QBTA 4WERA 4I2VA 3FN4A 3OX3A 5F3RA 4MS4A 3MHTA 3ICEA 5IJXA 2FR8A 1BE0A 1SHLA 2OXEA 2ZR7A 2Q3JA 2J45A 3QJ5A 3DW3X 1RMTA 4IP0A 4YROA 4UE3S 4Z0PA 2I8AA 4A6EA 1JZQA 3NDRA 4XI9A 1OTXA 4PN3A 1OV6A 2ODAA 2W4QA 2C2ZA 3SZMA 3L9WA 1DIRA 3H2ZA 3VYUB 4D8YA 3KAQA 3LVBA 1U5CA 5AUOB 5JWOA 1EA7A 3ZUPA 2DGDA 3ESXA 4AU1A 2BBTA 1NHGA 2QGFA 3BIJA 4U4AA 1SGWA 1N2OA 1SEVA 4XA8A 3T6KA 4F92B 3P71T 3GVIA 4UEQA 5AJUA 1E3LA 3INRA 3R4CA 5DF1A 1AM4D 5K01A 2HRDA 2PNFA 1FSPA 5DISB 4QUAA 3U6BA 4NARA 2YV2A 5BW6B 2O8EA 5C7IO 4WEQA 2OZKA 1LBSA 3T54A 1BN7A 1PQUA 1ZSYA 3U39A 4F6RA 1JRLA 2H06A 4BGDA 4HVCA 4Q5IA 2A2ZA 5ERGB 4AP5A 1U11A 4O1IA 3ZHYA 1QS0A 3PLNA 4WBNB 1Z15A 1OAOA 3BMOA 3Q5EA 1HF3A 1HTBA 3JD4A 4NZ9A 4OBWA 2WJ4A 5COQA 4DBZA 4KMRA 2QLBA 4JB0A 3T5CA 4Z4QA 3N1UA 1NUQA 3LHFA 3LY7A 1EVYA 2QX4A 2WUGA 4Y18A 8MHTA 4AKEA 2VH1A 2OGSA 3KT8A 4OA8A 1GTZA 3UJ9A 3ZTWA 2F1RA 3PIDA 4EX7A 5KO2A 1F06A 1U3TA 5FWXB 3U4MA 3E22B 4NLLA 3HLTA 1IU9A 1E3QA 1VA4A 3SJAA 4G41A 1NI3A 4D9FA 4YRNA 1ZLXA 4MLZA 4CW7A 3NOOA 4DHWA 5JXIA 5HP4A 4ZYZA 3PWTA 1ZUNA 5JAQA 2GZHA 3H2KA 5FWDA 2G4VA 3LFHA 5LJLA 2O5VA 1BDHA 5CIYA 2V7EA 1XHFA 1ZUWA 3L1IA 2GARA 3FRIA 3P2MA 1ZCJA 2IC5A 3B9BA 4W5OA 1F2DA 1G8PA 1I10A 1ZGHA 3C6QA 4TKUA 1TU4A 5ILQA 2OVFA 2QSYA 4YWJA 3UJDA 1MA0A 4KQ1A 3DT8A 4A2CA 4YV1A 1NUTA 1W30A 3VMMA 2IYSA 4JP8A 5B2FA 5ALEA 2VUTA 5CAEB 3BWDD 4CTMA 1X1RA 1M74A 5I7UA 5C34B 5AXAA 4ETIA 3ACBA 5IS2A 2R97A 4JQYA 2HCJB 3M3DA 2CUKA 4KLCA 4D6YA 3QVGA 5E4TA 2WR8A 1P1IA 3VKVA 3EZ6A 3L8YA 4FNGA 3ZWPA 4ERNA 4NXNB 2AI3A 3P20A 1QC5A 1MX9A 2UUOA 3VZBA 3L4BC 3O92A 4OMFG 3V4LA 1OXMA 1F6BA 3QFRA 4RFSA 5BSUA 5JS1A 2LV8A 1SK9A 3C8MA 5CLHA 1USVA 1V48A 2PTGA 4KOAA 4CQLB 1FFWA 3I3SR 3ZDZB 1F0NA 4GR5A 4NYJR 3DYVA 3MILA 2IPMA 4B7UA 1E6WA 2X9NA 2Q4RA 1MDBA 1BJTA 2Z09A 4LY0A 5DXFA 1R4MA 2XXJA 3IFSA 2CBGA 4XR4A 3UPTA 2W6JA 1FDVA 1Z35A 3OZVA 1BG6A 2VCYA 3CPJB 3LXRA 3PFHA 3DONA 2FLVA 1PJBA 4EJ0A 4KIJA 4J2TA 5EINA 3IMGA 1YZHA 3JQ7B 2IVFA 2WM2A 1PEDA 4F93B 2A5GA 4Y2JA 4D4MA 1JHZA 1KYTA 1S3GA 4PGHA 4F4JA 1R6UA 1CUVA 3GFTA 3HB7A 3NBMA 1CNEA 1KZ9A 5FV4A 5KHLB 2MSNA 3HDHA 4X1KA 1Q0RA 4EY8A 1Q22A 1IEXA 2V6GA 3AP1A 4P9NA 4AJ9A 1Y6GA 1SVIA 2I6GA 3VX3A 4IQ4A 4V03A 3IEMA 3HI4A 1U5BB 3ROGA 2C4WA 1CUEA 4Z8XA 2JD2A 1YQGA 1E4YA 1UMBA 1YQ9A 4R8KA 5H7XA 2VTBA 4RZIA 5C4IA 2FGJA 3WJ2A 2AYZA 4K8OA 2B4QA 1W29A 4YHBA 5HKLA 1M34A 4IVQA 3UXMA 3GGPA 4REQA 3CBQA 1KQOA 4WOCA 2I6SA 4KFTA 4RVOA 2I2XB 1X38A 2D4AA 3JATA 1R66A 1QZUA 3DVRX 4I4TA 5CK4A 3RW9A 3DH0A 3SXPA 4Z1MA 1E9BA 3MEQA 3NWEA 5BUCA 5CBPA 3U19A 1AO0A 4XWOA 2QTMA 4MEJA 4D9MA 3CLUD 2EKBA 3JRNA 3ZVKA 3UAYA 1FFGA 3BA1A 1QPGA 1NONA 121PA 2XYHA 3S4YA 2VDQB 3AUAA 2XA1A 4MRNA 4NTZA 4XUCA 3PKZA 3V1TC 4BQOA 4NJMB 2XUGA 4Q00A 3T5DA 1LPAB 3ZH9B 3WNDA 3QSYA 4B84A 2CC2A 1ESDA 2YC4C 2OTCA 3WKAA 2BEVB 3RE1A 1W0CA 2A59A 4N3AA 1RE1A 4HH0A 2W11A 3TLBA 3UK7A 3Q3HA 4NATA 3W7AA 2VFAA 3CXUA 4GBJA 3MUFA 1NRWA 2BV3A 1ZN7A 2QN1A 2DAPA 2IV3A 2WKSA 3E7DA 1VHQA 1SU6A 4PHCA 5CVDA 3T5TA 1U6IA 2AYXA 1TVCA 3BK2A 3DVSX 1A5SB 5AVJA 2IP1A 2BLNA 1M67A 2EGGA 4C7MA 3GLFB 4K6KA 1JWLA 1QK3A 4FHZA 4HP8A 4I6GA 3D4OA 3AFMA 1QLHA 1TC1A 1DAHA 3D43A 3BA6A 1GJRA 2A9KA 3A1CA 3I83A 3L0DA 3DPUA 4HJRA 5EI5A 4GPIB 4NESA 4K9PA 4BQSA 4JI2B 4HXEB 1I8TA 4LXXA 3J7TA 1SQFA 3EA0A 3KSMA 4G8JA 4J7CA 3TRJA 4NZYA 3ZHRA 1B14A 4PIVA 1YQDA 2ZWAA 4D9KA 4E4YA 1QG2A 5EMNA 4L0MA 5IK2D 2NTNA 2GM3A 2YFHA 5G2OA 2ODEA 3SICE 5KTTA 2XTAA 4HGNA 4CMIB 2RD2A 3W6PA 1PZXA 3CZMA 3I37X 3TPCA 4DMCA 3IOBA 4N40A 1UM9A 1SOMA 3HHPA 1KMHB 5FWNA 4OI1A 2D00A 3WDSA 1A9SA 1A2OA 1AKYA 1W75A 2NYRA 1TPZA 2POQX 4MVCA 4XB6B 5EHNA 3W6ZA 3T3GA 5E9AA 3OLCX 3TZEA 1RI5A 2Q5IA 1LKZA 1Q57A 4WLNA 3SLRA 2GEUA 2H29A 3M8KA 2FWNA 4FX2A 3I6QA 3V2HA 4KRFA 1YDFA 3MD9A 2WK1A 4UTZA 3ENKA 4NOKA 1W52X 3N74A 1K7SN 2J5RA 4BLTA 3HJHA 5JH7F 2W5UA 3PTAA 1ZUD1 3LX6A 4DBLC 1JA9A 5KSPA 3V4SA 2DF8A 2J4CA 2XCIA 1J5PA 2OQVA 2BGUA 1LQTA 3NT2A 1PTJC 4GNRA 5TPZD 3OBIA 4CXMA 2JCXA 3RGGA 1VDMA 3G5UA 3DCYA 2YZ2A 3UZUA 4G5GA 2ZIVB 1RE0A 1YKFA 2WIKA 1T5IA 2NU7A 4DANA 1E2LA 1KNXA 1N8TA 2F64A 3GGOA 4HH4A 3DBHB 3VU9A 4QUHA 4RIGA 2HV9A 1NLMA 4RPGA 4MAFA 1N2IA 1IULA 3FBTA 3LRPA 2H1LA 1U2QA 4Q3OA 4RGVA 2J0UB 5JZ9A 3D6MA 3KPWA 2RGXA 3L93A 1E1DA 4KV7A 1L4GA 1QKJA 3OD1A 4Q9HA 3G2HA 2PX6A 3LT2A 3ZJ4A 1FIUA 2X9QA 1TIPA 2V7WA 4LJ4A 4KPFC 1UMDB 1HLFA 1LZLA 4D6PA 3FVRA 3RABA 3VDRA 1X70A 5NLLA 3KK0A 4DM4A 4X90A 2A94A 4FFSA 4KVFA 1Q0TA 3JASA 1IHDA 4O29A 1CB7A 3AM1A 1D9XA 2VN8A 2XT6A 2B1JA 3PRKE 1UFVA 5A0FA 4R1PA 4CM4B 5BSRA 3STVA 3SYLA 3THRA 1Y9EA 5CMLA 5K0JA 1L4LA 3WGYA 2HTFA 4YRBA 3OPMA 5ALVA 4DR6B 3B2QA 4I9FA 4X6LA 2H9AA 1GM5A 1E3DA 2QN6A 2AG5A 2YIJA 3NVAA 5KYXB 5HUQA 3ZWDA 4MUIA 1INLA 2IP2A 2A5FA 1EBUA 3QBDA 2G0NA 3T8YA 4U2DA 1GLVA 3E8XA 3LKBA 4RUKA 4A9AA 5A06A 2SNIE 1WCWA 3NR2A 4JKOA 4YIHA 3SR4A 4QBGB 2E4XA 1DBPA 3CZ9A 1WDLA 1NMQA 2HU7A 1TRHA 4UE2A 2AWOA 3I92A 2NPFA 4PCLA 1IHXA 5EC8A 2EWVA 1RWVA 1TDJA 1GAQA 2FSVA 1X1TA 3KOZA 3SHVA 4D02A 2QRHA 4YMHA 5L3SB 2CKMA 4YJ2F 3S70A 4IVPA 2CF5A 2C5SA 3L8GA 1QR2A 3MXTA 2IFTA 5CRIA 3TDNA 3PDHA 1THGA 3CISA 2Z8ZA 4KPGA 2J0VA 3QK7A 4BFWA 1C7JA 4S1OA 2WTAA 3E7XA 2C8LA 2FR1A 3QVOA 3T9AA 3N2GB 1GXSA 5TQ0B 3QMPA 3S1AA 1PJLA 3DQZA 3OU2A 5AOCA 4ZTBA 1XTSA 1UC8A 2W58A 4H18A 3QP9A 3RRYA 4GL2A 1LDMA 1RHJA 2FJ0A 3WISA 3GNLA 4X97A 5CYPA 4DR5B 3DVAB 5TPWB 1TMYA 1YAJA 4IY1A 4W9RA 4EVIA 4DCTA 3ER6A 4OB7A 3PJDA 4MR8A 4BVHA 1GT6A 4M7OA 1P45A 1SZPA 3OUZA 4C9BA 1YB5A 1L3IA 1X1QA 1EXWA 3HKDB 3OMXA 3ZU3A 4LGCA 2C97A 3AJDA 5L3ZA 1LW7A 1NRJB 1UWVA 4ESEA 2BFEA 4X7BA 1T13A 2OESA 3QGMA 2HJWA 4TWRA 3L46A 4RXTA 3EH1A 2UUCB 2EIXA 1E0JA 4R6WA 1HE8B 4DA4A 3FPFA 5IF9A 5DGXA 2ZRLA 3QOXA 1X9IA 2I65A 5KYTA 1PLLA 3RH0A 1EFAA 3IDFA 1CG6A 3QX8A 2WSSD 1VI2A 3C6ZA 1AK1A 3TSCA 1BU5A 2FEOA 1TD9A 2VHEA 1Q12A 3GVCA 3JYPA 4DIKA 5L7YA 4EL5A 1S3IA 4NK4A 2RGAA 1DEHA 1DJPA 3GZ4A 3T7SA 2QPLA 4ZI7B 1IEVA 2P3QA 1YJCA 3PS9A 1S8FA 4AJEA 4N5HX 4YRLA 2VYQA 1P2DA 5DX0A 3ZDFA 3ABZA 5A6SA 1GKYA 2Y93A 3ZZTA 1W59A 2IJGX 1X8XA 4RHYA 3TNFA 5L9AA 1CDDA 2VHXA 2JGRA 5AW5A 1Y3CE 5LU9A 4GICA 3WQHA 4X20B 4XQEA 5F7XA 1M2WA 1S0UA 2IU0A 4CYMA 3EFEA 3ROTA 1X9GA 1BKDR 2UVPB 2GEFA 4RMIA 4BO4A 2CL5A 4MYSA 1WVIA 4FYIA 1WUIS 3GCDA 3IQGX 3WLFA 3THWA 3SDZA 4RPIA 1R5BA 4B3TB 1J7JA 3IR7A 1UBHS 2VXCA 4L6IA 4FGWA 1QANA 3GVHA 1CLUA 4BO1A 1RP1A 2BFBA 4RIFA 4GQIA 4ENTA 1U7TA 2RE8A 3H2JA 3ZI0A 1KK3A 2X8JA 1AJEA 1F3OA 1ZG3A 2PH7A 4QBIA 3W5DA 4LI3X 1CQIB 1KO1A 3R8XA 1MEOA 2QLFA 1Y8ZA 3DYBA 3ASYA 3BSWA 1DINA 1HGXA 2VJAA 3OIGA 2VSOA 2NO0A 3JVEA 4HN9A 3U3RA 1P5ZB 1SURA 4IFEA 3PLAE 2QP3A 4X24A 3M5CA 3F7TA 3WGHA 1HRKA 5AI9A 5AK5A 1MQ8B 1XU4A 3AKZA 1LDNA 2FCRA 2I7TA 5EJAA 4UUMA 1LNZA 4LBWA 4RH1A 3G8YA 5J5VA 5C1IA 4AWXA 3HYSA 4JEHA 1IEWA 1BX1A 1UXOA 1NN1A 1C0IA 3PNYA 3HBNA 4E11A 4CI9A 1LPNA 4ED9A 1DAOA 2Q0HA 1NI5A 1Y48E 2CJYA 5BV7A 4H27A 2AC2A 1Z12A 2CWDA 2HV8A 3NEAA 3QLTA 1F20A 4G5SA 3W34A 1WPXA 2C1XA 1EQUA 2DRIA 2JAQA 3RAGA 3HXOA 1EFVB 5EIFA 3H0CA 3WMWA 3EPLA 5ALRA 3GLHB 3G0BA 1LGYA 1SELA 4KX3A 3SJ7A 3FWHA 3BILA 3PHBE 4QWWA 1HDZA 4FYJA 3VYRB 4X0EA 4B6EA 3SEQA 1WP9A 1ZD2P 1TM3E 1GT91 2P3OA 5TS3A 5F4BA 3BIWA 1C0PA 2EX0A 1DRKA 1L5SA 2PRIA 1ZINA 2ENUA 3OIVA 2J4FA 3AEQA 3DF9A 3WRVA 1FW8A 1MB2A 3ZWWA 1CLEA 1SKMA 1HZZC 1M6HA 1HX7A 1A88A 3WGIA 4KR6A 4HDKB 3CNQS 2ZE5A 3GK3A 1CVRA 4BFVA 1CYEA 4AUNA 1ZOSA 4GXTA 3EGDB 3HNPA 3ROQA 4E22A 3CRRA 1BXKA 2CXPA 3O9VA 4MITA 1YB6A 3DXYA 1CDOA 2P2GA 2RJ3A 4NS4A 4OVKA 2IHKA 3QQPA 5ISMA 1C80A 1GNQA 4AF6A 4GLBA 4MUGA 3GEIA 3R0JA 2ORYA 1KKMA 1LK5A 4BFTA 5CDFE 1I7PA 5JSYA 4ENQA 4FFBA 3S5UA