1CYDA

Carbonyl reductase complexed with nadph and 2-propanol
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
242
structure length
242
Chain Sequence
LNFSGLRALVTGAGKGIGRDTVKALHASGAKVVAVTRTNSDLVSLAKECPGIEPVCVDLGDWDATEKALGGIGPVDLLVNNAALVIMQPFLEVTKEAFDRSFSVNLRSVFQVSQMVARDMINRGVPGSIVNVSSMVAHVTFPNLITYSSTKGAMTMLTKAMAMELGPHKIRVNSVNPTVVLTDMGKKVSADPEFARKLKERHPLRKFAEVEDVVNSILFLLSDRSASTSGGGILVDAGYLAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBONYL REDUCTASE
publication title Crystal structure of the ternary complex of mouse lung carbonyl reductase at 1.8 A resolution: the structural origin of coenzyme specificity in the short-chain dehydrogenase/reductase family.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 94
structure length 242
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.184: Carbonyl reductase (NADPH).
pdb deposition date 1995-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1cydA00
2P2SA 4CR8A 2OBNA 4RDIA 4W6ZA 3ZWYA 2QQ5A 1P1KA 4OKNA 3BTSA 3ZN2A 3NTOA 4MP6A 4WLVA 3RU9A 2ZYGA 3SLKA 5F1OA 3GAFA 4OKIA 1RM5A 2IXBA 2Q1SA 3A1NA 3LDHA 5TSDA 3GEGA 2HSDA 3I9OA 5H82A 2P5YA 4E2ZA 3UCXA 3I9LA 3ZW8A 3K96A 4RVFA 1EE2A 5LDHA 5EESA 2ILTA 1R16A 3I9MA 3HE3A 3RASA 3DHNA 3RC1A 1EUZA 4CL3A 5TQVA 4D0RA 1N9GB 2LDXA 3PGXA 3GVPA 3ZGYA 2Y67A 5HA5A 1UDBA 1MG5A 2E49A 3A4VA 1Y9EA 4G5HA 2TMDA 4KMSA 1J0XO 3HNPA 3ITKA 4HX5A 1U2GA 2FOIA 2AE2A 3IUPA 4B3IA 1PU2A 2VWHA 3BAZA 3RSHA 4Q3BA 1P45A 5K0ZA 2PZMA 3GDFA 3AI1A 5A9TA 2ZTUA 2BI7A 1T2AA 2AQIA 3AUSA 4F45A 1SB9A 2YHIA 1U7TA 1IYZA 1JDJA 1O95A 4BL5A 3RI3A 2WMDA 5ER9A 3NT2A 3W8EA 1UJMA 5JAIA 4XRGA 2V6FA 4XJSA 2GR9A 3TWOA 5AXCA 3OQ1A 4OGWA 4FW8A 1KEPA 1AXGA 5DBGA 1E1LA 3QE3A 4IDFA 5K9ZA 3GQVA 1CERA 2F1KA 5KWEA 4YRDA 3ZW9A 1VJ1A 1ZEJA 3C7AA 3WGQA 4GH5A 3H4VA 1FK8A 5DP1A 1NQAO 1PQWA 5FEUA 2VWGA 2FR1A 1SPXA 4II3A 2PFGA 3ROQA 1V9LA 3UVEA 1EZ4A 5KKAA 3T7EA 4R16A 1E0DA 1NYTA 1OAAA 2J5RA 1HXHA 3DZGA 1M76A 4CM9D 2ZJ0A 1C1XA 2YQ4A 1GCOA 4YJHA 3S1LA 3L9XA 2PGDA 2O50A 4IINA 4M89A 4BQRA 4MVJG 2B35A 1K89A 5KVSA 1QRRA 1QYDA 1RM0A 3VH2A 3RBXA 1LQTA 1X0XA 4BGVA 5C37A 3GRKA 1ZXBA 3ROKA 4FDAA 3UW3A 4H15A 3R1IA 3Q11A 1NXQA 5DOVA 4D0SA 1PSDA 3GG9A 4XA8A 2H63A 4EUHA 2GZ2A 3ANMA 1U1IA 1DLJA 4LSMA 4LGVA 2CDBA 5A1TA 5IZCC 3E6AA 3G17A 3VVCA 4BO5A 3IMFA 1JW9B 5COQA 3VPFA 1HDGO 4KQWA 3GFBA 4B4UA 4CM3A 2YDYA 4IJVA 2ZTLA 3MOGA 1BW9A 4OAQA 4XB2A 3NKLA 3GEMA 5EN4A 4Z6KA 2WD7A 4NJOA 1YB1A 3AW9A 3O38A 2WWRA 4FB5A 4M86A 1N1EA 4HFNA 2PD3A 3GY0A 2NM0A 4P38A 4DMMA 2BD0A 5T6BA 1ADFA 1DRVA 2G17A 1DRWA 1PQPA 4TZKA 2VTDA 4PLVA 4BNJA 1OZAA 2J8ZA 5I8WA 4HBGA 4EUEA 5CAEA 2SCUA 2CSUA 1ZO8A 4E5MA 1JAXA 3E5MA 3MJVA 4UREA 5COAA 3DQPA 2VHYA 3PZBA 2VOJA 4W9NC 3QIVA 3WLEA 5K6AA 2DM6A 1GDHA 1HRDA 1U3WA 4L8VA 3ITDA 4P4GA 2GCGA 4UEKA 1YRLA 1H6CA 2DVMA 5L45A 4OXNA 2QRJA 4DLLA 1G0NA 4F6LA 4EUFA 1ML3A 1U3TA 4LMRA 4ESOA 3K2EA 1JTVA 3OIGA 4O5OA 1AUPA 3DB2A 1EDOA 3E8XA 5C7IO 1EEHA 2O4CA 3ZWNA 1K5HA 4UEOA 2JCVA 3AK4A 4U6SA 1ZJYA 1YDEA 1GADO 2PKQP 1ISIA 4RVUA 1KVQA 1ZK1A 4XIYA 4XYBA 3SJ7A 4R1UA 1E3WB 2OZPA 2Q4EA 1A4IA 4FCCA 1NBOA 2E37A 3EAGA 5ADHA 4B4OA 4GLLA 2CDCA 2ZIZA 2X23A 5AXDA 1Q7BA 3WIDA 3GUYA 3PK0A 3H7AA 4A73A 2FP4A 1S6YA 5EQDA 5BSGA 5AYVA 1DHRA 5AXAA 3D64A 2VHWA 3E18A 2YUTA 3TZ6A 2G82A 1JAYA 1ENZA 3TOXA 1ENPA 3C3XA 4I8XA 4J7XA 2DAPA 5HS6A 1NQ5A 1XDWA 3ZWBA 1WDLA 5L9AA 3H6KA 1I3KA 4OJNA 1EVZA 4KP7A 2FHSA 4ZA2A 2OBYA 1QMGA 3U9LA 4BO6A 3LZ6A 4MKXA 2ZK7A 3TPCA 4YVFA 1E6UA 4IMPA 4BO4A 4E3ZA 4BO7A 2B69A 1IULA 1UR5A 5G0VA 4BO1A 5KJFA 1SAYA 4J43A 2C7VA 1MFZA 3UICA 4BOYA 4ID9A 2HK7A 5DCUA 5JC8A 3F3SA 2GF2A 1MC4A 3QWHA 4OXKA 4DIFA 1H0KA 1SBYA 1DJQA 1AHIA 1EUCA 4WCFA 3DFZA 3DMYA 3CXRA 5U4QA 5KJ1A 4CL8A 4R68A 1E7YA 1H94A 2BFOA 2RCYA 1OBFO 3P7MA 5CP8A 3OEWA 2Q4BA 2Z1MA 4IDCA 2CNBA 4DC0A 1Y5RA 3A9WA 1UXHA 4BIIA 3VZQA 1E7QA 1P44A 2HQ1A 3VPSA 4L74A 4QT0A 3E9NA 4FFLA 3I9NA 2Q46A 3EVTA 3PYLA 5JCXA 1V6AA 4E2XA 2DU8A 1BDBA 3OJFA 5F21A 3CPSA 3S2EA 1D7OA 2NVUA 4E30A 1Y8RB 1DC6A 4WPGA 3GPIA 3QV1A 5CPBA 4YBZA 1U4OA 3TDKA 1C1DA 2AE1A 1GZ6A 2FR8A 1YONA 3KO8A 4FJ2A 4D43A 1ONOA 2P68A 3LU1A 4BGEA 4JBHA 1PJ4A 4I5EA 4R3NA 1UXIA 2D5AA 2X9VA 1NX6A 1W6UA 4D46A 1PIWA 6LDHA 1HEUA 3PJDA 4NFHA 4L4RA 1Y81A 4YQZA 5IG2A 3IDSA 1OI7A 1WMAA 3OH8A 4TKMA 1O94A 2EHDA 3O4RA 1RYDA 2ZCVA 2Q49A 3ZNNA 2V7PA 3TF5A 3DBRA 1VL6A 1NTOA 5FWNA 1H93A 5JCJD 2QZZA 4YCAA 3BHJA 4PN3A 4PRKA 1MLDA 3ZV5A 3FI9A 1LLUA 4A7PA 3DBRB 2YHIB 4WCDA 3U09A 1CQIA 3AOGA 3WYCA 3ZV6A 2IYPA 5EIOA 4PZCA 5TLSA 1GR0A 4YYZA 1VI2A 4GSKA 2AA3A 3RUFA 2EF1A 4NBWA 1NAIA 1LC3A 1V3VA 1DIAA 1GZ4A 2G0TA 4O6VA 2H6EA 2PZKA 5BT9A 4J0FA 4WEOA 3LLVA 2EV9A 5GY7A 1WP4A 3K2BA 3T4EA 4FC6A 3NT4A 2X8LA 5DN9A 1IHYA 3EDMA 2Y68A 3KM0A 4QX6A 1F12A 3ETGA 3O8QA 1YO6A 3K9QO 1C1XB 2RHCA 5DCYA 1U8FO 3MTJA 2O3SA 1KBZA 1NVTA 1O8CA 3OECA 4YJHB 3S2FA 4BKOA 2O2SA 3HDHA 4PLZA 3DBLA 1MG0A 3L6OO 2Y0DA 4J9UE 4JCOA 4CODB 3KSZO 3ORFA 4FJ1A 3DTYA 2HMUA 3RC7A 4Z0HO 1LRKA 3LT1A 4YAEA 4LMPA 1DBVO 4PG7A 3FSRA 2E4AA 1ZIDA 1IL0A 1W8DA 4U0JA 5I8ZA 1PJ3A 2R2GA 3JYLA 3ASVA 3H9GA 1GV0A 3OA0A 2DFVA 1HWYA 3E9MA 3F4LA 2VNAA 4U0KA 7MDHA 2GYYA 5H83A 2HRZA 4M55A 3QJ5A 5GMOA 5HRUA 3D4OA 1GPDG 4I1IA 2P9GA 1B3BA 4J1NA 1QG6A 1BW9B 1CRWG 4ZQGA 4A03A 2HMVA 1VSUA 3EW7A 2WD7B 3NJ4A 3EMKA 1PR3A 3ZU4A 3ZU3A 2RHRA 3U4DA 1SNYA 1KVRA 1XGKA 1NAHA 3DEYX 1NFQA 3SJUA 2AEFA 2NU6A 4ALLA 4BV8A 3N58A 2JFHA 4BNYA 4PRLA 2CVQA 2ZB7A 1A9ZA 2NADA 4MKZA 1ISJA 4XWYA 2ZJ1A 1M6WA 3QWBA 1YGYA 3W8DA 2JCYA 4O63O 5KJEA 5IDYA 4P22A 1Z7BA 4PLHA 2C5AA 3IKVA 1HDXA 4HNHA 4J9VA 2NUAA 1JKJA 3NAQA 2GO1A 4QO7A 2PD4A 2P4HX 4RF5A 4YACA 1YQXA 1BVRA 1I36A 1I5RA 2VWPA 3NEPX 5L7TA 2J5KA 4N5MA 3WMXA 4WUVA 3I23A 4CQLA 1QORA 4ALIA 1AHHA 5JAQA 1SB8A 1JVSA 2OL4A 4BKPA 4PVDA 2DC1A 1ZZEA 4JIGA 4TRNA 4EW6A 3Q2KA 4OO3A 4I5FA 1ADBA 4R9SA 4G2NA 3WXBA 1I30A 3F1LA 1T1RA 2AG5A 4ONEA 3GLQA 1MP0A 3DFUA 2HKIA 1DHTA 4ZRMA 3CIFA 3H3JA 5L7WA 4JNKA 1VLLA 2D8AA 1ULSA 3KRTA 1I3MA 1GFSA 1KIFA 2DFDA 2WSBA 1O9BA 4CM4A 3I1JA 2BH9A 4GL4A 4CLXA 3DHEA 3HQ4O 1KEVA 4J7UA 4GMGA 4FFPA 1UDCA 3ZNPA 3W1VA 1JVBA 1K6JA 2FN7A 4GX2A 1TEHA 2PTGA 4IUYA 4LRTB 7ADHA 1Q1NA 4CMEC 3PGJA 4C7JA 3LYLA 3U3XA 2VZ0A 1F06A 4MPDA 4NBUA 4YRAA 4GSLA 3ICCA 1DFHA 3VH1A 3DOOA 4DWVA 1IE3A 1U8XX 4OQZA 4ZHSA 4ZVVA 2P9EA 2FY8A 4BKQA 3OICA 4Z9XA 4YAGA 1EDZA 1HE5A 1I2BA 3HFGA 3PQEA 2OORA 4BMNA 3U0BA 1Q2XA 2IZZA 1VL0A 2VHZA 3JQDA 4NK5A 1XELA 5H81A 2C54A 1D1SA 3DZJA 3HSKA 3CSDA 2ZATA 1JWAB 4KQXA 3RFVA 1K3TA 4GWKA 4BQPA 1GPJA 1MX3A 3ZHZA 3B1KA 1VSVA 2WJPA 1E3WA 4RLHA 3WSVA 4QFDA 2VRBA 3F5SA 2YQ5A 1ADGA 1Y6JA 1NWHA 4GMFA 2O2YA 2Q2WA 4IDAA 2BFMA 3BTVA 4NPCA 3HFSA 1X0VA 4PCVA 3SXPA 2XF8A 1R12A 2XXBA 4WCFB 2GERA 4Z0TA 2G1UA 8LDHA 1U3VA 1HDYA 2J3JA 4ALJA 4B3HA 2POQX 3VZRA 3KEQA 1QR6A 3FWNA 5EQFA 5JLAA 3AUTA 2NTNA 4QUKA 2YYYA 3FBTA 4JJGA 3L4SO 2QZ9A 2CUKA 1RYEA 3JQFC 4MVJP 3OQ6A 4XR4A 3IJRA 3ENKA 2V6GA 4N5LA 4RF2A 4W99A 1T1SA 4NI5A 4U5QA 2QRLA 1EMDA 4XYMA 4JJFA 5T57A 2YDXA 4L0QA 1R15A 5ER6A 3IKTA 4ALNA 2FRDA 2W2LD 4RQTA 1JA9A 2YV2A 2UV8A 3V2HA 2QRKA 2VUUA 2NVUB 3WJ7A 1FDUA 4ILKA 3WGTA 2O4UX 5CDGA 1JWBB 2EW8A 1H2BA 1IHXA 3OA2A 3B1FA 4J7CA 3GVXA 4OH1A 5BNIA 3PJEA 1C0KA 1C1DB 1P0FA 3TNLA 5CDYA 1E7RA 2OOSA 4RO0A 1B0AA 3F9IA 1LEHA 1XQ6A 2HU2A 3NX4A 1XHLA 5EJ2A 1EFLA 3MOIA 2GNAA 3QVSA 1FXSA 1TT7A 1XU7A 3RFTA 2YHUA 1W4ZA 2B5WA 4R1TA 3M2PA 4WNCA 3WBBA 4Z0PA 1KOLA 4E21A 1LQUA 5T5QA 3RUIA 3H9EO 4UVIA 3MJ4A 4R5HA 2GN6A 4CMKA 4DMLA 1KEWA 2PK3A 4J2HA 3BMNA 3MJEA 4L4SA 3C24A 4FOOA 4BVAA 3CH6A 2HJRA 3E1KA 1GEGA 4JBGA 2JAPA 3K8ZA 4DYDA 3I3OA 2RH8A 4BGIA 1H6BA 5U1PA 4W4TA 1H2HA 3A14A 2NVBA 1Y8RA 2NTJA 1XU9A 4OYRA 4AJJA 4QFCA 4INAA 4R54A 4FC7A 3QVWA 1Q0HA 1YS4A 2WTBA 2VCYA 3ONDA 3V1TC 4A5OA 3E03A 4P4NA 5DBFA 3G79A 3AJRA 1B16A 4DUPA 2EP5A 4E4YA 1DFIA 1ZSVA 3QA9A 4WASA 3EHEA 3GGOA 3QWAA 1GUYA 3NJ8A 1YOVA 2ZB8A 3WYEA 3P19A 2ZTVA 1XKQA 3RUHA 3JQ7A 2R00C 5B4TA 1VKOA 4BNTA 4PIVA 3GHHA 4FFOA 3VKVA 2EKPA 4IQGA 1M67A 3HDQA 2JKVA 3KYCA 5I7VA 1ISMA 1SOVA 4EI2A 1B8PA 5A5EA 1X14A 2Q2QA 1KC1A 1G0OA 2QYSA 3GDGA 4Y98A 4CMJA 2YV3A 4RV9A 2NNLD 4UAGA 4XEHA 2VT2A 1IY8A 1KEUA 4Q3NA 3O8QB 1KS9A 2BGKA 4CMAA 3U5TA 2QHXA 2VYVA 1VM6A 3HADA 3NDIA 1KY5A 1B2LA 1WW8A 3JQ9C 3DBLB 5TS3A 4QEDA 3V1UA 4B7UA 1HT0A 3AM4A 4CM8A 3DXFA 1QLJA 1PEDA 1V3UA 1QYVA 3JD4A 3LC7O 4O0LA 3FNGA 4CR7A 4BNHA 4ZU3A 5IN5A 2CMDA 2D0IA 3BMOB 5T8KC 1I32A 1GUFA 4HV4A 2I65A 1YJ8A 4MVJF 1U2DA 2D2IA 3GH3A 3I4FA 1XA0A 5JY6A 4IJWA 4OSOA 5FFFA 3PHHA 5L7YA 1BGVA 4UUMA 3UF0A 2EWMA 5FI3A 2C59A 2VQ3A 4XB1A 3ONEA 4TVOA 2Y05A 2NU7A 3GAZA 1IB6A 1AN9A 1LDGA 1DO8A 2YFQA 1LRLA 3N74A 5IN4A 4H3VA 1Y1PA 4KZPA 3EY4A 3GOHA 3FNEA 3OFSA 2VT3A 2CDAA 3KTDA 2XXJA 3DWFA 3GHYA 3OETA 4YT8A 2O3JA 5IZCA 4AJLA 1X13A 2O3RA 4E2WA 4FS3A 3DDNA 5AXBA 4WOJA 5CHEA 3H9UA 4CMGA 4BS9A 4YT5A 3DZHA 1P1IA 3LSYA 3LLSA 4DA9A 4Z9FA 3WSWA 2Y66A 1S7CA 4J91A 2WYVA 3VKUA 3VPGA 3WOHA 5JE8A 2Q99A 3VAZA 2DT5A 4XD2A 1HE3A 2X7HA 2GUGA 5JMWA 1TVEA 4W82A 2GZ1A 2P4QA 3PQDA 4BNFA 3LC1O 1XCBA 4ZQEA 1UDAA 4O59O 1MB4A 2UAGA 4CQLB 1WDMA 2A92A 3KZVA 1UXJA 4FR5A 4E2YA 3Q9UA 2ZKLA 4D3FA 3E9QA 4JP3A 4YT4A 4I5DA 2HUNA 3AY6A 3D5TA 3QSGA 3VH3A 1ISFA 2IEDA 2X5OA 3R3JA 4W9NA 1MA0A 5ILGA 4WNIA 1DIGA 2I66A 2J3HA 1JN0A 1U9JA 4YB8A 5BQFA 2FZWA 5B12A 1Y7TA 5A3JA 3WWZA 4BNVA 3X2EA 1WNTA 1XQ1A 5L4LA 4CM4B 1CDOA 4L75A 4IGFA 4J4TA 3FTPA 1KETA 4II2A 1EK6A 2GN4A 4FFMA 1EUDA 4HFMA 4UVDA 4XQCA 3DZKA 4L76A 3WX0A 3HDYA 1GYRA 1CF2O 2WDZA 4LISA 1N5DA 2I76A 4B79A 1P1RA 1PJTA 1PGOA 1ZBQA 4YPOA 4GWGA 4UVEA 4BNUA 2Y0EA 2BFAA 2X0NA 4RPGA 4MVJD 4N5NA 1P33A 3ZU5A 2IRWA 2B0JA 3WG9A 4P8RA 1PZGA 4CUKA 1YBAA 1T26A 4IDBA 4CV3A 3OM9A 1PS9A 2VHVA 1YVEI 4DC1A 4CLHA 1DFGA 2D3TA 1R4NA 4EDFA 2P9CA 4TVBA 2AQKA 3L4BC 4WE3A 1NNUA 2G76A 4RPHA 4LCEA 2JD2A 3QRWA 4BMVA 4XR9A 4PLFA 4YEDA 5FF9A 3U4HA 1NFFA 2RIRA 1FDSA 1PZEA 2B4RO 1LLCA 1I8TA 1GTMA 1OC2A 5DBIA 3FPCA 4OOEA 3OBBA 4BNIA 5IXYA 1ZVMA 4S3MA 3ZV3A 3HDJA 3AM3A 3D4NA 4PLCA 4B7CA 1EFKA 5I7FA 2X0IA 4KOAA 5CDUA 3TFOA 4TRMA 3VH4A 2W90A 5A9SB 2AQHA 3F47A 3K31A 2IZ1A 4PZEA 2CVOA 4ND3A 1W0CA 4DIBA 5BNTA 9LDTA 3Q0EA 1DIBA 1PX0A 5GZ3A 3FCOA 4IM7A 3QW2A 5AOVA 1Y5MA 3WGHA 2PKQO 3ZWVA 3GGPA 1ZSNA 4J4BA 4DXHA 3BTOA 4CM9A 3FNHA 2Q1TA 4NR0A 3OIDA 1X7GA 4Q3DA 4YTEA 2PR2A 1MFPA 3DBHA 4W7IA 3AFMA 1ENOA 4BGUA 2X0RA 4TROA 1E1MA 1TT5A 4M87A 1R0SA 1MUUA 5KJCA 5THKA 3LQFA 5EERA 3E5RA 3TQHA 2I9PA 3MWDB 4I9NA 1F8GA 1V35A 2EKLA 1E3LA 1U4SA 3HB4X 3ICPA 1B8VA 1GUZA 2IDZA 3PJFA 3HJAA 3ROMA 1T24A 4AJEA 2BFPA 2C5EA 1EQ2A 1LA2A 1T2CA 4PLYA 1EQUA 4Y8VA 1SCUA 2GRAA 4C7KA 3OHSX 4OSPA 1E7MA 1N92A 1P9LA 1GAEO 3M1AA 5C5IA 1ENYA 3KETA 3D0OA 3VPHA 4Y9DA 4XGKA 3JD2A 5CDSA 6ADHA 1ADCA 3IOYA 5L40A 3BMNB 3N7UA 4JX8A 2PKRA 2VWQA 4A26A 1Z82A 4YA6A 4E33A 5ENDA 2Q50A 4EBFA 3RC2A 3FPLA 4GVLA 2A35A 1YL5A 3CKYA 3WTCA 5G0SA 4DQVA 3EGOA 4XYEA 1LTHR 1LU9A 3WQRA 4Q3AA 1RKXA 1A7KA 1KVTA 1YDWA 5T64A 3U62A 4BUCA 1WLYA 1C3VA 4DL9A 1ZSYA 9LDBA 3TZKA 3ZWAA 4RPLA 4EITA 4RGBA 5TGDA 4J1SA 4IIVA 3WGYA 5G0UA 1XWFA 5DF1A 1YOVB 2HMWA 1QYCA 1ZMOA 2WM3A 4HUJA 2CFCA 4L9RA 2OUIA 2PY6A 4AJ4A 3JQ7B 3O03A 2Y1GA 4PFJA 4CV1A 4K28A 4U8GA 4ND4A 3A06A 3U4CA 3G1UA 1B8UA 1DXYA 2HAEA 3BHIA 4Q3CA 5HBRA 3KYCB 3NDRA 1QV6A 3CZRA 4DBVO 3TN7A 4MVJA 4BMSA 1WAMA 3Q3CA 4PLGA 3NTQA 5B4UA 4MIYA 1E3EA 3WGZA 3OSUA 1HDCA 5A05A 1E1NA 3B6ZA 2Y93A 4P4LA 2Q3EA 2UDPA 2C20A 1GY8A 3H2SA 1PGNA 1HE4A 4IIUA 4ND2A 3ZNQA 2YFHA 4C4OA 4CM5A 5HWSA 3GZNA 4LCJA 3MTGA 2UUPA 8ADHA 4BNNA 4FIZA 4CM8B 1LDMA 5CG1A 1FF9A 2ZB4A 4F6CA 2GN9A 4UEJA 3GC6A 3TRIA 1LX6A 3ABIA 4RZHA 5JDCA 1VE9A 1HL3A 1FDVA 2NU9A 4D3DA 4R01A 5IDWA 3KYDA 3OMLA 4Z3DA 1HYHA 5DP2A 2A4KA 5TC4A 2GASA 4AJPA 2YZ7A 4UUOA 1HLPA 5DULA 3C85A 3SEFA 3RIHA 3PHGA 1JLLA 2V6MA 1ZFNA 1NVGA 3DZBA 2VRCD 3PI7A 4U7WA 5DDIP 3OIFA 2OHXA 1PWZA 5A3VA 3S8MA 4N54A 1R66A 3ON5A 3C7DB 4IQ8A 4BV9A 4KWIA 2B4TO 4RJTA 2AQ8A 1ONNA 1BRMA 5JYDA 1H6AA 3JYOA 3KYBA 2EJWA 1Q7CA 3Q9NA 2W98A 3PQFA 4RPJA 3WQQA 1K6XA 1PWXA 1YJQA 3LT4A 3BMOA 4IZIA 4YQYA 1KVUA 4J90A 1J49A 4CUJA 4D7AA 2EJVA 1NPTO 1LSUA 1EVJA 1I01A 4K6FA 5A03A 3GUCA 5FYDA 1E5LA 1LJ8A 3B70A 1LDNA 1GYPA 5BSFA 2GZ3A 4RZIA 3EUWA 3IP1A 1E1KA 3MZ0A 4LVUA 3Q2IA 3VTZA 3UGKA 2FPGA 3HWRA 5HM8A 3L6DA 4FFRA 1NWCA 4WK6A 3WR5A 4PG6A 5F1KA 2C82A 2W4QA 4Y67A 3DC2A 4NG5A 3O26A 5EMHA 2GDZA 4GX0A 5CG2A 4GX1A 4NFYA 5TRTA 2FPPA 1LNQA 3ZWPA 3UHAA 4IBOA 4ZJUA 1Z75A 1KERA 4XKJA 4HFJA 4N18A 3W4JA 3F1KA 1WZIA 1P3DA 3G3EA 4YJFA 4CLRB 3RJ5A 1GQ2A 2Q45A 4J3FA 2GPTA 3AY3A 2PZLA 2RH4A 3AI2A 4AL4A 4FFNA 1PJSA 2HJSA 3JQ6A 4CR6A 4GAEA 1C14A 1L7DA 5A06A 5B4VA 2X6TA 4RORA 3GZ4A 4NIMA 1VC2A 3JQ8A 1A72A 4KUEA 4J1TA 4XIJA 3JTMA 3WGIA 1R4MA 3INTA 3E48A 3BMCB 4XZ3A 3RUDA 4TSKA 3PDJA 4R3WA 1U3UA 2HDHA 1PR9A 5DT9A 5U9CA 2EKQA 3JD1A 3V2UA 2RAFA 1U5AA 4I9HA 3WGGA 4E13A 4DREA 2PWZA 3IJPA 1WWKA 4MO2A 4NNJA 4WECA 3PWZA 5TIIA 2Y0CA 3RROA 2GD1O 1IPFA 5JNLA 1ZK4A 3PHIA 4MVJM 1BXGA 3PHJA 1LSJA 4MJLA 3H5NA 1BXKA 5HTOA 2D1YA 2HRBA 2OP0A 2CF6A 4OXYA 1A4UA 3L9WA 4E6PA 1DDOA 1R4NB 2CY0A 4OIMA 5JCJA 4NDNE 1V3TA 4CMEA 4CJXA 4DVJA 4K9DA 4XGNA 3DMTC 3F46A 3ETEA 1IZ9A 3FRJA 3PHLA 5ITWA 2EERA 2J5QA 1Y9AA 1PJCA 1DRUA 1NHGA 5G0WA 5I9MA 2CVZA 2W2KA 3MJTA 3WICA 3GNSA 3TOZA 3PDUA 5JXWA 2DBRA 1DEHA 2BRUA 4IXTA 5IZ4A 3K5PA 1ZK0A 4HKTA 2I3GA 2X9NA 4FJ0A 3TZCA 4NH4A 1NASA 4BKRA 1T2FA 5KTKA 2FSSA 3W6ZA 2X4GA 4JP2A 4IDDA 1LXCA 4RF3A 3P2OA 3VOSA 2E82A 3L0DA 1G1AA 4BB6A 2IZ0A 1IUKA 2FPIA 2H5LA 2ZB3A 3IIEA 3OEYA 4IQ0A 4ND5A 4XJTA 4R41A 4DRYA 3AU8A 5IJZA 4NJMA 1IZ0A 1RM4A 3IUSA 2FSVA 2BGLA 1HDRA 2ZQZA 3M1LA 4CV0A 5JAMA 1P1JA 3DBHB 2IEBA 2VUTA 4E31A 3AFNA 2WE7A 4LSWA 1ZCJA 2OMEA 4HY3A 4PVCA 4WLEA 1M2WA 4M1QA 4WKGA 4DPKA 1TT5B 3H5RA 3JV7A 4M8SA 5FI5A 1YBMA 4B3JA 2JD0A 1B14A 3LVFO 2JL1A 4GLOA 3UFXA 3WQSB 3BZUA 1NPYA 3WB9A 1T4DA 3C1AA 5KJ6A 2Q1WA 3RVDA 3C7CB 2QX7A 1K6IA 3JQFA 1M75A 3PPIA 3WBFA 5F3RA 1RJWA 1KC3A 2OP1A 1FDTA 1Y8QA 3VC7A 2FR0A 4GQAA 5A9SA 4L73A 4KUGA 1T2DA 4LW8A 5IDXA 2DBVO 4GI2A 4AICA 2C2YA 1EVIA 1PZFA 3DZFA 1UXGA 2C0CA 1I2ZA 1U7HA 5G0TA 1X7DA 5EPOA 3EZYA 3JYNA 1E3JA 4FSHA 5AQ1A 3K6JA 1M66A 1A9YA 1XSEA 4RLSA 3GEDA 3RUAA 4YDRA 5THQA 1AXEA 4YJGA 1EBUA 1QKIA 3GVIA 1HSZA 2Q1UA 1TB4A 4DPLA 4YAIA 1NFRA 2BLLA 1YH3A 1SOWA 2J3KA 4ZRNA 4RVSA 2Y99A 3GDOA 4IDGA 1X7HA 2YY7A 4U6QA 3JQBC 3CMCO 1F14A 2EXXA 4N7RA 4RVGA 5I7EA 4EJMA 2X0JA 3WJAA 3SX2A 4YT2A 4LN1A 2TMGA 5IXSA 1DC4A 1H9BA 3WYBA 3AOEC 2JJYA 3ANLA 4BNLA 1LDEA 2PZJA 1BXZA 3F4BA 4NFSA 5JDIC 3CE6A 2IXAA 3PIDA 1HE2A 4FPXA 3KHUA 3JD3A 1LSSA 3QWIA 3ANNA 3JYPA 2OXIA 3WNQA 1UXKA 5JPIA 1NM5A 4GX5A 1ZKMA 1FJHA 3NT5A 3L77A 1YB5A 4MP8A 4Q9NA 3VPXA 3AI3A 2CD9A 3MJCA 1NR1A 4R1SA 1J4AA 1PJQA 4JGBA 3ZWWA 4AJHA 1NQTA 2O7QA 3UKOA 3GG2A 2R00A 4RF4A 4R5MA 5MGBA 1H9AA 3GZNB 1PL6A 1V0JA 1NVMB 2JFGA 3F5QA 3NGLA 1DC3A 5KCZA 4NBVA 2HCTA 4BNWA 1MXFA 4TRJA 4PLPA 5CDTA 4PZDA 1I3LA 3FNFA 4G81A 1MC5A 3WGOA 1UZMA 3GN2A 3UUWA 4XX0A 2YJZA 1D4FA 3LC2O 4NHEA 1ISHA 2EIHA 4M54A 4WLOA 5J23A 3LF2A 4YRBA 3KYDB 1TLTA 2XAAA 3S2IA 1SEVA 3ONFA 3ZDFA 1HZZA 3CMMA 1X1EA 4FQ8A 2O3UA 1PJLA 3JQ9A 3TL2A 4D44A 4DYVA 4ITUA 4IGEA 4PLWA 1M6HA 1NHWA 3RKUA 1O6ZA 2XPCA 1LBEA 1YL6A 2NSDA 4LK3A 5I7SA 3NUGA 1UAGA 3JQAD 4NU5A 3DZIA 4LRSB 4CPDA 1YL7A 3AU9A 2JAHA 3QY9A 4QECA 5TT1A 3ST7A 5T8KA 1W73A 3H9QA 1ID1A 4IJUA 2UVDA 1DPGA 2VNSA 1E5QA 4Y6SA 1DOHA 2V6BA 3AUAA 1E77A 3K92A 4KDEA 2VZ8A 3KXDA 1QXSA 2FMUA 1B7GO 2IYOA 1I10A 4O1MA 2W8ZA 3WS7A 1LDYA 1XR3A 2BHLA 1VPDA 4IPTA 4QO8A 3W4KA 1C0LA 2HMSA 2QIOA 3IL2A 3DR3A 3LK7A 3K73O 1P77A 2XOXA 4ZICA 2BKAA 1HETA 3W6UA 4M49A 4NBRA 3PLRA 2JD1A 3BXXA 3RWBA 3PEFA 5A5FA 4R4JA 3RJ9A 3FWZA 5JC1A 3GVHA 2QG4A 4MVJH 4CMIB 4CMBA 4B4VA 3RUEA 1A7AA 2E48A 2DUWA 3DL2A 3L6EA 1LC0A 3DTTA 4AVYA 4E0BA 1DIRA 5B1YA 4YJFB 2W2LA 4TMFA 3UOGA 3GMSA 4B8WA 3GRPA 2EEZA 4E5KA 4HADA 3O9ZA 2DPHA 4ZD6A 4Y6RA 3CUKA 2NLOA 1ZMTA 1EBFA 2JCXA 3JQ8B 3HG7A 3PVZA 4RQUA 1HLDA 3JCZA 1KVSA 4CM1A 2DBZA 1R4MB 3NGXA 4E5NA 3EC7A 4WGGA 1LSOA 3LT0A 3AUUA 2X86A 5TJHA 5I9LA 1E6EA 3EZLA 3RFXA 2ZQYA 3M6IA 3AY7A 4LVCA 3ZNOA 1VKNA 3QLJA 4PG5A 5CEEA 1Z73A 1X15A 2Q2VA 1N2SA 1UAYA 3WFIA 1B15A 1BXGB 1VJ0A 2DBQA 3PIIA 1UZLA 3PRJA 3RU7A 4UUNA 2B37A 4AJIA 3PWKA 2Y1FA 1PGQA 2IE0A 4CLRA 3LF1A 3SC6A 5IAAA 1V8BA 3MCVA 5TNXA 1WPQA 2H9IA 3H3FA 2BMAA 3D3EA 4AJ2A 4MIEA 4DLBA 1YE3A 3D5QA 1KY4A 3PWSA 5L53A 3U49A 1QP8A 4FN4A 1GEEA 2W2KB 3NV9A 1GZ3A 3RBZA 4E5YA 3NYWA 3MEQA 4AFNA 2ET6A 1N8KA 4G65A 3BMCA 3ZHYA 4NBTA 1RPNA 4BO9A 2R6JA 4CQMD 3WFJA 3BYZA 4XQ9A 5EL0A 1LLDA 4DQXA 3DO5A 1N1GA 3HN7A 3L4BA 2GN8A 1L7EA 1CWUA 1E3SA 4IMRA 3D4PA 3Q1LA 4KTVE 2AXQA 1LI4A 4ROSA 3OJEA 4TWRA 3JQAA 4J0EA 4XYLA 5KIAA 2J6IA 5MDHA 4CV2A 4NJMB 1Z74A 2FWMX 5LCXA 4BO3A 1PJBA 1YKFA 3ASUA 1ZNQO 2DTEA 5ES3A 4AJKA 3CZMA 3DBVO 5DCWA 4EGFA 2I6TA 3D3WB 1OC4A 4FOSA 3ROPA 5TT0A 3DAGA 4YR9A 1FDWA 1ISGA 4J1QA 1UP4A 5IFLA 3V8BA 4CLDA 1KYQA 3RD5A 1VJTA 5JW6A 5JAZA 1ZJZA 4XQEA 1U28A 3L07A 5K6AC 3QQPA 1E3IA 1BHSA 4RPKA 2C2XA 2DLDA 2Z5LA 3CTMA 2PNFA 3OJLA 4RDHA 2A9FA 5JO0A 1Y8QB 2I5PO 5L4NA 5JBIA 4DGSA 4JBIA 5DZSA 1R0LA 1UP7A 4D3SA 3OJ0A 1FMCA 1WVGA 5C7LO 1ORRA 1ULUA 3S2GA 4BO0A 2Z95A 4EEZA 1OMOA 2FZEA 2BF7A 4JLWA 5L4SA 3SVTA 1HKUA 3DAPA 5KNLA 2NTVA 3R3SA 5ICMA 1VRWA 3H8VA 3D1LA 4TQGA 3TFQA 1GYQA 1DIHA 1J6UA 4E5PA 2QYTA 1I0ZA 2DKNA 4YJGB 4CMCA 1P1HA 4QQRA 4BHTA 4D79A 2ZCUA 1I24A 3AWDA 3F6YA 1K0UA 3ADOA 5G4KA 4A0SA 3VTFA 1F17A 3OF2A 3TSCA 4BNXA 4CMHA 1SMKA 1A27A 4CLEA 3RUCA 3PFFA 5G4LA 1GQQA 1HF3A 3BMQA 3WWYA 3H65A 1R6DA 3VZSA 4QXMA 5JMPA 4MINA 3TZQA 3ZV4A 4H16A 3KV3O 1P74A 3V2GA 1R37A 1BTOA 5F1PA 2QW8A 2X22A 4IJKA 3ZU2A 1SEPA 4R1NA 3RKRA 2PD6A 3FR7A 1DJNA 2I3AA 4PGFA 1T4BA 1VL8A 1ZUD1 2NQTA 4MVJI 1D1TA 1QV7A 3IQDB 4MDHA 4OMUA 5GZ6A 1TA4A 5LDGA 4DQUA 3KLMX 1N7GA 4XDYA 1ZXLA 1HYGA 3JYQA 1GQYA 1PQUA 4AJOA 3UXYA 2G5CA 1EVYA 4DBZA 4OHUA 3Q6IA 3ULKA 1DC5A 1DAPA 2AMFA 1D3AA 1DAOA 1I2CA 3PYXA 4GBJA 4WJZA 5TF4A 4CLOA 3FBGA 4DPMA 2PV7A 1QYWA 2VN8A 2JHGA 1ZH8A 4S1VA 1CETA 2X9GA 4A27A 4E12A 3FN4A 1ZEMA 1HDZA 1P31A 1C0IA 3R0IA 3INRA 1Q0QA 4WCFC 1PTJA 3GF4A 3KB6A 5DNAA 3ZI0A 1BSVA 5JSFA 4R9RA 3JQGA 2ZYDA 1ZK3A 3KVOA 3QVTA 1Q0LA 1YQDA 3PJGA 3UCFA 3UH1A 5JFOA 1B26A 1YBVA 5EINA 1IPEA 2AEJA 3WDSA 4NQZA 4CQMA 1ZW1A 2OFPA 5ILOA 2CF5A 4F3YA 3GFGA 5KVQA 3KOUA 2O48X 5I9NA 3FD8A 4Z9YA 4EJ6A 3ZWCA 2UYYA 2H1SA 4F46A 4JJIA 3PFWO 2I99A 4HP8A 3I83A 4E32A 1F8FA 4PLTA 1LRJA 1O5IA 1SO8A 2WEKA 5BSHA 1DB3A 1MV8A 4YAKA 1WDKA 3ENNA 3EYWA 4UUPA 4J16A 2DTXA 1Z45A 2YV1A 3GMDA 1XYGA 4ZQHA 4WLFA 5JO9A 2EP7A 1E7WA 2O23A 4D41A 2PGJA 3NDJA 1R0KA 4B7XA 2NV6A 5L51A 5T67A 3ZCXA 1HSOA 3H5AA 1A5ZA 4RL6A 5KVVA 1UP6A 3OJOA 4NMHA 4D42A 5CEJA 5KKCA 4K1LA 2WE8A 4IS2A 1JU9A 1YB4A 3ZH2A 1BMDA 2V65A 3MWEB 4RVHA 2EGGA 4Q39A 4R51A 4Q3EA 5JY1A 3TZHA 3C1TA 3KSDO 4QSMA 1PS8A 2AG8A 3PLNA 1JKIA 4ZQBA 2PH5A 3IAHA 1G6KA 4WEQA 5B37A 4BNZA 1BVUA 2A94A 1XLTA 2BI8A 4YWJA 4UULA 3T4XA 2GSDA 3TL3A 3KLPX 4IDEA 1NQOA 1EK5A 3QP9A 3S55A 4XCVA 5C3MA 3V5NA 1WZEA 2GLXA 4J2OA 3QHAA 3GNTA 3ZWMA 1B3RA 3FR8A 4JK3A 3U4IA 4GKVA 2HK8A 1J5PA 4KDFA 3W8FA 1N9GA 2NVWA 3KEOA 3FF4A 2NWQA 3WMWA 3GNQA 5IF3A 4CUZA 1XIVA 3I9KA 5JDCC 1PGJA 4GGPA 2B5VA 4AJNA 3UCEA 4YAJA 4AJ1A 4K6CA 2YW9A 2B36A 2ZTMA 2PGLA 2VHXA 3X2FA 2B83A 3SC4A 4GVXA 1U5CA 4ZGWA 3ZWXA 3VDQA 1MGOA 1YWGO 4I9UA 4GGOA 3E82A 3IP3A 4HNGA 2PA3A 2C07A 4J4HA 3K30A 1SZJG 4EEXA 4XQGA 4CMIA 2Y1DA 2D4AA 1HYEA 3GK3A 2DQ4A 2X58A 1BG6A 2PLAA 3HHPA 3PP8A 3JSAA 1GU7A 1YQGA 3EK2A 3W4IA 5BSEA 3COSA 1PGPA 5ICSA 3VHRA 3ZHBA 4UVGA 3OQBA 5GZ1A 2BGMA 3G49A 2DUUA 4OM8A 3SLGA 4DIOA 3CINA 3GR6A 4JN6B 4ZQFA 3STHA 3UAGA 4OL9A 4MOWA 2Z1NA 2EW2A 1DSSG 3ZZNA 1ZK2A 3C1OA 5KOIA 4ALKA 1TI7A 1UZNA 3TJRA 4NZ9A 4ALMA 1D8AA 1DLIA 2D59A 2EG9A 3RAJA 5F5LA 4BB5A 3WLFA 3B1JA 5A4DA 4XRRA 4X54A 4W7HA 4R69A 2GGSA 3G1TA 3DOCA 1QLHA 3JD0A 1HZJA 2VYND 2E6UX 2OGUA 5AVOA 1T25A 4MVJE 3IC5A 3DMTA 5CFZA 1N7HA 2RBEA 1GV1A 2I67A 4UVHA 5A02A 4L4XA 3JQAB 4KTTE 4BO8A 1NPDA 3VVBA 3GGGA 3QVXA 1PS0A 2X5JO 3I4CA 2BELA 4BNMA 3INGA 1PZHA 4AG3A 1MXHA 3HN2A 5A04A 3GT0A 4BNGA 2HK9A 5JS6A 2AW5A 5IDQA 4D45A 3PXXA 4IZHA 4K26A 4FBGA 5BR7A 3ZWOA 3IS3A 4J49A 4WLNA 1JKFA 3H9JA 2DPGA 2NACA 1RWBA 2VTEA 3WNVA 4A10A 2AHRA 3R6DA 4J6FA 4JXKA 2OO5A 4URFA 1I3NA 1OOEA 2C29D 3I6IA 1O0SA 2WYUA 3I52A 4ND1A 5TJ9A 1PL7A 2VZ9A 3HZZA 1PJ2A 3DONA 3SBOA 2C7GA 4OQYA 1UH5A 3AM5A 1XEAA 2O7SA 2WD8A 1Z7EA 4RCVA 2WYWA 2JHFA 1BDMA 4CM7A 2O3TA 4KUHA 3QWFA 1LDBA 3RQSA 3GN1A 4FGSA 4YXFA 4MIOA 2AEMA 3HUDA 2VRCA 3HB5X 3T7CA 1ARZA 2VOEA 1L1FA 1CIVA 4ZN6A 3JQCA 1PL8A 4XDZA 3D3WA 3UN1A 3V1YA 4HFRA 3RBVA 2UUOA 5CEFA 2EGHA 4BKUA 3CEAA 4IXWA 3KUXA 3D7LA 3DAFA 5G4KB 1AE1A 1CEQA 2HO5A 3KBOA 4NK4A 1LLQA 4TZTA 4DLAA 4BNKA 5CPFA 3VZPA 2P91A 3BMQB 5HS4A 4HXYA 1EE9A 3A28A 3GA0A 3M2TA 1ONPA 4KWHA 1P1FA 5F5NA 4PG8A 3P2YA 1HTBA 3DOJA 2VYVD 4Y6PA 1TXGA 4IY1A 4FGWA 1SC6A 4WLUA 4BO2A 1JQBA 1NR7A 5BNFA 4OOFA 4TRRA 5G2OA 5C7OO 5ENVA 2X1HA 3PYMA 4B8ZA 1H5QA 4JQCA 1CJCA 4B4WA 1I33A 3JQBA 3C8MA 3BHMA 2DTDA 4GKBA 3VDRA 1QSGA 4XGIA 5DOZA 3KSUA 3WIEA 4EYEA 3QVOA 3ETDA 4I5GA 1LUAA 1GL3A 1O89A 3AOEA 1Q7GA 1K2WA 1IOLA 4PG4A 3FTNA 3DHYA 5JDIA 4WOKA 2VUSA 1E92A 3FHLA 4NU6A 3RC9A 4CLOB 1GCUA 4IS3A 1E6WA 3WTBA 2PH3A 1OFGA 2Y1CA 5LC1A 1T2EA 4YJDA 1F0YA 2IODA 3OP4A 2D5CA 3PTZA 3ADPA 4GPD1 2NQ8A 1QYXA 3JQGB 1RM3A 4DTIA 3MJSA 3PZRA 1A71A 2B4QA 2CZCA 3RCBA 1BWSA 3JQEA 2Y1EA 4CQMB 1GD1O 4EZBA 3B20A 4JROA 1H6DA 1NP3A 2LDBA 1CQJA 1P0CA 1WMBA 1WXDA 2VYNA 2ZYAA 4CM6A 3NRCA 1E7SA 5A9RA 2P5UA 2JFFA 3I9JA 1Z6ZA 3H2ZA 3EVNA 3I5MA 4HWKA 3BIOA 5TX7A 2O3QA 3BA1A 1CYDA 4Z3KA 5ITVA 3ZHXA 5KVCA 1UUFA 3LT2A 3P5SA 1YXMA 4FD3A 5JYEA 1HDOA 2J3IA 5L3ZA 1X1TA 4EJ0A 3I6QA 2F00A 2HLPA 5COBA 5L95A 3BTUA 2HMTA 1XG5A 3GVCA 4I08A 4XYGA 3NTRA 4QTZA 1AGNA 4A2CA 4MKRA 4H7PA 4RVDA 4MP3A 2Y1OA 3G0OA 4TKLA 2NU8A 1C0PA 2X5KO 3GPDG
chains in the Genus database with same CATH superfamily
2P2SA 4D2IA 5FHRA 2OBNA 2W2TA 1XRRA 4RDIA 5C34B 4L0CA 3U3KA 1P1KA 2UUCB 3EG9A 4TWAA 2QVZX 1HOXA 1NF2A 2X2FA 2QZ4A 2I4NA 4MP6A 1YVRA 5H7XA 1AQ6A 1GPYA 4D3ZA 1EGAA 2ECOA 2J0VA 3SLKA 2IOQA 1KJIA 2H2FA 4M38A 2ZJ5A 4KGVA 4JJKA 2VG8A 2M98A 2Q1SA 3A1NA 4U2FA 3E5NA 5B1SA 3LDHA 5TSDA 3HXQA 1NV8A 1WR8A 5B53A 4E2ZA 2R6FA 5GOZA 4PZ0A 3I9LA 1OLUA 1NW8A 3NUQA 3BILA 3PFIA 4JNCA 3K96A 4DABA 2XR1A 2BEWB 4MV5A 1EE2A 4G5RA 4YWHA 4ZOBA 1R16A 2NQ2C 5LBTA 3W5HA 3CT6A 1Z5PA 5B57C 4RD2A 1NRXA 3DHNA 4FT4A 2Z08A 3IVGA 4D0RA 2FX5A 2YYZA 1H1LB 4DSOA 1N4DA 2PVPA 3PGXA 2Z2JA 4ZCQA 5KHAA 1XDGA 4AYTA 1Z68A 2OK7A 4NH0A 4OHFA 5HA5A 3X1WA 5CA0F 3THYA 1H4VB 1LZLA 1JQAA 3QBJA 1M2HA 2X8JB 3ITKA 4I4CA 1I6LA 1XX6A 4XUDA 3HCPA 1PZXA 3VSBA 4F1JA 1V48A 1DEKA 1SIBE 2VWHA 5IARA 5K0SA 3QHPA 2QY9A 2PZMA 3GDFA 4MKIA 4F5YA 1NQUA 2Z2KA 5P8WA 3I2GA 3AUSA 1T2AA 3UWSA 5LQKA 3EJWA 2IK8A 1BH6A 4KFUA 2BC9A 2NPFA 2YIDA 4F1WA 3ADBA 2YHIA 1IYZA 1JDJA 3HLYA 3NM4A 4LKOA 4A3SA 2C42A 4BL5A 3RI3A 3QE4A 1WBDA 5FAKA 4HOYA 1JIXA 1NJ6A 3NT2A 1J8MF 1IZYA 4DHEA 1UJMA 3E70C 2V6FA 4XJSA 2J85A 1D1PA 4NENA 4ZO7A 1WZUA 4Z7NB 3N2EA 3JWEA 1WQ1R 2PPVA 3K6KA 4G0PA 3KJNA 3WFZA 2CXRA 1KEPA 3AC0A 4N6OA 4J0HA 4OLFA 1D2HA 5LNK6 2Q3DA 3AP2A 3K2QA 3ZW9A 1VJ1A 3QEJA 1LQ2A 1SCNE 4UU8A 1JR6A 3H4VA 4TMTA 3O2JA 3R8XA 1XZLA 1QOZA 5AOAA 4EEKA 3LXXA 3AVYA 3RIYA 3QKRB 4B1FA 4DA7A 2D6FA 4CHTA 1RP7A 1SPXA 4IHQA 2PFGA 3SG0A 3UVEA 3HKDB 4BZZA 2P3LA 5KKAA 1NN3A 4R16A 3ELBA 2C8JA 1OAAA 1X70A 3UMBA 4A5SA 2R84A 2YQ4A 4J29A 4XXHA 1LWOA 3HCRA 3SHWA 4YJHA 2O50A 4KIGA 3CKKA 2G83A 4OVKA 1VPLA 4BQRA 4E5DA 4MVJG 1GPH1 1ZXXA 3BMXA 5HSGA 1T4MA 4OP3A 1QRRA 1QYDA 4W1QA 5D6NA 1K3FA 4BGVA 4TXLA 1ZXBA 3Q3IA 2GFHA 4FDAA 3UJBA 3UW3A 3QV2A 3WL6A 4HQNA 1YVDA 1LBTA 2H08A 3ETNA 5A6SB 3SU8A 3TEFA 3DCNA 2G07A 3SF0A 4EO4A 1PNRA 4D0SA 1CTQA 2YXLA 4B3BA 4EUHA 1SC3A 2GZ2A 1G64A 4LSMA 3EGWA 1TMYA 2V9CA 4LGVA 4QPJC 3R7WA 1J1IA 4ZI3A 2VPWA 3Q7IA 3VVCA 1GU0A 3BGSA 3MYRA 1TC2A 4GXQA 4IRXA 3V7NA 3WK8A 3K5HA 3WVNA 1TW3A 5COQA 4MV8A 1SK8A 4QJ3A 3WNZA 4EHNA 5HK9A 1AUOA 4Y9UA 4L3VA 2MSDB 1OFIA 4L8GA 1MZVA 4YO7A 1QF6A 2D2FA 3D4LA 3G8CA 4IJVA 1XHEA 5LBUA 3WI7A 1BW9A 4LXHA 3NKLA 2Z43A 3RF7A 2FUCA 4N3BA 4D4JA 5EWLB 3IIIA 1BS1A 4YRNA 3OZ7A 2P9FA 2QLNA 4J75A 1YB1A 3A1CA 4LJ5A 2WWRA 1DCFA 1HUQA 3KKOA 2JFWA 5ESRA 1N1EA 3PGKA 3K0KA 2PD3A 2PZAA 2RHMA 4XJXA 5AVZA 1XPOA 5HFJA 1QYRA 2G70A 3I1IA 1DRVA 3KT8A 4L08A 3GPBA 1S4QA 1N6RA 3DT8A 3WDLA 3HI6A 2VTDA 2ZIAA 2XITA 5ICGA 1OZAA 1Q7TA 1M1ZA 4HBGA 1TZKA 3I12A 1C9EA 2WHYA 1V8PA 3GRCA 4NV0A 3TBFA 4HRVA 1U8TA 3DQPA 1ZS9A 2VHYA 1J24A 3NVDA 3PZBA 4QOEA 2VOJA 5EHGA 3WLEA 4E2FA 2WOJA 2DM6A 1GDHA 2P9HA 4GRDA 4PXSA 4DV2B 3TVTA 2MSEB 2XZDA 2K2QB 1AT1A 1DUIA 2PS3A 3FDFA 3FMIA 1H6CA 4LVOA 2Q5LA 2RAVA 3KZXA 1IG3A 2PWPA 4FFDA 3VXKA 4BRSA 4DLLA 4YP0A 1RHQA 2C3YA 2ZULA 1JTVA 4UMEA 3T61A 5HCIA 5AUOB 3ISTA 3DB2A 3S44A 1EDOA 4GZ3A 3TIFA 1VI6A 3U7GA 1C3OA 3PV0A 4G25A 4X1IA 3ZI7A 3CEPB 4QDJA 4L78A 1BMQA 1KPGA 1Q22A 5DO9A 3FB4A 3E22A 1N75A 2AZDA 2CNNA 3AR4A 3OEEA 2JCVA 1V7QA 1K5GA 1Y1LA 2R8BA 1ZJYA 3STXA 2A59A 1SU6A 4WFKA 2HYDA 1W88B 1ZK1A 1QDEA 4XYBA 2BFDB 2IPOA 3D3KA 3EXHA 1XTKA 1E3WB 4BVJA 5FFMA 1FZTA 1Q0PA 4FCCA 5SYAA 4FONA 2C4KA 2PSDA 1NVXQ 4MW2A 1T1EA 5JHGB 4K0RA 1GWNA 2CDCA 2F17A 3OOWA 2PGAA 2ZIZA 5KC9A 1ZISA 2V7UA 3EXG1 4O1IA 3GUYA 3H7AA 3MLAA 2YQZA 3WK4A 1L7MA 1E62A 1ZH6A 2C3OA 4FFBA 1OGIA 3ZU6A 5BVGB 1DHRA 3L7OA 3GX1A 4Z49A 3BWEA 2PX0A 3ZG6A 3T94A 2JRCA 4Q9HA 4I55B 2QXYA 2W00A 1EFVB 1ENZA 1FYXA 4G9GA 3TOXA 3VJMA 4DY6A 1D04A 1G41A 1N6HA 2DCMA 4LDAA 4M0DA 4J7XA 1C8KA 1BCRB 1KJ8A 2J59A 1CY2A 1NQ5A 1G2OA 4PSUA 5JJBA 2PRIA 1FIUA 5L9AA 1I3KA 3OF5A 1QHHA 1PAUA 3CLTD 1D2EA 2E18A 5D01A 4ZA2A 4DNQA 3T3NA 1RWNA 3U9LA 2YIMA 1DDGA 2WHPB 4B3MB 2G63A 3G88A 3V48A 2JGKA 3KPVA 5B58T 4BO7A 4E3ZA 5K1ZA 5A3QA 5KOHB 2B69A 4KBYA 1R9MA 1XJWA 5DRTA 4ZI2A 5CD9A 3F6CA 3E4DA 3EIQA 2C7VA 3W6OA 2J0EA 3CEHA 4B83A 4C3UA 2QT1A 3O8DA 1DRJA 1QHIA 4UHJA 2HJWA 4GBED 3F3SA 2GF2A 1U8CB 1UFOA 2C9ZA 2OBMA 1H0KA 4AULA 1SUBA 2IHYA 3C3CA 4C5AA 5C7IO 3ICEA 4RY8A 1EUCA 5BQPA 4BVEA 3C8ZA 3FAKA 1NUAA 2CN1A 4RH0A 5KJ1A 4FGKA 4CL8A 2JFZA 1E7YA 4TXMA 5F64A 1WCYA 3G9TA 3USES 3W2HA 5JD6A 2Y1KA 3F2IA 1XRJA 5E4YA 1MTZA 1XVVA 2R8OA 3P7MA 2R1UA 2ZQ5A 3W04A 4DG5A 5K2OA 1ES9A 4QEZA 3RSQA 10MHA 3CZ4A 1U0RA 1YSCA 2BUBA 2ODTX 2IIBA 3T4PA 3ZQUA 5JIBA 3VZQA 5CB4A 2Q7OE 2B1JA 2DP4E 3JRNA 3LUKA 1ZBDA 1G8PA 3V3KA 3E9NA 4CIAA 4CN9A 4D9CA 3ZY6A 5JCXA 3KG2A 2DU8A 3SQLA 1BDBA 1POWA 1U9ZA 4MQEB 3VSDA 2I2AA 2HRCA 1GAWA 1TUEA 1UC4B 4HDMB 1Y8RB 1DC6A 1JHVA 1FLNA 1U4NA 1T1IA 4MWEA 3DB1A 4WPGA 2YZGA 5CPBA 1GKUB 1WB5A 1U4OA 2RIPA 5FD8A 2OBBA 3ZI4A 1R8QA 1LPMA 1C1DA 2QDXA 4RIFA 1ILEA 4QPPA 5DGIA 3T9CA 1Q57A 4IWNA 3OZIA 5B30A 3QFTA 4ZAXA 2CUNA 2QJFA 2BPOA 2N3ZA 2PS1A 5KYUB 5BSVA 1GZSA 4BPBA 1SU4A 3ABQB 4JC0A 4MS1B 2JBAA 1CUEA 1YJBA 1RJDA 4M7PA 4XFJA 3TSYA 5ALWA 1NTRA 3F0TA 1HEUA 3GFPA 4FGLA 2X0DA 4DZZA 2DSNA 3D8TA 1PR5A 1P18A 5CVVA 4JVLA 2OHJA 3RSOA 3UAVA 4AIRA 3BSFA 3DOHA 3F6RA 2QKYA 2XMSA 2P69A 4IIDA 4HUTA 4CVNA 4K40A 3OH8A 1T34A 2XNSA 1FVXA 4IWXA 1G3QA 3O4RA 3OOSA 1SKQA 1LBIA 4OFWA 2KLHA 5ICCA 2Q8QA 2ORED 4LYGA 2C2HA 3R2JA 1X80A 1Y42X 4HDNB 4MMXB 3TF5A 5CLIA 1O5OA 3MS4A 4ZT6A 3ZW7A 5DLDA 3CLKA 3LHFA 3R9XA 3TQFA 5BWOA 3EXEB 1P7ZA 1MLDA 3TRDA 2DH5A 4DIKA 4H6WA 1CUWA 3NHRA 1JB1A 2XMQA 3EH2A 4AXXA 5T3YA 4FVTA 2GTHA 2KI5A 1CQIA 2G1AA 2X1LA 1T5DX 4I46A 2IYPA 2PL3A 3L1VA 2GD6A 3Q2OA 3ZE1B 3ZHUA 1CJTC 4PZCA 5TLSA 1GR0A 2QM3A 1VI2A 2X0KA 3PWTA 4YJ3B 4AP6A 4YYZA 2VH2A 2WJIA 5LUBA 3D7KA 1NAIA 1Y4SA 3UMCA 3KQMA 4KQFA 2R62A 5JSYA 4KR9A 2BSAA 3NVMB 4LRWA 2BEWA 2A1UB 2B4AA 4N5IX 2QENA 4TTPA 3U48A 4WEOA 3F96A 2N9UA 5GY7A 3RTAA 3K1JA 5H4GA 1KOFA 4YASA 3K2BA 1H22A 1JMYA 3NHBA 1C0EA 2HWYA 4RDXA 1QRSA 3FVWA 5IP5A 5ICEA 5CK4A 521PA 4AD8A 2WYIA 3GMTA 3MUNA 3COPA 4OHBA 5JWOA 1P2UA 3MT8A 4RZ3A 3R76A 1ETHA 1MB0A 1F7VA 2HA3A 5EJ9A 1FL9A 1QGUB 3K9QO 1T0BA 3OURA 3IO3A 4M36A 3MTBA 4KR7A 1WBJB 2CYAA 1RIFA 1NVTA 1NN5A 1O8CA 1UT6A 3BERA 3CC8A 3IA2A 3OECA 3NETA 2Z83A 1MG0A 1VYUA 3DBLA 1H2AS 3MTAA 3VJKA 3O94A 4JCOA 4HGOA 3ORFA 3RREA 1XZJA 3DTYA 1XN4A 5LUAA 3OX4A 3S5UA 3IODA 2FX2A 3BCRA 4JP1A 4YAEA 1BD4A 2Z9CA 1DBVO 3RU3A 4I36A 5KOJB 4HGYA 2E4AA 4DJAA 4UPEA 1QQBA 1ZIDA 2XTMA 1W8DA 3IJ5A 4U0JA 1TJPB 1T1JA 2GUWA 3F74A 4CRWB 1SOAA 4MUYA 5I8ZA 5KYTA 1JEEA 4WBSA 2R2GA 1KFEB 3KEMA 5BXYA 3H9GA 1GV0A 3CHYA 2VAPA 4NS4A 4R83A 3SEAA 4QM7A 2WQ7A 4KJXA 1IIRA 4U0KA 1E2DA 3LVBA 4XOUA 3X0DA 2HRZA 3MRTA 3EYAA 3IUBA 3TLJA 3QKRA 5HRUA 4TSFD 4HEA1 4I1IA 5AM4A 1NJ5A 5K8VA 1Q91A 3BL8A 2P40A 1V39A 3CU5A 1QG6A 1CRWG 1I9GA 5DYWA 4A03A 1IN8A 2HMVA 4ZAVA 3W5UA 3Q8MA 2OWEA 1VP3A 5A4IS 4OU4A 1MJGA 3LM8A 5IJXA 3T1OA 3WRWA 4A1FA 4UU7A 1A5AB 2RGNA 5EAIA 2EJBA 1BMFD 1KI4A 4XTRA 5H4HA 3SHVA 2BBWA 2CVQA 2ZB7A 2R86A 3PT9A 4XSVA 1O6FA 3CVJA 2CLHB 1ISJA 4XWYA 4YX9A 4QBIA 1K8XB 4ZFNA 3UAZA 3AFIA 2BSXA 4NS1A 3W8DA 1QE0A 3O91A 2H2AA 2BJWA 2IHVA 5KMGB 2JLXA 2IPMA 4TS3A 3DF7A 4P22A 3QPDA 2C7BA 3L8DA 3OAAA 4I1UA 1F20A 1Z7BA 2I4MA 2VZEA 4X00A 3IKVA 4EF5A 5CFRA 1V4VA 4D96A 1E2EA 4HNHA 3NAQA 4F04A 1ORTA 3HL4A 3HCBA 3Q3GE 1FFCA 4XM0A 2JGIA 1D6JA 3PFCA 3O0DA 2HCBA 4D81A 2XNJA 3ONVA 4AK9A 1M72A 4AKIA 1DX4A 4N5MA 3Q0IA 2H00A 3I23A 3OCWA 1NQWA 3P4UA 3G0BA 3NBQA 5JUWA 4S05A 1RKUA 2QJWA 4XPIB 2B21A 1UCFA 4K9OA 1Y1QA 2O8CA 3CPEA 1TA0A 3HV2A 3L02A 1E5XA 1BHQ1 1ZZEA 2IYFA 5C1IA 5D1HA 5EGNA 3ZD8A 4EW6A 1ADBA 3VR4A 3P0RA 5KNCA 3TD2A 4FXPA 4HPXB 1TM4E 4V0SA 3S2ZA 2CMHA 1PX2A 1Q0UA 4JJAA 4AS2A 4BP1A 4ONEA 3GLQA 3DDOA 3HJCA 4FYMA 5LQCA 1TW2A 4NESA 3ORHA 1DHTA 4ZRMA 5SY4A 5CX1B 4ASUA 3K0HA 4OK3A 5L7WA 1VLLA 1CDEA 3G68A 5EFZA 1I3MA 2P7IA 4M1OA 4AZ0B 1YMVA 2WSBA 1QFJA 3KDSE 2PJDA 3I04M 5DASA 1M5UA 1Y3IA 2A0FA 2XUKA 3UKOA 3HQ4O 2I71A 4J7UA 3Q7QA 4KGXA 2EFJA 1EBBA 3VM6A 1I2DA 1KJJA 1ZD5A 3ZNPA 5A4KA 2LBPA 3HJFA 4IIFA 3H4MA 2OM6A 4LRTB 2PTGA 4IUYA 4UE3S 4ETNA 5CLFA 2RK6A 1CV2A 2C7PA 1ZPDA 1FFBA 2C9DA 1QIJA 3LYLA 4OK5A 3U3XA 2VZ0A 4XSGA 4CG2A 4MVCA 1OHHD 2VDJA 4DADA 3CWZA 2GTPA 4RIEA 4IUBS 1IE3A 1M6YA 2QA5A 3H2GA 3LQ2A 1NG9A 1VJDA 3AV0B 2EX0A 2RHWA 4TX1A 3C48A 1QUFA 3ROEA 3ZS9A 4BZPA 2FWPA 3OICA 3BKWA 1EDZA 4YQEA 4BMNA 1I7QB 1Q2XA 2IZZA 3E7WA 1O08A 5K8JB 1IM8A 2WFAA 3HGMA 3NO4A 4LV5B 1NKSA 2AYZA 1RAFA 3I32A 2C54A 4E22A 1D1SA 1VECA 3HSKA 4RHUA 4A0FA 2FEAA 1USUA 2IJGX 1SVMA 3OCJA 1K3TA 1XTZA 3BD7A 4GWKA 2PPLA 4PGGA 1MX3A 5LIRA 2A5JA 1BH2A 1BD3A 4P5EA 1P2DA 1TRHA 3E7XA 2WJPA 3PITA 1E3WA 4M0MA 4BX3A 4RLHA 4EZIA 3JAWA 2O8FB 4YJ2B 1BA2A 3D6UA 3UJDA 4F4CA 3K1AA 4JEIA 2WT4A 3UANA 4D4KA 3EZ2A 4FHCA 4Z4EA 3TEJA 3RYCB 1TFUA 3GLSA 2N47A 2V7QD 2FLKA 1G20E 3DVSX 3LZDA 5IKOA 3HU1A 3QG1A 1LV7A 3FMVA 3DL0A 4HH1A 5HP4A 5BVGA 1XDUA 2XXBA 1GNQA 4IW3B 3KS9A 5LQDA 3EQZA 4I4TF 4BAZA 2GTIA 1SCUB 4HLUA 5I9BA 1TD1A 2POQX 4I55A 2XT0A 4CDNA 4OB6A 4R8RA 3VZRA 4X3PA 5G1NA 4F86A 1XI2A 3FWNA 5KNBH 5B55A 3MPUA 3TZLA 4QUKA 3UNXA 4KDRA 1AK2A 1IONA 4JJGA 1ZDMA 4D0GA 3IVMA 1YULA 4XAQA 1XQ9A 1XQWA 1PEYA 3Q0TA 2HOQA 4E09A 1M5RA 3UJPA 3H0KA 1Z4PX 1APBA 2VJDA 5D3KA 1GNSA 4MVJP 4TLDA 4ARVA 1D6SA 4BCDA 2V6GA 4QBKA 2FSIA 2YN4A 1JR3A 3PQCA 3DJFA 3FVQA 1N1MA 2IYTA 1E2UA 2YDXA 1CJKC 3O90A 2FZVA 5LJLA 3CGWA 3HM9A 2HNKA 4KC0A 4RD1A 4S1PA 3HA5A 4WDQA 3PD1A 2QTCA 2OCKA 1FDUA 4C4RA 5JD5A 1QC5A 4ILKA 3FTEA 3T0IA 1TKCA 3M4NA 3W9YA 2TECE 2EW8A 2WYOA 1IHXA 2GH1A 5H5JA 4ZRDA 3GVXA 5BNIA 1D0SA 1C0KA 3NTUA 3CLRD 3LE8A 5ITZA 2CW5A 4X6UA 3KWMA 2HU2A 1V5EA 1ESEA 3WHKA 3JY6A 3Q3VA 2BFCA 3NX4A 1L5NA 2QPAA 4JIMA 1M2VB 1OW3B 3G7SA 4YRIA 4QUEA 4LOAA 3WGKA 4R2JA 3K9WA 3AUKA 2RHBA 4INPA 4N3NA 2YR0A 3OPMA 1UIRA 3ESDA 3ZBQA 2B5WA 2QRVA 3MAAC 4R1TA 4WNCA 4W1RA 2IEYA 3PA8A 2W2VA 5A71A 3L3BA 4CMKA 3BC1A 1U0OC 3UK0A 3VVMA 2VJYA 2ATIA 2N0SA 3LTNC 1LB1B 2EQ5A 2JAOA 1OB5A 2HR1A 3LUGA 4MLCA 1WO8A 3CVYA 4D1YA 1G8HA 3QLUA 5FULA 4HDMA 4W4TA 3K6SA 1Y8RA 3TCXB 1D03A 1KYWA 2NTJA 4KFRA 1V25A 2IHKA 1SWVA 1OV6A 3M4ZA 4RVNA 2M2IA 3QVWA 1WXXA 2C8VA 4RNCA 1KIAA 3LO8A 4U4AA 3R74A 4BLOA 2WTBA 5ECDA 4A5OA 5DFAA 4M0LA 4F7WA 2UZIR 2Z5GA 3G89A 4ZPJA 3CW2A 5JWHA 2XNDD 5K8LA 1TQ8A 1NM5C 1IFXA 2VTBA 5KYUA 1IATA 4BMYA 4LF5B 3L1IA 1E79D 1D2RA 1MQSA 5LPNA 1FTQA 2B4YA 4RK4A 4MRMB 5AP9A 1VLMA 2PNJA 2JLYA 3IEVA 2YOGA 4GECA 4XIFA 3SN6A 3AF1A 3K0AB 4HEJA 2PXXA 4ZPXA 3RFUA 5JJLA 2JKVA 3CNHA 3S7ZA 2CVHA 3GV0A 1FNNA 1PYDA 1X14A 2C95A 3HYNA 2VK8A 3IEIA 1RQRA 1VL5A 2G36A 1JLLB 2WF6A 4XFKA 1YFJA 5IH7A 3BWDD 4UATA 1QH1A 3CUTA 3FOAA 2P0AA 3EZGA 5I45A 4HDNA 1KEUA 1Z4QA 5DX8A 2HWWA 3ZDQA 1KS9A 2GFQA 3FDZB 3Q6MA 4C7BA 1GGNA 5CDHA 5KU7A 3U1VA 1HZZC 4L8WB 4MA4A 1NC3A 4PC1A 1UQTA 1PT7A 3KJGA 4NZNA 3KXLA 1LZKA 1EFTA 1XE3A 1PEDA 1V3UA 3LC7O 1YCFA 2EFDB 3W5JA 4MS3A 4WVFA 5E4FA 3P4XA 4ZU3A 1JSRA 1EJ6A 1KBOA 5JI3E 5IN5A 1ZVJA 5T8KC 1KORA 1I32A 2AJ8A 2O57A 4OI2A 1GQRA 1K6MA 2B61A 2I65A 1G20B 2A9OA 3KU1A 1U2DA 3R0QA 2C1XA 3QPBA 4R2KA 3T0GA 1PSWA 3QX7A 3WDKA 1Q1GA 1Y4DE 3UF0A 1JHXA 1NMEA 2XSZD 1M7GA 1PR2A 1SG9A 2VQ3A 1FA9A 3L1UA 3X1YA 2VP2A 3IDOA 3IO5A 4JB3A 4DLUA 1LDGA 4NCBA 5IT4A 2XUQA 4PTLA 4P7JA 4FDMA 4EYOA 3N74A 2PZFA 4H3VA 5IN4A 2WMOB 3BCHA 4MV1A 2Q4RA 3QVGA 4R7TA 3WGUA 2ETVA 1SQ5A 3M3DA 3GOHA 4J03A 3SQWA 1NXOA 1JG6A 3RSCA 2CDAA 1DI0A 1FFAA 3PUWA 1YHZA 3QA3E 5CIWA 4EATA 3OETA 1VBNA 4R1LA 3JALB 3VAYA 5KSOA 4FS3A 2NU6B 5AXBA 2PX5A 3VKHA 5CHEA 4S04A 1JSZA 2DULA 2ID7A 4NTZA 1EFRD 3PXGA 5B3KA 4DR5B 1VZ3A 3OG9A 3MK31 4YT5A 4GBGA 4GUDA 2AMJA 1SBHA 2J48A 4AMYA 1VFPA 2PCJA 4UM5A 1CJSA 3LSYA 3TDMA 2NMVA 5BYAA 3WSWA 2Y66A 4AZ3A 1W7AA 2CFRA 3AB7A 1THMA 3M89A 2EW1A 3PC2A 2RHLA 1NW4A 1ZCFA 4PAMA 1Q0ZA 1AU9A 2GZ1A 5CU7A 2PFSA 3AJ8A 1E1QA 3LX6A 4BNFA 1YAHA 3K8YA 3LC1O 4LHYA 1G4HA 2Q3JA 1EXWA 4XPZA 4QLOA 1UDAA 4ZQEA 3TQCA 1MB4A 3E35A 4ACBA 4D8XA 2H1VA 2CHGA 5CA1F 1WDMA 3KZVA 4FR5A 4E2YA 1SQFA 1EPUA 1JDPA 2DBYA 3F3KA 4OEHA 4ZO8A 4B09A 3KKEA 5I5GA 3AKCA 3O2SB 1AS3A 1Z88A 2Q1YA 3IGFA 4I5DA 2ATEA 3O1IC 4K9QA 2WUDA 3NP7A 4EJSC 4HC4A 1YD7A 2I7XA 3D5TA 4TLEA 5EXPA 2G4LA 4AG6A 4CU2A 4H1HA 4QA9A 4LSZA 4W9NA 4YGXB 1DX9A 4KCGA 2JKZA 4WNIA 2ZYWX 1DIGA 2J3HA 1JN0A 4U2GA 2B1QA 4BEVA 3R9IA 1ZGCA 1H8HD 3NHKA 2QL9A 5I3ZA 3SLRA 3WWZA 4L5JA 2F4NA 2NN3C 2Q5QA 4GZMA 3Q72A 3U0BA 4MYDA 3ANTA 1EP3B 5AKXA 2X8AA 5K0GA 4LRUA 3HKEA 5HQJA 3FTPA 4TPKA 1NSTA 1WTCA 1KETA 5AUNB 4II2A 1EK6A 4N76A 2LKCA 2BTQB 4EKYA 3ENWA 3DZKA 4L76A 4BB0A 2BFBB 1VCIA 4UPVA 4LOJA 4B79A 2IXDA 3CZCA 4OJTA 3Q7SA 2DJ5A 4ZCMA 2QOEA 1T9DA 1ZBQA 4OBEA 5CJPA 4QBTA 3AEXA 2JH3A 2LW7A 1GILA 5A7HA 2HLHA 4I50B 4RPGA 3RTDA 3RS8A 5KSZA 3ZU5A 3T3IA 2B0JA 4B73A 4URWR 3FDJA 1YBAA 1T26A 4QTTB 5BUQA 3OE4A 1RLIA 3OM9A 4KH0A 3PC4A 2VHVA 4FEEA 4DC1A 4HNUA 1DFGA 3ZTTA 1PJAA 1JIQA 3OLQA 1R4NA 1RAGA 2CNKA 1YR7A 5KKNB 4AMVA 1HK7A 5CX1A 4EYQA 1GDDA 4TVBA 1ZOOA 2RHDA 3QMPA 2AQKA 3HHEA 3L4BC 3BFJA 1QGOA 3NKVA 3PB3A 4J76A 2QRGA 4RPHA 2AB0A 4YEDA 4PLFA 3U4HA 4P0TA 4IV5A 4EG1A 2DWPA 1KZ7B 2K6GA 1OIWA 1OZ0A 4OOEA 1S3IA 2VH5R 3OBBA 4F5WA 1XZEA 4MWTA 4PW0A 3ICWA 4QAQA 1JEJA 1CZLA 2CHVA 3WL5A 1J1UA 3DD1A 4PLCA 3SZ3A 1TOAA 4EG0A 1CQXA 4TXNA 3SKXA 5IJ0B 1I1HA 3DBIA 1FUUA 2J5BA 3B2EA 1A9OA 4YRFA 3H2BA 4MDFA 5G3ZA 4HWPA 1TAGA 5FOXA 2WJJA 3NWOA 1MMFB 2NV2B 2NZUG 2EKBA 1Y9DA 4K1XA 2YRWA 1J2EA 4OQFA 3RS3A 4Z4CA 3K31A 4FGUA 4PZEA 2CVOA 2K5UA 4Y30A 4DIBA 1U28C 3NZEA 2JIRA 2ANBA 4R1PA 2IZ5A 4KQHA 4Z53A 1DUVG 1UFKA 2OB2A 3JR3A 5EWJB 2QORA 1NW6A 3CPHA 1Y5MA 1C4KA 2WJGA 1IQPA 2PKQO 3QE2A 3HWSA 4J4BA 2X5NA 2ZR8A 4NR0A 3KVYA 3NHPA 4Q3DA 2F7SA 4RTQA 2C2BA 3DKRA 1VPWA 1MFPA 1EAYA 3G9ZA 3GD7A 3O8LA 3R6TA 4RADA 4Q9LA 2ZWAA 3AFMA 1P4AA 2ZRPA 2FN4A 3GARA 4QSHA 4RTKA 3MTEA 2O8FA 3I34X 4X1YB 5K0TA 5E9WA 1MAHA 1E1MA 3QLEA 1XVTA 1AM4D 3FOBA 4EMTA 3CCFA 4I6EA 3WK6A 3TG2A 4CEIA 1PZMA 2VBIA 5EERA 1QOPB 3IPAA 1TQ4A 3X44A 2FSUA 1AGPA 4TLCA 4DWOA 4V38A 1Z0JA 3FPGA 2CUZA 2A86A 4H31A 4M88A 3RVJA 4IHJB 2CV2A 3EFBA 2UKDA 4G86A 3HB4X 3ICPA 2IDZA 1GUZA 4FNAA 4MUKA 4AJEA 5ALMA 2CMKA 1QM5A 3H9BA 4N7JA 4O2LA 6YASA 1M8JA 3THWA 2C5EA 1AK9A 5EC8A 5JBQA 5J2UB 1TJ5A 2PMDA 1T3LA 4FIDA 1VHWA 2YS7A 3AZQA 1SCUA 3EIEA 5B1IA 4C7KA 1AF4A 5J9FA 1DAGA 2WJZB 3OCCA 1JE1A 1ENYA 1QVWA 2VUHB 2I2FA 2QUJA 3H9CA 4IKPA 4ZT2A 5BN3B 3AB8A 5EJ8A 2VQFB 1RW4A 3VPAA 2BP7B 3OZFA 4QZVA 5IM4F 4WW0A 2B8NA 2FDRA 4XM1A 3M9WA 3R09A 3BXFA 3NNDA 4TLMB 5L40A 3UHFA 2HT1A 5J63A 2VWQA 4D8WA 4EUSA 4KR6A 1W0JA 4K8OA 2IHBA 4QRHA 3MWLA 4YAOA 1JFFA 1CSEE 1R10A 3PNVA 4H6PA 3FB1A 3VR1A 4EBFA 2VDPB 1YOBA 3O1JC 5G0SA 3SSNA 4ZCLA 2WTEA 5AHKA 3WZ2A 2PUHA 4RJ2A 4I66A 3WV5A 2A5YB 4XYEA 1HRKA 3I9FA 4YDQA 2GSWA 5E2BA 1G4UR 1GR1A 4Z1OA 5T64A 1WUJS 4A0RA 4LPKA 3VR6A 1P0IA 5JQGF 4DL9A 4MUIA 1VTKA 1QO7A 5MN5A 2KBEA 2PSJA 4G8JA 4MA5A 4EITA 3OM8A 4UQPA 2K4MA 1GGJA 2CBXA 2VJNA 1M2VA 1X9HA 2MYNA 2XYQA 1XWFA 1FSSA 1YOVB 4IIVA 4PQGA 1W4BA 3VU1A 4CCYA 1EGHA 4K9MA 2FW9A 3V7YA 1Z4MA 4L9RA 1F2TB 1W52X 1XWIA 3QH4A 3RIXA 5SZJA 4DCVA 3T3OA 2FW8A 3U4CA 1DXYA 5CFLA 3PRYA 5DHAA 5IVDA 3BHIA 1C9NA 1SHJA 3KYCB 3B8EA 2V03A 2YJTD 3SIPA 3MWYW 1R9GA 5C8YA 3WB0A 4DBVO 5BV1A 1CY4A 5DBOA 5B4UA 1ZIYA 3F8WA 1RCUA 3AYXB 5BR1A 1WPXA 2FPMA 3BB1A 5JCZA 1HDCA 1KU6A 1DVRA 2RHOA 2FQ1A 3DVLA 4GVPA 4ZVSA 2C20A 2HWXA 1YMQA 2ICAA 4G0NA 3H2SA 5CFOA 821PA 5K8TA 1S7GA 4LBVA 3RRJA 5JVDA 4FYHA 4IIUA 5EMKA 1CP3A 4CM5A 1JLMA 4H4EA 1N5LA 1DQZA 3MQFA 5H8WA 8ADHA 1JB9A 4BNNA 2QP4A 5LXTA 4M76B 4Q01A 1BS2A 2ZB4A 3QUAA 4ESEA 1Q6ZA 5B1EA 1CQZA 5IVPA 3EQ2A 3ABIA 3NGMA 4WGFA 3D4IA 3N2LA 1NUTA 2QD4A 3GBSA 3PENA 3QJYA 3TS1A 2WF8A 4D3DA 3FVRA 4JL6A 3BGIA 3ENZA 3IVXA 5FH9A 5J4LA 2ZI9A 1YS2X 3KYDA 5JLJA 1OTHA 2VDNB 4HBZA 3OMLA 3HYTA 3FSGA 3P9ZA 3R77A 2A4KA 3A9UA 2GK3A 1JMVA 2YZ7A 4UUOA 1HLPA 5CM9C 3OM1A 1UJ4A 1WP9A 1T5BA 3C85A 3ASYA 1AMOA 3RK4A 3BZBA 2BGNA 3DL7A 3SXJA 1JLLA 1VDZA 1SXHA 4LBWA 2EFGA 1FRVA 5EUCA 4U7WA 4PC3A 3K1ZA 4LDRA 5CUQA 3OIFA 2OHXA 4UJ3A 5KTRA 1IHPA 3FDZA 1PWZA 4O4IB 4AO7A 1ZUWA 4CU5A 3K1YA 4IQ8A 4BV9A 3V8MA 1A1SA 4RJTA 3Q7PA 2AQ8A 3DZDA 3BGOS 1JU4A 1BRMA 8ATCA 1H6AA 1Y6ZA 3LHDA 4LVNA 2EQBA 3Q9NA 3HCAA 4PYLA 1NMZA 4DN6A 4RPJA 4AURA 1BVYF 3EWSA 4M9XA 1XLTC 4QPNA 5J43A 4CL2A 4TGLA 4BEJA 2VXCA 4Y2PA 1QH8A 2WAOA 3O1HB 4J90A 1J49A 3HYCA 3O8BA 3RVOA 3X1JA 3I30X 4D7AA 5BMVF 1IVSA 1Q17A 1LSUA 1XZ8A 2I3ZA 4YP7A 2R6AA 2ZYHA 3H1GA 5GPBA 2GILA 4IFTA 1NUSA 5K03A 2IOFK 4OHYA 5K0CA 2AN5A 1E5LA 1P39A 1PFUA 2IITA 4DAEA 4ZVRA 1LDNA 3DQQA 4DIUA 4QU5A 3LOPA 3RADC 3UGKA 1DOZA 1SKAA 1L7AA 3HWRA 5EPEA 2I91A 4GPAA 2QM7A 4WK6A 4LF7B 2ACVA 2B8TA 3D6JA 4MQ4A 3O26A 4GM1A 4X0EA 3O4VA 4HTAA 5EMHA 4GX0A 4BQQA 3E61A 4BFWA 3LRTA 1KAHA 3TRKA 3T1TA 1W34A 2Q6LA 1BWRA 1ESNA 3EEFA 3EOBI 4F7DA 3FKQA 1P3DA 4LYDA 4OI4A 4EECA 2G9QA 4YCCA 2Q45A 2F1OA 4J3FA 1Z8HA 3Q5GA 3AY3A 4NCHA 3EDQA 5JJKA 2QG6A 1JQEA 3T5MA 1AQJA 2FKNA 3B38A 5THXA 2VS1A 1XAHA 4FYVA 3A10A 1QRUA 3GZ4A 1VC2A 2Y9MB 3PFNA 4L7QA 2JLBA 1W35A 4YR7A 4JBYA 2HA5A 4DHWA 2C83A 1EUDB 1LVUA 5KQPA 4UE6A 2XUOA 1R4MA 2YBDA 3IHLA 4MYTA 3E48A 3DGFC 4QDTA 1T5IA 2IE8A 3BMCB 4YJ3F 5IFKA 4HZGA 5EIFA 4TSKA 3RUDA 1FDOA 3ZJUA 4R3WA 1ODCA 2Z8YM 4FWTA 2ZI7A 1CU1A 1I7PA 1U2TA 4TMKA 4UZFA 2RKBA 3HMQA 2MYTA 1QTIA 3JD1A 4O8CA 3WGGA 2IBTA 4E13A 2E4XA 4DREA 1XOIA 4EG4A 4MO2A 1T2UA 3L0BA 3GUUA 4B45A 1K7SN 4PHTA 1G60A 2VPYA 1L6IA 2Y0CA 4KSYA 3QNMA 5EHIA 4EY4A 3W7BA 1ZK4A 1U8YA 2XRFA 5EHNA 3GT7A 5ESWA 1BXGA 3T7KA 1T0IA 4EG7A 1SRRA 3CZPA 5HTOA 2D1YA 3IPRA 2CF6A 4G4GA 4OXYA 3TLKA 3L9WA 4E6PA 2HCRA 4NDNE 4XWAA 1V3TA 4CMEA 3NH9A 3P0HA 1NBAA 3KQWA 4O4HA 4DVJA 1SIUA 3ETEA 5ECGC 3TX2A 3CTPA 1XCJA 5E9JA 1WABA 3EGDA 2P3SA 3T0FA 3VR5D 4BMDA 4C0QC 3L4JA 2AIRA 3EGXB 3O92A 4NZPA 1PJCA 1DRUA 1IM5A 2OXCA 3NFRA 2CVZA 1ZU5A 2W2KA 2WC1A 1T0UA 2XB4A 3GNSA 3MJTA 4QWMA 3FOFC 2A7XA 5JXWA 2BFBA 3ZE9A 1DEHA 2BRUA 5IZ4A 3QI2A 3CURA 2F8LA 3KKPA 1H05A 3F90A 3CX8A 4HKTA 5DYNA 1C7ZA 1X7XA 2HTFA 4CG3A 2PMWB 3UBTA 2CJFA 2XUDA 2Z3ZA 3L5KA 4EW1A 1Q7RA 1VHQA 1DCTA 4FBMA 4DIDA 5LN1A 3LC0A 5D7NA 1OIXA 2AYYA 3QKUA 4ZTUB 3OX2A 3E8SA 4FCTA 3VOSA 2E82A 1IJKA 2ZUWA 3L0DA 5K8CA 4NP6A 4PGAA 2ADFA 2JLQA 2BKLA 2H5LA 2FI1A 2YVKA 4OQLA 1PQ4A 3OEYA 4IQ0A 3GLGE 4OQMA 3G2IA 2P78A 2ZRFA 3E23A 4R41A 1XCGB 1FVHA 1IZ0A 3W5SA 2NUPA 3I92A 1U80A 3COVA 4G0MA 4RIGA 5EIWA 5GJCA 5K3SA 1V47A 1JUDA 3VGJA 2ZQZA 2O0MA 2DPXA 5SYNA 5BN5A 3TSOA 3UKDA 5JAMA 2V4UA 1H2WA 2IEBA 2VUTA 3QMWA 5DGHA 1ZP6A 2BKEA 1ZCJA 2WE7A 3MB5A 4HY3A 4LSWA 2ODQA 4MW4A 2GCPA 1YNSA 1RHUA 1YQ9A 3HV0A 3H5RA 3JV7A 4Q7KA 5AHWA 4ZEXA 3W6NA 3WNCA 1UPCA 4B3JA 4ZVQA 3UFXA 2JL1A 2YMQA 1C7EA 1QS0A 5ALQA 3BZUA 1T4DA 3C1AA 3V4ZA 2ZVJA 2IYEA 3C7CB 4LGYA 5T7BA 4G0OA 1TEZA 3F3MA 2JLUA 3EZ9A 3G2HA 4ZOLB 4RNDB 2N1MA 1SBCA 3U81A 4M9UA 3VC7A 1SBZA 4O08A 4RUKA 1OKKA 1JHYA 4GLFA 3U7EB 4COOA 1C2YA 1MEOA 2ZSJA 4DLZA 3SZLA 3AF6A 1SVSA 2WAYA 3TD9A 3AL0C 3LQRA 2HXYA 1YDMA 3C98A 3V32A 3WGVA 4QC2A 2C0CA 4JC4A 1I2ZA 5EWJA 4X97A 3K9CA 1X7DA 4RWEA 1D09A 1TO2E 4JKYA 2YV4A 5C8DA 3C5EA 1T3SA 3TLGB 2QAGA 1M66A 1IM2A 1A9YA 1XSEA 3GEDA 4YDRA 1HFKA 2AV6A 2E9SA 3H7IA 1EBUA 3KZOA 5KCMA 1HSZA 1FUIA 1TB4A 1WHTB 2Q1UA 1QP4A 1OPXA 3M6LA 1YH3A 2OYSA 5LQAA 2JW5A 4JLSA 5HMLA 1J8FA 3P9QA 1L5KA 3NAZA 4ZRNA 1RBYA 3RTEA 3AKDA 3OE1A 5DWDA 5LQRA 2AN1A 2NPOA 3LL7A 2YY7A 1JPJA 4G0WA 1RLTA 4QBFA 4KIJA 1F14A 4N7RA 3I45A 2JAWA 2RGYA 2KX7A 1RWMA 3VHLB 2PU5A 4IHJA 3EEQA 1EAMA 5D85A 3W34A 5FLKA 4LUCA 3AUYA