1CYDA

Carbonyl reductase complexed with nadph and 2-propanol
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
242
structure length
242
Chain Sequence
LNFSGLRALVTGAGKGIGRDTVKALHASGAKVVAVTRTNSDLVSLAKECPGIEPVCVDLGDWDATEKALGGIGPVDLLVNNAALVIMQPFLEVTKEAFDRSFSVNLRSVFQVSQMVARDMINRGVPGSIVNVSSMVAHVTFPNLITYSSTKGAMTMLTKAMAMELGPHKIRVNSVNPTVVLTDMGKKVSADPEFARKLKERHPLRKFAEVEDVVNSILFLLSDRSASTSGGGILVDAGYLAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the ternary complex of mouse lung carbonyl reductase at 1.8 A resolution: the structural origin of coenzyme specificity in the short-chain dehydrogenase/reductase family.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords CARBONYL REDUCTASE
total genus 94
structure length 242
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.184: Carbonyl reductase (NADPH).
pdb deposition date 1995-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1cydA00
4P4NA 1UXKA 1ARZA 3I23A 2OL4A 2H63A 3PLRA 5T8KC 3BIOA 1NQAO 2Q1TA 2CF6A 3QVXA 1HE4A 3T7CA 1SZJG 4OHUA 3ZNPA 2NQ8A 3WSWA 5DNAA 4E21A 2IEBA 1JA9A 2UUPA 3BMNA 4B8ZA 5DN9A 2ZK7A 1WNTA 3FWNA 2D4AA 1KETA 3BTOA 3OJEA 4E2ZA 1ID1A 3HJAA 4GL4A 3KEOA 4KWHA 4L4XA 1E3JA 1DRWA 1M6WA 2NTNA 2W4QA 3FPLA 2X0IA 1PJBA 3QW2A 5CPBA 5I8ZA 1YJ8A 1PR3A 2ZTLA 4K28A 2EV9A 1XCBA 4MP6A 4IPTA 1MXHA 3WB9A 3CZMA 3H9JA 2NVBA 4JCOA 1DPGA 1VL6A 3I9KA 3DBLA 3F1KA 1RM3A 4WUVA 5EQDA 2Y0CA 4WEOA 1GCUA 4LVCA 4IDCA 3DMTA 2F1KA 3UXYA 3GHYA 1C1XA 4BS9A 3FHLA 2VHXA 4Q3AA 2AEJA 5DCUA 4ESOA 2BGMA 1WP4A 2GRAA 1LDYA 4BNIA 3PWSA 3PHGA 2DT5A 4ALMA 1V3TA 3QE3A 4YT2A 3M1AA 3GFBA 3HQ4O 4XQCA 2EWMA 2P5YA 4ALNA 4GSLA 4CM4A 1RM5A 5JY1A 5T5QA 1BTOA 1GCOA 4J90A 4B4VA 1P1IA 5EMHA 4IBOA 4R9SA 3W8EA 1B8PA 1ZK1A 3GAZA 2QHXA 3EZLA 5JMPA 1XA0A 2PZMA 4JBGA 1F06A 2OOSA 3P2OA 1HWYA 1W4ZA 2AXQA 4NFHA 1I36A 1ONOA 3RFVA 4FSHA 1SB9A 2HMTA 1CYDA 4BNFA 4B4WA 3DZGA 4YAIA 1ULSA 3I9JA 5ICMA 3K96A 4R16A 5BNTA 1I33A 5IN5A 2DPGA 3WBBA 2C0CA 3ZV6A 3ST7A 4DTIA 4RF4A 3RBXA 4C4OA 3BMOB 2VTEA 4E4YA 1K5HA 3QSGA 3JTMA 5CHEA 1IY8A 2V65A 4W4TA 1HSZA 4LSWA 2GCGA 5MDHA 5CAEA 3BXXA 1RPNA 2ZKLA 1A7KA 4J16A 4BO4A 4GX0A 4AVYA 4WLOA 3ETEA 4Y6SA 3GF4A 4ROSA 2I6TA 3JD4A 3WDSA 1VL8A 1H9AA 5JLAA 1W0CA 3NT5A 1LSJA 5DBIA 4ZJUA 1O0SA 1DBVO 1VC2A 3MCVA 4H3VA 2GN9A 4XB1A 3GVPA 1B2LA 2HUNA 4BNZA 4YT5A 1WDMA 2P9GA 5JC1A 2J3HA 5G4KB 3L4BC 3E03A 3E6AA 1XYGA 3QVOA 4RVDA 2WSBA 1P1HA 5T6BA 2OXIA 3S55A 1QKIA 2EW8A 2I99A 4JGBA 3RU7A 3E5RA 4WEQA 3FSRA 4LISA 1ZXBA 4YQYA 4LSMA 3CINA 1ULUA 3X2FA 2FHSA 3TSCA 4MVJF 1PZFA 4ZGWA 4FPXA 1ONPA 1E3WA 2A92A 4B4UA 1KBZA 3FWZA 1E7MA 2XF8A 1YOVA 2PGDA 2Y1GA 3FD8A 5B1YA 5IF3A 1GQYA 2VZ9A 2YUTA 3IP1A 2BGLA 3GPIA 1BVUA 1GR0A 4OM8A 4E13A 1Z75A 3C8MA 2HMUA 3GFGA 4HY3A 3HSKA 2YHIA 5DF1A 1U7TA 2D8AA 4JXKA 1NHGA 3WGYA 1JKIA 3PJGA 2YV2A 3VZSA 4BMNA 1YB1A 1HDXA 5JDIA 2C20A 5KNLA 1Y7TA 4NBVA 4J1TA 4LCEA 3H2ZA 5L4LA 2JCYA 2YV1A 4CM1A 3EDMA 1XQ6A 1PEDA 4FOSA 4M55A 1EDZA 3GG2A 4HV4A 1HE3A 2QQ5A 1E1MA 2C07A 1EMDA 4HADA 4PG6A 5AQ1A 4WLUA 4CMAA 1GY8A 1H6DA 3L0DA 1B14A 4GGOA 2VRBA 1KVSA 3F6YA 1CQIA 4L4SA 4BHTA 1U4SA 2OMEA 2RAFA 4MOWA 2NTJA 3PK0A 4PFJA 3G1UA 4BKUA 4L75A 4XGIA 1M66A 4M87A 1BXKA 2FRDA 2CVOA 1UP6A 4GMFA 4R51A 3EUWA 3UCXA 1ENOA 1J0XO 4HP8A 4GWGA 1EUDA 1F8GA 2BGKA 3NT2A 4GLLA 4WOJA 1NPYA 4U7WA 3ETDA 1E5QA 1T26A 3L6OO 3L77A 3AI2A 1TT5B 3GLQA 3SBOA 1Q7CA 2ZB4A 3QHAA 3EGOA 3JQEA 2BLLA 3ANNA 4J4TA 2AQKA 4BB5A 1AHIA 3KBOA 2B4TO 1DC3A 4BO2A 4BNUA 4QQRA 4XA8A 4HFMA 2HK9A 3ZHXA 4I5FA 4Y98A 5L7YA 2GR9A 3PFFA 2IODA 3JQFA 1C0IA 2AQHA 1NFFA 2G82A 1B7GO 2HK7A 4BO3A 3C1AA 3AFNA 1V9LA 4Z3DA 1GL3A 4FD3A 4ID9A 1JTVA 1K6XA 4OXYA 2Y1OA 4XGKA 3QRWA 1KOLA 3H6KA 1QV7A 2X9VA 3SJUA 4QUKA 4BO1A 1DAOA 2O3SA 4FN4A 2WWRA 3U9LA 3ZI0A 4YAKA 4FQ8A 2I76A 2FWMX 1P3DA 5AXAA 2DFDA 1RM4A 2QYTA 3WLEA 2OP1A 1ADCA 2BI7A 5F1OA 3VDQA 1PGNA 4FFOA 1U3TA 1BVRA 5JO9A 5KVQA 3JYPA 1SEVA 2HO5A 2WDZA 1UZNA 3PXXA 3C7AA 3GOHA 4MINA 3PQDA 3AY6A 5CG1A 4B3JA 4MVJM 4R1TA 1NP3A 1DC5A 1PJ4A 1PZHA 3QWBA 3VVBA 3SXPA 1UUFA 2A94A 1I2ZA 3LDHA 1ADFA 4IMRA 4TROA 4BNMA 2HLPA 4YACA 4C7KA 2J8ZA 3QWAA 1E6WA 2V6FA 2FPPA 4BV9A 5CEJA 4NBWA 1KERA 3GDGA 5FI3A 2IE0A 5ER9A 4YJGA 1NWCA 3JYLA 5THQA 5JDCC 1LC0A 2PWZA 2UV8A 5BNIA 1UXJA 4HUJA 4J43A 6ADHA 4A27A 4YJFB 3BZUA 4JP3A 4RLHA 3Q1LA 3BHJA 3BTSA 3NDJA 3PZRA 1DFHA 3G3EA 4CPDA 4CMGA 5EQFA 2VYVA 4N7RA 1GAEO 4BVAA 4NBUA 3ZNNA 3E9NA 3KYDB 5EINA 3OQ1A 2CDAA 4LGVA 1OI7A 4AL4A 5KVVA 1LLQA 2H1SA 2I5PO 1ZXLA 3KSDO 4LRSB 2NQTA 1NAHA 3U49A 1I30A 1PS9A 1QORA 2X1HA 4BOYA 2X4GA 3GZNA 1D7OA 3H5AA 3IMFA 4HFRA 1N7GA 1PS0A 2JCXA 2PK3A 3AUUA 3GY0A 3U3XA 2HJSA 5KJ1A 5C7OO 4J2OA 1JQBA 1YQDA 3A4VA 1A7AA 1PSDA 2G0TA 3MJVA 1VKNA 1E7RA 8LDHA 1YXMA 4JNKA 1T25A 3I52A 2HAEA 4O1MA 1GPDG 2VUUA 5ER6A 5G0SA 3VHRA 4AJJA 1NHWA 3V8BA 4QECA 3DEYX 2PD6A 4J0EA 3GHHA 5AYVA 3HWRA 3H5RA 4ZVVA 1YL5A 4BNVA 4IQGA 1U5AA 3EHEA 4R1UA 5JE8A 4PGFA 3BA1A 2Y0EA 2VYND 3E48A 4Z0TA 2FSVA 3SJ7A 1NVGA 4BMSA 1MV8A 4BB6A 4YTEA 4MVJE 1LLDA 3WWYA 3D3WB 2GZ2A 1C0LA 4J6FA 2WE7A 3GVHA 1PJQA 2CVQA 4CV1A 1QV6A 4ZRMA 4MPDA 1QXSA 2NU9A 1O5IA 1T24A 4KQXA 2P4HX 1ADGA 4FJ2A 4Z9FA 4ZN6A 2FN7A 3IIEA 3HNPA 5T67A 1ZIDA 1B3RA 3D4NA 3E8XA 3VTFA 1ISJA 4BNKA 2Y05A 1UP4A 4ILKA 5BT9A 3KLMX 2HK8A 1K2WA 2BFPA 2X6TA 1NPDA 1ENZA 1KEVA 4D44A 4KQWA 4MKXA 2Y93A 3KYBA 4TRRA 5IDXA 5EL0A 5DCYA 1LX6A 2XAAA 3CUKA 3DOOA 1ZK3A 3DB2A 1UJMA 5EIOA 1ISFA 3UN1A 1YJQA 5F5NA 3AY3A 3RKUA 3VH4A 1Y8QB 3DZKA 2NADA 3GDFA 3PDJA 1DLIA 4MIEA 1P9LA 1P0CA 2BELA 3AJRA 1VRWA 2PY6A 1DC4A 1ZCJA 2BKAA 2HMWA 3SEFA 1GYPA 3M2PA 2QIOA 3PTZA 4J9UE 3DMTC 3EZYA 3OBBA 3ZWAA 3L4BA 2QRLA 3N58A 5C7LO 3AW9A 3C7DB 4R69A 4UEOA 1ZFNA 4YPOA 1VE9A 3K8ZA 1MG5A 3F3SA 4XD2A 4E2YA 3F4LA 4DPKA 3Q11A 5JMWA 1YDEA 3K9QO 4GX1A 4MVJG 5HA5A 1WDLA 4YR9A 4RVUA 2VZ8A 3IJPA 3A28A 3O26A 3ENKA 3FRJA 4ALLA 4E33A 3KLPX 1U3WA 4DA9A 4FC6A 3OMLA 2XPCA 5ITWA 1I3KA 4JX8A 2ZJ0A 1YB5A 3B70A 1AXGA 5A1TA 1XWFA 4BO0A 2CZCA 4CR8A 1T2DA 4EEXA 3JCZA 2RH4A 1HLPA 3RU9A 2GERA 1C3VA 4DC0A 1L7EA 3WGOA 3QJ5A 4CMIA 4AJHA 5DOVA 4P4GA 2IEDA 2ZB3A 1ZVMA 5JYDA 4EBFA 3LT4A 3TQHA 3ZU3A 1WW8A 3SVTA 3TNLA 4RQTA 3C24A 1UZLA 1LRLA 3JSAA 1KVRA 1ZJYA 3AUTA 2ZCUA 4IDDA 3I9MA 4I5EA 4F46A 2CVZA 3ANMA 2O3QA 4UEJA 3HFSA 3S2FA 4YAGA 1MP0A 1ZEJA 2J5KA 3EW7A 3WTBA 1N8KA 3A1NA 1YB4A 4D43A 4F45A 2ZCVA 3H9UA 2GUGA 5IAAA 2ZB7A 4W9NA 1BW9A 1JKJA 3EAGA 1T2CA 3DBHA 4RORA 3NJ4A 1GYQA 4KTVE 4DBVO 2EHDA 4ITUA 3UF0A 1VL0A 4TRMA 4UVDA 1KIFA 5I7FA 4ZQHA 2HQ1A 3NRCA 3FNEA 4WECA 2PZLA 1JN0A 1K6IA 4BV8A 4D79A 2C59A 1DIHA 3K5PA 5LCXA 1V3UA 2CMDA 1WPQA 2D5AA 4J1QA 4GVXA 4EJ6A 4U6QA 2B83A 3ZGYA 2NU8A 3S1LA 2PFGA 3JQ6A 4ZQEA 4BO8A 4RO0A 4Z3KA 1OC2A 1XU9A 2OUIA 3IUSA 4CMJA 2Q2VA 5TT1A 2JFHA 5JAQA 3VAZA 4ALIA 3P7MA 4MP8A 1GZ3A 1HT0A 4CM9A 3T7EA 4M89A 1B8UA 2DVMA 1PR9A 4G65A 4FFMA 1OFGA 4UVHA 3VTZA 3JQ8B 1LTHR 1EQ2A 4A5OA 4II2A 4IJUA 2HSDA 2PKRA 4FC7A 4Q3DA 1P1RA 1XSEA 2BH9A 1LC3A 3IDSA 3JQDA 4U6SA 5L53A 3PPIA 1U4OA 1HDYA 1WXDA 2ZTMA 3Q3CA 2BD0A 5GMOA 4GH5A 2Q2QA 4I1IA 3GDOA 3KOUA 3RVDA 4MVJI 1E7SA 3PQFA 4JK3A 3D1LA 4D0SA 5IXYA 1VPDA 4GKVA 4AJ4A 5HWSA 3HN2A 1RJWA 1ZEMA 3GN1A 4UVGA 3BMQB 3EMKA 4RZHA 4E5MA 2CDBA 1MFPA 1S7CA 3LF2A 5G0VA 1X15A 1LEHA 1WDKA 3K31A 4HFNA 2UUOA 5COBA 1EBFA 1DFIA 1H2HA 3BMQA 3OQBA 2RCYA 2PH3A 3ZWPA 1ZZEA 4IUYA 3ASVA 1C1DB 3D64A 3GUCA 1H5QA 2Z1NA 2W2KA 1Y5RA 3LSYA 1C14A 4QO7A 3NGXA 3ZU4A 3KYCB 4RDHA 1NAIA 2FR8A 1XG5A 2QZ9A 4IZIA 2Q4EA 1LDEA 1R4NA 3PYMA 2CNBA 3LVFO 3D5QA 2LDXA 1TLTA 3OA2A 3ROPA 2J5QA 1EFKA 5ENVA 1EVYA 2D3TA 2Y1DA 4TRJA 1JLLA 3GH3A 3RJ5A 1Z7EA 2W98A 3GRKA 2B4RO 3UICA 1E3IA 4R01A 3I5MA 3JQ7A 5DP1A 4CV2A 5JAMA 3AU8A 2CSUA 4JQCA 4OGWA 4Z9XA 1W8DA 3W8DA 3GEDA 4FIZA 2YQ4A 4OOFA 4AJ2A 1NFQA 3JYQA 5A04A 1O6ZA 2X9NA 4W82A 4U5QA 3SX2A 4N5LA 3KYDA 5ITVA 3KO8A 3FBGA 1U2GA 4OYRA 1O9BA 5KOIA 4YJDA 5FF9A 3AOEC 2XXBA 3FR8A 1QMGA 3WGQA 3HUDA 4WLEA 4DMMA 4F6CA 3OHSX 4JN6B 2PA3A 4R5MA 4DLLA 5DP2A 3JQAB 2Q3EA 3AOEA 3DDNA 4AJLA 5BNFA 1GDHA 3G17A 4RL6A 4UUNA 4QFCA 3T4EA 3DTYA 1OOEA 3CXRA 4JIGA 1R66A 2EKQA 1R0LA 1I8TA 1U3UA 4Y67A 3RUIA 4CMEA 3NTOA 1HXHA 5IN4A 4WOKA 2OBYA 2PKQO 4AJ1A 1IHYA 1EZ4A 1ML3A 4O59O 3F1LA 1X7DA 5A3VA 1X14A 1DIBA 3BTUA 4ALJA 1VSUA 2X0JA 2CDCA 2PV7A 3HFGA 1RWBA 4OQZA 4RQUA 1B16A 3D4PA 1Q0LA 4MO2A 2P4QA 3Q2IA 3GEGA 4KWIA 2VRCD 1KEWA 2I3AA 4XB2A 5B4VA 4F3YA 3ZWBA 3WYCA 1VJTA 3EK2A 3Q9NA 2ZYDA 1DAPA 2OORA 2IYPA 4CLDA 2I3GA 4BQPA 2AE2A 1NM5A 8ADHA 4Q3CA 5AXCA 3R1IA 3QVTA 3FN4A 3UHAA 3ZHZA 3RC9A 1LSUA 3PDUA 2EXXA 5JSFA 1R0KA 4YVFA 2BI8A 2JJYA 3LU1A 3LC7O 4TMFA 4WPGA 1GUYA 3V2HA 1JKFA 1Z73A 4ND2A 1XLTA 4GKBA 3RUCA 3LF1A 1UH5A 3OECA 3O4RA 3KSUA 3GVIA 2OFPA 7MDHA 1I2CA 3MTJA 5I9MA 5TSDA 2NU6A 4FJ0A 4GSKA 3WNQA 3H3JA 5A4DA 4K9DA 1KEUA 1NASA 3QVWA 2C29D 4TQGA 3W4JA 3MTGA 4B7CA 1KVTA 4KUEA 2Z1MA 3ABIA 5BR7A 4M1QA 1JW9B 3RFTA 2C5AA 3WGGA 1YQGA 3LK7A 5MGBA 1WLYA 2BMAA 3OICA 1I3NA 1SOVA 2QRJA 3KETA 2J3IA 5GY7A 5AXDA 3RQSA 4CMHA 4KTTE 2ZATA 5K6AC 5K0ZA 3TFOA 4I9NA 4D3FA 1LQTA 3COSA 2O50A 1X1EA 1N1EA 3TZ6A 5BSEA 3ZNOA 2UVDA 2IZ1A 4CM7A 3OJFA 1HSOA 3MJCA 4E5NA 3WICA 5BQFA 4NHEA 1C1XB 1I01A 1IHXA 3EVNA 4IS2A 2DBZA 1BGVA 1JVBA 3ZU5A 1OC4A 1MLDA 4J9VA 2PR2A 2E82A 1PQUA 3V1UA 5DOZA 4QSMA 4WJZA 1K0UA 5CP8A 3DZFA 3ONFA 3L9WA 3DHYA 1UAYA 4YB8A 3UUWA 4EUFA 1G0OA 3A14A 1BW9B 5L95A 1IOLA 4HKTA 1VM6A 4ZHSA 1OMOA 4N18A 4AJOA 1XGKA 4CLEA 4AFNA 3HHPA 1A9ZA 3MJTA 2VUSA 1QRRA 2HMSA 1MA0A 1FDTA 2GGSA 3F47A 4DRYA 2GYYA 1D1SA 2LDBA 4AICA 3F4BA 3G49A 1MG0A 1CF2O 4XX0A 4RPGA 4UAGA 5KJEA 4DL9A 1XEAA 5F3RA 5CDUA 1J4AA 2ZYGA 1P1KA 1RKXA 1D8AA 3ZWMA 1EK5A 4TZTA 4YAEA 3INTA 1LXCA 4XYGA 4RDIA 1SEPA 4WCFA 3WQSB 1BDBA 4BNXA 1MGOA 2Q50A 1VSVA 4AJKA 4FFNA 2X5JO 4R54A 4CM9D 4BO6A 1PQWA 3E5MA 2Q1UA 4TKMA 2JCVA 1LSSA 1T2AA 1ZO8A 2NACA 1E6EA 1ZMTA 3OH8A 3K2EA 4CLXA 1GFSA 4N54A 3CMCO 1NX6A 3GGPA 1QYDA 4BNYA 5DBFA 3FCOA 1E6UA 1T1SA 1SCUA 4DPLA 1DIAA 4UUOA 3DMYA 4O5OA 4UVIA 4GI2A 1IPFA 5F5LA 1PL7A 3OEWA 3ICPA 2R2GA 3R3JA 4ONEA 1D1TA 1E92A 1HDCA 3KVOA 3ZNQA 1IULA 1AE1A 4E2WA 2EKPA 4PLZA 2C2XA 3PWKA 3TZKA 3GAFA 3O9ZA 3T4XA 3UH1A 5AVOA 2O2SA 4B4OA 2VN8A 5FYDA 3NTRA 1ISIA 4U0JA 1ZJZA 3ZWOA 1X1TA 2X22A 4OKIA 3W4IA 3EC7A 2PZKA 4Z9YA 5T8KA 3VZPA 4XZ3A 2JFFA 2C7VA 4CLRA 1FF9A 1AN9A 1E3WB 2Z5LA 5GZ6A 3RC2A 2C7GA 3KTDA 3MWDB 1ZSVA 3WLFA 5ADHA 5EJ2A 1B0AA 2E49A 4ZU3A 4Q39A 2EJWA 4YBZA 1BXGA 2Q1SA 4H7PA 2XOXA 3QY9A 1SOWA 1V35A 3GVCA 5FI5A 1QLJA 4J1SA 1OZAA 4NK5A 1R16A 4QO8A 3H8VA 1KVUA 3E9QA 3LZ6A 3CMMA 3Q0EA 5HS6A 4M86A 1Q7GA 5B4UA 1ZSYA 5A9SA 4RF3A 1TI7A 3QP9A 3U4CA 4NI5A 4YRDA 5TC4A 1Z45A 1WZIA 4U0KA 3K92A 3RJ9A 3V1YA 1PQPA 3JQBC 1ZUD1 1MUUA 2D0IA 1U1IA 1U3VA 4Q3NA 3OIFA 4XQGA 4NK4A 2OP0A 3ROQA 4Z0HO 2RIRA 1WVGA 3AI1A 1EUCA 2QYSA 1EBUA 4GMGA 3ZWCA 4PZEA 1O95A 3EYWA 1PZGA 4PG4A 1E5LA 1K3TA 4P22A 4CUZA 4LN1A 4E2XA 4O0LA 1YVEI 3VPGA 3RROA 4KP7A 4DQUA 4K26A 1A9YA 4K6FA 1I32A 4PLHA 5COAA 3M1LA 2X9GA 4DC1A 1EE2A 4RCVA 4B7XA 4BNWA 4CM4B 4EYEA 4XQ9A 1M6HA 1Q2XA 2X7HA 2GNAA 1Y8RA 4FFPA 4CQMB 4J3FA 4CMKA 4A0SA 5TRTA 1VJ1A 1TVEA 3JYNA 1QYXA 1A4UA 4UUPA 3H5NA 5C37A 2Q1WA 2EP5A 4KZPA 4U8GA 1I3LA 4C7JA 4AJEA 4KOAA 4P38A 1N9GA 3K30A 4DBZA 1UXIA 3QWHA 5L4SA 4ZICA 2GLXA 1YL6A 4RPHA 2X5OA 4KDFA 3NAQA 3AU9A 3PGJA 2G17A 3NUGA 2NV6A 4MDHA 1P31A 3WMWA 2YFQA 2HCTA 3HB4X 3KB6A 3OF2A 9LDBA 3GA0A 1IZ0A 1NXQA 1SC6A 3KUXA 4JJFA 4BMVA 1E3EA 3KV3O 1MC4A 3UFXA 4BNHA 4FGSA 1AGNA 4WLFA 2ILTA 3AM5A 4GBJA 3OM9A 2DBQA 3BHIA 3UAGA 4OAQA 3LT1A 3DZBA 1GV1A 4BGIA 5L9AA 4LW8A 4PLVA 4K6CA 3ZWYA 3PP8A 4R1NA 1NR1A 4L8VA 3PGXA 1P1JA 3NEPX 4E31A 2D59A 2VWGA 1NPTO 1A71A 1Z74A 3PFWO 3QLJA 3GNQA 3M6IA 5I9LA 1LA2A 4PIVA 2GN8A 3DONA 3WMXA 3H4VA 3DXFA 4XCVA 3U4HA 4DQVA 2YW9A 3STHA 1DHTA 1F14A 2ZTUA 4JJGA 2NUAA 5G4KA 3TJRA 4EGFA 2HMVA 3PHHA 1UDCA 2POQX 3IQDB 1Y5MA 4PLFA 2EERA 1I10A 3GVXA 1H0KA 1IE3A 2IDZA 2J6IA 3E82A 5C5IA 2E6UX 2Q45A 2B0JA 4NFYA 3CIFA 1DFGA 3RC1A 1U5CA 3DR3A 1X13A 4HWKA 2YHUA 1HEUA 4IDBA 4ZQFA 4BIIA 4NNJA 4CV3A 3CPSA 3VH2A 1DEHA 3D0OA 2JHGA 3D7LA 2AG8A 2C5EA 5L7WA 3TL3A 1QSGA 2Q2WA 3KRTA 2O2YA 1BWSA 1PU2A 1NVMB 3FPCA 4OSOA 1YGYA 2AEFA 2NVUA 4J4BA 1LLUA 1GV0A 1CJCA 3OIGA 4H16A 1O89A 3MEQA 2VYVD 3P5SA 4PZDA 4MP3A 5JDCA 2B37A 3MZ0A 2W2KB 2AQIA 4R9RA 3VKVA 3X2EA 2W2LD 4BKOA 3BAZA 2FPIA 3H2SA 4N5MA 1TB4A 2GDZA 1PJLA 1QYCA 3L9XA 4YJHB 3GT0A 3VC7A 4MKRA 3ZN2A 1CETA 4R1SA 5CDTA 5LDHA 1WMAA 2WD8A 2ZQZA 3GZNB 3PJEA 1E1NA 4RVSA 3R0IA 1U2DA 4LMRA 3E18A 5EN4A 3ZW8A 3B1FA 1DRUA 3E9MA 1XHLA 4ZRNA 4NJMA 4XYBA 3RUFA 3DAGA 3VDRA 1AXEA 3FF4A 1NR7A 2Z95A 4XR4A 1M76A 2AMFA 4BKRA 4BO9A 3K2BA 5JXWA 4F6LA 1YBMA 2VT3A 3IOYA 4NQZA 4NFSA 2EF1A 2VWHA 1M75A 3HDQA 4OJNA 2FR1A 4YRBA 5JS6A 4B3HA 4DIFA 2PH5A 5JFOA 1F17A 1YBVA 2WMDA 5TJ9A 3LC2O 5A3JA 5H82A 1FDVA 1M2WA 5ES3A 1NQOA 5ILOA 5TQVA 3WGZA 3N7UA 4MIYA 5BSFA 5IDQA 1EUZA 3CZRA 2E48A 1SMKA 2AE1A 3TDKA 3W4KA 3IAHA 1ENYA 4NJOA 5HM8A 2GASA 5DT9A 1B3BA 1DIGA 1LU9A 2O3UA 2B35A 1NVTA 4IY1A 3ZHYA 1NNUA 2EG9A 2JHFA 4A10A 2JD0A 2QRKA 1B15A 1U7HA 4WCFB 2VCYA 3PVZA 3ETGA 2SCUA 1LNQA 4IDEA 3V2GA 3U62A 4CMBA 3TOXA 4CQMD 4IIUA 2NLOA 2QX7A 3NT4A 1T4DA 3OETA 4TRNA 3V5NA 1Z82A 5HTOA 4FW8A 4FCCA 4CR7A 3TZQA 2NWQA 1X7HA 5JO0A 2VWQA 1YONA 3WJAA 1BHSA 2WE8A 3AOGA 3C1TA 1QP8A 3FR7A 3JV7A 2AW5A 2J3KA 2O4UX 4FB5A 3DHEA 3MJ4A 1DIRA 2A9FA 3W8FA 4IGEA 5K6AA 1WWKA 2JKVA 2R6JA 2VZ0A 1QG6A 2WM3A 3PHLA 1NTOA 1V8BA 2FR0A 4PLPA 1GPJA 1BXZA 3G1TA 2VHVA 1P77A 2GZ1A 3IC5A 4M54A 3ZV4A 1I3MA 1JAYA 1V6AA 4P8RA 4MKZA 1HDZA 1MX3A 4URFA 1RYEA 2TMDA 4R68A 2ET6A 2D5CA 2W8ZA 4QT0A 5B12A 2GO1A 1IPEA 4I9HA 2YFHA 4E12A 5GZ3A 4MIOA 4GX2A 3DTTA 1NYTA 5KKAA 5JCJD 1HE2A 2I9PA 1EDOA 3U0BA 1BSVA 1NBOA 5IDYA 4EJMA 4EITA 2Q46A 2I65A 1EVZA 1LDBA 1FDSA 2V6GA 4IGFA 4AJNA 1R37A 3PZBA 2B4QA 1SPXA 4A73A 4FFRA 3ORFA 1DLJA 5FEUA 1KVQA 4LK3A 5A9SB 4A2CA 4WGGA 4EDFA 2Y66A 5JYEA 4CMIB 5TIIA 3H9QA 4S3MA 3TZHA 5U1PA 3GG9A 5J23A 5BSHA 1XELA 1R15A 5T57A 4GLOA 3QQPA 2EJVA 2RHCA 3B1JA 1LDGA 4J1NA 3QV1A 5EPOA 1HZJA 3Q9UA 3F9IA 3JQBA 4CM8A 1N5DA 2V6MA 4OQYA 4WK6A 4TVOA 3I9NA 1CIVA 4CUKA 3JYOA 4BGVA 1D4FA 3L07A 4CM8B 5GZ1A 1DSSG 2Y1FA 1IB6A 3UOGA 1X0XA 1E1KA 4I08A 3HDHA 2Q49A 3OQ6A 3PIIA 2DUWA 3AK4A 5LDGA 1W6UA 4B8WA 4Y6PA 4I9UA 1XKQA 4CQMA 4WNIA 1P74A 3WG9A 4RPLA 2ZB8A 1C0KA 1SAYA 3KSZO 1X0VA 3OEYA 1UXGA 4IXTA 2WEKA 4CQLA 3DFUA 3JQCA 3LT2A 3WFJA 4YDRA 1U28A 4W9NC 5JBIA 4RF2A 2NVWA 4HNGA 2P9CA 1CRWG 4XIJA 5K9ZA 1LUAA 2BHLA 4L74A 4LRTB 3W6ZA 1VJ0A 1UAGA 4YA6A 3D3EA 1UZMA 2BFOA 3LT0A 2R00A 4OKNA 4UREA 4LVUA 4AJPA 1AHHA 1IYZA 2QZZA 2WD7A 4IJKA 4D3DA 2IXAA 1BMDA 3OFSA 3RUAA 4O6VA 1T4BA 3QWIA 2O23A 3S8MA 3PWZA 4RPJA 4II3A 3WBFA 1DO8A 4DPMA 2H6EA 3WIDA 3O8QB 1MC5A 2WYWA 5I7SA 3IKTA 3C3XA 1LLCA 3JQ9A 3HADA 4NDNE 1Z6ZA 2FY8A 3BHMA 1NFRA 3RBVA 2X86A 4Z0PA 2DU8A 3GGGA 4W6ZA 3U4IA 1DRVA 4CMCA 1W73A 3Q2KA 3LYLA 1Q1NA 3WWZA 3GPDG 2HRZA 4OO3A 1P0FA 4FFLA 1GUFA 2GZ3A 5A9TA 1YQXA 1HDGO 1I2BA 4NG5A 4D45A 2JAHA 2NTVA 1A72A 3UKOA 3EVTA 2GN4A 3OA0A 2Y1EA 1TXGA 4W99A 2VQ3A 5JNLA 4PLCA 5KCZA 3IJRA 2GN6A 4CLRB 3ONDA 4XYLA 4HFJA 3GNSA 3WR5A 2IZZA 4J2HA 4MVJP 2DTDA 2AQ8A 1QLHA 3O03A 3OJOA 3VPXA 5DDIP 2VWPA 4YT4A 3F5QA 4J49A 4JBIA 4LMPA 4JLWA 2X0RA 2JD1A 3GK3A 3RASA 4BO7A 1HLDA 1PWZA 4GGPA 2O3RA 4RVGA 1YOVB 2DQ4A 1GADO 2C82A 3VZQA 3WOHA 2GPTA 3DO5A 1CQJA 4PRKA 3RCBA 3LC1O 3NTQA 2F00A 4YXFA 5KIAA 1H6CA 3FNFA 3RBZA 4CMEC 2PKQP 4WLVA 3ZWVA 4J0FA 4JROA 4ZA2A 4CUJA 3AUSA 4YEDA 4DIOA 4RF5A 3QA9A 1NQ5A 1P45A 3C1OA 4Y9DA 5JPIA 3ZWXA 5IDWA 4BGUA 2FSSA 4M49A 2BFAA 3H7AA 3ADPA 5CDGA 2Y67A 3D5TA 4NMHA 3RIHA 4E6PA 1E3LA 3PIDA 1SB8A 1Y9AA 4PLGA 1T1RA 4G81A 1GUZA 1PL6A 3BTVA 1ISGA 2O3TA 5L3ZA 5TT0A 5I7EA 4A26A 1XQ1A 3ZZNA 4HBGA 2VNAA 4WKGA 1C1DA 4FBGA 3WJ7A 4XYEA 3I9LA 3VVCA 4MVJH 4ND4A 4GX5A 4XR9A 5U4QA 5TX7A 5IZCA 9LDTA 4D41A 2P9EA 2DPHA 2DUUA 1FDUA 1H6BA 1JAXA 1SNYA 3PYXA 4FR5A 2YV3A 5KJCA 1OAAA 5THKA 1KY5A 4YJHA 2Y1CA 5EERA 4D0RA 4OH1A 3INGA 2HJRA 1HYHA 3UCFA 5CDSA 3DBHB 3TPCA 5DULA 1CEQA 2AHRA 1A4IA 3DZIA 4IDAA 3A9WA 3S2EA 2X5KO 4ND5A 2W90A 5A06A 5L4NA 1I0ZA 4NJMB 3JD0A 1ISMA 2YQ5A 4BNTA 2PZJA 4R3WA 5JAIA 1V3VA 1E1LA 5JCXA 4E5YA 1N9GB 1ZH8A 4W7HA 4PG8A 2YDYA 2C54A 4E5KA 1DJNA 3AUAA 4AG3A 3K6JA 4TKLA 5G4LA 1M67A 5JY6A 2BFMA 3NGLA 4TWRA 4J7XA 2DKNA 2X8LA 3GZ4A 1PL8A 4J7UA 2DFVA 4IJWA 1MXFA 2Q4BA 3ZDFA 4DGSA 4WNCA 1PIWA 1R6DA 3AM4A 3ENNA 5JW6A 1XDWA 3MOIA 3HN7A 1HZZA 4RGBA 2EIHA 2P68A 4EEZA 2B36A 3CEAA 3BMCB 1P1FA 1R12A 2VUTA 3PRJA 4XJTA 3NYWA 4PVCA 4Q3EA 1H94A 1JWBB 4N5NA 4DQXA 5G0TA 1PJCA 1U8FO 2PGJA 3GQVA 1HRDA 2VYNA 3NKLA 3LLVA 4BNNA 4CR6A 5A5EA 1RM0A 1YKFA 1T2EA 5JDIC 2ZJ1A 1UP7A 2RH8A 3JQGA 3PJFA 4XJSA 5ILGA 3RC7A 1PTJA 1QYWA 4QEDA 4XWYA 3WFIA 2DLDA 3GN2A 2CUKA 1KC1A 4BL5A 4R41A 1R4MB 2VNSA 2JAPA 2HDHA 3R6DA 1YBAA 4D42A 1PGPA 1JU9A 4ALKA 5HRUA 2OBNA 1F0YA 3RUHA 1LI4A 4IIVA 1JDJA 1XIVA 2E4AA 3I3OA 1KS9A 3GR6A 3M2TA 4WE3A 3TWOA 3SLKA 2J3JA 3U4DA 1L7DA 7ADHA 4E0BA 2YZ7A 1DOHA 5KVCA 3S2GA 3RAJA 3I4CA 4E3ZA 3H9EO 3C85A 3L4SO 1YWGO 5L51A 2B5VA 1BRMA 2QG4A 4GWKA 2O3JA 2P91A 2XXJA 1B8VA 3FI9A 1I24A 2G1UA 2AEMA 1EQUA 4PZCA 3KYCA 4TZKA 1U9JA 5T64A 1E77A 2NVUB 1R4NB 3KXDA 3CTMA 4YRAA 4TVBA 4DUPA 4NBTA 6LDHA 4CM5A 4I5GA 4RV9A 4E30A 3JQAD 3BMNB 1NQTA 4UVEA 1HDOA 3MJEA 1JWAB 3DBLB 1Y81A 4CLOA 3CE6A 1HF3A 1CWUA 4B7UA 4I8XA 4IDGA 1LBEA 1N2SA 2RHRA 3ANLA 2VOEA 1LRKA 5L7TA 1LDMA 3ROKA 2NU7A 4EZBA 3VZRA 1ONNA 2J5RA 1GZ6A 1YDWA 2VRCA 4IDFA 3UCEA 4CLOB 1ENPA 4QXMA 1YH3A 3W1VA 1ZK2A 2ZIZA 2HKIA 5H83A 1DHRA 5DBGA 3P19A 3PHIA 1MB4A 2Y99A 4J7CA 1PZEA 3U5TA 4PLTA 3AI3A 1YO6A 3DQPA 3SC4A 4IQ0A 2DC1A 2DAPA 4NR0A 2EW2A 4IMPA 1FXSA 3GC6A 3ZV3A 2IXBA 3D3WA 1N1GA 2R00C 3DZHA 3N74A 4RVHA 4QTZA 3FBTA 1YRLA 3PHJA 2X0NA 4YQZA 1PJ3A 2YYYA 4DMLA 2Y68A 1TA4A 1O94A 2ZYAA 3VH3A 3O38A 4YWJA 2YDXA 3NDRA 5I9NA 4O63O 4W7IA 3VPFA 2WD7B 3AM3A 3ZCXA 3QIVA 2UYYA 4L76A 1HYEA 5ENDA 1X7GA 1UR5A 2PD3A 4PVDA 2VHZA 3ASUA 4NIMA 2GF2A 5A5FA 3WX0A 1U8XX 2OHXA 5C7IO 4LCJA 5I8WA 3S2IA 2EGGA 3DAFA 5IG2A 2CFCA 3IKVA 3INRA 1IL0A 4KDEA 3MJSA 5CFZA 5TLSA 5FFFA 3WGIA 1Q0QA 5CDYA 5CPFA 4D7AA 3ROMA 3FNGA 4M8SA 2VTDA 5TGDA 1CDOA 1UDAA 4P4LA 1KYQA 4QFDA 1EVIA 1EFLA 4CODB 1DDOA 3RUDA 4ND1A 3ZHBA 5IFLA 2JL1A 3NJ8A 3A06A 4MVJA 1LRJA 2CD9A 4DXHA 3HB5X 3TFQA 3DC2A 4OIMA 2W2LA 1GEGA 2DTEA 4OL9A 2JFGA 2VOJA 4S1VA 2PNFA 3RSHA 2YY7A 4WCFC 4BNGA 1ZMOA 1BDMA 4MVJD 2WJPA 5C3MA 2OO5A 3DHNA 4GAEA 1IUKA 4NH4A 4RPKA 4BNLA 4EUHA 5KTKA 3V1TC 1PGJA 1BG6A 1KEPA 3KHUA 4CM3A 2WYVA 4INAA 1JVSA 4L4RA 1VKOA 4GVLA 4B79A 2FZWA 1FDWA 1PX0A 3RUEA 3SLGA 3ONEA 5DZSA 4OOEA 5B4TA 4WASA 2EGHA 3WSVA 3I6IA 3QVSA 2V7PA 4PLWA 5A05A 3CKYA 3QWFA 4IZHA 3L6EA 4XRGA 3DAPA 3I9OA 4CM6A 1DC6A 2EKLA 4J4HA 3KEQA 3E1KA 1HYGA 1EE9A 3JQ9C 1H9BA 1Y1PA 2B5WA 4XRRA 4B3IA 4DLAA 3UGKA 5CG2A 5TS3A 4PCVA 5CEEA 5TJHA 3V2UA 5I7VA 2A35A 4D46A 3WGHA 1V0JA 3JD3A 3OSUA 3TZCA 2OZPA 2A4KA 3H9GA 3RWBA 3TRIA 3VOSA 3DZJA 3NX4A 2QW8A 4FJ1A 3WYBA 2CY0A 4NU6A 4D3SA 4YCAA 1HL3A 3PQEA 3I4FA 1Y6JA 3K73O 3PYLA 1FJHA 3Q6IA 3PI7A 4QX6A 1GYRA 3B20A 4ZQBA 4EW6A 3JQ7B 4CQLB 1NWHA 4EUEA 1SO8A 5A02A 3JQFC 2Q99A 1ISHA 2YHIB 2FPGA 4G5HA 1Y8RB 1ZBQA 2D2IA 4A03A 4UEKA 4BGEA 4Y8VA 4RJTA 1FK8A 3I6QA 3P2YA 4Q9NA 4E32A 4HX5A 4ZQGA 1G6KA 3LQFA 1ZK0A 3DOJA 4IXWA 2E37A 3MWEB 2NM0A 4MJLA 4E5PA 4UUMA 4XDYA 3ON5A 5ICSA 3F5SA 1GU7A 5KWEA 3O8QA 1GQ2A 2BF7A 1H6AA 3KM0A 1C0PA 4H15A 3OJ0A 2NSDA 4J91A 2HU2A 5U9CA 1YS4A 1E7QA 4WLNA 4Z6KA 2G76A 4BO5A 1WAMA 5H81A 2AG5A 5BSGA 3DWFA 2CF5A 3F46A 1KC3A 1CERA 3UVEA 1R0SA 1TT7A 5G0WA 5KKCA 1ADBA 2DTXA 3R3SA 4IINA 3ITKA 3BMOA 5COQA 3TL2A 1P44A 3IL2A 2P2SA 3WIEA 1F12A 1LQUA 4DREA 1AUPA 4RZIA 1HDRA 2IRWA 4OMUA 1D3AA 5KJ6A 3ADOA 3CSDA 4FDAA 3ZWNA 3AWDA 1QR6A 3DOCA 3EY4A 4OXNA 2BRUA 1YE3A 2VHWA 3DFZA 3JQ8A 4OXKA 4DYDA 1EVJA 4DIBA 2FZEA 4IS3A 3HE3A 4PRLA 5AOVA 1L1FA 3IUPA 5IZCC 1PJSA 3GNTA 2O7QA 5TF4A 5AXBA 3VH1A 5IZ4A 1FMCA 3DBRA 4WCDA 4BUCA 1E0DA 1E7WA 3GMSA 1E3SA 3SC6A 4PN3A 4EJ0A 3ZWWA 1ZW1A 2FMUA 4BKPA 3TOZA 4BQRA 1A5ZA 3IS3A 5JAZA 1DJQA 1HTBA 1ZSNA 2I67A 3DBRB 5A9RA 4RLSA 3JQGB 1EEHA 4Q3BA 1LSOA 1IZ9A 4XDZA 4FGWA 1BXGB 3OJLA 4NZ9A 1XU7A 5A03A 2FOIA 4NPCA 2UDPA 3WQRA 1HKUA 2YJZA 3PEFA 5F1PA 1GD1O 4ND3A 3DBVO 4XGNA 3RI3A 3GUYA 1S6YA 3HG7A 3VPSA 4CJXA 2H9IA 4NBRA 3NDIA 5HS4A 1J6UA 2WYUA 3D4OA 1PWXA 1H2BA 5HBRA 1F8FA 3BYZA 2IZ0A 5FWNA 3OP4A 4XQEA 1VI2A 3I1JA 1B26A 2O48X 1WMBA 4IJVA 1ZK4A 3ITDA 2JD2A 1ZKMA 1DXYA 2PLAA 5B37A 3TF5A 3VPHA 4YJGB 4BKQA 1ZNQO 1T2FA 3RD5A 5TNXA 3WS7A 4JBHA 3B6ZA 4KUHA 1Y9EA 1K89A 2ZQYA 3NV9A 2D1YA 4G2NA 2IYOA 1XR3A 2GSDA 4XKJA 4YT8A 2UAGA 5JC8A 1OBFO 4R3NA 5CEFA 1PGQA 3ZV5A 1K6JA 1MFZA 3JD2A 3AY7A 4ZD6A 2EP7A 2H5LA 4PG7A 4L73A 4GQAA 3H3FA 3W6UA 2NNLD 3JD1A 1GQQA 3ICCA 3JQAA 1H93A 4NU5A 1PS8A 4XEHA 4YAJA 4GPD1 4L0QA 1GEEA 3LLSA 3L6DA 5KVSA 4KMSA 2G5CA 1LDNA 4FOOA 4L9RA 2DBVO 2X58A 1O8CA 3ZH2A 3TN7A 1PJ2A 1GZ4A 3OIDA 3ULKA 5DCWA 3B1KA 4HNHA 3FTPA 3VKUA 5G2OA 2Y0DA 1WZEA 2ZTVA 3HDYA 4A7PA 3G0OA 3G79A 3PJDA 3HZZA 4KUGA 2EEZA 2WTBA 1HETA 1TT5A 3WTCA 3U09A 1G1AA 5F21A 5G0UA 4UULA 2RBEA 2O7SA 2DBRA 1N92A 3BMCA 4JP2A 4BNJA 2AA3A 5JCJA 5IXSA 2FP4A 5L45A 1UDBA 1P33A 1GTMA 1YL7A 3RFXA 4AJIA 3WYEA 3WXBA 1TEHA 2DM6A 3WNVA 4YYZA 3GEMA 4DYVA 1EK6A 4X54A 4CL3A 2HRBA 3DL2A 1I5RA 1J5PA 3CH6A 4K1LA 3HDJA 3KZVA 3FNHA 2P5UA 4R4JA 3WGTA 2PTGA 4FS3A 1PGOA 2PD4A 4PG5A 4CV0A 1ORRA 3UW3A 1R4MA 2B69A 1G0NA 4Y6RA 4DVJA 2C2YA 1N7HA 2VT2A 3I83A 4RVFA 4IQ8A 4CL8A 1QYVA 3PLNA 3ZU2A 1LJ8A 1SBYA 3C7CB 1J49A 1UXHA 4JJIA 1HE5A 5IJZA 2GD1O 4IM7A 4R5HA 2OGUA 4TSKA 5KJFA 5L40A 2V6BA 1VLLA 5LC1A 4DWVA 3GRPA 3AFMA 4CLHA 2VHYA 3FTNA 4I5DA 2O4CA 4HXYA 4OSPA 5EESA 2TMGA 4XYMA 5F1KA 1A27A 2I66A 3H65A 1Q7BA 4XIYA 1Z7BA 4DLBA 3GMDA 1RYDA 2PGLA 4EI2A 3ZW9A 1PJTA 1Q0HA 1KY4A 3WQQA 2X23A 1DB3A 4YJFA 3IP3A 3GGOA 3MOGA 4PLYA 3RKRA 1E7YA 1Y8QA
chains in the Genus database with same CATH superfamily
2KLHA 3QLUC 3WNZA 3AESA 4XDHA 4TXNA 3SS8A 1XTZA 3SYTA 3KKPA 3PLRA 2AYXA 5A5DA 1LWNA 3BIOA 1N5RA 1NQAO 2Q1TA 3CPEA 5HJ7A 1MNAA 3IB3A 3DLHA 1SZJG 2QU8A 3A6DA 2DUMA 1MNQA 3EA0A 4G0WA 1ORIA 2HXGA 2W2OA 4KNWA 3G7NA 3ZH9B 5DN9A 4D9HA 2ZK7A 4NBSA 5C51B 1GA6A 2CFIA 2LXNA 2W5UA 1O97D 4GL4A 5K3SA 1E9DA 3DT8A 3K4HA 4KWHA 1BCSA 3DKIA 4UW9A 5EE1A 4AMZA 2WT8A 1G9TA 5JAUA 1X19A 3IO5A 2ZTLA 3LA8A 4AX4A 2EV9A 4KQCA 4RZ2A 4IPTA 2LCQA 5BPFA 1H4SA 3WNCA 3GGSA 5T4HA 1GSIA 1MABA 4JL5A 3SP1A 3BULA 1PO7A 1N5IA 3OLWA 4E4RA 1M1YA 3PNPA 3DBLA 2I2FA 3F1KA 1MRSA 1RM3A 4OUDB 1NMEA 1FUIA 4WEOA 1SOMA 1GCUA 5EJIA 1Z2EA 4QVKA 2ZE8A 2HJHA 1JHRA 3OKAA 5JOQA 1O87A 4A8JC 4BS9A 2CCJA 3BXPA 5E3JA 3SYRA 3PUHA 1P5HA 2OZEA 2X1LA 1QHFA 4ZTZB 2BGMA 2E3JA 3OT1B 3TLBA 3D6JA 1LDYA 3JWIA 3PWSA 3IODA 3KJEA 3M6WA 5HCNA 2DT5A 3O7MA 4YT2A 3M1AA 3B3GA 3GFBA 4HEA1 4XQCA 3UW1A 3I2JA 2EWMA 3M8KA 4ALNA 5FNZA 3SPXA 3X1ZA 4CZ2A 5T5QA 4X7RA 2B4AA 2OVBA 4TWAA 3URKA 3D1VA 1P1IA 1WUJS 2XUKA 4LOAA 5EMHA 3P27A 3F67A 3L06A 1B8PA 1J0BA 1TRHA 1ORTA 1V96A 1Y9ZA 2QNIA 3O83A 4M46A 4CCAA 3TL6A 2LKCA 3IELA 4DA4A 3SKXA 2PRZA 3GAZA 3EZLA 5JMPA 4CHTA 1L4HA 3KOMA 4MGEA 3R7WB 3PQ6A 1F06A 1OB2A 2KBEA 1HWYA 1W4ZA 4PHFA 5A1JA 2C5SA 1BQ4A 3TK1A 1PW5A 3LBHA 4LSZA 3X43A 1M3SA 2HMTA 5TVKA 1CYDA 5AQ1A 2CDRA 1S2MA 1IN5A 4K6KA 3VNQA 1MDBA 1PF7E 5ICMA 1W4CA 5AW7A 3O1LA 5K0EA 1DZ3A 4N8SA 3GROA 1H66A 2DPGA 3SG0A 3IBGA 3WBBA 3JVDA 3ONVA 1IIRA 3ST7A 4RF4A 4JODA 2QAGC 2QRNA 4DCPA 4REQA 3BMOB 2VTEA 1WOMA 4DRXB 4E4YA 3HCNA 1K5HA 4C6TA 3L8FA 1Q21A 3ET4A 1HSZA 2CNWD 2A7QA 4X1OA 1CR2A 1Z62A 3O1JC 3BXXA 5CAEA 5CB0A 1RPNA 1T9KA 3FKSD 3H0EA 2ZZMA 4WLOA 4ROSA 2HNBA 1VIDA 2BZGA 2YC4C 5DBIA 5CDFE 1O0SA 2Z3ZA 2A1TR 2GN9A 3NHBA 1T1IA 1F9AA 1TMKA 2NG1A 1IEXA 3FTCA 3VO9A 5BWOA 8MHTA 1X7YA 3DC7A 3D9QX 3IT0A 3V1KA 1BYIA 9MHTA 2PRYA 3SEZA 1IJKA 3OUZA 1RMYA 3GX1A 4YT5A 3CGGA 4EOGA 5BYKA 4L8GA 1T36A 1P7VA 4TYQA 2P9GA 3OESA 4GF5A 5DXFA 5FTNA 2J3HA 1N75A 1VPLA 2OD7A 5BWLA 1LJLA 2DHRA 1MQ8B 3S55A 4OBWA 4KSBA 1W49A 3E05A 5TMBA 2WPDA 1GT6A 4WEQA 4UBNA 3WY9A 3FSRA 1ZXBA 2GNOA 3ET5A 4YCDA 2CWWA 2PYZA 3WAKA 2R25B 1RRCA 2ZUSA 3W2IA 4BP9A 1KSGA 4QASA 1YQWA 3KTOA 1QZUA 4OHBA 4S1NA 3TSOA 4JA0A 2R8EA 4DCJA 3M6UA 1QS0A 5IKOA 3KU4A 2X4IA 3EIUA 2B2CA 3K53A 1RYFA 1HEIA 2EP8A 4FFDA 1XLTC 1QZ3A 1IBKB 1HFWA 2PGDA 1DX9A 3D4LA 5IF3A 5IUJC 1L7VC 3HVUA 3LFHA 1I51A 4G25A 2V74B 2WUFA 2XDWA 4IYJA 5GTDA 1OLXA 4CKYA 2VZ9A 3HI4A 3MGBA 4F72A 1ADJA 1VJCA 1L8QA 4OM8A 3D2LA 2P8SA 4BX0A 5EJMA 4Y2QA 2J6CA 1MB2A 2P40A 1W48A 2ZVDA 2AFHE 3C8MA 3CSSA 1KJJA 2HMUA 3R6TA 2VQSA 4PAGA 1ZD3A 3HSKA 4GMKA 1A96A 3ZE2B 1PFUA 1U7TA 1U3DA 1KZ9A 4LJKA 3JYHA 4UZSA 1JKIA 3WGYA 4AKTA 3PJGA 1RXVA 3VAYA 5E2BA 1E5XA 1YB1A 1HDXA 3DGFC 1DJMA 5J2UF 3FFTA 5CGQB 2ZUTA 1HFEL 2I78A 3T9DA 3GH1A 4MEJA 3COJA 1Z34A 3H2ZA 4AO8A 5ITZA 2YV1A 1XVLA 3TZBA 1ND5A 1XQ6A 3EDMA 1H69A 4MW7A 1T3TA 4KLCA 5CVVA 1O95D 3ZZUA 2PH7A 4QOJA 2QQ5A 2QNRA 1E1MA 3MT8A 2QX9A 4CEIB 3RPEA 2QUIA 2PUCA 4RQAA 4CI0B 3FCXA 1H6DA 1B14A 3BOSA 2H1IA 3N6VA 2QDXA 1CQIA 2O8EA 2OMEA 1Z6XA 2NTJA 3R4VA 3RLFA 1U9ZA 1CV2A 3DG9A 3EGEA 3GT4A 2KYRA 1FNBA 3MFYA 4Y6LA 2NO6A 4RA9A 1XNHA 3B7WA 4OXIA 4BKUA 5EP2A 2VP3A 4UU8A 4BN0A 3ZDCA 1ZOSA 1BXKA 1DJLA 1NLUA 2QEQA 2VTKA 2W00A 4GMFA 5G40A 1IM2A 1PLJA 1J0XO 2QD3A 3D8TA 4GWGA 1WABA 4PYLA 3GLGB 1Y7HA 3VPAA 4QG3A 1CUDA 3L0BA 4GLLA 4WOJA 2ZBGA 4FDUA 4OGKA 5K4HA 4NC9A 3S70A 1Q0UA 1USVA 2J67A 1Q6ZA 1TT5B 5GVRA 3D7RA 4OI4A 2OORC 1BCRB 1GCAA 4AZSA 2AQKA 4BB5A 1W4LA 2ADFA 1GPWB 4KH1A 3PRYA 4K9MA 3KBOA 2YMLA 5KSZA 4QUDA 2Z6VA 4PSVA 1JNXX 1QHGA 1Y98A 4MQ6A 4XA8A 1WY5A 5DNDA 4C4TA 5KTTA 2Q6OA 1AUVA 3EXIA 3IAS6 4HDKB 4Y98A 3N8GA 2GXSA 1V39A 2GR9A 2IODA 1D0SA 1ZOOA 2CE7A 2Z2KA 4ZREA 3EQ2A 3SICE 1QQ6A 3X1XA 1OXBB 3AMVA 3G2NA 2W2VA 3EEIA 4N48A 3W8RA 1G42A 1NW7A 1GJRA 5BRJA 5AIAA 4PHGA 2G82A 1CNEA 1XZEA 1IONA 4JA2A 2RIPA 3AR5A 1QGOA 1SVKA 3L92A 2EFDB 4G1UC 4IVPA 4N3NA 3I64A 1LH0A 3M49A 4ID9A 4Z3DA 4P7GA 1YDFA 4XGKA 3QRWA 3H6KA 4UDXX 2X76A 3SJUA 2M9MA 1V5EA 3C6KA 3GEEA 4E5VA 5BT8A 5LZ9A 1DAOA 3GRFA 4KVFA 4OGGA 1JSLA 3U9LA 3ZI0A 1THMA 2GXQA 5IM4F 4U9IS 1N3BA 3B3AA 2XD4A 5ICGA 3EZ2A 1R6TA 3HJRA 3WLEA 4X64B 4Z4IA 1II9A 1T5LA 2QBYB 1K92A 4R40A 1A5AB 1SUBA 1P2UA 1WXWA 2Q4TA 3INYA 5F1OA 1P17A 1Q2UA 3R7BA 1XA3A 2VK8A 3BWMA 3I9FA 4QRIA 3ROTA 1U3TA 7REQA 2OXRA 3JYPA 1DTWA 1UZNA 1HQYE 3C7AA 1UODA 2MDTA 3BXFA 4R1TA 3STUA 3F4KA 1DCKA 3KQPA 2B7BA 2OCGA 1ZCBA 1J22A 2BGJA 3L0IB 5F51A 5FLKA 1UUFA 1WD7A 5AH0A 13PKA 1ADFA 3PR3A 4IMRA 2Y3IA 4RD2A 4ZEXA 1CRPA 2RGWA 4FMDF 4ETNA 1USGA 3VA7A 1TUBA 5JSYA 3K5HA 3AH8A 3NPMA 4F5DA 4PBSA 5LA6B 4YRKA 3UK2A 1T5HX 3SAJA 1DP4A 2ECPA 5HSGA 3W77A 1TF5A 2IE0A 2GD6A 3OCZA 1IM5A 2VJLA 3TH5A 4MPRA 2W6JD 2QK4A 3LGXA 3U26A 2GT1A 4XJXA 5A4KA 1YD7A 2PWZA 2XBLA 2UV8A 1VMIA 3H16A 3KLOA 4EZIA 2NP6A 4J43A 1YHZA 4HK4A 4OMCA 1J1ZA 5AJYA 4WFIA 1QWOA 1IXRC 2FR8C 1OXVA 5LQAA 1Z2PX 1GXSB 2JAQA 4MQEA 3Q1LA 4PSUA 2WVAA 4JLJA 1X1CA 1UKAA 3PITA 4DZTA 2NXNA 3H0CA 4CPDA 4V0NA 1KDTA 2VPPA 1Q83A 3ZVNA 3ZY4A 3GFRA 1NNSA 4GOOD 3AFOA 4QUBA 2CK3D 3TAUA 1OI7A 4AL4A 5KVVA 2VJKA 2DR2A 1S7GA 2NZ2A 2GEBA 3GPBA 5HF5A 1V5GA 1ZXLA 4YREA 1NAHA 4YH1A 2BHRA 2HDOA 1QORA 4Q02A 2X1HA 2Q41A 3R3UA 4LE0A 3GZNA 2AWOA 5CLIA 2XA9A 1NT4A 2IUSA 1S4MA 1RAGA 2DPXA 4EB6A 3IMFA 1N7GA 4L15A 1MT3A 2HJSA 5HCIA 3PEEA 1BE6A 5IW8A 5KJ1A 3L6RA 5KYNA 1EFAA 1Z5OA 1JIVA 1QNLA 5BQOA 4DV1B 3OX1A 4K8OA 2DJ5A 3WGUA 1OA1A 2COEA 1RP1A 2UZ3A 3WBJA 1D9ZA 1E7RA 3ML1A 1DJPA 2H51A 3NRBA 5K0NA 4G67A 3QXXA 1ZICA 2HAEA 4O1MA 4UNNA 1HMYA 1U1GA 4LHYA 5G0SA 3VHRA 3VKFA 3EPKA 3INNA 2DY0A 1VGQA 4AWAA 2PD6A 1M7BA 1TVKA 3GHHA 4AY4A 2J1LA 4K86A 2OBFA 2VPYA 2BHSA 4RHXA 5GZ6A 2PLNA 4R1UA 3ZX5A 1QFMA 2P9YA 4KR7A 5HBGA 2HCJB 3E48A 4WACA 3P96A 4BMSA 1ZH4A 1SJ9A 3GDWA 1D2NA 3NORA 5AM0A 4YTEA 4RK4A 1JALA 1RLIA 4E94A 1XMIA 3V4PB 5JSZB 5TB5A 1F9EA 2O1WA 3AR8A 4K0KB 3ZV7A 1K98A 3DJFA 3H4TA 1VSQA 5DSTA 4ZRMA 5KTMA 4PRZA 3G2JA 2P2ZA 1Y34E 1EFRD 2CXUA 4FLFA 1W7AA 2Y8EA 2P4HX 1EFUA 1ADGA 1FY2A 3MMSA 4ZT7A 1O54A 2ZUFA 2XXAB 1UBEA 2PKEA 1D4OA 4KKVA 4UUAA 4RVOA 5E1MA 5FOVA 4GI3A 3W9SA 4QRDA 1ZIDA 3VTFA 1ISJA 4HRYA 3W8NA 3AEQA 1E6LA 4K2AA 1UP4A 3H2YA 3H42B 4ZOCA 4BX9A 4K3VA 4IEFB 2IW3A 3ZDBA 4I9FA 5A3RA 3SF8B 1WXEA 5CAEB 4GR9A 3V48A 1ENZA 1R8QA 1X77A 4UMVA 3TR0A 3GYGA 5FTWA 2Y93A 3UHJA 4DXDA 3THYA 1JQAA 3HJBA 2PLWA 4LI0A 5EL0A 5DCYA 4E03A 1LX6A 1CKEA 1TIKA 3LX6A 4YALA 2ZI9A 3W5BA 4D9BA 2OBXA 5KYGA 3REQA 5EIOA 4P82A 2O5RA 3RKUA 5A2QA 5HNKA 4GI5A 2IZOA 4HB0A 3VH4A 2EARA 3GDFA 3VUEA 2ECFA 1DLIA 4MIEA 5T4FA 1P9LA 1P0CA 4DCVA 2BELA 1Z3IX 1DXOA 3KPJA 3NM6B 2JGAA 4UM7A 2PL1A 3OQVA 1ZC3A 3MA0A 3QKRB 5A2GA 5AI8A 1JH8A 2A86A 2ATIA 4C89A 3PTZA 4XUCA 5AKXA 5BN5B 3OBBA 3T5DA 1ZNZA 2GZRA 3NTUA 3QEMB 2QRUA 3HV2A 4UM8B 2JF0A 2B94A 1FXWA 4UEOA 2FF7A 3QOYA 5EOVA 5EE0A 5K4GA 3K8ZA 4QOSA 3EG9B 2ERXA 4FYIA 5AM1A 2E6KA 4DPKA 3ASYA 2YWJA 4F4FA 3Q11A 3F71A 1CUXA 1YDEA 3EIQA 1R0ZA 4MVJG 5HKLA 4L85A 1JT2A 1WDLA 1U9IA 3O26A 3NALA 4ALLA 1GG9A 4AXXA 1KKUA 4QOFA 5L8VA 3S40A 1N2IA 4F3RA 4JXJA 721PA 1MCZA 1JB9A 1W2HA 4HEQA 1AXGA 1L5WA 1FW6A 3KJHA 2AXPA 4FI3C 1XWFA 3AINA 1XMOB 1EP1B 4RH1A 1FSPA 1YZUA 2CZCA 3JZAA 3GOQA 4CR8A 1MAUA 4WJKB 3MUOA 4NE7A 3QF4A 2ONYA 3KUUA 2GERA 3X1MA 2F1IA 3WGOA 5JJKA 1ZVMA 1COWA 4HDAA 5JYDA 4PC7A 5DYYA 4GC9A 5I6DA 1YI1A 2H7XA 3V1NA 1KI7A 3WLRA 1WW8A 1HOTA 3U7JA 1F5NA 3TLGB 1NOKA 1QHHA 4CKWB 3V97A 4L9AA 3UGJA 1UJNA 1HDEA 2HA6A 1KVRA 4GEGA 5FNVB 1XPOA 1Q6YA 3TGPA 4IDDA 3I8SA 1E0AA 4IMJB 3ANMA 3TNFA 3HKCB 3F2VA 3EEQA 4K9NA 1EZ1A 3TLCA 4YAGA 3TVDA 1W75A 1LPBB 4URWR 3CO0S 3BD7A 2JFUA 4G6ZA 4PFQA 5LU8A 1G2OA 3NNNA 4D43A 2BHTA 1S9DA 2BEUA 4ENVA 5KO2A 3TPZA 2ZB7A 4P36A 1I0LA 4XIIA 2ZM5A 4W9NA 1BW9A 1JKJA 3EAGA 1RZVA 4KL8S 2ILVA 4PAOA 3RK4A 2W6ID 3DBHA 4DBVO 1E0JA 2O8CA 4JENA 3L4JA 1P0MA 3PX7A 3PUYA 5FV4A 4ZKEA 4BBZA 4UVDA 4BFZA 1KIFA 1QIDA 1WB4A 3T7DA 5I7FA 1KZ1A 2JIBA 2NGRA 3P2IA 4U2GA 4Z1MD 1X3SA 5GJCA 4D4MA 2PZLA 1JN0A 1VMDA 5LP1A 2FUG1 3GJTA 4HXGA 2IYLD 2YVLA 1CY4A 2PN1A 3TTYA 1DO0A 1GL7A 1SELA 1SGWA 5LQMA 5EYPA 1RYMA 3HKBA 3N6XA 1MEJA 3NOQA 4RIHA 1TEZA 2FP3A 5CYPA 5SZKB 3GRCA 4U6QA 1YA6A 2B83A 5L4LA 4J7AA 4WADA 2W8BB 2NU8A 3HZHA 4ZQEA 3E7WA 3F6EX 3RRXA 2OXEA 3UAOA 4YMGA 2HFJA 4ED9A 4D97A 1OWPA 1Y0BA 4Z3KA 1XU9A 5AJXA 1NLMA 3IUSA 1R9JA 4IHJA 3M34A 3I8OA 4Z7NB 4U7JA 1IATA 1Z9BA 4ALIA 2JB9A 4MQBA 3T7EA 4E09A 1XC7A 3QFFA 4WZAB 1H2RS 1B8UA 1NJ6A 5KTPA 2E7ZA 5AKEA 1OFGA 1KY3A 2PSDA 2DBYA 4YLGA 4Q3OA 5G53C 2OAGA 1KO7A 1RXSA 2HEGA 1ZD8A 4LY3A 4RVNA 5EWJB 3VTZA 2ZR0A 3ZE8A 4D3YA 3T3OA 3L18A 1FVFA 1YC5A 2PKRA 3R4CA 4EYOA 3V8PA 2Z9BA 2GFIA 2G09A 1HTWA 2FJUA 2FRVA 2BSXA 3LQ2A 3PPIA 4INPA 4NYMR 1U7ZA 3K0CA 2XE7A 3NETA 3O8OB 3W7BA 4ESHA 1WXDA 4H77A 1ZL0A 1J0CA 4KWTA 1RWOA 5AW4A 4F5ZA 1NGSA 4E08A 4FFBA 1G6Q1 1XZIA 5E7JA 3PEWA 1O77A 4H27A 3KOUA 1PKEA 2DHQA 3H83A 3IKLA 3I6MA 2PX4A 4MVJI 1MV5A 4B43A 3FI0A 1XA4A 2LWIA 2V55B 4N8EA 3DP9A 3WLHA 5KQPA 5IXYA 5THXA 3U3KA 3IDOA 4AJ4A 5HWSA 3IH5A 2JGRA 1XRSB 4QBTA 4OEHA 5DLDA 2PCLA 1TAQA 2CLHB 1THZA 3GN1A 4NCNA 3UOAB 4CF5A 5AKLA 1QUFA 1D4AA 1FP2A 3GLIE 3I05A 2CDBA 4JAVC 3RARA 4QT4A 1G98A 3H1AA 3BJMA 3LF2A 3PIRA 2WWHA 5G0VA 3BX1A 1X15A 5K09A 3ZCSA 1QS0B 1LEHA 1WDKA 3K31A 1FTWA 4HFNA 4OHOA 2B8TA 1TLFA 1U5BA 5BURA 3OQBA 3RW9A 2ZTSA 1VJDA 3K7EA 3ZWPA 2BGIA 5M34A 1Z56C 1ZZEA 1L9KA 4IUYA 4JSTA 4XIFA 1C1DB 4Q1DA 2Z8ZA 4X91A 3GUCA 2Z1NA 5DGIA 3SDZA 4TTSA 3TSYA 5GIOE 3NGXA 4HGNA 4RDHA 3VV2A 4Z86A 2FR8A 1XG5A 3LS2A 1IZ8A 4V03A 1LK7A 1B4DA 3E1GA 1J06A 4K6OA 3ZIAA 1LI7A 3QPCA 5ARCA 4G0YA 3U4GA 2C1ZA 4C08A 5G3ZA 4GYWA 3HYSA 4A15A 4ZI7F 1E59A 2J5QA 3DUFB 3LGSA 4KPEC 4O4HB 5EZQA 2HF2A 4Q48A 2QMQA 1UBNA 4GHWA 3ZD8A 3P0IA 1Z7EA 2AGVA 5ALQA 2OENG 2X13A 3EPRA 2BFFB 2HPZA 5EKXA 3T9FA 3W0LB 1XLVA 1Z4NA 1FYEA 1YBHA 3L1IA 1A5SB 4BEJA 4CV2A 2CYBA 1FVOA 5DX1A 3WMEA 5JAMA 1E0SA 2CSUA 2VDRB 1FFAA 2MT9A 3W8DA 5BUSA 4F85A 2KBFA 2QPTA 3W3AH 5IT9A 3WA7A 3JVVA 3SS7X 2HREA 4QPNA 2RH5A 3W2TA 2PSHA 3JYQA 2PRIA 4GM4A 2XYGA 1O6ZA 2GJAA 2VDQB 2X9NA 3HPQA 3DEJA 1JFRA 1KORA 4PZPA 3MAJA 3SX2A 4HYYA 1X1BA 3C15C 5AO9A 5ITVA 4COOA 4MKFA 3L8GA 4KXYA 2JRCA 1U2GA 2FPLA 2MHCA 3LX5A 5LZ8A 5KOIA 1IVYA 4WXPA 1TDJA 1WV0A 2CVFA 2HCFA 3MF4A 1F8XA 1G7SA 3LSTA 3FR8A 4YJDA 2ESRA 3KQTA 4KC0A 4YJ2F 3UHFA 4JN6B 2PA3A 3COWA 3PEVA 4R5MA 5DP2A 2C92A 1QQTA 2XMZA 3LFTA 3NZEA 3PQ3A 4AZVA 4KR2A 3CJTA 2ETXA 5FPSA 1VRCA 4DCSA 3HU2A 4DR6B 4UKDA 5TGZA 4N1AA 2BOVA 4RL6A 1Z8DA 1FTNA 3DTYA 4Y67A 1TYEB 1UMDB 4JIGA 4LJ9A 3TR6A 5AVRA 5ALFA 3FCYA 3VKGA 4FMCB 1JIJA 1WCWA 3CYFA 4CMEA 1J97A 1DTSA 1HBJA 4DZRA 4WOKA 1EP3B 2OBYA 4AJ1A 2QTBA 4HLNA 3SMVA 4LBWA 4LZAA 2QUBA 2DG2A 2XD9A 1X7DA 1E4EB 1XV5A 3F1LA 1XAJA 2A0YA 1C30B 2IYEA 1DIBA 3QLVA 4MULA 2JARA 4PAQA 3DKPA 2OO7A 3PL1A 3UK6A 4E5SA 1C29B 4J76A 4L6IA 3ROXA 1TYZA 5J43A 1RCFA 1R1DA 2HT6A 2ATCA 2D5IA 4HPJB 1FTYA 3Q2IA 4M0DA 1UL1X 1VYTA 2KI5A 3IEPA 5B4VA 5HZHA 3WYCA 4CVNA 1TLLA 2G25A 1XD9A 4ZP1A 2QTVB 3EK2A 1YSCA 3W79A 5EHZA 5P8WA 2ZYDA 1DAPA 5SY6A 2OORA 3NBYC 3ZEAA 3PJRA 1P7ZA 2VF8A 2QZPA 3T5CA 4X9XA 1UQRA 2RI1A 4HUQA 3L41A 4RCYA 3RYFA 2GEFA 2XQIA 3ESDA 2QTHA 1AF4A 4OF4A 4JHXA 4XD7A 1E2GA 3IV7A 3V4LA 4RTRA 2AI2A 2Y9MB 3PFNA 1JIUA 3QVTA 4I4TF 4N7BA 4Q93A 3SY8A 5K5EA 4YV1A 1DKUA 2D0OB 3ZQUA 2QTTA 1XTVA 1R0KA 2JGDA 3CRW1 3R9WA 1QOPB 2D8MA 3V2HA 1GUYA 2LNDA 2GM4A 1Z73A 1Y7LA 1XLTA 2BFCB 3ZJUA 1A9RA 3IBTA 2FMXA 1E2MA 1FFCA 3NOVA 4X94A 4P34A 2ACVA 1B43A 4IVRA 2FGKA 2OUKA 3O4RA 4GZLA 1TAUA 2OFPA 1I2CA 4Q18A 5I9MA 2ZR7A 1I6WA 1YFJA 4EG8A 5A4DA 3A0UA 3PNOA 4K9DA 3A4NA 1NASA 3W4JA 1JFLA 1OHHD 2C29D 3A25A 1HMPA 1XXHE 2DECA 3FNRA 2Z1MA 4BLTA 4DLWA 3KXKA 3VR5A 3OE5A 3SYKA 1JW9B 4F6RA 1FBTA 5AI4A 2IELA 3SBEA 1Y1KE 4GZ6A 1YI0A 3WGGA 4C0LA 3LOPA 2PL3A 4NCAA 2O8DB 3E0QA 3LK7A 3PFIA 2HOQA 1OTXA 3M4XA 4QU8A 1WLYA 3QJYA 5LYYA 2NXWA 3OOSA 3OX3A 2W48A 3I01M 3OICA 4Q5IA 4LRYA 2M6KA 4DE5A 1FYVA 2KMLA 3PFHA 1SOVA 5E7IA 2QRJA 3BB1A 3DF9A 2EZ9A 4R7ZA 3KETA 1P91A 1KI2A 2X3UA 3FLAA 3K0FA 3KSRA 2QSZA 4BV3A 1J23A 3E3NA 1P0IA 3L1JA 4ZARA 4CMHA 2ID7A 4DA0A 4TSRA 5PGMA 4MV3A 1RC1A 2BW0A 3QY0A 2WHPA 2WJIA 2O50A 4PNPA 4W8OA 1T0HB 2WSSD 1MGPA 1N1EA 1ODTC 2CJWA 3DDWA 5BSEA 4GOJA 1QFXA 4TLEA 3ZNOA 2JJQA 2UVDA 3HDVA 4B2YA 3PPWA 2XE8A 3MTIA 4RL4A 3OJFA 3BK7A 1R7RA 3RYIA 4E5NA 5BQFA 2VQFB 2Q62A 1C1XB 1IHXA 1GQRA 1NJ2A 1U7UA 1UMBB 2NPOA 2PL9A 4IS2A 5ALLA 3THRA 3UMYA 4AKEA 1EDBA 4IOJA 4QPZA 1W4BA 4RNCA 4DIDA 4J9VA 1OI4A 3JALA 3RYIB 1WXGA 5DBOA 1V1RB 1B73A 4US1R 2OGTA 1XN4A 3GJ7A 1QIHA 1K0UA 3I8XA 2C4VA 4U1RA 4Q03A 4CF4A 2W4IA 3BF8A 1UAYA 4YB8A 1RYBA 1JRLA 1QJCA 3A14A 4IJ6A 5LP6A 2ZDGA 2J7KA 2A3RA 4O2BA 3EFEA 4N18A 1FMLA 3L8ZA 4AFNA 3FUUA 3EJWA 1OYYA 4RHFA 1QFYA 1N4DA 3HRKA 1MA0A 2OV2A 3R7WA 1W581 2ZCJA 1SVUA 1KYTA 2OV3A 5E7MA 3K5IA 1MIOB 4M7OA 2NNWB 3VOTA 5JJ5A 2OQIA 1Y3DE 3G49A 4XVCA 2R7MA 3B2NA 1RLJA 3CONA 3QEJA 4G1CA 4RPGA 4UAGA 4XX0A 5IEJA 1Z63A 2CEAA 1O4WA 4WNAA 5F3RA 2Z6AA 3MELA 4BWYA 1ZRNA 1RACA 3AWIA 3WQBA 4AULA 1SUEA 2PH1A 2Z57A 4M1EA 1SIOA 2XTMA 4GOXA 2O2JA 3BWDD 1YT5A 1RYZA 3LL7A 5SYMA 5IJ0A 3FAZA 1LXCA 4YCJA 4WCFA 5EMLA 1BDBA 2G4VA 2A88A 1MGOA 2Q50A 4AJKA 2J59A 4FFNA 4S2UA 1JA0A 1K7EB 4PICA 5T4EA 1NXWA 1QE5A 4COKA 4BO6A 4YLYA 5JTTA 1N5MA 2F1HA 1JPUA 3BJEA 3HUFA 3OPQA 3FFXA 4TKMA 4YUZA 4QAJA 1LSSA 2BTQA 3NHKA 4M9RA 1UPUA 1ZO8A 3KKNA 2HHHB 3IEMA 4WA7A 1E1QD 2CJYA 2WKPA 3E7FA 4FMCF 4QTTB 3VHLB 2Z2YA 4LRXA 1NX6A 4MB6A 1QYDA 2F3SA 4IH1A 2ZITA 3OIYA 4M6WB 1G20B 4XAQA 2ZRMA 2C99A 2CK3A 1Z0AA 4GI2A 1PL7A 4LYAA 3OEWA 3EXEB 1LCIA 4YRTA 4ES6A 4JLPA 1IHPA 2JI8A 4EVRA 1GAXA 3KVOA 3AB3A 3C16C 2ZKIA 1KI6B 2A9PA 2MYUA 3SYLA 3MTEA 2A6PA 1K6MA 4WINA 3X3HA 2N9UA 4MA0A 3HMQA 5CNIA 5ADVA 1LK0A 5AKYA 3LY5A 4CBVA 3GARA 3G68A 1NC3A 4JUDX 4DQ0A 1XQ9A 1ISIA 2PZAA 4NE9A 4NDZA 1S02A 1WSDA 3BIWA 4AY2A 1YQTA 1NVKA 2I0FA 1XJWA 2Q7DA 2X22A 4WL0A 1CB0A 5CFRA 4OKIA 3SC2A 2HR1A 2Q0QA 4I99A 2IE8A 3KIPA 1OBVA 1U0JA 4PY2A 4XZ3A 5E6SB 5FFMA 5KNBD 1FF9A 1AN9A 1E3WB 1WVMA 5GINE 1V7QA 3NATA 2C7GA 3KTDA 4XCXA 5AOCA 5EP3A 1ZSVA 3M81A 2ASEA 4HYTA 4NV1A 2O0LA 3WLFA 5JXGA 1MC8A 2Q4OA 4Q39A 1E5VA 1GKLA 5LB2A 4OFZA 2MINB 2XOXA 1AM4D 3TB4A 4ZO7A 4D3DA 3C48A 2XTAA 4C0XA 1D5WA 2DP4E 3BXGA 1OPXA 3ECSA 1R16A 1T6BY 1VECA 3KKOA 1YR6A 4UM9B 5IBRA 1KVUA 2B8EA 3Q0EA 1VE5A 2CCKA 3Q6NA 1R88A 2XUQA 4K9SA 4G5OA 5A9SA 1JJAA 2MJLA 2C8VA 1JT9A 3QP9A 1O0BA 4O2RA 4YRDA 4ZCLA 5TC4A 5LBIA 2AYYA 2W11A 7YASA 3WLJA 1OTHA 4G5GA 1SQGA 1AKEA 4MUAA 4U0KA 2WSIA 4MWBA 2ZUCA 3ESRA 3HKCA 2X9QA 2INGX 4NPHA 4ZOLA 2D0IA 1U1IA 4QRHA 3BK1A 2PRJA 3R3XA 4EK9A 1T34A 2ZBVA 5AVSA 3U1VA 4EHDA 1F2UB 1SC9A 1GQFA 5ALNA 1F0NA 2FPSA 3ECAA 3ZZ1A 5EIXA 4PZEA 4Y9RA 1ZI9A 3QMPA 4DBLE 1E5LA 1JE0A 1K3TA 1KJIA 4AUEA 4E2XA 4JU8A 2RGGA 2O8CB 2DHEA 3VPGA 3TLZA 1G4AE 3H3XA 1XTQA 3LPCA 3OTWA 1COZA 4XWGA 1SBHA 3WL5A 4KREA 2H16A 4RCVA 4BNWA 4EYEA 4ZI5A 1M6HA 3PNVA 4G26A 3JATB 3LVRE 3B13B 2J3QA 3FJYA 4GD3Q 2JLBA 3LIPA 1O5TA 5DJ5A 2R1TA 3BG5A 4XVRA 1VA5A 5IX8A 4PYKA 2H2GA 3VR2A 2FSFA 1VJ1A 3JYNA 1MENA 2V5UA 3TFWA 4ZXPA 3QJGA 4R8RA 1RCTE 4P3PA 4KZPA 2VCEA 4C7JA 4AJEA 1YKSA 4P38A 4BQEA 3K30A 3VGJA 4ASUD 3MHTA 3F49S 2PQ0A 3K5WA 1VYUA 3OPMA 4ZICA 4JELA 5BSVA 4TLBA 1YL6A 3H1TA 2H4XA 2D5BA 4S0XA 2O2XA 4Y7DA 2YHAA 3V7NA 1O1YA 3EMDA 3QVLA 2OV4A 4PZUA 4BEBA 1CZNA 5CM8B 1IH8A 4V0QA 1MJFA 1L6RA 2ZANA 2ZWMA 3TMYA 2CLOB 4OJTA 3VYTB 5CBPA 4G8DA 3T0GA 1RBMA 2RB5A 3VVMA 1IZ0A 1NXQA 3FPHA 3ZXUB 4KE6A 4YP1A 1SC6A 2IEAA 3ABSB 4JQOA 1MJGA 1U11A 5E1OA 4OQ4A 3KV3O 1U7OA 2J9YB 3MXOA 2CT8A 3OD1A 4ZMBA 1GCIA 2GCEA 3JPWA 2Q5QA 3PKIA 3AM5A 1RRFA 1Y3BE 1XQWA 3P26A 4DPMA 3EXIB 4HDKA 3BHIA 4X95A 5EHGA 2X2OA 3LT1A 3PPVA 4H1TA 1GV1A 3V3TA 5JALA 2PUEA 2GEDA 1O6FA 3QI2A 4JUAA 3VX4A 3ZWYA 3ETHA 4JC8A 3DLBA 3O4VA 2V96A 5HZGA 1P60A 2JFOA 2KJQA 3NEPX 4E31A 4EMSA 1T3GA 1JS1X 3BS4A 2BDUA 1KBQA 2D59A 3T1YB 3SOPA 3PFWO 4IIJA 4MS3B 3QLJA 4MUYA 5D00A 2AOUB 4H3SA 1N5KA 1DQYA 1T2UA 2Z9DA 3ZGZA 1LA2A 2GN8A 2Q1YA 1XK6A 3DONA 5CVJA 3WMXA 2VJCA 3U4HA 5CA1A 5HXAA 1NIPA 4ZT5A 3STHA 2Q1XA 3UPUA 2QRVA 3L5OA 3LAWA 4XEUA 4HTAA 1VCMA 1GL9B 3TJRA 4EGFA 2HMVA 4L4UA 3N76A 1UDCA 2XNJA 3NV7A 3IQDB 1A7UA 3R5HA 1BFDA 4QQFA 3LHKA 2IDZA 2R60A 4HQOA 2J6IA 2JIOA 4RC9A 3T5MA 2Q45A 1IUOA 3CKLA 5ALMA 2G06A 4UTPA 3BRSA 4Y9UA 3WJ2A 4YFYA 3T35A 4QREA 3F73A 2YV5A 3CZ9A 3I5YA 4WESB 2Y92A 4ZYYA 2A9VA 2YVAA 3VDMA 3WB1A 1D2RA 1SHZA 4JT2A 2G9QA 2ZI5A 1X13A 2HM7A 4ZQFA 5ELXA 1TCCA 5F76A 1XTUA 3ABRB 2OSBA 3QHPA 1WXXA 1DEHA 1LS1A 3CXUA 1F51E 4X3OA 3VH2A 2O8BA 3LUFA 5C3UA 3SJAA 4NVRA 3VNAA 3SXUA 1L5HB 1BN6A 2VZEA 3EOBI 3QU9A 1X74A 1G5RA 1EH5A 3F7MA 5LPNA 4QYSA 5D51S 1T43A 4WZBB 1AHNA 3TX2A 1GKKA 3WGVA 3WRXA 2IZ6A 2VDMB 4HBZA 4B6QA 1D4ZA 1N6IA 5BYBA 2GBIA 1YQQA 4GDMA 5C8YA 1NZFA 4F60A 4KO1S 2B37A 3UNXA 3AYZB 1NBME 1Z35A 2AQIA 2JVJA 4G0PA 4WZBA 2W2LD 4CTMA 4D5GA 4BKOA 1I1OA 2PMDA 2GAAA 4G0ZA 1BCSB 1TB4A 3AUJB 4N5MA 4RD4A 4UHDA 5G1PA 1II0A 1WMFA 2NIPA 2PT5A 1OY1A 3VXKA 1HG1A 3VC7A 3C5WP 1GNVA 4X63A 1L5MA 1Q7TA 4TUYA 1NSYA 3PJEA 2ZQZA 1O4VA 5K8JB 3D3NA 5J9FA 1PFQA 2OZLB 3OZWA 4MA5A 1RJGA 3LGAA 1JXQA 1PBTA 4NLLA 4QQNA 5KI6A 1DRUA 1YJAA 2ES4A 4ZRNA 4KV9A 4XYBA 1ESMA 1AXEA 5F1YA 4PZ9A 5SY4A 1NR7A 4QE3A 4XR4A 1ZESA 1M76A 2ZPTX 4R2IA 4BO9A 5EJ5A 1Y6FA 5J59A 2WKWA 4OHCA 2PE5A 3K2BA 3ILXA 2H9AA 4RADA 5J1TB 4F6LA 5KB3A 3BM5A 2SECE 1YBMA 1ZS9A 5LJIA 2ISCA 4MEBA 1A1SA 4QICA 3E7DA 3CKKA 1H2XA 1HG0A 1QZTA 1UDRA 3PKJA 3CS3A 4HAYA 4MI9A 4X7PA 4B3HA 4KI0A 4PCUA 1M2NA 1YBVA 4JSRA 5GM1A 4RD1A 5J58A 3LC2O 2QD2A 2AFRA 3GZTB 5AI6A 5T4BA 1Z13A 3FDFA 3ZLJA 4FILA 1NQOA 1G291 1FYFA 3CWQA 1ZRHA 4YP6A 1AU9A 1GPBA 2QORA 3ZCTA 3GBSA 3W9BA 1ODSA 5HQ3A 3VSDA 1UJ4A 3DAOA 1VSTA 4M98A 4DY4A 2H11A 2FUKA 2V3VA 1D6JA 2FEPA 1LU9A 4FHFA 3NVAA 4IY1A 5H70A 1NNUA 3SS9X 2QGZA 3TDMA 1MQ9A 2QVZX 2JD0A 2QL9A 1ATIA 3EZ9A 3DE6X 4WCFB 2HZ7A 5LD2C 3PVZA 3ETGA 5EE5B 3I61A 5BQXA 1LNQA 2CXXA 2R9VA 4C22A 2ICAA 3TOXA 1Y48E 4RK6A 1D6SA 1KSFX 1QRDA 2OCXA 4FFSA 3NT4A 4PC1A 3GWZA 4Q1AA 3OETA 4I7EA 4P2GA 4YRZA 2BC9A 1O6GA 1Z82A 2BCGY 4UE2A 4LHVA 1W5SA 3TIFA 1P5FA 1EJ0A 3QNMA 2OCBA 4CR7A 2Q8NA 2WMNB 1DWPA 3TZQA 5H7XA 1X7HA 5JO0A 2UU9B 3AVUA 1YONA 3RIXA 2VKTA 3AOGA 1QP8A 3NWPA 4FGZA 1W0KA 1W85A 2BJHA 3WP1B 3NI2A 4QFMA 3V4FA 5GV7A 3DHEA 4DUGD 4FB5A 3GJ8A 3LE8A 1NZDA 5K6AA 3U7EB 5ALKA 3CZ5A 3K70C 3VX3A 1QQBA 4LNAA 4UPDA 1JXAA 5I9TA 1OE0A 1QTRA 5TQ0B 1NTOA 2YIMA 5JU6A 2FR0A 3EHDA 4JMLA 4MZDA 3UXEA 4BB9A 4C0SA 5EGNA 1BXZA 3IOEA 1XTKA 2W2TA 1A8PA 1N2JA 1P77A 2GZ1A 3IIKA 3OC6A 3VKHA 1CUSA 5HYVA 1L4GA 4IGIA 1F3OA 5DGXA 5A4MS 3FTFA 4X1KB 4MKZA 1MX3A 3IUQA 3KB8A 1JEYB 4EVIA 4DYHA 4C07A 2C88A 4P7BA 5YASA 5B12A 1IPEA 3FVVA 4ARZA 5C8XA 3A6JA 5LA6A 3B36A 4MIOA 4PQRA 3DTTA 2QLMA 2I2WA 3BJZA 1K7CA 5F5XA 1ABBA 1HE2A 1EDOA 3TSWA 1NBOA 1YKGA 3KL2A 4EITA 3AGPA 3CR7A 4PCAA 2FWJA 4NZZA 3W1WA 2NUPA 1DEKA 3WLKX 2F1OA 2RHOA 2B4QA 3W04A 2G0NA 4FFRA 3OMXA 2X8JB 3DLIA 1C3XA 5FEUA 4JR1A 3TMAA 4UXIA 3LH5A 3GQBB 1KFEB 2R4UA 4P1ZA 5AHWA 3MUFA 4FNAA 2QDKA 3VFDA 1G60A 1H5UA 9ABPA 1L8XA 2I6SA 2X19A 1SD1A 3LVBA 3P9YA 4JZYA 4ZT2A 1G5FA 2VXOA 2RONA 3HYTA 2AD5A 3E3OA 3DQZA 4MARA 1XELA 4R2KA 4GPIB 2WT4A 4FGUA 2P78A 1R15A 3Q8LA 4GLOA 3U6BA 1YUBA 1BHO1 2O7RA 1LDGA 2FWPA 3NYIA 4I50F 1J8DA 3Q9UA 5EPOA 4Y2GA 1UDWA 1N5DA