1CYDA

Carbonyl reductase complexed with nadph and 2-propanol
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
242
structure length
242
Chain Sequence
LNFSGLRALVTGAGKGIGRDTVKALHASGAKVVAVTRTNSDLVSLAKECPGIEPVCVDLGDWDATEKALGGIGPVDLLVNNAALVIMQPFLEVTKEAFDRSFSVNLRSVFQVSQMVARDMINRGVPGSIVNVSSMVAHVTFPNLITYSSTKGAMTMLTKAMAMELGPHKIRVNSVNPTVVLTDMGKKVSADPEFARKLKERHPLRKFAEVEDVVNSILFLLSDRSASTSGGGILVDAGYLAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBONYL REDUCTASE
publication title Crystal structure of the ternary complex of mouse lung carbonyl reductase at 1.8 A resolution: the structural origin of coenzyme specificity in the short-chain dehydrogenase/reductase family.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 94
structure length 242
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.184: Carbonyl reductase (NADPH).
pdb deposition date 1995-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1cydA00
4BO5A 2PZMA 3BMOA 4QSMA 4BNIA 4CUZA 4MVJE 3U5TA 3OIFA 3NDRA 4U0JA 4U6QA 2VRCA 5CPBA 1SMKA 5BSEA 1YB5A 2ZTMA 3W8EA 1U8XX 3MJ4A 4XGNA 4D79A 1K3TA 3D1LA 4B7XA 5JNLA 1MV8A 1P9LA 2Z95A 4C7KA 1R37A 3JQAB 4OH1A 3WQQA 1HYEA 1C0KA 3QLJA 1YOVB 4KUGA 4NBUA 4P38A 3VPSA 3WIDA 4BKPA 1GEEA 1FXSA 3H9GA 2OL4A 4YYZA 3VOSA 4BNWA 4DIOA 3AM3A 2VWHA 4CM4B 1C14A 3RJ9A 4ID9A 1VSUA 3JD1A 2GZ1A 1JA9A 2WYWA 3GN2A 3ZDFA 3ONEA 1LDGA 2NACA 2RHRA 3EZYA 3PJDA 3GVPA 4YT2A 4NI5A 3PQFA 4BNHA 1MG0A 1IPFA 5JBIA 3PZBA 1MC4A 1L7DA 1TEHA 4KOAA 1Z7EA 3U49A 3VH3A 1O89A 3WR5A 4DVJA 2P91A 1HE2A 5U4QA 3OEYA 1SEPA 1NR1A 1YQGA 1JKIA 1I0ZA 3W4KA 1YQDA 4FFLA 5G0TA 5CDSA 2E82A 2NNLD 3ASVA 1I01A 1PJ4A 2NU7A 4WCFC 2YZ7A 4O63O 4I5DA 4OIMA 3W8FA 3S2IA 5F3RA 4Y9DA 2I76A 4BB5A 4WLVA 1JAXA 1UJMA 2IYOA 4R5MA 4OQYA 2C2YA 1H9AA 1BXGA 1PGOA 1ENOA 3D4PA 4KMSA 4O5OA 3BIOA 2AXQA 4BNXA 4HNHA 4JP3A 1YO6A 3LK7A 4XGIA 1R16A 5KIAA 4N5LA 2NVBA 4Z3DA 1ZK0A 4E5KA 4XYEA 3IP3A 4AJOA 2OZPA 3WXBA 2VZ0A 4JJFA 4BO4A 4ZQGA 5DULA 4YB8A 4CLXA 4ESOA 3UH1A 3I9MA 3U09A 4P22A 5BR7A 2VWQA 1EZ4A 4R4JA 3DAPA 3M6IA 4I1IA 2GUGA 3JYPA 2ZYAA 1KEWA 2Y0DA 3VDQA 1EFLA 3BTVA 1VKOA 5IDXA 3BZUA 4MP8A 1HL3A 3GOHA 1U28A 3DZIA 1D1TA 1I36A 4HKTA 4ND5A 3TZHA 4BKUA 4BNTA 1C0IA 2E48A 5B4TA 2PY6A 1M2WA 2JD0A 4YJFB 3VHRA 1U8FO 5IF3A 4YAEA 8LDHA 4LN1A 2YV2A 3Q2IA 3JYOA 3EY4A 4K28A 4WOKA 4AJHA 2PD4A 1GAEO 7MDHA 1E3WA 4Y6PA 3G1UA 4MVJG 1YBVA 1Z75A 2X0RA 1KVQA 1EE9A 5IN5A 2NU8A 1V0JA 1HDGO 1BXKA 2Y66A 1UXKA 5A9SA 1WLYA 2D8AA 3DTTA 4NG5A 2HU2A 3P2YA 4RVSA 4JLWA 4PLWA 4PN3A 1GZ6A 1PX0A 2HSDA 3WGQA 3GVXA 3JYNA 5ENVA 4HNGA 5CFZA 3CSDA 3D64A 1TA4A 3AI2A 1NFFA 3KLPX 4FC6A 3DDNA 5JSFA 5TS3A 3GPIA 1ZFNA 2HMWA 2LDXA 4IS3A 5DF1A 1E7QA 3U4CA 5CPFA 4LCJA 4OAQA 4PZDA 4RCVA 3UCXA 4IDDA 5TSDA 1PJCA 1DJQA 1WPQA 3VZSA 3ASUA 1W73A 1JWAB 5A9RA 1YDEA 3IS3A 4GX0A 2GCGA 3D7LA 4OSPA 4Q39A 1KVTA 2VYND 1U2GA 1FK8A 4GSKA 1LSOA 3SLGA 3OH8A 2QRLA 2E4AA 4KUHA 9LDTA 3K6JA 4IINA 3ST7A 3VPFA 3RCBA 4E5NA 4IPTA 1M75A 4IDCA 3UHAA 5BSFA 5JDCA 4XJTA 5DDIP 2DBRA 3EVNA 4MVJI 3AOGA 2EW2A 4NDNE 4XD2A 3L77A 4HBGA 3KYDB 3OICA 3WICA 1DIAA 2IDZA 2VOEA 3JQGB 3FCOA 1LA2A 2VRBA 1U4OA 2DUUA 5L7YA 3NTRA 3GMDA 2FZWA 2Z1MA 3H8VA 1HWYA 3DBRB 3ZW9A 4YA6A 4CV0A 4TSKA 4RZIA 1ZKMA 2EJWA 4BNUA 2GN9A 4PCVA 4WCFB 5I8ZA 3ADOA 4GBJA 4I5EA 4J16A 1D1SA 5CDUA 1WNTA 2ET6A 2Z5LA 1I33A 1CWUA 3IL2A 2JJYA 2PFGA 5EL0A 4II2A 1JLLA 3TFQA 3RQSA 3HB5X 5ITWA 3T4EA 4P4LA 3EGOA 4E31A 5DNAA 1UR5A 1ZCJA 5G4KB 5KJ1A 1MXFA 4NR0A 2JL1A 1E0DA 1SC6A 2WD7B 5G2OA 1QYDA 3CIFA 3KETA 2HO5A 4PLZA 4GX2A 3GH3A 3CMCO 2O3RA 5LDGA 3JQ7B 4CQLA 2DVMA 2E6UX 2Q2VA 1U3TA 1IULA 1T2CA 3BHJA 2XXJA 4WJZA 4JBHA 3QSGA 3L6OO 3H65A 4XKJA 1J4AA 2Y67A 3B1FA 1PR9A 1CETA 3W6ZA 1F8GA 4DMMA 1ZK1A 4BS9A 4E12A 4OOEA 1XR3A 3NDIA 4UVIA 5JXWA 5G0UA 2GN6A 2I67A 4DQUA 4YAJA 4RV9A 3AOEA 4NQZA 5T57A 1EBUA 2J5KA 5B4UA 4FQ8A 1NWCA 5LCXA 7ADHA 3QVWA 5FEUA 1E5LA 1HSZA 3RUIA 5JAMA 1UXJA 3PWZA 5KWEA 1PQUA 4YWJA 5IZCA 2XF8A 1GQ2A 5CDYA 4E13A 4Q3NA 4BMNA 4WLEA 2DQ4A 3TRIA 3H7AA 4XYBA 2BD0A 2O4UX 3ZWYA 4UVDA 1U4SA 2D5AA 2Q50A 3AFMA 3VZPA 3SVTA 3ABIA 1DRUA 2XPCA 4FR5A 4MIOA 1EQUA 3TSCA 3LT1A 3GAZA 1GCUA 3AFNA 5AXAA 4RPLA 2H6EA 3F47A 1LX6A 4WK6A 2VUTA 5G0VA 3JD4A 1KYQA 1PJTA 3GA0A 3JD3A 4CLEA 1JU9A 1E7MA 3RKUA 1OAAA 1K6XA 5EIOA 3TWOA 4J2OA 4MJLA 2GSDA 4UVEA 2VNSA 4IJVA 3KXDA 1I2BA 1N9GB 1F0YA 4JJIA 4PLTA 1ZUD1 3V2HA 3PZRA 4YRDA 3PLNA 4CQMB 2HMTA 2JCXA 3NT2A 1D4FA 1ADBA 2O48X 1FF9A 1UP6A 1E1MA 3EC7A 3EZLA 3OA2A 4FW8A 1DHTA 2BGMA 3AM5A 4FFRA 3UAGA 4IIUA 3I1JA 3WGTA 2G17A 3I6QA 3SX2A 1DJNA 2QIOA 3HQ4O 1LC0A 1GL3A 1KIFA 3X2FA 4ZRNA 2VWPA 3COSA 4Y8VA 4KWIA 4XR4A 2HKIA 2R2GA 2CVOA 5ER6A 4ROSA 4RLSA 1YRLA 3CUKA 3RIHA 5B12A 2YV1A 1EVYA 4R41A 1B0AA 2FR8A 4B7CA 4L8VA 1B16A 3JQ6A 5DOZA 3BAZA 3Q9NA 4AJKA 2O3UA 1UP7A 3WIEA 2VCYA 1T24A 3I9LA 1GYRA 1R15A 3MOGA 3AUAA 1QV6A 4G5HA 4IJUA 3F1KA 1WDMA 1ZIDA 2QZ9A 1LLUA 3DBHA 3GRKA 2GGSA 1GU7A 5HS6A 3ZV5A 2Y1EA 1B7GO 1YS4A 3ZV3A 5I7SA 1Y5RA 2C82A 5TX7A 3U0BA 1BMDA 3HN7A 4IMRA 4XEHA 5KVQA 2H63A 3OIDA 5GZ1A 1RM3A 1F06A 3DZBA 1PZHA 5JDCC 1LQUA 1T4DA 3U4IA 1F8FA 1F14A 4FC7A 1ONOA 2ZK7A 3F9IA 4KTVE 1F12A 1U5CA 2YQ4A 3MTJA 4UEOA 2IEDA 5COBA 1UAYA 3ZWBA 3DZGA 3NJ8A 1CF2O 2DBZA 2P9GA 4BMVA 4OGWA 4F6CA 4J1QA 5MGBA 5TIIA 2C5EA 1N2SA 3GDFA 3GGPA 3GAFA 1GPDG 4MIYA 4IQ0A 4MVJH 1P45A 5L51A 2GZ3A 4GVXA 4H16A 3TZKA 3LU1A 4U8GA 4WLFA 5MDHA 5A1TA 4JQCA 1KVUA 4L9RA 1CERA 2ZB3A 3PRJA 4YQYA 1YONA 1GQQA 1U7TA 4ZRMA 1SOWA 5LDHA 1HDRA 4LSWA 4Z0HO 4E33A 1F17A 1UDCA 1DOHA 1LRKA 5DBIA 3I9OA 4MVJP 1UUFA 3CPSA 3M2TA 1E6UA 2J8ZA 1OC2A 4D46A 5CEFA 3LT4A 3CXRA 3I23A 3FNHA 1NPTO 1KBZA 3E03A 1GEGA 4OJNA 1Q1NA 3QY9A 3NRCA 4MVJF 3VZQA 4M8SA 1VKNA 3CINA 3UN1A 4YJFA 5L3ZA 4B4VA 3JV7A 3WDSA 4C4OA 3WGIA 1EDZA 3LC2O 2B36A 5L40A 4Y6SA 2I6TA 1IHXA 3DL2A 4IQGA 1VRWA 1NHGA 1DFGA 1XYGA 3QQPA 4NJMB 3AOEC 4QO7A 3WOHA 2IE0A 1UP4A 4PLCA 4WEOA 4NBVA 2V6BA 3C7DB 2AQHA 2NU9A 2BELA 3Q0EA 1QP8A 4W7HA 4CLOA 1HZZA 1E3WB 3PYLA 4DL9A 3JYLA 4R3NA 1ONNA 3AUTA 5IZCC 5I7FA 4NH4A 2P4QA 4CLDA 3H5RA 3LLSA 4OL9A 4XZ3A 4NFSA 3QWAA 5A9SB 3C1OA 4UAGA 2V6FA 2FZEA 4J1SA 3ROQA 4KUEA 1V3TA 4GQAA 4AJEA 4W6ZA 3HZZA 1BXZA 4NBTA 5L9AA 4BUCA 2HMUA 4KQWA 2QQ5A 1R4NA 4RDHA 1OZAA 3ONFA 5IDQA 3AI3A 3AJRA 1T2AA 2J5QA 4BOYA 4U5QA 4HFNA 2PZKA 3KO8A 2GO1A 3RC2A 1SCUA 1Y9AA 2FMUA 4D3SA 4L76A 5A9TA 2CMDA 2A9FA 4GL4A 3GHYA 5EJ2A 4RF2A 2UAGA 4BQRA 3F5QA 5JYEA 1K5HA 1S7CA 3QVOA 3H9UA 1DFIA 4TKLA 1UZLA 2Y68A 2F00A 4U0KA 2GERA 4R01A 4ND4A 4WKGA 3EW7A 4JJGA 3DHEA 4PRKA 1DLIA 2D1YA 2UVDA 2BFPA 3OBBA 4GAEA 4UUNA 1HLDA 3W1VA 5IXYA 1X15A 4W99A 1GADO 1WMBA 1IUKA 2PKQO 3FBTA 3OSUA 2NQ8A 3A4VA 4FGSA 1OOEA 1I3KA 1DXYA 3KEQA 4M86A 4RPKA 1H9BA 3I4FA 4OO3A 3VDRA 1E3LA 4E30A 4XJSA 2VZ9A 1E7YA 1ENPA 1XG5A 3ANMA 1KETA 2OOSA 2X5KO 4NIMA 5A4DA 3PGJA 2UDPA 4Q3DA 5ES3A 2DPHA 2AG8A 4I5FA 3ZGYA 2PGLA 4B4UA 1VC2A 4QEDA 3CTMA 4IQ8A 4EJ6A 4EUEA 3LF1A 4CQLB 1QYWA 5C5IA 4ZN6A 1Y7TA 2VUSA 5L7WA 4I9HA 1DSSG 3GVCA 1GUFA 1AUPA 1A9YA 2HUNA 5JMWA 3WYCA 3R3SA 2G0TA 1MB4A 4JIGA 5EINA 5T6BA 1GR0A 4LMPA 4LSMA 4WASA 1JDJA 2X0JA 3DZKA 4OMUA 4PZEA 4LRSB 4OXKA 4U7WA 4AVYA 4EEXA 1IE3A 2BRUA 3T4XA 2FRDA 5DCYA 2IODA 1ZO8A 4HFMA 4D45A 1B3RA 2ZB4A 2DFVA 2G5CA 4GWKA 2VHZA 3RUHA 5G0SA 4BNLA 4FSHA 2PZJA 4XR9A 3PHLA 1I3MA 3RBXA 4ONEA 2GYYA 2Y93A 5KCZA 3RD5A 5B4VA 4YJHA 5ER9A 1X7HA 2OP1A 3ZV4A 1BRMA 1KVRA 4YT4A 2HMSA 1CYDA 5I7VA 4FFPA 4BKOA 3KHUA 5DP1A 5CDTA 2AW5A 1Y6JA 3E1KA 3S8MA 3CEAA 4G65A 2D2IA 3EHEA 3GZNA 5TJ9A 2VYVD 4Z3KA 1WZIA 3Q11A 3E82A 3FPCA 3WSVA 4BGUA 5ILOA 4J9UE 4TKMA 1UXHA 2O4CA 3V2GA 2D59A 1E1KA 1XSEA 5JMPA 3DO5A 4K6CA 5CEJA 4DREA 3UF0A 4TRRA 4ND1A 4FIZA 3DTYA 3GG9A 2QYSA 5JC1A 1UXIA 2WWRA 3IIEA 2EG9A 4YJDA 1Z74A 5AOVA 3W4JA 1PGQA 5G4LA 1BTOA 1DDOA 4UUPA 2PZLA 3TZ6A 1XIVA 3V5NA 1WMAA 3ONDA 4KDFA 2FPGA 4LMRA 3C7AA 3GGOA 2WSBA 1NAHA 5FWNA 1Q0QA 2ZQZA 3OA0A 2JFHA 4E6PA 2HK9A 3NDJA 4XB1A 5A03A 3B6ZA 2GN4A 3BMQA 1ISMA 3I5MA 1XU7A 1NBOA 1V3UA 4CLHA 3RASA 5HM8A 4QUKA 3H4VA 3PYXA 1PL7A 2QZZA 3E9QA 2VHVA 3WMWA 5EPOA 3RUCA 4AICA 4HY3A 3VH4A 1LDEA 4XRRA 1T25A 2W98A 3FSRA 3KSDO 1LLDA 3CZRA 3B20A 3PLRA 4GVLA 1W6UA 2I3GA 2Q1WA 3SEFA 2PK3A 3NT4A 4XDZA 1PJLA 1N8KA 2Q2QA 1WDLA 5B37A 1E7RA 4Z9FA 3S1LA 4R54A 4M1QA 1SEVA 1YL7A 4RVUA 4BIIA 3NEPX 3DBHB 5TQVA 5FI3A 2XOXA 4RDIA 5JCJA 3QHAA 5C3MA 2I66A 2OUIA 1YJQA 2V65A 3IKVA 2WYVA 1ZJYA 2FHSA 5DN9A 3WB9A 1CQJA 4R1NA 4WCDA 1MG5A 2YFQA 3ZHXA 2Q1TA 3G0OA 4CMCA 3PHIA 1QLJA 2Q2WA 2D5CA 3OQ1A 2PH3A 1PQWA 4I9NA 4DRYA 2FOIA 1NP3A 1VL0A 2PKQP 1P77A 2X22A 4NU5A 1LUAA 4RVHA 1BWSA 4EW6A 5L45A 3BMNB 4PLVA 1YBMA 3RC1A 3Q3CA 3E48A 3Q2KA 4J0FA 4EI2A 2JCYA 2VHWA 5J23A 5JC8A 2NLOA 4GMFA 4CV2A 3MWDB 1O9BA 2R6JA 3E18A 3PQDA 2W8ZA 1EDOA 4CM7A 4W82A 1FDTA 5F21A 4IDAA 1HE3A 1HYGA 3PI7A 3VPHA 4JBGA 4ALIA 1D7OA 4FJ1A 4XIYA 3Q9UA 5HRUA 2NVWA 4EITA 2YHUA 1ISJA 3AWDA 2TMGA 3G17A 3PFFA 1J6UA 4XDYA 1X7DA 3TJRA 2PH5A 3LLVA 3GUYA 1FDVA 1H2BA 3UICA 2V6GA 4R68A 5AQ1A 4UVGA 5HTOA 2J3HA 1RWBA 1ZSVA 4P4GA 1PWXA 4CMIA 3ZNPA 3ON5A 2B83A 2X9GA 4PIVA 1ENZA 3G3EA 4ALNA 4NNJA 4QT0A 4WLUA 3PIDA 1GUYA 2RBEA 5IAAA 3DOOA 1ISGA 2Y1OA 2RAFA 3ADPA 1P74A 2CDAA 4QXMA 4RQTA 2HDHA 4NZ9A 4B4OA 1BVUA 3FNGA 3T7CA 2JAHA 4NJMA 3RUFA 3PXXA 3PQEA 3GUCA 1MA0A 3AY3A 3TDKA 3ZV6A 2EV9A 1JN0A 1ZEJA 2VYVA 4M54A 1PGPA 4IDBA 4DC0A 3E5MA 4RVFA 4HP8A 4F45A 5THQA 4J91A 1KEPA 5C7IO 1QORA 3VAZA 4ND2A 1R66A 1QG6A 3KUXA 3ZWXA 3MJVA 1SBYA 2ZYDA 1H0KA 1QV7A 4CLOB 4INAA 4CR8A 1I2ZA 3OF2A 5L7TA 4E5YA 2P4HX 4BHTA 3DHNA 1NM5A 3O9ZA 3UCFA 3RFXA 4HXYA 4ZHSA 1EUDA 2NWQA 1WWKA 5CDGA 4NMHA 5TRTA 1P1HA 4GLOA 3NJ4A 4MKZA 4QFDA 4NHEA 3F3SA 1KY4A 3RC9A 3ZWNA 1A4IA 2CZCA 2AQ8A 2OMEA 4TVOA 1J5PA 1R4NB 5KOIA 3VPGA 4FGWA 1HSOA 4MKRA 1ZMTA 3KSUA 5EMHA 4AJ1A 2CVQA 1V8BA 4R1SA 1AXEA 3ZZNA 5K6AA 1NR7A 1PJBA 2ILTA 3VH2A 1JWBB 4A2CA 1LI4A 2D0IA 2P5YA 5TGDA 3X2EA 1H93A 1SNYA 4RPGA 3LVFO 4J3FA 1V9LA 3KSZO 3IKTA 4C7JA 5IDWA 3ROPA 2I65A 1VLLA 1VJ0A 1ZVMA 3ITDA 1TLTA 1B3BA 1XGKA 1N1GA 5DCUA 1W4ZA 5DBFA 3TZCA 5TT1A 3PTZA 4D44A 3IC5A 1X0XA 3DHYA 4I8XA 5KVVA 2DTDA 2NU6A 1YE3A 3JQAD 3E9NA 2JCVA 4BO0A 4IDFA 4BKRA 5U9CA 1N7HA 1W8DA 1T2DA 5F5NA 1O94A 3OJEA 1TT5A 5ILGA 1HE5A 2AE1A 3CH6A 2OXIA 4NBRA 1LRLA 2X9NA 1J49A 1TI7A 3FNEA 3LT0A 4XRGA 5JS6A 4WUVA 2VT2A 4GMGA 3WGGA 2HCTA 2WDZA 3ICCA 2FPPA 4EBFA 4UUMA 4Q3BA 3A06A 4RVDA 1LBEA 1XCBA 4QQRA 5ADHA 1E92A 4FJ2A 3S55A 1GFSA 5KVCA 3K9QO 4F46A 4N18A 3JQBA 4Y98A 2NTNA 2WE8A 3RU9A 5KKCA 3U9LA 2HAEA 2CSUA 5EQFA 1QLHA 4U6SA 2EKPA 3WBFA 1IZ0A 2CUKA 2Z1NA 5KTKA 3K30A 3TFOA 2ZB8A 2JD1A 2G1UA 5KJ6A 5JPIA 4YXFA 1NX6A 3VTZA 2H9IA 3MCVA 4R16A 3LC7O 4N5MA 1PSDA 2GR9A 1PJ2A 3HFSA 3NTOA 1E77A 2O3JA 2P5UA 1YL6A 4L4SA 5COQA 5IZ4A 2IYPA 1NAIA 2IZZA 4D0RA 4DQXA 3H2SA 5F5LA 3CMMA 2W4QA 2YUTA 2ZQYA 3NGXA 3VVBA 1QYXA 3TNLA 1MFZA 4BNFA 3GF4A 1I24A 1CIVA 1MGOA 4KP7A 5BSGA 2EGGA 2WMDA 4ALKA 1IPEA 3PPIA 2A94A 2O23A 4PRLA 3BYZA 3ZN2A 4BGEA 2JHGA 3GRPA 1DC6A 1E3JA 2PD6A 1BHSA 4J6FA 2EF1A 4J4TA 1PTJA 3KYBA 4RGBA 1XHLA 1H6AA 1LDMA 4YJHB 1RPNA 4CMJA 5KKAA 1R6DA 4I9UA 4LW8A 4BNYA 4HUJA 2B4TO 1Y9EA 4XQEA 1T26A 3HWRA 5DCWA 2ZCUA 4FFMA 4YQZA 1C1DA 2I3AA 2RHCA 2X7HA 3GZNB 4Z9XA 1AXGA 2WJPA 3F5SA 2ZCVA 4JGBA 1ISIA 4R1TA 4TRJA 1UXGA 2Q3EA 1NFQA 1HDZA 4LVCA 4PG4A 2C54A 2CVZA 4RLHA 4RPJA 3LQFA 3ZHZA 2LDBA 1T2EA 4BGIA 5JCXA 4IJWA 3QVTA 3SJUA 2X5JO 1YDWA 3VVCA 3JYQA 3MJEA 3ZCXA 1ARZA 1RYDA 3GC6A 3K92A 1SZJG 1D3AA 2AE2A 3FWZA 1R4MA 3D0OA 5L95A 3NAQA 5ITVA 4XYMA 2VYNA 1Z7BA 1XKQA 4MP3A 1P44A 4CODB 2V6MA 2UUOA 3LSYA 5EN4A 3L07A 1KY5A 3TQHA 3LYLA 3ICPA 3PDUA 4XX0A 2JD2A 3BMQB 3OETA 2H5LA 1U9JA 2C29D 4E2XA 4B3IA 1PU2A 2O3QA 2B0JA 2BHLA 4TMFA 5B1YA 3QW2A 2JHFA 4NK4A 1JAYA 2UUPA 2BGKA 4II3A 2BFMA 5L4SA 3NX4A 4JNKA 1HKUA 1NQAO 4GWGA 4ZU3A 3OQBA 4Q3EA 4DPLA 1B8PA 2Y0CA 3D5TA 5K6AC 4RORA 4NFYA 4DBZA 4E21A 2PD3A 5L4NA 3I3OA 3L6DA 4PLFA 1WXDA 1KEVA 3EYWA 1K6JA 1P31A 4ALMA 4AJJA 1BDMA 4FOSA 3WNVA 4XIJA 2EKQA 4H7PA 3KEOA 3WQRA 3D3WA 3DFUA 1IL0A 1EK5A 1G0NA 4CR7A 3KM0A 3EDMA 1T2FA 2E49A 3BMNA 4Q3CA 1H2HA 4R3WA 4WNCA 3FHLA 3STHA 3GVHA 2NM0A 4K26A 1O95A 1BVRA 3OHSX 5HA5A 4ITUA 1QKIA 1EK6A 1IB6A 1WVGA 3AY7A 2VUUA 3GDGA 3L9XA 1DC4A 4YDRA 3WYEA 1N1EA 1WP4A 2J6IA 3GZ4A 5T8KA 1B14A 2HQ1A 2OBNA 4YTEA 3JQFA 1XELA 2BMAA 3B1KA 4E32A 2FSSA 1A9ZA 2EEZA 3IUPA 1ISFA 3WGHA 2QHXA 4MDHA 1ZW1A 3E5RA 3F4BA 1RJWA 4Z0TA 5A5FA 2R00A 3GVIA 1PWZA 2X1HA 2X9VA 3ZNQA 3JQBC 1Z73A 4F6LA 3PWKA 3HSKA 3QWHA 3BTOA 4CMIB 4CJXA 4A26A 4TRMA 1LJ8A 3GGGA 5A3VA 3WLFA 1DRVA 4KZPA 4BNVA 3I9KA 4M49A 4CM5A 5I9NA 3ZU2A 1HE4A 3JD0A 2PTGA 3AU9A 3GMSA 3K8ZA 4HWKA 4J7UA 4QFCA 4AL4A 5I8WA 3WJAA 5KJCA 1FDUA 4L4XA 4LK3A 1VPDA 3RC7A 2Q4BA 4K9DA 1DEHA 4M87A 2DTXA 1YB1A 4S1VA 3SLKA 1TXGA 2CF6A 1U5AA 2GD1O 1I32A 1P1RA 3HN2A 3PHHA 2AA3A 4WNIA 3C1AA 3F1LA 3WTBA 5JFOA 2GF2A 1N7GA 3OJLA 4E4YA 5A06A 1XWFA 2A92A 4PG8A 3DC2A 1DC3A 4IZIA 3TL2A 3HFGA 1OI7A 5TC4A 3RBVA 1DFHA 3RJ5A 4M89A 4CM1A 4YEDA 1ZXBA 4EGFA 1HRDA 2ZTVA 3KYCA 2J3JA 5JY6A 2VHYA 4YAGA 2PWZA 4GSLA 3S2EA 1QXSA 2RH8A 4D42A 2HRBA 1U1IA 3WG9A 4BNMA 3RROA 1O6ZA 3IOYA 2O7SA 4CR6A 1ZK4A 1QYVA 5EESA 4RVGA 2C5AA 3WTCA 1DIRA 3ETGA 4K6FA 1ULUA 4A5OA 1NXQA 1GQYA 3GNQA 2RH4A 3PK0A 5DOVA 1Q2XA 2HK8A 4IXWA 3LZ6A 1PR3A 3FWNA 4MVJM 3INRA 3LC1O 4XCVA 4D3DA 1P1IA 5L4LA 1RM4A 2YDYA 3DZFA 1CEQA 1A7KA 4AJNA 3L4BA 4J1NA 4NBWA 1W0CA 1I3LA 2WM3A 1LSJA 3ZWOA 5A04A 5A5EA 3PVZA 4WLOA 2DBVO 1PGNA 2VRCD 5IG2A 1DIHA 4BO3A 4GGOA 2I9PA 2DPGA 4HV4A 1I30A 3O38A 1GV0A 3P19A 1TVEA 4Q9NA 1UZNA 1LDYA 2C07A 3HB4X 1LDBA 3FNFA 1EVIA 4GX1A 5COAA 5IFLA 2DUWA 3QIVA 5BNTA 4BGVA 2RIRA 3UCEA 1Y8QA 3WFJA 1SPXA 5ICMA 1DRWA 2Q49A 8ADHA 3MJCA 3WJ7A 1S6YA 3W4IA 1FMCA 4RZHA 1TT5B 1KC1A 2WE7A 2B5WA 3MZ0A 1TB4A 1A72A 2Q45A 4HX5A 4FPXA 2EXXA 4FFOA 4DPMA 4NK5A 3PP8A 4NU6A 1R0LA 3IJPA 4ZQHA 3GHHA 4IDGA 2YFHA 4BNZA 2A35A 3A14A 4IUYA 3AW9A 1LU9A 3F4LA 4CV1A 3H3FA 2G82A 2QYTA 3I52A 5C37A 1HDOA 4PVCA 4A73A 4PLYA 4TZTA 3TOZA 4G81A 2X4GA 4MIEA 3R0IA 3UVEA 5CP8A 3SJ7A 2ZTLA 4CMAA 2VOJA 1HLPA 5I7EA 5F1OA 1B15A 1SAYA 3QV1A 3R3JA 4MKXA 1LSSA 1P0CA 2AG5A 3E9MA 4L4RA 5FF9A 1SOVA 4A03A 2DFDA 4DWVA 1XU9A 4K1LA 1WW8A 3NUGA 1BW9A 3CZMA 3U4HA 2PLAA 5HS4A 3A1NA 2Y1FA 3EK2A 5CG2A 1J0XO 2DKNA 3ORFA 2DLDA 3QWFA 3DMYA 4MOWA 3GNSA 2V7PA 3HUDA 4JROA 4WLNA 3SC4A 5T8KC 1PJ3A 1U3UA 4PZCA 4OHUA 1MC5A 1Y8RA 3JQFC 3ZWPA 3ZWCA 4EYEA 1YH3A 4XYLA 2ZJ1A 3PJGA 3VC7A 2DU8A 1DPGA 3PWSA 1SB9A 1I2CA 1X14A 2CFCA 3PGXA 5AYVA 4AJ4A 1R0SA 1Z45A 4EJMA 5GZ6A 4L75A 5LC1A 2R00C 2VN8A 2D4AA 3I4CA 3RU7A 4CL3A 4DLBA 9LDBA 1X1EA 4BO7A 3ANLA 2Q1SA 3JQ9A 1QSGA 2ZATA 3QP9A 1LNQA 2AMFA 2DM6A 2FR1A 3H9JA 4LRTB 4R9SA 2B69A 2B35A 3OJFA 3QRWA 4E2YA 1C1DB 4IS2A 3BHIA 4BNKA 2OP0A 4FDAA 2Q1UA 4KQXA 2GPTA 3ZNNA 3RUEA 1KOLA 1H6BA 3V8BA 4EDFA 3D5QA 1X7GA 2ZJ0A 1ENYA 3OP4A 4BNNA 3GEDA 1ZSNA 3DOCA 5BT9A 1CRWG 5BNIA 4XYGA 2W90A 4FJ0A 4YT5A 4AJPA 2VNAA 1R4MB 3GEMA 4YACA 4QO8A 4YJGA 2NTJA 3FTPA 4EZBA 4R69A 1EE2A 1ZK2A 3H9EO 3ZU3A 3W8DA 3MOIA 4IY1A 2J3IA 4PLHA 1PZFA 2W2KA 4OXYA 3M1LA 1SB8A 4AJIA 4IIVA 4JX8A 5JYDA 3DAFA 5HBRA 1QYCA 4J2HA 2UYYA 4WEQA 3OJOA 3NTQA 3RWBA 3U3XA 1UDAA 3E8XA 1H6DA 2DAPA 3VKUA 1AE1A 3DONA 5JW6A 1K2WA 1NYTA 1WDKA 2JAPA 4DPKA 2OHXA 5AVOA 5DT9A 1ULSA 1Z6ZA 1P1KA 4CM3A 1EUCA 1XEAA 4D0SA 3CE6A 3GN1A 5KVSA 5EQDA 1L1FA 1NPDA 2Y1DA 4CM9D 5JAIA 3GFBA 4DLLA 3EVTA 3RI3A 2DC1A 3ROMA 3N7UA 4DMLA 2WEKA 1JVBA 1MX3A 1MLDA 3FD8A 2FPIA 4RO0A 5THKA 3PJFA 4PG5A 3T7EA 2PA3A 4OSOA 3OMLA 1LQTA 3HHPA 4BV9A 5GY7A 3KV3O 1RM5A 4RF5A 2I5PO 2C59A 2FP4A 3L4BC 2OBYA 4WGGA 5BNFA 3LF2A 2EWMA 3D3WB 1GV1A 4DLAA 3UOGA 1I5RA 4MPDA 2HRZA 3WLEA 3KOUA 4BO1A 4EEZA 3Q6IA 3K5PA 5JY1A 6ADHA 2QRJA 3KVOA 4UEJA 4O1MA 3ZWAA 2AEFA 5L53A 1NHWA 3ULKA 3PEFA 3FBGA 3NT5A 4YAIA 1XQ6A 2GDZA 3DWFA 5JE8A 4B4WA 3L4SO 1GYQA 1C3VA 4DIBA 4O59O 3GFGA 1T1RA 3UGKA 2NV6A 4OYRA 1Q7CA 2ZB7A 3ZW8A 4XQ9A 2P9CA 4BVAA 4Z0PA 1P0FA 2BF7A 2G76A 5IN4A 3A9WA 3KLMX 4ALJA 2O3SA 2NVUA 1XLTA 1KERA 2HMVA 3AK4A 3ZU5A 2YQ5A 1OBFO 1EUZA 1T4BA 1IZ9A 5AXCA 3WS7A 4YRAA 4YR9A 1ZMOA 2YW9A 5KJFA 3HDQA 3OEWA 2YHIA 1Q0LA 2IEBA 1HYHA 3WNQA 1YJ8A 2RCYA 2YJZA 1PL6A 3WSWA 4UULA 1D8AA 1X1TA 2QW8A 4J4BA 4CPDA 4XB2A 1LLQA 4GLLA 1LLCA 3L0DA 1DLJA 5ENDA 4RF4A 1C0PA 3SXPA 2AHRA 3DB2A 4W9NA 2OGUA 2POQX 3ZNOA 1V35A 3FF4A 3INGA 2BI8A 1B26A 1P33A 4J1TA 1U2DA 1BGVA 5TF4A 1GYPA 1QRRA 1I3NA 3AUUA 3BTUA 4JP2A 1P1FA 3WMXA 1JW9B 2ZKLA 4BV8A 1NASA 1PS9A 3JQ9C 4RPHA 4J9VA 4L74A 3KYCB 2Q46A 3DZJA 3IP1A 4MINA 3L6EA 4D7AA 3G49A 1ZXLA 1ML3A 4G2NA 4GH5A 4DIFA 1R0KA 2X0NA 4CM8A 1YGYA 4BB6A 5FI5A 1NTOA 4QECA 2EKLA 5DZSA 3WX0A 4B3HA 4BO2A 4L0QA 4Z6KA 3JCZA 5ICSA 4NFHA 3KRTA 5JDIA 3C24A 3M2PA 2CDCA 1RKXA 4D43A 2HK7A 1PS0A 2GASA 1K0UA 4XQCA 2BI7A 3O8QA 4ZICA 4BO6A 2NTVA 3DOJA 1UAGA 4IMPA 4TVBA 5H81A 4AG3A 1UDBA 3JQ8A 5A05A 4CM9A 3FR8A 3G1TA 4YCAA 2Y0EA 3B1JA 4DXHA 3VH1A 3DBVO 2VZ8A 1ZBQA 2CD9A 2IRWA 1QR6A 3W6UA 3ZH2A 4ZQEA 3HADA 4GKBA 6LDHA 2ZTUA 2C0CA 1NVGA 1YWGO 3TPCA 1DO8A 3H2ZA 2WYUA 1KEUA 3GG2A 2YV3A 1EMDA 1A7AA 2Y1GA 4AJ2A 1E3EA 3MJSA 3AM4A 4N54A 1Y8QB 1VL8A 5T67A 1Y81A 4EJ0A 1K6IA 2X58A 1YBAA 3WWYA 5EERA 2JFFA 2FWMX 3RKRA 3TZQA 1WAMA 4LVUA 3NKLA 4FCCA 1HDCA 3HG7A 4TZKA 4BO9A 1XQ1A 2ZYGA 1C0LA 4OXNA 3AU8A 1Y1PA 2OO5A 3ZI0A 1EBFA 1LRJA 1O0SA 1L7EA 3AUSA 4FN4A 5F1KA 2D3TA 4EUFA 4RF3A 2OFPA 3FTNA 5KNLA 4P4NA 1B8UA 1IYZA 1YKFA 4MP6A 1ZEMA 3ANNA 4DGSA 3ITKA 3C1TA 4BKQA 1EVJA 1DB3A 4O6VA 4J90A 4IGEA 4YBZA 2NSDA 4NJOA 3GQVA 4BNGA 5DBGA 1N5DA 5H82A 1ZZEA 3FPLA 1XDWA 3GY0A 4E2ZA 3EMKA 1C1XA 4GKVA 2P2SA 4LCEA 5H83A 5GZ3A 1PL8A 4B8WA 2VTEA 1E7SA 3B70A 4CLRA 1BW9B 3PIIA 4PLPA 1PZGA 4DYDA 5AXBA 2F1KA 1R12A 2PGDA 4N7RA 3PFWO 4QX6A 1E3SA 1NNUA 4FOOA 3BMCA 1T1SA 1WZEA 3IDSA 4DUPA 2C7GA 2CY0A 1Y8RB 2Q4EA 1YVEI 1CDOA 2QX7A 4HADA 3L9WA 3ZWVA 3OQ6A 2PGJA 3VPXA 3RVDA 4DQVA 1HDYA 2EJVA 4PGFA 1ADGA 1BSVA 3HE3A 3P7MA 3UXYA 2EERA 1ORRA 4UEKA 1P3DA 4FBGA 2VHXA 3PDJA 1MP0A 5I9LA 4TRNA 1KVSA 1NQOA 5BSHA 4UVHA 1DAOA 1G0OA 3UW3A 4E5PA 3FN4A 1PQPA 3OM9A 1DAPA 4IZHA 4WECA 5IXSA 2WD8A 2O50A 4OKNA 1LEHA 1LTHR 3DBLA 4CL8A 5JAQA 4E5MA 5TLSA 4CMHA 5CAEA 4I08A 4D3FA 4J4HA 2BFAA 4YPOA 4CUJA 1YXMA 5GMOA 3E6AA 4W9NC 1JQBA 3KB6A 3WQSB 2I99A 4IDEA 1HDXA 3QA9A 3HDHA 4YJGB 4CM6A 1E1LA 3CKYA 1NVTA 3ENKA 4YVFA 4ZD6A 1FJHA 1BG6A 1G6KA 4TWRA 2DT5A 1X13A 3V1TC 2X8LA 3JD2A 2W2KB 4CV3A 2J3KA 3KTDA 2PNFA 2O7QA 1H6CA 3JQEA 3JTMA 4CUKA 1OC4A 2TMDA 2AEJA 1PZEA 3ZHBA 2X86A 4OKIA 4R1UA 4ZJUA 4IGFA 3DQPA 3BMOB 1O8CA 5IJZA 3V1UA 4A7PA 3JQAA 3WYBA 2XXBA 3U62A 4FD3A 1BDBA 1YOVA 5G0WA 1FDSA 4J7XA 1PIWA 3H5AA 5I9MA 4MVJD 4OM8A 3ZWMA 3K73O 4CM4A 3QJ5A 1NWHA 1V3VA 3BHMA 4EUHA 1XA0A 3EAGA 3BTSA 2EGHA 3GPDG 3GEGA 1YL5A 1U3VA 4P8RA 4RL6A 1GZ4A 3NYWA 4RQUA 2AEMA 5JDIC 1Z82A 3KZVA 4BO8A 3AY6A 4JCOA 3D4NA 4X54A 2PV7A 3S2FA 1U7HA 4J49A 1JVSA 3PYMA 3Q1LA 1E5QA 4I5GA 4B3JA 3FR7A 1M66A 2BFOA 3A28A 1EQ2A 3D4OA 2XAAA 2JKVA 4XQGA 3C3XA 1AGNA 2FR0A 3TL3A 2P9EA 2BLLA 3JQCA 5HWSA 3LDHA 2EP7A 1NVMB 2OORA 3QWIA 1EEHA 2CDBA 2GN8A 3O03A 4R9RA 1IY8A 1GTMA 2UV8A 1LDNA 1AHHA 2B37A 2O2YA 3WBBA 4CMEA 1ZJZA 5CHEA 4JK3A 2Q99A 1EFKA 2NQTA 1M6HA 3WWZA 1G1AA 2EIHA 4KDEA 1JKJA 3AI1A 1MUUA 2X0IA 3I6IA 3DEYX 1AHIA 5JLAA 1PJSA 3ZWWA 1GUZA 3MEQA 3RAJA 1Q7BA 2IXAA 5JO9A 2VQ3A 5AXDA 4PG6A 3RUDA 3K2BA 1Q7GA 5U1PA 3FI9A 4XA8A 1M76A 5DP2A 4KTTE 3F46A 2Y99A 1BXGB 3GDOA 4ZQBA 4PFJA 1JTVA 1PEDA 4E0BA 1ZK3A 4YRBA 2CNBA 1NQ5A 2YY7A 2NVUB 4R51A 4E3ZA 1H5QA 2NUAA 2HLPA 3FRJA 2GRAA 3DMTA 4DC1A 3RSHA 3C8MA 1NFRA 1Q0HA 1RYEA 4Q3AA 1IOLA 4W4TA 2IZ0A 3F6YA 3GK3A 1E3IA 2YDXA 2YHIB 3UFXA 4ILKA 2NADA 1EVZA 1VL6A 1HTBA 2ZIZA 3ETEA 3M1AA 3O4RA 2FN7A 4H3VA 4BL5A 3C85A 4GGPA 1HETA 1HF3A 3IQDB 2PKRA 1N92A 3TF5A 5K9ZA 1I8TA 2J5RA 1VJ1A 4CMKA 4N5NA 5KJEA 4NPCA 3PHGA 3VTFA 2QRKA 3DR3A 3OECA 3GR6A 1PGJA 2JFGA 1IHYA 4ZVVA 1VM6A 5C7OO 5K0ZA 1VI2A 1A27A 3GNTA 2W2LD 4RJTA 1M6WA 2AQKA 3HNPA 3N74A 2O3TA 3PHJA 2E37A 3ZU4A 5FFFA 3VKVA 1FDWA 4A10A 1V6AA 4W7IA 3P5SA 4B7UA 4DBVO 3SC6A 1MXHA 1I10A 3QVSA 3G79A 2B4RO 5IDYA 1PS8A 1H94A 4MO2A 5TNXA 3JQDA 3MTGA 1E6WA 2Y05A 3TN7A 1VJTA 4CQMD 2CF5A 1A71A 2EHDA 4ALLA 4CM8B 4PLGA 1HEUA 3DXFA 1ONPA 3EUWA 3V2UA 2Y1CA 4JXKA 3GT0A 4O0LA 1JKFA 1NQTA 3NV9A 4TQGA 1E7WA 1LSUA 4FFNA 2SCUA 3HJAA 3WGZA 4ZQFA 3O8QB 3RFVA 5JO0A 4MVJA 5T64A 4B8ZA 3ETDA 3JQ8B 1DIGA 1E1NA 3H3JA 2B5VA 4YAKA 4Z9YA 4ZA2A 4URFA 4XGKA 3KYDA 2QG4A 3O26A 4WPGA 3IMFA 5T5QA 3JQGA 3NGLA 1LXCA 2GLXA 5CEEA 2GNAA 3QE3A 3DAGA 3RUAA 1ADCA 2EP5A 2C2XA 2GZ2A 1ZNQO 2IXBA 3DBRA 4YT8A 4GX5A 4R5HA 2IZ1A 1UH5A 4HFJA 2X23A 3IJRA 4WCFA 5FYDA 4DTIA 5TJHA 4WE3A 3H5NA 5A3JA 1E6EA 1VE9A 1DBVO 4E2WA 4IM7A 3K2EA 3HDJA 4J0EA 1TT7A 1KC3A 3BXXA 2BH9A 4OQZA 1ISHA 3DZHA 4JN6B 4L73A 4LGVA 4OOFA 1A5ZA 1GZ3A 3S2GA 3KBOA 2DBQA 1CJCA 5JCJD 5G4KA 4D41A 4A27A 1HZJA 1AN9A 2WD7A 3LT2A 1GDHA 3TOXA 1SO8A 1KS9A 3INTA 4DYVA 4ZGWA 3JQ7A 2C7VA 2FY8A 4LISA 3OFSA 1UZMA 4Y67A 3ENNA 2HJSA 4M55A 4FB5A 5A02A 4TROA 3DFZA 3MWEB 3OIGA 4PVDA 4XWYA 1A4UA 4HFRA 4BMSA 1Y5MA 3HDYA 4UUOA 2FSVA 3UUWA 1OMOA 3IAHA 1C1XB 2HJRA 3ZHYA 2X6TA 4JBIA 1M67A 5BQFA 4CMEC 1ADFA 2DTEA 2PR2A 2VWGA 4CLRB 1YB4A 1B2LA 1ZSYA 3PJEA 3BA1A 1MFPA 4DA9A 1PJQA 4CMBA 4GI2A 1DC5A 3QWBA 1QMGA 3BMCB 1LC3A 3RBZA 2H1SA 1NPYA 3SBOA 3JSAA 4J7CA 3P2OA 4S3MA 3WGYA 1K89A 3VZRA 3GLQA 3RFTA 1U3WA 4IBOA 2B4QA 3N58A 4BNJA 1B8VA 1GPJA 3IUSA 4ND3A 4QTZA 4F3YA 2P68A 3QVXA 4PG7A 3ROKA 2YYYA 4A0SA 2O2SA 4H15A 2C20A 4FS3A 1GD1O 2EW8A 4AFNA 5JAZA 3H9QA 3K31A 1OFGA 3WGOA 1GCOA 2W2LA 1X0VA 3DMTC 2BKAA 2X5OA 1ID1A 2BGLA 5CG1A 3I9JA 1P1JA 3K96A 3R6DA 3OJ0A 3R1IA 2A4KA 3DBLB 4IXTA 1VSVA 4GPD1 4B79A 5TT0A 3U4DA 4IJKA 4UREA 4Y6RA 4AJLA 3C7CB 3I83A 4WOJA 3D3EA 1N9GA 1ZH8A 3V1YA 4KWHA 4CQMA 1DIBA 4CMGA 1GY8A 1HXHA 5F1PA 1RM0A 1CQIA 1O5IA 2AQIA 4J43A 5C7LO 3I9NA 1YQXA 1HT0A 4BQPA 2VTDA 1DHRA 3WFIA 3H6KA 3UKOA 3MJTA 2VT3A 2WTBA
chains in the Genus database with same CATH superfamily
4D92A 1J5XA 4CUZA 4BNIA 2YJ6A 4Q3KA 1M8PA 4FE3A 4I8IA 4ND6A 5SZJA 4P53A 1MNQA 4U6QA 2FSPA 1P4SA 1R3DA 1GRNA 2VRCA 3EAQA 5CPBA 5BSEA 1R3UA 4DR6B 3ETJA 4HGPA 4GF5A 4PFQA 1I2DA 1UK8A 2X1MA 1U8XX 4RM2A 4IQFA 2KMLA 1J90A 1K3TA 2IP1A 4TM7A 1MV8A 1P9LA 2Z95A 2B99A 3IUQA 2XJ9A 1V4VA 1VIDA 1KRHA 1WU8A 2H2GA 4OH1A 1HYEA 3R0JA 2IYLD 3DUFA 4YP9A 2AKEA 2ONJA 3SS7X 1YOVB 3ONWA 4NBUA 4P38A 2Q4OA 3FHJA 3VUEA 1WUTA 4TTJA 1KL7A 1T2NA 1SXJA 3TDNA 4YYZA 3JSXA 2BGIA 3AGPA 2R5WA 1IXSB 2VWHA 4HQNA 3CM0A 4ZVTA 3A3NA 5KSWB 4C4TA 1SCKA 3QITA 1NX9A 4C06A 3G68A 2QSJA 1X3SA 1VSUA 3JD1A 3GB9A 3WMFA 1JA9A 1VMAA 2V5UA 1T0IA 2NUPB 4OL0A 4YT2A 3PQFA 4M8LA 3S68A 4BNHA 1ZR2A 1IPFA 1MOSA 3FDJA 5JBIA 4RSHA 3U7GA 2OZLA 1L7DA 4U7PB 5JRDS 1JIXA 4KOAA 2FCAA 1L1QA 1P73A 1GKLA 1RJ9A 1Z26A 1Z7EA 4D6PA 2DR3A 2N46A 3OPYA 1O89A 2FUNB 3AUYA 3D4BA 1SQ0A 1DKMA 4KFSA 4R98A 3ZTTA 5AJWA 1NYRA 1NW3A 1XB2A 3Q98A 1QHSA 1KAGA 1ZGCA 5HOEA 1HDEA 1ECLA 1NR1A 2CLSA 3TLXA 4ATNA 4DIMA 3A6EA 4YPVA 1YR7A 2WP8J 1A0OA 4H77A 1T3LA 3OEED 1AS0A 1VPVA 1V47A 2H2DA 1B6TA 3L92A 4G5QA 1Z08A 4B73A 3AETA 2DXIA 4FMPA 2E82A 2NNLD 3LL4A 1EJ6A 4UHKA 1PJ4A 2IOYA 3PX3A 1E9EA 2ZFUA 4O63O 2IH2A 2JLQA 3W8FA 3DZDA 4FKBA 1J1ZA 4Y9DA 4H18A 3H2JA 4F6RB 1KSFX 5HKBA 1N8TA 4L8WB 3ZHQA 4Y9UA 4U2GA 1AHPA 1IXKA 1GCGA 4G4JA 4RNCA 5FXMA 2MIIA 4OQYA 1OE0A 1TVMA 1Z4LA 2D7CA 2VSYA 2XECA 1YACA 5JBNA 3D4PA 5CNJA 4X93A 3RNLA 4BQNA 5FYQA 4YV7A 5A6SA 4H6VA 5CJPA 1GCIA 2PLFA 4JP3A 3HM9A 1MJNA 1XQWA 2QTHA 1YO6A 1H2ZA 3LK7A 4KN9S 4MUNA 1E94E 5DASA 1YUNA 4BAZA 1ZOPA 3UMCA 3R3WA 3SOZA 3VBCA 1WLSA 1RKBA 3L1IA 4X8OA 1V5FA 2FEXA 3VQTA 2VZ0A 4BU0A 1YUMA 4C0AC 2OQRA 3ESCA 2PT5A 2ZSJA 3IHKA 4ZQGA 3WL4A 5LLDA 2W6ZA 5CDFA 3DD1A 3C4QA 3JQRA 5I9BA 1J42A 2QZJA 2II6A 4PZ0A 3QLTA 2OKCA 3UH1A 4CLXA 1XZIA 1PJRA 1KORA 2I3DA 1SVNA 1XJQA 3FTQA 5D85A 2X15A 5BR7A 4IVQA 4JKOA 2VWQA 3MBOA 1EZ4A 2RHWA 4R4JA 4I1IA 4OBXA 1QF6A 3NI2A 4YC7A 1KEWA 1EFLA 2BGNA 3BTVA 5I7OA 4MP8A 4P2GA 1U28A 3EQ6A 1D1TA 2KPOA 1S8NA 4XJXA 3U9SA 4BLOA 4NXNB 1M8JA 1XX6A 2ENUA 5E6SA 2HBZA 4NOLA 1THMA 1D6MA 1FSSA 3SS9X 3VHRA 3GLGB 1NJ8A 3PRKE 4YAEA 2ICAA 3VM6A 2PE5A 4C04A 2IUSA 2YV2A 1J1IA 5KOHA 2D0OB 3EY4A 3JYOA 4WOKA 4JMLA 1I3CA 4J2TA 2PD4A 4NL4H 5K8CA 4ESVA 4Q3OA 4JXZA 1YS1X 1ZGAA 1ZJJA 3UJ3X 5CFRA 4M4SA 3U3RA 4HEQA 5EXSA 1E98A 2Q6LA 4KPYA 4JUFA 3G1UA 4MVJG 4WFQA 3CRVA 5E9QA 5ED4A 5KNCH 1KJ9A 4FHZA 3AERB 3E58A 1DXOA 5IN5A 4RMIA 1HDGO 4NZOA 2PWBA 1DINA 3P20A 3Q8KA 4HDSA 4U3JA 4PCAA 4YREA 2D8AA 5A9SA 3HXPA 3P2YA 2Q0XA 3TSZA 5D5PA 1GZ6A 3T4UA 3UT6A 2NO0A 1KI2A 3HCDA 3IPYA 5ENVA 5FLXA 3HL4A 1EKXA 4E5UA 5CFZA 5BSWA 3AI2A 2VZEA 4FC6A 3FVTA 3PQ3A 3P52A 2RHTA 1DJOA 2PHZA 5JSFA 1RPZA 3GPIA 1ZFNA 2HMWA 4IS3A 4NAHA 1E7QA 5I7HA 1J0EA 2HBYA 3BGDA 3QUSA 1KI8A 4HN4B 1Q1ZA 4X1YA 5CPFA 3UCXA 1HORA 4BEWA 3QPWA 2VUIB 2PUFA 5AW5A 1VL5A 3ASUA 4UBKA 1LGYA 1W73A 5LNK6 1YZHA 3DLBA 1A9RA 5JWHA 1CJBA 3D7LA 2P5SA 3O9MA 4OSPA 4OG2A 4O4JA 5GJCA 1B1AA 1U2GA 2A7QA 2GJSA 3WRYC 4PXYA 1KGDA 1OUMA 2Z5FA 3AFGA 3GCWA 5EZQA 4DWJA 2E4AA 2XCIA 5GONB 3K6JA 4HMPA 4IINA 3ST7A 1V5WA 4J07A 4PF1A 1MBZA 3LUDA 3RCBA 4TMXA 4E5NA 1OH5A 2O8EB 1Z2NX 2DBRA 2EZ4A 4MVJI 1A7JA 3SIRA 5C4IA 4EABA 1N2JA 4HBGA 1G9XA 4IF4A 3WICA 1DIAA 3PT5A 2AI2A 1BYIA 2IDZA 4XAQA 3FCOA 2VRBA 2OPBA 3KZCA 1GPWB 2DUUA 3SF8B 3ORRA 1AN0A 1T43A 3ZK8A 4MS1A 4ZDIA 4ZFNA 2HU7A 3T3GA 1IY0A 4YA6A 4TSKA 1C81A 5LUAA 1ZKMA 2QYHA 5H3HA 3KEGA 2POCA 3EBOA 1GGFA 4KO2S 1PLLA 1D1SA 4J16A 1WNTA 3EHDA 2Z5LA 1SIUA 1I33A 1P81A 2QTAA 3G0GA 2ZLBA 3CB2A 4XGQA 5I3ZA 1TUIA 3IL2A 2CYBA 2X0EA 1F9EA 3RFUA 1Q1GA 4V0SA 3MELA 3QXCA 4I4IA 4RSRA 3AF6A 3VGJA 2QX6A 1PVOA 1HT1E 3FKQA 5FNZA 3TFQA 1UBJS 1A95A 1C8LA 3EGOA 4D3YA 4TXMA 3DO8A 3F6PA 1T5HX 4PICA 1OV4A 1RPJA 1DQPA 3L05A 3OC0A 4LKOA 4NR0A 3RYIA 1E0DA 2ARKA 3I4LA 3CIFA 2CMKA 2P1RA 1J7JA 2HO5A 2RGWA 3IIMA 3OCXA 1SUDA 5FL7A 2O3RA 5LDGA 1Z2DA 4FS8A 3SN6A 2B3TA 2DVMA 3T3MB 2D0DA 4UASA 1Y4ZA 2HCFA 4QYTA 2QP3A 1SXHA 1MRNA 2ON6A 4WX2B 3OJCA 2HMYB 2IQ5A 4UU8A 1E9CA 4WN9B 2GVZC 1VLMA 3G23A 2OG1A 5IWCA 2NZUG 4CCWA 5IEJA 3VBEA 1SVOA 2JA2A 3IBCA 3QOWA 3IE1A 2FPRA 1R0BA 4U7DA 3U44B 1S2IA 3OLZA 4P80A 1UBSB 3AF1A 3ZXSA 2R8OA 3QENA 4RA9A 1IB0A 4KMRA 4EO4A 1E2GA 1ECCA 1NUQA 2GN6A 2I67A 4LJ9A 1TM4E 3C16C 4YAJA 4DQUA 4WXPA 1F9AA 2ZSKA 3QVUA 3RIMA 1G8AA 1QQ5A 3EG9B 5H3LA 1KYXA 4HMQA 2J0EA 5LCXA 3ZOZA 2C3YA 3B6EA 3QVWA 1WY7A 2FJ0A 5JS8A 4F0JA 4R1OA 1Z6GA 1UXJA 2GSWA 3CWQA 4Z4IA 2UZIR 5LMCA 2PJRA 5CNKA 2XB2A 1Q1BA 1SHZA 4FZJA 3AJ8A 1W9HA 4YWJA 1ZLXA 2XF8A 4XUCA 3TQOA 4D25A 1GQ2A 1JLKA 2X8JB 2R86A 1P5FA 3ZYCA 4UNSA 4OLBA 1KI3A 3T9EA 4Z51A 4GRAA 5C8DA 2VTBB 2WVGA 4WLEA 4LC9A 2Q3BA 4TTPA 2DQ4A 1R88A 3MJRA 4C5BA 4L5YA 1BNCA 1BS1A 1G291 1LV7A 3WL5A 2RSLA 1M6YA 1OY1A 2JJMA 2O4UX 1JEJA 4E09A 4CF7A 1SCQA 1TAQA 1N1MA 1DRUA 2EL7A 3ABIA 3IDQA 1IEWA 1N9KA 1EQUA 3K9NA 3QUTA 5DGDA 3SDSA 3UC9A 4FOTA 1CSEE 3CT6A 1GCUA 1FLAA 2FCRA 1B73A 5C1IA 3PEVA 2R79A 1NVFA 3HC7A 4NYMR 4PGAA 4R2IA 5T4EA 5FBVB 2RB5A 2ZYVX 1PJTA 5EJ4A 2G9RA 1WPXA 3NCHA 3LUAA 1OAAA 1K6XA 2AN4A 5EIOA 2YWHA 4FYVA 2FAXA 4NBKA 1SHKA 2MDTA 4HJXA 3PQCA 4X63A 1UJBA 3P27A 4A91A 4RK1A 2CKMA 1LZLA 2WIDA 2ADMA 5DU2A 1ZUD1 1YNSA 3PZRA 2CMHA 3PLNA 3PU6A 2HMTA 4YRDA 5KVAA 4EEKA 4NEQA 4ENTA 1ID8A 2JCXA 3FAZA 2AR7A 2C83A 3OA2A 4ZAFA 3AM5A 3UAGA 1OSNA 3T7RA 3WYGA 4IIUA 3A1UA 2ZVPX 4KXNA 5JQWA 3H17A 1G20B 2QT9A 3D6JA 3FHTA 4JJ4A 4BV3A 3S8EA 3M81A 1JWLA 3X2FA 4URUR 4ZRNA 1ZAKA 3U1VA 4L08A 4N5DA 3D9QX 2R2GA 2CVOA 3SHVA 2YIDA 1RP7A 2Y77A 4RLSA 3UGTA 3EPHA 2WPDD 5B12A 1BE1A 4BLQA 1NV8A 4QUHA 2A1TS 1EVYA 4RZQA 2IYVA 2E4XA 5E4FA 3W6OA 2ZE6A 4AM8A 2DMRA 1B0AA 3F6BX 3FYSA 1TX4B 2FTKE 2C4MA 5DOZA 2AF4C 1W2WB 4I50B 5AW8A 1JRLA 3FDIA 4EWLA 1QVWA 1W36D 3U4AA 5HE8A 4D9JA 5ERXA 2VCYA 4TV8A 1FRZA 1WCWA 3I9LA 4S1OA 3FYUC 5LQKA 5B3JC 2PWYA 1ZC3A 4Y2SA 2XQVA 3RVNA 3Q87B 4AKSA 1OPRA 3C5EA 3W2GA 1CX9B 3ILVA 4ZPXA 1WQ4A 1LLUA 1DC7A 1RIFA 2GAJA 2QZ9A 1MAHA 3IKMB 2YVUA 4G5XA 1EIWA 1ODIA 3ABRB 3DPIA 2I71A 1T9DA 1YS4A 3ZCRA 2B94A 3RHSA 4B9EA 4KEAA 4LHWA 1ABFA 1WXFA 2BL4A 2C82A 3K0FB 3FDXA 3NIGB 5IEBA 1MGPA 2H7VA 2QEQA 3A9VA 1PKEA 4XEHA 3S7TA 3EDCA 5IS2A 5ENZA 1JR6A 1RM3A 4Z1MA 5CBPA 3A11A 3NM6B 1E0SA 4B17A 2D3WA 1CT9A 3GJZA 1CC1S 3U4IA 4PZ9A 5NULA 4IUDS 4KW7A 3H6HA 3MTJA 2C57A 2WPNA 4LY0A 5BVHB 2Q8PA 4LIPD 3DZGA 5KBYA 3DOUA 3KKQA 2D8MA 1TMYA 2P9GA 3KNZA 3QEMB 4M1MA 3TM4A 5M04A 3ELUA 1M34B 2C9ZA 1UBMS 3CW9A 3L8DA 3DL4A 3LKZA 2ZBGA 3UM9A 1OBOA 4J1QA 4YASA 5BQ5A 4AYTA 2OXEA 4BDSA 1XZDA 3DQQA 3IR7A 3COWA 1FFDA 1GPDG 3ICWA 3QMPA 5H4HA 4IQ0A 2GZ3A 4BKMA 1ZMXA 2BGUA 1OXTA 4U8GA 1GITA 2Z4TA 3EFBA 1BEZA 2XT6A 3K0EA 4JQCA 8ABPA 5JU6A 1P9OA 2E4ZA 4X84A 1QO9A 4ZWNA 4B47A 4F97A 4ZV4A 4Q05A 2QWXA 5BSRA 5C5DA 3QSYA 3KAQA 4YQYA 1YONA 1U7TA 5I5GA 5LDHA 1HDRA 1CD5A 4J75A 4C43A 1U65A 2VF8A 5AESA 3TI9A 1UDCA 2WB4A 4MVJP 3DV2A 4L2IB 1V8OA 4F60A 2HREA 4R2KA 2AB0A 2J8ZA 1OC2A 1Y6ZA 2M2IA 3T3PB 2IPMA 3CXRA 5L3RA 1SD1A 4Q4JA 3Q3EA 3TB6A 1NPTO 3L4KA 2V7TA 3E03A 5EKDA 3FCUB 4QHYA 1ZNXA 1X1SA 3O8BA 4AS2A 3B48A 1CUZA 5HP4A 2BCJQ 4NCJA 5DLDA 2WVHA 2IW3A 1ZGGA 5L3ZA 3B36A 3JV7A 3WDSA 3WGIA 2UUAB 2P4UA 4HZUA 3Q41A 4Z53A 3ZCPA 2JHCA 1S3GA 3JWJA 2I6TA 4KK4A 1RZ3A 3DL2A 3DKPA 3MERA 1EXVA 5K51A 4MEJA 4P9NA 1XVAA 3RRMA 3PITA 4GEKA 2PQ0A 3ZY4A 4CIAA 3KTOA 1A2OA 2YN2A 1UP4A 1E4EA 1N78A 2ZRFA 4NBVA 4WEOA 2ECOA 2AQHA 2NU9A 1QP8A 4W7HA 3FLAA 1M5TA 3FCCA 1J8YF 1SC3A 3NIDB 2WZQA 4W9RA 1GTL1 4Q16A 4CKEA 3MJFA 1M8FA 3NBKA 4FOLA 4N4AA 4W1SA 1CVIA 5E3IA 5EAIA 4EM6A 2J3LA 2ZJYA 3H5RA 4ZI7F 4ETWA 2NXNA 2O06A 1T6XA 1PN3A 2HWKA 4UAGA 3NTLA 3OQVA 4V1CI 4J1SA 1XVTA 2LV8A 4PSKA 1V3TA 1T5LA 1YRQA 3PNVA 4GOXA 4MK4A 1BMQA 3IMKA 3MT0A 3SEQA 3UK1A 4RBNA 1BXZA 1EQAA 1FLVA 1KJNA 4ZAVA 1TYAE 3LX8A 3QY0A 5ECWA 4BUCA 5KC8A 1E64A 2HMUA 3CU5A 2JGEA 4P7KA 4Y2VA 4YRRA 1OZAA 5IDQA 4HWRA 1NG1A 4H1UA 3KP1A 2JI6A 4PSVA 5DHRA 3QKUA 4KQEA 3EZ7A 5EC8A 4QE3A 1KEEA 1CUFA 4U5QA 1E6CA 1ETUA 1SBTA 1SZPA 3FYUB 3KO8A 4NBNA 2PPVA 1SOAA 2SNIE 4HQKA 4YRPA 2H1LA 2EX4A 5HIIA 4ZANA 4EG4A 1X7XA 4D3SA 4AT1A 3C0KA 3PC8C 1T3ZA 1Z3CA 4UHEA 1IUOA 3HCRA 3GHYA 4PPQA 4N8DA 4COOA 4F6CA 2UAGA 2Y76A 5CVTA 2IUYA 3OIWA 4IDPA 4H1WA 5JTUA 3LGAA 3O93A 3TVYA 1KKMA 4OY3A 1YZTA 4HDMB 3TSYA 3DE7X 2A6PA 2Y68A 4WACA 4ASUD 2OC9A 3X43A 4C5CA 1XNRB 4ND4A 1UC5B 4AMBA 2BKLA 5DW3A 1ZJ6A 4EG6A 3DT9A 5DI3B 1TCBA 5AJHA 1G16A 2WU4A 1J0AA 3HO6A 3OZRA 3KKNA 3V8QA 4K86A 3BRSA 5FBKA 3KUKA 2QRHA 3CRZA 4RH0A 3ZJYA 5DYYA 5HKKD 2BFPA 5ITZA 1KWGA 5JVDB 1XMSA 3LY8A 4UUNA 3T7TA 1JAHA 2DKOA 3R41A 1GN9A 2NZVG 4V24A 4NVRA 4YJ3B 1WMBA 4ZVMA 4CTOA 4PTYA 4TYYA 3OSUA 2WJVA 3LO8A 2GNPA 1X8XA 2NU6B 1Z0IA 2FR8C 4Y2XA 1QC5B 5ELMA 2O2ZA 3DAHA 4F4CA 1E2UA 4RPKA 4J8PA 4OO3A 1Y63A 1E3LA 2AW3A 3QFCA 4QTTB 5C53B 1FX1A 1CR2A 5J2TB 1E7YA 4ZT5A 4ZCPA 3VO9A 1ZJ4A 5TQJA 1WXIA 4DJAA 2OOSA 1UIMA 6YASA 4TYQA 4C4PA 1TC2A 2PX5A 1I3OA 2WZBA 3E5HA 4Q3DA 2ODTX 3WWDA 2DPHA 4I5FA 3ZGYA 4P34A 2QAGC 1WDWB 3CZ5A 3M4YA 5K0NA 4E22A 2WABA 1JDBC 4QEDA 3RTEA 3CTMA 3LF1A 3S5UA 5BMVB 2WW8A 2WA2A 4ZN6A 1Y7TA 2MSLA 1XTKA 5FKJA 5JWOA 1PJ8A 1DSSG 3IA7A 3HGTA 3UK6A 1AUPA 1A9YA 3ZJVA 3R3SA 1C7QA 2G0TA 4NS1A 3E2IA 4GIBA 5FO1A 3ETHA 2I1QA 5AW9A 3UOWA 3UJ7A 3X44A 3TYXA 4KN5A 5EINA 1QAMA 1JDJA 2PL5A 2F1IA 2H4JA 4OXKA 2A1IA 4AUEA 2DG2A 4EEXA 2BRUA 1QK5A 2GHTA 2WJJA 3NYQA 4FDTA 4AP6A 2WG0A 4B1FA 2OCIA 2N42A 1P9RA 2Z8ZA 1M1YB 3LGSA 1RACA 1XP5A 2DWUA 2JF0A 3LYAA 4HFMA 2YZMA 2ZB4A 2FZVA 4I55B 2O1XA 4BFWA 1W19A 4EAAA 2G5CA 3GJ6A 3MRXA 3W5VA 3RUHA 1ZD5A 1N2CE 1VYVA 2PZJA 4HT3B 4EUSA 4EHFA 1RLIA 2ZUCA 1I3MA 2REBA 1JDUA 1JQJC 3F7MA 3GFTA 3HPRA 3OFJA 4QUAA 3WNBA 1NQVA 3FVWA 5HW0A 4ONEA 3RYFA 4DMRA 4IV8A 3UH0A 1JH8A 5CFMA 3EGEA 1L4KA 2OGWA 4GZMA 1VLHA 4JKYA 1X7HA 4HB2A 5C52B 3V1NA 4P5PA 3WBKA 1XDUA 2EOAA 1KVRA 1RQ7A 4M7RA 4BWYA 4YT4A 2GQ0A 1CYDA 3KPWA 4IIJF 4QVIA 2P2NA 2R6DA 1WB9A 2RCNA 4MWEA 3SM3A 1NMSA 1E63A 2O8CA 1XZNA 3TCXB 5JXIA 3C6YA 1Y6JA 3E1KA 2CNOA 4P7GA 1YJAA 3AP3A 1VCIA 2IE8A 4V0OA 3QPVA 1I7NA 5GPBA 2YJ3A 2C58A 3I05A 2CLHB 3SYTA 4BB0A 2Q8NA 5FR2A 4LE0A 3R0XA 1IZZA 4B8YA 2WQ7A 1UC8A 2P35A 3E82A 4BGUA 3AY0A 3OZIA 1JI0A 2O4CA 3IODA 4Q15A 1AXRA 5JMPA 3WL8A 5AJTA 4DREA 3P9QA 4P0PB 1N5RA 3HB7A 5BOSA 1BU5A 3AVOA 3B2EA 3C7TA 4ND1A 2QG9A 4TSFD 3DTYA 3ZBTA 3AVTA 3UUFA 2QYSA 4NULA 2C5SA 1E60A 1PK9A 2FOXA 4YJDA 5IVPA 4B75A 3U7HB 5AOVA 3WDMA 1YTUA 3TZ6A 1M1ZA 1BTOA 1YCFA 4QU5A 5B6JA 1G1MA 1TW3A 1XIVA 2PXHA 1Z2PX 3WXMA 2YNMC 2WSBA 1E5TA 1MDBA 4AYWA 4CU5A 3EEOA 1BE8A 4TSRA 1QDEA 2PVCA 3D02A 1USGA 1U9YA 4YV2A 2HK9A 4KXUA 5G3ZA 1B43A 1EXNA 2FWJA 2QJRA 4BLTA 4POOA 3JVDA 1Y8CA 2AWNA 2FFRA 2GN4A 2Z4RA 2QLJA 1W8IA 1K8ZB 1V3UA 4WESA 1P8AA 2F8LA 2HJ9A 1RYZA 4QUKA 3H4VA 3UBTA 1PUJA 3VKGA 4TWJA 2W48A 5KOJB 5BNWA 4JSYA 5ELXA 2W98A 3FSRA 1LLDA 4I6GA 2RGDA 3CGGA 4Z4HA 4X3OA 3CZRA 3ECSA 3PLRA 2NMVA 5JQGB 1TMOA 2WNIA 3ES9A 4OYLA 4W8OA 4N47A 3UJ6A 4EUKA 3E3AA 4WDRA 5MN4A 3SEFA 4XDZA 1PJLA 3IULA 2FX2A 1R5NA 4TLCA 1MJGA 1E7RA 1U0LA 3TE7A 4R54A 3R9WA 2XVAA 3JATA 3MTQA 3FPJA 3O74A 4M1QA 4U2DA 1U63A 3AILA 3U61B 1JEYB 1VLZA 2WU1A 3NEPX 5TQVA 2CUTA 4RDIA 4LJ8A 1Z15A 2NUBA 2HLDD 2DPXA 2GARA 2I66A 5C3MA 2QRQA 4BNDA 3NFYA 4U4AA 4QNRA 4LYAA 1JDBB 2WYVA 2VLIA 3NUZA 5THXA 5DN9A 2BGRA 1B6SA 3MGKA 3RFCA 3UHJA 3KQNA 4NYJR 4DILA 1UDXA 3ZHXA 4CMCA 3PHIA 1ZHHA 5K8JB 2HQOA 3O4FA 1PQWA 1J2EA 1VRVA 3QX9A 3E27A 4H6XA 3C3CA 3EXIA 4JY7A 4UU1A 3WMRA 4WY8A 1NP3A 1VL0A 4RVHA 2X22A 4NU5A 1LUAA 3JWEA 2RG1A 4P4SA 5L45A 5H80A 1BCRA 3BMNB 1XN4A 3WMGA 3NMUF 1PAUA 1UMKA 2DFNA 4ZO8A 2V74B 4EI2A 2P2GA 2XTMA 4Y9TA 1HR0B 1DVRA 1LS6A 1GCAA 2A0KA 4CV2A 1O9BA 1OIXA 3A6PC 2W8ZA 1FJXA 1FDTA 5HX7A 2O20A 1HYGA 1PO7A 1RHKA 2KW5A 3L1KA 5E1MA 5HRUA 3Q9UA 3QU2A 2NVWA 1ISJA 3E1GA 3R8CA 3Q8MA 1FEZA 1U2SA 1IWOA 1ODTC 1TEZA 1UOPA 1VFNA 2PH5A 5H1YA 4DCNA 1WB6A 1FDVA 4JLOA 1BKYA 1HA3A 4N5HX 5DH9A 1L3BA 4WNAB 3PNYA 1WXEA 1VXOA 1Z5NA 1ZSVA 4O4LB 4P4GA 1PWXA 1R4ZA 2ZJ8A 4ZOAA 2G9NA 4CEHB 1M9NA 2X9GA 1EFVB 2HCBA 4IEEA 4YO7A 2BZGA 3A10A 4NNJA 3NFRA 3OZVA 3K20A 1GUYA 4JHXA 4MB2A 2X41A 4EF5A 3H86A 3MPOA 5CLFA 1RHJA 2J85A 5GJVC 1ISGA 3TOCA 2CDAA 4QXMA 1QNLA 2HDHA 2K2WA 4R8RA 3F4KA 4NZ9A 4C22A 2PS9A 3A58B 5ELLA 3T7CA 2JAHA 3RUFA 4ZPJA 4YIKA 4RKQA 4RAOA 3WVNA 3QYAA 5DX1A 2ZUTA 2VK8A 3AY3A 1XL1A 4KGDA 4X1IB 4HNTA 1C9YA 1ZEJA 1TPYA 2UVPA 3EGDB 1XMQB 1PGPA 3BK2A 4CF3A 4FWIB 1FDRA 1WCIA 3T9FA 3E81A 1KZGB 3VAZA 2JHAA 1QG6A 6ABPA 3EH2A 1J56A 3GROA 2ZYDA 3KPJA 1PFWA 1PG5A 2WOJA 1H0KA 1I4DD 1Q0ZA 3ACDA 2C42A 2R6CA 3CN7A 4QDKA 5L7TA 2RK6A 1JSZA 4BHTA 1U1CA 4LXHA 3RHTA 1F1BA 3EBLA 3RFXA 1S9HA 4LNUA 1JMKC 2R8ZA 4MVCA 3SJCA 3ZIUA 5CDGA 4R2XA 1RC8A 3C4VA 1P1HA 1UCFA 3NJ4A 4KQFA 4LYYA 3I09A 3DP7A 2WKRA 2C7QA 4COKA 3HXKA 1MRSA 1AGPA 1W0KD 1DAKA 4L07A 1SCNE 5DWQA 1H8HA 4YUVA 3ZWNA 1RAIA 4DM3A 2I4OA 4H0CA 4ZDJA 5FPHA 2BGWA 1ZJWA 4CVNA 2CZCA 3OZFA 4ZEOA 4TVOA 1I1OA 1JDTA 5BMVF 3ER9A 2VS1A 3ILHA 4FGWA 3LWNA 4MKRA 1RTTA 2OD7A 3CFYA 3CPJB 3JRWA 2R87A 4WBNB 1TKAA 1UODA 1RR6A 3ITEA 4P5EA 4R1SA 2O8FB 5KYUB 3D8RA 3S2SA 3V4OA 4KCGA 3W2TA 1NR7A 2P8JA 4KV7A 5K6AA 3X2EA 1GGNA 5IASA 4NCKA 1HYQA 4J3FA 4YP0A 3KSZO 4NARA 1PFKA 2WSSD 1JPNA 2J9RA 2HU5A 2FGKA 4P2BA 5IARA 1Y0BA 4Q1DA 3D43A 5CRIA 4UZSA 1W88A 3VR0A 4MA5A 3ROPA 2LRHA 3NHYA 1ESZA 5K3BA 1LW6E 3QVLA 1VJ0A 1ZVMA 4I55F 5HHTA 3L6BA 3PWTA 2FZ4A 4KKVA 3B8EA 1SCBA 1T9ZA 5AI4A 3ETNA 1D7AA 3W6NA 5TEWA 4C2BA 5TARA 5KVVA 3OLWA 5DX0A 3LOQA 3D6MA 1YE3A 2ZYWX 4ZC8A 1I4WA 1Q19A 1ZXXA 2IT1A 3A6GA 2O59A 1YS9A 4IDFA 4P3XA 4B3CA 4EVSA 2FPOA 3O94A 5F5NA 4P7FA 3BM5A 3MRSA 3OEEA 2F3TA 3OJEA 4ZZIA 1TT5A 5HZMA 2AE1A 2CLDX 3VZDA 5A0VA 4O4HA 1LRLA 2E1RA 1TZKA 3ISTA 1TCCA 2H4YA 4M9CA 3FNEA 1UBGA 2FRVA 3BIXA 2EFGA 3CRNA 1C9NA 2XMGA 2J9GA 2JCSA 3CUYA 4YPFA 1YHZA 1Q6YA 3EXHC 4YALA 3T0FA 2FPPA 5KHAA 3SZUA 1K7FB 2QNIA 2D2VA 2HSJA 4HRVA 5EHIA 5CCDA 4EBFA 3OPQA 3NWOA 4Q3BA 3DGEC 5GGYA 3OI7A 4ZMBA 1E92A 4P81A 1GFSA 2A9RA 1THTA 2FPLA 3JQBA 3EQZA 3IB6A 3MAGA 1MKYA 1XVVA 2B25A 3K1YA 1QIJA 2CSUA 3OTGA 4TYWA 1WPRA 3N8HA 4MROA 5BR8B 1O95D 2AMLA 3KXKA 3RF7A 2CUKA 1BE0A 3OO1A 3PUKA 3TFOA 2I1WA 6PFKA 5KTMA 1OI4A 2G1UA 2O0JA 3LHDA 3PNBA 1NX6A 3Q3HA 2H9IA 2VDMB 4FEAA 2JJQA 3VTZA 3G2IA 3LC7O 4N5MA 3HFSA 1IFXA 1PJ2A 4AJIA 3JASA 5EIBD 2O3JA 3D3NA 1YL6A 4L4SA 1U9ZA 1D2EA 2FPXA 2FLVA 5IZ4A 4RHEA 1WBDA 2DR2A 1TQ8A 4EMBA 2IXEA 3FLBA 3FPGA 2WR8A 3F7NA 5F5LA 5ULLA 2W4QA 2PO5A 2YUTA 5JCOC 3K6SA 2GKOA 3WHKA 4LPKA 3TNLA 4DDUA 2BSXA 1E1RD 1WS6A 2XNHA 3FWKA 3BBPA 3WIOA 5IBCA 2ZAIA 4C0LA 4BNFA 3GF4A 4IXNA 1MGOA 4YIHA 1QB7A 3FVQA 3L46A 4CCSA 4DLPA 3BSYA 3MJHA 3L43A 4TV9B 3VU8A 3KHKA 1IMOA 4D79A 1P72A 1L4LA 1QE5A 3PPIA 4G07A 3ROXA 3E7PA 3FRIA 3MRVA 4PRLA 2IDJA 3BYZA 3ZN2A 4K8OA 3GRPA 5A4KA 1DC6A 1CUAA 3EXAA 1BHSA 4MUAA 4J6FA 3KYBA 2HWWA 2WTMA 1NF2A 3FZEA 1KYTA 4RGBA 4X1KB 4EVRA 4K9KA 4UDXX 1RPNA 3VC1A 4I9UA 2BDUA 4LW8A 1QTIA 4HUJA 3HLYA 3VYTB 5K0SA 1Y4AE 2TS1A 2O19A 1Y9EA 1VL2A 4LI3X 1VDZA 3HCBA 4XQEA 3FOZA 1KQ3A 1L5MA 2IBMA 2MMGA 2X7HA 3DTNA 1X3LA 1MB9A 3A4LA 2W6QA 3LQRA 4OMCA 4GDFA 4PYMA 4KXYA 3JQQA 4TRJA 3GZTB 3EPRA 1IG3A 4JMPA 1PLJA 1UXGA 1O6BA 3Q7EA 1B2RA 4PG4A 4RNDB 2R4UA 4OK6A 4WK0B 3ZHZA 3DR5A 4WBSA 1FNCA 5AHRA 1CIPA 4IJWA 3BIFA 1N2EA 4OP2A 5E0KB 1GUAA 2PAFA 1F2TB 5DCLA 4K7JA 4JQSA 1FSPA 3LVQE 4JB0A 1JQKA 1PWEA 2NTYC 3MJEA 3JALA 5CD9A 3IAFA 4F7WA 3GC6A 2B8WA 2XOEA 2AE2A 3R0ZA 4LQ4A 1NT2A 1LK0A 1TIBA 3RRNA 4Y0AA 3V00A 3OOHA 2C2KA 4CL2A 1ULBA 1N0VC 1OTXA 3DOIA 4C89A 4PRYA 1YJBA 2EVWX 1NM5C 1WOYA 1G2QA 1XEFA 2JLSA 1D0SA 2OFWA 2Q0QA 5DBHX 4ACBA 3M6LA 3CH7A 3PDUA 4XX0A 2RKBA 3BMQB 1BFKA 1Z0FA 5MHTA 2OBMA 1O58A 1RNLA 4YUAA 1GSHA 1ATIA 1NJ6A 3F0TA 3LXXA 1QHNA 1G3UA 1JU4A 1N6NA 4O4LF 4TS9A 4B3IA 1XCMA 1D2CA 2BHLA 2XUAA 4CKWB 2H1FA 5IJ9A 2W6JD 4LECA 3QBVA 5BYBA 4ND8A 5D51S 4LFBB 4X6LA 4BXOB 5FI0B 3NX4A 3TO5A 4EJFA 4X3PA 4ZU3A 3EXHB 3RVSA 3P2KA 2XRYA 3NP7A 1P0IA 2A5DA 4KSBA 3D5TA 4RJLA 4RORA 1TYCA 2PCLA 4XUEA 1D2GA 3GV0A 1WOMA 1ZVKA 1XEWX 3L6DA 1L6IA 1R9GA 3CEMA 3H2YA 2RGCA 3L5OA 3MWYW 4EF4A 3QPDA 3EYWA 4CL0A 7REQB 2QTZA 3AJDA 2P0YA 2R48A 1Z6AA 3GJTA 4DBLE 5C18A 1H2XA 2QLBA 2PLRA 3G9TA 5JD5A 1GARA 4W5QA 3D3WA 3QNWA 1YS6A 4LSGA 3U26A 1ZI8A 5WRFA 4RENA 3LFHA 3KM0A 2HLHA 2E49A 4RTPA 1X1AA 4KYTA 4GD3Q 4KQ2A 2JPDA 2Z2XA 4Q3CA 3ZKWA 4QOFA 3H4TA 4JB3A 4R3WA 1KZ4A 1Z83A 3L1UA 3MINA 3KWLA 1MT0A 2YXEA 3MWDA 4CKCA 5BW5A 3KDPA 4DY4A 3TLCA 4IFEA 3Q3GE 4XVQA 4FQ7A 4DHEA 5EEHA 1KDTA 4F4JA 3AY7A 3I5XA 1W7AA 1WB4A 4G36A 3N76A 5JS7A 4YDRA 1TQ2A 2PEZA 4RKWA 3ITNA 3V34A 3EFEA 2J1LA 1YHYA 3MUNA 3HVUA 4LWQA 4MYCA 2QXUA 5BWOA 1QVAA 1L5ZA 1JXMA 3JQFA 3QKIA 4H4DA 4PY2A 3TX6A 2FMXA 2BMAA 5LYJB 1KJQA 1ORVA 1GKUB 2RAUA 2V1XA 1YRBA 3W06A 5EUCA 4PEVA 5F4BA 5KYYA 4EG3A 5C3UA 3ZOKA 3V8MA 5DTEA 4MTLA 4KE9A 2EATA 4Z0TA 1HC7A 5K03A 5BWBA 3GT4A 3NANA 5J59A 3ZDBA 3BXZA 4FOPA 1LBTA 2ZSUA 4YROA 4F6LA 1FU4A 1Z73A 1QU2A 4E11A 3PWKA 3ZV7A 1PEKE 3HSKA 4CDRA 3BDVA 4CMIB 1VHQA 2CB0A 4LDJA 1MX5A 4N01A 1KJ8A 3KHTA 3O47A 2ZDHA 3LE8A 1EAYA 2VSFA 3M5WA 4A26A 4G0QA 1UBFA 5LXTB 3GGGA 1FTQA 2OWEA 2UXCB 1HOTA 1Y42X 5JRZA 2CEAA 3AXTA 3WLFA 2FG7C 1OH8A 4ZAGA 1GAJA 3I9KA 3SYLA 4XCQA 4TL9A 3AHCA 1Z8DA 4RSGA 3ZU2A 1S4MA 4HLNA 2P2DA 2YTZA 4OQFA 2PTGA 4QFCA 3LPCA 3S40A 5C2JB 4FYMA 1FS5A 3CLSC 3WJAA 3NBUA 1PFYA 4DAOA 4EHJA 4KO3S 5AVTA 1KOGA 5SICE 3RC7A 3EVDA 3IA2A 4K9DA 4MV1A 5IT4A 1XEWY 1ZCZA 4X64B 3ZE2B 2DTXA 3X0DA 2QI9C 2BPOA 1YR6A 1U5AA 4CR6A 1P1RA 3HN2A 2WKQA 5J1TB 5J47A 1U7XA 1DQSA 2V3VA 2D1SA 4PANA 2B20A 3GCXA 5AVXA 5KQRA 2QM7A 2LXNA 3EASA 4V1CB 5A06A 2HJVA 3K8OE 4HTAA 2A92A 4FEYA 1NVVQ 3K6RA 4YRQA 5CA0A 2A86A 3DC2A 3KR2A 4IZIA 2H4HA 3L7MA 3NC0C 3P8ZA 4WZAB 2HZ7A 1PTJC 2XWBF 1PNTA 3HFGA 3G89A 5TC4A 2FW8A 4IV0A 2JIRA 4Z8XA 3RBVA 4US2R 4M89A 1TC1A 4PZYA 5EKXA 721PA 3IOEA 2RHOA 1KE1A 3KYCA 4RACA 2GEDA 2YOHA 3HFJA 3O7MA 3EMBA 1OJLA 2GXSA 1T5BA 2XRMA 3QW4B 2PUWA 5G02A 5TMBA 3S2EA 1E66A 4NY1A 1VCMA 5AD1A 2WPDA 3L7KA 4MUHA 3WLLA 2WTAA 2YJTD 5KNBD 4DDWA 1R6UA 1QYVA 4WXHA 2NO6A 1QGED 1NIPA 1DIRA 1L6RA 3W3AA 1QYRA 3HXOA 5EJEA 1GVNB 1NVWQ 1GQYA 1SN7A 1L5HB 3KC2A 1BKSB 1NA5A 3E9EA 4I1RA 2Q5LA 5LA6B 1RKUA 3WKEA 3FWNA 4D3DA 1GRQA 3INRA 1E2IA 1JHXA 2FEWB 5JSZA 2DH5A 2YDYA 4YFYA 1NSTA 2H0AA 1CEQA 4FKMA 4CRWB 1A7KA 4AJNA 4DSZA 3PNPA 2AZMA 2HBRA 2Y8EA 2ZE7A 2WJWA 3G2NA 4J1NA 3FSGA 3KPVA 2ETXA 4ZTBA 5A04A 2G4CA 2XUHA 3QVVA 3SOPA 2ZPAA 3OT4A 4TV9F 3JZFA 1PEYA 4WLOA 1NC3A 1XZCA 2OKGA 2A0UA 1XCJA 5IG2A 1DIHA 3B1YA 4BO3A 2CDRA 2IYUA 1YMQA 3M5PA 4QNNA 1EHYA 5CXSA 4P7JA 5FDFA 5LMUB 2WC1A 2ZU6A 3CZAA 3LBFA 4ZOEA 1A9QA 1LDYA 3AV3A 2GHRA 3HB4X 2Y6VA 1VB3A 2VF7A 4GX1A 2HIGA 3NHJA 3ZCUA 5BN5A 7GPBA 4BGVA 1N5JA 3O9VA 3UCEA 4B40A 3FUWA 1SPXA 4IYJA 3OTOB 3BEDA 1GNTA 3AIOA 3LQQA 5HFJA 8ADHA 4D9EA 1BJKA 1POWA 1YU9A 3P9XA 3I04M 3M4NA 4HN2A 1AT1A 1LB1B 3A1TA 4MIKA 2VNJA 4ZVNA 1TB4A 4RIEA 2ZYRA 4HX5A 1SKBA 5KREA 3OQIB 3HXTA 2J9FA 4FZVA 1S8OA 4NU6A 3AX6A 3QHPA 1YI8A 4QBKA 5HQ3B 2GEUA 2YFHA 4MQEA 2AF3C 2HQSA 3AW9A 4OI2A 1DKNA 1LU9A 3ZUGA 5EIEA 5FOSA 3PNMA 5M2QA 4CNQA 1VJCA 2QR5A 1WX1A 1S7GA 2ERXA 1HDOA 1XE3A 4RVCA 4A73A 2OHFA 2Q6IA 2BEUB 3TOZA 1IVYA 3ZWDA 2GD6A 3NW9A 4AUNA 4TKVA 2QG6A 3NVDA 2Y6UA 3R0IA 4LXQA 1Z5PA 2W7TA 3EGCA 3RG8A 3UVEA 4CMAA 4NH0A 4JI2B 2FK7A 4UC0A 1NRJB 1B15A 2Q3DA 4ZVOA 2R47A 3NTXA 1P0CA 4MLPA 3B52X 5FNVA