1CYDA

Carbonyl reductase complexed with nadph and 2-propanol
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
242
structure length
242
Chain Sequence
LNFSGLRALVTGAGKGIGRDTVKALHASGAKVVAVTRTNSDLVSLAKECPGIEPVCVDLGDWDATEKALGGIGPVDLLVNNAALVIMQPFLEVTKEAFDRSFSVNLRSVFQVSQMVARDMINRGVPGSIVNVSSMVAHVTFPNLITYSSTKGAMTMLTKAMAMELGPHKIRVNSVNPTVVLTDMGKKVSADPEFARKLKERHPLRKFAEVEDVVNSILFLLSDRSASTSGGGILVDAGYLAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords CARBONYL REDUCTASE
publication title Crystal structure of the ternary complex of mouse lung carbonyl reductase at 1.8 A resolution: the structural origin of coenzyme specificity in the short-chain dehydrogenase/reductase family.
pubmed doi rcsb
total genus 94
structure length 242
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.184: Carbonyl reductase (NADPH).
pdb deposition date 1995-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1cydA00
3TZQA 1DHTA 1IE3A 3ZNQA 5CPBA 4NJMB 2VRBA 4LCJA 4QTZA 3TSCA 4I1IA 1E1MA 3RFXA 4AJ4A 7ADHA 3TFOA 1UXJA 5G0UA 2H1SA 5G2OA 3DZIA 3WGTA 3L4SO 3FR7A 4XYLA 1HE2A 1Y8QA 2IYOA 2X0NA 3TL3A 3LT2A 4ITUA 3S2EA 4J1QA 1VSVA 1E3EA 1F14A 1F8FA 2DTEA 4Q3AA 2YUTA 4RVUA 2GN8A 4A73A 4CUJA 1E6EA 3K96A 3IL2A 1H6AA 5FI3A 4DLBA 1C0PA 4PIVA 1HDXA 3ANMA 4CR6A 4E3ZA 3CZRA 3HNPA 1Z6ZA 4D3DA 2J8ZA 4Q3DA 1HWYA 4R51A 2VYND 3JQCA 2NQTA 4JJFA 4JJGA 4Y8VA 4NMHA 3WXBA 4J7XA 4OSOA 4NH4A 4HP8A 5IZCA 1MLDA 3D3WB 1LU9A 5F1PA 1KEUA 4GI2A 4HFRA 2Y67A 1MB4A 1XQ1A 3KO8A 5THQA 5JYEA 1E7YA 3H2SA 1I2BA 1B3RA 4QFDA 4JBIA 5CDSA 1J0XO 1EQ2A 2RH4A 1GZ6A 4NK4A 1NVTA 1ULUA 1YGYA 2W2LD 4GGOA 3AUTA 3R6DA 1P31A 4PZDA 2FZWA 3I1JA 1XYGA 1DOHA 1SCUA 4PFJA 3GR6A 3C1OA 5BSEA 5HRUA 4PGFA 1WAMA 2ILTA 3SLGA 5C7LO 3SJUA 3UKOA 4UUMA 1NYTA 3IJPA 5JS6A 2AG8A 4E5PA 3VPXA 4MP3A 3ZHZA 4NBRA 5AXDA 5I7EA 1UXHA 4TSKA 1M6WA 4MKXA 1B7GO 2JHFA 1EVYA 2V6GA 3GY0A 2X22A 4A7PA 2YJZA 3RC9A 1N2SA 3ULKA 2Q1UA 3BMCA 1QV7A 1JW9B 1SOVA 2QRKA 3EZYA 3SJ7A 3WYCA 4F45A 1NQTA 4ZRMA 4ZVVA 3LK7A 5TQVA 3ICCA 4UVHA 2G17A 2HRBA 1U3VA 4H3VA 2NWQA 3GHHA 3A9WA 3NUGA 4RJTA 4BGUA 4NBVA 3DDNA 4E0BA 1CDOA 4GLOA 1MX3A 5I9MA 2NSDA 5L9AA 3JQAB 4E5NA 4FOSA 4FPXA 3GGGA 4MP8A 4QECA 1J49A 1MFZA 3WIEA 4FFPA 1R15A 1ZFNA 2DLDA 2EXXA 4AJLA 3COSA 3JYLA 1IOLA 1OAAA 1B0AA 3PGJA 5FI5A 2Y68A 4JJIA 1MC4A 3PDUA 2Y66A 2EKLA 1BSVA 1SB9A 2QZZA 3OIDA 1Y9AA 4PG5A 2DFDA 2WSBA 4KUGA 2J5QA 2OXIA 5GZ3A 3DOCA 4E5KA 4CV2A 3H3JA 1I3MA 3DBVO 2OFPA 3PRJA 3IP1A 2NTVA 4Y6PA 2NNLD 2GZ2A 5CP8A 1B3BA 3ZWBA 2ZQYA 1JAXA 1OC4A 3LQFA 2BD0A 3DHNA 3CMMA 2NVUA 3K30A 2QW8A 4CMJA 2O50A 1YL5A 1ARZA 4IBOA 3SBOA 3TJRA 1EFKA 3N7UA 5LDGA 5ENDA 3PJDA 1L7EA 1CETA 1WP4A 4R54A 4HX5A 5A3VA 1N5DA 2J5KA 1J5PA 1Z75A 2YDXA 1T24A 3GRPA 4W4TA 3DBRA 5IDXA 3LC2O 2AEMA 1Q7GA 2PY6A 2UDPA 1PJTA 4E2ZA 1DFIA 4GQAA 4IZIA 2VHZA 3ZWNA 3BZUA 4CPDA 5ICMA 3AK4A 4NBTA 3RJ5A 3H9GA 3WDSA 3AY3A 1ZZEA 2F00A 3K92A 2P9CA 5BSFA 2CD9A 4MJLA 2QHXA 1K89A 1I0ZA 4XJSA 4CLDA 4I5FA 2ZB3A 3BTSA 4UAGA 4YA6A 2EGGA 5LDHA 1QRRA 3EUWA 5CEJA 4E13A 4BMVA 1ZUD1 3PYLA 3RKRA 3D5QA 5JDIC 3KSZO 3RFTA 4G2NA 3JCZA 3F1KA 4BIIA 2UUOA 2YFHA 1E7WA 4YBZA 2VHWA 4LSMA 4WOJA 3RUIA 3LYLA 1ZIDA 4FC6A 1NAIA 3EW7A 5IN4A 1MA0A 1WDLA 4CR7A 5FWNA 3DOOA 1DLIA 2PA3A 4HFNA 1HDCA 4Z9YA 1LLDA 3STHA 5JCXA 1VRWA 4L73A 4UEKA 3ZHXA 2RIRA 2D4AA 4OGWA 1LRLA 2HMUA 3U4IA 1L1FA 2B83A 1P3DA 4TQGA 2J5RA 5A05A 4IJVA 2PZKA 3JYNA 4NHEA 3IP3A 4IJWA 4DTIA 1KETA 3PPIA 2EJVA 2DC1A 3PI7A 1PSDA 3RASA 2IXAA 4A5OA 2JJYA 1OOEA 3BYZA 3F4LA 1GTMA 4S1VA 4YWJA 4LVUA 4QT0A 4YACA 2B4QA 2Y1EA 2EKPA 5TC4A 3GK3A 3JQDA 4WLFA 5IN5A 5I8WA 3QA9A 3UCFA 2IXBA 4XQGA 1AN9A 3G0OA 4XGKA 1JA9A 1N1GA 2A94A 2YZ7A 2ZK7A 4L9RA 4DBVO 1XLTA 1O9BA 1I3LA 4J0EA 2J3JA 5DDIP 1UDCA 4KWHA 1LX6A 4R4JA 4Y6RA 3WQQA 3BTVA 1DIAA 5H83A 1MG5A 2UUPA 1T1RA 2GN9A 5CDYA 3O38A 5BNTA 4GAEA 1L7DA 1C1XA 2HMSA 1XEAA 1KS9A 2BFMA 2VNSA 4M54A 2CDCA 3CZMA 5KNLA 3JQ6A 3QWBA 4GSKA 4ONEA 1NP3A 4ZN6A 2C2XA 3I4FA 5EPOA 2O3QA 3PJGA 1PJSA 4Q3CA 4G5HA 4D3SA 5B12A 2PZLA 4H7PA 1H93A 5A03A 1Q7BA 4K9DA 4EITA 5COBA 4W9NA 1E1LA 2DQ4A 4GL4A 4OL9A 3E9MA 3RC7A 2P2SA 5L95A 4L4SA 1A7KA 1M67A 3S2FA 5A4DA 3KYBA 1UZLA 4P4NA 2HRZA 4J3FA 4F6CA 4URFA 3JQAD 3VH2A 3VDQA 1LSOA 3E9NA 3RSHA 1NR7A 3GQVA 3K2EA 4AJOA 2W90A 5EL0A 5JAMA 4XDYA 1VPDA 1YE3A 3QWAA 3N58A 3OICA 5BR7A 4OKNA 3H4VA 4YQZA 1UZMA 1NQOA 3MZ0A 4ZQHA 2NU8A 4KMSA 3INTA 3FI9A 3TF5A 5ILGA 1RYDA 2X4GA 1WW8A 3VOSA 8ADHA 3I6QA 1SEPA 4YAJA 1PWXA 3WGOA 1G0OA 3KYDA 4N5MA 1NHWA 2B0JA 2X0JA 5L4LA 1PZFA 2AW5A 3RC1A 3VVBA 1K6IA 2H63A 5ENVA 1AUPA 3A4VA 4YJGB 4BNZA 3JYPA 2C5AA 5TIIA 1PQUA 3JQBA 3ZWYA 3GGPA 3ROPA 4UEJA 3S1LA 3FTPA 4JQCA 5F3RA 4H16A 1EK5A 1BXGA 1GV1A 1TA4A 3RUCA 3UVEA 3R1IA 4BMSA 2X5JO 1TI7A 4R68A 3ZH2A 2I6TA 1QG6A 1ZSYA 1IZ0A 2D2IA 4IDDA 1YOVA 3L6EA 4IIUA 4BO2A 2E6UX 3GDGA 1CQJA 5TNXA 2DUUA 4GMGA 3WTCA 1XG5A 4J7CA 5IZCC 2X9GA 3EVNA 1BG6A 4FB5A 4CM6A 2GO1A 3RQSA 3HB5X 1O89A 1P0CA 1YQDA 4XX0A 3FRJA 3A1NA 2GNAA 3D5TA 3EGOA 1ZMTA 3HWRA 4NBUA 1R6DA 4CM9A 3DHEA 2V6FA 2O7SA 2V7PA 1ZJZA 1Q0QA 3KSDO 2E37A 2DU8A 2JCXA 4OQZA 4NBWA 3WGHA 2UVDA 5EN4A 3ROKA 1YKFA 3E03A 3WOHA 1J4AA 1BVRA 3V5NA 4ZHSA 2VQ3A 2HAEA 4O63O 3K6JA 3PWSA 4BS9A 3JD2A 1Z74A 1ZK4A 2PLAA 3RIHA 3UUWA 3HUDA 3NX4A 1CIVA 2D0IA 2WTBA 3OJLA 3ETDA 4B4VA 3NRCA 1LNQA 2WEKA 2UV8A 3ROMA 3GVIA 3VTFA 1NM5A 4BUCA 3T7CA 1XU7A 5EINA 4KUHA 2I76A 1XELA 2NVBA 2WWRA 3EVTA 4ZQFA 1K6JA 2VT2A 3EHEA 3LF1A 5KOIA 2YHIB 3NGXA 4BKRA 1XSEA 1GUYA 1IYZA 2O7QA 4E4YA 2TMDA 4GKBA 4XDZA 4D44A 1JLLA 5U4QA 1K0UA 1DIHA 3E6AA 4GX0A 3L4BA 1R0SA 1ZCJA 1LDBA 1LBEA 3DZKA 4J90A 1QKIA 1T26A 4RPKA 2O48X 3O8QB 3ENNA 3OEYA 4FGWA 1QLHA 4E32A 2HCTA 2C29D 2Q45A 2DFVA 4XGIA 4KTTE 3B70A 3FHLA 4WCFA 2P4QA 3ZV6A 1I36A 1H9BA 3S2IA 3ZV4A 2Y0EA 5B37A 3KOUA 1E3SA 2AE1A 2VUTA 5F21A 3E82A 4F3YA 5G0SA 4PLPA 4CLRB 4DVJA 4MVJF 4WEQA 2AQ8A 4Y98A 1EUDA 2I5PO 1FK8A 3QSGA 3RAJA 3W4KA 4D42A 3ASVA 4RVHA 1MP0A 3FNEA 2AQKA 2FZEA 4U0KA 1BW9B 1CF2O 1MFPA 1PTJA 4TKLA 4CL3A 1NHGA 2ZATA 5JE8A 3MJSA 5G0TA 1SOWA 2Y1CA 1MG0A 1K6XA 5EIOA 2O3RA 1MV8A 3KSUA 3ZWCA 3GNQA 1JN0A 5CAEA 3VPSA 1LLQA 4JP3A 4DMMA 1PS9A 3EMKA 3PQDA 4A10A 3GT0A 2GSDA 4BNUA 4OMUA 4R1TA 4R5MA 1F06A 5JO9A 1V0JA 1C0KA 4B8ZA 3BTOA 3WTBA 2YV2A 3MEQA 4XQ9A 4NU6A 4ALMA 1H2HA 4KDFA 2IDZA 2CF6A 2OOSA 4KWIA 4YJFA 3OEWA 1UZNA 3NT5A 2R2GA 3TNLA 5KJCA 4AICA 1I01A 4L74A 4BNGA 2H9IA 1CRWG 1F17A 1MC5A 2HUNA 3G1UA 5B4UA 2WDZA 5LCXA 3PJFA 1R4NB 1MXHA 4AJIA 3H7AA 4CMEA 1A9YA 4JXKA 2DPGA 3PQFA 3WYBA 2H6EA 4RVDA 5THKA 1UXIA 3OMLA 4FJ2A 2BI8A 2RH8A 1E1NA 2FP4A 3QQPA 1ZBQA 4KUEA 1PQWA 3TQHA 1WPQA 5L51A 4YQYA 4HUJA 3FTNA 1IL0A 3EY4A 4J7UA 1X7HA 1WMAA 1W6UA 5JO0A 3PLRA 4O1MA 3DBHB 3RKUA 3JYQA 2PKRA 3G3EA 1ADGA 2IE0A 1LDMA 1NWHA 4K6FA 1QYWA 4BO6A 3BMOB 3MJVA 3ONEA 3FBTA 4RCVA 1JWAB 2RCYA 1T2EA 4O0LA 2EHDA 3RROA 4B7XA 3NJ8A 3AM4A 1GUZA 4RO0A 3PFFA 4WLEA 5IZ4A 4E12A 4AJ2A 5L7WA 5BQFA 4RZIA 2VT3A 3HQ4O 1U28A 1KBZA 2Z1MA 4CM8A 4A0SA 2NACA 3ZCXA 1YS4A 3P19A 4DL9A 4DPMA 1X7DA 3PP8A 4Z9FA 1WVGA 1ZVMA 1R0LA 1GU7A 1ISHA 4XD2A 2NVWA 4U0JA 3PQEA 4D0RA 4B7CA 1B8PA 1WXDA 3M1LA 4BKQA 5IAAA 1B15A 3ORFA 4B8WA 4CQMD 4J2HA 4ILKA 5DNAA 1KY5A 2HMVA 1DFHA 1U8XX 2PGLA 3LSYA 5B4VA 5AXAA 2YY7A 1ZSNA 1U9JA 5IDQA 5JNLA 4BO0A 4BQRA 1B16A 4MVJH 2GGSA 2VOJA 2PH5A 3NV9A 3ST7A 1DRUA 4YXFA 2X86A 1Z45A 1WDKA 5FEUA 4BNYA 1ISMA 2B4TO 2JAPA 4J1TA 2YHUA 2HO5A 1MGOA 3WS7A 3NDRA 5IDYA 5KVQA 2Y1GA 1ULSA 2W4QA 4MVJD 1GR0A 3U09A 5CPFA 3LT4A 2Z1NA 4XJTA 3LT1A 4FSHA 5JMPA 2WE8A 3F9IA 1X14A 5COQA 5TLSA 5CHEA 5JCJA 1D4FA 3WYEA 1XA0A 5LC1A 3A06A 2ZCVA 3WGYA 4BNNA 2WE7A 2X6TA 3ZWAA 1UP7A 2EW2A 1YQGA 1P9LA 1U2DA 4AG3A 5KIAA 5GY7A 3PIDA 1H2BA 3WR5A 4RVSA 4WNIA 2VNAA 2EJWA 1HDOA 4RF2A 2R00A 2VWPA 4Z0PA 3PJEA 4MVJP 2C59A 1CWUA 2O3JA 4W9NC 2Q46A 5JMWA 4BNTA 2G0TA 4WUVA 4LSWA 4PG8A 1FMCA 5C7IO 3UH1A 3JYOA 1I24A 1QYDA 4NQZA 3ZHYA 2UAGA 4DYVA 5C3MA 3ZZNA 4Z6KA 4K28A 1GZ3A 4CMHA 3WWZA 3M1AA 3FF4A 4IINA 4D0SA 4OXKA 4BOYA 1UR5A 1ZK1A 4RORA 1U4SA 2NVUB 1UXGA 3GMSA 2RHRA 3OIGA 1EEHA 4P22A 4E5MA 3FN4A 3T7EA 2AMFA 4YRAA 4NU5A 3DB2A 2YV3A 3QJ5A 4RV9A 1EVJA 3F5SA 1JU9A 5I7FA 1NNUA 4TRMA 3JQ8B 4PG6A 1NX6A 1YWGO 1X0VA 8LDHA 3HZZA 3QLJA 4FCCA 3WLFA 3BMQA 3R3SA 2GN6A 3L9XA 9LDBA 3M2TA 3IQDB 3ZWXA 5EMHA 1JDJA 3DTYA 4R16A 1B2LA 2VYVA 1PWZA 4YEDA 3JQ7A 1FF9A 3JQBC 4IJKA 3WJAA 1LTHR 3JQGB 2EP7A 1UH5A 4I5EA 4RPJA 2IYPA 1EDZA 4CV0A 2D5AA 2PD3A 1A71A 2FN7A 1D1TA 4U8GA 5JAZA 1LC3A 2DTXA 1DLJA 3C24A 4MP6A 1VE9A 2QRLA 1GCOA 2OORA 1GEEA 4J2OA 4CR8A 3I4CA 2BHLA 1ENPA 2WD7A 1YJ8A 1EUCA 2B69A 2OP0A 3PK0A 1PJBA 4W82A 4QO8A 3GVHA 2CDBA 3KB6A 3WWYA 4GLLA 1E7RA 3HDQA 3KEOA 2BFOA 4AJKA 1UUFA 2GZ1A 2DTDA 3ASUA 2FOIA 3GZNB 4K6CA 1IPEA 1DHRA 5AYVA 4NFYA 2W2KA 3PGXA 1UDAA 1ISFA 5AVOA 2Y1OA 1VJTA 1ENOA 4GH5A 3IKTA 4NG5A 3VZPA 1DAPA 1XQ6A 5CEEA 3PWZA 3PHLA 3ITDA 3UICA 1ID1A 1I8TA 1LQUA 4ALIA 5U1PA 1EBFA 5JFOA 2FRDA 3H8VA 1BHSA 1P1HA 5G4KA 3FNGA 4JIGA 4N7RA 2JKVA 1HYHA 4UVEA 4BNXA 2C5EA 3BHIA 1NFQA 4IUYA 4DPKA 1UXKA 2IRWA 3WFJA 4BKPA 3RJ9A 1ZO8A 3AJRA 3RUDA 4GVLA 2P9GA 3DMTA 3F1LA 1NPTO 3ZNOA 1P1JA 4PRKA 4ZGWA 4CMIB 2D8AA 3H9QA 1T25A 1N7GA 4FDAA 1KYQA 4RQTA 1HSOA 4E6PA 1FXSA 2OGUA 1I32A 4GBJA 4PLTA 4YAGA 5GMOA 4CQLB 3F5QA 4CV3A 4ZRNA 4ZU3A 2IZ0A 5TJ9A 1QV6A 1N9GA 4BKUA 3VH1A 2NM0A 3L4BC 4L4RA 4DYDA 2O4UX 4CMAA 3EK2A 2X8LA 2P91A 5HBRA 5FYDA 1JQBA 3X2EA 4DPLA 3INGA 1R4MB 1ZEJA 3U49A 5K6AA 1QYXA 3V2UA 2NU9A 1LSJA 1PU2A 2EGHA 3OJOA 4NJMA 2PKQP 1RJWA 2PR2A 2X58A 4WCFC 5C7OO 3DZGA 1ONOA 1ADBA 4L75A 3DZHA 4L4XA 3H9JA 2EW8A 4JGBA 1U7TA 3FWNA 4TROA 3WBBA 3EC7A 3RUHA 3GUYA 3TZKA 2X0IA 2GN4A 1Y8RB 2NADA 3AY6A 3GG2A 3UGKA 2JD1A 4I9UA 5ER9A 5JLAA 1GAEO 4EBFA 4GWKA 4U6QA 3QWHA 4CMKA 3VH3A 3BMNB 5F1OA 1EBUA 5T67A 2IEBA 1OI7A 1JTVA 1BDBA 1NVGA 3ZV3A 1YO6A 1ORRA 2I3GA 4UUNA 2GASA 3A28A 4YT4A 4NJOA 4OAQA 3SC4A 1NWCA 2AQIA 2DBZA 2DUWA 3MTGA 4MINA 1GPDG 3W6ZA 3P5SA 3D3WA 3VPFA 2J3KA 1Y81A 3B1FA 3GA0A 3JQFA 3QIVA 4K26A 4AL4A 1R66A 2BLLA 2ZYGA 2ZTLA 5COAA 4HXYA 2HKIA 2C07A 3L07A 4AJNA 1X13A 3CIFA 4LGVA 4BNFA 4YT8A 2WMDA 3KLPX 3KM0A 4Q3EA 3HSKA 5F5LA 2OMEA 3RUEA 5HS6A 3RVDA 5CDUA 1AE1A 4MIEA 4QUKA 3RBXA 3R0IA 2EERA 3W4IA 4UREA 4CMEC 3GN2A 1O94A 1DJQA 5L7YA 2WD8A 3LDHA 2E82A 2FR1A 1F8GA 3GAFA 4RPGA 4Y6SA 3NTOA 2Q2QA 3GZ4A 3OA2A 4WE3A 4BNIA 1RM0A 3DAFA 4RF5A 2PTGA 1RM5A 4IDCA 5KWEA 2YQ4A 1QLJA 2LDBA 3DAPA 3TZ6A 1ZXLA 1KIFA 2EF1A 2I67A 3VKUA 1TT5B 1VC2A 3VAZA 1NFRA 5AXBA 4XQEA 4IY1A 3WNVA 3GEGA 3N74A 3UHAA 2X5KO 3R3JA 4JLWA 1CJCA 4DWVA 1U3WA 5JDCA 3ANNA 3GDFA 3V8BA 5JYDA 2VZ8A 1PJ4A 1VM6A 3RUFA 4P38A 2ZJ1A 4MKZA 4BB6A 1EFLA 1BTOA 1TT7A 3OFSA 3AUAA 1M2WA 1HE5A 3QHAA 4E21A 3NDIA 3I9OA 3QVTA 4HKTA 3H6KA 1XU9A 4RDHA 3Q3CA 1VI2A 2Y1FA 3ITKA 3JQ9A 4ZQEA 4IMPA 3GDOA 1V3VA 1O5IA 4IXTA 3INRA 2B4RO 1W0CA 1PGOA 4ZA2A 4EYEA 3GPIA 3D7LA 3HADA 1X1TA 1YONA 1I3NA 5DOZA 2YYYA 2ZTUA 3B1KA 4JNKA 1WZIA 2Z95A 4IDGA 3MCVA 4PVDA 2P5UA 1RM3A 1LDEA 4J1NA 4M89A 1HE4A 1I33A 4OKIA 1LDNA 4QSMA 1H6DA 3DBLB 1YL6A 3E8XA 4H15A 2AEJA 4XB2A 3RUAA 4WK6A 3ZHBA 5JY1A 5IF3A 1GYQA 4CLOB 3S2GA 4BQPA 1HE3A 1PZEA 3MWDB 2X1HA 4FGSA 3MJCA 4FFMA 2BH9A 1E3LA 4IDFA 3U4HA 3WLEA 5J23A 3WGQA 2R00C 2YV1A 4II2A 4XZ3A 2QZ9A 1C14A 2XOXA 4TZKA 2B36A 2CY0A 2IZZA 1PJLA 3KXDA 4QO7A 1I5RA 5L7TA 1Q0HA 3NJ4A 1SO8A 2X0RA 3OJFA 4RZHA 1I30A 4XCVA 3AOEA 4II3A 3AOGA 2CUKA 4MOWA 3HE3A 1WMBA 3WMXA 3HDHA 4R1SA 3RI3A 3FNHA 4PG7A 4LN1A 4GX2A 2CVZA 3K31A 4IPTA 1GD1O 3ZWOA 4E2XA 2EIHA 2FWMX 4R01A 4BO5A 1TXGA 1ADCA 2FPIA 5L45A 1V6AA 4YJHB 1DB3A 2E48A 2VRCA 3JQEA 3H2ZA 3IS3A 1DDOA 2PD4A 3Q2IA 4FJ1A 4MVJE 1Y6JA 2DVMA 4XYEA 2JCYA 3L6DA 3DTTA 1XR3A 4J43A 5AOVA 4E5YA 2Q49A 4GX5A 3Q6IA 2B37A 3D64A 4I08A 4PVCA 3PWKA 5EQFA 4CM3A 3HHPA 5DT9A 3WIDA 3WJ7A 1N92A 3PHIA 2BF7A 2OP1A 4I9NA 2XAAA 3ZWWA 4EW6A 1E7MA 1E5LA 3HN7A 3FBGA 5GZ1A 3QVSA 2EV9A 4LISA 4PRLA 1QMGA 3GUCA 4C7JA 4CQMB 3QP9A 5L4SA 4HADA 1E7SA 1VL0A 4M49A 3FD8A 4OO3A 2G1UA 1JVBA 4Q3NA 4D41A 3G49A 4RVFA 4OXNA 5B1YA 4IM7A 3VZQA 3U9LA 3L6OO 3LLSA 1BWSA 1ZXBA 2EWMA 4K1LA 4I5GA 2CSUA 1DC5A 3D4PA 2EP5A 4AVYA 4W7IA 5ITVA 5JPIA 2C82A 1DJNA 5BNIA 3PLNA 3L9WA 3ADOA 2CNBA 3GLQA 4CM1A 2I99A 7MDHA 3VZRA 3AM5A 3C3XA 2ET6A 4RPHA 1KVSA 2Y1DA 1XDWA 4XA8A 3DONA 5AXCA 5CG2A 1D8AA 1OMOA 1XWFA 3GRKA 2IODA 2HK7A 4BO4A 2CDAA 1C1DB 2ZB8A 1N8KA 1P74A 1JAYA 2Q1WA 1QP8A 2OBYA 4XB1A 4OXYA 3CE6A 2CF5A 2AHRA 3KYCB 3DOJA 5A5EA 1VLLA 3I9KA 5ER6A 1IHYA 1Y5MA 1GUFA 2C7VA 2OL4A 3QVOA 4M8SA 3EDMA 5KTKA 3M6IA 4PLGA 1X0XA 3CXRA 2WYVA 4R1UA 1Z7EA 5A9SB 1Y5RA 1Y1PA 4M1QA 4AFNA 3DMTC 3GMDA 2Y0CA 5L53A 2YW9A 1SEVA 2VWQA 4CM9D 1DAOA 5JW6A 1EE2A 4NI5A 1EVIA 4MIOA 5T8KA 3RU7A 6LDHA 1P33A 1D7OA 1X7GA 1YBAA 2OHXA 3PYXA 1XIVA 3I83A 1PGPA 3BIOA 3E48A 3TZCA 3VC7A 4JCOA 1T1SA 2NLOA 4E30A 4YDRA 4CM4B 1SC6A 4R3WA 4KQXA 1VJ1A 2VHYA 1RWBA 2GCGA 5TS3A 2JD0A 4ND2A 3K5PA 4CV1A 2ZTMA 5JAIA 2VN8A 3Q0EA 4QFCA 1HEUA 5A9RA 1SZJG 4IGEA 1M75A 2I65A 2D59A 5BSGA 5K6AC 4CMGA 3D4OA 3FPCA 4BO8A 4IQ0A 5A1TA 3C1TA 1GQ2A 1HXHA 1UAYA 3WQSB 4CJXA 5A9TA 1G1AA 2V6BA 4N18A 5TJHA 2GRAA 3OSUA 9LDTA 2DM6A 3I3OA 3WFIA 5KKCA 3L77A 5AQ1A 3D4NA 4TVOA 1ADFA 1WZEA 4D79A 4YYZA 4YJGA 1OBFO 3L0DA 4HNGA 3NTRA 1LLUA 1LJ8A 1ZNQO 5GZ6A 4TZTA 2DBVO 2SCUA 1PR3A 4ALLA 4GKVA 1E3JA 2PKQO 4FW8A 4Y67A 2JFFA 4BO3A 1PQPA 2AQHA 2Q50A 5TRTA 4PLFA 4FFRA 1KEVA 3W8DA 4A03A 1Y8QB 4OOEA 3IIEA 5EJ2A 1KOLA 3VDRA 3CSDA 3JD0A 3JTMA 4CL8A 1OC2A 2GD1O 2OO5A 3ETGA 2CMDA 1E77A 1U5CA 4WLUA 3DZJA 1VKNA 3C7AA 1KY4A 2VWHA 3ANLA 3JD3A 3ZWPA 1GDHA 3JQFC 4RGBA 3ONFA 3RD5A 4CUZA 2Q1SA 4B4WA 4LVCA 3AU9A 5KJEA 4ZICA 4RLHA 3DFZA 1LA2A 3CEAA 1PEDA 3PDJA 4WLVA 3O03A 2FSVA 3WQRA 1CQIA 2I3AA 1NFFA 2G82A 3BAZA 5MGBA 3ZNPA 3H5NA 3QW2A 1P0FA 5TX7A 3TZHA 2BMAA 5TT1A 4A2CA 4Z9XA 3U4CA 4Q39A 2XF8A 4WKGA 4NIMA 3DFUA 4B3IA 4IIVA 1QORA 4BO1A 4D45A 4EEZA 5CDGA 5ADHA 3RC2A 3HDYA 1V9LA 3FWZA 4RPLA 5JBIA 3GHYA 3QWFA 4PLHA 2A92A 1QSGA 4ALNA 5CFZA 3DAGA 4M55A 1VSUA 3WNQA 4IDBA 1X15A 1SAYA 2F1KA 2NU7A 2ZCUA 4OJNA 4B3JA 4AJJA 1T2CA 4UVGA 1E6UA 2NU6A 3OQ6A 4P4LA 4EUHA 1GYPA 4UVIA 3S55A 2C20A 2ZYDA 3G1TA 1DBVO 1DC3A 1IULA 4FC7A 3P2OA 1IY8A 3F4BA 3UAGA 5ITWA 4ALKA 5A3JA 1J6UA 2X7HA 1U8FO 4BGVA 4NR0A 3JV7A 3QVXA 1P45A 3P2YA 3GNTA 1I2CA 1PL8A 1UJMA 1YJQA 3GVPA 3PEFA 4BVAA 3T4EA 1LRJA 3OQ1A 2J6IA 4YRDA 1PGQA 2AE2A 5JDCC 3CKYA 2RAFA 3WX0A 2GPTA 2HMTA 4BKOA 1CEQA 2ZB4A 3RCBA 1UP6A 4TKMA 3WGGA 1IUKA 1O95A 2G76A 2CZCA 5K0ZA 1QYVA 3BMCB 4L8VA 1EMDA 3O8QA 4FS3A 5U9CA 4GX1A 2HU2A 1ISIA 3FR8A 2Y0DA 4TRRA 3ABIA 1FDUA 5KCZA 1R0KA 3DZFA 3MTJA 4IS3A 5H82A 5I8ZA 4AJPA 4CLEA 5CDTA 3E18A 4P8RA 2VHXA 1E3WA 1DIBA 2GR9A 3B1JA 3U0BA 1DIRA 3AFNA 1YBMA 3Q2KA 3GN1A 4YB8A 4UUPA 2YDYA 4OSPA 2FSSA 3UCXA 3K9QO 3RBZA 1GQYA 4EEXA 2VYNA 4B4UA 2FR0A 4CLRA 1ZMOA 3JQ9C 2AA3A 3AW9A 4DIOA 2PGDA 1YB4A 4FJ0A 3DO5A 4Q9NA 2BI7A 3LZ6A 2NV6A 3T4XA 1BW9A 2ZIZA 2O4CA 3HN2A 5T6BA 3GH3A 3ZN2A 1TLTA 2Q4EA 3JD1A 4BNHA 2FR8A 3NT2A 2W2LA 3UOGA 3OHSX 1GZ4A 3GEDA 1LQTA 1H94A 2FHSA 2HSDA 2I9PA 3PYMA 3DEYX 2HLPA 1ISGA 4DGSA 3CMCO 2DBRA 4PLZA 4B79A 3SX2A 1GADO 5DCYA 3AUSA 1R16A 3GVXA 1ZK0A 4R41A 1EVZA 4CMBA 2WJPA 4BV8A 1HF3A 2VZ9A 4OIMA 3W6UA 4RDIA 4YCAA 1ISJA 4EJ0A 2A35A 3OBBA 3DBRB 3CPSA 3CINA 3VPGA 5HM8A 1XKQA 3JD4A 3I5MA 1V35A 1NQAO 3BHMA 3AOEC 4XWYA 1LI4A 3HDJA 4BL5A 2QG4A 1TEHA 1JKIA 4Z3DA 1FDVA 1R4NA 4HFJA 4PZCA 1DRWA 4TMFA 2DBQA 4UULA 5F5NA 1YB5A 1HLPA 1U2GA 2O23A 1GY8A 1A27A 4IS2A 4LK3A 2Q4BA 3HFGA 3I9NA 4DBZA 3GFGA 4R9SA 5MDHA 2HDHA 4L76A 2ZYAA 5JCJD 4IDAA 1YH3A 2GDZA 2I66A 3VH4A 1PL7A 4JK3A 3BTUA 2X23A 3GGOA 3VKVA 1WLYA 3D0OA 4DRYA 4D7AA 3DBHA 3P7MA 3PVZA 3SLKA 1GEGA 1NQ5A 3ENKA 3DQPA 3GOHA 3HFSA 3PZRA 3BMOA 3K73O 3ZU5A 1YL7A 2UYYA 5I7VA 1PZGA 1VKOA 4IZHA 3OF2A 4B4OA 2NTJA 3UW3A 1BRMA 3E1KA 4FOOA 3C7CB 3GPDG 2VUSA 2VTDA 3VHRA 4DREA 3MOIA 4GWGA 4KTVE 1A5ZA 3PHJA 2PGJA 4LRSB 1DSSG 3IKVA 5JXWA 4FFOA 5HA5A 1T2AA 4F46A 1DFGA 4TWRA 5C37A 4P4GA 2PWZA 1PL6A 1PZHA 1Z82A 4PLVA 3TN7A 5A04A 1T2FA 4RF3A 1SMKA 5DBFA 1O8CA 5IDWA 4ZQBA 4EUEA 3E5MA 1AHHA 2P9EA 4BNVA 4QXMA 1A72A 5TT0A 5BT9A 1SNYA 1U7HA 3CTMA 3C85A 1ZH8A 3SC6A 1HDYA 2Q2WA 1I3KA 4MVJI 4XQCA 2O3UA 2VYVD 1DC6A 1YDWA 2QYSA 4FBGA 3VPHA 3LF2A 1ENYA 1KEWA 3KEQA 4BMNA 5A06A 4FQ8A 2G5CA 3LC7O 3DR3A 4M86A 3ROQA 1VL6A 4FFLA 1EDOA 2DKNA 5I9NA 3BA1A 2C0CA 1U1IA 1P1RA 3PIIA 2R6JA 4BGEA 2A4KA 4I5DA 1MXFA 1T2DA 2AXQA 4IJUA 4BO7A 1GQQA 5CG1A 2IEDA 4TVBA 1DXYA 3LT0A 3K2BA 3E9QA 1C1XB 2ZJ0A 4WCDA 3DHYA 3ZNNA 4DA9A 4WEOA 4XIJA 3TPCA 3CUKA 4NFHA 1V3UA 1SPXA 5T8KC 3ZU4A 1LUAA 3NTQA 4MPDA 3NYWA 4XEHA 2VCYA 4NPCA 4PLYA 2POQX 1EZ4A 2PK3A 1IZ9A 2D1YA 3LLVA 4XYMA 1K5HA 5C5IA 2DT5A 4ND4A 4NNJA 1A9ZA 2CVQA 1ZKMA 2PZMA 3ZWVA 2E49A 1HTBA 3PHHA 4IQ8A 3KTDA 4R1NA 4DIBA 1I10A 4AJEA 4I9HA 1LLCA 2O3TA 2RHCA 3GF4A 4NZ9A 1DC4A 2TMGA 3JQ8A 1Y7TA 3H65A 3A14A 2ZQZA 4OH1A 2D5CA 3ON5A 3F3SA 4YT2A 3UXYA 1DIGA 2O2YA 4DXHA 4RL6A 4TRNA 1EK6A 4J16A 5ILOA 1E5QA 2WYUA 3JQGA 4BV9A 2JL1A 3DXFA 3KYDB 2PD6A 5KVSA 4FIZA 2B5WA 4R69A 3UN1A 4A27A 3EZLA 4OYRA 5JAQA 3ZI0A 1AXEA 1GCUA 3ZWMA 2J3HA 3I23A 3NKLA 4E33A 1PX0A 1XCBA 2BELA 3GG9A 3NDJA 1G6KA 4RQUA 3OP4A 1R37A 1HDRA 3QWIA 4KZPA 2NQ8A 3VVCA 2W98A 1FDWA 1BXGB 3QV1A 4BHTA 1IB6A 1Y9EA 3NAQA 4XYGA 4MIYA 1Q7CA 1GPJA 3GZNA 1YOVB 3WG9A 2DAPA 1B8VA 2BGLA 1P1FA 3V2HA 4YT5A 1S6YA 1Z73A 4MVJG 4U5QA 1TVEA 2AEFA 1V3TA 4FD3A 4IXWA 5EERA 1D1SA 3PFWO 3GAZA 4PLWA 4YJDA 1UAGA 2VZ0A 3TFQA 3UFXA 4XR4A 5A02A 5DCWA 4YPOA 3DL2A 4OHUA 1YXMA 2WYWA 3O26A 1N7HA 3Q1LA 4KQWA 1PJ2A 2BFAA 1B14A 2A9FA 5DZSA 3X2FA 3MJTA 1BMDA 1M66A 1B26A 3WB9A 4Z0TA 3KV3O 3JQAA 4J4BA 2FPPA 4QX6A 4CM5A 2XPCA 2QYTA 1D3AA 1BXKA 2DPHA 4N5NA 4CMIA 4KP7A 4PLCA 2Q3EA 1LXCA 1G0NA 5DF1A 1NR1A 3K8ZA 1NVMB 5JC8A 4Z0HO 4CQLA 4IGFA 3WBFA 3NT4A 1DEHA 2C54A 3C8MA 4O6VA 1HT0A 4WPGA 3AI1A 2JHGA 4HNHA 4J49A 4XKJA 3KVOA 1Q0LA 4J4TA 3ZU2A 4YAIA 1F0YA 2YQ5A 5H81A 2Q99A 2HJSA 5KKAA 4MVJM 4LMPA 3NEPX 3KLMX 1HYGA 1W8DA 3OJEA 1R4MA 5HS4A 2HK9A 1N1EA 1YDEA 3VTZA 1EUZA 2VHVA 5IXSA 1LDYA 2C2YA 3EYWA 3U62A 4JN6B 4XYBA 1W73A 2Y93A 1ENZA 4X54A 1UP4A 4B7UA 3GFBA 4Y9DA 4E31A 4AJHA 4GGPA 1HDZA 4JBGA 3W1VA 4CMCA 4WGGA 3EAGA 2B5VA 2X5OA 4CODB 1KVQA 1HETA 1K2WA 2CVOA 3HJAA 3O9ZA 3AWDA 1CERA 4WCFB 1Y8RA 2X9VA 4XGNA 5KJ1A 3OIFA 2GF2A 5L3ZA 4HWKA 4DMLA 4EI2A 1U4OA 1H5QA 3BMNA 4ESOA 3RBVA 5KJFA 5BSHA 4Q3BA 1BVUA 1KVUA 5I7SA 3SXPA 4ALJA 1H9AA 1HZZA 1PGNA 1JKFA 1XGKA 2JFGA 4RVGA 5HTOA 5TSDA 4U6SA 3DZBA 4O59O 3QVWA 1HL3A 3UCEA 3H5RA 3VZSA 3HG7A 4ND5A 1FDSA 1LSUA 2XXJA 4W7HA 4WASA 5IG2A 3MJ4A 4G81A 4GVXA 1E0DA 4KDEA 1UDBA 1U3TA 3V1UA 4WECA 4EJ6A 6ADHA 3OM9A 4RLSA 3I9MA 1M6HA 1LDGA 2GZ3A 2QQ5A 3ZU3A 3B6ZA 1A7AA 1QR6A 3KZVA 4XR9A 1T4DA 3QY9A 5DBIA 4HBGA 4WLOA 4E2WA 4IQGA 5TF4A 2W8ZA 1E1KA 4N54A 2P68A 3ETEA 1OFGA 4XRRA 4ZD6A 4NDNE 1ONNA 4J9VA 2PNFA 3W8FA 4PCVA 2GYYA 1AGNA 3B20A 4J4HA 5ICSA 1VL8A 5DOVA 1DO8A 3IOYA 4MO2A 2H5LA 3TL2A 2V6MA 3TOXA 2Q1TA 1KERA 3AI2A 4JROA 3IUPA 4YJFB 3AUUA 1O6ZA 1YBVA 4TRJA 4PN3A 3LU1A 3JSAA 3WICA 2B35A 4CLXA 1C0IA 4YAKA 4ZJUA 4DQXA 2EKQA 1KVTA 3V1TC 2IZ1A 4J1SA 2P4HX 4R3NA 1E6WA 1FDTA 2FPGA 2OZPA 2WM3A 3ZV5A 2JFHA 1SB8A 2JD2A 4LW8A 3TDKA 4FN4A 3KETA 3HB4X 3WGIA 2VUUA 3IAHA 3ZW9A 4LCEA 4YAEA 1TT5A 3H3FA 4JP2A 3OH8A 1NASA 1A4UA 2PV7A 4BB5A 1QXSA 5TGDA 1NPDA 1OZAA 5L40A 5EQDA 3G17A 1PS0A 3AI3A 3WSWA 2Z5LA 4XIYA 3OQBA 4DLLA 5T5QA 2VRCD 1VJ0A 1U3UA 2ZB7A 4W99A 3GVCA 3FSRA 3OECA 3D1LA 3GEMA 5DULA 4S3MA 1HLDA 5T57A 2HQ1A 1ZEMA 2BGKA 1K3TA 5DP2A 2Y99A 1ZJYA 3LVFO 1BDMA 3PZBA 1NTOA 3O4RA 1GV0A 1PIWA 1YVEI 4CM8B 4ND3A 1QYCA 4E2YA 1AHIA 3D3EA 4XRGA 1PJQA 3DWFA 4J9UE 3IUSA 4LRTB 2QRJA 4C4OA 5I9LA 1BGVA 4D43A 2NUAA 2HK8A 1H6CA 4GMFA 4C7KA 4J91A 5T64A 3ONDA 5L4NA 1IHXA 1HYEA 1Q1NA 2GUGA 1JVSA 2JCVA 3Q11A 1O0SA 3H5AA 1KC1A 2RBEA 3RU9A 3ADPA 3G79A 3IC5A 2CFCA 5FF9A 3KUXA 1NXQA 3DBLA 1M76A 1GL3A 5G0WA 3S8MA 1KC3A 4U7WA 5IJZA 1MUUA 1ZK3A 3H9UA 4WLNA 4CLOA 1B8UA 4FFNA 2EG9A 4ZQGA 3WMWA 1ONPA 4I8XA 1LRKA 4D46A 3W4JA 2GLXA 1RYEA 1E3WB 1X1EA 4WJZA 4R9RA 2BRUA 4J6FA 2P5YA 1WWKA 4QQRA 3QE3A 5G0VA 1Q2XA 1FJHA 5G4LA 1H0KA 3C7DB 4YRBA 3IDSA 1PR9A 5A5FA 4YR9A 3IMFA 4CLHA 2VTEA 3U5TA 1ZK2A 1EE9A 4J0FA 1A4IA 1Z7BA 3AY7A 3QRWA 4N5LA 3RFVA 2O3SA 2OBNA 3I6IA 4R5HA 4CM7A 4G65A 3Q9NA 4YJHA 1E7QA 3MOGA 4INAA 3AFMA 4BNWA 4DC0A 1F12A 1IPFA 3M2PA 4UVDA 4IMRA 5JC1A 1V8BA 4WOKA 4HY3A 5BNFA 1HKUA 2OUIA 1E3IA 5K9ZA 1SBYA 2HMWA 3PHGA 3U4DA 4DIFA 5DBGA 3OJ0A 1PJCA 2VWGA 3MJEA 4CUKA 5JDIA 1YRLA 4M87A 2NTNA 1U5AA 3GNSA 4YVFA 3UF0A 1EQUA 1ZSVA 5JSFA 3KBOA 4WNCA 2FY8A 1YQXA 1E92A 4NFSA 3F47A 4EGFA 1I2ZA 4UUOA 4PG4A 1W4ZA 2VOEA 4CQMA 2C7GA 4EUFA 2AG5A 1WNTA 2PH3A 4OOFA 1JKJA 4O5OA 3SVTA 3BMQB 1YB1A 3TWOA 3MWEB 1TB4A 3I52A 2PFGA 3ZGYA 1P44A 1BXZA 4YTEA 2Y05A 3H9EO 3JQ7B 4F6LA 3FNFA 1PS8A 4DC1A 1LEHA 4RF4A 1RKXA 1S7CA 1ML3A 4D3FA 5B4TA 5IXYA 1GYRA 3BHJA 3U3XA 4Z3KA 3F6YA 2XXBA 4MVJA 3ZDFA 3V2GA 4ID9A 3SEFA 3W8EA 5HWSA 3LC1O 4W6ZA 3E5RA 3Q9UA 5ES3A 4AJ1A 5KJ6A 4BNLA 1C1DA 1NPYA 2WD7B 3KRTA 1KEPA 2GERA 1DRVA 4MDHA 2YHIA 5IFLA 4OM8A 3NGLA 3KYCA 1HSZA 1PJ3A 2X9NA 3TRIA 2EEZA 4BNKA 3CH6A 4B3HA 1LSSA 4KOAA 2PZJA 4A26A 3F46A 2BKAA 1HZJA 3IJRA 3V1YA 3AU8A 1P1IA 5KVVA 2W2KB 2YFQA 3KHUA 1P1KA 3TOZA 1DPGA 1PGJA 1ZW1A 4ND1A 1CYDA 5DN9A 2FMUA 4JX8A 4IDEA 1NAHA 3PXXA 5A9SA 4GPD1 3I9LA 4HV4A 2HJRA 4OQYA 4JBHA 5G4KB 1R12A 5EESA 2LDXA 3ZW8A 3OA0A 2V65A 1RM4A 4GSLA 2ZTVA 4DLAA 4PZEA 5F1KA 3I9JA 4BGIA 1RPNA 3GC6A 1JWBB 2J3IA 4QEDA 5FFFA 3C1AA 4CM4A 1GFSA 4LMRA 4HFMA 2O2SA 1KVRA 3WGZA 5DCUA 1HDGO 1XHLA 3ICPA 1AXGA 2JAHA 3AM3A 4BO9A 4FR5A 3FCOA 2BGMA 3PTZA 2E4AA 2Q2VA 4BNJA 4EDFA 1N9GB 1NBOA 5CEFA 4UEOA 2ZKLA 1C0LA 2D3TA 3BXXA 1P77A 4DQUA 4L0QA 1HRDA 1LC0A 2QX7A 4BNMA 3RWBA 3DC2A 3DMYA 4NK5A 3WSVA 4EZBA 2BFPA 5DP1A 4MKRA 4DUPA 4DQVA 4EJMA 5JY6A 1T4BA 3FPLA 4ROSA 1C3VA 2QIOA 1WDMA 5KVCA 3OETA 1H6BA
chains in the Genus database with same CATH superfamily
1IE3A 1GGNA 3CV3A 4LCJA 4QTZA 4I1IA 4N1AA 1E1MA 1KQPA 4AUNA 2F9MA 3NXKA 3UGJA 5F76A 3WDLA 5EJFA 2R7MA 3V1MA 3BQMB 3A7DA 1I14A 2UYOA 2QSYA 3HCWA 3Q9LA 3TX2A 3ESBA 2F43B 3FR7A 2NSYA 1HE2A 2GPNA 4A91A 2ASEA 5LL6P 5FTNA 2NAFA 3J7AC 1YCHA 3W8RA 4BEJA 5JQWA 4X90A 4KNVA 1HZZC 4U7GA 1Q19A 5BVHA 2J9GA 3J81A 5D1NA 1E3EA 2EL7A 1DKOA 3Q3VA 2Z08A 1U90A 3ZJ4A 2W71A 1OTXA 1T5HX 4IMJB 4HZUA 1H6AA 3WIUA 1C0PA 3I2KA 2AMJA 5BWMA 1ICEA 1ZCZA 3UPTA 1ZJWA 1RXYA 3BWMA 4LKRA 2IYWA 2A78A 2ZBEA 4Q3DA 5BMVF 4R51A 1N77A 3ZCRA 4BWGA 3JQCA 2C4NA 4UU0A 2IHNA 2YXDA 3B60A 3AYXB 2APJA 4EUNA 2DQZA 3L0OA 1M5RA 3W2FA 2RKOA 3CEJA 1EX1A 1N6PA 4OB8A 2H2DA 4NH4A 4HP8A 4OSOA 4RACA 3OZEA 4C0XA 5IZCA 3T3NA 5FEMA 4Z7QB 4QBIA 3HUFA 3GFTA 1JDNA 3GA7A 3IEXA 4E4TA 5JAOA 1M5TA 1YSCA 1Z2EA 2CVPA 2FUNB 2SBTA 5AKJA 5EXXA 2GPYA 2FPSA 3V8NA 1E7YA 1QUFA 1DDGA 3BDAA 1U98A 1J1ZA 1J8QA 2ESRA 3FPGA 3O1LA 4KPUB 5BN4B 1J0XO 3I5UA 1TMOA 3WB1A 1NVTA 1ULUA 2GSWA 5C8DA 4GUDA 3AUTA 2I0FA 1MO5A 3K0FA 4DLKA 4PZDA 3VR4D 1QZUA 5FIUA 1F1JA 3LUJA 4RDXA 1J5EB 1MAWA 4B3DA 1V48A 1G8KA 4GR4A 1XYGA 3ZBQA 4UU8A 1P3JA 3ZE1B 1D4OA 1AZWA 1XRJA 3B12A 4HDRB 3NFRA 3GIWA 1PFKA 5TEWA 4EHJA 3HC7A 1GA1A 4PGGA 1SGWA 2LGJA 2VZEA 5C7LO 3UKOA 1E4VA 1DEKA 4UUMA 1NVEA 4PTZA 2HJVA 3NZEA 5ENZA 3ZBTA 2EJTA 3GPBA 4NQRA 4U1RA 1RRFA 3IJPA 1ZYUA 3BHNA 5LKRA 2JASA 1X38A 4E5PA 5JWOA 4EI9A 3LE8A 3BEDA 1NVFA 1YZTA 1R6AA 1Q1QA 4OBXA 2G36A 2V5AA 1JHAA 2V6GA 4CF4A 1U2QA 4A9AA 1VI6A 1YZNA 2P6PA 3QXGA 3AESB 1ORHA 5DYNA 1W29A 4MV9A 2Q1UA 1DE0A 1K7CA 2GBLC 5ANRB 3MPOA 1JW9B 1SOVA 5DWVA 3H1BA 1W34A 2HTFA 5TQVA 1I7QB 3ICCA 2PT6A 2HRBA 3LHSA 3P0RA 3PHBE 3QX9A 4UVHA 5TGTA 4AN4A 4DRXA 1U3VA 1U81A 4Q9AA 3DKKA 1Y9DA 3FCSB 4OGLA 3KOXA 2LCQA 4BFYA 3UMMA 3A9WA 2BUAA 2CMHA 3T9CA 4NF2A 5FOVA 4NBVA 4E0BA 5BWLA 5LMCA 4GW3A 5E4TA 421PA 2XKKA 4WX2B 4TTRA 5L9AA 1Q3TA 2QTZA 1SKAA 2VYQA 4MP8A 3TLBA 4MGHA 3UKDA 4QRIA 2DHCA 3AILA 4H6VA 4YWHA 4TLAA 3WIEA 1ZFNA 2ZSHA 4BY9E 1CEEA 2BW0A 2J3EA 2EXXA 3C14C 1KWGA 1IXSB 1TGYA 4Q7KA 3JYLA 3OQNA 1N34B 1TTTA 1Y4AE 1B0AA 3DC7A 4HLUC 3K15A 4F85A 3KWMA 4RY0A 4EG1A 1QOPB 2HC9A 2GARA 2Y68A 4JJIA 1HK7A 1J2YA 4MQ6A 1C81A 2IOHA 2Y66A 5K0FA 2EKLA 3UAYA 1BSVA 4N3GA 1B74A 1T1EA 3E84A 4OHVA 4LOKA 4HDKA 4YCBA 4KUGA 2OGWA 4R3UC 1G16A 1Z6PA 5GOZA 1IRXA 1U7OA 4Q12A 3ECCA 3LHKA 1SKYB 4XDHA 2OFPA 4Y6PA 1GL6A 1D8TA 2IUTA 1AQ6A 2W83A 2WAOA 2CNDA 1DBWA 1O2DA 1UKBA 2CDNA 3AB3A 4HGNA 4O3FA 1JAXA 1BQEA 2W43A 2W4MA 3LQFA 1S01A 3CMMA 2NVUA 1AGRA 3Q4GA 3KJHA 2EFCB 2QW8A 3NC0C 1XLWA 3H19A 3SBOA 1G66A 1EFKA 3TJRA 4W5RA 4RK7A 4G85A 2QMUA 2J48A 3TD9A 4N9WA 5EUMA 1L7EA 4CKCB 4C04A 4HX5A 1J5PA 3CKLA 5EY5B 5B3KA 5KU1A 1AQUA 3GRPA 4YY3B 4EG8A 2C3YA 1JE1A 4EPVA 2XVZA 3C3MA 2AEMA 1IJEA 3MNFA 4GIBA 4LF7B 3W6OA 2A0KA 4LECA 3G2PA 4E22A 1E61A 1PJTA 4E2ZA 2VHZA 5DV9A 3KWJA 4ZARA 2FRXA 2IYTA 4X6UA 1X8KA 3H9GA 4KE8A 1XD8A 2QMHA 1IN5A 4G5QA 1QAQA 2GB4A 2GPBA 5HRAA 5KX5B 3V42A 4LZAA 3OTHA 4MJLA 3RSGA 1SPBS 3ZI4A 4OB6A 4D8TA 2PS1A 4I5IA 3HDVA 4NEHB 2P77A 4BP1A 1ULZA 3HGQA 3SYNA 3ZDZB 3ES9A 1GZDA 3QOYA 5CB4F 1K86A 2PL3A 2GYWA 3KHTA 1TZJA 3EUWA 4POAA 4ISBA 5CEJA 5LDHA 2UYGA 4KV7A 5JU6A 1IY2A 1MU0A 4Z4IA 4AIIA 4E13A 1GSAA 3BWVA 1PK7A 3D6UA 4I4NA 5DYGA 3PYLA 3RKRA 2FDXA 4O1IA 5EPEA 4ZT3A 4C76A 2WSYB 5AIBA 4KEAA 1E8MA 4DIUA 5ALPA 1H4SA 1QB8A 4Y7CA 3IAXA 3F1KA 4PIPA 3QEMA 5KSZA 1EGHA 2UUOA 3OOJA 2WINI 1PUJA 2R1TA 5JPCA 3O3CA 3T95A 5A7HA 2PHZA 4KXQA 1OXKB 2L18A 4WOJA 1VLMA 1A2KC 1MEJA 2CE7A 3QHQA 4OF4A 1A8UA 3BCHA 1L1RA 3KJFA 3LYLA 3AF5A 3ZDYB 5GPBA 5T6MA 3RAEC 5AJUA 1W88A 4RETA 1XC7A 1NF9A 4F71A 1MA0A 2K2QB 3FUXA 4HEHA 3M5WA 1Y9ZA 4MRNA 1G5TA 3QEOA 3UWDA 1H1DA 5FWNA 1SG9A 2NYVA 4JGGA 3OPQA 1HDCA 4UPEA 1EB8A 1LLDA 1FFCA 1T3HA 1BEUB 3LJKA 1N6LA 2J87A 3I6BA 3K72B 2QRQA 4DJFC 2A88A 2YKGA 4Q3LA 1WNFA 1P73A 4OGWA 4ZAWA 1C7EA 1TM3E 3KV1A 5K3FA 1UL1X 3U7JA 3IQHX 3UV7A 5JXGA 4PFQA 1L1FA 1IHOA 4TQGA 2JLZA 2A5LA 1H2EA 2A59A 8ATCA 2P41A 2QE7A 1UOPA 1IOVA 1E2FA 2BFBB 1Y6QA 1M10A 2QNBA 3RKSA 4UOEA 2DC1A 1PSDA 4A5OA 3D6VA 1CZNA 2Z9DA 1GTMA 3JAKB 4I1SA 2QMEA 4QT0A 5IKXA 1E94E 1M72A 3FX2A 1X7XB 4DG5A 3OD5A 1FMJA 1RNLA 4RAOA 5IN5A 5I8WA 1DQPA 3FXAA 3QA9A 4I6JA 3KLOA 1SUSA 3W90A 4WUTA 1KZ9A 1P17A 3L0IB 5IHXA 2IXBA 3NVMB 4RWZA 5D3QA 1GG2A 4JBYA 3G0OA 3BJMA 3GCDA 2DLCX 5L3RA 1XLTA 1O9BA 2VCEA 2I2XB 4GSYA 4IYRA 4J0EA 4F12A 2B5OA 5MFZA 3IE1A 4BVKA 2G5GX 1J90A 2JHPA 4R4JA 1Y4SA 1DIAA 4L5IA 4YFVA 1EWKA 2VJMB 3OX3A 1JZQA 3HKBA 3IULA 4M6WA 4PX5A 4P80A 3IMKA 3RPEA 2OHHA 4L2IB 4PY2A 2P30A 3BILA 3KPUA 2BFMA 2VNSA 4JENA 4LV8B 4WFJA 4UDYX 1YD7A 2HF8A 2I4TA 2JLCA 2X76A 3PNBA 4KYTA 4HGOA 4F6RB 1ECGA 4QLBA 1FLNA 5JZMA 3RABA 4KXWA 1M2FA 5KNLA 1L5HB 3FJ1A 5LZ4A 3JR7A 4MB2A 4YUWA 4EB3A 3AEUB 3FNRA 1CF9A 1T2VA 1NXVA 5KYVA 1GM5A 3PJGA 4Q3CA 1UBGA 4CDRA 1XQVA 2PUHA 2QDXA 4HQ0A 1X8JA 4ZI3A 3ZZUA 5A03A 1Q7BA 4KMOA 4W9NA 3Q12A 2WUEA 3LCRA 4D74A 3HCRA 3OT5A 4OL9A 3V8VA 4CTNA 3VI4B 1OBOA 3IT2A 4H3SA 3FY4A 4GP7A 2CCKA 5A4DA 1VCHA 3ETNA 4BNDA 3RTEA 4M7RA 3RNLA 4KHZA 2VDWA 3FDZA 4DWJA 1XQ9A 2QTWB 2WWYA 5TPWA 1U9ZA 3DDZX 3QX7A 3VDQA 1NI4A 4K88A 2QE6A 1HQDA 5HM6A 2HPZA 5EL0A 5JAMA 4CG1A 1JJIA 4NOLA 3BD8A 3TAUA 5CNJA 3ZE8A 4DJDC 3TGLA 2JBAB 2A9RA 2K5UA 1UIRA 3L6BA 1XCGB 3OE4A 1GRVA 4I4IA 4KMSA 3UT0A 1P80A 4LBYA 3PQ4A 5IJ0A 4Y2JA 2I80A 4P2GA 3TH5A 2X4GA 1ZM7A 3ORHA 4V0MA 1SY7A 5D01A 1SEPA 5K01A 1GNRA 3UT6A 4DEVA 4KNYA 3ESCA 3EAFA 5FR1A 3EC2A 3N8DA 3WGNA 2Q4TA 4J0IA 2B0JA 2PU7A 3PF8A 5A3SA 2CJWA 2YWFA 2ZSAA 2GJ9A 4L27A 1JZTA 1QB7A 2H63A 3GBPA 2YJ5A 1AUPA 4O4IF 5ENVA 4DSNA 3DYVA 1XZIA 1S3FA 5TIIA 2OFFA 1XNHA 3LT5A 4ZPJA 2C4UA 3GGPA 3ROPA 2QMQA 4Z49A 4TL6A 5G41A 3S1LA 4ENSA 1SBCA 4JQCA 1WB5A 2X4DA 4Q9JA 2VA8A 4N4AA 3FH0A 5CA1B 4H16A 1R1DA 1EK5A 1TA4A 2YJNA 6Q21A 3CLVA 4RYLA 3UJ8A 1PLLA 2QL9A 1Z2AA 1ZGHA 1TI7A 2WMOB 3A1UA 3DL4A 3H9CA 3ZH2A 2PTHA 1XD9A 2OHIA 3LX8A 3SC2A 2C88A 2I6TA 2LCIA 1IZ0A 5EKSA 3JZAA 3ZDCA 2PYZA 1NC3A 1ORWA 3CRNA 4G37A 4HUQB 3KOOA 2FZVA 2L17A 4IIUA 5SYNA 1QYIA 4YP9A 1CQJA 5TNXA 3ZK9A 3V9AA 2XNKA 3NCTA 5DGDA 1ESNA 2LIVA 1ATIA 4JS0A 5DO9A 3WTCA 1XG5A 5I01A 2ZRBA 4FT2A 4B3XA 4FB5A 2VLBA 2RE8A 3RQSA 3HB5X 4XX0A 1P0CA 5A4KA 1NW6A 2SKEA 2YN4A 3FRJA 2ZSJA 5IT5A 3HWRA 1ZMTA 3RT7A 2O2GA 1RFGE 1YUBA 4Y1RB 5CURA 1GAXA 2V6FA 1CQIB 4KGXA 2WB2A 1Q0QA 5JJBA 3QE9Y 2DU8A 1VJ5A 4JVMA 4UMDA 3CC8A 3N8NA 4UZSA 3GGSA 2W6ZA 3CUEF 1QFXA 5EN4A 1SU7A 3KR0A 2VR1A 3QITA 3TUJC 3R5TA 5SZKB 1J4AA 2A5GA 2VSNA 2OV8A 1N7JA 1IBSA 3ZPXA 1YBHA 2WR8A 1MNQA 2JAUA 3K6JA 4L78A 1E0SA 1RRCA 2EZTA 3HM9A 3JD2A 1G19A 1WUIS 4P3NA 4AY6A 3EA4A 3ZUPA 1ZK4A 3RIHA 4NCAA 3IUMA 4UTXA 3IVMA 2WTBA 3ETDA 2ZU0C 1IN7A 1QGUB 2IS2A 3UG7A 3CBGA 3LP5A 2V96A 2WEKA 2JHCA 2UV8A 1XRQA 4MW6A 3ROMA 4KYIB 3JVDA 1Q0PA 2ZSBA 3SQLA 1C41A 2FQQA 3T7CA 4BUCA 4OVKA 4NPAA 5EWJB 2HPVA 1T15A 5EJ6A 2NVBA 4PGMA 2BBSA 3OJCA 3UJBA 4V38A 5A6SA 2AX4A 3AO0B 3ENVA 3CVVA 2A1UA 1K66A 1GZ7A 3OIYA 4RS4A 3VR6D 3CZQA 2TMDA 1K0UA 1DIHA 2P78A 1ZOOA 3UK7A 2ODTX 3U61B 4GX0A 3E7FA 3L4BA 4H17A 1LBEA 3U7IA 1UC4B 1T26A 2VPQA 1T0PA 1QHIA 5BW4A 2LZ0A 2FW1A 5FHQA 4KFSA 1Y3BE 2R87A 4IRUB 4C7OB 3DNMA 4FGWA 2PQ0A 1DBIA 1QLHA 5J63A 3S70A 1UMBB 5KYYB 2UUCB 4B3SB 5CM8B 3LY9A 4UDOA 1DAIA 2XA2A 1BGWA 3SKVA 1RJGA 2C7BA 2ZW9A 4KTTE 1J23A 4FINA 2P4QA 3C7TA 5AM1A 1I36A 1LGYA 3QNWA 3ZV4A 1L0BA 2Y0EA 1QGZA 2FWBA 3KOUA 4ZO7A 5TS2A 2VUTA 3IR7A 5CVJA 2P0EA 1CUUA 1SZCA 3ENZA 3FOBA 1CC1S 2FWPA 4PLPA 3UB2A 4DVJA 3DAHA 2IYNA 2P1ZA 1EUDA 2I5PO 1FK8A 2F59A 3W4KA 1B43A 4L6AA 4M1YA 1D2GA 4MUHA 3E9CA 3A0RB 4WDRA 5LN1A 2OECA 1ZW6A 3ZQ4A 4U0KA 4S35A 3R20A 4PM4A 4YLGA 2IJGX 4QJIA 3H5OA 1SOWA 4FGLA 1XYYA 1KYXA 4OI0A 2BDTA 1Z5OA 4I1UA 5JQGF 5K20A 1AZTA 2GZRA 3D31A 4BU0A 1A1SA 3GNQA 3ZWCA 3ER9A 3MERA 3MUFA 5HX7A 5LWHA 1KK2A 3PQDA 4LG1A 4XSHA 3TNJA 1XVAA 3TGWA 2QD1A 4FYXA 2QQGA 5BYJA 3S99A 4YAUA 2VP0A 1T5BA 4KZKA 3DXYA 1APBA 1C0KA 1J8YF 1HFJA 4PAMA 2H8KA 2O59A 3LY8A 4D4GA 4YP7A 2YIVX 2GRUA 5K3SA 5K99A 5KINB 1USWA 4YJ2A 4XQ9A 4KOEC 4NU6A 4ALMA 4DT1A 5BNWA 5AOAA 1H2HA 2PLNA 1FYXA 3JZFA 3H42B 1W5EA 4X93A 2HW8A 1KZ4A 2QM8A 2X9QA 3ECAA 2VYFA 5AOCA 4B2PA 2R2GA 3TNLA 5HG0A 5JHGB 4AICA 1I01A 2QI9C 3EIWA 4L74A 4CKXA 5F3WB 2QTAA 1HMYA 1PT8A 1VKJA 4KQ6A 5EJ4A 3FPHA 5F9FA 1R4NB 2PBZA 4CMEA 1A9YA 2CZGA 5EMMA 4B2YA 3PQFA 1H05A 1P9RA 1QO0A 3QM1A 2HL6A 1QWOA 2UZIR 4KX5A 3WYBA 7MHTA 4K86A 2VP3A 4QYTA 2OZKA 3OPNA 1XEXB 1XDDA 2OSBA 3DFFA 3F8WA 5IW8A 1YA8A 4KUEA 1PQWA 4QXRA 3CLRC 4HUJA 5C8ZA 2DY1A 1XDGA 1X7HA 4M7PA 2BZ0A 1DJLA 1TIKA 4QL3A 1MR3F 1HYQA 2I6UA 2ONZA 3I0MA 5JO0A 5IT9A 1NJ8A 2FJUA 4IUBS 2HXGA 2PKRA 3L7LA 5CVVA 1NJ6A 2H5JA 1NWHA 3DBOB 5DU2A 4LOIA 1VA4A 2EL9A 3SYRA 1WMSA 1IJKA 3ONEA 3L7YA 2QR5A 2WKPA 2VJNA 3B3GA 3TTXA 1WUJS 3B89A 4O0LA 1PZMA 3SY8A 3RROA 4ER3A 4UEQA 2O2XA 4IIJF 3NJ8A 4C3VA 3O8LA 4LJSA 4BCCA 1E79D 5AK4A 3E3OA 4AJ2A 3TQIA 4DCMA 5IAKA 4RZIA 1Y3DE 5ES4B 1KBZA 5E8RA 4CM8A 5D6OA 2NACA 2VTVA 1YS4A 4LJ8A 2XADA 2INGX 2XBLA 5AW9A 3TXXA 2AFHE 3PP8A 1H8ED 2IUUA 3T7JA 3AERA 3OQJA 1Y8AA 4JEHA 4NPHA 3ZDRA 4EG0A 4DDWA 2HFJA 1R4ZA 1ZJJA 5D5HA 4U0JA 2X15A 2G83A 5JSZA 3OCJA 2HIMA 1WXDA 5AW8A 5IAAA 1PBNA 4PYIA 3DDUA 1JG1A 4CQMD 3ORFA 1QU2A 3GBVA 5E6UA 2BBTA 4AM8A 4JODA 1UJBA 5DHUA 2B99A 5EHIA 1TNDA 1PYOA 1II8B 2PT5A 3DV0A 3A9SA 3H97A 1YDGA 3N2KA 1U9JA 4UTOA 4U7TB 4BO0A 4BQRA 5FWAA 1NXOA 5I8PA 4Q93A 2VOJA 1ZG3A 2FHPA 3Q6MA 1FTQA 4QU5A 4QNMA 1ZNWA 4Y1FA 2E4ZA 2B7LA 1KSFX 3MINA 3C15C 1DRUA 4MRMB 2CL5A 3DTNA 4QAQA 5CIYA 5FEUA 4DCTA 3KWLA 3BGIA 4PF1A 2YHUA 1JDZA 1DBSA 2RGBA 5ALZA 3RYFB 5BMVB 3NDRA 3MWYW 2BJWA 5IDYA 3Q8WA 2I6SA 2QN1A 2W4QA 2Y1GA 1GR0A 3AETB 3IAEA 1MAHA 3H6GA 5CPFA 3CWZA 1K75A 5KSPA 4QKQA 3AQIA 3TLKA 2MOKA 4FSHA 2A67A 1X14A 3ZCUA 5CHEA 1SVKA 3Q15C 1DTWB 3WYEA 4BNNA 1ZINA 2VF5X 2BFEB 2PQMA 2MYUA 3H1PA 5CXSA 3IKLA 2IUSA 4JOCA 3R7LA 1OU0A 5B7NA 3LP6A 5KIAA 4I9FA 1N32B 1J8MF 4JJ4A 2PLRA 2ACEA 3QLTA 3WR5A 4RVSA 4ZCLA 4RF2A 4JNCA 1C0EA 2VWPA 5AT1A 1M0WA 3O47A 4GF5A 1S2LA 2P6OA 3R5XA 4MIKA 4CHGA 4X60A 2WWGA 3QYJA 3U40A 1R9MA 3I1FA 5JPDA 2HSJA 1GKLA 2Q46A 2Q7XA 4OHFA 3S1AA 4LJLA 4B75A 5JMWA 3AF2A 2RFLA 3K9LA 4LXIA 2GEBA 4WUVA 4LSWA 5AD1A 1K0FA 4KNWA 4PG8A 2I91A 1T8RA 4FWIB 4G25A 1FMCA 5ALFA 4ZAZA 2Z2ZA 3WSTA 2C7PA 1Z6QA 5J5AA 2FF7A 3IKJA 5BN1A 3TMYA 2UAGA 4DYVA 4HGZA 5F3DA 1JMYA 1F4VA 2D1FA 2Q62A 2C4WA 3EGIA 3WWZA 4D0SA 5CA0F 1FP6A 1L5FA 3B36A 3CF6R 1SZPA 1RE0A 2NNWB 5E6RB 2I4RA 5D3MB 2NVUB 3VXKA 4U7DA 1UXGA 2XE7A 4GBED 2XSZD 2Z6UA 1W2GA 2ANBA 2Q9BA 2WU4A 3CLKA 3UJ9A 4D8XA 4DMKA 5AVSA 4EB6B 3O0DA 1BD4A 1JU3A 3DB2A 4WOPA 3QJ5A 2I2BA 3TB4A 3W9BA 2C31A 4M9SA 5A1JA 5KO2A 1NRXA 2EU8A 2GBFA 3RS8A 3O2SB 1K92A 2G9UA 3JQ8B 3OURA 4P53A 4CNQA 4D8VA 1X0VA 1I2AA 5A4IS 4FHZA 4GXNA 2R7AA 3IODA 3WLFA 3BMQA 1H3FA 3R3SA 3E0XA 4MMZB 3WWCA 1I13A 4NNPA 9LDBA 3M2TA 3IMCA 5EEGA 3BQNB 3ELBA 1ZBDA 1JDJA 2OK7A 3FPJA 4Q4LA 3U3MA 4ACBA 4BU1A 2O19A 5AOBA 3NHFA 1ZH4A 2E2WA 3HCOA 3B7WA 3JQBC 3K70B 3JQGB 3FFAA 1WZCA 5B1EA 3ORQA 2PPVA 4I5EA 3KOZA 5J58A 4RPJA 1FJXA 2HBRA 2OCXA 2YWRA 1EDZA 1NUHA 4CV0A 3GRVA 3NHWA 1X87A 3OCVA 3M89A 1Q7RA 2QN3A 3ZHVA 2FP3A 2OZVA 3FSGA 5JAZA 2DTXA 1UPBA 1AF7A 4PAWA 1E8DA 3UHPA 4F4UA 3OMWA 4Y0VA 2OORA 5JFTA 4CR8A 5KQSA 2W6JA 1VL5A 5JD6A 2NP7A 2H54A 3MMPA 4N39A 1EUCA 1U1EA 1P7PA 5JOQA 3QEMB 3GVHA 2CE2X 1XFDA 3KEOA 4YDSA 4PXSA 2W2VA 1NXWA 2GZ1A 3MAJA 4YT4A 2FOIA 4DR6B 4XWKA 5CXUA 4F4CA 4GPBA 4Z99A 2OKGA 1Z4OA 4P3PA 4KIWA 4HL6A 1F38A 3PGLA 3HJUA 3HL4A 3EX7C 1XQ6A 1XZ8A 1RQNA 2JARA 1T3ZA 2MTBA 3ITDA 1ID1A 4DKXA 5JJIA 1BGXT 3REQA 1V7PC 1LQUA 1QKKA 5KAPA 4ALIA 3DM5A 3CG0A 4CETA 1QTRA 3NNSA 3FMIA 3OIWA 4S05A 4EJSA 3FNGA 2P3SA 3FPAA 5ALNA 5IU6A 3B3JA 4DSZA 1PFQA 5AJXA 4HR7A 1J97A 4UCFA 4EVQA 3EEBA 3C3EA 3K05A 4BNXA 1KOJA 1V43A 2W2MA 3LOQA 5IJ9A 1C7ZA 2ZE7A 1GAJA 4BKPA 4PO1A 4Z51A 4BZWA 4FYMA 1N4DA 4WACA 5AKIA 4DB4A 3OTWA 4DM3A 3GLHB 2P9GA 4PSCA 1NM5C 1RR6A 3F1LA 5TEVA 3WI7A 3WQBA 1ID8A 1F5NA 4ZGWA 4CMIB 3DOFA 4XWTA 5FBKA 1V16B 3TRFA 1G1MA 4FDAA 2C2KA 4F93B 1XMOB 3PQ2A 4R05A 2O0HA 2ODNA 4J2TA 1HSOA 5LYYA 1NJ1A 3WYFA 4E6PA 5JBQA 5GINE 4GBJA 1I32A 1MVLA 3W5AA 5CB4B 5GMOA 5D6NA 4OHOA 2QZSA 4CV3A 4KMRA 3EQ7A 2VQEB 4JJ6A 1M1NB 2WJIA 1QV6A 4QUDA 3SHTA 3ELYA 3HP7A 3I9V1 1JR4A 5DSXA 2AF3C 3I0NA 3CX8A 1EM6A 4DYDA 5BV8A 4LDNA 2PVPA 4UASA 2IP1A 2AR0A 1MJ5A 3BE5A 3CQ9A 3DT8A 1NLMA 1NU8A 4ZO8A 2XWJI 3RS7A 3FTQA 2PXXA 1IRIA 5G1NA 3H05A 1GSIA 2BV3A 1OAOC 4NYJR 1XTRA 2AOUA 4EI8A 3UMRA 1MJFA 1FU7A 3VUFA 5K6AA 2Z4SA 3V2UA 5KSOA 2BGNA 4IZOA 4BDTA 4NJMA 1PJZA 2C77A 1G8SA 4Z9BA 2X58A 4F5WA 1ONOA 3QBJA 1YS6A 3H1GA 2VLIA 4ZDWA 2OENG 4IRMA 4NCXA 3HP4A 1YHNA 2CHQA 1UKEA 2EW8A 3HA2A 2QYOA 4JL5A 1XZPA 1MIOA 4TROA 1QHHB 4TUYA 5FBRB 4PHHA 1Y6GA 1XI2A 3E23A 3L1JA 3Q7RA 3RUHA 2A0FA 2MMGA 5H9VA 3TZKA 3ZQ6A 1PTKA 5FA8A 1Q77A 2Z43A 3ADDA 1OLSA 2HDNB 1NUTA 4KR0A 3QVVA 3VHXA 1YZKA 3UK2A 1O1YA 3OE7D 1E8NA 4PYQA 4JH0A 3D5EA 5ER9A 2R1VA 9MHTA 3VH3A 3BMNB 3QBTA 1EBUA 4ZCRA 1BMQA 1JTVA 1VHWA 1B0PA 1IPHA 5DK4A 3ZV3A 1EK0A 1JDBB 3BBPA 3LDGA 1C3LA 1ORRA 5KTTA 5F9HA 4C4RA 1HEIA 1GL7A 1N2EA 1JKXA 2PPLA 3N3AC 1T91A 4FLFA 1UOOA 1TF7A 1WA5A 2YTZA 1SC1A 3G13A 1SQ6A 4ES6A 1O6FA 3TLYA 1HFWA 3ZUGA 2AKYA 5LXTB 1WRBA 1KIAA 1RJFA 2GK4A 2YJGA 3B1FA 3GA0A 3QIVA 4QBTA 4RD0A 1R66A 2C92A 1CDEA 2BY4A 2ZYGA 1I7SB 3EOBI 5COAA 4KC0A 3N0RA 5IFKA 3I12A 4OV6B 2CXQA 3GRUA 2HKIA 2ZUBA 3RTAA 2C07A 3C5CA 3L07A 1WSAA 3SKYA 1JFFB 1TD1A 4D0LB 5BWCA 1A8QA 2GXAA 1DINA 3VNUA 5LLTA 2XEDA 4Q3EA 1U8AA 1X8XA 2P2NA 4HQKA 4EENA 1FZTA 2V54A 4PTYA 4CF3A 4LX0A 3HKDA 3GJQA 5KNBA 3F2VA 4J7AA 5B2EA 1LF0A 2XJ9A 1AE1A 4MIEA 1ICIA 2R8BA 3R0IA 1PD0A 5BSVA 5L7YA 2EYUA 2P7IA 1NW8A 3GAFA 1F8GA 5K3DA 3GMTA 4TQUS 4Z0NA 2VHEA 4C03A 6ABPA 1UAAA 1IBMB 3GT3A 1G5FA 3A6GA 4KDCA 1NW4A 1UFKA 4MS3B 1QHNA 2AZ4A 4JBLA 3C6KA 3U26A 4RF5A 3V7WA 2WIBA 4B80A 3WNBA 3U44A 1CQJB 1RM5A 3SMVA 1P2BA 3TI7A 3UT5A 3SSOA 2JFVA 2WM2A 2REXB 3MYYA 3R5FA 4BQSA 5KWEA 1FX0A 2OLKA 3M3DA 1MABA 1T3SA 1XTPA 2ZJ2A 2FWAA 2LDBA 4HXFB 3DKVA 4P0TA 4KX3A 5HIIA 3UGQA 4D4HA 3JVVA 3VKUA 1TT5B 2GX6A 2W6PA 4DRYA 1N4AA 2OXTA 3UHAA 2X5KO 4IXDA 2P1RA 3FW1A 4JLWA 4QGHA 1U3WA 2J46A 2NUTB 4MCHA 4RJJA 3WLQA 4QATA 3QUCA 3T7AA 3V80A 1Q11A 3T35A 3A6PC 3LPLA 3LC0A 2CHVA 3BAFA 3MCAA 1HM5A 4OSEA 1F60A 4JASB 4IIGA 2OXFA 1BTOA 2QTVB 1M5UA 1ZCBA 3AUAA 3PR1A 5DMHA 1ULHA 1SXJA 2FFRA 3QHAA 1MKYA 3PC8C 1R64A 3CLRD 3HB0A 4I3FA 5D1HA 1XL1A 3I9OA 3ZIAA 4HKTA 3L93A 1KPHA 4P4SB 4X6LA 1G21A 3PDIB 2AUMA 4QOGA 5JNVA 4JMPA 4O4IB 1T6NA 2BKEA 2O52A 1MO4A 4RCZA 3U7EB 1JNYA 1C7RA 4I1PA 2OCGA 1E5TA 3PUHA 3JQ9A 2D0PB 1P5RA 4S0ZA 4R2HA 4BWVA 1KR2A 3ZXYA 3VVMA 3HLTA 2B4RO 1W0CA 2NUAB 2CJFA 3NW9A 4LDQA 3KD3A 4HVAA 4I3GA 4O2BF 2E87A 1VBMA 1ZL2A 3Q3IA 1GKYA 1VJRA 4AZ3A 3UTDA 2JCGA 2GWHA 5ARBA 4BPBA 2F2TA 5DI3A 2OZLA 2FW6A 3T3PB 1HC7A 1ISSA 2A30A 2I1QA 2X8JB 3OFNA 1B73A 2CB9A 4OKIA 4UQLA 4RADA 2PEZA 3W34A 5GM1A 4YUXA 621PA 2JIDA 3O82A 2HCFA 4I66A 3UWSA 3E8XA 3UHOA 4BN4A 5M29A 3ZVNA 4WK6A 3PFHA 5DSZA 1KAHA 5JY1A 3I1YA 3IQEA 2C3UA 4EGCB 4ZV4A 1GYQA 4Q6BA 4CLOB 2I55A 5IF3A 5K0JA 3KTOA 1Z4NA 1HE3A 3NHAA 3TO5A 3FHTA 1U2DC 3BWYA 2X1HA 3MWDB 2EQAA 2G71A 4FGSA 5T4FA 3U4HA 4RNCA 3WGQA 2R00C 3FYHA 2YV1A 4WJKB 2R8YA 3FIUA 2O0KA 3ESAA 3OU6A 4XZ3A 4TZKA 5TQ0A 3VC2A 4BEWA 1WMEA 4NFLA 5F51A 2CY0A 2Y1LA 3C6ZA 4QO7A 4TXNA 1Q0HA 1QG4A 4XLLA 5JROA 3TLZA 3ZHTA 3OJFA 3WK9A 4GXTA 4XIIA 3BKWA 3UXMA 4MOWA 1PG2A 4GQIA 1HRKA 1QFJA 1EUDB 3MJHA 1AKUA 3S68A 3NC4A 3CCCA 1TPYA 1BOFA 3FNHA 1E2LA 4FYWA 5I7WA 4PG7A 4LN1A 2QMOA 3K31A 3GCZA 3ZWOA 1MAVA 1E2DA 2OV1A 2FWMX 1D6SA 3TEMA 4DCUA 2WDPA 2HNBA 3SYTA 1G41A 1CJBA 1WDTA 2DQYA 4OA5A 4O4HB 3O3NB 1FRFS 1L8XA 1HMPA 1LLFA 1V6AA 3GEIA 4YJHB 5J43A 3J81k 3WLOA 5K8TA 3QLUC 1YU9A 1DDOA 4FJ1A 1M2VB 2DVMA 3WNZA 2JCYA 3VO9A 1OXSC 3DTTA 3ND7A 4KBFA 4BP9A 2W8BA 1OI4A 1TKRA 3Q6IA 3D64A 4O2BA 4I08A 4EA6A 4ZCTA 2B1IA 3ZLJA 1NKSA 2DFPA 2JFYA 3HHPA 4INPA 3INNA 4OAPA 2QTHA 2JGDA 4UD2A 1N92A 5FO0A 1PR2A 4QD3A 1NUQA 3W5HA 4P3KA 1A50B 2RB5A 2GFQA 2J3QA 1ZN9A 1KSGA 4TL8A 5IJAA 1YJXA 1X42A 4LISA 4N49A 1P7CA 4PC3A 3IUYA 3VR6A 3WB0A 1XZMA 4LXGA 1L5YA 4C7JA 2WPNA 3HPQA 4HADA 3DOHA 1VL0A 3FD8A 4OO3A 5CBPB 5AVKA 1C80A 1TQ4A 3E1SA 4M1EA 1K97A 4JSRA 4NZOA 4Q3NA 4RVFA 4OXNA 3WMFA 3ZHRA 5J2TA 4IM7A 5SYAA 4V02A 1SCBA 3LLSA 2I3ZA 4I19A 3U9LA 1BWSA 4HNRA 5A7FA 2ISSD 4K9KA 2H2FA 3DOEA 2ZBVA 3RVLA 1P0MA 3HO6A 4IKEA 4W7IA 2AN3A 5REQA 3H17A 2C82A 1DJNA 3C3JA 3P97A 5E9JA 5IC6A 4EGSA 2CJYA 3SF8A 4TKVA 5KREA 5MF6A 5D85A 2XUDA 1GL9B 2CK3D 2CNBA 3H86A 4ZV9A 5D00A 3MS7A 3TPZA 5CFRA 2AC4A 7MDHA 2ZULA 3OX1A 2UZ4A 5LZ5A 3OEHA 1XDWA 3CY6A 4R2JA 3DONA 1VQ1A 4GOKA 2YJ4A 4JEIA 3I2JA 2DKOA 4DRZA 5EP3A 1C30B 1W5FA 1A5TA 2CDAA 2ZB8A 3MWFA 4KR2A 3DTVD 4CIXA 5EJ5A 3PE4A 4RFVA 4RTKA 3T1VA 1JAYA 3WKCA 5JQGB 3CH4B 4D4KA 3S1SA 4OXYA 2CF5A 1DTSA 3WZLA 4FE4A 1V37A 3I6YA 4I81A 4N03A 3I9KA 5A5EA 3A4YA 1U3GA 3EQ2A 1IHYA 2FRDC 4LE1A 4G24A 1GUFA 2OL4A 4ZQIA 3UXEA 4F91B 1ZHHA 1KF0A 3EDMA 5KTKA 1EFAA 1Z13A 1XDUA 2ONKA 5KOJB 1A5BB 5B7QA 3W3AD 5KYWA 1QH9A 1OY1A 2AFRA 3IUQA 5A9SB 3T1YB 1DKQA 1WY5A 1U0LA 1Y5RA 5FDFA 3DXXA 2A5DA 1PRYA 5LOVF 5IS2A 1FFEA 4YH1A 3L7BA 3DMTC 5FOSA 2NO7A 7AT1A 2I4MA 3CA8A 4OAOA 5JSHA 3QOFA 1QOQB 1KO8A 2XVAA 3EBLA 1HQYE 4OXQA 4RIGA 2QNRA 1U7DA 1RLJA 2BKXA 2C9DA 2PR7A 5E6UB 5JSYA 3RSCA 4UTRA 2B4YA 5FTJA 5G1OA 5JW6A 1EE2A 4NI5A 4MLDA 2JK0A 1RE1A 6YASA 3ZJYA 3EIHA 3TXAA 3FWKA 3E2MA 1VJCA 3N2KB 2NZWA 4CTKA 3FLBA 2C2ZA 4BTEA 3I83A 5FWYA 1PGPA 4OYHA 3STWA 3MWGA 3A2NA 3L0SA 4HDAA 2RGYA 4EI7A 2JEZA 2WJYA 4BASA 4W1SA 1Y5LA 2RHJA 2BCEA 2CUZA 1ZUNB 2XCRB 4WNAA 1R6UA 1KAEA 2ZDHA 3HL0A 5TS3A 3K5PA 1EFPA 3KS9A 4H0NA 3UXHA 3S29A 5IBCA 1DX6A 5ALSA 1WPXA 1IXZA 4C7XA 5HQTA 3GLGB 4CZ2A 3PNYA 1U5BB 1KAQA 1M75A 2O1EA 2YXPX 1NLYA 2ZBUA 3IX7A 4CMGA 3D4OA 1EB9A 1WO8A 5LMZA 5BYBA 3L92A 2HADA 5A1TA 1U8UA 1EVEA 1I1NA 3C1TA 3E27A 3MHPA 4FMBB 3BOSA 4MJXA 3R09A 5CLFA 4PR3A 3V7YA 2C4TA 1ZGCA 2V6BA 3JWEA 4N18A 5TJHA 1QPZA 2ZR7A 2TMKA 1EDBA 3AIIA 3I3OA 4HGYA 1EZ1A 4O4LF 4R8LA 3SZLA 3ETHA 4JI7B 4L8YA 2YOFA 3D4NA 4IIJB 3ZTWA 3ELUA 3A1WA 3L0DA 4ME6A 4OYYA 1LLUA 3TMKA 1PG5A 2QXTA 1U2PA 4BX2A 3WGUA 2XNHA 4G5YA 2IYXA 5F2EA 1PR3A 2IPAB 4ALLA 2Z5GA 3M6FA 3HEBA 4FW8A 3AONB 1UFOA 4Y67A 3HVIA 3NHSA 4BLVA 5TRTA 4IEIA 3C39A 4PLFA 3DUFB 4KYVA 3SX4A 4A03A 6NULA 2D7JA 5DXJA 3IIEA 3IPXA 5EJ2A 3E5HA 3JTMA 3RVNA 2EW1A 3VDRA 1OC2A 2GD1O 2OO5A 3ETGA 3H1EA 3HJRA 1BMFD 4H4EA 4CG2A 1U5CA 4HN2A 4Y1GA 4WLUA 3RIGA 4BP3A 5J4LA 4FYPA 1VKNA 1CVRA 1ZKDA 3I4LA 3O92A 2Q2OA 1RI1A 2VWHA 3KYIB 4L8LA 1NUSA 4BMCA 4UBJA 4A6EA 1CRZA 1GDHA 3KZMA 2QQ0A 1XJ5A 2BUCA 1RHKA 3TW4A 4W5NA 2J31A 3AU9A 3NORA 4D57A 1MT0A 1LA2A 4QFBA 3R5KA 3RV4A 4Y9SA 4QPNA 1RQGA 1W76A 3O03A 2V5VA 1ST3A 2GD2A 3KTAA 1NFFA 3QPDA 4TTSA 5TQ2B 1L5KA 5B58C 1UMCA 1FC0A 1T9ZA 2B1JA 5FPQA 1GFWA 3QW2A 3ZNPA 1P0FA 5AFSA 5CIQA 2XD4A 4Z9XA 1DAEA 1ZM9A 3GP5A 4Q39A 4WKGA 2P6MA 3SNHA 5LQJA 2P69A 4ENPA 1TEXA 1OILA 3EY9A 3HDYA 3FWZA 3RC2A 5JBIA 3VJLA 4DFDA 1ADYA 2JANA 4H7EA 2O8CA 4ALNA 1ZGAA 4O0MA 1O94C 4REOA 5CFZA 3DW3X 1FNNA 2C2HA 4YRTA 5H4GA 2G9RA 4HAZA 3ZKWA 3MCUA 4OJNA 5KNCA 4AJJA 1RSZA 2QJTA 4GEKA 5DTIA 1SCUB 3TR6A 1P2SA 4UVIA 1SBZA 2C20A 1MB9A 1K3UB 3G1TA 1DC3A 5JSUA 1IULA 3A37A 2DOKA 4K46A 4BLWA 3FOZA 4HO1X 1TVMA 3P2OA 3E7XA 3OOYA 1XTQA 4H59A 4S12A 4OHBA