1CYDA

Carbonyl reductase complexed with nadph and 2-propanol
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
242
structure length
242
Chain Sequence
b'LNFSGLRALVTGAGKGIGRDTVKALHASGAKVVAVTRTNSDLVSLAKECPGIEPVCVDLGDWDATEKALGGIGPVDLLVNNAALVIMQPFLEVTKEAFDRSFSVNLRSVFQVSQMVARDMINRGVPGSIVNVSSMVAHVTFPNLITYSSTKGAMTMLTKAMAMELGPHKIRVNSVNPTVVLTDMGKKVSADPEFARKLKERHPLRKFAEVEDVVNSILFLLSDRSASTSGGGILVDAGYLAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBONYL REDUCTASE
publication title Crystal structure of the ternary complex of mouse lung carbonyl reductase at 1.8 A resolution: the structural origin of coenzyme specificity in the short-chain dehydrogenase/reductase family.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 94
structure length 242
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.184: Carbonyl reductase (NADPH).
pdb deposition date 1995-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1cydA00
1JKFA 3O8QA 1NVGA 4E2ZA 1CIVA 5JS6A 2ZJ0A 3NDJA 5T8KC 4WLOA 3ONEA 4JROA 5JMPA 3ROKA 5KJ6A 3EGOA 4OKIA 1T2FA 1P77A 3A14A 4J49A 1BXZA 3L6DA 4XGKA 2J5QA 3KV3O 4ND5A 2O23A 3LT4A 2EJWA 2CZCA 1DAPA 3NAQA 2YHIB 4PRKA 4QUKA 4KWHA 3PQEA 4J91A 3RBXA 5TT1A 3GT0A 3QWAA 3TWOA 1PR3A 3RJ9A 1XYGA 5CP8A 1E7RA 2ZQYA 3TRIA 2PKRA 4NK5A 1L7EA 3IKVA 2IXAA 3VDRA 5JC1A 4RPKA 3JD2A 3QHAA 1HKUA 3MZ0A 2ZYGA 1K6XA 3JQ9C 4JIGA 1Z75A 4MVJG 3NDRA 5I8ZA 4NDNE 3D4OA 1N5DA 1YL5A 2VWPA 2I66A 3F4BA 3AW9A 3QIVA 1JQBA 3JQFA 4A7PA 3ZW8A 1ULUA 4KQXA 5DOZA 3GGPA 1Z45A 3D4NA 4YAIA 2UVDA 4RQUA 1V35A 3K73O 2JD2A 5G4LA 4YRAA 4JGBA 2BH9A 2CF6A 1KY4A 3FNHA 5CHEA 2BMAA 4B3IA 5KVCA 4ALJA 4XWYA 5IDWA 2A92A 4W99A 2X9NA 2CSUA 2NU9A 4BO3A 1PS9A 2HKIA 2OFPA 1WVGA 4GGPA 2IZZA 5JYEA 2O3TA 5FYDA 1TT5B 3SC6A 1U3UA 3CMMA 4AJ2A 1B14A 4BO0A 4DBVO 1DJQA 3DTTA 1ZCJA 5JAZA 1E1KA 5FFFA 1HXHA 3ROQA 5IAAA 3QWFA 2ZB3A 2RCYA 5DZSA 5MGBA 2BFAA 2NTVA 5TQVA 4E32A 4J0FA 1HSZA 1E7YA 3F46A 1YQXA 4RO0A 3ETDA 1NX6A 1NAHA 4YAGA 3M6IA 4Z0PA 4CM9A 1UXJA 2JFGA 4FIZA 3SBOA 4BV9A 2I9PA 1ZIDA 1PJSA 5TF4A 5TX7A 3JQEA 4XYBA 3BXXA 1UP7A 1FJHA 3TZCA 4D42A 3OIDA 3UUWA 1KERA 3H4VA 1T4BA 2VN8A 1JKIA 1KS9A 4FFOA 4RVHA 5EPOA 4CLEA 3JYOA 4UVHA 3AOGA 1HYGA 4M87A 4DRYA 3ROPA 1HE5A 4EGFA 4R1TA 4BMNA 1T25A 5CAEA 3L4BA 4CMEC 1XHLA 1ONPA 2EEZA 2OHXA 2RHCA 3Q9NA 4AICA 3RFXA 3VHRA 1SZJG 3DQPA 1GY8A 1N9GB 1PZGA 3JQ7B 1ZUD1 2GUGA 4NBVA 3UICA 4RZHA 4RF3A 2NTNA 4YEDA 1MP0A 3OECA 5G0SA 4UEKA 1ORRA 5I8WA 3C85A 1GDHA 1D1SA 5L51A 3IS3A 4Q3CA 3QV1A 4FGWA 1CETA 1ZSVA 3FRJA 2J8ZA 1UP4A 4HFNA 2J5RA 1AHIA 3I9JA 3MEQA 3PLRA 5HWSA 3GN2A 1LNQA 3QVXA 4XQGA 5H81A 5F5NA 4RDHA 3K9QO 5IJZA 4BNIA 1BDMA 2BI7A 4OHUA 3AUAA 4ZVVA 4BO4A 2VWHA 5ADHA 4AFNA 2FSSA 1E3SA 4XA8A 3VKUA 3DBHB 4A26A 1F8GA 5TGDA 4GLLA 2HAEA 5FF9A 1LQTA 1EVYA 1JDJA 3A06A 5TLSA 2I5PO 2G17A 3BMQA 2NU8A 4BHTA 5THQA 5CDGA 1YH3A 3W8DA 3RUDA 3DFZA 1DRWA 2PD4A 4YAJA 3HN2A 1GPDG 2JCYA 3S2FA 5IN4A 1P31A 3ZCXA 4IJKA 4A73A 4BB5A 5EL0A 1EUDA 4CV3A 2XOXA 4JBHA 1M2WA 2GF2A 1DIHA 4UVDA 5KJ1A 3PWSA 2ZK7A 2P4QA 3PDUA 3VDQA 2DUWA 5K9ZA 2NLOA 2Y99A 3K31A 1R12A 2HSDA 1I10A 2Y1DA 1B16A 1EMDA 3DONA 5A04A 4D7AA 5TT0A 2GLXA 4LVUA 3F3SA 2FSVA 3VPHA 4JQCA 1LBEA 5DP1A 5DF1A 1WP4A 4UULA 5JY6A 1NAIA 3V2HA 5EINA 3KRTA 4QTZA 2DFVA 4FFNA 1YBMA 2VYVD 3RC1A 3BAZA 5MDHA 1GQYA 4J2HA 5JW6A 4PVDA 1DOHA 1VE9A 2VYVA 3CPSA 4K28A 2W90A 4WOKA 3S55A 4CMJA 1N8KA 5A3JA 5IZCA 3DMTA 2PTGA 5JC8A 4PCVA 1YDEA 1YB4A 3KLMX 1E6UA 3G79A 3NRCA 1P33A 4OSPA 5IDXA 3TDKA 2R2GA 2VHWA 4YWJA 2VOJA 5JFOA 2CVOA 2HMTA 4GQAA 4IJVA 1G1AA 1E3LA 1IHXA 2GNAA 3GNQA 4Q3EA 3INTA 4UEOA 4GX5A 3IMFA 4ZQGA 4I1IA 1P0FA 4QFCA 4LGVA 5CEEA 1QYVA 2GERA 4XRGA 4IDGA 2FPGA 1PIWA 1B15A 3RAJA 4GMGA 3GVHA 4EEZA 3QWHA 3ZDFA 5KWEA 1E3WB 2BD0A 3H9GA 2OO5A 4GMFA 4RJTA 1I01A 4M86A 4BNMA 1VI2A 1PU2A 3PWKA 1AXGA 1JVBA 1ZXBA 3I52A 1GR0A 1X7DA 4DC1A 1UAYA 4UVIA 4I9UA 2HMWA 1D3AA 1ML3A 4BNUA 4CODB 4FFLA 4YT2A 3WGZA 4NFHA 3WYCA 4BNVA 4BGUA 2HRZA 1CERA 1Y9EA 3LT0A 3PZRA 3PRJA 1J0XO 4K6CA 3SJUA 1IPEA 2R00C 3DHYA 5B1YA 3H9QA 3VPGA 3KM0A 1MG0A 3I23A 4W9NA 1E1MA 1A9YA 4IMRA 1UZNA 4CL8A 1E3IA 4RZIA 1PX0A 2P4HX 1MC4A 1QLHA 4DUPA 1JTVA 2E37A 3PYXA 1NVTA 4OJNA 4YT8A 3E03A 4XCVA 4RGBA 3G1UA 3V1YA 1XQ6A 1JWAB 3AWDA 4BNJA 4D0SA 3UVEA 4E5PA 3RI3A 4IBOA 3BMOA 4EEXA 4D43A 3GDOA 3JQAD 3UOGA 2Z5LA 1ADCA 4FBGA 4ZU3A 3WJ7A 3U5TA 3VVBA 4BGVA 3ZWXA 3TPCA 3BMCA 4QECA 1JAXA 3NTQA 3JQAA 2XXJA 4CV0A 1NYTA 3TZ6A 4R41A 1QMGA 2VZ8A 4MIEA 5B4UA 3ULKA 5TJ9A 2J3HA 2BRUA 1TEHA 4YR9A 3GMSA 1PJ4A 3PJFA 4BQPA 1Z6ZA 3QRWA 5IZ4A 3U0BA 4RF5A 3FCOA 1JLLA 4CR7A 4F6LA 4I5DA 4ID9A 2Z1NA 3GG2A 1V9LA 2CF5A 3GLQA 2Q4BA 1PJ2A 4NBWA 2E6UX 1C1XB 1H0KA 1ZK4A 5IDQA 3JQBA 2UUPA 3E82A 4OGWA 4DTIA 2EGHA 2FRDA 4GGOA 3WNVA 3CE6A 2B5VA 4BQRA 4E3ZA 1EVZA 2F00A 3X2FA 1JN0A 1PJQA 2TMDA 1HETA 2NVWA 3ADOA 2X0JA 3OM9A 4JP2A 4PG6A 4PZDA 3JD4A 3TJRA 1D1TA 4XR4A 1R0KA 5EERA 4RCVA 3VC7A 3I9NA 4HBGA 4WE3A 3PFFA 2DM6A 2ZCUA 3RU9A 2O48X 3FSRA 4IDCA 4CUKA 4ZA2A 3T7CA 1KETA 3PJDA 1AHHA 2PZLA 1U5CA 5CEFA 9LDBA 3W8EA 4L4SA 1SEPA 3VZRA 2GSDA 5KIAA 1VL6A 1HT0A 1UAGA 2JL1A 1DSSG 3DZGA 3RC2A 4BNTA 2VHYA 3WS7A 1XQ1A 5ILGA 4NFSA 4BVAA 1V6AA 5TRTA 1DFIA 2Y05A 3G1TA 1BW9A 3PI7A 4RVGA 2CDBA 1NNUA 4BGEA 3ETGA 3VTZA 4OL9A 3ZNNA 4B7UA 1U3VA 1U3WA 4A03A 5A9RA 4UVGA 3FBGA 1VSUA 3I6QA 2CY0A 4BKOA 1LLQA 3STHA 1B8VA 3H65A 2H1SA 1RKXA 3AY7A 1VKOA 5T8KA 2IEBA 3E5MA 3ITKA 3WGGA 3ZNOA 3OF2A 1IZ0A 1M6HA 4BV8A 4YRBA 4JBGA 3RKRA 1C1DA 1OZAA 4DL9A 1X7GA 2BGMA 1RM3A 1EQUA 3H7AA 3WB9A 3FNGA 4DC0A 1RPNA 1DRVA 1SBYA 1O8CA 3AY6A 3GZNA 2X9VA 2OORA 2ZCVA 3Q6IA 4WNIA 4WUVA 2IDZA 2HMUA 1K6IA 4OMUA 4RL6A 4XGNA 5TNXA 1GUYA 2FPIA 3MJ4A 4RVSA 5AXBA 1LC0A 2X4GA 2HJRA 1BTOA 4TKMA 1N2SA 5B12A 3UH1A 1OMOA 2B4QA 4XYLA 3RSHA 1H5QA 3PJGA 2RH8A 4Z3DA 5J23A 2WD7A 1PR9A 1ENPA 4IM7A 3JQ9A 3HB4X 2VZ0A 2P9EA 5L4LA 3HDQA 4DYVA 4J16A 1NFFA 1T26A 3GNSA 4CLOA 4AL4A 4B8ZA 3HE3A 1YRLA 5B4TA 2C5AA 5AXCA 3Q1LA 1ONOA 1OFGA 2I65A 4U6SA 3H2SA 5L7WA 2GPTA 1DFHA 1ZZEA 2JCXA 4EI2A 4XX0A 2ZATA 3NTRA 1G6KA 4Q3DA 1FDTA 5IFLA 3GDFA 2O2YA 4D0RA 4ITUA 2PV7A 3OFSA 1OOEA 3GA0A 4B4OA 1KBZA 2X5OA 3GY0A 1K5HA 4A10A 2VCYA 4WJZA 4ALKA 3BYZA 3U4IA 1M6WA 2YV1A 4AJNA 4F45A 4E13A 5DULA 2J6IA 3HNPA 4MKXA 3EYWA 5T57A 1ISMA 1R16A 2YQ4A 2YV2A 3GMDA 1EFLA 3BTSA 3JQDA 4NBRA 3WSVA 3PFWO 5K0ZA 2B4TO 4KUGA 3U09A 4BOYA 4TVBA 1RYDA 4L9RA 1J5PA 1P0CA 2FN7A 4YJHB 5H82A 1DIRA 3TFOA 4HX5A 4FW8A 3D3EA 3IKTA 1ENOA 4MVJM 4XD2A 4Y6RA 3I9LA 2D2IA 1H93A 3WMXA 4P22A 5DOVA 2G5CA 2NACA 4JK3A 4L4RA 1A7AA 1XELA 3JQ6A 3ANLA 4R69A 3F1KA 4XQCA 4CMCA 1KC1A 4AVYA 1LSJA 1DPGA 5G0TA 3VPSA 4J7CA 4BS9A 3ADPA 3UF0A 3PZBA 3EVTA 4PLHA 4YYZA 4OIMA 1J6UA 4CMEA 4J1TA 2OL4A 3V2GA 2GN8A 1CF2O 3P2YA 3QLJA 3ZHYA 1VJTA 5JBIA 4II3A 2RAFA 4UAGA 3JTMA 4PZCA 1N92A 2ZTLA 4RPGA 1ZK3A 4YTEA 4YVFA 1DJNA 1KVQA 1AGNA 3D4PA 3RQSA 4TKLA 5A5FA 2AE2A 4IS3A 4NR0A 3DEYX 5JCXA 3UW3A 1S7CA 2VRCD 2OBYA 3GUCA 4YRDA 1J4AA 1PJCA 2QYSA 1R66A 3QWIA 5DDIP 1EE2A 1PWZA 2I76A 3INRA 1U1IA 4YXFA 2UAGA 4W4TA 2VRCA 1B0AA 2O4UX 5AYVA 5ILOA 4WLEA 1RYEA 2ZQZA 4FOSA 3SEFA 3WQRA 2FMUA 4ZQBA 4M49A 1NR1A 3VH1A 3H9EO 2O7QA 3DZKA 3BMOB 3DTYA 4WEOA 3LT2A 3VTFA 4PLYA 4YAKA 3K2BA 1YVEI 3GGGA 4IXTA 4U6QA 3ZU3A 1HF3A 4J1QA 3BMCB 4Y98A 4AJ4A 3JQAB 1X1EA 2A94A 5KTKA 3GAFA 4X54A 4MIYA 1A72A 5JNLA 3RIHA 1LQUA 4E5NA 1YGYA 4IIVA 3P19A 4HP8A 1DEHA 4KTVE 3WGTA 2QZ9A 3GR6A 3KZVA 1QORA 2FY8A 1XCBA 2PD3A 2ZB8A 3IP1A 3MCVA 2R6JA 1ZMTA 2E48A 4PG7A 1QG6A 2O50A 4TRRA 2VWQA 2GR9A 3RWBA 1ZJZA 1N1EA 4LSMA 3WQSB 5JDIC 3NJ8A 1ZH8A 3DAGA 4WCFC 3PEFA 1QYXA 4IZIA 2VHZA 3ICPA 4TZKA 5IXYA 3EVNA 3T4EA 3V1TC 4ESOA 2FR1A 2DKNA 2AEFA 5KJEA 3RVDA 3ZWPA 4ALLA 1BWSA 4GKVA 4DVJA 5L4SA 3K5PA 5T6BA 3MJSA 1F8FA 4BNYA 1TI7A 1X14A 3ZHXA 3IOYA 4QEDA 1WWKA 2NV6A 2AEMA 4BO8A 4IDBA 5LC1A 2YV3A 2NNLD 4FD3A 3E48A 4YJGA 2YHUA 4IMPA 3BMNA 4XIYA 2Q1TA 3S8MA 2B35A 2EGGA 3K2EA 3I4FA 3ZWWA 3WR5A 5BSGA 4UUPA 4ZQHA 1QSGA 4G81A 3E18A 4CUJA 1BW9B 1PS0A 2I67A 3H3FA 3G3EA 3DZBA 2EHDA 4ALIA 5CDSA 2O3QA 1LX6A 3IL2A 1BXGA 1GPJA 1MX3A 2AG8A 2HDHA 3A4VA 4U8GA 4B3HA 3LT1A 3H6KA 1ONNA 4R01A 1IUKA 1EQ2A 2EF1A 2R00A 4R9RA 1LRLA 4MIOA 3VPFA 4OM8A 1WW8A 3RU7A 4ZQEA 3NT5A 1Z82A 2YY7A 2WMDA 1FK8A 3O03A 4YQYA 4NJMA 1HEUA 1D7OA 5EJ2A 3BHMA 2G76A 1B8UA 1C1DB 3LVFO 3VH4A 1RWBA 4IDFA 3WWZA 2Y67A 1U8FO 4MP6A 3PP8A 5FWNA 2NWQA 3L9WA 1K6JA 5KOIA 2D1YA 3PLNA 1XIVA 2G1UA 3JQCA 1OBFO 2TMGA 5JAIA 2CVQA 3AUUA 5IDYA 1PSDA 3E1KA 4DPKA 1SB8A 4B7CA 4QSMA 3VPXA 4MINA 1DIAA 3HUDA 5L9AA 1ADGA 1FXSA 4CMIA 2WD7B 4LVCA 3O38A 3C24A 3GGOA 1K3TA 4FJ2A 4CLOB 4FPXA 3QSGA 2QRKA 3COSA 1LLDA 3TOXA 3ASUA 1EZ4A 4N5LA 3JD3A 4WOJA 1K89A 3NGLA 1Z7EA 2I6TA 2DPGA 3PPIA 4CM5A 1KYQA 3DBVO 3CUKA 4IGFA 4EITA 3I9KA 4XQEA 4I8XA 1ULSA 3DDNA 4P8RA 1E92A 4R3NA 2VOEA 3UCXA 1V0JA 3A1NA 1MFZA 3IJRA 3W4JA 4KOAA 4MP8A 2JD1A 3FPLA 4IPTA 3D64A 4XJSA 4BKRA 1Q0LA 3KLPX 3HQ4O 1KOLA 1JKJA 2FR0A 5F3RA 4ZD6A 3VZPA 2Q2QA 4BL5A 4F6CA 1O5IA 2GD1O 1IHYA 4JN6B 2X5KO 3UHAA 2B37A 1I2CA 2ET6A 2YJZA 3AM3A 4G2NA 2Y93A 1GFSA 2B4RO 2C82A 1V8BA 4NZ9A 4CL3A 1ZSNA 1ISHA 3ENNA 5F21A 1NPYA 4RDIA 5A1TA 2PY6A 3OH8A 7MDHA 1YJQA 4J6FA 1MV8A 1T2EA 3WQQA 1H6BA 1E5LA 4R4JA 1YBVA 3KVOA 2Y0CA 4ZRMA 2DVMA 3R3SA 4GWKA 2NVUA 3LU1A 5TIIA 1GUZA 2F1KA 2DC1A 4D45A 3VAZA 6LDHA 5L3ZA 2EP5A 2Q2VA 2WTBA 4L4XA 4WLUA 2NU6A 4O59O 4RPLA 5DBGA 5U1PA 3KTDA 2HUNA 1GADO 3GF4A 4Z9YA 5L45A 3WMWA 2ZJ1A 3D3WA 4G5HA 2Y1EA 4MDHA 1NQOA 4GX2A 3ZGYA 4R16A 1M67A 3VKVA 4IJUA 4INAA 2WWRA 1SB9A 3ZI0A 5KKCA 1GYPA 2PNFA 1Q7CA 4J43A 4GI2A 3CSDA 4D3DA 2B69A 3I4CA 4DPMA 1DRUA 4IIUA 5DP2A 2VUSA 3AI1A 3NT2A 1LSSA 1LRJA 4FCCA 2ZTVA 8LDHA 2GGSA 4LMRA 3U49A 5CPBA 4IDDA 1WDKA 4TZTA 2HO5A 1NASA 2C20A 4ZGWA 1QRRA 3I3OA 2PLAA 4EDFA 3SJ7A 3ZV4A 1P74A 4NFYA 3T4XA 1OAAA 4J0EA 5L95A 3Q11A 3PK0A 3WSWA 2ZIZA 2V6MA 2GN9A 1WAMA 5L4NA 4Z9FA 2J3JA 2IRWA 3M1AA 5JYDA 2ILTA 2IYPA 3KXDA 4OQYA 1PL7A 3C1AA 3NTOA 3DAFA 3TNLA 3ABIA 4AJIA 3OEYA 4CMAA 1PL6A 5B37A 4CLXA 4OXYA 2CD9A 1ISFA 2H63A 4GX0A 2X8LA 1KEVA 1GZ3A 1YOVA 2EW8A 5JDCC 4RPHA 4BO2A 2YQ5A 1E3EA 2AXQA 4I9HA 1OI7A 1A4IA 4WLFA 1P9LA 4F46A 3WOHA 2GASA 1HDCA 1T2AA 3VZQA 2FZWA 1DLJA 2NADA 3ANNA 4GKBA 3WGYA 3C7CB 5LCXA 3TFQA 3WXBA 2O4CA 3KYCA 4NU6A 1BVRA 2Y68A 1NP3A 3TOZA 2W2LD 3JYPA 3B1JA 3RASA 3G17A 2FR8A 2B83A 3HZZA 4J4BA 3P7MA 1QV6A 1Y9AA 4NJOA 4PG5A 2W2LA 1RM0A 3EDMA 5KJCA 2UDPA 2O3RA 2X0RA 5JXWA 1HDYA 2PR2A 1JAYA 4PLCA 1V3TA 3Q2IA 4QO8A 3GHYA 5HS4A 1L1FA 4U5QA 3HDHA 3WFJA 4DPLA 1LUAA 2JFHA 2O3SA 4HFRA 1NWCA 1P1KA 3CIFA 4OXKA 5HS6A 2QYTA 3PHIA 1IOLA 3LLVA 4YJGB 4E0BA 4FS3A 4A0SA 3O8QB 4LCEA 3BMNB 3OSUA 3DBRA 4II2A 4PLGA 3JQ8A 4J7UA 3FTNA 2FOIA 2NVBA 1WDMA 1U9JA 3HADA 3UGKA 3ORFA 4MPDA 4CMHA 5JMWA 1EDOA 5G0WA 2CFCA 1PZEA 2QX7A 4JXKA 2EWMA 3GVPA 3V1UA 4NMHA 1I3MA 3M1LA 3WG9A 4S3MA 5C5IA 3DC2A 4AJOA 4URFA 3I9OA 4B7XA 2DU8A 4IXWA 3NYWA 4NBTA 1BXGB 1BXKA 3WX0A 3AUTA 2DBVO 2Y0EA 3EY4A 3QVTA 4MKRA 4XDZA 5TSDA 3E9NA 3PIDA 3OMLA 5A06A 3IUPA 3WLFA 3H5AA 3I6IA 2IEDA 4DGSA 2X6TA 4J3FA 3NT4A 3N74A 4CQMD 4TVOA 1B26A 3PJEA 4ZICA 3OA0A 4HKTA 4NJMB 4FQ8A 2C2XA 4I9NA 1QKIA 4Z0TA 1ZW1A 1WPQA 3ENKA 4F3YA 2OBNA 3EHEA 4P4NA 2OXIA 1NQTA 1R0LA 2VRBA 1SEVA 3EW7A 3UKOA 4YT5A 1WMAA 4IDAA 2IE0A 4GLOA 4GSKA 1GEGA 1FDWA 1LA2A 3AJRA 2X1HA 3JYNA 2DTDA 4G65A 3S2IA 3DOJA 1X15A 4JNKA 1DHRA 1NWHA 3U4CA 3LC7O 3BTUA 5DCYA 1IY8A 3OA2A 4YPOA 2WD8A 1PGJA 3KOUA 1NQ5A 2EP7A 3C3XA 3NUGA 3D5TA 4CMIB 1BG6A 4I08A 4BNNA 5BQFA 4Z3KA 5KCZA 2FHSA 3NDIA 3GFBA 4QO7A 4FJ1A 2Q45A 2OZPA 4DIOA 1H94A 2B0JA 5AXAA 1KVSA 1CYDA 3OJEA 3UCEA 5LDHA 4CQLA 1LJ8A 4R68A 3RBZA 3WLEA 3SXPA 2CUKA 3L9XA 4GH5A 3PDJA 1QV7A 5HRUA 3F9IA 3KBOA 5BSHA 3ZWBA 4J1NA 5BR7A 3IC5A 4DLLA 3EAGA 1XLTA 1A9ZA 1Y8QA 5JDIA 4WCFA 3V5NA 2JCVA 2H5LA 2A35A 3KYBA 2BF7A 1BDBA 5JO9A 5L7TA 2WEKA 2EKLA 3N7UA 4RV9A 2X86A 4LSWA 1XWFA 2C5EA 3E6AA 3JYQA 1PQUA 3JSAA 4MVJH 4E5YA 1HYHA 4YBZA 3GG9A 1CRWG 1PS8A 3R0IA 4EJMA 1SCUA 5GZ6A 1LSOA 3JCZA 4EYEA 4QX6A 1PZFA 2NQ8A 3V2UA 3GVXA 1MB4A 5JPIA 3TZHA 3O26A 1UXKA 1I2ZA 1NR7A 1P1HA 2Q49A 3HDYA 2Q1SA 2DBQA 4MVJE 5G0VA 2SCUA 1O9BA 4KQWA 4UEJA 3RKUA 3WGIA 1HSOA 2OOSA 3DZFA 5IF3A 4YJDA 1PJ3A 3WIDA 2C59A 3OQ1A 3FR7A 1EK5A 5BNTA 3G49A 3B1KA 4RLHA 3KSDO 2DTEA 4ZRNA 1EE9A 1PGOA 1S6YA 1TT7A 3DB2A 2NVUB 4JJIA 1M75A 1YQDA 2DBZA 3L6OO 1ADFA 2X0NA 3L0DA 3WWYA 4E31A 2VTDA 1RM4A 5ITWA 1LC3A 4I5GA 5ER6A 4JJGA 1UUFA 3KO8A 4NI5A 4XZ3A 4EUFA 4S1VA 5I9MA 5I7VA 2ZYDA 5IN5A 3AFNA 4BO6A 1E6EA 3B1FA 2BGLA 1NHGA 1YB1A 3CZRA 3D3WB 4PIVA 5JAQA 2CDAA 1KEPA 4UUOA 2HMSA 4WPGA 2EG9A 4ZQFA 5C7IO 3BTVA 1XA0A 2Q2WA 3BMQB 3QQPA 5CDUA 2DLDA 2ZTUA 4ZN6A 1W8DA 5AOVA 3RUAA 2J3IA 3IIEA 4A27A 2O2SA 3A28A 4KDFA 3U4DA 3RUEA 3WBFA 3GNTA 2P9GA 3PVZA 3FBTA 3DZJA 2Q99A 3TQHA 4FGSA 4BNFA 3QVSA 4XGIA 2IYOA 3T7EA 2G82A 4K6FA 4K26A 1C0KA 4L75A 1U7HA 1BVUA 3M2PA 2W2KA 1TVEA 3R1IA 1XKQA 2C54A 5DNAA 1O95A 3NV9A 1HDGO 3F1LA 1EEHA 4RVUA 3ST7A 4YAEA 2OMEA 3WNQA 4EJ6A 4DQVA 3DWFA 4I5EA 2C7GA 1DDOA 3UXYA 1Q0QA 4R9SA 4R3WA 5JCJD 3W6ZA 3PTZA 3W4IA 4DQUA 3DMTC 3AFMA 4TROA 1W4ZA 3GZ4A 2AMFA 2E4AA 2X0IA 5JCJA 1B8PA 2CDCA 3PHGA 4J1SA 2BFOA 4E2YA 1PQPA 2PZJA 5GY7A 1YOVB 5JLAA 5L7YA 1LXCA 4GL4A 1GV1A 1E5QA 2DPHA 4FFRA 3SLGA 1NFQA 3QJ5A 1UDCA 3KYCB 3JQGA 4GAEA 1DB3A 3UFXA 2GN4A 2GO1A 4GBJA 1YXMA 1BGVA 3FF4A 4N54A 4IS2A 2DUUA 2W8ZA 1NVMB 2PGJA 1PQWA 2EXXA 3MJEA 2CVZA 4CM8A 1ISJA 3INGA 1D4FA 3IP3A 2ZTMA 4BKPA 3QW2A 1FF9A 4L74A 2VUTA 4B4VA 3ZWMA 2WM3A 3S2EA 3Q0EA 5A03A 3S2GA 2GYYA 4TQGA 4Q3BA 4PLZA 1C0IA 5KVQA 3FD8A 5L40A 1XU9A 1N7HA 2AEJA 3TL2A 5K6AC 2YDXA 3ZU5A 2J3KA 1H9AA 3H5NA 1QYCA 3PIIA 1UZMA 4RLSA 2VZ9A 2RH4A 4XEHA 3LK7A 1CJCA 3DBRB 1QP8A 4YACA 3ZZNA 1U2DA 4OAQA 5F1PA 1I36A 3E9MA 2PFGA 3JQ8B 3LF1A 3FNFA 4E2WA 4OOFA 4DLBA 2QIOA 2D59A 3DL2A 4ROSA 4W82A 5TS3A 2EIHA 1HDXA 4PG8A 3CZMA 2I3AA 4HFMA 5CDYA 4IGEA 3NEPX 4TRMA 1XU7A 2NM0A 5EMHA 4Z9XA 3HWRA 4BO5A 9LDTA 2AE1A 2AQIA 2RBEA 4PLFA 4XJTA 2P91A 5ER9A 4E12A 2WE7A 4ND2A 4Q39A 4GSLA 2AHRA 5JAMA 2Q1UA 3OBBA 1PWXA 1P45A 4A2CA 1DO8A 1Y6JA 3SX2A 3CMCO 5A05A 1QXSA 1FDVA 4NK4A 4PVCA 1O0SA 3DZHA 4H16A 1X0XA 3PWZA 1MXFA 3W8FA 3ZV5A 5KNLA 1U5AA 3GK3A 3JQBC 1EFKA 1ZVMA 4M55A 4KTTE 2P5YA 1D8AA 1Q7BA 5G4KA 5EN4A 2GZ3A 5JE8A 2PGLA 1UH5A 3HB5X 3QP9A 3QVOA 2PWZA 4XQ9A 1Y5MA 3OICA 5DBFA 4CM3A 1YQGA 5I9NA 2AQKA 4PLPA 4JP3A 1A27A 3IDSA 3C1TA 3GPIA 3H8VA 3AUSA 3QA9A 2P9CA 4WGGA 3A9WA 3LSYA 4Y6PA 2QRLA 2VQ3A 3LC1O 3IJPA 3W4KA 5C3MA 3ZNQA 4HY3A 4PRLA 4CQLB 4IINA 2BELA 2V6BA 4WKGA 4DLAA 3CKYA 4YQZA 3AOEC 1QLJA 3UN1A 3MTGA 1UDBA 4MVJI 3DXFA 1T24A 1H9BA 4CMBA 1AXEA 2AQHA 1GU7A 2D3TA 1DC4A 4ND1A 3BTOA 1Y8QB 3OJ0A 3PHHA 4WCFB 3ZN2A 4PLTA 1TB4A 2EERA 3L07A 4IJWA 1YL6A 1T1SA 1YB5A 1F06A 1HLPA 3JYLA 1NBOA 4GWGA 3MJCA 3ZV6A 3AI2A 2HRBA 3HFGA 3EK2A 4E30A 1W6UA 3GUYA 4Q3NA 2AQ8A 4B4WA 2XPCA 2HJSA 1GZ6A 3H9JA 4R1NA 1WZIA 3HG7A 2IZ1A 1X7HA 4H15A 1GCOA 4BUCA 1W73A 3ZW9A 1ZFNA 1HL3A 3KEOA 2JHFA 2YFQA 4HXYA 1YE3A 1IL0A 1I2BA 1LDBA 4ALMA 4R51A 5A9SA 3K92A 1VL0A 4XRRA 3ASVA 4NQZA 2HCTA 2A9FA 3I83A 3OJOA 1PGQA 4NG5A 1FDSA 3RJ5A 1GV0A 1SOWA 3FR8A 3Q2KA 1FDUA 4FSHA 2ZB4A 1BHSA 1GUFA 2NTJA 5C7OO 2D5CA 2LDXA 1NXQA 1RM5A 3O9ZA 2X9GA 1GTMA 4CM6A 3WJAA 4GVLA 3GZNB 1I3LA 4CM1A 4MVJP 4OXNA 8ADHA 3N58A 2X7HA 4YB8A 5L53A 4BNLA 1DC5A 5LDGA 5DT9A 4FJ0A 5CFZA 1XDWA 4D46A 3BIOA 3E9QA 1E1NA 2VWGA 3W1VA 3WTCA 4CM4A 3HJAA 1GQQA 1I5RA 2WE8A 3ZWYA 1T2DA 4AG3A 5BSFA 1HDRA 1VSVA 4B4UA 4CPDA 1B7GO 4PG4A 3P2OA 2DTXA 2C2YA 1H6CA 1Q7GA 4D79A 2C29D 4ND4A 3DOCA 3OHSX 4M8SA 4BNHA 4BMVA 2Y1CA 2BFMA 2BHLA 1ARZA 3ETEA 4CR6A 1E1LA 1KVRA 1VM6A 5HTOA 3RFVA 1ZEMA 3I5MA 1C1XA 5FI3A 2OGUA 2RHRA 4D3FA 2LDBA 4C7KA 5U4QA 3NJ4A 1HRDA 2W2KB 3GPDG 4HADA 3UCFA 4BB6A 2QW8A 1N7GA 4XDYA 2XF8A 4DYDA 4J7XA 4Y9DA 1HTBA 4BNWA 3X2EA 3KYDA 2GZ1A 2HMVA 4JX8A 4DREA 4HWKA 1MGOA 4XYEA 5GZ3A 3C7DB 5CDTA 2JAPA 3AM5A 4QFDA 1Y81A 2D0IA 5TC4A 3PQFA 1HYEA 1E7MA 4N18A 1I3KA 1YKFA 4CM9D 3TSCA 1GAEO 2IZ0A 1O94A 5GMOA 1DLIA 1VPDA 2CNBA 2QHXA 2YYYA 3SLKA 4OQZA 5BT9A 3VH2A 4E5MA 1E6WA 4O6VA 5KVSA 4HNHA 1HLDA 3VOSA 1NHWA 2JHGA 5ENVA 1FMCA 1R4NA 3GHHA 1Z73A 4WECA 4C7JA 1K2WA 4KUEA 4GX1A 5BNFA 2P2SA 3AY3A 1VL8A 2B5WA 3JQGB 4CM7A 2PH5A 3TZQA 1Y7TA 1R4MA 5IXSA 4H3VA 1L7DA 2HK8A 3ROMA 4DBZA 2H9IA 1KEWA 4YJFA 2D5AA 4M89A 1DAOA 3ZNPA 4BKUA 1IPFA 2FWMX 5I7EA 3KUXA 2JJYA 4CM8B 4HV4A 2D4AA 3WYBA 1I32A 3ZWNA 5DCUA 1X0VA 2HK9A 4ZHSA 1QYDA 1ZO8A 3WICA 2DFDA 5CG2A 3QE3A 1NPTO 3QWBA 1OC4A 4DWVA 5I7FA 4N5MA 2FP4A 5CPFA 3SC4A 4MO2A 3WYEA 2D8AA 2Y1GA 4Z0HO 2HU2A 1UZLA 3GVCA 3DAPA 2W4QA 1F17A 1H6AA 4UUNA 1SPXA 4IDEA 1IB6A 4CLRA 1UXIA 5JSFA 5EQFA 3RC9A 2BLLA 2PGDA 1ADBA 4QT0A 3LYLA 2C0CA 5T5QA 2POQX 3EUWA 4MOWA 3RUHA 3WBBA 3F47A 3PHLA 1IE3A 1T1RA 2NU7A 3B6ZA 2G0TA 3DZIA 1MXHA 4FOOA 3KEQA 3DOOA 4YA6A 4NBUA 2XAAA 3RBVA 3D5QA 2O7SA 5HA5A 1SC6A 3DBLA 4OO3A 1KVUA 4JBIA 4U7WA 4BGIA 3PXXA 5U9CA 1W0CA 4YDRA 5H83A 2HK7A 5C37A 5I9LA 3ZWAA 4UVEA 3GEMA 1YONA 2QG4A 3FI9A 3VVCA 5ITVA 2C7VA 3C1OA 4B3JA 1JW9B 2Q1WA 1R0SA 5GZ1A 3IAHA 4Q3AA 1MLDA 3CTMA 2V7PA 4DMLA 4J4HA 3LDHA 3K30A 1GYQA 3K6JA 5B4VA 4TSKA 1Y8RA 4EJ0A 2P5UA 1M66A 4CV2A 5JY1A 1X13A 1E7WA 3VH3A 5KJFA 2O3UA 1C0LA 3PYMA 1SOVA 4R54A 2ZKLA 1P1FA 1T4DA 5G4KB 4EUEA 4DQXA 1WZEA 1VLLA 3MWDB 3DMYA 5AQ1A 1CDOA 1WXDA 4EW6A 1A4UA 3TN7A 3W6UA 3MJVA 3ZWCA 5JO0A 1NFRA 3EZLA 4FC7A 3SVTA 4YCAA 2JFFA 4Z6KA 5HBRA 3U3XA 4J4TA 4PZEA 4YJHA 2WYWA 3O4RA 4Y6SA 3MWEB 4Y8VA 4KP7A 4XB2A 3RUCA 3UAGA 3P5SA 3QVWA 4FFMA 1YWGO 3BHIA 5DN9A 3DO5A 3ZH2A 1PGNA 2Q46A 1MG5A 3FWZA 2QRJA 4ONEA 5KKAA 3GFGA 1PGPA 2IXBA 4J2OA 4CJXA 2FZEA 1J49A 3WDSA 3CINA 1YL7A 3OJLA 3RUFA 1ENZA 1U3TA 3GN1A 4LCJA 1GZ4A 3ZWOA 3D0OA 4A5OA 4OH1A 2DQ4A 1U4SA 4AJKA 1UJMA 1GQ2A 4DA9A 4NH4A 4BIIA 4R5MA 2I3GA 3OQBA 2JD0A 2P68A 1KEUA 1V3UA 3E8XA 4IQGA 3FHLA 1PL8A 3GDGA 1R37A 1ZKMA 4FN4A 1UXGA 1QR6A 1Q2XA 2PKQP 4I5FA 4W7HA 2WDZA 3ZHZA 1H6DA 1PJBA 4BNGA 3CXRA 5A4DA 1EK6A 3ZHBA 4UREA 1LRKA 2BKAA 5K6AA 3K8ZA 1B3BA 3LC2O 1LDGA 4XYMA 2X23A 1JWBB 3KSZO 5A9SB 3PHJA 3Q9UA 5CG1A 3FN4A 4NU5A 5ENDA 3L6EA 1B3RA 1HWYA 1CEQA 2VHVA 1KY5A 1PEDA 5COQA 5KVVA 1ZJYA 2V65A 3JQFC 1XR3A 4E5KA 4CQMA 1TLTA 1LU9A 4JCOA 2OP1A 4O1MA 1XEAA 1HE3A 2EW2A 1CQJA 3JV7A 4PN3A 3WTBA 3U9LA 4BKQA 1NPDA 4M1QA 1LDMA 1Z74A 4NNJA 2UUOA 4EBFA 1HE4A 1ZK2A 1DBVO 1E7SA 4O5OA 4Q9NA 1EBFA 1LTHR 4CM4B 2VTEA 2BI8A 1T2CA 3MTJA 3OIFA 4P4LA 1E3JA 1DC3A 3GH3A 2V6FA 2Y1OA 3H9UA 4WNCA 2RIRA 2YW9A 2YDYA 1TXGA 4HNGA 1WMBA 4TMFA 3RUIA 4IUYA 4WEQA 2GZ2A 1I24A 4J9UE 4N7RA 4FB5A 4EZBA 1LI4A 4LRSB 3ZV3A 1F0YA 3FPCA 1ZNQO 1ISIA 4DIFA 5A9TA 4DXHA 4E4YA 5CEJA 3WGQA 5EIOA 1DFGA 4TWRA 1BRMA 1DXYA 4RF2A 3ITDA 4CMKA 3ZU4A 4AJEA 5HM8A 1B2LA 3IUSA 1YDWA 3KYDB 2Q3EA 4OKNA 5IG2A 1H2HA 2GCGA 3DHEA 1M76A 3GEGA 1AE1A 3FTPA 3OP4A 3L4BC 5AXDA 3GRPA 2AW5A 5F1KA 1A5ZA 3E5RA 2FPPA 3F4LA 2YZ7A 4KMSA 3S1LA 1ZSYA 4H7PA 1P1JA 4E2XA 3HFSA 3AOEA 2DAPA 1UDAA 1SAYA 4GVXA 2Y0DA 3RCBA 4E21A 1R4NB 5C7LO 4RVFA 1EUCA 2EJVA 2H6EA 2BGKA 1P3DA 5AVOA 1C0PA 2PA3A 1LDNA 2Y1FA 2YHIA 3MJTA 1R4MB 4WLVA 4P38A 3ZWVA 2Y66A 4D41A 4LRTB 3GC6A 3ONDA 4YJFB 4J9VA 4CLDA 4NIMA 1UXHA 3MOIA 1UP6A 1HZJA 3AU9A 4EUHA 1N1GA 1EUZA 3ANMA 3WIEA 3HDJA 1OC2A 1WLYA 1VRWA 4FR5A 4C4OA 1E77A 1XSEA 2VUUA 4JLWA 3D1LA 4XIJA 4W6ZA 3GVIA 3FNEA 4L0QA 4CMGA 5FEUA 2YUTA 4PFJA 4KZPA 2DT5A 2BFPA 1AUPA 1U28A 4RF4A 5F5LA 3R6DA 4CUZA 1XGKA 3KHUA 1VJ0A 2PH3A 3G0OA 1KC3A 3L77A 1Y5RA 4CLRB 4WK6A 3VZSA 4UUMA 3B70A 4BMSA 1P1IA 1SO8A 4L8VA 3L4SO 1A71A 3JD1A 1EBUA 2EKQA 4PLWA 1QYWA 4RQTA 2NUAA 3NKLA 3OEWA 4OYRA 4KUHA 3EMKA 4P4GA 3PQDA 5EQDA 2VYND 4FDAA 4OOEA 1MFPA 4AJ1A 5T64A 1EVJA 3DBLB 1JVSA 3AI3A 1RJWA 1I0ZA 2VYNA 4BO1A 1TT5A 4MKZA 1LSUA 1U4OA 4E33A 3H5RA 5IZCC 1LLCA 3GRKA 4O63O 4K9DA 4CR8A 4WLNA 2PZMA 2B36A 4PGFA 3LQFA 4FFPA 1GL3A 2HQ1A 1U8XX 1X1TA 1CQIA 1DIBA 1WNTA 4ILKA 4E6PA 4LK3A 5FI5A 5I7SA 3NX4A 1TA4A 6ADHA 1ZK0A 3RD5A 1Y8RB 4U0KA 1R15A 4FC6A 4D44A 1K0UA 2PKQO 5EESA 1R6DA 1LLUA 5G2OA 3WGHA 3EZYA 3B20A 3LLSA 2JAHA 3GEDA 1VJ1A 3GQVA 2QZZA 2X22A 4IZHA 4DIBA 1A7KA 2GRAA 3JD0A 2QQ5A 4CLHA 2WSBA 1EVIA 2VHXA 3TZKA 3WGOA 5BNIA 1Q0HA 2VT2A 2AA3A 1MUUA 4IQ8A 1Z7BA 1IYZA 3GOHA 3RFTA 3RROA 3U62A 4AJHA 1BSVA 3F5QA 5F1OA 4R1UA 1MA0A 1Q1NA 1PZHA 1N9GA 1I3NA 3JQ7A 4L73A 3F5SA 3V8BA 5COBA 5A3VA 1C3VA 2WYVA 4AJLA 3PGJA 3D7LA 1DIGA 2X58A 3I9MA 4XB1A 1YJ8A 4W9NC 1JA9A 3LZ6A 1BMDA 1I33A 3R3JA 1H2BA 4D3SA 3C8MA 4RVDA 3FWNA 1LDYA 4HUJA 4MVJF 3CH6A 4J90A 1ZXLA 3MOGA 4N5NA 1G0NA 2UYYA 3GAZA 4RORA 2ZYAA 2I99A 3BZUA 3DHNA 1YO6A 4XKJA 3DFUA 5COAA 3DBHA 5ES3A 5T67A 4B8WA 4KWIA 1CWUA 4ZJUA 1IULA 1KVTA 2PK3A 3BHJA 1LDEA 1VC2A 5TJHA 3I1JA 1PTJA 1IZ9A 4B79A 4AJJA 2Z1MA 3DR3A 4KDEA 4R5HA 1UR5A 5G0UA 1GCUA 1KIFA 4R1SA 2PD6A 4MVJD 3KB6A 4OSOA 3M2TA 2WJPA 1GYRA 1HZZA 3KSUA 1C14A 1JU9A 1PJLA 3U4HA 2OP0A 2EKPA 4AJPA 2PZKA 4MVJA 4W7IA 4JJFA 1I8TA 1O89A 3IQDB 2Z95A 4O0LA 4BNXA 1G0OA 1DHTA 3AM4A 3C7AA 2EV9A 2V6GA 4CQMB 2VT3A 2HLPA 4M54A 2Q50A 3LF2A 4TRNA 2E49A 2VNSA 4PLVA 1ZBQA 3ICCA 2E82A 4ND3A 4ALNA 2DBRA 1O6ZA 3H2ZA 4GPD1 1SNYA 1P1RA 4BO7A 1XG5A 3RC7A 1LEHA 2YFHA 4RPJA 4BNZA 4BNKA 4U0JA 3EC7A 3OQ6A 1WDLA 2XXBA 4IY1A 4XR9A 3Q3CA 1E0DA 2W98A 4LISA 3AK4A 4MJLA 2UV8A 1Y1PA 5ICMA 1E7QA 3AU8A 3K96A 4Y67A 5A5EA 1DC6A 1I30A 1GD1O 4WASA 1HE2A 1YBAA 2OUIA 2X5JO 1YS4A 3PYLA 4LW8A 1PJTA 5JDCA 1EDZA 1ENYA 3HHPA 1U2GA 3WFIA 4BO9A 3OJFA 3TL3A 2GN6A 1GEEA 4DMMA 4TRJA 1ZEJA 1MC5A 5A02A 3QY9A 2VNAA 4LN1A 5BSEA 5ICSA 3NGXA 2ZB7A 2AG5A 2C07A 3OETA 1HDOA 4IQ0A 1AN9A 4K1LA 4CV1A 4L76A 1NTOA 1E3WA 1VKNA 3OIGA 4QXMA 2O3JA 1ISGA 4MP3A 4NPCA 3ZU2A 2NQTA 1P44A 3BA1A 4LMPA 1SMKA 3KETA 2GDZA 1ID1A 2Q4EA 1F14A 2IODA 3H3JA 5DCWA 3TF5A 4QQRA 2NSDA 2WYUA 3ON5A 1HDZA 4XYGA 5THKA 1F12A 3F6YA 1ZK1A 1ZMOA 4HFJA 2A4KA 1NQAO 1V3VA 3PGXA 4WCDA 4NHEA 3ONFA 4YT4A 3HN7A 1U7TA 1NM5A 3HSKA 2CMDA 7ADHA 2J5KA 2JKVA 5DBIA 3CEAA
chains in the Genus database with same CATH superfamily
1YB7A 2DFLA 3D0QA 1LWNA 3O8QA 4LYGA 4PEVA 4RKQA 2HXYA 3ZWQA 4EB6A 2VJDA 2VXCA 1TVCA 4JROA 4YUYA 2BFNA 5KTNA 3H1EA 4XCXA 1DKLA 4UMEA 3G5LA 1T2FA 1P77A 4RS4A 2PL5A 4ZT7A 3B36A 1P4SA 1EUCB 4ZP1A 3A31A 3QOWA 3QU9A 4Y3UA 1NYRA 4Y7CA 4JUIA 1BKSB 3NR2A 1TM3E 1OVMA 2E1PA 3NETA 4YK7A 3E53A 3DDWA 3O8LA 4KWHA 1QUFA 3H1FA 3KSMA 4JQYA 4JEUA 2Z6UA 5DH9A 3Q7SA 2J85A 4Q34A 1F2VA 1XYGA 2FPKA 2WZBA 3I8XA 4HGPA 3W34A 2JATA 1L4EA 2RHBA 4MQFB 1DKMA 3GJXC 4OLHA 4DCVA 1CRPA 2OHFA 4TV9B 4IRXA 4NE9A 4EA6A 5JC1A 2B94A 2DECA 4G24A 1OX4A 1ZUNA 5E9WA 1P6QA 4LHVA 3WL8A 3MZ0A 1QH1A 5LBIA 4D4KA 4AY2A 1JYFA 1ZVVA 2CL7X 1QHXA 1RHJA 1V9SA 3BEOA 5G02A 2WTEA 2V7QA 1ESDA 1XFAA 4KJXA 4EAAA 4G5FA 3D4OA 2ISQA 4G0QA 4QPPA 4REQA 4TKVB 2AT1A 2XUFA 3NPMA 1JPJA 1Y0BA 4JJ7A 3SC2A 3EQ8A 1OU4A 3JZFA 3AW9A 2XA1A 1EGVB 3QIVA 5SZHB 5I01A 3GJ7A 1ULUA 2P9HA 4YAIA 2RGGA 3D4NA 3DDZX 5I5EA 5DK6A 4Q48A 1NDUA 4CIBA 2GYVA 1ZN9A 1USUA 2IUSA 2EBHX 4OG2A 1MEEA 4EW2A 1S4QA 1V35A 4HMPA 4QDKA 1GPAA 1H8ED 4RQUA 1PFGA 1XVAA 4ZDWA 3G85A 4YRAA 1OAOC 2D74A 2BH9A 1KY4A 4RNDB 2E21A 3GUHA 1NKSA 4JC4A 4B3IA 4ED9A 4ALJA 3ZXXA 4DF3A 1H8EA 2IIVA 4DWJA 3G9XA 3DB1A 1PS9A 2HKIA 1SQSA 2V0CA 3EZ9A 5HQTA 3PCRB 4I99A 5F9HA 1I6LA 3G2NA 5FYDA 3RTEA 1U5BB 4FDLA 1FRNA 4AJ2A 2VVTA 5GQSA 4FXOA 1YASA 3IH5A 1VBNA 1D6NA 1DJQA 1VHQA 2H4WA 3DTTA 3H4MA 3D6TB 1VQ1A 2PBZA 3I9V1 3KT0A 3K2QA 4V0NA 2X9QA 2OVFA 3GLHE 3QWFA 4Q4JA 2O1SA 3Q15C 2EZTA 5L3RA 4L8FA 4I6GA 1WUHS 1BXRB 2AZ4A 1YQXA 3NBAA 3DL4A 3OLQA 4CM9A 1DEOA 5G53C 2Q1XA 2PZEA 4N8DA 2I9PA 4INJA 1PJSA 3SBOA 2W8BA 1EXNA 5E7MA 3UGQA 2K5UA 3HRHA 4ZVPA 2JLBA 2P90A 1FJHA 2HX1A 4D42A 3QLEA 3PKJA 3PB3A 4HCJA 3UJNA 3UB4A 2VN8A 1JKIA 3F7MA 3VYUB 1FW8A 4UVHA 4ZARA 4M87A 4YY3B 1HE5A 4R1TA 4ND7A 2OWDA 4OUDB 1KI3A 2HRRA 4IOLA 3IKLA 5I3CA 3L4BA 4NV1A 3SQXA 4AO7A 2FEKA 3I53A 2VP5A 4AICA 3ZCPA 2PYZA 4RJJA 4ZVRA 2O8FB 4ZU1X 3AF6A 3DQPA 1GY8A 3HCDA 4PC2A 1LTQA 4NBVA 4P7GA 4W5RA 2IH5A 4G5QA 4X63A 1A7JA 4GP7A 4YEDA 1S1MA 3FAKA 5FLKA 2GCNA 4LF6B 1AK1A 5G0SA 1PNOA 5IVPA 1VB3A 2JGNA 5HIMA 5G41A 3WHKA 4MVXA 4LDRA 4PQRA 3SJBA 3O5AA 2M2IA 2N46A 4FU0A 4RVCA 5EXDA 2PT9A 2O5RA 3EPPA 4S1NA 5D00A 4ZU6X 3UG7A 3PQ5A 1K06A 1R18A 4YRJA 4FGWA 5ALPA 3R7AA 1PFVA 1E2MA 3FRJA 1QU2A 3L79A 4G84A 3RLFA 4EYGA 2LTAA 3H2JA 2PSSA 2G0NA 4WDQA 1TVMA 3MEQA 3PLRA 4XQGA 1NVXQ 5IUJC 3K9QO 3SVLA 4BNIA 3P9IA 4NDAA 4OHUA 1E1RD 3J81A 2X8AA 4ZVVA 4MR9A 4BO4A 4F1JA 2VUIB 1CB0A 4AFNA 5ADHA 2FSSA 1E3SA 2XDYA 1QQBA 2EKBA 3VKUA 3EA5A 5A4AA 3RGGA 3PPWA 3JAWB 4RDCA 5CNMA 4QOGA 5TQ0B 2YJNA 5FF9A 1E1RA 2GS9A 2CXQA 4BP3A 3ACBA 2A30A 1EVYA 1KNQA 5TLSA 1WL8A 2ZJ5A 2OFFA 4BHTA 3EBOA 5CDGA 1YH3A 3CWZA 1ZIOA 1DRWA 3DFZA 3USZA 2JCYA 3COJA 3CF0A 4L7VA 4M21A 3ZCXA 4YQEA 5CB8A 3LC0A 4BB5A 5EL0A 8GPBA 2A86A 2BFCB 1J5EB 1UPUA 5CVJA 3ZR4B 1M2WA 1TUGA 2GF2A 2W5UA 4UVDA 5ULLA 4K6MA 2ZK7A 1ZZGA 4LPKA 4ZV9A 4PYOA 2P4QA 1KL7A 2IELA 3UC9A 5JJIA 3VUFA 2I4LA 2Y99A 3K31A 1P0MA 2QTWB 3LM8A 1R12A 4B84A 5HX7A 3L7AA 1GN8A 5CYOA 4WK0B 1EMDA 5GM2A 4BASA 1WBDA 5TT0A 4NAUA 4UD2A 3F3SA 5KYXB 2FSVA 4Y0VA 1A5AB 4JQCA 1LBEA 3GXOA 3ZY3A 5DF1A 4D4LA 1DDIA 3VTKA 1XMJA 3ICOA 3LP8A 1S9HA 4U1RA 3WBJA 2H7VA 3KRTA 3OOHA 4FFNA 4KXYA 4BFTA 2VYVD 1KMCA 2VHEA 1W48A 4MLCA 5F98A 5AVQA 3BAZA 5MDHA 4JZYA 4QBGB 4Q7JB 1H0HA 2H16A 1AH2A 2O2HA 1DOZA 1RD4A 1ULAA 3I5AA 3M3HA 3NHJA 2VYVA 1KZ9A 3LPAA 5BSMA 4B34A 4B9EA 4CMJA 1N8KA 1DC7A 4Q1DA 1J07A 3MIIA 3WOVA 4JOCA 4WY5A 4OSPA 1SBQA 3TM5A 5BN4A 5IDXA 2VHWA 2HMYB 4U2FA 2H1HA 3V7FA 1ZKDA 1YZ3A 4HDNA 3L6UA 3GJ4A 3V4VB 2NSJA 1JLKA 2YJ6A 2PXCA 1Z6YA 3QKIA 4OH7A 3KWJA 3SFTA 4EB3A 2IVZA 3WC4A 1C81A 2XVMA 4GX5A 4NJEB 5GM1A 3ER6A 4LE2A 4YDHB 4Z4FA 1SD1A 2GT1A 4DBLE 3OPNA 5TVKA 4KPUA 1JFRA 3WAJA 3NHMA 4U3JA 1QTRA 2G8LA 4KW7A 4TTQA 3RTAA 2CNOA 1B15A 3E3LA 3U3JA 3A2KA 5IYZB 5CX1A 3TYXA 4HQKA 4M9RA 2HQBA 2IUFA 1XZAA 5KWEA 3OX1A 1VP9A 1TAGA 1YK0A 2GJSA 2OO5A 2VJMA 1ZJJA 4IIEA 3VYWA 3PC4A 4M86A 4D82A 4F04A 3U26A 5C3UA 2Q27A 2JIOA 4X1OA 3AEYA 5ERYA 1ZXBA 2VK8A 3I52A 4F11A 2FSGA 3SGLA 3OQIB 3JS5A 1G38A 2HMWA 7MHTA 3KPYA 3WGZA 4RTPA 1KWGA 3AHFA 4F9EA 1WE2A 3WYCA 2R11A 4BGUA 2HRZA 1B0UA 1X8JA 3CLUC 4JY7A 1QC5A 2HPVA 2R00C 4EB6B 3MCWA 1N2EA 3E15A 4V3CA 4C4PA 3I23A 4CFYA 1Z6QA 2V9CA 2JBAA 2QIPA 3GV0A 1VJGA 1YR3A 2FVXA 1XDSA 2ZIVB 3FCUB 2FOLA 3HVHA 1X2EA 2YV5A 3DMGA 1ZP6A 4I1OA 4RZIA 5EKDA 4W1PA 4YJ2A 3ZWKA 1RI3A 1RLMA 2F67A 2LCIA 3IEXA 1MC4A 1QLHA 4M0KA 1JTVA 3PYXA 4DUPA 2Z57A 1NVTA 3LQ2A 4OHCA 3UT6A 3E03A 2AF4C 1MDBA 1OCEA 1KYYA 2OZVA 5B7QA 1MB9A 1XQ6A 1Z4QA 3HB1A 4UE6A 5FL7D 1E3DA 4ETIA 3GT4A 3VR2D 4YMUA 3W5BA 3PEWA 5HDBB 4EAQA 2IV2X 2FFQA 1S3FA 2WWXA 2X6RA 3KKEA 2XZPA 1CJKC 5FL7A 4QU5A 5INTA 2FKNA 3GDOA 1LPPA 3JQAD 4PFQA 3VR2A 1ORIA 2WG1A 5K99A 1V1JA 4ZU3A 3WJ7A 2HBQA 3FSJX 1ZUNB 4BGVA 2ODWA 3ZWXA 4JC0A 4XGRA 1JAXA 2WF5A 3JQAA 2QX9A 1YR6A 4CV0A 1QH1B 3CVOA 1QMGA 3EQ7A 3HCCA 4R41A 1VYTA 3T1YB 2E7ZA 3IVMA 1CJVC 1JE1A 3IUJA 5DX8A 4TKZA 2H5JA 1SIOA 2NO1A 2VDWA 1N5MA 1M1YA 3NVDA 4RMNA 4REQB 4YR9A 1DWQA 5EFZA 1AO3A 3U7IA 2FJPA 5C8ZA 5IZ4A 4MA5A 3WXMA 4I5DA 4Z7JA 2XEXA 2OBFA 1WCWA 2GK6A 2Z1NA 1P4GA 3FRIA 2VK1A 1LPBB 3GG2A 2DHRA 3BRCA 4GVPA 4TSFD 4KGZA 1DX4A 3JVVA 1P2GA 4OYHA 2IXTA 1RQRA 1ST2A 1EUYA 5IXJA 1AUVA 2F43A 2PWYA 3C3YA 3DDHA 5EE3A 4BJ1A 2YVLA 1XTUA 5FFMA 5LP6F 2EGHA 5D6NA 2DHCA 4Y2XA 3HJRA 4BQRA 2F8MA 4E3ZA 1DG1G 3OFND 4OFZA 4RZQA 4D3SA 3OM9A 4PZDA 3OTQA 4PZ0A 4ECAA 5HZHA 2Q0HA 1JIJA 3JD4A 3ROTA 3BWMA 3OWHA 4XIFA 6REQA 4XR4A 1R0KA 3BRSA 1T2NA 1IHOA 5CYGA 2Y1WA 2DM6A 3N2EA 3OFNA 1AK9A 1E2JA 4WZZA 3V1NA 2LIPA 5JR3A 5FLYA 1JAIA 1E1DA 4IDCA 3E9RA 4CUKA 3PUHA 5K05A 1XZHA 3VTAA 3IPLA 3T7CA 1G7CA 2VP4A 4DR7B 5CEFA 5AW1A 3NIFB 4G37A 4DM3A 3N05A 1F8UA 1UMDA 1RS0A 3AZOA 1H3EA 1G1MA 1X1SA 3UWDA 3U4QA 2Z9CA 2JFBA 2GF9A 1Z16A 2NNWB 3DOUA 1N9ZA 2JL1A 3O73A 2REQA 1Z15A 3C5WP 3DZGA 2CC2A 2IU6A 2ASVA 2X41A 4RMHA 3RC2A 2XCUA 3RDPA 1XAHA 2ECOA 2GAIA 4IGAA 1G2OA 1V6AA 2XE4A 2V3CC 4BE7B 5JCZA 3CZPA 2CDBA 1DXOA 1OROA 1QGED 1QFSA 1Q7RA 2ZYTX 1KDRA 4L4UA 4YAOA 4F4HA 3L7LA 2QVGA 5DHQA 3S8YA 3H16A 1GA6A 4XFJA 4WRRA 2Q07A 2GMWA 3R7SA 3QEBZ 3PD0A 3ZNNA 4GR5A 3T5DA 2IOHA 4A03A 3FBGA 1NVDA 4L72A 1JG7A 3O4VA 1D0IA 1RI5A 2CY0A 4OGGA 3TS1A 3W1WA 4HXGA 3CU5A 3H65A 3ZY2A 1RKXA 3ZI7A 1VKOA 1XC7A 2CW5A 4TL8A 3W3AH 3NBUA 3ITKA 1SQ6A 5HGXA 2DWPA 4UPVA 2OK7A 3U4GA 5J4YA 2PLRA 2WUFA 1G20E 1FYEA 4Y2HA 4JBGA 1J8QA 1L8XA 3R74A 5EWJA 3C39A 1NF8A 2DG2A 5F9FA 4QXAA 3LUHA 5BWOA 4TN1A 4CG1A 1IQUA 1FBNA 3WB9A 2JLSA 4DC0A 4GQIA 1RPNA 5AK4A 1SBYA 1O8CA 3AY6A 4BFVA 2X9VA 2OORA 4WUVA 5CLFA 3NZEA 3NYIA 1K6IA 4RL6A 3GLIB 3DFIA 5LQRA 3MJ4A 4DMKA 2FN9A 3GBVA 4MV4A 1IMJA 2QAGA 3ETHA 1BFKA 2QA5A 4QBHA 3QBJA 1W29A 5FR2A 2V1XA 5LZ2A 1YZNA 4KLAA 3LQRA 4C29A 3KFLA 3COZA 1JR6A 2RH8A 5T6MA 1ACLA 4LHEA 4QE3A 5TGTA 1ENPA 3T3MB 3SWWA 1ZVJA 4LXYA 4MPJA 5FUQA 3R8XA 2P9EA 5KZMB 4XASA 3PDIA 1OYYA 3OE1A 1W87A 3C98A 4MLZA 4JEHA 3HE3A 1YRLA 5K2OA 1Q0TA 1XD8A 4KITB 2D00A 4Q9IA 1ACMA 2AOUA 4DQKA 4EFNA 3U7HB 1SVWA 1WOMA 2HF7A 2O2DA 4F6RA 2BYTA 1N2XA 3E5HA 1YDGA 4LEIA 4Z7QB 5EJ7A 3SLRA 4F3TA 5LU8A 3UMCA 2OV1A 5CCDA 3OP1A 4GPEA 1M7GA 4R40A 4D0RA 1CNFA 3B82A 3D6MA 1MHPA 5LQJA 3V00A 1CZOA 4HX9A 3HI4A 4CM3A 3BDVA 1EH5A 4PNPA 3JU3A 5K8VA 1KBZA 3HXMA 5JAOA 1J20A 3AEQA 1Y8AA 2H2WA 1QCCA 1OGYA 3V34A 4A10A 2VCYA 1MAAA 4LXTA 1JFFA 4JH0A 4ALKA 2Z09A 3W90A 4OHVA 3BYZA 1UPCA 2YV1A 4F45A 3HVRA 2XUHA 2WT9A 2JIDA 1EA7A 2J6IA 1N6HA 5DULA 4E13A 2WVGA 5DIFA 2OAP1 3HP4A 5T57A 4ZYTA 3GMDA 3WSVA 5JH7F 3P96A 1CEXA 1L4LA 4M8NE 4RMJA 3U09A 4RKWA 3TLYA 3Q9SA 4C78A 1RYDA 1J5PA 1P0CA 2PZGA 3EXEA 1OIWA 1P73A 5BN4B 4DJDC 3W5DA 4YJHB 3I42A 3A6JA 2CUZA 4HDNB 2WRZA 5H82A 4EKDA 3K0FA 4X6YA 1BJRE 2O2ZA 5JZBA 4PPYA 4HX5A 4FW8A 4BJHB 4K5QA 3TFOA 2XA9A 3ET4A 4P3OA 4XD2A 1L8LA 5E3HA 4ACBA 3WMXA 2EFEB 1P1CA 1II9A 2IZ5A 4KPUB 2OHIA 2ZPUA 2HR1A 2ZSJA 3ENZA 4ZAWA 5FR1A 1EG7A 1TKRA 2GPSA 4ARSA 4U3JB 4KIJA 1H3NA 3JQ6A 4KVAA 1A9OA 1EWRA 3ANLA 5DLQC 1KOJA 1M34B 1H5UA 1NI4A 5CX1B 1II8B 2CKDA 3FI0A 5TPZD 5AW4A 2VJOA 5KWVA 1DPGA 1K8QA 3D02A 3L8YA 4IVRA 4J7CA 4BS9A 1YR8A 3ADPA 1ZHHA 2VJMB 5D7NA 2RHJA 4ZOLF 4YYZA 5LU9A 3OPXA 4TV8F 5ABPA 4OIMA 1PG2A 1X3SA 3Q8KA 3ZLTA 3ZHYA 5JBIA 3UWSA 2RAFA 1RXEA 4W1SA 5F51A 3RS2A 3C7TA 1XDBA 2RH9B 1JSZA 2Y2VA 2OV6A 1PUXA 4YUXA 1Z08A 1ZK3A 4YVFA 1DJNA 1DQNA 1AGNA 3D4PA 3S40A 1EJBA 1VLZA 3V1LA 4Y2SA 4NZZA 3HBLA 3LL4A 3H0KA 3KQPA 2PUTA 2VRCD 4YI3A 3A6DA 1GTVA 2W11A 2YXNA 4FYPA 1GA1A 1LVHA 3QWIA 4YJ2B 2I76A 1W36D 1U1IA 2GM9A 3DMRA 2VRCA 3REQA 3QI7A 1B0AA 4GR4A 2A9KA 3N1UA 4JYCA 5ILOA 1CUGA 1WW3A 1VKHA 1AQYA 5K4HA 1W25A 4EY3A 2ZQZA 3GL9A 3ONVA 1TCBA 4ZHQF 3ED1A 4H59A 1XRRA 3T5GA 3VH1A 5ALUA 5ALKA 3IERA 2VDLB 1WR8A 4QARA 2XECA 3IQXA 2UZIR 3G0HA 3DTYA 2X8WA 3I2KA 4QNRA 3LT2A 4GBED 4ACAA 2JAWA 1HLGA 4RD2A 3E23A 3BJRA 4KQCA 4NOJA 4FYKA 2BP7A 1N6LA 5DTJA 3AGPA 1CUFA 4DDHA 1RKQA 3PNQA 4J1QA 2YMMA 1GL7A 4A9AA 3F6SA 1FDOA 2AS0A 3JQAB 1HI9A 3PNMA 1N2OA 4IFIA 4JOSA 4Q02A 3WGJA 4AMZA 3REFA 2A94A 2BMFA 5KOJA 1BFDA 4YFVA 3M81A 4XSVA 4MIYA 1TCAA 3KOMA 5JNLA 4TZ6A 4LY9A 1A5SB 5FI0B 2ZYHA 1M1YB 2GAAA 2PXHA 4KK3A 4E5NA 4IIVA 5G1PA 1SVMA 4X3CA 5SYAA 3QELA 4DJTA 2IU3A 4DR1B 4HP8A 5EC8A 1DEHA 4B3TB 2BEWA 4DJEC 3GR6A 4KQEA 2FY8A 4M4SA 2R6JA 4DLUA 1ZMTA 2BOVA 1SELA 3OCVA 2GR9A 3LLUA 1ZJZA 4G0NA 3FLAA 1CHNA 3WQSB 3H2HA 4YN3A 4R98A 5KDLA 4DV5B 4BQFA 1QYXA 5ECYA 4EI8A 4IZIA 2F43B 3I5YA 2JH3A 1F0PA 1RRPA 1V8PA 4R2WA 3OF5A 1WU7A 1W5AA 5IXYA 3O1HB 4UD6A 3T4EA 3DNFA 3RSGA 5A4IS 5CA1A 5EIBD 2DOKA 3MELA 4ESOA 3NYQA 4IVNA 1SXJE 1H0SA 3SS9X 6REQB 2HSGA 4QJBA 1SC4A 4XLLA 1NW3A 2G7MC 1BWSA 5EZSA 3TQCA 4DFDA 4G07A 4DVJA 1FCJA 1N2BA 2HPZA 4BNYA 4HGNA 2CHGA 3G7NA 3WP0A 2PIDA 1HFKA 4GXRA 1FTQA 2PMCA 3W6NA 1Y7IA 2Z83A 5TGZA 2AEMA 3MG9A 5IVIA 4C3OB 2HCRA 5LZ7A 2WWIA 1YKGA 3EB9A 3LO8A 2K2WA 1ESCA 1W5BA 4UJ3A 4CCAA 4OA8A 3SMQA 1V16A 3I0MA 3WMRA 2VSQA 1NI3A 2H5IA 2RARA 1VDMA 2BSXA 2ZYIA 2P30A 3F74A 3FF1A 3MXTA 1FXWA 2QROA 4P0TA 4RKEA 5JFTA 3U4QB 3FMOB 1I7PA 2VSFA 1E94E 2QY9A 2YNMC 3ORYA 1XB2A 4MV3A 3U39A 2REQB 4JLPA 5T7BA 2O5EA 3ZWWA 2GOYA 4LJ6A 3L0YA 4A91A 3PXAA 5BNZA 4AY3A 3SIPA 3LNTA 4ZT6A 2EEPA 3ND6A 4N12A 1TC1A 4UAVA 4BC1A 1I7SB 1HTWA 2ALJA 4F97A 1Z25A 4LF7B 1QRUA 1D4ZA 3G3EA 4OK5A 2VRNA 4INPA 3GFTA 2Q2NA 4JXJA 4AMYA 3RRXA 5IH7A 5KTOA 2B2XA 1JV2B 4HDMA 4BVFA 1KMMA 2XQVA 4WERA 2O2IA 1MX3A 1GKIA 3WGUA 1KFEB 4JP5A 2KE5A 2FVYA 2Z5GA 3VSDA 2IH4A 4U8GA 2BGJA 2D7JA 3MOSA 3NVKI 1MOSA 1U8ZA 2ATXA 2H51A 3SDSA 4LFAB 3VKGA 3E2PA 1Z6TA 2MOKA 5FV7A 2OC4A 2EL7A 4HD8A 4PZAA 3TRJA 4OM8A 1QQAA 3OKAA 2DRIA 3NT5A 4UXIA 2WMDA 1TUBA 1IU9A 4L28A 2VNHA 5B36A 5FOWA 1PW5A 1IN5A 2I3ZA 3I0NA 4EYOA 5KSWB 1D7OA 4A6XA 2E3JA 2G76A 3BHMA 1GNRA 4DVGA 4GEGA 5HKOA 3I45A 2XGMA 1GSAA 1ORVA 2VJYA 2Y67A 1Q3TA 4KV7A 5AOBA 2XNDD 5ALFA 3EDYA 4QPCA 2JA2A 5FTNA 5BR1A 1ZMBA 2IK8A 3PL1A 3ZK7A 1Y98A 4WBNF 3EFBA 1H5NA 1XIVA 2G1UA 3F7TA 3GJ5A 3KVVA 4C0XA 4KREA 1OTHA 2OBLA 5JAIA 2PS0A 3AUUA 2XNDA 2ZM6B 3CX7A 1PSDA 2DXIA 4US1R 4UE3S 3PDWA 1MOPA 1SB8A 1J0AA 3EFOA 2GPJA 1C80A 1UZUA 1WIWA 2QAGB 1FUIA 4OHMA 4DDMA 3A1WA 4PZUA 2A57A 3OQOA 1FJ2A 4QFBA 3UQYS 1Z2EA 1TOAA 4FZ3A 5L9AA 2B61A 3L0IB 3LTNC 1MT3A 4W5WA 4GMXA 3DW3X 5AJWA 4EKIA 1M7BA 3VO9A 1J33A 4JQSA 1Z7YA 3PDIB 4IV8A 1KTIA 2XZOA 1K3TA 3KC2A 5L3VA 3O4FA 1RXSA 4QA9A 5JD6A 8MHTA 1YTLA 2BEVA 4EPWA 5LWHA 3QSGA 2QRKA 3VV2A 2D54A 8ATCA 4HPWA 2DR2A 1EZ4A 1BX3A 2AFIE 5DI9A 3OX4A 3NGLA 2H2AA 2IQ5A 1LFDB 2I6TA 4F6RB 4HXEB 4TLLB 4G85A 4LDPA 2PAFA 1C9NA 1EWVA 2OG2A 4XQEA 1BJKA 3K0AA 3UCXA 1IN1A 1MFZA 2E4VA 2Y8EA 1CT9A 2D1QA 1GPYA 2RHLA 3DO8A 5E8JA 3C5VA 4ZVNA 3UZUA 1E5XA 3ZWDA 4IPTA 3BK2A 4FDUA 4REMA 4XJSA 5KYWA 1DAHA 3KLPX 3MWGA 3IQIX 3AEQB 1KOLA 1BU5A 2WWGA 3F71A 4BL5A 4UU7A 4BNDA 1U2RA 2JLUA 3VPCA 4QBTA 2YJ4A 5AM3A 1WKVA 4DANA 4PANA 1N8NA 1JF8A 4JN6B 5AUOB 2RGNA 4X92A 2F8SA 3C6BA 4OY3A 2ET6A 1DKUA 1M6YA 3ESQA 4G2NA 5LLDA 2Y93A 5EMJA 2WB2A 3B89A 1V8BA 3CWQA 1L3CA 3QEJA 4CL3A 2QAIA 2Z56A 1ZD1A 4B47A 4ER7A 1E96A 1K27A 1ISHA 3ENNA 3EXEB 2VZLA 3NKFA 3OH8A 3K0FB 3EC2A 5A1TA 4J6FA 2GZRA 5IAOA 1T2EA 5IVDA 3M6MD 3SOPA 1QIKA 3GP5A 4RENA 3WQQA 3FUCA 4FQ5A 3M4ZA 1H6BA 2AV6A 2QRVA 5HKKD 1E5LA 1EZZA 1AQ6A 4GXNA 4EGQA 2JZNA 3KVOA 3OY2A 2HDWA 2B21A 4Y6LA 3FUTA 1C2YA 4HXFB 3SQMA 4RH3A 4AIIA 1JZSA 2AZMA 2DVMA 4FXPA 3V48A 3R3SA 5HKKA 3LPMA 5JXIA 3IXQA 4W5QA 1NUTA 2NVUA 4CKZA 4S05A 2DC1A 3SNKA 4D45A 2GKSA 2PCJA 3P97A 5L3ZA 2PZFA 3O2JA 2EP5A 2MSKA 5GJWC 4L4XA 1NXOA 1LH0A 1UC5B 1ZM7A 2EFDB 2P2ZA 1U8YA 3CZCA 3H5TA 1GDTA 1QJCA 3G89A 4B74A 4O59O 5DBGA 1DKOA 2A1IA 3RABA 3GF4A 5JPDA 4MGZR 5L45A 3WMWA 5HCUA 2ZJ1A 2HFJA 1G60A 1F48A 1K88A 2OSBA 4QXQA 3IE1A 3L8CA 1O87A 1Q5PA 2G9UA 4TL7A 5DM1A 4MRRA 2CHEA 3UTCA 4MRAA 2LXNA 4RLFA 1E5DA 3G1WA 1VSBA 4KVGA 5EKUA 1EA5A 2ID7A 2PMBA 3D59A 2E4YA 3CE9A 4AQ7A 2PNFA 4LZNA 1T3GA 1TAQA 1NT2A 2H08A 1E0JA 1HNXB 1DOAA 3CSDA 3GU3A 3UAWA 4OFWA 5AW8A 4I3FA 1VI6A 1KJZA 2B69A 2FG6C 3E1SA 3K5HA 4DPMA 2DHQA 2XITA 4CKCB 3LD9A 3HYRA 3EWAA 5FWAA 4A0RA 3VYVA 1LSSA 1DJMA 1T9GR 2V0NA 2VRWA 2Y6VA 3REQB 3ZJUA 2GGSA 4RY9A 3SF0A 1FU4A 1ZX1A 5CPBA 4TZTA 2VK4A 3EJ6A 3Q3GE 5CMLA 3SX4A 3I3OA 2PLAA 1W36B 3SJ7A 2J3LA 2O1XA 1MH9A 3L0OA 3WLRA 4JLVA 1OAAA 4BTLA 4J0EA 2R4TA 4ASUD 3T7KA 1JDSA 3GLFE 2IYZA 2AUTA 2ERYA 1R8SA 1UFVA 2XRZA 3BSSA 2DKFA 4ENQA 5EUCA 5HYVA 2OCDA 2BDEA 2IRWA 4ASUA 3BJIC 2BP7B 3OWOA 2IYPA 3AIIA 3TJMA 5KNDH 1CFZA 3KXDA 4RTLA 5FYQA 1LPMA 4PAGA 1TYAE 3NTOA 3CVWA 3R7FA 1HEIA 4C6RA 3TIXB 5KOJB 3GIWA 4FE4A 5CIYA 2GAOA 3RYHA 4DR4B 2CXRA 1PWHA 1VL5A 2H3EA 3OEYA 2WP8J 5B37A 3TPFA 4AO6A 3KQSA 1PT7A 4NEGA 4CLXA 5AD1A 1X9GA 1R4ZA 2CD9A 4OXYA 1C7ZA 3QELB 1KEVA 2I3DA 3TCNA 1WVIA 2BEWB 3RH0A 3U3MA 2PKXA 5A5DA 3S8EA 1E3EA 4R1PA 2XUOA 5THXA 2NYUA 2IE8A 2IYTA 4F46A 1YZHA 1A5TA 2DJIA 3S2UA 5I6DA 1T2AA 1A5BB 2HU8A 2P6PA 4U2EA 2FZWA 3CWCA 3A9SA 3MTDA 2EJBA 3HCNA 1EFCA 4FHEA 3SIWA 4GKBA 1XKLA 3RT9A 3CF4A 4O4LB 1E0AA 3EPRA 4LUCA 2HSJA 3NOOA 1A2QA 1A8QA 1BVRA 2CV2A 4PQYA 2PRSA 4G1MB 1NP3A 4QNMA 4QVGA 2W2LD 4AYXA 1ZN2A 4GO1A 3G17A 3UGTA 4B6SA 1VGVA 3EZ2A 4MRPA 3HZZA 3RHSA 3WZMA 3HKBA 1L5WA 5CA1B 3VR0A 4BJ6A 4NJOA 1MQ9A 2W2LA 5KJCA 3II6X 5G40A 2ILVA 2O3RA 2PBFA 3GDHA 4EF4A 5JXWA 1OA0A 4BNHA 1SHLA 2PR2A 2VH5R 2O14A 4MPPA 4O33A 4PLCA 1BAPA 3TSWA 2WWVD 1JB1A 1L1FA 1NNI1 1YHNA 3JWIA 3N8NA 1VIMA 5BYJA 3VR5D 1VIDA 4X8OA 2QSUA 1F6BA 3FVTA 5HOQA 3CIFA 3TLJA 2PMFA 1OI2A 3PHIA 1IOLA 3MFYA 3BXPA 3C6YA 3VR5A 2FOXA 1V16B 3GJ3A 5EKTA 3HJHA 3SHWA 4J0DA 3S81A 3DBRA 4M53A 3ZTWA 4II2A 1WNFA 4RULA 2YZGA 3NUZA 4LC0A 1E6KA 2OB2A 2X3YA 3WWCA 1MZVA 1S2IA 2WAOA 1U9JA 1O6GA 2J0UA 2OQVA 3ORFA 5H5JA 5CYPA 5HJEA 2QX7A 1T0UA 4TYNA 3V1UA 3G2IA 3A70A 5BYKA 4NMHA 4RTNA 3MTQA 3WG9A 4Z4GA 4I81A 3RVBA 3WRYC 2OBMA 4AJOA 4HDMB 4HLNA 2RK3A 4Y6QA 3HYCA 4V0OA 4DADA 1BXKA 1E2LA 3FNQA 1LBIA 5EZ6B 2Y0EA 2HREA 3AF1A 4MKRA 4Y9SA 3I39X 4LJ7A 5AM1A 5A06A 2BHSA 4UM8B 3CX3A 5FPTA 5E4JA 3WLFA 3WLJA 4DGSA 3EG9A 5JROA 3IA7A 4PWYA 4R1MA 3G2MA 4KO3S 1SD2A 4H7EA 4YROA 2ECPA 2GXUA 1THZA 3VKWA 1TUBB 1NG9A 3PJEA 4XFDA 3KB8A 3W1EA 5A2GA 4UUQA 3FHCB 1Z39A 3OA0A 3L7OA 2C2XA 4FQ8A 3Q7IA 4OATA 2ZSHA 3UKDA 2C7QA 4PNZA 4F3YA 3FTQA 1KNXA 4AUNA 5BN3A 1Y48E 4G23A 5FT9A 3HJFA 1NQTA 2VRBA 1GTRA 2I8AA 3UKOA 3V4OA 1Z8DA 5K0TA 2VPIA 3M1YA 2YX1A 10MHA 3GEPA 3BB3A 1QK4A 2X1HA 3JYNA 4IHQA 4FUTA 2GTIA 3OG9A 3O3MB 1GG5A 3EFOB 2Z98A 3U56A 1DHRA 2C0PA 2DPYA 1QCZA 3QMMA 1Y3CE 2WY2D 3U4CA 4C20A 2TYSB 4J0HA 2E5FA 4LV5B 3OA2A 4YPOA 1JQ5A 2WD8A 3AR6A 1NW7A 2EP7A 5JAPA 3DE1X 4AWAA 1P9RA 5BQFA 1USVA 2CEKA 4Z3KA 4ZI2A 3W2TA 1MABA 4U02A 1CPYA 1YCHA 1FLDA 4QO7A 3WB1A 1PWYE 3IUBA 2OZPA 3ZUGA 4EK9A 1PV4A 2E4UA 2UZ0A 3L84A 2BEVB 3M82A 3TQQA 4DSZA 1L7QA 4HZGA 4FLEA 4P3NA 5LDHA 1RXYA 1LJ8A 1JKXA 3KU1A 5ERXA 1YRYE 3RHTA 2H06A 1UKEA 1LJLA 3WNBA 5E0KB 3D3QA 3RRYA 2IPXA 3D8RA 2C1EA 3K0AB 3IC5A 3O8BA 4DLLA 1C3XA 4UEQA 4JB8A 3D6FA 3X43A 1U7XA 5JDIA 3NVMB 4M1OA 4Y2GA 3A3YA 4XCQA 4F8JA 3LA6A 4ZCSA 2H5LA 3KOWA 2BE9A 2R96A 3KYBA 4LMBA 2ACVA 1BDBA 5KYWB 4E7OA 2W4IA 2PGAA 1Z4PX 4I14A 3N7UA 3VHLB 2QVZX 5JUWA 2C5EA 1G98A 5M5BA 1PQUA 4E5YA 4O4JA 1KI9A 3GG9A 5KYUB 1L3BA 1SCUA 3BGVA 1H8HD 3L49A 1LSOA 3E9YA 4NBKA 1AKUA 5IKOA 4EYEA 2CUTA 1WG8A 5DGXA 1XT6A 3TI7A 4DG9A 3BWYA 4OP1A 2SKDA 3KOOA 3TZHA 3ANYB 3G2LA 3O26A 1UXKA 4BMPB 4BCDA 1H8HA 4BBJA 1SURA 2ZUEA 4N6NA 1CVRA 2R25B 3GLGA 2I1WA 3PF8A 2BPOA 5IP5A 2GBGA 3T9AA 4BWYA 2JKZA 2DT8A 2C4KA 3DZFA 5AKYA 4V1CI 3EPKA 2QRVB 3L8HA 3BJEA 3MN1A 1AGRA 4LE1A 5LWQA 5AI8A 1GXSA 2C59A 5LLTA 1XA3A 4AU1A 2PYIA 3EGXA 1L5ZA 3PA6A 3G49A 4HH4A 4LZJA 2AMVA 1XXHA 5CH5A 2NVUB 4JLOA 1JB9A 3QX7A 1POXA 1R9NA 3L6OO 4UHCA 3L0DA 4E31A 2VTDA 1FVFA 2DHEA 4JI7B 3PGMA 4M7OA 5ER6A 4NI5A 4FZVA 5KHOC 2DFKB 1ZCZA 2GA9A 3VPBA 2ONJA 1IBKB 1E5VA 3IBCA 4XSGA 5EKXA 1E6EA 2BBSA 1WV1A 2BGLA 4BLTA 2R8RA 2J3QA 3GRZA 2ICAA 1A76A 1PKXA 1YB1A 2GHQA 2QVXX 3A6EA 3P9YA 1IHUA 5JAQA 3SR4A 1KEPA 4ZZIA 2JS7A 1U0OC 4WPGA 3EOAI 4WV3A 2J45A 3BTVA 1XA0A 5KI6A 2Q2WA 5DYTA 4DLYA 1T0HB 1FVOA 3LVQE 1W8DA 5AOVA 4JS0A 3IKMB 1DQRA 3KE8A 1XVLA 3KKOA 1L4KA 4TXLA 1NBAA 2COUA 3EA0A 3BFKA 3EASA 4M7WA 4MS3A 5BW8A 1CUAA 3FBTA 3FKSD 5HGJA 4F4IA 4RJKA 1T3ZA 2Q99A 4L9SA 2X0FA 2CCKA 1I1HA 2WFMA 1D03A 3PICA 2VQSA 1CNMA 3FKSA 3T7EA 1UBEA 1O95D 3AGQA 3PC8C 4Q7KA 5IBPA 2G82A 1YSCA 4K26A 1KIMA 2ZVJA 4HQ6A 4J7AA 4DILA 5JZVA 1U7HA 3DBIA 1TVEA 3VDXA 3PCTA 2C54A 1O95A 3NV9A 3V97A 1HDGO 1MO6A 1NZFA 1Q1EA 3ST7A 4OX9Y 2OMEA 1GSIA 3IO5A 3EPJA 1THTA 2AX3A 2OESA 4G8DA 2H0AA 1E61A 3BH7A 3BBPA 4OU4A 2OV2A 5JCJD 4DGQA 3T1TA 3ZDRA 5REQA 4AZTA 5B58C 1TYCA 1W4ZA 3FGOA 3L7IA 3GZ4A 4EQ6A 3HS3A 1ZD3A 2ZJYA 1ZY2A 2ZKIA 4MWCA 3RYHB 2X7XA 5JCJA 4H7KA 3ZU6A 1TTPB 4V1CB 1FTWA 2ADMA 2PJDA 1A9XA 3PHGA 1RXWA 1ZRNA 3KJGA 2ROQA 3L02A 4NICA 3DPUA 2BZ1A 2PZJA 3WB2A 4E2YA 3RFUA 2BBOA 3WRWA 5JLAA 1BYUA 4MKIA 1ZM4A 1ES9A 1LXCA 3HU5A 4GL4A 4LJSA 4C5CA 4QGSA 3DV0A 1VECA 2ECKA 3L3BA 1JFLA 2WDPA 2WHQA 3KFXA 2PA0A 4FFRA 4IFBA 4ZV4A 2AVDA 2ZITA 1FS5A 3QZUA 1IB0A 3W2FA 1G5TA 1I3OA 1JG3A 1L7RA 1SZDA 2OGSA 2ZIAA 4RDXA 2I34A 2ZI4A 2G5PA 3G8DA 1UDCA 3MT7A 5JSUA 3JQGA 1DKNA 1E63A 3MMXA 4GAEA 4RXTA 3UY4A 1KI4A 4H1VA 2XZLA 4FZJA 5AI9A 1JHQA 3LAWA 1DO0A 1IZ7A 1BGVA 1V41E 1Z3IX 2H1IA 2SHKA 3R23A 1KDOA 4DZRA 3MCUA 1KDVA 2ZRDA 3B51X 1ZICA 2MSNA 3BL8A 2R7LA 2ZRIA 1BEZA 3MJEA 3P8ZA 3UA3A 3A1DA 3N0RA 3IP3A 1SVNA 2QE7D 4PYRA 4TUYF 4BKPA 2XSZA 2HHHB 4QRHA 4L74A 2JGAA 1ZM2A 4B4VA 1TIKA 1KO4A 2WJJA 1JPVA 4S35A 2QE7A 3G82C 3NHBA 2IUUA 2I1QA 3S2GA 4PLZA 5HMMA 1PFQA 3N9IA 4Z4CA 5J59A 1C29B 3PE6A 4H6WA 1SXGA 4MJXA 4ARUA 1HQCA 2J3KA 3C2QA 1F51E 1N2GA 1X42A 1QYCA 1KEZA 1KQ3A 1UZMA 2VZ9A 4YNBA 1C50A 5E7IA 3DBRB 4ABYA 4OPMA 1U2DA 4DXDA 2N0SA 4YHBA 5EIHA 3V9AA 2B1GA 2P62A 4RM2A 4OOFA 4I3GA 1U0EA 2LKDA 2IBTA 2J0UB 3OFJA 4ZDIA 4BFYA 4HTAA 2D59A 5DHSA 4E22A 1W5SA 3INNA 1RRCA 3DL2A 1IM8A 4ROSA 5JEDA 5TS3A 3GAAA 1WCYA 3RVKA 2QUIA 4PG8A 4TV8A 1T4GA 1XZ8A 4HFMA 2EP8A 3IP8A 3IDAA 4IXNA 3N28A 4OMCA 3UATA 3PV0A 4Z8YA 2VH2A 3NEPX 3RV3A 5EMHA 4MQBA 2HHCA 1JIXA 2RBEA 4XJTA 2DEUA 2WSIA 2P91A 2FPSA 4L08A 5ER9A 3CZ5A 3SE7A 5IDVA 3IT3A 3IBGA 2Q8NA 1EWTA 2C4WA 4HNQA 4Y2RA 2A3RA 2NV0A 3N8DA 4QJIA 9GPBA 4N4AA 2HBRA 5JG7A 3C15C 1DO8A 3A7EA 4AB1A 2HTFA 2Q7DA 4AZ0A 5LJIA 2FWAA 5EFOA 1TA0A 3HY4A 1Y1SA 3CMCO 5DBOA 3HJNA 3MNFA 3CSSA