4F4JA

Conversion of the enzyme guanylate kinase into a mitotic spindle orienting protein by a single mutation that inhibits gmp- induced closing
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
189
structure length
189
Chain Sequence
FQGSMSRPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVPSTTRTPRAGEVNGKDYNFVSVDEFKSMIKNNEFIEWAQFSGNYYGSTVASVKQVSKSGKTCILDIDMQGVKSVKAIPELNARFLFIAPPSVEDLKKRLEGRGTETEESINKRLSAAQAELAYAETGAHDKVIVNDDLDKAYKELKDFIFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanylate kinase
publication title Conversion of the enzyme guanylate kinase into a mitotic-spindle orienting protein by a single mutation that inhibits GMP-induced closing.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 59
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature ec 2.7.4.8: Guanylate kinase.
pdb deposition date 2012-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 4f4jA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4f4jA01
1LNZA 1IN8A 2ZRFA 2LCFA 2W6JA 3F0TA 1Z6XA 3UPUA 1BIFA 4DSUA 1TX4B 1XDBA 2IF0A 2ZIAA 2BIFA 3QSYA 2VF8A 2R9VA 2V8OA 2GF9A 1P72A 3KJGA 4HLUC 3RRZA 4Q01A 4ILEA 1CKEA 4JSTA 2ZI3A 2A3RA 2FZLA 2KE5A 4MQBA 4BEJA 3ZH9B 3AEZA 3NDPA 4Q4AB 1COWA 4BLRA 2GAOA 4BFZA 2YZ2A 1IHUA 1S8FA 1FMJA 4S2EA 4Q9HA 1E9AA 1T0JB 4JLJA 3TRFA 4BPBA 3SYKA 1AQYA 2REXB 1XCGB 1UBEA 2FV8A 3KX2A 4QRHA 2PJZA 1HURA 1FQKA 2GZDA 2WWXA 4QM7A 1HQCA 5FOSA 4TL7A 2UVQA 3CUEF 5GVRA 3CBQA 4MA4A 2AFHE 5JJIA 1EFCA 1K8RA 2IBMA 3QKSB 2O8BA 3PEWA 1YVDA 1DE0A 2X77A 2J1LA 3IO3A 4GZMA 1GAJA 2DWQA 3DZDA 4ABYA 2WVJA 1WE2A 1ZD1A 2FF7A 1SKYE 4CEJB 3CH5A 3C41J 1G7RA 1TQDA 3K0CC 1FP7A 5JS7A 4C7OB 1IXZA 5J4LA 1L7VC 1NMYA 4FMDB 4DB2A 1G4UR 4P32A 4US0R 4TYWA 2IUUA 2F3RA 1KDOA 4KV9A 1F5NA 1OFHA 2QAGC 3LO5A 1DBSA 1E9DA 5BYKA 1ESMA 3IGFA 5SZHB 2ZANA 3GD7A 1P7CA 3NBYC 4LHVA 5LB4A 4XIGS 2VP6A 3EPKA 3Q85A 3AF1A 1RW4A 5CK4A 4LV8B 1RYFA 3AP1A 4IJMA 5EE9A 1Z29A 1NKSA 3TR5A 4EQ6A 4M22A 5C18A 1EFRD 1SVIA 1Z0DA 4RD6A 1TF2A 4HZUB 1G6OA 2ASEA 2H8KA 4OKSA 4LJ6A 3RS5A 1OKKA 3UMRA 1E9EA 3P27A 4OHWA 1EFHA 2RHMA 4OI2A 4M53A 5EQTA 3TAUA 2XXAA 4GMDA 5L3SB 2AFIE 3OEHD 4GT1A 3EC1A 4M1MA 5JEEA 3T35A 2X19A 2QT0A 2NO6A 1XBTA 4M1TA 4P0TA 1DO0A 3U44A 2C95A 2ZUDA 4CEHA 1IJEA 4ZCLA 4TYPA 1VPLA 2GCNA 1KI7A 4IW3B 1Z6YA 1SKQA 2PCJA 1OIXA 3AQ4A 3H2YA 5CDFA 4B3BA 1NN3A 4C0QC 2IEYA 3BS4A 3NKVA 4I1UA 4LC0A 3WMGA 1G8FA 2ZJYA 5A0FA 2ZROA 3GJ6A 2NOAA 3T1QA 2VHUA 3WHLA 4AD8A 4HUQB 3MWKA 3L82B 4DLYA 1KNQA 3T61A 2WTUA 4EJSA 2ZI4A 2RCNA 3I3SR 3T34A 3B6EA 3A1SA 3EC2A 4LBWA 1XMIA 4OJQA 1U8AA 4Q7MB 4DVGA 2YJTD 4GRAA 2FG5A 4Q4HA 4V0LA 4A82A 5D3MB 2GDJA 2OLJA 2BKUA 1W7AA 1JQJC 4GP7A 2DWOA 4HAUA 3V4RA 4OHVA 4XVRA 2NTYC 4UNPA 3GLIB 2P6NA 4ARZB 5JSZB 2IXFA 1CF4A 2YWHA 4NH0A 3ZDQA 1T5LA 1MR3F 4ESVA 4XSHA 2GZAA 1M6NA 1YZQA 2QAGB 3CRQA 4JLBA 2JJ1D 3Q7QA 3THXB 4A8JC 1GL7A 1KDTA 3DMNA 2H16A 2QA5A 2HF9A 3X2SA 1NRJB 3PUYA 5KDOA 1II0A 3REFA 3RS7A 3AKYA 1G4AE 5IHPA 1DO2A 3K09A 3U3OA 3KB1A 3VAAA 3OHMA 1L8QA 4ZCIA 4C0LA 3RANA 2VF7A 3BERA 4BUJA 3NTUA 4L16A 1U0HC 3FMPB 3IPYA 4JLKA 4DUGD 4H1UA 1NBMD 1DAEA 4NHOA 4M9ZA 1VYVA 3RWMB 4D4MA 1SHZA 1ZUNB 2QSZA 2A78A 4PTLA 2AXPA 4XVUA 3AVPA 2CHGA 4IEIA 1UEJA 1E32A 2X2FA 1J2JA 1Y63A 2ATVA 1EWRA 4HAYA 4L4UA 1Q1QA 2HF8A 1BH2A 2WJHA 4FMCF 3OIVA 2A7QA 1ONBA 4UNSA 3DKVA 1AZTA 2NGRA 4D26A 1N6RA 2DYKA 1NL3A 2IYSA 5TB5A 2KBFA 2WJGA 5HZHA 2C96A 4S35A 1HEIA 1MV5A 3P20A 1CR1A 4BFSA 2ZAOA 1T3HA 3DHWC 2V54A 2CL7X 4ZI2A 1RC8A 4CEIA 4Q03A 3ADDA 4NKRA 3F3YA 3QY0A 3UMFA 4LC1A 1E9RA 2YNMA 5FTNA 1G64A 4ASUA 4IDQA 2JJ2A 2UZIR 1IBRA 5H1YA 4TZ0A 1EK0A 5FOUA 1QZXA 4Q48A 2P65A 3NBZC 2QAJA 2GCPA 1CIPA 1Q1EA 1QVRA 2YYZA 4HAXA 2O8BB 1UBCA 4FINA 4BLSA 3OF5A 4MH0R 3GLIE 4B34A 3WYAA 1E2QA 3L0SA 1IQPA 2KWIA 2AK2A 1DARA 1Q57A 4W7SA 4DJTA 3M4YA 1OHHD 1G8YA 1Z6TA 3N70A 4JZKA 1NG9A 3QPUA 1MO3A 1RE0A 4DDWA 3T1TA 1UAAA 2D7CA 5DLQC 2FEMA 4DEYA 3TBKA 3AVVA 2EFDB 5F98A 4TLDA 1G8GA 4NCNA 3FPAA 1X8KA 3LBHA 3KKPA 5LPNA 1XP8A 3K70B 4EQ6B 2OFWA 4TTPA 4DCTA 4MDEA 1ZINA 3K09C 2JIZD 2RGAA 5EP4A 2ORVA 3MWYW 2C8VA 1HT1E 1KSHA 4A9AA 2GILA 1FOEB 1MO4A 4KLZA 3FFBA 4MKIA 1J8MF 1NMZA 1ZNXA 4B74A 4ACBA 3TW4A 1SQ5A 5JCZA 1TU3A 2XXAB 3C16C 1BYIA 3BXZA 1ZM2A 2GKSA 4PHGA 1HTWA 5J4YA 3MD0A 5FFMA 1S1MA 4WZAE 3U44B 1UKEA 4CEHB 1E1QD 1VYUA 3SHFA 5DISB 2QP4A 3S1AA 3PENA 3AF3A 2B8TA 1RJ9A 2ZR0A 1YZLA 2QQEA 3A37A 2ZU6A 4E5UA 2XTNA 3FMFA 2AKAB 2GF0A 2I1QA 2YOHA 4LYFA 2BCJQ 2AXNA 4WZ6A 5KSZA 5EXPA 2QPTA 1RFLA 2LKCA 1M8PA 1ELOA 1N6IA 2BJWA 1KI8A 2GK7A 4YDSA 2J59A 2ZYVX 3FMOB 4KYIB 2WAYA 2MMCA 4EJSB 2IS4A 1W4AA 2ZRGA 2VP9A 1GWNA 1TMKA 2W58A 4DLRA 2B8WA 4MKHA 2XAUA 1BYUA 4A6PA 4RFSA 4W5JA 4Q4HB 2V9PA 4B2IA 4BGDA 1WQ1R 1ZC3A 4BZPA 1KK1A 4HZIA 1W5TA 1DAFA 3NC0C 4PC1A 5CJ2A 5JFGA 2HXSA 4D2IA 1KK0A 3KQUA 4DT1A 4A6XA 1WMSA 1XXHE 2AL7A 4C4PA 4PSKA 2QORA 1IJFA 2DHRA 4JBXA 4Q7JB 1XD9A 3AB3A 3IHWA 4IOMA 4F93B 2XOKD 2ZSEA 5JLJA 2XNDA 2O5VA 3RS2A 4JKYA 5DI3A 2V7QD 2ZUCA 3WP0A 2NO0A 1I4LD 3RRYA 3IIMA 2IX3A 4B43A 1G3IA 1XB2A 2BBWA 3AF2A 1TF7A 4Q9LA 1G41A 3ZVMA 4UNNA 1M34E 2D62A 3O47A 2GVZC 1SXJA 2ZSFA 3KJIA 3AF4A 1OFUX 2RGXA 3ZQJA 3FGNA 2WM9B 2QE7A 1WA5A 3GPLA 3T5GA 4L9WA 3AUYA 1DEKA 1SVMA 5EJEA 4P4SA 2QMEA 3HU1A 2FJUA 1GIAA 3IILA 2V55B 5FL7A 2HDNB 3SJCA 1E0AA 3RHFA 3LH5A 5CM8B 4F92B 3R9IA 3KJEA 3OEEA 5J40A 3L0OA 1RPZA 4QBGB 2IS2A 3THYA 4N1AA 2VTKA 3NWJA 3NBXX 1XEWX 4G0NA 3DL0A 1Z0FA 3CPHA 3IIJA 3TJZA 3CWQA 5CDFE 1X86B 1T6NA 4KHZA 4TQUS 4V03A 4MUBA 1GILA 5GJBA 1KDRA 4CEIB 2ZJOA 4RFVA 1WRBA 2QGNA 1NLFA 1UJ2A 1P73A 1TQ4A 2VLIA 2QGZA 1II8A 4GOKA 3KB2A 1N6PA 4RKEA 3KFVA 2G6BA 4QHTA 3CX8A 5IK2A 1Q21A 1QHYA 3MFYA 1AGRA 3K0FB 5KDLA 3ZZTA 4K46A 4Q7LA 3D3QA 2QROA 1UDXA 3PEVA 4IXMA 2PCLA 5FBRB 4BLQA 1KGDA 4HDCA 4RD4A 4JT4A 3OZXA 2JLZA 3QNUA 4A0RA 5BN4A 5JRZA 3QXHA 4TYNA 1QHXA 1W36D 1G3UA 3CX6A 4CVNA 1E3MA 2GTPA 4LCBA 3I5YA 2C2HA 1FNNA 1I4TD 1NIPA 2HUPA 3N2EA 4FIDA 1ODFA 1PV4A 4XH9B 2ONJA 1KSGA 5DI9A 3TUJC 1Z8FA 3VR5A 3ADCA 3HDTA 2FSFA 4HUTA 5J5CA 3ZYCA 3VKGA 3I8XA 4DSNA 2P5TB 2GZHA 1IY0A 2C9OA 2QUZA 1CBUA 2GXAA 2ZUBA 4W5WA 3K9GA 2IYLD 2OCAA 4IHQA 3QF4A 5FUXA 1WP9A 1E2NA 5HPYB 4URWR 3RC8A 4BFVA 3Q72A 2C9YA 2WPDD 2WV9A 5JJLA 1E9CA 3GJ3A 5KSPA 2ZREA 2G77B 4PHHA 2F6RA 3CR8A 3VX4A 1OT3A 4QM6A 2O8EA 4BQSA 3X1WA 2Z4RA 4JJZA 1SXJC 1ZU4A 4G5OA 4II7A 3P4YA 2QMOA 1OV4A 2J46A 4XTCS 3UIEA 3VKHA 1CULC 2QENA 2XTZA 4I4LA 3VNUA 1JI0A 4D25A 1SVSA 2GEUA 1OFIA 1G7CA 3BE4A 5TARA 4DLWA 3A8TA 4BECA 2C9CA 1W4BA 3VR6A 2JLRA 4I81A 3M1IA 3S1AB 3SNHA 4XSGA 1KI2A 2DFKB 1YR6A 1BMFD 1AS0A 1FUUA 1RJ9B 2CBZA 1IONA 3EZ9A 4LPSA 1EXMA 1VG0B 1SULA 1ZCBA 2G83A 1KHTA 1VG8A 3CWZA 1OF1A 1H8ED 2ZM5A 4PAMA 3EA5A 4H1VA 3EASA 1GRNA 3T15A 2PH1A 3VMFA 1A82A 1I2DA 1P60A 2WSMA 4Z51A 1MO5A 1D2EA 2WWGA 5EUQB 1JB1A 1Z0IA 2Y8EA 5HCNA 2OCPA 2SHKA 4NYIR 3X1XA 2OFXA 2F9MA 3F5FA 4O2LA 4RFSB 4LWZA 3KUDA 3BRWD 2PT5A 3B8HA 4Q1BA 4E22A 5JJKA 5KU1A 1N0UA 3VHLB 1FW6A 2TMKA 3C15C 5DO9A 4A15A 2D2EA 4RD2A 4BWYA 4GL2A 3PVSA 2AR7A 4QJ5A 5F3WB 4DT1B 4XWAA 4TMZA 1U98A 3BD9A 4AYTA 3FWYA 1N0VC 2FE4A 3SR0A 5CB6A 4V0ME 3TGPA 1EESA 1FX0A 3VR3A 2IYQA 4TMWA 1NG1A 1R5NA 1TF5A 3H0KA 5DI3B 1SZPA 2F1RA 3TQFA 1KKLA 3O8CA 1XCPA 1KY3A 1GNPA 3PFIA 1W0JA 3QIAA 4QGHA 1G18A 1UBGA 1GVNB 3TKLA 4C3ZA 1MRSA 2ECKA 1WXQA 2HXYA 3CRMA 1Q3TA 4JS0A 4TN1A 5KOYA 4R7ZA 1NJGA 3GLGB 2IYUA 1SXJB 2IUSA 2OE2A 2D74A 2WJVA 3HWSA 2WICA 4UKDA 4ZO4A 1COWD 3KUCA 3L0PA 3ZS9A 5KNDA 1OFTA 5CIWA 1E79A 1VHTA 5JWHA 3FMIA 4LOAA 4O0MA 1J8YF 2P3SA 2R6AA 4TLEA 5C2JB 4P4SB 4TSFD 4TT3D 3U3KA 4FCTA 4I1OA 3BFVA 4X8MA 4E07A 2O8DA 2FSHA 4B76A 2YVUA 1UDWA 3CB4A 4CF7A 1H8HA 3PUWA 2O0HA 1V43A 3BFKA 1VIYA 3RRMA 2VL7A 3QJYA 4NP6A 1GNRA 3THYB 1N6OA 3CF2A 3GEIA 4PSAA 3TVDA 1QG2A 3NDBB 2C77A 4NU0A 1PVOA 5FI0B 1LS6A 4C0JA 1E2DA 2MMGA 4ITRC 3AVOA 2OAP1 1AA9A 1G3MA 3OE7D 4IVQA 5CJPA 1P62B 5FPTA 3TK1A 3OESA 3BK7A 1II8B 4F4IA 4I1SA 4MKGA 3I62A 1ZAKA 1ZCAA 4Q1FA 5FTMA 3SJAA 5EXXA 2IYTA 4KLNA 1Z08A 2JDIA 1VMAA 5AWFC 5JECA 1XMSA 2CNWA 4PO8A 1AS2A 1UKZA 1ETUA 4QGGA 2J87A 4YONB 3ZGXA 3CNNA 3K70D 1W1WA 2J7PA 5AJZA 1HE1C 3SBDA 3TSWA 4LYJA 3KKNA 2OHFA 1GITA 4TL6A 2P67A 1HUQA 4MITA 3WYGA 3LY5A 3CF0A 1ZJ6A 1OKKD 2VSFA 4BE7B 5A4JA 5HR5A 1W47A 1XEXA 1Z6GA 2W2VA 5KSYA 1CRQA 4DLTA 1OH5A 1SGWA 4MYUA 1GRRA 1UFQA 2VYFA 2GRJA 4JLVA 3CKLA 3FB4A 3SHWA 3W3ZB 3KQLA 3I4LA 4PZZA 4BEBA 4E09A 3TAHA 2CHQA 4D4JA 2JASA 5IDVA 2B6HA 3QF4B 5FUVA 3X1YA 2QRZA 3LAWA 4EPWA 5GJWC 4C2UA 5AK0A 3GLGE 4BZXA 3C4JA 1VKJA 2A2ZA 3GFTA 1DAGA 3QE0A 2R44A 4PQRA 3AVQA 2O8EB 2ZAMA 5JS8A 3RAPR 1JJVA 1N6NA 2BBTA 5F9HA 2AWOA 4EFNA 1NN5A 4Z8YA 4AY2A 1S4QA 5K8UA 1FFHA 4G1UC 5CLQA 5DYGA 2ZJBA 2CLCX 1F2UA 4PFSA 3B85A 3SBEA 4D0GA 3SU8A 4HAZA 2F43A 3EZ2A 4BLTA 2K5UA 4KCGA 1E2LA 2BWJA 4M0LA 4DC9A 5FTLA 5IT5A 4HB3A 2WMNB 2IYYA 1II9A 3G0HA 3EIQA 5BQ5A 4A8JA 4RZUA 4Z8XA 4CIDA 1SVOA 3B7GA 1Y3AA 4Q19A 2R2AA 4J0QA 1YRBA 2ANBA 1M2OB 3LLUA 4TTRA 4Q9JA 3BIFA 4MGKR 1XJ0A 4LSGA 5G40A 3VU9A 1P9RA 1VCOA 3IKJA 3WXMA 2E1RA 3MLEA 3KDSE 2EFEB 5HKKA 3EIHA 4DDUA 2JLVA 2GWHA 4MGYR 1H65A 4TQAA 5FOVA 4ZV4A 5DGXA 3UKDA 4BFYA 4L9SA 1VCIA 3T1OA 4HLDA 2R62A 2F1HA 3QI2A 5UKDA 4Q21A 1VDZA 2OILA 1GDDA 1EGAA 1ZUHA 3ASYA 3KXKA 4YC7A 4Q66C 2GCOA 3GQBA 4DIEA 4JLOA 2JLXA 2QTFA 4JYCA 3B1YA 4WZBE 4MDFA 2H57A 2EWVA 3PQCA 3RLFA 4U02A 2WJYA 3QQ5A 1Z5ZA 3A1WA 3GLFE 4OHXA 5EE5B 2PLFA 3KQKA 1P61B 1W0KA 5FOTA 4JJKA 2W6ID 3MJHA 4PX9A 1G6HA 4RZ2A 3EPHA 1BKDR 2ZSDA 2WOOA 2R65A 8OHMA 3LD9A 4NCJA 3CIOA 1K5GA 3BB1A 3HR7A 3PUZA 2VO1A 2FFBA 4QHYA 4KAXA 2ZYWX 1NY6A 5DYIA 1J99A 2FFAA 2D06A 1FX0B 4M9SA 2F3TA 5EUMA 1NY5A 2H18A 3JVUA 5EP3A 3K0EA 3LBIA 4GI7A 4LRWA 2IYVA 1G3QA 1G7SA 1KO7A 4DLUA 2I3BA 4GSYA 3D31A 3FKQA 1MO6A 3ICEA 2PEZA 3HYTA 4F4CA 4TMVA 3VKWA 3QVUA 3QKRA 4YMUA 2IEZA 5KUTA 1UF9A 4UXIA 4UXHA 1GM5A 2P2LA 3K9HA 1A2KC 4GDFA 2WSSD 4L5BA 1KJZA 2QG6A 4AG6A 5EE1A 4AYXA 1JAHA 3PEYA 1GG2A 4LGMA 4IVRA 2BC9A 1MRNA 2NO9A 4URUR 2O8DB 2ZYTX 1HT2E 4UXJA 4A36A 5J4VA 3BBPA 4KVAA 3LVRE 2F9LA 2YOFA 2ZRKA 5EZ6B 3I72A 4KU4A 2H5EA 1TADA 2PL3A 1T0HB 4PQYA 2FPKA 1UKVY 1RRGA 2GVDC 3KKQA 5B64A 4Q9KA 2FSIA 1PLLA 3CW2A 2CEAA 4Z1MD 3QBVA 4V0NA 1J90A 1KO4A 2JLUA 4G3XA 4NCKA 2ANCA 1N5JA 5F9FA 2J7KA 3SEAA 3LRPA 3CLVA 1OXVA 4FW9A 2RH5A 2DBYA 1A4RA 2FOLA 1W2HA 2BKEA 3TR0A 2EFCB 4G5SA 5JZVA 1T8TA 3AH8A 3KKMA 1LTQA 4JL8A 1OE0A 2RGEA 5FH9A 1T91A 2W2XA 4LHWA 4B6FA 4XVQA 4I1VA 4RZ3A 1EFRA 4DEXA 5KDDA 2ZI6A 3CZQA 4EDHA 2ZQ5A 1R5OA 4JVMA 4W9MC 4I99A 3JZAA 1E2KA 1RRPA 1TPZA 3K53A 2FGKA 1A1VA 1A2BA 5K8IA 4URVR 2EFGA 4HEJA 1E4VA 1XEXB 4YQFA 4RKFA 2ZS8A 1CEEA 3B2EA 1JQLB 4TLAA 1YZUA 1CR0A 5LD2C 1E2JA 3R20A 2WWIA 3O8DA 1ZM3A 2OXRA 2IHYA 2IXEA 4LHXA 2G0TA 1DS6A 2ZS7A 2CL6X 4YMTA 2EQBA 4NL4H 1S9HA 2AK3A 1C1YA 3BFXA 1R10A 2FZ4A 3FOZA 4DCSA 4DZZA 4BRUA 5J47A 2KI5A 1IY2A 1XJQA 3A4MA 2A30A 4KSCA 2PEYA 3M6AA 1HE8B 4FMDF 1UKYA 2VEDA 2RB4A 2ZE7A 4FCVA 4M9QA 3WBJA 4B3FX 4M4SA 3U4QA 2Z5FA 4A92A 1F2UB 4M1WA 1KAGA 4G5QA 3TW8B 3W5JA 4B47A 1P9WA 3W8NA 2ATXA 2F43B 3GLHA 3CM0A 4R2HA 2FPLA 1RVDA 1OH8A 1UEIA 2EFHB 1EX7A 4UQOA 2NPIA 4A8JB 4ZIRA 2CL0X 2JA1A 4A2PA 4IFBA 4PQFA 5DHAA 5FL3A 5FR1A 4AKEA 4HAWA 1EX6A 3UG7A 4NYMR 4TZ6A 2HYDA 1JJ7A 2ZTSA 4N0DA 2MSCB 1TL7C 1Z22A 2PT7A 3VU9B 4CYMA 1S3GA 3U61B 2VHCA 4AKHA 2BHRA 2XZOA 1R2QA 1E2IA 2JJ1A 5TV2A 4LJYA 3JVVA 4DRZA 1K5DA 2XNDD 2JLSA 3SQWA 1AQUA 3ASZA 1DG3A 2H92A 1NLZA 1FNMA 2ORWA 4KODA 3TUZC 2GCOB 1T4GA 2JJ8A 3HU2A 4KFTA 3AVWA 4FN5A 1G9XA 1U0JA 4JLMA 4YMWA 4V0KA 2RGGA 2IHBA 3RS0A 2QBYA 5GJCA 1JNYA 2KB0A 3EA0A 4FWIB 1DVRA 1Q1BA 4M9XA 4YLGA 2C5LA 4QNMA 1Q3HA 2ZE5A 4LYHA 1GKIA 1P6XA 1XWIA 1G5TA 3DEFA 4QL3A 4DUGA 3O8RA 2QTHA 2GJSA 4OQXA 1NBMA 3QOFA 2QE7D 1G7TA 2WHXA 2CDNA 1G19A 3OFNA 2PZGA 3KFXA 3DM9B 3LW7A 3PUXA 4MYHA 4PSVA 5LD2B 1OB5A 1DPFA 3OIWA 4IOKA 2ZE8A 4ZKEA 5JHGB 621PA 5AJVB 2AX4A 1JPNA 3PXGA 3P32A 4OI4A 2F1JA 5FPKA 3SYNA 3OEED 1DAIA 3K0SA 3DVLA 2V3CC 3ND9A 1Q20A 2BBSA 3QXCA 2XTMA 4KBGA 1E4YA 3MJRA 3MWJA 3QKTA 1MOZA 4RD1A 2QI9C 1ZD9A 3GJ4A 3QKRB 3I92A 4E03A 4LPKA 3RRNA 3CNOA 4LBZA 1TU4A 5CK5A 4LHZA 4MGZR 1ZIPA 4TYQA 5EXTA 3A1TA 4Q1CA 4RZXA 2ZETA 5G41A 1E1RA 1E98A 1QHGA 4K8OA 5KTYA 3FTQA 2GXUA 1ZU5A 5DIFA 4NTZA 2LWIA 3Q5DA 4NDZA 4GPTA 4OQLA 1YKSA 5B30A 4QBHA 1BS1A 3CNLA 2PZFA 3LXRA 2GEVA 5JMTA 1NP6A 3EG5A 2VHTA 3AVUA 3G5UA 2IWHA 2W0SA 4M8NE 1N5IA 1W44A 1KJYA 3QG5A 1NVWQ 1DELA 3BB4A 4R9UC 3U60B 3A1UA 4C0KA 2QP3A 3AKEA 4KO8A 2FGJA 3HR8A 4HATA 2NG1A 3SE0A 3KQNA 2V6IA 4PPNA 821PA 1W46A 4URXR 5DNYB 4B73A 3E2IA 2XB4A 4LY6A 4D0LB 3LWNA 3T06B 2J0UA 4XTRA 2PMKA 4TTQA 4EFMA 3V00A 4FD2A 3CR7A 4WXRA 1E2FA 2XJ4A 4XD7A 4DSTA 1CJKC 1V5WA 3CF6R 3NG1A 4HAVA 3W6NA 1LFDB 3U3RA 3LW8A 3H84A 4Q47A 4BRWA 1NVVR 2Q9BA 2JIZA 4D81A 1P2UA 2J0QA 4B6EA 1LVGA 2CHVA 3L2OB 4NCIA 2O8FA 3LDAA 2Z6VA 1KMQA 1N2CE 1XX6A 4NYJQ 4C0BA 4A2QA 1DOAA 2AWNA 2RAPA 2ZPTX 1M7HA 3O8BA 4C0AC 2ZEJA 5CITA 2YWGA 3A1VA 3R8CA 3W6PA 3SDZA 2ODNA 3BOSA 3W34A 3R9XA 1IOZA 3AM1A 2J45A 4RCYA 5ANRB 3C8UA 1L4YA 1XEWY 5M04A 1E1QA 2O8CA 2AHOA 4BFWA 4D6PA 4D0NA 4L15A 4Y0VA 2HT1A 3WY9A 3ZIAD 5H68A 5JWOA 4EPYA 2EVWX 5L3QA 2ZI9A 3U5ZB 3SJBA 1F60A 3UWKA 2CVHA 1ZD8A 1OXUA 3W90A 5AUNB 4TYYA 4MRVA 4AG5A 3ZD7A 2IF2A 4OBEA 5BN3A 1QHSA 5AUOB 5JHHB 3U7GA 1YU9A 3U4QB 3UANA 3AUXA 1FTNA 4JT2A 2CMKA 2YWFA 3CH4B 1Z83A 1X1SA 2UZ3A 3RVBA 3T5DA 2VP4A 4MUAA 3GLHB 1Z2CA 4PXAA 3MAAC 1Z63A 3SYLA 1ZUIA 3VR2A 2HV8A 2ZRIA 3B13B 2PJRA 2HLDD 4O25A 1YZNA 2ODWA 1XTQA 4GP6A 4ZIRB 4HB0A 1UM8A 4F4JA 4IVPA 2AKYA 2FEOA 1KZGB 1WF3A 2OBNA 2OCBA 3TSZA 5JBQA 3CONA 1N6LA 1ZRHA 2N42A 5CYPA 1JEDA 1WBBA 5FBQB 1YQTA 5BYJA 4PHFA 4YXWA 5C1BA 1EG7A 4AWXA 2WKPA 1NLYA 1RKBA 1TUIA 3B5JA 3PUVA 4P4TA 3G82C 4ZI3A 4XJXA 1A5TA 4B3GA 2XOKA 1D8TA 4CRWB 3DKPA 2V7QA 2BBOA 1KIMA 1S2MA 2W2TA 2XZPA 3SOPA 1GKYA 2CK3A 2VRWA 3A4LA 4NCHA 4IOJA 1U2RA 1W0JD 1R0ZA 2JAQA 3KZ1E 3UWOA 1VG1A 3A6PC 1U90A 1QDEA 2EWWA 4IEEA 1QVAA 2QBYB 2QP9X 4KI0A 4W5HA 4ON9A 2FWRA 1DAHA 3D6TB 2XNSA 4Q18A 1QHIA 2BCGY 4QHSA 3T12A 3TH5A 3GMTA 2Q6TA 2RMKA 3AGQA 1Z0JA 4IRUB 4UJ5A 4DDTA 1R8SA 4MRSA 1CJMA 4UNRA 3SQXA 4A0FA 3TVTA 1NN1A 1EFUA 5FPHA 4N0EA 3K9LA 1Z0AA 2XGJA 4QKQA 1FTSA 4DCUA 1XD2A 3H4MA 3Q7PA 1KI9A 1OYYA 4R98A 3AVXA 2LKDA 1RRFA 3I61A 2XJ9A 3FYHA 4NONA 1KI6A 3ETLA 1E6CA 1YZGA 3IPXA 5FTJA 2C78A 3OAAD 2QRNA 3RS3A 3RSLA 2V4ZA 5E4FA 4QNRA 2GETA 3QPWA 2FFHA 3SS8A 2OCYC 1M7GA 1E9SA 2BMDA 1NI3A 1WB9A 1LF0A 4Q1EA 3W5IA 1VCMA 1GFIA 2ZI7A 4WIAA 5BW8A 3BWDD 1CTQA 5AJXA 2PBRA 1GP2A 3IBGA 4AI6A 1ZVQA 4LUCA 4DLZA 3R9WA 4N3NA 3SI7A 1OH6A 2DCUA 3N5CA 3LBNA 2IYXA 1F6BA 3Q8XB 2Q0HA 1E0JA 2AN9A 4TLBA 3DDCA 2WWHA 4US1R 2CNWD 3QXXA 2VIIA 1GNQA 2BEKA 2WIBA 2ZRPA 4M1KA 1J7KA 3EIEA 4JMPA 2FA9A 3MCAA 4LHYA 1YZTA 5TMPA 1U81A 2VH5R 3PG5A 1AKEA 1YR9A 1HA3A 2W6JD 1OH7A 2ZRBA 2IS6A 2PMDA 3A36A 2OESA 1WCV1 4KFRA 3TLXA 3K1JA 3F8TA 3EWAA 5KSOA 2VHJA 3CRRA 4NBSA 4Q00A 3THOA 4DCVA 2JCSA 2PLRA 4RD3A 4HI0E 1E0KA 2VP0A 4JKIA 1F2TA 4HSEA 5KPJA 1GUAA 2QL6A 3I5XA 1QHHA 4OHZA 2QPOA 4P4UA 2GESA 1ZMXA 2PX0A 2VP5A 3X1ZA 1SVLA 1M7BA 3B78A 1DAMA 5B2ZA 1G3RA 5DN6A 4FCWA 3L8ZA 2EW1A 1NVUQ 4ESHA 3K8YA 1XZQA 2FNAA 3WBKA 2O8FB 5LB2A 2DY1A 1XRJA 1ZW6A 1G8HA 5E95A 4AK9A 4IXNA 4HUQA 4LI0A 3TMKA 2NMVA 2QT1A 3RC3A 4FMBB 2Q3FA 3KKOA 2KBEA 4X8HA 2C98A 1C9KA 1F48A 1Z47A 2FN4A 4XWOA 1DTSA 3LFUA 5GVSA 1E96A 5K8TA 2DB3A 4KXFB 2VBCA 5GADl 1KI3A 4M21A 4M1SA 2RGBA 1D2MA 3NEYA 2VA8A 4EFLA 5JI2E 3HPRA 2X2EA 1ESNA 2F7SA 4DHEA 2E87A 2VQSA 1KOFA 3GLIA 2Q3MA 2BV3A 4G01B 3AVYA 4ZDJA 4HB2A 1G291 3BJIC 1CRPA 3QENA 1H8EA 3CPEA 1I2MA 1SKYB 1S0UA 5B57C 4NMMA 121PA 3C5CA 1G5RA 1VECA 4BFXA 3THXA 1KSJA 1LB1B 1VIAA 2PZEA 3QF7A 4JL6A 1LF5A 4V02A 3PEUA 4D82A 1G8PA 3B9PA 3R8FA 1QBKC 4KVGA 1AJEA 1X3SA 2GXSA 5JI3E 3ND8A 3KQHA 3B9QA 1BO6A 3NHAA 5AJYA 1CXZA 5DSZA 4U7DA 5B58C 3B1XA 3U6KA 1IXSB 1TQ6A 1W0KD 5E3HA 3VR1A 2VP2A 2HEIA 1UPTA 2ZU0C 1GTVA 2YKGA 1JXMA 2BEJA 4GMXA 5FUWA 1DADA 1JR3A 3ADKA 4Q5IA 3X1DA 2CE2X 2BM0A 2DPXA 5HTKA 3UXMA 5LDDC 5HE8A 1GL6A 3E1SA 4O3MA 1GSIA 1XNJA 2ZVPX 3DZ8A 3Q3JB 1SXJE 2BVNA 3FKSA 1ZM7A 4MRRA 3ICQB 2VSOA 2YC2C 2Z0MA 1NIJA 5BXQC 1G20E 3DPUA 1YR7A 2QQ0A 5BWMA 5KNBA 3ZVNA 4QC2A 3EPLA 3R7WA 3P1JA 4BZQA 1JAIA 1TAGA 221PA 3ZS8A 2P6UA 1XTSA 4ZDWA 4MRNA 5L3RA 3RDPA 5FBWB 2Q9CA 3IIKA 4KYUA 3BAFA 4QGAA 3VR4A 1JPJA 1CS4C 3ECCA 3LVQE 2IS1A 4FMCB 4TSFA 3NEJA 1NF3A 4JVNA 4MYCA 4L8GA 4TT3A 5EXSA 2JLWA 5DH9A 1DAKA 3QEOA 1XD2B 2J9RA 1G16A 1R7RA 2A5DA 2ZR7A 3HPQA 4TWZA 3SC3A 4CGZA 2A5YB 3E70C 2H17A 1FP6A 2NZJA 2IL1A 2ZITA 1KY2A 4Q1DA 1LS1A 3GFOA 3LXXA 2GBLA 1KI6B 2KJQA 4KITB 3D7MA 2QMHA 2W0MA 3H86A 4ZDKA 4TMTA 4RSGA 4D4KA 4AIIA 2XSZA 4RCZA 1B0UA 1M74A 1R5BA 2ONKA 4IFEA 4DB4A 2B7BA 3GJ7A 2HJGA 4V0OA 2W00A 4IDPA 3SZRA 1HH4A 3NXSA 3I73A 2X8AA 5KPDA 1W5SA 1MABA 4P3YA 4WBSA 3OE7A 2OM2A 3NVAA 3TIFA 1XXHA 4X8OA 3W6OA 3QXJA 2IT1A 2CCGA 5D3QA 1XMVA 2OBLA 1IN6A 1M1YE 1R8QA 4TMKA 5C4GB 1N0WA 3L43A 1E2GA 2V6JA 3GJXC 4F38A 3SN6A 1PJRA 1ZC4A 3VNVA 1Z0KA 4KFSA 1PUIA 4U00A 1OPXA 3PV0A 5EP1A 1E2MA 2FFQA 2G1KA 4BLOA 2J41A 4LX0A 3Q5EA 2Z43A 1U0LA 1G21E 1S1CA 2R6DA 3EAQA 1GOTA 2YWEA 5J4KA 3KL4A 3VFDA 1XTIA 4GOXA 1D2NA 2G3YA 2IYZA 2D2FA 3AV0B 3DOFA 4OI1A 2EYQA 2QTVB 1U9IA 1UBFA 1E99A 1ZM9A 4OYHA 1F2TB 2CVFA 5FOXA 2FDCA 3P26A 2WAXA 1QHHB 2AD5A 1KJWA 4Q4JA 4WA7A 4HDQB 1FZQA 2OV2A 3LA6A 3ZLJA 5KHOC 5JWRA 3IHLA 2J0VA 1U8YA 3KTAA 3WMEA 1EWQA 1KI4A 2JGNA 1XPOA 2XX3A 4ASUD 2DFTA 4EAQA 3HJNA 1IN7A 2JJ2D 3IBYA 4PPQA 4DSOA 2F55A 1KAOA 3AVTA 3B1WA 2A5FA 2YOGA 1HY3A 5A5GA 1JEEA 2ZRMA 1UADA 4RVCA 1E2PA 5IRCD 1KMHA 2G88A 4TMXA 4OL0A 1LV7A 1RIFA 3ONWA 2H7VA 2Q21A 1YRAA 1W48A 3VQTA 4DKXA 3PR1A 3A4NA 1U94A 1FMLA 3VX3A 1GL9B 5EP2A 5FBLB 2DFLA 2Z4SA 3AP3A 2GBLC 2ZR9A 1N5LA 2REBA 3P4XA 2XZLA 4YMSA 3QVVA 1KNXA 2QM7A 3GFPA 3KJHA 1AKYA 2IXGA 3MUFA 1KZ7B 4NYMQ 1OXSC 1TEVA 4LBVA 1W4CA 4MRPA 3U7EB 2Z83A 1RRCA 3QUSA 4OHYA 2WWWA 4QG7A 2B21A 4JLDA 3WYFA 4QXAA 1T3SA 1T9HA 2FSGA 2WKQA 3HU3A 2YHSA 4EUNA 4F7WA 5DHFA 2EYUA 2WJIA 3V4FA 2ZSAA 4NZYA 5G3ZA 3ZD6A 3VHXA 1XJCA 3WNDA 4B75A 2BMEA 5K8LA 2XB2A 4KSBA 2HJVA 4IOLA 1N5KA 3M0EA 2CCJA 4ZPXA 3V9PA 1CJTC 2OBMA 1Z06A 2QN6A 5FI1B 3B82A 2W6IA 3Q9LA 3UG6A 3K70C 3OEHA 5TY0A 2ERYA 2GJKA 4PAOA 2CCKA 1ZIOA 1OYWA 2FPMA 4QBFA 3OFND 3U2QA 3NC1C 3WP1B 2OG2A 2OEPA 2RGNA 1NKTA 1Q44A 1XTRA 4GOJA 4GZLA 3QPVA 4IKEA 3UMSA 2HCJB 1HQYE 1WBDA 1G17A 1FQJA 1S96A 4EPTA 3MRSA 4B32A 2ZRAA 1FL9A 3L0IB 3QG1A 2Q3HA 1U9IC 4BASA 4M1YA 1P4SA 1NMXA 4MKFA 4TLCA 3LNCA 1HV8A 1X1RA 3R7WB 1S9DA 1Z07A 4PZLA 2IC5A 2FMXA 3U3JA 2NO1A 4BLPA 3IEVA 4Q1AA 1FUKA 1W2GA 5LBIA 1PLKA 2WSSA 3RYTC 2J5XA 1ZNYA 4URYR 4RJLA 3K0AA 4JLNA 4G5RA 4B3DA 4AC9A 3K0FA 3RWOA 1E1RD 3U3MA 3BH6A 4C9BA 1R6BX 1R0YA 5AJWA 2VSXA 1Z3IX 3DMDA 2I4IA 4EJSC 4WOPA 2XEXA 1E9FA 1U99A 1D9ZA 2GJAA 3GJ8A 1KO5A 1VHLA 1X8LA 3GP8A 3FDIA 6Q21A 4PO1A 5FR2A 3BC1A 1CP2A 1MABB 1TTTA 1KK2A 1OSNA 4Z1MA 2IA5A 2J0SA 3FHTA 3PJRA 1XXHB 4G5GA 1JR6A 5IF9A 1Q22A 4P31A 521PA 5L3VA 4V0MA 4ACAA 5E7MA 2G1JA 5L8VA 4OK3A 1YR8A 4Q9IA 3QBTA 4DLSA 1W36C 3E5HA 1SXJD 4A0GA 2NO7A 4WAUA 2QMUA 2G0NA 2B7CA 4HDOB 4XD7D 3EPJA 4GFDA 4A0HA 2C03A 4O2RA 1IAQA 4QOSA 2IYWA 4C2TA 1XZPA 4JLPA 5F2EA 3ZJYA 2CXXA 4XWKA 1US8A 4FI3C 2WJJA 5FL7D 1NVVQ 2XITA 4NE2A 2AD1A 4B2PA 1ZM4A 4IDHA 1JR3E 2OFOA 2JLYA 4TQ9A 1E2EA 1NNEA 2P0EA 5FUYA 3LQQA 5G53C 4OK5A 3ZVLA 5GJVC 2VHQA 4CW7A 1CU1A 2RGNC 3EXAA 2NQ2C 4FXPA 3W3AA 3IUYA 3LX5A 2E9SA 4B33A 5EE3A 1XMJA 1TNDA 4Q4JB 3IQXA 1I4DD 3RSOA 1NJFA 3IEUA 3OIYA 2YINC 3ZZUA 4QGFA 1CR4A 5KYKA 3KTAB 4AURA 2IYRA 2WKRA 4URZR 5IK2D 1NSFA 2QY9A 1TEXA 1ZYUA 4NPHA 3TQCA 3T1VA 1QHNA 4Q02A 2QM8A 5AR1A 2REOA 4JVSB 3GEEA 2DWPA 3RABA 1CJUC 1KMHB 3NIBA 1Q1ZA 2GJ8A 2QSYA 3W8RA 4D80A 3ZQ6A 3J81k 2NIPA 2ZRLA 2KSQA 3FHCB 1TQ2A 3IQWA 2JATA 3WNBA 4MYTA 3LV8A 3TE6A 1XF9A 1B23P 1BOFA 1OHHA 4JYBA 3EZFA 2ZYUX 5CLLA 3N2IA 4LZZA 2FH5B 4IDOA 1D5CA 2ODBA 5FPSA 1ANKA 1KKMA 3OIUA 3IO5A 4JSYA 3FVQA 1DG1G 3JZMA 5FOWA 1SVKA 2GHIA 1KSFX 4GBMA 4UNQA 4LJ7A 2I1VB 3C5HA 1E94E 4OK6A 4YXWD 4D4LA 1P75A 1PUJA 3NBFA 4Q7KA 1W36B 1GZSA 2R8RA 721PA 5G3YA 3ADBA 3IDQA 1IN5A 1E69A 4PAQA 3EZ7A 4OQNA 5SZIA 2OLKA 3ZZ0A 5TVKA 2CK3D 3BGWA 4LV6A 4AYWA 1A7JA 1SHKA 1K6MA 3AP2A 4OQMA 4PR0A 3FE2A 1QRAA 4DBLC 1N3BA 1AIPA 1NSTA 2BMJA 2HT6A 3GLGA 4P33A 5TDHA 1KYIA 1Z6AA 1PLJA 5HZKA 1AS3A 1TUEA 2A5GA 4KBFA 3UATA 3PCRB 4EIWA 3B1VA 2R6FA 3L8YA 1XPUA 3REGA 2EU8A 1J70A 3THWA 1KO8A 1U8ZA 1N25A 1MT0A 2ZRDA 2ZJAA 2ZI5A 1QF9A 2RGCA 2FX3A 4KFUA 1OW3B 3DOEA 1L2TA 2ZRHA 3KXIA 3GCGA 3WHKA 2ZRCA 5HE9A 2ODEA 3SFVA 4EPRA 2ZJ8A 3CRVA 1P9NA 1XU4A 2GNOA 1XPRA 2C99A 4PC7A 4M1OA 4YMVA 2H1LA 3EARA 1Z28A 5AUQA 4GNKA 4MGIR 1VYTA 4HLCA 2YV5A 4LDJA 2YC4C 2CJWA 5H70A 4YDHB 4LJ8A 4TL8A 3CX7A 2FU5C 4HLQB 2V1XA 3EZ6A 1T3LA 3NHBA 4Z54A 3I1FA 4ZKDA 2IW3A 4LJ9A 2ZXUA 2F1IA 1OIVA 2CLDX 2OO7A 2A9KA 2ZS9A 4R2IA 2PX3A 1Q12A 3GJ5A 1OXXK 1RYHA 2RHDA 1XFAA 1W4RA 2MSEB 4ERNA 4ZDIA 3K0AB 4BFUA 3BH0A 4M2LA 4NYIQ 1RZ3A 2L0XA 3MGCA 3ZVRA 3A58B 2A5JA 2QPAA 2RGDA 5JEDA 3BORA 1R0XA 3MWLA 5ELXA 3KXLA 1QG4A 5SZKB 2WMOB 2JLQA 4B48A 4WXPA 1WDTA 4Y0AA 2WWFA 1KO1A 3AKDA 2O0JA 2ZVQX 1ZBDA 4PHTA 5FTKA 3I32A 2CE7A 1VCNA 1YHNA 1AN0A 3TNFA 3VTKA 4DIDA 3GLFA 3U7HB 3MG9A 3B1ZA 4EPXA 3QEJA 4B44A 1Z2AA 4US2R 1VG9B 1EFTA 4CT5A 3W9YA 4DWJA 2GK6A 3WRYC 5KO2A 4C0SA 2D7DA 4CT4B 1IY1A 1JBKA 4POAA 4QFMA 1E0SA 3EWSA 2O0KA 3C14C 5CM9C 5CYOA 2BDTA 2ZRNA 4B3XA 4A1FA 5FBVB 4FWTA 3GEHA 1YE8A 4OQFA 4Q4AA 1X8JA 1P2TA 5SZJA 4A4DA 1IXRC 4HB4A 1XCMA 2MSDB 1F3OA 1G1MA 3AF0A 2OZEA 1E79D 3D8BA 2GA8A 2GJ9A 1KDPA 4X8LA 5DN6D 1US8B 4LJAA 1R4AA 2UKDA 1D6JA 3QXSA 4NYJR 1H8HD 4QJ3A 2IWRA 1R0WA 1S3SA 2VPPA 5AUPB 1MH1A 1JECA 2OAQ1 2BMFA 3CO5A 421PA 3I8SA 2NZ8A 4JLAA 4AKIA 3QKSA 4C30A 3CZPA 1ZNZA 1KTVA 1T8UA 3RNLA 4B2LA 1E9BA 2D3WA 3DM5A 5J4HA 5KNCA 4DXAA 3PITA 4CDGA 5H8WA 4CEJA 4C7OA 3SFZA 4OJKA 2ZJ2A 2G9NA 2IUTA 1PZNA 2OUKA 3HP1A 3ZIAA 4DCNA 1AGPA 4PC2A 3WMFA 4JBWA 3K9NA 3WRXC 3WNCA 3PIRA 3SJZA 5JRJA 2RKOA 2JDID 3GLHE 4LBYA 4LJ4A 4OI0A 4EKDA 1P2SA 4LYAA 4B71A 1CJVC 5CIQA 4BFTA 2IK8A 3B60A 3H1TA 4C0HA 1OB2A 2QNRA 2X1VA 1IN4A 2J7PD 3FHOA 2ZE6A 1YZKA 1L4UA 2BOVA 1N6HA 5DE3A 2WOJA 4HZUA 4TL9A 3C7KA 1T5IA 2ZJ5A 2O52A 1OJLA 4JL5A 2HLDA 3LQRA 4PPGA 4QJ4A 5JCPA 1O3YA 3EW9A 1E2HA 5P21A 5C4MA 2N1BA 1OIWA 4UJ3A 2GXQA 2Q9AA 1CR2A 4PC6A 5BN5A 5L3SA 2OT3B 1Q0UA 2W83A 2J0UB 1NN0A 4HLUA 1P3JA 3LLMA 2GAAA 2WZQA 5TXGA 3U6BA 4PO9A 4LK2A 1JR3D 1GRQA 1GKUB 4LJ5A 4CZ2A 1FPMA 1P5ZB 2QZ4A 4PC3A 3RS4A 2C04A 2DFNA 2WPDA 2B92A 4JBYA 1IM2A 5E7IA 4JVLA 3FKSD 2BJVA 4JIMA 5HCIA 2V1UA 4RY2A 1KK3A 1NBME 2QEQA 5FPYA 2BM1A 1O87A 2WIAA 1SVWA 3NH6A 1HYQA 1X6VA 1XTJA 4DLVA 3BH7A 4K81B 1LW7A 2P5SA 1KI1A 3AGPA 2CLSA 3AKCA 1AM4D 3THWB 2ZJZA 2QU8A 1YJ5A 4RD0A 3DO6A 1ZNWA 2DR3A 4HYYA 5D3MA 2D4HA 3MMPA 2NPFA 5CB8A 2O8CB 1LY1A 2ORIA 1ZP6A 4LV5B 3K0CA 3NH9A 1BMFA 1MKYA 4B35A 3GJ0A 2J3EA 4DLXA 3U7FB 1G5PA 5L3QB 1CLUA 4ARZA 5E7JA 2HCBA 5JSZA 2OSBA 4XOIA 1AK2A 3OAAA 1AZSC 3FFAA 4PZYA 5EE0A 2ZRJA 5HKKD 2CJWB 2QAGA 3QKUA 4PANA 2XSZD 4WW0A 3TSOA 1JALA 4U5XA 2R6CA 4QBIA 3BB3A 2ERXA 3UK6A 2R6GA 4AKGA 5EZ5A 2ZSBA 1XEFA 1JXOA 4KJZA 4A2WA 4B3CA 2JEOA 4IDNA 1VTKA 1NVXQ 3HYRA 4EPVA 2WBLC 3TUIC 3EX7C 5C46F 3MSXA 4PPFA 1P2VA 4ZCMA 1OXTA 2GEDA 3CRW1 2HYIC 4Q4LA 2N46A 1C4OA 4F91B 4R71A 2WWYA 3CPJB 4H9GA 1XD8A 1D9XA 3LX8A 1OLOA 4WVFA 1W49A 1N6KA 2OXCA 4DDVA 3GLFB 1XTKA 2P6RA
chains in the Genus database with same CATH superfamily
4GMKA 1LNZA 1PNRA 1IN8A 3M6LA 1SMKA 3HJGA 1TX4B 4ND8B 4URHA 2WINI 2ZIAA 2O54A 3QSYA 2VF8A 4MP6A 4UTVA 2IXTA 5KYXB 3CVYA 5C8DA 4IIXA 2AOUB 4ILEA 5KWIA 1CKEA 4AY3A 1Q7RA 2FUKA 3ENZA 2RHTA 2KE5A 4PG5A 5CDTA 3ULKA 4RTQA 3EPPA 3QW2A 3D4PA 2ZZKA 1AE1A 4QD3A 1NC3A 2GAOA 2YXEA 3IAUA 3PCTA 5JNSA 3DOOA 1S8FA 1L5HA 4D3SA 2C5GA 1FMJA 5FWXA 3TRFA 4D5EA 5ICMA 2PA3A 1A7AA 3CO0S 2G5GX 3KX2A 1V7ZA 4NICA 4QRHA 2PJZA 3HYLA 4R2XA 2O2YA 4XWYA 2GZDA 1IZYA 2WWXA 4QM7A 1NF8A 2H59A 1V11A 1JE0A 2GYWA 4TL7A 1YSCA 3NU1A 3VOBA 2AGVA 3J81A 1RXVA 2X9GA 2D8MA 4DMCA 3PEWA 4F11A 2XBUA 3KL2A 3CISA 2QVYX 5TC4A 1O96B 3PT5A 4MARA 3DZDA 3KOZA 4QQRA 2C4NA 3LPLA 3LKDA 4BAGA 2PR7A 2H4XA 4C7OB 3C41J 5JS7A 1FP7A 1JG4A 1IXZA 1R37A 4GX0A 4XRGA 1L7VC 4FMDB 5LLDA 2GS9A 3FYDA 3JZIA 4NCBA 2NSJA 3JAMA 2CMDA 1IB6A 1M2WA 4XXHA 3P2IA 4DG5A 1K8YB 3ZGYA 2F3RA 3B2NA 5ULLA 3TZCA 5CFZA 1OFHA 1ZMRA 3ETDA 1ZOLA 3J7TA 1TAQA 4MWDA 4XB6B 2OZLB 3LUJA 5EC8A 5SICE 4RPGA 5SZHB 2ZANA 1JDBC 2IYAA 2FMTA 1I1NA 1ZJJA 3PYMA 4J8PA 5LB4A 5C35A 1SXHA 4BEWA 3FD8A 3Q85A 3EPKA 4QDKA 2O4CA 1JSLA 4B7UA 1OFUA 1Q3KA 1RYFA 4IJMA 4AO8A 1Z29A 4YALA 1NKSA 4EQ6A 1FB5A 1E60A 4M22A 4ESEA 2VI5A 1NI4B 2O3RA 4HEHA 4R1MA 1EWYA 1M34A 4YPFA 5B53A 4AP6A 4LZNA 1PBNA 1Y8CA 1Z0DA 2DBZA 2QTNA 2QZZA 2YIDA 3HP7A 1JDUA 4HZUB 4OFXA 3VO8A 2ASEA 1N5DA 3T5CA 1VSBA 3WYEA 1CDEA 1DBPA 4LJ6A 1OKKA 3LTNC 2GN9A 1L8AA 1KZ9A 2WT4A 3ZWMA 1M72A 2VT7A 2O06A 3GHHA 3P27A 2WLTA 3KOXA 3U49A 2P90A 2A9FA 5B7GA 2RHMA 3UBMA 3RQIA 3LG2A 4XQCA 2XXAA 1DKLA 3Q3VA 4GMDA 3W9UA 4A23A 5L3SB 2AFIE 3K1AA 1NXOA 3OEHD 4D8XA 1HFKA 2RFLA 3AU9A 3RRFA 4DL9A 1I3MA 1JFVA 1IY9A 2NO6A 5LMNB 2WG1A 1Q2XA 4M1TA 3MQ4A 2PKCA 1VA5A 3KZCA 4GQBA 1DO0A 1SCBA 3E18A 3TWOA 2YIVX 1R4NA 3GLSA 2WDZA 4S0XA 1V25A 4F3TA 1L8OA 1ZOPA 2GTIA 5CDFA 3ZBPA 1XMQB 1BTOA 1GEEA 3NKVA 3AHJA 4C0QC 1BWRA 3I2JA 1GN8A 3KUXA 1G8FA 4LISA 4YWHA 1QIJA 3DHYA 3IUJA 4X7PA 5JUWA 5DEIA 3GJ6A 4PF1A 2NOAA 4TKZA 3T1QA 1Z4KA 5EZYF 4EHAA 3WHLA 4CG1A 2QN2A 3EBLA 5CVUA 4ETWA 4F1WA 1G0OA 1G5IA 1TZKA 3DTVA 1I13A 3MWKA 3DT9A 3L6BA 4HUQB 5E8JA 4DLYA 3UWMA 3RAEC 1P18A 1P80A 2CL5A 2X5JO 3EXHC 3GQVA 3I3SR 4JI4B 1WZUA 4C6HA 3A1SA 3E27A 1Y4DE 3N2NA 3H5LA 5IXSA 1ZMBA 1A9OA 3FNFA 2YJTD 1JKJB 1ISFA 3SSNA 3FNQA 2DETA 4G6ZA 3AI1A 5D3MB 5JU6A 3UO8B 3ZGVA 1R6DA 1AUQA 2I8AA 2I6QA 1Z6ZA 3I9KA 1M1UA 3I01M 1MIOB 3S7ZA 1DJMA 1M5TA 4GP7A 4DA4A 3BM5A 1K3TA 5JSUA 4YIKA 1U1DA 4KQ1A 2I4RA 4UNPA 2VXYA 5F51A 5U9CA 5JSZB 4AQYB 3GLKA 5I7OA 2YWHA 4FONA 1NQOA 1C4XA 2OHOA 5D3KA 4B4VA 4ZHSA 1T5LA 1MR3F 1MHPA 4EF5A 4ESVA 4MJXA 1YZQA 3T4EA 3PQ8A 4EVQA 1H0SA 2BISA 2C2ZA 2Z30A 3ANTA 3GDOA 3LPDA 2WVAA 3FTDA 3L01A 3IUBA 1Q5PA 3QLVA 4FEAA 3VPAA 3THXB 1E6WA 4RPKA 4ZOAA 4B1FA 2QA5A 2HF9A 3NUGA 3X2SA 5KDOA 3REFA 1TAHA 1KXJA 1C9YA 4YLEA 4RXUA 2FPGB 3NBMA 3EQ8A 4ZV9A 2WUVA 1DO2A 1RLIA 2AJLI 3LDFA 3VAAA 2IW1A 3EVNA 2HPHA 2ZLBA 5EHXA 3RANA 3BERA 1VSQA 3IPLA 3R3SA 4G24A 1LPSA 1SBTA 1L7QA 2Z3ZA 5JO0A 3IPYA 4WEQA 3ROMA 4R01A 3O03A 5TRTA 4I5FA 3G0GA 3NXKA 3ESZA 3TZEA 3RWMB 2PUHA 4L75A 4B8WA 2BJHA 1I7SB 2QSZA 4UULA 4J6EA 2JLCA 1LCIA 1ZN2A 4HGPA 4TVOA 4BVEA 3ANMA 3G9XA 2HU2A 2Y0CA 1P8JA 5K0NA 1EQUA 1Y63A 4R1OA 1FYVA 4NCXA 3S8YA 1COZA 1HX7A 1BH2A 3OIVA 3IIIA 4LGCA 3S2IA 3R0XA 2VNJA 1TT5A 1G2OA 2NGRA 1Q7BA 1PGPA 2Q49A 4EYSA 5TB5A 2IYSA 2KBFA 2WJGA 4YJ3F 4OATA 2VDJA 2C96A 1JG3A 4S35A 5F5NA 1NRIA 3G6KA 3CNBA 4BFSA 2ZAOA 3ADDA 2V54A 4YXFA 1HDGO 2Z3WA 4Q03A 1XCBA 1X77A 3RTGA 5CPBA 1MT3A 4OTZA 4CUZA 1XAHA 3A2MA 3JYLA 5FWXB 5HA5A 3CF4A 4YACA 1TMOA 3USCS 1UR5A 3SQLA 3WGUA 4M0UA 1KMNA 2IU3A 4PXYA 3MFQA 2JJ2A 4L28A 4QX6A 1EUYA 4K6HA 4RH1A 4LXYA 3AOGA 2VPXA 1FP2A 1YWGO 5H1YA 4TZ0A 1V11B 3F73A 1XQ1A 4PGMA 3KD2A 4JUBA 4QU0A 1FBTA 2QAJA 2GCPA 4WLUA 2GAIA 3DA8A 3N7AA 3M70A 1UBCA 3OF5A 4MH0R 3GLIE 2HSEA 2IPMA 5IAGA 1E2QA 2KWIA 3EF1A 3ST7A 1NDQA 3V7FA 5JSFA 3MJSA 5I7AA 3KEGA 3AIKA 5FULA 2JFVA 5CUQA 3KHKA 1Z6TA 2P9FA 3HN2A 1EM6A 2WF7A 4MGHA 1M2HA 1N2OA 1TM2A 1SU7A 1KEVA 1UJNA 1UMCA 1ZO8A 4N8DA 4W5NA 1JJBA 2YZKA 2R85A 4YRFA 3QKIA 2I4LA 5A4KA 1ZH8A 1X1CA 1CY4A 1K63A 2J5QA 4ENQA 4IKOA 4ZCTA 1OTYA 3VO1A 1R12A 5KQMA 4RK5A 1GPUA 4CM9A 3AVVA 1YCFA 4DPLA 3SVLA 2L82A 3KBOA 1H2RS 4DQVA 1DBVO 1GCUA 3CMMA 4WCFC 5DNVA 1X8KA 3G9TA 3S55A 3K70B 1YS4A 4EQ6B 4F1KA 6REQB 4DCTA 5EJ6A 1YB5A 3ZK8A 1M34B 3VZSA 1IQUA 2JIZD 5D1HA 5EP4A 3Q4GA 1T4DA 2ORVA 1GTSA 1XK7A 3SZGA 1E8NA 1X3LA 2JFQA 3QU7A 1FOEB 2IVFA 1MOPA 3WKEA 4KLAA 3JYPA 1KQPA 1P0CA 2J3MA 1JZSA 2H51A 3BIJA 4A3SA 4FIZA 4INAA 2CNNA 4YBRA 2XXAB 3C16C 5GIOE 2JCXA 1AZWA 3FZQA 3K1AB 3L7DA 5LQUA 1ZM2A 1I1OA 2GKSA 5IVKA 2P91A 3U3XA 1H4VB 3BZBA 3D7NA 3D6MA 2BD0A 3KP1A 1XJWA 5FFMA 5HF5A 4PEVA 4WZAE 3RLIA 1E1QD 3JWJA 5IABA 5IW8A 5DISB 4D0SA 1T24A 2FEAA 2CWWA 2DRIA 3S1AA 1DEXA 4KHPB 1KMCA 4FFSA 4XE5A 1TQ8A 1YZLA 2OKCA 2QQEA 1I6WA 2HBRA 3AFNA 3FMFA 4HEA1 4E5UA 5A5EA 4FGSA 2GF0A 4LYFA 2G9UA 2YOHA 3BJEA 4B6GA 2BCJQ 2AXNA 1U8TA 5KSZA 3DWGA 4MZXA 5EXPA 1DBRA 1LZLA 1RFLA 4EGAA 4G07A 4DADA 1N6IA 2BJWA 4NG4A 3DTVB 2CZCA 1GCAA 3TRJA 4KQCA 4KYIB 2IS4A 2MMCA 2P0YA 2YVLA 1Z7YA 8ADHA 5I4CA 4Z4EA 2ERCA 4KDRA 1GZ4A 2N3ZA 4GXTA 2B8WA 2VBFA 1M1NA 2XAUA 4XR9A 2BL4A 2UUPA 2IOFK 2C07A 4AJ2A 4W5JA 5KYXA 4DLKA 4BGDA 1WQ1R 4Z0HO 3B36A 5AVSA 1RYYA 4KGDA 3EZXA 3PDUA 2ZBDA 3NPAA 5CJ2A 5JAZA 3IQIX 2F8TA 1J1UA 5H02A 2MYTA 3UHOA 3SQOA 4EPRA 4J0CA 3TZLA 3KQUA 2BH2A 1DRVA 3T1HB 4A6XA 1JQ5A 3RFFA 1QDUA 1ZD4A 1O95C 3O73A 3HWRA 2VYQA 2AG6A 2QTLA 3R2JA 2DHRA 3RIMA 3IP8A 4IQ4A 4P0QB 1XD9A 3AB3A 3CSUA 2EIHA 3C8MA 3N3BC 1Z37A 2XUHA 4U7WA 4G1VA 3RS2A 4JKYA 4RTLA 2V7QD 3OSZA 3V4ZA 3PNSA 3SMVA 2NO0A 3RU2A 4C4AA 3R09A 4CJXA 4P81A 1RE1A 3IODA 4K9RA 3NWOA 5EJMA 1XVUA 4PNZA 5AI9A 5ITVA 3ZVMA 1GR0A 3FDFA 4AF8A 2BGJA 2HHAA 5F1KA 3RQSA 4I1YA 3DVQX 2BRUA 3O47A 5BWNA 3QP9A 2ZSFA 3ZEAA 1OFUX 3M4ZA 3WWPA 2YXNA 5B4TA 4DA0A 2WM9B 2QE7A 3FDXA 4D96A 3GPLA 3FOEC 2AW3A 3ILVA 3HJFA 5HHTA 1KYVA 1SVMA 1DIBA 1N8KA 1WZNA 1TXGA 4ZC1A 4Z9YA 3N2KB 4CLXA 4Q9NA 2J9FA 4JHLA 4RK0A 3M1YA 3D2LA 4ZT2A 4DBZA 3LH5A 1P7ZA 2IYFA 3QVMA 5LUAA 3V55A 1KKUA 3L0OA 4H7DA 1RPZA 4O33A 2ARKA 5C8YB 2ZZMA 3D2BA 1GFSA 3THYA 4N1AA 1TT5B 2B35A 1NP7A 3NBXX 2AI2A 5DVZA 4AAYA 1Z0FA 4F8EA 4ZYXA 3CPHA 2GN1A 3CWQA 2RJOA 2OO3A 4D5GA 4KHZA 4TQUS 3FGOA 1E5DA 2A4KA 4ND7A 4ND1A 4RSRA 4YJHA 1JHQA 4LMBA 1PQWA 5K7SA 5EVCA 5A0VA 2R5NA 1WRBA 2O2CA 4M37A 4BJ6A 1W2WB 1AMNA 3IAXA 4EHBA 3T7TA 4BO3A 1N92A 1TQ4A 2IX9A 4MP3A 2NNWB 3A0UA 1N6PA 3KB2A 2RGUA 5IH7A 1NWCA 1XDDA 2G6BA 3C3BA 4AJJA 2PKRA 1M33A 5KNCH 2Y6VA 5ERXA 4YRIA 3TMYA 1GQYA 3D3QA 4Q7LA 2BFMA 2H4FA 3PEVA 1XDWA 4R0VA 5CDSA 1F17A 1R3UA 2XOEA 4IWXA 3PGMA 5FBRB 1U8CB 3KVNA 3OECA 1A8UA 4CKBA 2LE0A 1XYVA 2B83A 3CEMA 4RD4A 2VQFB 3QNUA 5CD1A 1J97A 4X7BA 3WLKX 5EJ8A 4X3OA 4UBLA 1E3MA 3CX6A 3HFRA 1V7CA 3ZDDA 1QU2A 2BTQA 4LCBA 2QD5A 1FNNA 1I4TD 4XGRA 2QYOA 1P9LA 3IVMA 3N2EA 1WR8A 3O0DA 2I2DA 3PXXA 1ODFA 4H3VA 4JX8A 3CW9A 2Q3BA 3E61A 2GBGA 4YT4A 5DI9A 3QEAZ 2E55A 3V9AA 1J9EA 2D1FA 2E5FA 3TZBA 1ZN9A 3CCFA 4OEHA 1QKIA 2XQVA 1UMCB 1TVKA 5J5CA 2CMFA 3VKFA 1AHNA 5EMHA 3EDMA 4BTVA 1EG2A 4DAOA 1IY0A 1NXXA 4N18A 2XRFA 4MYDA 1YKGA 4H4CA 3GGPA 2DSNA 1D7AA 1TKAA 1FYDA 3AUSA 2J6HA 3K9GA 2IYLD 4KNYA 1ZD5A 3EF3A 4IHQA 2D5IA 1E2NA 4A26A 5AKJA 4DDMA 4E6PA 2XMCA 2E4XA 1AMOA 2IITA 1P4RA 3FAKA 3V3TA 1E9CA 4F4FA 3HE3A 3MOGA 3VPFA 3FPSA 4V39A 4CKZA 5L51A 2YWDA 3SLKA 5DHPA 5LYJA 4HH3C 2Z4RA 2JFPA 3SAJA 3CZAA 1IULA 1WB6A 4B6PA 3BSWA 3ND6A 3UYKA 4II7A 1NE7A 1V8DA 3ZK7A 1H3EA 3P9KA 2ORYA 2NYVA 3AX6A 2W11A 3NJ4A 1HNZB 2FN7A 2J46A 4PS0A 4XTCS 3ROGA 3UIEA 3R0IA 2QENA 5EINA 2PUDA 3VNUA 4OB6A 2PMBA 3IUQA 4H7JA 5F5XA 1SVSA 4IINA 2ALJA 5EJFA 3DL2A 3UVEA 5DB4A 1XRLA 2ZBQA 3UV6A 3Q87B 4JQSA 3VBEA 1NJ5A 4DLWA 5JTUA 3PI6A 4BECA 1WXGA 1EQAA 1F20A 3DE1X 2HNKA 4HMOA 3HL4A 4RNCA 2P8JA 4YRRA 1JN0A 2V6GA 3S1AB 4BRSA 4LJKA 3H83A 4XVHA 2NXCA 1KI2A 3WE7A 3WA7A 2CBZA 3IHTA 4LPSA 1DFHA 1ZIXA 4X7RA 1VG0B 4UM7A 1VL2A 3N1UA 4UUPA 1KHTA 1VG8A 2IZZA 3MF4A 4GLOA 5FUBA 3ZBUA 3KEMA 3RNOA 2W22A 3ZWWA 3KC2A 3PPXA 5DNAA 2E4UA 3SIWA 3V7NA 5HRCA 2O7NA 1I2DA 3F6BX 4Z51A 2VCYA 4HWTA 2IDKA 1SCUA 4FP9A 3NEAA 2FPPA 3U13A 3TW6A 3VGJA 5HNKA 5JS6A 4RIEA 1QP4A 4E11A 2Y8EA 4YQEA 2OCPA 1M1NB 2VPTA 4UEOA 1TLFA 1ZJ5A 1DI0A 1U0SY 2F9MA 2G80A 2IXBA 2PTGA 3F5FA 2EX1A 3G1TA 3Q40A 4NDAA 3KUDA 4Y6RA 5TEVA 5JFOA 2PT5A 4E22A 5JJKA 1BVHA 1PZHA 5F2KA 3C15C 1E8DA 5AW1A 1V5FA 1Y3CE 2D2EA 3PA6A 3U80A 3B1KA 3AM4A 4BE9A 4RD2A 3HVRA 1EXDA 3FOWA 3HACA 1EA5A 2Y3IA 3CC8A 4MPDA 4QJ5A 4ZK6A 3OH8A 4ZK2A 2FKNA 5B6PA 2VXCA 4P3PA 1GUDA 1IC6A 2X0EA 3EOAI 3EXFA 3FWYA 1N0VC 2FE4A 4FDMA 3SR0A 2PXAA 1M6HA 2HSWA 1PFVA 2O1EA 3L7YA 2FPSA 1J07A 3CZ9A 3RJTA 4CMJA 1Z18A 4DBVO 3H2HA 3VR3A 4TMWA 4FOOA 1R5NA 1SZPA 2F1RA 3TQFA 2Y68A 3GBPA 1BVRA 3PFIA 4QGHA 4YUWA 4I50A 3VKVA 3WYNA 2ZBFA 2GPNA 1NXTA 1V48A 1K3UB 2GEKA 2PV7A 4J6FA 2VFAA 4XB1A 3EVAA 2HXYA 3CRMA 4JS0A 4QXQA 5TE9A 2XKAA 3EXG2 3GLGB 1Z4QA 2IYUA 3GRAA 3OZRA 3VYVA 4KR3A 2F48A 3O4GA 4X6XA 2E6KA 2WM2A 3CHYA 1COWD 2E5WA 1PL7A 4M0FA 4UMDA 2JAUA 1U7XA 4PVDA 4LOAA 4OMCA 5CVEA 2QTCA 2P3SA 1IQRA 2R6AA 1M75A 2FWMX 2MINA 1K97A 3O7MA 5C5EA 3RTDA 2V97A 1PUXA 4I1OA 4X8MA 1EYZA 3A28A 4ZQEA 5FYQA 1BWPA 3N2YA 1GNSA 2J9FB 1UDWA 3ACBA 3I0NA 3ZHQA 1H8HA 4QPPA 2RSLA 3G49A 3BFKA 3CUWA 1N33B 4M99A 4MICA 4EHNA 2VL7A 4EABA 3QJYA 3BQNB 3I2HA 1A97A 4PV7A 3THYB 3CF2A 4PSAA 3TVDA 2O5RA 1SU8A 1M6EX 3CNEA 5LA6A 4KUHA 3IQEA 2XAAA 3W8FA 2C77A 3NDBB 4NE7A 4XCQA 1UKCA 3SHVA 1J8DA 5FI0B 2H54A 5TMBA 4C0JA 4YJHB 4RKWA 2MMGA 2P40A 1RHRA 4N7JA 1N2IA 3VM6A 5GM1A 1AA9A 1DBIA 2FZVA 4HOYA 2C4UA 5FPTA 2ZYDA 3OESA 4ZGWA 3BK7A 4YUXA 2HEGA 2JARA 5T67A 2CLOB 4I1SA 1B8VA 4MKGA 1ZAKA 1M8KA 1ZI9A 1O5TA 2ZXEA 5EXXA 1XA4A 2AG5A 3QLTA 4PLVA 2XRYA 3K1ZA 1C3LA 1SBZA 2DKNA 2P27A 1BWSA 1QX3A 3N05A 4L8LA 3U7QA 1XMSA 3QYPA 4ENSA 5FDFA 2HMTA 5JECA 5JT1A 4N82A 2XCRB 1VE6A 3WSWA 4CKBB 4M3NA 5G1PA 1QPGA 1AS2A 2O20A 2RAVA 4G8BA 1Y7PA 3UCFA 4B7AA 2Y77A 3TSWA 4U5QA 3HBFA 1Q7TA 2QAIA 2OHFA 3KVRA 3NS7A 4INPA 5EUBA 3T41A 5EJIA 2BTQB 5IN4A 2IZ7A 2Q3DA 2V9ZA 2P67A 3ADOA 3I01A 2YYSA 4MWGA 5DGIA 3LQFA 3NX4A 1Q7GA 4Q16A 3WYGA 3W05A 3II6X 4OUKX 1O6CA 2VSFA 4CI9A 2VLBA 5HR5A 2O07A 4OD0A 3ROEA 3TO5A 5CFNA 1M2FA 2QN9A 4UTRA 4RKQA 1LBHA 1NA5A 1TVKB 3K6KA 5JQGB 5DBFA 2RKBA 4ND2A 3SHWA 5ICSA 4JLVA 3EH1A 5LQJA 2CHEA 2ZJ1A 1Y48E 4EW3A 4LF6B 3I4LA 2P7HA 3TAHA 1FSSA 2FFJA 2K6GA 2RBEA 4LEIA 3ZV6A 4Z4CA 4ZN6A 2B6HA 5FUVA 3X1YA 2AT1A 4YJ2A 3HUEA 4ZVKA 2IHNA 1Q74A 3N2LA 3VHQA 3HS3A 1WQ4A 2YXPX 3UOAB 3LUKA 4UOEA 5FJJA 5GJWC 3PP8A 3S2ZA 3VO2A 3C4JA 3GFTA 1DAGA 4PQRA 3UK0A 3FETA 4EYOA 4ZANA 3LU1A 1HLGA 2BBTA 1JJVA 4PZEA 4BDTA 1DKMA 4Q3OA 3BSFA 2R8XA 5JZ9A 5KOJA 5CLQA 2ZVDA 1R6TA 2CLCX 1F2UA 4P3OA 2I62A 5G0SA 3TW8A 3OQ6A 3SP1A 4XARA 3WJ1A 4HAZA 5CHYA 5FBHA 1CPYA 2QSJA 3WDLA 3L4JA 1IDOA 4DC9A 1EVIA 2BELA 2K5UA 2J3HA 4KCGA 3EHDA 3ER8A 4AJ9A 3VU8A 3LMKA 1EEXB 3ABRB 5BQ5A 3ZU5A 5J2UB 4GMHA 2CVOA 3L1IA 2PZ8A 3AY7A 3DAYA 1SVOA 3HDQA 4Q4DA 4FWBA 1KE1A 1JTEA 5IASA 3DUWA 3HXLA 4X62B 3MJFA 1TYZA 2X9QA 1AKRA 3LLUA 1CNEA 4TTRA 4MGKR 3ZLTA 4R84A 3ONEA 3PGVA 4Y3UA 2X22A 3IKJA 3WXMA 3WAGA 2Y1GA 5HKKA 1PR4A 2BHTA 4DDUA 3OU2A 5IFLA 1ZGZA 3HU5A 2C7RA 2JLVA 4K05A 3EGWA 1W36D 3AT1A 1ESDA 4JDPA 3LJKA 1VCIA 3VJRA 4GOND 1UK6A 4HLDA 5I9BA 4ZT6A 1MA3A 1SCUB 1G9SA 2GN6A 1VDZA 3A0RB 2FPPB 4R9RA 1ZUHA 2PRZA 3ASYA 3G7NA 4LOJA 4AS1A 3PHJA 2V6BA 1SUBA 4YDQA 4JZYA 4MDFA 1AHHA 1XTPA 2AXQA 3B1YA 3AR5A 3T7IA 2J6IA 4W4TA 1XNRB 3PQCA 4OQYA 4AIRA 4F9TA 1Z7EA 1T1RA 1GRVA 1VJ1A 3A1WA 4YUVA 3VNRA 1PS9A 5K1ZA 4BQPA 4OHXA 5AH0A 5EE5B 5MGBA 2P3OA 1C8LA 1Y1QA 3KQKA 2LPMA 4JJKA 1D4FA 3RSQA 1VMDA 2HLPA 2PQ2A 3EBOA 5F21A 2SCUA 2EW8A 1F2DA 2XXJA 3D3NA 2BHNA 1L4LA 4KLCA 3EPHA 1MX9A 3CEJA 1E64A 4C6SA 2ZATA 1DINA 2FUG6 1F8XA 3PUZA 4KQHA 3WNVA 3LY8A 2HO4A 2X23A 3OCJA 2A0KA 2PUCA 1NY6A 1TI7A 3I58A 3I0MA 2D06A 2PQ0A 4M9SA 5CB4A 1GN9A 4DTCA 3EE6A 4Y2GA 4ZO7A 1K5HA 1B1CA 1O4VA 1NY5A 1EA7A 5EKDA 2FWNA 4HAOA 1RQ7A 5EP3A 5F23A 3K0EA 3DEZA 2XUGA 4I50B 3RVOA 5K0LA 2PZMA 4DCGA 3ZCSA 3RTAA 2Y1KA 3OO1A 4F56A 1FRQA 1MO6A 2HH9A 3TNDA 2PEZA 3HYTA 4AMBA 2X9NA 3VU3A 4WBNF 1GTJ1 3AI2A 3VKWA 1Z5UA 2PGNA 3QVUA 4EH1A 3K72B 3NHYA 2MR6A 3QFHA 4KWIA 5IJAA 2XRZA 1E7RA 1GUBA 1GM5A 1WTAA 4MI1A 1QFXA 5JZMA 3TQSA 3ZDBA 2WSSD 3EOZA 4LE0A 4ZCRA 1JAHA 2Q07A 1WULS 4P7BA 4W1PA 2IOFA 4L4SA 2MINB 3PEYA 1Z45A 3BJZA 3LS2A 4LGMA 4BVBA 1MRNA 5CFQA 1HT2E 5KCZA 2VQ6A 1DJQA 5J4VA 1RWPA 1U1IA 1Z5OA 4I9FA 1YU6A 4DM4A 4LF9B 2YOFA 2PPLA 3RHTA 5EZ6B 3WJ2A 2QQ5A 4CKXA 4F4UA 1T8SA 3WK8A 2RGYA 4KU4A 5LZ8A 1QVZA 1A9YA 1B7GO 2FX5A 2PL3A 3KAJA 2BSAA 4PQYA 4TM7A 2FPKA 1GFZA 5LA6B 5EJ4A 1FK8A 3GJTA 1I14A 1UKVY 1TO6A 3N8KA 1RYDA 2VH1A 4KQEA 2F64A 2O23A 4G9EA 3M4XA 3MSCA 1JRLA 3JYNA 3K73O 2R8PA 1VXRA 1JS1X 4CNBA 1PLLA 2XH8A 5B1EA 2QUIA 2G1AA 4EO9A 1UFKA 5JDIC 5A06A 4M36A 1LQTA 2R6ZA 2LV8A 3KQYA 1KH3A 3QX3A 4YJKA 3LUFA 2J7KA 1YR1A 4IO1A 4WKGA 1GSAA 1V16A 1LSOA 4KO3S 4Q37A 5CW1A 5BSFA 1MQAA 3ENWA 3U7QB 1W2HA 2XUIA 5CNJA 5JZVA 4H7KA 5BQPA 3AH8A 3KKMA 3BIOA 3F6EX 2FDRA 3FNGA 3JSXA 3E15A 4I46A 4JL8A 4BFCA 5BWCA 3HY6A 5FH9A 5EIAA 5E4TA 3WG9A 5JALA 2J6CA 1YRQA 1V5GA 2OKGA 1OGJA 4DEXA 5KDDA 4EDHA 2NLOA 2N75A 2ZQ5A 1GV0A 3CUUA 1GLVA 3UJ9A 1GCOA 2YFHA 3L4BC 1PQUA 4QYXA 2HZBA 4F60A 4FSDA 5AW2A 1EZZA 3UXEA 1AQIA 2EX0A 2D2XA 4NHEA 4XRRA 3ZHVA 2XVXA 4ZMBA 1HRKA 4YREA 1EVJA 2ZS8A 1SC1A 1Y7TA 2YRXA 1BA3A 3EPRA 3LGSA 4YRTA 3V1LA 1X7YA 1Z12A 1NASA 1ULSA 3EDOA 1S3FA 2Q7OE 1KEWA 2OXRA 5K6RA 2IHYA 3QX8A 1M67A 3VV2A 2CSUA 3LL7A 5ADWA 2XD9A 3OKFA 3UT0A 3BXPA 5JOQA 4XIJA 2YJZA 4EGQA 2BPOA 2P2CA 4YMTA 1YC2A 3EXHB 4NL4H 1DEAA 1C1YA 3BFXA 3DFKA 4WPGA 3UWPA 4O0LA 1RZRD 5CVVA 5DN9A 4CLDA 4DCSA 4DZZA 3PJEA 1K7XB 3LY7A 1JSCA 4UZFA 4ALNA 2QL7A 5KQSA 1AGXA 1XDSA 3GRRA 2VQDA 3IVAA 3E58A 4PLGA 3NHZA 3ZWKA 3L77A 1YA4A 5IJWA 1KR5A 1PEDA 5KOJB 1TKBA 2VEDA 2I2WA 2ZE7A 3WBJA 1Q0LA 1ZK3A 4I6EA 3ZV3A 5BNTA 4DLAA 4Q3DA 1F2UB 1Y1PA 1KAGA 3WTBA 1Y34E 3HCDA 3TW8B 1RC1A 4D9EA 1WUKS 4MAFA 2HHLA 1A5ZA 1RXWA 2ES4A 2O2GA 2YV1A 1JLKA 1U3VA 2FPLA 4R2HA 2PUAA 2W8BA 5KJFA 1UEIA 2ZW9A 3AIIA 1X38A 2XYVA 3COWA 3L8DA 4MVJI 2Y1CA 3IPRA 3DCNA 2CL0X 2JA1A 4QU5A 2IPLA 3TPZA 5HXAA 3D6VA 4HWKA 3BIWA 4IFBA 5DHAA 4AKEA 1IDN1 3BDAA 4U63A 3LCCA 3V8QA 4ZCQA 4I4NA 4NFHA 5BMVF 1JJ7A 2XDYA 1C8KA 1XZCA 7MHTA 3ZY6A 1YJXA 4Z4GA 4I5GA 1S3GA 3FOAA 4WOKA 2NXNA 3ETHA 5H9VA 4FGJA 4AKHA 4TRJA 1WJGA 4Q9AA 5EMJA 2XI4A 2EKDA 5AW3A 4BEVA 2D5AA 3PEEA 1HT0A 4E3WA 2VF4X 2ECQA 4LJYA 3QEKA 5LDGA 3BTVA 1AQUA 1MRZA 1DUIA 2BFEA 2V7PA 1SXIA 1DG3A 2H92A 2Q5FA 4PYIA 2ORWA 5ED4A 4H4DA 4H77A 2JJ8A 4L08A 3HU2A 2OD9A 4N5MA 4FYWA 4TM8A 3TUZC 1NC1A 2OD7A 5LQCA 3DNMA 4UDNA 2V98A 2XBLA 3OPNA 5K6AC 1AT1A 2YY7A 2WFAA 2BR3A 1W9MA 3EA0A 4UTNA 1JVSA 1DVRA 1QYDA 4FWIB 3ENVA 2H7CA 4IAOA 5J2TF 2ZE5A 3F7NA 3NONA 1CLEA 1S2DA 1ORTA 3FPFA 4KMOA 3RUEA 1NVTA 3RKSA 3PWKA 2GCGA 4DUGA 2SCUB 4PICA 3QOFA 3I6MA 1SCAA 8AT1A 3H3FA 1TB4A 2CDNA 4IP0A 4JUCA 4RHCA 1JYEA 1ACJA 4YNBA 4BMCA 1R64A 2VSNA 3LW7A 2C3YA 4F71A 1OB5A 1DPFA 1FNCA 3OIWA 3AJ9A 4LQLA 4LSZA 4EEXA 1P7VA 2Q5EA 1Y5RA 4C0WA 2ZE8A 4ZKEA 4HV4A 2Q4DA 5KTPA 5CB4B 2L2QA 3IXQA 4MI9A 3PXGA 3P32A 3ESRA 4HH0A 4FJ1A 2F1JA 1A9XA 3OEED 4DWVA 4ML3A 5A4DA 2FOXA 1PT7A 2IBSA 3QMPA 1V4BA 1N8TA 1T4BA 2V3CC 3I53A 2AI3A 2BBSA 3RT9A 3E2PA 2JI4A 5EWLA 1E4YA 4BNNA 3MWJA 4ZJUA 4N40A 2IPAB 2PXCA 4D9GA 2D5BA 5EMNA 1FFAA 4R1LA 4O3FA 3I92A 1YNSA 3C5WP 1T15A 2PVCA 4LPKA 3W4IA 4E03A 2IDMA 5GQSA 2FSPA 3A9WA 3WWZA 4MGZR 1RWBA 3O3CA 1ZIPA 4BP8A 3A1TA 5DW3A 2QKYA 2XXBA 3OT1A 4KB5A 2OPHA 3WL6A 4UHEA 1V96A 4CCYA 1PSDA 1E1RA 3QOYA 5F1PA 1YRWA 3FTQA 2YHUA 5HOEA 3WNQA 4WN3A 1L4MA 3EXG1 4D99A 1EP2B 2LWIA 1QO0A 3O21A 3Q5DA 3BYZA 3BILA 4GPTA 3GPDG 3TBHA 2QZ9A 5K8VA 2WD9A 5ALPA 3UT5A 5JMTA 4RETA 3ZUGA 5JZBA 5CEEA 4OUDA 2OHIA 4Y6OA 3AVUA 2DTEA 4NULA 2AKEA 4MUGA 4BNKA 5LUBA 2HV9A 3BB4A 3IT1A 4REQA 3PGKA 2R68A 2XHZA 1RJWA 5KCMA 2FGJA 4HATA 4RK7A 1IG0A 2EZ4A 1RM4A 2NG1A 4K8RB 4WCFB 3SE0A 3KQNA 2V6IA 3ENQA 2WQZA 1W46A 3TTVA 1C41A 5DNYB 3M82A 5ALOA 3UT6A 5HUJA 2DFVA 4G0UA 2OV1A 3LWNA 4A0SA 2ESRA 2I80A 1V16B 3H4VA 2FWPA 1CQIA 2A0FA 2YJNA 3FUWA 4EFMA 4FD2A 4P7GA 4DNXA 4MLPA 4WXRA 1KRXA 1KHHA 3O91A 3A3OA 1GT6A 1EP9A 2B2XA 4MO2A 4YRPA 1LFDB 2KLHA 3LW8A 1GLNA 4XM2A 3W6NA 4CKEA 3JRWA 4AM8A 4PX2A 2WRZA 3SIPA 4WLEA 4DQXA 1UXHA 1P2UA 3EQ7A 2G1UA 4B6EA 1SHLA 4EG1A 5CAEA 2CHVA 3L2OB 3OM0A 4NCIA 1T5HX 1KOGA 3DMHA 2WHQA 1XX6A 2OFFA 1X2BA 3OT4A 4KRXA 4ZVUA 4C0BA 1PS0A 2J30A 3YASA 4JYZA 3U4DA 1ODLA 1UPBA 4JIGA 5AK4A 2UDPA 2FK7A 5ALKA 3TZQA 4NQRA 2ZEJA 2Z6QA 2V7TA 1RHJA 1YL6A 1ZKMA 1X7YB 4NBTA 1C7IA 3BDVA 3SDZA 2C83A 4FE3A 2FEKA 5CBKA 3QUBA 4G85A 1SPXA 1VKHA 3AM1A 3PE6A 3GGCA 4ZAWA 4GG1A 5I6DA 2PXHA 5EZYA 4M9RA 5KVCA 4BFWA 2Y1XA 5AKYA 4D0NA 2AFHA 3PC4A 3QTBA 3O1IC 1WXIA 4Y0VA 5BSWA 5F52A 2HT1A 1MEEA 4HS4A 4AP9A 1HFJA 1RYBA 1QVVA 4E2YA 1C9MA 1UKAA 3E5RA 1ZD8A 3NYQA 4UU1A 5AUNB 3L02A 1B8UA 3HA3A 4J7XA 4MRVA 2HWKA 1QHSA 5JHHB 4OL9A 2F8MA 1U2PA 3BF7A 1YU9A 1D6MA 3FFTA 3OBIA 4NAUA 3UANA 3OOSA 3SWWA 4G81A 4LDZA 4O02B 3OP4A 2OBFA 1TK3A 3HM9A 3T5DA 3RSZA 1UPUA 1Z2CA 1DDOA 3S99A 2HJRA 2HV8A 2ZRIA 2W8BB 3H5NA 4RPHA 3B13B 3SYMA 5JJCA 4V0QA 4O25A 5L4NA 2PJRA 3UYLA 2ECPA 2W4IA 4QA9A 4WFJA 4MV9A 4RIFA 4Q34A 1FVXA 1QE0A 1UM8A 5D2CA 3UZUA 2AKYA 1YL7A 3DO8A 1KZGB 2PL1A 1PJQA 1AQNA 5JBQA 3PYXA 1UKBA 3GDHA 4UU7A 4YRDA 2E1PA 1JNXX 2BLLA 3DEIA 1T35A 1ZRHA 3MRTA 4R9VA 4BQQA 5CYPA 2X0DA 5TS2A 1WBBA 4BJHB 5K0TA 3WX0A 4I6GA 1YQTA 1RZUA 2OC4A 4XB2A 4XGKA 2WV7A 3TX2A 1U1EA 2C1XA 2GLXA 3PGLA 1JMKC 3ZJ5A 3UJHA 8LDHA 2VCEA 1NLYA 2WKPA 2UUOA 3B5JA 3PUVA 4NZ9A 3G82C 2VUIB 5DM2A 4GU5A 1THMA 1RWNA 1RU3A 2ZT6A 3L92A 4REOA 1JDNA 4J7UA 1Z26A 2BFEB 1XL1A 2C2BA 4WXHA 3UJ7A 4IOJA 1IEQA 3V33A 5I01A 3HGTA 2EV9A