4F4JA

Conversion of the enzyme guanylate kinase into a mitotic spindle orienting protein by a single mutation that inhibits gmp- induced closing
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
189
structure length
189
Chain Sequence
FQGSMSRPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVPSTTRTPRAGEVNGKDYNFVSVDEFKSMIKNNEFIEWAQFSGNYYGSTVASVKQVSKSGKTCILDIDMQGVKSVKAIPELNARFLFIAPPSVEDLKKRLEGRGTETEESINKRLSAAQAELAYAETGAHDKVIVNDDLDKAYKELKDFIFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conversion of the enzyme guanylate kinase into a mitotic-spindle orienting protein by a single mutation that inhibits GMP-induced closing.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords Guanylate kinase
total genus 59
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature ec 2.7.4.8: Guanylate kinase.
pdb deposition date 2012-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 4f4jA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4f4jA01
1J8MF 4PZYA 1VPLA 1PZNA 3GLFA 3JZAA 2QA5A 1B0UA 1IN8A 4OJKA 2V1XA 2XZOA 1Z6XA 3FE2A 5K8LA 3GLIA 4PANA 1FL9A 3KJIA 4WVFA 3CRMA 1QRAA 1ZM2A 3BXZA 3TUZC 3GFPA 3TW4A 4KBFA 1YHNA 1IXZA 4TQUS 2CNWD 3IUYA 5H70A 3IQXA 4EJSC 2ZRBA 2A5FA 3RNLA 1YR8A 4B33A 4PHTA 4GMDA 2H92A 3C15C 1I2DA 3LW7A 5GADl 4A82A 2QQ0A 3K70C 5JZVA 2AFHE 3PEUA 4MKFA 3WHLA 1COWA 2VYFA 4RD2A 5DHFA 1ZNWA 1KKLA 3EAQA 3NIBA 1KMHB 1LB1B 4RD6A 5F9HA 5KDLA 1T8UA 1E2IA 2D2EA 2ORVA 4PPNA 3M6AA 2VHQA 3ZLJA 1RRGA 2BEJA 2C99A 4BZPA 4C9BA 2JLYA 3L0SA 2IXFA 5FL7A 3RANA 2NGRA 2WKQA 4LYJA 1VYVA 1G7SA 2R2AA 3I73A 2BKUA 2RGBA 4D6PA 5K8IA 2PEZA 2P6UA 3AP2A 1JR3A 1TEVA 3MGCA 1DOAA 2WIBA 1NVVR 4TMKA 5L3QA 3ZS8A 4JZKA 4MGIR 2ASEA 4DDVA 1GKUB 1FZQA 2FX3A 1EGAA 2FFHA 2N42A 4BFSA 4NYMR 3H4MA 4KXFB 4PSVA 4TSFA 2NZJA 1UKEA 1FMJA 3C5HA 4PQFA 2V4ZA 4FMCB 2VHUA 5AJXA 3LQRA 2PT7A 4HLQB 1Z2CA 1G19A 1DVRA 4PSKA 2IEYA 1CEEA 2FZ4A 4W5WA 3FKSD 4JLOA 5LDDC 4KLNA 4LUCA 5F9FA 2QENA 1G5PA 1XJQA 4JJZA 2IW3A 3QVVA 4BLOA 5AUPB 4BEJA 4DUGA 2GJ8A 1QHNA 3MWKA 2A5YB 2GWHA 2EWVA 2QAGC 1OB5A 3FHOA 5LB2A 3DZ8A 5JJKA 2GZDA 4BLTA 5KTYA 3CF6R 3KUCA 2F1HA 1ZCBA 5D3QA 1N6LA 2VL7A 1G7TA 2AR7A 4PTLA 2QNRA 5HCNA 4LK2A 1NI3A 1JI0A 1E9SA 2JLRA 3UG7A 3THYB 2BKEA 1DAIA 2RHDA 4JLDA 1G5TA 4UXHA 1J8YF 1KSJA 2IHYA 1D6JA 1T6NA 2WWWA 4P4UA 5F2EA 4LBYA 2HYIC 3NBFA 4F4CA 3UPUA 4V03A 4QM6A 2P3SA 3VHLB 2PEYA 3FMIA 2JLSA 4DZZA 3BORA 1YZGA 3NH9A 1XCPA 2GZAA 1VG8A 3S1AB 2F9MA 1KSFX 3I32A 4G1UC 1FP7A 2XJ4A 1JALA 3AF1A 2EFCB 5HKKA 2ZRMA 2O8FB 3UK6A 1VIAA 2QGZA 3AV0B 2ZRAA 3DVLA 3GEEA 1XWIA 2WSSD 5P21A 1IXSB 2IXGA 4Q48A 1JBKA 2UZIR 2WVJA 3PUXA 3WBJA 1DE0A 2NG1A 4DLTA 5JRZA 3NTUA 1EX7A 3FB4A 4M1SA 1E96A 3BIFA 3B85A 4BFZA 2F55A 5FUXA 5AUNB 5JJLA 2BOVA 5GJCA 1CJUC 4ZKDA 1NJGA 1ZNYA 3SOPA 4BZQA 1GNQA 2H18A 3LAWA 2CLDX 3S1AA 4EJSB 1TUEA 1DEKA 3MRSA 4L9WA 4D80A 5KSZA 2PBRA 2VHTA 1Z28A 4I1SA 4TSFD 4BZXA 4Q4AA 3TUIC 3LX8A 1YQTA 5JWHA 2RHMA 1HV8A 1Z22A 2C78A 3HR8A 3OIWA 2BVNA 4YMWA 1KO5A 1F60A 1LS1A 3QG1A 1P2SA 1PLJA 5TMPA 2FA9A 5DI9A 1IN6A 3LVQE 1CLUA 2EFGA 2PCJA 2YINC 3ZVRA 2CEAA 1KY2A 1W46A 5FOTA 2BJVA 2OLKA 4HAVA 4KVAA 1GTVA 2ZI5A 4EDHA 5EXTA 2A9KA 3Q9LA 1VCMA 5J47A 3B7GA 3CPJB 4JLKA 5BQ5A 1U90A 2FH5B 2QMUA 3VKGA 2ZJ5A 1COWD 4GMXA 3LH5A 1W0KA 3IKJA 3H86A 3TR5A 1E0AA 1SVMA 3A58B 5J4HA 3CR8A 4QJ5A 4PC3A 4YXWA 3GJ3A 4TT3D 3CRVA 4V0KA 4V0MA 4C0BA 4ESHA 3EIHA 1S2MA 2FFQA 4L5BA 4TMWA 5BN5A 3EASA 1G3IA 1U2RA 2GCOB 1E79A 4LI0A 4JLNA 1BMFD 5IK2A 5TVKA 2D7CA 1IAQA 2GA8A 4Q5IA 2GK6A 1E9FA 3QKSB 4URUR 1XTIA 3RRNA 5DH9A 3W5IA 2H5EA 2FPKA 3HDTA 1BYIA 1JQLB 2IYQA 3ZZ0A 3NBXX 4AYWA 2ZITA 1M7HA 1AKEA 1ZYUA 1L7VC 4A0FA 1ZU5A 3ZZTA 2FU5C 1A2KC 5DN6A 1JPJA 3CNOA 2GAOA 2RGCA 3LV8A 1OXUA 1AGPA 4MA4A 4XIGS 4DIDA 1XNJA 3O47A 2J7PD 3VQTA 3LBHA 1NVUQ 3KFVA 3THXB 1UDXA 2AKAB 2RAPA 2D2FA 3WHKA 1H8ED 1JB1A 1AIPA 1GM5A 2QL6A 4PQYA 3QKRB 1OYYA 3T34A 1TNDA 5E7JA 1KK1A 2C04A 1GIAA 2WKRA 1E1QA 3SBEA 3GD7A 2WWHA 1G4AE 2FN4A 1XTKA 3BD9A 3U7GA 3QKSA 3I4LA 2X77A 1ANKA 3ADCA 4AKGA 3C5CA 4F92B 3BRWD 3SN6A 1DG1G 2GRJA 2YYZA 4O2LA 1AM4D 2Q9BA 5TV2A 2DB3A 4KLZA 1SHKA 4QNMA 1YZUA 2ZUBA 1E9CA 3GLGE 1T9HA 1E94E 3BFXA 4RFSA 2ZSDA 1ZUHA 4BLQA 4NONA 3A1SA 1E2FA 2IYVA 4A4DA 1Z6YA 1N25A 4QJ3A 2QU8A 3TMKA 4A1FA 1OF1A 4F38A 2WSMA 5CM8B 4KYUA 1MKYA 2MSDB 3QG5A 1G3MA 4AK9A 3L0IB 4RCYA 3WY9A 1KI1A 3KKNA 2J3EA 1JR3D 3U2QA 2ODNA 4PAOA 4UNSA 1P2TA 2QAGB 2XNDD 3IIMA 1TQ6A 4B76A 1Y3AA 2W6JA 4NP6A 1BS1A 3CX6A 4Y0AA 2NO1A 5CDFA 5KNCA 3HWSA 2V8OA 4B35A 1K5DA 4FWIB 2FF7A 1XJ0A 3MLEA 2XNDA 3EIEA 2CLCX 1AZTA 3VTKA 3GP8A 2F7SA 2A3RA 3U60B 5FTLA 2JLWA 4IEEA 4N0EA 1TU3A 4DCVA 1RRCA 1PJRA 4V02A 3RWMB 4ACBA 3ASZA 5BXQC 1XTRA 1E2KA 4Q02A 2PMKA 2R6FA 4RFVA 2ZRKA 4P4SB 4Q01A 3ND9A 4Q47A 3RSLA 3ZIAD 3BOSA 4E22A 3K09C 1MABB 2BDTA 4R2HA 1NKSA 1O87A 1ZNZA 2YOGA 3GEIA 5LB4A 4M8NE 3CUEF 1CTQA 1IY0A 1KZ7B 2ZPTX 4EKDA 1ZM4A 1OFHA 2C98A 1A2BA 5IF9A 2CJWA 1G8PA 1DAEA 2JJ2D 1CP2A 2J0UA 1NLYA 2QY9A 4LX0A 1NNEA 3PEYA 1Q1EA 3OIVA 1SVOA 2H8KA 5AJYA 4IOKA 3NG1A 4NZYA 5L3RA 4TYNA 4DJTA 2O8DA 3O8DA 4LC0A 4URXR 3AF2A 4OYHA 4L4UA 2F43A 2DR3A 2WOOA 3WNBA 4Q03A 1HURA 2ZTSA 1W5TA 1ZU4A 5L3VA 1XEWX 3W8NA 2OBLA 4HZUB 2WWIA 3EWAA 2GDJA 3CR7A 2QMOA 3BFKA 4QHYA 3RWOA 1G64A 1U0LA 2VEDA 4ZCMA 2F1RA 4A2QA 1DARA 1ZVQA 3C7KA 3AB3A 2XOKD 3QEOA 4DHEA 3NC0C 3K70D 2O8BA 4KU4A 2FE4A 4URYR 2E87A 4OJQA 4MDEA 4RJLA 1E4VA 2BBOA 1Z0FA 2BV3A 1P60A 2P6NA 3H1TA 2P5TB 4XVQA 1GZSA 3P26A 1G7CA 4JL6A 6Q21A 2CLSA 4DSTA 1DAMA 1QBKC 4G0NA 2QPOA 3QBTA 3LDAA 5G3ZA 2WJHA 2H16A 4JBYA 3SJAA 3KQHA 3DHWC 5JRJA 2BMJA 1L2TA 1T3LA 1P75A 3B9QA 1R0YA 3CZPA 4WW0A 3ZQ6A 4A2PA 4A8JB 4YXWD 1R5NA 2HJGA 3QXXA 4ITRC 3HU3A 5CM9C 2C9CA 1Q21A 2VP5A 1AS2A 1WCV1 4JSYA 3RDPA 3BC1A 2G83A 1J70A 1EFUA 2ZI6A 1MO5A 4FMBB 2ZJAA 3IPYA 3SHWA 2DCUA 4ASUA 1XMSA 4W9MC 1IONA 3U5ZB 1P9WA 3RC8A 1ONBA 3BE4A 2JLVA 5KPDA 1WXQA 2OZEA 4W5JA 4B2LA 2A78A 2ZJOA 4NCHA 1OIXA 2HV8A 4Q66C 4B3FX 3F3YA 4DDUA 4AC9A 4V0LA 4HB2A 2DWOA 2ZRPA 1AA9A 3BWDD 3FHTA 1Q3HA 4TZ0A 1GDDA 2CVFA 1XPRA 5FUYA 3G5UA 4JL5A 1SULA 3X1XA 2E1RA 3CLVA 1XPOA 5KUTA 1U9IC 1E0JA 2GXQA 1E2QA 1E2HA 1VMAA 1ZD8A 3KZ1E 4MUAA 1XBTA 1VCOA 2JJ8A 3I1FA 3WYFA 4RKEA 2JLZA 5AK0A 1GITA 3NBYC 3MFYA 4KCGA 3M1IA 3DOEA 5CYOA 2ZQ5A 3WMFA 3MJHA 3RS2A 3NKVA 3X2SA 1HEIA 3OEHA 3THWA 1W36D 2XXAA 2J0SA 5EJEA 4KSCA 1FTSA 1XF9A 2AK2A 4RD1A 5DI3B 3M0EA 4FMDF 3OHMA 3TK1A 1YRBA 3IBGA 2GBLA 3FMOB 1SKYB 3BK7A 4NTZA 5JS8A 4IOMA 3D6TB 3PUZA 3QUSA 5CYPA 1E2NA 1Z6TA 1NBMA 2UKDA 2GEUA 5C46F 3QXSA 1D8TA 2B21A 4AWXA 4GZMA 3U3RA 4IVPA 3O8BA 4QGHA 4V0OA 4X8HA 1FPMA 1XB2A 4YQFA 1XTSA 2OCYC 1M6NA 4M1KA 1MV5A 5BN4A 5M04A 1Q1BA 5EE9A 1UBGA 1XD8A 2HLDA 4E5UA 2ZS9A 4P33A 1RRPA 3LBIA 3SU8A 3GJ0A 1SHZA 5DYGA 3B8HA 3L2OB 4IDPA 4B34A 3V9PA 3ICEA 3AVYA 1F6BA 2XITA 3BB3A 4ASUD 4KJZA 4ZIRB 1KI4A 2QPAA 1OHHD 3IO5A 3K1JA 4QBHA 1W4RA 4JVSB 3ADBA 3MWLA 3QQ5A 5FOWA 2J7KA 1TAGA 3AF0A 5JSZB 5FOVA 2EWWA 4MYCA 4QBIA 4DLRA 5FPYA 2IYSA 1O3YA 1YR9A 5BN3A 1KAGA 2ODBA 1KJWA 3RS0A 1GG2A 2OT3B 2SHKA 3T15A 4B44A 1TQ2A 4GZLA 3GLIE 2AXPA 1E2DA 5AJZA 2IHBA 1YR6A 3O8RA 4Q4AB 1II0A 4G5OA 2ZS7A 3SYKA 2C9YA 2IYZA 2XB4A 1H8HA 1E2MA 5DE3A 3RHFA 3VR5A 1KI9A 1XD2A 5FTKA 2O0KA 1SXJE 2JA1A 2P0EA 4LJ5A 2FG5A 3VX4A 4IDNA 2ORIA 4DUGD 1NG9A 4U02A 4NYIQ 2ONKA 2JEOA 5KHOC 2A5JA 2C5LA 2WWYA 3Q5EA 2J1LA 1S3GA 3IILA 2R62A 4OI1A 4BECA 2YV5A 4XH9B 2ZJZA 2Q3MA 5L3QB 2I3BA 5KSYA 1G17A 1JR6A 1EFTA 4M9XA 2HUPA 3JZMA 5FPTA 3B60A 2VSXA 1W0JD 4BFYA 4KI0A 5K8TA 4TTRA 4L15A 2IF0A 2KBEA 4JLBA 4Q4LA 3FVQA 4RKFA 3VU9B 3B6EA 4B3XA 2BMEA 4DKXA 3KTAA 2G0NA 2VF8A 2J0QA 2W6JD 3NH6A 3QEJA 4UQOA 1SKQA 4TLAA 4M4SA 4BRUA 4L16A 1V43A 3ZD7A 4MKIA 1JPNA 1FW6A 2W6ID 1WDTA 4R98A 1M1YE 3FYHA 4JLVA 3U3OA 1YJ5A 4CGZA 3WP1B 3REFA 3SE0A 3UWOA 2Z5FA 5L3SB 1HT2E 3EA0A 4G5SA 3BJIC 5CK5A 1GSIA 2IC5A 1EFCA 1KSGA 4OQXA 1TQ4A 4JJKA 3AVOA 2IYTA 3BB1A 2ZE5A 3QY0A 4CYMA 2IX3A 1N2CE 4L9SA 4B3BA 1X8KA 2FV8A 1FUUA 5JEEA 4IDQA 2PCLA 3DL0A 2R6AA 4C0LA 1XFAA 3C16C 2G9NA 821PA 2R6DA 1HY3A 4DT1A 3NHBA 2GHIA 2YHSA 1P2VA 3ADKA 1RKBA 4PZZA 3LNCA 1GFIA 1Z08A 4LBVA 2VP9A 5AUOB 1TF7A 2YWFA 4YC7A 2PZGA 4BGDA 2YNMA 3MMPA 1P9RA 3AQ4A 3LA6A 4LRWA 5JWOA 2ZJYA 3VFDA 1KK3A 2D74A 2P67A 3C14C 1Y63A 3SJZA 3IGFA 1GOTA 3K0FA 3P27A 5JWRA 1KDOA 2FEMA 3KXIA 4OK3A 1E9BA 1OIWA 2YKGA 1P6XA 1XMVA 4HAZA 2NZ8A 3IEVA 2DFLA 2FSIA 4R9UC 2IYYA 4Q1BA 2OCAA 1N0WA 4KV9A 1NVWQ 3LLMA 3I8XA 1TADA 4H1VA 1U0HC 3WXMA 4UNRA 3NWJA 4CEIA 1OV4A 3IDQA 1Z0IA 3FTQA 5EE1A 2O5VA 3TSOA 2CJWB 4FCVA 1OXVA 3B9PA 5JS7A 1W0KD 2NPIA 2NOAA 3B5JA 4KAXA 1G6OA 2Q3HA 2IYRA 4D4KA 4BFXA 1CIPA 5CIWA 2W6IA 1FQJA 1AQYA 2QN6A 2FSHA 1QHSA 3IEUA 2JLUA 1VDZA 3L8ZA 4RD4A 4D82A 1NVXQ 2DFKB 1T3HA 4LOAA 4CF7A 1AJEA 2OG2A 1FTNA 3DPUA 3GEHA 3DO6A 4MGKR 1ZMXA 2VA8A 3AVWA 4RZXA 1J90A 1HYQA 2JATA 4CEHA 4M21A 1QHHB 2IK8A 4GOJA 2KI5A 1LF5A 4DDTA 1ZAKA 2OM2A 4Q7MB 3A8TA 3A1UA 4QBGB 3WP0A 1BMFA 4I1OA 5G53C 5IK2D 5EUMA 1SGWA 2ZM5A 4PXAA 3DEFA 2ZR0A 4Q18A 3SHFA 1KDTA 3ZZUA 3I62A 3UMFA 1H8HD 1HE8B 1FX0B 3VR6A 1OKKA 4B3DA 1DAGA 3PJRA 2QT1A 2GNOA 5HZHA 5GVRA 1FQKA 5DI3A 2BBWA 4G5RA 4B2IA 1JQJC 1SVWA 1PV4A 2J9RA 3GJXC 5HR5A 4QNRA 2H7VA 1FMLA 2KBFA 1M7BA 2CHGA 3Q5DA 4P31A 1SXJC 1ZP6A 2ZRJA 2VP4A 2EFDB 3ONWA 3P4YA 3EPJA 2C96A 1RW4A 3GPLA 3TBKA 2GTPA 3QF7A 1WE2A 721PA 2ZRIA 5B2ZA 5FTJA 1XD9A 4PHHA 3LXXA 4ZCIA 4LBZA 1YRAA 1JXMA 1YR7A 2EYQA 1K5GA 4M1WA 4DLXA 4I4LA 3QJYA 2DPXA 5CITA 5IDVA 2IS4A 1NN0A 2OCPA 4LPSA 2C95A 2NO6A 4WXRA 2ZXUA 4BLRA 2E9SA 5G41A 4TMZA 4JLAA 1LV7A 3BAFA 2QTFA 1XRJA 2XGJA 1JECA 5L8VA 3I61A 4OHYA 2PL3A 4PSAA 3DMNA 2PLFA 1PVOA 4YDHB 1SQ5A 4B71A 1RVDA 3DKVA 1KI7A 2QORA 1KI3A 1RJ9A 3C8UA 3TW8B 4TT3A 1MABA 1S1CA 2JJ1A 2ZE8A 4GDFA 3LY5A 4MKGA 4BWYA 5SZKB 2F1JA 2WWXA 4Z54A 1OJLA 2REXB 5J40A 1QVRA 1E0KA 3W3ZB 1Z3IX 1CR0A 2WJYA 3FWYA 1W48A 1NVVQ 2OAP1 1W1WA 1NJFA 1P62B 2OO7A 2WSSA 4H1UA 4BRWA 8OHMA 1KOFA 4MRSA 5TB5A 1ZRHA 2V54A 1WB9A 1NY5A 4ZV4A 1ESNA 2QI9C 3FDIA 3KFXA 4KFSA 4OI2A 4A0GA 2GCNA 3R7WA 2YWGA 2QGNA 2UVQA 4DLVA 5FH9A 2MSCB 5FOSA 4XSHA 4TLDA 1GVNB 2DBYA 2RGDA 4HI0E 5HE9A 2HXSA 3RS4A 3QXCA 1XMIA 1U8YA 4F91B 5DNYB 1Q12A 1Z63A 4PC6A 4Q1FA 4CT4B 2QBYB 3WNDA 1P2UA 4JYCA 4E03A 4TYQA 1XXHB 1UF9A 2FFBA 4I81A 4G01B 2R9VA 1YE8A 1U0JA 1N5IA 4KFTA 5TY0A 1D9ZA 3M4YA 3Q72A 4D4LA 3RVBA 1G291 3PVSA 4F4JA 1W5SA 3KJHA 1V5WA 4Z8YA 2DFNA 2IWRA 4Z1MD 3WYAA 1J2JA 1HQCA 1R8QA 1IY1A 1GL6A 3EZ2A 3W6OA 1ZD1A 4JT4A 2ATXA 3AGQA 5AUQA 4NPHA 1IQPA 3SQXA 1XTQA 4ZIRA 4IDOA 2JJ2A 621PA 4JLMA 3C4JA 4RY2A 4PZLA 5HPYB 2QUZA 2GJAA 1M74A 2BC9A 3GFOA 3U4QA 1R8SA 2NO7A 1N6RA 2J0VA 4LWZA 1N0VC 4HAWA 4FMDB 1XJCA 5HKKD 4PX9A 1IN7A 2F3TA 1US8B 5TARA 3UKDA 4HSEA 5HZKA 4M1MA 1VECA 3ZYCA 3EXAA 4AURA 2IYWA 1E99A 2BCJQ 4AG6A 1H65A 1U99A 5L3SA 4Q4JA 3RS5A 2CHQA 1E79D 4LYFA 5JCPA 4A0HA 4UXJA 3QENA 1K6MA 4EPVA 1FUKA 2RB4A 4POAA 3U61B 2XOKA 4I1UA 2F6RA 5ANRB 4DIEA 1KHTA 1KMQA 2QAJA 1CXZA 4P4TA 4NCNA 4DSNA 1HQYE 2IUTA 2WJGA 4H9GA 2HYDA 4EQ6A 5KYKA 5LD2B 3OAAD 1Q0UA 4PPGA 2RGEA 1YZTA 4B47A 4TL7A 3CKLA 1Z8FA 3ZS9A 2KE5A 4U5XA 1GWNA 3UIEA 1TU4A 1E9DA 1R0WA 2J46A 2RCNA 2W58A 2ZRDA 3X1WA 1E9RA 1VTKA 1RE0A 1Q3TA 2FPLA 2VP6A 2HJVA 5IHPA 4EPYA 1G20E 2X2FA 4ARZB 3RABA 1K8RA 4QG7A 1OPXA 1W4BA 3A37A 4DSOA 5J4LA 3TNFA 4ZPXA 3WYGA 3A6PC 3FFAA 5FBQB 3PUVA 4I1VA 4LHVA 2IBMA 1OFTA 4Q1CA 3OEHD 3K0CC 3HYRA 2PLRA 2ZAMA 4KYIB 2LCFA 4URWR 5SZIA 2OILA 4NYJQ 2QM8A 3IQWA 5D3MB 3KTAB 2ODWA 1T0HB 1II9A 1ESMA 2ERYA 4D2IA 1KO4A 1FNMA 2G88A 1C9KA 4DLUA 4WZAE 5JHHB 4CEIB 1E32A 2J59A 4JMPA 4A15A 4IRUB 4LJ4A 2VSOA 3MAAC 3UATA 4FI3C 2IXEA 1W2HA 2AWNA 2ZUCA 4KSBA 2J87A 4AG5A 3HJNA 2ZEJA 1LNZA 3IHWA 1BOFA 3GLHE 5EXXA 3VR4A 4QHSA 5KNDA 1R6BX 1J7KA 3PUWA 4IVRA 1KMHA 5C4MA 2AFIE 2G1KA 2O0JA 4YMVA 3AVTA 1Z0DA 2IUUA 2EFEB 1SKYE 1UBEA 4NL4H 3KB1A 2EU8A 1GRQA 4EFNA 1NLFA 3SS8A 4JLJA 2HXYA 4BLPA 3K9LA 3TRFA 2R6CA 2UZ3A 2F3RA 4DT1B 4KITB 1QG4A 3ZIAA 4P0TA 2V3CC 3ADDA 4LZZA 3VNVA 1RPZA 2GEVA 4IJMA 1S1MA 2GVDC 1U94A 2ODEA 3WMEA 1Z06A 5AWFC 3SR0A 2R6GA 3W5JA 5EUQB 2DFTA 3E2IA 3T1QA 3R9WA 1KKMA 2HDNB 5FBRB 4K46A 2X8AA 3A1WA 4K81B 4LY6A 4BFVA 5G40A 2XNSA 1N5KA 1SVSA 1I4LD 4XJXA 1FNNA 2A5GA 4IEIA 5J4VA 3P4XA 5KOYA 5CB8A 4B32A 4ZCLA 1SZPA 3K0CA 2ZJ2A 2V6JA 2YWHA 2C03A 3A1TA 3SDZA 1U8AA 2B6HA 1E98A 1MH1A 2QE7D 1QDEA 4F93B 121PA 5FUVA 4CDGA 2QAGA 2W0SA 1U9IA 1BIFA 1DG3A 1T8TA 4MITA 4K8OA 5HE8A 4JKIA 3CWQA 4TLCA 3WNCA 1GNRA 3LWNA 5JJIA 5B64A 3BH0A 3AKYA 4DRZA 2FGJA 1T91A 4DXAA 1Z2AA 3KQLA 5EP3A 2LWIA 1S0UA 2AKYA 4XWAA 5CJPA 4YMSA 2R8RA 4RCZA 1QHXA 2JAQA 1X1RA 1QVAA 4GP6A 4LYHA 3K0SA 3CX8A 2JLQA 3CRRA 3SC3A 2REOA 1NY6A 1G1MA 2LKDA 2WBLC 2Z6VA 3K0EA 1XEFA 5HCIA 1NSFA 5KDDA 2QP9X 2FGKA 3F5FA 1J99A 4V0NA 4A92A 4U7DA 2V6IA 2VSFA 1GRRA 2GBLC 2QZ4A 4Q1DA 3U6BA 3E5HA 2ZE7A 3AEZA 4A8JA 5D3MA 1W36C 2ZVQX 2OUKA 1W7AA 2V55B 4Q9LA 1NG1A 3NXSA 2ZSEA 1MOZA 3HU1A 3I5YA 3HU2A 4FD2A 3RRYA 3RRZA 4RVCA 4IOJA 3K9HA 3MJRA 4Q9KA 4TTPA 2C9OA 4JSTA 3AVUA 1KDRA 2C2HA 1IJEA 4CT5A 3D7MA 2IYXA 3QXHA 5BWMA 3R9IA 2ZSBA 1CU1A 1KI8A 3GQBA 1NRJB 3B1YA 1CJMA 4FW9A 3THWB 5IRCD 1D5CA 1OHHA 1P3JA 4TZ6A 2EW1A 1HT1E 3QF4A 2REBA 3PCRB 3L82B 1FP6A 2J45A 2Q9CA 4M2LA 1OXXK 2ONJA 4OHZA 2JJ1D 2VH5R 2WAXA 1KJZA 2OAQ1 3K0AB 2QTVB 4LYAA 3I8SA 1IXRC 3CIOA 2XZLA 5FTMA 2KJQA 2OXRA 4HB3A 3AKEA 3KKPA 4M1OA 3KDSE 4UNPA 1Q57A 4R71A 3QXJA 1M8PA 1PUJA 2IS1A 2B7BA 1Q20A 1I4DD 2BMFA 2W00A 4HLDA 2DYKA 3I3SR 4ZDJA 2RGAA 4J0QA 1CULC 1HE1C 2L0XA 4HAYA 4G5GA 5EP1A 521PA 1RYHA 3UG6A 1G6HA 2ECKA 3L0OA 5KO2A 3VX3A 3CF0A 2ZUDA 4N3NA 3FFBA 4RD3A 2YOFA 4O3MA 4OQMA 1G21E 3H2YA 2VQSA 1CRPA 1E4YA 1SXJA 5A4JA 2ZREA 5C4GB 4HZUA 2ZIAA 4OI0A 4PO9A 2ZU0C 4ZDWA 3SYNA 1LY1A 2GKSA 2F9LA 4M9QA 3Q7QA 1JEDA 4B75A 4M22A 4BLSA 2OFWA 1QZXA 1RZ3A 4DLSA 1NN3A 5JI2E 5FBVB 1NBMD 3GJ6A 4UXIA 3CWZA 3VKHA 4QC2A 2WICA 2FEOA 2ZRHA 4BASA 5K8UA 1G7RA 1VG0B 1XEXB 3G82C 4HATA 2ZYUX 5JLJA 1YKSA 4MRRA 1S3SA 1EFHA 3MWJA 3MG9A 1S96A 3K8YA 4HB0A 3T1TA 1KSHA 3W6PA 4C0JA 2CCGA 2YC4C 5SZJA 5CJ2A 2X2EA 3PFIA 2FMXA 2W83A 3EZ6A 4BFWA 1TF2A 2H1LA 2WPDA 3VR3A 3EC2A 4M1YA 3TLXA 2PH1A 4CZ2A 3ZVNA 2WPDD 3A1VA 5H68A 1DO2A 4JBWA 4ON9A 2R65A 4ZO4A 1MRNA 5DN6D 1G5RA 1RC8A 3VR2A 3W3AA 4HUQB 1CJVC 2QMHA 1MR3F 4DC9A 2CDNA 3ASYA 1EFRA 3CX7A 1XP8A 4A8JC 1Z0KA 1TX4B 1II8B 3B82A 5LBIA 4AYXA 1XXHA 4ZKEA 2D3WA 1HH4A 2ZROA 4DCUA 1OFUX 3W34A 4MGZR 1MRSA 2WKPA 3KJGA 5F3WB 4D0NA 1G3UA 2VP2A 4DEXA 3SJCA 1W49A 2GAAA 2D4HA 3EW9A 2WIAA 2XJ9A 3GJ8A 4LJYA 3N70A 5EE3A 3ZVLA 4IW3B 4PQRA 1GL7A 3EPLA 1JAHA 5FBLB 4Q1EA 2D62A 4LJ7A 1Z6GA 1HTWA 1NKTA 3E1SA 1Q1ZA 3BH7A 3K0AA 2ZI3A 2H57A 1ZIOA 3P32A 3CPHA 5UKDA 3DMDA 1M34E 3OIYA 2HT6A 3NHAA 1Q44A 4LJ9A 4BQSA 1ZM7A 2ZYWX 4GOXA 1IOZA 3RS3A 1ZBDA 4FMCF 1OXTA 3ZVMA 4OK6A 4S2EA 1WA5A 2OFOA 2Q6TA 3WRXC 4LJ6A 1W4AA 4MYUA 1WP9A 2PZEA 5JCZA 1G3QA 1UKYA 2NO0A 3U44B 1P61B 5CLLA 3AKCA 2ZANA 2OCBA 1RIFA 2RGNC 1ELOA 4PAQA 2G3YA 1W2GA 2PJRA 4D4MA 1G8FA 1AKYA 3SZRA 1VHLA 3DDCA 5B58C 1DS6A 4C0AC 2YOHA 1XTJA 1ETUA 1MO6A 1OKKD 3VMFA 3WRYC 4U00A 4XOIA 1KTVA 1F2UA 1X3SA 4C30A 1S9HA 1ODFA 4KODA 2QM7A 3O8CA 2Q0HA 2YWEA 5FR1A 2VHJA 4TLBA 3GLGA 4Q4HA 4LV5B 2Z4RA 2GCPA 3NEJA 1KNQA 5KSOA 2NIPA 4KO8A 1N6NA 3OE7D 4MRNA 1FX0A 1R5OA 4KFUA 2GJSA 4DLZA 3T5GA 3GJ7A 4AKHA 2RKOA 1W36B 2EFHB 1N3BA 4QJ4A 4B2PA 1UM8A 2QSZA 2WWFA 3QNUA 1DAFA 2FWRA 1D2EA 4B74A 1KO1A 4GFDA 2QG6A 3DOFA 2GXUA 3Q85A 1ZINA 1YU9A 3ZH9B 3KKMA 3ETLA 4NCJA 1SVIA 4C0HA 2PX0A 1NIJA 4WOPA 1CJTC 4ZI2A 2P6RA 4M0LA 4GBMA 4QGAA 1AQUA 1SVKA 4CW7A 3CO5A 3TSWA 3DM5A 1FOEB 1E1RD 4P3YA 2D7DA 2ZYTX 5TXGA 1U81A 3FKSA 3C41J 3IPXA 1E3MA 1P72A 3P1JA 1LFDB 3FKQA 2W0MA 1GUAA 2WV9A 2BMDA 5J4YA 5JMTA 1UAAA 2F43B 2H17A 2IUSA 4XSGA 5JEDA 1KI6B 3X1YA 2CVHA 2DWPA 3T1OA 3A36A 2CL0X 4W7SA 1GP2A 3TSZA 4OL0A 1D2MA 4G3XA 3FMFA 3H84A 2RGNA 4Q00A 2ZETA 1PUIA 3Q3JB 2YVUA 1C4OA 4UJ5A 3KJEA 2LKCA 2WOJA 4LHWA 4YONB 1Z6AA 1VYUA 4YLGA 4NHOA 4TMVA 3K9NA 2QTHA 3QPVA 5FFMA 2G77B 4US0R 4II7A 4PC1A 4LCBA 3OFND 4DB4A 4O25A 4OBEA 3CZQA 2QRZA 3W9YA 2EVWX 4Q9JA 4TQ9A 2OHFA 2CHVA 2FOLA 1N5LA 2KB0A 4MGYR 5GJWC 4QRHA 4TLEA 2EYUA 4X8LA 5AJWA 4HDQB 3LQQA 2JASA 3ZDQA 1OE0A 2PJZA 2ERXA 2BHRA 4GRAA 4QM7A 3PEVA 4JVLA 2AD1A 1MT0A 3TQFA 3AM1A 3R7WB 4C0KA 4R7ZA 2Z0MA 1F5NA 1TTTA 5J4KA 2K5UA 3EARA 4EPRA 4DCNA 4TTQA 4AI6A 3LFUA 1OH5A 1BH2A 2WJJA 2A30A 1I2MA 1GAJA 2ANBA 3HYTA 5EP4A 1WMSA 3BFVA 5A5GA 1CRQA 1ZUNB 3HPQA 4CEHB 3HP1A 5SZHB 1S4QA 1H8EA 2ZI9A 3AP1A 3CRW1 5DYIA 2RMKA 4KBGA 4QFMA 2V1UA 4AKIA 1R5BA 1CR2A 1KIMA 2WMNB 4IDHA 3R8CA 3X1DA 4HAUA 2IWHA 4HZIA 4RZ3A 3W90A 1N6HA 4MKHA 4XWKA 421PA 1KI2A 3L0PA 4DWJA 4MRVA 4DDWA 2ZR9A 3EPHA 3U7HB 1EWRA 2OSBA 1XXHE 2AHOA 2N1BA 1A5TA 1RYFA 4QGGA 3PG5A 4DBLC 2ZE6A 5EXSA 3UWKA 3QSYA 3EZ9A 3T12A 3LXRA 1Z29A 3T1VA 1JEEA 4B73A 1UADA 3KXLA 4M1TA 2O52A 1I4TD 1S8FA 5CLQA 4BEBA 1IJFA 4DSUA 5JSZA 2W2XA 2A5DA 2ZSFA 4FINA 3X1ZA 4BFUA 5C18A 3HR7A 3D31A 5FI0B 1ZCAA 1E9AA 5KSPA 1UEIA 4GPTA 3KL4A 4M9ZA 4NMMA 1UEJA 4RFSB 2OLJA 2OXCA 1JNYA 5GJBA 1NLZA 4ERNA 2AWOA 1DELA 2WAYA 4D26A 1IBRA 2MMGA 2QRNA 5HTKA 4HUTA 1X8JA 4OQNA 4D0LB 2HCJB 5E7IA 2QP3A 4IVQA 1W44A 4IOLA 4Q21A 5DISB 2ZS8A 2ZRGA 3CNLA 3UMRA 4HEJA 1KDPA 4DVGA 1WF3A 3KKOA 1E0SA 4MRPA 2VTKA 3GLFE 4RSGA 3QKUA 1IN4A 1GL9B 2ORWA 4NDZA 1ZD9A 3LVRE 2BIFA 4Y0VA 5JHGB 4LV6A 4TWZA 2G1JA 3ND8A 5DHAA 3NC1C 4GOKA 2IF2A 1EXMA 2GVZC 1G8HA 4LBWA 2O8CB 3AH8A 1L4UA 4IKEA 1GKYA 5BYJA 2AK3A 1LF0A 4TYPA 3EZFA 1NP6A 2WMOB 4LGMA 4Q9IA 5J5CA 4C0SA 2J41A 1CR4A 2GXSA 4MH0R 5IT5A 3NDBB 2HF9A 4OI4A 1LTQA 3HPRA 4XTRA 3VNUA 3CM0A 4OK5A 2WZQA 3CH5A 3THOA 1N6KA 3ECCA 2X19A 2VRWA 2O8DB 2V7QD 3A4MA 2Z4SA 4QOSA 4C7OA 1KO7A 2J7PA 3UANA 2FPMA 2P65A 3ZD6A 3FPAA 3RC3A 3REGA 4PO8A 3GLHA 2ZRNA 1E1RA 1GRNA 1YZQA 4Q9HA 1WBDA 2Y8EA 4TL8A 3U3KA 3WMGA 2O8CA 2Q21A 3GFTA 3KXKA 2QBYA 4XD7D 3PITA 3UXMA 4WIAA 1AZSC 4B6FA 1OH8A 3EG5A 1G8YA 3GLGB 2O8BB 1JXOA 2FJUA 1W4CA 4YMUA 3LBNA 4EPTA 1T0JB 2VLIA 5FI1B 1XDBA 3N5CA 1OW3B 4JL8A 5B30A 1DAKA 1AGRA 3IIJA 1BO6A 3N2IA 4Q7LA 1PLLA 3QVUA 2DY1A 2IS2A 2GETA 1T5IA 3PUYA 4WAUA 1R0ZA 4AD8A 3NVAA 3LW8A 4TN1A 1AK2A 2BBSA 3BB4A 4JBXA 3AUXA 4NCKA 4URVR 1OH6A 4G5QA 1E2JA 4EQ6B 4N1AA 3FHCB 1XEWY 3NDPA 1N5JA 4NYIR 4A2WA 1A4RA 1VCIA 4LSGA 1G9XA 3JVVA 3U3MA 4EAQA 1UDWA 1WBBA 3CB4A 4JYBA 2G6BA 2FFAA 4Q4HB 1TQDA 5EQTA 2ZYVX 3A4NA 4LPKA 4TMXA 4NCIA 1BKDR 4QGFA 5DGXA 2WTUA 2QEQA 4QHTA 1QG2A 3THYA 3R8FA 1CR1A 2B92A 1OH7A 2AD5A 3OFNA 1TL7C 4TYYA 1N6PA 3LX5A 1RFLA 2CE7A 3CBQA 1BYUA 2MSEB 5DIFA 4Z51A 1E2LA 1DAHA 1NMZA 1Q1QA 4A0RA 4NYJR 5DLQC 1NIPA 3TJZA 3B78A 3GJ5A 3OZXA 4AYTA 2PX3A 2W2VA 3IO3A 2R44A 4A9AA 3TGPA 3F0TA 4E07A 2O8EA 1CF4A 4E09A 3AP3A 2O0HA 3AGPA 3Q8XB 4F4IA 1KYIA 2GESA 4XWOA 2NO9A 5KPJA 1NMYA 4TMTA 5FOUA 2FNAA 3EIQA 4IXMA 1ZC4A 2BWJA 2GF0A 2CK3D 4PR0A 2WWGA 2CBZA 1B23P 2I1VB 4MUBA 1R10A 2IS6A 3V4FA 1SXJB 1E2EA 2QE7A 2ZU6A 4UJ3A 3B1XA 3EX7C 1IY2A 1UPTA 4DLYA 3B2EA 4S35A 1UBCA 1X86B 2GXAA 1QHIA 4Q19A 1X6VA 1WRBA 1W47A 4LDJA 1XD2B 2MMCA 2NPFA 1F2TA 3U4QB 1OB2A 4C2UA 1G18A 3OEEA 2VP0A 2P5SA 3TVDA 1NL3A 1LW7A 5FPKA 3EZ7A 3UMSA 2JLXA 4HDOB 1UKZA 3B1WA 2B7CA 4ACAA 3VHXA 4AKEA 5JI3E 4NBSA 2ZJ8A 3SJBA 3MWYW 1QF9A 5BW8A 4FN5A 1Z47A 3B1ZA 1N0UA 4B3GA 2WHXA 4PPFA 1FFHA 3W8RA 5EZ6B 4WZBE 2HCBA 3FGNA 5EE5B 4D0GA 1NF3A 4Z8XA 1XX6A 3RLFA 5H8WA 4JT2A 3IBYA 3K53A 4EFLA 1KO8A 4D81A 3VKWA 1RJ9B 1KK0A 4Q7JB 2CMKA 5CIQA 1EK0A 4X8MA 2YZ2A 1C1YA 3GCGA 3GLHB 1ZIPA 1F2UB 2BM1A 2A2ZA 1OSNA 3N2EA 4KVGA 3GLFB 3FOZA 5F98A 2YJTD 2ZI7A 3TR0A 5TDHA 1U8ZA 3KX2A 5JBQA 2Z83A 5JECA 1E2PA 3QBVA 4ILEA 4IFEA 3I72A 4JIMA 3PR1A 1GKIA 3QKTA 4LHZA 2VPPA 3CONA 2X1VA 3ICQB 1P4SA 3QIAA 2GZHA 3SNHA 2GF9A 3FMPB 1KAOA 3TVTA 3L8YA 5AJVB 1DPFA 1T4GA 1KI6A 3PQCA 3PV0A 4PPQA 4RZ2A 4EUNA 3E70C 4LHXA 4WXPA 5LPNA 5H1YA 1NBME 4ESVA 2IYLD 2WJIA 3KQKA 2HT1A 3QOFA 2ATVA 3T35A 3Q7PA 4P4SA 1JJ7A 3J81k 2IEZA 4LV8B 2I4IA 1ZJ6A 1UBFA 4GP7A 3QI2A 4LHYA 4F7WA 3T5DA 2IA5A 1N6OA 5EP2A 2QP4A 1E9EA 3TH5A 1GNPA 1YZLA 1VHTA 1Z07A 2ZAOA 4NKRA 4V0ME 1DBSA 1TUIA 1Q22A 1KJYA 2O8EB 1IHUA 4TL6A 3EPKA 3GMTA 4QL3A 2J0UB 3JVUA 3IHLA 1NSTA 5KU1A 2DHRA 1R0XA 4URZR 2CK3A 2RH5A 4EPWA 1DADA 2XX3A 3TAHA 3IIKA 1SVLA 1R7RA 4WBSA 1N6IA 3AVVA 1UKVY 3K0FB 5CK4A 1XU4A 5KDOA 1OT3A 2Z43A 4RZUA 2XZPA 5E4FA 2YC2C 3AF3A 4NE2A 1IM2A 5C1BA 2CL6X 3B1VA 3MUFA 4Q1AA 3CH4B 5EXPA 3SFZA 5E95A 1ZM9A 4DCTA 2FSFA 1XCMA 3V4RA 1W0JA 3EWSA 2QQEA 3PENA 1CBUA 1G8GA 3CF2A 3QPUA 4NYMQ 3RS7A 4DCSA 3DM9B 4GI7A 4PO1A 1LVGA 1DO0A 1P73A 2WM9B 4OKSA 1OIVA 4OQLA 3DZDA 4MYTA 4PAMA 3DKPA 4L8GA 4HLUA 4HLUC 4GL2A 1RRFA 4NH0A 1KNXA 5JFGA 221PA 2BJWA 3W6NA 3KQNA 4C7OB 1IN5A 2OV2A 2NQ2C 3P20A 3SEAA 3U6KA 1OYWA 4XD7A 2B8WA 2WJVA 4WA7A 2VO1A 5A0FA 4QBFA 2ANCA 3AKDA 3SFVA 4EPXA 3SYLA 5CB6A 1NN5A 1LS6A 1US8A 1VG9B 2ZJBA 3ZGXA 5AR1A 2CL7X 3RYTC 1E2GA 1GILA 2OE2A 3OF5A 4AIIA 4N0DA 3EC1A 4JVNA 5FUWA 3U3JA 2J5XA 4Q4JB 3QE0A 2XB2A 1S9DA 2XTMA 2D06A 4M53A 3BGWA 1A1VA 4O2RA 2O8FA 1F3OA 5EE0A 1MO3A 3TUJC 3K70B 2I1QA 1KY3A 2BM0A 4MYHA 3SI7A 1AS0A 2GJ9A 4QKQA 5GVSA 4ZI3A 5CDFE 4UNNA 2CCKA 2QSYA 4GNKA 2ZSAA 3D3QA 3SQWA 2Q9AA 2ZRLA 3CPEA 4FXPA 4B6EA 3U7EB 1AN0A 1A82A 1JAIA 3A4LA 1T5LA 2XAUA 4KFRA 2VF7A 4FCTA 1F48A 1HUQA 3RRMA 3ZJYA 4US2R 2VHCA 2CNWA 3BS4A 3T06B 1PLKA 4C2TA 1UFQA 4B3CA 4TQAA 2HLDD 1P7CA 1XZPA 5GJVC 3KB2A 1X1SA 4PC7A 2JDIA 3OEED 5ELXA 4CIDA 1U98A 1DTSA 4LC1A 1II8A 5B57C 2AN9A 4HB4A 1L8QA 2JDID 2CCJA 3RAPR 2QMEA 1NN1A 3AVXA 4JKYA 2W2TA 1E6CA 1VIYA 4BUJA 3F8TA 4LJAA 1JJVA 2GEDA 3V00A 2XXAB 2ZI4A 2XEXA 4FCWA 1TPZA 3OIUA 1CKEA 4PFSA 1ZNXA 1G4UR 3OE7A 3QF4B 3PIRA 2BBTA 4Z1MA 1ZC3A 5FBWB 1G41A 2GCOA 3G0HA 4OQFA 4MQBA 1X8LA 1OXSC 4WZ6A 1WQ1R 3BERA 2NTYC 2RGGA 4OHWA 2OBMA 1ZW6A 5FPSA 1ZUIA 1G16A 4BPBA 3PEWA 4C0QC 3GLIB 4C4PA 1D9XA 3I5XA 5C2JB 4DB2A 1MO4A 4XVRA 2ZRCA 3AF4A 5FL3A 2QT0A 3CNNA 2FZLA 1EX6A 3MSXA 4GT1A 3L43A 1A7JA 2A7QA 2BEKA 2IL1A 4HLCA 4UKDA 3NEYA 1TMKA 3WBKA 2AL7A 1R4AA 4PC2A 2OBNA 3THXA 1QHGA 2OFXA 1M2OB 3AUYA 1EESA 1P5ZB 4XTCS 2P2LA 5KNBA 1VCNA 1D2NA 3B13B 3VAAA 4A6PA 3U44A 4BFTA 4CEJB 3BH6A 5E7MA 2ZVPX 2HF8A 1L4YA 1ZM3A 3LLUA 3NBZC 4IFBA 3PXGA 4A36A 3VR1A 2B8TA 1KZGB 1XCGB 2AXNA 4R2IA 4A6XA 3BBPA 5FOXA 4X8OA 4I99A 2TMKA 3T61A 3TE6A 1CS4C 1Z83A 2EQBA 4NU0A 2PMDA 2OEPA 1XEXA 3OAAA 4ZDKA 5DSZA 1TEXA 2ZRFA 1VYTA 3TKLA 2IYUA 2IT1A 4Q7KA 5EZ5A 4ABYA 1YZNA 2BCGY 4HDCA 2PT5A 4D25A 2C77A 3H0KA 1YVDA 4D4JA 2G0TA 1E69A 4B48A 1XZQA 2C8VA 1QHYA 3CRQA 3QKRA 3LO5A 4PHGA 1XPUA 1P9NA 2JCSA 2CE2X 4O0MA 3SBDA 5E3HA 2N46A 4DLWA 2VBCA 3LRPA 4KHZA 1G3RA 3R20A 4MDFA 3D8BA 1HA3A 2Q3FA 3MCAA 2OESA 3EA5A 4AY2A 1VG1A 1EFRD 4GSYA 5LD2C 2GK7A 2QPTA 2XTZA 4FWTA 1M7GA 4JLPA 2GJKA 3KQUA 4HYYA 1VKJA 5FTNA 4EJSA 3CW2A 4IHQA 2VIIA 2JGNA 2KWIA 3KUDA 2GILA 4OHVA 1T3SA 2ZR7A 1KGDA 1EWQA 4M9SA 4YDSA 2KSQA 4IXNA 1OLOA 3QPWA 4CRWB 2V9PA 4EFMA 2HEIA 2XTNA 4QXAA 4BE7B 1CJKC 3K9GA 4PHFA 4W5HA 1KK2A 4HAXA 2V7QA 1F2TB 4OHXA 5DO9A 3R9XA 1E1QD 4XVUA 3I92A 4HUQA 1Z5ZA 4JVMA 2RGXA 1TF5A 3U7FB 2FDCA 4RD0A 4TYWA 1QHHA 3KKQA 3TAUA 4US1R 4EIWA 2FSGA 3TQCA 4FIDA 4JS0A 5BYKA 5FPHA 4C3ZA 5FL7D 3K09A 4DEYA 3RSOA 2XSZA 2F1IA 2CXXA 2PZFA 4UNQA 2AX4A 4B43A 2NMVA 3MD0A 1AS3A 3OESA 2JIZA 1R2QA 2QROA 4P32A 4TL9A 1OFIA 4CVNA 1JR3E 4ZDIA 1SXJD 5G3YA 2JIZD 2DWQA 4YMTA 4ARZA 1YZKA 3AVPA 1UJ2A 1NMXA 3AVQA 2XSZD 3TIFA 1EG7A 1XMJA 1Z0JA 4LJ8A 3VU9A 1Z0AA 5FR2A 3ZQJA 4CEJA 3GJ4A 3LD9A
chains in the Genus database with same CATH superfamily
4B9AA 4LZNA 1V2GA 2YFKA 1RKUA 3ZDAA 1IN8A 2XZOA 1XCOA 1JAYA 4Z6KA 2EJCA 1FL9A 4WVFA 4P9NA 4X3PA 4EATA 3TUZC 1V48A 2GLTA 3GFPA 3TW4A 3OLXA 1SXIA 1IXZA 2PX5A 3EVEA 4NU8X 4RLQA 3IUYA 5H70A 3IQXA 3KT3A 1AKTA 2ZRBA 4LXHA 3RNLA 4BBJA 2Z8XA 2HK9A 4QQNA 1V8BA 4PHTA 4RHUA 4CM9A 3C15C 3MWDA 4W1RA 3LW7A 1NBAA 4D46A 4J2TA 4A82A 2GYYA 3ABSB 1KFCB 3FH0A 4M7RA 2AFHE 4EUHA 4MX8A 4EW1A 3WHLA 2VYFA 1A4UA 4RD2A 4NICA 3WBFA 1LB1B 4FFPA 3B52X 2HQRA 3AERB 5G0WA 1HE2A 3VM6A 3AF5A 3LCRA 3R0JA 1QH9A 4C9BA 1AV7A 5DULA 2BDEA 2NGRA 1F6WA 2WKQA 3QQPA 1VYVA 4QULA 4QELA 4MVJA 2XA2A 2VDWB 4R69A 2RGBA 4P53A 2GPYA 1TEVA 1DOAA 2Z58A 1K06A 4KAJA 2LUOA 1JDSA 2HCFA 4MS1A 4C2AA 3ZS8A 4ND8B 1E7QA 4QBKA 1CQIB 2CZGA 1F4LA 1EGAA 1SKMA 1Q7RA 1C4XA 3R3XA 4HDNA 2X1HA 2E6UX 4PSVA 3DTVD 4TSFA 1KETA 2W11A 3PVZA 1T6BY 2NZJA 1FW8A 1UKEA 5FA8A 4DMLA 2QUIA 2J32A 2V0GA 1LEHA 4PQFA 2V4ZA 4RMNA 1IZ8A 2ZBEA 3ITEA 3L9WA 3ME5A 4J0FA 4P08A 3ZDXB 3LQRA 1A76A 4HLQB 2WJAA 4MB2A 5I4KA 3UT6A 3S1SA 1DVRA 4PSKA 4MROA 5E9JA 1Q1AA 2PRYA 4W5WA 4IDGA 4JJEA 2NVBA 3FKSD 3ICCA 4YROA 5LDDC 5F9FA 5DBHX 2ADOA 3RROA 1XJQA 4MEBA 4JOBA 5IW8A 4BMNA 1STOA 4EAAA 5IMSA 1PTKA 5IBCA 1QF6A 1RABA 2GWHA 3FI9A 3L0YA 3S0JA 1OB5A 5JJKA 4OQDA 1UUFA 3DZ8A 5LB2A 1Y37A 2IKQA 3HKCB 4H0FA 2I99A 3HXLA 3OQBA 4G63A 1UDBA 5IWAB 4FX5A 1H2AS 1N6LA 2WTXA 1RRKA 4MVJM 1UM9A 3W6UA 2ZJ6A 2WMYA 4DMMA 3FX2A 1BHQ1 3NHMA 4XJTA 2JW5A 3H1EA 4GWLA 2Q1WA 1M34A 1FU7A 4QYIA 5ALHA 1YOVA 2IHYA 2RHLA 1U2TA 1XZMA 5ALYA 2HYIC 1Y3BE 4AJ1A 2BD0A 5BSWA 3NS7A 4TVOA 3UPUA 4QM6A 5KHLB 2P3SA 3VHLB 3CY6A 1UXHA 2XB8A 3GOQA 3RASA 3TBHA 4N8DA 4DZZA 1DT3A 1OI7A 4G4IA 1AN9A 4CT0A 1PR3A 1ZW1A 3ONEA 3HXKA 4YAEA 3EIWA 4X64B 4Z4IA 3TMYA 2HCRA 1P0PA 3GDHA 1HX7A 3R40A 3IEPA 2GZAA 4L8FA 1NVGA 1QGUA 1CJCA 3E9ZA 3H9CA 3S1AB 3F73A 1E3WB 1QS0A 3CNHA 5JQGF 1KSFX 1WZIA 4FBMA 1N2HA 3EMVA 2O8NA 3BREA 1U7XA 2HWYA 4CHTA 1PHRA 5K0FA 1PNRA 3DE0X 3ZLTA 1DEHA 5B1SA 4N39A 4LE1A 5I9BA 4G97A 1FNSA 3E9CA 3ZKWB 2M6SA 1P1JA 1YK1A 5EMLA 3EIXA 1X7YA 2ZRAA 1PS8A 1SD5A 1XWIA 5P21A 5BUCA 3LXMA 1IXSB 1EEXB 1QYXA 2C42A 2IXGA 2ECPA 2ZDGA 3PNSA 3DBIA 4TTJA 3WBJA 3WGVA 1DE0A 3ZY3A 3Q15C 9GPBA 3NTUA 4U6SA 3RYIB 3M6VA 1ADBA 2Y0BA 3FB4A 1PEAA 5KTSA 1I2CA 1T5DX 1JB9A 2FXVA 4BFZA 2Q4RA 5CXSA 4YUAA 2FLKA 2C9ZA 4XVRA 4LC9A 2BOVA 5T67A 1OASA 5GJCA 2MCFA 1VE5A 4ALIA 3H18A 3BXFA 4NMXB 1GNQA 2H18A 4BZQA 2G9UA 1K27A 2FUKA 4RMIA 3RIHA 2CLDX 4MW6A 2QTNA 3UMMA 4Z0NA 1TUEA 1EBFA 5C8YA 4FOPA 3V2GA 4DDMA 4JJAA 3JAKA 1KIAA 3SZLA 1NJ6A 4R1SA 5BVGB 1FJ2A 3QY9A 5KSZA 1Y5LA 1IQUA 4PS1A 5IM4F 3TUIC 3LX8A 4P92A 5JWHA 4OHOA 2QL9A 3LHFA 3AQIA 2XKBA 4QXQA 1X42A 2IDZA 1HV8A 1Z22A 2C78A 3HR8A 1C7JA 4GS5A 2VG8A 3Q4GA 4EM6A 4YMWA 5EJ6A 1KO5A 3WGQA 4RTKA 1JFTA 1LS1A 3T1HB 3QG1A 2IY9A 2P68A 1J1ZA 1UQRA 1P2SA 3K05A 1UXJA 3HNRA 4IX1A 4P82A 1ZMTA 4IHKA 4P3OA 4DYHA 3LVQE 1CLUA 4YRDA 4EEZA 5BNTA 2YINC 3W5VA 3H1GA 3JYLA 1N1GA 1CY8A 3OA0A 4U0JA 3UJDA 5CGQB 3K2BA 2BJVA 5FOTA 4EDHA 4EBBA 3BHNA 4UTPA 1G55A 4PNHA 4F7DA 2HBRA 1FS5A 5AW2A 2VS1A 2WTMA 2A9KA 1G66A 1VCMA 3Q9LA 3DLHA 5KYXB 1R3DA 3OCVA 1U90A 3ROPA 1RC0A 2FH5B 2QAIA 3L8FA 4ZRDA 2QMUA 5JRDS 3GNQA 5KTKA 5A3SA 3VKGA 4GMXA 1YMVA 3L05A 3RTEA 3UJ9A 3VPHA 3QPBA 1W0KA 3BM5A 3BWMA 3IKJA 4MWBA 5AHOA 4AY4A 4CTJA 3CR8A 1QO9A 3KOWA 1R6TA 4MMYB 4PC3A 5GV7A 2HQ1A 5BMOA 4WZAB 1Q1NA 1ULUA 1F2DA 1PV2A 3EIHA 4L5BA 2FFQA 4AN4A 1Q0TA 2ZBRA 3SSNA 1U2RA 3D2LA 2Y2VA 3CCFA 3MJSA 4JLNA 4QYIB 5IK2A 4ENQA 5BPHA 1L6IA 3FSRA 1YL6A 2GA8A 4DQVA 4E5NA 4AWBA 3K16A 1I94B 3OIDA 5CVUA 1QC5A 3DZKA 2Y1OA 3GYBA 3HJTA 1EHCA 2P40A 4LSMA 3MRTA 2RARA 3VZRA 5E6UB 4MTLA 1M7HA 5H16A 2DUWA 1ZYUA 2CFRA 3L07A 1ZU5A 1C9JA 1ILEA 2YWRA 1I4WA 1JPJA 4DUPA 4AY6A 3LV8A 4RHXA 1OXUA 1AGPA 2BGKA 4C6TA 3O8QA 4R6WA 3E0XA 2J7PD 1EQ2A 3CINA 3O3MB 1PSDA 1PK9A 4CTNA 4V1CI 4OUDA 2W2NA 3JPWA 3WHKA 1JB1A 5F3DA 2UYQA 1HE3A 4XZ3A 1OYYA 4MW2A 5JARA 3L7MA 1REQB 1JHDA 3WGIA 3J7AC 4J4HA 5HS6A 2QK4A 2ALJA 3I6QA 2HRBA 2BUBA 3F9CA 4Q3EA 1ESCA 5HNKA 1CZNA 2K6GA 2FN4A 3PHLA 2V7GA 1A9SA 1K8ZB 1QIEA 1MUUA 3BIWA 2Q5HA 3QKSA 5BXYA 2OK7A 1XQ6A 3KJXA 1EUDA 4ETWA 4TRMA 3DAHA 3ORRA 3T0IA 3GJZA 5TV2A 3HK2A 1SHKA 2ZUBA 3PQ5A 4F8JA 2XQGA 1Q0ZA 4EW2A 1Z5VA 2VYCA 3A1SA 1E2FA 2RAFA 3CKKA 2FQXA 1N25A 2IPLA 3R76A 5ECYA 4EJMA 4BGUA 2C5AA 3Q1KA 4M7OA 4QJ3A 2QU8A 5KWVA 3AFOA 1OF1A 4F38A 1FBTA 3I2JA 3P0EA 4EHIA 1S2NA 1U1IA 4KYUA 3OLYA 3CEHA 1GD1O 2B0JA 3Q9UA 1Q84A 2X5OA 1GU1A 1TW3A 3OTGA 4RCYA 4TKUB 4AK9A 4C7BA 1Y1PA 5JCJD 2J3EA 5K4GA 3U2QA 3OLCX 3FR8A 3HUDA 2HCTA 1EG2A 4UHBA 4K9LA 1ZNQO 4DDHA 2WD7B 2Y0PA 3NO4A 1ZKDA 5TPWA 4DJEC 1K7CA 2PX8A 2PY6A 1D8AA 1OMOA 5KNCA 3N53A 2EDAA 4ZAXA 2V8OA 1NR5A 2GERA 1XJ0A 4BEWA 4PGHA 3PNYA 3RVNA 1JWBB 2VPIA 2ADMA 5CA1F 2Q07A 2YYSA 3MAGA 3TS1A 1T1RA 1U8CB 2EHDA 3VNRA 2ZRQA 3I9V1 3EIEA 3TB6A 5KVCA 1AZTA 3VTKA 3GP8A 2XUFA 2J5RA 1LJUA 4HQLA 3SQNA 4BVGA 3WA6A 4IQGA 3IEKA 3SLKA 5C8ZA 4AMYA 3LC0A 3SE7A 3TOZA 1PJRA 4GKJB 4PEVA 5GWXA 4ACBA 2PKXA 4BP9A 4XX0B 3ZDYB 2WINI 2F8LA 2LW7A 2VHWA 2R6FA 4DNOA 4J29A 4ZVKA 1TM1E 2QG9A 4Q01A 3L3BA 3T99A 1FFYA 1DPGA 1JQDA 2E37A 3BOSA 3I37X 2YRFA 4OXKA 3KB8A 2QJTA 1RJFA 1MABB 3JD4A 3WK4A 1KZHA 4BC0A 1ZNZA 1P7PA 3GEIA 3PKZA 2QZZA 5B3JA 2ZAYA 2A94A 4GU5A 4H2DA 3ZOKA 4Z3OA 2ZPTX 1LSSA 4IF4A 4CIVA 1CF2O 2C98A 1A2BA 3TX6A 1FNBA 1BMTA 2JJ2D 5ALLA 4UCWA 2K2WA 3COVA 5FPQA 4DHWA 1ZD4A 1Q1EA 2P79A 3B6JA 2VRBA 3HV0A 4ZK6A 1XMQB 3TGLA 4RLHA 4D8WA 3O8DA 2X6TA 4GVLA 1YNSA 2WW8A 1QHFA 4OYHA 3UWSA 1ZGZA 3PSAA 1B7GO 4ZA2A 3QWAA 3D6HA 2PKYX 3KPWA 3KKLA 2AMVA 3OZAA 4CKBA 3MBKA 3D43A 1HURA 4YASA 4L7QA 1HEUA 4MEJA 1VB5A 1Z2EA 7MDHA 4IQFA 4JYPA 1A8QA 1HL7A 4XQ9A 4FFBB 4D4IA 1EYZA 3BHJA 1ICIA 3CLUC 1DBRA 3N2NA 2QN8A 3NT2A 5B2FA 3FLBA 5FHRA 2X40A 5IKEA 2RHHA 1UOEA 1GPBA 5HS4A 4DRYA 3U7QA 3C7KA 4B8ZA 3AB3A 4OATA 1QE3A 2NP6A 3QEOA 5AKIA 4AZSA 3UMJA 1LSOA 4GM0A 5LJIA 3A1CA 4TTVA 5FNVF 3F7MA 3MT0A 1H3FA 4MUFA 4YR9A 3TF5A 4MDEA 1PJQA 3S5UA 1CFZA 5LD2B 1OTHA 3L7AA 4EKGA 1LSJA 2FUCA 3CHYA 4YRIA 1GZSA 4CHGA 1YS2X 4G6ZA 4BN5A 3FCSB 4E70A 2EQ5A 1CVLA 3DWGA 2CLSA 4UREA 4GAEA 3BG5A 3RIYA 3BWYA 2C1ZA 5FWYA 4KIUA 3KQHA 3SJAA 5JVDF 1N2IA 2CXOA 2GO1A 2ZIFA 4YYZA 1WUYA 1RP1A 5LOVF 3R7NA 2ZUFA 4BY9E 3GUHA 1T3LA 5G2OA 3ZGYA 3FNFA 2YWXA 4WW0A 3H7IA 3ZV5A 2Q1SA 4A8JB 1R5NA 2VC2B 3ZD8A 2PUGA 2CHUA 4RVSA 5CM9C 5HRUA 3A70A 3MGAA 3F1LA 2VP5A 1AS2A 2F3PA 5A3JA 3RBXA 2OWDA 5JNRA 3AR8A 5DYYA 4UARA 4S1OA 4KUHA 2YIDA 3REOA 2IITA 1H6CA 4J0IA 2Q6OA 2D54A 4PFJA 3SHWA 4AQDA 1A9XA 4ASUA 4W9MC 3RC8A 1ONBA 1QCCA 2WHPA 2G07A 2IVZA 3EFOA 5U4QA 1D1QA 1K5PA 1FRNA 3OJ0A 1WXQA 3R4CA 1H05A 1XNGA 2FOIA 4Y9DA 1TA4A 2A78A 2GM9A 4HLNA 1OIXA 2X9VA 4FHZA 1XRRA 3HLTA 4FN4A 4DDUA 4R7GA 1DP4A 4AC9A 3F74A 2DWOA 5F52A 1AA9A 4NENA 1C3OA 1OX5A 1JJAA 4OF4A 5E2AA 4QXPA 1Q3HA 1CX9B 5BSRA 3OEWA 3V4ZA 16PKA 4OUKX 4B5LA 4ER3A 4C06A 1EAYA 1FXWF 3RK0A 4JU8A 1DCKA 3MS2A 1E2QA 8MHTA 3QU7A 3RAJA 5JDCC 4F5EA 1ZD8A 3KZ1E 4I4CA 4MI9A 4LDNA 1DIRA 2PPVA 4DJ5X 2WB4A 1ZZGA 2FSVC 1P18A 1VCOA 4B6JA 2JLZA 5F64A 3R5KA 4AQ7A 4JXZA 1B8NA 3M1IA 3N2KB 1GSOA 3DOEA 1O96B 4JI7B 3NKVA 1D2HA 2WWTA 4JUCA 1RBMA 1Y7PA 2PVCA 1E6WA 5AOVA 3O2JA 1NP7A 1QQ7A 4P2GA 5GIPE 3UWMA 4Q82A 1XF9A 3F5SA 3FJOA 5K03A 5DI3B 3VGJA 4QTYA 2GBGA 1TI7A 3JCZA 1YRBA 1KBOA 3UUEA 5CBPA 3TECE 3KSDO 2ONYA 1U3TA 2GBLA 4JASB 4BX9A 4XIIA 5A1JA 5J5AA 5C1DA 1JBQA 3ZXYA 3QUSA 2DH5A 2VSNA 4B85A 4QYSA 4J49A 3QLVA 1OU0A 3LTEA 4UUNA 3ROEA 2B21A 4D9EA 4YRAA 4GZMA 2FW7A 1W5AA 4IVPA 1SB8A 1YDEA 4V0OA 4DQDA 4X8HA 4Y2UA 4F1JA 1NLMA 1VSUA 2R4UA 1XB2A 4YQFA 5LSAA 4Q3NA 1T25A 2RH4A 1GUDA 4M1KA 3V7YA 4RNCA 5IS2A 2MWMA 3QE3A 5HIKA 1BWSA 2XR1A 1XD8A 4WOBA 4XFKA 4NV3A 1XHFA 1SUSA 1D3AA 1U0FA 3UXHA 5JJBA 4HZGA 4KDCA 1SHZA 1X7HA 2JGEA 3HHEA 1DKUA 1JHYA 1TCUA 3AFHA 3R7BA 1G8MA 2P9ZA 1VDMA 2WJ4A 4ND3A 2NVUB 2N47A 3NDRA 2CNLA 5CURA 1L8XA 4ASUD 1T4BA 5FWYB 2W4MA 4BKMA 3RD5A 1WHSA 3S81A 3JYOA 1ND5A 3IO5A 3K1JA 1W4RA 2WF8A 4JVSB 1ZH6A 2VSYA 5AHXA 1QYVA 3PSHA 5A6SB 3CZ9A 1W59A 3AF0A 3S8EA 5FOVA 4MYCA 1ODCA 2I87A 4M8SA 1SCUB 3NGLA 4OFZA 5FPYA 3H9UA 2IYSA 1XQVA 5DZSA 1KAGA 4Y2YA 5HVNA 3H9GA 4JC4A 3JAKB 1KZ9A 1EVJA 1T3GA 4GZLA 1JR2A 2AXPA 1W1UA 3ZI4A 4MJ7A 5SYNA 1EX9A 1YR6A 2AEFA 3O8RA 5CW1A 2Z5GA 5CXXA 3UK0A 2F8TA 1JSZA 3DOUA 1EP2B 3SYKA 4CQMB 3JX9A 1M6VB 2G63A 1M34B 2WIDA 3UK2A 3ET5A 3M6LA 2CSUA 5AXDA 3TB4A 3HO8A 3WL7A 4EKEA 4CU2A 1EEHA 3I6BA 1KI9A 1XD2A 1TU0A 2O0KA 3JWGA 1DMSA 1UZLA 2PVPA 3NGXA 5E2BA 3D5QA 1HEYA 4FFMA 4LJKA 3RYHA 3VX4A 1B6GA 4EEXA 2J9FB 3K5HA 1Y9AA 1XN1A 2HBQA 2HMYB 2WVHA 3OCXA 1ZJZA 4FYXA 4XGRA 3DOCA 1QGUB 1F5SA 3OQVA 4IIBA 4NABA 5DXAA 2GAFA 5KHOC 3NOOA 2WWYA 2Q3JA 3Q40A 4EYEA 1GLGA 1I2BA 1BDMA 2POCA 2R62A 3F97A 1EUZA 1GCGA 1OBVA 2D1RA 2YV5A 4Z9AA 5BPFA 2CV1A 3BGVA 3DZFA 2ZJZA 4IYJA 5DX0A 5L3QB 5KSYA 2ZP1A 2VKQA 1G17A 1JR6A 1WKVA 1ENZA 5HFAA 2X3UA 5TT0A 1IM5A 3UAWA 1W0JD 4CM1A 1HDRA 1HWYA 1LLUA 3IVAA 4TTRA 4AX4A 4BJ6A 4CTKA 5LDHA 2IF0A 2KBEA 2R00C 5F2KA 2BH9A 3EIFA 4Y2RA 4RKFA 4AJOA 1GPYA 2YDYA 4L57A 2QVCA 3KTAA 1ECBA 1JKIA 2DKOA 3KCQA 3NH6A 4UHFA 4NOLA 4TLAA 2G80A 4X54A 1QLWA 1R88A 3FRIA 2A9OA 4Z9YA 4F9FA 3FOCA 3WWYA 3ZIUA 3E9DA 4Y6QA 2BGWA 2HIAA 2WU4A 3ZD7A 3SEZA 1FW6A 2W6ID 4UDXX 5D87A 2CN1A 5C8YB 3FYHA 4JLVA 1YJ5A 1T2EA 4O6VA 1XHEA 3DTYA 5K20A 5JD6A 5L3SB 3EA0A 2Q6VA 4FVTA 4F3YA 3OU7A 4Y6SA 1HETA 2W6QA 2HMAA 2X4IA 2XNHA 1NX6A 3AHHA 3ZHTA 3CFYA 4YT4A 4AXXA 5EIBD 1OLUB 2AMYA 2VDQB 3AVOA 4FLMA 2K7FA 1IAVA 2F3QA 2X3FA 2ZE5A 3UMCA 4L27A 5DNWA 1N7GA 3KRTA 1LX7A 4L9SA 4LIPD 4IICA 4B3XA 1QGZA 2J9GA 3G1TA 2A7XA 2ZAGA 3DL0A 4NOKA 1K3FA 5EWMB 3KOXA 1TRKA 4LQDA 3DNPA 4FD3A 4PX3A 5AW3A 4EMUA 3FPLA 5IMBA 4DT1A 1MHTA 1KJQA 2GHIA 4N47A 1YGPA 2P9EA 1NURA 3QMWA 1YFKA 3ADKA 4PZZA 3LNCA 1J8FA 4PS0A 2ZYRA 3G6KA 4CDMA 5LYJB 3CO0S 3QITA 4BMSA 4Y3UA 2PZGA 3PGVA 4K9RA 2YNMA 2YMLA 3PI6A 3MMPA 3DOHA 3DNFA 5ALZA 5JWOA 1YJXA 1XYGA 2P67A 1E0DA 5EESA 4ZOBA 1JHOA 3AI3A 3ZKWA 3B9BA 1J5PA 1E1MA 4PTZA 4ZAWA 3P27A 4NPCA 5EZSA 3WOVA 1XP5A 3AWIA 4JDUA 3KPYA 3LUFA 2YKGA 4WQMA 4G0OA 2OCKA 2NZ8A 3URMA 3LGSA 1IN1A 4AUKA 2IYYA 2R1VB 2OCAA 1QKIA 1N0WA 4NBUA 3DHVA 3EB9A 4WINA 1NVKA 1HKHA 1QGYA 1TADA 1TK3A 1USVA 2FPIB 3IS3A 3KEGA 3RG2A 4UHDA 4CUZA 1P2BA 1RM0A 3WXMA 4UNRA 2CV2A 3WMWA 3IDQA 1NQ5A 1TTQB 5EE1A 3TSOA 2CJWB 1X1DA 4DKJA 1R00A 1QIGA 3D6VA 4KBYA 4C6TB 5JS7A 3OH8A 1W0KD 1NRIA 3OIFA 1WP4A 5G1NA 2QLFA 3BAZA 4B6RA 2JH9A 3B5JA 4KAXA 1G6OA 3CX3A 1QZ3A 1Z8NA 3W1EA 4MWDA 4D4KA 5L6LB 5FWDA 1MFZA 2W6IA 4EG4A 4EHFA 5DB4A 3T9FA 4X7MA 5A9SA 1UBHS 1QQ6A 1DAPA 1QHSA 3FSGA 4F45A 3A4YA 4D82A 5TR9A 3Q0IA 4LOAA 2WFMA 1TEHA 1T9CA 3MB8A 2OCDA 4OSPA 1AJEA 1B0ZA 3DPUA 2B4YA 4MGKR 1O0SA 1UMCB 3OJWA 2NSYA 1U4NA 2O7SA 1X7GA 3M1AA 2YJ6A 4YDRA 4IVNA 4ND4A 1SCNE 4JC0A 2V7WA 1XZLA 2EW8A 1JEAA 1QHHB 2OB2A 4BO1A 4IG9A 3ESXA 4FS3A 3ZVKA 4Q7MB 3A8TA 3UJHA 3WP0A 3WLFA 1BMFA 1UBKS 2X13A 1I2AA 4I1OA 4NESA 5EUMA 3H2HA 1WXEA 5DYNA 5KYXA 4IWXA 2O5CA 1YAJA 4FYWA 1KDTA 5E8RA 3QTTA 3SHFA 3UMFA 1KARA 3A04A 3QYPA 4B3DA 1DAGA 2AJ8A 2GNOA 1AC5A 1GQYA 4J1QA 3VZCA 4MV9A 4RW0A 3PLNA 1PJ3A 3FGOA 2WE7A 2ZSUA 5F1YA 2O19A 5EKXA 4GMGA 3B48A 3B3GA 4R51A 1FLAA 2H7VA 2KBFA 3Q5DA 4DMRA 3GFBA 4ISCA 2P78A 1ZP6A 3B53X 1OFGA 3H8JA 2C96A 1RW4A 2YVAA 3PDWA 1WE2A 3L9XA 1N8SA 1P6QA 3G5MA 1WZ2A 2VDNB 1QE5A 3UMVA 1O8BA 2QSJA 1XD9A 3UBMA 5JC1A 2LP4Y 3IBTA 2F64A 1JXMA 3EH2A 3QFHA 3AYXB 4Y8VA 2F3UA 1Q2UA 2XMDA 3KXDA 4ZQBA 4H6WA 3W5DA 3BA6A 5CITA 2EQAA 2O5EA 1SU8A 3VPBA 3FYUA 3PTAA 4FR0A 2B2CA 2C7OA 1WB9A 2PO7A 3OY2A 3HJCA 4LY0A 3UWDA 1RRVA 2OBFA 5G41A 1KRXA 1X7YB 1U9YA 4JLAA 4K9PA 4ZRMA 3V5NA 1T9AA 1J0DA 1B16A 1F4PA 1TYDE 4ZALA 4A03A 1ZFNA 1L4EA 5D1HA 1KDVA 4YRZA 3ZU2A 4RY9A 1NXOA 2PGIA 1Y1QA 1AXGA 1I9CA 3KOOA 1RQPA 2OSVA 2C3UA 2PLFA 3DMNA 5I47A 4B71A 4EA9A 4F56A 1RVDA 1PBNA 4OGFA 6REQA 4C4XA 1S1CA 4GDFA 4YO7A 4AUNA 1QGAA 3LY5A 4UTNA 1QORA 4KE6A 5KVVA 4WCVA 1EUDB 2REXB 3SLRA 5J63A 1VSVA 5EFOA 5LWQA 3ASUA 1CR0A 2WJYA 3LY7A 4QPCA 2JLCA 2R7KA 1IRIA 1IDN1 3MM4A 1MDBA 1U4SA 4YYEA 1GAQA 1W1WA 1P62B 2OAP1 2OO7A 4YR7A 1HLDA 2WSSA 2C57A 4GPEA 4MRSA 5TB5A 2NXNA 1O03A 3ICVA 4BFCA 4ZYUA 3FKJA 2IY7A 3K8ZA 3IUMA 3S2UA 3E8MA 1ESNA 1U0SY 4YRLA 1Q7CA 1DC6A 3FDIA 3JQFA 5TMEA 1YVPA 2JL1A 4DYVA 4OI2A 5J5VA 4A0GA 1XE3A 4DLVA 2C5BA 2CW5A 3GT4A 1CEQA 1LPAB 2AYZA 1A0OA 2FP4A 2DCMA 2WU3A 4TLDA 1W35A 4QXMA 3V2UA 2HXSA 3HBMA 4JAVC 5EJGA 5H02A 2P69A 5JALA 3M4ZA 1G20A 1NGSA 1X70A 4CG2A 2PUFA 2WU8A 1SOAA 4F91B 3FOEC 4PC6A 1R0KA 3RJ9A 1QOPB 1Z6QA 3IXQA 1P2UA 5DLEA 4TYQA 5DGIA 2DLNA 2FFBA 1X7XA 4G01B 1U0JA 2W7TA 4HH1A 4QDUA 5TY0A 1U7TA 1H85A 4B4KA 5J23A 4LF9B 1G291 2OUIA 3PVSA 3WK8A 3KJHA 3HBNA 2QUHA 3PFCA 4M0DA 4RDIA 3SOZA 1HQCA 1XZEA 3WYAA 1GL6A 3SY8A 4C3OB 5C5IA 1XDUA 2ATXA 3HYSA 4JT4A 3M9LA 4WZAA 3UFBA 4NPHA 1IQPA 3SQXA 1XTQA 4ZIRA 1AKRA 1YH3A 3G9ZA 5CNIA 4ZVUA 5BWCA 3R09A 4N7JA 4B3JA 2VQ6A 1YZVA 5IEJA 4MUKA 4FHFA 4MVWA 4BQFA 1TKRA 5A3VA 2GJAA 2UUAB 1Z82A 4W99A 2O3SA 4CM4A 4YFVA 2IZ0A 1XJCA 1NZFA 1AQ6A 3L6UA 3NKLA 4OYRA 1IN7A 4RVFA 3IYLW 2NU6A 3DMYA 5EZQA 1QUFA 5TARA 1F2VA 2PQ2A 1VECA 3A3YA 4GSKA 3EXAA 2IU3A 5PNTA 4DKXA 3A28A 4MV1A 3I1JA 4AURA 2W4IA 2BCJQ 4QYWA 3CLRD 5GZ3A 1H65A 4Q4JA 4YUYA 3HRKA 3C74A 3FVWA 5JCPA 4ZVPA 4EMTA 3C7TA 3UC5A 2PZLA 4UXJA 3ZDEA 1FUKA 4KX3A 1SCQA 5J1SB 4O59O 4I1UA 1P39A 1E6LA 1E7YA 1PZXA 1QWSA 3OPYB 1KHTA 4OFWA 1YBFA 5DGDA 4DIEA 1DKMA 3KYCA 3DZCA 1PWXA 1QO0A 3NUZA 4CIWA 3F6PA 1HQYE 2IUTA 1ZK2A 4HYTA 4IO0A 2D59A 5JAQA 1TA0A 5HKAA 3C1TA 4A6DA 3G9QA 1QX3A 3DCNA 3M1YA 1T0IA 4G26A 2M1ZA 4PPGA 2CZCA 1KEWA 1OREA 4U7WA 2RGEA 4GYYA 3ZEIA 1QTQA 1LC3A 1T5HX 4EGQA 1ECJA 1PR4A 4JBHA 4GVXA 3JWIA 1EE9A 4QTXA 3R5JA 1WPRA 2C5FA 4MHSA 3UIEA 1G0OA 2DPGA 1QO7A 4YUZA 2XIJA 1E9DA 1R0WA 3X1WA 3PPIA 3L7JA 1OV6A 5MF6A 1ZXLA 3RJ5A 8LDHA 1AHHA 4JUFA 2ZCJA 2ZULA 2I91A 2OO3A 2WDPA 5L7WA 1N5MA 3OFVA 3DHEA 3TNFA 4F3TA 2P3OA 3WYGA 3KWFA 3FFAA 4E32A 3A6PC 3DFUA 1QFXA 4LHVA 4Q1CA 1LJ8A 1H6DA 4JEIA 2VUTA 3P9NA 2H4FA 5SZIA 4OY3A 2Q0QA 3NHYA 4NYJQ 2DWUA 2HAEA 3IQWA 4CLOA 4M98A 1G98A 4HPXB 2CF5A 4XM2A 1U02A 2G8NA 4HWSA 4EG5A 3GN1A 4FNMA 5IT9A 1C9KA 3R7SA 4HFNA 4DLUA 3RU9A 1JZSA 1KYQA 5EPUA 4F21A 2HTEA 2CNKA 2FMTA 3R9XB 1E32A 5KYVA 2V98A 1YGYA 2CFCA 3B36A 4NARA 3PC4A 3WSWA 3VVMA 1MQAA 1C7IA 1RADA 2BFWA 1W2HA 2IXEA 4RXTA 1X7XB 2J87A 5K0LA 5K8VA 1EUYA 5MHTA 4PFQA 2HA7A 4MR7A 3P2EA 2B4AA 1ZUWA 5DF1A 3GLHE 3FNEA 2CB9A 2WPNA 1UKBA 4QWWA 5KNDA 3R3WA 2NADA 5C4MA 1YNOA 2XE6A 4KAAA 2BMWA 4Z53A 3H5AA 3ZE0B 3AVTA 1JA0A 2Y1LA 4LY9A 4ZO6A 5EJ2A 2IUUA 4CNQA 2G40A 4FTWA 5AHRA 2FLVA 3KB1A 1E89A 1GRQA 2PSHA 1NLFA 1R9GA 1CDEA 2HXYA 2Q1XA 3IUQA 4CM3A 4EFNA 1U0BB 2OBBA 2UZ3A 3S70A 2CLHB 3EXHB 3R7DA 4GYKA 1QG4A 2HDHA 3SZGA 1XNHA 2PBFA 4J3JA 2DR0A 2FMIA 2C29D 1S1MA 2GVDC 1U94A 2ODEA 3BIJA 2FK7A 1LWOA 3HJGA 4BNMA 3W5JA 5EUQB 4RTJA 1B8VA 2DFTA 2HGZA 2RHJA 4XW2A 3T1QA 3R9WA 1KC1A 3KIPA 2EATA 1FDTA 3R0IA 1ECFA 3E5RA 2Y4NA 4LY6A 1SUEA 1DGQA 4MGHA 4HQRA 1N5KA 2OO5C 1D7AA 2XAAA 1KYZA 2BR4A 5GZ1A 4B3TB 4L0DA 1I0IA 2A5GA 2NZUG 3B7WA 3ZXXA 3BJMA 2VJKA 2FWNA 3FA2A 4YPFA 1ISPA 1N57A 3BRWA 4H3KB 3BDIA 3K0CA 3TQOA 5CB8A 5DP1A 3PTLA 4AJ9A 3I3OA 2O2GA 3KYCB 4G4GA 5T41A 1E98A 1B4DA 2WHQA 3CUSA 3IAAA 3PNLA 2H1SA 4KPFC 1O77A 3O31A 3ED1A 5FUVA 1TM4E 4YCCA 5I9MA 4JBGA 1U9IA 3GFRA 3ML1A 4R3NA 1BIFA 1DG3A 4PLWA 1T9BA 5C8YF 1DI0A 1UXOA 5JAUA 1YONA 1GR0A 4JKIA 1DQNA 4LGVA 3CWQA 4R0NA 3SKXA 1GNRA 2JD0A 3BIXA 3BH0A 3IEIA 1PQYA 4NU6A 3GK3A 1P8JA 2PGAA 3E7FA 3M6MD 3OJEA 3EWIA 2EX4A 4I3GA 4PQEA 4RA6A 2FDRA 1VZ2A 2FDXA 3PU6A 5CJPA 4RCZA 1KPGA 4RM3A 4ZU1X 3LLCA 1CUZA 4L76A 1HYEA 4BAGA 4Y2TA 4FDMA 1EFPA 1IJBA 1O4VA 1XZIA 2LKDA 3FWKA 5ALSA 3K0EA 3WNZA 4PBTA 1NSFA 3IMFA 1FNCA 2IDKA 2FGKA 2WIJA 1XJ5A 2X14A 4MAAA 3ZN2A 1GRRA 1MQSA 2GBLC 4MTCA 3JVIA 4ZU3A 2OBXA 2HEGA 5I3CA 1W36C 1RI2A 1E1DA 4L8VA 2P1ZA 3LQ2A 3PEEA 1W34A 2YV3A 3RR2A 4AKTA 4JV5B 1NG1A 1U8UA 1PU2A 3L84A 4K5QA 2OGSA 2QRMA 1SC3A 3HU2A 4CFSA 1JQKA 4IOJA 1SVUA 3A32A 4Q9KA 5GOTA 1ORHA 4L3VA 4GOOD 1YB4A 2AVDA 4IIXA 2I7XA 3CVUA 5MN5A 1IJEA 3NAQA 1CRZA 2COKA 3D7MA 2P9QA 2ZSBA 5GQSA 3RE1A 3B1YA 4GM4A 3G88A 2VWGA 3THWB 3O4IA 2PQ6A 1D5CA 1WCYA 2PK3A 3GB9A 1CUHA 4RYDA 1H2BA 3ROMA 4INJA 1ZGGA 1Y8RA 4QOFA 2BEUA 3L82B 1NW6A 4KVFA 1BJTA 2QUJA 4B9EA 2RONA 2X5XA 5B7QA 1X9GA 3R41A 2WAXA 3G2QA 3TPZA 1LZKA 2QTVB 4LYAA 5AFSA 1NUTA 1WDWB 3CIOA 2XZLA 1O9HA 2J07A 3K5WA 3L46A 1E64A 4O4HA 4HB3A 3KKPA 4OAPA 5AYVA 3KDSE 2ZZKA 4Q7QA 4ZMSA 4W1QA 1UQUA 1J25A 1NQVA 4R71A 2ZATA 3FB1A 1HG0A 1TUGA 3Q41A 1Q20A 2C2KA 3FNQA 3ZGZA 1Q0PA 1QV9A 3JQ9C 2DYKA 4BE4A 3I3SR 1GUBA 4ZDJA 1GYQA 3F3MA 2IP2A 4G5GA 2UDPA 521PA 3GL9A 3GGOA 4C7XA 1VMEA 2D1FA 2ID4A 3QPCA 1JXAA 2C97A 2MR5A 1MTOA 3L0OA 3LYHA 1P74A 4UPDA 2HA4A 3CN7A 3F7TA 3FFBA 5GGYA 4RD3A 2XGMA 1CZUA 2JC3A 3OZWA 5AI6A 4OBWA 1SXJA 3NV9A 2WFLB 1EUCB 1AB6A 3USCS 5HIAA 3GI1A 1CE8B 2R1VA 2YS6A 1OXMA 4LMRA 5C4GB 2MOKA 3HRIA 4OI0A 2V6BA 3EUWA 3KQMA 1LY1A 3F6RA 1IE3A 4REQA 4M9QA 4YEDA 2O54A 3QSGA 4U63A 3HYLA 1RMQA 1SA0B 4B75A 2OFWA 3UAZA 1RZ3A 2K7ZA 4PY2A 5FBVB 5JI2E 3IT0A 1XZHA 1JSXA 4B81A 2VJDA 5C32A 4BASA 1VG0B 2ZYUX 3SQDA 4MRRA 1EFHA 1KH1A 3I2IA 1UMBA 4NEGA 3IXMA 3MG9A 1S96A 1L9KA 4HB0A 4HEA1 1KSHA 4JC5A 3W4JA 2FWJA 3W6PA 2AR9A 2CCGA 4C0JA 3R9XA 1JWLA 2VCHA 2V4MA 4NPAA 5GY7A 3VI3B 3HY6A 1H1LB 2R5WA 1PWEA 1CFJA 1TYCA 3EZ6A 3KTOA 4MV3A 1EIWA 2H1LA 3KWMA 3VR3A 1V11B 1H66A 1WVIA 3EC2A 4M1YA 4O29A 4OGKA 2BZ1A 1YA4A 3VAYA 2WPDD 3N8KA 5H68A 1DO2A 3QFFA 3V8EA 3WZLA 2I7TA 1Z3CA 4WV3A 1ES9A 4ON9A 4X6XA 3T3GA 3UUFA 2Q7XA 4DE5A 1RC8A 3RAFC 2WABA 4TM7A 4KQ2A 4C88A 4CM6A 1QJCA 5JASA 2QMHA 2YQ4A 3CX7A 1GKLA 2VUSA 5AI5A 2PFGA 3IVMA 3TINA 3B82A 3M6UA 4H31A 1F6DA 3FPBA 1XDSA 5TLSA 1XXHA 1A7UA 1VGRA 4UUMA 5EJ9A 4L8YA 3LT5A 4AIRA 4DA8A 2M32A 2X0IA 4M1EA 5AKJA 2HFJA 1G3UA 5JSYA 3F3SA