4F4JA

Conversion of the enzyme guanylate kinase into a mitotic spindle orienting protein by a single mutation that inhibits gmp- induced closing
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
189
structure length
189
Chain Sequence
FQGSMSRPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVPSTTRTPRAGEVNGKDYNFVSVDEFKSMIKNNEFIEWAQFSGNYYGSTVASVKQVSKSGKTCILDIDMQGVKSVKAIPELNARFLFIAPPSVEDLKKRLEGRGTETEESINKRLSAAQAELAYAETGAHDKVIVNDDLDKAYKELKDFIFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanylate kinase
publication title Conversion of the enzyme guanylate kinase into a mitotic-spindle orienting protein by a single mutation that inhibits GMP-induced closing.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 59
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature ec 2.7.4.8: Guanylate kinase.
pdb deposition date 2012-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 4f4jA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4f4jA01
4K46A 2VP9A 4FWIB 3QENA 4S2EA 2OCPA 3I5XA 4GRAA 3QKUA 4LJYA 5HCNA 1E79D 3TR5A 4I99A 1MOZA 3SE0A 4DCVA 3Q9LA 4K8OA 4QGHA 4ERNA 6Q21A 2XAUA 3OEEA 1QVAA 1L4YA 2VHJA 3RSOA 5BQ5A 4L9SA 3TBKA 2JJ2A 4IEIA 4TQ9A 5EXSA 3ZZTA 4XH9B 2OFXA 2PJRA 2HYIC 3PEYA 3EIEA 2H57A 2P3SA 4Q1EA 5L3SB 3IIMA 2P6NA 2ZRJA 4HB0A 1NIJA 3LDAA 2OBNA 4DB2A 1YRAA 4QOSA 5KDLA 1SXJD 4IRUB 3U60B 3B78A 2XTZA 4N3NA 4PC1A 4M1OA 1OSNA 2DY1A 4GP7A 4YMWA 4F92B 4W5JA 4M21A 4MQBA 2VP2A 4M9XA 2QP4A 5J4VA 3UATA 1TEXA 2QAGA 3VR2A 4ZIRB 2XZLA 4Q9HA 1JXMA 3SJZA 4BWYA 4F4JA 1SKYE 1CJUC 3AM1A 3W9YA 4G5GA 1P9WA 1KJWA 2OG2A 2QM8A 4Y0AA 3DM9B 4PHFA 2FWRA 1ZAKA 1UF9A 2WJYA 2Z43A 4ILEA 2G3YA 1Z63A 3U44B 4R2HA 3WBKA 5DNYB 3X2SA 1T6NA 2ZQ5A 4CDGA 3UMFA 4PZZA 3SI7A 4NYMQ 3GP8A 5SZHB 2FZLA 4CEJA 2AR7A 3KQLA 3OEED 1KI4A 1NLZA 2J0VA 3C7KA 1IXSB 1R4AA 1X8KA 4M9ZA 1GVNB 5A4JA 5K8UA 3CBQA 3X1XA 3FMFA 4KLZA 4JT2A 3L0OA 1Z07A 3NDPA 4AG5A 1MH1A 1WCV1 5FPHA 4LPSA 2RGNA 4W5WA 4NYMR 3OESA 1IQPA 3VR4A 2IF2A 3GCGA 1S1CA 1E2HA 2B21A 3B60A 4XTCS 1AK2A 4EQ6A 3IHWA 4FMDB 3SS8A 2P6RA 1KMHB 2YYZA 3AUYA 1TQ2A 1XXHB 2IBMA 3A1TA 1T5LA 1XZQA 2VO1A 1FPMA 1ZU5A 5CIQA 3GJ7A 3GLFA 2JLUA 3EPHA 2OXCA 3FKSA 2X77A 1M2OB 2ZUDA 4R2IA 1U0HC 2D62A 2GWHA 4C7OA 2MMCA 3HWSA 2C9CA 5JHHB 1TX4B 2PX0A 4RFVA 2ZVQX 2O8EA 2VRWA 2W00A 4OQFA 1J70A 5JI2E 3BFVA 4POAA 3WHKA 1ZP6A 3QXCA 2ZETA 3QF4B 1JEEA 3DMNA 5AJYA 2XXAB 2AK3A 2PEZA 3LBHA 3BB1A 4KO8A 3TE6A 1X1RA 5TY0A 4NYIQ 1OFIA 1U99A 3RS3A 1CLUA 4LBZA 4JL6A 4Z1MA 4ASUA 3VU9A 4D26A 1CJTC 4HLUC 1P72A 4KFUA 4XVRA 4XTRA 4AD8A 1L2TA 3LRPA 4AIIA 5FPSA 4JLNA 4MRRA 5B2ZA 2VHUA 4IXMA 1DAKA 1T9HA 5HE8A 1NJFA 5FR2A 5EXPA 2OCYC 5FPKA 1PLLA 4RD0A 4GOKA 3AP2A 1NKSA 3THWB 2KI5A 3KKNA 1E94E 3AGQA 1SGWA 1V43A 4NYIR 2A5FA 3GPLA 2PZEA 4TMXA 4R98A 2WJHA 3W6OA 4JYCA 1N5JA 1JAIA 2WMNB 1XMSA 3RC8A 3Q7QA 5ANRB 4FINA 4YLGA 2VSFA 3NEYA 2HT1A 1E1QD 3TK1A 1CTQA 2ZS9A 1BYIA 2ZSAA 3CRMA 4KITB 2BBWA 1CS4C 5E4FA 1ZIOA 3NHBA 3NC0C 3KJGA 3M1IA 3SU8A 2H1LA 2OLKA 1JAHA 1Q1QA 2YC4C 2ZRNA 2FGJA 4W5HA 4EPTA 1U98A 2CJWA 1A5TA 3RABA 1S3SA 1K8RA 2TMKA 3BWDD 3VAAA 3GEHA 1KI1A 1TUEA 1E32A 1WP9A 4KCGA 2BC9A 1DADA 4M1TA 2W6JA 2F55A 3NG1A 2XX3A 3K70D 4X8HA 5E95A 3HPRA 3A4MA 1DG1G 2NPFA 1ONBA 4B75A 2B92A 4E09A 4Z1MD 5JZVA 1TMKA 2AD1A 3F8TA 1GRRA 2V55B 2ZVPX 3UPUA 4OHYA 2ZI7A 3CRW1 2ZR9A 1XJ0A 4HLDA 1XZPA 4QGFA 1OT3A 5CLLA 1DBSA 4FCWA 3W8RA 3IEUA 1E4VA 3A37A 3VHLB 1KNXA 3H84A 3B1ZA 2Q3FA 1GNRA 2Z4RA 3KFXA 1P3JA 3SNHA 4URVR 5L3SA 2ZRFA 4TLCA 1XTSA 2VPPA 3LVRE 1JNYA 2FFBA 3NBXX 2D06A 5KSZA 3QEOA 3DZ8A 4HATA 4OBEA 4BFUA 1ELOA 4I1VA 3RWOA 3HP1A 4B71A 4PFSA 3LLMA 2V1XA 4A9AA 1LNZA 4URZR 3PJRA 3O47A 2ZJOA 3LD9A 1R5BA 3DKPA 2UVQA 4ZIRA 4E5UA 2EFGA 3A36A 2WOOA 2B8WA 2WPDA 4N0DA 2GEVA 1Q1ZA 2VHTA 1W47A 2V54A 1EG7A 5GJWC 2W6JD 4A15A 5F3WB 5ELXA 3AVXA 4JLPA 4PPGA 4LV8B 5D3QA 1MR3F 1NN0A 3U44A 2GXUA 2V8OA 1QBKC 2R65A 1R7RA 2J87A 3MAAC 4RD3A 2GEDA 3EWAA 5TB5A 1UDWA 2HLDA 1GRNA 5FL7A 3RYTC 4LBWA 3CLVA 4MYCA 1F2UB 3JVVA 3HYTA 2GBLA 4GFDA 1IY1A 4AKEA 4DEYA 3OF5A 3T12A 4IFBA 3VTKA 4D4MA 3CO5A 4IDOA 3A1UA 4P4UA 2OAP1 4DSOA 3GLIE 2QGZA 2C04A 2BHRA 2BJVA 1E0SA 1E2LA 2C96A 2QNRA 5CYOA 3TVDA 3IHLA 4ESHA 2ZI4A 4KI0A 1LF5A 3BB3A 4NHOA 1N6HA 5K8IA 1QHSA 5EE1A 3R20A 1KMHA 1VMAA 2NO6A 1Z0IA 5EP4A 1XXHA 2WWGA 2GCNA 3NBFA 5FTJA 3I61A 2DFKB 3EA5A 5SZKB 4RD4A 3DO6A 4V02A 3ICEA 4DBLC 1HH4A 2BBTA 4TYQA 4BFXA 1KY2A 3SHWA 4A2WA 5KSYA 4GP6A 5JWOA 2WPDD 1S4QA 3K0AB 3U3RA 1NVWQ 3NHAA 4ZI3A 3SQXA 1DARA 5J4HA 3CW2A 1E3MA 2PX3A 2NGRA 3GJ4A 4ACAA 2K5UA 1OIXA 5TDHA 5HZKA 3TVTA 1HQCA 2ORVA 3OIVA 4MA4A 2NIPA 3QPVA 3T15A 1UKYA 4NP6A 1IN6A 3O8DA 4Q1DA 2FGKA 3R9XA 1XB2A 3KUCA 1NVUQ 3LQQA 2HLDD 1US8B 4C0JA 2XXAA 2WAXA 1KK3A 4RKFA 1ZINA 5JWRA 1ZUNB 4B6FA 4BLQA 3A4NA 3TKLA 1A4RA 4IDHA 1X86B 1DTSA 1CIPA 1EFUA 1NMZA 5BXQC 5DHFA 1AA9A 2G9NA 2ZEJA 3CONA 5GADl 3IDQA 2ZYUX 1T3SA 2RH5A 2IL1A 3IQWA 2QT1A 3PUXA 3FHCB 4HAYA 2X2FA 1UKVY 1QDEA 4B6EA 2GCOB 3EC1A 5F9HA 3THWA 4FMDF 1KAGA 2FFQA 3P26A 3ZZUA 3E2IA 1WRBA 1NG1A 4TLBA 1JR6A 2QP9X 2FU5C 2GTPA 3B8HA 4P32A 4ZDIA 1HE1C 1Z2AA 1OYWA 1Q57A 1YHNA 3C5HA 1XD2B 2WBLC 3AF2A 4LDJA 4QBIA 1U0LA 2PLFA 2CHQA 2IA5A 3RRYA 1NP6A 4V0MA 1AKEA 1C4OA 1N0VC 2P0EA 1I4DD 3R8CA 2B7BA 4QJ4A 1SVOA 1RW4A 1WB9A 3VMFA 1P75A 3K0EA 3FDIA 4B34A 1NY5A 4N0EA 5DYGA 2QM7A 4IHQA 2FSGA 1EWQA 3KKOA 3ADKA 4U7DA 1AM4D 5GJCA 1RYHA 1WQ1R 3OEHA 4MRSA 2O8DB 5E7IA 3MUFA 5KYKA 2YZ2A 4FCVA 2KE5A 3GJ5A 3TGPA 2O5VA 3Q85A 1HV8A 3WBJA 4K81B 5EXTA 2ZXUA 2QMOA 2VP4A 3EASA 4TWZA 2BMJA 3U7HB 1HURA 4MGZR 2OLJA 2PZGA 2VIIA 5B30A 4F93B 1K5GA 1MRNA 3FMPB 1XD8A 4ITRC 3AP3A 2B8TA 2ZJYA 2J9RA 3I8XA 1G6HA 2I1QA 3E1SA 2OO7A 1HQYE 1GILA 2IYYA 421PA 4KFSA 1N6LA 4MDEA 5B57C 4HUQB 1YR7A 2GJ8A 4DLVA 2XNSA 2V1UA 3K0FB 4DWJA 4JSYA 1EWRA 1F2TA 4RY2A 3AVVA 3QG1A 4DLRA 4JVNA 4PTLA 2W2TA 1OXSC 4GI7A 2F6RA 3C41J 3LX8A 4DC9A 1G19A 2GCPA 1BOFA 3WMFA 1KOFA 3LFUA 1OIWA 2BMDA 2RGCA 2ZRGA 4ZV4A 5G3YA 3SOPA 1P2TA 4TYWA 1ZD8A 4LPKA 2Z4SA 1ZC3A 3KJEA 4LRWA 3THYB 1NBMA 1EFHA 3OAAA 1DAHA 4E22A 4HLUA 3CH5A 1KSFX 1W4BA 4ZCIA 1XWIA 3Q72A 1KSJA 4IVPA 3FHTA 3LH5A 4KU4A 1IAQA 4TMVA 1UKZA 2HCJB 1X3SA 3NBZC 3V00A 2Z0MA 1M7BA 1N6NA 3PVSA 1Z47A 1IY0A 4JVLA 1VG8A 4PX9A 1E0AA 2XZPA 1G5RA 2QAJA 3K70C 3O8CA 4JLKA 3JVUA 3WMGA 5FTKA 5IDVA 2J45A 4TLDA 1L4UA 2ZSFA 2WTUA 3C14C 3ND8A 1TF2A 4QM7A 4UXJA 4D0NA 3AKCA 2F1RA 1HTWA 3QXSA 4RCZA 4TMWA 3RWMB 4B43A 3TAUA 1NLYA 4Q19A 3SZRA 4W9MC 2QAGB 2EQBA 2XTMA 1SHZA 4PZYA 4MYTA 4QHYA 3RS4A 3U6KA 4YMSA 3MWYW 1KO7A 1ZYUA 1OIVA 1Z6GA 5CITA 5UKDA 3U5ZB 1YR9A 1MO5A 2ZRIA 4JIMA 4NTZA 4KV9A 3SHFA 5J5CA 2BWJA 5JWHA 1II0A 2GJ9A 1OFUX 2W0SA 1KHTA 3L82B 2P5SA 1Q20A 3IQXA 3MSXA 3SBEA 1CXZA 1E2GA 1N6PA 2FSFA 2WKQA 5JI3E 3K9LA 4OHWA 3U3KA 1Z0DA 4PC6A 1ZJ6A 4C30A 1F60A 2CMKA 3GLIA 1IM2A 1IN5A 2Q9BA 3AF0A 3K0AA 3K8YA 2G0NA 4EPVA 1ZUHA 1J2JA 4OJQA 1OHHA 3B9PA 5GJBA 4TYNA 1VCIA 4GT1A 2AKAB 1FTNA 2LKDA 3IIJA 2WWFA 2QPAA 4OK6A 1RYFA 2VHCA 4DJTA 1AKYA 4Q4AB 1NY6A 1Z08A 2EWVA 2CLCX 3HJNA 5AUQA 4EQ6B 1S1MA 4OYHA 3BBPA 1EFTA 2QMUA 3QQ5A 3JZMA 4HAVA 2IS6A 1US8A 1XEXB 3NH6A 4NCKA 4XVQA 1RFLA 2F9MA 1EESA 3FGNA 5FUVA 5BN5A 4YDHB 2ZTSA 2W58A 5JECA 4PAQA 4Q4JB 3GLFB 1YU9A 3BFKA 4EPYA 1FQKA 4RKEA 3PFIA 1U8AA 1QF9A 3QJYA 2C77A 2VA8A 3OFNA 4MRNA 4B3GA 1ZD9A 3C4JA 4L15A 2IEZA 1G8PA 1E1RD 4QHSA 2CNWD 4PO1A 4WXRA 2IWHA 2Y8EA 3SJBA 2X2EA 1Z83A 5JCPA 3KL4A 2EVWX 2G77B 3MWKA 4UJ3A 3KQUA 2AX4A 2GCOA 3F3YA 4MRPA 4BPBA 4F4CA 1K6MA 4Q18A 4TQAA 1G8GA 2O8EB 3LBNA 4Q48A 1A2BA 2FFHA 1QHXA 3D6TB 4QRHA 4L9WA 2YWGA 2AK2A 3HU3A 1P9NA 2ZI9A 1XD2A 2EFCB 3DKVA 4KFTA 3UK6A 2RGGA 1JR3A 4Q66C 3K70B 1QG2A 2V6IA 3VNUA 3CM0A 2OBLA 3X1YA 3BK7A 4H1VA 3EXAA 2Z83A 4ZI2A 1XRJA 1OHHD 4JBXA 1KI2A 5CB6A 2JLVA 3RSLA 1ZCAA 1IONA 1J99A 3RLFA 2FX3A 2ZE6A 3MJRA 4TZ6A 3ADBA 4BFSA 3X1WA 3EX7C 4QXAA 2KBEA 4NH0A 2V7QA 5FOSA 3E70C 1DAGA 4NCNA 1JALA 4G5SA 4JVSB 4QKQA 3EIHA 4DEXA 3BRWD 2ZJ2A 2HJGA 1U0JA 1KIMA 4A4DA 2Q6TA 1G5PA 2VQSA 5HTKA 2H17A 3QNUA 3WNCA 3LV8A 3BFXA 4A0FA 4C0AC 2CHGA 3OFND 2FJUA 2QQEA 2HT6A 2ZE7A 4II7A 2GVZC 1TQ6A 1W36C 2BM1A 4LYHA 4FD2A 4HUQA 3RAPR 3N5CA 1XX6A 1GZSA 4D2IA 3K0FA 3TH5A 1SVIA 2IYUA 2HDNB 3A8TA 1XMVA 4M4SA 5LB4A 1HT2E 2ZSDA 3B7GA 4CRWB 5EE3A 2CCKA 3TRFA 4HAZA 3ADCA 2ZRLA 5A5GA 3VNVA 1YRBA 5E7MA 5EE0A 4MGYR 1WBBA 1UM8A 5GJVC 3CB4A 2CL6X 4M9QA 4GNKA 1FFHA 1M34E 1R0WA 1AGPA 1N6RA 2J1LA 5J4YA 3THYA 1HUQA 1KK0A 4Z8YA 4OI0A 3E5HA 3UANA 3H0KA 5JJKA 2ZYWX 4BFTA 1IY2A 1KJYA 4FW9A 4WBSA 2YJTD 3QPUA 2VEDA 1CEEA 1VG9B 1KI6B 4IW3B 1DVRA 1NMXA 2V7QD 3FFAA 1KO4A 4NDZA 1TL7C 2BMFA 3FKQA 1XPRA 3LO5A 4MKFA 3V9PA 1NF3A 4Q1AA 2GZHA 1CJKC 1NIPA 1BH2A 2WWWA 1XJQA 3EARA 4ZKDA 2WHXA 5AUOB 4J0QA 4FXPA 3QXXA 4AYTA 1G6OA 2QZ4A 2ZU0C 1M1YE 4AWXA 2GF0A 3R7WB 1GITA 5C4GB 4LZZA 2CLSA 1YR6A 5DLQC 3NH9A 4BE7B 2OM2A 4M53A 2OFWA 5KSPA 4A2PA 1AQUA 2IYLD 4M0LA 4CZ2A 2QBYB 4LI0A 3KKQA 4JKIA 3GFTA 2FF7A 2NTYC 1GL9B 2J3EA 2YHSA 5A0FA 2JASA 1NRJB 3BGWA 1KKMA 3RS7A 1GG2A 3BXZA 1VYTA 1OB2A 1PUJA 2ECKA 1G20E 3BIFA 1R0ZA 1J8YF 4TL6A 2HXSA 2WSSD 4RZ2A 3KXLA 2QENA 1SKYB 4CT4B 1RRCA 1Z5ZA 1R0XA 1MKYA 3TW4A 3I72A 2AWNA 4TN1A 1OJLA 5EE5B 2RGXA 3PUYA 4JLAA 2WV9A 4HAXA 3DHWC 3LBIA 3PCRB 1E96A 3WY9A 4RZXA 1DG3A 1W36B 1B23P 2AN9A 1W46A 2WKPA 4BZQA 3D8BA 2EFDB 4Q4AA 2J7PA 2CLDX 1NN5A 3W3ZB 4PAOA 1XP8A 3ICQB 5JBQA 2IS4A 3QXHA 2WICA 4D25A 1NL3A 1F48A 1XEXA 1R8QA 3AF4A 2JA1A 4HAUA 2WWXA 4HZUB 2WVJA 2REOA 4Q4JA 2CVHA 2ZRAA 1AZTA 3ZIAD 3U7FB 1E1QA 2PT5A 3W8NA 2IXEA 4BEJA 3TAHA 3UWKA 2G88A 4B3XA 1OH8A 1CKEA 1QHHB 3PUZA 4FCTA 4MGIR 4QGGA 4QNMA 1H8HA 4PHTA 5EZ5A 2IUSA 4B35A 1OF1A 1Q1EA 2XJ9A 4EFNA 4GOXA 4QJ5A 3ETLA 4V03A 5C1BA 2D2FA 4NYJQ 4UNQA 3T61A 3ZVRA 1Z0KA 4MUAA 1NI3A 1JECA 1ZD1A 5J40A 4B76A 1SKQA 2GEUA 3UXMA 4AKGA 1KI8A 4ZDWA 3FE2A 1S2MA 4MKIA 3DOEA 4WVFA 4D0LB 1D2NA 4C2UA 1TADA 4XOIA 4D82A 1G5TA 3N2EA 1AS2A 2D7CA 3IUYA 4JT4A 4R7ZA 4RFSB 4ZDKA 2NZ8A 2YOHA 3MLEA 4NYJR 5KDDA 1FW6A 2A78A 4IOMA 2QTVB 3P1JA 2R6DA 4GZLA 3PITA 4IFEA 4Q02A 3QE0A 1VDZA 4JLDA 4OHZA 2QL6A 2WJIA 1VCNA 1W44A 5FFMA 2J7PD 2QSZA 2VP0A 1SVLA 3SJAA 3AVOA 4F7WA 3T5DA 2D74A 1LW7A 1VECA 3PIRA 4E07A 4DDVA 1Z29A 3H4MA 2Q9CA 4ZPXA 2F1JA 3CNOA 4JL8A 3N70A 3A4LA 4JZKA 2OE2A 4IDQA 3HU1A 3QKSB 4Q7JB 3TUIC 4EPRA 1NNEA 1TTTA 2HCBA 2J0QA 1Z0AA 4PC3A 3QUSA 5CJ2A 2GXAA 2CE7A 2PLRA 2WIBA 2XGJA 3REGA 4URXR 5FBVB 4C4PA 4JJZA 4B33A 5CLQA 3VFDA 1G3QA 2GAAA 1H8HD 3VR5A 1N6KA 1JEDA 4V0NA 3KJIA 1EFRD 1MT0A 4GBMA 1RRPA 3CRQA 2AKYA 2QPTA 3K0CC 3VKHA 4AC9A 2Z6VA 3D31A 1E2PA 4BRWA 3EAQA 3ZZ0A 4BFWA 2BKUA 2RHMA 2I1VB 2YC2C 4EJSC 1Z3IX 3BJIC 2AHOA 4JSTA 2H16A 1TQDA 2RB4A 4DVGA 1ZNXA 1NSFA 3CZQA 1OE0A 1X6VA 5FOWA 3U6BA 3I62A 2VF7A 4DZZA 1PJRA 1W4AA 2PCLA 1T8UA 2CBZA 3GFPA 3Q3JB 3H2YA 2XZOA 1KI6A 4DLYA 2QRNA 5CDFE 1OPXA 2HF9A 2MSDB 3BH6A 4LYAA 1BKDR 1GKIA 1WA5A 2O8FB 2VP5A 1F2TB 1N5IA 2EU8A 1U8ZA 2KWIA 3IBGA 2IUUA 1MRSA 4XSGA 1F5NA 1VHTA 1BS1A 2N46A 3L8ZA 4URUR 1W7AA 2VF8A 1BIFA 4UNSA 1FMLA 2Q21A 1P2UA 3T1QA 2IYTA 1Z6XA 2BKEA 2FPLA 2YOFA 4AURA 3TIFA 1E6CA 4P0TA 3R7WA 1G3UA 3UMRA 2F9LA 4RCYA 3IBYA 3ASZA 2H92A 3NDBB 1GP2A 2PJZA 4TTRA 4DIDA 1E2NA 4JLBA 2LKCA 5DI3A 1XBTA 4DCTA 1YZNA 1ZW6A 5J47A 4TYYA 4YONB 1LB1B 4O25A 1GAJA 1GFIA 3FYHA 2F3TA 3K9NA 2QBYA 2N1BA 3WRYC 2OV2A 2DFNA 1RRGA 2VSOA 1FOEB 2X19A 3VKGA 2GAOA 2FE4A 1DO0A 3QXJA 2QA5A 3NXSA 2NO9A 4LV5B 1XTQA 2ZU6A 4X8OA 2GHIA 2P6UA 3GQBA 2AXNA 3PUWA 3UG6A 1MO4A 4LHWA 2JLXA 1V5WA 4M1WA 8OHMA 1L8QA 2OT3B 5EQTA 4YMTA 1G7CA 2BM0A 4DDTA 5JRZA 2WJGA 1CU1A 4P4TA 4LYFA 3SYLA 4KYUA 2ONJA 5AJZA 2DPXA 1GKUB 4LYJA 3RS2A 1Z0FA 4M1YA 1A2KC 1QRAA 4GSYA 1D9ZA 3QBVA 4Q00A 3CF2A 3RRZA 1E0KA 3TJZA 1WXQA 5LBIA 4LCBA 4DT1B 1DAFA 2WMOB 4F4IA 1RIFA 2ZROA 4G5QA 3AB3A 4H9GA 4RSGA 1FTSA 1CR2A 4MYHA 2JIZA 4JLJA 5EUQB 2PBRA 3TR0A 2FNAA 2PH1A 5C2JB 4G01B 5JEDA 3QPWA 4IXNA 3W6PA 4EJSB 1Z2CA 1P73A 2OESA 4HZUA 4I81A 2A2ZA 3L8YA 1CR1A 4CEHB 4A6XA 4A1FA 3GLIB 1RZ3A 3EWSA 3THXA 1ZRHA 3KDSE 4OI4A 2J0SA 5KU1A 3GJ8A 3CX8A 2DFLA 1IN8A 4B3DA 3ZYCA 1CJMA 3RS0A 3Q5DA 1QG4A 1QHHA 2QPOA 4HB4A 3GLHE 4HDCA 1II9A 3RDPA 1E2EA 3G5UA 1S96A 1T0HB 1FNMA 2RGAA 2VTKA 3NTUA 2FPKA 5CIWA 1VIYA 2QU8A 4PO9A 3GJ0A 5DSZA 2XJ4A 1MV5A 1OYYA 3I8SA 3SC3A 2C98A 2W0MA 5L3VA 2D4HA 3ADDA 2ZI5A 1Z22A 121PA 5FPTA 2PT7A 1G3IA 4IKEA 4PSVA 4RFSA 1I2DA 2FN4A 1KDPA 4XSHA 5AJVB 3B1XA 2OAQ1 5M04A 1W36D 3TUZC 3ZQJA 1QVRA 4EDHA 4YXWA 1SZPA 821PA 2YKGA 2JIZD 3D7MA 1UDXA 5CK4A 4Z54A 3P4YA 4US1R 1E2QA 2XNDD 4O2RA 4LJ6A 2WAYA 3WMEA 2OHFA 5JMTA 1YZTA 1NVXQ 1D2EA 1G18A 3K09C 3QKSA 2WWYA 2H18A 1UEIA 2V4ZA 2ZITA 1FP6A 2F1HA 4LJ8A 4Q4HA 1CP2A 2OZEA 4G5RA 4KSBA 2HJVA 5FTNA 5BN4A 2IW3A 3U7EB 4C9BA 5H68A 2HYDA 3K1JA 2A3RA 4L8GA 1RPZA 5DO9A 2P5TB 2ZYTX 4NMMA 1R5NA 1RJ9B 1SVKA 1G291 2DWPA 1CR0A 4LC1A 4DUGA 1OW3B 2DWOA 1NN1A 3N2IA 1CBUA 4TZ0A 4MYUA 1NG9A 3B85A 5JCZA 2F1IA 4ABYA 2B6HA 2MSCB 4XWOA 2NO7A 1IXZA 1R8SA 3CX7A 2UZ3A 1MABB 3ZVNA 3PEWA 1LV7A 1SXJE 3KKMA 2A5YB 4YXWD 2J59A 3QF7A 2QY9A 2Q3MA 3K53A 1YZGA 3U3MA 2JJ1D 4DLSA 2YVUA 3JZAA 4L16A 1GOTA 2KBFA 2QN6A 1O87A 5FUWA 2O8FA 3B1WA 4Q7LA 2LWIA 1Z6AA 2ZJZA 4HEJA 4G0NA 2DR3A 3L2OB 4LHVA 3LAWA 4WZBE 2JAQA 4C0QC 4B48A 2GJKA 5JFGA 3CRVA 4MKGA 5JRJA 4B2PA 621PA 3CR8A 3EC2A 5FOVA 2DWQA 4JLVA 5CDFA 1KI9A 1TU3A 4UNNA 2PEYA 3NKVA 3NWJA 4C3ZA 1GIAA 3AF1A 2FDCA 4MGKR 3KB2A 1Y3AA 5E7JA 5LDDC 4Z8XA 3IIKA 4YMUA 1FP7A 3CWZA 4DB4A 2EFHB 2XTNA 1KK2A 2DBYA 4JLMA 4B73A 4KJZA 2R6GA 3LXRA 1YZUA 3TW8B 3MFYA 4DUGD 1KYIA 3RS5A 4JLOA 1E2KA 4M2LA 2CCJA 1W2GA 3BS4A 3DZDA 1R5OA 2C2HA 4U00A 5FBWB 1AS3A 1P4SA 3U61B 2HUPA 4EKDA 4IVRA 4TLAA 3KZ1E 2FA9A 4DLTA 2AFHE 2RHDA 4TL7A 5LB2A 3W5JA 3X1DA 4YMVA 1W0JA 4FMCF 4D80A 1QZXA 1SQ5A 3RHFA 5G40A 1XPOA 1Z6YA 2G1JA 5HE9A 1VG0B 2WZQA 3ZGXA 5C46F 3AP1A 1PV4A 3ZD6A 4PANA 2R9VA 1A1VA 2DCUA 5CM9C 4LHXA 4MITA 1YZQA 5BYJA 2ZR7A 4UJ5A 1WDTA 1UBEA 4FMBB 4CVNA 5L3QB 4X8LA 1E1RA 1T4GA 2CNWA 4DT1A 2JLSA 3AV0B 2QMHA 1KKLA 3K0CA 5AK0A 3AH8A 3T5GA 4BLPA 2UKDA 3ZVLA 4DHEA 1U8YA 1ZM9A 2IYRA 1XF9A 4OK5A 1Z0JA 1KMQA 4NCIA 2C9YA 4QHTA 3NBYC 5HZHA 1IJFA 4BLSA 4EJSA 3UKDA 5BW8A 3R9IA 4MDFA 4DLZA 1R10A 3LY5A 4CEHA 1W5SA 4YQFA 1KO1A 1E2JA 1ZM2A 1JXOA 1OLOA 2O8CA 4NZYA 4D6PA 2ZSEA 3A1WA 3OE7D 2IXFA 1P61B 2A9KA 3FPAA 3WYFA 3ZVMA 2FEOA 2OCAA 4OQXA 1G7TA 1G8YA 2IYSA 3L0SA 1C9KA 1R2QA 3SJCA 4P4SA 3EZ7A 1XU4A 1KO5A 2O8BB 2BIFA 2FSHA 2BOVA 1W0JD 5AR1A 3O8RA 4LC0A 1N5KA 3QIAA 1BMFA 1Z06A 4A92A 4JBWA 1G3RA 4YDSA 5FOXA 3AEZA 3RANA 1OKKA 1DAEA 1R6BX 3EA0A 4C0LA 3GLHA 1B0UA 4PO8A 4D4JA 1I4LD 2ZUCA 5JEEA 3DDCA 1LF0A 2C8VA 3CUEF 5FUYA 2WM9B 3H1TA 4UXIA 4YC7A 3ZS9A 1UPTA 2A5DA 2WOJA 2YOGA 5FOTA 3T35A 2BDTA 4JVMA 1D2MA 1VYVA 1LTQA 1YZKA 3BOSA 5TMPA 1TF5A 2C9OA 2IEYA 1W2HA 4PPQA 3RC3A 4DDUA 1AZSC 1IXRC 2V9PA 1J8MF 1DOAA 2IYZA 1W48A 2E9SA 2GJAA 2V6JA 2ZJ8A 3WNBA 1AQYA 1ZMXA 4TMKA 1T5IA 2PL3A 3ZS8A 2NO1A 3KJHA 5EJEA 3G0HA 2KJQA 2C03A 1Q0UA 1XMJA 2ODBA 4H1UA 2FSIA 2BBSA 4E03A 1ETUA 4IOLA 1P9RA 2O0JA 2MMGA 5P21A 4B2LA 1P7CA 3B5JA 4D4LA 5DYIA 2G1KA 1DO2A 2OSBA 4B44A 2BJWA 5B64A 3LNCA 1N6IA 2QTFA 1KTVA 5J4KA 1NKTA 1RJ9A 1Q1BA 1H8ED 5DH9A 4GDFA 2V3CC 3K0SA 1BMFD 2ORIA 1I4TD 3WHLA 1IN7A 2YNMA 4B3CA 2QI9C 4PPFA 1GM5A 3GLGE 1G1MA 1OKKD 3KXIA 3Q5EA 4PXAA 1ZNZA 2DB3A 1MABA 4A6PA 1J7KA 3GEEA 1KI3A 4QBFA 4CEIA 4RD1A 1RVDA 3B82A 4AY2A 1E2MA 4Q7KA 3CH4B 4OHVA 4Q1BA 1ZM7A 2FZ4A 3AUXA 3AGPA 3SDZA 4P3YA 1YJ5A 1CF4A 1W1WA 1Q22A 3L0IB 2IX3A 1J90A 4A0GA 4FN5A 1U81A 1VCMA 3L43A 5EP3A 2C95A 3QG5A 5FL3A 3CR7A 1ZNYA 3RVBA 2REBA 4MRVA 4V0OA 4BASA 4BFYA 2CVFA 3EZFA 1U94A 4R9UC 2WSSA 3SFZA 4WXPA 1IHUA 4EIWA 3EZ6A 2O0HA 4EAQA 2QT0A 3TSOA 5H1YA 4TT3A 3MGCA 1BYUA 4TMZA 1E2FA 4D4KA 4PQRA 3I73A 4G5OA 2JLQA 4D0GA 3P4XA 4NCJA 1E9FA 1TU4A 2OCBA 4JYBA 1RRFA 3PG5A 4ON9A 4BFVA 1T91A 2R8RA 5EE9A 1CR4A 1OXXK 1S3GA 3AVYA 1EK0A 3C8UA 5IF9A 1TQ4A 2ZRDA 1AGRA 5KO2A 5HKKA 5LPNA 2R62A 1M74A 3W6NA 4PQFA 1S9HA 3V4RA 2XB2A 4Q9KA 4RZUA 1E9CA 2W2XA 3K09A 2EW1A 3WYAA 3LX5A 1Z8FA 1T3LA 2GKSA 1VCOA 4US2R 3AVUA 1G16A 4P31A 4U02A 2PMDA 1TAGA 2CEAA 4KVGA 5DI3B 2ZYVX 2YINC 2R44A 3ZH9B 5JSZB 3ZIAA 1NN3A 3I32A 1RC8A 1OH5A 5JS8A 2FFAA 4OHXA 5L3QA 4DXAA 5K8TA 1YR8A 4TLEA 1WBDA 1VG1A 3K9HA 2NMVA 3P27A 1N3BA 2VYFA 3CKLA 4KXFB 5D3MA 1OH6A 2ZUBA 3FWYA 3RRMA 3C15C 5FR1A 4HLCA 5DN6A 3DPUA 1JJ7A 1W49A 2BEKA 4JMPA 5AUNB 3B6EA 2I4IA 2YWEA 5H8WA 3OHMA 2QGNA 5C18A 2R6AA 3P32A 2GF9A 1PUIA 1LS6A 3OIUA 4TT3D 2ZRCA 4QNRA 1E9RA 4TTQA 3BE4A 3THOA 4ARZA 4DLUA 4M1KA 1G41A 4IEEA 4DSNA 1ZM4A 3VX3A 1W5TA 5IRCD 4RD2A 2OUKA 4BLTA 5FI1B 3TMKA 3HYRA 1UFQA 1EGAA 1CJVC 4JJKA 4NCHA 4QM6A 3FHOA 4BGDA 4BZPA 3KTAB 2OXRA 4PZLA 1NJGA 3AF3A 2QORA 4L5BA 4LJ7A 1SVSA 5HKKD 2O8BA 2REXB 2G0TA 4JL5A 4WAUA 4LUCA 3KQHA 1GNQA 2YWHA 3DVLA 1II8B 1NMYA 1N6OA 4LJ5A 2GZDA 1VYUA 1Q3TA 4Q1CA 1XXHE 1UBCA 2JJ2D 2NO0A 4FIDA 4LGMA 2AFIE 3VHXA 2XSZA 1CRQA 3THXB 3W34A 3HU2A 2SHKA 2R2AA 1ODFA 4GMXA 5AWFC 4EFMA 4XJXA 3CNLA 3GEIA 3MCAA 2ODWA 1M7GA 1QHYA 5IHPA 2BVNA 3FTQA 5KPDA 1XJCA 4NONA 1N25A 1Y63A 1EFRA 4OJKA 4KBFA 2P65A 4WA7A 5DN6D 3WXMA 3F0TA 1KZ7B 1KJZA 1CRPA 1YZLA 2CCGA 3DM5A 5FBQB 4C0HA 2AWOA 4LWZA 2QE7A 3B1YA 4PAMA 2ODNA 3WNDA 1RE0A 4LSGA 2RGDA 1Q12A 1EFCA 2JLRA 3VKWA 3EZ9A 2GZAA 2OFOA 1AIPA 1VPLA 3HDTA 1EX7A 1COWA 2F7SA 2GA8A 5LD2C 3IPYA 4A8JC 4DRZA 3ZJYA 4XWKA 4IDNA 2IXGA 2DFTA 1VIAA 1OV4A 1G4AE 2RMKA 2PCJA 5L3RA 5TARA 5GVSA 3QKTA 3KFVA 1GWNA 3AQ4A 1Z6TA 4OQLA 2GETA 5H70A 1HT1E 3V4FA 1UBFA 2EWWA 1VKJA 2ZRMA 1E9DA 2VSXA 3BAFA 1TEVA 4QL3A 4DCNA 1XFAA 5L8VA 3U7GA 1C1YA 2NPIA 3S1AB 2Z5FA 1GL7A 2W6IA 1E9SA 1KI7A 4HDOB 5FH9A 3SR0A 3AKYA 2H7VA 2N42A 2FPMA 4HSEA 2XSZD 4Q4HB 5SZIA 1OXTA 4OQMA 5DI9A 3CZPA 1L7VC 1UKEA 1KNQA 2ZJAA 4DIEA 2GXSA 4V0ME 1E69A 2QSYA 4BQSA 3R8FA 3SFVA 2WJVA 4CT5A 5KUTA 2OILA 2W83A 3GD7A 3DOFA 4Q9LA 4AKHA 3K9GA 3UWOA 4C0SA 3GLGA 2EYUA 3NC1C 5CYPA 4M8NE 4M1SA 1KO8A 2QE7D 2XOKA 3LLUA 4UNRA 4BECA 3MWLA 1GSIA 4OL0A 2ZM5A 3FKSD 4NKRA 5JLJA 1WF3A 1ZM3A 4A0HA 1ANKA 1ESMA 2IYWA 2BV3A 1SVMA 4IOKA 4NU0A 5E3HA 2QRZA 3FOZA 3J81k 5F2EA 1LFDB 3IGFA 1COWD 2PZFA 3Q7PA 4PHGA 5FTMA 1OXVA 4TTPA 4KLNA 1FMJA 3PENA 2VBCA 4FMCB 2HF8A 5AJWA 2UZIR 3W90A 2GVDC 4AYWA 2Q0HA 3MMPA 3EPLA 4LBYA 3PQCA 3TUJC 2F43B 4LJ9A 4Q03A 4DLWA 5F9FA 4ZCMA 3REFA 3IEVA 3ND9A 2W2VA 3GJ6A 1XEWX 3MD0A 4CGZA 3WP0A 3GJXC 3U3JA 2W6ID 1PLKA 4NBSA 1DEKA 3RRNA 3TQCA 4ASUD 1VHLA 1GUAA 3AKEA 1X8LA 3LVQE 3LW8A 4LJAA 2IS1A 1W4RA 3OIWA 3WRXC 3BB4A 1IN4A 4Q21A 4C2TA 1KSHA 5DHAA 1E2DA 1Q44A 1E99A 5C4MA 1XTJA 4GL2A 2WJJA 4KFRA 4D81A 3NIBA 4A82A 3MRSA 3IO5A 3C16C 4UQOA 1NBME 3BORA 4RVCA 3BH7A 4ZCLA 5JSZA 5LD2B 3HPQA 4LY6A 1OXUA 4A8JB 4JKYA 4Q9JA 1E0JA 1LS1A 4OQNA 2ERXA 5CJPA 2XOKD 3OIYA 1JQJC 2JLYA 3I92A 2YV5A 4C0BA 1ZCBA 1G3MA 1A7JA 2FV8A 4LBVA 2ZJ5A 2RGBA 4LV6A 1PZNA 4F38A 4C0KA 1UBGA 5GVRA 5FTLA 2ASEA 1TPZA 2Q9AA 2A30A 3QVUA 2FH5B 5J4LA 2MSEB 2XB4A 4M1MA 2QP3A 2GK6A 3QVVA 1G4UR 521PA 5KNCA 1XCMA 1TNDA 5JJLA 5DIFA 4WOPA 4BFZA 5JJIA 1E9EA 3Q8XB 4M9SA 4MH0R 3SEAA 5F98A 3MWJA 3KB1A 1LY1A 3CIOA 4XWAA 3KTAA 4BRUA 1U90A 2F3RA 1VTKA 3AVQA 1NLFA 2O0KA 4GOJA 4KYIB 2A5JA 4PR0A 1UEJA 1YVDA 3QI2A 5G3ZA 1MO3A 1LVGA 2XNDA 1II8A 1JPJA 3VR3A 3LXXA 2ZS8A 1S0UA 4O0MA 5HR5A 1AN0A 2X1VA 4LOAA 2ORWA 1Z28A 5EZ6B 1FL9A 3M4YA 1I2MA 2NQ2C 2ZJBA 4V0KA 1GTVA 4Y0VA 1G8HA 2BMEA 2O8CB 3BERA 3VR1A 2RAPA 2ZE8A 5TV2A 2EFEB 3PEUA 2G83A 2J5XA 3EW9A 2ANCA 4NPHA 5DISB 2IT1A 4KBGA 5EP2A 2R6CA 2QROA 4GPTA 2J7KA 4P4SB 2ZSBA 2ZS7A 4LHZA 1SXJC 3TSZA 4PSKA 4Q1FA 4LK2A 3KX2A 3EG5A 3H86A 1KGDA 3CF0A 4Q01A 2DHRA 2VHQA 5SZJA 4FI3C 1U9IC 4DKXA 4QG7A 3QEJA 4W7SA 3GJ3A 4DSUA 5G41A 3GLHB 2HXYA 1FX0B 4WW0A 3NEJA 5JHGB 2CDNA 1P2SA 2IYVA 2ZAOA 2ZANA 1HE8B 3DL0A 2IYXA 1ZC4A 4PC7A 4BUJA 2ZREA 3RNLA 1ZBDA 1S8FA 2LCFA 4WIAA 1P60A 1U2RA 1RKBA 2JJ1A 3ZLJA 3QF4A 1XD9A 4TSFA 1KDOA 5FL7D 3CPHA 2IHYA 5FPYA 3M6AA 3QKRB 3HR7A 1FUUA 2KB0A 3VR6A 1KDRA 4PPNA 2D2EA 3S1AA 3I3SR 4HUTA 1WMSA 3ASYA 4XIGS 4HB3A 4KODA 1N2CE 1F6BA 1GL6A 1JR3E 2NG1A 3FMOB 5EUMA 2AXPA 1XNJA 1ZUIA 2ZIAA 3PV0A 2YWFA 4Z51A 4OK3A 3P20A 1H65A 3W5IA 2JATA 3MG9A 4DDWA 1W0KA 2C5LA 4F91B 1XPUA 1XEWY 2L0XA 3BD9A 3CRRA 4JS0A 2ZPTX 3B9QA 4GMDA 2A7QA 3HR8A 2ZE5A 1FZQA 3AVTA 4EPXA 3IPXA 5K8LA 3T1VA 3QBTA 2VLIA 3EPKA 1KK1A 3R9WA 3KUDA 1G64A 3O8BA 1DAMA 2BBOA 1PLJA 4UXHA 1DE0A 1JBKA 4ZO4A 3QY0A 3QOFA 2QAGC 5CM8B 1D6JA 1GKYA 3G82C 2JDIA 1YKSA 4MUBA 4S35A 4L4UA 4A0RA 1ZIPA 5KDOA 3B1VA 5FI0B 4CEIB 3TNFA 1A82A 3CNNA 1NVVQ 2ZR0A 4Q9IA 4HYYA 4NE2A 4OKSA 3GFOA 4FWTA 3M0EA 1GNPA 1E9AA 1HEIA 2G6BA 5KNBA 2C78A 2F43A 2JCSA 3LA6A 4TSFD 5HCIA 3T34A 721PA 2DYKA 2H8KA 2A5GA 2X8AA 3F5FA 4HDQB 4UNPA 4QFMA 1N5LA 1R0YA 1P2VA 1UADA 2QQ0A 3U4QB 4TYPA 1SXJB 2ZRHA 3U3OA 4B3BA 2O52A 1G8FA 5KHOC 1NVVR 4HI0E 3L0PA 4KVAA 1Q3HA 2J0UB 2QTHA 2D3WA 4BZXA 2RGEA 2H5EA 4BLRA 2IC5A 4V0LA 4B3FX 1W4CA 1S9DA 2D7DA 1TF7A 2IYQA 3CPJB 5EXXA 4IOJA 4XD7A 3SYNA 1W0KD 3KQKA 2ODEA 1SHKA 2RGNC 3CPEA 4A8JA 4WZAE 4PSAA 4IVQA 3OE7A 2CXXA 1KAOA 4UKDA 1QHNA 1OH7A 1KSGA 4RD6A 4A2QA 4HZIA 3SYKA 3SQWA 1JPNA 5G53C 2WWHA 4EUNA 3PXGA 5BN3A 2C99A 1T0JB 1G21E 2BCJQ 3FMIA 2RKOA 1P6XA 3UMSA 1FUKA 2OEPA 4TQUS 3WP1B 2VL7A 1OB5A 2JDID 2CK3A 2ATVA 5DGXA 3A1VA 1UAAA 2JEOA 3FFBA 3OEHD 1ESNA 1YE8A 1SULA 5FBLB 2IUTA 3IKJA 1K5DA 1P62B 221PA 2Q3HA 4X8MA 4BEBA 4AKIA 2XEXA 4DCSA 2JLWA 4MKHA 5FOUA 5KPJA 2BEJA 2BCGY 4WZ6A 1T8TA 5KTYA 5D3MB 5KOYA 1D9XA 5TVKA 1YQTA 4Q7MB 3KQNA 3OZXA 3I5YA 3AVPA 1KZGB 1HY3A 2JLZA 1DAIA 2E87A 4P33A 1F2UA 4ZDJA 1E4YA 2B7CA 2ZAMA 3A1SA 3PEVA 4URWR 4OI1A 4B2IA 3W3AA 3IO3A 2FEMA 1N0WA 2IHBA 2ZI6A 3CF6R 4XD7D 4EFLA 1G7SA 2CHVA 3BH0A 1XTKA 3TLXA 4ARZB 5FUXA 2WWIA 4DLXA 4QC2A 1OFHA 1OFTA 4Q47A 2WKRA 4B74A 2PMKA 2ZI3A 3GMTA 1MO6A 4RZ3A 3EPJA 1AS0A 4KHZA 4LJ4A 3CWQA 1HA3A 4EPWA 4ESVA 2GXQA 1JJVA 3PUVA 2JJ8A 2FOLA 1E9BA 1NBMD 2CK3D 3DEFA 1XTIA 3OAAD 4I1UA 1JB1A 1H8EA 2IK8A 3UIEA 4CW7A 3B13B 4AK9A 5DE3A 3TSWA 1X8JA 4LX0A 5HPYB 4KAXA 4CEJB 4QGAA 4CF7A 3ECCA 4BLOA 3PR1A 1DELA 4PC2A 4ACBA 1IBRA 4B47A 1FX0A 1ZVQA 1ZU4A 3B2EA 4Q4LA 4XVUA 4HAWA 3TQFA 3CX6A 3KXKA 3GLFE 5B58C 3NVAA 2ATXA 3MJHA 1F3OA 1G17A 1M7HA 1Q21A 3VQTA 5IT5A 1XDBA 3IILA 4R71A 4G1UC 5CK5A 1X1SA 5AUPB 2QUZA 3A58B 3T1TA 1O3YA 3AVWA 4O3MA 2P2LA 3EZ2A 4CIDA 2ANBA 1JI0A 4OI2A 4CYMA 3QKRA 4US0R 2KSQA 2QEQA 5IK2A 3I4LA 2R6FA 3UG7A 2GDJA 2VP6A 4RJLA 4U5XA 3LWNA 1XCGB 3A6PC 4IJMA 2AD5A 2IS2A 1EX6A 1D5CA 2NOAA 2CL0X 2QG6A 3VX4A 1D8TA 5KSOA 4C7OB 1XEFA 4DCUA 3ZD7A 3T06B 5JS7A 4NL4H 4I1SA 2WIAA 4HB2A 5BYKA 4QBGB 4TL9A 5BWMA 1QHIA 4AI6A 2GNOA 1N0UA 2ONKA 3ONWA 4PHHA 1GRQA 4KSCA 2HV8A 3SN6A 1KDTA 2I3BA 1CULC 1XCPA 2AL7A 1IOZA 1XMIA 1XTRA 1HYQA 4IDPA 2XITA 1UJ2A 3FVQA 4O2LA 2ZRKA 1ZNWA 1NSTA 1QHGA 2ZRPA 3LQRA 1WE2A 3VU9B 1IJEA 4AG6A 2NZJA 3T1OA 3D3QA 2CL7X 1DPFA 4N1AA 3KKPA 1SVWA 1E79A 2JGNA 2ZRBA 3WYGA 2GK7A 4B32A 2FMXA 2WSMA 3U2QA 2O8DA 3X1ZA 1AJEA 5KNDA 1T3HA 4ZKEA 1P5ZB 1M6NA 2GESA 2P67A 3AKDA 3FB4A 4DSTA 1JQLB 2ERYA 2J46A 2IWRA 3GLGB 1TUIA 2GILA 4TMTA 5IK2D 1E98A 2QMEA 2GRJA 2FG5A 5CB8A 5EP1A 3U4QA 3LW7A 1SXJA 4HLQB 1FNNA 2GBLC 3EIQA 4AYXA 5AJXA 2EYQA 4M22A 3I1FA 4Q5IA 3QSYA 2J0UA 1U9IA 2GJSA 2J41A 3ZDQA 5TXGA 2E1RA 1M8PA 1EXMA 2CJWB 1BO6A 4TL8A 3DMDA 4PQYA 4QBHA 5FBRB 1E2IA 3ZQ6A 1G9XA 2VH5R 4LHYA 1JR3D 2RCNA 4A36A 4I4LA 2IF0A 3C5CA 2HEIA 4I1OA 1DS6A 1FQJA 2OBMA 4GZMA 1GDDA 1G7RA 2CE2X 1KY3A 3BC1A 4URYR 3SBDA 1PVOA 4G3XA 4JBYA 4QJ3A
chains in the Genus database with same CATH superfamily
4N6GA 1DXHA 2JGDB 4OAOA 5BV2P 2EX1A 3K0KA 2FPRA 4LJYA 3HCCA 5HCNA 1YVPA 4MCHA 5IYZA 4ZU6X 2WFMA 1ORIA 3HM9A 3VSBA 3WGIA 4RETA 3CLKA 2ATEA 1L4YA 1R6XA 3PWSA 5JE8A 4L9SA 4R31A 4QBKA 3C6MA 3SKVA 4DV6B 1PHPA 5ICGA 1Q1NA 1RP1A 2XNCA 2H57A 5CPFA 1EB8A 1YL6A 4ETWA 3OQMA 4EK9A 2O1XA 2WUVA 2H5JA 1OBCA 1GFSA 4HB0A 2OBNA 4RH1A 1YRAA 1P4AA 4QOSA 3EDCA 5KDLA 3SQLA 4OATA 1BC5A 1SXJD 4IRUB 1H2RS 3JD2A 5FQNA 3DMPA 4N3NA 1TPYA 1XF1A 1LPMA 2NVUA 3QVJA 1L5OA 3U5TA 1EUQA 1C3LA 1FDWA 3ZH2A 3HP4A 3IEXA 1XWFA 4R7TA 3RUIA 3VO9A 1QE0A 1XTTA 5JR3A 5JYBA 3D6NB 2QAGA 3EEBA 3TF5A 3HN2A 5ICCA 3SJZA 4BWYA 4D9FA 5A4KA 4E21A 3PHGA 1DFHA 2V9CA 4JHXA 1A9TA 4BVBA 4GXRA 4CR6A 3L5KA 2R0QC 4B3SB 2VWHA 1KJIA 2R6ZA 1MEOA 2WF8A 3BE6A 3IXMA 2P4QA 4NHEA 4D9KA 1PZFA 2OG2A 2QM8A 4UHJA 3DZFA 1FNDA 2H9AA 2VF2A 4PHFA 1ZAKA 3TL6A 1UF9A 2G3YA 3LLCA 2NX2A 2HZ7A 4R2HA 5DNYB 4NI5A 4Y9UA 4HTAA 4KXQA 4PZZA 3UMFA 4BNDA 4L8WB 3I6QA 3PUHA 4YT8A 4BU1A 2Q50A 1QFYA 2JI9A 1PJZA 2ZDQA 1A7UA 1HEUA 3E3MA 2AR7A 2B7LA 4L08A 5T3YA 4TTAA 3KQLA 2XUZA 5F4BA 1DX9A 1NLZA 1U3GA 1H93A 3DAYA 2XA2A 5IWAB 1IXSB 1VBKA 2YMLA 4AF6A 1DIBA 2CJXA 3ZCPA 5IDQA 1GG5A 3FMFA 5GPBA 4C08A 4OX9B 1WP4A 1BXRB 1JFVA 1Z07A 1LTKA 2X1MA 3NDPA 4I50A 3UVEA 1MH1A 1WVIA 3NYQA 4OMCA 4DLPA 2A0FA 2XE8A 4N5LA 4NYMR 1J1IA 3AJRA 1IQPA 3O26A 1P1BA 5CH8A 3GCGA 3RVKA 3RASA 3H5TA 2HOQA 2OAGA 2RK4A 4KNYA 1RLTA 1V39A 3HBJA 3JZIA 4WSOA 4FMDB 4P4SA 3SS8A 3HADA 1TQ2A 2IBMA 1SKBA 1XZQA 1L5LA 2DY0A 5CIQA 2BHLA 2M6SA 3DOHA 5JO9A 1XLTC 4ETIA 1MT3A 3DNPA 3EPHA 3VR6H 4YCAA 3FKSA 3M4XA 1I7SB 1YQDA 1YS7A 2X76A 2NACA 4R2IA 4C06A 2HAEA 5KHLB 3K4QA 3ELBA 4NZZA 2J32A 3ACBA 1FTYA 5KYUB 4JC0A 4W8OA 4YMGA 3LC0A 5EKXA 4CT0A 3R76A 3E82A 3X1MA 4EG0A 5JHHB 4ND1A 3H11B 4JI5B 3JYPA 4E5VA 1V8FA 3T1YB 2ZVQX 3WISA 3MINA 2BUAA 3QIVA 1ZEJA 1Z8NA 1J70A 1NUQA 1FXWA 2H06A 3ENQA 1SUWA 3R5TA 3VGJA 1DG9A 4ZK2A 2QVXX 3CF4G 3QF4B 4V0SA 4AF7A 5KC8A 2I2WA 3D2CA 5LZ8A 1QRSA 2LBPA 1WNTA 2GSWA 2WNIA 2Y67A 4KO8A 2BFNA 3CCBA 4E11A 1X1RA 5TY0A 1U99A 2ON6A 1CLUA 1P0PA 4HEHA 1LSJA 4JL6A 4Z1MA 2DHDA 1CJTC 1MB3A 1VSBA 2CUTA 3OTIA 1V6AA 4ZI7A 3HNPA 3HWRA 1L2TA 3I39X 3QHAA 3GLVA 4IXMA 3NTQA 4M8IA 3WNZA 5HE8A 4WESA 4QNNA 5FR2A 2P2GA 4RAQA 1MLDA 2DG2A 2OCYC 4HMPA 1PLLA 3AONB 4WASA 3VR4D 5A03A 5BWNA 4QQKA 1NKSA 1NVAA 1N0HA 2JI4A 3AGQA 2GF2A 1GNVA 3FVTA 4S1VA 3N39C 2HZBA 4GBGA 2XOXA 3PUIA 2WJHA 4UATA 4BB5A 5KNBH 1YOVA 1O0BA 2GHTA 4OSOA 4GVLA 3RUPA 1N5JA 5KTRA 1Y3DE 2WD9A 2BR3A 2PFKA 3L1VA 2I66A 5ANRB 3PWTA 4FINA 1JXQA 4H16A 4UARA 4J2TA 1U7WA 4XWWA 2BEUA 1QVVA 3NEYA 4V3CA 4J0KA 2HSEA 4L1KA 3TK1A 1CTQA 3HKEB 3LU1A 4LGCA 4YV1A 5HS4A 3IEMA 3KKEA 2JJYA 3QUQA 1CS4C 1IY9A 1FW8A 3MAJA 5E4FA 1ACJA 2X4GA 3VSAA 3NHBA 2ALJA 4M0DA 1PX2A 3KJGA 3SX0A 3ZV6A 3I05A 2YC4C 3NT4A 4XCQA 3GA5A 2CJWA 1A5TA 1FY2A 4ZWNA 3CLUD 1S3SA 2TMKA 1OBHA 4QXQA 1T10A 3WK7A 1KI1A 4G5FA 4I4NA 3EXHC 1WP9A 2AN4A 3F7OA 1I8TA 1SA0A 2Q2WA 2D8AA 2W6JA 1UBHS 3LQFA 3PHCA 3ZYZA 2F55A 2WVHA 3C4QA 5DBHX 1MQSA 3K70D 1U3UA 1UOOA 3QFTA 3RLIA 3ES9A 1XYGA 3RC7A 1PF7E 2GN4A 3R3HA 4QWWA 4CHGA 2HGZA 1VKNA 3A4MA 2R6JA 2YZGA 1PSDA 4ZYTA 1PQ4A 2NPFA 3FTFA 1S2IA 3ENWA 4LZLA 5JZVA 5M7EA 1TMKA 4XVHA 3JAKA 1IEVA 1GRRA 4CL8A 4J91A 4KYTA 4UDYX 4V24A 2ZI7A 1YRLA 1T9ZA 1IB6A 1WW2A 3OOEA 4E88A 1PKXA 1D04A 4WOJA 5HJ7A 1RQPA 2H0RA 4X1YB 4Q3BA 4A3SA 1A7KA 5C1IA 4X90A 3SFTA 1XQ9A 2I65A 1X15A 3LVFO 4REQA 3IEUA 1OU4A 1MIHA 2DR0A 1WULS 4K26A 1I4WA 4YFYA 2RG7A 1P3JA 4MW6A 1YMQA 5L3SA 1GPBA 1I6LA 4INPA 2ZRFA 4HNRA 1XTSA 2A0WA 2G9QA 2HJHA 5KYWA 1YS9A 4WGFA 1LC3A 3WDSA 4E2YA 4BKUA 3GJSA 1NW3A 4N9WA 1UFVA 1W19A 3VMMA 1Y8RB 2O50A 1SFRA 3NV9A 3H5VA 3B1KA 3HP1A 3Q9NA 1DKUA 4FLEA 4PFSA 3LLMA 4UEJA 1UXHA 1MB4A 4FZ3A 3ZXYA 1LNZA 1HDZA 3PGLA 4WLFA 3ZEAA 3EZXA 2ZJOA 5IBPA 3NYRA 1R5BA 2IV2X 3U4DA 2MR6A 4N3AA 4ZIRA 2EFGA 3E5RA 1CY2A 1H9AA 3IXQA 4GGMX 1C2TA 5KAMA 5KOIA 5EJIA 4DV0B 1TCUA 5B6IA 3FY4A 3V4OA 2ECPA 3A04A 5K6TA 4A15A 3MRXA 5CVDA 1H69A 2UYYA 5FUQA 5HTOA 3PUKA 2P9EA 4LZPA 2COKA 3AVXA 1ZGJA 1V2GA 4LV8B 4WBNA 4QJIA 5D3QA 5D01A 1NN0A 4G6ZA 3U44A 3FSRA 2C4HA 3ROMA 2V8OA 2R65A 3EDOA 3QLJA 2J87A 5FL7A 2HLDA 1GRNA 3RYTC 2VG8A 2Q07A 1PS9A 3FH0A 2HIMA 3NBMA 3R6DA 1A27A 4LBWA 5BSRA 4A8HA 4BMXA 2A9RA 3ND7A 4GFDA 4K9QA 3ZCQA 4AKEA 1JYSA 3LUGA 3OF5A 4IFBA 3AR5A 3IVAA 4R84A 1PGOA 2ZBQA 4TX1A 2VFAA 3FPSA 4L5AA 4O63O 4UVHA 1SKMA 3O9MA 2OAP1 1AC5A 2QNRA 2I22A 2QZZA 1E0SA 3LYUA 3PPYA 3H42B 3VKUA 1UBLS 1AQ6A 1L8XA 4C4TA 4NESA 1NI4A 1H5NA 1JFLA 5AFSA 1XALA 5TS2A 3EB9A 1WEKA 4X6LA 4XR9A 1BFKA 1VMAA 1L5YA 1Z0IA 2G71A 5EP4A 4W5RA 3R74A 8MHTA 1JWBB 4IZIA 2GCNA 2XTJA 2Z95A 1SU8A 3I61A 3UGJA 3EXIA 5SZKB 3THRA 4BP1A 4V02A 1YB4A 2CXPA 4IXTA 5JSQA 1KY2A 3SHWA 5IPFA 5KSYA 3F6BX 3K0AB 1NVWQ 1BCSA 4QQ8A 2HMSA 3IJPA 4LXIA 3B3JA 2WHPB 2B4TO 2QRKA 3R7AA 2F3SA 2SKEA 1SC1A 1R9MA 5HIMA 5C5DA 2PX3A 3R5KA 1JG7A 4HVTA 1FP4B 1TIBA 1OIXA 4TROA 4FB5A 3TVTA 1HQCA 2ORVA 5CB4A 4JJEA 3DZIA 2QT9A 4ECEA 4BNFA 1CE8B 1U7UA 3LNTA 4WKPA 5TGZA 4NP6A 1IN6A 1KFBB 1OWOA 1DIOB 4D3YA 1I3CA 1XB2A 1FRFS 4WCVA 5THQA 4BB0A 3WAJA 1XK7A 1Q77A 1NVUQ 1R1DA 2YQ4A 3DJYA 3LQQA 4O1HA 4O8ZA 4S05A 3QPCA 2OD2A 3DZKA 2WAXA 1KK3A 3N7UA 1ICEA 4NWIA 1WL8A 5TQ0A 4EHLA 3BREA 5JWRA 1ZUNB 3EVEA 2GJ4A 3PDUA 1QYWA 1X7ZA 1M0SA 2NSDA 3IE0A 4UUAA 4EEKA 2Z2ZA 3II6X 5A9SB 1F0NA 3S81A 2GARA 2J3LA 2ZWOA 2WZBA 1EFUA 1NMZA 5DLYA 2XLCA 4LNUA 1T5DX 4CCYB 1MFZA 2ZEJA 2ZYUX 4E5KA 4IDAA 4F9EA 4CIXA 2VBIA 4L6CA 1JR2A 2XMBA 4RKQA 2QT1A 3HCBA 4DIFA 2HJRA 3FHCB 2Z9BA 2GYWA 2QYSA 4UEQA 4F84A 1Z74A 3ETEA 3EUFA 3OG9A 4FMDF 3TVYA 1O8CA 3P26A 5DT9A 3ZZUA 4DZRA 2Q3DA 5IKPA 5L4LA 1JR6A 3P2KA 4E15A 2GO7A 3ZLTA 5EQDA 2FF5A 1Z2AA 3GH1A 4HDKB 4QBIA 5K6AA 1HTBA 2IA5A 3L7DA 3RRYA 2IXTA 1NP6A 1EEXB 3PR2B 3QJ5A 1AKEA 4V0MA 2VEOA 3YASA 5ALXA 5IF3A 4OLBA 2P0EA 1RS0A 1Z4IA 3R8CA 3ZXUB 4UTRA 1CB0A 1I32A 5ALKA 3HV2A 3VMFA 2F8TA 4B34A 4GYWA 1EM8A 2QM7A 2QJOA 2HNAA 3BHIA 3T7JA 1C2YA 2D00A 3DEYX 3K16A 3KT0A 3M33A 4HCJA 3U7RA 2YJ3A 3HXPA 4EW6A 1CHDA 3A1DA 5AXBA 4CQMD 1PFGA 1RYHA 1WQ1R 2VNIA 3HGMA 1OU0A 3U62A 1WCWA 5LP6C 3MUFA 1J22A 2P2NA 2YZ2A 4PSUA 4DV4B 1I30A 2OVFA 4RPLA 1O6FA 4AMZA 4QVKA 2PR2A 1A9OA 3ZV3A 2X58A 3E9NA 4NDNE 2X42A 1MOSA 4MHTA 3HLTA 2RD2A 4DF3A 1L8AA 4LYEA 2VP4A 1MAAA 3EASA 2BMJA 5T67A 2VIIA 2X40A 3B6IA 2HO5A 5B30A 1K5GA 1MRNA 4HWTA 1XD8A 2JCGA 4P83A 3TR6A 5JCJD 3P96A 2P6MA 5IZ4A 5JROA 1UJ6A 5HRUA 4CDRA 3BL8A 5A6VA 1G6HA 5I3ZA 1PNTA 1ZHHA 1M3SA 2WNSA 2YBEA 4AQDA 5CFOA 1SN7A 2XGMA 4FFDA 2FUNB 2X9LA 1N6LA 5CGZA 5JJCA 3T1HB 4MDEA 3VAZA 4E94A 3N28A 2GJ8A 4HNAB 5EERA 2JIMA 1XA0A 1MGOA 4O8CA 1MAHA 4DWJA 1XHEA 2LR0A 4RY2A 5F77A 1E6LA 3IR6A 2HU7A 1P19A 2G09A 2PLWA 1C9EA 2GPBA 3QG1A 4H15A 2CB0A 3A14A 3Q41A 4GI7A 1MH9A 5DHTA 2IU0A 3HJAA 1GPNA 4MRMA 3D4PA 1BXGB 1TE2A 3TAXA 2G9ZA 3QPAA 4DRXA 1F0PA 2HU2A 4NZOA 4QO7A 3RVSA 5GGXA 2ZRGA 4Z1OA 2KLBA 2GTIA 4V2UA 3SOPA 2B4AA 1PUXA 1N8NA 4CQNA 1CK4A 4UE2A 2IYPA 2VHZA 4LRWA 4WUTA 3THYB 3C5VA 3L1KA 3G23A 3QVGA 1NBMA 3ROPA 4IH9A 1EFHA 3VSEA 3OAAA 4YRMA 2EZ8A 1RI3A 3WLEA 2FUEA 4HLUA 2OHJA 4TQGA 3A9CA 1W4BA 4X1IB 1YDEA 3N8DA 2JKVA 1FU8A 1KSJA 2VJQA 3PDIB 3QRWA 4IVPA 4K5QA 3T7IA 5FDFA 5KTPA 1IAQA 3NCHA 1U9ZA 1UKZA 2C61A 2H11A 4F1JA 4OHFA 4KXMA 3NBZC 1M7BA 4AZVA 3QFHA 1FB5A 2R1TB 5AKJA 5M3BA 1AV7A 3L4SO 3ELYA 3P0EA 3EXFB 1SUBA 1JBQA 1VG8A 4IILA 1JVBA 1WIWA 1DWUA 1G5RA 1OOEA 1YQEA 2C8KA 2GZSA 2XZPA 3H5IA 1PJQA 3ZE2B 2A58A 2MTBA 4NG5A 3ASVA 4R9NA 3KWFA 5FTKA 4OB8A 2WTUA 2ZSFA 3OU2A 3MTAA 3Q7TA 3L0DA 5HWSA 3B5EA 2UU9B 4FC6A 2GPAA 1Z9BA 4JFRA 2FZVA 3AFHA 3NMUF 2NO4A 3TB6A 4D0NA 1QQAA 1QUEA 1T1JA 2J3JA 2WG2A 4G0MA 3ZW7A 1DHRA 3H9JA 4CCWA 2DULA 2XTMA 5DNDA 4QHYA 1SHZA 3LHIA 4W9MC 4YB8A 1NLUA 3S29A 1A76A 3BTOA 3DVAB 4RA6B 5ALVA 4K6KA 1YQGA 2E21A 3E9MA 1ADJA 1ZAYA 1JKXA 1ZYUA 1U0TA 4EGJA 1XVAA 5AHXA 1Z6GA 3FYUC 3JQAB 3OURA 4HEA6 3FCSB 3WIOA 4CN9A 2VCHA 4W7HA 5I7VA 2ZRIA 5CFZA 4KV9A 5BYAA 2GAJA 1II0A 1ZY2A 1OFUX 1U9CA 2GJ9A 5HILA 3IQXA 1CXZA 1KPHA 3QU9A 2FSFA 5JI3E 1QVZA 3PQ8A 4GKBA 1EYZA 1Z36A 2QIOA 5EJAA 4AJIA 4JUCA 2UXBB 5INTA 3D3WB 3FGZA 4MV0A 4PC6A 2C4TA 5KJFA 1ZJ6A 5EJMA 4UBMA 3TOVA 2XGSA 3JTEA 4U5QA 1UXKA 2N9UA 1HORA 3GLIA 2Q9BA 4BVFA 3QXGA 1KQGA 1VP3A 2IKQA 1DIRA 5HK8A 2ZCJA 1J2JA 4RMGA 1OHHA 2G63A 3WADA 1P8AA 1FTNA 2C88A 2LKDA 1Y1SA 2B0JA 3ETCA 3IIJA 4W9NA 2WWFA 4NICA 3LL4A 2QPAA 3QW4B 2BEVA 3U1TA 3IXLA 4DJTA 2JRCA 1WUJS 1CB7A 5K0CA 4F86A 3KQMA 5KJEA 3RYFA 4MLDA 1ENOA 2QLJA 3JQBA 3ZY5A 3SYLA 4RPHA 3BBPA 3QQ5A 4HAVA 4GZ3A 3IBFA 4DMFA 2V7WA 4NCKA 1NG9A 2FK8A 5EQJB 5FUVA 4QYIB 3AEXA 4UMEA 4YDHB 1WO8A 5DU2A 1T1GA 3RHZA 4MWDA 3GLFB 1XKXA 1YU9A 4F0JA 2O59A 5FWYA 2O57A 2EBHX 3PFIA 1QF9A 1D6NA 2VA8A 5H81A 2LVBA 5AIAA 3OHPA 4UCQA 4L15A 5DTMA 4WXRA 3OPVA 1G8PA 4FSHA 4QU8A 2BZ1A 1Z83A 3DT8A 1SD1A 1XR3A 1XWWA 2EVWX 1HRKA 1L7AA 2AX4A 3BXXA 5K03A 1MEJA 2BTOA 4BPBA 3C6QA 4BCBA 3WLIA 1G8GA 1TJ5A 2OO5C 2OMKA 4B2YA 3FLMA 4OHCA 3WQQA 1QHXA 1W5EA 2AT1A 2I2DA 3G8BA 2YWGA 2CLOB 2Z58A 3DE3X 3OX4A 1GZDA 3DKVA 4KFTA 1N2CA 4RANA 1FA9A 4MWBA 2Q6OA 4KBYA 3IQHX 1RBYA 1QG2A 1JQDA 3MYRA 3GLUA 4Y6QA 3K6JA 3LPNA 3ZVKA 3EXAA 3ZD8A 4ZI2A 3TCKA 3DVQX 5M29A 1FS5A 4G89A 3E8SA 5GQSA 2C7RA 4JBXA 4PY2A 4IRMA 1CJBA 1RQGA 3ZKWB 1YF3A 3RYCA 2FX3A 2ZE6A 2ZIEA 1MOPA 2XKKA 1WOMA 2V98A 1KP3A 1N75A 4GLJA 3E58A 1KS2A 1YXMA 1A9QA 1BWQA 1SXGA 2OB1A 2PQ6A 2WHRA 3X1WA 2CLFB 3ZBPA 4YRNA 4YCMA 1TYDE 2TECE 3C8DA 3HL0A 2OB2A 1DAGA 3R0QA 5BMVA 4NCNA 5LNK1 1SD2A 1BVYF 4DEXA 4DYHA 4EGFA 3BRWD 3ULKA 4N03A 4FLFA 2AOWA 3HCOA 4A4DA 4OHBA 3PBKA 1ZD2P 2VQSA 3TGWA 3A7EA 1TVMA 1H2XA 2P2DA 2PMCA 3A2NA 3HG7A 1D2GA 1FXSA 2H17A 3FPEA 3QNUA 1N4DA 4UM7A 4C0AC 3GLQA 5BY2A 2PWYA 5IDWA 3DQPA 1DIGA 2HT6A 1NQAO 4GGOA 4GX0A 5E6UA 1T5OA 2V97A 3TEFA 5D8DA 2BM1A 3ANTA 1R12A 5AQ1A 3RC2A 1GPWB 1SVIA 1J9GA 2IYUA 2HDNB 4BKRA 1XMVA 5CIYA 2ILTA 3CVYA 4MVWA 1W35A 2VCEA 3B7GA 1MD9A 4CCAA 2Z57A 1G42A 1NC3A 4HAZA 4LAFA 2A1UA 3LUDA 2P9TA 2JD1A 3DYVA 4FOOA 5TGDA 3VNVA 3P2JA 1ZUWA 3M4JA 1EVKA 1VBNA 1DV1A 4H3KB 3GT4A 1N8SA 1G9TA 3HCDA 3HI4A 3K8QA 4B83A 1WDWB 3H04A 3OQHA 2CGEA 4LEIA 3IOCA 4P08A 3WGKA 1JEYB 2NU9B 5FWNA 1FFHA 1R0WA 5EJ5A 5J4YA 4ARUA 4LRUA 2QZPA 4HRYA 5ADVA 1HUQA 3T4UA 1LLUA 3HYSA 3KDAA 3N0WA 4WZAA 1G38A 4N82A 1KJYA 4WFKA 4YI5A 2WF6A 1DDIA 2YXPX 4UE6A 1DVRA 4HX5A 4NBTA 1KO4A 4NDZA 1JHZA 2BMFA 2BPOA 3FKQA 2GTHA 1HDXA 3H8JA 5AHKA 4AW9A 4RK6A 1GNTA 5EMMA 1AXRA 2XYRA 2PGNA 2PSEA 1YHYA 3CZMA 4UAUA 4WCFC 1KJ9A 4DMRA 1FDIA 1YWGO 1NIPA 1RPNA 5HIKA 1T36B 3GZNB 4FXPA 1QP4A 3STTA 3V4PB 3PHIA 4BP9A 4CDMA 5DCYA 5JDCA 4ZOBA 3PGVA 4D0RA 5U1PA 1C7FA 2ZU0C 5DX1A 4YR9A 2GBIA 2Q2VA 4I9FA 1EAYA 1GU7A 4MKRA 4XWGA 4YECA 1PYDA 3FIJA 1YR6A 5FNZA 2H7CA 3RNOA 3NHWA 3TTVA 3UJPA 1XJ5A 4BE7B 3MIZA 2OM2A 5HF6A 3S4YA 2HIHA 2OFWA 5CVEA 2FW0A 3EGVA 5KSPA 4YJHA 3Q40A 4NABA 1NVKA 1KAEA 1VLQA 4O2BB 1CUXA 2X15A 2QBYB 5GZ1A 2A33A 3PIIA 2C5SA 1T2VA 2OXTA 3T0GA 3KKQA 3OMXA 5KMGB 2G8NA 2JFPA 7MDHA 1EVLA 4B5KA 2YHSA 3OZ7A 4FHDA 4KRFA 3KZOA 2DT8A 2GVNA 2H4WA 5EIHA 4DTCA 3G1TA 3LIIA 1VLVA 1GCOA 3QKIA 4O6VA 5AK5A 2QSUA 2ZWPA 3EVCA 1GG2A 4KGDA 2AV6A 1HYGA 2UV8A 1EQ2A 1KYXA 2HHCA 4EMUA 4JCCA 1ECLA 1UPFA 1TDJA 1R0ZA 1SU4A 4TL6A 3FRJA 3L7AA 4NFYA 1X2BA 3ZE8A 1JDPA 4RZ2A 3KXLA 1SKYB 1UJNA 1Z5ZA 3PXBA 1ZXLA 5ARDA 5JD4A 4BJ6A 2AWNA 4TN1A 3PGKA 1ECPA 5K99A 2RGXA 2CF5A 3PUYA 3M49A 8GPBA 3GMIA 1M54A 3Q0EA 2X8LA 1W4LA 1FUEA 2E82A 3A3NA 2GM3A 1W36B 1FCJA 3H1BA 3W8FA 3LF1A 1B23P 4D57A 3AR8A 2WKPA 2FHSA 3JASB 1IULA 4ND5A 3H75A 2ADMA 2J6BA 5ALWA 4BZQA 4PYMA 4Q4AA 4LFBB 1QFSA 1C9YA 2BKAA 3ICVA 3N2KB 2JIPA 5HQ3A 5K0LA 3QHQA 3RT7A 4Z99A 3A26A 1JXAA 2J3KA 2NV6A 3KB8A 4YDQA 4Z7JA 4C4XA 4WCDA 3DF9A 3GRVA 4X93A 5CNIA 3F73A 3AF4A 5AESA 4C5CA 3HJFA 1N3LA 2HDHA 3RUDA 5KQSA 2X5JO 3IP1A 2WWXA 3HK2A 3B8EA 4MQ4A 1ORWA 2CVHA 3GC6A 2GBFA 4EI7A 1VZ3A 3KYCA 2IKSA 2PT5A 3QSGA 4JB8A 3HUFA 3LWZA 3SQDA 5BXYA 4XX0A 1R00A 3K9CA 2BSQA 2FX2A 3V3TA 1YJBA 3PUZA 4FCTA 4AQ7A 1H8HA 4PHTA 1QTNA 2IUSA 3HN6A 4IS3A 4R2JA 4EFNA 2GN8A 4CMHA 4D02A 4MIOA 2HTEA 4NLLA 3I9FA 4UNQA 5C1BA 3T61A 1K0UA 1GG9A 1Q0SA 4Y2TA 4AWBA 3R9XB 4FK8A 2GEUA 4UPVA 3OWHA 3OX2A 3SXJA 1VBFA 3DTYA 3FE2A 2C7GA 1O9HA 4QSMA 1BE6A 2AVNA 2QUAA 4IPTA 5FAXA 1Q3KA 4WV3A 4XOIA 1P4HA 1X9HA 1AS2A 1KZYC 3I34X 3BSFA 3PCXA 2PR7A 4RFSB 4G24A 3M6WA 4BNUA 5I7SA 1JU4A 2N1MA 4OQ4A 2A78A 2GM9A 2P90A 1EE1A 1ISRA 1NTRA 1T6YA 2H9YA 3I83A 3P1JA 5KTTA 2R87A 4MK4A 4JLDA 4OHZA 2NUAB 2QL6A 1ID8A 2VT7A 5FFMA 1U11A 2J7PD 2VP0A 2QR3A 1B8OA 4TZKA 1EXWA 2D74A 3R0ZA 3HYNA 1LW7A 1CNMA 1VECA 2JVJA 3O4GA 4DDVA 1X1CA 4AS3A 5B7PA 4NDAA 1RWXA 1BRTA 2FE1A 4QEKA 3I8OA 3EEYA 5BQOA 4BO7A 3CNOA 3L0YA 1NYTA 4JZKA 4EPRA 1KRWA 2V0CA 5LXTA 1NT2A 2J0QA 4G4SO 2B82A 2YWCA 3ETHA 3NIDB 1MV8A 2Z2XA 3EVGA 4FZVA 2AQIA 3QUSA 3R3SA 4XJVA 1AKTA 2AHRA 3SXUA 2VXYA 4OY3A 5BQXA 5JS1A 2Q1TA 4OYLA 2X0EA 1T4BA 1T5BA 1JFFB 4OF4A 3FA2A 4QDJA 3WWPA 4JJZA 4E30A 3NEAA 1MEEA 3VFDA 1G3QA 2GAAA 4R1MA 2Z9DA 3NOOA 3I0NA 2JFOA 3KJIA 5LYJB 2RGYA 4UUMA 1MT0A 3FNQA 4GF5A 1ZS9A 4OOEA 1R3DA 4DBZA 3VKHA 3IVXA 4BN0A 3D59A 2GD0A 3WIVA 3A6GA 5HKAA 2G1AA 3PNQA 1T29A 2DBQA 2FY8A 3DZJA 4UU0A 1EDBA 3O91A 3QEAZ 3UCEA 4AROA 4EJSC 2I1VB 1QAQA 5AICA 4RMNA 2PKQO 4HY3A 4TLLB 5ALMA 5DXJA 3IMFA 4ZQHA 1LK7A 3UJNA 1TQDA 2RB4A 3C45A 5IAJA 4DVGA 4PCVA 3CZQA 3GGOA 2IZZA 4RSMA 3UK1A 3WB1A 3U6BA 4LOJA 2C07A 1BD4A 1YD7A 1YULA 2HQOA 5JALA 4IIHA 5AXAA 1QBGA 2DFPA 1FFGA 5F12A 1W4AA 2PCLA 1T8UA 2CBZA 3GFPA 3LUAA 3UW1A 4C29A 4KR3A 2D4AA 4F1WA 5CDFE 1BMTA 1Y98A 2HF9A 2MSDB 1NF2A 5JVDA 4BVHA 2AC2A 1GAEO 4ZEOA 6ABPA 3PXAA 3IBGA 4MUNA 4Y2SA 3DTTA 3WXBA 1V3TA 5L4NA 4IIYA 5KYNA 4GNRA 3GLTA 1VHTA 5CG2A 1Z5PA 5CMLA 2JW5A 2PL1A 2XKJE 3FTCA 3CS3A 4UNSA 1V1RB 1ND5A 3MMNA 2YOFA 3UO8B 2AEEA 2MSNA 4RESA 1XEAA 2A1TR 1F20A 1G3UA 3MHPA 3UMRA 4RCYA 4GKVA 3TQIA 3WKDA 3LHFA 3PR3A 4NR0A 3MERA 4TTRA 2E48A 3IOYA 4H6PA 2JLCA 3NHSA 4ZZ3A 9LDTA 4D46A 4O25A 1BN7A 2RB5A 1XZMA 3H2ZA 1FUIA 1K8XB 3FYHA 3JXEA 3BGVA 3UT6A 3WRYC 4EHDA 4B7UA 4XWYA 3ZGNA 4MUMA 1FOEB 2OXEA 5DYYA 3VKGA 1CUDA 4M54A 2WKWA 3DLHA 3DBRB 1GZHB 1LD3A 1X3LA 1SCUA 1LBQA 2HA6A 2HLHA 1UZUA 4FMPA 2XWQA 4OQYA 3RRXA 1UAYA 4LV5B 3ZNQA 3I1YA 4D3FA 4HAIA 1V6CA 2ZU6A 1IWBB 2GHIA 2P6UA 2QX7A 4PTZA 2AXNA 4O29A 3NFYA 1DRVA 5AVYA 1UMCB 2IEDA 2CD7A 1L8QA 3KR0A 4CM8B 2XKBA 1Z82A 5B1EA 5JRZA 1OZAA 2V45A 5DKFA 4U7PB 5J23A 2HA7A 3NQ41 1Y7PA 4PG4A 2DPXA 1DC3A 1JHXA 3HFRA 4PLPA 2ONJA 4BDTA 4JGIA 4M1YA 2RKWA 3HA7A 3O4IA 2H4YA 3NTOA 4Q00A 3QBVA 5HGJA 5EPUA 3TFWA 3CF2A 3V5NA 5EMJA 1OX4A 3IQFA 5G02A 5LBIA 4I3FA 4EY7A 4Q4CA 4DT1B 2ZYAA 3R3JA 1RIFA 3C48A 1VBMA 1FTSA 1CR2A 1TQ8A 2YY5A 3DTVB 3F5DA 1QIHA 1D0VA 4CV2A 1GTG1 2MINB 3HMKA 3F71A 3IAUA 3OJXA 1DB3A 4D8YA 1UP4A 4DFDA 2FNAA 2PH1A 4GPD1 1KC1A 2GEJA 4XVCA 5C2JB 1E2UA 3RYHB 4G01B 4JOCA 3C1AA 2CUZA 3ND5A 5K0FA 3W6PA 2CL5A 5HFAA 4B31A 1Z2CA 3L46A 5EGSA 3Q5GA 1DUSA 1B41A 4PZDA 4X6UA 1KC3A 3LYHA 4O2BF 3FBGA 1NR5A 1N8TA 1VLZA 3T7DA 4TV8F 2NP7A 3MF4A 4P54A 2O23A 1TUBB 1C3VA 2B20A 3UF0A 1B4DA 2CXOA 3KDSE 4PGMA 3E05A 2J0SA 5EHZA 5KU1A 4L74A 3CX8A 2L2QA 3BDAA 4UEWA 3ZYCA 3FNBA 1CJMA 4X1KA 3U81A 4H7PA 3OETA 4HB4A 4KV7A 3V6LA 3RDPA 1UWLA 4V1CA 4BXOB 3G5UA 1S96A 1GTMA 4YLEA 3CH6A 2FPKA 2OHIA 4H7DA 1ECJA 2FPGA 5C8YB 1C80A 2W7TA 3GJ0A 2POCA 2XJ4A 1OYYA 3D8SA 4C01A 4QXRA 3SM3A 3D6JA 1QIFA 3TJRA 3NHZA 2R1UA 4L3OA 1Q6ZA 2VSQA 121PA 5GIPE 2PT7A 3SZGA 1RYEA 3L7BA 4RBNA 3AHIA 4PSVA 4RY9A 1OQAA 4XSHA 1EFVA 5JCJA 3DMHA 3NP7A 4YYEA 1NQWA 5M04A 3C3XA 1U0NA 3ESYA 2AOVA 2H07A 2O2CA 4ZAZA 2ZQZA 1SZPA 2DUJA 1QTQA 2JIZD 3PNSA 1BD3A 4KXLA 1L7XA 4HWPA 1IXYA 3GGPA 1Y37A 1E2QA 4MUEA 5CVTA 2VPXA 2XNDD 4DJFC 4MCJA 4YASA 4EMTA 1J6UA 2OHFA 4JJ6A 4UVGA 2OLEA 5ALJA 3FGPA 4G84A 5JFOA 1CS0A 2H18A 2C5BA 2A9FA 3PYLA 2FXIA 2HWUA 2Z5LA 2F1HA 3IOEA 4LJ8A 1L9XA 4XUDA 2ZWMA 2JAWA 1FLVA 4G5RA 3UAGA 1J8VA 3MPOA 1QO0D 2HJVA 2FMUA 2JGIA 3EMKA 3FVRA 3SHVA 5CBPB 5K09A 3EMBA 2IW3A 3TL2A 1VKRA 4C9BA 4EHFA 1G5IA 2HPZA 3I2KA 1J5EB 3OM1A 3QLUC 1CUFA 4HTFA 3CRNA 1XT6A 2CDAA 4KX3A 4TKUB 1G291 3L49A 2DZDA 4P98A 3A10A 3GV0A 5LQCA 2DWOA 4Y6GB 1JAXA 2Z2YA 3E81A 4TZ0A 3EWNA 4MYUA 1NOKA 3F6SA 4GLOA 2VK1A 3KVYA 3PFKA 3GDFA 3NDRA 2F1IA 2BP7A 5HBGA 1JHMA 1K1EA 1FC0A 1XL1A 2B6HA 2GMWA 1IPFA 3HLYA 4TT8A 3TMAA 2W90A 2JFFA 3PEWA 1CNFA 1I33A 1FLDA 1RSZA 1XQYA 3UH1A 4CU5A 5AM2A 4UPEA 3B5IA 3ITEA 2ZXFA 3D1JA 4ZARA 4F06A 3RG8A 3VJKA 3H19A 3QF7A 3K53A 4EL0A 3Q7SA 2PX2A 1PJLA 4KE8A 3ZE7A 4FN4A 1JR4A 2JJ1D 4AZSA 1E61A 3JZAA 1VOTA 4ZOEA 1O87A 1E4EB 2O8FA 3L1JA 3B1WA 4Q7LA 4AJLA 4J2HA 5CP8A 3HJUA 2YQ5A 4R1UA 4XIIA 4TTIA 2QF7A 2QRJA 1N3IA 2BI8A 2BHSA 4CKYA 1QHEA 3KALA 4LHVA 3RKRA 3LAWA 1MDFA 3F74A 1W30A 1X9GA 4PINA 4Q9AA 1EVQA 1IL0A 2GJKA 5JRJA 3QEBZ 2CUNA 1OGIA 1CP3A 2PZJA 4B2PA 4CQLB 4OQZA 4PN7A 1HL3A 3EC2A 2W5UA 1DBVO 2DFVA 4QUAA 2VVTA 3DE1X 3RTCA 1FVOA 5JZ9A 1TU3A 4UNNA 3ZXIA 3NWJA 2W6PA 3CT6A 3AF1A 3KB2A 1XKTA 1Y3AA 2DM6A 1O97C 2QX9A 4WKGA 2PLAA 1ABEA 1VIVA 3MLBA 5LDDC 1KJQA 4F3RA 1RAIA 2H1OA 3G2OA 4MCAA 5HM6A 2JKZA 4H17A 3SLRA 1IWPB 1P6UA 3LXRA 4J8PA 1YZUA 2QZJA 5I5GA 2ZM6B 3PPIA 4N3GA 3RS5A 1ZGAA 1E2KA 1KEUA 1I6KA 4YQFA 1W2GA 2J9YB 3BS4A 2C2HA 2R2GA 1D1TA 2EG9A 3O1JC 4OP2A 3FLAA 4S0ZA 1C0EA 2M6LA 2JARA 1BX3A 1RQXA 4IVRA 3H2KA 1U0RA 1FK8A 3DEHA 3IBCA 4PRZA 4N8EA 5LB2A 1H6BA 4NMHA 4YQEA 3W5JA 4ICIA 3VOAA 4BVKA 4FMCF 4YMVA 4L0DA 4DA6A 3BKWA 5BSFA 1I1HA 1QZXA 4F2HA 3QH4A 5CRIA 5G40A 1Z6YA 2VHXA 1DBPA 3ZGXA 1T1SA 3ZD6A 4C87A 3DHNA 4M0UA 1KU0A 3L92A 2MSWA 2DCUA 2JA2A 3MZ0A 2CNDA 5CM9C 1QK3A 2RBEA 4KZKA 2DGDA 1ADGA 4UJ5A 3QBDA 3UT0A 4FHGA 5IT9A 1QU2A 2OYSA 2RC6A 4UHFA 3JYHA 1CQWA 4QDTA 4CVNA 3NORA 3MT9A 3ONFA 5JMOA 1ZHOA 4ETMA 5ALQA 3OIGA 2JIBA 2J85A 2QMHA 1LA2A 4BGEA 4MPTA 5IM4A 1LPNA 2J3IA 4ZHQA 3VO1A 4DHEA 3ZI0A 4MDHA 4KDRA 2SKDA 3PVZA 4CKWB 1V7PC