1MB3A

Crystal structure of the response regulator divk at ph 8.5 in complex with mg2+
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
123
structure length
117
Chain Sequence
TKKVLIVEDNELNMKLFHDLLEAQGYETLQTREGLSALSIARENKPDLILMDIQLPEISGLEVTKWLKEDDDLAHIPVVAVTDEERIREGGCEAYISKPISVVHFLETIKRLLERQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic and Biochemical Studies of DivK Reveal Novel Features of an Essential Response Regulator in Caulobacter crescentus.
pubmed doi rcsb
source organism Caulobacter vibrioides
molecule tags Signaling protein, cell cycle
molecule keywords cell division response regulator DivK
total genus 38
structure length 117
sequence length 123
ec nomenclature
pdb deposition date 2002-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1mb3A00
3RVLA 3IPAA 3NNNA 1FFWA 3N6VA 4KK4A 1NXOA 5CHYA 4MQFA 4QPJC 2KYRA 4HNRA 4N03A 4W5OA 3FFTA 2IPLA 2WMYA 2L19A 1DP4A 3CU5A 3IPCA 3LUJA 4LE0A 4ETIA 3F6PA 1KMIY 1E2BA 5IULC 2FSPA 1BDJA 4JP1A 2FEKA 3URMA 1M5UA 4OG2A 1ZITA 1JDPA 3C3KA 4RSMA 4TN5A 3K9CA 4KQ9A 4PZ0A 4DQDA 1DG9A 2MYTA 3CTPA 3NHMA 4IF4A 3N0WA 4MS1B 4XARA 2FMHA 2A9QA 2PJUA 4MGEA 4DN6A 3DGFC 1JFTA 3O2JA 4KVFA 4G0MA 4MS3A 1SRRA 2JVJA 2CHEA 1H9CA 3VNBA 4Q6WA 4LDZA 3F7NA 1F51E 2DRIA 3GBVA 4RDCA 5FWXA 2GBPA 4EY3A 4UHKA 3HO1A 3N75A 1QP7A 4RKRA 3KTOA 1QQBA 4ETNA 5EWJB 3RH0A 3RVKA 4DADA 3H5LA 4Z9BA 5TQJA 2X7XA 2VUIB 2VUHB 3QEMA 4Z4CA 5CNMA 4EYGA 1C4WA 3SM9A 1CYEA 5ABPA 3JPWA 2NZVG 4WT7A 5HKOA 1ZY2A 2MSLA 1EWVA 1QO0A 3LMKA 4G86A 5TPWA 3F6CA 5TPZA 3QLUA 3KLNA 3O1HB 5HM6A 1B00A 2CHFA 4NCBA 4RKQA 3F73A 4TLLB 4MAAA 5F64A 4EVSA 3N53A 1JHZA 2ZWMA 4XAQA 1DJMA 5DTEA 2IPAB 3I09A 4P98A 2A9RA 4FB4A 1BDIA 3CRNA 2W42A 4RK0A 4PYRA 3HVRA 1E6MA 3CNBA 1XWWA 1BAPA 3CKMA 2IDMA 1BVHA 3T95A 1RXEA 3G1WA 1DC8A 4OTZA 1U2PA 4HNQA 1JX6A 3DZDA 4RXTA 4TLMB 3CG0A 3C3MA 4W5QA 1MAVA 1UDRA 4TMYA 3N0RA 5HSGA 1FFSA 1D1QA 6CHYA 1M5TA 1JYFA 2P9HA 3FDFA 5TQ2B 4OBBA 1VKRA 1ZDMA 1QNLA 2MYPA 4N47A 3QK7A 5GOTA 4HNSA 2GWRA 2FVYA 1PHRA 1QKKA 5IEBA 5TPZD 3R0JA 3H6HA 2E4ZA 1M2EA 3VNAA 1WETA 3LKBA 2R25B 3K4HA 4CBVA 2N9UA 1R8JA 5FWYA 4GPAA 5JS2A 2QW1A 4G0PA 1W9HA 4IMIB 5T7BA 1IIBA 4G0XA 4WUTA 3H75A 1USIA 2LBPA 1MB3A 2F8TA 3KYIB 5BRAA 1Z18A 3TB6A 3Q7TA 5TQ0A 3OO0A 1NATA 1U2QA 4MS1A 2HQBA 4LDAA 3OQNA 1BDHA 1GCGA 2AYZA 6ABPA 1ZN2A 1USGA 1E6LA 1Z2EA 4KPYA 3BRSA 3A0UA 3A10A 4PE5B 9ABPA 4JOQA 4EYKA 2RGYA 3QELA 2V0NA 5FBHA 1YK0A 4LE2A 2JCGA 1YS7A 4H3HB 2JRLA 3N0XA 2ZAYA 4RZSA 1YIOA 4D74A 2LIVA 2I6FA 2IYNA 1P6UA 2HJ9A 5IBQA 2FMFA 3HUUA 4MYRA 3IP5A 2PUAA 4N76A 3HUTA 4LX8A 1Z26A 1JBEA 1Z2DA 3EQZA 1NXTA 1ZH2A 3CZCA 3ILHA 5T3YA 2IOYA 2PAFA 3I42A 4IGAA 4NICA 1FFGA 1K66A 1DBQA 4RK6A 3FGZA 3NNSA 2QR3A 4HYEA 4MS3B 2XDYA 3LFTA 1U04A 1ZGGA 4YWHA 1A0OA 4D6YA 3D8UA 3RVQA 2HQOA 1F4VA 3JVIA 2JVKA 3H5VA 3M9XA 1PNRA 1JFSA 4MPTA 2QZJA 5IEJA 3MF4A 5KQGA 1LBIA 2LP4Y 2RDMA 3IDOA 3RVSA 3QLVC 1L5ZA 5DGCA 2CD7A 3KG2A 1D5WA 4MR7A 4ZJPA 3O74A 5KQPA 1Z12A 3OO1A 4RK4A 4YR7A 4LE1A 1RPJA 2GX6A 3EDCA 5FBKA 5FWXB 3LUAA 4Z0NA 4KQCA 3OMXA 3QEKA 4PEVA 4W5NA 4YRZA 3UUGA 4YS6A 1D2AA 1RNLA 2R48A 1RZRA 2LPMA 2PKXA 5D2CA 1URPA 4MR8B 3OLWA 4XASA 3HK2A 2GKGA 3GT7A 2QU7A 4RS3A 4KZKA 4YP9A 5TQ0B 1LJUA 3TX6A 1EAYA 2PUDA 2P4UA 3LOPA 4E7OA 2LUOA 3FFWA 3KS9A 2FQYA 3HSYA 2PUCA 5E3JA 5TPWB 1QPZA 3EULA 4MLCA 2L18A 4L85A 1NY5A 2HPHA 4RXUA 3ILYA 3W9SA 4IRXA 4JA2A 3UK0A 5JNUA 5KWSA 3N8IA 3IP6A 3LUFA 3HEBA 3MYYA 3TD9A 4Q6BA 4MQEB 2JB9A 2PUBA 3BBLA 4Z9AA 2JBAA 1TM2A 4RK5A 3QX9A 3JTEA 4EYQA 5BR1A 1P6QA 4Q7EA 1NXVA 1OXBB 3MQ4A 4XXHA 2QVCA 3OM0A 4MS4A 2FTKE 3P9YA 5CNIA 5BQ3A 1GUBA 1LBHA 1APBA 2WB4A 3ROFA 2PL1A 2QVGA 1YVUA 2QXYA 3OLYA 4EGSA 3HV2A 1ZAYA 4JB2A 3HZHA 1C0EA 3O2SB 3I5AA 2PUFA 1AB6A 3OLVA 4F12A 3HS3A 4KV7A 3T6KA 3O75A 2NT3A 1CEYA 1Z16A 2MSKA 4B09A 1DC7A 3H5IA 4KK3A 4YV7A 1GCAA 3IP9A 1VPWA 4MR9A 3C97A 1S8NA 4OATA 1PEAA 3CG4A 1EWKA 5I4CA 3OLXA 2WWVD 3EODA 3NHZA 3GA5A 3JPYA 3Q9SA 3EGCA 2QV0A 4RK1A 1KRXA 5EWLA 2L17A 4ZPJA 3RVPA 1D4ZA 1A04A 5EWMA 1TLFA 4ETMA 2R4QA 1Z17A 4WXEA 4Z4GA 4O1HA 2PMCA 1JYEA 4O1IA 3DBIA 4XLTA 5FWYB 5IX8A 1JF8A 4Z4EA 3L6UA 5ED4A 1QP0A 1USKA 4LRQA 4YGXB 1DBWA 2VK2A 1DCFA 3QELB 1Z13A 3KKEA 4OLBA 4MRMB 3EJWA 1VLZA 2IKSA 3NNDA 4ZMRA 4WWHA 5CNKA 4N0QA 1CHNA 4NCAA 2WY2D 1JH9A 3DGEC 3JS5A 3OMWA 2AYXA 1EFAA 5HQJA 4S04A 2ID7A 3GYBA 1L5YA 2A9PA 1JL3A 4YCSA 2RJOA 1SXIA 3LKVA 5TE9A 3CHYA 4MR7B 4EVQA 1RXIA 2FEWB 2IPMA 2NUBA 2WJAA 1DCKA 5DLEA 5CNJA 2FXIA 2M1ZA 3MM4A 3Q41A 4W5RA 3RVJA 2PUEA 4WZZA 2E4VA 1BA2A 2WJWA 1NXXA 3A3KA 2VYCA 3KJXA 3CLKA 4NV3A 1YTUA 2B1JA 1NXWA 4P1ZA 1MVOA 1KRWA 3A0RB 1QP4A 4MQEA 3NBMA 2JBAB 3GBPA 4FE4A 2IPNA 3HJFA 3KSMA 2FQXA 4MS4B 1P2FA 3GL9A 2R47A 3CZ5A 5KC8A 1SXHA 1RZRD 1TMYA 2HSGA 1QO0D 1Z25A 4NQRA 3SAJA 3HDGA 4IILA 4N41A 3OQOA 5DCLA 3SNKA 4KNYA 5JS1A 5IC5A 2JK1A 3Q7RA 1SXGA 3D02A 2PLNA 4H3KB 1OXKB 5JNSA 1NXSA 1TVMA 1ZH4A 1ZHHA 1NTRA 2NZUG 4G0OA 5KQLA 3FFXA 3O1IC 3S99A 1PUXA 4RWEA 1NXPA 3QLUC 4MR8A 4KRFA 3H5OA 1U8TA 4Z4IA 2NT4A 4RY9A 1YK1A 1ISSA 3HXMA 2FMKA 3OQMA 3OM1A 1EHCA 3Q7SA 3GRCA 1ZESA 4F06A 4FE7A 4RY0A 4EVRA 2FLKA 5KQMA 5C5CA 1JLKA 3UKJA 4OLAA 2FW0A 4JASB 5JNWA 4G97A 2MYNA 1D1PA 4MRMA 1PEYA 3O21A 3QLTA 4L4UA 4MR9B 5KI6A 1YMVA 1YMUA 2FKAA 4KMRA 4MLDA 1MB0A 1P8AA 3KYJB 3LTEA 3M6MD 1Y1LA 2WRZA 3RVNA 4RU1A 2FLWA 5BRJA 4IMJB 2GI4A 2PE5A 3ROTA 2FEPA 4Z99A 4KREA 3T38A 1XHFA 3B2NA 1LK0A 3OLZA 4G0YA 3RVMA 3H6GA 3H5WA 3RVRA 3SY8A 2Q5CA 3M9WA 2FN8A 1M2FA 1TJYA 2J48A 3E3MA 3HM9A 5DKFA 4JB0A 4G0ZA 2ID9A 5PNTA 4Z4HA 3GWGA 5JNTA 1DRKA 5EWJA 5C5EA 3RVOA 1ABEA 2YHAA 2MYUA 4D6XA 2JVIA 3Q15C 1KGSA 4MQFB 3JVDA 1K68A 1MIHA 3BREA 1AB5A 3I45A 3L49A 3QX8A 5EWLB 5EWMB 5JNVA 1T34A 2B4AA 2FN9A 1DZ3A 4ZMSA 3KLOA 2E4XA 1Z15A 3MIZA 3H1EA 3DLHA 1XHEA 4GNRA 4W5TA 1YS6A 4RY8A 3LUKA 4O5AA 4QYWA 4QICA 4PICA 3LUGA 1SD5A 4ML3A 1GLGA 4S05A 3MMNA 1JWLA 4EUKA 1ZVVA 4Y9TA 3MA0A 3RQIA 1ZGZA 1E6KA 3BRQA 3O1JC 5TQ2A 4G0QA 4Z4FA 4N0PA 4LZLA 4EYOA 3TMYA 4F8JA 1FSPA 2PUGA 3CS3A 4H60A 4RV5A 2E4WA 7ABPA 1I3CA 2O20A 1JFVA 1VRVA 2A9OA 2PL9A 8ABPA 2H0AA 2FMIA 3C6QA 3LUHA 1FQWA 4XFKA 1GUDA 1EWTA 4WXMA 5IUJC 2QSJA 2TMYA 5KC9A 2L2QA 1DBPA 3T8YA 3LUDA 3HCWA 4RK7A 2CWDA 1QMPA 3QLVA 1J56A 1HEYA 5IUKC 4JAVC 5B3JA 1QQAA 3E61A 3LUCA 2M98A 4M88A 2OENG 1DCMA 2HQRA 4UHJA 5IUNC 3O2QB 4F3TA 2RJNA 4F11A 1ISRA 3G85A 5B3JC 3C3WA 2BGGA 2OQRA 4QYMA 3QEMB 3CFYA 3H5TA 1U0SY 3FMVA 4RXMA 3H1GA 3IP7A 3SQNA 2MSWA 3DLBA 3BILA 3KHTA 2YHBA 3TO5A 1ABFA 3JY6A 3EAFA 3EQ2A 3SG0A 4YLEA 5JNRA 4KFCA 2E4YA 2FQWA 3H1FA 3HDVA 4ZYLA 1LJLA 1DRJA 2E4UA 4YO7A 5GQSA 4E7PA 3KCNA 1JDNA 1W25A 2H3HA 3GV0A 2F8SA 1PNTA 1A2OA
chains in the Genus database with same CATH superfamily
1W75A 1Z7WA 3KZXA 4M1WA 3OOSA 1KO7A 3N6VA 3RUFA 4WBNB 5KX5B 2EW1A 4L9SA 1KEPA 2KYRA 2ZI6A 3EPLA 1HFWA 1S9DA 1IZ7A 2J7PD 4HY3A 1WZCA 4PU0A 4QBKA 5DM2A 1XNQB 4NZPA 4XWGA 4RV9A 5C46F 1YUBA 2UVDA 4E5YA 5JSUA 1VI5A 1P0IA 2R97A 3OT4A 4GOXA 2XUKA 4ETIA 1J1UA 1WAMA 5IVIA 2DVMA 3TOSA 1EVEA 1P61B 3PRKE 3AEQB 2FW8A 2GS9A 1ODFA 3GI1A 4MDYA 4GXNA 4ZAGA 4Q7QA 1LTKA 4BGDA 2J5BA 1UZLA 3PE6A 3D54D 4JP5A 4UDNA 5AICA 3ZGVA 4KJXA 4JQCA 4ZKDA 2X8JA 3OT1B 1OA1A 2OQIA 3G5UA 5KSZA 4D92A 1EB9A 2V7EA 4JNKA 4DHWA 3VDXA 2VQSA 2MT9A 3AR8A 3EWSA 2YXNA 3R8CA 1TAGA 2Y1EA 4O2BB 4BNVA 4MS3A 4XRRA 4EEZA 1CY6A 3CX8A 2AEEA 2VP6A 3EN0A 3H84A 4NOJA 2F00A 5KYNA 1PLKA 3RAEC 4IZOA 2GH1A 4MIEA 2XRYA 4PZCA 2IXBA 1EJ2A 3EMDA 4M7OA 4PYLA 1MBZA 4UHKA 2WYUA 4MQBA 4PG6A 2ES4A 2NU9B 3L0PA 3ZGNA 3P5SA 2D5AA 2ORYA 1DRVA 3LECA 4RTNA 1VYHA 2MOKA 4EHLA 2EKLA 1OILA 1R6VA 1ENPA 3VR2D 2XYQA 4PRKA 3DBHB 3A1EA 3RSZA 2XB2A 1BWPA 1T1JA 2RH8A 4OHBA 4MW7A 3OPXA 1KFEB 4LQLA 4KI0A 4WZAB 3CNNA 4TL6A 1UPBA 2HDOA 4MYHA 5JXHA 4YJHB 4JLOA 3C7AA 3H2YA 1BIFA 1GTL1 1Y8RA 2P9FA 3DBLB 2CJXA 3EXAA 3CCFA 1M8FA 3FOWA 3IH5A 1DXHA 3ZHSA 4KN5A 3WGNA 1TAUA 3ZZUA 1V1RB 3T1TA 3MS2A 1A5BB 1NM5C 3U7RA 3CXRA 4Q3LA 2A67A 3COVA 2QRJA 4IWNA 5IAOA 3KJNA 4ZT3A 3NEAA 2GZMA 2W58A 3ACBA 5E9AA 1VLVA 2B1RA 4OU5A 3DHNA 1XCGB 2GBLC 5AKZA 2OVBA 2OXCA 1E4EA 1X7XB 3TQCA 1Z2OX 2KMLA 4IDCA 4TTTS 2QM0A 4Q93A 3L79A 4M1KA 4NDAA 4IICA 4LDNA 4BATA 3N1UA 3RS8A 3L7BA 5A6VA 1YMQA 1VPTA 1LLUA 4PYOA 2G0AA 4PVDA 3VKVA 1QNLA 5BN5B 3GNSA 2ZSIA 1HRDA 4LYAA 4ZDWA 2V7PA 2QMEA 2DLDA 3MTGA 2FH5B 1WXEA 3FTQA 3A14A 4R5HA 1U0JA 3UWPA 4AN1A 5IEBA 5JD6A 5BRNA 3D5QA 3K4PA 2CFIA 3DC7A 1NNEA 1JEQA 3FPKA 4FU0A 5B4UA 2ISSD 2RBGA 1V26A 1NVVR 3L5OA 4UBNA 2GAOA 2XF2A 4HAUA 4N6NA 2FV8A 2B8TA 2VG8A 3KTAA 1ISJA 1HZZC 3GRRA 1RZUA 2V9PA 3Q4GA 4R1QA 4WINA 4CV0A 2WSSD 1QRDA 2MR5A 1WXHA 3X2FA 2Q6KA 2LD4A 1JVBA 3K6SB 4WK4B 4EARA 3F2IA 3PC8C 4Z9XA 1Z18A 2EZ4A 2X5NA 2C4VA 4KC0A 3TB6A 2HGZA 4WNCA 4YIKA 2CVFA 2AVNA 1AKVA 4LDAA 1BDHA 4BGUA 2OOKA 2XZOA 1DJOA 4EP1A 1ZN2A 2XVZA 1KZYC 1RYHA 2C4TA 1JJVA 4Y7DA 3X0DA 3A0UA 4ENVA 2IV7A 5FO0A 1IVNA 5HCIA 5K3FB 4B76A 3HCRA 4G0NA 5FPHA 4Z1MA 3REOA 2GKOA 4KLZA 3T41A 1HH4A 5AW1A 1Z8DA 1JILA 1L5WA 1PJCA 2NSHA 4OHCA 5CW1A 5E2IA 4YACA 2HZ7A 4DDMA 1DKMA 1KFKB 3N8KA 4RZSA 3RJ9A 2Z9BA 4DPMA 3CW8X 4AJHA 4YCMA 3L04A 4TSFD 3ZDQA 3B2EA 4KXFB 4NYJR 3PDJA 3BD8A 4W8OA 2DTDA 2Q27A 1PS0A 2DPLA 3AEYA 4KSYA 3H11A 3UHAA 4OQDA 2W6ZA 1NAIA 4BLUA 3PG5A 2J0QA 1NUTA 1O0SA 3L6CA 1JBEA 4FZJA 2YOGA 5AJWA 3U81A 3WTBA 1QH8A 2W2LD 4O2AF 5TSDA 5JYEA 1SB8A 1SOVA 4XYGA 1OU4A 1HDYA 1L7AA 4IDHA 4FMCB 5IJ9A 4GX0A 5F52A 2PAFA 3DHEA 4FX2A 1W47A 2FZWA 1T5LA 4I81A 4UVIA 1KK1A 3GZJA 4ECEA 2FXVA 1K5HA 1ONNA 1USVA 4JC5A 4P4SA 4B71A 1P7ZA 2G80A 4P93A 1U7HA 1YFKA 4KE7A 3QU9A 3RIXA 5CYOA 1BN7A 4L3WA 5LNK6 5F2EA 1TYZA 3O6VA 1QOQB 3ZX5A 4EG5A 4RDXA 1J8YF 4CG1A 1LZKA 1U1FA 4Q9DA 2EV9A 3PHIA 2WVHA 3TLXA 4MK4A 4CMIA 3FTEA 1JLRA 1UC8A 3B6EA 1RM5A 3AZPA 1H2EA 1XXLA 1V11A 3OIFA 2N3ZA 3T1QA 3ZKWA 4ZJPA 2DWUA 1YI8A 5KQPA 3OO1A 4ALIA 3M49A 3BMOB 3DMGA 4PC7A 4M53A 5IF9A 4DPLA 2G17A 2QRNA 3CKYA 4DLZA 1CSEE 5ADUS 4W5NA 1ESZA 4IOKA 2PM8A 4RDHA 1UXGA 2R48A 3GJ5A 2XY4A 3WWEA 2O5VA 4B6RA 4ZAYA 1ULAA 5I9LA 1WXWA 3OLWA 5GINE 3FOCA 5L6MB 4B82A 1SCUA 2AFHB 1LJUA 2HDWA 4R3UC 4J8PA 2G0TA 1JB1A 2C5AA 3FX2A 4CF5A 3BE6A 3FVWA 4JITA 1S8FA 1N77A 2WTXA 2VTKA 3O8LA 3KOZA 4QOHA 5B55A 3BMQA 2BD0A 2IZZA 5CGQB 5IU6A 3EULA 4UEKA 4DG9A 2UKDA 4UTOA 3SR3A 1HK7A 2F2TA 1BH2A 1ZIPA 4AKTA 1BW9B 2HPHA 5FORA 3I01M 3L7JA 4IX9A 3ETEA 5KYVA 2I29A 2O2ZA 2ZS7A 4JA2A 3UK0A 1PGJA 5IJ9B 3LUFA 2XXAA 1IVSA 1VJCA 1GG5A 4IFTA 5BMVF 1C3XA 4H4CA 3KSAC 4CEJA 2ZM6B 5M04A 1WD5A 3SIWA 1NXVA 4NECA 4BDSA 1J70A 1LY1A 3ETCA 3EZFA 5BYBA 1T0UA 1FY2A 3HH8A 1LBHA 3PP8A 3TPFA 1SBHA 3AB3A 1Y1TA 4I5GA 3KVNA 1UBMS 2ZB4A 3LWDA 2O1WA 4WEOA 5H82A 3TNYA 5I6DA 2PBLA 4N6OA 4WKPA 3T3GA 2GMWA 1R00A 4JZYA 2ZZMA 3TJRA 2R6FA 3QTTA 1HDRA 4NAUA 4X8OA 5DASA 4I55F 5KAPA 1Z16A 2PMBA 2ZSDA 2ZIEA 3O47A 2OWEA 1O94A 3AI2A 3W6NA 2EW8A 5ILOA 1Z0FA 1F38A 3UBMA 3U44A 3QW4B 3JQQA 1JHXA 1L7QA 3KXLA 3GFQA 1XJCA 4QGFA 2BE9A 2GK3A 2ZRMA 1G19A 1VE9A 3MJFA 4GYJA 4EY8A 1XB2A 2AXEA 2F1HA 1V4VA 2HHLA 4ZXPA 4X1KB 4B47A 1ZXXA 3PEVA 1H2ZA 1Z17A 1I2BA 5TMEA 2OCDA 1T5IA 1KS9A 1YWGO 2BHNA 1WPQA 3WLMA 3U7QB 3I39X 1QP0A 1QM5A 2OUIA 4EJMA 3GFSA 4TRJA 2BEWA 3K7EA 4N3NA 1U94A 3ZQUA 3ZHXA 2G09A 1MH9A 4LQCA 5ERGB 3FLMA 5G0SA 1U2ZA 2AOTB 3C87A 3B1VA 2OZEA 1VA4A 3ZWVA 4URUR 2NVUB 1ZS9A 4X91A 3Q87B 4V0SA 5B7PA 3EFHA 3GPIA 3PK0A 4KPUB 4HAIA 4EO4A 1KKUA 1F6DA 3C70A 3SZLA 4UOZA 3R9XA 3K0EA 2ZAOA 1Q0HA 5TF4A 3GW8A 1H2YA 3BWBA 4Q3BA 4H1UA 2YWDA 4ZQHA 4XH9B 3VYWA 3R5JA 1HRKA 2FZ4A 2ROQA 1BRTA 3DD1A 3TRJA 4F92B 1JKMA 3MS7A 4X41A 4OGLA 1PSWA 4P9NA 3FMPB 5A4FS 3NBFA 2QTVB 3LSTA 1S2DA 5G0VA 4TT8A 3ZWNA 3T3OA 3OPYI 1Y81A 3IP3A 5EZ6B 1NSFA 3DKIA 1NXXA 4MMZB 1FXSA 2CK3D 4D98A 2NU7B 5EE3A 5FFFA 2JIDA 4DF3A 2QMHA 5DCUA 4BUCA 3MWFA 1IXYA 1NLUA 1SM4A 1CBUA 1T10A 1G6OA 2XSZD 3G8DA 2IY9A 3TOVA 3WYNA 1QP4A 2BFCB 2G83A 4FMCF 4L0CA 4LVOA 4RM2A 1G4AE 3C39A 3EUFA 3L8MA 3KQKA 2JAXA 1OYWA 3UJNA 3HLKA 3RADC 4K88A 3DCIA 1NVBA 4PM4A 1JFRA 4FYKA 4PZZA 1C1YA 2ZROA 4Q4JB 3IYLW 3V80A 1KMMA 4DYHA 1QO0D 3TW6A 1QFXA 1FFCA 3FVQA 4ZCIA 1T6XA 2KW5A 3T12A 2ZRFA 3P4XA 4LDQA 2DBVO 2J5KA 5IDVA 1UFKA 4MB6A 4TL7A 5DXFA 4XWOA 3WOVA 5JD4A 5FNZA 3UANA 5FNVA 1E5VA 3DF9A 2HU7A 3BERA 4L95C 2NPIA 1AN0A 3LF2A 3CLRC 5L3RA 4DNPA 4C05A 4ZIRA 2SNIE 3NEPX 1Y1PA 3H5OA 4HX9A 2BFNA 2AUTA 1FDWA 2FFRA 3L6DA 3OQMA 3HXMA 3OM1A 2MDTA 2GN0A 2WTEA 1R0KA 3R3SA 3RJMA 1EWQA 3HKBA 1RYMA 1H2HA 1ZK2A 1HZJA 3T5AA 1XT6A 4FNOA 1OE0A 3NTOA 1UJ5A 3QXGA 5EUCA 3WMFA 2VUUA 2CUKA 4I14A 3H3XA 1JLKA 3NIBA 4KNWA 4XJTA 2NQ2C 1WRBA 3VYVA 1FXUA 5C2JB 4GKJB 3EXHA 1NA5A 3UA3A 4G97A 1H1LB 1T1GA 4U4AA 3HRHA 3N7TA 2R11A 1YMVA 1UBCA 2ZJOA 1Q19A 2ZSAA 1P44A 3FIUA 2ON6A 3BZUA 4QLBA 5KDOA 3LSYA 3PZRA 2RK3A 4OO3A 1BMDA 1C9YA 4HUTA 1AKYA 4HQLA 4C1BA 4PIVA 1OI7A 1DG1G 5EOVA 3VHLB 1MNQA 3VISA 4AUNA 5AUPB 3GG9A 5A7GA 3WGKA 5IABA 1FDTA 2C7QA 4OHKA 3U4DA 1QVVA 1M6VA 2AFRA 3OZIA 3PQEA 4YAEA 1VYVA 4OB8A 5K0NA 3HWRA 1YFZA 1E89A 3FYHA 2IP2A 1I6MA 2BEKA 3Q12A 1AG9A 4RQUA 1P9NA 4KUHA 4XLLA 5JH7F 1I3KA 4LXGA 4BEWA 1FLAA 3HR7A 2I67A 3GOHA 2V1UA 5TJ9A 1SHZA 4AG3A 4E46A 1DXOA 2GLUA 3RROA 1RI1A 3BMCA 1BVRA 1HLDA 3ANNA 1N3IA 1ECGA 4MKGA 4HRXA 2KHZA 3BREA 5EXXA 3LQRA 4TXLA 4PGFA 4A6DA 3S2EA 3QFFA 2AEJA 2XRZA 4XEUA 4I55B 3SX2A 1KXJA 2D5IA 3IAEA 1XK6A 1P1FA 5LLDA 9LDTA 1V6CA 4TMTA 4FZRA 3PPWA 2OLJA 4PAOA 2I3DA 5LVAA 2Z9DA 1G6KA 1LJ8A 1YI0A 1X2BA 3LQ1A 1IWPB 1G98A 3NH6A 3QKSB 4I1IA 4KO8A 4B4DA 4GPEA 1FRQA 3B82A 3CW2A 2V55B 3QPBA 1GL9B 1Z5WA 1FYWA 2RAVA 3QVGA 4ILKA 2VP0A 5TQ2A 4G0QA 4Z4FA 2I99A 3NP9A 3GPCA 1YULA 4ZTUB 3G23A 4Q3DA 2D13A 2H11A 2EL9A 3ITKA 4WRRA 4XSHA 4B3GA 2W2KA 3PL1A 3QFHA 4F7WA 2O2YA 4A9AA 1M1XB 2O20A 3NKFA 2VIIA 1LBSA 3PE3A 4MEAA 4TXHA 1R16A 1YRAA 3WGOA 1DV2A 3WHIA 2Z6QA 1CTQA 2CUNA 4UM9B 4J7UA 4CKCA 1JDVA 3IP1A 1GTMA 4URVR 2TMYA 8LDHA 2L2QA 1DBPA 1M34E 2H7YA 2PX2A 3GGDA 3LPAA 2I4NA 3BBPA 1JQEA 1XTQA 2CNLA 4PTYA 1PUJA 3EXFA 2IYXA 3D6JA 4NJEB 1WDLA 1TF2A 3E8MA 3NBZC 3LOQA 4UVDA 2P78A 4CMHA 4LZWA 1GM5A 4YDQA 2VF5X 3FKSA 1RPNA 3R77A 5D51S 4I50B 4BMXA 4IIDA 1BS1A 4CNQA 3EUAA 5JE8A 3IODA 2X5JO 2ZJ1A 3MTQA 4GI5A 1XPOA 3QEMB 5KMGB 4RPJA 3IALA 3AHEA 4FZVA 4LISA 1XRMA 3GEHA 4IOLA 1PFVA 1KJNA 4RXMA 5EA2A 1XTZA 2C3PA 1CVLA 2XOXA 3TTUA 2FSGA 2GSWA 3OWHA 3MCVA 1A9TA 1AM4D 2JIMA 2VDVE 3CKLA 3PR2B 4WL0A 1BU8A 3TPCA 4Z4QA 1GPDG 3KDSE 4PBTA 1GRRA 5ARCA 4LFCB 4ZHQB 3I1JA 5ADWA 4UQLA 5L45A 1PV4A 3N28A 1Q50A 3IPLA 1R9JA 1FNCA 3DT6A 1M54A 1QV9A 2HHCA 3QWHA 1Y8ZA 3WJ2A 3GCWA 4XFDA 4RENA 4CDMA 2F8SA 1O6ZA 3C3YA 3IMCA 3EEQA 4L8YA 2ZE5A 5T8KA 2WZBA 3COJA 5LB4A 1I7LA 4ZVOA 5TGZA 3I6MA 3RJTA 4B6GA 2J9FB 2WEKA 2QMOA 3AGPA 4MV3A 2HHJA 4FJ0A 4D3YA 1N1GA 3IILA 2YMPA 1SHJA 3QLJA 4D8XA 3DF7A 5AW3A 5F3RA 4CDGA 2PBFA 2PSFA 2YQ5A 4IZ6A 4LHEA 1JA0A 4PSKA 5BWNA 2POCA 3ASZA 5KOHB 2JS7A 2EEZA 2J0UA 2PUHA 3DFKA 3G8AA 5I8ZA 4XPIA 3Q6IA 3SOPA 4BO5A 3D8NA 3K6JA 5IBRA 1ZI6A 5EJFA 4N7JA 4XQGA 3RT1A 1E5DA 4J1TC 3WLHA 1BKSB 3ONWA 2GAJA 1BJRE 1LNSA 1CEXA 1G291 5HXAA 2R2AA 5JMTA 2ZSEA 2W90A 4J0FA 2I6SA 4IMPA 4MVXA 5FT9A 5AXAA 2QDKA 4D8TA 4DJAA 2PJUA 1WXFA 3O2JA 4KVFA 1R2QA 5JD3A 2VUTA 3D81A 3WYFA 2VPZA 4P81A 3N8DA 3FCOA 4OXKA 2WG2A 4TUYA 1Z4JA 5GIPE 2QTLA 3P2EA 3ZV7A 4HSGA 5KOIA 3LC2O 4MHOA 1G4HA 1NYQA 1T8TA 4Q3CA 3HO1A 5TVGA 2ZR7A 1GN9A 2OK8A 3W3AH 1Z8HA 2MHCA 4DCCA 1HOXA 3KL2A 4YUAA 1RQNA 1U4NA 3AFHA 4ZI3A 3K0FA 1V43A 1K92A 1X7DA 5CVEA 2JGRA 3SSNA 3V2GA 5ICGA 4NU6A 4JI5B 1SC3A 5CT4A 3PUXA 3D0OA 3OESA 4GYWA 2X41A 3PXCX 1F3LA 4PFKA 3V4VB 3OJ0A 4EYGA 4F2GA 1NV9A 1K0FA 2FSVA 4OQQA 3RWOA 5J4LA 1LPSA 2Y1FA 5ITVA 2J07A 5TPWA 2RAUA 4XZ3A 2VJAA 3ESCA 2EHDA 2GCPA 4XUEA 4MJ3A 1OFHA 5H5JA 1OKKD 1Z0UA 1C7EA 1N8NA 1VSBA 1Z6YA 4GBJA 3F73A 1XO1A 3PNBA 1LC0A 1WEKA 4HDRB 3BGOS 4MYTA 4XAQA 1VYTA 5EI5A 5LN1A 1XD2B 2YBDA 4E4RA 4F2HA 2SKEA 3ERCA 2CGEA 3NEJA 1BEZA 2HWXA 2Y99A 4ID9A 1R6DA 1Y7IA 3ZHVA 821PA 1PD0A 2FN7A 1N0HA 2PGAA 4PZDA 5ADHA 4XJSA 1VQ1A 4LF4B 3K71B 4JGBA 2H4YA 2IDMA 3CIOA 4ZAFA 5LDGA 3OFSA 4FXPA 1O57A 4AIRA 4DTIA 5K0TA 1LDEA 3R7AA 3IHTA 4JQYA 5KTPA 3RTDA 1OA0A 2QN7A 1D1QA 4EM6A 2IHZA 3S1LA 3RS5A 1P2TA 1RHQA 2QTCA 3AG6A 4NYMR 4AKIA 1MT0A 1TTQB 3E9EA 1KAEA 1S3IA 4M1QA 4OSOA 1AKNA 3VPDA 4BB0A 1B8PA 4RTOA 4KDCA 1CNMA 1XDDA 3BWEA 4MLZA 1BO6A 2DUJA 2X15A 3G0BA 5C1IA 1J2TA 3U7HB 3TBFA 3OURA 3GP5A 4PC3A 1HDOA 4KX3A 4DSTA 4O29A 2EC5A 4ZEXA 2OCLA 1QGOA 1KZGB 2WKWA 2VSQA 3AUYA 3H9QA 3K9WA 3KO8A 2BVNA 3GYGA 3C14C 1YGPA 4A2PA 4M21A 3VOAA 4AMVA 2FP3A 5FUMA 1B41A 3EXHC 1AU9A 1X1QA 2J3DA 4DGQA 2IWHA 1AOXA 1KZ1A 1RQXA 1J09A 1TFUA 3NHYA 3IUYA 4YWJA 4CKWA 5BQXA 1Q11A 4FFLA 4LOAA 2N42A 4OK6A 1NU6A 5AXDA 1RIIA 2CLCX 2QDXA 3CNLA 3D1JA 1WCV1 6ABPA 2Q5EA 4KPYA 2FRDC 3QUAA 4YCNA 1FDRA 3FWYA 3CUYA 3S2YA 3SZOA 2V4ZA 3I83A 1PK9A 1OV6A 2QBYB 3S55A 4AKGA 5KNDH 3C15C 1SQSA 4QJ3A 4CCSA 1GT91 1UDWA 1WHTA 1MDBA 3BQMB 3WA7A 2Q6LA 1V5FA 3CLSD 3CM0A 1MTOA 3OUTA 3PNPA 4UEOA 1SBZA 5KAMA 2EBWA 1Y5RA 2IX9A 3V4ZA 1IEXA 5AK4A 4C3UA 4QFCA 2B20A 2JHAA 1N3LA 3W5UA 2F67A 2FMFA 4AJ9A 1G7TA 1Y42X 2PXAA 2XUHA 1XLVA 1TVCA 3HUTA 1R5NA 4HDQB 4YRJA 4JJFA 3S1AA 1YR2A 4QOIA 3DLIA 1IUNA 2O0KA 2QB5A 1FE8A 3F2VA 4G5FA 2CHUA 4ZI5A 3EA0A 1NX6A 2HCBA 5A62A 3B1JA 3KOUA 4L5YA 4LOKA 2RSLA 1P5ZB 1RCTE 1MMFB 4RX1A 5K20A 1ZW1A 4IQ4A 1XMSA 4M3NA 2P2NA 5EIBC 3X2SA 1DBRA 4G01B 5ADVA 5L7WA 1HPLA 2AEFA 2A0FA 3D3WB 2C9YA 1DCTA 5B58C 4K6KA 1KKMA 2G6BA 1RJFA 4X44A 1LPBB 1ZISA 1H0RA 3GUCA 2FOXA 1RYEA 2XCQA 2VDUE 4GMGA 3TAUA 2VTEA 2W6ID 1NJGA 3D6NB 3OKFA 4UC0A 1Z2NX 1IPFA 4XD7A 3EXEB 3VO8A 5KQGA 4II2A 3VX4A 2JK0A 3L92A 2YV1A 3OKCA 4D9FA 1SU4A 1GZ5A 1K0UA 1VGVA 5JSZB 1OPXA 2IGBA 4N01A 3H1AA 5CCBA 2FMXA 3ILVA 2BM1A 4CNBA 1YBMA 4B6SA 3FPBA 4R7TA 4TKLA 1I30A 2CLDX 1AHIA 3EVCA 3W2EA 2H4WA 3F8WA 2XMQA 1X15A 2FUNB 3BX1A 3DOUA 1JIUA 2XR1A 3HXKA 3RVBA 1HSOA 1LF0A 1B2RA 3H4IA 4TV9B 5G4LA 4PZUA 2GETA 5HF6A 3ZE0B 2WABA 1YR1A 3UUWA 2OV3A 5AYVA 4F5ZA 5CLQA 3WWCA 4UMEA 2O3UA 2RHWA 2YVQA 4KYIB 4DLAA 1YC2A 2GWHA 3EQ7A 5K0JA 2YZ7A 3K73O 1TK2A 4Z51A 1M2WA 3OIWA 4MRRA 2XMBA 4WW0A 2W6QA 3T3DA 1NY5A 1NAHA 3TQQA 2E2WA 5EIBD 2CXUA 4TZ6A 2R8XA 3UK7A 3ABOB 3L4KA 1V39A 1Y8CA 3AF4A 3DDOA 2H9AA 3FSJX 5F5LA 3TLZA 1H8HD 3ZE1B 1J90A 3HEBA 4EKIA 3HXOA 3GLGE 3ZHTA 4TLAA 3I4LA 5AVYA 4OQEA 4Z9AA 3TB4A 3E5NA 4BQQA 1JSCA 5F4BA 3EDQA 1RSZA 4D43A 3UJHA 4AY5A 2VVTA 5JSHA 4JLJA 4L50A 3WR5A 4AF8A 2CV2A 2Y1WA 3EVZA 3K92A 5AJXA 1APBA 3PJRA 3QXXA 1NE7A 4DV5B 1IONA 2P4QA 1O0CA 3I5AA 3GEEA 5GVRA 1KWGA 2V6MA 4INPA 1GU1A 5D6OA 3FYCA 4MZXA 1V16B 4BQPA 1G42A 1RQGA 2RHGB 4BP8A 1T13A 5B2EA 4OHXA 5IS2A 2G1KA 1Q16A 5GPBA 4JMPA 1VPWA 1XDBA 3KVVA 4OATA 4RLHA 2YJZA 4LF6B 3OQVA 2VDWA 3CG4A 2D1RA 1BMFD 4MO2A 4U39A 2MSNA 2VZ8A 3EGCA 1QLWA 4Y1RB 4F4FA 1XTJA 1F12A 1JTEA 4WCDA 1ZUIA 2VSYA 4DYDA 4CL8A 2QSZA 2GEBA 1E1QA 1EFPB 3KEMA 3UHPA 1JSLA 3VTAA 1T4BA 3PIDA 1N6IA 4HDNA 5EGSA 2CBXA 1NULA 2VK2A 3K8QA 3ZJVA 4KAFA 4FNGA 4RMHA 4L78A 4ZCSA 4WY8A 1TM5E 2OCAA 4PINA 4FD2A 5AVJA 1B6SA 3RHSA 1C7ZA 1D03A 2RCNA 3K9QO 4IVPA 3VHXA 4OB6A 3SBOA 1ZUNA 3SF0A 2P6MA 4D9MA 4H3VA 2AI2A 5LKRA 4NCAA 1P7CA 1EWYA 3DLTA 3A1DA 4B40A 1QYIA 4HFRA 2F3UA 4ZOCA 4JDPA 1ZPDA 1IVYA 2GUWA 2BMFA 2GSDA 5ALZA 3IPRA 5A6SA 1XQ1A 1L8QA 4FOSA 4TV9A 4CM4B 1RCFA 3N05A 3Q1KA 4LZJA 2XCTB 5AR1A 2GHTA 1GLNA 3LHDA 3AEZA 5K03A 1UCFA 4M83A 2WMNB 5DLEA 1Z83A 5FOVA 1RWBA 2AD5A 2ZUSA 1V3QE 4HZIA 2AIRA 4R0VA 4BV8A 4LUCA 2EKBA 4WLFA 4DR3B 5EPUA 4KN9S 3A3YA 3N2EA 3E3LA 3PQ2A 4FQ7A 5HEKA 4PLVA 3VR4H 2C8KA 4RVUA 1I3OA 1WZUA 2P40A 3OEWA 2Z58A 4UTVA 4R1LA 1J20A 1ORTA 2PU7A 2WVGA 1ZLYA 4QM7A 5THQA 2C04A 3UHOA 4W9RA 2E85A 1E1DA 1II0A 4CDNA 4EGCB 2FQXA 2QJRA 4HWRA 3SU8A 3V4SA 1J99A 1N6NA 2QPTA 1G64A 3K09A 5CH8A 1X70A 2H52A 3ZY3A 2E87A 2HK9A 4P3YA 4ZGBA 3SJAA 4N48A 1CFZA 3NTVA 2PH5A 1L7EA 1X7HA 2ID8A 3IUQA 1J8FA 2A9JA 1E3LA 2FZLA 2GRJA 2GZ2A 4IILA 4PGHA 2C9BA 1XZMA 2YYYA 3K1AA 5CT8A 3UAWA 4D4MA 5F2NA 2I6GA 4ID3A 1GZDA 3AEQA 5C31A 5DTIA 2XMZA 2Q3EA 2I4OA 1ST3A 1KDOA 3Q3CA 4W9NA 2HLDD 1JQKA 1T5BA 3HYRA 3S99A 4K8OA 1VSVA 2GAFA 3F7OA 4KRFA 1ORWA 2JD1A 3IHLA 3QKIA 3R6DA 3N2ZB 4JWKA 13PKA 3BHIA 721PA 1FMFA 1QH1A 1EHCA 4QYSA 5A9TA 5FYQA 1VIMA 4PYIA 2IF0A 4FLEA 4TROA 1EUCB 2FJUA 2V9CA 5JTTA 4D9BA 4F06A 1SVWA 4R7GA 1XQWA 1L7NA 1X1BA 3QPDA 1CQJA 2D2VA 2PZJA 2H1IA 4H77A 4IEFB 3NVKI 5DOZA 2QR5A 4B6QA 5KNBD 3ROMA 5JDCA 4MKXA 5BYAA 1K2VN 3FCCA 1GAWA 4PGMA 1B76A 4NP6A 4L4YA 2C2GA 5LQSA 5AM0A 4R1SA 2FFHA 4ISBA 4ZWNA 1BXGB 3P4UA 2BFFA 5BR4A 2C97A 2WFZA 3PHJA 2Q3FA 3LC1O 2AN1A 1VCHA 2JAPA 2XUOA 5U9CA 2O8DB 1N2SA 2QE7D 1CY4A 4XKJA 3OF5A 3U39A 4X8LA 3C6YA 3TSYA 2WILA 3T38A 4JH0A 1R8QA 2ANCA 1W87A 4F4DA 2J9FA 5KU7A 3A7DA 1U2GA 3QX3A 3GA0A 4R2JA 1JEOA 5B12A 4HNGA 2I7VA 2I6TA 1S3SA 1J1IA 2C07A 5E4YA 1H6AA 2BGLA 3AXSA 5DI9A 4WN3A 1WUJS 3UM9A 3HU1A 3UQYS 3PFBA 4WXPA 3OMLA 2NP6A 4G85A 1HYQA 2VTVA 3NWJA 3PUZA 4IH9A 4LBYA 4RKYA 1VDZA 5A3QA 2JJ2D 2LCQA 3FYUC 1Z4OA 2ATXA 3HLYA 3JV7A 4Y30A 1H5QA 2R6GA 1G8GA 1DJLA 3I8SA 4PV7A 2V0GA 1K68A 5EWLB 3KXIA 3W8FA 3AVYA 1P9RA 5K3EA 3K6RA 3ZJ5A 5HPYB 3DLHA 4YLGA 3NS7A 3P4YA 1SVOA 4GXRA 4HQ6A 3HCEA 3OU6A 3DBLA 4M9UA 4FQ8A 4QYWA 4B85A 4CTJA 3FI9A 5DBGA 2WUDA 1SD5A 3IDAA 4ZK2A 3VR0A 5TT0A 1SCKA 2FK7A 3I6QA 1ZVVA 3AM4A 1U7PA 2W93A 3JQBC 4A8PA 3UMVA 5AW6A 2RI1A 3VA7A 2Z09A 1YFJA 9LDBA 3LC7O 2Y1LA 3SLKA 1NW5A 3NAMA 1ZIOA 1R10A 1KSFX 1NVUQ 1AKTA 3GFGA 1A9QA 1KYVA 2AVDA 2PXCA 4G4IA 4RV5A 3K9HA 1ZINA 4J0KA 5A0FA 3SHFA 4CUKA 4ZEVA 2WPNA 1VRVA 3ZGLA 5E9JA 1U6KA 4WI1A 3OIVA 4L9AA 1QZZA 3MGBA 5C7OO 4XVRA 4EFKA 4DT1B 5IUJC 3LVFO 1SXQA 4DV0B 4OBWA 3LUDA 5CDFA 4EB6B 1PT5A 1SCBA 2AJCA 2ASVA 4BNDB 4MOWA 1SCNE 2VTBB 3E5MA 1YT5A 1CV2A 1RC1A 3UGKA 1DCMA 4WKOA 5IUNC 1S2OA 4GW3A 4F11A 1RQ2A 2QX8A 2I71A 2JAOA 2BL4A 1UANA 4MRNA 3ELUA 1Q74A 3RC2A 3SYNA 4A6PA 1LQ2A 4W63A 1PFUA 1PWZA 2PRSA 3IP7A 4IXDA 3A70A 3G2HA 1ZD5A 5D3ZA 5K4AA 1E2GA 1PJZA 5DHFA 1IULA 3MHPA 1AKMA 3FYSA 4P2GA 2YHBA 1RZ3A 1V0JA 4B3CA 2XGJA 1XE3A 5K0BA 1NN0A 4E5KA 2ZIWB 1RBQA 3ZJYA 2AG5A 3JAWA 1GTZA 1L7BA 4QDZA 4C0SA 2FQWA 4L57A 1W9MA 2F3PA 3K6SA 4CTMA 4EZIA 3RUAA 4LSMA 1XJQA 1KC1A 1O4WA 2CXHA 5LOVA 2V96A 4DGSA 5KWEA 1E99A 2B5VA 2DJIA 3EEFA 3WIOA 3NV7A 1KFCB 4CUZA 5K0FA 2WD8A 4GMXA 5JIBA 2AG0A 3DMFA 1DPGA 1TEHA 2DSTA 3KJGA 2HMTA 1T8YA 3AUKA 3G0CA 4R31A 3TRHA 1PKEA 1F2UA 4N03A 4C5BA 4F8YA 4YJ2B 2P3SA 1YL7A 3MB5A 3BC1A 4Y1GA 3Q6MA 4FT2A 3LVRE 1OAOA 3KKKA 4O2AA 5KYXA 1EK6A 1KMIY 2VT3A 3Q3JB 3PKZA 5EQTA 3ZDEA 2OM6A 1QFMA 2BM0A 1GSAA 1XA4A 1M5UA 1Z73A 3TTYA 2GRUA 5HKLA 1UMDB 5E7JA 2ODPA 2W5UA 3DAHA 3PLNA 3W2TA 4QTUB 2YZ2A 4RTJA 5AVSA 4DQDA 4E12A 4NIMA 3L4SO 5FX2A 3I2IA 3I2KA 4I6GA 3KM0A 4BO7A 3DZHA 1GCOA 1T29A 4XIYA 2WPDD 1KY3A 4LJ6A 1QQ7A 3VZSA 3DMTA 5K6AC 1H0KA 2OORC 5CDHA 1DFIA 4KAAA 4G0MA 4B8YA 3O94A 1IXSB 3VX3A 5HUJA 1QRRA 3FGNA 2EGUA 1FRFS 2NSDA 2J3JA 3L84A 4QXPA 1EP3B 1GR1A 3RYIB 5FWXA 3ZU6A 4BFTA 2GBPA 4EY3A 1SG6A 1W29A 4BN0A 1R4NA 3G1TA 4JFRA 1NJFA 4XI9A 3RIHA 4IJKA 1G5PA 4Y6LA 5EWJB 1N2HA 4OHUA 1M2NA 4HRVA 3NHLA 4OKSA 3V9AA 4JVLA 4PQGA 1XCOA 1UBFA 5FEUA 1P5RA 1Y4ZA 3HY6A 2X7XA 5KDLA 1A1VA 4H7PA 1U4SA 4ZQGA 4GDFA 3PZBA 2ZE8A 1CR1A 1JKJB 3LGSA 4UUOA 1UOQA 2Q1TA 3T3PB 3ELBA 2WHRA 4W6QA 3QVJA 3ED5A 1YZHA 1WLSA 5HGXA 1BQEA 1G41A 1ZRSA 3OKPA 3RC3A 4NK4A 1ODIA 5FHRA 4RGQA 5EMJA 3LAWA 5JY6A 3GR6A 1SBYA 5E6UA 3U3OA 8ADHA 4IXMA 1N0VC 1Z0DA 4CUJA 3GG2A 5DNUA 4P98A 4QDOA 3AM1A 4ZO4A 2DAPA 1SVMA 4RJ2A 4E22A 1TYAE 1XJ0A 5IYZF 5IT5A 3HQ4O 1ECJA 2R4TA 2YCBA 4UZFA 3WZ2A 2BLLA 1SVIA 4ER7A 5PGMA 4AWBA 5K0ZA 4GWKA 2QLNA 2EG5A 1GU0A 2XB6A 4ESEA 2Z8YA 4QOEA 5BMVA 2ZPAA 1CG6A 4TRNA 1L4UA 2V6FA 3LY8A 5THKA 5DCWA 3WGMA 4CV2A 2ZAIA 1W4RA 2AJLI 2PFKA 2O8NA 4QDTA 5HOEA 2W6OA 1SMKA 2GBIA 3LP8A 5AOCA 4Q21A 3CRW1 4MA5A 1DKPA 1E1MA 2VP4A 4LC1A 2DOKA 3QQ5A 3D7LA 2OPBA 4UMFA 4X95A 4HYTA 2GWRA 1VBKA 3UOWA 1PHRA 3S5UA 1JDJA 2CHVA 5DV9A 3WQHA 1PEDA 2WP8J 3OJXA 4YIHA 1OCEA 3PICA 1BS9A 1UPAA 2JHFA 4R8RA 3I0ZA 3I92A 1T8RA 1VL1A 1OF1A 1RI5A 5T7BA 4EB8A 4KH0A 2OFXA 3IEIA 2XB4A 2ADFA 2HMYB 1P3JA 2NQ8A 1TQDA 2B6NA 2QRUA 2HA4A 2QI9C 3IDZA 3OOHA 4AX8A 5SY9A 1PWXA 1AV6A 2F8TA 3H9JA 3SVLA 2AOTA 2UVQA 1Z0AA 4AIIA 3KLMX 5KVSA 1U2QA 1KL7A 2ORIA 2HQBA 4MS1A 1HFKA 2F8MA 3PDIB 3QKRA 3SBXA 3NWBA 4WA7A 1CJCA 4B34A 4NWIA 1ZP6A 4RTLA 4WY2A 3CLRD 5ESWA 1N5KA 1JA9A 4U2FA 3Q1LA 5EL0A 4BNJA 3TUJC 1FMTA 5ENVA 5A5GA 4C43A 3HP4A 2YWHA 2QN1A 4QTTB 1CJSA 1CETA 2YV4A 3JWIA 2ZTSA 1L5RA 1Q3TA 3I9JA 3VPXA 1YK0A 2NUTB 5D86A 4FZ5A 4UNRA 3TNDA 1ISPA 2P65A 3WP1B 1T1EA 4XQCA 2I78A 4KGDA 2QN6A 1QHIA 1JHAA 1VKNA 5F51A 2JAQA 2Y6VA 4JL8A 1VMKA 4PS0A 4B3DA 3NC4A 2PL3A 3BL5A 1OW3B 4M7WA 3FR7A 4MYRA 4WNAA 4N76A 2WZDA 2ZVQX 1VE3A 4LX8A 1RJ9B 1XDGA 3A4MA 3DHYA 2NSYA 5TV2A 5KX5A 4ZVRA 4QT0A 4KH1A 3O0TA 3OT1A 5IXSA 1GGKA 2ZR8A 3AUXA 1NXTA 3L0CA 2C83A 3KJQA 4ITRC 3HPRA 4POOA 4O4IA 4JI0B 3ISTA 2R1VA 4IGAA 4QX6A 1AV7A 1NZJA 4X3CA 4ZV9A 1ZD9A 4MS3B 4WEQA 1Q0RA 3SHWA 4UM5A 2XDYA 3SQOA 3WK6A 4MUFA 4A6XA 1ZIDA 2BJVA 3BDVA 3TXYA 3I9MA 3F74A 3QA3E 1ADFA 2NU7A 1CJMA 4MMYB 2I7DA 2JD0A 1T6NA 4D6YA 5LU9A 3NM4A 4D3ZA 2BTQB 2NSLA 3HI6A 2AG6A 1PGOA 4YUWA 521PA 3V6MA 2XTNA 4U9HS 1L4FA 1SIOA 1RM4A 2W48A 4P34A 3B1WA 1DWOA 2IZ1A 2EX1A 3EIEA 4BLQA 5H3CA 4DDKA 4EUSA 1OKKA 2SHKA 2DSNA 1XIVA 3Q7IA 4YUZA 5FV4A 3J7AC 2G6TA 4CM4A 2LKDA 1P5JA 3Q8XB 4N12A 1I24A 1ZN8A 3JZIA 3NKVA 4RPLA 4TV8F 1GL7A 5ILQA 2HDNB 3ZQKA 1Z12A 5EMLA 2R00A 4FHDA 4ZVMA 4R1OA 1PZNA 2ZRHA 1BE1A 3WO0A 3PCTA 1UAAA 4YS6A 4F45A 3C8ZA 2XADA 5DNEA 4OU4A 3CT6A 1AZSC 1RWVA 3IA7A 4MR8B 3JAMA 3B1ZA 3N6RA 5DLDA 1X7YB 4OI1A 3DE1X 3DBHA 2PUDA 2V6GA 2QM7A 3KYCA 3WMRA 1H5UA 1Z7YA 4FW9A 4MVYA 3JWEA 5FNVF 2E82A 5HK9A 2VYVA 4UREA 4I8IA 2V5UA 4UNIA 5EIXA 5U4XA 2ZUBA 4CL3A 3LHIA 4B48A 4DTCA 3FLAA 4HQFA 2NG1A 1QC5A 2O6HA 4TZKA 1ARZA 1F3OA 2PGJA 2PUTA 5HFAA 1B6TA 2I34A 2VXBA 4MI9A 1TDJA 5L4LA 2BEVB 4CWAA 3W7AA 3PTZA 4F71A 1E9CA 3C3DA 4QAJA 2GZSA 1P4AA 5ALXA 4DSUA 3MT0A 4N5IX 5CB6A 3TD9A 1Z33A 1R9NA 3ROXA 3FPFA 1BXZA 1W19A 3F6RA 3ML1A 4W82A 1TM2A 3WDLA 3JTEA 1ZD3A 3IDFA 1TZKA 1NRIA 2GLTA 3ELDA 3JZAA 3OQ6A 5JH7B 1T2EA 3H9UA 3OZWA 4Q1FA 2QQFA 4NESA 1Z28A 4BJ3A 1SOMA 1WEHA 3L0SA 1TOAA 2RC5A 4LYJA 3QY0A 1BQ4A 1HQYE 3ETGA 2GM5A 3B78A 3A9WA 1R0RE 4WQMA 5BNWA 3I6BA 2Q4TA 2G1JA 1QV7A 3H2IA 3TECE 3A25A 2FP4B 1DC7A 1XEWY 3M33A 1E6EA 2B1IA 3D6VA 1LUAA 3V8BA 1GGJA 3BH7A 4EZBA 3I23A 3QHQA 1OLUB 5KHAA 3FA2A 4N5NA 3U0BA 1ZVQA 5A05A 3V34A 4FHCA 4AKEA 3UATA 2WWVD 1H3NA 2NX2A 3EODA 1WR8A 1XRSB 3GA5A 3NHZA 1LTHR 4IIJA 3QVTA 2ZRQA 4MIOA 1QIGA 4N9QA 1Q1AA 4UZSA 2VHTA 1W4ZA 3HNRA 4Y9RA 1DJPA 1X38A 1U8EA 5BOVA 4PN7A 2R8YA 2FJPA 3DBIA 2O7QA 3M6WA 2X4LA 4L8GA 2ARKA 4TGLA 4EI2A 2BFOA 4ND8A 1PWHA 2D0DA 3HRKA 4LA4A 2SKDA 2XH8A 3ORSA 2H1VA 1H6DA 1C8KA 3DVAA 4PRZA 4Y2XA 5DF1A 2CK3A 4EHIA 3WJAA 3VYRB 5C1BA 5EJ5A 1PEKE 3K0BA 1Y6JA 3GX1A 3JWHA 3R0QA 4GGMX 5LA6A 5MN4A 3L02A 4N0QA 3UMMA 4EQZA 1KDPA 1W35A 4C9BA 1P29A 4O2LA 1WW3A 3RGWS 1NRJB 2YUTA 4GMFA 2ZATA 3H0KA 4CTNA 2XVAA 1L5YA 1O96A 3QPVA 4CG2A 4AJIA 2PZBA 3HBFA 5HK8A 4Q3OA 4CKCB 3W2FA 1JEAA 1KEWA 3UBTA 1IWBB 1BOOA 1M8GA 2FWRA 2J4DA 2XOEA 3LG2A 3W6PA 4AICA 2B9VA 2BRUC 4GUDA 3T0IA 4CQLB 4D9KA 4RTPA 1U0LA 2JFFA 4NS1A 4OKNA 3UMJA 1NBMA 3FZEA 2V3VA 4IKEA 3CWZA 3H97A 3MFQA 5CFMA 1Z07A 1HL7A 2B1JA 3GJYA 5E6SB 3EWAA 3KUDA 1LDGA 2OAGA 3GLHE 2JLQA 6NULA 5EZSA 5C4GB 3UJAA 3HJFA 4K9DA 2RGXA 3DP7A 4LI3X 4XCVA 3ZX4A 3PXUA 1IJKA 5JH7A 1DGQA 1XMXA 3VC7A 4E2FA 1P2FA 1MW9X 1W8IA 3MT9A 1Z88A 4LTDA 5DDIP 5ALDA 5CM8B 3WKBA 3IBSA 1P33A 5FOSA 2JIBA 5CT6A 4DT1A 3TIVA 4HZGA 2JGMA 4N41A 2XCRB 2KJQA 4FSDA 1LV7A 4QTXA 1O03A 1EEXB 2AE1A 2QN9A 4D0SA 1R18A 1RQLA 5ITZB 2ZJ4A 1Z6PA 4IXNA 1C81A 4H6PA 2NZUG 1DWPA 2XCIA 3I12A 4QGSA 4I4TF 4CG0A 7AT1A 2QEQA 1HXHA 3UFBA 4RZIA 4A4DA 1BFDA 3A2MA 2UVPB 3GCGA 1J42A 4ZJZA 1DKOA 1OHHD 3D7RA 1T9DA 3MLAA 1ZESA 5ES3A 3DEYX 1TB4A 2MJLA 3ZKWB 4LK3A 3DHVA 3IOMA 4G1EB 4NOMA 3UGJA 4KR7A 4Q9IA 4C7MA 1TZBA 3OCXA 1NKVA 1WL8A 4LRXA 2GAIA 1PHPA 4AG5A 1PTJC 2ZRIA 3FSGA 2J1LA 1I4WA 2O8CB 1XRNA 4FCTA 2EFGA 3ZNOA 5EIEA 2Q6TA 3P9XA 1U28C 3F47A 1IY1A 2DLNA 2OAP1 4C3ZA 3U1VA 3KETA 3VU8A 4AXBA 1XLUA 3O8NA 2YIDA 4ZZ0A 3IAS6 3VI4B 3E3AA 5EHXA 2LRHA 5LBIA 2Z2JA 5IDYA 1ZD4A 3LD9A 2P2CA 1ISHA 5AVQA 1R0XA 3DE6X 4YX9A 1G3UA 3BEDA 3KT3A 4LVCA 5I4BA 5DEIA 3CVWA 2PKEA 4KREA 9MHTA 2PUJA 4FZ3A 4GE3A 1SOUA 3K35A 1IZ8A 2XA1A 5FXMA 1FX0A 4K40A 2CNBA 3ZTYA 2W2QA 4X64B 3R40A 4U5QA 4CQNA 1TCVA 2SBTA 3EF1A 4B3RB 1ONOA 1CUIA 2AOVA 1HSZA 1LPAB 4WOKA 4FSHA 1Z4KA 4RAQA 2OT3B 3DZ8A 4QU5A 5HWSA 5DSXA 2FFQA 3EGVA 1I7NA 1T2VA 3BYZA 1I5EA 4DILA 1KGSA 5I9SA 3R5TA 1RRGA 1B73A 1CE8B 1UWCA 1G8FA 3QH4A 4MQFB 4JT2A 3I45A 2P3LA 2O8BA 1RWKA 5B1SA 1NMEA 4HUQB 4L6AA 5LFAA 4J1TA 1X7ZB 2P1ZA 2WFLB 4YI3A 4ECAA 5IAKA 5EPOA 1TCUA 1ML3A 1RT9A 4UOEA 1EFAA 1NW7A 3D2CA 1JWLA 2G1UA 5FRDA 3OQ1A 2PPLA 3KEOA 3UH0A 3BRQA 2OKGA 4A0GA 2FMTA 2BMWA 1NG9A 3PFFA 1UBOS 3T1HB 1PI3A 2J6CA 4CR8A 2ENUA 3LHSA 3BDIA 3K0HA 2HRBA 3AY7A 1RM3A 5G0TA 1IUOA 4ZRDA 1QGAA 1AUPA 3INGA 3SEAA 3SXUA 4MDFA 3C3BA 1EFVA 2X86A 5JVDF 1JDUA 3GT0A 4BVKA 1OD6A 1VG8A 3NETA 2QQEA 3VVLA 4UE2A 4OM7A 4EL0A 4WXMA 3G2NA 1ADYA 5DM0A 5KC9A 1CQIB 1MJGA 3PB3A 3R3HA 3AFOA 3SCZA 4LPKA 1UDXA 3K1YA 4IHQA 4N54A 4ZCQA 3WLFA 1W36C 3L7NA 3FUVA 3I5UA 1BRMA 3IURA 3L7KA 4KBYA 1AGNA 4R3NA 4R41A 4TRRA 1PZFA 4YECA 3TEFA 2YVKA 4GOKA 3U62A 2WIAA 1FP6A 4B2LA 5I8PA 1ZQ9A 1CR2A 3AZQA 5ALJA 1G7SA 1MHPA 4OMDA 2G07A 4L8VA 2NVBA 4KE6A 3KYDA 1WXIA 4OSPA 4KPUA 2WV7A 1NC1A 3PWZA 1U9ZA 3OSZA 1JLSA 1CVRA 5KJFA 3F1KA 4NBTA 4GO1A 2A1UB 3SQNA 3A26A 3D0RA 4X6LA 4BFUA 1T4CB 4ZOBA 2JEOA 2WAMA 1K6IA 1DQYA 2VOJA 3P0IA 3T7SA 2FEMA 2IKQA 4D0NA 1P9LA 2J33A 2QTHA 2WVAA 3WLTA 4OAQA 4PWYA 3BXZA 4R7ZA 4BLOA 4C0AC 2ZYRA 5EJ8A 1F0PA 4I19A 3WQSB 2PH3A 4GR4A 3D8TA 4FN4A 3EBLA 5F35A 4ZYLA 2Y6UA 4BV2A 3LLMA 4JCOA 5FNVB 3VC3A 4F3KA 3PR1A 2IITA 3UKDA 1N1DA 1E9SA 5CJPA 5AXBA 2DXIA 3PWSA 2VZLA 4DANA 1X8LA 5LP6C 3NNNA 1SNYA 5CVJA 2V7QA 1T3ZA 3GJSA 5T5QA 3BRWD 4C6HA 4QRIA 3W6OA 4J29A 3V97A 4W5OA 1DX9A 2X8BA 3PJGA 4C2BA 1J2UA 1H42A 3AHHA 4FYPA 1UMCB 1PLJA 2YHIA 3I2FA 4FFRA 5I5EA 5ICMA 2BSQA 5ICSA 4LJ5A 4QODA 5C5DA 1L8LA 5E0OA 2OCBA 5IULC 3SZUA 1BE6A 1AJEA 2IHJA 3D3NA 3URMA 3CW9A 3E9MA 3EY4A 2NSJA 1IK4A 4ZMBA 2DHRA 4CDRA 4G5SA 3QUCA 1N6OA 3KVRA 3PFHA 4OGGA 2M6KA 3ZGYA 2RHTA 4G9BA 4KQ9A 4PZ0A 3TIIA 5IVKA 4OFBA 3CTPA 1CW2B 4OJNA 4B43A 3G2OA 1O9HA 5CA0A 5FPQA 1EE1A 1PJRA 1XQYA 4KE8A 2PZ8A 1PSZA 3OPVA 4JX9A 3VNRA 4D44A 4ARIA 2ILTA 3WKAA 4O0LA 4LSWA 1V5EA 4EMTA 5HRUA 4YLYA 1PYOA 2VO1A 1M6VB 2WT8A 3LPLA 4IVNA 4L3OA 5DHQA 4Q12A 3VYUB 3WI7A 2DRIA 4E3WA 3EPKA 1M9NA 4E33A 4Y0AA 3R20A 4OB7A 1MABA 3K70D 4F9FA 4HG2A 3CRRA 2JNWA 3EVDA 1QFZA 5KX5F 3B7PA 5C8YF 4RSGA 4ETNA 2BTEA 1H65A 4FKMA 1P8JA 1SK8A 1PQUA 2DC1A 4EHDA 4RTKA 2BCEA 3ESQA 4LJAA 3JWPA 5EZYA 4G4JA 5CNMA 4RIIA 3B6JA 4HTFA 1COZA 1PJBA 1WBDA 4QFBA 5DP1A 1EJBA 1M6WA 1T4CA 1NKTA 1ZOSA 4Q00A 4XYMA 1UZUA 2P2SA 1M83A 4LCEA 2VHWA 1I1HA 2ZSKA 3AGQA 2I2XB 1UOOA 3CH5A 2JBHA 1HTWA 2GN2A 4G5QA 3N70A 4QJ5A 5F64A 3U9SA 4MWBA 4RLSA 4BIMA 2IPAB 2PT7A 5A9SB 4WESA 3GEMA 3LLVA 1SQ6A 3DVSX 2ZSBA 4M0EA 4RVFA 3UCXA 4HO1X 2RBEA 3MWDA 5DMXA 1RFLA 5AIAA 4BQEA 4OIMA 5AFSA 2WJ4A 4C4OA 2B1GA 1DC8A 2FZCA 1U2PA 3DD5A 3G1WA 3PENA 5GM1A 3AK4A 4EABA 2YINC 3CG0A 3C3MA 3KPVA 3O1LA 2RAPA 1MJGM 4ZPXA 3KAKA 3PGLA 1FFSA 4KQWA 5JCOA 1KJJA 1YVPA 1ANKA 2ZT5A 4UHCA 3S2IA 2P9HA 2GB4A 2JLBA 5TQ2B 3L7YA 2C3UA 3QKTA 3PNYA 4DNFA 3UW3A 9GPBA 3D8HA 1PFGA 1W46A 4H6VA 1HR0B 2D4HA 1T5TA 4NAHA 2QPOA 5GV7A 3H6HA 4LKOA 4RJLA 3ICPA 5F9MA 3R3UA 2PS0A 5AKKA 5FLKA 1YS4A 2FU5C 5ALVA 2H4ZA 1YONA 1MXFA 2R25B 1NN3A 4FT4A 3QEBZ 3ZJUA 2QTTA 4M38A 3H4VA 1X1DA 2ZREA 2OBXA 4NMMA 1UM9B 3I9NA 1KYIA 5K51A 3WRXA 5I7EA 2HBZA 3FUTA 3L7MA 2C0CA 5EHZA 4W4TA 5CX1A 1LGYA 2FZ5A 1UPFA 1LRJA 1SRQA 4ZVQA 2ZRPA 4K9OA 3DJFA 1NRXA 1R8SA 1ZICA 1D1SA 2PTHA 2X9VA 5EJ9A 2QRGA 2DULA 3L9XA 1U28A 2BFBA 5D5HA 3KQOA 2BMEA 2NVWA 5DTJA 3A9TA 3UJ3X 1YBHA 4YXWD 5JVDA 1A4RA 3F4LA 3BRSA 4GT1A 4J43A 4LDPA 3OJOA 1N3YA 2OV1A 1SUAA 4WLEA 2F3SA 5IT4A 3PLAE 5K8UA 2C29D 1K7CA 2GF0A 3Q0TA 1O5IA 3NONA 1VECA 1G20E 1DKUA 1KOLA 4TTAA 2QTBA 1HWYA 5LB2A 1P6UA 1H85A 1W88A 1UK7A 2G70A 2PANA 3QTLA 3RFVA 3IP5A 4IJQA 4C0XA 3OOJA 5BY2A 1RPAA 5DNCA 1W2GA 1MQ9A 3NIFB 5FOUA 1HUQA 1NJ1A 4OJQA 4WESB 2E0IA 2AR0A 2QE6A 4IDQA 2EF1A 3IOYA 1Y5NA 1IY8A 4NNJA 5A5DA 1WZ2A 3RK4A 1THMA 1XI2A 3IIJA 4RC9A 4TMXA 2C96A 3I6ZA 5TS2A 5I9IA 4BWVA 1A5AB 4E2WA 3KNZA 3JYQA 3JTMA 1AZLA 4OP2A 3I42A 2GCNA 1QB8A 4MQLA 2NO0A 2YY5A 2F17A 4BO9A 4N0MA 3IPYA 3NNSA 1CQWA 1C3OA 2W4MA 1FK8A 3TZKA 5HNKA 2DY0A 3EFOA 3IR6A 3NHSA 4N0EA 3WLPA 5KOHA 3WK9A 1ZMBA 1P62B 2NXWA 5EFZA 1DU4A 2QPLA 2C00A 2AUMA 1W0KD 3JVIA 3KKOA 5DLPA 3CR3C 1OBFO 4BB5A 3VFDA 1G2QA 2EZUA 2WWIA 3L01A 2YV5A 1E20A 4UCFA 2ZJ3A 4DLKA 4DFDA 4GWGA 5A1JA 1XPUA 4X84A 1E8DA 4CIXA 3ZXXA 1UBEA 3GRFA 5CA1F 2CJYA 4CLDA 2AD1A 1X1CA 4MR7A 3MUEA 4EGJA 1ECLA 2FQQA 2C5SA 2GX6A 2V7WA 1EESA 2WIBA 4M76B 3QJGA 2HK7A 5D7NA 4ARVA 3AX6A 4BKUA 4V3BA 5G1OA 1GG9A 4G5OA 1MOQA 2QRPA 2YOFA 1NI4A 2Z2ZA 2W2LA 1NFQA 1D2AA 2Q0XA 5HIIA 4BAZA 2B4TO 1O95A 2B5OA 3WYCA 2EW2A 4I08A 1IATA 5LLTA 3B6KA 4WOCA 3GUHA 1R9MA 1AS2A 1SVKA 5AHWA 1JXAA 3IC5A 2XECA 2BSAA 2OPHA 1QLHA 4E7OA 2PUCA 3WLQA 4F97A 4XD7D 4DIMA 3KAQA 2CHGA 1K97A 3ME5A 4HLUA 3RS4A 3P0FA 4A92A 1RYZA 2ZB3A 2EFYA 3SQMA 3CH4B 1MX3A 4MLCA 1N92A 4EFDA 2ZUUA 1XEXA 4L85A 3DH0A 3M1IA 1RAFA 4FLMA 2SCUB 3W9SA 1AY0A 4U2EA 3IKLA 1T8UA 3CVYA 4Q6BA 2GA9A 3BBLA 1GNTA 1KQ3A 4J16A 3TLGA 4EHAA 3I9FA 2W6JA 2C9CA 3R0ZA 4IXWA 3KQVA 4YQFA 3MQ4A 1I5RA 1QORA 2QVCA 4XPZA 1Q7RA 4XXHA 4CT4B 4EG1A 5I7SA 1AK2A 1DJNA 4AI6A 2HU5A 4DIEA 4YRKA 5LP6A 3OLYA 5CDSA 4CRWB 4F2DA 3EMVA 3RPEA 3TRDA 4I4IA 2C4HA 4L5BA 2HSWA 2BBWA 4HP8A 4XB1A 4AJNA 1W96A 4GP7A 3DEIA 2WHYA 5LLSA 5MGBA 5FBWB 2YJGA 4HYQA 3UY4A 4ND2A 5C18A 4ARZB 1SOWA 1CQZA 4UUAA 4DMRA 4YAKA 1EVZA 3SLRA 3EX7C 4JI8B 1F1JA 3IP9A 1MH1A 4P83A 4Y2SA 3VSEA 4EQ6B 5JFGA 4IIBA 1PEAA 1EWKA 3FNIA 3M4YA 2BM9A 2QLBA 2W0SA 4IQ0A 2QRQA 5IDWA 4FYHA 2A5LA 1KRXA 2WWGA 1SOAA 2IXFA 3IQEA 3D7NA 5ALKA 1NQAO 3AOEA 3M6UA 3VR6H 5DTRA 3HWSA 1CS0A 4Z4GA 3HKCA 3IQXA 1VRCA 1U2EA 2YZNA 1AGPA 3HVKA 3LS2A 3QPCA 1WVGA 4GAEA 5AMXA 2NACA 3AESA 1W1UA 1W4AA 2ID4A 2K6GA 2VA8A 3H9CA 3L8DA 4G5GA 4GYKA 4TWZA 3F71A 3U9TA 3ZCUA 2HLHA 2WU3A 4EDHA 4EBFA 3U7GA 1D2HA 1E2DA 3RBXA 3NNDA 2CW5A 1AIPA 3B3JA 4KDFA 1AO0A 5J2TB 2QLLA 4Q4HB 1V25A 3FSEA 1S2GA 4PAGA 4PHFA 2Q1XA 2ZUTA 4K1XA 1Z29A 4H7HA 1JL3A 1YE5A 4B79A 2PA0A 4NFLA 1FYDA 1JIIA 2RJOA 4G1UC 5ED0A 3QWAA 1SCDA 2PRYA 2EP5A 3I9V6 3G79A 1RQ7A 2FPGB 3IRVA 4B2YA 4RGVA 3TSZA 3M6VA 2OB1A 4GGPA 5H4GA 3UK2A 2NUBA 2Q5FA 2XTJA 4AK9A 3W34A 5KTOA 2PRJA 4JV5B 2QVLA 2M1ZA 1AF4A 3KE8A 3MM4A 2V7VA 3ZDCA 1Q7GA 1JE0A 1FYEA 1Y5IA 4Y2YA 3HTXA 2RKOA 1RWQA 2QAGC 4C4YA 2VCHA 3ECCA 1E96A 1O94C 2HCTA 3P94A 1Y3CE 1VHTA 1QIKA 3CLKA 1RD4A 3ITEA 1EXMA 1GKKA 1U3VA 2PH7A 4AUKA 4D0GA 1Y3BE 3T61A 3FVRA 3ADDA 1MC1A 3OZ7A 3I9KA 4HQKA 4N9WA 2ADOA 3QWBA 4BNMA 5KYKA 2QYSA 3K94A 1YAJA 4BUJA 1MP0A 5EP3A 3IUJA 1W1IA 1IJFA 2ZBQA 1Z25A 3LK7A 4G67A 1F4LA 2BUCA 1DZIA 2COUA 4GD3Q 2F1OA 3SAJA 4X66B 3FSGD 2AZXA 3K9NA 5D84A 3L05A 4ZEOA 1ZQ1A 1TL7C 1VG0B 4DMCA 2YY6A 1XC7A 2JK1A 1ESNA 1CY0A 4L7VA 4CM9A 3FDXA 4K9NA 5AVUA 2JFQA 3TVTA 5JCOC 1ZHHA 3HYLA 1QJCA 4D26A 3ND8A 1E3SA 2EGGA 3KVYA 1QTNA 2W71A 1TZMA 3WGIA 3RIYA 1ISSA 2J6HA 2C3MA 5DMHA 3A04A 2XOKD 5FHQA 1I2ZA 3BXHA 2HRDA 5HTKA 4EVRA 3DE5X 2YWEA 1H9BA 3QITA 3PXGA 5AVTA 1UKZA 2FG5A 2P77A 3E23A 4WDRA 3TG2A 1UF9A 5ALHA 1B3BA 2BF7A 2JFOA 1JBKA 3U13A 3W6ZA 1KOFA 4Y0VA 1D1PA 2AQIA 4DCNA 4O2BF 1R27A 4OA8A 4JI4B 1W6UA 4GPZA 3SJCA 1G5FA 4J75A 2ETVA 1DUSA 2VEOA 3HCAA 5IM4F 3D2BA 1P8AA 2P9YA 2ZM5A 1YE8A 1NF3A 2ZE7A 3L1JA 4JJAA 2PKCA 2VQ6A 3EDOA 3MFYA 4DUPA 2V8BA 3IT0A 4Y6OA 3RODA 3N5CA 4WBXC 4ZICA 1JR2A 2FRVA 1M0EA 1XMPA 3CSDA 5D3MA 4HGYA 2BMDA 2JLYA 4DLXA 2WA1A 5HIJA 4ZZ1A 1Y6ZA 2ODQA 2ZPTX 3KHSA 4ZZ2A 1GKLA 4TKVA 2C5EA 2D7JA 4IOMA 4LZPA 4CEHA 3ODPA 1K7FB 3GZNB 4LRSB 4YALA 2FOIA 3LBHA 4BE7B 3GXOA 4UZEA 5H70A 2PNJA 4EKYA 2ERCA 1EM6A 3ZI4A 4RGYA 5J43A 1VBFA 3C1OA 1LBTA 4CLHA 5FOWA 2AGVA 1QZTA 1GKIA 3D43A 1U0TA 3CMCO 5C5IA 3Q15C 1QK5A 4JC8A 2R8BA 4WBNA 2ZRDA 1ADCA 4QXRA 3ZV4A 2X8LA 1WZNA 1CUJA 1EH5A 1LPNA 1YKFA 3DL0A 2ZJ6A 4FS3A 4FFWA 2JFUA 4LZNA 2ODEA 4JU9A 2OL4A 2QRZA 1YS6A 4N65A 5JWRA 3TF5A 1ISFA 2PIDA 3L0ZA 4TQUS 1SUIA 2HF8A 3MJTA 4G1MB 4HDNB 2QVYX 4PVCA 5GZ3A 2QWXA 4IL5A 3B89A 1OB5A 4EVIA 2JFPA 2HY7A 1PBTA 2QNIA 3AKEA 2IBMA 4KHZA 4Q1VA 3ZR4B 4Z6KA 4PCLA 2D0IA 2QQGA 1DTEA 4WUVA 4EYOA 4RVGA 3RJZA 3KV1A 3ZBUA 4IRUB 3OZBA 1XROA 3IAM1 3TS1A 4OHZA 3STWA 2R68A 1AZWA 1MJFA 3PD0A 1BXKA 2RJ3A 2J87A 1Z0ZA 3HJHA 5HBRA 5B1IA 2H7CA 2HGSA 1V7ZA 2O1XA 4TVBA 4ZVLA 3MWLA 3EQ8A 1JHRA 3P26A 4XGKA 2VNHA 2XEDA 4A8JA 1YOVA 5C7LO 4AD8A 5KNCA 2F4NA 2AN4A 1Q0QA 2FWMX 2YN0A 4M6WB 3U48A 4F21A 4ZCTA 1B14A 4TPKA 2PGOA 4B46A 2P2DA 2J3KA 3JWGA 4H0CA 3OC6A 4GX2A 3CN7A 5C1OA 4Z1OA 2A7XA 1N2GA 3D4BA 3F97A 3OQBA 4DMHA 1E9AA 4UJ3A 4DMLA 3GAFA 2BT4A 4OH1A 3GLSA 5JSFA 3AEKB 1JG6A 1UT5A 3GRVA 4XJXA 1DDGA 2VUSA 4C7OB 1WS6A 2Q4DA 2RGRA 3JY6A 3QMPA 4D9IA 3NT4A 3E48A 2RAFA 5BNTA 5CFRA 1D5CA 5JXGA 4QTYA 1ZN9A 2GF2A 3KZ1E 4UARA 2XNJA 2NUAB 1YR9A 2BGKA 1HKHA 3ZCPA 1IRIA 4JLSA 3KCNA 1JDNA 1JMVA 2XNCA 3Q5GA 4ER0A 2AI1A 4TL9A 4ER6A 2OXEA 4IHJA 1P9OA 2C9OA 5IG2A 4ND1A 3L6BA 4HR7A 1KJQA 1DO0A 5CHYA 5DT2A 4V0MA 4LZOA 1PT9A 3QNUA 2DTEA 3CURA 4M36A 3TDMA 1YASA 4CMIB 2IPLA 5IF3A 3O9VA 3B13B 5K2MA 2XKKA 2XGMA 4G9GA 4JI1B 4G84A 1GL3A 4L02A 1WQ4A 1H2RS 2FSPA 2O52A 3TKYA 3AY0A 1MAAA 2BR5A 1YFLA 3FMIA 1WV0A 3DW1X 2QT1A 4PXAA 2LDBA 4D8YA 1U5AA 1ZOPA 1WZEA 1EYZA 2XW6A 4IPTA 4DR7B 4Y6RA 5FYDA 2YVLA 3TLAA 4QFDA 1KEZA 3KRTA 4CF4A 3WKDA 2LDXA 4DUZB 1PL8A 1Q3KA 3MQ2A 1R0YA 1W5SA 1YR7A 1YBAA 2IC5A 1JTVA 2VJMA 3NCHA 2OZVA 4II7A 2V7TA 3C4QA 3TW4A 3DONA 4CYMA 4FB5A 1FRNA 3D9QX 4Q24A 1H9CA 3AJ8A 1Y9DA 1YOVB 3LIIA 3U3DA 4UTNA 4R9VA 3GBVA 3BDAA 4AJPA 3WDSA 4DSOA 4NZZA 5DX8A 1VL6A 1EK1A 2H65A 2VLBA 1O9BA 2J59A 1ORRA 2QORA 4KO4S 2P6RA 1YZKA 2AHOA 4GPBA 4O63O 3QOFA 2QUZA 4B2PA 5L6LB 2YBEA 2WTNA 3F7MA 3H5LA 3GNLA 3KUUA 3P2IA 2AQKA 3OQIA 4P3NA 4J49A 1IC6A 1RKXA 3SSMA 3V8RA 3O73A 2ZAGA 3VVBA 1ESEA 2OZLA 2H1WA 2PUVA 3INTA 5FUQA 5HKOA 3UV3A 1HE8B 5EE0A 3CMMA 2K2WA 4Y18A 4X54A 4V1CI 3UPTA 2AMYA 3BJMA 3QVUA 3VJRA 4CFSA 2IF2A 1RLTA 2D1TA 5EMHA 1VE6A 5HM6A 4Z8XA 4ZN6A 5KSPA 4PSVA 1H4VB 3VJKA 1HYGA 2FDRA 1XCMA 3EZ7A 4DIKA 4DW8A 1GRCA 1H05A 2J9YB 4GOLD 2C2XA 2PEYA 1PZXA 5DTEA 1BCSB 1NHWA 1DIOB 2IZ6A 2D4AA 3AIKA 4MVJG 1EFDN 5DSZA 5GY7A 3IAHA 2QNBA 3SX0A 4BNHA 5E38A 3FOAA 4RETA 4MV8A 1E1NA 1VJDA 1J22A 1FYVA 1D6SA 4QYXA 5AQEA 4F4HA 1GQSA 3IVCA 2AL7A 2ZWPA 2R751 4TYMA 1FNDA 1HOTA 1DINA 1FJHA 1PVVA 2O4CA 2WIGA 4JLUA 1RXEA 4OUDA 4TRMA 5BQFA 1UIMA 4HNQA 3C24A 5F9FA 1TXGA 2QW0X 4JLNA 4W5QA 1RJEA 1GTSA 4R98A 4GVLA 4HMQA 5TQVA 4BJHB 4BFWA 3F0TA 3JQFA 3P45A 421PA 4EUEA 5A1TA 1TM1E 3CVVA 4I5FA 4YP1A 3K96A 4XIIA 4HFNA 4ZV4A 3F96A 4N47A 3A27A 3UMYA 1C50A 4G0UA 3WK4A 2VCYA 1T4GA 3R6GA 3K5PA 3JASB 2FVYA 1YJ5A 3R0JA 3SDZA 4YCCA 5FFMA 5IT0A 2C5GA 2AR7A 3CINA 4XWTA 5EXTA 3JD1A 1CRWG 3USES 4RPHA 2PJZA 3STXA 1PJ8A 4FYIA 1YR3A 2WT9A 3BA1A 3THYA 1J8VA 1YVRA 2ZITA 2C1XA 4LVUA 4B8ZA 5JXWA 2PMEA 4TMWA 4JLWA 1SKBA 4MUHA 3NDRA 1WKCA 2PWZA 4J2HA 4LNAA 4Z2AA 1SCUB 2AFHA 5AVXA 2O48X 5FL3A 5JQGB 4GRAA 3TLGB 3OQIB 4BPRA 1CRPA 2E1RA 5L3QB 8MHTA 1G5IA 2VXYA 2BFEB 4DA4A 4PHTA 4NK5A 3UYKA 5BUCA 8AT1A 1I0ZA 3CEJA 3M2TA 4LE2A 1TMGE 4RF5A 3X1YA 1YS7A 4I8DA 4BC0A 1LX6A 2R7MA 3W7VA 4CGZA 4J0EA 5AK3A 2BBTA 4B8WA 1WNFA 1KQOA 3NTXA 5EY5B 3QOYA 4EF5A 4DEVA 2WU1A 2FRXA 4LXQA 5L51A 3K0FB 4NONA 5DW0A 4L07A 4QKQA 5AIBA 2PUAA 2AZMA 3MCUA 3D7SA 4QYTA 3ZHUA 1TCAA 3VU9A 3DM5A 3MPUA 1Z2DA 1MHTA 4ZZIA 3WB1A 5IT9A 3GRUA 3NTRA 1KEKA 2VRCD 4ZRNA 3EDRA 3UMGA 4NDZA 1L4KA 1W5TA 1KFJB 4RK6A 5I47A 4ZOLB 2AG8A 2EARA 3RTBA 2J3QA 5CB0A 3Q2KA 3BZBA 4MVJA 4H27A 4MUXA 1RRMA 1XWIA 2HFJA 3I1IA 3RYIA 2ZS9A 4YWHA 2HJSA 2G5GX 2JFYA 3D8UA 4RS4A 4WAUA 5E6SA 1ZL0A 4C7XA 2IH5A 4NSNA 1D7AA 5BV0A 3TSOA 5HTOA 2CDRA 1JKIA 1JDZA 1G6Q1 1PNRA 5ETJA 1L4HA 3FZYA 1OBVA 4MPTA 3FOFC 1J25A 2J31A 2ZYIA 3GJZA 3RS2A 2ZXEA 4DAEA 1OREA 3L0OA 3IDOA 4XX0B 1YBVA 4EJSA 4I4CA 1CUEA 4GVPA 1RMQA 1D5WA 2VHQA 2X0NA 5JAHA 1X8XA 1FPQA 5J4KA 2CF5A 1T25A 1N6HA 2CVOA 3CUTA 3GB9A 4EW6A 2FPSA 1J2JA 2WU8A 5ER9A 2R6ZA 2IELA 4I46A 3ROKA 4BEBA 3PHLA 1B1CA 4FNAA 1GADO 1FLNA 3U9LA 2O7RA 4UXIA 1URPA 1MAUA 4HWOA 4L0MA 4E0BA 1RQRA 4XASA 4Q4AB 2QX9A 2ONCA 2B36A 4HVLA 2W8BA 4W8HA 2R7LA 3PGKA 1GZ3A 2FB9A 3THXA 5CD9A 4KV9A 1SHUX 2GZDA 3TBKA 4COOA 1J5EB 1DOHA 1RRPA 3I5YA 2QGZA 1BWRA 4Q47A 2NUPB 4M37A 4PANA 2XDAA 4IHJF 1WXQA 4JBNA 4MCHA 3KVOA 5DVZA 1K3FA 3KQHA 1EUDB 1GIAA 3O5AA 5DEOA 1WUHS 4TOIA 4RD4A 2N46A 2O57A 2BFCA 2XI4A 4JEMA 2R87A 1G2IA 1ZUWA 2QF7A 1P2UA 2GD0A 3B6ZA 2CZCA 4FXOA 5CFOA 3OZGA 4QWMA 2YNMA 4RH1A 5I9MA 3AFMA 1T9KA 4D3XA 1GPYA 2C9ZA 4FYVA 5AM1A 5H02A 4AMZA 4EPVA 4OQZA 4B4KA 2OCPA 2QTFA 4BNGA 5FLEX 2VXOA 2Q5JA 1YB6A 1LH0A 3EK2A 1FXWF 3HS3A 4Q1EA 2CNNA 2ONKA 1RC8A 1IG0A 3DE7X 4PO3X 2MSKA 4GEGA 1GG8A 1L5FA 3OCVA 2KLHA