1MB3A

Crystal structure of the response regulator divk at ph 8.5 in complex with mg2+
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
123
structure length
117
Chain Sequence
TKKVLIVEDNELNMKLFHDLLEAQGYETLQTREGLSALSIARENKPDLILMDIQLPEISGLEVTKWLKEDDDLAHIPVVAVTDEERIREGGCEAYISKPISVVHFLETIKRLLERQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein, cell cycle
molecule keywords cell division response regulator DivK
publication title Crystallographic and Biochemical Studies of DivK Reveal Novel Features of an Essential Response Regulator in Caulobacter crescentus.
pubmed doi rcsb
source organism Caulobacter vibrioides
total genus 38
structure length 117
sequence length 123
ec nomenclature
pdb deposition date 2002-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1mb3A00
3SAJA 2FQXA 1ZVVA 4JA2A 3ILYA 4LE0A 5FWXA 1VPWA 3I09A 1SD5A 2R25B 1E6LA 2LIVA 3TB6A 2MSKA 2QXYA 4F11A 4HNRA 3K9CA 4N0QA 5TQJA 3LUGA 3CS3A 5TPWB 2FVYA 2HSGA 3N53A 3I45A 3HZHA 4RKQA 1ZY2A 2JVIA 4G0ZA 4B09A 4O5AA 1Z18A 3HS3A 2GX6A 3FGZA 3IDOA 3LUJA 3BRSA 2ID7A 2IKSA 1ZITA 1JFSA 2X7XA 1GCAA 3JTEA 3A10A 5EWMB 3W9SA 3OLZA 2KYRA 1FFWA 4RSMA 3F73A 5DLEA 2I6FA 3H1GA 4LE2A 4G0YA 1BDJA 1LBIA 4IILA 4MQFB 4EVRA 1NXSA 6ABPA 4WWHA 4DADA 3N6VA 3MM4A 3T8YA 1M2EA 4LZLA 2LP4Y 3O1JC 4RY8A 1TLFA 3O2JA 1ZDMA 3EQ2A 3O75A 4WXMA 4ZMSA 1U2QA 4YV7A 3DLHA 1DCKA 5TQ2B 1C4WA 1XHEA 3EQZA 4Z4HA 3O1HB 3Q15C 2B4AA 4OLBA 3QEMA 5KI6A 1M5TA 2YHBA 5I4CA 1YMUA 1KGSA 3ROTA 3JY6A 4TN5A 5IBQA 3T38A 4MS4A 2PUBA 3OO1A 3M9WA 2WMYA 4JAVC 2GBPA 3MMNA 4KMRA 3OQMA 3HM9A 1UDRA 2F8SA 2RGYA 3KTOA 2QVCA 1XWWA 2FW0A 1Y1LA 4ETMA 3C3KA 1DJMA 2A9OA 1DC7A 1NXPA 1U04A 1EAYA 7ABPA 2PUDA 1SRRA 4Z4FA 3H5VA 2PUFA 4G0XA 3GA5A 5CNIA 3NNDA 3H5TA 4QYWA 5C5CA 1D1PA 5TPZD 2PLNA 1JWLA 3HDVA 4Z99A 1DRKA 1Z16A 4PZ0A 1FSPA 2P4UA 5B3JA 2VUIB 5IEBA 1QKKA 3SQNA 1I3CA 3TD9A 1GCGA 4Z4GA 3CLKA 2WWVD 5PNTA 2L19A 4MS3B 1K68A 3RVLA 3SNKA 5JNSA 1DCMA 3FFWA 2XDYA 5T3YA 4EYKA 4OATA 2MYPA 2L17A 3OLXA 3SM9A 3QELA 3GBVA 4WUTA 2FQYA 1L5ZA 5HSGA 1BDHA 4XXHA 4NCAA 1LJLA 2VUHB 1E6KA 1EWVA 3MIZA 4IRXA 3GYBA 5CHYA 4NV3A 2GWRA 3K4HA 2IDMA 4O1HA 1AB5A 4XAQA 4MR7B 5CNMA 1DG9A 5GQSA 3CU5A 3FDFA 5IC5A 2JBAB 4LDAA 3GL9A 3H6GA 4O1IA 5IUNC 1MAVA 1Z17A 4IF4A 1GUBA 4RU1A 4D6YA 3CHYA 2FMFA 2MYUA 4RK7A 4RY9A 1K66A 2LBPA 3L49A 1PUXA 1WETA 4KFCA 1ABEA 1JYEA 3A0UA 1MB3A 3C3MA 4MQEA 5IULC 1PNTA 3ROFA 3A0RB 5TQ0B 4G0MA 3SY8A 3RQIA 4RK4A 2ZWMA 3OQNA 3LUKA 2H0AA 3M9XA 4LRQA 5BQ3A 1U8TA 2CD7A 4H3HB 1NATA 4MS4B 4XARA 3OLWA 3BREA 3D8UA 1JF8A 3CZ5A 1L5YA 4LDZA 4UHJA 2E4XA 3N0RA 1JFTA 4F3TA 4YCSA 2FEKA 3DGFC 3HVRA 3M6MD 2WJWA 1JFVA 1EFAA 3LUAA 5BRAA 3T6KA 3IPCA 1SXHA 1J56A 4NQRA 3RH0A 1LBHA 4Z9AA 2A9PA 2IPLA 4JB2A 3DLBA 4S05A 1DP4A 1QNLA 2RJNA 3KLOA 4D74A 2IPAB 4EVSA 3LFTA 5KC9A 4MGEA 3DGEC 6CHYA 4NICA 3O2QB 1KRXA 3CG4A 1DBWA 2JB9A 4Q7EA 5JNUA 2HPHA 2QVGA 1GLGA 2MSWA 3MYYA 1MVOA 4GPAA 4N41A 5HM6A 1URPA 3I5AA 2NT4A 1PEYA 2OENG 3KLNA 4IMJB 1TMYA 3OO0A 4Z4EA 5TPZA 1RNLA 5JNRA 2CHFA 4YWHA 2FLKA 4YLEA 2IPNA 2PL1A 4KQ9A 4MLCA 4E7PA 4MYRA 5DGCA 2OQRA 4F8JA 2CHEA 5ABPA 2R4QA 3UUGA 2FXIA 3E3MA 2HJ9A 3BBLA 5EWLA 3OQOA 1OXBB 2PUCA 1YK0A 5B3JC 1W25A 1NY5A 1P6QA 5KQLA 5EWJB 1JL3A 3I42A 4RDCA 2FSPA 2PL9A 4ZJPA 1D1QA 3OLYA 4XASA 1FFSA 2FLWA 2MYTA 5E3JA 1USKA 1JLKA 5IUKC 1JDPA 1LK0A 3KYIB 1Z15A 4JOQA 1Z2EA 3CG0A 4JASB 2PE5A 1TJYA 2AYXA 3MQ4A 4PEVA 1YVUA 4MPTA 2IPMA 3KCNA 2MYNA 3LOPA 1JYFA 3HO1A 2F8TA 1T34A 1EHCA 1USGA 3H1FA 3H5LA 2FN8A 4Z9BA 2B1JA 4Z4IA 3GBPA 4MRMB 5JNVA 4KPYA 2N9UA 5FWYA 3LMKA 3LUFA 1DBPA 1NXWA 1SXIA 3JVDA 2QR3A 1USIA 3O2SB 1NXVA 5JS2A 4MR9A 3EGCA 2FEPA 3GRCA 2LPMA 2E4WA 3LKBA 4MR8A 3N75A 4RXTA 3JVIA 1SXGA 4QICA 4ZMRA 5FWXB 1QO0D 2E4UA 3P9YA 1FQWA 4WZZA 2GKGA 3HCWA 2PUAA 1RPJA 1B00A 1A0OA 4MS1A 4KNYA 3HUUA 3CKMA 1QQBA 2PJUA 4HNQA 1BAPA 1QP4A 3JPYA 3QLUC 4RS3A 3RVQA 3ILHA 2HQRA 1Z25A 2QU7A 3KG2A 3FFTA 3KKEA 4EUKA 3O21A 1CHNA 1APBA 4D6XA 1W9HA 3EAFA 5TPWA 4N03A 4WT7A 2E4ZA 3N0WA 2IOYA 1DCFA 1JH9A 1A04A 2E4VA 4H60A 4RK1A 3LUHA 5F64A 1QP7A 2RDMA 4G86A 3H5OA 3IPAA 4Y9TA 5EWMA 1BDIA 3C3WA 3HXMA 1YIOA 1CYEA 4OLAA 3HUTA 1U2PA 3QX8A 4RK0A 5HQJA 4MQFA 2NT3A 3KYJB 5BR1A 1YS7A 2QZJA 5CNKA 3Q7SA 4EVQA 2V0NA 1P2FA 3QEMB 3C6QA 2FKAA 4MAAA 1ZHHA 5TQ2A 4TLLB 4KV7A 1ZN2A 2FMKA 4F06A 1Z13A 3NBMA 1XHFA 3KHTA 4EYOA 5HKOA 4KREA 3LUDA 4WXEA 3KJXA 3QLUA 2PKXA 3H5IA 4H3KB 3BRQA 3RVKA 1E6MA 3A3KA 3QLVC 5BRJA 3HJFA 2WY2D 3R0JA 3NNNA 4RY0A 1F4VA 2J48A 2PAFA 1DBQA 3E61A 4ML3A 4FB4A 4RXUA 4N0PA 1JHZA 2E4YA 3VNBA 3DBIA 3EODA 4ZYLA 3RVJA 3RVMA 3DZDA 2NZVG 1RXEA 5DCLA 2A9RA 1BVHA 3G1WA 4HYEA 1ZGZA 3LUCA 3SG0A 1ISSA 2WB4A 5KQGA 2FEWB 4N76A 3CNBA 5D2CA 1JX6A 3TMYA 3H6HA 1P8AA 1R8JA 5JNWA 4YO7A 1QPZA 3GT7A 2WJAA 1DRJA 3QELB 4E7OA 1D5WA 1LJUA 4QYMA 4MS3A 1ISRA 3KSMA 4PICA 4MS1B 3QLTA 5IUJC 3G85A 1VLZA 3O74A 3CZCA 3Q7RA 1A2OA 3HDGA 1QO0A 3D02A 3QLVA 3GV0A 1QMPA 3OMXA 3FMVA 4W5QA 3OLVA 3LTEA 3NHMA 4EYGA 2W42A 8ABPA 3Q9SA 2R47A 2VK2A 1PHRA 4G97A 3B2NA 2M1ZA 5JS1A 1JDNA 4MR7A 4QPJC 4F12A 4P98A 2TMYA 4YRZA 2FN9A 2JBAA 1M2FA 4P1ZA 2DRIA 4G0OA 2MSLA 1YK1A 4XFKA 4ZPJA 4MLDA 5KQPA 4RZSA 4MQEB 4RK6A 4W5NA 2R48A 4YP9A 2JRLA 1IIBA 4LX8A 1RZRD 2QW1A 2NZUG 2NUBA 3IP9A 4KK4A 2PUGA 4YS6A 5KQMA 4RXMA 1F51E 5T7BA 3F6PA 5TQ0A 3CTPA 3RVNA 4LE1A 3NNSA 4OBBA 4KVFA 3QEKA 3UKJA 1U0SY 3EULA 5DTEA 1KRWA 2BGGA 1P6UA 3L6UA 2FTKE 2VYCA 4RWEA 3O1IC 3F6CA 1FFGA 1VRVA 4Z4CA 3Q7TA 1NXXA 4EYQA 3JS5A 4DQDA 4EY3A 3TO5A 2A9QA 1QQAA 2ID9A 1BA2A 3F7NA 4KQCA 1EWTA 2JK1A 3H1EA 5IEJA 2JCGA 4CBVA 4W5RA 1VKRA 3MF4A 3URMA 4W5TA 4Q6WA 4GNRA 3T95A 1S8NA 1YMVA 9ABPA 2FMHA 3H5WA 4OTZA 1PEAA 4XLTA 4KRFA 2Q5CA 3OMWA 4PE5B 5KC8A 1EWKA 1ZESA 1ZAYA 1YTUA 3JPWA 5KWSA 4IMIB 2ZAYA 3NHZA 3HK2A 1E2BA 4KZKA 3MA0A 3RVRA 1RXIA 1NTRA 2PMCA 1MB0A 4JP1A 5ED4A 3N8IA 1H9CA 4Q6BA 5FBHA 4G0QA 1Z2DA 3S99A 3BILA 5GOTA 4NCBA 2PUEA 4FE4A 5C5EA 1NXTA 4M88A 1GUDA 3OM1A 5EWLB 5FBKA 5TE9A 3IP7A 1QP0A 1HEYA 1ABFA 3EDCA 1ZGGA 3HSYA 3HV2A 1DZ3A 3OM0A 4JB0A 1KMIY 3FFXA 4RV5A 5CNJA 1CEYA 2RJOA 4IGAA 5IX8A 5JNTA 1Z12A 1JBEA 3LKVA 1MIHA 2H3HA 4EGSA 4PYRA 2CWDA 2HQOA 2P9HA 3TX6A 4YR7A 2L18A 2YHAA 5EWJA 3UK0A 1PNRA 2GI4A 4TLMB 1Z26A 4G0PA 2JVJA 3KS9A 4OG2A 3H75A 4W5OA 4L85A 2IYNA 4HNSA 3QX9A 1ZH2A 3IP6A 2L2QA 1AB6A 4Z0NA 1YS6A 3EJWA 2JVKA 4N47A 3Q41A 4RKRA 3HEBA 3RVSA 1D2AA 4FE7A 1ZH4A 1NXOA 4TMYA 4RK5A 2M98A 1OXKB 3N0XA 2AYZA 1TVMA 2FQWA 2WRZA 5FWYB 3VNAA 4DN6A 3C97A 1RZRA 2LUOA 5DKFA 3GWGA 4KK3A 3CFYA 4ETIA 4MR9B 4L4UA 3RVPA 4MRMA 1C0EA 1TM2A 2HQBA 3CRNA 1D4ZA 3IP5A 3RVOA 4UHKA 4MR8B 4ETNA 3QK7A 2QSJA 2FMIA 2QV0A 4YGXB 1M5UA 1DC8A 2O20A 4S04A
chains in the Genus database with same CATH superfamily
4JWTA 2PRZA 5HOQA 3L8DA 4MVJI 1NN3A 1Y9EA 4B7XA 2I9PA 3C2QA 4D8VA 4F9TA 1DAIA 1T3HA 1X80B 2DQKA 3I1IA 4E2WA 4ZTUB 2VDWA 1NJSA 4LHWA 2XXJA 5FA6A 3ZHYA 2E7ZA 1BVUA 2PTGA 4PX5A 3O0DA 4N0QA 2K4MA 5CGZA 3B8HA 1NR1A 1XJQA 3G5MA 1LK7A 1OUMA 1BHO1 1YR7A 2PKEA 2VPXA 3O4FA 3WLRA 2A1TS 4FCWA 3T3EA 2ZG6A 1W44A 3GLTA 3NYRA 5JZVA 1KY4A 2MTBA 4FFOA 2FW8A 5JG7A 3GUZA 1N9KA 3GNTA 3ICPA 4XIFA 1XAJA 3DMDA 1OI3A 4BE4A 4I50A 2WI8A 3BSWA 1A4XA 2PVSA 4C4RA 4DW8A 1Q7RA 3W9SA 2IH5A 1E2HA 2RCYA 3ONEA 4NMMA 3SD7A 3QFFA 2DAPA 1Q2XA 2I6TA 1H42A 3PITA 1KE1A 3T7CA 2NNWB 1W29A 3JR3A 3M4ZA 3THOA 4FMCB 4TQ9A 1J0XO 3VAAA 1D04A 2P9JA 4O2BA 4C0KA 5A06A 1Z35A 5JASA 3B1FA 4G9GA 1V11B 5E1BA 1TGYA 2AN1A 3TQRA 2AC4A 2P3SA 4CEIA 3REQA 3WLJA 1T6BY 5TQ2B 2GK4A 3BXOA 4MWBA 1YI1A 3GPDG 4XA8A 5AQ1A 4LK2A 4BNZA 1G6OA 3OPVA 1O6ZA 5DNAA 5KI6A 5KQRA 4C89A 2OGZA 4D45A 1KGSA 3UT6A 1Z0ZA 5M5BA 2REQA 1A9XB 4RCZA 2AKEA 1LW6E 5FOSA 5B1IA 5CA0F 1GYQA 5A6SA 2VVTA 1JDBB 2X0FA 3GOQA 1H6AA 2AJDA 3L4BA 3RSZA 2H65A 4KMRA 2XVAA 3E4CA 3HFJA 1QF6A 2QUAA 3T3IA 2CKMA 4IX1A 5BSUA 3OZAA 1A69A 1W2HA 4XQ0A 2BR5A 1SB9A 3VR6A 3ZYZA 4AMVA 5CA0B 3HJNA 5AW9A 4D6PA 2IYLD 1ECLA 2RBKA 2ZFUA 1C9KA 1GITA 1J8YF 1YR8A 2BI4A 4UBJA 3N2EA 4Q66C 3BS4A 3SICE 3TPZA 1N8SA 4RE6A 1P7PA 4GL4A 3GVIA 1IRXA 1NBEA 4H1UA 5EXSA 2FV8A 2PY6A 2D3TA 3SJCA 4IEEA 5KTSA 4X85A 3WO0A 1FSPA 3H9UA 1HYGA 4F4CA 1CQJB 1KMHB 2ZYRA 5DIZA 3RHSA 2EWWA 4YDRA 5JJBA 2O8FB 1SKAA 3QPWA 4LYEA 4MS3B 5JJCA 1OZ0A 3O5AA 1U7TA 4HRVA 1I1NA 5T3YA 1Q22A 2FPLA 3BGSA 4KLRA 4LHEA 4XRRA 5FA8A 2C5LA 3C8DA 3WS7A 2GK3A 4XPIB 1PJ3A 1W6UA 3R3WA 5AI6A 3W6OA 4W82A 4WRRA 3LDFA 2VQFB 1HQCA 1KZ1A 3CUYA 5GJCA 2W37A 4OQMA 3DONA 4LC0A 2QGNA 2N1BA 1BQEA 3K4HA 4QBFA 5FTJA 4ZYWA 1Z3CA 4RM3A 1UT8A 2X86A 3CISA 1Q7EA 4Q9DA 4NV0A 5DBFA 3T9CA 3BE6A 4EUNA 4TYQA 4YV1A 1CY0A 3MFYA 1M2GA 4EOGA 1YRAA 4YRLA 4ZDKA 2I4NA 2ATXA 1O1YA 1G20A 4PYIA 3KZMA 1I01A 2JAPA 5AHWA 7GPBA 5CJJA 3VKWA 4R9SA 2YICA 4LHVA 1QDUA 4BVEA 4QPDA 3FTDA 4IJVA 1JLHA 2WSIA 2IWHA 4JX8A 3OE7D 4EW6A 1EXNA 3GGPA 3ROFA 5JMOA 2JIMA 3IDFA 4ZI2A 4Q15A 2XRYA 3GT3A 4BDTA 1D9ZA 4MJLA 5EXPA 5TS3A 2XQKA 2IUYA 3AL3A 3BH6A 4L57A 2C2YA 4FMPA 4AZ3A 1UDXA 4H3VA 1L6IA 1R4NA 3UW3A 2BF7A 2J7PA 4HH4A 1L1QA 3UG7A 2XCSB 3G13A 5DYIA 4OP3A 3RFCA 5D84A 5LQMA 1ECGA 3LZ6A 1YE5A 3I58A 5A04A 2GHRA 1DT5A 4M7RA 5A7FA 4RLSA 4EHJA 4NFHA 3LHKA 2PH7A 2WABA 1QZTA 4W7SA 3K70C 5HCNA 4XR9A 1DG1G 2X0RA 2GF2A 3PNLA 4YO8A 1T35A 5LQNA 1NRJB 4ZO8A 3DZKA 1PR4A 3M6XA 4OYRA 4C7MA 5ERGB 1YUMA 3HJTA 5BWCA 3UT5A 2Q6OA 2DY1A 2OR3A 5LIRA 3O2QB 3U4QA 4PLHA 4DLVA 1Q92A 5AOCA 1DADA 1MT3A 3ET4A 1M1YB 2B7BA 1OT3A 2QVGA 3EEIA 1CP2A 1KH1A 2C4UA 3FD8A 3SHVA 4COOA 4M0PA 1N6IA 5K3DA 1QG4A 1W2WB 4N5HX 1DRWA 2V4MA 4PPGA 2AFIA 4UD2A 1KPHA 2F3SA 1MDBA 1TEXA 1H6DA 4E5SA 4JQZA 5B1DA 2EFEB 3IOMA 1DBIA 4ZYZA 1SQ0A 3STTA 3VR3D 2ZYTX 2VHCA 4CR7A 1NWCA 2VK4A 3P9ZA 1QRDA 5B1YA 1FC0A 1BXGB 3V8RA 1XCOA 1MV8A 3MTEA 1Z8FA 1P1RA 1W25A 2GD2A 1XU7A 3JATA 4GXRA 5I9IA 3S81A 4EG0A 1CBUA 4XGKA 3TSYA 1OIWA 4M6WB 2TMKA 1JHDA 4TV9B 4H18A 1QRAA 1QGOA 4RDCA 1N5KA 3T7IA 5HG0A 3VHLB 2EFHB 3W77A 5K0ZA 2ZRIA 4JENA 1I3KA 3RG2A 4N1AA 5IVDA 1XRLA 1JLKA 4IGEA 3V8EA 5AVSA 3ADCA 2O2SA 4NOKA 5JZOA 3SYNA 3HVIA 1Q20A 5B58T 1L9XA 5A03A 4PAMA 2G36A 2PE5A 1FFAA 5TF4A 5HUHA 3QEJA 2NGRA 4KTVE 3EYAA 3BVPA 5I7SA 2IYRA 4Z1OA 2E18A 3AU9A 4G8CA 1TLTA 4A36A 3AUSA 4X71A 3TNDA 4V2UA 2MWMA 4BL5A 4QTTB 4DEYA 3VGJA 1EI9A 2R9VA 2X8BA 1LC0A 2Y9MB 2I03A 5JZMA 1R4NB 1BS1A 2Q7XA 5AIAA 3ZBUA 5C3UA 1GRCA 3K2EA 4MRMB 4KPYA 4YBZA 3A9WA 4TQUS 3RWBA 4JCCA 5L9AA 3VDNB 1SXIA 1XTUA 4WOPA 3WTCA 3ISVA 5JS2A 3P9PA 4XCVA 1REQA 2DWCA 1A82A 1C8KA 3ABIA 4P82A 4B80A 1RJWA 2A33A 1OQAA 4OQXA 3ZGVA 4JGIA 2QMZA 3THSA 4HN2A 4OH1A 1AGRA 1QVVA 2Y68A 3N75A 4K03A 1XD2B 4S2UA 3T0FA 5HJEA 2O8CB 2WFLB 2FEMA 2Z2ZA 4WNCA 5DSXA 2NUAA 1U0FA 2G4LA 4RV4A 3UUWA 5BXQC 5H7XA 4DV3B 2ETVA 2MSEB 3ESDA 3O2NA 1S89A 3BXZA 4JUBA 3LYHA 3DV9A 4F3YA 3L0DA 2WAAA 4R05A 1QVRA 2IU4A 1XIVA 3RVQA 1HDOA 2PCLA 4IIVA 4F6RA 1CB7A 3ILHA 2AKYA 4FT2A 3F2VA 1ZZGA 1V2GA 4KGDA 1NRXA 3GA7A 1RLTA 1K9SA 1Z0AA 1NJ6A 1I51A 5LQKA 1R9GA 4N5IX 1C2YA 1IAQA 3ZE0B 4HAUA 2BBSA 1MGOA 2FZLA 2Q6LA 4Y2YA 5EP4A 4C5BA 5J4YA 2NUPA 2O3SA 3LUHA 4G1MB 4G86A 2XOXA 3EW9A 3NALA 2IV3A 1P1BA 2D2FA 2EYQA 4GZ6A 1KDTA 5FBQB 4XB6B 3FYCA 4ZPXA 3FMFA 1FDIA 1PDWA 2JPDA 3NH6A 4KI0A 2BCEA 1PJ4A 3F1LA 4LMAA 2WF5A 4X3PA 3KPYA 2C0CA 4DPKA 3Q7SA 3RODA 1OX6A 1E7MA 4H4DA 1VB3A 1K9VF 3GFFA 1XSEA 1AZWA 3ID6C 2ZDQA 5U4XA 3WNCA 5DI9A 4PONA 3EXAA 2PDAA 4IOJA 3UBMA 4DDKA 2ZI6A 1HE2A 5FV4A 4AJIA 3QMMA 2AR9A 2QTNA 2J33A 1HEIA 1E89A 3A26A 1M0WA 2WD7A 3M6IA 3N5KA 4AX4A 1U0BB 3DBRA 4M9ZA 2XB4A 4WBSA 5EERA 1B43A 2IXBA 3G8AA 1SXJA 2PKXA 2CE7A 1CHDA 3D59A 3QLUA 2E6KA 3QQPA 1K8QA 221PA 2NLOA 2VATA 4PLPA 3L07A 5E4FA 3NORA 5EY5B 1VMEA 5DV9A 3IOEA 1EFHA 1H1LA 2O2HA 1SUCA 2R2AA 3GLKA 3Q3VA 3SJ7A 5EUCA 4BQFA 3H05A 3LGAA 3LWZA 4QFDA 3N86A 4F3CA 4WZBB 2BGMA 4LNHA 2ECQA 3I5UA 2O23A 3NV9A 4XM0A 5BVHB 2PXCA 3SR4A 2JS7A 3O4GA 5A7HA 2ZANA 1Z75A 1U8ZA 2QJFA 3P2IA 4WX2B 3RVJA 4RVNA 1W581 2C5EA 2NZWA 1OH6A 3ZU4A 4LISA 3EPRA 5IFLA 1WQ3A 5GZ6A 1VXOA 3TR5A 5DHQA 3X1KA 1SKQA 1MJGA 2X15A 2CZCA 3JWEA 4K9PA 5GV7A 3A14A 3UHAA 2CLCX 2ZE8A 3F4KA 4RH1A 3KL4A 4BX2A 5CD9A 4N76A 1ZD1A 1GV1A 2CCJA 2C84A 3QELB 2H4FA 4FINA 2ZJOA 4B75A 2QRJA 2EXXA 2WTMA 1QCDA 2WJGA 5IXYA 1ORTA 4LTNA 1ACJA 1JSCA 1Y8RA 5B3KA 2CJPA 4JFRA 1BFUA 4RAQA 2GPYA 1ZL0A 4ZCTA 1GSIA 2IIQA 5IC4A 2R6ZA 4L07A 2QIOA 4MCHA 1O2DA 3R20A 4OK3A 3PWZA 4HQLA 1JWBB 1T24A 2EG9A 2HY7A 3AIMA 1W8IA 3FPGA 2KQUA 4FQ8A 4KO2S 2Y92A 4P5PA 3W8NA 1BDBA 3VH2A 1F06A 3ZNPA 3NYQA 4D7AA 5CBKA 1Y89A 2RD2A 2PEZA 2PO5A 1KFKB 3S44A 5AK3A 4RGQA 3B2NA 4U7PB 2R1ZA 5B3LA 4MGHA 2OESA 3DLCA 3VYTB 4J9VA 4J7AA 1MU0A 4I4TF 3A6ZA 3BMOA 5DWVA 3M4XA 4EEZA 1T36A 3KQQA 3KJEA 5DHRA 4LI3X 4PZUA 4CTJA 5ER9A 4XFKA 3FSEA 2Z04A 3K0KA 1O96B 2E87A 3ITNA 4RZSA 4W9MC 1SHZA 1YZHA 2ZB2A 3VTKA 3M6AA 1T43A 5IN5A 3I2IA 3MTIA 4RA9A 3C41J 4N3GA 4H6XA 2Q7DA 1NQUA 2AXQA 4M8LA 4LNUA 4ASUA 3PFWO 3WVNA 3IMEA 3OP4A 4CHGA 3LBNA 3HDJA 1VP9A 3B5IA 2I3BA 4ND2A 5F1YA 4CQLB 1YV9A 1DINA 1W35A 1ZN9A 1VL1A 1VYHA 2R6CA 3QF4A 5CIWA 4BNTA 3NDJA 5JD4A 1KK1A 3DBRB 2AIRA 2BGGA 1P6UA 2CLLB 1KZYC 2D00A 3DLPX 3LUPA 3PNYA 3F8SA 4FI3F 1E1NA 2DETA 4DA7A 4EJ0A 2A1UA 4M2LA 2FWJA 2Q2VA 5IG2A 1WXXA 4NZPA 1U9ZA 2AA3A 3H2JA 1JHXA 1L4UA 1ZCJA 2BM9A 3BA6A 3WGVA 2J5RA 2Y1EA 1SC1A 3FIUA 2BM0A 3BULA 1V6CA 1HURA 2FPSA 3AB8A 4LCJA 3BE8A 1KEWA 1SEVA 4RPJA 2P2NA 1K8YB 3BC1A 5HK8A 1NYRA 3OD1A 4UNIA 3AV3A 2G77B 3PF9A 3U62A 2JCYA 4RSHA 1BCSB 4TTSA 5D3QA 1KK0A 5EYPA 1EIWA 3PGKA 4KX3A 3U31A 1KKMA 3M49A 1R6XA 2VYVA 4KZKA 4OHOA 1IH8A 5ITZA 1YFJA 4GGPA 3W8RA 3DKKA 3GELA 3HRHA 1TAUA 2D4HA 1SCUB 3WL6A 1I6LA 4JT2A 4BGDA 2A0YA 4D9BA 3CKLA 3ELYA 1YL5A 4GDFA 2FSIA 2QRVB 1QO7A 3HNPA 1SEPA 2BKUA 2XPCA 3E48A 3KJQA 1GUDA 2GQ0A 5J5CA 5SV2A 3U1TA 3RFFA 5A1TA 3BOSA 4R2WA 3RU9A 3UWPA 4AT1A 2HZBA 1ES9A 5ENDA 4F3KA 4J0FA 3N0VA 1KJIA 3EUWA 3PQEA 2F3TA 4XDHA 1I32A 4I08A 3FYUC 5IVIA 1YGYA 1NBWB 3RIEA 3H4TA 1XTSA 1YHNA 4L3WA 4QKQA 1KVSA 3TOZA 4DLNA 4G23A 1YQGA 2XMDA 4HDAA 1IBCA 3KELA 2G3YA 4I9GA 2RHJA 5KTPA 4W5JA 3BHIA 4NE2A 3F0TA 3K8OE 2X19A 4RA9B 5JRJA 4JT8A 4P92A 2C94A 1TQHA 2CXUA 4UTPA 4LNUB 2JVKA 3E9EA 4N47A 4I3FA 3G89A 4BN0A 3MT0A 1T8UA 3PLNA 5JC1A 1AHIA 5EPUA 2G04A 1ULUA 3RE1A 2KW5A 1JH8A 1OXKB 3AEXA 3VUFA 3UMFA 4FKZA 1CERA 2JFPA 4OEHA 1YAJA 3C3EA 4NX2A 2C2OA 1T9BA 1FYWA 5DKFA 4O8CA 1HETA 2VF4X 1ORWA 1SHTX 3RBVA 4L4UA 5CPFA 2R1TA 1UMCB 2EJUA 4FX2A 1WXFA 3VMFA 2P8JA 4JLOA 3NBUA 4XUCA 3S70A 3AXTA 2F48A 3N2KA 2IX9A 2JBHA 4DCPA 4OUDA 1LA2A 1TU4A 1W48A 3MAGA 5B2ZA 5HF5A 1ZJYA 4BMSA 3ILSA 2FCAA 3IBCA 2IF2A 3BJZA 5FWXA 4B0OA 5A5VA 3J7AC 3RAJA 2W6JA 2P9YA 3ND7A 5FBRB 1P4GA 2ZJFA 4RHFA 4JSRA 4BLRA 3P9QA 4K9DA 3NUGA 5F78A 4IICA 2I3GA 4CF3A 1FDRA 1G4UR 2QA5A 1ZGCA 3P2MA 1SKMA 3RHFA 2FVYA 1E61A 3WQHA 2VP3A 3ZW8A 1ZVQA 3P7MA 3KNZA 1J0BA 4NZ9A 1TW3A 5DEOA 1TVKA 4LJRA 1J22A 3PPVA 1ZK0A 1MRSA 4H7KA 1SC4A 3HSSA 3JTEA 1QV9A 1PR6A 1PZFA 3E3OA 1T1JA 2GD6A 2XF2A 3A10A 1UQRA 2VJBA 3QKWA 3R1IA 3EVFA 1K8XB 5LQDA 1Z7YA 1FFXB 3NVKI 3A70A 2VSXA 1GQYA 2ZP1A 2C58A 2IHZA 1Z6TA 3OQIA 5EZYB 5L3RA 2PIAA 2EZUA 2QAGA 3PGLA 1IEXA 3RYIB 4NMHA 1KWGA 2PQMA 1P33A 2R7MA 3O1JC 1N77A 4AULA 1DB3A 1U1EA 1ZA1A 2DLNA 2JARA 3D81A 5I7UA 3PNOA 4YI5A 1FQKA 1UFOA 1DCKA 4NMWA 2E49A 3MBOA 1OAOC 4MVCA 4ZK6A 1TCBA 3G8CA 4I19A 5I3ZA 2HADA 2IP2A 2Q4EA 5K6AC 4C4TA 2K7FA 4V1CB 2C5FA 2W83A 1NDQA 3L8ZA 3AV0B 3IMFA 3U4GA 4EBFA 2JFBA 3AUTA 3F90A 1E5QA 5FTMA 3HVJA 1FNNA 3IXLA 3KWJA 5CP8A 4MEAA 3V1LA 4D98A 4WL0A 3VV2A 4DMLA 2J4CA 2J3QA 4I4NA 4WECA 3IR5A 4MGZR 1K7EB 5LQRA 5TGDA 4KYTA 4JI5B 1FVOA 1FYXA 1JYSA 3IFSA 4PO8A 4DY4A 4ETMA 5CXQA 3DMTA 2PGDA 2AQKA 4G1VA 4LFCB 2KWIA 2P2GA 2VPYA 3O6VA 4GMXA 1L7BA 2A0KA 1AV6A 4LFBB 3LBFA 3O3MB 2JGEA 1C7RA 2G9NA 3L02A 1PYGA 1ZD8A 1P5ZB 1XMSA 2CDCA 2H9AA 1KF0A 1TZJA 2DZDA 3N2KB 1MHTA 1XBTA 3WGZA 2CV0A 4J0EA 2P4UA 2ZAMA 1NAIA 1D7AA 2H16A 1H2WA 4Z4GA 2PYDA 2DY0A 4M9SA 2HCRA 2ID4A 1V96A 1K68A 3JYLA 3F7TA 1KI1A 1JLMA 2Z5GA 3M83A 1EZZA 4JL5A 1H94A 3M4NA 2XCRB 3WC4A 3WJAA 1N2CB 1E5TA 2Q5QA 3R3JA 4ZFNA 4BMOB 3I9NA 3H8SA 3NRCA 4YAUA 4YPFA 4J9UE 5FF9A 4D02A 4YMHA 1NN1A 4Q7QA 1KI6A 1P5FA 3O84A 1AVTA 3TR6A 2TSYB 3NT2A 2P4SA 4CFSA 4PZEA 1TFUA 2GWRA 3SOPA 3OQVA 5G3YA 1HDXA 1IJKA 1AB5A 3MYRA 1UBMS 1DG9A 1TM1E 2CLOB 2OCLA 3OIGA 4KSCA 3GR6A 3R3XA 4RIGA 2JCXA 2ONZA 1FTWA 1D0IA 1RRPA 1K5GA 2ON6A 1GPAA 3FZQA 3QI2A 5EVCA 4EB6A 3PQDA 4M7OA 4ABTA 3GL9A 4X6YA 3EE6A 5LNK6 2PGNA 1Z17A 1HLDA 1KA9H 2GD0A 3NAMA 4HQKA 3ZOZA 2EC5A 3TZQA 1G6HA 2X3YA 3X2SA 4E0BA 2WZCA 3T9BA 2FX3A 3OC6A 3X1XA 3L8HA 1AQ6A 4K9OA 1T25A 2YMLA 3L49A 4LWPA 2XA9A 2RI0A 4KFCA 4YR9A 4ZV7A 1F14A 2PBRA 4NBWA 2IIPA 1IZ9A 4DR7B 1HLFA 2WJZB 2XB6A 4DA0A 3K9QO 1PK9A 4KR7A 4NH0A 4TYPA 4BVAA 3K0AB 2WPDA 2K2QB 1WU8A 1L8OA 3O03A 1DX9A 1ZVJA 1U0GA 4GOND 5JC8A 2NO7A 4BVGA 1SK8A 2V6FA 1U8TA 2CD7A 1WDLA 3KVYA 1B2LA 2OLKA 4DIBA 4I9NA 3FUWA 2ONCA 4KHZA 5E2AA 1KFBB 1N34B 4OQEA 3TUJC 2OBFA 1U7OA 3WQQA 4YRQA 5IBPA 4YCSA 3PFFA 4RMNA 1VL6A 5LYYA 4RFVA 4FWIB 4KQEA 1NC3A 2QXTA 1GNLA 2CLKB 1T0UA 2HJGA 4TS1A 3T6KA 7REQA 1DAOA 2Q9AA 5JMWA 1Q83A 5BUZA 2FP3A 1BROA 2QK4A 4HF7A 1MC5A 3WI7A 1KWKA 4HDSA 1PR1A 1CV2A 1GNRA 3K9WA 2IPAB 2WKWA 4N18A 2EJBA 4K86A 1B8OA 4RVOA 4B6OA 3EQ7A 4EKGA 5HM8A 3COPA 4ZOQI 4N41A 1S01A 4RH0A 1CZUA 3V46A 4YXWA 1XKTA 3GIDA 5EMJA 2H0RA 5KWVA 1JMYA 3T7SA 1S8AA 2Y1KA 2Q9BA 5ENZA 2HGZA 2N1MA 1DXYA 4TS3A 5JNRA 5DGIA 4P0TA 4ZEVA 2LCQA 2C2HA 2X9GA 4BRZA 1TM4E 3HA5A 3ADDA 3UUGA 2QOEA 3I3OA 1RC1A 2P27A 1YQQA 3D4NA 3MJTA 2OYSA 1YBAA 2C4KA 4L9SA 5BOVA 3FG9A 1JBQA 1PT6A 2CEAA 3LXRA 5ARBA 5B3JC 5I8WA 3IPYA 4IOMA 3RC1A 3HL4A 1OPRA 1XA4A 3USZA 1GG9A 4ER6A 3LLCA 5BV2P 4FLFA 1H5UA 2F62A 2D1YA 1SK9A 3KPWA 2WR8A 5C8XA 3CY6A 1KI4A 4HWKA 4L8VA 2OZLA 3D6NB 4QU0A 5KTTA 3IE0A 2JFVA 4HLUA 1PX2A 1HNXB 1PUIA 1XQVA 4PINA 4TXLA 3UAWA 1ESEA 2RGCA 4OHKA 5LZ9A 3TDKA 4AN1A 3ZHCA 1KOGA 3BDVA 3P0JA 2ORVA 1CF9A 4GIBA 2XQVA 3LRXA 1IOVA 1COZA 4UE6A 2GRAA 1NVTA 1USGA 5K4HA 1SG0A 1ORIA 2ZE5A 1T4MA 2MMCA 4H7IA 4LFAB 1LLFA 4B8WA 3GZ4A 2OCYC 3BHMA 1J0CA 3PIDA 4Q0MA 1DPGA 1VC2A 5LBIA 3TIIA 4YYEA 4B2PA 1Z5PA 5BSHA 1N2XA 3AUAA 1QIFA 1DOAA 1N0HA 2Z3ZA 4KITB 2WWGA 1EH5A 5KQSA 2FEPA 2NOAA 1OLSB 1E58A 1AIPA 2P9GA 2PD6A 3OIDA 4DUPA 1ZHOA 3R6TA 4UHEA 1J09A 1UC5B 1KR2A 4MR8A 4IHKA 1E79A 4QGHA 3PFNA 2FZEA 4MI1A 5IANA 3EQ6A 1O5IA 3NM4A 4ARZA 5TSDA 2NZJA 1P2GA 1A76A 1J2RA 5CDGA 3HCWA 4FU0A 2A30A 2WZBA 2YHUA 3PYXA 4O4LF 5FR1A 1RJDA 4LF9B 3AETB 1E3WB 1Q19A 2PR7A 3KT3A 4FHDA 3ZHBA 3IKTA 1ZX1A 3BTSA 4QOHA 3O9MA 3I8SA 4KXWA 2Q3BA 1P6XA 5AXDA 1X1DA 4Q93A 2B83A 2M32A 4MYHA 4X8MA 4Q4CA 4BBJA 3KHUA 4FI3C 3KJZA 2JI9A 3L6CA 4K5QA 4MW1A 5DBIA 1U1CA 1KY2A 5IBRA 2F4VB 1FK8A 1XVLA 3TTTA 1VL0A 4Y2QA 1OHHA 5D1NA 1T4BA 2ONJA 4DQXA 5AW3A 2YHSA 4FUQA 4GI1A 3QBVA 1ZNWA 3VTAA 1KZ9A 1SZDA 1BRMA 1U3DA 1L7MA 3EXHA 2JJYA 4YMSA 1QZUA 3DE2X 4RK0A 5HQJA 3DTVD 4YAEA 5BR4A 2G82A 1D03A 2JIZA 2XE8A 3OY7A 3QNMA 4MMZB 3PJFA 1DRUA 1KMMA 1RXSA 3OICA 1T4CB 3DZFA 5EEHA 1A2BA 2YV5A 4JR1A 1NHGA 4R9NA 3MGAA 3V1TC 4K6GA 3SYLA 3VUEA 2ZXUA 1GNSA 2GHTA 4J6FA 1BG6A 3FYHA 3WGKA 5ES4B 2FMKA 5HS4A 4F06A 1G17A 3PRJA 4O4JF 4ALNA 4A0HA 2AX3A 4RGVA 1V9SA 3AYXB 1N6PA 4R0MA 4W1RA 2ZT7A 3FWHA 1XG5A 4BNKA 3R0JA 1R6AA 4Y2GA 3NNNA 1E9CA 2O7NA 5P8WA 4HQNA 3FLMA 4Y2JA 3ACBA 4Q00A 3UEOA 5CFOA 1EFVB 2H4JA 4FM9A 1CXZA 1HV8A 3EGDB 4U9IS 5ALPA 4QPNA 2VLIA 1P0IA 3D5TA 4OHWA 4PSCA 3LE8A 4PTLA 1L3IA 2PX2A 3TTUA 1HL3A 2G80A 1SC6A 5IJ0B 5A9SB 3U56A 3RANA 3GLIA 1G2PA 4R6WA 1N2GA 1WLYA 4MTLA 3OF5A 2ORIA 1S1MA 3I64A 4FQ5A 5EMMA 5T4BA 5KNDA 3GFVA 4NZNA 3T3MB 2Z3WA 2WD8A 4AF8A 5D2CA 3WRYC 4EZIA 5JNWA 3PUYA 1KYVA 4EI7A 2AUMA 1B6SA 4GGMX 4R2XA 3IELA 5HZHA 4YC7A 2ZULA 3GDOA 1YJCA 3INYA 4RKWA 1STOA 4CMBA 2RKBA 4UM7A 5JLJA 4W8GA 4DR3B 1QF9A 2H5JA 1AX9A 1I2CA 3G85A 1Y6RA 4XDYA 4CFZA 5EP1A 2VP2A 3L5OA 1NNEA 1OLXB 1MKYA 1GXSB 1B23P 3ZY2A 4FOOA 1BU8A 3D8TA 3KT8A 5J40A 5B2EA 2FK7A 3VVMA 3HL0A 2TMDA 5F77A 3KYDA 5DJ5A 1RYDA 5B53A 1Y8QA 2CVHA 3P2OA 1VRCA 3PE3A 1PZNA 2M1ZA 5DM70 1JDNA 1L7DA 4UXHA 3TW6A 1AQNA 4N54A 4RNDB 2ZYHA 2X14A 5E3IA 4JYZA 4U8HA 3A9VA 4G0OA 3D9QX 3EXHB 4L7VA 3W0LB 1P3Y1 3NEJA 4C7OB 4PN7A 2GXSA 1RM0A 4F7WA 4U7JA 1T8RA 4GWLA 5IBCA 2NUBA 1UKAA 1WZEA 2B8EA 4XZ3A 2DE0X 1C7IA 4EHLA 2B8TA 1J7JA 2HHCA 1JXOA 2AZDA 1EVQA 1FUUA 1Q3KA 3FI9A 4QHYA 2EZTA 3WQRA 4AMGA 5JH7A 1XCJA 4J0HA 1XPRA 3IT0A 2VZEA 2AJ8A 3D0RA 4C5CA 1ZOLA 3C5CA 4XQGA 5D3MA 5IRCD 1VSUA 4L76A 3MT7A 4HTFA 5AK0A 1U2ZA 2XUDA 3F6CA 2YVQA 3GJ6A 3NVAA 3GDWA 3Q6MA 1AU9A 4JUAA 4Q3BA 2B35A 2AFVA 2QX9A 3GFRA 2WJ6A 3PTZA 4CG3A 5BNZA 5AW2A 1OBHA 2NACA 1EK2A 1Y9AA 3LD9A 5CVUA 2P91A 2GETA 3NVMB 1IOWA 1Y9JA 3MF4A 2VO1A 1ZRSA 2QD1A 3MW8A 3A8TA 4L4RA 4D1YA 1XXHB 3JVUA 3TQOA 1FP4A 1KRHA 3U44B 3MRTA 1M10A 1BW9A 2D7CA 1YR9A 2C2WA 4HXYA 3WIDA 3JQ9A 4K6CA 2JI8A 3DM9B 5BQXA 1O8CA 2JLQA 4TTVA 2JD0A 2JJ1D 4CRWB 3JZDA 1WV1A 1HYQA 3PXUA 4ZYXA 2JGDA 3CH6A 1EG2A 3OT1B 1Q44A 4V3CA 4Y7CA 4GSLA 3WAKA 2WHQA 3AI2A 3JRNA 3MUNA 3AWDA 5M3BA 2HOQA 3B5EA 1GDTA 3N8IA 4C0XA 5J2TF 2Q8NA 2XWPA 3TSZA 3CB2A 5KIAA 4C0JA 4TXHA 4UQOA 1DO2A 3D3JA 4G3XA 3OM1A 3INTA 1RYFA 3OFVA 3IOBA 4OGKA 2JFXA 2FR1A 4EY7A 2JGJA 3E7WA 3TLAA 3CZMA 3HV2A 3IPXA 3U0BA 2GSDA 2DC1A 2FEAA 2WZDA 3OBBA 4C76A 3BORA 1K2WA 4RELA 4CUJA 2PX0A 4EHKA 3T4XA 1V4BA 2R00A 2HHJA 1ZICA 1C3VA 1LX7A 4LZWA 3ZNQA 3RRXA 3O47A 1LF5A 3EZXA 3F49S 3P2KA 1IZ8A 4UCXA 1OFHA 1PE0A 1YGPA 2H3HA 1L5HB 1M66A 2RIPA 4YR7A 1N6HA 3AESB 4HI0E 1P9NA 1DJLA 1E7WA 1CQZA 3VDRA 3K2QA 4E3WA 1C30B 2XDQA 1SRQA 3PQ4A 3C6YA 2GA8A 3OJXA 1TC2A 4E33A 5FPKA 2WQ6A 4ITRC 4OG2A 1JGTA 4PHFA 4XH9B 3W3ZB 4ER0A 4B83A 1OA1A 1T0IA 1GT91 1U0JA 4BZZA 5HRAA 3IAUA 3ODPA 5ALOA 2V58A 1MTOA 5A02A 2CNNA 3F6EX 3H7AA 4URWR 3W3AH 2PKQP 1UADA 4FE7A 2JFFA 1IPFA 1DG3A 5TJHA 5LCXA 4RJTA 2DJIA 3F3YA 5B37A 4BS9A 1UMDB 4ZCIA 5BSEA 1E2JA 4RK5A 4AN4A 1ETUA 3BHNA 4TTPA 2FQWA 2YIMA 1KIAA 2AOUB 1QG0A 4URFA 3E8XA 4DARA 4PZDA 3CEJA 4OGLA 4B4WA 5ES3A 4NJEB 2VJCA 1Z62A 2JH3A 2XH8A 1SBNE 1O7JA 1UMKA 3CMMA 3H99A 5GM1A 4CQJA 1F12A 2Z6VA 1Y48E 1YRBA 2JCVA 2RH5A 2GZ3A 3OIVA 2AFHB 3IULA 2H4YA 3CZQA 3OIYA 4KBFA 4LBVA 2B6HA 2H0QA 2FMIA 3DL0A 4H7DA 4ECEA 2CUKA 1MLDA 5FDFA 2C5HA 3W3AD 1W2GA 5FTKA 2R85A 4IXMA 2J9YB 4P34A 4C2UA 3M1IA 4PYNA 3TPFA 4CL3A 3C5HA 2FZCA 4J1SA 4HQ6A 1L7PA 1SVOA 3F71A 2MSKA 2GASA 4XI9A 4QPZA 3V97A 3GH3A 3RPEA 1PZHA 1TLLA 3TAXA 1BWQA 2CNKA 1G8JA 4AUMA 3L04A 5CK4A 1RKQA 5TPWB 3G8DA 3QPCA 1UZAA 4GR9A 4QYIB 5FTNA 3B9PA 1Z18A 1Z2AA 1Z34A 1U8FO 3LUJA 5CM9C 1ZNYA 2JJQA 4NCXA 5MGNA 4MVJH 3TE6A 1AXGA 4IEIA 3KSDO 1EEXB 5AVJA 4TKUA 5KKAA 2YWEA 2XF8A 2Q5OA 2OUKA 3LL7A 5FPYA 3MS2A 3N2YA 1OBOA 1ZDMA 5IDQA 4X1IB 1XZEA 3ME5A 4IWNA 4NOJA 3U3RA 4KDEA 5JR3A 3WG9A 4CUZA 4OSPA 2AXNA 2ZT6A 2HBZA 1EFKA 1QHEA 2OB1A 3NIGB 3RUFA 1ZGHA 1AUPA 1FDVA 5DP1A 5FHQA 3G2OA 3UHJA 3G1TA 3KJHA 3OZIA 4ZEWA 1KOLA 3IKVA 4MVJD 5AKYA 1BD3A 3JQCA 1HA3A 3QNUA 4HQFA 4LQ4A 2ZAGA 5HGJA 3V8VA 3ZWMA 3C5WP 3PVCA 4ATNA 4XWWA 3ZK9A 3UC9A 1GTZA 1BEEA 1DIHA 1KAQA 1G16A 1P2SA 5AJUA 3DAPA 3DCJA 4N6OA 2PAAA 5FUXA 4CV3A 1AQYA 2QW0X 4OGGA 1GT6A 3ML1A 1C80A 2D1QA 5T57A 3RSGA 4IM7A 2VCHA 2W93A 2MHCA 2E85A 1F38A 3P9NA 2VRNA 5K8IA 3N8DA 3FHTA 4UCWA 3LLSA 4P4UA 2O8EB 2PKCA 3HH8A 3NUQA 1C1HA 1SRRA 2GHIA 1W5FA 2OV1A 3BMQA 1TEHA 2IP4A 2WW8A 3BM5A 4WBXC 4KN5A 4UC0A 4ZVSA 5A9TA 2NPFA 2QTRA 3ZLTA 3FXAA 4LZJA 1U3GA 2PV0A 2Q45A 3QKIA 1FU7A 3W6NA 3QMVA 2FFQA 3A1DA 3B6ZA 3HM2A 4LPSA 2VR1A 1IY1A 4RMHA 2WVJA 2GLXA 1UC9A 2B25A 1YMQA 1XALA 5EKTA 4BO4A 2AD5A 4EHBA 2ZRGA 3SM9A 1IEQA 1R66A 1O6GA 3ZHZA 2ABWA 2ID8A 1ZW1A 3G02A 3LXMA 3V33A 4UD6A 3WIVA 3EF1A 3IVGA 1E2GA 2F8LA 4JBHA 3QE9Y 1JG1A 2AMVA 2JLVA 1L5MA 2H2WA 1UJNA 3C3JA 2QUHA 5E9QA 2Q3DA 4DCJA 1GPBA 1C0LA 4NYMQ 4BATA 1H2RS 5AW7A 3HCFA 3HKDB 2KBFA 3KKMA 3PHIA 5E6RA 1YVPA 1QPGA 3DAYA 3F3KA 3OX1A 3KB2A 1Z6ZA 4U0KA 2WU8A 4I66A 3ST7A 3VX4A 2ODEA 4HGYA 1Y3DE 4MV0A 1DEAA 1YL7A 1II0A 4XVRA 5DBOA 3QE3A 5THQA 2MYUA 4FLEA 3GD5A 2KE5A 2FG5A 3M6LA 1TADA 4RY9A 4LY6A 4P5DA 4XVHA 4BNNA 5THXA 4LRUA 1JYEA 1IHOA 3SX2A 4TTAA 3GP8A 4DPLA 1BX0A 2A6PA 2PS3A 4TKZA 4CGYA 4TUYB 5ALQA 5IULC 2I62A 5JPDA 3A0RB 1ZUNA 3KKZA 3QKSB 4PZLA 3I5YA 4I36A 1UJBA 2VF8A 4R6XA 4BZQA 2P68A 3RSQA 1XROA 1YE3A 5AVZA 4LF8B 1KP9A 3W5HA 1TIBA 1RCFA 1UPXA 2B5OA 5BQ3A 4BLPA 1OH7A 1NATA 3H2IA 1JSZA 5B6IA 5I8PA 3P4YA 1BRTA 3M1LA 1JF8A 3D1VA 2ZE7A 4P80A 3LC2O 4EF5A 5B7QA 3RSLA 3FCSB 2ZIZA 3ACCA 3IA7A 4F9EA 4LVOA 3ZK7A 2UYCA 3K0CC 4KMOA 1L6RA 1Z6AA 1CUUA 1FRFS 1JTVA 2RHCA 2PX6A 2WJWA 3GJYA 1JFVA 5BSWA 1W96A 6REQB 1U0NA 1FDUA 3QHQA 3RS4A 2FHSA 2WE7A 1VJ5A 4REQA 5J63A 1H2EA 1KHHA 5EIBC 1P2VA 1U9CA 1L5FA 1Y1PA 2HA2A 2MSCB 3ETLA 2D5LA 4S05A 4ZRDA 2P5SA 4BX3A 2Q5HA 3B52X 1A7UA 3E70C 4UM9B 1J25A 4DC9A 2W9XA 2CJWB 1XZFA 1OSNA 2JGMA 2Q4DA 3NBFA 5JWHA 1TU3A 4RTSA 1M6EX 1E0AA 1Z4QA 3WOVA 4NEGA 4KJXA 4DBZA 4DIUA 3MCZA 1AXRA 3UWDA 3U1VA 2CHFA 3RYCB 1N2ZA 4X7MA 1HFEL 1VMIA 4IIXA 1U2RA 1AQIA 3WV4A 4KWIA 1M1UA 4FD3A 4ZK2A 3H97A 4E5MA 4J0IA 1CCWA 2IZ7A 3FF1A 4MUGA 4RZXA 4M55A 5CFMA 3BIXA 3HCRA 3K94A 1QS0B 2JGAA 3C1TA 3PC4A 4KRYA 1T0BA 4NONA 4YTEA 1XCLA 4KJZA 3S5UA 2Y4NA 2BJHA 1YIAA 3GRPA 3G82C 5EWJB 4EIWA 4NBKA 1NP6A 3MWYW 5AM4A 5JXWA 1X1SA 2V7QD 3QVOA 1YS4A 3T61A 3A4VA 1ILEA 4C2TA 4E11A 1JDPA 3JSXA 1V7PC 3GEHA 2YC4C 1RP1A 2AH5A 2DBVO 1GSHA 3LU1A 4YP5A 2A3NA 1OMOA 5DE3A 1JQ3A 3MQ4A 1GQSA 2D2VA 2Z83A 4XX1A 1YQWA 4MPTA 3RKRA 4ZOCA 3ZGOA 1BFKA 1X3SA 3VNSA 4F8EA 3MCAA 3ZH2A 5KU1A 1PR3A 3KETA 2C57A 3PZRA 1NUUA 2XKBA 2YHIB 3C6KA 1OBCA 1OIXA 1P4JA 2F8TA 3FUTA 4I2VA 2ZJBA 4UUOA 4UAJA 2GZDA 1YULA 2TS1A 4HXEB 1NVMB 4XWYA 3DUWA 3OZ7A 4AKGA 4G85A 2E5LB 2VK1A 3KZNA 1EFPA 4BPBA 2W4IA 2OV8A 4O0LA 2B1IA 4G8BA 4N9QA 4WASA 5FI3A 4EFMA 4ACBA 2C9ZA 2QRHA 2P6RA 2I4MA 4JR2A 4I3GA 4B7AA 2AOVA 3B8EA 3G5AA 1ZXBA 2I2WA 2P7HA 2X40A 3A1SA 4OD0A 1A8PA 4J75A 3L7JA 4IIJB 2CK3A 2BFEA 1Y80A 3FI0A 3HLYA 2ZYGA 2RAFA 2YBEA 1A4RA 3ICEA 3JQ7A 4DREA 4B3TB 3B9QA 2BR4A 2GKGA 4P3YA 1UKBA 3GXBA 2RH8A 4Z8YA 2W2OA 3NHBA 5JVDB 3CONA 4OI4A 4L0DA 4MS1A 3KEMA 1V6AA 2EX4A 1QFYA 4JD5A 3MTAA 1N33B 1YQXA 4N40A 2H11A 4K9NA 1KSJA 1T6YA 3AHEA 4N0EA 2Y1DA 5AMXA 3TRIA 4C1NA 3UMCA 1H2YA 1SWWA 4BFSA 3CVXA 4OQPA 2VRWA 5IJAA 1X7WA 1XDZA 3EZ6A 1WXDA 4FGUA 4XPZA 3V8MA 1V6SA 3GEIA 3VZRA 5I9LA 4EHAA 2VJAA 4QFBA 5BT8A 4H60A 3VZCA 3IIEA 4AO8A 1TB4A 2RDMA 2Z4RA 2AGVA 2J6BA 2NU6A 4UREA 4U63A 4RTPA 2H7CA 2BFCA 3PVSA 2BFPA 1L8LA 5B36A 2C7OA 3DBLA 4X95A 4DHEA 4JJIA 5CNKA 3PDIB 4J6EA 4JT9A 3WNBA 4LS3A 1XZGA 4ZIRB 2IUFA 3OFSA 4D9FA 2YJZA 4WDRA 3RC3A 1XTIA 3TNYA 3KZ1E 2QN3A 1EP2B 2BP7B 4GOLD 4WFIA 1RCTE 4KV7A 2BGTA 3U4HA 5KTNA 2R7KA 4H17A 2DPGA 4OX9B 4Z49A 2YXNA 3B3GA 5A4IS 3G0IA 1U28A 1V35A 1GL7A 2WA2A 3W8EA 4AJJA 1IQUA 4ZT4A 1FYFA 3CNOA 4YJ2B 3A3KA 3QLVC 5CVJA 5JD5A 5DXAA 2J87A 2DFLA 2Q1YA 3LCCA 1F4VA 4GNKA 4I55A 1PL7A 1GUAA 2FYTA 2PKQO 4EW2A 3LY7A 1PS0A 1MW8X 5C4GB 4LHZA 3B20A 4FN5A 3BXHA 1U8EA 3TLEA 3CVVA 4YRNA 1H0KA 2OVFA 3VRHA 1EFPB 2PSHA 3MWEB 4UPVA 3BRWD 1Q7CA 4BZPA 5AW0A 4GE0A 1FMTA 2FPPB 3BWMA 2YOFA 4RTRA 1ZMRA 2IUTA 3EA5A 1NKTA 1C4OA 1F0PA 3RD5A 3P26A 5HUQA 3FWPA 1ZJZA 2HNAA 3A11A 3HYLA 1RLOA 1MNQA 3D6FA 1Q84A 1ULHA 4UCFA 5E6SB 2VTKA 4FDTA 4COKA 2J0SA 3IJEB 3L40A 2AOTA 4HQOA 4JQSA 3A9UA 4IS3A 4OBWA 4X93A 4GX5A 5JXGA 4XWKA 4QTZA 5CIQA 4BBZA 1C50A 1KC1A 2GRUA 3HI6A 1GZ6A 2C0PA 3EMKA 2KB0A 2W4QA 4M8KA 2HSWA 4MS1B 5IUJC 2LZ0A 2NQTA 3M6WA 1QO0A 2O06A 1JIIA 1KK3A 2AE1A 4FYJA 4AJEA 2C29D 3ADPA 1J49A 2VHEA 3EYWA 4MVWA 1V47A 1VKJA 1X7WB 3OOEA 3GEEA 1CZHA 4MLZA 2HTFA 1UJ5A 1N9GA 2ODAA 3LX4A 4LC9A 3GRYA 4P4LA 4YCAA 2HTEA 2VZ8A 2XTAA 2IUSA 4IO0A 4R81A 1JHYA 4FIDA 3IURA 2IY9A 3FKSD 4I9FA 4M8IA 4FGSA 5BMVF 3K0FA 1EBBA 1W36B 3EIEA 3FYTA 2YXPX 4MP8A 4RK6A 4ZOEA 3V9AA 5FB3A 3DUFB 5TR9A 2ZPAA 4UUAA 3NHUA 1OVMA 1NVGA 2VUUA 1J5PA 2VNKA 2JA2A 4FPXA 4UM8B 3DVQX 4FTWA 4F9FA 3E5MA 2HNKA 2BM1A 2QN8A 3BZWA 3UAXA 3ZW7A 4ZCSA 4BJ6A 4HPXB 4O2AA 3G9ZA 5DTEA 3VO8A 3JTMA 3MJFA 1TUBB 2BEUA 2ZBGA 1WP9A 4Y2XA 1Q77A 2W43A 3JCZA 1DUVG 2J6IA 3RRFA 3CNEA 1FRVA 3G9QA 3QKRB 2A9QA 3L7LA 4FMDF 2ID9A 3F7NA 4JBXA 4JDPA 4DV0B 4X20B 1XRPA 3KQHA 1TM7E 2M6RA 1VKRA 3RF7A 4CIYA 1VYTA 2EJWA 1Z6PA 1UXIA 4M36A 2MJLA 1S8NA 1W34A 1E1QD 1EE1A 3DYBA 4NE9A 4DB2A 5IAJA 4HNHA 3PGXA 5NULA 4OMFG 4AY4A 1L5WA 4OHUA 1IXRC 1V95A 4XJTA 1AKMA 1EXMA 1E9SA 1USWA 3BJRA 4NNJA 2H92A 3GFPA 4B43A 3FHJA 1YTUA 1RE1A 2CJXA 4IMIB 2HCBA 3PUXA 4RF3A 3KYBA 4INJA 1NJFA 2ZIFA 1CE8B 3A58B 2R8XA 1XTQA 2UAGA 4JL6A 5DM2A 1XZJA 5DLPA 1T1GA 2E0IA 3R7DA 5A4DA 5MN4A 5ILGA 5C5IA 3PWKA 4N7BA 1I7PA 3BILA 1EPUA 2Z9CA 1FRQA 3NHPA 3OT4A 3GZTB 1BMQA 2PRKA 2TYSB 3SC2B 5ERYA 1XE3A 1KY3A 1GZ7A 3G59A 3ZI4A 4NBVA 4AMBA 2AYYA 3MHPA 4F92B 4MUFA 2R62A 4AO7A 1PDOA 4FYVA 2AI1A 1KMIY 3HR8A 1PJRA 3LF1A 4DIOA 3CNNA 2PQ2A 2FSSA 1N9GB 3N7TA 1R74A 3QVMA 3PV0A 1FVFA 1I9CA 1K97A 2F9MA 4FGKA 3NHLA 4PYRA 3TX6A 1JH9A 3ZWBA 3HBMA 3EUAA 2BKEA 2DR3A 2BTQB 3L77A 3LDAA 3MBKA 4JEMA 4ZCRA 1H2HA 5I9BA 1MUUA 2NU7A 5B6PA 3WWPA 1S2LA 5AXBA 3WGMA 1LQ2A 1JXAA 3C1UA 3QYPA 5K4GA 3IP6A 5EJ4A 4CG0A 2NZXA 2I54A 2QNBA 3UOGA 4Q16A 1JQBA 5GV8A 4GSKA 5FBZA 3X1YA 4JOBA 5KOHB 2R0QC 1O94D 2NVWA 5JSKA 5IJ9B 1UK6A 5ELXA 1YZGA 1Y6GA 4B4UA 2IYPA 3FNFA 4QJ3A 1QQ7A 13PKA 5ALZA 4DG5A 4ED9A 1WEKA 1I7LA 1X86B 2QD2A 3R5SA 4Q18A 5JI3E 1Q0QA 3C97A 4CPDA 1KJYA 3I8OA 2QTAA 4J2TA 1OWOA 1WQ1R 1J70A 3K9FC 1KJ9A 2R60A 3DPUA 3V4RA 4NFYA 3CBQA 2YDYA 3ISJA 2WU3A 4J90A 4L3OA 4DJDC 1OXTA 4F2WA 3QA3E 4QUDA 2HXGA 2QJOA 3FYUA 3OOSA 3OFKA 2QROA 1A2QA 2QQEA 1VL8A 1MMFB 2GS9A 1VJ1A 4ZREA 3BK1A 4AUKA 1VG0B 3KAPA 1MZPA 4JITA 3VHXB 5A3JA 4E4TA 1QLWA 1S9DA 1IB0A 4ZO6A 2C1ZA 3SJUA 1GQOA 1CUSA 4OK6A 4NYMR 4D42A 4R2LA 1N4AA 3VPFA 1G60A 3DZHA 3VGPA 3VKGA 4BYGA 3LH5A 5A7GA 1KNXA 4ENTA 2QWXA 3AZPA 1SG9A 3PGJA 3MJ4A 1T29A 2X4IA 3PJGA 4A6PA 4IHJF 3G0DA 3ODGA 4FW8A 1P0QA 1CR2A 3BRSA 3BAFA 3K53A 1DJOA 2H2GA 5C52B 4X65B 3LPNA 1P2BA 2HEIA 4MP3A 3WLFA 2F1JA 1BZYA 2VJPA 1A9QA 3OLZA 4JK3A 4UHHA 2A84A 4FFBB 1YRWA 4MW5A 4TWAA 3AKZA 4K26A 4G0YA 1GGMA 4CT5A 2DLCX 2C4WA 4WNIA 4D26A 1XZLA 1NQOA 1XNJA 3W1EA 3O2JA 1UBTS 4ZMSA 3FB1A 3GMSA 4HDOB 4AROA 2BAGA 1XAIA 3CLTC 4RW0A 1RJ9B 2AI2A 4W7IA 4OV6B 2PRIA 4WFQA 4M1QA 1PGJA 2HGSA 5FUQA 5I7AA 3ZVKA 1QU2A 1M0SA 4NP6A 3REFA 4OLBA 2Z6AA 1RMQA 1XX6A 3NGLA 2CLIB 4I6EA 4GU5A 1DMSA 1NT4A 2QZ4A 3ENVA 5E4JA 1BN7A 1CUAA 1ZD3A 2GK6A 3DTYA 4LV5B 3R5HA 1WVMA 4MPRA 2Q5IA 3AWIA 3Q4GA 4X24A 3T1NA 4DSZA 3PBKA 2NSLA 4E2YA 3A9CA 4F2HA 1Q1GA 3K9BA 2NO9A 5K3AA 2ENWA 2FZVA 2QVCA 1QGUA 4MB6A 4PG8A 2VA9A 4DUYB 2Q3HA 3OURA 3AKYA 4XQCA 1X3LA 1G64A 3W8FA 4D9HA 4Y0NA 1ZD9A 4Z4FA 2PUFA 1LCIA 3MLAA 2CHQA 3MSXA 5CNIA 1E2KA 3Q8XB 1EUDA 4MUNA 2Y6VA 5FV7A 5TPZD 2EW1A 2V6BA 3L79A 1JEAA 2HLNA 3R6LA 4Z99A 2X6RA 1M7HA 5CXXA 4X62B 1OAOA 4NU5A 4CMEC 1AMOA 5K6AA 4DR6B 5EHQA 2VHTA 3JQFC 4FX5A 1K8ZB 3FFWA 3K5HA 3GGSA 3INRA 4FFVA 4GRAA 3RYHA 2OMKA 2PHZA 3OLXA 1C7QA 3P27A 4LY3A 4YREA 4RBNA 4K88A 1L5ZA 2P79A 3CH4B 3H2KA 5DHSA 3SF8A 5AJVB 1UAYA 4WVFA 2G4CA 4YJFA 4KOAA 4EB8A 5E7MA 1GPDG 3ANXA 3OWHA 4KVAA 4OL0A 1A77A 1CVLA 1E6KA 4IRXA 1GPYA 4WIAA 2ATVA 5CHYA 1LSJA 2W2LD 2RFLA 3ZHTA 4FZVA 5IH7A 4R8SA 3IR7A 3KQWA 1PLKA 1RADA 2WUVA 4NJEA 4GXQA 4I4IA 3WK8A 3AR6A 3LWNA 5A9RA 1WCV1 5AO9A 3RNLA 3A4MA 3BJEA 1E64A 3OOJA 4ZU1X 3BD6A 3KQYA 3ITDA 2OGTA 4OMCA 2CL0X 4LOIA 3W4KA 1LI7A 4GOOD 4II7A 5MN5A 4FVTA 3VR0A 3ZHUA 4PYLA 5KEIA 1QUFA 4KQWA 1F8UA 2FSFA 2XB2A 3NFRA 4FEGA 3KB1A 3P97A 4QXPA 3TJRA 2EKQA 1AGNA 1L9KA 3R8FA 1PNTA 1SB8A 5AUOB 4YT5A 4F91B 1ITZA 4LIPD 3U3DA 4EG5A 4R2HA 5C1OA 2H1OA 1R0ZA 5BMOA 2IL1A 1SXQA 1N3IA 4S1PA 1EIZA 2QL9A 4JYCA 4PC6A 4PC3A 4NYJQ 4LXGA 2PO7A 3QX7A 4DTCA 3CW9A 1T1EA 1XELA 2W48A 3NH9A 3Q0EA 4YRJA 3ROZA 3GFGA 4D9MA 4EPRA 3C3YA 5J1SB 4MDEA 2O5EA 4F3TA 4QU9A 5CLIA 1VJGA 3BWVA 1TZCA 1FSSA 3HGMA 2CVFA 1M72A 1NN0A 5H3LA 4DMMA 4DY6A 4XD2A 3TYXA 2EJTA 2CZQA 2ALJA 4IKEA 4KQJA 5KWJA 2LV8A 2XZOA 5H1YA 4FFRA 1QYVA 2ZU6A 1DP4A 2RJNA 3AB7A 4QBIA 1KSGA 2CUTA 3W04A 3HKBA 1EUDB 4W4TA 4DGQA 3RUDA 4ALKA 1V16A 3M1AA 1WB4A 5CTAA 5IVPA 2XUIA 3CJRA 2JHAA 4JS0A 4C7JA 3FTEA 1S7GA 2M6SA 3MYYA 1Z6YA 1PHPA 1Q3HA 1HMYA 4L4ZA 5T67A 3KKPA 4L4YA 3G2NA 4MV8A 2NVUB 4FSHA 4ZODA 1A1SA 2VNHA 2V8BA 4YRPA 1NA5A 1YQTA 3AJAA 3CCBA 4B40A 1V1MA 1YSCA 1DQPA 3SF8B 3T06B 1TCUA 3B36A 3UPDA 3BGIA 1RQNA 1ZWLA 3G7UA 1GNVA 2PL1A 3GJTA 4TZTA 3JRWA 4X00A 1R0BA 2JLRA 2Y2VA 3C4JA 5DGCA 2R4QA 4FQ7A 1AS3A 3UATA 1VRWA 5UKDA 4HV4A 1GRNA 3D6HA 3PEYA 3H4IA 4JHLA 1R1DA 3OEHD 3WLHA 4DQUA 4P32A 1T26A 1PJTA 2DCUA 2P41A 3UQZA 3S1LA 1USUA 4QT0A 5BOSB 3TM4A 4NXNB 3HCOA 1YD7A 1OTHA 4X1OA 5IH3A 3SP1A 3FPSA 8OHMA 4E5UA 4XWTA 1XCBA 4KU4A 5BN4A 3HKCA 3LY8A 4MWTA 2CBGA 5KYTA 2O0LA 1XMOB 4P3NA 1ZIOA 5LWHA 5E95A 2GUGA 2ZJ1A 4B7ZA 1XDBA 2YXLA 3NKVA 4PEVA 2OPHA 1JR4A 5KSWB 1ECPA 1BMDA 1T2NA 3N2NA 1P7WA 1P5HA 1PJ8A 3AZOA 1QH1B 3KALA 1K3UB 3H8JA 1QGED 2OHHA 3B1KA 5J5VA 3ZUPA 4UVIA 1T34A 2VUSA 1DEHA 3AP3A 3ZU6A 5IKMA 4MQLA 4Z9BA 2G4VA 1BS9A 3OE7A 1T13A 2JGNA 3AJ9A 4IF6A 2ZT5A 3VQTA 2GRJA 3BIJA 5TJ9A 3K72B 3OJEA 5HILA 4ARBA 3U3JA 1G21A 4ZN6A 1M6VA 4BO3A 3RIGA 5F7ZA 2E82A 4YJDA 1J33A 2H18A 4B85A 4GPIB 2UXCB 3EBOA 5ANRB 2A5YB 4IZ6A 4JI8B 1KQPA 4PFQA 4EY4A 1I7DA 1PZMA 4DLWA 1JNYA 4EAAA 4C0BA 3IBSA 2BEKA 4AK9A 2FEOA 2DT5A 2GPSA 3COWA 2RHDA 4Q47A 5JAIA 4QDXA 5C46F 3AVVA 1O95D 1GRVA 2ZIGA 5COQA 1Y98A 4KCGA 1P17A 3DZ8A 2GZ1A 3KPJA 1JTFA 2MMGA 4EW1A 3CKMA 1LDYA 1JVSA 2V54A 3D7NA 2AI3A 4R8LA 1K5HA 1QH9A 3L6EA 4LY0A 3WHLA 3PSHA 2ZT8A 5K3OA 1XKLA 2FWAA 3L0SA 3KKEA 4ES6A 4ESEA 4ZICA 3THXA 4G5HA 5F52A 3H9BA 2RK4A 1GNPA 3LDGA 2EBUA 3SIXA 4D97A 1RYNA 1ZMTA 1FW8A 2BT4A 3TQQA 2ZRLA 4NV1A 1TAHA 4DVJA 1AGYA 1OGJA 1T5TA 4Y9TA 3R40A 4NIMA 1B0PA 2BH9A 2H5EA 3OEYA 5K3BA 1YDEA 5EKXA 3UKDA 3HUTA 5ITSA 2X3FA 2ZIUB 4IVPA 4IVQA 3AYZB 1ORHA 2DMRA 4LXUA 3IQXA 5JEEA 4I4TA 1EG7A 1PJAA 3VR3A 4Q39A 4IG4A 5KWEA 4CM7A 3QEMB 4Y30A 1BHJA 2H9YA 4BMYA 3CINA 3QPUA 1OFGA 4QYSA 3T1QA 3IDQA 4TLLB 5G53C 5KVVA 3WGJA 3LNCA 1TEVA 2Q6IA 2IV7A 3ZD8A 1ZN2A 4BQPA 3MTDA 2HJVA 1KU6A 1XUOA 1SA0A 1C3OA 4HNAB 1Q57A 4O8ZA 4O4HF 4UAGA 1Q50A 4UVGA 4XQ9A 4D81A 4D5EA 3H11A 3GFTA 2HW8A 3H2YA 1P74A 1N5LA 3CR8A 2VJMA 3O94A 3FZGA 2R79A 3KQLA 4NFSA 1OZGA 1P2DA 1W8DA 3QBEA 4WLEA 5LZ4A 3PXGA 2VJNA 2PAFA 2CXQA 5AKZA 3E61A 1EVJA 5AQEA 5J23A 1U9JA 4MGYR 3TMAA 5AVYA 4BKUA 2I1WA 4KQHA 4M3NA 5FJIA 4YY3B 2QT0A 1T3GA 4FJ1A 1F7UA 1RWBA 1H0HA 1WOYA 1F60A 2P9FA 4DKJA 3O4RA 4Y9RA 3R76A 4R84A 3IUEA 3HUDA 1C14A 3LUCA 1M2VB 1TVEA 5TEVA 3SG0A 3U1BA 4AG3A 4O29A 2BEVB 1KMCA 2WIFA 3B2EA 3CNBA 3CPEA 3GMDA 4UU1A 4L08A 1JHVA 1ZK1A 3WMEA 1R5JA 4JL8A 1GEGA 1PZGA 1SIWA 2G7MC 1B8UA 4DDWA 1N1EA 3FR8A 1TTPB 3KQSA 1F8GA 2NU9A 2OG1A 3ZDRA 4YCCA 2LKCA 2VPPA 4LQDA 4BXOA 2O7VA 4JMPA 1SKYE 3STYA 3D4OA 2XVYA 2Y66A 4LRWA 1GG8A 2WJIA 4OYHA 2WKPA 4DA8A 3EDOA 1MG0A 2W8BB 2ZIXB 5KYWA 4YMLA 4YCNA 3N70A 1C3XA 3IV9A 3SHOA 3GP3A 3THXB 2KLBA 3UXMA 3OPMA 4RYLA 4L0QA 2OV4A 1AA6A 3GIWA 2J0UA 5L7WA 4RZHA 4JYBA 1NW3A 2RGBA 3NEPX 5JS1A 1ECJA 4MR7A 1J9GA 5TC4A 3AKCA 4OUKX 2IHYA 4ND8B 5JQGF 4E94A 5IU6A 4P1ZA 3ZJ5A 2YNMD 3LBIA 2GN1A 5CD1A 2R97A 4FBGA 2C4HA 2ARKA 1UXOA 2R48A 2LCIA 3M6UA 3W78A 3OPXA 5ECYA 2J9FA 1K6XA 2GJ8A 1FZQA 3ZGLA 5CG2A 3CF4A 2DUUA 1V5EA 1S2NA 1CB0A 2ZAIA 1N75A 3BQ9A 3P0FA 2H7VA 3AUYA 1F51E 2FRXA 3N74A 1V48A 4PAQA 1RKVA 4G5YA 4H1WA 1KETA 2O8BA 3S7TA 3R7FA 2XCQA 1WUYA 1A8HA 5E1DA 3TM5A 3QOXA 2CWWA 4C3OB 1NW6A 2ZSKA 5DHFA 4D3FA 2XHZA 4LOJA 1IN8A 4E6PA 5C8VA 3NM6B 2R6JA 4MUJA 5L8VA 1RRKA 2VDNB 3RBZA 1KO7A 1RAFA 2FSUA 2B8JA 3JS5A 4O1MA 1P4SA 4J0DA 2W2XA 4ZAXA 5AUQA 4ENVA 2ILVA 3A4NA 2YY5A 4B6RA 4RMJA 1FFDA 2ODNA 2UYHA 2IEZA 1HZJA 4LCEA 4H16A 1EAMA 3URMA 3ZTWA 5IASA 4Q24A 3NI2A 2PKRA 3WXBA 1CUEA 1JW9B 1YMVA 4DLSA 2CFOA 2R68A 4OTZA 1YCGA 1BH2A 4INOA 1NONA 3DV2A 2A5GA 3L0PA 4Q1BA 3ZBPA 3PXDA 5DXJA 5GGYA 2B34A 3L7OA 1OC4A 2Q8PA 3IERA 3JQ6A 3CJQA 2XUGA 2WOOA 1KI8A 1VFNA 1EU1A 3RVRA 1GG2A 1DAGA 4KWTA 4MQBA 2UZ3A 3G2JA 1ZO8A 2V7UA 4AJ2A 1N6RA 1SBCA 1L8AA 1P0FA 3BXXA 3GLGA 3R0VA 2FUG6 5IZCC 1X39A 4UVEA 4R71A 3TNLA 1UP6A 4X64B 1DOHA 4B31A 1V41E 4QELA 4DC0A 3T3PB 1TK3A 1H65A 1NIJA 5C80A 1MXFA 3YASA 1P75A 1FYVA 2IYUA 3OT5A 4LYAA 1TO2E 4AIRA 5I5EA 2OCAA 2EARA 1UZMA 2IV2X 4BV3A 1NLFA 2GTIA 4NK5A 4PYQA 1Q14A 2G09A 2X58A 3MG9A 3ZR4B 4N5MA 4RWZA 1V1RA 3LKVA 1OXMA 1RRVA 3E9RA 5D3KA 3U7GA 5LNK1 5B1HA 1S9HA 1PWEA 2F00A 4NPHA 1EX9A 2HK7A 3ZKWA 2O2IA 4MARA 3LLVA 1JU4A 1XV5A 2A5FA 5JBIA 1Z26A 3KS9A 5F7OA 3IALA 5DTIA 2Z1NA 3ORHA 1G8AA 1TT7A 3T9FA 1NJ2A 4RD6A 2BLLA 3P0RA 1UXJA 2G6BA 2J6CA 2J5QA 4HADA 3VZPA 1E3DA 1WB6A 4DT1A 1M8JA 2R7AA 1QLHA 3K0HA 4UEOA 4M9CA 1ZH4A 2ENUA 2IC5A 4HJRA 2GYUA 4U4AA 4TMYA 4UMDA 3WJ2A 3WLSA 1TD9A 2AEEA 1MC8A 1WMDA 2A5JA 4W63A 1K0UA 3QU4A 4OJMX 2OD9A 4O2RA 4BAUA 5L7TA 1SVSA 1WSAA 1Z45A 3IAS6 4DSTA 3B85A 5A05A 2HC9A 3H1BA 3AH8A 3GAZA 2V96A 5K5EA 2KHZA 3OE5A 4LX0A 4BO2A 5B64A 1DI0A 4C88A 3MPOA 4UUBA 5AHOA 1IHPA 3FA2A 1NJ1A 4CF7A 1FMFA 3OHSX 5FNVA 2RI1A 1XZQA 2W98A 3M5PA 4Q3DA 4QQ8A 5CYOA 2IY8A 2Z1MA 3BICA 2OHXA 4AB1A 4AECA 4LYYA 1NSYA 4P93A 5EGSA 3DKRA 1QCYA 3LX5A 2EWMA 1RDFA 1ZI9A 1J1IA 3EW7A 5LOVF 2YN2A 3UV6A 1IPEA 3I2JA 1FU8A 1KPGA 5AM0A 1T15A 2CVOA 2YWDA 1PFGA 3I2FA 2A9FA 4JWKA 4PO3X 1ISGA 1GDHA 4RAOA 3CX8A 5BN3A 4UBMA 5CVVA 3HN6A 4AJOA 4ZGWA 1KJNA 5TQJA 2IYYA 4BWYA 4EQ6B 2Z08A 5T5QA 4PHCA 2B8NA 1CY1A 1TJ4A 4Y0VA 1YBMA 3PDWA 4O5AA 3VPXA 1B1AA 1YB7A 3FJYA 1EA5A 3ED1A 2ID7A 3SIPA 2XTNA 4PR0A 2PZAA 3HY6A 1GCAA 1NW9B 3RLFA 3WB9A 3G2LA 5EWMB 4FR2A 1O94C 3SLRA 1WG8A 2PM8A 2WTXA 1KSHA 5ICCA 4QL3A 2IYZA 2DUMA 3IUYA 4IOKA 4JQYA 4RKYA 5DISB 5LXTB 5IJ9A 1O9BA 3GF4A 5DNYB 1ZINA 3N6VA 4U6SA 2WP8J 4MKGA 1Y7HA 4TV9F 1I7QB 1ISJA 4WXMA 3SLGA 5EIWA 4KR0A 5FYDA 2YS7A 3T7RA 4PG5A 3TSCA 4RIFA 3LI2A 5EUMA 1PWZA 2XIQA 3DZIA 4NYJR 3ZKWB 1Z82A 2UVDA 9MHTA 3CSUA 3FUXA 2YW9A 3QVXA 4L4SA 3SBEA 5CIYA 1WB9A 2QVZX 2CXRA 4MS4A 4V0SA 3W2FA 4RV9A 1KVQA 5BQOA 4DT1B 3OZBA 3QWBA 1U3TA 5B7GA 1FUEA 5AJHA 3MLBA 1HK7A 1FJXA 2JGLA 2ZUVA 4G56A 4S24A 3OZUA 4WXRA 4WBNF 2ZI5A 3DVSX 3R7WA 2QZZA 5K0NA 1YQ9A 2P2ZA 1DJMA 2A9OA 1DC7A 1ZPDA 1JHRA 1R10A 1FQOA 4PSUA 4NARA 4D4LA 2C7VA 3V4SA 4R5MA 4TT8A 4E5NA 2D5BA 3HLKA 4N8EA 3FTPA 4W5HA 3NKLA 5GMOA 1VL2A 3T0IA 4D9KA 1ZQ1A 3HUFA 1MB9A 3UAZA 5DW0A 3HCPA 2HXSA 3UHPA 2D2EA 2BFOA 2AL7A 4I8IA 1MABA 3SZ3A 4X1KB 4PAWA 3RDPA 3TD9A 1A7AA 4TYWA 2D1RA 4IXNA 5DBEX 5AXCA 3FUVA 5JD6A 2I4IA 3QZUA 1DXOA 3CO5A 1CZOA 2C99A 5DHTA 4CEHA 3F5QA 4S1VA 4WGFA 4DDTA 1NG9A 4QLOA 4GRIA 5FI0B 1HG0A 3D2LA 2GM4A 4G2TA 4XXHA 4S35A 5DIFA 1QYXA 1SVKA 3EA0A 1LFAA 3H1AA 1VPEA 1U1FA 3GYBA 3QXCA 2ZSAA 1G21E 1DAMA 2NUTB 2WSYB 4O1HA 2IBMA 2P77A 4XAQA 2FG6C 4IDNA 4B5KA 2FX5A 1JR3D 3E22B 2AZXA 2JBAB 4GEGA 4G1UC 4LDAA 3M33A 1EVEA 3FAKA 5IUNC 1MAVA 3JWHA 4QSHA 5B6JA 1U5CA 5ADHA 4RK7A 3CXRA 3NHAA 3WMWA 1DTWB 3VC2A 4Q3AA 1PUXA 3H16A 3OTWA 1O5TA 3MN1A 4HEHA 1J8MF 5I9MA 2JD2A 2JFWA 4QGGA 3A1FA 1VLQA 5CCEA 3NTOA 4JLBA 3SY8A 3JZFA 5H16A 4B47A 1GCOA 1N92A 1MX9A 3N8NA 4H6PA 1EFRD 2VXBA 4HYYA 3UJ6A 4DLAA 4Q4AA 4L5AA 2VBIA 3G0HA 1AKWA 2YIDA 1T9CA 2XUZA 4MS4B 1KO4A 5CFQA 1W1IA 3V8NA 3AFNA 1FXWF 1N5JA 2Q5JA 3PFCA 1I30A 1EBUA 3KFVA 1O0CA 3CN9A 3FOBA 1T2UA 2JLCA 3I72A 4WV3A 4YJHA 3R8CA 2I22A 2AVDA 1CUJA 3C3DA 5TDHA 4KPEC 1WCXA 1A96A 1AM4D 1RP7A 2ZEJA 4HAIA 4N12A 3KQKA 3CR7A 3L92A 4EYSA 4BV2A 3AJEA 4AJ9A 4NENB 4HNUA 2ZCUA 3MGKA 1PN3A 3EFHA 4RHXA 1IB6A 4ZAFA 4DMFA 1GG5A 4IKPA 4ZGGA 5JBQA 4K46A 1J0AA 1L7AA 4ND7A 2UV8A 4GOKA 1LNQA 3I73A 2DVMA 1EX1A 4ITVA 4KBGA 4MV4A 1NPTO 2VYVD 4MGIR 1QB7A 1ZRNA 2OCXA 4NICA 2F17A 1P44A 1WCWA 2O8NA 2R44A 5MGBA 1J6UA 1MABB 1GOTA 3VH1A 4IXDA 5KHLB 2ODPA 1WO8A 4JC0A 5E38A 3SEQA 3JD2A 3I5AA 4US0R 4R7TA 3D1JA 2C1XA 5K2MA 2J07A 2C88A 2QTVB 2ZJAA 3ZD9A 1TMYA 5BQFA 1MQ8B 3FKJA 4O4LA 5HQ3A 2O8DA 3DDHA 1SY7A 2WIJA 4BKQA 3WL4A 1DAPA 3H2ZA 4LEIA 1GAXA 1Q6YA 3TW8B 4XCXA 5E8RA 2EFYA 1EZ4A 3EWAA 4C14A 2I2XB 4F96A 3PUZA 1TT5B 4IIDA 2DT8A 3ZU2A 2WLSA 4XYEA 5H59A 1SHJA 5KX5A 2PKWA 3FUUA 3DAHA 2JZNA 3RKSA 2R3SA 4M83A 3MQFA 1O6CA 1MIOA 3PPWA 2WHPB 2EG5A 2BE7A 2OCPA 2OXFA 1TZ2A 1F17A 3HZOA 1W19A 3NR2A 1W0CA 2PL9A 2PVPA 5ICFA 1T1SA 3CCFA 4Y3UA 3WHIA 1X1CA 1XN1A 5IUKC 1WXEA 3TUIC 3BFJA 4D96A 2OM2A 1XYVA 1U4SA 2RCNA 3CPJB 3ULKA 3RR2A 5KYYB 3O26A 3B7GA 4JOQA 4R3UC 2N0SA 2H1LA 1ESNA 4X3OA 5BW5A 4B17A 4IMPA 5LN1A 2AOXA 2ZVDA 4BAGA 3TRFA 1XWIA 2IPMA 3C3PA 2WYHA 4AJ1A 1ND6A 1ZHFA 2CBZA 1AQJA 1X1BA 1NE7A 3EA4A 3L0IB 3RM3A 3RAFC 2RH9B 3DFFA 1UMBB 5D86A 2O9JA 3EC7A 3NKFA 3QWAA 3H5LA 2JF0A 3FJOA 3RV3A 3OQBA 1EWQA 4TM8A 2YWRA 3DLTA 2OO7A 3JRXA 3O38A 5JNVA 2OO5A 4IIFA 3KZOA 4M9UA 4W8OA 3TGPA 1TA9A 1XWFA 2VT2A 3Q5EA 3ZHRA 2OSVA 3R5TA 2NU8B 1NXVA 2HFJA 4MR9A 2Q3MA 1PV1A 3G23A 4NY1A 1DRVA 1EQ2A 2BGIA 2V3WA 3O8QB 1T9HA 1GAQA 4EG3A 3WISA 3KOMA 4BRWA 4RXTA 1M8KA 3UJBA 5ESXA 1G0OA 3MINB 3PXCX 4RESA 4UOEA 1W4BA 2PZMA 1HDRA 1VJTA 1ZD2P 4ZVTA 3DDOA 4YXFA 1XF1A 1YRHA 3A37A 3WZLA 2ZLBA 3JVVA 5KYUA 4OHBA 4FSXA 4QUBA 4CM4B 4Q1FA 2XGGA 4NEQA 2OECA 4OHRA 2P6UA 3TMKA 1KEZA 4KTTE 1KDVA 1JDBC 2HMVA 2NG1A 2WMNB 2V4ZA 4LSGA 1OXXK 2XCUA 1PTJC 2OBNA 3WMRA 4DJEC 5K6TA 1VYUA 2W00A 4EA9A 3HO8A 2DPHA 1Z6QA 1DCFA 1JKIA 3K3PA 2P1DA 1X14A 2YVKA 3F8WA 4JKYA 1VI6A 5CYFA