3I6QA

Structure of the binary complex leucoanthocyanidin reductase-nadph from vitis vinifera
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
307
structure length
291
Chain Sequence
GRVLIAGATGFIGQFVATASLDAHRPTYILARFKALEDKGAIIVYGLINEQEAMEKILKEHEIDIVVSTVGGESILDQIALVKAMKAVGTIKRFLPSEFGHDVNRADPVEPGLNMYREKRRVRQLVEESGIPFTYICCNSIASWPYYNNVLPPTDFFQIYGDGNVKAYFVAGTDIGKFTMKTVDDVRTLNKSVHFRPSCNCLNINELASVWEKKIGRTLPRVTVTEDDLLAAAGENIIPQSVVAAFTHDIFIKGCQVNFSIDGPEDVEVTTLYPEDSFRTVEECFGEYIVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and catalytic mechanism of leucoanthocyanidin reductase from Vitis vinifera.
pubmed doi rcsb
source organism Vitis vinifera
molecule tags Oxidoreductase
molecule keywords Putative leucoanthocyanidin reductase 1
total genus 96
structure length 291
sequence length 307
ec nomenclature ec 1.17.1.3: Leucoanthocyanidin reductase.
pdb deposition date 2009-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05368 NmrA NmrA-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3i6qA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3i6qA02
4K1LA 1Y8RA 5JDCC 4NBWA 1J5PA 3PYLA 2CVQA 3RC1A 4BO7A 1OMOA 3DTYA 3IP1A 3UGKA 1WDKA 3ZWYA 3E48A 3G1UA 2YJZA 1BRMA 3VOSA 1SPXA 4YR9A 1KC1A 2VUTA 3RIHA 3SEFA 1ZK2A 2NTNA 2H1SA 3ITKA 2HJRA 5C7IO 1T2EA 1Y5RA 2DFDA 2OP1A 4MIYA 3RUDA 3TJRA 1D8AA 4J16A 3OIDA 3VPSA 3RROA 3AFNA 1JN0A 3DTTA 4YACA 4OKIA 4FFPA 4N54A 3H9EO 5KJ6A 1GUZA 1PJ2A 3BMQA 4DIBA 4YXFA 1BTOA 1H6AA 4YJHB 1FXSA 1YJ8A 2AMFA 3KBOA 4OQYA 3JQAB 3WFIA 1R0KA 4IDGA 4ALIA 2XXBA 3T7CA 3DHNA 3PHGA 4EYEA 3WB9A 3H2ZA 3FTNA 1LDBA 3O26A 3RUAA 3KTDA 3NT4A 3V8BA 5IF3A 3VTZA 2NU6A 3DMTA 3ZW8A 3C85A 1WAMA 5HS6A 1UH5A 4I5DA 4YT5A 3QA9A 1NR7A 1PL6A 4EEXA 2HK7A 4IGEA 4XRGA 5TJ9A 4FN4A 1ZH8A 5DCUA 3Q11A 3DR3A 3P2OA 2O50A 3OQBA 3PYXA 5KJ1A 2GR9A 3ZH2A 4BO9A 2WYUA 1VJ0A 4BHTA 3L77A 1E7SA 2RH8A 5BQFA 2NWQA 4XQ9A 1OC2A 1NFRA 4TQGA 3K92A 5I7SA 5ITVA 3IKTA 1XU9A 3QVXA 4M54A 3I6IA 1YL7A 3DAPA 4H7PA 3DHYA 2Z1NA 4IPTA 4PG5A 1HE5A 3PP8A 3VH1A 4AICA 1UJMA 4QFCA 1DIRA 3LC7O 4RO0A 1YB4A 4ZRNA 3GEDA 1ZEJA 2C59A 3RUFA 1IPFA 3GN2A 2JKVA 4CM3A 2WYVA 1T2FA 1EQ2A 1CQIA 2W90A 3VC7A 5THQA 1GQ2A 5AXDA 1FDWA 3JD2A 2GCGA 3BHIA 3ICCA 4BQPA 3JQ7B 4MKXA 1JKFA 1U3VA 1GTMA 3ZW9A 2PTGA 4BMNA 4E2WA 1JKIA 2PA3A 2WD7A 2W2KA 3AK4A 1X14A 3KEOA 1LJ8A 4RPGA 1HKUA 2P9EA 2W2LD 5ENVA 2CDAA 2ILTA 3ROQA 4NBRA 3GRPA 2FSVA 4I9HA 1XLTA 3QSGA 2VWQA 4NJOA 4R4JA 4GVLA 1UDCA 5I8WA 1YJQA 3I23A 1ZEMA 1KEWA 2WMDA 2WTBA 1LEHA 1RYEA 2EHDA 3VDQA 1SOVA 4B4WA 1AE1A 1ISMA 3JQGA 4Y98A 1ZFNA 2I3AA 4WNIA 5JPIA 3GA0A 2EW2A 5A03A 2YFQA 3ONFA 3Q9NA 2X23A 4CPDA 4RQUA 5AXAA 1PX0A 3GPDG 2WD7B 2LDXA 1Z82A 3KYDB 4E2XA 3MJ4A 3WJAA 3U9LA 3AOGA 3ZWCA 3L9XA 5BT9A 2CZCA 4YA6A 4JGBA 2B0JA 4RQTA 1YWGO 1B8VA 5FYDA 1PJLA 2CDCA 3ZWAA 4I5EA 4YCAA 4R1UA 3WX0A 5G4LA 5ICMA 3PRJA 3FPCA 3V2HA 3O4RA 4DYVA 5CPBA 4XEHA 5JSFA 1MFZA 3OF2A 4JJIA 4W4TA 3JQDA 4AJKA 3COSA 5ILGA 5ILOA 5L4LA 1PGOA 2VHWA 2D5CA 1DAPA 2IRWA 3PK0A 5A9SA 3U09A 1C0KA 1MGOA 2YY7A 4CQMD 2EXXA 1F12A 1NR1A 1GAEO 1U5AA 5DP1A 3GAFA 3ROPA 2DBQA 1JKJA 2YV2A 3LK7A 4W82A 3RUEA 3VPGA 5J23A 2GN4A 4HADA 1QYVA 4OSPA 4XB1A 5KNLA 3U5TA 2NV6A 3SJ7A 4QX6A 1UUFA 4DLBA 2BFPA 2DT5A 3BTUA 4WASA 1F8FA 4PG8A 2HMUA 3PLNA 2DPHA 4MVJF 2DBZA 3WQRA 5C5IA 1JTVA 1NAHA 4J91A 1PJ3A 4R51A 1EBUA 1Y1PA 1K5HA 2W2LA 4HFMA 4G65A 5CEEA 3GEMA 3IOYA 5C7LO 4N5LA 3DAFA 2YHIA 1EBFA 2JFFA 4UVIA 1T4DA 4W6ZA 4YJGA 3SC4A 4E5MA 2RHRA 1X0XA 2WM3A 3SC6A 2JAHA 4BO1A 1LX6A 5JCJD 3OIGA 4NFYA 4RVGA 4PVCA 3VPHA 4MINA 5IXSA 3OETA 3NDRA 1XIVA 5FWNA 1LI4A 4FPXA 1O95A 4FCCA 1OOEA 4KUEA 5DP2A 1ZUD1 1BXGA 4PLFA 1DAOA 5CG2A 2EP7A 3HE3A 3MWEB 1PZEA 1BGVA 1RM0A 2EIHA 4JNKA 3HNPA 1XQ1A 1BMDA 5LCXA 4LVUA 2YDXA 1ZXBA 4WEOA 1NFQA 3U62A 1Z7EA 2Y1OA 3QY9A 2Q1SA 4J9UE 1UZMA 3QE3A 4R9RA 2YQ5A 3ADPA 2P68A 4CLXA 3DMYA 1ISIA 1E7QA 5TJHA 3S2GA 1MX3A 1OI7A 5EINA 1PWXA 3B70A 4WLEA 3H8VA 4BNMA 3JQGB 3SX2A 1J6UA 2C7GA 3WWYA 3AM5A 1MP0A 5H81A 4R1TA 3VKVA 4E5KA 2RAFA 3I4FA 2X0JA 3KSUA 5AXCA 4Q3AA 1PEDA 3KLPX 1B14A 1NPYA 2YHUA 3BTOA 3EC7A 1I01A 4BKRA 1N7GA 5L7YA 5TLSA 1T26A 2GDZA 3DC2A 2VRBA 3CZMA 1NHGA 3H6KA 3O8QB 4I1IA 4L4SA 1FMCA 3S2FA 1ZSNA 4FC7A 5A05A 2QIOA 5TQVA 3OECA 2FR0A 1HYHA 4M87A 1PR9A 2AHRA 4RVUA 4BQRA 3LYLA 4EW6A 1A7KA 1C0LA 1PS9A 4Q3DA 4A7PA 4E6PA 4CM1A 1Y6JA 1DIGA 3T4XA 3VPFA 2B4TO 4GAEA 3QWFA 3F1KA 1PWZA 1ZXLA 4OOEA 5TSDA 1UXKA 2I5PO 5JCJA 2ZK7A 3QRWA 1BHSA 2V6GA 4DGSA 4E5YA 5TC4A 4Y9DA 5TIIA 1E1NA 4GX5A 4XDZA 4B3IA 5ITWA 4J1NA 4U6QA 3EUWA 2O4UX 1AHIA 3DXFA 3GN1A 2O7SA 3INTA 4IJVA 2C29D 1CERA 4E30A 1R4NA 2JHFA 4HY3A 4FW8A 3GMDA 3FSRA 3Q6IA 3EK2A 3F6YA 4B8ZA 3HDHA 3OJFA 2PK3A 1Y5MA 4CLOB 2VOJA 3KYBA 3OP4A 3RFXA 1GPJA 4J0FA 1RYDA 1YBVA 1EUCA 3WMXA 2W98A 2B83A 1I32A 2C82A 2UUPA 3ZU3A 2CY0A 4CQMB 1YDEA 1H5QA 2ZYDA 1L7EA 1GEGA 3JQFA 3PZBA 5BNFA 2AEFA 4DMLA 1E7RA 1DHTA 3BMNA 3WYEA 4CQMA 3E03A 1PGNA 4EJ0A 3JYPA 5EN4A 4LVCA 4IGFA 1I2ZA 1VSVA 3OSUA 1DFGA 1OAAA 1ENOA 4BNXA 2OGUA 3I9JA 4CM4B 5KVCA 5HRUA 2YV3A 1PQWA 2O23A 1E7MA 3C1TA 3SVTA 4CMAA 3NAQA 4BNHA 3I9LA 5IZCA 4BUCA 3ZHXA 1VE9A 4EJ6A 2I65A 4WCDA 5TX7A 3PHHA 4PZCA 3K96A 1IZ0A 1L1FA 2BGLA 4CMCA 4ZICA 2VNAA 3GVPA 4E2ZA 1UP4A 2B35A 3LQFA 4ONEA 1FJHA 1SAYA 4IZIA 4L9RA 1GADO 3V5NA 4D43A 6ADHA 1KY4A 1DIBA 4R5HA 4D41A 4D0SA 3PJFA 3W4IA 1W73A 1H93A 1BXKA 1DIHA 4MVJG 3WNVA 4EUFA 1TT5A 3P19A 1HE4A 3ITDA 3S55A 4DLAA 2IZZA 3FRJA 2PKQP 5JY6A 3IUPA 2CVZA 1PQUA 4NR0A 4RPKA 2IEDA 3PHIA 4WLNA 2VT2A 4OMUA 4RJTA 3RJ5A 3OHSX 2HRBA 4R16A 5ICSA 2C20A 4J3FA 4NFHA 4CMEC 1TVEA 4RGBA 4MPDA 1Z6ZA 1WMAA 2OUIA 4NH4A 5KJEA 4IMRA 4RF3A 9LDTA 5DNAA 3FBTA 1VL0A 4ND1A 1RM4A 4Y67A 5EJ2A 5A5EA 4IQ0A 1EMDA 2G17A 4GLOA 3PDJA 1KOLA 3QVWA 2AEMA 1WDMA 2DTDA 1DPGA 4Q3NA 5IN4A 2A92A 4XJTA 2PGJA 5DZSA 4GH5A 3MTGA 4NBUA 1NWCA 2J3KA 2NTJA 4I9UA 5I9LA 4RLSA 2GD1O 5JAQA 2PD3A 4PRLA 3I9NA 1M2WA 2P4QA 2QRJA 3VDRA 4W9NC 1PTJA 3VVBA 4F6CA 4LSWA 1PS8A 5U9CA 1E1MA 3DOJA 5EL0A 8LDHA 2NVWA 4QUKA 5JXWA 1LLCA 1J0XO 3PJEA 1PIWA 4UVEA 3ZWNA 2Q1WA 1D3AA 3JQEA 3DQPA 3QP9A 5KWEA 2FZEA 1X1EA 4OXNA 3VZQA 4KZPA 2EJWA 1U1IA 2VWHA 4DMMA 4ZQEA 3PFWO 4MDHA 5G0WA 2X8LA 1V3TA 3NX4A 4BO3A 3G79A 1IHYA 4YJGB 3Q1LA 4DIOA 2DVMA 5COQA 1GQQA 1UAYA 1ZK3A 2BGMA 2Y99A 4O5OA 3NTOA 4LCJA 2HDHA 1YB5A 1HDGO 3ZWWA 4P4GA 4YT8A 1E92A 5F3RA 4Y6PA 2FRDA 2Z5LA 3PJGA 4Q3EA 3BMCA 4RPLA 3F4LA 1C0PA 3ASUA 3JCZA 4CM9D 1ADGA 5DF1A 5IZCC 4GLLA 1G0NA 4TKMA 4E0BA 1BXZA 4MP3A 1NNUA 2GO1A 4Z9YA 4FB5A 3GNTA 5C37A 1IULA 4P4LA 4XGNA 3IDSA 3L6DA 1ULSA 4B4OA 4IXWA 2CF5A 1EVJA 4XIJA 2Y05A 4XJSA 1X0VA 2SCUA 3DBRB 2HLPA 3GGOA 3Q9UA 2OOSA 3CH6A 5BNTA 3JQ9C 3TZQA 5HM8A 1A4IA 4LGVA 5DCYA 1B7GO 4Q3BA 4NBTA 3ZNNA 2OP0A 2C0CA 3Q3CA 4CQLA 1HSZA 4YVFA 4RDHA 1CIVA 3MEQA 1N9GB 1GZ4A 4WLUA 4XD2A 2Y1FA 1Q7CA 4PIVA 2HK8A 3MJSA 1M75A 2WD8A 4E2YA 5B1YA 1KY5A 2J5RA 3DZFA 3WQSB 1DRUA 4FBGA 2QG4A 2ZKLA 4L76A 1EFLA 1HDRA 4II3A 1YGYA 3TOXA 1PJ4A 4TROA 3TWOA 1ZBQA 1ZMTA 2D59A 3MJTA 4IIUA 3KOUA 4U7WA 4WLVA 3TPCA 2DC1A 4WK6A 4CLDA 4XDYA 4QT0A 1BVUA 3F3SA 3GVCA 3TL3A 2HMWA 2I99A 4E21A 4DPLA 3MOIA 5GZ6A 1H6DA 1X1TA 2WE7A 4AFNA 4GSKA 4XWYA 3UCFA 1LBEA 3WLEA 5C3MA 4ZQFA 4J4HA 3QLJA 1VL6A 4BKUA 3T4EA 3U4IA 1DOHA 1NHWA 2EV9A 4M89A 5EQDA 1JQBA 1EVYA 3EDMA 5G0VA 2E82A 3CINA 5I7VA 1B15A 3TN7A 3STHA 4WCFA 1R66A 1WPQA 4NZ9A 4B7XA 2X9VA 2UYYA 1JA9A 4INAA 4Q9NA 1V8BA 1TXGA 2CVOA 3M2PA 1H9BA 4J90A 3T7EA 3VZPA 2RHCA 4U0JA 1NVTA 4G5HA 1X7HA 1BVRA 4C7KA 1ISFA 2EGHA 2Q49A 4MVJE 3S2EA 4TKLA 4WLOA 3KXDA 8ADHA 2Y93A 1Y8QB 3MTJA 3JQ8B 4Z0PA 3M2TA 3UOGA 4EJMA 3IQDB 2H6EA 3KUXA 3WG9A 4ESOA 4UAGA 4CUKA 1TI7A 4GSLA 3AWDA 3I83A 1G0OA 3PXXA 2OMEA 4R1NA 4U5QA 3UICA 1EDZA 3R0IA 3JYOA 4J2OA 1M6HA 2GSDA 4J1SA 3K31A 1WXDA 3ICPA 4W9NA 2UUOA 4JBGA 3RBZA 4E32A 2BMAA 3IMFA 2ZYAA 1FDTA 1P1RA 3NT2A 2E37A 3RKUA 3ZNQA 1ADFA 4EZBA 3H9JA 4CR6A 4QQRA 4L73A 5CP8A 3ETEA 4MVJD 5KTKA 2PLAA 3GZ4A 4J4TA 3HB5X 1YS4A 1IE3A 3A1NA 2E48A 2IE0A 4CR7A 5I7FA 4ZGWA 2IYOA 1A71A 2D3TA 4QSMA 3CXRA 5F1PA 3WGZA 1MXFA 4PLYA 5G0UA 1MB4A 4IQGA 2RCYA 1T2CA 4WKGA 2ZB3A 3G3EA 4ZQGA 1QP8A 3VH3A 1A5ZA 1UXIA 1D1SA 3H2SA 4BNNA 2NVUB 4BNGA 1LDNA 2F00A 2FPPA 2GZ1A 5HS4A 3UXYA 2X4GA 4RF2A 2NLOA 4R41A 5H83A 4FOOA 3DZIA 1NPTO 3DO5A 4K6FA 3KM0A 4MVJM 4NMHA 2QYTA 2VYND 3NJ8A 4CR8A 1PJBA 4BB5A 4EBFA 2QRKA 1T1SA 4CM7A 4FOSA 4G81A 5H82A 5GZ3A 3EYWA 1EVZA 1OC4A 3OEWA 3IC5A 2X0IA 2RBEA 3D3EA 4ZHSA 1W4ZA 3JYQA 1N7HA 1D1TA 3D3WB 1UP6A 5K0ZA 5CFZA 5HWSA 4ZN6A 1NYTA 5T6BA 3L6EA 4IJWA 1R15A 4D45A 4J49A 4GMGA 3DMTC 3BHMA 4MVJH 2BELA 1N5DA 2R00A 3CMCO 3RD5A 1P74A 1EK6A 1HLPA 4XB2A 1LSUA 3M1AA 4KQXA 2BI7A 1EUDA 2ZQZA 1Y8RB 4KTTE 2WSBA 3C7AA 2CDBA 1CQJA 1A9ZA 4HKTA 5IAAA 1KVSA 1VKOA 2IODA 1P9LA 2CF6A 2NM0A 2NU7A 3RAJA 3X2FA 3D5TA 4J7UA 1ZKMA 2P91A 1SC6A 3LT4A 1DLIA 3PHJA 4Q3CA 1DBVO 1MA0A 1QXSA 4TVOA 4ROSA 2NVBA 3AUAA 1JVSA 5JYDA 4A0SA 1DC5A 1B3RA 1F14A 4CM8A 2EEZA 4MVJA 1GZ3A 3TZ6A 1C3VA 2X6TA 4DC0A 2JCYA 4Z9FA 3I9OA 1ZJYA 4WJZA 5T8KA 1LQUA 2JFHA 3ZWMA 4ID9A 5COBA 5TGDA 3WSWA 2QRLA 3DBLA 5L45A 3P5SA 4YAJA 4PG4A 3C7DB 2R00C 3D64A 3I4CA 3SBOA 2YV1A 3AJRA 3U0BA 4ZA2A 3OM9A 2FZWA 5F5LA 3D1LA 2PH3A 2DFVA 2HRZA 1NQ5A 3I5MA 4UEJA 3X2EA 3OJOA 5FI5A 1IOLA 3ST7A 1ZCJA 4I5GA 4W7IA 3ADOA 4CMBA 4FSHA 4ND2A 4CLRA 2GPTA 1XDWA 2VYNA 1YO6A 4EDFA 4ALLA 1IL0A 3F1LA 4UULA 4R54A 1U8FO 1YOVA 3GZNB 4UEKA 2JD2A 3ZWXA 3K2EA 3NJ4A 3TZKA 4IIVA 3E82A 1TEHA 2X9NA 3WTCA 4BMSA 2VYVA 4PLPA 3K73O 2QQ5A 4BNKA 1Y9AA 2NUAA 3WOHA 4LRTB 2OXIA 1X7DA 3QW2A 2O2YA 2PFGA 4R69A 1RKXA 4YT4A 1PJQA 2UV8A 3ETDA 4NPCA 4QO7A 4AJPA 1LSOA 1EE9A 3EMKA 3HSKA 4YAIA 4BB6A 1LSJA 2I76A 3LT0A 4YAGA 3B1KA 2Y1CA 4J4BA 3M6IA 1U28A 4M8SA 6LDHA 4YTEA 3EY4A 2PKQO 2XXJA 4IMPA 3OBBA 4GWGA 2G82A 1ISGA 4BNUA 1Q0HA 2OHXA 3IKVA 1R4MB 4J2HA 3RI3A 4BNJA 3TFOA 1R4MA 5FEUA 3BAZA 3R3SA 4K26A 4L4RA 5L40A 3DBHB 1KYQA 5JLAA 1JLLA 1I5RA 4DXHA 4UVHA 4F3YA 1B26A 4IY1A 4Q39A 1HYGA 3NDIA 2O2SA 1XG5A 1HXHA 2OBYA 5KIAA 1MXHA 3S1LA 3SXPA 4JBHA 1FDUA 1GY8A 1W0CA 1FDVA 3E8XA 2PD6A 4I08A 5CG1A 4XRRA 3UKOA 1DJNA 4E4YA 4DYDA 1GZ6A 1LSSA 5DDIP 3WGIA 4M86A 3JD0A 1VLLA 3OICA 3OH8A 3CUKA 3TZHA 4OHUA 1I30A 3EAGA 1N2SA 4R9SA 2DTEA 1T25A 1IZ9A 4NU5A 4BGEA 1T4BA 2E4AA 2VRCA 1YQXA 1W8DA 3GUYA 3MJVA 4YEDA 4J7XA 3QVOA 2UVDA 2J5QA 5CAEA 2NNLD 3UH1A 1T2AA 2JAPA 1DO8A 2OFPA 2QZZA 1V6AA 2VTDA 5FI3A 4IDEA 1O94A 1NTOA 4MKRA 4J7CA 2B4QA 1GU7A 1NVMB 3GG2A 3E5MA 3OJLA 4GMFA 3SJUA 1ZIDA 4D3SA 3NUGA 4P8RA 3FBGA 1QYCA 4RZIA 4WE3A 1E3WB 5EESA 1C0IA 1DB3A 3WMWA 3FNEA 1ZJZA 5EIOA 4CM6A 3PWKA 3F9IA 3I6QA 4ZD6A 2W8ZA 3H7AA 1XU7A 4JK3A 3RVDA 4DRYA 5U4QA 4KTVE 1U3TA 3K8ZA 3GMSA 5F21A 4L8VA 4TZTA 5IG2A 1MG0A 3GDOA 1EFKA 4LISA 5BSGA 3JQ7A 2J3IA 3AOEA 3U3XA 1UDAA 2NU9A 4FQ8A 2O3TA 3UHAA 2X0RA 1XGKA 1A4UA 4WEQA 3QWHA 4RL6A 1WNTA 5LDHA 1RM5A 1O0SA 1H6BA 1MC5A 2VHZA 1XWFA 3VKUA 2GYYA 3IL2A 4XYEA 4MJLA 1ZSVA 3OA0A 2VN8A 3JQ9A 3PFFA 2AG5A 1BG6A 3P7MA 3RQSA 3LLSA 3WICA 7MDHA 4RVFA 1GV0A 4UUMA 4HFJA 1I3NA 2QZ9A 5T67A 3ZV6A 3OEYA 4GX2A 2Q46A 3HQ4O 3KSDO 2V7PA 2HMVA 1UZNA 4U0KA 4GVXA 3AY3A 2A4KA 2Q99A 3DZKA 4XZ3A 2BF7A 1SB8A 2EGGA 1PZGA 5ES3A 4H16A 5BSEA 4XX0A 1BWSA 4O59O 1SNYA 1U4OA 1V9LA 3AU8A 2EF1A 4AJ4A 3WDSA 1P1FA 3RSHA 5I7EA 3WBFA 2YUTA 2GRAA 4BL5A 3DZBA 1XR3A 1HWYA 3GT0A 3I3OA 3W8DA 2PWZA 4E31A 1V35A 4S3MA 4CJXA 5KVQA 4JBIA 3TOZA 2C5EA 5GY7A 3DZHA 1Z7BA 2Y0DA 2YZ7A 3BTSA 2CSUA 3LDHA 4IINA 1AHHA 1XHLA 2DTXA 4J0EA 1QG6A 4NJMA 1ZSYA 1ZVMA 4B3HA 1ZK1A 4E33A 3KVOA 3W6UA 3TF5A 5CDTA 4YJHA 3F5QA 2QW8A 2IXBA 5HA5A 4OO3A 2VUSA 2YQ4A 1LRLA 3ORFA 1SB9A 5KJFA 1A7AA 2VNSA 1XELA 1JWAB 3JSAA 4FDAA 3E9QA 5I9MA 1ONOA 4R5MA 3BA1A 2AE2A 1XA0A 2PD4A 1WP4A 3HJAA 1KVRA 3ZV4A 1D7OA 3FR8A 3ZWPA 1CF2O 3G0OA 2BFOA 3PVZA 4DTIA 1O6ZA 4XIYA 4DREA 1HDYA 1HYEA 4WOJA 4JQCA 1P1JA 3ABIA 1T2DA 2X5JO 4R1SA 3KETA 1H9AA 1QV7A 2ZTLA 4UEOA 3E9NA 3EVNA 4YAEA 2B37A 4IXTA 4K6CA 3HADA 5B37A 2Y68A 3LSYA 1Y8QA 1VPDA 1LC0A 1NQOA 2UDPA 1O9BA 2O3QA 2DU8A 5CDGA 1M76A 2BHLA 2O7QA 3RWBA 5ER6A 5JY1A 3ENNA 5LDGA 4K28A 5DT9A 2C07A 1KVUA 3JQAD 4CLHA 1V3VA 4L0QA 4BNZA 1M66A 3BHJA 2NSDA 4DBVO 5B12A 1I2CA 2OORA 3JD4A 2PKRA 4I5FA 2ZB4A 1R37A 2EKPA 4BO5A 1A72A 1N1GA 2IDZA 2DBVO 3KSZO 4EEZA 3DB2A 1O8CA 1VSUA 3PIDA 1E6WA 1SZJG 2OO5A 1C1XB 5KKCA 4XGKA 3ROKA 2X0NA 1DEHA 2UAGA 3P2YA 1GUFA 4PG6A 4GKVA 1NVGA 1F17A 1YDWA 2Y1EA 1OFGA 4LK3A 4OIMA 3F47A 5G0TA 1GCOA 4X54A 4OL9A 1PJSA 3S8MA 1C1DA 3WBBA 3ETGA 4FGSA 3F4BA 1IB6A 1BW9B 7ADHA 2X58A 2C2YA 1JAYA 2FMUA 3GUCA 3RU7A 4XKJA 2BKAA 3HUDA 2X5OA 1X13A 4YJFB 1JDJA 1N9GA 4DL9A 5MDHA 4TWRA 1JU9A 4FJ2A 4XA8A 3IJPA 3NTRA 4IDAA 1E77A 4P38A 2D5AA 5L7WA 1CYDA 3RC2A 2R2GA 3PQDA 4BS9A 4QECA 5B4VA 5JNLA 1XSEA 1B16A 3W6ZA 2ET6A 4I8XA 2QX7A 2V65A 1S6YA 4CM5A 4BNIA 4OOFA 4CMJA 2EWMA 4JP3A 5KCZA 2G5CA 3HHPA 4A27A 3R6DA 5L53A 5T64A 4FR5A 2WJPA 5F1KA 2TMDA 1WZIA 1KVQA 4U8GA 3CMMA 3ONDA 4JXKA 3HDYA 4L75A 2O4CA 3WNQA 2PR2A 3OQ6A 4TRMA 2HCTA 3D0OA 3D4NA 4AJEA 2G0TA 1TLTA 2EG9A 1CWUA 2B4RO 3PZRA 1PGQA 2JCXA 4ND3A 1P31A 3BXXA 1I10A 2AQIA 1DC6A 3OJ0A 3C1OA 4OAQA 2I6TA 3V1UA 3L0DA 1K6XA 3GG9A 5ER9A 3WGOA 2ZJ1A 2NADA 1ZO8A 3PEFA 2TMGA 3PPIA 5AOVA 5T8KC 4CMEA 4YRBA 3N74A 2NACA 1OZAA 4GX1A 4TRNA 2FHSA 2VRCD 4XYMA 1RWBA 2Q1UA 3NGXA 3D7LA 2D0IA 5JAZA 1U2GA 3TL2A 4ALMA 1TB4A 2XF8A 4GPD1 1PSDA 3JD3A 4IDCA 4CMHA 3GQVA 3QHAA 4II2A 4HWKA 3PLRA 1AXGA 1QKIA 1BDBA 1ONNA 1NWHA 3N58A 1FF9A 4DQUA 3RC9A 2BGKA 5I8ZA 4YDRA 1E1LA 4JJFA 1C1DB 3IP3A 5JMPA 3D5QA 5CHEA 3ZU5A 4HP8A 3ZWVA 2PGDA 5AQ1A 1WLYA 4LRSB 1JW9B 2GNAA 2ZTUA 1I3LA 4FFLA 2B5VA 3GPIA 1PJCA 3IJRA 1JAXA 1U2DA 4OH1A 1YRLA 4OJNA 1GD1O 3D4PA 1UDBA 3ONEA 4DPKA 2J8ZA 1YL6A 1ORRA 3PQFA 1DRVA 3PTZA 3CPSA 3EZYA 3NEPX 3W8FA 3WXBA 4AJLA 3VH4A 3RJ9A 4BOYA 3GVXA 3G1TA 3R1IA 1Q0QA 4CL3A 4A5OA 4C7JA 3K2BA 1KVTA 4NDNE 4DVJA 1XCBA 1YL5A 2VHYA 1IPEA 1EVIA 3H65A 4GL4A 5BR7A 2HQ1A 2P5UA 3U49A 1WVGA 1U4SA 2FPIA 3IAHA 3ROMA 1DLJA 2BH9A 3H4VA 3QIVA 1GUYA 2VWPA 4YT2A 3UCXA 3S2IA 3F5SA 4QFDA 5L4SA 1UAGA 3FWZA 3U4HA 2P9GA 4BO0A 1E7YA 1P0FA 3Q0EA 2JJYA 2X1HA 4CMIB 5TT1A 1YQDA 4O0LA 4CV1A 5JCXA 1ZZEA 3DOCA 4GGOA 1Q7BA 2NQTA 2PZMA 1PGJA 4Z9XA 3NRCA 1NM5A 4NBVA 3AI1A 3FPLA 4S1VA 2IEBA 5B4TA 3WTBA 1Z74A 2EW8A 3DHEA 3KV3O 2O3RA 1HTBA 2GUGA 2ZATA 1HDOA 2PZKA 1QSGA 1QYWA 4N7RA 4PGFA 5T5QA 3CZRA 3VZRA 2VZ9A 2ZTMA 4C4OA 2BFMA 2JD1A 5IFLA 3O38A 4PZDA 3W8EA 3KYCB 5EQFA 3VVCA 3WJ7A 5JAIA 3K5PA 4EUEA 1PL8A 3B1JA 2YYYA 1QR6A 2BLLA 4MOWA 3M1LA 1EQUA 4YJDA 3GC6A 4RVDA 3UFXA 4CMGA 2FN7A 4GGPA 1LLDA 4KDFA 5JBIA 1R16A 4CM4A 1IHXA 4UVDA 3PJDA 4I9NA 1W6UA 4NK4A 2HAEA 2E49A 4IUYA 4KUGA 1R0SA 1Z45A 1I24A 1HL3A 1R12A 4FJ1A 4JLWA 4OQZA 1XQ6A 4IDDA 5KKAA 1LA2A 1HLDA 4GBJA 4AJHA 2D2IA 2HSDA 4YRAA 3VTFA 1LDGA 1CETA 3ZHZA 4IQ8A 1ZMOA 1LTHR 2ZYGA 1AN9A 3MJCA 3KYCA 5JAMA 4DQVA 1ULUA 4NU6A 4B8WA 3ZN2A 4XYGA 4MP6A 4L4XA 4JX8A 4ZRMA 5CDUA 3PWSA 4Y6RA 4E13A 5JS6A 4A2CA 2GZ3A 3AM4A 1BW9A 5IDWA 1E3EA 4CODB 1SBYA 4LSMA 3LT2A 5A1TA 3RUHA 1JWBB 3E6AA 4RORA 1ZNQO 2CNBA 2Q2QA 3C7CB 3ANMA 1I36A 1WMBA 1HDZA 3EW7A 1PZFA 3ANLA 4IDBA 1H6CA 3MOGA 3GK3A 5FFFA 3JQ8A 1AUPA 2NQ8A 5TRTA 4LN1A 4PLCA 1C1XA 5AYVA 4B7CA 1LLQA 2LDBA 3HZZA 3TFQA 1QV6A 5K6AA 1DFHA 3DBLB 1VC2A 5JC1A 4BNTA 5G4KB 4DC1A 2OZPA 2DPGA 2Q4BA 4BMVA 5CDYA 3LF1A 4PLGA 3O8QA 3CEAA 5JO9A 4JJGA 4TRRA 5GZ1A 2DUUA 5L51A 1MV8A 4ND5A 3AOEC 3DL2A 1U3UA 4CV0A 4DPMA 1PJTA 3ZWOA 5G4KA 1CRWG 2YFHA 5JDIC 4ALKA 5KJCA 3K6JA 1Q7GA 3TQHA 1NAIA 1E1KA 4A10A 3WYBA 4BKOA 3EGOA 2WWRA 1E5QA 3CIFA 5A9RA 1EUZA 3MZ0A 4QO8A 3GLQA 4MIOA 1KETA 4D44A 1N92A 3MCVA 5DCWA 3QV1A 1FK8A 3LU1A 4DA9A 4MKZA 3D4OA 1PR3A 1VJTA 3HB4X 3KEQA 4RDIA 1E3JA 3GVHA 1ML3A 4RZHA 2GZ2A 2VOEA 4EITA 1RPNA 4FFMA 1CJCA 2I67A 2VZ8A 4XCVA 3QQPA 1Y9EA 3DFUA 3LLVA 4RF5A 5A04A 5JDCA 2VHXA 4XGIA 2HMTA 1Z73A 1HE3A 2A9FA 1TT7A 3PIIA 4YPOA 3KRTA 5A9TA 1UR5A 2HUNA 1IYZA 1GCUA 4MVJP 1OBFO 2FY8A 3FWNA 3AW9A 1V3UA 2ZB7A 3ANNA 1DC3A 1XYGA 3R3JA 2B5WA 1H2BA 1BSVA 2AQKA 3MWDB 3WGTA 4RPJA 9LDBA 4UVGA 3KO8A 3TDKA 4PLWA 4WGGA 1GQYA 3RKRA 4KMSA 5DULA 1BDMA 2EP5A 3FNHA 4R68A 3JQ6A 1NQTA 4RPHA 3RC7A 4HFRA 4PRKA 1VL8A 4YQYA 4NJMB 3L4SO 5JC8A 5LC1A 1QLHA 4TZKA 1F06A 3V1TC 1KEVA 3AUSA 5GMOA 1KEPA 2GLXA 1YXMA 3IS3A 4NG5A 2NU8A 2ZQYA 3EZLA 1DXYA 4FD3A 4YAKA 3GHYA 3RU9A 4PN3A 1MLDA 1UXGA 4PZEA 5I9NA 4BKPA 3H9UA 3ENKA 3UN1A 4F6LA 5THKA 2VUUA 3ZHYA 1WZEA 2DUWA 3A4VA 1ENZA 3WLFA 4FJ0A 4BNWA 5COAA 4IZHA 2E6UX 1YH3A 1NFFA 5CEFA 3NV9A 5L9AA 2O3UA 4RVHA 5TS3A 4IS2A 5DBIA 3WGYA 3BYZA 2WE8A 4PVDA 3RASA 3GEGA 1QRRA 1EE2A 1B3BA 2X86A 4B4UA 4D0RA 4NNJA 1DIAA 1U8XX 1E3IA 2POQX 3GFBA 5IN5A 4OYRA 2J5KA 4E5NA 4PLZA 1PGPA 3L6OO 4A73A 3B1FA 3WGHA 1V0JA 4E12A 3A14A 4CMIA 5IJZA 3QWIA 2RIRA 2V6FA 2P5YA 1SO8A 4CUZA 3ZV3A 2ZTVA 1B2LA 2P9CA 2VCYA 4D3DA 1HE2A 3DDNA 1P1KA 3ZHBA 1I8TA 2ZCUA 4NHEA 3I9KA 4DQXA 4UUPA 5KVSA 3A9WA 3NKLA 4ILKA 2Y67A 1I3MA 3KYDA 1GR0A 3PI7A 3AUTA 4XR9A 2X7HA 2C54A 4GKBA 4Z0TA 1U3WA 4AJNA 4WECA 4YQZA 1E3WA 1U7TA 1U9JA 3ZZNA 4CLEA 1P1HA 4GI2A 3LF2A 1YKFA 2V6MA 2GERA 5T57A 4B7UA 3K9QO 4EI2A 2HJSA 1GL3A 4GX0A 4ZVVA 4BO8A 3O03A 4BGIA 4CM8B 3JD1A 1K6IA 3WIDA 3FI9A 3TRIA 3E18A 4NI5A 2RH4A 2XPCA 2Y0EA 3HDQA 4U6SA 5L7TA 1LUAA 2EKQA 1RM3A 3LC2O 2W2KB 2FOIA 4FFOA 4MIEA 4HNHA 4D42A 1NPDA 1VM6A 5U1PA 1ID1A 3AY6A 1UZLA 2Q50A 3GOHA 3UUWA 3WSVA 2HO5A 4BO4A 5CDSA 2DLDA 1Q2XA 3GY0A 4BNVA 5JFOA 2D8AA 4FFNA 1P45A 2F1KA 1AXEA 3U4CA 5HTOA 4BKQA 3UCEA 3RBVA 4LMRA 3H9QA 1SEVA 5B4UA 3H3FA 4GQAA 4CQLB 2PZLA 3UAGA 1I2BA 5JW6A 2B69A 1LQTA 5F1OA 3FF4A 5KOIA 3KZVA 5MGBA 1MFPA 2JL1A 1DJQA 2BI8A 4JCOA 1VJ1A 4YBZA 4BVAA 4Z6KA 1NBOA 3DBRA 3DFZA 4AJ1A 4IM7A 3HG7A 2VHVA 1HEUA 1QLJA 3H5RA 3JQBC 3DBHA 3G17A 4HNGA 4UREA 2DBRA 4AJ2A 3C1AA 5JMWA 3OQ1A 5EMHA 4CUJA 1LDEA 3H5AA 5IXYA 5DBFA 4B79A 2ZB8A 5ADHA 2Z95A 3A28A 4BGUA 3HFSA 3GNSA 4PCVA 1Z75A 2FR1A 3DZJA 4W7HA 1P44A 2X22A 1P1IA 4MVJI 1EK5A 4A26A 2BFAA 4BV8A 1B8PA 3BMNB 3ZV5A 3EVTA 4E3ZA 4FGWA 4RCVA 5IDQA 4D46A 1F8GA 1HF3A 4AG3A 3EHEA 5L4NA 1E7WA 1TA4A 5DOVA 3GGPA 2ZJ0A 1O5IA 3JV7A 1PL7A 1Y7TA 4OXKA 4CLOA 4N5NA 3WGGA 1HT0A 1PS0A 4MO2A 4ZQBA 4W99A 3BZUA 3F46A 1LNQA 3AFMA 1R4NB 1X7GA 1HRDA 3DZGA 3PGXA 2Q45A 5JYEA 4E5PA 2HU2A 5K9ZA 1QORA 1ZK4A 3NYWA 4KUHA 1E5LA 2AE1A 1WWKA 3CKYA 4DLLA 1DDOA 3VAZA 3SLKA 1MUUA 3GDFA 3GDGA 3LZ6A 1ONPA 2WYWA 3DEYX 4BO6A 3RCBA 4CM9A 3W4KA 4DUPA 3PGJA 3RUIA 4ALJA 1KEUA 1QMGA 3E9MA 4XYBA 1ISJA 1Q1NA 1YBMA 4D7AA 3RUCA 5A06A 1DFIA 1YVEI 4ALNA 1RJWA 3I52A 1KERA 4G2NA 4IJKA 4KQWA 4XR4A 3TNLA 1HDXA 4UUOA 4KOAA 1EDOA 2GF2A 3ZU2A 3DWFA 4ZQHA 4D79A 2CFCA 3FN4A 2AXQA 2VYVD 4IBOA 5KVVA 2I3GA 1WDLA 1KC3A 1VRWA 1P3DA 3I1JA 4BNFA 2A35A 1HZZA 2P2SA 3E5RA 3L9WA 3FNGA 2H5LA 2PV7A 3U4DA 1Q0LA 3GGGA 4IDFA 2ZCVA 3G49A 3AI2A 1R0LA 1ADCA 4O1MA 4RF4A 4NFSA 4DBZA 5FF9A 3L4BA 4WCFC 1GEEA 4LW8A 2GN6A 2DQ4A 1D4FA 2G76A 3V2GA 1E0DA 4CL8A 3VZSA 3LC1O 1U5CA 1DHRA 4QTZA 3C8MA 3INGA 3JYLA 3ULKA 1K6JA 3GR6A 5DBGA 4BV9A 2YW9A 4Z3KA 1YE3A 5TT0A 3INRA 1TT5B 1LU9A 4IJUA 1ZK0A 1LRJA 2C7VA 2Q4EA 5BSFA 4EUHA 1JVBA 5EPOA 1E6EA 1WW8A 2C2XA 3GHHA 1K2WA 1SMKA 4NIMA 4PLHA 5TF4A 1KIFA 3AM3A 5IDYA 1S7CA 3GFGA 1MC4A 1PZHA 4R01A 3I9MA 2Y0CA 2HMSA 1E3LA 1VI2A 3WR5A 2JD0A 4BO2A 3D3WA 3PYMA 4NK5A 5BNIA 3RFVA 2IYPA 4OXYA 1BXGB 1ENYA 2VQ3A 1LDMA 3HDJA 4JROA 4JIGA 1H94A 1I3KA 2GGSA 3DBVO 3ZNOA 3BMOB 3AI3A 2FPGA 4PLVA 2BRUA 1GFSA 1E6UA 1ARZA 1XEAA 2VT3A 4M49A 3Q2IA 5A02A 2WEKA 4ND4A 2Y1GA 4EGFA 4Y8VA 1ZW1A 2PY6A 1HDCA 4LCEA 4J1TA 3H9GA 1PQPA 4FS3A 4O6VA 1HSOA 3WWZA 1LC3A 2AQ8A 3BIOA 5JE8A 5K6AC 1KS9A 2JFGA 2EERA 2FP4A 2XOXA 3N7UA 5AVOA 5G0SA 2IZ0A 3BMCB 2IZ1A 2HKIA 4RLHA 2P4HX 1PU2A 4URFA 2YDYA 3PDUA 4OGWA 4AVYA 2G1UA 3JTMA 3MJEA 3W4JA 4WOKA 4WUVA 2OL4A 2VTEA 3V2UA 3A06A 5DOZA 2Q2VA 1CDOA 1A27A 2FSSA 4P4NA 4YRDA 4AL4A 3NGLA 4KDEA 2JHGA 1YB1A 1J4AA 2AQHA 1N1EA 2WDZA 4N18A 3ZCXA 3TSCA 4QEDA 2I66A 5CPFA 4XQGA 1MG5A 3IUSA 3GZNA 3NDJA 4BNYA 4R3NA 4UUNA 5L3ZA 5A4DA 1HETA 2Q2WA 3L4BC 2AEJA 2GASA 3QJ5A 3AUUA 2ZIZA 4DIFA 2C5AA 4J6FA 1IUKA 4QXMA 5A3JA 1QYDA 3B20A 4HBGA 4P22A 4HX5A 3JYNA 1FDSA 4OM8A 5IDXA 4L74A 4TRJA 3RFTA 2DKNA 3GVIA 1YQGA 3TZCA 3O9ZA 2J6IA 1ISHA 3OJEA 2PGLA 4DWVA 3QVSA 1A9YA 3WS7A 2CMDA 3B6ZA 3CSDA 4MP8A 4KWIA 3C24A 3QWAA 1ENPA 5EERA 4AJIA 3NTQA 1ADBA 2A94A 3W1VA 1YBAA 1GYRA 1SEPA 2O3SA 3UW3A 2NTVA 2AW5A 5L95A 4Z3DA 4H3VA 3RBXA 3BTVA 1T1RA 4TMFA 4RV9A 2HK9A 4YWJA 2Q1TA 4WNCA 4XQCA 2D1YA 1IY8A 4O63O 2DAPA 3AU9A 3FCOA 1P33A 1Y81A 4OSOA 4TSKA 2QHXA 3FHLA 4B4VA 2AG8A 3ZI0A 1LRKA 4YYZA 2H9IA 1LDYA 3WIEA 3OFSA 4FC6A 1NASA 1AGNA 3QVTA 1HZJA 3UVEA 2H63A 3KHUA 3PWZA 4PG7A 3WQQA 5JO0A 3FR7A 3H5NA 3VHRA 3ON5A 5DN9A 3ZU4A 4Y6SA 3HN7A 4R3WA 3E1KA 4WLFA 2IXAA 4JN6B 3NT5A 2YHIB 4F46A 1UXJA 4AJOA 4F45A 4WPGA 3VH2A 4H15A 3WFJA 2Q3EA 1P0CA 2CUKA 3OA2A 2FWMX 1EEHA 1U7HA 2OBNA 3K30A 3LVFO 4FIZA 5CEJA 1GV1A 2PNFA 3DOOA 2EJVA 2FR8A 3GH3A 2AA3A 3JQFC 3ZWBA 1L7DA 4GWKA 1EZ4A 1LXCA 4PFJA 4K9DA 1I0ZA 3LT1A 5IZ4A 2J3HA 1UXHA 4J1QA 4PLTA 3CTMA 3GAZA 4XQEA 1K0UA 1SCUA 2NVUA 3WGQA 5JDIA 4CMKA 5F5NA 1I33A 4RVSA 4Z0HO 1UP7A 4LMPA 5C7OO 2Y1DA 3KLMX 1SOWA 1E3SA 2BD0A 3OIFA 4ITUA 5G2OA 3GF4A 2Z1MA 3FTPA 5A9SB 4M55A 3JQAA 2GN9A 2PZJA 4NQZA 3SLGA 4YJFA 1GPDG 1NX6A 3ZNPA 3HWRA 3BMOA 1NP3A 3BMQB 4TVBA 4ZU3A 1CEQA 1DRWA 3JQCA 1NXQA 1M6WA 1QYXA 3L07A 2DM6A 5A3VA 2J3JA 3C3XA 3ASVA 1YOVB 5A5FA 4BIIA 1GYQA 1O89A 4ZJUA 1GYPA 3GNQA 3IIEA 1LLUA 2I9PA 4B3JA 3ZDFA 4J9VA 4BNLA 3GRKA 3H3JA 4IS3A 4CLRB 1VKNA 1NQAO 2X9GA 2CD9A 1N8KA 4J43A 3WYCA 1XKQA 3PQEA 4HUJA 2QYSA 1F0YA 2W4QA 3AY7A 5BSHA 1P77A 2V6BA 2PH5A 1H2HA 3OMLA 4BGVA 4YB8A 3FNFA 4N5MA 3DAGA 5TNXA 2JCVA 3QWBA 1T24A 2O3JA 4FFRA 1K89A 1G1AA 3V1YA 3HFGA 1H0KA 2VZ0A 4HXYA 4AJJA 2B36A 1G6KA 5ENDA 2VWGA 2XAAA 2GN8A 4HFNA 4XYLA 2Y66A 1B0AA 4KP7A 5HBRA 1DC4A 4WCFB 4HV4A 1DSSG 3DONA 3JQBA 3Q2KA 1K3TA 1R6DA 1C14A 4A03A 3FD8A 4D3FA 2X5KO 4M1QA 1GDHA 3HN2A 1KBZA 4KWHA 1X15A 1B8UA 3VPXA 3PHLA 1YONA 5AXBA 4OKNA 2EKLA 1J49A 2O48X 2R6JA 4JP2A 4CV3A 1M67A 3UF0A 4CV2A 2D4AA 3KB6A 3CE6A 3ZGYA
chains in the Genus database with same CATH superfamily
4JT2A 2IBTA 4PX9A 1S5PA 2R66A 2C3YA 3C4QA 1YB7A 1T4MA 4NBWA 1FLNA 4GP6A 4RD1A 1OMOA 3IP1A 2JHAA 4NARA 5BWBA 2F3PA 3E9CA 1SPXA 2X40A 3OUUA 3PEYA 3SNHA 4YR9A 2C2BA 5BVGB 1A5SB 3G2PA 3RIHA 4F2HA 4B3MB 3SEFA 1U63A 1YCDA 1ONSA 2GHQA 1LF0A 4C7BA 1EWKA 3ITKA 2HJRA 4JLMA 4IIJF 1Y5RA 3OJWA 3ZK7A 3UMJA 3CN9A 4IIYA 4MIYA 3RUDA 1IBMB 3IDAA 2K2WA 4J16A 3OIDA 3THRA 2PYZA 1EVKA 1VCHA 1BZYA 2YBEA 4YACA 1TCBA 3H4TA 2PYIA 4N54A 5B1DA 3WRWA 2XUPA 3MFYA 1PJ2A 1WZNA 3BMQA 1CY0A 1H6AA 2A14A 2PJUA 4YJHB 5F9HA 5DCLA 4CI0B 4G0VA 4M98A 4Q9JA 3TTUA 3DHNA 3KDAA 3T0GA 1R6BX 1YS6A 3WB9A 5ITSA 3H2ZA 3WP0A 4OKSA 3PPVA 2DPXA 3FTNA 1F6DA 4UTVA 2AMVA 3NC4A 1LDBA 1OIVA 4RU1A 4TSFA 5FUWA 3V8BA 1I3CA 4HAUA 3VTZA 1ABBA 2NU6A 2QTAA 3ZW8A 5DM70 3OEED 3MXTA 4FNGA 3MC1A 1IPHA 2XCQA 1PL6A 2XJ4A 3R77A 2XUJA 2FE4A 4XRGA 1F20A 4WESB 1IVSA 5TJ9A 3RUPA 4ENSA 5HMLA 2ZCJA 4C3ZA 1AURA 1LPAB 1ZH8A 1G5TA 2F3RA 4Q1CA 5DCUA 2HHLA 3DR3A 3P2OA 1CUIA 1JQ3A 2O50A 3PYXA 2IKSA 5AI0A 1XTBA 5AM5A 4ZCSA 5KJ1A 1CY6A 4QZVA 2V7QA 3M4JA 5KTMA 4TLEA 1NW7A 2VAPA 9GPBA 2WYUA 3I62A 3TDMA 1EG2A 3IUYA 4BHTA 5B3LA 3L77A 1PI3A 2O5EA 1RJDA 3D0KA 3ESBA 4XQ9A 5BQFA 1W7AA 1OC2A 2WHQA 1Q1ZA 1BE8A 3G2IA 1V5FA 4TQGA 5AKJA 5K3FB 1BJRE 1T3TA 1N32B 2O19A 2IU4A 3R2JA 4BB9A 2VQFB 2YMQA 3B82A 5ALYA 1VJRA 4M54A 4H7PA 3DHYA 4Q24A 4KGZA 1WX1A 4B09A 4RFSA 2CV1A 4ARAA 2AEEA 3M3HA 4LRWA 3G0GA 3PP8A 4LOHA 3G8YA 1UJMA 4PG5A 4BAZA 3LC7O 4RNCA 4RO0A 5JNVA 1QCCA 4ZRNA 1TNDA 2H0QA 1TVKA 2C59A 3FOFC 2D4HA 3ADDA 4CM3A 1ODSA 3OOEA 3D6UA 2ON6A 1XA3A 2VHUA 3NP7A 2QE7D 2W90A 4DCGA 4DA8A 1ZN2A 4TL7A 2YIDA 3PNPA 3ZE7A 1GNPA 1NJ6A 1X92A 2OLEA 1HNNA 1JKFA 2NYUA 2ZDHA 4FOPA 4HAIA 4AY2A 1EFHA 2PTGA 1OH6A 1DELA 3VZCA 4J29A 4E2WA 5IU6A 2BKXA 2GFQA 4FYJA 1JKIA 2YQZA 2WD7A 1X14A 4N82A 5DHUA 1L1EA 4BZPA 5I47A 3CLHA 5EE1A 4JKYA 1CR6A 1NOKA 4KPUB 1DG1G 2JI8A 3U7HB 4G0WA 3SPXA 2REXB 3TEJA 1M1NB 5HDBB 1IMOA 1G21A 3OKPA 3AP2A 4HD8A 3FIJA 4NBRA 2IA5A 3RIYA 3ELWA 4OQ4A 4YV2A 4HTFB 4W5QA 1XLTA 4L16A 1JTFA 2C5GA 2VWQA 3NHLA 3H9CA 1UANA 2HWUA 3AP1A 4OP3A 2HY7A 3RS7A 1E20A 4JSTA 1PDVA 4TL8A 3DLTA 3WXMA 4CIBA 1U7XA 4HNSA 2WTBA 2EHDA 2XOKD 4X45A 4B4WA 3SIWA 1ISMA 3CH5A 2FVYA 1A8QA 3DVRX 3DYVA 2I3AA 1UBLS 2XEXA 3VBEA 3J81A 4ITRC 1FXWF 2EFHB 1JNYA 1JPJA 1NF8A 2EW2A 3FZGA 5ALUA 1SXJA 2VDRB 3VHXB 4D9GA 1A88A 3WZ2A 3ITEA 2RGNA 3IAM1 4RQUA 3TM5A 4CPDA 1BROA 1WD7A 2ZI6A 3HO6A 4D6XA 4US0R 1NURA 4XQ0A 1CJBA 3U9LA 4R6WA 5B6JA 3A1TA 4DR2B 1Q0PA 2CZCA 1ZAYA 1OFVA 5KVAA 4BBAA 3E7PA 2XGOA 4ZYTA 5FUYA 4YA6A 4RQTA 4Q9KA 2QAIA 2GAJA 1B8VA 3VX3A 1SBHA 3A1CA 1RI1A 1WKBA 4YRZA 1WR8A 3CZPA 4QDOA 3B6JA 3H75A 1SCNE 3HUTA 2Z8XA 3V2HA 3FPCA 3LT5A 3O4RA 2PE5A 1ZRSA 1XMOB 3FPGA 1AGYA 1K88A 5CPBA 4DYVA 2QX8A 2R60A 5HK9A 3U7GA 4WN9B 2ZI3A 5JJKA 1UFOA 1MFZA 4XVQA 3RRYA 2GK7A 3DMGA 3OF2A 6REQB 4PNHA 4AJKA 3COSA 2VDLB 1V5WA 1DAPA 1PFVA 1T43A 4ZVKA 2OXFA 4UEQA 1KYZA 2W70A 4BIMA 4ZI3A 3W5SA 4EHBA 1JH9A 3SYMA 1NULA 3BULA 3I8OA 2PZFA 3JWHA 3Q3VA 1JLLB 1NR1A 4FQ7A 4HRVA 4MYHA 3VJLA 1DT5A 4M83A 3ROPA 4CN8A 2YV2A 3I64A 1DXHA 1QPGA 7REQB 5AKGA 4BKMA 1VE5A 4OSPA 3T35A 1NJSA 1NL3A 4ZAVA 2ILVA 4ZT4A 1C29B 5FFMA 5LP6F 5KNLA 7MHTA 1F38A 2BIFA 3IEPA 4MS1B 1CRLA 2HCBA 2ZE6A 4IWYA 3OTOB 1CUGA 4RZ3A 3SJ7A 1TLLA 1UUFA 2EYUA 2XIJA 3S5UA 3BTUA 3D3QA 2GPAA 3P2JA 1K86A 2J6HA 3L46A 4PYOA 4R83A 2DPHA 4MVJF 5EPUA 3WQRA 3I1FA 4YP7A 3V4LA 5DGCA 4NDZA 4ZHQF 2DR2A 2GLUA 3TIGA 2J7PD 4B7ZA 1OHHD 5LLTA 3NEAA 1KI2A 4G65A 4DQDA 3GEMA 1OI4A 4EGSA 1U99A 1IZZA 4NFLA 4PZ0A 4DMRA 5C7LO 4FR2A 5KSPA 4WCVA 2JFFA 4W6ZA 4UVIA 4YMSA 4YJGA 2OILA 4E5MA 5JFTA 3OEEA 2I8AA 4NS1A 3AHCA 4E1VA 3W5VA 1TYZA 2LD4A 2YUIA 4P32A 3UT5B 4YV7A 1BS1A 3VPHA 4MINA 1YA6A 5FAXA 3OETA 5FWNA 1XIVA 3S6JA 1O95A 1P62B 1WQ4A 3MLBA 3GJ8A 4FCCA 3AR6A 1Z08A 3KU1A 2LVBA 3OT4A 4PLFA 3LLUA 4QXPA 1FRQA 2ZQ5A 2O6HA 1XDBA 2R6FA 4L7VA 4BRUA 3MWEB 1C0EA 3AG6A 1RM0A 2HEIA 4UCXA 5H3LA 1AB6A 2OUKA 5LQSA 4UBJA 5BVHA 4WEOA 4E22A 4BJ3A 3UAOA 3WLOA 3FKSD 3W7BA 4CI9A 4OHRA 3PF9A 5EZ6B 1NMSA 1U7DA 1MO6A 1UZMA 2GARA 2I80A 4NU8X 1EPUA 3IVAA 1O0BA 1W5EA 2OTCA 2P68A 2ONZA 5LMCA 1MRNA 4LYJA 1OI7A 2CN1A 1SA0A 4MW0A 4A6EA 2B7LA 3VO2A 1O0CA 3JQGB 2QV7A 1WF3A 2Q4TA 4QOJA 1J6UA 3HBAA 2P0EA 4QJ5A 1US8A 3SBEA 1PFUA 4X8MA 5HQTA 4ECEA 1MP0A 4REQA 2YWJA 5H81A 4EM6A 1I1OA 2RAFA 3CXUA 3I5UA 2WICA 1MAUA 3CCCA 4G2TA 3VV2A 3W05A 5F3DA 3HGQA 4JVLA 2G07A 1W5BA 3KOYA 2OGWA 3BTOA 5LZ5A 1N7GA 4D9IA 2DPMA 1QHIA 2AV6A 4ZVSA 4DY6A 4B82A 5AM3A 2EJBA 1U6KA 3CS3A 5I01A 2JGFA 2ZZKA 1FUIA 3V8QA 5FWYA 1NHGA 4HQ0A 4G36A 1DKPA 1G8SA 3ZE2B 2EJTA 2HA0A 2NQ2C 1T15A 2AF4C 3A3OA 3B3JA 7YASA 1PR9A 4CGYA 3RS9A 3FWYA 1UFKA 4G84A 1EX9A 5AKEA 5BN4A 1EXVA 1PS9A 2HBQA 4Q3DA 4AP6A 4Z4CA 4A7PA 3KR2A 4AMGA 2H7XA 2JVKA 1QGED 4ZK2A 5E2BA 1J24A 1MOQA 1Q3KA 4G1UC 4JKIA 1ZXLA 4RV4A 1CJVC 5DYTA 4KACA 4QDKA 1XJQA 1ZNXA 2YKGA 3AVWA 2ZK7A 3KBBA 4IEFB 4KQ6A 2VJPA 5AHXA 1JPNA 3QMPA 4RKQA 1GPBA 1E1NA 5TC4A 3VU1A 2C7QA 4HF7A 1DCKA 4U6QA 1HEYA 3ETJA 3UO8B 2W2MA 2OHIA 3ZE9A 3Q8KA 3GN1A 4LXGA 4UATA 5JJLA 1E5VA 3KTAB 1TTTA 4IJVA 5T3UA 1KSGA 1U1EA 3U44A 2JHFA 4KZKA 3GFOA 1OH5A 1KXJA 1FLVA 3GMDA 3Q6IA 3OX4A 4IHJA 2RD2A 5KNBA 4B33A 3P9KA 4O2BA 4B8ZA 3AF1A 3DM5A 1P6UA 1V7ZA 3OP4A 2WWIA 4H6PA 3RFXA 1L7RA 3UK1A 1GPJA 2WHYA 2XMDA 3PEUA 2X1LA 5F9MA 3KVNA 1D4OA 4IRUB 4HBZA 1DQYA 2AX4A 1SBIA 4U63A 1YDEA 4FLFA 4HLNA 2RGDA 1GEGA 3HYRA 3JQFA 5LMUB 3RVJA 3PZBA 3JS5A 2QBYA 1E7RA 1DHTA 2AHOA 2PRJA 2XV1A 5EUCA 4DV6B 1WZCA 4OU5A 4EJ0A 2IYRA 4LVCA 3V34A 4IGFA 4MHOA 4YUAA 2QP4A 3PF8A 3ORQA 1POWA 3VR2A 1CEEA 3DF9A 1K63A 4RS3A 2WTUA 2G36A 2GZSA 1UBSB 5EHNA 1EUQA 5AH0A 3SEZA 3ROFA 5HILA 2CXTA 5HRUA 1JKJB 4I6EA 1PQWA 2RAPA 2O23A 1L5HA 1E7MA 1QGDA 2X15A 3M1YA 5F7JA 3NAQA 4G5RA 3ABQB 4ZCMA 3UIEA 3I9V6 1VE9A 2BV3A 2C98A 2I1WA 1BX3A 3LECA 3Q8XB 4MEBA 1HYQA 4PZCA 3PNBA 1OFIA 3ZGXA 5IS2A 5TY0A 3HR4A 2BGLA 3CO5A 3O95A 1ZM2A 2ASEA 2F8TA 2PSEA 1GSHA 4BLOA 1X42A 5C3UA 4PZUA 3ZIAD 1VIAA 1DS6A 5LBIA 3SSMA 2B35A 4L8FA 3IAAA 1JMVA 2V7XA 5B6IA 4LJYA 3T1OA 1XVVA 1ZIXA 4QDXA 5EXPA 2H54A 3FCCA 4AB1A 2W7TA 6ADHA 1G64A 2MSCB 3CRQA 2J59A 3H83A 5C8DA 4D41A 2LUOA 4D0SA 4G56A 1HY3A 4KR9A 1W73A 4K6GA 1RKQA 4Q01A 4QUAA 3WNVA 4OREX 4LF9B 1CRPA 3OQJA 2R6ZA 5GONF 3HCWA 3LDUA 4DLAA 3Q7SA 1R0RE 3C3KA 3IUPA 1Z0UA 2YVAA 4TSRA 5K99A 2ONKA 1DXQA 2FCAA 3EF3A 4GT1A 2ZIXA 4NMXB 5J40A 2CW5A 1JFFA 1JX6A 1W29A 5E0OA 4WXHA 5FWYB 4GMKA 3UMMA 4JI8B 1KAOA 1QCZA 2A1UA 2NYVA 3QPCA 2C20A 2PX3A 2VI5A 4KN6A 4DNQA 1TVEA 3BF7A 5AR1A 3ZIUA 3TZLA 3TTSA 1CE8A 1FNCA 3C3AA 3MGKA 3UWPA 5KYUA 2QN8A 4D4LA 4XGRA 4FYKA 5AVJA 4XUGB 4Y67A 5EJ2A 2NGRA 3EBOA 3HJUA 1EESA 2G17A 4GLOA 4J0DA 4FX5A 4NOLA 1QFSA 3EGWA 2AEMA 2WU3A 2WBLC 3BXOA 2DTDA 3UAZA 1STOA 3AB7A 2JH9A 4CKZA 4MUXA 2GXSA 3U3JA 3DR5A 3WLTA 2PGJA 2QD4A 3C6ZA 1ZCBA 1I4TD 2FQYA 4S2EA 1IIBA 1IK6A 2KX7A 4GPEA 4QXAA 5BNWA 2OK7A 1RQNA 4RLSA 4KOEC 4C0WA 4PRLA 1EB9A 4PSUA 5A4MS 1J7JA 4M53A 2I7VA 2P4QA 3RS2A 5YASA 1VHTA 5KYYA 1X7YA 5U9CA 2DQZA 3F7NA 4HWRA 2RGCA 4CKCA 1V16B 8LDHA 2PKXA 1C4OA 2Z0MA 2AOTB 3ZLTA 5CTJA 4B5LA 1Y9JA 1TW2A 2EG5A 2PUJA 4UVEA 2Q1WA 3SZGA 3NHAA 4PGHA 3A3YA 4LHSA 4ZTZB 3IESA 2XUGA 4X20B 5KWEA 4P0TA 3U80A 4YASA 4YIHA 5F1YA 1CNMA 3KU4A 1GGFA 1II8A 4HPWA 4AXXA 2VK2A 4ZEWA 1VA5A 1KPIA 5AK5A 5E1BA 5CFMA 4AQDA 2SCUB 2ZBGA 3BBPA 4YJGB 2VJYA 3Q1LA 2HYIC 1Q3HA 5H70A 3H8JA 2M2IA 3LRTA 5EAIA 4J1GA 3EJWA 2BGMA 2FWAA 3PA8A 5JAUA 1BU8A 4LTNA 3T7TA 4RK6A 3INNA 3TLBA 5KTRA 1YB5A 3A4NA 3GAMA 3SE0A 1GUAA 3TM4A 3ZWWA 3H1EA 4C4TA 5IWCA 1KSHA 2WK1A 1VYUA 4Z2AA 5KQLA 3FOBA 1NXVA 5AOAA 1E92A 1RPJA 2JLSA 3L7YA 5F3RA 4PINA 5AJYA 4DSOA 1A2BA 3WYNA 1LV8A 4KG7A 3ASUA 4CM9D 1VJGA 1XXHE 1EFTA 5BWMA 1QGZA 1OAOA 3W9SA 3UTCA 2WAAA 4D81A 5DFAA 5KDOA 4TKMA 4E0BA 1XU4A 5D7BA 3QIAA 4RPCA 1S8AA 4Z9YA 3F5DA 4P4LA 1ULSA 4MYDA 3HXTA 1L4EA 4YFYA 3W06A 1W36D 1GPYA 2FHPA 2Y05A 1T0UA 3HBMA 3N7AA 2EZ8A 4KB5A 1U0LA 2OY0A 2C7BA 3OQVA 2I7TA 2SNIE 3GLIA 5GJBA 3V6LA 1SVWA 2ZYWX 4KO2S 3Q5EA 3FSEA 2GJ9A 3QBJA 4MW6A 2W6ZA 2I4IA 4JL6A 2C0CA 4K03A 3TRDA 1SVUA 2RC6A 2WKSA 3MWDA 1NMXA 2V9CA 2R68A 4CQLA 5CFPA 4DEXA 2MMGA 5JSUA 4DA7A 1JIUA 5CLIA 4DABA 1VL1A 4DFDA 1QBKC 1SUWA 5IT5A 2XB2A 5CXXA 1QH8A 4JJ8A 3MJSA 1BE1A 4HXFB 1B74A 1K5GA 3MHTA 2HHAA 1BIFA 1DRUA 1TYCA 4B6OA 5J2TF 3WMEA 4KV9A 5FADA 4L76A 1EFLA 1HDRA 2QG6A 1T9AA 2PMWB 2BM0A 2XUOA 2D2VA 3PPXA 4II3A 4LGCA 5C1IA 1YS1X 3P9PA 4L6AA 3ZIAA 1ZBQA 4N9QA 4OMCA 1VE1A 3RABA 1M9NA 3NCTA 2W00A 3ND9A 4IIUA 3KOUA 4U7WA 4AMYA 3ZD6A 4F84A 3NHRA 4DLUA 1XDUA 3TPCA 4WK6A 2Z8YA 1OY1A 4ZVQA 1EX6A 2E7ZA 1BVUA 2W6QA 1ZH0A 3F3SA 3OZEA 4HZGA 4MAAA 3IAS1 1YB6A 3NU1A 4XUEA 1OWOA 4Q3LA 4R8KA 1SPBS 5DYNA 2XECA 4EY3A 1CQWA 2I6GA 3ZUGA 4HWSA 2NUBA 3EQ9A 5F2KA 2PMCA 5ADVA 2UXDB 3A6JA 2Z57A 1H0SA 5C3MA 4ZQFA 2R87A 2OZLB 4Q34A 3T95A 1DOHA 4IMIB 1OSNA 2ZVPX 3MXOA 3PFBA 4IQFA 4M89A 4CHTA 1K7XB 3CR3C 3GJ4A 4R8VA 3WOVA 4C4RA 3DKRA 3FYUC 1B15A 4PICA 4XXHA 3GA7A 2A7XA 3STHA 1IBKB 4WCFA 2FX3A 4EBBA 5FLXA 1JA9A 2VA9A 3DE4X 3ZLUA 4B85A 1D03A 2CNDA 1SQSA 2Q28A 5KOHB 1Y6ZA 2NOAA 4WBNB 1DDIA 2AMYA 4GZ3A 1R74A 1H9BA 4P3YA 3TFWA 1JA0A 1NVTA 1X7HA 1W4LA 1Y1RA 2IUYA 4FX2A 1ISFA 1DKOA 3P9YA 1Y7PA 4MVJE 3M49A 4TKLA 3S2EA 2V7QD 1XD2A 4Q4LA 2COKA 8ADHA 3JAWB 3UOGA 5ALPA 3IQDB 4DDUA 3WLQA 3ZC3A 4FYXA 3KUXA 1D5WA 1YS9A 1TVKB 4HYQA 4ESOA 1DX6A 1XZGA 1FFBA 3AWDA 1NI5A 1RVDA 2AWNA 3PXXA 3UICA 4DOMA 1S8NA 4INJA 3VKFA 3PNSA 2IV2X 2GYWA 4TLLB 3AKDA 1JEYB 1E2UA 5MF6A 1D6NA 4LZAA 4P81A 2Y71A 5AHKA 4YMUA 4OP2A 3IIIA 1LQ2A 2P2GA 2EC5A 2NUTA 3I6ZA 5IAOA 2AFVA 2FTKE 3L7NA 4OHWA 2AC4A 1LTQA 5HGXA 2PL3A 4HXEB 4N65A 4NAVA 3SJCA 3SU8A 8MHTA 4IEEA 3UMVA 1ADFA 3H9JA 1SC3A 2IEAA 5DM60 4C03A 4FUQA 1TUBB 5K0GA 1PVVA 3I3SR 4MQUA 4GLJA 4MVJD 3GZ4A 4J4TA 2O2ZA 4L95C 5J5AA 3VNUA 4RQBA 3MJFA 2IYOA 2D3TA 4KHZA 4UXJA 1MXFA 4GEGA 5G0UA 3L84A 4IQGA 2BDEA 1T2CA 2CT8A 2BTQA 3G3EA 2VP3A 3QELB 4Y1GA 2WJIA 2XUFA 3M4XA 2C2KA 5AJVB 3FIUA 4Y6GB 1X8LA 3WE7A 3K5HA 5LQJA 2V4MA 3GBVA 3TBFA 1CBUA 4ZPJA 1QRSA 4OLFA 5EJMA 3T7JA 4R41A 3VPDA 5H83A 4ES6A 3SZ3A 1MAHA 3DZIA 3R7SA 4EX7A 1N2EA 3M6XA 5DHQA 1P19A 3DE6X 5DNVA 3MOSA 2QRKA 1V8PA 3FYCA 3ND8A 2X1VA 4FOSA 4G81A 4F4HA 1A69A 1W44A 2JG3A 3QXCA 5H82A 3OEWA 3KKEA 4ZHSA 2ASVA 3JYQA 4EHJA 2J4CA 4ZAYA 3ILYA 2H4WA 2CK3D 3QU7A 2FPRA 2Q3FA 4L57A 4LNAA 5AJZA 1AK2A 1E9CA 5F5XA 5IC6A 4TV8A 1YS7A 3IEVA 1HUQA 1JHDA 3BDVA 5K3AA 3V8NA 5HK8A 5DNWA 3CUUA 3HPRA 1QOZA 4BDTA 4UNQA 3VFDA 2E55A 5FO1A 2PT7A 3KQNA 1GDDA 4C4YA 1HLPA 4PYRA 3M1AA 4KQXA 1QFZA 2H5EA 3FOWA 4KTTE 3T06B 3UHPA 4DLVA 2G06A 2Q5IA 1R6VA 3AFOA 2KSQA 4WI1A 1XAIA 1A9ZA 2WZDA 3IOBA 4HKTA 4Y2RA 1VKOA 4IMJB 4OQQA 5EJGA 1NUSA 1TRHA 4QBIA 3H5WA 2XGMA 3W5UA 4B0OA 2DECA 2Z58A 4C6RA 3ML1A 4A1FA 5HIJA 3EHDA 3TQFA 1MT3A 2WTAA 4J7UA 3TH5A 2YVLA 3DV0B 4TT3D 4UAUA 5HG0A 1DBVO 2C77A 3TIFA 3ZQJA 4ZTUB 1DX9A 2P9BA 5L3VA 3AUAA 5AVYA 3SY8A 2O1SA 2IBSA 4WBNF 1QC5A 3GYBA 4WXPA 2BBTA 4WKBA 1F14A 3RVNA 4D26A 4DMUB 1Z6XA 5KINB 4BC1A 5FV4A 3HLTA 4DJTA 4F5WA 1XTPA 1C3VA 4KX3A 3TXXA 4DC0A 2CV2A 4OHKA 2JCYA 4QRDA 4Z9FA 2VO1A 3I9OA 1ZJYA 3GD5A 4BP3A 1N2IA 3LUKA 1KBQA 4YJ2F 1U7WA 4Q7JB 4ABTA 1AXRA 2GCIA 2DCMA 3FVWA 5JROA 4EARA 3EVAA 1VGRA 5L3RA 1BN7A 4CT5A 4DJ5X 4ZI2A 1SQFA 3I4CA 1SHLA 3LCMA 1TZCA 3K0FB 1V39A 3LO5A 4H08A 5FR2A 5FTJA 5F5LA 3U0BA 2OK8A 3V46A 4DSNA 5JQWA 2HRZA 3X2EA 3HL0A 2ETVA 1K7EB 3CF2A 1NW8A 2WIGA 4U8HA 4EPTA 1E64A 2I33A 4JVOA 4RVNA 4ND2A 1FXWA 4M22A 3K70D 2VYNA 1PFYA 3N75A 3SHOA 1HZZC 1W25A 2ZT7A 3U60B 4QWMA 4CT0A 1OKKD 1WDTA 1YDFA 4ALLA 4IG9A 1IL0A 1W46A 1V95A 3ZWXA 2JD2A 4OVKA 3OT1A 2WWXA 3S44A 1YHZA 3G0BA 4BMSA 2VYVA 2ID8A 4LZPA 3K73O 1Y9AA 4G9BA 3LPDA 4RMIA 5IJAA 1IXRC 2C9DA 4LRTB 3TCNA 5H4HA 3DD5A 4NV3A 3W1EA 4QAQA 3CYFA 1TIPA 4WY8A 2R62A 5FBWB 3ZHQA 2AKEA 1CDEA 1N6KA 3CH4B 4BFYA 1KH3A 4UOEA 3BRWA 1PJQA 2SKDA 3ETDA 1Z2DA 2VUIB 2C5FA 3UMFA 1FDOA 4QE3A 1LSOA 3HSKA 4RCYA 5A2QA 3MTQA 4BB6A 5M2QA 1PQ4A 3RH0A 1XROA 3ZU6A 4HQFA 1IIRA 2KW5A 2QQ0A 4MNTA 1M0SA 1X1QA 4IHAA 3ZJUA 2FR8C 4DIKA 2VS1A 2YY5A 2ZJ3A 6LDHA 4ZT7A 2GD2A 1EJ2A 3EY4A 2PKQO 2QV0A 3F74A 4ND7A 4YRJA 1CRZA 5JV5A 3EXEA 1S8FA 2GBCA 3FMPB 1W47A 3BG5A 3PQ7A 4GICA 4ZU1X 2PGIA 4PHCA 1QF7A 4R2MA 1CY1A 1GTL1 3IKVA 5D5PA 1MTOA 3GCGA 3TZBA 1USKA 3GLFA 2QX6A 2HIHA 4D9FA 3ZW7A 1FFCA 2H2FA 3BAZA 3GD7A 3PG5A 4UE3S 1Q44A 5L40A 1XZ8A 2QORA 3QOYA 5JLAA 5LIPA 5H68A 5KO2A 2VJNA 5CVUA 5HJEA 3AVTA 1T3GA 3HA2A 3KLBA 3ZY3A 4LZZA 2R47A 2V4UA 4RD6A 4UVHA 4DXHA 1CHDA 1W0JD 1GKUB 1XE3A 2CEKA 3Q0TA 3PNQA 1L9KA 2RH5A 4PBTA 4J1JA 2G7MC 4ER6A 1W0CA 2J6BA 1OIXA 4XRRA 4LYAA 3UKOA 3WAGA 2I6XA 1ZIYA 4E4YA 3NBFA 2YHBA 3TE7A 3FTFA 1LSSA 2OXRA 3I8SA 2HA2A 3GBPA 4RJ2A 3OICA 3MW8A 3EWNA 3UAYA 3CUKA 2WTXA 3EH1A 3OFND 3IIKA 3FMFA 4Q9LA 1A8SA 3L7DA 3TZHA 3EAGA 2XTNA 4M4SA 1PUIA 1TMKA 2DTEA 4R9SA 2R0QC 2Z43A 4R9UC 1ZIOA 2YHSA 4LCBA 4I0WB 2ZUVA 1KL7A 3EGVA 5B3AA 2BW0A 3F2IA 3GUYA 1KNQA 4X6LA 2J5QA 1ND6A 5J2UF 2QW1A 1QX4A 3N8DA 3OKAA 4KMRA 1DO8A 2OFPA 3W9BA 2PKEA 4M9QA 4JYMA 4ZAXA 1WD5A 1V8ZA 4O2LA 4CNQA 1O94A 1I4LD 5BSUA 3HJNA 1L4KA 3PLAE 3Q3GE 5FBRB 2NO7A 4TUYB 5KEIA 2B4QA 3OJLA 3FDXA 3D1JA 4GMFA 1LGYA 2FETA 3DDZX 3HKDB 3WRYA 1RXEA 4D3SA 5KYWB 1CCWA 3A0RB 3OHMA 5KWSA 5TARA 3OKCA 1FMLA 1XZLA 2AXPA 5EESA 3R0JA 1C0IA 1FUYB 4K8RB 4WNAB 3WMWA 3MPOA 1HURA 4BCBA 4G4SO 3PWKA 1HL7A 1KGDA 3I6QA 2L82A 4UU7A 3H7AA 3THXA 5HBGA 3RVDA 1MDFA 2XMRA 4QDTA 2H51A 1U3TA 2R84A 1ACJA 3K8ZA 4RFLA 1C3OB 4JZKA 1KI7A 3CVWA 1IXYA 5BSGA 4AIRA 3U3XA 1P7CA 1N3IA 3IURA 2P7HA 4CQJA 4FQ8A 2WPDD 4YRGA 1ZG3A 3O6VA 3RYIA 2X0RA 5EZSA 3F7OA 4WEQA 4PYMA 3ZLVA 2WFMA 4PBSA 2RHJA 3GIWA 3VA7A 3L1JA 5TE9A 4M1SA 2ZIFA 3E0QA 1UINA 2F1OA 2GX6A 2X76A 4F7WA 2W22A 4HX9A 2AG5A 4MRPA 1FUEA 1ZOOA 5CB4B 3RM3A 3EE6A 1V1MB 1NT2A 2OG2A 4LYGA 2FFHA 3HKCA 4IO1A 2DHCA 3OE1A 4Q7KA 3IMGA 2D3WA 4K9LA 3DCYA 2DOKA 1E2GA 4I9GA 1Q1BA 1MORA 4LZNA 5DEOA 4XZ3A 2A4KA 2Q99A 3H1GA 1WXGA 4Q1VA 4PYLA 5A5VA 1VXOA 4WK2B 1H5UA 1XVTA 3OQHA 1U2TA 4ZYWA 1SUCA 5I7OA 2GMWA 2WFLB 2PG3A 3CW2A 1A9PA 1T6YA 4EQ6A 1YA8A 4DG5A 5EIBD 3ROTA 2QWXA 2JJMA 1HC7A 5BW6B 2X3YA 2PH7A 3SC3A 3UHFA 3UMGA 5LKAA 2XLCA 2JW5A 3OKFA 1QQBA 3DGEC 1Q50A 4B7AA 3PV0A 3SS8A 4DV2B 4MDFA 4JOCA 1UKVY 5TDHA 5C2JB 1OF1A 2RGNC 3GEBA 1FZQA 4XLZA 4JQZA 1GZVA 5C9ZA 3KQPA 3TOZA 4QXRA 1MV5A 5EGSA 3ZDAA 1IBCA 2J0VA 4LAFA 1Z7BA 2Y0DA 2ZRMA 3IO3A 4HWOA 1ONBA 2W93A 3GJRA 5J58A 2Z5GA 3KZKA 1ZK1A 1T9CA 2FN3A 5AW6A 1B1AA 2QX9A 3KVOA 3BQ9A 3TF5A 5CDTA 5H3HA 2EKBA 3F5QA 1YNSA 2V8BA 1K0FA 2IXBA 2ZR9A 3H5TA 1OUMA 2LRHA 3L0ZA 4OO3A 3MYRA 1CS0B 2GZRA 3TI7A 2VKQA 4UNSA 1SB9A 2HJWA 2HZ7A 4HL6A 3EIQA 4NICA 5LXTF 4CTMA 1XELA 2GCOB 1N36B 3CVJA 4HWGA 1CR2A 3DAHA 1F8YA 3E9QA 3NIGB 4KVFA 3ZE0B 3QTLA 4JUBA 4R2WA 4ZO8A 5ECGC 4MCAA 2MDTA 3UBTA 3HBJA 4BC0A 2V7TA 4R1OA 3AZQA 4LDJA 4QJ4A 1D7OA 2CJYA 2HF9A 2PRIA 2A5FA 5JD5A 2QTRA 2Q3CA 1Z29A 4P3XA 4XIYA 4UCWA 5JZ9A 1MENA 1FP4A 4LBYA 4JQCA 2BMDA 1P1JA 3VMMA 1D9ZA 3X1XA 1UEXC 2C4HA 4QD3A 4R1SA 1JXAA 4UEOA 5FB3A 3EVNA 3W04A 3S8YA 3BD6A 4C6TA 4IL5A 4J75A 4K6CA 1BN6A 1NF2A 1Y8QA 2BR4A 3U31A 1J8VA 1NQOA 5C53B 2RHDA 1JJIA 4TXLA 1A8PA 3AY0A 3WC4A 4HVLA 3ZG6A 4C4AA 4R2IA 3KKPA 1ZH4A 4KSCA 3ENNA 2F2TA 1QK3A 4P4UA 1KNXA 1X94A 4U7GA 5KWIA 2JLUA 1S02A 1KVUA 4CLHA 2XUKA 1V3VA 3K09C 1U5BB 3GGDA 4URHA 4ZEVA 2DFTA 2VT6A 4RTKA 1GAXA 3IQEA 5BN5B 4B3BA 2NSDA 5C0OE 4DBVO 3NBMA 1PVDA 1QU2A 1U5BA 1R37A 4PM4A 4PSVA 1RJ9A 4JD5A 1KA9H 4HAZA 3CEPB 2DBVO 1JLMA 1O8CA 1VSUA 5ECDA 4I8IA 1IN5A 1WBDA 5EG5A 3CFYA 1TDJA 1SZJG 4M9ZA 1TYDE 3NDBB 2EBFX 4D43A 3MUOA 2I55A 1Y3BE 4GP7A 1C1XB 3KEGA 3DZCA 1JJVA 1XTRA 4GG1A 2P2DA 1KFKB 2PVCA 3B89A 4K6OA 1OROA 1N3YA 5A1JA 1DGQA 1J8QA 4BVEA 2X0NA 1DEHA 3BIXA 2MYUA 1QK4A 4GM4A 2YMLA 4K9MA 2Q8QA 2YTZA 5LUBA 2JK0A 4QBFA 4JA0A 3KR1A 2PQMA 1NVGA 3MERA 1F17A 1KI9A 2OSVA 2REQB 4TWJA 4EJ2A 4Y6OA 1YFLA 1GCOA 5WRFA 4OL9A 2VRNA 1J8YF 1PJSA 2HWKA 3KOWA 4IVRA 2G5TA 3PR2B 1NN0A 4FNOA 3LUGA 1T1EA 3ETGA 3KWFA 3CTPA 2ORVA 1N7JA 1U11A 7ADHA 1RRCA 2X58A 1ZM4A 4IJ5A 4UEWA 2I87A 2FMUA 3GUCA 4JWKA 2EAUA 3HK2A 4XKJA 2ATXA 2BKAA 2VXBA 5K0BA 5KU7A 3DXYA 2L0XA 1M2KA 1NQXA 1TTQB 1AZTA 2X5OA 1J2TA 3OJXA 3VPAA 5CDFE 4YJFB 5AKYA 1F4VA 4UZFA 4DL9A 3AHJA 4YUXA 2BEKA 5JXGA 4HEHA 4DMCA 2WY2D 1JU9A 1JDVA 2R5FA 4XA8A 3N59A 5DGHA 1RWPA 1EQAA 5L7WA 2VH5R 3KJHA 4ENUA 5DTIA 3P2EA 2HF8A 4YMTA 4BS9A 4YMGA 3OEHA 4K0RA 4OD0A 5JNLA 2H1OA 3BGSA 1FFHA 2NG1A 2P79A 3OOSA 1V2HE 5F3WB 3U4QA 4QSHA 3AGQA 4CMJA 1IZ7A 2JJ8A 1KJZA 2GCEA 4JP3A 5AWFC 3R6DA 4X1IA 4F96A 3IV6A 5L53A 1C8KA 1SRRA 2QTLA 2YC4C 5E8JA 2Q41A 3UM9A 4E2FA 1NE2A 5F1KA 2ZRKA 4S35A 3BICA 4W5TA 3DF7A 4C3UA 4U8GA 3A1UA 2UXCB 1V6CA 4Z1MA 3FBWA 3ONDA 4JXKA 4H27A 4RK0A 1ZRMA 4AD8A 3GQBB 3K0CA 2VDOB 3RS0A 3T3DA 4G37A 3D4NA 3U6KA 2P9JA 4JC4A 2Q21A 2ZS9A 2X0DA 4C7MA 1ZXXA 1W35A 3RTBA 4KE6A 2ODQA 1QFYA 2JCXA 2CL5A 3BXXA 3N0VA 4RZQA 1CX9B 3OJ0A 2I6TA 3ZVKA 1L4UA 3L6RA 5KNCA 1AS0A 2ANBA 2ZJ1A 2NADA 2F67A 4CMEA 2XD9A 5DNUA 5CXQA 2O2EA 3I8XA 5D3ZA 3N74A 1C30B 1T5IA 2NACA 4FINA 2VRCD 3DMHA 4TRNA 5BMVA 2QR5A 1RWBA 4RIEA 5AVWA 2Q1UA 1NSFA 2GILA 2D0IA 2JIOA 3LUBA 1R8JA 4Y2XA 3K9HA 2ZJ8A 1V41E 2ZUUA 1ZLXA 3HDVA 5KTSA 3JD3A 4NECA 4P5EA 3K71B 3PLRA 4QUBA 3H6GA 1I51A 2IEGA 1MKYA 4DQUA 1RFGE 1FF9A 3WLRA 3RC9A 5LXTB 2BGKA 4TS4A 2ZJ5A 3WJ2A 1NN5A 1JHAA 5E6RB 5I8ZA 3K9NA 2QROA 2Q6KA 4FXOA 4RK7A 1AVTA 1C1DB 5FBKA 5LZ2A 3OOYA 3C16C 1NE7A 5JMPA 5D84A 4ZCLA 2XQFA 5BWLA 1F4PA 5CHEA 2YHAA 3RYIB 3K09A 4NMWA 3U1BA 4L5CA 3OE7D 1RRMA 1ZGAA 4LBWA 3WGNA 1AUQA 3DLPX 2RJ3A 4LRSB 2EP8A 3C5WP 2KB0A 4H1UA 1I3LA 5DU2A 3GPIA 1T3HA 1WRBA 5FHQA 2X3UA 1U2DA 4OH1A 3UUGA 3I04M 4AS1A 2VZLA 2KQUA 4BPBA 1UDBA 4DPKA 1I7PA 2IUFA 1DRVA 1UPTA 3WXBA 1JDSA 2Q5LA 4AJLA 4IIJA 2G6BA 1B0ZA 2FQQA 1Q0QA 2A9RA 2CDRA 1XNJA 3G1TA 1J21A 3QPVA 3R1IA 4N5IX 3E70C 4XE5A 1IBSA 4RJKA 4ON9A 2RGRA 1Z0IA 3M1IA 2OCKA 5G3ZA 4CF7A 2QE6A 1Y3AA 3EQ2A 4RTPA 1EVIA 3SDZA 4D3ZA 1Z0ZA 2XA9A 2BHNA 3BD9A 3R5JA 4RZXA 2A1TS 2WWTA 5KHLB 4Y2QA 5EXXA 4COOA 3FMVA 1O4VA 1KTVA 3QGMA 3U49A 1W1UA 1U4SA 1L3BA 4KSYA 3BGOS 1WHSB 2DHEA 3ROMA 4TTVA 2AFIB 1OREA 3DVQX 3FCAA 3K0AA 4IV5A 2NX2A 2VWPA 4I1PA 3DE0X 4PX2A 1N5KA 4X3OA 3CLSC 4W6QA 1MVNA 1GU1A 3V4OA 3FWZA 3HFRA 3AKZA 3T4UA 1RAEA 2H59A 1E7YA 3NAGA 3K9LA 5KHAA 4LDQA 1L8AA 3CGGA 4H1WA 3U6BA 1JG3A 1CUYA 2K4MA 4G23A 4CMIB 2WI8A 4V0KA 2FK7A 3BXHA 2PZMA 4AECA 1PGJA 2CHQA 3OOJA 4Z9XA 4QUEA 3FPLA 1IQPA 4S1VA 2V1XA 1U8AA 4FUTA 5B4TA 4LJLA 1Y7IA 5ILQA 4E08A 3BWVA 2EW8A 3A26A 2F7SA 2HADA 4OXRA 2ISSD 3OAAA 1HTBA 2PZKA 3KAKA 1J06A 2F9MA 1X8XA 2VZ9A 2F17A 1DTSA 4QEZA 3TOCA 1P81A 2ZTMA 3PQ8A 4RLFA 2BFMA 4QOEA 4C4OA 3VDNB 1C3JA 2HCJB 5IH7A 3G8DA 4LJSA 5EKTA 1W85A 5LOVB 1T5SA 2C5LA 2HU8A 3K5PA 1PL8A 3HA7A 4Q1EA 4EELA 5EEHA 2YYYA 3VAAA 3N2KB 3M1LA 2GN0A 4ZYXA 4CMGA 4GGPA 2BUBA 1LLDA 4KDFA 1R2QA 1GRNA 1TYAE 2J45A 3K1AA 4RWEA 4F9FA 3P45A 5CXUA 4DV5B 2UXBB 5F2EA 3EIUA 4L5BA 4B9EA 4HWTA 4LNUA 2QTNA 5TMDA 2ZM6B 1ZD8A 3U3KA 4RTMA 1R64A 1V6SA 4IEIA 1N8SA 3HJHA 3K7EA 1ZU4A 3O8DA 2GJSA 4IUYA 5IH3A 1U8TA 1NBEA 2JHPA 5E9WA 1BHJA 4ZAFA 1EGMB 4X1IB 2IPOA 4FJ1A 4JLWA 3K5IA 1WBBA 4OQZA 4IDDA 1RCUA 1SQ6A 4FYYA 4OI1A 2FKNA 2Q9CA 4LRQA 4HTAA 5AI5A 1ELOA 4Z9BA 4W9MC 1HFEL 2D2IA 3DV9A 4KWEA 4MR7A 3A2KA 3VTFA 1UBNA 1FC0A 2BE9A 1D2EA 2YJ4A 1V1RA 3W1WA 1ZMOA 3AEXA 1TEZA 1P29A