3I6QA

Structure of the binary complex leucoanthocyanidin reductase-nadph from vitis vinifera
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
307
structure length
291
Chain Sequence
GRVLIAGATGFIGQFVATASLDAHRPTYILARFKALEDKGAIIVYGLINEQEAMEKILKEHEIDIVVSTVGGESILDQIALVKAMKAVGTIKRFLPSEFGHDVNRADPVEPGLNMYREKRRVRQLVEESGIPFTYICCNSIASWPYYNNVLPPTDFFQIYGDGNVKAYFVAGTDIGKFTMKTVDDVRTLNKSVHFRPSCNCLNINELASVWEKKIGRTLPRVTVTEDDLLAAAGENIIPQSVVAAFTHDIFIKGCQVNFSIDGPEDVEVTTLYPEDSFRTVEECFGEYIVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative leucoanthocyanidin reductase 1
publication title Crystal structure and catalytic mechanism of leucoanthocyanidin reductase from Vitis vinifera.
pubmed doi rcsb
source organism Vitis vinifera
molecule tags Oxidoreductase
total genus 96
structure length 291
sequence length 307
ec nomenclature ec 1.17.1.3: Leucoanthocyanidin reductase.
pdb deposition date 2009-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05368 NmrA NmrA-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3i6qA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3i6qA02
1EVJA 1BMDA 1IHYA 1NPYA 3KB6A 1QYWA 3N7UA 2DT5A 3Q9UA 2CVOA 3KSZO 3O4RA 1LDMA 3WQRA 2EKQA 5C7IO 3PTZA 2Y1GA 1EUDA 1HTBA 1Z6ZA 3EAGA 2VHXA 3BTVA 3I5MA 4J3FA 3SLGA 3C1AA 4RVDA 1CWUA 2YV3A 5DBIA 4FW8A 2DBQA 4XYGA 1HETA 2GZ3A 4W4TA 3RJ9A 3ZHYA 2IYOA 1YB4A 4G81A 1EFKA 4ND2A 2W2LD 1XQ6A 3EDMA 1S7CA 2Q4BA 1DBVO 1EDOA 3KRTA 4LSMA 3SVTA 2Q1SA 4R68A 3V2GA 1OC4A 3TRIA 1X14A 1YB1A 1C0KA 3K96A 4CM9D 5C3MA 4BB6A 1ZJZA 2JAPA 3GNSA 3CMMA 1I3NA 4OQYA 1X0XA 2ET6A 2HAEA 2PGJA 5A3JA 4BGUA 3L4BC 1ZXBA 2EJWA 1EBFA 2Q50A 3JQFC 2YW9A 5C37A 2NACA 1NX6A 4LMPA 2DTDA 3VKUA 4TVBA 3STHA 1PIWA 4CMIB 4II2A 1HWYA 3V2HA 1QORA 1YWGO 3EGOA 4NFHA 1FF9A 3QE3A 4GGPA 4PLCA 1YGYA 3D4PA 2RIRA 3F6YA 3DAGA 4TRNA 1Y8QA 4JJIA 4KUEA 2ZYGA 2CY0A 1R4MA 4R5HA 1YE3A 4IIVA 1AXGA 1PJSA 1PL7A 1DJQA 4ND4A 4U6QA 4I5EA 1A71A 1XWFA 4DMMA 3ONDA 4P8RA 4QTZA 3M2PA 1TLTA 3ZGYA 5KJ6A 2B4QA 1BWSA 1DEHA 3W6ZA 1NPTO 2PY6A 1ADGA 1I36A 2X0JA 3F47A 3VVBA 4TZKA 3ZWVA 4IS3A 4EI2A 1G1AA 5A04A 3L07A 5EINA 2EF1A 4IJKA 2BFPA 4FR5A 4BNZA 3QWFA 4RPJA 4E2YA 5K6AC 3OIDA 3GVCA 4GX0A 3X2EA 4R9SA 4YXFA 1X7HA 4AJ4A 2GASA 4PGFA 2WE7A 5JDIC 4J9UE 4CPDA 1B26A 4UEKA 4P38A 4XKJA 3UCXA 4YWJA 3WJ7A 4TQGA 4TMFA 5FI3A 1OC2A 1UDBA 4OH1A 4M89A 4QO7A 4RGBA 1YL6A 3ROKA 2R00C 4CQLA 4E5PA 3OSUA 3EZLA 1X13A 2HRBA 2CFCA 4CV0A 2V6BA 4U5QA 3U3XA 4CMKA 5ILOA 4LN1A 4JN6B 1T1RA 2AE2A 1VL8A 1OOEA 4CM8A 4E2ZA 1BW9A 2HUNA 2NUAA 4RQTA 1T2AA 2I3GA 3HN7A 4YCAA 3VH2A 1FDTA 1CYDA 5JC1A 3QVWA 4JQCA 3PHGA 3RD5A 4YA6A 4UVIA 3FRJA 4EZBA 4Y67A 2NU8A 1TB4A 4RPGA 1NAHA 2LDBA 1PSDA 1Z7EA 1NWCA 5TJHA 2UUOA 3GVPA 5TJ9A 1VRWA 4IQ0A 4DLLA 1YVEI 5G0TA 1I2BA 3ZNPA 2G1UA 3H8VA 4WLUA 1K6IA 1WDMA 2VN8A 3LVFO 1KVUA 2H1SA 5JYEA 3F9IA 2BLLA 3H9GA 4UVGA 1NQOA 4GAEA 5FEUA 1T2FA 2ZCVA 4YJGA 1MB4A 2Y67A 4IUYA 1KEPA 3S2IA 4N18A 3U0BA 4CLEA 1ISMA 2BHLA 4I08A 4GLLA 4LCEA 4PLWA 4LISA 4BKPA 3FR8A 1UAYA 3AY6A 5CDTA 1NXQA 1PL8A 1ZK2A 4L8VA 3TZHA 4YRBA 3LT2A 2FR1A 4B4WA 2O2YA 1HE5A 3JQ8B 3OJ0A 5BSEA 4NBVA 3TZCA 2J5RA 3PLNA 3WWZA 2OP1A 1DB3A 2NLOA 4LW8A 5DNAA 3JD4A 2VWQA 4MVJH 3KLMX 3JD3A 4TKMA 1UP6A 5JMWA 3AJRA 2GN4A 3DMTC 3VZSA 1E7QA 5LCXA 3VKVA 2CMDA 4U0JA 3W4IA 3BMQB 2V6FA 4QX6A 4CQMA 3AUSA 2Y93A 3OQ1A 2FPIA 3GG9A 5L53A 4NG5A 4CMAA 1WWKA 2VHWA 4BS9A 3QV1A 1UXHA 2FN7A 4XCVA 5THQA 1ZSYA 3RWBA 1SOVA 4FOOA 1ZSNA 1CQIA 3PHJA 3B1JA 1ZFNA 4XDYA 5HBRA 2FMUA 4YQYA 4PLGA 1B8VA 4K6CA 3VPFA 3H2SA 3ZI0A 2C5AA 2D2IA 3GPDG 4OXNA 4PLFA 3GVXA 2W2KA 4PG5A 4XB2A 3DOCA 3P2YA 4QQRA 3GDOA 1DFGA 4Q9NA 3AK4A 4R1SA 5L4NA 3VDQA 2RH8A 3OJLA 3ZWOA 1PGNA 2HKIA 4NJMA 2DTXA 5FYDA 5BQFA 5L40A 1C1DB 1O5IA 1QP8A 4JK3A 1JKJA 1UZNA 2C5EA 5CPFA 3TL3A 1O0SA 2Y05A 5JY1A 2EJVA 5COBA 2NVUA 3JD2A 4RPLA 5EN4A 3CEAA 1U5AA 3Q2KA 4BNMA 3DHYA 1JAYA 1IE3A 2Q2VA 3VHRA 4EJ0A 3D3WB 5U1PA 3RJ5A 5B4VA 5L45A 2RHCA 4FC6A 5JO0A 1NPDA 3G49A 1M75A 4ZICA 4LVUA 1XYGA 2D4AA 4CR8A 1V3UA 4CLHA 4JBGA 2NV6A 4PIVA 2OMEA 2AXQA 3AOGA 3QY9A 3PJEA 4EUFA 2X9VA 3WDSA 1N5DA 4N5MA 4ZD6A 2BELA 4FJ0A 5A02A 4MDHA 5TQVA 1I10A 3OETA 2C54A 3U62A 1P33A 1Y7TA 4HNGA 2D1YA 4EUEA 2PD6A 5L7WA 2JKVA 2ZYDA 2LDXA 3RFTA 5AXBA 1B0AA 5DBGA 2GNAA 1YJQA 3HDYA 4IIUA 3L0DA 4RPKA 4R51A 2BH9A 7MDHA 3AWDA 4GGOA 5H83A 3WGHA 3VDRA 5A1TA 3FN4A 3S2EA 4CMIA 5JDCA 1FDVA 1VKOA 1E7WA 1AE1A 1MLDA 2JCXA 4O6VA 2PZKA 2Y99A 4BOYA 3VZQA 4I9UA 1E77A 2Q45A 1NR7A 4WJZA 2Q46A 2VRCA 4GVLA 2DTEA 1GCOA 4JIGA 4XD2A 3GRKA 4HY3A 3ZNOA 1LTHR 5CDSA 4J90A 1T24A 1NBOA 2X22A 2O2SA 5IN5A 3M1LA 3QWHA 4LVCA 4AJEA 2FWMX 1JLLA 4XIYA 4HUJA 4KTVE 4BUCA 2BKAA 4IDCA 4N5LA 1BRMA 3QJ5A 3K73O 3H9JA 2DPHA 1EUCA 3ROMA 4M86A 3ZWXA 3WYEA 5B12A 3ORFA 3HE3A 3IMFA 2EG9A 5B4UA 3ENKA 4RDIA 4G5HA 4YAIA 1LXCA 3LT4A 4R9RA 4WE3A 4B7CA 4YYZA 4D0SA 1HDYA 4YJFB 4OOEA 3FBGA 4E3ZA 4YVFA 4EUHA 3C7DB 5DBFA 3JQCA 2F1KA 1JVBA 2JFHA 4WPGA 1LLQA 3DQPA 3L4BA 2DLDA 5I7VA 3H3FA 1BVRA 1NM5A 5JAMA 4CLRB 3JQFA 2OHXA 4B8ZA 3LLVA 2NQ8A 2WTBA 4EW6A 4W99A 3WR5A 2CF5A 3ZNNA 2P9EA 2VHZA 4YAGA 2XXJA 4CUKA 5T64A 4BMSA 3ON5A 1XIVA 1YOVB 3BTUA 3I9JA 2YFQA 1UH5A 4A27A 4CQMD 3QW2A 1W8DA 3S1LA 1NHWA 3U9LA 2FPPA 1RYEA 1XHLA 2P4QA 1N9GA 2C82A 1VE9A 4ZU3A 3LQFA 4XR9A 4IQ8A 2XAAA 1VL6A 1ZEMA 1SNYA 3ZWPA 4Z0PA 4GL4A 1N2SA 3I9OA 3ROQA 3DAPA 2I67A 4I9NA 1PGPA 1XQ1A 1ZSVA 4HP8A 3MZ0A 4Z6KA 1V8BA 1VJTA 1Q0QA 3PYXA 3WGTA 2VTDA 4MOWA 2YHIA 3QVXA 1ADBA 5T5QA 4AFNA 3E6AA 3MCVA 3PLRA 4FPXA 4LMRA 2WDZA 5BSHA 3QIVA 1KEUA 3S2FA 3TF5A 4BNKA 1YRLA 2WYVA 5K6AA 1E92A 2VZ8A 4CM5A 1ZNQO 3HB5X 1DIAA 4ZA2A 3BYZA 1MC5A 2B69A 2TMGA 3L6EA 4PZDA 1Z73A 2GYYA 3AU9A 1EK5A 3HFGA 4FC7A 2ZB3A 2V6MA 3V1UA 3KYDA 2WYUA 3NGLA 5JDIA 1E7RA 3ANMA 5L7TA 4NIMA 4XRRA 5HRUA 1WDKA 3GGOA 1PR9A 3L9WA 3ZV5A 4GSKA 4Z9YA 1CQJA 5KJEA 1K6XA 2NQTA 1PL6A 4E13A 1GUYA 5KJFA 1UUFA 3DZBA 4URFA 4MVJP 4MVJA 1XKQA 2YV2A 2EGHA 1R0LA 3GY0A 1A7KA 2R00A 3PIDA 3GC6A 4J6FA 2PFGA 3JQGA 2YDYA 2DC1A 3IOYA 1ORRA 1GR0A 4CLDA 1WAMA 4X54A 2OO5A 4E5KA 5HM8A 2FPGA 3ZWNA 4BL5A 3DFZA 1UXJA 1E5QA 3DMYA 3B70A 4MJLA 2GD1O 3INRA 2YHUA 4L4XA 1I2CA 4XJTA 2PWZA 4K1LA 3HUDA 1ZK4A 2Y0EA 3M6IA 3DONA 4FFPA 4R1UA 1MXHA 2O3JA 2ZB4A 3IKTA 1YDEA 2DAPA 1GV1A 1Y8QB 4CUZA 3ZWMA 2CSUA 1I0ZA 1B14A 4G65A 1R4MB 2DPGA 1FMCA 4F45A 3DZJA 5JLAA 2VRCD 4IZIA 2BI8A 3LSYA 3NT4A 3I6QA 3ADOA 1KEVA 3QRWA 5I9NA 4R4JA 4ALKA 4GMGA 1IULA 1DFIA 3DBLA 4EEZA 3KOUA 1ZEJA 4RL6A 4YACA 2YZ7A 4MVJM 4GVXA 1UP4A 2C7GA 4ZRNA 4IS2A 3RKUA 4PLHA 5BSFA 3F4LA 4Z3KA 3DOJA 3MWEB 2WE8A 4J7CA 4WOKA 1GYQA 3Q9NA 4OJNA 3WYBA 4FBGA 3N74A 3JD0A 3MJSA 4L4RA 4J16A 4PRKA 3SC6A 1JAXA 3RC2A 5K0ZA 2P4HX 4QEDA 5JBIA 3W8FA 3BHJA 1NYTA 1PQUA 2ZB7A 1XDWA 1EUZA 4BV8A 4FN4A 4FS3A 4BIIA 4BNIA 2GF2A 3GNQA 5DN9A 2VOEA 3DMTA 3JYNA 2E48A 1KEWA 2PGLA 1PQWA 5BNTA 3RQSA 3VOSA 3UFXA 4CV3A 4S1VA 4B3IA 3CH6A 3MTJA 1GQQA 2B5WA 4KQWA 4IDBA 1K89A 1U4SA 5EJ2A 4CM8B 1PJLA 2JHFA 1BW9B 3CXRA 4IGFA 2QRLA 2NU7A 3PWSA 5BT9A 3GZ4A 4D45A 3GEDA 3WMXA 3I6IA 4R3NA 5TLSA 3DWFA 1Z45A 5TSDA 2EP5A 5KIAA 4RVHA 1DIRA 3PEFA 4DPKA 1MA0A 4LRTB 1M6WA 2AG8A 2GN9A 3HQ4O 5B37A 4RF2A 3E82A 3ZU5A 2PNFA 4EGFA 2GUGA 3GGPA 1E3SA 2GLXA 4O5OA 4OQZA 3PZBA 5AXCA 1YQGA 4GWGA 3VZRA 5KWEA 1QMGA 2DBVO 5IG2A 1X7DA 3GHYA 2W90A 3ASUA 3GEMA 4YJGB 1O95A 5GZ6A 3DOOA 5FWNA 2NM0A 2X0RA 4IM7A 1Z75A 5DP2A 4AJKA 1YL7A 2O3RA 2FP4A 1Q0HA 1PS9A 4GX2A 5IXSA 1JA9A 2TMDA 3OBBA 2VWHA 3V2UA 1LC3A 2B0JA 3JSAA 3LK7A 1SCUA 1PX0A 3GFBA 1WMAA 4BO1A 3OH8A 3I23A 3JQAA 5DOVA 3WX0A 1ZH8A 2AEMA 1HE2A 4QO8A 2Q2QA 5JY6A 1ISHA 1PZHA 2B37A 4W6ZA 1EVIA 2NTVA 1E6UA 3ZWAA 1E7MA 5CEJA 4Z3DA 3WFIA 4QXMA 3DC2A 1W6UA 3E18A 1E5LA 1HE4A 2BGLA 3UH1A 2XF8A 3ZV4A 4WK6A 5G0UA 4YB8A 3A28A 4ALIA 5A06A 1AHHA 2W2KB 2O4CA 3AM3A 3P7MA 4DUPA 1MXFA 4J1QA 4EDFA 4D79A 3C8MA 3KLPX 2QQ5A 4HFRA 1SMKA 2CDCA 3HG7A 3GMSA 2BFOA 1LU9A 4NI5A 1GFSA 2GR9A 4PFJA 4NJMB 4OGWA 5L9AA 3LF1A 4J4HA 5CPBA 1GEEA 3OMLA 4FFOA 1NVMB 3WGZA 3DZFA 4Q39A 5JMPA 1T25A 4XDZA 1F17A 2P2SA 2NVUB 1CIVA 2IZ1A 3CTMA 3GLQA 2O4UX 4RLSA 6ADHA 5KCZA 1NQTA 4XIJA 3T4XA 1KVSA 3V1YA 2PH3A 3GK3A 2I5PO 3L6OO 3BMCA 1BXGA 4J91A 2GZ2A 3D7LA 2IEDA 1GZ4A 4YT4A 5CDUA 5IN4A 1J5PA 4PVCA 4YAKA 2X7HA 4Y6PA 2QX7A 4AJ2A 4E30A 3GMDA 1HT0A 3DHNA 3ZW8A 2VYVA 2Z1NA 2NU9A 3KO8A 4AJHA 3C85A 4XEHA 2GCGA 4I5GA 3X2FA 3U4HA 1Q7CA 2J5QA 1LDEA 1F06A 1NVTA 1Y5MA 2UV8A 2OGUA 4PLZA 4R01A 4BGIA 3H5NA 4BKRA 2VNSA 4BO7A 4XYBA 4DA9A 4DQUA 8ADHA 9LDBA 2VT2A 1U4OA 2ZQYA 4NBTA 2RHRA 1B2LA 2UDPA 3LU1A 1KOLA 4MKXA 4K26A 1M67A 2R6JA 1XEAA 3WQQA 5IDXA 5TC4A 1X1EA 5EMHA 5CP8A 5TIIA 5BNFA 2O48X 4ROSA 1PZFA 4HNHA 5BNIA 2CF6A 3QWBA 2CZCA 2X5KO 4F6LA 3BMNA 3Q2IA 1PJBA 2UUPA 1I5RA 1ZIDA 3AW9A 1X1TA 1LDNA 4AJ1A 4TRMA 3LDHA 1KIFA 2ZCUA 1GUFA 1U9JA 1ZMTA 2PV7A 3BHMA 4RF4A 4OO3A 1NFRA 3TFQA 3M2TA 1HDOA 4IJUA 3PHHA 4W82A 2PKRA 2P68A 3H9EO 1CDOA 3MJ4A 5T8KC 3PQFA 4BNHA 1H2BA 4WCDA 4RZIA 3PFWO 3HWRA 1GL3A 5AVOA 2Y66A 3HZZA 3I3OA 5HS6A 1H6AA 3IC5A 4KWIA 1DRWA 1EE9A 1ENYA 3PYLA 1CRWG 5A4DA 1XCBA 1VC2A 2F00A 2IODA 4NBWA 3GDGA 4OKIA 1LSSA 2X23A 1LLUA 1R0KA 5JE8A 3NAQA 4TSKA 3UAGA 4F6CA 1J0XO 4CM3A 2VOJA 4HX5A 1WW8A 3JQAD 1Y8RA 3IDSA 3KYBA 4KUHA 1QV7A 4D44A 3HN2A 1YL5A 3GN2A 4M55A 3WBBA 5AQ1A 3HSKA 4HKTA 3AM4A 4ZHSA 1IZ0A 1T4DA 1JW9B 4HBGA 1BHSA 1N9GB 4ZQGA 4Z0TA 4TRRA 3RUHA 4AJPA 1IY8A 5FI5A 1U3VA 1SB9A 1T26A 1QSGA 1U2GA 5G0SA 4DXHA 4EYEA 1NHGA 1ONNA 2Y1OA 3QWIA 1CERA 1GDHA 2H63A 4YRDA 3HFSA 3GGGA 5KVSA 1PJ4A 4BNUA 3O26A 3GFGA 4LRSB 2FHSA 3C1OA 4HXYA 5A9TA 4RPHA 4R16A 3PQEA 2YHIB 3WSVA 4BB5A 1B15A 2J3HA 1UXGA 1P0CA 1MG5A 4GX5A 3C3XA 4WASA 4RF3A 5JO9A 1HYEA 3E5RA 2Y1EA 4XZ3A 5DZSA 2BFMA 4FDAA 1I2ZA 3JQ7A 3DTYA 2ZTLA 3OF2A 4O63O 3WJAA 2Z95A 3I9LA 2Y0CA 2BF7A 5G0VA 2X58A 2I66A 4M8SA 5FFFA 1ZJYA 3KYDB 1Y9EA 2QYTA 1BSVA 1A9YA 4J1SA 2P5UA 4XYMA 3WLEA 1F8GA 1GCUA 3GOHA 2EWMA 4ZRMA 5IXYA 1YKFA 3TQHA 3PHIA 3ETGA 2NWQA 3ANLA 3WWYA 3UHAA 4L73A 1R66A 2OUIA 4LCJA 3SJUA 1RM4A 1SAYA 2VYVD 3JQGB 1A4IA 4G2NA 4PG6A 4QT0A 5J23A 2OL4A 1OBFO 5AXDA 4J1NA 3L77A 1WMBA 4NNJA 1QV6A 3E9QA 3UGKA 5GZ3A 4B8WA 1DRUA 1V3TA 3I83A 2HSDA 4CM4A 2QYSA 3RCBA 2CNBA 4L0QA 4RCVA 4CV1A 1T2DA 3RUDA 4Q3BA 3S2GA 2FOIA 4ALLA 2IYPA 5G4KA 1C1XA 4DQVA 4J43A 4KTTE 1Z7BA 3AUAA 1DHTA 4NZ9A 1HDXA 4J2OA 3S55A 5F5LA 1RKXA 4NU6A 5F1OA 2Z1MA 1D7OA 5AXAA 4AG3A 1ULSA 3H65A 1FXSA 3UUWA 3ABIA 1U1IA 1F12A 2HO5A 4W9NC 1MGOA 5JAQA 1LSOA 5IJZA 2C0CA 5ER9A 2EERA 3K6JA 3TOXA 4CR6A 1I24A 1AGNA 1LLCA 1P1HA 4Y98A 3DBLB 5TF4A 1F8FA 1YBVA 3A06A 3O8QA 5DCUA 1C3VA 3NDRA 2YQ5A 3NYWA 4C4OA 3I1JA 2ZATA 3ZV3A 3FR7A 4WKGA 5IDYA 3VC7A 1PGJA 3U4DA 2WM3A 4PLYA 1OI7A 3AY3A 4UULA 3HB4X 4NH4A 3AI1A 3RROA 2NTJA 4JP2A 1ULUA 1ZUD1 1ARZA 3TNLA 1DSSG 4HFMA 5TT1A 3TWOA 4D3DA 2PA3A 3OA2A 3PVZA 2E6UX 4NMHA 1V0JA 3SBOA 4Y9DA 1I01A 1T4BA 3OJEA 1G0OA 1SC6A 4D3SA 3TL2A 3RSHA 1ISJA 4CMEC 4PLTA 5B4TA 2J3KA 3G0OA 4LK3A 3RUCA 4B7XA 3RC9A 1HXHA 3EK2A 2EKPA 1H6BA 4B7UA 2FSSA 3WGGA 1EEHA 3ETDA 3INTA 1MFZA 3S8MA 3ITKA 1HRDA 1SB8A 4RZHA 4D43A 3IAHA 1V3VA 3NV9A 2QW8A 4RF5A 3GN1A 6LDHA 5TRTA 1E3IA 4PG8A 3MJTA 2G76A 4P4LA 2QRKA 1LC0A 2Y1CA 4J7UA 4BVAA 1YQXA 2E37A 3FNEA 1XR3A 3ZH2A 1U28A 1KVRA 1IZ9A 5EL0A 5JXWA 4INAA 4BO6A 5C7OO 5ILGA 1JKIA 5L95A 1ENPA 4CJXA 2NSDA 3AOEC 5IF3A 5L3ZA 1NQ5A 1ISGA 1EMDA 3MOGA 4GKVA 3OQ6A 3BIOA 1B8PA 3MWDB 3G3EA 4IBOA 3R0IA 2FZWA 1ENZA 3FI9A 5AOVA 5HWSA 1JDJA 1GY8A 3NEPX 3GNTA 3T7EA 4WLFA 4DIBA 5KJ1A 3O03A 4XYEA 1XELA 5COAA 3GA0A 4YBZA 3NUGA 1ZCJA 4JGBA 4Q3NA 5G2OA 1EBUA 5B1YA 3C1TA 3UKOA 2DUWA 4R1NA 5T6BA 1XLTA 4H16A 4NFSA 3W4JA 4U8GA 4MVJF 2GGSA 4GPD1 1WVGA 2J5KA 3E8XA 4XQCA 2EHDA 4KZPA 1I33A 2AEJA 2PZLA 3DAFA 2R2GA 2Y1DA 3TSCA 3GUYA 3JQAB 4OKNA 5A03A 2B36A 1RPNA 4J2HA 4E21A 1D8AA 5HA5A 3L6DA 2I3AA 4FIZA 2B35A 2ZJ0A 1QYDA 1DFHA 5IDQA 3AUTA 1PJTA 4L76A 4ND3A 4DREA 3W4KA 1PJ3A 1P44A 2Q49A 4BKQA 3DL2A 4J0EA 3VVCA 5MGBA 3KTDA 4DRYA 4YDRA 1MUUA 4FGSA 4IZHA 3TPCA 3WGOA 4YT8A 1EZ4A 1KC3A 1HSZA 1MFPA 1P1KA 3A1NA 4AJLA 1TT7A 2IEBA 1XSEA 3H2ZA 2QG4A 4IJWA 2DVMA 3FD8A 3RFVA 3WGYA 3VH1A 2Y0DA 3FNHA 1Y81A 4PG4A 1Y5RA 2HMWA 2X9NA 3CZRA 1CF2O 3RUIA 1RWBA 3OM9A 1R4NA 1EFLA 4ALNA 4OMUA 2JHGA 4J4BA 1TVEA 4NHEA 5A9SA 2VQ3A 2BD0A 4IINA 4OHUA 4BO5A 4E33A 3IQDB 1KYQA 5T8KA 4DGSA 2IDZA 4XYLA 2BMAA 1Y9AA 2OP0A 3SEFA 4YAEA 1T2CA 2WYWA 3ITDA 3PHLA 4W7IA 3VH4A 3BMCB 4YEDA 4CMCA 1BXGB 5CG1A 2D5CA 3QVTA 4K6FA 4MP3A 3I9NA 1PS8A 3OIGA 8LDHA 2YQ4A 1ZW1A 2FSVA 5GY7A 3RIHA 1LDYA 4E6PA 1XGKA 5ER6A 3ONFA 3NDIA 1ONOA 4OIMA 5EERA 3RUFA 2VUUA 4NBRA 4FB5A 5K9ZA 2RCYA 1E0DA 4K28A 2RBEA 5BR7A 5IAAA 2YDXA 3KUXA 4DC1A 2P9GA 1R37A 4GMFA 4JJFA 1U3UA 3MTGA 3H5RA 3KZVA 5DCWA 3N58A 1GEGA 3D4OA 1LRLA 3JCZA 4RVGA 4GBJA 4R69A 2P9CA 4J1TA 4WLNA 1D3AA 3K2BA 4QSMA 1W73A 5C5IA 4WCFC 1QXSA 1WLYA 2H5LA 3ZZNA 4A7PA 3QLJA 4A26A 1VL0A 1TI7A 3I9KA 2ZB8A 3FTPA 3Q0EA 1E3LA 2B4TO 2HK8A 3PP8A 4H3VA 4QECA 3IL2A 2ZTVA 3EVNA 1J4AA 3K31A 2GN6A 3PGXA 3TZQA 5CDYA 2IXBA 4YRAA 3NTQA 2Y1FA 4Q3CA 4N7RA 5I7FA 3BMNB 4UEOA 1PZEA 3AI3A 3F5SA 1Y1PA 2P91A 3LC7O 4XJSA 4I5FA 5CEFA 3VPHA 2D0IA 1ENOA 4BNXA 3ZNQA 4B79A 1P1IA 3RU9A 4FJ2A 1P1FA 1AXEA 4I9HA 4TKLA 4UVHA 5EESA 3ULKA 2Q1WA 3RKRA 4YR9A 1YO6A 4BNWA 3GPIA 3AFMA 3IKVA 5JAIA 1U3TA 4I1IA 1K0UA 4U6SA 4FFRA 2IZZA 4CM1A 4E5YA 2B83A 1LNQA 1QRRA 1FK8A 2HMSA 4JP3A 3H4VA 4D3FA 1QKIA 4XX0A 2ZYAA 3FWNA 4UAGA 3GH3A 4CODB 1KBZA 4NK5A 1DRVA 4CL3A 1P45A 4MKZA 5TT0A 3U49A 2IXAA 3TDKA 3WS7A 3FHLA 3AI2A 1PEDA 2B5VA 1AN9A 2XXBA 5IDWA 1BGVA 1IUKA 1LSJA 3CMCO 2WSBA 1Y8RB 3QA9A 1C14A 1C0IA 1HSOA 2AA3A 4WUVA 1KY4A 1U5CA 2G0TA 1U8XX 4CMBA 4DLAA 4XQEA 3LF2A 5LDHA 1X7GA 1ZKMA 3GR6A 1VKNA 3WICA 2DQ4A 4R1TA 3E5MA 3ONEA 4IXWA 3PIIA 1A5ZA 2GN8A 2W2LA 3OIFA 2PH5A 3D4NA 3OEYA 4TWRA 2WD7B 2C2XA 5F1KA 5JCXA 4DMLA 3MJEA 4QFDA 1LA2A 1NTOA 2X1HA 5JPIA 1VPDA 3HNPA 4YT2A 5IFLA 3GEGA 1LQTA 1E7SA 4E4YA 4NDNE 2QIOA 1EQ2A 2D3TA 3OJFA 4E31A 3F5QA 3PFFA 3WIDA 5C7LO 4ILKA 3DHEA 1FDWA 1IPFA 3JQ6A 1HKUA 2DFDA 1YDWA 4FFLA 4ZQEA 1F14A 2GDZA 1B8UA 3H5AA 3TJRA 2C7VA 1E7YA 4M1QA 3RC1A 4A73A 3PWZA 1MC4A 3PRJA 3JYPA 5KVCA 5ICMA 1A7AA 5I9LA 4BNNA 3D3EA 4UREA 4EITA 3JQ7B 5ENVA 2PLAA 5L4SA 2VZ0A 2O3QA 2O7SA 5KVQA 1PWXA 1DIHA 1WDLA 2I9PA 2EEZA 3DBRA 4MKRA 4WLVA 3RBXA 3SJ7A 5A5EA 2ILTA 4Z9FA 2C29D 2YV1A 5I9MA 3HJAA 4A5OA 2DU8A 1OMOA 3ST7A 4DTIA 3EW7A 3HADA 4E32A 2E82A 3DZIA 4H15A 3JQBC 4CV2A 1UJMA 4CMEA 4DLBA 1NASA 4IMRA 3PJFA 2NNLD 4M49A 5CDGA 3TZKA 1XG5A 3DZHA 4KQXA 1SZJG 3ZU4A 3R3SA 4CLOB 4DVJA 1XU7A 4BGEA 5I8ZA 1ZZEA 5U9CA 4MVJD 3EHEA 1YS4A 2X5JO 4PZCA 1O8CA 3DBHA 5DOZA 3LT1A 5JC8A 2X0NA 2QHXA 4U0KA 1BG6A 1R15A 1HF3A 3I9MA 4AJOA 4CM4B 4UUNA 1OZAA 2CVQA 3KXDA 3TFOA 4BNTA 1JTVA 1XA0A 3QWAA 4RLHA 1C0LA 1C1XB 3GDFA 4NBUA 2HMVA 4XGNA 5G4KB 3WIEA 3LLSA 4ZJUA 4II3A 3FNGA 3PJDA 2CDBA 2WJPA 4NU5A 1EQUA 3L9XA 3ICCA 3UW3A 3W8EA 1BVUA 4ALMA 3C7AA 1D1SA 5LDGA 3E9MA 3O9ZA 1MX3A 4DL9A 2EP7A 3FCOA 4NR0A 3AOEA 5KKCA 1JKFA 4ESOA 3RC7A 4OSOA 4F3YA 1UXKA 4WLOA 3F1KA 3BTSA 1E3WA 1Q7GA 3NTRA 3GZNB 1H9AA 3CUKA 4XGKA 1P0FA 1BXKA 1GAEO 3G79A 4XQGA 3WTBA 2PTGA 4E0BA 1HL3A 3O8QB 1ZVMA 2OORA 1N7HA 2E49A 2JL1A 4TZTA 1PTJA 2G82A 2X8LA 4YT5A 4AJIA 3ZU2A 1GD1O 4MO2A 3EVTA 4OYRA 1JU9A 5ITVA 4XGIA 2H6EA 2WWRA 4WEOA 4J7XA 3BAZA 3GF4A 4QUKA 1O94A 3K92A 3W6UA 3OECA 5F5NA 3JQDA 2NU6A 2CD9A 2J3JA 3WOHA 2Q1TA 1UAGA 4IDFA 2JD0A 4GH5A 3DXFA 4PLPA 4AICA 2HU2A 3K2EA 3ENNA 1JN0A 4KOAA 4ID9A 1GYPA 2OBYA 3GQVA 1VJ0A 3VPSA 2VHYA 4BMNA 1WZIA 4Q3AA 4IQGA 1U8FO 5F1PA 1M66A 4YJDA 3KETA 2O3SA 3ANNA 1ONPA 1X15A 1ADFA 1QYXA 2JCVA 1GADO 2FZEA 3BHIA 1IHXA 3HDJA 1H94A 1QLHA 4HFJA 3ZW9A 3RUEA 2CUKA 1L7DA 3GT0A 4D41A 3NX4A 4U7WA 1N8KA 1VLLA 1C0PA 4E12A 1CETA 4Q3EA 2OFPA 2PK3A 1GZ6A 2DM6A 3UVEA 4B3JA 3BA1A 3M1AA 2B4RO 1NAIA 1R0SA 2BGKA 2GSDA 2JFGA 4CR7A 5DDIP 3PQDA 4XRGA 5AYVA 1Z74A 1VSUA 4YJHB 1M76A 3ZWYA 2SCUA 5G4LA 2DUUA 3WSWA 3KSDO 2YFHA 4QFCA 1UP7A 3INGA 2X0IA 1D1TA 3BMOA 4NPCA 1SO8A 5KVVA 3OICA 4LGVA 4XB1A 3K5PA 3G1TA 3WG9A 2DBZA 4OOFA 2PGDA 4BHTA 4PZEA 3LC2O 5IZ4A 3HDHA 5G0WA 1TT5A 3RI3A 5IZCC 1FDUA 5JS6A 2DBRA 3CPSA 4P22A 2OXIA 1ZK1A 2X86A 2YYYA 4PCVA 2X6TA 1LRKA 4IMPA 4E5NA 5CAEA 5T57A 5EIOA 1X0VA 2EXXA 1BDMA 1I3LA 2CVZA 3I4FA 2A92A 1ISFA 3OJOA 1PS0A 2EIHA 4MPDA 2A94A 5H82A 4CM6A 1H6CA 4BO3A 3KVOA 4R3WA 2AG5A 3IUSA 4CM7A 4WCFA 1LEHA 1LX6A 3JQ9C 1V9LA 3PI7A 1YJ8A 3D1LA 1NQAO 4PRLA 3KBOA 2VNAA 3AY7A 3K30A 5HS4A 5JCJA 3CKYA 3CZMA 1KY5A 3WBFA 1BDBA 2WD7A 1PQPA 1QR6A 3MJCA 3H7AA 4BNVA 3IP3A 3FPCA 3U4CA 1HDZA 3ZN2A 1Q1NA 4KDEA 2PD4A 1H93A 4UUOA 1MV8A 2VRBA 2YJZA 2XOXA 1HZZA 3TZ6A 4CMJA 3RBVA 3GG2A 3RU7A 1R4NB 3H3JA 3T4EA 3EUWA 4B3HA 1WZEA 1R6DA 4XA8A 1H9BA 3JYQA 1HDRA 2OZPA 5TGDA 4TRJA 5A9SB 4UVDA 2HMTA 1MG0A 4Z9XA 3VTFA 4ND1A 3LC1O 3G1UA 2Q4EA 1RM3A 4JBHA 1O6ZA 1V35A 1B3BA 3F4BA 5A05A 4J4TA 4NJOA 1DJNA 4FFNA 2UAGA 2QZ9A 3MEQA 1GPJA 3E1KA 1KVQA 3I4CA 3NDJA 4B4UA 4IDEA 3A14A 3UXYA 2AE1A 4WEQA 2VZ9A 3KM0A 1DAOA 3R3JA 1D4FA 1QYVA 2AW5A 4EJ6A 5EQFA 2HMUA 1SOWA 3B1KA 2I76A 5F21A 1ZXLA 4CLOA 4KDFA 4L9RA 2D59A 4OAQA 1HE3A 1Y6JA 1HYGA 4OXKA 2O23A 1E1MA 3UCFA 1GYRA 4PVDA 3CSDA 1NVGA 4GWKA 4DPMA 4EBFA 1KVTA 3FTNA 4FGWA 2D8AA 1B16A 3A9WA 1ML3A 4RJTA 1ISIA 4A0SA 5A9RA 3TOZA 1S6YA 2VYNA 4DBZA 1M6HA 1HZJA 1Q2XA 1EE2A 4C7KA 2UVDA 2YUTA 3PDUA 4I5DA 2AQIA 4OL9A 4AL4A 2NVWA 4A03A 3RASA 1BXZA 1N92A 1P3DA 3WXBA 5JNLA 3IUPA 4W7HA 1IOLA 1H5QA 4RDHA 4EEXA 4F46A 5DF1A 4RQUA 3B20A 4YAJA 3T7CA 4PLVA 2AMFA 1DOHA 3GZNA 5I7SA 3AFNA 1N7GA 2O50A 2UYYA 5CHEA 4CUJA 4R41A 3RUAA 1EVZA 1M2WA 4Y6RA 4O59O 4O1MA 1P74A 5JW6A 3MJVA 3V5NA 5L51A 3JQBA 3NJ8A 2ZKLA 2VHVA 5ENDA 2HQ1A 2QZZA 3DZKA 3RBZA 1DAPA 1VI2A 3KEOA 3OA0A 4AJJA 4RV9A 1G0NA 3K9QO 4LSWA 3NKLA 4Y8VA 5KJCA 5JAZA 3WGIA 4IDDA 3SC4A 1HDCA 4KUGA 3C7CB 4WGGA 4WECA 4AJNA 2WMDA 1HLDA 3DEYX 1F0YA 2CDAA 2ZQZA 4M54A 1UZMA 5A5FA 3JTMA 2JD1A 5KTKA 4Y6SA 1AUPA 1YH3A 3JYLA 3JQEA 3PK0A 3IS3A 2DKNA 1VM6A 1ZMOA 1NNUA 3GAFA 1DXYA 3ZWCA 4S3MA 2JCYA 1GTMA 4BO9A 3UCEA 4PN3A 5JCJD 1K6JA 1TA4A 5BSGA 3A4VA 1E6WA 2EV9A 4DBVO 2GO1A 1H6DA 4TROA 1E1NA 1ADCA 2BFAA 1R12A 3KYCB 3NGXA 1E1LA 1W0CA 4R54A 3QSGA 1HDGO 2PKQP 1N1EA 3W8DA 4D7AA 1UR5A 4O0LA 1KETA 4GI2A 1QYCA 1ZO8A 2JJYA 5CEEA 1T2EA 1G6KA 2PZJA 1HLPA 3GRPA 3B6ZA 5TX7A 4E2WA 2VUSA 1ID1A 3FPLA 3LT0A 3QVOA 3UN1A 2OOSA 3H9QA 4YJHA 1HYHA 1L7EA 3DR3A 4FD3A 1PJCA 3DFUA 3KSUA 3EC7A 3WMWA 3ZDFA 4WNCA 3U5TA 1FDSA 1K3TA 4BQRA 1DC3A 5JSFA 2W4QA 2Q99A 3DBRB 1U3WA 3LYLA 3ZHXA 3VPXA 2O7QA 2VWPA 4DYDA 3AUUA 4K9DA 3PDJA 3QVSA 4UVEA 4FCCA 2NADA 1FJHA 1Q7BA 4IDGA 4BNFA 4R5MA 4GX1A 3OEWA 5EQDA 3DZGA 3R1IA 1LJ8A 2C20A 1QG6A 3EYWA 3JV7A 4DIFA 4FSHA 3E03A 4N54A 5CFZA 3E48A 1BTOA 5KNLA 4J9VA 2W8ZA 3ETEA 2EW2A 4DPLA 3L4SO 4M87A 2GRAA 5U4QA 1IL0A 3DBHB 4D46A 1UDCA 3DO5A 2AEFA 4BO8A 4MVJE 3PJGA 1W4ZA 3VTZA 3P5SA 2A35A 5T67A 5GZ1A 3UF0A 3COSA 3UICA 2V6GA 3GHHA 1CJCA 1A9ZA 3VZPA 1RM5A 1YONA 4CLXA 1I32A 3TN7A 4A2CA 4BO0A 1T1SA 4DYVA 2VYND 4WNIA 5KOIA 4IDAA 2G17A 1V6AA 4L74A 1LSUA 4D0RA 2VCYA 4D42A 5DCYA 1LDGA 1SPXA 5F3RA 3PXXA 1LQUA 2X9GA 1AHIA 1MP0A 4KMSA 4JX8A 1LDBA 1E3WB 2HK7A 5ES3A 3PYMA 4IPTA 1QLJA 4NFYA 3IJRA 3WNVA 4YTEA 2PKQO 3SX2A 1PWZA 4RVSA 1LRJA 1P31A 2EGGA 5ITWA 1EVYA 1H2HA 1JVSA 5IZCA 2AQHA 2VUTA 3GVHA 3NTOA 2EW8A 1HEUA 2C2YA 4UUPA 3F3SA 1I30A 1PJQA 3OFSA 1UXIA 5I7EA 1YBAA 3B1FA 1GV0A 1P1JA 1O89A 4BNLA 2IRWA 1KS9A 2Q2WA 3Q1LA 1JWBB 2BRUA 4ZN6A 4RORA 1E6EA 3P19A 5ADHA 1IPEA 2BI7A 4BO2A 2I99A 1TEHA 5ICSA 3U4IA 4J0FA 3PZRA 1YQDA 4B4VA 1RJWA 1WP4A 3O38A 3D0OA 3Q3CA 2VTEA 2HK9A 1H0KA 4H7PA 4CMHA 2G5CA 4P4GA 4ND5A 3QHAA 5FF9A 3EZYA 3OHSX 3JQ9A 9LDTA 4GQAA 1GPDG 2AQKA 2FR8A 3DBVO 3NRCA 4UEJA 4IXTA 4HV4A 5HTOA 5JFOA 4TVOA 2PR2A 4BNGA 1PZGA 1UDAA 5COQA 3PWKA 1JWAB 4ZGWA 3ZV6A 4JNKA 5EPOA 3MOIA 5KKAA 1DC4A 1R16A 3LZ6A 4NQZA 4DWVA 4FQ8A 2I65A 2ZIZA 4MIYA 4RO0A 2V65A 2IE0A 2ZTUA 4MIOA 1JQBA 3UOGA 1YB5A 3V1TC 3JD1A 3WYCA 1GZ3A 3ZHBA 1J49A 2RH4A 4GSLA 3WNQA 3JQ8A 3I52A 3BTOA 3PPIA 1K2WA 4JBIA 4JLWA 5THKA 5DT9A 1WNTA 2Y68A 3K8ZA 4CMGA 4ALJA 4WOJA 3F46A 3BMOB 1U7TA 5GMOA 1DLJA 1N1GA 1K5HA 3DDNA 2IZ0A 2JAHA 4DIOA 1B3RA 1NFQA 3VAZA 3BMQA 1VJ1A 2C59A 4OSPA 3VH3A 4BV9A 2W98A 1B7GO 4E2XA 1TT5B 4JROA 4YPOA 4NK4A 3DTTA 2QRJA 3IP1A 3CIFA 2AHRA 4KP7A 2A9FA 2HJSA 3SLKA 2AQ8A 4N5NA 3NT5A 2NVBA 1EK6A 1PU2A 4FFMA 4WLEA 4RVUA 2DFVA 5CG2A 3CE6A 4ZQFA 1DIGA 3C24A 3V8BA 2GERA 3PGJA 5DP1A 1DLIA 1TXGA 4MIEA 1U2DA 1RYDA 4HWKA 4FOSA 2HJRA 2E4AA 2WD8A 3FF4A 4J49A 2VT3A 2HLPA 4IGEA 1Q0LA 3BXXA 3D64A 1C1DA 1NWHA 4ITUA 4XR4A 1OFGA 4WCFB 2P5YA 4GKBA 4RVFA 1RM0A 4MVJG 3IJPA 2ZK7A 1IB6A 4ZQBA 3DB2A 3Q6IA 1A27A 3WTCA 1DC5A 4DQXA 4XQ9A 1YXMA 3EMKA 4L4SA 4OXYA 2HCTA 3QQPA 1NFFA 3D3WA 4Z0HO 1IYZA 4JCOA 1CEQA 2PZMA 1PR3A 2FY8A 1I3KA 4BMVA 3EY4A 7ADHA 3JYOA 1ZK3A 1WPQA 4UUMA 5DULA 1DC6A 2EKLA 3KYCA 3FBTA 3NJ4A 4GLOA 4W9NA 4CM9A 1DIBA 1VSVA 3NT2A 4BO4A 1XU9A 3AU8A 3SXPA 4CL8A 1SEPA 3WFJA 4CQLB 3H9UA 2HDHA 4ZVVA 4DC0A 1YBMA 2ZTMA 5L7YA 1GUZA 1NR1A 1P9LA 2O3TA 5H81A 4EJMA 2OBNA 1E3EA 3ZCXA 1A4UA 2FR0A 2X5OA 3VPGA 1U7HA 4HFNA 2A4KA 3OQBA 3WLFA 4MINA 1LLDA 1DDOA 1DPGA 1I8TA 5A3VA 4JXKA 2J8ZA 2J6IA 3FWZA 4BKOA 2RAFA 1SBYA 3HDQA 2D5AA 4MVJI 1PJ2A 4ZQHA 5L4LA 4L75A 1DO8A 5MDHA 3KV3O 3RVDA 3ASVA 3HHPA 2GZ1A 3RFXA 2NTNA 1ZBQA 3R6DA 2POQX 4MP8A 3W1VA 1I3MA 3ROPA 4YQZA 1A72A 3QP9A 3ZHZA 1KERA 4JJGA 3ZWBA 1ZK0A 4BNJA 1Z82A 3KEQA 2C07A 4XWYA 4AVYA 2Z5LA 3AM5A 2GPTA 2JD2A 3ADPA 3E9NA 1NP3A 2JFFA 5TS3A 3GAZA 2FRDA 4B4OA 1L1FA 1OAAA 3KHUA 3P2OA 4KWHA 3ICPA 1P77A 5LC1A 4BNYA 4OM8A 1O9BA 2ZJ1A 3U09A 1LBEA 1PGQA 4IY1A 1E1KA 4E5MA 1DHRA 1J6UA 2XPCA 3H6KA 3BZUA 4YJFA 3RAJA 2X4GA 4MP6A 1UZLA 1E3JA 4I8XA 1GQYA 3WQSB 5TNXA 2WEKA 2O3UA 5I8WA 3G17A 4C7JA 4CLRA 2Q3EA 3D5QA 1KC1A 1LUAA 3OP4A 2V7PA 4IJVA 4PG7A 1EDZA 3Q11A 3ZWWA 4CQMB 2H9IA 1PGOA 2VWGA 3GVIA 4FJ1A 3WB9A 3WGQA 1YOVA 4BKUA 1P1RA 4A10A 1SEVA 1LI4A 1WXDA 3IIEA 4BGVA 1GU7A 2J3IA 4BQPA 3D5TA 2Q1UA 2I6TA 4HADA 2BGMA 3CINA 3ZU3A 3FNFA 5JYDA 3FSRA 1GQ2A 2PD3A 3GUCA 5JDCC 4Q3DA 2HRZA 4P4NA 4ONEA 3F1LA 2YY7A
chains in the Genus database with same CATH superfamily
1Z34A 5ELMA 3IHLA 4YP6A 1W19A 2X77A 4XVUA 1QCZA 2Q3BA 1W48A 4LHYA 2FOLA 4MW0A 2P9TA 3KB6A 3WRXA 1QYWA 1KARA 2PYIA 1GPYA 3Q9UA 4EX7A 2O20A 3WGKA 4H0NA 1XLUA 4F97A 1IN7A 3OCJA 2EKQA 4CIDA 1AQUA 1HTBA 3I5MA 4N7BA 1UK6A 4JLKA 2FSUA 4J3FA 2YV3A 1NLFA 5E3HA 4WUTA 3SNHA 4XYGA 2YZNA 5AVZA 1S8OA 1U9IA 2GZ3A 4ND2A 4D4KA 2Y27A 3PQ5A 3EIWA 1NF3A 1IK4A 1OXBB 2Q4BA 1EDOA 1KE1A 1P6QA 1PSZA 4DV6B 1WW2A 5IJXA 1QBGA 2XYQA 5HE8A 1MAHA 3SVTA 2G4LA 2Q1SA 4R68A 5EIBD 1N2ZA 1OC4A 3AIMA 3V2GA 1WXQA 1X14A 3K96A 3NAGA 4CM9D 5C3MA 4LOAA 2JAPA 3GNSA 4D5EA 5JFTA 1LB1B 1AB5A 3S27A 3KXIA 3W5BA 5FTKA 2OLKA 5HW0A 3E9CA 3IPRA 4PM4A 5FV7A 1W0JD 1ZGHA 4Z54A 3PNQA 3ZVLA 2C8JA 4CDMA 1VPWA 3OLVA 2VSQA 5ALRA 3C5WP 5EZYF 3LLUA 3JQFC 2IYXA 1RJEA 3HRIA 2JHPA 4LC9A 1NX6A 2IY9A 3G8DA 3R24A 1I14A 2VPXA 2XE8A 3KQOA 4Q6WA 3STHA 2CLSA 1L5MA 1PIWA 3CEJA 2B20A 4GBMA 3OE7D 5IBRA 1H8ED 1UQUA 2ACVA 3GT4A 1FF9A 1WQ1R 1X7WB 3CNQS 3PHCA 1H4QA 2OHJA 3OFND 1VE1A 1YGYA 1J1ZA 1NLMA 3W7VA 4TRNA 5BWMA 3TRHA 1Z62A 4JJIA 3M9XA 1K7SN 4FKMA 2JB9A 3BJRA 4R5HA 1L4YA 4ZFNA 3ANSA 1AXGA 1DJQA 4U6QA 1Z63A 2I6GA 4PPFA 4QUGA 1A71A 3QKTA 1R0XA 1XQWA 3T0GA 4AMZA 3AVYA 4F4JA 3AESA 1IBRA 1F1BA 1MIOB 2G5TA 1LVUA 4MQ5A 3TL6A 4JBLA 2PMBA 3MTBA 3OZIA 1PWHA 4WT7A 4QE3A 4RJLA 4G3XA 3LE8A 4H4DA 1JLLB 2ERXA 2H1FA 2HSWA 1GARA 3W6ZA 5IM5A 4MQFA 1TTPB 2X4LA 2PRIA 3Q3JB 5TXGA 1MNAA 4KYTA 4Y2UA 4NZMA 4W5WA 5A04A 3L07A 4OBBA 1KI2A 1X87A 4GZMA 2BFPA 4FR5A 4XD7D 4E2YA 1TTHA 3SZGA 4JL5A 4AN4A 1YJBA 5FUWA 1FYDA 4R9SA 5AUNB 4YXFA 1THGA 4NRDA 4MPPA 3UHPA 3WL6A 1O97D 1QBKC 5BUCA 2UKDA 3L8YA 4C1BA 2E21A 4YHHB 4IMIB 1U7DA 2C2HA 5JDIC 4J9UE 3GGCA 4MVWA 4BBPA 1ISRA 2HHAA 3TD6A 2OA0A 3WIBA 3JALA 4P38A 3H4MA 2JLAA 4Q7KA 1W4LA 4TQGA 2NZJA 3AHGA 4ZODA 5IJ9B 3QE9Y 3KEFA 1SXJE 5CRIA 2X14A 4E5DA 4RD2A 4M1TA 2C9CA 1U7OA 3PE4A 4OH1A 5DHQA 4MUYA 5AVVA 5FPYA 4AWAA 1QF7A 3AQ4A 3QKUA 4KQ2A 1FBTA 1SHJA 2IZOA 1VLVA 3EZLA 5KSYA 1KE2A 1C2YA 4AN1A 5CA0F 2BFBB 2CFCA 2OO5C 4J0HA 4CMKA 1V5EA 2EZ8A 1WEKA 5AK0A 1Y5IA 4W5QA 1OXXK 3K35A 2ZI3A 1T1RA 2AE2A 4HDQB 1FRNA 1EX9A 4J1JA 1MBZA 3QOFA 4D6XA 1Q57A 2CL5A 3VH2A 3E0QA 1VIYA 2REQB 5K8UA 3LYAA 5JC1A 4RJIA 2WFLB 1U81A 3RD5A 2GHTA 2JI9A 1N2BA 1Q74A 5KTRA 1T36A 3ND7A 3G7NA 3ZD7A 1P0MA 2ID4A 4HVAA 4RPGA 5HPYB 2LDBA 3Q4GA 4QELA 2IBTA 4BJ5A 4E46A 2HCFA 2VR1A 3O0DA 3RYTC 1NWCA 1BGXT 2Y9PB 3KAQA 4MQBA 1GGVA 1P4RA 2DPLA 2UUOA 5TJHA 1VRWA 3H3XA 3SYRA 3LUGA 3U7QB 3UWSA 3F7NA 3KELA 1T4GA 2X2PA 5G0TA 3O3NB 3N75A 3FJYA 4WLUA 1QQTA 2R8YA 1WDMA 2EJBA 2WPNA 3D2AA 5DLYA 1KVUA 1V9CA 4CQNA 4UTOA 1HTTA 3OESA 1ORTA 3IXQA 3AVWA 2BLLA 2P7HA 3LUKA 1NQOA 4ANFA 2GJ9A 3B9BA 3I58A 1DUSA 1T2FA 2ZCVA 1MB4A 2D2FA 3U0BA 2GJ8A 3S2IA 3KSRA 5C1OA 2BHLA 3EZNA 4PLWA 4GLLA 4M36A 1KFEB 1EZZA 3CM0A 3FR8A 5ALOA 4IYJA 4RZ2A 3RW9A 4BX9A 5FLXA 5CDTA 1T5OA 2CFSA 2PUWA 2FUEA 4JP5A 2ZBDA 1C30B 1PL8A 4L8VA 5HF5A 3TZHA 4YRBA 3LT2A 4WY2A 4B4WA 4PBTA 3AHEA 1JR3E 1IAQA 2O2YA 1YZNA 2OXTA 4DDUA 2O2CA 1ECLA 1SD5A 1WSWA 3WWEA 4YV2A 2HRCA 2OP1A 2D8MA 1MIHA 1KR5A 3OCCA 2CBZA 2J3EA 3JD4A 4GPBA 5EMNA 1B6RA 3FYSA 3KWMA 4ZAVA 5LUAA 3THWB 3OLCX 1VP9A 3K1YA 5JMWA 1KKMA 2FK8A 2CNNA 1KZ1A 1VE6A 1Z4LA 3W2TA 2GN4A 1BWQA 4I9FA 1WPGA 2YV4A 5JASA 3VKVA 2CMDA 4U0JA 1XJWA 3P9PA 1XK6A 5C2JB 3VR2A 1QH0A 2O54A 1IHDA 2X15A 1Z39A 3F71A 1JLKA 4XCVA 1UXHA 5THQA 1ZSYA 1EAYA 2XNKA 3DZDA 1CVRA 4Q48A 4QIHA 4UHFA 1T8RA 4X45A 3RWBA 5DGDA 2CCJA 2R47A 3AV3A 1DKPA 3NIDB 3T5TA 1N36B 5CYFA 3KE9A 4ZVOA 2GCEA 2YKGA 1XCGB 3ZI0A 4HQNA 4LYAA 1JV2B 4DLKA 1HPLA 1WKBA 2COEA 2CXRA 4GKJB 5TQ0B 3DOCA 1DX6A 3Q0IA 1XKXA 1EGAA 3LWNA 2W2TA 2MSLA 4CTOA 3CX6A 2A9OA 2EFCB 4G41A 8ATCA 1XTQA 3NFRA 3NCTA 1NUAA 1E2JA 3DE0X 3GGSA 4NJMA 2QRUA 3ORYA 3NAMA 5B7GA 3FGPA 2RGWA 1GKYA 4WOPA 3R9IA 1JKJA 1UZNA 4Q9HA 1NTRA 3IVXA 3OTHA 4KV7A 4X3PA 4AYTA 3F5MA 3G2OA 3K0CA 1V26A 3HV0A 4XXHA 3DMHA 3JD2A 2HWYA 5EN4A 1NYQA 3N07A 4KL8S 2Z3VA 5DK4A 4REQB 1QFYA 2I1WA 2LCIA 5E1BA 4KHPB 4LGMA 4UCQA 3NM5A 2HTEA 2ISQA 3D3WB 4Y9TA 3RJ5A 2EU8A 4F2DA 5B4VA 5L45A 4FC6A 4ZT4A 3QYAA 2O0MA 2QTNA 1NPDA 2WU3A 4YDHB 5DTEA 5B3AA 1M75A 3E0XA 4R1MA 3HDVA 5KWSA 4EY6A 3EXIB 1AQ6A 1XYGA 4LVUA 2PR7A 3TS1A 1E2NA 4FX2A 5LU8A 5AVTA 4U02A 5I5EA 4UNQA 4OHWA 5DHUA 4CLHA 2NV6A 4PIVA 3WAJA 5KC8A 2AXQA 3QY9A 3PJEA 2COUA 4RCYA 2IXFA 2FUNB 3LV8A 3KZNA 1USGA 5TQVA 3OETA 1BZYA 2PRZA 4BAUA 1P33A 2CLKB 4HNGA 5IBCA 2D1YA 4I50A 2V0GA 2JKVA 3RFTA 2ALJA 1RQRA 1LBIA 3AYZB 1L3BA 2EHJA 1FC0A 3MRTA 4UD6A 1FFYA 4Y6OA 4O4LA 3L0DA 3K2IA 2JI8A 1MH1A 4RPKA 4HWRA 4UMEA 1BU8A 1JQEA 2WMOB 3DL4A 1FFXA 4B34A 3SOZA 1KMCA 3AWDA 3AR9A 4GGOA 1JXQA 4QUHA 5AICA 4AY3A 4JKIA 1B76A 4QNMA 5JANA 4MROA 5FI0B 3CX8A 4Z49A 1FX0B 2WFMA 2MHCA 1JX6A 3ZZMA 2Y99A 4QU9A 3VZQA 1E77A 4ZJPA 3RU3A 3AFGA 4JIGA 1S2MA 3GRKA 1IJBA 1IJFA 1S2NA 1XTRA 4D41A 1IH8A 5K3EA 5I4BA 2F59A 4Z86A 2IQ5A 3H9BA 1NBOA 4Q93A 3D31A 1YA8A 1LV8A 2ODAA 3F3KA 4UMDA 1W44A 4RKEA 1L5HA 4NMLA 1WDWB 4AJEA 1TMKA 2BEJA 2PAAA 2CT8A 2EQAA 3UJ7A 3HKBB 4KTVE 2QD1A 3H5OA 1RQNA 1TU3A 2AV6A 2RBKA 4AN0A 4BUCA 1OWNA 1BRMA 3H9JA 1CU1A 4OB7A 4OHPA 4B76A 5EKUA 3WYEA 4Z3OA 1UKVY 4EKIA 3R3ZA 1QCYA 2RD2A 2X8WA 3IMFA 2H3EA 4K2HA 4NNPA 3VI4B 1P5JA 2C3PA 5J5VA 4YAIA 3GJSA 3AHCA 5C8YB 5KYXB 2VSYA 3LT4A 3MUFA 4R9RA 4WE3A 4B7CA 3ECAA 1DBPA 2CJFA 4YJFB 5E0OA 4KSCA 3ANXA 4OOEA 4YRLA 1AQLA 4RA9B 1YQTA 5LWHA 2JLSA 3TQIA 4V0SA 1JQJC 4P3OA 4S2UA 1D2HA 3V7YA 4QA9A 1IOWA 3AH8A 4AZTA 2BC9A 3L0BA 2W0MA 1UC5B 2B4AA 3FLMA 1NM5A 2PKEA 2VDRB 1GTJ1 3JTEA 1PW7A 3VU0A 4AP5A 3JQFA 3GNLA 4NP6A 5ALYA 4DDKA 1Z4PX 1MW9X 3IQHX 3WR5A 2W2QA 2H0AA 4CKEB 2F3SA 3LP8A 5B55A 3T7TA 5K1ZA 4DV7B 4RTRA 2VHZA 4B6FA 4YAGA 2O2HA 3TAUA 4CUKA 5JG7A 2INGX 2ZWMA 4GQIA 1EG2A 3ON5A 1UM8A 1IXZA 3BTUA 3LUHA 5ALJA 2YFQA 1UH5A 3BJMA 1NZDA 3PBKA 2R8XA 3PL5A 3VR2D 3EUFA 3HV2A 1TQ6A 2HBZA 2C82A 3N6RA 1VE9A 4RABA 4N8SA 4ZU3A 3TH5A 3C5EA 2G25A 2ONJA 2VHQA 1LWNA 4IQ8A 2XAAA 4KKXB 1WZCA 4WA7A 3T8YA 4Z0PA 2ECKA 5F7XA 4BLVA 1NJGA 1RHMA 2B8JA 2WHQA 3I9OA 1GA1A 3P2MA 1YQEA 1T0UA 2I67A 4I3FA 3OT4A 4K9MA 1XQ1A 2QTRA 4PYKA 2RGAA 3ZE8A 1G6Q1 3EEBA 4HP8A 3LLCA 1HX7A 1PI3A 3DVAA 3IQZA 2AUTA 1V8BA 1WXHA 4K46A 3W5UA 1DMSA 4C01A 4BTVA 1KMIY 1VJTA 3OZCA 3SM9A 3I2KA 3PYXA 2OV4A 2VTDA 3IBSA 4MOWA 3T12A 2IS1A 4KVAA 4AY6A 4EPWA 1PFWA 1SWVA 1RACA 3MCVA 4LJSA 3LUDA 4JUAA 2PAFA 4MGYR 4D8VA 3QIAA 1EUDB 2FSFA 1TM7E 4CM5A 1RLTA 4KWTA 2LRHA 3V4VB 4ZA2A 5LQAA 1JG7A 5HQTA 1XZMA 4BFLA 4EMBA 4Y2VA 3CGWA 5DK6A 2X13A 3MWLA 4FK8A 2JGRA 4PZDA 3ZZTA 2ZWOA 1WUJS 2DJIA 1EK5A 3HFGA 3O1HB 3EGCA 3OKPA 4HRAA 2ZB3A 3FTFA 1UANA 5JDIA 3RYIB 1VLMA 5L7TA 4QKQA 4XRRA 3R76A 3K53A 4N8DA 5HRUA 3RT7A 1NRIA 3EC2A 4EG7A 1CQJA 4OLBA 3DF7A 3H6HA 3CZPA 4KXVA 3FB4A 1UUFA 1WP9A 3KDSE 3AI7A 2WKSA 2C0QA 5CLHA 4AZ3B 2IU0A 3V3TA 4V1CI 3VOBA 3ZE1B 2VLIA 4QBKA 1A7KA 1V11B 4ZEVA 1RHJA 3GC6A 3IUBA 1FUEA 2PFGA 3IPCA 3BJZA 2DC1A 2XRMA 1ORRA 1GR0A 3IOYA 1BJTA 4K0RA 4W8GA 1FFWA 2OO5A 4XH9B 4D81A 4E5KA 4TLLB 1F2DA 1OLSA 3TSYA 3OG9A 2R65A 3C97A 3DMYA 3B70A 5FADA 3INRA 2YHUA 2OG1A 3T9BA 1LPBB 1VKHA 3DT9A 2WUGA 1I2CA 4V0QA 4XJTA 2GM3A 1SIWA 4IV0A 4K1LA 3HUDA 4FFPA 3DONA 4IILA 4B5LA 3SZLA 5AI9A 4N47A 2IXTA 2QSUA 2PX0A 4NV1A 3WLTA 3ICEA 5AW0A 2NP7A 2Q5FA 5BR8B 1EI9A 1YDEA 3CWZA 2A5DA 4GNKA 4Y0NA 1NNSA 3CS3A 4DR1B 5AD1A 3UV7A 5FLYA 1R4MB 3I2JA 4Q9KA 3TX6A 3VPCA 2W42A 1AV7A 3GD5A 4LV8B 3DZJA 2XD9A 3PUIA 3AFOA 2BI8A 3LSYA 5C34B 3Q9SA 3WE7A 3ZHVA 4DV2B 1KEVA 4KDCA 2P65A 3QVMA 3HDTA 4HTFA 3HZOA 1G7TA 2YWFA 2ODBA 5EG5A 5F2EA 3RVKA 3N76A 2A9PA 5I9NA 1PO7A 3EMVA 3FYUC 1HG1A 5IM4F 5MF6A 4KDRA 2VQFB 2W2VA 3BRWA 3LPAA 1RYBA 4BBZA 1E0AA 4AYXA 3NYIA 1RADA 2O0HA 4Q3OA 1TEVA 3C3JA 4F8EA 1P2BA 3DO6A 2YZ7A 1CHNA 4L8LA 2A5JA 4MVJM 1ATIA 1BKDR 4E7PA 2A3NA 3N2KB 3RKUA 3CUYA 1XLWA 5BSFA 2CV1A 5EXTA 1IRXA 1LBTA 3DOJA 1BX3A 4JD5A 3R7WA 3PEEA 1GYQA 4G1FA 3WYBA 3DLPX 5A6SB 3JD0A 3MJSA 4N6NA 3U40A 4BC1A 3VYRB 4Y7CA 3USCS 2Q3FA 1AOXA 3C14C 3EY9A 5K0ZA 1CUXA 1N2OA 4BQQA 1PDWA 5IMBA 4NBSA 4QVIA 1NYTA 4UD2A 3HL4A 5UKDA 4ESHA 2PBZA 2RGDA 2BLNA 1Q95A 4JC8A 1EUZA 4BV8A 3QU4A 4JI6B 4FN4A 2CC2A 4BIIA 3AIIA 3EEQA 1VCNA 1EX1A 3SF8B 2C4NA 1HGXA 1WL8A 2VOEA 3B60A 1A98A 4XDGA 2PGLA 3QX8A 1OI3A 4Q0MA 3IVGA 2HI0A 3HABA 4RWEA 1KMHA 1FDRA 3CKMA 5EWLB 4CV3A 1FCJA 2XGGA 2X8AA 3G7UA 4LPKA 4AS3A 5LJLA 3CH6A 1F4PA 2I62A 1VLHA 5EJ2A 4G4SP 4US0R 4DUGA 4D92A 1QIHA 5LOVA 4OIFA 5E2AA 2NUAB 1XD8A 2PMDA 3FY4A 4JVMA 3OPNA 3ECCA 4GYYA 2DFTA 1M1ZA 2A3RA 3WMXA 3I6IA 1M10A 2WYIA 2BVNA 2PSDA 3JVDA 5TLSA 1Z2OX 2E4VA 1I3OA 3TNFA 4XARA 1RPJA 5KAPA 5TSDA 3LBHA 5JT1A 2NU8B 2EP5A 1RQPA 1RP7A 1SXJC 1KEKA 1M2EA 1O9HA 2NIPA 4B4KA 5ADVA 1NN0A 1SXGA 2AF4C 3ONWA 4HGRA 1DJPA 1ZKDA 3OQOA 3LUAA 2GN9A 2V7TA 3CXUA 3HQ4O 5B37A 2COKA 4O5OA 2RHOA 2VAMA 5SY6A 3WFZA 1AF7A 1ZJ6A 2Q9AA 3LUBA 5AXCA 2Y1WA 1YQGA 2YYSA 4GWGA 3T1QA 2E0IA 4ZOBA 2R8ZA 4DLSA 4DS3A 5IG2A 4O4HA 1P80A 3GHYA 3T9AA 4EHBA 3DV9A 4I3GA 2JIQA 1P72A 1DKRA 1KI7A 1N75A 2JATA 2Q41A 2JAOA 2X0RA 2ZRNA 3G6WA 3NH9A 4IM7A 1Z75A 5DP2A 1ORVA 3IV6A 4HAVA 2ZRDA 4X60A 2QTBA 2VA9A 3ED1A 3AFIA 1QV9A 4QM7A 3O4JA 4QODA 2J07A 1QZTA 3RM3A 3L18A 5EWMB 4GX2A 1M1NA 1WV0A 2V8BA 1VIDA 1F38A 4LZPA 4MS4A 3UJBA 1CJBA 1VMKA 4S1TA 3GROA 3EXEB 3TQFA 1J2RA 3LK7A 2H29A 3GFBA 4EPXA 2HRQA 1UJBA 5ITZA 1SQ5A 4QU0A 3OWXA 3JQAA 1OV4A 3P0FA 1ZH8A 2IHNA 2BGNA 2JCGA 3MCAA 2WVAA 1GQFA 1VCHA 5JY6A 4PYRA 2BUBA 1WVIA 2WR8A 1XZJA 1K7FB 3C3DA 2V0NA 3N3AC 2NTVA 3O21A 3ZWAA 5KX5A 1LK7A 2FPRA 2WT8A 3I42A 1GPWB 3GP5A 1C7FA 1JEYB 1QC5B 1MVLA 3DC2A 5H4GA 1X42A 2XYHA 1W6UA 3NHYA 5FQNA 3NPMA 4A91A 3E18A 1FS6A 3WLAA 3VU3A 3ETNA 5CA0B 5JSZA 3ZV4A 4D9MA 1OIWA 4MLCA 2KWIA 3WHKA 1XTJA 1PT8A 3E7FA 3DOFA 4M1MA 4GP9A 4QEZA 4ALIA 2CN1A 1Z16A 1AHHA 1MOQA 2OXFA 2W2KB 2X2EA 2ZUUA 3D3JA 3FMVA 4J1QA 1RBQA 4LRYA 4EDFA 4ZREA 2XX3A 3C8MA 1GNPA 2X0DA 1U28C 3EZFA 1C80A 3KLPX 3M0EA 3TNJA 1SMKA 5HUJA 2CDCA 4HGYA 3UW1A 4PZ0A 5JLJA 1LU9A 1Z36A 5IC5A 4M8LA 4ACAA 2FQQA 4Z4GA 4OGWA 5L9AA 1AN0A 3LF1A 2GEBA 3BRWD 1GILA 4JH0A 5LLSA 4AUMA 3BFJA 5H9VA 1KFKB 3D7RA 2C04A 1ZIYA 2HHJA 2PH1A 2PT7A 3DZFA 4Q39A 5TMDA 2NUTB 4K03A 1T5LA 2FCAA 5AKYA 1T25A 5LQMA 1DKUA 1VJRA 3UMYA 3RS3A 3PQ8A 4YV7A 2O4UX 3HDGA 4GMDA 3FYDA 4FFVA 3VYUB 5C52B 3BSFA 3DPSA 1KVSA 4D9JA 1N6NA 4BX3A 4IWXA 1T9CA 4D02A 5FBLB 3K9FC 2J7KA 4J91A 3MAGA 4MGIR 1GZ4A 4OB6A 4P5EA 1QDLB 2O07A 2Y2VA 3LY9A 1KZYC 5CDUA 3DOUA 5ALXA 3N1UA 2PVSA 1YZUA 5BR1A 2XE6A 4YAKA 2CJPA 1E5XA 1W59A 5CA1A 2X7HA 3MS4A 4Y6PA 5CNKA 4HH1A 3RTCA 7YASA 1YC5A 2VJNA 2AI3A 1AUVA 1QK3A 4AJ2A 4E30A 1Y63A 2NVOA 2V7GA 2QN3A 1M7BA 4IKEA 3VHLB 4O25A 3SIXA 5FWXB 3FPBA 3KO8A 4AJHA 3WADA 5JXIA 3C85A 2CB0A 4PZUA 1ESZA 2JNWA 4XE5A 3X2FA 3U4HA 1MO3A 1KS2A 1Q7CA 2OBFA 3GRFA 4TLMB 1LDEA 1F06A 1NVTA 4OXIA 4R0VA 2UV8A 3WK9A 4WJLA 4BGIA 5IKMA 4ZQCB 5BUQA 5AJUA 1Q1GA 4EW2A 4ED9A 3JAMA 1MKYA 1N3YA 4A0FA 5HRAA 5FT9A 1XMOB 1GWNA 2V3CC 3EIXA 2I80A 2V8OA 4WACA 2IZ6A 2ICAA 4IDNA 5C9ZA 1B2LA 3HVJA 2YS7A 3UJHA 2F3PA 3VR1A 4QDOA 2NXNA 4LY3A 3AP3A 3I76A 3MQ2A 4D9IA 4JENA 2VK1A 4YI5A 4OLAA 2MYPA 1PZFA 4JZKA 4YJ3B 2NYRA 3KVNA 3QXGA 3SS9X 2XGJA 1V3QE 3HBNA 4LX0A 4EBBA 3ZE9A 4K7JA 5LZ7A 1URPA 1ODFA 1Z4OA 2VDMB 3Q2IA 4EIWA 4MRMB 5C1DA 1F51E 4EHLA 3NWPA 1PR2A 2W2MA 3U39A 4TRMA 1UQTA 1XCJA 4IH4A 1Y1KE 2JAUA 4FNOA 2ZCUA 1U9JA 1M1YA 1KEEB 1ZMTA 5EZSA 5CYOA 1NBHA 3STTA 2XKJE 1L7RA 3UJDA 1XRSB 1ULZA 3AVXA 3MMSA 3BL6A 2VDLB 4W82A 5IYZF 3EA4A 1GAXA 2HT6A 1O96A 4IQFA 4Q7JB 4ZDWA 1Z5GA 4Y2QA 2NPOA 3SZMA 2ENUA 1BHO1 3ET5A 3LHIA 4Y2SA 3VKGA 4RZIA 2ZJZA 1QWSA 1QGUA 1UWVA 5E4YA 2PVPA 3B2NA 5AVOA 2P9HA 3S68A 3U1BA 5MHTA 5BMOA 1N8NA 4GWLA 4PNZA 1QB7A 4EI9A 2GPYA 2YIVX 2RGXA 1ENYA 2CSXA 2IHJA 4DEXA 1ZMRA 3ZQUA 3BFXA 1B2RA 5A4DA 4GC5A 1XCBA 2F00A 2Q9BA 3ZTYA 1OI4A 4OKIA 2UXCB 3EDYA 4BEWA 4XVQA 3CUWA 1LLUA 1R0KA 5JE8A 1NW4A 1WOMA 3UAGA 2CZGA 1ZW6A 2FSVC 3IVMA 1E2LA 3GIWA 4MUIA 1ZWKA 4CM3A 2AS0A 3MMPA 1HLGA 1UK8A 1GU0A 2GN1A 3IQGX 3JQAD 3USZA 2DB3A 3IKLA 4L51A 1Y8RA 1QHHB 4FEEA 1QV7A 4H7JA 1XXHB 2DQZA 2GWRA 2IW1A 2WUEA 1E9AA 3EISA 3GOQA 3OUZA 4JI1B 2VPQA 2ACKA 4IIBA 4W9MC 1UODA 3QPWA 4LDNA 4OAPA 4M55A 3WBBA 5AQ1A 1QNLA 1TA0A 3PXAA 4V02A 4HKTA 1T6ZA 4MMYB 1IZ0A 3QUCA 1T4DA 1Q0PA 2NO7A 2OO3A 3OEHA 4YMGA 1N9GB 2EW1A 3H0EA 3RUHA 2WJJA 4GD3Q 3TR6A 4AJPA 3L2OB 5EJAA 5BN4A 3EOBI 3LVRE 5LU9A 1P19A 1T26A 2ZUCA 5AW6A 4NU8X 5FHRA 4ERXA 1FRVA 4DXHA 1Q19A 1ONNA 1BAPA 2PUDA 4I55A 1JLHA 3OZAA 1R5OA 4IIEA 1FNDA 3UKJA 1PJ4A 5E8JA 3FMPB 3FYUA 1MX1A 5DIFA 1PE0A 3GFGA 3HEAA 1XZGA 4K1XA 4LRSB 4MUAA 5EWJA 5A9TA 4Q4AB 4ZV4A 4R16A 2JFBA 3BMXA 3GFVA 2CLFB 4BB5A 4YQFA 5J1SB 1WBBA 5D86A 3LRTA 1UXGA 3SFVA 3INYA 4FHCA 1P0CA 5T3YA 2D6FA 3OZXA 1I4DD 3C3XA 4RF3A 1SUDA 2BSAA 2EX0A 2IELA 2RC6A 3T3DA 3ZLJA 3E5RA 1V7PC 1NW8A 2AX3A 3RHTA 1EUYA 4NBKA 1O2DA 3TVTA 3JQ7A 2HIGA 5AMXA 5IX8A 3LNTA 3WJAA 1YK1A 1HEYA 2JBWA 4BX8A 2J9RA 4E07A 1NJSA 4QUAA 2I6XA 5DKFA 4YUAA 2AFRA 3K16A 5G0VA 4EG4A 3CR3C 2CMKA 5DFAA 3SQLA 3L7LA 4FONA 1Y9EA 3GJZA 4HF7A 4KW7A 2BTQB 2P5UA 2XYPA 3Q87B 1K0FA 3H18A 3DMNA 5CT5A 3HCPA 3GOHA 7GPBA 1DKMA 3D3QA 1YBFA 3E3LA 5IXYA 3E9DA 4Z8XA 5GWXA 1RSZA 4C04A 4ZCPA 3AJAA 4TXNA 3C7KA 3WWYA 3D9QX 3V8EA 5B53A 5TF0A 2DFKB 2OUIA 3DTNA 1C8VB 4G2NA 3AR8A 1RKUA 1O6FA 3NR2A 1DTWA 4IHAA 1W1WA 3SEAA 2VS1A 5AVJA 3BFPA 5J23A 4FT4A 4KN8A 3ZCQA 5JCZA 4J1NA 1T9KA 2XITA 3CF0A 4LJ6A 1QV6A 5DO9A 6ABPA 1DRUA 1K8QA 5EA2A 3I83A 4YMWA 3LVBA 4RCVA 4ND8B 3LGAA 4PC3A 4Q3BA 5KYKA 1MQSA 1OTYA 2EZ4A 1Z7YA 4LIPD 3S2GA 1AGPA 2IYPA 1KYWA 5G4KA 5JNSA 4KTTE 1Z7BA 3NVAA 4FUQA 2LXNA 4ND6A 2BBOA 2GYUA 4AXXA 3A4LA 4G0UA 3MK31 1RXCA 4RH3A 2FE4A 3UEOA 1GLVA 4C4YA 2Z1MA 3A3YA 3CLKA 1GTSA 5BWLA 4B3TB 1GJRA 1W5FA 3UUWA 1FSPA 2HXGA 4HJRA 1OV6A 4PIPA 1W75A 2GN2A 1Z0KA 1UZUA 3BRQA 2HO5A 2NZXA 2R6R1 3D8TA 3HCCA 1CUJA 2AFHE 3KUDA 1OTXA 3LYHA 1LSOA 4KI0A 4KZKA 4RTOA 1U3DA 2BZ0A 3BILA 3K6JA 3L4KA 5EFOA 4OK6A 1YTUA 4A8TA 2R7NA 2D1FA 1V2HE 2NXEA 2BGUA 2R96A 4JVSB 1DQNA 2P79A 2G72A 3DBLB 3SJAA 1KXJA 1NJFA 1X1CA 4MUEA 1C3VA 3DS8A 4O08A 5LWQA 2IH2A 1QIJA 5HIKA 1ZNYA 3PDWA 2I1QA 3FHOA 1M6VB 5IDYA 4OSEA 3PC3A 4ZIRA 4PLYA 3K1AB 3CVXA 2OSBA 1E20A 3HB4X 2JIRA 4FFBA 4NSNA 2OCIA 1T5HX 1EJ6A 2FX2A 2Z5VA 3H11A 1LWOA 1DP4A 3KPUA 2QENA 4JP2A 1ZUD1 4MKIA 3HO8A 3V9PA 1ARZA 1AZSC 4HLQB 1V41E 5TT1A 3TWOA 5L8VA 3AEYA 2Y1LA 1TFRA 4C7MA 1W581 1KRHA 3KJQA 1T4BA 5LQKA 4KYVA 1P17A 1NW9B 1SC6A 1YULA 1MA3A 2G0AA 3ONNA 5KOHA 4L72A 1UWKA 1I5OA 2RBGA 4L8WB 2J3KA 4BBJA 5DX1A 3O8OA 4MICA 4RXMA 5REQA 1TCAA 4LZAA 1SK8A 3CNNA 5JZBA 3T5CA 1WE2A 4YP1A 3WGGA 4G1BA 1JHZA 3FCCA 1XZIA 1TAHA 3ZH9B 3INTA 1MFZA 3D6FA 4U6NA 4RZHA 1HRDA 1R8QA 2WW8A 1XXHE 3RVRA 1E4YA 3FPGA 4NH0A 1RU3A 3X44A 1V3VA 4QQKA 3OEHD 2VPPA 4LXGA 4ECEA 3GRUA 1RNLA 3GN1A 2PNJA 5TRTA 2PL1A 4P84A 4Y18A 3TOVA 2BY4A 5CXUA 2G76A 2H18A 3P2JA 1H2YA 1JR3A 2GEKA 4XFJA 1RXVA 3EE6A 1RW4A 5E3IA 1M0SA 2R4TA 3GV0A 4DA7A 1UF9A 1U28A 1KVRA 2GMWA 4I6JA 4KQCA 1IZ9A 2BP7A 5AI4A 3OCZA 3TE6A 5JXWA 3D8NA 1TW3A 1OIXA 4RU1A 5KTMA 3R5TA 4BO6A 4E03A 1NQVA 4UOZA 1BHJA 4JJAA 3KHSA 1L4BA 4FHGA 5CMLA 1X1RA 3RS9A 4UZEA 3AOEC 2V98A 2I2AA 3H5WA 3OTWA 2LZ0A 4NE7A 4ZGBA 3D6VA 4R2IA 5JU6A 1EMDA 4M0EA 5HIJA 2FMKA 4GKVA 2PJRA 1Z2DA 1P9NA 3BIOA 4RANA 1B8PA 4MVCA 5FA8A 5BWOA 3S2ZA 3R0IA 3BZBA 4QOGA 4K81B 1I13A 3E2MA 5AOVA 3C6YA 3DKPA 3FIJA 4RH1A 2OORC 3GNTA 1PTJC 4WLFA 3T7EA 4DIBA 5KJ1A 5DYWA 3EYAA 3ZGNA 1XELA 1YR8A 2CLCX 3GA0A 2OXRA 3NUGA 4WZAE 1ZCJA 4Q3NA 2GAJA 5G2OA 4LGYA 1E1QD 3W04A 1L1EA 2CHVA 4H16A 4RD3A 4NFSA 1PLLA 3W4JA 1KQGA 4BRWA 1EWQA 3D6HA 4FCWA 5MN5A 1O94C 3KLNA 4AUEA 4LC1A 4LXYA 1G21B 2QXUA 2REOA 4GPEA 4JBYA 3STVA 1OB2A 2XVZA 1QG0A 3DAFA 3M6LA 3QF7A 3G2NA 1GAJA 1MT3A 1OIVA 3GUYA 3S0JA 3EGDA 1XP5A 2GTPA 5A03A 2B36A 4JXXA 1QHSA 1VJGA 4L8GA 3UBMA 4C5CA 3N7TA 2QRZA 5HA5A 2XNJA 3L6DA 4FIZA 2O2GA 4FS8A 2AZ4A 2HPHA 4U7PB 2ZJ0A 3VC2A 1QYDA 1I1NA 1QOQB 2R5WA 1DFHA 1B6SA 4OA5A 4LOJA 4X95A 1IBLB 1NJ8A 2PGIA 2R5NA 3W4KA 3W0LB 2ZT7A 2HYIC 1ODLA 3DL2A 3HM9A 3V8MA 1R18A 4YDRA 1MUUA 3TPCA 3S8YA 4RJ2A 3Q40A 4XFDA 5HM6A 2GRJA 3AILA 2QG4A 2XUQA 1IBMB 4XM0A 4FM9A 2J3MA 1GSOA 1TAQA 4NYJR 3SHWA 2ZREA 4OQMA 1Y81A 2TYSB 4ZP1A 4IO1A 1ZA2A 4AKEA 4KR3A 1SBHA 3CZRA 1RXWA 5ALWA 2JFPA 3OM9A 3K2QA 1R4NA 1E99A 1V37A 2QK4A 4HZGA 4N1AA 1ODCA 3L6UA 3ZI4A 1KSHA 3OO0A 4ALNA 1UOEA 4NHEA 5DLEA 5DWVA 5A9SA 1U63A 1N6PA 2PBRA 2VQ3A 4MQUA 3WYNA 4BO5A 4E33A 2H52A 4GFDA 5GVRA 1JG2A 3A6ZA 4O8CA 4XYLA 4MTCA 3R75A 1Y9AA 4LYYA 2GK7A 2QGZA 4ITVA 3SEFA 1F48A 4N6OA 4NPAA 3J80A 3LBYA 2RE8A 3U3JA 1MAAA 1T2CA 2PZBA 3MWJA 3PHLA 5ETJA 5AWFC 2GH1A 2J08A 5CG1A 1ZP6A 2D5CA 3QVTA 1QTNA 2FFQA 3FPFA 3JW8A 3FUVA 4QYWA 4RL4A 2IOQA 1PKXA 4PNEA 3P4XA 1RAFA 2FSVA 4C05A 3RG8A 1EWVA 2JA2A 1EWYA 5LLTA 2FZ4A 2HV9A 3H86A 1YSCA 3ONFA 4PO9A 4HMQA 4CDRA 1ZCAA 5EE5B 2X0FA 2VUUA 1UOOA 4NBRA 1WPXA 5M5BA 2AMJA 2RCYA 2W48A 1YKSA 2HWUA 4G5SA 4P2GA 2Z6AA 4BGPA 1UBSB 2YDXA 3L0YA 1M54A 2PKXA 1TO6A 3I37X 1LJLA 3IAS1 4N5HX 4JEHA 3VR5A 4G0XA 1HEIA 5AK6A 4IJSA 4FI3C 2VXBA 4NC9A 1U3UA 3NB0A 4K9SA 1I80A 3N58A 3MA0A 1CUFA 2AOXA 1LRLA 3PCTA 3A6LA 1SXQA 4GBJA 4A2QA 3JPWA 4IJ6A 1QVZA 1UPTA 1LI5A 5C5IA 4M1KA 3VU9B 5AKHA 1RAIA 4LZZA 5J5CA 3QVKA 3KT6A 1L1QA 4TTIA 4A26A 4H6XA 4NJEA 1I1OA 1TI7A 2FEMA 5E7MA 3PU6A 4TT3A 2OBBA 5LIPA 1NG1A 3IL2A 1KAMA 3EVNA 4KIJA 3E53A 1JJ7A 1J4AA 2PSJA 3PGXA 1PWEA 3K0AA 4BAGA 4IV8A 3NTQA 4YRAA 3HA5A 5BW4A 4Q4JB 3NNNA 4MS1A 4Z2YA 4AO7A 2GD0A 2PX8A 3CBGA 3MS2A 4JUDX 4Q3CA 2OVFA 3IFSA 1DWUA 4W5JA 5EGSA 4AAYA 5K8IA 2YWBA 3O9VA 4KGVA 3RYHA 3RIXA 1NXPA 3LC7O 2I7TA 5C5DA 1ENOA 1P2UA 1HL7A 2R9VA 1P9WA 5FD8A 2X3UA 4FJ2A 3ZCTA 3ZEAA 2YS6A 4HTAA 4K6KA 1AXEA 2XMBA 4I9HA 4TUYA 5TEVA 2VCEA 1HI9A 4YR9A 4BNWA 3GPIA 4YV0A 5L3SA 3BJEA 3R0QA 4FMCB 5IDVA 3IKVA 1HT3A 1V7CA 4I1IA 2HDNB 3KAJA 4CEIA 4MWSA 1NVBA 3DD1A 4OLJA 4CGYA 4PSKA 2ZYAA 3FWNA 3P9QA 3GH3A 4QPPA 1LBQA 4FBLA 2GI4A 4LTNA 5KYVA 4CODB 4CT4B 3NATA 1AMNA 2TRSB 4LC0A 2WF6A 1DTSA 1KBZA 3PKJA 2I8AA 3C8DA 1R74A 4PQGA 4UXJA 1I6WA 2JGDB 2Z2JA 4H0CA 3YASA 3AUYA 4CL3A 1T3SA 2OPBA 1T6BY 2ZSEA 3VYSB 1PEDA 3VU1A 4Q9JA 2XXBA 3WAGA 3TSAA 3MERA 4XM1A 1O1YA 5IDWA 1HFWA 3X1MA 1LSJA 1N5KA 3D02A 1WEHA 1OT3A 3NYRA 4DEYA 1DXHA 1HSOA 1NP6A 2IIPA 3NC0C 4HATA 4ZC1A 2Y77A 5LYJF 4ZTZB 2I0FA 2WNIA 1ZVKA 1G4UR 1VGQA 4MJXA 3WDMA 3RRZA 2ZKIA 4YAFA 1BMFA 3C48A 2A9VA 4DLAA 1IC6A 3M1IA 1X7GA 4G1EB 3FRIA 1YFKA 4BZWA 4B3MB 4LOKA 1U6KA 2OBMA 1E2MA 3ONEA 3VUEA 1I7PA 1DXOA 3N8HA 3PIIA 4G25A 4W9RA 3IOBA 1G7CA 2PH5A 1Z15A 1ZOPA 2A14A 3BDIA 4MRVA 3UT5A 1E2IA 2C2XA 1V1MA 4QFDA 1WM1A 1NTOA 2AN9A 1D03A 4LHWA 3KB2A 1E7SA 1OYVA 2Z09A 3CFYA 2ZPUA 3OJFA 1EQ2A 4NDNE 5GGYA 4QWMA 4E31A 5GTDA 3ZDZB 5JCOC 2OBXA 2WP8J 3KVRA 3K1JA 3WIDA 4ECAA 5BSKA 4GM1A 3R6LA 3LG2A 1M8GA 3EG5A 4H6VA 3WB2A 2IDKA 4F4HA 2ODPA 4H4EA 1GFIA 1XALA 2F64A 1N7IA 1RMTA 1YS7A 2Q9CA 4FFLA 3H83A 4ZQEA 4A8HA 2VTBA 2GDZA 1JDUA 3ZS9A 1E7YA 3EODA 2XHZA 2FEAA 3UV6A 2ZRLA 3HO6A 4Q3KA 4JUBA 4FFDA 5EHNA 1F8XA 2VP9A 4MB6A 1L4KA 1GGMA 2FZ5A 2IZ5A 2OKCA 2F43B 2I87A 3IDAA 5ENVA 1KDVA 3SN6A 3OM8A 4BMDA 5HMLA 5L4SA 1RRCA 2WUWE 4PAQA 4A6XA 3MYYA 4H17A 1DIHA 1WDLA 5A5EA 5LZ2A 1BEUB 2ZJ2A 3RBXA 4EP1A 1Z38A 4BXOA 1IXKA 5E6SA 3MWGA 2YV1A 2DMRA 3KKMA 1I2DA 3T9CA 1TCBA 2VQ6A 3P9KA 3OTOB 1UBEA 5EIAA 5IYZB 4PPNA 1BO6A 2GJ4A 2E82A 2PU7A 3F6BX 1Q7RA 3JQBC 3DV0A 3CN9A 1NASA 4IMRA