3I6QA

Structure of the binary complex leucoanthocyanidin reductase-nadph from vitis vinifera
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
307
structure length
291
Chain Sequence
GRVLIAGATGFIGQFVATASLDAHRPTYILARFKALEDKGAIIVYGLINEQEAMEKILKEHEIDIVVSTVGGESILDQIALVKAMKAVGTIKRFLPSEFGHDVNRADPVEPGLNMYREKRRVRQLVEESGIPFTYICCNSIASWPYYNNVLPPTDFFQIYGDGNVKAYFVAGTDIGKFTMKTVDDVRTLNKSVHFRPSCNCLNINELASVWEKKIGRTLPRVTVTEDDLLAAAGENIIPQSVVAAFTHDIFIKGCQVNFSIDGPEDVEVTTLYPEDSFRTVEECFGEYIVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and catalytic mechanism of leucoanthocyanidin reductase from Vitis vinifera.
pubmed doi rcsb
source organism Vitis vinifera
molecule tags Oxidoreductase
molecule keywords Putative leucoanthocyanidin reductase 1
total genus 96
structure length 291
sequence length 307
ec nomenclature ec 1.17.1.3: Leucoanthocyanidin reductase.
pdb deposition date 2009-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05368 NmrA NmrA-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3i6qA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3i6qA02
1P33A 3ORFA 1KVQA 4B7XA 5B37A 3BMQB 4NK4A 1PWZA 5GZ1A 3RFXA 2IZZA 4EI2A 5IAAA 4YCAA 1CYDA 1YKFA 1DIRA 2AEJA 1E7WA 4BNYA 1C1DA 4FSHA 2OP0A 1DFGA 4PLCA 4ALIA 1YL6A 3I9JA 2B4RO 1MUUA 4J49A 3TRIA 4EEXA 2YUTA 3C7DB 4YRBA 2UDPA 3CZRA 1PQUA 3WQQA 5KTKA 4CM8A 1RM3A 4WASA 2VZ0A 1DHRA 3MCVA 1B15A 4W9NC 2Q2QA 4ND5A 4JQCA 5G2OA 1GUFA 4CJXA 4YYZA 1FJHA 3GA0A 3DTTA 3LF1A 2C2XA 3I23A 1G1AA 1T24A 4KQWA 2EXXA 1W6UA 3GDOA 4OSOA 1E7YA 1WVGA 1UP6A 3D3WB 4OAQA 1U1IA 4ND1A 3QP9A 4MKXA 1CWUA 3OMLA 4BO6A 4OM8A 4BO1A 2P91A 3F4BA 3OEWA 1GR0A 3F6YA 3RJ5A 2HRBA 4Y6RA 3OA0A 3UFXA 4J3FA 5IZ4A 1NPDA 4E21A 4OOFA 2NVBA 1EBFA 4D0SA 4HFMA 4XWYA 1EK5A 1MFZA 2DPHA 2V65A 4WLNA 4IMRA 1ENOA 3SC4A 3PWSA 1EEHA 3O03A 1EUCA 1U9JA 1P3DA 5KOIA 4IJVA 3LZ6A 1LLDA 3IMFA 4GSLA 1DHTA 2C29D 3AJRA 2X6TA 4NMHA 1P44A 4GWKA 4K6CA 2XF8A 1GQYA 4NK5A 3AOGA 2DTEA 2EF1A 1U8XX 3Q1LA 1JTVA 1MXFA 3GEDA 2WE8A 4MOWA 2WWRA 1UAGA 1ZKMA 2C7GA 3I4CA 3V1YA 2ZB3A 5COQA 3H6KA 1K3TA 1YB1A 3HHPA 2ZKLA 4J1NA 3AW9A 2P4QA 4GLLA 2YV3A 2ZJ0A 2Z95A 3RBVA 1Q1NA 3DOOA 4NFSA 5A1TA 3A9WA 3BMOB 1UXKA 3GPDG 3GRKA 2HCTA 4TZKA 1YRLA 3B6ZA 3OH8A 1A4IA 2C82A 1UDAA 3UOGA 5I7FA 1N7GA 3DOJA 4H7PA 1G0OA 5DCYA 4NH4A 3T4XA 1D7OA 4EUFA 2ZATA 1EDZA 2E6UX 1Q2XA 4MVJH 4QQRA 3DBVO 3L9WA 4BO0A 4BNMA 4BV8A 2FZEA 5F1OA 1U5AA 3ROKA 4UUPA 3VDQA 2O7QA 4IDEA 4IXTA 4R1NA 4CV2A 1NAIA 4YBZA 3IIEA 1PS9A 3U4CA 3L4SO 5B4VA 3E8XA 1UDCA 1ZMOA 3VH2A 1B3BA 1WLYA 1AN9A 4JN6B 4R9RA 3ZWCA 4ESOA 1E77A 3JQFC 4KOAA 3AY3A 3KUXA 3ZHZA 4DQXA 4R3NA 2FR8A 1PJCA 3QVSA 2Q2VA 1HF3A 5MDHA 4E0BA 1GQ2A 5JCXA 3INRA 1GZ6A 4DLBA 5A5FA 1KEUA 1G6KA 4E31A 1OZAA 4CM6A 3PWZA 1Q7CA 1CJCA 1Y1PA 2VTEA 3NDIA 4L75A 2IE0A 3GHHA 3HE3A 1ZSNA 2E37A 3PQEA 3VPXA 1PS8A 3QWFA 4XRGA 1U2DA 4NBTA 2IODA 1K5HA 3L77A 1UP4A 4XYEA 1JVSA 2IYOA 2BKAA 3DBLA 4NU5A 2VHYA 3L07A 3MWDB 1KVUA 1BW9A 1VC2A 1DOHA 1MXHA 3O4RA 4XR9A 3STHA 4DRYA 1QYDA 2VNSA 3E48A 3F5SA 3V1UA 2VHWA 3FCOA 3VH3A 2EP7A 3LC1O 1AE1A 5K9ZA 2WYUA 4IPTA 1BTOA 4MVJF 1EMDA 1T2CA 2ZQYA 1V3VA 1YQGA 2F1KA 1BWSA 8ADHA 4H15A 3VC7A 3OECA 3D7LA 4K9DA 3WG9A 3CXRA 3SLKA 1Q0QA 4PG7A 5T57A 4QXMA 1I10A 1SBYA 1Z45A 3ZHXA 4RZIA 1HETA 5GZ6A 1H6BA 1E7RA 3SXPA 4I1IA 1ZH8A 4G5HA 1N92A 1ZK3A 3A06A 5HA5A 4BNUA 3RUEA 3RFTA 6ADHA 4MP8A 1T25A 5TS3A 1E3WA 5K0ZA 1HLDA 1LSJA 4Q9NA 3ANLA 2AEMA 4LSWA 1YBAA 1E1NA 2E82A 2VHVA 4OKIA 3CINA 3DZBA 4R69A 4XYMA 3VPSA 2X5KO 4GGPA 4EZBA 3U0BA 2DT5A 2Z5LA 4CLOB 2J3IA 1EVYA 1W8DA 2BF7A 3JQ8A 4BMNA 1TB4A 2EGGA 2Y0EA 3FTNA 3KRTA 1F17A 4CLHA 4R16A 4B8ZA 3WGYA 4M1QA 3RU7A 4BNFA 3BXXA 4Z9YA 5HS4A 1HZJA 2WDZA 5ENVA 1N5DA 4BHTA 1B16A 4R68A 2AQIA 4KUGA 4YTEA 3UH1A 4BKUA 3FTPA 1UXJA 3ZV4A 4JCOA 3E5RA 1BDMA 4H16A 1PJLA 2VRCA 1PGOA 3ZNOA 4PN3A 4WOKA 1LQUA 4AG3A 2QX7A 1X1EA 3VH1A 5HM8A 4RDIA 4CM1A 1FDVA 2JCYA 4CM9A 4WK6A 2CSUA 3K96A 4OGWA 4NQZA 4LCJA 3B20A 3OJFA 5IXYA 1X7HA 2QYTA 2JD2A 1NQ5A 3FD8A 2NU7A 5JDIA 3WGOA 5AQ1A 1AXGA 4IS2A 1IE3A 2ZYAA 1EUZA 1GDHA 2JJYA 4HBGA 1PQPA 3RUHA 4BO4A 2IZ0A 3IDSA 1ADFA 3WTCA 4BO7A 3B70A 5JY6A 3H5AA 4S1VA 3EYWA 1WAMA 2I76A 3ROMA 2OMEA 4DREA 3L6EA 4WUVA 1BSVA 1U7TA 3HDQA 4KWHA 5CEJA 4OO3A 3GZ4A 4FD3A 1GYRA 5FI5A 3K92A 3WGIA 2WSBA 5JCJA 3WGZA 4E2XA 4EUHA 5AXDA 3ETDA 4IZIA 3NEPX 1PR9A 2WD7A 4EYEA 1PGNA 4FGSA 4N5NA 2UAGA 4W6ZA 5B4TA 3ZWVA 1ORRA 4EW6A 2GASA 4Q3CA 3RSHA 2Y0CA 3ITKA 4Q3DA 4C7JA 5CDTA 4YJGA 4UREA 2QRLA 5EQDA 5AYVA 3ASUA 2JD0A 1IHYA 1X7DA 2CNBA 2WM3A 4HUJA 3AK4A 4UEKA 4R4JA 3GLQA 3C85A 2OGUA 3R0IA 5JO0A 4URFA 4YRDA 4AJ2A 3BAZA 3ZW8A 2NADA 4PLFA 3OQBA 3E9QA 3ENNA 1Y7TA 4WCFC 4PVCA 4PG5A 3K5PA 1KEVA 5F1KA 1BXZA 1QP8A 3GNTA 4R51A 1LA2A 3CPSA 1ADGA 4MVJM 2I65A 1GYQA 1U3UA 4A03A 4NFHA 3ZHBA 2O3RA 4UEOA 4S3MA 2VQ3A 2B5VA 4DMLA 2QYSA 2JD1A 1Q0HA 3W8DA 4XQGA 1HE2A 3LLVA 4GMFA 2J3HA 1G0NA 2P4HX 2Z1MA 2VZ9A 4OXKA 4J2HA 4Z0PA 3D4PA 5ILOA 3MOIA 4ZQBA 3ZGYA 1A7KA 1XG5A 5JPIA 2O48X 5F3RA 1SEVA 1UXGA 3JYPA 5KKAA 2PR2A 1HDGO 3FSRA 5GMOA 5AOVA 1U4SA 3U3XA 1N7HA 3KTDA 3AM3A 3IQDB 2CZCA 2OHXA 1VJTA 3OBBA 1TT5B 3W8FA 1K2WA 2A92A 4E32A 3JV7A 2HQ1A 3IJPA 4QX6A 3DWFA 3GQVA 1EK6A 4L73A 4WOJA 1KEPA 1SZJG 1WPQA 3HQ4O 4U6QA 4BOYA 1ZNQO 2VRCD 1YS4A 1H94A 1LRJA 1DLIA 3WGTA 4ZU3A 1PIWA 4PRKA 2DFVA 1LC3A 3RUIA 3SX2A 4J9UE 4DIFA 4DQVA 2Y99A 3K31A 3O8QB 3VOSA 1Y9AA 2C7VA 5KJEA 4PCVA 1B2LA 2V6MA 2EKQA 2LDXA 1V35A 5G0SA 2GRAA 3EZYA 2JAPA 4UAGA 5L45A 4WLEA 2I66A 3ZU4A 5BSFA 5DCUA 4XJTA 2DU8A 4O5OA 3QHAA 1I24A 1GUZA 1LUAA 3KLPX 1C0KA 1JWAB 4U8GA 3EZLA 4ALLA 1WDMA 2I99A 3HUDA 3IUPA 1UR5A 1IPFA 3PJGA 3UN1A 2BH9A 2ZB8A 1X13A 1IZ9A 1LDGA 4FCCA 3JQ7A 1PJBA 1NASA 1BMDA 3VHRA 4LW8A 1RYDA 4CR8A 2HMUA 2FOIA 4KDEA 1TI7A 2EKPA 1N9GB 4FGWA 4KZPA 1LLQA 4L4SA 4TVOA 3QVTA 1R0SA 2XXJA 3LT4A 1HLPA 4L74A 2B83A 1I2CA 5LC1A 1UZLA 3EAGA 2EKLA 3GH3A 3JQEA 4LK3A 1CF2O 5J23A 2IZ1A 4AJPA 1H2BA 4DYVA 5IDWA 1DAOA 5T67A 1LEHA 1LC0A 2PY6A 4BQPA 4B3JA 1Z7BA 4GPD1 1GCUA 3NDJA 1LLUA 2EWMA 4PG8A 4D45A 3ZV6A 3EGOA 2AE2A 1QMGA 5FEUA 5CFZA 2DFDA 3MJSA 4J16A 4ZVVA 3VZPA 3NUGA 4CUJA 3TL2A 5KKCA 1N1EA 4RDHA 3WR5A 4P4GA 1DEHA 3FWNA 1BXGB 4OSPA 2CDAA 1XQ1A 4NZ9A 1T26A 1ZCJA 3F1LA 2Y1OA 2C59A 2NQ8A 3FNHA 3PIDA 3Q3CA 4B4OA 5HTOA 3JQAB 1H5QA 1IZ0A 3ZNPA 2BD0A 1XGKA 1OAAA 1LBEA 5KWEA 4K28A 3MJEA 4U0JA 1QSGA 1WMAA 3FRJA 1U28A 4UUOA 1XR3A 1YBMA 3GN2A 3OJ0A 1OI7A 1O94A 4XB1A 2IDZA 3PI7A 2FPPA 3RBZA 5KVSA 2QRKA 1J4AA 3GVIA 4RF5A 5DDIP 4XYBA 5BT9A 1UZNA 4JP2A 1ZIDA 1OFGA 1CQJA 4YB8A 3DBRB 3EHEA 3KSDO 3V5NA 2BGLA 3D5TA 2OOSA 3ZN2A 1ISIA 3GG2A 4IQGA 1BHSA 1WDLA 1EDOA 2OBNA 4PZCA 4WCFA 1LX6A 3QV1A 4Z9XA 3GAFA 4IGFA 5TF4A 3PJEA 4BKPA 2PNFA 3DMTA 4I5DA 3DHEA 2E4AA 4J0EA 5A9TA 4BMVA 1E7SA 4CLRA 3NYWA 3ITDA 4E30A 4IJWA 4WNIA 2NQTA 3OFSA 5EJ2A 2Q45A 4EUEA 1Z6ZA 4CLOA 4LMRA 5JAMA 4E5YA 3IS3A 2ZIZA 4CUKA 2YW9A 3FNFA 1T1SA 1W73A 3VPFA 1VLLA 4XEHA 2DQ4A 4OXYA 4D3FA 1K6IA 5COAA 4INAA 1KBZA 5ICMA 3HB4X 3R3SA 3GR6A 1C1XB 3JCZA 3DAGA 1NQTA 3LVFO 5BR7A 2VUTA 2OZPA 2AQHA 5FF9A 5HS6A 4QEDA 3PJDA 4YAJA 1I8TA 2PLAA 2W2KB 4D3DA 1DJQA 2EG9A 3CH6A 3E18A 3LT0A 1SOWA 4YT5A 2RH8A 4RVGA 4WEQA 3F46A 3A4VA 4PLHA 1P1RA 2EJVA 4A10A 1KC3A 2A4KA 3L4BA 5CEEA 1TEHA 2W90A 1QYCA 1R4NA 4FBGA 4RL6A 1R12A 1N1GA 3RAJA 4QECA 4CQMA 4F6LA 4E33A 3WGQA 3TQHA 1NX6A 1VM6A 5GZ3A 4BNHA 2DTDA 3DB2A 3K73O 4TRJA 5L40A 4JP3A 2GGSA 2HMWA 4PLZA 4E2ZA 4BIIA 4AJHA 2YJZA 1IY8A 4BNKA 2C0CA 3QWIA 3HN7A 1SO8A 2X4GA 3Q6IA 4BNWA 2BLLA 2D1YA 2ILTA 1DFHA 3KEQA 3KOUA 4ZQEA 1M6HA 4IDAA 4BB5A 5IN4A 1E3JA 4YJHB 4DBVO 4E5PA 4QSMA 1TXGA 2Y68A 1H6AA 2X58A 4HY3A 2LDBA 1MG5A 2G1UA 4R5HA 3UKOA 3VZQA 2HKIA 1R37A 3DC2A 3R1IA 3OEYA 1SPXA 2H63A 2VN8A 3D1LA 4ZRNA 2AG5A 3KV3O 1UUFA 5BSGA 4CMJA 4WLUA 1T2AA 4CQMD 3B1JA 5JAIA 2NU8A 2C20A 4MVJI 1E5LA 1VL0A 4YAIA 3WGGA 1B8VA 2POQX 4JJGA 2FR0A 4CM9D 2CY0A 3I6IA 3I9KA 3PVZA 3RI3A 5ES3A 4CPDA 1BG6A 3KSUA 3KEOA 1NHGA 3PWKA 1ZMTA 1V8BA 5LDHA 4TQGA 1H2HA 3G49A 1I3KA 1ZSVA 1MG0A 3K30A 1I3LA 4MVJD 4XGNA 4RQTA 4FC6A 3PDJA 3Q9NA 4B4UA 4LRSB 3TZKA 1KYQA 1Q7GA 2P9EA 2NWQA 1SCUA 2UYYA 1EFLA 1HDRA 3QWBA 1NQOA 4NHEA 1NPYA 4BNLA 3G1UA 2X5OA 4MVJG 4Y9DA 3GVPA 4UEJA 3MTGA 2CDCA 3ZW9A 2IXBA 2FSVA 4ZQHA 4Z6KA 3Q0EA 4BGUA 1ARZA 3U5TA 1ISGA 2D59A 3ANNA 3UCFA 4E2WA 4O1MA 3WXBA 2PH5A 4QO8A 3INGA 3TN7A 3GMDA 2Q1UA 3TJRA 1ZFNA 3PLRA 1LDNA 4GAEA 3PGJA 1ZSYA 1KERA 3KYDA 3EK2A 3ZWXA 3ZV3A 4TROA 1PJ3A 3LT2A 1BVRA 3GNQA 4OH1A 3UVEA 1RJWA 4J0FA 3EUWA 1I3NA 3KYDB 3NT2A 2DBVO 4IJKA 4OIMA 2NLOA 1HDXA 3HB5X 3OIGA 3E6AA 3M2TA 4OQZA 3O8QA 1DAPA 5T8KC 1LDBA 4QO7A 2X9VA 5IXSA 2YDYA 3HFSA 4IIVA 3PHIA 1XU9A 4CMKA 2H9IA 3RU9A 4CLRB 2X0NA 3GHYA 3JYQA 4OXNA 1E3WB 4XDZA 4IINA 1J6UA 4PLPA 5C7LO 1RM5A 3OICA 4PGFA 2B35A 1WP4A 4PZDA 4EGFA 2Q1WA 1RM0A 1P1HA 4PIVA 3H2SA 1SB8A 3JQGB 3O9ZA 4CQLB 1XWFA 4AJNA 5IDQA 4IDBA 5A05A 1Y8RA 3DEYX 3LDHA 2PWZA 1EFKA 5JC1A 4IXWA 3HDJA 4P38A 2NVWA 3F9IA 4RV9A 4N18A 4DYDA 3MOGA 4AL4A 2BGKA 1YL7A 4AVYA 1E92A 4ALJA 1E1LA 2D0IA 4NFYA 4A0SA 1I5RA 3OJEA 4ZA2A 3EVNA 4OYRA 3DBLB 2OUIA 5KVVA 4W7HA 1VI2A 3JQAA 4BQRA 1XCBA 4BS9A 5KJCA 2VUSA 2B69A 2PKRA 3WGHA 2CF6A 2FP4A 2ZB7A 2QHXA 2DM6A 5MGBA 1H9BA 3S2GA 1BXKA 1XSEA 2ZCVA 3QWAA 1E5QA 3D64A 4HP8A 1WDKA 1ZVMA 1E3LA 1H93A 3JQGA 1Z73A 4II2A 4B3HA 3GVXA 5F1PA 3SJ7A 4BO2A 1FK8A 4CMIB 4DL9A 3JQ9A 1DIAA 3LLSA 4O0LA 4UVGA 1MP0A 1K0UA 1PL6A 4YQZA 2RCYA 1PJ2A 2ET6A 4RGBA 1HXHA 1KC1A 2EP5A 5G0WA 3GVCA 1P1FA 4BKOA 4PLTA 2DBZA 4ALKA 3IKTA 5I7EA 4QUKA 5EQFA 3AUSA 4GVLA 4XGKA 9LDBA 3IOYA 5A9RA 1Z82A 4CL8A 3PZBA 3AUTA 4XIYA 5A3JA 3VZSA 2J3JA 5A4DA 1XU7A 3CZMA 2NTVA 1HWYA 3A14A 3TDKA 4BO3A 5A5EA 3P5SA 1LRLA 4GVXA 2J5RA 1B14A 1P1IA 2BI8A 2VWHA 4K26A 2E49A 4B7CA 1ENZA 1PS0A 3HWRA 5EN4A 1HYGA 3DBRA 4DMMA 1HKUA 4GL4A 3GT0A 3AM5A 4LN1A 5F5NA 4FJ2A 2CVZA 1PZGA 2H1SA 3DZJA 4II3A 4W9NA 1OBFO 5KJ6A 2VTDA 3S55A 2BHLA 2EW8A 5KCZA 4E5MA 3HADA 5JBIA 2DVMA 2ZTMA 4DC1A 5ADHA 1LNQA 1IHXA 5JY1A 3WIEA 1GAEO 1GZ4A 4RORA 4MJLA 1UJMA 4XR4A 1ZEJA 1LQTA 3QA9A 2Y66A 1TT5A 2GN9A 3ETGA 4JK3A 4CLXA 1X0VA 3PJFA 4FIZA 2DUWA 2FHSA 3VVCA 3AY6A 3WNQA 3PGXA 1GQQA 3RROA 4B79A 1QV6A 1M6WA 1YXMA 4Y6SA 3VTFA 5JNLA 3GGOA 2C5EA 1L7EA 3DAPA 2CD9A 5JAQA 3NX4A 1GPDG 2B37A 4J2OA 4RLHA 9LDTA 4E13A 3H2ZA 3CTMA 2C5AA 1NAHA 3LYLA 6LDHA 3BTVA 1YJ8A 4LRTB 3U4IA 4WE3A 3WMWA 4CMAA 4G81A 3QRWA 1QV7A 2XXBA 3QE3A 1IOLA 3OETA 1VRWA 4KDFA 4E6PA 1UXIA 1WNTA 4OKNA 3R3JA 4FJ1A 4NNJA 2Q49A 1N9GA 1HDOA 4CM3A 4RPLA 5KVQA 3H5NA 3RUFA 2ZK7A 3H7AA 2DLDA 2RIRA 3COSA 4NBUA 1YBVA 3PEFA 2AQKA 3D5QA 5L51A 5LCXA 2EERA 4GWGA 3GGPA 2YFHA 1O89A 5EMHA 1U3VA 2QQ5A 2VZ8A 4CR6A 2PK3A 3HDYA 3L0DA 1C1DB 4MPDA 1YE3A 3H9UA 3JQAD 5EINA 5FWNA 1BGVA 3SLGA 1MGOA 4R01A 3ROQA 1PJ4A 4GX1A 4PZEA 3I9MA 4FJ0A 3I9OA 4UVEA 2JFGA 2FMUA 2PKQO 2R2GA 3VPGA 1SAYA 1JQBA 1X1TA 1ISHA 2Q46A 4ID9A 2C07A 3AI3A 3AWDA 1ZO8A 3LK7A 2QG4A 3ZWAA 1Y8QB 1NFFA 4UUMA 4YJHA 3VDRA 1SMKA 3AM4A 1PGPA 1PZEA 4XDYA 3RKRA 4DPMA 5IZCC 1R15A 1CRWG 3H9QA 4J1QA 1B26A 3ZWBA 4HFNA 2AE1A 3TOXA 3IP1A 1KETA 1DIHA 1M2WA 4CMIA 2DPGA 3UGKA 3CKYA 2HK8A 2X0JA 3NTOA 4I5EA 4IUYA 1QYWA 3BHJA 1C3VA 2Y0DA 3OP4A 1GCOA 5TJHA 3C1AA 4XD2A 2JCXA 4C4OA 3RQSA 3TZCA 1B7GO 2O3JA 4WLFA 2PTGA 1ZBQA 5IFLA 4DUPA 4YAGA 1X14A 2GD1O 3F1KA 3I52A 5U4QA 4CM4B 5DP2A 5I8ZA 1DC3A 3CIFA 1U7HA 3FR7A 1D1TA 1V3UA 4DLAA 3UAGA 1NXQA 1CETA 2EHDA 2YHUA 1C1XA 2EGHA 5C7IO 4R5MA 5TRTA 1F06A 2VNAA 1HSZA 3AI1A 5A3VA 2Q4EA 3KHUA 4HFRA 5A9SB 3CEAA 1D8AA 3IAHA 5H82A 4KTTE 2RAFA 5DCWA 3VKUA 1K6XA 1NP3A 1PZFA 2B36A 3NTRA 3ZU2A 1AHIA 1AGNA 1T4DA 2VWGA 4Q3BA 3GPIA 4CMBA 3CE6A 3MJTA 4RZHA 3FR8A 2J3KA 2OBYA 3Q2KA 4EEZA 4XJSA 4F6CA 4J90A 4A27A 1A9YA 5JDCA 1NYTA 4WNCA 1AUPA 1MFPA 4R1TA 3OA2A 4A2CA 3DBHB 3KYBA 1CERA 3TNLA 4F3YA 4JXKA 3O38A 4FDAA 1XYGA 4RVUA 4B8WA 1LXCA 3VKVA 3ETEA 3HJAA 1U3TA 4OL9A 1A5ZA 4R54A 4BVAA 3AU9A 4RVHA 5DF1A 1L7DA 1Y8RB 5C5IA 5TLSA 3NT5A 2Q1SA 1ZW1A 4CMEA 2EJWA 1R6DA 3G79A 5B1YA 2VYVA 5JMWA 3BMNB 3OJLA 1HE3A 4Q3NA 2NUAA 1GV0A 3HG7A 4UUNA 2JFFA 3UCXA 4E4YA 2WE7A 3PP8A 4KTVE 1XEAA 1DLJA 3R6DA 3SC6A 4JROA 4EBFA 1OMOA 3FHLA 2HLPA 1GPJA 4Q39A 1E1MA 3C3XA 3V2UA 4LISA 4O6VA 4GLOA 3WSVA 4H3VA 3JQ9C 1DIBA 4BNIA 4BNTA 5BSHA 3D0OA 4OJNA 4IQ8A 4E2YA 1HEUA 4BMSA 2TMDA 3JQ7B 3BA1A 3A28A 5IN5A 3DO5A 1PWXA 1NNUA 2Q99A 3ABIA 1MC5A 4WLOA 1P74A 1Q0LA 4J1TA 1JAYA 2GNAA 3M6IA 5I9LA 1A9ZA 3RFVA 3DHNA 4NDNE 5JFOA 5I8WA 2D5CA 2O3QA 4XQCA 2IYPA 3VVBA 5KJ1A 2OP1A 2IEBA 3QIVA 2YFQA 2WJPA 2IXAA 4MINA 4GX5A 4F46A 3GNSA 1IPEA 1GADO 1JLLA 1LSUA 4M54A 1GY8A 4AICA 3ZWMA 2UV8A 3W4IA 3W6UA 5CG1A 4TRNA 5A03A 3TFOA 1TA4A 4AJOA 2GN8A 5TT1A 4FFOA 1PJSA 4C7KA 3JD0A 5DOZA 3NGLA 3GUYA 4KP7A 4JGBA 2O7SA 4L0QA 4AJJA 1PGQA 3DL2A 3JQBC 4NJMB 4O59O 4R3WA 4CLEA 1ZXLA 2CFCA 2YY7A 4CM8B 2VYNA 3ZDFA 4GX2A 3WQRA 2EW2A 4YAKA 1YH3A 1ZZEA 4BNVA 3RASA 4A7PA 2NSDA 3CMCO 4DBZA 4QTZA 3ZNNA 4YT2A 1UP7A 4NJMA 4YT4A 3DZFA 5EPOA 1RWBA 3FPCA 1LDEA 4ALNA 2HAEA 5THQA 3UCEA 1VPDA 4I8XA 3K2BA 1JDJA 4DIBA 5KVCA 1IULA 2XAAA 4W99A 3EVTA 4WCFB 3HDHA 4ILKA 4M86A 4EJ6A 2DBRA 4XQ9A 4CV3A 2CVOA 5CPBA 1HZZA 1CIVA 4TKLA 1EE2A 4JX8A 3ST7A 2P5YA 1ZK4A 1UZMA 3PYXA 4A26A 4OHUA 3BZUA 3QVXA 1PU2A 5L4LA 3VAZA 3LC7O 5FFFA 1L1FA 3PFFA 1ZJYA 1A71A 3BMCB 4RPJA 1UAYA 3WBFA 4BO8A 2P2SA 3FF4A 3OQ1A 4IZHA 3ZZNA 3X2FA 5I9NA 1A7AA 4IJUA 3UUWA 3EY4A 2UUOA 4TKMA 3MTJA 1VE9A 2VT2A 1GV1A 2CF5A 1VL8A 1HDCA 3DZGA 1W0CA 2R00C 5DBGA 3RVDA 2J6IA 5BNIA 3SJUA 1FDUA 3PQDA 1WZEA 4DXHA 4KUHA 4RVDA 2GZ3A 4FN4A 5H83A 5T6BA 3DR3A 5A02A 4BKQA 1GD1O 3VPHA 4B3IA 1DC6A 1GFSA 2P5UA 4IBOA 3K6JA 3JQ6A 3KO8A 4WKGA 3DFUA 4LGVA 1T2DA 3LQFA 3WSWA 3BMNA 1LRKA 1C0LA 3T4EA 3WB9A 5L95A 1P9LA 1I0ZA 4GKBA 1HYEA 4ZHSA 3HFGA 4FFLA 3S2FA 1ZXBA 4KMSA 4RLSA 4E5KA 4J7CA 2O2YA 4L4XA 1P0CA 5ITWA 3WMXA 4JJIA 1YVEI 2ZJ1A 1ADCA 1PJQA 2PFGA 1NFQA 1A4UA 1KY4A 4WEOA 2Q50A 1I2ZA 3FWZA 3DTYA 4HV4A 3D4NA 2I5PO 3VZRA 1OC4A 5CHEA 2PGDA 4L76A 1FXSA 3OSUA 2HJSA 4HWKA 4PLVA 1JKJA 1N8KA 3OIDA 1D3AA 1HTBA 4DWVA 1I33A 2RH4A 3QSGA 5ENDA 3KYCB 3GY0A 5TSDA 4Z0HO 2PGLA 5L3ZA 3JQCA 3JTMA 4Y8VA 1NFRA 4P8RA 2AG8A 3OJOA 1QXSA 4K1LA 1XKQA 1T2FA 3I9NA 3WJ7A 5JMPA 1K6JA 1I2BA 4P4LA 3RIHA 1P0FA 4X54A 5CP8A 3DMTC 4PG4A 3DMYA 4J7UA 3OQ6A 5HWSA 2VWQA 4R9SA 2WYVA 1H6DA 2GUGA 7MDHA 1YB4A 1BVUA 3L9XA 4J9VA 4CM4A 2FRDA 4AJ4A 4AJLA 4I5FA 2I3GA 1VL6A 3GG9A 2O3UA 2V6BA 2PZJA 3BTSA 3HN2A 4IDDA 4XIJA 3BHMA 2YDXA 3MJVA 2Y05A 3MZ0A 4BB6A 2ZTVA 5CPFA 5G0UA 4HFJA 5AXBA 1U8FO 4UULA 5TIIA 2RHRA 1EZ4A 3ASVA 3AUUA 5JYDA 4XKJA 2PGJA 2YZ7A 5I7VA 3AI2A 2H5LA 1YOVB 3L6DA 3NJ8A 2OO5A 3RKUA 1E7QA 3I83A 3NV9A 4JBGA 4CR7A 1QR6A 4G2NA 5BSEA 1P31A 1V9LA 4GX0A 4WPGA 1ADBA 3GMSA 3JD2A 2O3SA 3JQ8B 2HMVA 5IZCA 4CUZA 3T7CA 5IJZA 2B4QA 1R0KA 3PIIA 2FY8A 2YV1A 1F14A 1GEEA 3H4VA 5L9AA 3KETA 2C2YA 1DRWA 4YPOA 3MJCA 4FQ8A 1D1SA 3ADPA 2PV7A 3PTZA 5L4SA 5U9CA 1A72A 4YJFB 4U0KA 4FC7A 3JYOA 3IP3A 4F45A 1LSSA 1DO8A 1BDBA 3WNVA 4MIEA 2HMTA 1B8PA 5F21A 4BO9A 2VYND 2B0JA 2RHCA 2Y1DA 2D2IA 1ULSA 1WWKA 1QYVA 3GC6A 4E12A 3RUDA 4IDGA 4TMFA 2BGMA 2O23A 1KEWA 7ADHA 4TVBA 3ZHYA 1JAXA 1QG6A 3PHLA 1I32A 1F8GA 2X7HA 4IIUA 4Z0TA 1S7CA 4BGEA 4LCEA 1ML3A 3PYLA 4EDFA 4BNNA 1NM5A 4J4TA 2IEDA 4MO2A 4FB5A 3L4BC 1GUYA 3ROPA 4KQXA 1BRMA 4DA9A 3ICCA 4GI2A 3SEFA 4GSKA 3AFMA 3GZNA 4DGSA 2GSDA 4YQYA 2H6EA 3RUCA 3ONDA 2WD8A 3KB6A 3G17A 1PGJA 3ANMA 4NR0A 4I5GA 3JSAA 3PLNA 2JHGA 3WJAA 3EDMA 1HT0A 2Q3EA 4U6SA 3H3FA 3E5MA 1SNYA 3NGXA 4FFPA 3TZHA 1YWGO 4IM7A 4RVFA 4D46A 1J5PA 2YV2A 3GEMA 2BMAA 1ISJA 4Z3DA 1QLHA 2JCVA 1QKIA 4OMUA 3ON5A 3H65A 3K8ZA 3ADOA 2ZTLA 1I36A 1C0IA 1KY5A 3RCBA 1DRUA 2ZCUA 4ZJUA 4LVUA 4Y67A 1R16A 3WYCA 5U1PA 2AHRA 1O9BA 5HBRA 2WEKA 3LF2A 5THKA 1FMCA 5TQVA 1DFIA 3GEGA 4KUEA 1E7MA 2I3AA 4EITA 1DC4A 4MDHA 1Y8QA 3G1TA 3MWEB 1H6CA 3ZNQA 3ZU3A 1JVBA 1LSOA 4D41A 4R1UA 2GERA 2SCUA 3K9QO 5ER6A 4WJZA 2G82A 1LJ8A 4LVCA 1KS9A 3DZKA 3DZHA 4WLVA 2BI7A 3QW2A 2Y1GA 3FPLA 1OC2A 2FSSA 4J7XA 1IYZA 5T64A 1BXGA 3GRPA 4HNGA 3BTOA 5CDSA 5DBIA 2WMDA 4R41A 4BNXA 5DZSA 1DIGA 2A9FA 2AA3A 2B5WA 3EW7A 3IC5A 4ZRMA 3U49A 3WOHA 4BKRA 4CMHA 2VHXA 4RPKA 2X0RA 3U62A 1LDYA 3E82A 4LMPA 2DTXA 3TWOA 3TFQA 3S2EA 4JIGA 1ZK0A 4J43A 1JU9A 1JKFA 2DAPA 1ZK2A 5DOVA 3RC1A 1YB5A 3GOHA 3JQBA 3WICA 4ZICA 4PLWA 4Q3EA 3FI9A 4EJMA 5G4LA 1ENYA 3I1JA 4EJ0A 2ZYGA 3TZ6A 3DQPA 4E3ZA 1DBVO 4UVIA 1FDTA 4P22A 1Y6JA 2QZ9A 5JE8A 3BTUA 4DPLA 1F12A 1HL3A 3AY7A 4GH5A 1PL8A 3L6OO 4TSKA 1HE4A 3FBGA 2NTJA 1I3MA 3ZWOA 2Q2WA 1XA0A 3K2EA 1ZJZA 3QVOA 4BNJA 4U5QA 4AJKA 4NBWA 2R6JA 4HNHA 1XHLA 3G0OA 1N2SA 2D5AA 4JBIA 4JLWA 2V6GA 2OL4A 4D43A 3ENKA 2GLXA 4IDCA 5L7YA 3ZWNA 3I3OA 5AXCA 2JFHA 1EVIA 4GMGA 3AFNA 1W4ZA 1Y81A 2NVUA 3G3EA 4M89A 3WX0A 3HZZA 1O5IA 1B0AA 2Y1FA 1HYHA 2OFPA 4J4HA 5ICSA 1ENPA 2PH3A 3RBXA 4GBJA 2CDBA 4JBHA 1F0YA 2X22A 3VTZA 3GDFA 1VJ0A 1YO6A 1Y5MA 5JAZA 5JSFA 5L53A 3PHJA 5KIAA 4DPKA 4CV1A 3PK0A 2A94A 4XX0A 5TC4A 3GDGA 4PLGA 4I9NA 5TGDA 3WWYA 1YJQA 3FBTA 5CDGA 2QIOA 3A1NA 4I08A 3F3SA 3RC7A 1LDMA 2BFOA 8LDHA 5IDXA 4ITUA 1SEPA 4BNGA 1WZIA 3B1KA 5L7TA 1SOVA 1D4FA 5A06A 4RJTA 3ONEA 2I6TA 1FF9A 1NWHA 3GZNB 3DZIA 1ID1A 3T7EA 1QLJA 2YHIB 2G17A 4YJGB 4K6FA 4FFNA 3WLEA 5TX7A 1Z75A 3V2GA 2ZTUA 2JHFA 4B4VA 5JCJD 4CM5A 1T4BA 4BV9A 5L4NA 3ZWYA 4Y6PA 3JD1A 2OXIA 3UHAA 3U9LA 2GZ1A 2W2LA 5ER9A 2BELA 3TOZA 5BQFA 4NU6A 2Q4BA 4MIOA 1LLCA 1B3RA 3PXXA 3ZU5A 1YDEA 2DUUA 4ALMA 3P2OA 3WYEA 4HKTA 4D7AA 1NQAO 1P77A 4U7WA 4XA8A 4TWRA 2NNLD 3NTQA 3PDUA 2P68A 1PX0A 4J6FA 4IDFA 3TSCA 2IRWA 5FYDA 4N5LA 4UVDA 3PHHA 4P4NA 5CEFA 1PSDA 1GYPA 1TT7A 2R00A 1T1RA 3KZVA 2PD4A 5EERA 5ILGA 4Y98A 2WTBA 4L4RA 4ND2A 5IF3A 4BNZA 2P9GA 4D44A 3TZQA 4W4TA 1KVRA 3ULKA 1P45A 4MKRA 3WLFA 5DBFA 3WTBA 3WWZA 4FR5A 4N54A 2J8ZA 1ZEMA 1KVTA 3GN1A 3WYBA 1EQ2A 1F8FA 3PFWO 1X15A 1HSOA 2NTNA 4DC0A 5C3MA 3NKLA 2PZKA 3M1LA 2HUNA 3W1VA 1EE9A 4RF3A 2JKVA 1ULUA 1E6EA 2AMFA 1AHHA 3CMMA 2VHZA 1PJTA 3EC7A 4R1SA 2NM0A 1QORA 1FDWA 2EIHA 2A35A 3P2YA 1K89A 2AQ8A 1UH5A 3QVWA 5T8KA 4AFNA 4XYLA 4MP6A 2DC1A 5JXWA 1EBUA 4YJFA 2W4QA 3W8EA 2X0IA 3KM0A 5DN9A 3BHIA 3E03A 3I4FA 3MEQA 3NJ4A 4M87A 1UXHA 1M66A 2I9PA 5DP1A 5CG2A 4ND4A 1DB3A 2X8LA 3DDNA 3AOEC 2NV6A 3KBOA 3QJ5A 1U2GA 4YAEA 3S8MA 4D79A 4Z3KA 1E6WA 2W98A 4XZ3A 3RC9A 5LDGA 4YRAA 3JYNA 2EV9A 3WS7A 1E3IA 1GL3A 2G5CA 3DBHA 2VOEA 4J4BA 2BFMA 1JA9A 1WXDA 1GZ3A 4QT0A 2YYYA 3RUAA 4PFJA 5C7OO 2JAHA 1VKOA 1YOVA 2BRUA 4A73A 1H9AA 2D4AA 4HADA 4CQMB 5I7SA 4FW8A 1ZUD1 4RQUA 1DJNA 3BIOA 2CMDA 1LTHR 2HU2A 3O26A 1YQXA 3FNEA 4YJDA 3QY9A 1XDWA 3TL3A 3H5RA 3INTA 4HXYA 3BMQA 2GO1A 1PR3A 2J5KA 5CDUA 4TZTA 2XOXA 2W2KA 1ISMA 2X5JO 2I67A 4FOSA 3GVHA 3FNGA 4MVJA 1LI4A 3QWHA 1C14A 1Y9EA 2O4UX 4MKZA 1NR1A 4Z9FA 1HDYA 3KLMX 1QYXA 3C1OA 3Q9UA 1JKIA 3ZI0A 2AEFA 2HJRA 4YT8A 3PPIA 3Q2IA 4FS3A 1DXYA 4QFDA 4YWJA 4DVJA 2FPIA 1MV8A 4M8SA 1R66A 2FN7A 5L7WA 4ROSA 4PRLA 3D3EA 5TNXA 2X9NA 3H8VA 1DSSG 1KVSA 1LU9A 4IMPA 4D0RA 2P9CA 2PA3A 2O4CA 3OF2A 1VSUA 1NVMB 4XQEA 1NBOA 1YGYA 3EMKA 3C1TA 3PRJA 2Q1TA 4CODB 1M75A 2GN6A 3E1KA 5F5LA 2GR9A 2X23A 3GUCA 1IL0A 2YQ5A 2GCGA 1OOEA 3GK3A 3JYLA 3V1TC 5G0TA 4ZQFA 5K6AA 5KJFA 1O8CA 3OHSX 1NVTA 2G0TA 1EVZA 3OIFA 4PLYA 5TT0A 3V8BA 4ZN6A 1DRVA 4OOEA 1HDZA 2F00A 3DFZA 5T5QA 4B4WA 1NTOA 2BFPA 3W4JA 4N7RA 4YR9A 2D8AA 5JW6A 2Y1EA 1QRRA 1IB6A 4ONEA 4HX5A 3WDSA 4J91A 3I9LA 1XLTA 4FPXA 4NPCA 3PZRA 3GFGA 4PG6A 4FFRA 2EEZA 2NACA 2DBQA 4IS3A 3H9JA 3PHGA 3JQFA 4IY1A 4XRRA 2QZZA 5AVOA 3LT1A 3WQSB 4W82A 3S2IA 1BW9B 3DOCA 3BYZA 5BNFA 1Z7EA 2W8ZA 5JO9A 3SBOA 3U4HA 2J5QA 3TPCA 3WFJA 3GAZA 2FWMX 4NIMA 2X9GA 3BMCA 4BGIA 3Q11A 4ND3A 2HK9A 4CM7A 2XPCA 3SVTA 2TMGA 3RWBA 3UXYA 3P19A 2VUUA 4CV0A 2HRZA 5AXAA 5A9SA 5EESA 2X1HA 1J0XO 5ITVA 1MB4A 3WBBA 3WIDA 5IG2A 5K6AC 5COBA 1XIVA 4RF4A 2FPGA 3ZCXA 1RM4A 2HK7A 1PTJA 2NU6A 4XGIA 3M2PA 4ZQGA 4MP3A 2Y1CA 4QFCA 4CQLA 3TF5A 4XYGA 1S6YA 4RO0A 5EIOA 4B7UA 1Y5RA 4LSMA 2AXQA 3PYMA 2C54A 1DDOA 3C24A 1MX3A 3DHYA 3ZWWA 1IUKA 2FR1A 1H0KA 3IUSA 4DLLA 4N5MA 5JDIC 2V6FA 2GN4A 4CMEC 1WW8A 1MA0A 4YA6A 2QRJA 1VKNA 4G65A 4BUCA 2RBEA 3RD5A 1E6UA 2O3TA 2PKQP 1JW9B 3AOEA 3GF4A 1DC5A 2Z1NA 3AUAA 3LU1A 3IL2A 3ONFA 4TRMA 2HMSA 3QLJA 3KVOA 4IQ0A 4NBRA 5CAEA 2Y67A 1UDBA 1E3SA 3LSYA 3C7CB 2Y93A 2WD7B 1NPTO 4RVSA 4CLDA 3BMOA 3HSKA 4M55A 2UUPA 3E9NA 3I6QA 4Q3AA 4M49A 4DQUA 1ONNA 1PZHA 1YDWA 1YONA 4NI5A 4YACA 3RC2A 3H9EO 1JWBB 1SC6A 4RCVA 4AJEA 1U5CA 2E48A 2X86A 3HNPA 1NVGA 2VT3A 3D3WA 3IJRA 1TVEA 5HRUA 4CMCA 2W2LD 5BNTA 4YEDA 2NU9A 4BL5A 1FDSA 3AU8A 2ZYDA 4NG5A 4DTIA 3IKVA 2GZ2A 1GEGA 3GFBA 5G4KB 2OORA 2VYVD 1NHWA 4YXFA 1KIFA 1GU7A 1WMBA 2D3TA 3PQFA 4BGVA 5H81A 3W4KA 2VRBA 4MVJP 3ZV5A 3X2EA 4J1SA 4XCVA 3V2HA 1KOLA 4ZD6A 3F5QA 3FN4A 2PD6A 5G4KA 1V0JA 1U4OA 4UVHA 3MJ4A 2PZMA 3CUKA 2O50A 2UVDA 3KXDA 1ISFA 4RPHA 3ICPA 4L9RA 1PL7A 4E5NA 1XELA 1RKXA 2GYYA 4NJOA 1I01A 2CUKA 1P1JA 3I5MA 1NR7A 4WGGA 3WFIA 1J49A 2VCYA 4OQYA 3UF0A 4A5OA 5KNLA 2HDHA 2B4TO 1RYEA 1VSVA 2GDZA 1E0DA 1O0SA 1JN0A 3KYCA 1O95A 1GTMA 2JL1A 3S1LA 3QQPA 1VJ1A 1EUDA 2VOJA 4O63O 3NDRA 3UICA 1E1KA 2YQ4A 2O2SA 3DXFA 5B4UA 1V3TA 5GY7A 3UW3A 1T2EA 1NWCA 4MIYA 3P7MA 3JD3A 4GQAA 3F47A 3NRCA 4FOOA 4GKVA 1B8UA 2DKNA 3W6ZA 2QW8A 3B1FA 3D4OA 4CMGA 2GF2A 4MVJE 3OM9A 1PEDA 4XB2A 1TLTA 3JD4A 1R0LA 1ONOA 3ZWPA 4RF2A 4AJ1A 1ZK1A 4CL3A 4L8VA 1AXEA 3VH4A 1EVJA 4ZGWA 4WECA 5FI3A 3KSZO 2GPTA 2HSDA 4YDRA 4JJFA 4W7IA 1MLDA 5JYEA 1Z74A 1X0XA 4PVDA 2V7PA 4NBVA 5DT9A 3U4DA 1R4MA 2ZQZA 2VWPA 5TJ9A 2WYWA 2G76A 5JC8A 1EQUA 5IDYA 1RPNA 5CDYA 1YL5A 2ZB4A 2PD3A 3F4LA 3NAQA 2CVQA 1U3WA 2AW5A 1P1KA 3C7AA 3M1AA 1CDOA 1M67A 4D3SA 3JQDA 3LC2O 2BFAA 4FFMA 1CEQA 1SB9A 1R4NB 4KWIA 4TRRA 1CQIA 2YHIA 1A27A 3U09A 1I30A 1XQ6A 2HO5A 4YVFA 4D42A 1PQWA 1M76A 4WCDA 4GGOA 1YQDA 2FZWA 1DPGA 3E9MA 2PZLA 3ZH2A 3C8MA 4DIOA 3NT4A 1X7GA 1HRDA 1MC4A 4IGEA 1O6ZA 1E3EA 1R4MB 1Q7BA 3H3JA 3N7UA 3DONA 1C0PA 5DNAA 4I9HA 5A04A 5JDCC 5DULA 5C37A 3H9GA 3N58A 3RJ9A 5JLAA 3DAFA 1HE5A 1V6AA 4I9UA 5EL0A 5G0VA 4BO5A 4AJIA 3GGGA 1ONPA 4JNKA 5I9MA 5B12A 5JS6A 3CSDA 2NVUB 3N74A 4RPGA
chains in the Genus database with same CATH superfamily
3K15A 1YB2A 1NBMD 3ORFA 1A9QA 5B37A 2PUFA 2ABWA 3BMQB 2BSXA 4NK4A 4TYMA 1NBWB 4OK5A 2WQ7A 1L8XA 4RTKA 1WUHS 1JR6A 2BMVA 3E84A 3VR6H 3Q15C 1B8OA 1C9DB 4N7JA 3BS4A 1CYDA 3GU3A 5EJAA 5BSKA 5LQAA 3ETHA 4OQNA 1QDLB 5CB0A 1IBCA 3VHXB 4PLCA 1YS1X 1DFGA 3BULA 4W7SA 1BD3A 1US8B 4CIVA 1W4CA 4MTLA 5D01A 4E5UA 2HK6A 5L4NA 2HT1A 1CYEA 1XFDA 3UENA 2HWUA 3CWCA 1TK2A 4CFZA 3CLSC 3SC3A 3RNLA 3DE5X 5BW6B 1QYRA 4EEXA 1M54A 3PPVA 4ZXPA 1SVNA 1T3SA 3PX3A 1KFBB 5LWHA 1AX9A 3W5DA 3MHTA 4KPYA 3O90A 2FUG6 1WSWA 2XE4A 1PQUA 4YREA 3WQQA 1C1YA 1ZICA 1P9NA 2FK7A 4TM8A 2EQ5A 5T4FA 3HV0A 1EFUA 1K8ZB 3P71T 1E6KA 5G2OA 1ZINA 3OHMA 4YYZA 1QFYA 4LBYA 1ZU4A 4AW9A 1NMZA 2C2XA 3Q1KA 2F1RA 5EWLA 1T24A 3GDOA 3A7DA 1Q22A 4LRXA 1CUEA 3D3WB 2GAJA 3QP9A 4ND1A 1YRHA 1CWUA 3GLKA 4MKXA 4OM8A 4ENWA 2WINI 3CSSA 4WA7A 2P91A 2ZPUA 1EIZA 4JJZA 1M2FA 4RCYA 3OEWA 3UWDA 2AFHA 3MUOA 4B4DA 3F6YA 4C88A 4EATA 4EG1A 2HRBA 4B84A 1QX3A 2AFHB 4F5WA 1YQEA 2A67A 2L18A 3SYNA 1U04A 3OQIB 2O8BA 3M9LA 1EBFA 1QTIA 1ZMXA 2O2DA 4Y7CA 3S2SA 4D81A 5CDFE 5JRDS 1NSFA 4HFMA 1EK5A 5AI0A 4WLNA 2CW5A 2CFRA 5CH8A 3AVXA 1Y80A 1GLVA 1KJWA 1XCJA 2MMCA 1MJ5A 2PZGA 1R10A 1ENOA 3DVRX 3KCQA 3L7OA 3R3WA 4GYKA 4LYGA 5C34B 3SC4A 3V7NA 4OI1A 1Q2UA 2PYDA 5CJJA 1P3DA 2XNKA 3RLIA 3GPLA 4UAUA 4IJVA 1QHYA 3LZ6A 3G9QA 4IH9A 2GPYA 4GSLA 1PFYA 4IAOA 4UQLA 5KOHA 2UXBB 4GG1A 2I3ZA 1YU6A 4NMHA 4JZYA 4PSVA 1E59A 2XB8A 1DRKA 4H6WA 4GWKA 1ESMA 1G6OA 2XF8A 4HLDA 4KVFA 3UH0A 4ZJYA 5IVPA 1JIJA 5KNBA 4OKSA 1AV6A 4G26A 4GP9A 3GEDA 1ECFA 5EJIA 5EA2A 2CLHB 2DFKB 1MRNA 4R3UC 4ESVA 3H6KA 1XJCA 2VQSA 4IV5A 5JJKA 3JZMA 2FA9A 3P9QA 3QNUA 3QX9A 3U0VA 4J1NA 3AW9A 3S44A 2ZSFA 4JNCA 4EPYA 5D3QA 1KIMA 4QJ3A 4AZ3A 5AVTA 3RBVA 1Q1NA 1DINA 3A9WA 5HDQA 2QSJA 4EJ2A 4H60A 4CL0A 2IUTA 3ZQ4A 4EGCB 1A4IA 4YYEA 4HT3B 1NDQA 1ICIA 5TPZA 4YS6A 1Y3AA 1R00A 1QPBA 1O4WA 3KZKA 4HNUA 4NH4A 5DMHA 1EP1B 1ZAYA 1D7OA 4UUAA 4EUFA 1E3TA 1PUJA 1Q2XA 4JI0B 4BMXA 1Q7RA 4BV8A 1Q0ZA 3ROKA 4KO4S 1IPHA 3LBIA 1KRHA 3S2UA 7MHTA 1QBGA 3OF5A 5IKMA 3VDQA 2O7QA 2A7XA 1E2FA 3NOQA 4CV2A 2CKDA 1NAIA 3HUEA 1QFMA 1F20A 4WXMA 2GSWA 3LA6A 4GC9A 1SKUA 2C92A 4CT5A 5AM3A 5CYGA 4WX2B 1AK2A 3NAZA 4RLFA 2X41A 3NALA 1SUWA 1Z35A 1YI8A 1AN9A 2FI1A 3K53A 2BCJQ 4JN6B 2O2CA 1W7AA 1C7JA 4JEMA 4KLAA 1NW3A 1RRFA 3KUXA 1GL9B 1N78A 2B34A 1C7ZA 1Q0UA 1UEJA 2HO4A 1PJCA 2PJZA 4BE7B 1DI0A 5MDHA 3KKOA 3KLBA 2BI4A 4HGYA 4N5IX 2VSNA 4DLBA 5A5FA 2W5UA 4QXQA 3ANSA 3GFOA 2CNOA 1QVVA 3IAFA 5P8WA 2FPLA 4D3YA 4G56A 5CCEA 4BVKA 2NO7A 1CJCA 2HXSA 4L75A 2IE0A 3RV4A 1ZNXA 3GHHA 2ZWOA 4FXOA 1YR8A 3HE3A 3BL8A 4F11A 4V24A 3GJ6A 1DCKA 1UT5A 1YE5A 1E8DA 1SU7A 3PQEA 3VPXA 4NEHB 3WLJA 4ZI2A 2P0YA 2LGJA 1U4NA 2HCBA 2VJQA 3BDAA 3IHLA 3K4PA 5B6PA 1SQ5A 1U2DA 3A27A 1I6KA 2BKLA 2F9LA 1BS2A 4BB9A 1K5HA 3AW8A 3L77A 1KZ1A 4R8SA 5E9QA 5F2KA 3ZCRA 4EY5A 3DKKA 2G07A 1MZPA 2C4TA 1JVSA 5HCNA 3KP1A 4H1WA 3BB4A 3GP3A 4RTNA 2ORIA 5CLJA 2V74B 1R6AA 3PVSA 1UJBA 1OFUA 3LIPA 4YP7A 3O4RA 4P3NA 3BRCA 4PM4A 3MWDA 3FZEA 4KWCA 1X92A 2Q5EA 2EP7A 5KC8A 3Q41A 3LC1O 1AE1A 1ODTC 5K9ZA 2UUCB 4MVJF 1OH6A 1QIFA 5HVNA 4FXPA 3T5BA 5K4AA 3DEKA 3ZU6A 4G23A 2EAUA 1JEQB 1VXRA 2EFDB 2D62A 1Q91A 3LPMA 3ASZA 4BX0A 1UQUA 2IUEA 4A2PA 4RS4A 3KZMA 5BW8A 1PWEA 1IWPB 3D7LA 4ESHA 1T1EA 2CB0A 4Z3OA 4MUKA 3GGSA 1JDZA 2V3CC 4D82A 3REGA 4RZIA 3AVUA 3GGDA 1W88B 3RKSA 4I1IA 4BBPA 5CM9C 3PHBE 3OG9A 2XGSA 6ADHA 1F2UA 3I8XA 4JHLA 2VJAA 3O4IA 1I80A 1XMSA 2AFVA 4IDUA 4Q3KA 1LSJA 1MEOA 2REQB 1JT2A 3ANLA 3GFPA 3LPAA 4WZAE 4M0KA 1TW3A 2E82A 2C9YA 2DE0X 2FWRA 2JLUA 3M8KA 5EWJB 2XCSB 4XPIA 1W87A 3CINA 5FUVA 3UY4A 4EARA 4R69A 1L4EA 1WKCA 4TWIA 4Z99A 2IUSA 4GGPA 4J0CA 3U0BA 2BZ1A 2DT5A 2Z5LA 2HBQA 2O0MA 3JALA 3JQ8A 1JDBC 3S7TA 2CJWA 4BMNA 4TV8A 2GRUA 3KZCA 4M0UA 3TGWA 1N32B 1TB4A 2EGGA 1L4UA 2IOFA 1TDJA 2V3WA 1MENA 3CH4B 3CX4A 3I01A 1M8GA 1MX5A 3H0KA 4K6GA 3P0IA 3RU7A 1HE1C 3WLAA 3HEMA 4PU0A 1HZJA 2PJRA 5ENVA 4OAPA 3R0QA 1DADA 2H8GA 5DBEX 5T4EA 5AICA 4D9GA 3PV0A 4MS1A 2CWWA 2GD0A 5HDBB 2YFYA 4RIEA 1BDMA 3C16C 1V48A 3DE3X 3CX3A 4PN3A 3CUVA 2GD2A 4AG3A 1W52X 2EWVA 3FNBA 2EP8A 5HM8A 1TVMA 4RDIA 4FEGA 3R76A 4F8JA 4YMWA 5FV4A 3L4JA 2FETA 4HZUA 4KRXA 4KI7A 2D1FA 5AK5A 1UBCA 1NVKA 3K96A 3LQRA 4NQZA 3SHQA 4LHEA 5G1NA 4AKTA 5FLKA 3OJFA 4LSGA 3EBOA 3KALA 1BJKA 3ZHRA 1NQ5A 3K4QA 1SHTX 2GAFA 4C4ZA 1RLOA 2NU7A 5ECDA 5JDIA 5ESDA 2E4XA 3WGOA 1IN5A 1MIOB 3WKCA 4TV8B 1Y7IA 2XMGA 3FPGA 1EUZA 3O73A 2Z8YA 3EX7C 3OE7D 1JHYA 1WQ4A 3ZBTA 4RTJA 4BO4A 1IXSB 2IZ0A 3LTNC 2B8JA 2SECE 1C5KA 4CKCA 4BO7A 1WUJS 1UKZA 3S3TA 3SHWA 1SQFA 1Z8DA 4DG8A 2AXEA 4DREA 3CKLA 3AKCA 1BSVA 3O47A 4KWHA 5KQPA 3F9RA 2DFNA 2OILA 1JGTA 2C5FA 2RHJA 3T0IA 2ZYWX 5JCJA 2WWYA 3D5EA 2BGUA 4EUHA 5AXDA 3ODGA 2A9JA 1UANA 1NN3A 2QT9A 2ZYSA 4PQFA 3E7DA 1KZHA 3RVOA 5K45A 1YGPA 4RTSA 1PR9A 4JUIA 3T5GA 2AN3A 4YCSA 3VI4B 2WD7A 2D2XA 4POOA 4LQCA 3ZGLA 4V0RA 4N5NA 3L5KA 3LWBA 4HGPA 4GEKA 4CDMA 3WRWA 3G68A 3GA5A 3E35A 3K70D 1K6MA 1Y42X 2A0WA 2F1JA 4HEJA 2Q5FA 5AHWA 2WNSA 3MIIA 4Q3CA 1C7EA 2H2IA 4V0ME 4BBJA 1NW6A 3D0QA 4UREA 1JF8A 1N57A 4EYGA 5C51B 3FHOA 4LCBA 5ALDA 3ASUA 3FIUA 4FDMA 1X7DA 1YC2A 1FSZA 2CHQA 3AK4A 4FFWA 5D85A 5AKJA 2QJTA 2ADFA 2GN2A 4DV5B 1XWIA 3EVFA 3UT5B 5JO0A 3JAMA 1S3GA 1Y8ZA 4YRDA 3H1GA 1SHJA 1XZCA 3RHTA 1Z8HA 4KH1A 4EGAA 1AKVA 3BAZA 3PCRB 4IMRA 3UYKA 3E9QA 2RGAA 1HORA 3ENNA 5ALUA 3TYXA 1RWWA 4MWZA 3ZQUA 4BRUA 1MBZA 1EJ2A 2HF8A 1I2AA 3K5PA 4KYUA 1KEVA 3G59A 4MRMA 1WEHA 3KAKA 2GZRA 2H1HA 2DEUA 1BXZA 4CKWB 1QPZA 1SXJD 3GNTA 1LA2A 2C5SA 3LT5A 1ADGA 1RRGA 4UM5A 1U3UA 1FFEA 1ZPDA 2XDAA 1RRMA 2CUZA 1YZ3A 4RHXA 1C2YA 2J32A 4FHDA 4IXNA 2B5VA 2QN2A 1YR1A 4DMLA 2VSFA 5CVEA 3O8OB 5EOVA 4A6EA 2WM9B 1HGXA 1E9CA 2ZI6A 1ZOOA 2G8LA 2YKGA 3GJ3A 2VR1A 4CIDA 3LLVA 4NV0A 1G0NA 2IC5A 2R0QC 4HLQB 1OXVA 2VZ9A 3A3NA 1X39A 1BCSA 3MOIA 4ZQBA 2R6ZA 4F92B 3WDKA 4L28A 1S9HA 3K9GA 1RZUA 4HWGA 5JPIA 3U3MA 1QGOA 1YRAA 5KKAA 2PR2A 1HDGO 1Q57A 1AJEA 4P2BA 2Z4SA 4DCMA 3NKFA 2VBCA 5D87A 3TD9A 1LNSA 5G3YA 1NG1A 3OT5A 2CZCA 4OLFA 2OHXA 3GARA 2PYZA 3IDAA 1MPXA 1PYOA 1VJTA 1TT5B 1PK7A 1XA3A 1K2WA 3OBBA 3E7XA 4H1TA 5BWNA 2HQ1A 3FOBA 1GGVA 4QX6A 1U6KA 1QC5B 3DWFA 4JU9A 4NABA 1EK6A 2XEDA 3UKDA 1CW2B 2HWWA 4RENA 1QOZA 4HTFB 5GM2A 1PDVA 4AMBA 4AY3A 3HQ4O 4LHYA 2B21A 4DLWA 4CIWA 6NULA 3CA8A 5CXXA 4P81A 3NYRA 1QIIA 3DVAA 3U1VA 4PRKA 2DFVA 1YCGA 2FUG1 3N6VA 3T6KA 1IEVA 2VPZA 3OP1A 2C9DA 4X1KA 3RIMA 3SX2A 3VRHA 4DIFA 3E61A 3K31A 1SCIA 16PKA 3MLEA 2GBCA 4HWOA 5CJPA 3HUFA 5A62A 2XZOA 2Z43A 1KXJA 1OAKA 1B2LA 1E94E 2EKQA 2ZJFA 1F4PA 2LDXA 3AXTA 3M3HA 2EX1A 4QICA 2WICA 3V6LA 2ACKA 1YZVA 2GRAA 2SICE 3HA2A 4ODIA 4JI4B 2GEDA 3LBHA 4WLEA 2O8VA 4KYVA 3V1LA 2DU8A 4O5OA 3FKQA 4C0QC 1K8QA 2Y1WA 4TKMA 1FYWA 3AC0A 4WOPA 1R6VA 1EGQA 1THTA 2X40A 5JAUA 5ITZA 4EECA 3T9FA 4MVXA 3CRMA 3IUPA 4OK3A 4S0XA 1DCTA 4A8TA 4P53A 3UAZA 2H5JA 3OU7A 1X13A 3N3AC 3VU8A 4H7HA 1NJFA 5LMZA 1ESEA 3IFSA 3R0VA 2C78A 1BMDA 4Z7QB 1RYDA 4II7A 4CR8A 1U8ZA 1JQKA 5CB4F 3KQUA 3ABOB 2WKSA 4KDEA 1N9GB 1XCPA 3H9BA 2GH1A 4FGWA 1FYFA 5CBPB 5I9TA 2P62A 4TVOA 1RIFA 2YHAA 3IO3A 1NULA 2A9PA 1R0SA 3L79A 4L74A 2B83A 3RFUA 2SNIE 2HPHA 1JG1A 2DULA 4QHYA 1UZLA 2EKLA 3NYQA 1WZ2A 2CL0X 1J00A 1CF2O 5J23A 3COPA 3CU5A 3E5NA 2AC2A 1LPBB 3JY6A 5LXTB 1OUMA 1U7UA 4OJMX 1S5PA 1LEHA 4PGMA 1OU4A 1TUGA 2PY6A 4A0QA 4NESA 1DWOA 4M4SA 3T35A 4D45A 3NOVA 5JEDA 2AOTA 5FEUA 3NHWA 3VZPA 2XODA 5BYBA 1W36B 3NUGA 1THZA 1KH3A 3TL2A 1K68A 1V96A 2F1OA 1N1EA 2JIPA 2X9QA 2FEMA 1DEHA 3K20A 3QFTA 1AS2A 3D7RA 4RDHA 1UT6A 4C89A 1S8FA 121PA 1XQ1A 4BGPA 4NZ9A 2X2FA 3F1LA 2Y1OA 2C59A 3PIDA 1XZFA 1VSQA 3I72A 1H0SA 1BGXT 4R2MA 5TF0A 2NMVA 3MWFA 2DUNA 4TKVB 4ARAA 3VBCA 1RYMA 4K28A 2EZTA 3MJEA 2QUBA 4U0JA 5H16A 2C2WA 3FRJA 1WMAA 2PZ8A 3KU1A 1U28A 3UTDA 4ZI7B 4B73A 1XR3A 4BJ5A 4BAUA 1SC3A 4RNDB 4XEUA 2X42A 3NV7A 4W9RA 1O94A 2YYSA 3KR0A 3KKQA 1IJBA 4WKPA 1TKCA 3RBZA 3SC2A 5KVSA 4X62B 3TIIA 1J4AA 4IHAA 4RF5A 1AHNA 1IBRA 1L5SA 2IFTA 3DTVB 4QHTA 2QGZA 2VJKA 4FSDA 1ZIDA 1NURA 1CQJA 2C7OA 2BGLA 2OYRA 1PJAA 2OOSA 1ISIA 1DKMA 1NC3A 1O94C 1P2UA 4IQGA 3LRPA 2ZAOA 4QUGA 4QZVA 1SQ6A 2HGZA 3K6SA 4MA0A 1EDOA 3TGPA 2MTBA 2VPIA 2DPXA 1ZIXA 4WZBA 4B7AA 1A50B 3A1EA 3QV1A 1I4EB 1WIWA 4IGFA 3ZVLA 3B85A 1GG9A 2VK1A 2PUHA 3DMTA 2W6NA 2J41A 5JSKA 4AWXA 4ZCLA 2JZOA 3NYWA 4I8DA 4CLRA 3LG2A 2V1UA 1C3OA 4DZRA 4IJWA 4OQPA 2NQTA 1UIMA 5JH7F 1NE7A 2JATA 1V5GA 1WSBA 2XNSA 2Q45A 5EJ2A 4D26A 2Y1LA 4RVNA 5DNWA 2X76A 3SX4A 5KTNA 4CLOA 4LMRA 1G7SA 3W5BA 1SA0B 5JAMA 1V39A 2PIAA 4D9HA 1A4XA 1A5BB 1OQAA 1R6UA 2KQUA 3ACDA 4CUKA 1T1SA 4IJ5A 4JAVC 1VLLA 1JDUA 3GEEA 3RS3A 1MB9A 2PQMA 2R48A 3VPFA 4C22A 1CP3A 2DQ4A 2I4TA 1BU5A 2MINA 3B3AA 1ID8A 1DJLA 1KBZA 5IC4A 4GPIB 3K8QA 2C1ZA 3L0YA 4EL0A 3HB4X 3R3SA 3PGMA 2E6KA 1QPGA 1JBQA 2CMKA 3GR6A 3JCZA 3C6YA 2VUTA 2OZPA 3LK6A 3OCVA 1GAWA 2QAJA 2G06A 3WK9A 3AB8A 3L01A 2PLAA 1GGNA 4GIBA 4H7KA 3DKVA 4KYIB 4EY3A 2RGXA 1NJGA 3ND6A 4AX4A 4RVGA 4MICA 4N40A 3F46A 3MGKA 1JH8A 3ONVA 5FNVB 4A10A 2BT4A 4R7GA 2F3TA 2GEJA 2XOKA 2W90A 1QYCA 4NATA 5LOVA 2JKYA 1N1GA 2RJNA 2RE8A 1XROA 4E33A 5C35A 1QZUA 4V0LA 3QVKA 2JLCA 1NX6A 2IT1A 2V5VA 5GZ3A 3F0TA 1UL1X 2IKSA 4MYCA 3BF7A 1F3LA 4FEYA 2AI3A 4NARA 2W6ID 5T3YA 4C5CA 5JR3A 4JP3A 1KSHA 1JXAA 2H5IA 2HMWA 2R9VA 3IODA 4QTUB 10MHA 3K70B 3QJGA 5C0OE 3TQTA 2XAUA 3B2EA 4INOA 3G2OA 3HJCA 2EF0A 3DDWA 4JWKA 1OBOA 1GWNA 3MRSA 3ZJ5A 4U2GA 2WPNA 1ZM7A 4DSOA 1P4GA 4IDAA 1IZ8A 3LNCA 1JL3A 3QMWA 4PX3A 5IN4A 3O1LA 1E3JA 3OIYA 4BBAA 5KNDA 4DBVO 4F7DA 4Q3LA 4Y6GB 3VR6A 4OHKA 1GRQA 2I6QA 2X58A 2Y68A 5JJLA 1MG5A 2G1UA 2YNMA 4C0KA 3T52A 2LCQA 3VZQA 2HKIA 1RYFA 3HKDB 5EXTA 1ODJA 1R37A 1SPXA 1JR4A 1ZC3A 2BGIA 2O2EA 2OO3A 4O2AB 4UZFA 1N6IA 4HNRA 1RRPA 4LI0A 1AD2A 2V55B 5BSGA 4BCCA 5BSUA 3C4QA 821PA 4CQMD 4PX2A 3B1JA 2FWBA 3LXXA 1HA3A 4GM4A 4N1AA 1T15A 1KK1A 4EP1A 1VL0A 1FUKA 4F9GA 4YAIA 2O5CA 3WGGA 1B8VA 2POQX 4JJGA 521PA 5JFGA 4S12A 1YVUA 4KITB 4KQKA 2NSYA 2B92A 4O2AF 1TVCA 3RI3A 2Q9AA 2NP7A 1N2JA 3AVYA 1AQLA 1NHGA 1GPBA 1ZMTA 1CE8A 3G49A 1QOPB 4UNPA 2XNDD 4YY3B 3OPYB 4MVJD 4JDUA 4QAJA 4XGNA 4RQTA 1A2KC 5DGHA 5CFOA 1P91A 1YQTA 2I2DA 4MRAA 3KWJA 5KAPA 2RK3A 3A0UA 5FPSA 1Z0IA 4M38A 4F91B 1T5TA 3F7NA 1HDRA 3G13A 3QWBA 4NHEA 1C3EA 4HGZA 5M5BA 3GRFA 1DG9A 3FCUB 3WXMA 1BDIA 4LJ8A 2BM9A 3AL2A 4UFPA 3GVPA 4ZIRA 3TKYA 3V2UA 1FP4A 5C8YB 1LZKA 1D6MA 5AI5A 4FEAA 4BPRA 2A6PA 5DE3A 4Q47A 1K7EB 4WZAA 1R0BA 3ZG6A 5BMVA 5K09A 1IUNA 1KDPA 2Z3WA 3FZGA 2WTAA 3UCFA 2DR3A 1BFUA 4L0CA 2R4QA 4JVMA 3KKNA 1IRIA 1X38A 2QP3A 3V4ZA 2PH5A 3N2ZB 4HDRB 8GPBA 5C4IA 4LJLA 3CKMA 2XRZA 1ZIOA 4Y6QA 3TUIC 5FNVF 1FYEA 3FM9A 3K0AA 3TJRA 2RMKA 3ELUA 4RD4A 1LDNA 1KERA 3M6WA 1GQOA 2Z6VA 3QPDA 2QWXA 4X85A 4KXXA 5BR1A 3R5TA 1BOFA 3O8BA 1BVRA 1FIUA 4D0LB 4F5YA 1E6CA 1X86B 5EIWA 1Y63A 4I81A 1GN8A 4OH1A 3UVEA 1J42A 1RJWA 3LBAA 4J0FA 3KYDB 3NT2A 2QMUA 1ZA2A 2VF4X 4OQLA 2PQ6A 1DUSA 3O8QA 1YS9A 1DAPA 3DF9A 5JUWA 1SVLA 1RJEA 2DPMA 4IIVA 5DM70 1UBNA 1L1QA 5HE9A 1WXFA 3LOPA 3L49A 4CLRB 4WSOA 4X7RA 1BGWA 1M8KA 1VPLA 3JYQA 1GNRA 3PITA 4JR1A 1E3WB 4XDZA 4MUIA 4IINA 4FKZA 1DXHA 2AOVA 1WDTA 3HGMA 3JZIA 4PLPA 5JTTA 3AM1A 2QUJA 4MSUA 1WP4A 1P7ZA 1P1HA 2PS1A 2BBOA 3NANA 3TOCA 4Z53A 2IKQA 3H2SA 1KO5A 1V1JA 4Q7KA 4D9KA 2QU7A 1OFHA 4QGSA 4C29A 1FCJA 1M7BA 4D4HA 3IEUA 5A05A 2IX9A 2ZBPA 3NPMA 3IA7A 1D8TA 2FG6C 2PWZA 1ST2A 1OSNA 2WB4A 1IHOA 3W7VA 4BLPA 3IMKA 3HDJA 2ZYHA 2GM9A 4OQQA 3DE2X 4P38A 4BFYA 5C32A 2W9XA 1NP6A 1BMFA 3QKSB 4RIIA 4AL4A 3VYTB 2BGKA 4IYJA 3NHJA 1E92A 2BDEA 1Z8FA 3PNKA 2QYOA 3FFBA 5BW5A 3EVNA 2ZRFA 5KVVA 2QAIA 4JB0A 4W7HA 4ZZ1A 3ZOZA 3UA3A 4C3OB 1OFUX 5KJCA 4DR3B 3K16A 4BRZA 4MDFA 3SICE 1QJ4A 1K0FA 2CF6A 1N2HA 2ATXA 3HJNA 4PZUA 5IBPA 1SUCA 4DA0A 5J2UA 3ZCSA 4C7BA 5MGBA 1DPFA 3AUFA 3ONWA 4Z4QA 2XSZD 1TYZA 2ZCVA 4CF3A 5BV2P 2WWHA 2XBMA 3NQ41 3ICWA 4HP8A 1ACMA 4P7JA 1XTKA 1XJ5A 1ZVMA 2PN1A 4GKKB 4JELA 2PUTA 2QMHA 5B3JA 2MCFA 2ZZKA 3EFEA 3GVXA 3V4PB 5KQRA 2PBFA 4HSGA 1BEZA 1L1RA 2Z0MA 4Q19A 5F1PA 3HGQA 4UNNA 4DL9A 1O96A 1XZMA 2GBLA 1N2CE 2P9TA 2Q6TA 3JQ9A 3AEQA 4M8KA 4LY9A 4S35A 4U2FA 5EIFA 2FSVC 5L8VA 2C9CA 1T9CA 3OOYA 3WK4A 3D1VA 5JECA 2WG1A 2QN8A 4S1TA 4A3SA 3OZ7A 1PJ2A 4IEIA 2RHMA 4S0ZA 4WZ6A 4RGBA 4IIHA 4MW7A 3GVCA 4DVGA 5ECWA 3DMFA 2CE7A 1P1FA 1G3RA 3EQ2A 3FSEA 3HI4A 1FJ2A 1MEEA 4MW5A 4BKOA 1I6MA 5K0NA 3MWYW 1KFJB 1EWKA 4RIFA 2FPWA 4DM3A 3ZDRA 2D5LA 2JIDA 4GVLA 4H9GA 3TNJA 4P33A 2WFLB 1SHZA 3IOYA 2OAEA 1HL7A 1KH2A 3LPDA 3PG5A 1A98A 1GSOA 1MHPA 3K94A 3OEEA 4PICA 4PSDA 5DHSA 3VZSA 5A4DA 3CZMA 1I0IA 1QVZA 1HWYA 4HQ6A 1DDIA 1N2OA 2R8ZA 3A14A 1EDDA 3D3JA 3P9YA 5CB4B 3EFHA 4DIDA 1MJNA 1XYVA 3FRIA 2F1IA 5AM0A 5KWIA 1FLVA 4I6GA 2BI8A 3SBEA 2BVNA 3B3JA 3JARB 4K26A 3DCNA 3DS8A 3JWIA 4IQFA 3ZD7A 4Y2PA 1F2TB 2MSEB 3HWRA 1OLSA 2R96A 3BXPA 3F6RA 3DBRA 3PFNA 4GL4A 5AQEA 3GT0A 2O2ZA 2GM4A 3E23A 4TVSA 2R6GA 2GVZC 3WIBA 5ICCA 5FXMA 3SNHA 4X1KB 1P5RA 3A4LA 1YCFA 2FPKA 2I7DA 3RJZA 1AA6A 4OAOA 3EASA 3DZJA 2GAAA 2NPOA 4JQZA 5YASA 2I3DA 1DT3A 4GLFA 4I4TA 2EW8A 1W30A 1IN7A 2I2CA 5AOCA 2X4IA 4LJ4A 2JLSA 3L93A 3RHZA 1W4AA 1VPWA 1P2GA 1Z2AA 2HLNA 4BLUA 1TJYA 4ZDWA 3IEXA 5JY1A 1R0YA 1TU4A 1PUXA 3DE0X 4M88A 4MJLA 4RH0A 4XR4A 4JEHA 1LQTA 4QEZA 3RS8A 3SZMA 1TT5A 4Y9RA 4S2EA 1VL2A 1U7OA 4X1YA 4GFDA 2YHSA 3OZFA 4DLKA 1D2GA 5GAJA 2WZBA 5E1DA 2PX6A 4M1YA 3SFVA 4L72A 1VI6A 2AC7A 3ESZA 3IVRA 3STVA 1P19A 2AFRA 1M6WA 2INGX 3EAFA 4Y6SA 3TRHA 5H9WA 4WAUA 5JNLA 1L7EA 2PFKA 1MT0A 4GPAA 5JAQA 3TB6A 4CCAA 1DO2A 1L3IA 5FOWA 4V1CI 5J2TA 4W9MC 1GPDG 4BX3A 2B37A 1P62B 2K5UA 2WU8A 3MWKA 3H2ZA 3L46A 1T5HX 5CK5A 3DCIA 4F96A 9LDTA 5IYZF 3G0IA 2FWIA 3U4IA 2FSFA 4R1LA 3EF3A 1QAMA 4WE3A 2IEIA 4G81A 4AROA 2R7LA 5FTMA 3SX0A 2GVNA 4WK0B 4C01A 3KB1A 4HLUC 1VRWA 2BGTA 4KDFA 2QE6A 4TWAA 1JR3E 4E6PA 4R2JA 2J4CA 4YUXA 4FJ1A 3NHFA 2Q49A 3I04A 4CM3A 1Z8NA 2O0LA 3BE4A 3BK2A 3CBQA 3SE7A 3G2PA 1BDHA 1RAGA 2ZAYA 4ZWNA 5EP2A 4TXHA 2YVKA 4NBUA 1YBVA 5DLDA 3PFBA 1X7WB 1ZZGA 2AQKA 5L51A 5LCXA 3QENA 1U2TA 1I5EA 4ARBA 2F3QA 3A0RB 1QP0A 1EGAA 2YFHA 1NBHA 3AZPA 1U3VA 1WJGA 4U9IS 1YS2X 4MUMA 2PK3A 3HDYA 3FVRA 6GPBA 3M4XA 3L0DA 1C1DB 5FWNA 3H9UA 3SLGA 4PBTA 4MWCA 1E1RD 2KW5A 3P2JA 3NNSA 4OYYA 1YNOA 3ZS8A 5I9BA 3QYPA 3V7FA 1ORWA 1SVUA 4PPYA 3I9OA 3HR4A 4LC1A 2WMNB 2JFGA 4K0RA 3NAGA 5CNMA 3N8IA 4E6EA 5LLSA 4AB1A 3VPGA 4TMKA 4ID9A 1CDDA 1ODFA 1XRQA 1Y5LA 3QPVA 4W1PA 5F7ZA 3W04A 3ZWAA 4BMDA 3M1YA 4YX9A 1Y8QB 5JZOA 3CT6A 3WYGA 3VDRA 3NUQA 1SMKA 1Z3CA 5F9HA 1R15A 1CRWG 3LCUA 4I1VA 5JOQA 3OZIA 4J1QA 5B36A 2O7NA 1VCHA 3DBOB 3ZWBA 3NC1C 1VLVA 2EG5A 3L3BA 1VHWA 1M1XB 2BR4A 3DNMA 4TMWA 1M1ZA 3H1BA 4NV1A 1KJNA 3SS7X 2I71A 2X0JA 3GLGB 2VJYA 1FBTA 3NTOA 3OZBA 1JYEA 2FK8A 2WHPB 2JJ8A 1XU4A 3VM6A 3HXMA 1O0CA 1C3VA 1X1CA 2ERYA 4GOMD 1KI8A 1V37A 4LWPA 1AM4D 1T6ZA 3K4HA 2JGEA 4GYYA 4KQFA 4TLEA 4ROTA 2BTEA 1D2EA 4S1PA 1Z2PX 1JHDA 2W6JA 4W5HA 1U1DA 2JCXA 4NWIA 5FP0A 3IQHX 4Q12A 1SY7A 2O3JA 4P84A 2XDYA 1WU8A 5IFLA 3VX4A 2BM8A 1Z5PA 4P31A 1NUPA 4DSZA 2GD1O 1ZU5A 3UJHA 5IYZB 4S05A 2XUIA 5AVWA 4CM4B 2F3PA 2MT9A 4YCJA 2LKCA 3LXUX 3BE5A 3BJMA 3B1XA 1U7HA 3KT0A 3NASA 4OP2A 4PZZA 4REMA 5FULA 1YRYE 1GSIA 3S4YA 5LZ9A 2EC5A 4OGFA 4WESB 3V8EA 5IJ9A 1NXQA 3KJEA 2OCAA 1CVLA 1ZD8A 1CETA 3TLGB 3ECAA 4AX8A 5JS8A 1C1XA 2EGHA 4R1QA 5TEWA 1I94B 2VAPA 5KPJA 3KR1A 4FLMA 3EGWA 2XDQB 2ZR8A 1EGMB 5TRTA 1F06A 4CXMA 1HSZA 1D2CA 2ZU6A 1NUSA 1OV4A 3PICA 2A5JA 4L8WB 1CR2A 1CUBA 3UC9A 1FSPA 5CT8A 3CEAA 1T0PA 2GTIA 3IAHA 4KTTE 4G0QA 2A5LA 2IXFA 2RAFA 3ELYA 4TTIA 5DCWA 3VKUA 2R6HA 3VOTA 1AHIA 3H1TA 1UWKA 4Y7DA 4UM7A 2RONA 1HX7A 3R5XA 3PDIB 4JI6B 4ZHQA 4MYHA 4CMBA 2DRIA 2ID4A 3CE6A 3MJTA 1OGJA 1WP9A 3A1VA 3BKXA 4RZHA 4U5XA 4XFKA 1RXWA 4X6UA 3Q2KA 5JAHA 4DV7B 4J90A 5AJXA 3KAQA 4Z7NB 1BCRB 2AV6A 1QO0D 1P4HA 4MGEA 1JV2B 4A2CA 3W0LB 4S2UA 4U39A 4Z8YA 5CIQA 5I51A 1ATZA 3CEHA 2LRHA 1XYGA 1CY4A 1PLJA 1UAAA 1LXCA 3EXIA 3L40A 3VKVA 4TXJA 1K9VF 1TKRA 3OFVA 4RY0A 3RT1A 4ZYTA 4E1VA 1TIKA 4OL9A 3Q7IA 3KTAB 1Q3TA 4XGQA 3DLCA 2ZAIA 3PC2A 2P3OA 2VZLA 2H2DA 5B1YA 3ROFA 2VYVA 1ST3A 1LK5A 3ROZA 1LD3A 4Q3NA 4HAWA 2ODTX 1OXXK 1ZL0A 2BZ0A 2NUAA 2P0AA 3C6MA 3GL9A 4OUDB 3LI2A 4H4CA 4UOEA 2JFFA 2WE7A 3JXEA 1KYXA 3MINB 4R7TA 2GYWA 1Y48E 2WSMA 2XBUA 5KOJA 4JROA 4EBFA 4JGGA 5KSOA 1SD1A 2HLPA 4GNKA 1DZ3A 4R2KA 4Q39A 1RABA 4LF5B 4XASA 1V7PC 4IMJB 3BXEA 3UMYA 2JH9A 1H4TA 3QEJA 4XWKA 3B7GA 1MAWA 1DIBA 2GQ0A 2RKWA 3IUMA 1QIGA 1DQPA 4WDRA 2ZWVA 2R79A 3RG8A 3N8GA 3L2OB 5DTMA 2QEQA 3TLEA 2BC9A 1ZVJA 2V8OA 1V5FA 2C0PA 3FF1A 3FY4A 5AHRA 3S0JA 1MOQA 2FPIB 4G5GA 4H3SA 2W42A 4CL2A 3B5IA 5J5CA 3RRXA 4BN5A 2M9MA 4WLOA 4RVOA 1XTVA 1OX4A 4J1TA 1BFKA 2J4DA 2QK4A 4V0MA 3DHNA 4NDNE 1QLWA 2H16A 2OBFA 3R0XA 3PEWA 2VH1A 1GG8A 4KQHA 2O8FA 3QXSA 2O3QA 5MHTA 4WA8A 5I3CA 4XQCA 2AMLA 4LKOA 2NU8B 2WY2D 3GP8A 3N39C 2IEBA 2GZMA 4ER3A 2QX9A 2YFQA 5JALA 3B9BA 5KU1A 2QE7D 4MINA 3IAXA 3NVKI 3GWGA 3UG7A 1OXSC 3UPTA 1IPEA 1GADO 1X87A 3C5CA 1I1NA 2WYOA 4M54A 2ZSKA 1FUEA 1GY8A 1UBTS 3ETLA 4UHDA 4JC5A 1A1VA 4ZIRB 1JHAA 3TFOA 1BDJA 1DUVG 3L7MA 1XZDA 4AZ0B 2OD9A 1OYVA 2QZJA 2ODEA 4RK1A 1PJSA 3CNHA 3Q3GE 1TCAA 2PDAA 4C7KA 4CKBA 1UJ4A 1KZYC 1Z6YA 4L5JA 5ED0A 1DCFA 3GUYA 2YRXA 3OFJA 4O59O 1PBTA 2XQGA 4R0VA 4CM8B 1U5BB 3G02A 3CLRC 3PA8A 3WRXC 1A96A 1NUTA 4GX2A 1Y4SA 1ZZEA 3PUKA 1G19A 3E05A 2A1UB 4BNVA 5AW2A 3GLIA 1XXHE 4TKUA 5A0VA 1P61B 4A1OA 1QGED 1OTXA 2RHTA 1G60A 2IOFK 2VH2A 3FPHA 1XQYA 2PSEA 5CA0F 4YT4A 4G01B 5DASA 5EPOA 5LN1A 3REOA 1BYUA 4C2AA 2IY7A 3BD9A 2HAEA 5AOBA 3SFTA 5ALTA 3KCNA 1LS1A 2GFIA 1IULA 3EGDA 2XAAA 1FMLA 4W99A 1TNDA 4WCFB 3RODA 2QIPA 3HWSA 1PHPA 1J0CA 2DBRA 4DY4A 4EAQA 5L6MB 2CVOA 4OPMA 2DERA 1CIVA 3C3KA 1S2GA 4TKLA 2YWGA 1JIIA 1UINA 3R09A 3C5WP 4A0HA 1UZMA 2C8JA 4JWTA 2A8YA 3KQTA 4NE7A 4OHUA 1MJFA 5D51S 4FOTA 1TMKA 2FZGA 5EKXA 3LDGA 4DADA 4G0WA 1L1FA 4CCSA 4TTJA 4JMLA 1WUTA 1A71A 3R7WA 3UWSA 4RPJA 3KV1A 2P8JA 1OFTA 2QBYA 4ZT6A 3U1TA 1YRQA 3B7WA 4C08A 4TTPA 5C2JB 1Z29A 4BWFB 3CRQA 1HQKA 2ZS7A 3E5HA 3PIRA 1DJOA 3MTJA 1VE9A 2CFIA 4PWYA 4RFSA 4LGCA 5HUHA 3ML1A 5TMDA 2VT2A 3TKAA 4N3CA 3T7DA 2J9RA 2X14A 1W0CA 1DX4A 1DOAA 1XTPA 4NCIA 4R05A 3Q5GA 2RH5A 3DBIA 3F8SA 3RVDA 1Z6GA 2J6IA 2PAAA 3SJUA 1FDUA 4B2PA 3PQDA 3X1WA 4YRGA 1GVNB 1EQAA 4RU1A 3A7EA 4R9VA 4Y30A 4A8JC 5IJ0A 1RWKA 1QONA 4FN4A 5LQKA 1EUYA 3F3YA 1J09A 3L0CA 4HWTA 3S27A 3SQXA 2ISCA 3VPHA 1EP3B 1DC6A 1OHHD 3HEBA 3QYFA 5F78A 3CX6A 2QKYA 4WKGA 4YASA 3DFUA 2BJHA 3AHIA 1VBFA 1HQDA 2GAOA 2EL9A 3BMNA 1LRKA 3A2KA 3R5KA 1WZCA 2QVXX 3G88A 3JAWB 4FYKA 5FADA 3RO7A 4CMHA 5JJBA 1P9LA 4HWPA 5H02A 4LJ5A 2NP6A 1HYEA 3DVLA 3EIHA 4AN4A 2X13A 1BX1A 4HR7A 3HFGA 3RT7A 1E2EA 3HKCA 1ZXBA 5HFJA 3WP0A 1ZGCA 4E5KA 4J7CA 4M1MA 4ETIA 4DDHA 2FTKE 3FZQA 3ZY6A 2BUAA 2DH6A 3ZLUA 5ITWA 3WMXA 4JJIA 1YVEI 3TG8A 5EE0A 1USKA 3NR2A 4MVCA 5F52A 1V4NA 4P5EA 1LFDB 3OCXA 2PX8A 4U8HA 3TQQA 5K99A 1PJQA 1KY4A 2HIGA 3LY8A 3TX6A 5SV2A 3VZRA 1VE5A 2BL4A 4GBGA 4ARIA 2J6BA 4L76A 2C58A 4F2WA 2HJSA 2WLSA 4HWKA 4PLVA 4C07A 5K0FA 5EUMA 3C8DA 2JGMA 4AC9A 2XUQA 3KT8A 1PR1A 1WQ3A 4QOSA 1UBLS 3IDFA 3OIDA 3E3OA 3I45A 4FB4A 2A59A 3RE1A 3AIMA 3DP7A 4F2HA 5JV5A 1NJ5A 1PV2A 1RTKA 2VP5A 1VA4A 3GY0A 2C3MA 4QPPA 5E3JA 3WA6A 4F4JA 5L3ZA 1KQPA 5EJ8A 3JQCA 3OPVA 4Y9SA 5DTEA 3DTVA 2IV7A 2EEPA 3KJZA 2QOEA 2PO5A 3KEFA 1P5ZB 4KXVA 4RHCA 4NFLA 2H1CA 3A3PA 3NHMA 3WGKA 3BAFA 3H4TA 3OOJA