3I6QA

Structure of the binary complex leucoanthocyanidin reductase-nadph from vitis vinifera
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
307
structure length
291
Chain Sequence
b'GRVLIAGATGFIGQFVATASLDAHRPTYILARFKALEDKGAIIVYGLINEQEAMEKILKEHEIDIVVSTVGGESILDQIALVKAMKAVGTIKRFLPSEFGHDVNRADPVEPGLNMYREKRRVRQLVEESGIPFTYICCNSIASWPYYNNVLPPTDFFQIYGDGNVKAYFVAGTDIGKFTMKTVDDVRTLNKSVHFRPSCNCLNINELASVWEKKIGRTLPRVTVTEDDLLAAAGENIIPQSVVAAFTHDIFIKGCQVNFSIDGPEDVEVTTLYPEDSFRTVEECFGEYIVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative leucoanthocyanidin reductase 1
molecule tags Oxidoreductase
source organism Vitis vinifera
publication title Crystal structure and catalytic mechanism of leucoanthocyanidin reductase from Vitis vinifera.
pubmed doi rcsb
total genus 96
structure length 291
sequence length 307
ec nomenclature ec 1.17.1.3: Leucoanthocyanidin reductase.
pdb deposition date 2009-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05368 NmrA NmrA-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3i6qA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3i6qA02
2EP5A 4AJPA 3F5SA 3VPGA 4YB8A 3M2TA 3DHEA 4HXYA 1ZK4A 3CUKA 4GKVA 3VKUA 3KSZO 1PJSA 3DAPA 3KHUA 3Q9UA 3UGKA 4KTTE 1QMGA 3JQ7A 1N5DA 1UH5A 1E3WA 1ZCJA 5A03A 1X7DA 2HUNA 4JLWA 1GQQA 2NTNA 4B8ZA 3TFOA 1KY5A 1YB4A 1YL7A 3UCFA 1F14A 1GUZA 3GUCA 3DTYA 2DTDA 5TRTA 1TXGA 2FRDA 2R00C 3WGOA 2ZYAA 4PLTA 1C0IA 1ZZEA 4IDAA 2IDZA 4IXTA 2DBVO 1HDXA 4FBGA 4GX1A 4BL5A 4CQMD 4L0QA 4E30A 5COBA 1ZNQO 3WLFA 2OBYA 4FSHA 3WX0A 3R1IA 4RL6A 1WDLA 4GWGA 4UEOA 3VZQA 1NFFA 2XAAA 2JD2A 1LNQA 1Y6JA 3E5RA 3QVXA 3FTPA 4RPKA 1VLLA 4TRRA 1ZSNA 3K6JA 1WAMA 4FFOA 2B37A 3UOGA 5JS6A 3VZPA 5A5EA 1I5RA 3D3EA 4DMLA 5EN4A 1VPDA 2WD7A 2X23A 2VT2A 2VZ0A 1ZMTA 1DRUA 4KUGA 4ALNA 1LLQA 4J0EA 3ZWAA 3S2IA 3ROMA 3GGPA 1LC3A 3WDSA 1HSZA 1HXHA 4OXYA 3Q2KA 4BNYA 4EUEA 4RVHA 4NR0A 3TFQA 2ZTUA 5CDSA 3WGHA 4DIBA 3WWYA 1MA0A 2PD6A 3JQBA 3OQBA 2QRLA 3M1AA 1O8CA 1BXKA 3FD8A 5DCYA 1HZZA 1W73A 1Z7BA 3PHIA 3RUEA 4B3JA 4E21A 1QYDA 1NFRA 4AJOA 3KO8A 4ND3A 5H83A 1E1NA 3PQEA 2ZB4A 4FQ8A 2W2LD 4NJMB 1A71A 4NBVA 4UUPA 3TZCA 3INRA 3MJTA 1YKFA 2HQ1A 3AUSA 3VH4A 3WQRA 5B4TA 4UUNA 3JD4A 1RM0A 4XRRA 2O4CA 3LT2A 1LEHA 1H6AA 2X0RA 2W8ZA 3FBGA 1DAOA 4JCOA 4E0BA 4XGNA 1ISHA 2NV6A 4O0LA 3IP1A 2WE7A 5EESA 3E9MA 4YAEA 5BT9A 1T2FA 2X0NA 3WJAA 2B5VA 3RUAA 1FMCA 2A35A 4JJFA 1E5QA 4AICA 1CDOA 4RO0A 1VSUA 5COAA 4YJHA 3DBVO 3DFZA 3E6AA 3WNQA 1KC3A 4MVJA 2DTEA 1BTOA 4W9NA 1EVYA 5I9LA 2QG4A 5DOVA 4U0JA 3RUIA 4Z9YA 1MP0A 1I32A 3SC4A 5CEFA 4RF5A 1I3KA 3V2HA 1HEUA 1NR7A 5F21A 1GTMA 4F45A 1KBZA 4BO0A 4Q3CA 4BNKA 1YQXA 3AM3A 5DBGA 4I5EA 1D8AA 3BTUA 5T57A 4CMAA 2CDBA 4EYEA 4HBGA 4PG8A 3H2ZA 1IE3A 1JN0A 4R1UA 4UVIA 3R3SA 2VYND 3QW2A 4BVAA 2JKVA 2D1YA 4FCCA 4G5HA 2E37A 2B4RO 3NGXA 1LQUA 1PJ3A 4CPDA 4XA8A 1BXGB 2OFPA 4Y6PA 3W4IA 2ZJ0A 5TGDA 1I8TA 2CFCA 2WD8A 1PGNA 4O5OA 4TRMA 5JO9A 1MFZA 3F46A 2O3UA 3NJ4A 4UAGA 2O2SA 3ADPA 5L4LA 1P3DA 5C37A 3GHYA 1V3VA 3ONDA 1CRWG 2C29D 1C0PA 1Y9EA 2ZB8A 5C7IO 4ND1A 2HAEA 2GN6A 4BGIA 3EGOA 2Q50A 1NM5A 1JDJA 1YRLA 2CDCA 2Y1FA 3NUGA 5G4KB 4OKIA 3A4VA 3UH1A 5U9CA 4J3FA 3ORFA 3LDHA 3NDRA 4UVDA 4R3NA 4EW6A 4BS9A 5L3ZA 2JL1A 4CJXA 1P1JA 4ZGWA 3FF4A 4IGEA 2A94A 4I5DA 3WGYA 4YRDA 1RPNA 1ZXLA 1N9GA 2DFDA 4J0FA 4R51A 1HL3A 4IMPA 4DREA 2EW2A 2FY8A 3BXXA 3ZH2A 5A3JA 1TVEA 3K2EA 4Z0HO 3O03A 4IJWA 2HSDA 2V6BA 3PYXA 4PFJA 5T5QA 5CHEA 3PQFA 2J5KA 1WMBA 4RORA 5EQDA 3PWZA 3GAFA 1UJMA 4M87A 3JQGA 4OSPA 1FDSA 3AI3A 4E5MA 5I7EA 1PGPA 3IJPA 1VM6A 4WEQA 1PJCA 4L4RA 4CODB 3ZWXA 1GZ3A 4OL9A 4EEXA 1HLDA 1LDBA 2ILTA 2FR1A 1PL6A 1R37A 1LXCA 1TI7A 4HFMA 4RDHA 4CM8A 1NBOA 3DZFA 3U3XA 4D3DA 4NFSA 4KWHA 4M49A 1WMAA 3H9QA 3D3WB 5KVQA 1W8DA 4IDDA 1I3NA 2EGHA 3FN4A 2SCUA 5ITWA 3IS3A 1WNTA 1YONA 4FC7A 1VSVA 1ZO8A 3IKTA 2RCYA 1LSOA 4TVOA 2J3HA 5CPBA 1Q7BA 3LT0A 3WFIA 1CJCA 3RC1A 1NWHA 1QV6A 3DAFA 4JQCA 4J9VA 3QRWA 3KYDA 4R1NA 4J6FA 3SVTA 1EVJA 5EERA 3ZWOA 5LC1A 1P1HA 1E77A 3OSUA 4ROSA 4ZQFA 2B4TO 2PD3A 1XWFA 4RV9A 1ADGA 3BIOA 1Z75A 1T4DA 1QP8A 1IZ9A 1U3UA 3ZHYA 4RDIA 4E32A 3NT2A 4ALIA 3FBTA 3MTGA 3H5RA 3DOCA 4GMFA 2C7GA 4GX5A 1JKIA 3RCBA 5FYDA 3DZGA 5T6BA 3RBVA 2W2KA 4MIEA 4EZBA 1VI2A 1BXZA 4BNZA 4YXFA 4BKPA 3U0BA 4XEHA 1PIWA 3N74A 1YDWA 3F1LA 3OFSA 1HDOA 2OUIA 3EZYA 1XA0A 2Z1MA 4MVJF 2TMGA 1ADCA 4XGIA 3PP8A 5EQFA 4Q39A 1K5HA 4U6SA 1BDBA 1NAHA 2YFQA 4LSMA 4GGPA 4YJFB 4CLEA 5B12A 3KETA 4KDEA 3LC1O 1ADFA 4ZQGA 3UF0A 5I7VA 4TZTA 2RAFA 4CMCA 1A72A 1QR6A 3NV9A 4MJLA 3IQDB 4DYDA 4EUFA 1EBUA 1LTHR 1U1IA 2X6TA 3ZHBA 3JQ6A 4BO1A 1E7SA 1X0XA 1MB4A 1BW9A 3ICPA 4OOFA 1NNUA 5EMHA 3RBZA 5CG2A 1UZMA 2IZZA 4XRGA 2Q1UA 1ZK2A 2GZ2A 3FWZA 3JQBC 2LDXA 1XCBA 2V7PA 4YVFA 4NU6A 4GLLA 1XG5A 3T7CA 6ADHA 3NX4A 4U6QA 1BVRA 1DDOA 3ON5A 1EDOA 4Z9FA 3W8DA 3GNQA 4BMVA 3DBLA 4M54A 2VWGA 4QXMA 4IQ0A 2PK3A 3DQPA 3I4CA 1JWAB 3S8MA 2BKAA 3AI1A 3AWDA 4M55A 2YHUA 4TKMA 5TS3A 3NRCA 2Y68A 2IXAA 4DC0A 5KJEA 3WQQA 1YQGA 3ZU3A 3RFVA 4CMIB 2C0CA 2GYYA 2IODA 3RU7A 1M2WA 3QWBA 4FGSA 3GAZA 1U2DA 1KVRA 3BMOB 3C85A 4BO2A 4WOJA 1ENZA 2QX7A 1KVUA 4M1QA 4C4OA 2C20A 4BIIA 4CR7A 1UR5A 3I9MA 4CQMB 5IAAA 2ZTLA 3LQFA 5T8KA 3X2EA 3I6QA 4BQPA 5AOVA 5TQVA 1KIFA 1YB1A 3CZRA 1H0KA 1P33A 2NACA 5DCUA 4D3SA 4IGFA 4L8VA 4CM7A 1LDNA 2NU7A 4XYEA 1GEGA 1RYEA 5F3RA 1IYZA 1X7HA 1MFPA 3H5AA 3RIHA 3ZNQA 5I8WA 2X0IA 4AJKA 3PHHA 2ZYGA 3EDMA 4Z6KA 1PEDA 2Y99A 2X58A 3LZ6A 3WB9A 3K31A 2YY7A 1GZ4A 3TWOA 3FNFA 4O63O 5T8KC 4OOEA 3VH2A 4EITA 3JQFC 5KNLA 4CV2A 2PWZA 3Q9NA 5EL0A 1E7WA 1MGOA 2HJRA 2HRBA 4HKTA 2P9GA 1ZJZA 4U7WA 3D5TA 1ZKMA 2I65A 4KQXA 2BI7A 1U4SA 3SEFA 1M76A 4OXNA 3GHHA 5DULA 4WCFA 4B79A 3MJSA 1D7OA 4XJTA 3RQSA 4A27A 2BGMA 1XKQA 3JYPA 4HFJA 1BXGA 1K6IA 3GZ4A 4J16A 4MPDA 4RVFA 4ALJA 5ICMA 4CM8B 2GPTA 1IHYA 1Y5MA 2Q2WA 4MP8A 4PG5A 1PJLA 5L53A 3JCZA 1I01A 3FNHA 2PGJA 4CMEC 2HO5A 1EEHA 2DU8A 3D1LA 3EMKA 1SMKA 4XGKA 5COQA 3SBOA 2BFOA 1JLLA 1DRVA 3B1FA 1TT7A 4W7IA 3FPCA 5GZ1A 2X9NA 3GVHA 4XCVA 4Q3BA 4MP3A 5J23A 2FMUA 1A9ZA 2YYYA 3AM5A 3ETEA 3ZWVA 4UREA 4ZQBA 4E3ZA 3PGJA 4R01A 1BRMA 1XR3A 1RYDA 1QXSA 2VOEA 3U62A 1MV8A 5TNXA 4MVJI 4A10A 4Q3DA 1B2LA 3P2YA 4F46A 4A5OA 2HRZA 2JJYA 4J2HA 3WFJA 4MVJE 4HNHA 4KWIA 3QWFA 4FS3A 3UXYA 1AXGA 3KSUA 3K8ZA 1K2WA 1GYQA 3LF2A 1N9GB 1YJ8A 5JNLA 2G17A 4FN4A 3Q1LA 1QORA 5GZ3A 4XQEA 3H65A 3PJGA 8LDHA 5TX7A 1BSVA 1U7HA 1RM4A 1YH3A 4YAKA 1GU7A 4D41A 2E6UX 2JCVA 1F06A 3RC9A 3AOEA 3VPFA 3G1TA 2PLAA 2YHIB 1HYGA 4A73A 5TIIA 1ZVMA 1VRWA 1LSUA 3AK4A 3AI2A 1VJ0A 3AM4A 4UEKA 5IXSA 3VPSA 1Y8QA 3ZW9A 4FOOA 1T4BA 1LLUA 2OP0A 3ZWNA 3BHIA 1JAYA 3DXFA 4CR6A 3S2GA 3RU9A 3TZ6A 2GERA 3H9JA 4XQGA 4BO3A 3GOHA 2R2GA 3PLRA 4CQLA 3NT4A 2ZCUA 3TSCA 4WUVA 5L40A 2EV9A 3ONEA 1ML3A 4R5MA 1Y1PA 4XB2A 3W6ZA 1EQUA 5ER9A 2DBRA 5IFLA 4D42A 3AUUA 1K6JA 3G1UA 4BNWA 1EQ2A 1Y7TA 4CMBA 4WE3A 4ZHSA 3P7MA 3NAQA 3FSRA 1U8FO 1X1TA 1ONOA 4PVDA 1H6BA 2CF6A 3D4PA 1R66A 1RM3A 1KVSA 3HDQA 1ID1A 3MOGA 3I83A 1TT5A 3ROQA 3BA1A 4CUZA 2B5WA 5MGBA 4B8WA 1NXQA 1U3VA 1ENYA 2PZLA 5CDUA 2BMAA 1EE9A 1GCUA 1JVSA 5F1OA 2DVMA 4OIMA 1B14A 4IIUA 1P0FA 2ZTMA 1HE4A 1HDGO 3B6ZA 4BO4A 1P0CA 4YT2A 3I9NA 1JVBA 2DAPA 5L45A 4GX2A 1SPXA 1CQJA 1LJ8A 3S2EA 3D4NA 1SOWA 4ZQEA 1XU7A 2VT3A 3B1JA 5AXDA 2D8AA 2A9FA 1UDCA 4CM9D 1DXYA 2WJPA 1YS4A 4YAIA 4EI2A 2FZWA 4DL9A 3ROPA 4GQAA 4HWKA 3QWAA 2NLOA 4IJVA 2F00A 3UKOA 5C5IA 1M75A 4FD3A 1WP4A 3RWBA 4CM5A 2VYNA 4H3VA 1O95A 1GV1A 3ZWBA 4DIOA 1VL8A 4UUMA 4E2ZA 4AJNA 1Q0QA 1GEEA 1QKIA 4YT8A 1GD1O 4DYVA 1NASA 2DFVA 4Y98A 1EMDA 3NKLA 5BNFA 3VC7A 4YRAA 2VHZA 1U5CA 1W4ZA 4GGOA 1LC0A 1E3IA 1DC3A 3LT4A 4AJ4A 3JQ8A 3HFSA 1LDYA 4QO8A 4YT4A 3F1KA 3CH6A 4D7AA 3UCEA 3LT1A 2B4QA 4RVDA 5CAEA 3L6OO 4CLXA 2Q1TA 3MJVA 2ET6A 3ZV3A 1YOVA 3H5NA 4XYMA 1A7AA 3U4HA 3OQ6A 4LCEA 3G79A 5IZCC 1SCUA 2OBNA 4TRJA 4UEJA 3TQHA 1NVMB 1A4IA 2QW8A 2E48A 1XU9A 4E4YA 1WW8A 3GG9A 2VQ3A 3ZU4A 1VE9A 4BNGA 1B7GO 4HV4A 5DOZA 2EJVA 1VC2A 1MXFA 1YO6A 4J4HA 2O7SA 4NHEA 3RUCA 1Q7GA 3PFWO 2QQ5A 1PGOA 2Y1DA 3QWHA 2Y0EA 3BHMA 1R4NA 2H1SA 3MZ0A 1QV7A 4DPKA 1DFGA 3TL3A 2HDHA 1JWBB 5KJCA 1B15A 2PY6A 1UXGA 3FNEA 1LX6A 4PN3A 4L4XA 1LBEA 4RLHA 5JDCC 3DBHB 3UICA 3AU9A 4AJIA 3RJ9A 4D45A 3GF4A 2GNAA 3CKYA 3HUDA 2FP4A 1T2AA 1O9BA 3JYQA 1WWKA 2O4UX 5GY7A 3BTVA 5JE8A 4AJEA 3KEOA 1NPYA 4RPHA 5I9NA 1M66A 4TQGA 4R69A 4ID9A 9LDBA 4FJ1A 3DEYX 3IDSA 1PS9A 1WXDA 3A06A 3W4JA 4IM7A 5L51A 5KOIA 1QLJA 2CF5A 4I8XA 2JCXA 3GA0A 1N1GA 3E5MA 2G5CA 2YQ5A 5L4SA 3RUHA 1E3SA 2I99A 3KV3O 4FFNA 1BW9B 3WSWA 2P9EA 3CE6A 1YB5A 3DR3A 3HDHA 5JDIC 4B3HA 3H2SA 3GFBA 1U28A 2GZ3A 1ZSYA 3DZBA 1TA4A 4HP8A 5CEJA 4UVEA 1HE5A 3HDYA 1K0UA 3C3XA 4A0SA 4DBZA 4DLLA 3DHNA 4PLYA 2W2LA 5TJHA 2XPCA 4GX0A 2EGGA 5ICSA 4N54A 5A9SA 5MDHA 5THKA 3ZHXA 5HS4A 1UP6A 4ZVVA 5CDGA 1XHLA 4NQZA 5JLAA 4YJDA 3JQCA 4DUPA 5G0VA 1IULA 3ZCXA 3KXDA 3ZV6A 1NVTA 3PLNA 3PHJA 1UXJA 4W4TA 2ZCVA 3SJ7A 5JC1A 1D3AA 4JXKA 1KETA 4L76A 3TRIA 3GVCA 3EZLA 1Y8RB 3KZVA 3W6UA 3G3EA 2I76A 5JCXA 3I5MA 5ES3A 1A5ZA 3C8MA 4WLUA 3ASUA 5ENDA 2C59A 3IKVA 3ZGYA 2DT5A 4BNVA 1I36A 3AOEC 1B3RA 4GPD1 2HMSA 2IZ1A 4YBZA 4DLBA 2Q1SA 4NK4A 5I7FA 1ZJYA 3D64A 3ONFA 2W98A 1FDVA 4Q3EA 2AG5A 4PCVA 4DXHA 5KWEA 1RM5A 2FWMX 4R54A 3H9EO 2D4AA 1XYGA 4CM9A 4BO5A 1H2BA 5G0UA 2IYPA 4QQRA 2Q1WA 4BKRA 1TLTA 2VTDA 1N1EA 1YBAA 5GZ6A 5HWSA 4D46A 3UHAA 3WMXA 4LRSB 2UDPA 2Q49A 2GDZA 1GADO 3IOYA 4PLVA 2G1UA 4PGFA 4YWJA 3L6EA 2DPGA 1YDEA 3N58A 4KP7A 4BOYA 2E4AA 1P1FA 4XZ3A 3VH1A 3DO5A 3V5NA 4KMSA 2E82A 2D5AA 3PIIA 4WJZA 1Q1NA 4FJ0A 3V1UA 4I5GA 5DZSA 4R9SA 2AEMA 1OFGA 3OIFA 2IYOA 3DMYA 3KB6A 3S1LA 2DBQA 1NWCA 4XYBA 5A05A 2QRJA 4CQLB 2X0JA 5AYVA 2DPHA 4I1IA 3QP9A 4MKXA 4ZD6A 4CMGA 3U4CA 3DWFA 2GO1A 2JFGA 2NWQA 1GV0A 3BMQB 3ENKA 5DT9A 3ZU2A 5LCXA 1ZEJA 1IL0A 4BNIA 1ZUD1 3HSKA 3ZWPA 3CIFA 1T2EA 2OP1A 2FOIA 1T24A 2B83A 4LN1A 4DLAA 1SOVA 3HJAA 1XSEA 2ZQYA 2W4QA 3KVOA 3PPIA 3UUWA 4DBVO 5DBFA 4AFNA 5KCZA 3WMWA 1P9LA 1J6UA 4D43A 4II3A 1D1SA 2J5QA 1ZK3A 5TSDA 1T2CA 1ZK1A 2C2XA 4PZDA 5T64A 4FFPA 3ZI0A 5HRUA 3WBBA 3L4BC 5DNAA 2X9VA 3PRJA 3LK7A 1DOHA 1ZW1A 1V3UA 3IC5A 1M67A 4K28A 2JD1A 3EC7A 3EYWA 4BO8A 4RF4A 3GUYA 4GL4A 4DQXA 2HKIA 4XJSA 1K89A 5DN9A 1E6WA 2RH8A 2FPGA 5H81A 1H6DA 4BB5A 2BFAA 2G76A 5A04A 5AXCA 4LMRA 1UXIA 1I10A 5L7TA 2ZATA 3WYEA 5AVOA 4RQUA 1PGQA 3H7AA 1KYQA 4Y9DA 5TJ9A 4J43A 4J7XA 4OHUA 2AQIA 1UP7A 3WIDA 5I8ZA 4GSLA 4IDGA 2PKRA 4YEDA 5THQA 3UN1A 3WTCA 5G2OA 1S7CA 4CM4B 3U4IA 5I7SA 2ZB3A 3JQEA 4DQUA 4CL3A 4MKZA 4U0KA 4CLDA 4OJNA 1JKJA 2EWMA 2ZJ1A 3RFTA 3M1LA 1U4OA 5I9MA 4KDFA 3ENNA 4BV9A 3LLSA 5CPFA 3RD5A 1N2SA 4KUHA 3V8BA 4Y6RA 2GRAA 3NTQA 1IB6A 4NZ9A 5DP1A 4MIOA 4IY1A 1HLPA 3JD0A 2OZPA 1XQ1A 3NT5A 3FR7A 5L4NA 1Y81A 4EEZA 2LDBA 3VAZA 1AN9A 5F5LA 4J7UA 1FDUA 3I9LA 4M86A 2GUGA 5IZ4A 4XKJA 1D1TA 1FJHA 1O89A 4J49A 4HY3A 4FR5A 3HZZA 3AW9A 1YQDA 3PGXA 1W0CA 4WASA 2PZMA 4N5MA 4AJJA 5HA5A 1ONNA 1P74A 4CMIA 1I3LA 1KEPA 1TEHA 2GGSA 3HQ4O 4WECA 2BLLA 3E1KA 4TSKA 1HT0A 3GNSA 3VHRA 4CV1A 2I3GA 5C7LO 3WQSB 5KVCA 3PEFA 4FC6A 3BMNB 1CYDA 3FHLA 3GZNA 1GR0A 3GDFA 4NBTA 4RF3A 3WGQA 3OH8A 4P8RA 4LGVA 4RJTA 4ESOA 1E3WB 2D2IA 4NFHA 3E9QA 1GYRA 4G65A 3OJLA 3QVTA 3OETA 2VHYA 1C3VA 2O7QA 2BELA 2HMTA 4N7RA 3ZHZA 1VJ1A 1BVUA 1B26A 2DKNA 4P4NA 1TB4A 5L7WA 3PWKA 1PWXA 1JTVA 1V6AA 4X54A 2IRWA 1IPEA 3JYNA 3SC6A 3B70A 4CM1A 3UVEA 1NR1A 4XWYA 1JU9A 3RKUA 1R16A 3AY6A 1NAIA 3DDNA 4HFRA 1DHRA 4GBJA 2H63A 4IXWA 1U7TA 4HADA 4NMHA 5B37A 1Z74A 3Q6IA 4J90A 5A9TA 1V9LA 2GN9A 1IPFA 1QSGA 2OHXA 3HN7A 2C2YA 1A9YA 1N92A 1QYCA 1XGKA 4I9HA 4ND5A 4XYGA 2BHLA 4ZJUA 2WM3A 3DC2A 1UXKA 5BSEA 3HDJA 2VZ9A 3UW3A 1LLCA 4WCFB 2OO5A 1M6WA 4INAA 1R6DA 3VKVA 3INGA 2HCTA 2WTBA 3D0OA 1LSJA 3LVFO 4LMPA 4O1MA 5K6AC 2VHVA 3F9IA 1C14A 4FJ2A 1EFLA 2VRCA 2NM0A 4MKRA 2EJWA 1E1MA 1E7QA 1U3TA 4OM8A 2QYSA 4AG3A 1HE3A 4TRNA 3DZIA 1XQ6A 2H9IA 2ZQZA 1LU9A 4BNJA 3Q0EA 4CUKA 2QYTA 3EAGA 2VUUA 3DB2A 4PG7A 4IIVA 3GNTA 3I1JA 1R4NB 3EY4A 1YVEI 2Y0DA 2JFHA 1A7KA 4DRYA 3HB5X 4GMGA 4Z3KA 5IN4A 2EKQA 3TZKA 3RJ5A 4R1TA 1ZXBA 2YW9A 4PVCA 2NVUA 1AGNA 1WDMA 1P44A 2AE2A 4BUCA 2GSDA 4UULA 4Q3NA 1ZIDA 2W2KB 4IDFA 4BV8A 4OQZA 1F12A 1L1FA 5BNIA 1ONPA 1HSOA 1PWZA 1WZIA 4HUJA 4IJUA 5G0WA 1PQUA 2CY0A 2UV8A 3MOIA 2FPPA 1V35A 2EXXA 3L4SO 1YE3A 2AE1A 3GMSA 4TVBA 3ST7A 3EHEA 3ICCA 3OECA 5GMOA 2Y93A 2V6FA 4TMFA 2GCGA 3A1NA 4R3WA 3ZNPA 3QLJA 3U09A 1MUUA 5JAMA 2WSBA 1E1KA 4J4TA 4BNFA 2BFMA 3GVPA 4CM4A 1CEQA 5BSFA 2QHXA 1HRDA 1E1LA 4WCDA 2O3RA 1C1DA 3E82A 1DIAA 1OC4A 4IS3A 2AMFA 1Y8QB 5JYEA 1S6YA 2OXIA 1F8GA 3H3JA 4M8SA 5CFZA 1E3JA 4YJGB 1E0DA 3OP4A 3R6DA 3GQVA 5BNTA 3BMCB 2VNSA 3GN2A 4XIJA 1GUFA 3DBRB 1F17A 1X0VA 1NTOA 4BMNA 1PJTA 1DBVO 4OH1A 5DCWA 3RAJA 3TNLA 5FFFA 2ZTVA 4OKNA 2EERA 3GT0A 3JV7A 1EBFA 3MWDB 3NEPX 5AQ1A 3DMTC 3DOJA 2VTEA 1HKUA 3BMNA 3MWEB 3PZRA 2BI8A 4GVLA 2DQ4A 5L9AA 3OEYA 4YDRA 4YQZA 3DBRA 2HMWA 4ONEA 2CVOA 4E5KA 3D4OA 3QJ5A 1CERA 3L6DA 3DZJA 2NQTA 1AHHA 1C1XB 1QYXA 3I23A 3AY3A 3DMTA 4WNIA 4XB1A 3WSVA 4CLOB 1XDWA 2NTVA 1E92A 4NBRA 4H16A 5KJFA 1I0ZA 3FPLA 1X15A 3PHGA 3OIDA 3MTJA 1SBYA 1X7GA 3FRJA 2JFFA 4W82A 1DB3A 2ZB7A 1KY4A 1YGYA 3M6IA 3ZN2A 3UFXA 4Q9NA 2JAHA 1UXHA 3GMDA 3NYWA 4WLFA 3QWIA 3W1VA 5ITVA 1I2CA 1QG6A 3I3OA 4IQ8A 2NVWA 4RZHA 1YJQA 3L77A 3WYCA 1IOLA 4L4SA 5JAZA 3H3FA 2I6TA 4DPMA 4DQVA 1EVZA 1PQPA 4PLWA 1KOLA 1IZ0A 1HETA 4D3FA 1FF9A 1PJQA 4WK6A 3RROA 3A14A 4R16A 3QE3A 4BGUA 5KTKA 1UP4A 1GFSA 5JAIA 1DIBA 3AUAA 2J3KA 4JP3A 2I3AA 1LDEA 1P31A 4BNXA 2BD0A 3ETGA 1T2DA 1T25A 2PA3A 3D5QA 4QECA 9LDTA 4DWVA 4RPJA 3VTZA 3SLKA 1BGVA 4QX6A 1WZEA 4L75A 2OORA 2C07A 1ENOA 4E12A 1PZEA 3QVOA 2FHSA 1P45A 2EKLA 1KS9A 2X8LA 1G0OA 4U8GA 4DC1A 2IE0A 1AXEA 3AU8A 1PX0A 3VOSA 1JW9B 3K92A 4QT0A 1J5PA 4DVJA 4JNKA 1ISMA 2DBZA 4MDHA 1OOEA 4FDAA 4IZIA 4MVJP 4QFCA 4ZA2A 3I52A 2BGLA 5ENVA 5BR7A 1GCOA 1NHGA 1E6EA 1PZFA 3O8QA 4URFA 3AY7A 3TL2A 2C7VA 2J3JA 1PU2A 4CL8A 2VUTA 2GZ1A 3PQDA 5CEEA 4CR8A 1C1XA 1R12A 3GY0A 5K6AA 1E3LA 5IF3A 1L7EA 4NJOA 3E18A 1HDRA 1C1DB 1YBVA 1NQAO 4OSOA 5JMPA 4D79A 3U5TA 4JBGA 2UYYA 2PR2A 4E6PA 4P22A 3O8QB 4FB5A 1UZLA 1C0LA 4KQWA 4F6CA 3SLGA 4TZKA 1Q0HA 4Z0PA 4EJMA 2VZ8A 5JSFA 4MO2A 3VPHA 3KTDA 2R00A 2VNAA 3D7LA 4LRTB 1P1IA 3ZW8A 2A4KA 4E5NA 1SAYA 2ZIZA 3G0OA 3GVXA 2X86A 1H94A 2O3JA 1ISJA 2NVBA 3KBOA 4G81A 1GL3A 3GEMA 5KJ6A 1RKXA 4G2NA 4IINA 2P9CA 2QRKA 4ZQHA 3A28A 4YJGA 3G17A 1Z6ZA 1NFQA 2O2YA 1XEAA 4I5FA 4I08A 3C1OA 1EZ4A 1QYVA 2UVDA 4YCAA 2AXQA 4N5NA 3WYBA 4RPGA 4W7HA 4MINA 1LRLA 1GUYA 2VCYA 4P4GA 5CP8A 2FR0A 3PTZA 5F1KA 3JD3A 1R0SA 4Y8VA 3BYZA 3WLEA 4N5LA 1Q7CA 4W99A 4WLVA 4A26A 3KLMX 3C24A 2FSSA 1FXSA 2Y67A 3PYMA 5FF9A 4ALLA 2PV7A 2HU2A 3L0DA 1DAPA 3HFGA 4FFLA 3ZWCA 1IHXA 4WOKA 1I24A 4BO7A 1XIVA 3K9QO 1ZK0A 2VHXA 2D3TA 3S2FA 4RZIA 3O38A 7MDHA 4RF2A 4PLHA 3INTA 3Q11A 4RVSA 1ZMOA 4UVHA 3N7UA 5A06A 3PIDA 1NQTA 1ZSVA 3ITKA 3LF1A 3BMOA 5TT0A 2UUPA 3VVBA 1FK8A 3TZHA 1U9JA 5BQFA 4AJLA 4MVJG 3PXXA 3JQAD 4MIYA 4R4JA 1K6XA 3GRKA 1PZHA 4IDEA 2CMDA 3HADA 4MVJD 3QHAA 5IZCA 3KSDO 3KYDB 4YACA 3ROKA 3B20A 3STHA 5C7OO 2VYVD 3KYCB 1PSDA 2CUKA 5U4QA 1XLTA 1L7DA 2VYVA 1EK6A 5A4DA 1YL5A 5LDGA 1VKNA 2J5RA 1YL6A 3GFGA 3K96A 2Y1OA 4CM6A 3H4VA 1SB8A 1DC6A 1DJNA 1UAYA 2HK9A 4IS2A 2VRCD 3IUPA 5KKAA 3W4KA 2NU9A 3GK3A 3VDRA 4WLNA 3WG9A 1DSSG 3TDKA 2FPIA 2O23A 1LDMA 1MG0A 4E2YA 3GGOA 4LW8A 2XOXA 5ADHA 1A4UA 1QLHA 2Y1CA 3DFUA 5KJ1A 3BTSA 1HF3A 2HJSA 3DTTA 2BFPA 4JIGA 4LISA 1GPJA 3SJUA 3DONA 3QSGA 4P4LA 2RHRA 2CNBA 2CVZA 4K6FA 4KTVE 2NQ8A 2NADA 4L74A 3BMQA 4BQRA 4NH4A 2Y66A 1YXMA 4RCVA 3PDUA 4A2CA 3GPDG 1B16A 1DFHA 1HYHA 2C5EA 1EDZA 1H9BA 1OZAA 2FR8A 3F6YA 4XQCA 4B3IA 2IEDA 5B4VA 5TLSA 4BGEA 2NVUB 4OO3A 1PGJA 1HE2A 6LDHA 3WIEA 4WCFC 2WMDA 1SEVA 1N7GA 1NPDA 3MJEA 3I9OA 1CWUA 4J2OA 4WKGA 4E31A 4JP2A 3RBXA 1PQWA 1LRKA 5B4UA 5JO0A 2TMDA 1B0AA 2XF8A 1PTJA 4JBHA 5JXWA 2WYVA 1HYEA 4OQYA 4BNHA 8ADHA 3ETDA 3F5QA 3KEQA 4K9DA 4BNMA 2DLDA 2RIRA 3P2OA 2ZYDA 3QIVA 4FFRA 3PDJA 3OMLA 4PLFA 4WNCA 1SC6A 3RUDA 1EE2A 3C1AA 1Z73A 4Z3DA 1M6HA 1A27A 5BSGA 4EBFA 3JQAA 4RPLA 4EJ6A 1GY8A 4CM3A 2IEBA 1QYWA 3C7DB 3VH3A 4DTIA 2V6GA 1LRJA 1E6UA 5ILGA 1Z7EA 3WICA 1SZJG 3GLQA 3IAHA 5JBIA 4XR4A 3FCOA 3PWSA 2IXBA 4IUYA 3E8XA 1B8VA 3OM9A 4ZRMA 3IMFA 5ER6A 5HS6A 1KEWA 3NTRA 1NQ5A 1WLYA 4EJ0A 3JQDA 3QY9A 5JYDA 2C82A 4IDCA 4ALKA 3QA9A 2RHCA 2JHGA 2H6EA 2CD9A 2RH4A 2GASA 1KVQA 2C54A 3JQGB 1YBMA 3PYLA 3KOUA 5FI5A 2HMVA 1WDKA 1EVIA 2F1KA 1PS8A 3WOHA 4DA9A 1ISFA 1H2HA 1NX6A 3NDJA 4LCJA 2I66A 3PJEA 1ZFNA 2AQHA 2WDZA 3OJFA 4IDBA 4WGGA 3F47A 2NUAA 2GR9A 2UAGA 1KVTA 2JHFA 3DL2A 3GVIA 1NQOA 2AA3A 4Q3AA 4RVGA 1GDHA 3OF2A 3RVDA 3TPCA 4CV3A 2EIHA 2J6IA 4LK3A 3CPSA 2UUOA 1X13A 4YT5A 3W8FA 3TJRA 3GPIA 1MC5A 2Z5LA 3GH3A 3WGIA 1K3TA 2PH3A 2HMUA 2GD1O 1TT5B 2G0TA 3BHJA 3PI7A 1F0YA 4XIYA 3WR5A 3EVTA 1BG6A 1GPDG 2PTGA 3F4LA 3P19A 1H6CA 1CQIA 1MX3A 2EKPA 4C7KA 4CLRB 1VL6A 1I2BA 4R9RA 2C5AA 3QQPA 4NFYA 5G4KA 1P1RA 4EGFA 4CMEA 3RUFA 3DHYA 4ZN6A 1HDZA 1AHIA 5TF4A 1SB9A 3H8VA 3WS7A 3GDGA 1ENPA 1JKFA 4JROA 4FGWA 1LA2A 5DF1A 1O6ZA 2D5CA 3GC6A 1C0KA 2NTJA 4KUEA 3T7EA 4ND4A 3G49A 4NPCA 3FR8A 3O4RA 3WWZA 5JW6A 1GQYA 2P2SA 1FDTA 1E3EA 2D0IA 4QSMA 3DZHA 4JK3A 3ASVA 4ND2A 4R41A 2POQX 4FW8A 4HFNA 1CF2O 5U1PA 3FTNA 3I4FA 3DBHA 2JD0A 4LVUA 3UCXA 4NK5A 4D0SA 3V1TC 3JD1A 2PGLA 3JQFA 4JJGA 1LLDA 2EHDA 3PVZA 1R0LA 3IJRA 2AQ8A 2QZZA 4GKBA 3VPXA 3OA0A 3HHPA 2PNFA 1E7RA 5JPIA 2PZJA 4MOWA 3L9XA 4QTZA 3FWNA 5K9ZA 4RQTA 3H6KA 3ZU5A 2W90A 2Q2VA 3GR6A 4UUOA 3ZDFA 1N7HA 2XXJA 5A3VA 1P1KA 2NSDA 2I9PA 4BB6A 1RWBA 3VTFA 1MLDA 1U3WA 1DFIA 3HG7A 2P91A 4O59O 4YAJA 2AQKA 1ULSA 3FNGA 3KYBA 2V6MA 2VWQA 3MCVA 4L9RA 5EIOA 3T4XA 2D59A 1N8KA 2Z1NA 2B69A 3CSDA 1KEVA 3JTMA 1NPTO 2CZCA 4TKLA 1UAGA 1OAAA 1YOVB 1ZBQA 4LVCA 1O0SA 5G0TA 1XELA 2AEFA 2WYUA 4Z9XA 4DGSA 4RGBA 3V2GA 2FZEA 3ZNOA 3RI3A 4NBWA 4KOAA 2J8ZA 5L7YA 1JQBA 3VVCA 1MXHA 4E2XA 1I33A 4JGBA 3UAGA 1MG5A 5IJZA 3QV1A 3WGZA 3IP3A 1GYPA 2GLXA 2B35A 1QRRA 2GN8A 3E03A 4JN6B 4BO9A 4DIFA 1EUCA 1DO8A 1HZJA 2Q3EA 1F8FA 4A7PA 2YV3A 4OYRA 4HX5A 3ADOA 2EP7A 4R1SA 1V8BA 4NDNE 3V1YA 2JAPA 4PG6A 3IL2A 2OGUA 2H5LA 1EFKA 5A9SB 3DZKA 3JYOA 3TOZA 3MEQA 2Q4BA 3GG2A 5HBRA 4MP6A 3K73O 1EUDA 1PZGA 1HWYA 2Q46A 1CIVA 4E5PA 2VN8A 3KYCA 3HNPA 3R3JA 3ANLA 4K1LA 2P5YA 2AHRA 3ZWYA 4ZU3A 4IQGA 3OJ0A 2YZ7A 3U9LA 3BAZA 3JQ9C 3JQ9A 2PFGA 3U49A 3PJDA 3TOXA 1Z45A 5T67A 1R4MB 3X2FA 2PZKA 4YJFA 5JCJD 3QVWA 4TROA 4FIZA 4AJHA 1GAEO 1PL8A 3GRPA 3OBBA 5G4LA 4F6LA 1LUAA 5JMWA 4GSKA 5CDYA 4OGWA 2HLPA 3GZNB 5EJ2A 2X5KO 3WJ7A 2Q4EA 4EDFA 1OI7A 1OMOA 3ZWWA 2X1HA 1R4MA 2DTXA 1UDAA 2EEZA 1IY8A 1I30A 1VKOA 1ZH8A 3OJEA 4B7CA 1SEPA 1VJTA 4YA6A 3IIEA 4AJ1A 4FPXA 4YYZA 2OMEA 1B8PA 4S1VA 1PJ2A 2VOJA 3JQ8B 3NTOA 4YRBA 3JYLA 5CDTA 3CXRA 4J4BA 3FI9A 4MVJH 2P4HX 3C1TA 4K26A 4EUHA 3EVNA 4HNGA 4BNNA 4PIVA 1NVGA 3F4BA 3JSAA 4I9NA 4J7CA 2BF7A 5JDIA 1UUFA 1BDMA 1G1AA 3DBLB 3OA2A 5IXYA 3PHLA 4F3YA 1R0KA 4IPTA 2E49A 1PL7A 3KRTA 3RC2A 4NBUA 3RC7A 3JD2A 1GQ2A 1E7YA 4IJKA 2YHIA 1KC1A 1MC4A 4ILKA 2WWRA 1BWSA 4E13A 3O26A 3HE3A 1ISGA 4XD2A 2X5OA 5L95A 1H5QA 3K2BA 2O3SA 4DPLA 4W9NC 5KVSA 3V2UA 4QFDA 2RBEA 4R68A 2GF2A 3BTOA 4BGVA 1PR9A 1J0XO 2YJZA 2YDXA 3HWRA 2XXBA 4CMKA 1HTBA 2O3QA 1SO8A 4IBOA 4N18A 4DMMA 2Z95A 4PLZA 4O6VA 2HK7A 1JA9A 4B4UA 3WTBA 2AG8A 4PLCA 5BSHA 1DJQA 4B4WA 2YV2A 5IDXA 3OQ1A 4J1QA 5JY6A 3A9WA 1IUKA 3OJOA 4S3MA 1LI4A 3SXPA 2O3TA 2BH9A 1R15A 4II2A 1OC2A 5JDCA 2EG9A 1RJWA 3E9NA 2GN4A 3OICA 5A9RA 3GN1A 3S55A 4BO6A 4GH5A 4WLOA 2PD4A 5A5FA 5IG2A 4WEOA 4AL4A 3HB4X 4XDYA 1BHSA 4NI5A 3VDQA 1T1SA 4W6ZA 4M89A 3H9GA 1NP3A 2J3IA 3U4DA 1Q2XA 2HK8A 4BKUA 4D44A 2B0JA 3I9JA 3PJFA 2YQ4A 2Q45A 1T26A 1EUZA 5IDWA 3T4EA 4RVUA 2YV1A 1B8UA 4XR9A 2DC1A 2Q99A 1DIHA 3MJCA 3ZWMA 3B1KA 4TWRA 1LSSA 3RKRA 3E48A 3WNVA 4BHTA 3BZUA 3EW7A 1PR3A 2DM6A 4CLRA 2PGDA 3GDOA 5JCJA 5F1PA 1GZ6A 3KLPX 2VWPA 3LYLA 4JX8A 4CMHA 3R0IA 5A02A 5LDHA 4FOSA 2O50A 4OAQA 1DLIA 1I3MA 2P68A 3ABIA 4RLSA 1LDGA 5B1YA 3K30A 4H15A 1E5LA 1G6KA 3CEAA 2FSVA 1I2ZA 3TZQA 5JAQA 4PRKA 5FWNA 1X14A 4XYLA 4QEDA 2BRUA 3LC2O 1U2GA 2VWHA 2AEJA 3LLVA 1Q0LA 3M2PA 5G0SA 4A03A 3EK2A 3P5SA 4D0RA 2DUWA 2BGKA 3CMCO 5KKCA 2I5PO 5JFOA 4BMSA 2WYWA 4QUKA 5DP2A 4JBIA 3RFXA 3VZSA 4ITUA 4Z0TA 1DIRA 3HN2A 1T1RA 4CMJA 5CG1A 4OMUA 5DDIP 3Q2IA 4BKQA 2YFHA 1PJBA 2Y0CA 4LSWA 5AXAA 4ALMA 5IN5A 4YTEA 3NJ8A 3WXBA 1KEUA 4B4VA 1SNYA 2AW5A 4GVXA 4WLEA 1ADBA 1CETA 2PKQP 3Q3CA 4L73A 2X4GA 3NGLA 4PLGA 1HDCA 4E2WA 1WVGA 2ZK7A 3RASA 2PKQO 3WGTA 3PZBA 4E33A 4WPGA 1D4FA 4PZCA 4IMRA 2Y1EA 4R5HA 1Y5RA 3GEGA 3BMCA 4QO7A 4NJMA 4AVYA 4XX0A 1H93A 2CVQA 5IDYA 5IDQA 4CUJA 2CDAA 1DHTA 2P5UA 4NNJA 2CSUA 4PG4A 4CV0A 4C7JA 2DUUA 2B36A 5KIAA 3C7AA 3O9ZA 3OIGA 2I67A 2JCYA 1DEHA 3CINA 4GWKA 5A1TA 2EW8A 1FDWA 1AE1A 3GEDA 3OHSX 1V0JA 4BKOA 1P77A 5HTOA 2Q2QA 4J1TA 3COSA 3TF5A 2OOSA 1ARZA 4PLPA 4XDZA 3LSYA 2ZKLA 1ZEMA 3KM0A 1PJ4A 3I9KA 2G82A 2O48X 3VZRA 5C3MA 2NU6A 3AJRA 4OXKA 3LC7O 4PRLA 2VRBA 3ULKA 2WD7B 4B4OA 4IZHA 1X1EA 2IZ0A 1JAXA 2QZ9A 1W6UA 3AUTA 3JQAB 2FN7A 3PK0A 1BMDA 5F5NA 4CQMA 3ANNA 5DBIA 1J49A 2NNLD 1UZNA 2QIOA 3ZV5A 4YR9A 3ITDA 5AXBA 1UDBA 5KVVA 2Y1GA 3GGGA 4CLOA 4BNUA 3CMMA 3LU1A 1EK5A 1PS0A 2X22A 1U8XX 4JJIA 4PZEA 4K6CA 4NU5A 1V3TA 2WE8A 3AFMA 3ZNNA 2YDYA 3DAGA 5TT1A 3DOOA 4KZPA 4CLHA 3ANMA 1Y8RA 1YWGO 2VHWA 4NG5A 1DRWA 2Y05A 4Y6SA 1NHWA 3AOGA 1G0NA 2VUSA 4FFMA 3RSHA 5K0ZA 4H7PA 4YJHB 4J9UE 5EPOA 7ADHA 4U5QA 2V65A 3L07A 4MVJM 3SX2A 5FEUA 5HM8A 3I6IA 1E7MA 3QVSA 3K5PA 3PFFA 1B3BA 2PH5A 3EUWA 3IUSA 1O5IA 5H82A 5JC8A 4GI2A 4J1NA 1DIGA 1Z82A 3JQ7B 1J4AA 3AFNA 3CTMA 3CZMA 4NIMA 4BNLA 5ILOA 4GAEA 1H9AA 3OEWA 3D3WA 5TC4A 3WBFA 1WPQA 2A92A 2OL4A 3L4BA 1ORRA 1DC5A 2NU8A 3WGGA 5FI3A 1DC4A 4XQ9A 2WEKA 4YPOA 3C7CB 3MJ4A 1DLJA 1O94A 1ULUA 2X7HA 1ISIA 1Y9AA 2X5JO 1DPGA 4YQYA 4I9UA 3NDIA 3ZZNA 1KERA 4Y67A 3ZV4A 3W8EA 2X9GA 4B7UA 1OBFO 5EINA 4J1SA 4YAGA 2R6JA 1AUPA 2YUTA 3F3SA 2EF1A 4BNTA 4P38A 1HDYA 4ZRNA 4J91A 1U5AA 4GLOA 1NYTA 2P4QA 3L9WA 5JY1A 1VL0A 4E5YA 3KUXA 4AJ2A 1LQTA 4B7XA 3TN7A 4UVGA 4ZICA 3H9UA
chains in the Genus database with same CATH superfamily
2PUWA 2EP5A 4AJPA 2C03A 1K9VF 2QLNA 3S68A 4HXYA 3CUKA 5K03A 3VKUA 3KSZO 4FEGA 3FDXA 4JSYA 1D4ZA 1NXSA 1QTIA 1QF7A 3HABA 3N86A 3R2JA 1EWVA 2QGFA 2QP3A 1JQ5A 3LOQA 1QMGA 2IZ7A 2MSLA 1SN7A 1UH5A 3LW7A 1X7DA 3TTXA 1G98A 1EFVA 3DDWA 5FBRB 4Q03A 1SFRA 2BFEB 3TFOA 4M1TA 3CNOA 1YL7A 3THRA 1DAKA 1F14A 3G0DA 2X3YA 4Z7OB 4OA5A 5TRTA 5IVKA 3CPEA 1AGYA 3HB1A 3E9DA 2HA4A 4NRDA 3I6BA 4AURA 4F5WA 5LP6B 4BQOA 3FJYA 1RMTA 4JODA 3WGOA 3EH2A 2CE7A 1B0PA 4OA8A 4C29A 4DUZB 1ZZEA 4KJZA 2X6QA 4KIJA 2IDZA 1Z38A 4S24A 1AF7A 2CLMB 3RHZA 4I4TA 1HDXA 3PICA 4FBGA 1EK1A 1ORTA 2FSPA 3HRIA 3BXEA 5GJCA 3CCCA 3O9VA 1JR3D 3R1IA 4NCJA 4RL6A 1O77A 4GWGA 4UEOA 5AICA 3CLRD 3RVPA 3VZQA 4DLZA 5J1SB 4DR2B 2FYTA 4ESHA 1AS0A 1BAPA 2O20A 4HXFB 3UQYS 5SY4A 3KZNA 4PFQA 3DLTA 3FTPA 1RWMA 4AMUA 1EEXB 5EKTA 3SS7X 1T5BA 2FPUA 1WAMA 2YINC 2B37A 5GOZA 1XWIA 4MHOA 1YRWA 4PYMA 1P1CA 3D3EA 4DMLA 4QELA 1DMSA 2W6PA 4EKNB 1FW6A 3C3PA 1VBKA 3HZRA 2X23A 4KR2A 3LE8A 4HAWA 1DRUA 2QZJA 1UJ5A 4LY0A 4OUDB 3W2GA 4DRXB 4CEJA 4BNDA 4JKYA 3U80A 3D7RA 3Q2KA 4RVHA 1ZKDA 3LLUA 4IJ6A 2FMFA 4TTJA 3U7QB 4EHAA 4F1JA 2IDJA 1M1NB 4K0RA 3WGHA 2VSXA 1N1MA 4GVPA 2XECA 1KI3A 3K05A 3JQBA 4LDQA 2QRLA 4QATA 2PKCA 5KYWB 1O8CA 4KZKA 1P7PA 2W6CX 3R7WA 1JXOA 3CURA 3FD8A 5EHZA 5DCYA 1HZZA 1Z7BA 4JY7A 3G0HA 4LAFA 4UCFA 1MO2A 3RUEA 3LGSA 3Q8KA 1I1QB 4NQRA 1BE6A 4BVJA 1KQFA 2ZXUA 3KO8A 1FTQA 3D2AA 1SIOA 2ZB4A 3T12A 1QUEA 1ZHFA 3TZCA 5NULA 4BWVA 3HMQA 1BXRA 5HSGA 2PUGA 3AUSA 3ETHA 3IAAA 4X8HA 4UUNA 3TVYA 4IHJB 4IV5A 1PKXA 2H51A 3OU2A 4WT7A 2CV2A 4AYTA 1N8TA 2BFCA 4FZJA 2OLKA 1F0PA 3VHXA 2W8ZA 1ZUHA 4XGNA 3IQGX 1TQ8A 2PMEA 3HCRA 5LUBA 2Q6IA 4L4ZA 2B2CA 2FW6A 1Y3HA 1KRWA 5FA8A 3UIEA 1PG0A 3E9MA 4QOHA 3TZEA 1A7UA 1SD1A 2MYTA 5BT9A 3GLFB 1KARA 3U26A 4OFXA 2X0NA 3WJAA 2Q07A 3HCFA 1GVHA 3A3KA 4GF5A 1FMCA 2A35A 4GBMA 2HSZA 2XSZD 4LPSA 3PD7A 5ITZA 5JJ5A 2VJQA 4YJHA 4B81A 2RAUA 3N8NA 1FXWF 5LZ2A 6Q21A 2VP2A 3IA7A 1EVYA 3L8YA 2Z3ZA 5TE9A 3ELDA 3GL9A 4JBXA 5ALEA 1Q7EA 4KQ9A 5BV7A 3CF4A 2IU4A 5E7JA 5L6LB 2ZQ5A 1MP0A 1YVRA 2ADFA 4GNRA 4M7WA 4QPDA 1UFOA 4Q4HB 1U11A 5C81A 5C8XA 1WMSA 5AW0A 3EZXA 3L92A 1NR7A 4WACA 2FPOA 4AKEA 4F45A 2NZVG 3HB7A 4PBSA 3GX1A 4BO0A 4K8RB 3AM3A 2H7VA 3TW0A 4F4UA 1K63A 3BTUA 4FW9A 5T57A 1X7YA 3RRNA 4EYEA 4PG8A 3H2ZA 1JN0A 2XDYA 4Z7JA 1JX6A 2O8VA 1QBGA 3I1IA 4FGUA 4Q1BA 3KT3A 1ELOA 2GDJA 2AOUA 5CFMA 5JTTA 1VI6A 2CLSA 2QXTA 3DJYA 3AXSA 3PGA1 4F72A 5MF6A 5EKSA 4MXDA 3NG1A 2JLUA 3IALA 2R0QC 1BJRE 1DV1A 3C3KA 4DCJA 1ANKA 4H3HB 2QD1A 3DGFC 2OFPA 4Y6PA 3X1DA 3OLXA 1I8TA 2VDJA 1N3YA 1PSWA 3Q9LA 3EWNA 4C4TA 1ST2A 1PGNA 2PQ0A 2H2IA 3N53A 4Q1VA 4U4AA 4ODIA 1XNQB 3K0FB 3SVZA 1MFZA 1ZWKA 5B7QA 1QONA 1H2EA 1NBMA 2CL7X 2R6DA 3WYGA 4W6QA 3E23A 1KYYA 4OAPA 5JU6A 1X8JA 3Q5DA 3JASA 1X9HA 1GZHB 2KLHA 1C0PA 5I7EA 3P9QA 3R5TA 5IXJA 1JJAA 2WLSA 1NX9A 1WUKS 5CNJA 2GN6A 4AB1A 2RGEA 4PXAA 1NM5A 1C41A 2Y1FA 2CDCA 4QOEA 3CEJA 4DIEA 4G4IA 4OKIA 4J3FA 1WCV1 1P4JA 1NV8A 4Y9TA 2HBQA 4UVDA 2BDUA 5EWLB 4EW6A 4ER7A 6ABPA 1GZDA 1EU1A 1VLQA 2EIXA 4B3CA 2CGEA 1G9SA 3RHTA 4FNGA 4TSRA 1Y8AA 3CONA 2CUNA 2IV3A 4ZGWA 3SVLA 1DAIA 1GP2A 3QF7A 5BVHB 1L7PA 2DR3A 3IOBA 4FGJA 4I5DA 2JDID 2EWVA 1RPNA 4YRDA 3WGYA 1NLMA 2JJMA 2QAGA 1FEZA 2DFDA 4J0FA 5J59A 4R51A 4UCWA 3VR4D 4AG5A 1CY7A 1TQ2A 2FY8A 2Y77A 1P0MA 1WL8A 3MIIA 2B5OA 2ZRAA 1H1DA 4IJWA 3AP3A 2WHPA 4FLFA 3TQFA 3I2IA 3NGMA 4NABA 1M2VA 3ADKA 2QUAA 4NEGA 5CHEA 4BYGA 1KO8A 2WU1A 4D6PA 3PQFA 2J5KA 3DUWA 3ZLJA 1H4VB 2RGCA 3PWZA 3VDMA 4JNGA 3AZPA 1QU3A 1UJMA 1XTUA 2FPMA 2WKSA 3FYUC 4OSPA 2XWQA 3OVMA 4PQGA 6CHYA 1FDSA 2ZIFA 3RG8A 1GRNA 3NNSA 3V00A 5J43A 1TQHA 4OF4A 2JAQA 1YSCA 2GS9A 2QSJA 2YJTD 2DCUA 4Z1OA 4F4CA 1VM6A 3NUQA 3WLAA 2QRVA 5BT8A 3BS4A 3M6MD 2GZRA 3NHSA 4MR9A 1GGHA 2R8BA 1FTWA 2VDPB 4LOKA 2LV8A 1DDGA 4RDHA 1KQGA 2IV2X 3EB9A 3AVTA 4WY8A 2OXCA 2OENG 2OCBA 1Z5GA 5KNBH 1EFPB 1Z2OX 3QELB 1XKXA 2IEIA 2QYOA 3SC3A 3NTVA 4QPPA 2OFWA 1JSLA 1RBZA 1I3NA 3IKLA 4QOSA 2YWHA 1BOFA 3KEMA 1F2TA 1VA5A 4F60A 3LO5A 3ZOZA 3IKTA 1UF9A 1LFAA 1Y34E 2RCYA 2X5NA 3N0XA 3DKRA 1KFKB 2J3HA 5CPBA 2VO1A 3FB1A 2E6KA 4D3ZA 3LT0A 5HIMA 1J7JA 3ORRA 3ABRB 2JGNA 3IPAA 2XJ4A 4KYVA 4JB0A 3DAFA 3QVVA 5I3CA 2PM8A 4TSFA 3KYDA 3IB6A 4J6FA 4R1NA 1EVJA 2QSUA 3NHMA 4YNBA 3SVTA 1FVOA 1KO4A 5JQGF 1ZJ5A 3IULA 1FYXA 4TLMB 1E77A 5CXQA 1JPVA 1XLWA 1UL1X 4MUJA 3N59A 1XV5A 1GKUB 1SHJA 1UJ6A 2A58A 1NI5A 1ADGA 1H8HA 1OBCA 2ZDHA 1JQLB 4XM0A 5BYBA 2O7RA 1GRVA 1W34A 1Z5OA 2FN4A 4LNUB 1OXSC 3UMYA 3BCRA 4TT8A 5K99A 1EXVA 2OKCA 3NT2A 3VBEA 2Y4OA 2GEUA 1L4YA 4DIKA 4GMFA 3M4ZA 4GX5A 1JLRA 4TMWA 4Q9KA 4XCXA 5B58T 4XFKA 3RCBA 3B7WA 4EY8A 4GHWA 4LIPD 2ZUEA 4JMPA 1VI2A 1BXZA 4BNZA 4YXFA 1EI9A 2E3JA 4E09A 4C01A 1G6Q1 3C8UA 3F1LA 3OFSA 3EZYA 2EC5A 3PPWA 3PGVA 3KQSA 4PTZA 3I5AA 4A91A 2B1RA 3DSRA 2TMGA 1JFRA 4MA5A 4NYIQ 4UPVA 1USGA 3HWWA 2HZ7A 3HVHA 4B46A 4AMBA 1K5HA 4J8PA 1C50A 2QSZA 3GBSA 4JJ8A 5JPDA 3KETA 5B12A 4GGPA 4KNWA 4UTVA 4I4TB 3IPLA 3REFA 4DR7B 4HLUA 1Z5ZA 3U31A 3RVJA 1ID8A 3GRVA 4ZQGA 3O0TA 3O93A 1VL5A 1Z17A 2DRIA 3MAAC 2O2XA 5A71A 3IV7A 3JALB 3SQDA 4MRMA 3E81A 3PQ4A 5CLHA 4DZZA 1NN1A 1WS6A 2NYRA 1PF7E 1D09A 4GI5A 2ZUDA 4EUFA 2XNDD 4W5TA 4QHSA 3BULA 5B58C 3ZGXA 3TQRA 4HTFB 2IS1A 2EL9A 2IH5A 1KYVA 3RBZA 4B80A 1MB4A 1BW9A 2PS9A 3IOMA 1M54A 1NNUA 4MWTA 1IIBA 2IZZA 2ODBA 2V7EA 3IBSA 4RK5A 4XRGA 4ZXFA 3L8GA 3LUPA 3K0BA 1IN6A 2BC9A 3JQBC 3LUAA 1C3OB 2II6A 2ID4A 2V7PA 2WIJA 4DSZA 2QF7A 1BVHA 4RV4A 4XCQA 3SOZA 4B2YA 1VKHA 2JG3A 4KX3A 1BVRA 2WBLC 5DM2A 1W4AA 3TOVA 2L17A 1G3IA 1MOQA 3GH1A 2I91A 3ENWA 4QXMA 1UOQA 1AQUA 1HY3A 2PK3A 4IQ0A 3QEAZ 1APBA 1GGKA 3FLAA 1Q1ZA 5BSUA 1G19A 2IXAA 3CWQA 5M04A 3WQQA 1ICEA 3ZU3A 2ZR8A 3H4MA 2IEGA 3AUFA 4UHBA 4DCCA 3A11A 2QM7A 1BJKA 1FP4B 1M2WA 3RU7A 1VA4A 3GAZA 1TUBA 3ND6A 3OD1A 4EY6A 4YUZA 4HDMB 1GO2A 1QAOA 5FUXA 4OGLA 4WY5A 5IJ9B 2D2XA 4C4OA 4QLOA 1SC4A 2PVCA 5LIRA 4G8JA 3H19A 2C20A 3KQTA 2WYOA 4ML3A 5IAAA 4AS2A 2ZTLA 3X2EA 2QUZA 4ER3A 4CIBA 3TMYA 1JDSA 5AOVA 4F2WA 5DEOA 2H7CA 3WB2A 1KIFA 3AILA 1MH1A 1RC0A 4RZSA 5AK0A 5LU9A 1P33A 1RAGA 2FK7A 5CHYA 4IGFA 4CM7A 2C95A 3V1NA 3VR4A 3AR6A 5IBRA 4XYEA 1GEGA 1WXEA 2EEPA 1C4WA 3GJQA 3HCOA 4P2GA 1YR1A 3GT4A 5H3CA 3WMEA 1MFPA 5I8WA 1PFWA 1DQRA 5AVKA 4OMDA 4IJQA 2WZBA 4IVRA 5J2UF 2ZYGA 3EDMA 1BEZA 2HWWA 2Y99A 1V25A 3VV3A 1SUFA 3A4MA 4MSUA 2R8OA 3FETA 3K0EA 3UJ7A 3LZ6A 3UWKA 1KIMA 4IZ6A 2IIBA 4KH0A 1CRLA 1SK8A 2GEBA 3KJHA 2VJNA 5IASA 2HIAA 1RAHA 2I62A 1G17A 3WGVA 3O8LA 5T8KC 3VNSA 4OOEA 3RSSA 4C87A 3ZGVA 5KNLA 3P71T 4X85A 1ECGA 1FRFS 4IXDA 1IQRA 4K2AA 4QJIA 3TAUA 2C7RA 1NVDA 3PR1A 1ZM3A 3PNKA 1WP9A 1VIVA 1KP2A 3D5TA 4RKWA 2NO6A 2I65A 3IO3A 4IX9A 1EFUA 4G1CA 4G25A 3ZY3A 4KWEA 2BI7A 1TEVA 3PL1A 4UNQA 5I4IA 2K6GA 3KP1A 3GHHA 1SG0A 5B1HA 3TSOA 1LBTA 3X1WA 1D7OA 5EGSA 4UFOA 5TQ0B 3JYPA 3R6GA 4LX8A 2R1ZA 3RQSA 4A27A 4BPBA 4RVFA 4RTJA 4IIXA 4MKGA 4YMVA 5JNTA 2C2WA 1PJLA 1SBCA 1QK4A 2O8BA 3L7NA 4YRLA 2XDWA 1YB7A 3GJ3A 3LBAA 5L53A 2DWUA 1I01A 1J90A 1R0BA 2PGJA 1MB3A 1EEHA 2DU8A 2WJVA 2XIJA 2YY6A 2EBFX 3DZCA 3SBOA 3WKCA 2BFOA 2W42A 1JLLA 3DKIA 4S1OA 1TT7A 4UJ5A 4MI9A 2VHEA 1V1MA 2XGMA 4R8KA 1CQXA 1LD3A 1L1EA 1Z5WA 4KIUA 1EAYA 4Q3BA 1ABFA 1JRLA 3IIKA 4R1LA 5D6OA 4ZAVA 5J23A 3KR9A 3Q3JB 2EVWX 4W5HA 3E35A 4R31A 3TZBA 3UV7A 1NJSA 4A16A 1P4GA 1Y1TA 4LA4A 4P0TA 3KQPA 2FFRA 4C0QC 2HF8A 2NZWA 2ZSUA 4HWPA 2WWYA 1IY0A 2BL4A 2OAQ1 2VPPA 4M36A 4Q0MA 1MV8A 3R5KA 4F46A 1B2LA 4NDZA 4D9FA 5JRDS 3U3ZA 3M6WA 4MROA 4A5OA 1HRKA 2JJYA 4JI0B 5KNDA 4J2HA 3WFJA 3HP1A 3IMCA 4HNHA 3PITA 4PAOA 1AXGA 3GEBA 2IDKA 5C34B 1XAGA 3GUZA 3SX4A 3ZCSA 1Z5UA 3TG2A 4FN4A 1DQSA 5GZ3A 1DL5A 4R83A 3QI2A 3S2ZA 1W2HA 1BSVA 1U7HA 3WYFA 3BZWA 2ATIA 1CUBA 3ZG6A 2RGDA 2HT6A 4TWJA 1P2BA 1TZMA 1VB5A 3VPFA 3L0BA 2YHIB 5TIIA 4H4CA 3C5WP 4JT2A 4LYHA 4BAZA 1LSUA 2IXGA 1OE0A 3V8PA 1N0WA 3WY9A 1TRKA 5A7HA 2HYIC 4WBSA 2Q8NA 5DHFA 3VI3B 3RKSA 1Y1RA 5FEMA 3VJMA 1F4LA 1OVGA 1T5IA 2G7ZA 3IAM1 1EYZA 1HEYA 4QIHA 1Y8QA 2FX3A 4M8KA 4QVKA 2W22A 4FOOA 4PFSA 1LLUA 2FB9A 1ZC4A 3D6NB 3DXFA 5J5AA 1DS6A 2PYIA 2A0WA 3PC8C 2GERA 2Z2YA 4BUZA 4Z7NB 1TCCA 4X3CA 3WIUA 1CRPA 4MHTA 3EFEA 3K9LA 2QLFA 4HWGA 1JMVA 1QJ4A 2BOVA 4UDOA 3ZIAD 1SQFA 8ATCA 2XCSB 5IAKA 5HM6A 3TSCA 3LOPA 1Z0JA 3L7IA 4WUVA 2AEEA 3TPFA 2EFGA 3OURA 4OD0A 1ML3A 1Y1PA 3C4VA 4XB2A 3BC1A 1EQUA 2GARA 1YOBA 1FLNA 4K40A 4JR1A 1MQ8B 5F2OA 2R48A 2I22A 4GDFA 1R10A 3P7MA 2ZUFA 1REQA 3FSRA 5DYGA 3RWMB 2FVYA 2C97A 3I05A 4PVDA 3HVJA 2CF6A 4QXQA 2P62A 3D4PA 1RQNA 3P1JA 1RM3A 4RV5A 3ZVNA 1KVSA 2JKZA 4L6IA 3MOGA 1Z2PX 3UK2A 2CXTA 3M9WA 1K68A 4H3KB 2O0LA 4R9NA 3BA1A 2ORIA 1UPFA 2B5WA 3GD7A 1HMPA 1TD9A 1E3QA 3QYAA 4ZFNA 4UXHA 3Q3VA 1F8YA 1R9NA 2CCGA 2PZLA 1L5HA 1FU4A 3MYRA 1XLVA 4D99A 2B1GA 2CMFA 5KSOA 4KR3A 1U2SA 5KQLA 1CUJA 2DVMA 1T34A 2VNHA 4O4IB 4D8TA 1BU8A 1D6SA 4JCCA 1D4OA 5E6RA 3B6ZA 1YULA 3GZTB 4YRQA 1RLMA 4BO4A 3OTIA 13PKA 3RSLA 2DAPA 3HFRA 5GM1A 5FOSA 5J4KA 4F2DA 1EESA 2XTAA 3SHFA 3RAPR 3TM4A 4ANFA 4WDRA 2Q21A 4KEAA 4RWZA 5I45A 3B1JA 3U44A 2D8AA 3JQPA 2X0KA 1FTGA 4IIBA 4RSHA 4OG2A 5DYTA 2GAAA 1UDCA 3H6GA 4J03A 3SJCA 1DXYA 1OB2A 1Z29A 4YAIA 4EI2A 2CMHA 3OCZA 1D2NA 2OVBA 3O8BA 4R1QA 4RWEA 3R8CA 4QUIA 2CNOA 1M75A 1OJ7A 3QG1A 3R3UA 4FD3A 1Q16A 4G01B 1Z0FA 1C3EA 1SXJD 3PU6A 4CM5A 4D8YA 3SLRA 2VYNA 3A6EA 1O95A 2WPDA 4BFCA 4YRZA 2F43B 2CLLB 3GLIA 3T1HB 2JFXA 3LDUA 4O4JB 4HNSA 2H29A 5LD2C 2R8PA 4OHZA 3TAXA 2O8CA 421PA 4WTOA 3EXHB 2DFVA 5BNFA 1EMDA 3OKCA 2VHZA 1J7KA 3SDBA 1MC8A 4ICIA 1LC0A 1BC5A 3HFSA 3IQWA 3SR0A 3CH4B 3O6VA 1LDYA 4H1VA 4EG6A 1FFCA 3BBPA 3BRCA 3F1KA 4HTFA 4D7AA 4EUKA 3LT1A 2B4QA 1DNPA 3L6OO 5I5EA 5KTTA 2Z4TA 3IAS6 4MYCA 3E3NA 3ZV3A 1VJDA 1XL1A 3QNWA 1HNNA 1Z2EA 3MPUA 3I76A 1E2KA 1UBGA 1VHQA 1E64A 1EB9A 4QE3A 4DY4A 2YFKA 2JAOA 3G79A 4L85A 5IZCC 5LZ9A 1O4WA 4UEJA 3TQHA 1PR2A 1NVMB 1WO8A 2QW8A 1QHFA 3IP5A 1BQ4A 1NN0A 1B7GO 3ZQ4A 4HV4A 2WYIA 3C5VA 2QVCA 3LMKA 4TLCA 4M1YA 3ZZMA 2BLNA 4YPFA 1VC2A 1TC2A 1YO6A 3JZAA 2FDCA 3A3YA 2D00A 3PFWO 1WULS 1BDIA 1H69A 1Z16A 1N4DA 3AUXA 2QQ5A 2WSSA 3BWYA 3CZPA 2I2DA 3L46A 1YCHA 3BHMA 2I6FA 2O2CA 1DJLA 1A9XB 1CE8A 4Q66C 3I1YA 1JFVA 4OH7A 1QV7A 4DPKA 2FEXA 2OV6A 2FRDC 4FHFA 1K1EA 1SIBE 1BD3A 3LX4A 3UG6A 5B3LA 4EFLA 1BO6A 1USKA 1VCHA 2ZSHA 2C2GA 1HFKA 3NI2A 4RLHA 2YR0A 1DKNA 4ZVRA 3CRVA 2RH5A 3TTTA 3IBGA 4D45A 3OCYA 1CQZA 4YRGA 5AJWA 2D62A 1T2AA 1FL9A 4PCUA 4OHFA 1SH7A 2Z83A 2RGRA 1Y6QA 3ET5A 2O4UX 1SUCA 2B61A 4PC3A 5CTAA 5AW3A 1EIWA 4RPHA 2IYUA 4MKHA 2XCOA 3S8EA 1XMJA 2CWWA 2IHBA 1SBIA 1O5TA 3FCCA 4CTJA 2ON6A 1QIGA 1YCFA 3EQZA 3HJBA 2ZJ6A 4QJBA 3ZU6A 1PFYA 1QLJA 2AFHE 3N5KA 4GS5A 3ADDA 4NMWA 4F4HA 5G53C 3LO8A 4MLZA 5TQ2B 1N1GA 2G5CA 4I1PA 2GNPA 1GL6A 3TRJA 4B3XA 1C3OA 3A4LA 1W0JD 3LXXA 3MRVA 1Q0RA 1V39A 5TF0A 1P4HA 2F3PA 1I5EA 2WIKA 3E9CA 3KV3O 4HDCA 4FYMA 4YFYA 5ECYA 4BEBA 1EZZA 2FPWA 3L7LA 3SN6A 2AK3A 2GNOA 3WSWA 4DNOA 2EJTA 2P9EA 1QTRA 4W1PA 4F9TA 1U0GA 5JDIC 2JLQA 2QT1A 3GFBA 3PEWA 5HYVA 4UVEA 1RXYA 1U4NA 1HE5A 2O14A 1TZ2A 1U0SY 3C3XA 1N77A 5H4GA 1MD9A 1QQTA 2J41A 3NOOA 4DBZA 1BQ3A 1PNTA 2X2FA 1XNJA 3K5WA 2QGZA 3P27A 4PLYA 3JU3A 4GX0A 2EGGA 4NCKA 2LP4Y 5CM2Z 3MAGA 3RLFA 5A9SA 4EGSA 3WHPA 2JGFA 4IOKA 1VPLA 1R3DA 1QPBA 4HB3A 4NQZA 5JLAA 5CA1F 5CDGA 1HI9A 3ZKWB 3T38A 2GT1A 2V03A 3MGBA 5EJ6A 1QP4A 3HRKA 3ZV6A 3BQ9A 3PLNA 3HV2A 4W4TA 4BFXA 5H02A 4GZLA 1XTSA 3FZGA 2ZREA 4ZO9A 1KETA 1NKSA 4IVQA 4P6VF 4QD3A 3VA7A 3EZLA 2AGVA 1OSNA 3RHSA 3TW4A 3N3AC 1EX9A 4JQSA 3B3AA 2XRZA 1SD2A 2I76A 1IEWA 1MKYA 3G3EA 3I5MA 3LIIA 3MIZA 5AJYA 3GYBA 3C8MA 5HIKA 4Q9DA 3O1HB 3VR6D 3U19A 5GPBA 2C59A 4OQQA 3P9YA 1E2NA 3E3OA 4BNVA 2JIPA 3D8UA 1Y4AE 1ZH2A 3L1KA 4ZO4A 3IEMA 2HMSA 4DLBA 4WBNF 1NIPA 5K4AA 5BP7A 1G8JA 2H4YA 2AFVA 3MHPA 2JEYA 2XGOA 4L5AA 3KR2A 1HBJA 1UBSB 2N47A 2ZJ8A 3B38A 1ZGHA 5F78A 2GJKA 3VNAA 3WGMA 3BERA 1XALA 2FK8A 4UASA 1XYGA 2H2HA 3AVUA 4DLSA 3BCUA 3K4PA 2QG9A 4QTXA 1H2BA 3ND9A 5G0UA 3L7AA 1K7FB 5LDDC 3R3HA 4DMFA 4URWR 5EMLA 3B9RA 4EY7A 1RCFA 4YDSA 4BKRA 1KA9H 5HWSA 2QXYA 2I8CA 4MEJA 1S2MA 5MGNA 1XJ0A 3OWHA 1GXSA 1JHVA 1PG2A 2Q49A 1FQJA 2R6AA 2NUTA 4FOTA 4F38A 3EDRA 2HWKA 1KZ1A 4EIWA 3S27A 4EUNA 1YB6A 1KQ3A 4XZ3A 4ZVUA 3VH1A 2BY4A 2FLVA 3DO5A 1KI8A 4KR0A 3D1JA 5EWJB 2WJGA 3EZNA 2D5AA 3PIIA 2E4VA 1M8JA 4HX2A 4LYDA 4MCHA 3VOAA 4FJ0A 4XASA 3RU3A 4I5GA 4N3CA 4F7WA 4DR6B 4R9SA 2AEMA 1GA4A 4FI3C 4RVCA 4REQA 4K9SA 4HS4A 3S1LA 3DMGA 1E79A 2DBQA 2A78A 1F60A 2FDRA 1NWCA 1QO0A 1SIUA 4XYBA 4IWXA 1CUUA 3JZFA 5JZ9A 3T54A 1ZWLA 2XRYA 5JS8A 4QODA 2GO1A 4N40A 1PR6A 2C92A 2JFUA 1CZRA 3CO0S 5DT9A 4C3ZA 4YRIA 3K9FC 1FFGA 3QMPA 5JS7A 1MB2A 1VIDA 1ZUD1 4LQLA 4Q1AA 4FQ5A 1J25A 4U9UA 3VBCA 2CHUA 4YAFA 2VH2A 1T24A 4B6SA 1WCIB 3FJ1A 4PR3A 5BPHA 3D59A 3QXJA 1SOVA 2G4LA 3QMMA 4I46A 1MDFA 3HJAA 2ZQYA 3WWCA 2W4QA 4Q4DA 3PPIA 3AB7A 2XB8A 3HDGA 1U9YA 3B5EA 3MMZA 4L3VA 4BECA 2JPDA 1W1WA 1D1SA 4G23A 2GPBA 5T64A 4S1PA 1X80A 4FFPA 5IJ0A 3WBBA 3V34A 5JD6A 2X9VA 1AZTA 3N2IA 2J1LA 2GZSA 1ZW1A 4TTQA 3KPVA 1QTNA 5FNZA 5BN4A 4RIHA 3WK9A 4IVPA 1BE8A 4RF4A 1E32A 1WOMA 3A8TA 1V11A 3KELA 1QOPB 4GL4A 1UODA 4HYYA 5C8DA 1H6DA 1NF3A 4Q4AB 2D1QA 4LYGA 4KQIA 3TJZA 4CKEB 2JRLA 3CJQA 3VU3A 1FNSA 4BB5A 3LBHA 3SZ3A 5AXCA 4LMRA 2I29A 3EMDA 3R7FA 5KKNB 4J0KA 1TPZA 3BWDD 3WYEA 5CX4A 4G0UA 2CJFA 5T41A 3DO6A 1NV9A 3K7EA 3RRJA 1TLFA 3ENQA 4WZAB 2ZE8A 4S1NA 1LV7A 5BRJA 2PRSA 1S8NA 1IQPA 1M1UA 2BSXA 4NAHA 3KC2A 1E62A 4IDGA 2BUCA 2DSTA 1ATZA 3W5HA 1O0BA 3QQ5A 4CM4B 3BPSA 4X9XA 5H59A 4ABYA 5IEBA 5I7SA 4AY5A 4JT4A 3QF4B 4IL5A 4DQUA 3RJMA 4OJNA 1RYZA 3IDAA 4MUKA 3M1LA 4NYMQ 1FRVA 4JU8A 5A4JA 4KDFA 1Q19A 5T4BA 2HCFA 4BV9A 5JROA 2QXUA 1N2SA 1YR3A 4UFNA 3V8BA 4ND6A 1P9RA 1IN8A 1XMXA 2H1VA 3UOAB 1OZFA 3FNIA 4OX9B 4MIOA 1WCYA 4WADA 2HA6A 3JD0A 1MIOA 1GUBA 2OZPA 3I12A 4XPZA 3WMRA 3L6BA 1Q57A 1JNXX 1Y81A 3UTCA 3N2LA 4JLKA 2AJDA 2OGZA 2YN2A 4HMPA 3EUFA 4XTCS 1JL3A 1SU6A 2IDMA 3OIWA 1M6YA 1R4AA 4J7UA 4YC7A 4M86A 4Q4HA 1XTVA 5HX7A 1M7BA 2D5BA 2ZEJA 3OT1B 2GPWA 3TNJA 3AW9A 4URHA 1FFAA 4AP6A 1W0CA 2PUBA 5CMLA 5HOEA 2PZMA 3BKWA 4LDPA 4N5MA 1CG6A 2Z1DA 4O02B 1P74A 3EWSA 1KEPA 3B2NA 4KFSA 4AK9A 4MWZA 4WECA 2BLLA 4DLTA 4ZDIA 3E1KA 4TSKA 4CV1A 3VHRA 5C7LO 5E2BA 1Z2CA 2J0VA 1CUXA 2PYDA 3O47A 3ROEA 4IICA 3ESAA 5DHAA 3PEFA 4FC6A 3RPEA 3QFCA 4AECA 2NGRA 1SQ5A 3G85A 4QUEA 5ESDA 3SWWA 3GZNA 1GR0A 4J16C 3M49A 4KL8S 3ZLVA 3HXOA 2WRZA 3K9GA 1KFJB 3EXHC 1F4VA 3WGQA 1XA4A 3RVKA 4P8RA 3ZKWA 4LGVA 3KQNA 1SHKA 5LZ7A 3MCZA 3IP9A 2QMZA 4D80A 1YS9A 3QVJA 3HA3A 5BSRA 3QVTA 3U81A 4L2IA 3GXOA 1CT9A 3L1IA 3RR2A 3NXSA 2NV0A 2BELA 2H57A 3AFOA 2FEPA 1W88A 2PBRA 3O74A 3M9XA 3ORQA 1TB4A 3ZY2A 3PWKA 4A4DA 1YQWA 1J8DA 2OHJA 4CIWA 1V6AA 5DHRA 2IRWA 1JSZA 1XROA 2CHQA 1T0HB 3JYNA 1FX0A 3RS3A 3SC6A 3UVEA 3OLYA 4Q7KA 4RDXA 1QGZA 4D25A 1UKAA 3PX2A 5AVJA 1CR2A 4HFRA 3T3HA 2H8GA 4KIFA 1NZJA 3IA2A 2H63A 1TZJA 4A6DA 2WF6A 4MAFA 2GH1A 3K0SA 4TOIA 1Y9DA 2YWGA 1JLMA 5DM0A 1OXXK 3L5KA 3ZDZB 4EUSA 1V9LA 1XVUA 2GN9A 2FQQA 4MVWA 3GA5A 4FHGA 3GCWA 2ZUUA 3LPAA 4Z8XA 5EP2A 4I9HA 1RYNA 2Q6TA 3I2HA 1TA0A 4ND5A 1YUBA 2PUAA 1BX0A 5FPYA 1V7PC 1KWGA 4LJ9A 1QGUA 5DNEA 2IHNA 1A9TA 1M2VB 2FSVC 2P8JA 2WJ6A 2FV8A 3AEXA 3DC2A 4MS4A 4TPKA 3VPCA 2VZ9A 3UW3A 3ZHTA 1JG2A 4R2XA 3M4XA 1M6WA 3GUUA 4INAA 5AKZA 5HKBA 1HYBA 2HMYB 3Q5GA 1NOKA 1UKEA 4MV6A 3INGA 4WY2A 3TL6A 2ONKA 1YCDA 3M5PA 1MABA 3IAS1 4L4YA 3HUTA 2ZBUA 4LMPA 5K6AC 3H17A 1EWKA 1TM2A 2VHVA 5CCBA 3F9IA 1QHXA 3DBIA 3I9FA 4C7VA 1OFUA 5BY2A 2WD9A 1EFLA 2PEZA 2PPVA 2NM0A 1QZZA 2VRCA 2XJ9A 3I04M 3DB1A 5G02A 5KC9A 2XZOA 2QYSA 1HE3A 3E58A 2J0QA 1XQ6A 1LU9A 2R47A 4CUKA 1JG1A 1BCSB 3UAOA 5LP1A 2RHMA 1RD4A 1FUUA 4TXMA 1KI4A 2DKOA 1CDZA 3GNTA 5C8YA 3I1JA 1OZGA 2GJSA 4BXOB 4D82A 1BX3A 1U8ZA 4OHPA 1KKLA 2GYVA 3AHHA 1U9ZA 1QBKC 3LZDA 3PC3A 5JEDA 1XDBA 4UTOA 3PG5A 5KWIA 2DJIA 2D3WA 4NICA 2NVUA 5A1JA 2XQGA 1SC9A 3A1VA 3KCNA 3RRYA 4KGDA 1MH9A 3BFPA 4PR0A 3VX4A 1XTTA 4QXPA 2PT9A 2JFVA 2OORC 1L4UA 3GEEA 3MT9A 3EXEB 1FP2A 3EOBI 1PWZA 2COEA 1II9A 4IJUA 4JBLA 4DJ5X 2F17A 1M2NA 3LHIA 5L8VA 4ATNA 2P7IA 4MUXA 3MOIA 2OZVA 2FPPA 3DMRA 3OZWA 3Q7PA 1YE3A 4TVBA 1NUTA 1JJFA 1EWRA 3HCPA 3OECA 3L04A 2FZVA 4N7MA 1W4BA 1R88A 2Y93A 1W36D 3DEHA 5H68A 2I2AA 1FNNA 5J3JA 5FAXA 3DKPA 3EASA 3QLJA 1RQ2A 2Z57A 3OQIA 2IVZA 4DM4A 1E1KA 4DSUA 3OJXA 3F74A 2QD2A 2D7DA 4F71A 3R5FA 5BSFA 2ZBFA 4A7PA 2CNWD 5SZKB 3HYLA 4LSGA 1R6VA 2Q8QA 4A5SA 5BNZA 3BD9A 3V1KA 1TVMA 1F8GA 1PFKA 3ZUPA 1EFCA 4K9PA 5A7GA 1X6VA 1H23A 1E0DA 2QP9X 3R6DA 4G8BA 4QM7A 4FZ5A 4QOGA 4YJKA 2VDRB 1RMYA 4RK0A 2QM3A 3DBRB 5KOYA 2OZEA 1NTOA 5E4TA 5K3EA 3EZ9A 5C53B 4DA0A 3PE4A 5C1PA 3FGPA 1GPMA 2REQA 3K35A 2DX7A 1MQ9A 3TQSA 3LX6A 3MWLA 4NE2A 3KPUA 4YMWA 2ZTVA 3K20A 1JU4A 3EVFA 4QDZA 1G291 2FWBA 4RULA 5DO9A 1IJKA 2F3QA 3MB5A 1H2ZA 4RHYA 4YCSA 3KK0A 5AQ1A 3DMTC 1GPLA 5DLPA 2JLRA 4P4UA 4ZVQA 2ZLBA 4HEJA 4U7GA 3PZRA 1T6BY 2H0AA 2MSCB 2QTVB 3SJZA 4JZYA 5CA1A 2ZRCA 5A5GA 5CYGA 3DOEA 3OEYA 3L0IB 2IPNA 4P0PB 1L7QA 3G5AA 1WLSA 2K7FA 1RKBA 2LKDA 5E6RB 3SAJA 3OHPA 1J24A 4QULA 2YX1A 2NQTA 1AHHA 1RP1A 2FWJA 1C1XB 3CIOA 3I23A 3VFDA 1G63A 2IVFA 3DMTA 3WSVA 3RADC 4RD3A 4HLQB 1DRJA 1R8XA 4CKWB 5A3QA 1RT9A 1IOWA 3HBLA 4G63A 3IP6A 2I8LA 4OHMA 3ONNA 4EY3A 3PHGA 1DTSA 1ESEA 2OC4A 4B43A 2CL0X 1X7GA 3N0WA 2V6JA 3CF0A 3M6IA 3UAWA 1KY4A 1K92A 3QV2A 3ZN2A 1E63A 5I7UA 1QH0A 1FYDA 4MICA 2C4WA 2Q9AA 2BBWA 1B1AA 3BUSA 4KDRA 1ZESA 3V1MA 1P4RA 2WSYB 2XDAA 1QG6A 2OG1A 3PUJA 2NVWA 4UU7A 4IGIA 5IYZB 4HPJB 4PZZA 3L77A 4YS6A 1IN7A 2GETA 3CZQA 1QCZA 2F3SA 2I6TA 4ESEA 4OLFA 2QS9A 2MU1A 2GEFA 3R3VA 2BSAA 3C4QA 3COPA 4NJEA 1F3OA 3OE4A 4GXQA 1KOLA 1MENA 4G0QA 1IZ0A 1D9ZA 1SURA 2X6RA 3RROA 4WK6A 4R16A 3QE3A 1Q6ZA 5FUYA 4B5KA 1RJGA 3QNMA 3F6PA 2ZANA 2SNIE 2FWIA 3JAKB 5EHNA 3AUAA 3M8KA 4JP3A 5JAIA 2ANBA 1GFZA 3PUHA 3P9ZA 3QX9A 2BAGA 4P35A 4XDHA 3RODA 1O8BA 1PWHA 1T2DA 3D5QA 4WZAA 3AW8A 9LDTA 5JZSA 3T0FA 3K9NA 3VR5H 4RPJA 4JS0A 4L28A 1WZEA 4K6MA 2OORA 1VIAA 3IEUA 4LF6B 1ENOA 1PZEA 2NO1A 1LBQA 3SQMA 2P0AA 1Z2AA 4IZOA 4MRNA 1KS9A 2C2ZA 4Z4QA 1G0OA 3BDAA 4U8GA 1UWLA 1FSFA 2ZWOA 1NYLA 2IU6A 2QVBA 3U3KA 3UJBA 4EW1A 2KE5A 2IE0A 2GJAA 1PX0A 2QPAA 3V4PB 3VOSA 1SZDA 1XA3A 4CI9A 4X65B 3SHVA 1PK9A 2AOUB 1YQ9A 3FJOA 4MDHA 1I1OA 1G2PA 1LV8A 2YWXA 2QTNA 1NJGA 2WJWA 3CT6A 4FDAA 4A8JA 4QFCA 2P27A 4KAFA 1MJGA 1NURA 1O4VA 5BR7A 1SVNA 1ZJJA 5AW9A 1GCOA 4QXOA 1E6EA 4CF4A 3M5DA 4OM7A 2BEJA 3H8WA 1IBRA 3IEPA 2J3JA 1EX6A 1N2ZA 2N75A 2VUTA 2YJ5A 4MV3A 2GZ1A 4RU1A 3X1XA 1G38A 4P3NA 3TK1A 5FUQA 1C1XA 3GY0A 1OBVA 4CETA 1X1AA 1FIUA 4V0RA 1V71A 3AYZB 3E18A 3MUOA 1C1DB 1T9CA 1YBVA 3L7MA 3NHAA 1BA3A 3UMRA 2PR2A 1U65A 3G8YA 1AB5A 1JZSA 1UZLA 4QQ8A 1GQRA 1HURA 3DE3X 3L18A 4RK7A 5JD5A 3KKNA 4HWTA 1P0QA 4F5ZA 4Z0PA 2A3RA 1WSWA 1H1LA 2VZ8A 4NYJR 3W8NA 3ZY4A 2G9QA 4E1AA 3GI1A 3QITA 1XZCA 2X41A 1XYYA 2WJJA 2LTAA 3D7LA 2GA8A 3MBIA 4JIMA 5EIBC 3OEEA 3RRMA 4IF4A 3UAYA 3V9PA 4X41A 2IXFA 3GVXA 1M74A 1NYQA 4TKVB 1W88B 4TLAA 5D7NA 3PJRA 4RMNA 4RY2A 4G81A 3GEMA 4C0AC 1VB3A 4OEHA 3GGDA 4BWFB 3EFBA 1RKXA 2IX9A 3IIIA 2P9CA 4FFVA 1E2DA 4INPA 2Z3WA 2UXCB 4BZQA 3CRW1 3FRIA 3A28A 1RSZA 4R8VA 4YIHA 4TTSA 2HPVA 3G17A 1ZMBA 3TR6A 3B1YA 3G59A 1W93A 5B55A 3CCBA 3IPCA 3T7JA 3VR5A 3AKYA 3BMXA 5CIWA 1DWUA 4YCAA 3WYBA 1ITZA 2AXQA 1ZD9A 5CVCA 2FDXA 1SU7A 1T4GA 1RVDA 1HH4A 3PTZA 3DH0A 1FYFA 5F1KA 4PHTA 3TNYA 1WNFA 4DDTA 4NKRA