3I6QA

Structure of the binary complex leucoanthocyanidin reductase-nadph from vitis vinifera
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
307
structure length
291
Chain Sequence
GRVLIAGATGFIGQFVATASLDAHRPTYILARFKALEDKGAIIVYGLINEQEAMEKILKEHEIDIVVSTVGGESILDQIALVKAMKAVGTIKRFLPSEFGHDVNRADPVEPGLNMYREKRRVRQLVEESGIPFTYICCNSIASWPYYNNVLPPTDFFQIYGDGNVKAYFVAGTDIGKFTMKTVDDVRTLNKSVHFRPSCNCLNINELASVWEKKIGRTLPRVTVTEDDLLAAAGENIIPQSVVAAFTHDIFIKGCQVNFSIDGPEDVEVTTLYPEDSFRTVEECFGEYIVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and catalytic mechanism of leucoanthocyanidin reductase from Vitis vinifera.
pubmed doi rcsb
source organism Vitis vinifera
molecule tags Oxidoreductase
molecule keywords Putative leucoanthocyanidin reductase 1
total genus 96
structure length 291
sequence length 307
ec nomenclature ec 1.17.1.3: Leucoanthocyanidin reductase.
pdb deposition date 2009-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05368 NmrA NmrA-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3i6qA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3i6qA02
3MWEB 4CLOA 4J9UE 3GQVA 3IKTA 2R00A 4Z0HO 3ONFA 5THQA 3KB6A 5G4KB 1VL8A 1E77A 2GF2A 1GADO 4AJOA 1C0KA 3E03A 4TMFA 1ML3A 5HBRA 1VLLA 1NQAO 2ZB4A 1MLDA 3I6QA 5LDHA 1N9GA 2D8AA 4YJGB 2C54A 4YAEA 2E82A 2FMUA 1MUUA 3F1KA 1I2CA 1ONNA 2WEKA 4GWGA 4WECA 1RWBA 4S3MA 5H81A 5C5IA 3VZPA 3JQ7B 3K73O 2G82A 3QVXA 1KY4A 1I3NA 1VKNA 3C3XA 4YAGA 1PGOA 1PL7A 4MVJA 2VHVA 2ZKLA 3GA0A 3EDMA 4UUOA 1LSSA 1KOLA 1CJCA 2FPGA 2X23A 3AW9A 1R6DA 4NFSA 3F46A 4D3SA 5KJ6A 4CM5A 2NACA 1GZ4A 2Q3EA 1BSVA 3GUYA 3Q6IA 5TJ9A 3NT2A 1L1FA 5BNTA 2VTEA 1MX3A 4QT0A 4QECA 2WWRA 1SBYA 2PKQO 4Q3NA 4BO7A 1ZH8A 2PZJA 4GVLA 4XDZA 4EJ0A 1GQ2A 1MP0A 4TQGA 4L8VA 1PZHA 5BNFA 3A28A 4BB6A 3PHIA 3JD3A 2HRZA 3A9WA 4L4XA 5KVVA 4CMIA 4FD3A 3PWKA 4L73A 1A5ZA 1Z73A 4R01A 3H6KA 4KDEA 1YL7A 2R00C 2NUAA 3L9XA 1CETA 2HUNA 4BKRA 3JYOA 3JQGB 3K31A 4YT2A 4BIIA 4JP3A 2X0NA 1F8FA 3G0OA 4JBHA 4IXTA 4E5PA 5ICSA 3S2EA 2IODA 3BXXA 1P74A 1YBMA 4YT8A 3GDOA 3U0BA 5I9NA 1NYTA 1UR5A 2JCVA 3E6AA 1DO8A 2BFOA 4CMKA 5G4KA 1KVSA 3ANNA 3RBXA 3L6OO 4FFOA 3QWFA 3HFGA 1ENOA 5CEEA 2VZ8A 1T26A 1N1EA 2EGGA 5A05A 2CSUA 2VWPA 3BA1A 3H3JA 2DU8A 5JW6A 1ENPA 2VNSA 1E7WA 3VZQA 3KOUA 1YBAA 2P5YA 3SEFA 3GVIA 1HE5A 4YEDA 1DIAA 3GDGA 4B4OA 2DBQA 3GF4A 3MTJA 3WYCA 4BNXA 3AM4A 1P1FA 5JE8A 3LC7O 1F12A 1WNTA 2JFFA 5JFOA 4W6ZA 4D79A 2VZ9A 4ID9A 2GN6A 1PJLA 3HUDA 4LK3A 2BRUA 3OP4A 3JV7A 4MP8A 3SXPA 1S6YA 5TJHA 2JAHA 2H5LA 4DIBA 1O6ZA 1UZNA 4JNKA 1GY8A 3RUIA 4ALJA 2R6JA 1LJ8A 1KEUA 1HSZA 4IZHA 4R1TA 1UDBA 1ID1A 1O95A 4FOOA 1LLUA 5CAEA 2OUIA 1SEVA 2WYWA 1GU7A 3B1JA 3LLVA 5I9MA 4EITA 3P2YA 4O6VA 1ZCJA 1WLYA 3FF4A 5U1PA 5JMWA 4OGWA 1HT0A 3L6DA 2PGJA 1NVMB 1U7HA 3I83A 1MG0A 4ZHSA 3OJLA 5ILOA 4YWJA 4DL9A 3OJOA 4DPMA 2CNBA 3RBVA 1BXGB 4CLDA 2AEJA 1YDWA 1ZXLA 3I9MA 3OIGA 4J2OA 2PD6A 2NTNA 4FOSA 3VZSA 1TI7A 4W7IA 1B16A 3ON5A 3QJ5A 2GCGA 3TNLA 4B3JA 3HN7A 4URFA 4XQCA 3RC2A 5IXYA 4TRRA 5JC1A 4A0SA 3C7CB 4R54A 3R3SA 2VZ0A 5ENVA 4M1QA 1UUFA 4FDAA 1U2GA 4A27A 3KEQA 1E3WB 2DTEA 1GYRA 2VWGA 3U4HA 5KVSA 1R4MA 2EW2A 4WLVA 2NSDA 5KJFA 1Q1NA 2EERA 1V3UA 5JC8A 5GZ1A 5ICMA 2DFVA 4WOJA 4D45A 3F47A 2VQ3A 4BB5A 3MOGA 1U9JA 4IDEA 3VZRA 5T8KC 4J91A 2DC1A 4WCDA 3KHUA 4DQVA 3H3FA 1MFPA 3MCVA 4BHTA 6ADHA 1V8BA 1GCUA 4G2NA 4XQGA 1PSDA 4XZ3A 3TSCA 3UCXA 4H16A 3WLFA 1VJTA 2CD9A 1HWYA 2HMWA 1ORRA 2Z1NA 3U49A 2B4RO 4H3VA 4YQZA 4BNLA 4EDFA 5L7TA 4Z0PA 1OFGA 3I4FA 1GYQA 2ZB3A 4OQYA 4Z3DA 2AG8A 2QRLA 4EEXA 3ABIA 1DIRA 3IOYA 5IG2A 1JKFA 1Q7CA 2PGDA 3D1LA 4BV9A 2I76A 5A9RA 1KC1A 4PG4A 5JNLA 4L76A 2NU6A 3DBRB 5HTOA 2DQ4A 1F8GA 4TRMA 1JVBA 2BGLA 4RDHA 1C0LA 2HK8A 1EE2A 4IDFA 4IM7A 4OL9A 4WLFA 4GBJA 4M87A 5FFFA 1EUZA 4CMHA 2FZWA 1DFHA 2EHDA 3E9NA 1EMDA 1PJ4A 3FPCA 3PGXA 1KETA 4E5KA 4EJMA 4EW6A 4PG8A 4OMUA 4XRGA 2IZ1A 4LMPA 4WLOA 4BNHA 3PK0A 2XXBA 3KZVA 4QX6A 1UXKA 1B26A 4IJVA 3GVCA 3WYBA 1X15A 1AN9A 1QYDA 3D5QA 3LC2O 2CY0A 1LXCA 3GG2A 3PHHA 3VH4A 3GR6A 3MOIA 5TIIA 5GZ6A 4WUVA 4XD2A 2AQKA 1M67A 4DQXA 5L95A 2RIRA 4GLOA 4BO3A 2I5PO 3NTOA 4DBZA 2UAGA 1PJ2A 3D3WA 4YRBA 1FDSA 3GEDA 3PLNA 3Q11A 2OGUA 3WGGA 3PRJA 5BSGA 4ALIA 3H5AA 4P4NA 2ZCUA 1WZEA 3OF2A 4PVCA 2AQ8A 1LTHR 3NJ4A 5JDIA 1L7EA 3JSAA 4H7PA 4BS9A 2F00A 4I08A 4PLCA 1BMDA 3FNGA 3IIEA 3D7LA 4MP6A 4KOAA 4O63O 1A7AA 3QVOA 3FNEA 2C59A 3NJ8A 2WYVA 2C07A 4RV9A 4L4RA 3WQSB 4A2CA 1XA0A 4JXKA 1U3VA 2DT5A 3U9LA 2IYPA 4W99A 5EESA 1B14A 1HF3A 1HXHA 2EW8A 2TMGA 2RBEA 4UVIA 4GKVA 3TZHA 4LRTB 2RAFA 3RI3A 2PTGA 4CV1A 2WE8A 1WMAA 2EV9A 4XJTA 4JJGA 3C8MA 1BW9A 3EMKA 1Z6ZA 1XKQA 3TPCA 4CR7A 1HZZA 1NAIA 3LQFA 4BO9A 5HWSA 4FFLA 2RHRA 3JQBC 2YDYA 1LDEA 3ETEA 3F1LA 4CM3A 2W98A 3FRJA 4Z9YA 3SLGA 1P0FA 2D5AA 4IUYA 1GUFA 1ZEJA 3NDRA 3DOCA 3H9UA 3ADOA 3WFJA 1QYVA 3D3WB 4JQCA 4FQ8A 1XWFA 5BSEA 4MIYA 1Y5RA 3HDQA 5ADHA 3PHJA 4IJWA 2QRKA 4G5HA 1ZK4A 4II2A 1WDKA 1C0IA 1E7YA 2VHWA 4IIUA 2ZTVA 4MIEA 2PLAA 1DDOA 3U09A 1D4FA 2EP7A 4JBIA 3AK4A 3L6EA 4FGSA 8LDHA 2DTXA 2DPGA 4XB1A 5DNAA 3WDSA 4GAEA 4C7JA 3JYPA 4TKLA 5KIAA 1YE3A 1A9YA 1EDOA 2EJVA 4NK4A 4PLPA 4BQRA 1V9LA 3NT4A 3GZNB 5KVQA 4IPTA 1LDGA 4HFJA 2O4CA 1V35A 1ZEMA 2C5AA 4INAA 4WNCA 5TSDA 3R0IA 1HYGA 3E82A 4LSMA 1AHHA 5IF3A 2AHRA 4WOKA 1EVJA 1O8CA 3B20A 3KTDA 3VHRA 1G1AA 4OXNA 3SVTA 5L9AA 4AICA 1I2BA 4J4TA 5DCWA 3DBHB 1Y6JA 4OKIA 4UEKA 1PIWA 3PJDA 1XELA 1J4AA 4IMRA 1NQTA 2B83A 2XF8A 1KBZA 1LSOA 1AUPA 4DLAA 3ZV3A 4BNFA 4ND3A 5CDGA 1VL6A 1XQ6A 2DM6A 2G1UA 4D43A 3FCOA 3BMOA 3RUCA 4KTTE 2VT2A 2AXQA 4A5OA 1FK8A 2VWHA 2X9VA 4IQGA 2YHIA 2JCXA 2ZTLA 4Q3CA 3RC1A 3WOHA 3TOZA 1P1RA 4ZVVA 3QWHA 4XJSA 1T2EA 2VTDA 4YJFB 1Y8RA 3W4JA 3VH1A 4J4HA 4CQLB 2VN8A 8ADHA 3VDRA 3IJRA 3DAPA 4AJ1A 4RDIA 4RPHA 1H0KA 3PDJA 4DBVO 2B35A 3BTVA 2ZTUA 4UVEA 3MJSA 4YT4A 4M86A 4P38A 1LRLA 2HAEA 3OQBA 4QEDA 5G2OA 1GFSA 5MDHA 3FR7A 4JBGA 3AU9A 1G0NA 2PZKA 4W4TA 3D4PA 3H4VA 1JKJA 2D3TA 5JAIA 1Z45A 4ZQGA 4EBFA 4NJOA 3M2TA 4CLXA 2ZQZA 1V0JA 3DOJA 4B8WA 1UXJA 3KUXA 1ADGA 1P3DA 2Y05A 4R3WA 3JQ7A 4BOYA 2ZCVA 3W8DA 4RF2A 3PI7A 5JAZA 4EJ6A 5L4SA 4JK3A 1SZJG 2HMTA 2BF7A 3EZLA 3KSDO 4AL4A 1OBFO 4UUPA 4NZ9A 3WGIA 3GRPA 3KXDA 5JPIA 4D44A 4NI5A 1E6EA 3CKYA 2XOXA 2O7QA 4BNIA 1Y7TA 3AWDA 4R16A 2IXBA 2O2YA 2X22A 3SLKA 4IDGA 4K9DA 3WNVA 3LDHA 2IYOA 4M54A 3ETDA 3QQPA 4OSPA 1W6UA 1ZXBA 2OL4A 4NK5A 1PS9A 4OQZA 2NVBA 5A9TA 4HFNA 4BGIA 4WASA 1CQIA 3E5RA 4FFMA 3TN7A 2YFHA 2Q46A 5DDIP 3VTFA 2O50A 5KJEA 1TEHA 4RL6A 4AJ4A 4NR0A 4GSLA 2CUKA 4IJUA 4ND5A 3WYEA 4M8SA 5TS3A 4J1QA 3K6JA 3RUFA 3KVOA 3KYDB 3BIOA 4U6SA 1RPNA 4P4GA 2H1SA 4IDCA 1KEPA 1QR6A 3OBBA 3A1NA 3QWBA 4QFDA 1CIVA 4L0QA 4K28A 4RLSA 2C2YA 3M1LA 3GVPA 3S1LA 4PLTA 3ZWCA 4NNJA 5JAMA 2FWMX 3VVBA 3HADA 3DBHA 5JBIA 1ENZA 3NDIA 4BKPA 4DTIA 4TRNA 1GAEO 3FWNA 3RJ9A 2JHFA 4UVGA 2WDZA 1PQUA 3PHGA 5ES3A 4DIOA 2DUWA 3UICA 3DAFA 3PFWO 1P1HA 1R0KA 3ROQA 4ND2A 1F06A 3UW3A 5IXSA 4DGSA 2VNAA 4AJEA 1DFIA 4I8XA 4JROA 1BWSA 5FWNA 4QQRA 1H6BA 3Q3CA 5TT0A 2WD7B 1PQWA 3ZW9A 2HSDA 5JO0A 4Q3DA 1YKFA 1ISIA 4GSKA 4XYLA 1Q0HA 2V6FA 1Q2XA 1SMKA 1UXGA 3O38A 3KSZO 2OO5A 4LW8A 3ZWVA 1DRWA 1E0DA 3PWZA 1SNYA 2YQ4A 4BNMA 4DVJA 1MA0A 4MVJP 5AXBA 2E49A 3ZNQA 4OOEA 3INRA 1E1NA 3CZMA 5A4DA 5ITWA 1MGOA 1ZSNA 4RPLA 5L51A 1IOLA 2HQ1A 2UVDA 1FDUA 4B7UA 2HRBA 5JCJA 1GCOA 3EC7A 1YOVB 2G5CA 4MVJF 1HDOA 4XR4A 3CMMA 1XHLA 2FOIA 4Q9NA 2Y67A 1PJBA 3P19A 4DYVA 2CMDA 4RF4A 3HG7A 2OORA 2GZ1A 3BMOB 1FJHA 4ITUA 5DF1A 1LNQA 1PJ3A 4YJGA 3TFOA 2O3UA 1IPEA 5THKA 1E5QA 1W73A 3V2HA 3MJTA 3ZCXA 5C7LO 3ZWOA 3TQHA 2I65A 4NPCA 3ZGYA 3ZWAA 3U4CA 4CV0A 1ZUD1 1VC2A 3BMQB 3T7CA 3VPHA 1DJQA 4HWKA 1ISGA 1YONA 1PTJA 1P1JA 2LDXA 1E1KA 2Y1EA 3ENNA 2PFGA 1EDZA 1JAYA 1PZEA 1CYDA 3ZWMA 1J49A 2GN4A 4GX1A 1EK5A 1R4NA 4C4OA 2C82A 3EGOA 3I9NA 3PHLA 3PXXA 4J6FA 3FTPA 3GZNA 4QUKA 1K2WA 1PWZA 4BMNA 5G0SA 2Q1UA 1EEHA 1PL8A 3L4BC 3AU8A 1UZLA 2GGSA 3ANLA 4IZIA 4MP3A 2EGHA 3O9ZA 3JQEA 3SJUA 3DR3A 2G17A 3DBLA 3GOHA 4WEOA 2Y66A 3HFSA 2YUTA 1V3VA 3O8QA 2PD3A 4J49A 4NG5A 3A4VA 2Q99A 2FY8A 3H7AA 1BVUA 1HE2A 4PLZA 3FHLA 3CH6A 4A26A 4CUKA 1E7MA 5HA5A 1M6WA 1YOVA 4F6CA 4KUHA 3RU9A 4N5MA 3COSA 1GV0A 5LC1A 2RHCA 1B0AA 1ARZA 1E6WA 4N54A 3PYMA 1X14A 3OJFA 4NBTA 4JJFA 4M89A 2GUGA 1PGQA 1WP4A 4I9UA 3P5SA 4XIJA 3WS7A 4NU5A 5DULA 2W2KB 3G79A 2VUTA 1JWAB 2QIOA 2NLOA 3BTSA 1DHRA 4TWRA 2QX7A 4U0JA 5AXAA 3L4SO 3NX4A 3M2PA 1M2WA 1HEUA 3BMCB 1UXIA 1T2AA 1DC5A 3I9LA 3KBOA 3ZHXA 2O3QA 3DEYX 1LC3A 4TZTA 2UV8A 4Z3KA 5CDSA 5DCYA 4F6LA 2GSDA 4TVBA 1Q0QA 4BO2A 3GNQA 1SPXA 4YXFA 5TNXA 1QLJA 4RCVA 4XCVA 2C2XA 1LUAA 3CPSA 4W7HA 2CDCA 4IS2A 4BL5A 4BKUA 3RBZA 3TJRA 2ZYDA 3N58A 3AUUA 3CINA 1PJSA 4BGEA 4G81A 3SBOA 5CDTA 7MDHA 2ILTA 3ZU5A 3JCZA 3ZV5A 4YCAA 3U4DA 3FPLA 3ZN2A 1C3VA 3R6DA 3IJPA 4KDFA 4BNNA 2H9IA 4PIVA 3RC7A 2Q45A 3NT5A 4E13A 4MVJG 2W4QA 4XA8A 5T67A 3N7UA 5BQFA 3CMCO 4CQMD 2BELA 3K2EA 3ZHZA 5K6AA 3Q9NA 4TSKA 3GGPA 3ZHBA 3WSVA 4LN1A 3WR5A 2Y1DA 5FF9A 4EUFA 1XG5A 3IMFA 2I66A 4FIZA 4HX5A 1EVYA 1SAYA 2FPIA 4YB8A 3TL2A 3WXBA 4WNIA 1DLIA 1YXMA 5IZCC 3GUCA 4Q39A 2YW9A 1NPDA 3HDJA 4CMJA 4PLHA 4PN3A 1ISMA 1Y8QB 1GEGA 2AG5A 4MVJE 4QTZA 3UUWA 3HNPA 3QP9A 4UVHA 4AJIA 3M1AA 2P9CA 3NV9A 5T5QA 3ZU2A 3AJRA 3DBRA 5B4VA 1H9BA 5L3ZA 5TGDA 4YVFA 3GK3A 4MVJI 1J5PA 4AJPA 5AQ1A 4R9RA 1XU9A 4M55A 1ADFA 1UAGA 1R37A 1OMOA 2OZPA 4CMCA 1CEQA 4EEZA 2CFCA 3PJFA 4HXYA 5I7SA 5JXWA 2YQ5A 2X9NA 3H8VA 4O59O 4RVHA 3F4BA 4DWVA 4TKMA 4F3YA 1SB9A 1GTMA 1XGKA 1NXQA 4GQAA 3WGQA 4DREA 2Q1SA 3DZBA 5F5NA 1PZGA 2O3TA 1EZ4A 3DAGA 3Q2KA 4D42A 2GZ3A 3JD4A 3KEOA 4E12A 1JVSA 2C20A 1OAAA 3E9MA 1YWGO 3JQFA 3ZU3A 4YYZA 4N18A 4E6PA 2FSSA 4WGGA 3V1TC 1I36A 4CMEA 1I24A 1XLTA 2O7SA 4PZDA 1HE4A 2E6UX 1NFRA 2X7HA 3BTUA 3EVNA 1TLTA 5KKCA 4NH4A 2QW8A 3KM0A 5CPBA 4NBUA 1Z74A 4IGFA 4OAQA 4GMGA 1BG6A 3KLPX 1U28A 1H5QA 4BQPA 1K6IA 3LVFO 2QYTA 2VRBA 4A10A 3GC6A 1ISHA 4AJKA 3QWAA 3WGZA 4WE3A 1AGNA 1ZNQO 1D7OA 1X7HA 4UVDA 4BGVA 5CHEA 4OSOA 2B36A 4ZQEA 4CL8A 2W90A 4Z9XA 1P33A 3LT0A 4RVGA 4CM9A 3C7DB 3MEQA 4ZN6A 2B37A 3PDUA 2VHYA 3D0OA 1WW8A 1R0LA 4NIMA 3ZV6A 1BVRA 1YQDA 1FDWA 1DIGA 4J0EA 3GLQA 1E3LA 2ZJ1A 4ROSA 3VPSA 1C1DA 1WDLA 2Z95A 2EIHA 1BW9B 2JFGA 3HB5X 5EINA 4CODB 4CV2A 3BHIA 4KQXA 4L9RA 1MC5A 5AXDA 2ZIZA 4IIVA 1O0SA 5I8ZA 1SCUA 1JTVA 3EHEA 1K6JA 1BRMA 4DMMA 4K6FA 3IQDB 1I0ZA 4JLWA 3WICA 4J1SA 5C37A 2X0RA 1GR0A 3I9OA 5DN9A 1IY8A 5H83A 2ZTMA 5C3MA 4RZHA 1R0SA 1IZ0A 4PCVA 1LLCA 1PL6A 2VYVA 4IS3A 3T4EA 1KY5A 5GMOA 5CDUA 2OOSA 4XKJA 1WWKA 2GO1A 3H65A 1H94A 4GKBA 5JY1A 2ZK7A 3DZGA 2E48A 2NVUA 3GPIA 3OA2A 3QIVA 1DB3A 1E1LA 3IAHA 3RC9A 3D5TA 3UOGA 3AOEA 1K0UA 3KETA 2UDPA 1GZ6A 5HS4A 1MFZA 1ULSA 1OOEA 1EUCA 5F1PA 5G4LA 2B5WA 3TFQA 1JU9A 1H6AA 1X13A 4D0SA 4ZJUA 1D1TA 2Y1FA 3CSDA 2ET6A 4I1IA 4B3HA 3ZHYA 3LF2A 2G76A 3EYWA 3DMTC 3KYCA 5JYEA 3W8EA 1LRKA 2CF6A 3UCEA 2X5OA 1VSUA 2V6MA 4JGBA 4RZIA 1DC6A 1P1IA 2X5KO 5A9SB 3S55A 2B0JA 2Y1CA 3HN2A 2WYUA 2HLPA 4TROA 4UULA 1PU2A 1VKOA 4N7RA 3GFBA 3DTYA 4C7KA 3PYXA 2NU8A 5K0ZA 2YDXA 4U5QA 4R1SA 4MIOA 3I9JA 4I5GA 4YPOA 3PQDA 5DOVA 3I3OA 3QW2A 4HKTA 4QO7A 1DC4A 1YVEI 1I32A 1SOWA 3OJEA 4FGWA 3IL2A 3FBGA 1B7GO 2HCTA 3IC5A 4RVDA 4EZBA 4UREA 2FP4A 1DC3A 2NVWA 2ZB8A 4IINA 4ZU3A 4K1LA 4CJXA 5DP2A 1AE1A 4GMFA 3PVZA 3JQ8B 4EGFA 1ZKMA 2JFHA 1QLHA 3RUEA 1ZSVA 2O48X 1PJQA 1XQ1A 4I9HA 1NBOA 4OXYA 4XWYA 3FNFA 2BKAA 3WLEA 3ZNOA 1E3IA 1ZMOA 4ALNA 4YQYA 1AXGA 2ZB7A 4Y8VA 3RSHA 1DXYA 2I3AA 1LX6A 3DL2A 3P7MA 3WQRA 3ROKA 1FMCA 1MG5A 3WX0A 4E0BA 3U5TA 1PGPA 5AXCA 4W9NA 4BV8A 1HZJA 1JAXA 3MWDB 4D7AA 1E3SA 2Q2VA 4FFNA 3ZNNA 5B4UA 5JY6A 4N5LA 2X58A 5GZ3A 4MDHA 1KIFA 3ZWXA 4ALKA 1I5RA 1OC2A 2DBZA 4XB2A 3ZZNA 2YY7A 4XYBA 2O2SA 5DBGA 4MVJD 4AJNA 2GDZA 2X9GA 3W8FA 3ICPA 4R4JA 4RJTA 1ZFNA 4HP8A 4LCEA 3JQ9C 2A35A 5KJ1A 3DZJA 1DRUA 2VRCD 3MTGA 4OHUA 3RUAA 3VKUA 3ZW8A 1B3BA 3IKVA 4FS3A 3JQFC 2OBNA 1T2DA 4O0LA 3RFXA 3NGXA 1EE9A 4WCFC 4CV3A 2WMDA 4AFNA 3MJ4A 4J2HA 3NGLA 1B8PA 3DXFA 2PZLA 3ZI0A 2IEBA 3TF5A 3EAGA 4CLRB 2YV1A 3ITKA 3S8MA 4TVOA 3GH3A 2HDHA 3E9QA 5IDWA 1V6AA 4GLLA 2GPTA 1DPGA 3SX2A 5A06A 4GX2A 1LC0A 4RF3A 5T57A 1MC4A 2HJRA 4HNGA 5L45A 1KERA 2UYYA 1QYWA 3Q1LA 2D59A 1H2BA 4X54A 2VRCA 4MOWA 3KYDA 1ZBQA 3HDHA 5HS6A 4WLUA 3OA0A 1EQUA 5FI3A 4DXHA 4B8ZA 1HDYA 2X0JA 3QRWA 3E5MA 1EFKA 2HJSA 3A06A 3I9KA 4XEHA 2BGKA 2V6BA 1DAOA 3DBLB 1RYDA 4R69A 3FSRA 1U3WA 1GEEA 1YJQA 3STHA 1VM6A 2PKRA 1ZVMA 1R16A 3I23A 4J16A 3D64A 3OH8A 1I10A 1I30A 3WMWA 1Y5MA 2PH5A 3V1UA 3C1TA 5A5EA 1E3EA 1SO8A 4EI2A 4OM8A 2J5KA 3DDNA 1DRVA 1U3UA 4R5HA 5COAA 5TT1A 3HSKA 5L7WA 1U8XX 4AJJA 1WAMA 4IQ8A 2GN8A 1E7QA 5I7FA 5A5FA 5A03A 3GT0A 3VH3A 2GN9A 2GD1O 1YGYA 2E37A 5I7EA 1O5IA 3D3EA 1NX6A 4K6CA 2PV7A 3HJAA 2OHXA 3OEWA 1HDZA 3PJGA 5G0TA 5IZ4A 1GQYA 4J7UA 5TX7A 1DIBA 1NWHA 2Q1WA 2QHXA 5J23A 4J4BA 3JYNA 2IXAA 3WIDA 4D3FA 3JQ9A 2CZCA 5T6BA 3P2OA 3BYZA 4Q3AA 1LDBA 2QZZA 2TMDA 5F1OA 3S2IA 3KRTA 5JMPA 4BMVA 4E5YA 3OQ1A 2GZ2A 4MKZA 3Q9UA 5K6AC 3F6YA 1IE3A 1ZJYA 3H9QA 3L77A 3IS3A 3CZRA 4Z6KA 1GUZA 1CRWG 2Y0DA 3SC4A 3WSWA 3OIDA 2AQHA 5I7VA 3ANMA 2C7GA 4O1MA 4U0KA 1CDOA 1Z7EA 4JCOA 3W1VA 2YV3A 2WM3A 4PFJA 4QFCA 1AXEA 4J90A 3FI9A 4CM6A 4NFHA 5MGBA 3T4XA 5TLSA 2VUUA 2QRJA 3RAJA 2A4KA 4E4YA 2J3IA 2F1KA 3RJ5A 4BO5A 4R68A 5TRTA 1MXHA 1PX0A 4QO8A 4Q3BA 2D1YA 1MB4A 1E3WA 1U4OA 3OIFA 4WLEA 3GEMA 3L9WA 3RUHA 3CXRA 5TC4A 4BNZA 2AE1A 4I9NA 1S7CA 3D4OA 2AEFA 4P4LA 3DC2A 3OMLA 2CVOA 2OMEA 1O9BA 4GGPA 5KOIA 3INGA 1U1IA 1T25A 5KNLA 5L53A 3ONDA 4PG5A 4QSMA 4D41A 1G6KA 3LU1A 2CDAA 4YBZA 1NHWA 1N7HA 4I5DA 5C7IO 4XIYA 1A9ZA 1ZSYA 4JP2A 3PGJA 1Z75A 2BH9A 4BNWA 3GAZA 4ND1A 1E5LA 4I5EA 4PLWA 4E21A 4R9SA 2NVUB 5B12A 4CLRA 3PZBA 3SC6A 2YFQA 3PYLA 4XGIA 1W4ZA 5BSFA 3RQSA 4E3ZA 2R2GA 4YTEA 3RFTA 4XYGA 3PEFA 3W4KA 2B69A 1IZ9A 1N8KA 3K92A 4E32A 1A72A 5U9CA 2GR9A 3OSUA 4NJMB 3G1TA 4OXKA 3C1OA 1NR1A 1RM5A 2XPCA 1IL0A 3QA9A 1E6UA 1T1SA 3F3SA 3ST7A 1DIHA 4GX5A 4ZQFA 4DRYA 2AQIA 1FDTA 4Z9FA 3HZZA 4CUJA 2CF5A 2BFAA 4MKRA 1RKXA 3DB2A 1JDJA 1HDCA 3GVXA 1P31A 2NU9A 3WGYA 1YJ8A 2WJPA 2H6EA 4NHEA 3UVEA 5JYDA 1D3AA 3PZRA 4B7CA 5COBA 3RASA 1RJWA 2EXXA 3PFFA 1U7TA 4XQEA 3PIDA 2CVZA 4KMSA 1N2SA 1CWUA 1NTOA 1NPYA 3GMSA 4OJNA 3UCFA 4CMEC 1TT7A 3H9EO 5AVOA 1E92A 4OIMA 1EVIA 3NAQA 5IDXA 4FC7A 1Y8QA 2DBVO 5JAQA 3HWRA 3PIIA 5DZSA 5AYVA 4E5MA 2HK7A 5FYDA 2O3JA 1PS8A 3AM5A 1JN0A 4GPD1 2IDZA 1U5AA 2Y0EA 3MJCA 1YQXA 3WJAA 3U3XA 3X2FA 4CLHA 2J8ZA 5JDIC 1HDRA 4R41A 4NBVA 5A3JA 1LQUA 1PR9A 4RVUA 1ENYA 3F9IA 1LU9A 1PQPA 4CMBA 5F1KA 1LQTA 3LT2A 1O94A 3AY3A 1HRDA 3WB9A 3I4CA 4MKXA 4CR8A 3GEGA 4KUGA 4LMRA 3RROA 2YV2A 3RFVA 5CDYA 4IDBA 3DFUA 4DIFA 3GN1A 3RD5A 5EMHA 1NR7A 3M6IA 1WVGA 3JYLA 4ND4A 3PPIA 1WXDA 3VH2A 3VPXA 4DPLA 1TT5A 4CM1A 1N5DA 1JKIA 2PA3A 1H2HA 1ISFA 1HYHA 5F3RA 2OXIA 4E31A 2HKIA 5H82A 2GASA 2JD0A 4NFYA 5EL0A 1NWCA 2D4AA 4CLOB 4TRJA 1B15A 2VHXA 4WEQA 4CQMA 3WTBA 3V5NA 1TT5B 2HMSA 4DLLA 1YL6A 1P9LA 4JX8A 3DOOA 5BSHA 4BKQA 4RORA 4YT5A 3BMCA 3BHMA 2Y93A 4FN4A 3NYWA 2OP0A 1GQQA 4BNYA 1HLPA 4AJHA 2AW5A 3CE6A 2P4HX 4WKGA 4YDRA 2J5QA 3QVTA 4BKOA 4CQLA 1FXSA 5IN4A 1B8UA 1T2FA 1XDWA 4Y6PA 2GRAA 4YJDA 4KZPA 1EBUA 1GD1O 1KC3A 3DHYA 3E8XA 4RPKA 3LF1A 1TXGA 3VOSA 1VJ1A 2P9EA 3NEPX 1IYZA 1N92A 3LSYA 3S2GA 3WG9A 1HYEA 2C0CA 4WPGA 4S1VA 1QSGA 4Y67A 4N5NA 1IUKA 4A73A 3ZU4A 1V3TA 1XCBA 1TVEA 2Q49A 3ROMA 1T24A 1Y8RB 4YRDA 2BHLA 1PJCA 4J1NA 2XXJA 1GZ3A 3KLMX 2B4TO 1ZW1A 1DEHA 5IFLA 2B5VA 1A7KA 2W8ZA 4DA9A 1PS0A 2Q1TA 5LDGA 3LLSA 2O4UX 2ZJ0A 2Q2WA 2VCYA 2EJWA 3NTQA 2IZZA 3HDYA 1VSVA 4HY3A 5CG2A 1ADCA 3FR8A 3VC7A 1PGJA 4BVAA 2I9PA 3E1KA 5IN5A 6LDHA 1YBVA 4RGBA 1C1XA 3PQFA 1LDYA 3QWIA 1LSUA 3VDQA 2EKQA 1KYQA 4PRLA 1ZO8A 4Q3EA 3I6IA 3N74A 1VJ0A 5JDCA 2X8LA 2A92A 4H15A 3RIHA 3WGHA 3NKLA 4W82A 2PNFA 2UUOA 2XAAA 3ZV4A 1VE9A 1OC4A 1QORA 3F5SA 4ALMA 2FN7A 4GVXA 4PLVA 2IE0A 4RQTA 1OZAA 2D2IA 4IY1A 4FJ0A 1Q0LA 3BMQA 1N1GA 5LCXA 3AFMA 3GRKA 3L4BA 3AI2A 5CFZA 1DJNA 1GL3A 4ZD6A 2Z5LA 5L4LA 4JIGA 5EERA 4B4WA 1DHTA 1KVTA 1PR3A 1ZZEA 3DZFA 4CR6A 3CTMA 4LSWA 1C14A 4KWHA 5L7YA 2JL1A 3R1IA 4NBRA 2A9FA 5DBFA 2NWQA 1UZMA 1XSEA 4XYEA 4NBWA 5I9LA 4BNGA 5TQVA 1NNUA 2CDBA 3W6ZA 4F46A 3G3EA 5FI5A 1DSSG 4XYMA 1I3MA 1UXHA 4D46A 1X7DA 2FR1A 3W4IA 1DOHA 1N9GB 2GERA 2BMAA 2PWZA 4E2XA 4OH1A 1Q7BA 4AJ2A 3ASUA 1IB6A 1UAYA 3EVTA 1UP6A 2YJZA 3G17A 3B6ZA 1NASA 3OM9A 2J5RA 1ZJZA 3OICA 3DFZA 2C7VA 4DYDA 2AE2A 4IGEA 4ILKA 2W2LA 3K5PA 3QVSA 5BNIA 1I01A 2X5JO 4YJHB 2PD4A 2GNAA 1R4NB 2O3RA 1NHGA 4XGNA 5B37A 3IDSA 2J3KA 1X7GA 1UJMA 4P8RA 3GY0A 4JJIA 5EPOA 5B1YA 1A71A 4J7XA 3OJ0A 1M76A 5F5LA 2PKQP 4UUMA 3NUGA 1BXZA 1BGVA 4UEJA 4I5FA 1YDEA 3GDFA 3KYBA 4L75A 5ENDA 2P91A 2ZATA 4L4SA 2JKVA 1E7RA 2HO5A 5IDQA 5JCJD 3JD2A 1ONPA 1H93A 2NTJA 2H63A 1EUDA 1B2LA 3V8BA 5G0UA 2DVMA 3C1AA 3MZ0A 5GY7A 2ZYAA 2X6TA 3IUSA 4J1TA 4ZQHA 3ROPA 2I6TA 2Q4EA 2J3JA 1W8DA 1UP7A 1JW9B 3KO8A 2AEMA 4LGVA 5JCXA 2QZ9A 1ZMTA 3CUKA 3K96A 5I8WA 4U6QA 3LK7A 4PRKA 1ZK3A 2EKPA 4FPXA 3PLRA 4WK6A 3L0DA 4U8GA 3RWBA 4MPDA 2Y1GA 1QP8A 2QYSA 4II3A 2EWMA 3ZH2A 2B4QA 4NQZA 3UXYA 1LA2A 4FR5A 2PR2A 1LSJA 1C1DB 4CPDA 4PZEA 1PZFA 2W2KA 4OKNA 1T2CA 2EG9A 2FR0A 4DC1A 3FN4A 5IZCA 1QKIA 2BGMA 3CEAA 3B1FA 4ZRMA 4BNJA 1R4MB 3UKOA 1SB8A 4YAIA 4J9VA 2D0IA 2V65A 4GI2A 5KKAA 3R3JA 2UUPA 2NTVA 3QE3A 3GAFA 4K26A 2FR8A 2YHUA 1PJTA 2V6GA 2WSBA 4ZRNA 3AFNA 2NV6A 1GYPA 1DBVO 5C7OO 5KJCA 1KEVA 3A14A 3BMNB 3SJ7A 2BFPA 3B1KA 1H6CA 3H2ZA 2P9GA 5COQA 4DLBA 3DHNA 4R1NA 2NU7A 1NQ5A 5ITVA 3H9GA 4GL4A 3JYQA 3H5NA 1Y9EA 1M75A 1YO6A 3U62A 1RM4A 4WCFB 4RVSA 4BO1A 1JA9A 1KVUA 1EK6A 1X0VA 1NVTA 5EQDA 1LRJA 2NQTA 3GNTA 3RKUA 3Q2IA 3TL3A 4HUJA 1YRLA 4HFMA 1HETA 3WNQA 2BLLA 3BAZA 4KTVE 4WCFA 4WJZA 2PZMA 3WWZA 2IRWA 4MO2A 2VYVD 5L40A 2AA3A 4J0FA 1JQBA 1U2DA 3AOEC 4MINA 4FC6A 5EJ2A 3AI1A 4BNKA 5JLAA 4DC0A 2WD7A 3DBVO 3GFGA 3DWFA 5A9SA 3JD0A 3KYCB 3TZCA 2YHIB 1ULUA 4YAKA 4YJHA 4E2ZA 4E33A 4CQMB 4J3FA 1E7SA 4G65A 5BT9A 1ZK2A 3DTTA 3WQQA 1X1TA 3MJEA 4BGUA 1P45A 1RYEA 3U4IA 1YB4A 3WFIA 1EFLA 1XU7A 2JD1A 3HQ4O 5K9ZA 4EUHA 2Q2QA 4FB5A 3TZKA 2VYNA 2V7PA 3V2GA 3PP8A 4BNTA 1IHXA 1XR3A 3EW7A 5FEUA 1XIVA 4B3IA 1VRWA 2Y99A 3DO5A 3C7AA 4MJLA 3Q0EA 5G0VA 3OQ6A 2G0TA 1BXKA 5B4TA 3UN1A 1VI2A 3OETA 1LEHA 4CLEA 2BFMA 3GGGA 4XR9A 1QYCA 2Y68A 3TRIA 1KVRA 1H9AA 1HKUA 3WGOA 4AJLA 5CP8A 1NP3A 4ESOA 3PJEA 4IBOA 5ER6A 1HL3A 3DHEA 3GHYA 2FHSA 5DBIA 3JQAB 3K9QO 2O23A 3WMXA 4RVFA 1I2ZA 9LDTA 3F4LA 2DPHA 3RVDA 4YR9A 3IP1A 4ZGWA 4KP7A 1UDAA 1A4UA 2DBRA 4IMPA 4ZQBA 5EN4A 3VKVA 5HM8A 1U4SA 4R1UA 3AUTA 4NDNE 4YACA 4BO4A 3JQAA 1BHSA 1T4DA 3TWOA 3LT1A 4YAJA 1NM5A 1J6UA 5TF4A 3BHJA 3PQEA 3NTRA 1QV6A 4A7PA 4L74A 4IXWA 1FF9A 4ZICA 4RPJA 3X2EA 4DMLA 4WLNA 2VOJA 2YYYA 2VOEA 1CERA 4FCCA 4R51A 3LYLA 5T8KA 1WPQA 2OBYA 2GLXA 2PY6A 3JQGA 3ORFA 3V1YA 1U8FO 1X1EA 1QG6A 5KCZA 2X4GA 3PTZA 5EIOA 4KUEA 3ZWBA 4DQUA 1TB4A 4B79A 4FFRA 2VT3A 4OO3A 1ZIDA 4GWKA 1I3KA 4UEOA 2NADA 4RPGA 4FBGA 4CL3A 4TZKA 3RUDA 3AY7A 3AOGA 2JD2A 1HTBA 3JQCA 4E2YA 4U7WA 1U5CA 3HHPA 4Y6RA 5IDYA 1QV7A 2I3GA 1PEDA 2HK9A 1Q7GA 3QV1A 1P1KA 3B70A 2QQ5A 4NJMA 3KV3O 5IAAA 4LVUA 4O5OA 4EUEA 1R66A 3GMDA 1HDGO 2EP5A 3IP3A 4HADA 4R5MA 4CM4A 3K8ZA 1P77A 4BO8A 5HRUA 4KQWA 1UH5A 1Z7BA 3TDKA 1YH3A 2BD0A 1HLDA 3OECA 4YJFA 4E30A 3CIFA 4D0RA 5A1TA 4A03A 5JS6A 2X0IA 3BMNA 3JTMA 2EF1A 1ISJA 2JCYA 1YB1A 3H2SA 2VYND 3O8QB 4QXMA 3ULKA 3WIEA 4B7XA 3FNHA 1JLLA 4DPKA 5ILGA 1KEWA 3DQPA 1EQ2A 3E18A 3K30A 4PLFA 4BNUA 4XX0A 2PK3A 1QMGA 2JJYA 3FBTA 9LDBA 2Z1MA 2X1HA 3JD1A 5JSFA 5ER9A 1QRRA 2P5UA 3EY4A 3H9JA 4CM9D 3JQDA 1ONOA 2IEDA 1BTOA 4B4UA 1NFQA 2EEZA 4RLHA 1ZK0A 2NM0A 4XGKA 1NQOA 3AI3A 1LBEA 1LDMA 2OP1A 3GGOA 1NVGA 4M49A 1XEAA 2WTBA 2NNLD 3DZKA 4LCJA 4RO0A 1T1RA 2BI8A 3OEYA 2RH8A 1HDXA 1F17A 4YRAA 2DLDA 3D4NA 5F21A 2POQX 3C24A 3WJ7A 4PLGA 2FSVA 4CM7A 1F0YA 1K5HA 2HMUA 4IDAA 2SCUA 2GYYA 4BNVA 4PZCA 1NAHA 1CF2O 2A94A 3INTA 3BTOA 2DFDA 1D1SA 3ZDFA 2FPPA 3WWYA 1BDBA 3QLJA 1A27A 4OYRA 1LLQA 4MVJM 3C85A 3VTZA 4GH5A 1GDHA 1YL5A 3RU7A 1NFFA 4HNHA 3ZWPA 3ZWYA 3WBFA 4RQUA 4DUPA 3AUSA 5DP1A 1DFGA 1R15A 1QYXA 1WDMA 1NPTO 5CPFA 2HMVA 5KWEA 3DMYA 2WE7A 4NMHA 1RM3A 5JO9A 5DOZA 3WTCA 3FD8A 2LDBA 1SOVA 1K6XA 1VPDA 3S2FA 1OI7A 1KVQA 4W9NC 4NU6A 1P44A 3ZWWA 4IDDA 1R12A 3UHAA 1M66A 5A3VA 2BI7A 1KS9A 5CEJA 1ADBA 3TZ6A 7ADHA 1AHIA 3GNSA 3ONEA 5A04A 3MJVA 4Y9DA 2WD8A 4R3NA 4PVDA 5KTKA 4PG6A 1BDMA 3DMTA 3QHAA 1QXSA 4E2WA 4PLYA 3AUAA 1M6HA 3LC1O 3G49A 3O03A 2PGLA 3O26A 3T7EA 1IULA 2I99A 3LT4A 1DAPA 1GUYA 3HB4X 1MXFA 3I1JA 4ALLA 1EBFA 4J43A 3UH1A 3VAZA 4LISA 4LRSB 2QG4A 3GVHA 4CM8B 3FWZA 1CQJA 1VL0A 4FFPA 5DCUA 3JQAD 2E4AA 3VPFA 4HV4A 1PWXA 2OFPA 2DUUA 1XYGA 1T4BA 1YB5A 1C1XB 1IHYA 3GZ4A 2ZQYA 4GX0A 3ITDA 5A02A 1GPDG 3TOXA 4D3DA 4B4VA 4XQ9A 5JDCC 1LDNA 3AY6A 4IQ0A 3E48A 2ZYGA 1B8VA 3GHHA 3TZQA 1E1MA 2DAPA 2FRDA 4FJ1A 4Y98A 4ZA2A 3OFSA 4IJKA 5L4NA 1BXGA 1WMBA 2RCYA 4CUZA 2J3HA 2IZ0A 2Q50A 1SEPA 2VUSA 2PH3A 3I52A 3NDJA 3ADPA 5CEFA 1IPFA 1O89A 4RF5A 1P0CA 3DZHA 2FZEA 1RM0A 3H5RA 3K2BA 1F14A 3V2UA 1I8TA 3ASVA 2EKLA 3QY9A 3G1UA 2C29D 2DKNA 2C5EA 4E5NA 1Y1PA 4HBGA 1UDCA 1ZK1A 2NQ8A 3F5QA 1G0OA 5BR7A 4Z0TA 2AMFA 3UGKA 3UFXA 4EYEA 3WGTA 4FJ2A 1I33A 1A4IA 1LLDA 2JHGA 3JQ8A 3NRCA 1X0XA 4CMAA 3PWSA 5EQFA 3EZYA 3GN2A 3O4RA 3DONA 3UF0A 4FSHA 2DTDA 4Y6SA 1MV8A 5CG1A 4PG7A 2VHZA 1L7DA 2X86A 3KSUA 4XRRA 4CM8A 1TA4A 2Y0CA 1C0PA 2CVQA 1UP4A 3EK2A 3VPGA 3W6UA 1N7GA 3BZUA 4HFRA 4GGOA 4P22A 4BO0A 4XDYA 3ZNPA 3RCBA 1K3TA 4FW8A 2D5CA 3UAGA 1EVZA 5IJZA 4OOFA 1WZIA 3ETGA 4J7CA 4BMSA 3L07A 2O3SA 2RH4A 4CMGA 4PGFA 3RKRA 2J6IA 1SC6A 3JQ6A 1Y81A 3ENKA 4JN6B 5KVCA 2P2SA 1LI4A 2HU2A 1I3LA 2Q4BA 3AM3A 1E3JA 1Z82A 1PGNA 2Y1OA 2VWQA 5U4QA 5DT9A 4F45A 2JAPA 2W2LD 2I67A 3FTNA 4MVJH 4UUNA 3HE3A 4KWIA 4UAGA 3QSGA 4ONEA 1J0XO 1YQGA 1W0CA 3VVCA 1H6DA 1Y9AA 3WBBA 3I5MA 3OHSX 1D8AA 3DZIA 4YA6A 1HSOA 5T64A 3IUPA 3EUWA 3GPDG 3GG9A 4BUCA 1K89A 3LZ6A 4CMIB 1JWBB 1U3TA 1YS4A 2P68A 4BO6A 1FDVA 5AOVA 2P4QA 1HE3A 4AVYA 1B3RA 3QVWA 2YZ7A 5G0WA 3ICCA 3JQBA 1DLJA 1GPJA 4AG3A 3ZWNA 1GV1A 4CM4B 4LVCA
chains in the Genus database with same CATH superfamily
1IXRC 3WHPA 2FTKE 4QICA 3IKTA 2VSQA 2C3OA 2JFOA 2OK8A 3F8SA 4KFUA 3ONFA 5THQA 4I14A 4C14A 3PFIA 4I66A 4DM7A 1AGPA 5G4KB 2R79A 5BQOA 2JLWA 4TMWA 1X7XB 1YIDA 2J9XB 1UADA 3MB8A 1E77A 4DMKA 4PO9A 4GR5A 4CNQA 4AJOA 1BWRA 1K7YA 5HBRA 2CXOA 4F3KA 3I6QA 4X97A 4V1CI 4R2XA 5LDHA 2D8AA 3R3UA 1USKA 5FL3A 4YAEA 4EA6A 3WLHA 3HY4A 3RYFB 1J2EA 3NHAA 3UUGA 5JYCA 4JUBA 1KBOA 4G5XA 1BNCA 4QRHA 5C18A 1S3SA 1ONNA 3CX3A 4H1UA 4J0HA 4S3MA 3PPWA 5C5IA 4MI6A 4D4JA 4DEYA 1L5FA 1F9EA 3JQ7B 4LRQA 3H18A 3C3XA 4MTLA 4U9IS 4YAGA 5DYIA 1RPZA 1ZD2P 4B34A 1OCEA 1CY6A 3K4PA 5BP7A 1K4YA 1A9XB 1C4OA 1XQYA 1PDOA 3S27A 3M7IA 1LSSA 2YNMD 1FSFA 3AW9A 3MGCA 4L27A 4J0DA 4Z8YA 3F46A 4CU5A 4DV4B 3RIMA 4D4IA 1QR2A 4CM5A 3S29A 4CKZA 1GZ4A 3ZVKA 1BSVA 3GUYA 3JALB 2BUAA 3PXGA 3NT2A 1L1FA 3F7TA 3LI2A 2VTEA 3GZJA 4GE3A 4QECA 1SBYA 4GMXA 5LZ2A 1ZH8A 3W2TA 2JS7A 4Z1MA 3SPXA 4XDZA 4BVLA 1FYEA 1GQ2A 1TUBA 2FQYA 2XNHA 4TQGA 5TF0A 4L8VA 1M2OB 1PZHA 3HY6A 3PNSA 5GAJA 1VLJA 2ZROA 1TRHA 2Z6AA 1CUXA 1FFGA 4L4XA 1Y37A 1LK0A 4CMIA 1MQSA 4FD3A 4O0MA 3FGPA 3NCTA 1O3YA 3BXHA 1DKRA 2GZDA 2R00C 4OLFA 4OBBA 4H4DA 3HR8A 3ENVA 1X1SA 2F64A 3JQGB 2IYTA 3QUBA 4FNOA 4TOIA 1YJAA 3RV4A 1ZN7A 3G0OA 1F8FA 1K6EA 2H1HA 4IOJA 4BFYA 1D04A 5FWDA 4YCLA 4OI0A 1SKUA 3FTEA 1U2QA 3WMRA 2CXRA 3IHLA 3S2EA 1C4XA 2IODA 4KO2S 4EAQA 1YBMA 1SU6A 1VG8A 4OLHA 3AUJB 3RV3A 3V46A 3CLUC 4H7EA 2ATIA 2ID7A 3E6AA 1ZNYA 2JCVA 3QXGA 4HDKA 4P2GA 5E2AA 1LV7A 4JDPA 3DZCA 5AUNB 1QBGA 2IYYA 3UMGA 2C8JA 4OBWA 6REQA 4ZOLF 4FDUA 3HFGA 4GKJB 2KS6A 2EFHB 1XXHE 5CEEA 4H2DA 2AXPA 2HBYA 2HU5A 3IOEA 4OK5A 4C7XA 1FNMA 3E9ZA 2IDJA 4UFOA 1XZKA 2YV4A 2VH5R 3MTAA 1P75A 1QHXA 3ZD6A 2VNSA 1VGQA 1E7WA 3PWTA 2RAUA 4LC1A 1T91A 1R0WA 2R6DA 2P5YA 2AJLI 2VHEA 2O5VA 2ZSEA 3F3MA 3GDGA 3GVIA 3NM4A 4LVNA 4NG4A 2AWOA 4EYQA 1GPH1 3RFCA 4CT5A 3DMRA 1Z6XA 4YMUA 5LJIA 3ILXA 2AOTA 3GU3A 4B73A 2A5GA 4CKYA 5JFOA 5B58T 4UXHA 3TRHA 1IBMB 3C98A 4QM6A 1NQUA 2P1RA 1GNQA 2KE5A 3K6RA 4IZ6A 3I30X 4HWGA 2HA4A 2PIAA 1L2TA 5AK6A 3R76A 3SXPA 1QH1A 1FNNA 2VXBA 2FPGB 1UZNA 2ODPA 3OPVA 4ACAA 3EEYA 1Z16A 1T9GS 4F5YA 3WRXA 1UDBA 1O95A 5HE8A 4FOOA 4ZWNA 1XMIA 2O2XA 3SM3A 1SEVA 4ZJZA 3K1TA 4RAQA 2F3UA 3LLVA 5I9MA 3FKQA 2PRJA 2ZYUX 4J0KA 4RA9B 3OUUA 4O6VA 3I8OA 3FYUA 4ZXPA 1WLYA 5U1PA 3T7RA 3GPLA 4C7OA 2LVBA 4DUYB 2XZLA 3I53A 1SC4A 2PGJA 4QBIA 3UPUA 2VHCA 4P5EA 1MG0A 3Q98A 4ZHSA 2WIJA 2ZP1A 3AJAA 2P4EA 3EPPA 3PDIB 3BWVA 5ILOA 1SD1A 1W49A 2P40A 2YWDA 2IDKA 2VKTA 4YWJA 3E1SA 1JFTA 2CFIA 1BXGB 3M1IA 5H9VA 1X2BA 5HJ2A 3VYSB 3GEIA 1KQFA 3PNQA 1E9FA 5B1IA 5HGJA 2EOAA 1GTL1 2IZ6A 5HQJA 5E8RA 5HSGA 4FOSA 3G7UA 1MH9A 3OZCA 3QTBA 3EPHA 1FZTA 1B16A 2JGAA 5KNBA 1QPZA 3HN7A 4ZQIA 4JBWA 3SAJA 2YCBA 5DI9A 4L5JA 2J3DA 1T5LA 1XRQA 5JC1A 1U2GC 3SS9X 4A0SA 2HL6A 3N3BC 5EIBC 1KI9A 1XP5A 4GM4A 3QFCA 5ENVA 4M1QA 4A6EA 5EGSA 4EHKA 2V7QA 3PQCA 3KEQA 5ELMA 5JD5A 3ZDYB 2Y2VA 4IHQA 1G98A 1E3WB 3T1NA 2DTEA 4B74A 2VWGA 2JJ2D 3ND5A 1CDDA 1R4MA 2EW2A 3OZGA 5K0TA 1JLRA 2RGCA 4JOSA 4UXJA 5F33A 5KJFA 2BM9A 5KEIA 3RSOA 3ZHQA 1Q77A 1Z6YA 2H0RA 3L0IB 3N2KB 4UBOA 1QRTA 1SRQA 1KHTA 3H2YA 4UBMA 3OT1B 3IOMA 1ZUWA 4K40A 2IHNA 4QIHA 2PJDA 3W04A 4PZZA 4MWZA 4BB5A 3BE4A 4RTOA 3H83A 5HDBB 3AF2A 3VZRA 4Q3OA 2O0HA 2HXGA 2DC1A 3V2IA 1IATA 3H3FA 2PKYX 2XMQA 4GMDA 1RQRA 4KR2A 5IVKA 2R8PA 3UWKA 5AJVB 1ISSA 2OCLA 2XYQA 3IBCA 1PRYA 4BZPA 5GADl 2VP6A 1QGYA 2CD9A 3HGQA 4XUGB 4ZT2A 3REQB 1DGQA 1HWYA 2DLNA 4FCTA 1ORRA 1FE8A 3UQZA 1NSFA 4H3VA 4WV3A 2UVQA 4EDFA 5CB0A 4JC4A 2R48A 3OSZA 1OFGA 4CEJA 4A6XA 1GYQA 2HPZA 3K09C 1JIJA 3R0VA 1X2EA 1FZQA 1HMPA 1MIOB 1DC7A 1YFLA 4Z4FA 1AKEA 2O8NA 3E3NA 3IOYA 1RYBA 1Y48E 4V3BA 1JKFA 1Q7CA 5BMVF 1U8YA 6CHYA 1AMUA 2O8DA 4CKBB 2XCTB 1VZ2A 5JNLA 5F7ZA 1QFYA 4RY0A 1QHIA 3DBRB 4KAFA 2LIVA 1KYWA 5BPFA 5EWMB 4UBNA 1F8GA 2XSZA 5IM4A 4RDHA 2QYHA 1Z07A 2FF5A 3LZCA 4ED9A 1PFVA 4LQLA 2HV9A 2Q5HA 4IM7A 4NEHB 1Q1ZA 4JOQA 4OL9A 4M87A 3VZDA 3WVNA 4KR3A 4BVFA 4DT1B 3JZAA 3H5LA 3T1TA 3HR7A 1W44A 4KO8A 4ZAVA 5BYKA 4EJMA 4PG8A 1CUGA 4OMUA 3UBTA 9GPBA 4XRGA 2C58A 2WK1A 1MPXA 2IZ1A 5KUTA 3UT0A 3ZK9A 3B60A 1J7JA 4KSYA 4WLOA 4BNHA 4RVNA 3F5DA 2YYAA 2OCKA 1B26A 5BVHA 4UM7A 1VE6A 2Z08A 4DLVA 4F6RB 3WYBA 1CRQA 2Q7OE 3LCUA 1N6LA 4LTDA 4GPTA 3ZVNA 1CYEA 2C2OA 1QYDA 5B53A 1BMTA 1SBZA 1LXCA 2CY0A 1VSQA 3TS1A 3UOWA 3VH4A 2J0QA 1UOQA 3MOIA 2C2BA 5FUQA 4AO6A 4CN8A 1QRSA 5L95A 2Z4SA 3NTOA 1YZGA 1MHTA 1G5TA 1SFRA 2O14A 3ZWKA 1RP1A 1JGTA 1PKEA 2CL7X 3GEDA 4PAOA 1TKCA 3RLIA 4DDMA 3GEBA 4ALIA 3H5AA 4AUMA 1WZEA 3OF2A 3ESZA 4X6UA 5ALUA 3TD6A 2AQ8A 1LTHR 5JDIA 4RL4A 3U56A 3JSAA 5I5GA 2NO4A 2VTVA 1H85A 2YN0A 2NTYC 3KKZA 2QUBA 4H7PA 3A9SA 4QYTA 5SZHB 2F00A 3FNGA 3MMZA 3D7LA 3QV2A 1YHNA 2A0WA 1J8VA 2RGYA 2VH2A 4EHLA 2H1VA 3M6AA 5D85A 1TF5A 3L7IA 1XXLA 1D0IA 3FNEA 3LJKA 2PE5A 1XD2B 4JLMA 2WYVA 2GB4A 3RYCA 1UEIA 2B25A 3L5KA 3UA4A 1UK8A 2XI4A 4PBSA 3N2KA 1HRKA 3P0EA 4JXKA 3ZUPA 3U9LA 2CSXA 1JEQB 3DMNA 2FZGA 3KKMA 3U60B 4HUTA 1V5FA 5IMSA 1B14A 3LXXA 3AP2A 3I1IA 1WUKS 2DHRA 2GBLA 3RI3A 4UTNA 1LPMA 3KXLA 1T8SA 4CV1A 4DJJA 5IEJA 4XJTA 4HVLA 1YNOA 3OZBA 4DRXB 1XKQA 3T7IA 4NBKA 1NLZA 1H8EA 3OIVA 4JP1A 3DEIA 1WMSA 2PS1A 1L8OA 3NWBA 2PHZA 1X39A 4CG1A 1L5ZA 4IGKA 2C5SA 3DEJA 1LDEA 5KO2A 1RJ9A 2IEIA 3H1TA 2YNMC 2D5AA 4IUYA 1NGSA 3OX4A 5DTIA 5JJCA 1NN3A 1QK3A 1TJPB 3NDRA 3GROA 1DNPA 3E4DA 4TT3D 3U39A 2OECA 2VSNA 4RETA 4W1QA 4JQYA 4B1FA 5BV0A 1SU4A 4AU1A 2DJ5A 5BSEA 4MIYA 5JH7F 5ADHA 1X42A 3FMVA 4CW7A 3UY4A 1H66A 1ZK4A 1U99A 3H1PA 1Q0TA 5A7HA 2VHWA 5ES4B 3PDWA 2Y6VA 2CHUA 4KODA 3TQIA 1AN0A 3U09A 4HDRB 2YHAA 3QLVA 3W9UA 3EG9A 1ZITA 4FGSA 1SIOA 2DTXA 4GIBA 4QPPA 2X5NA 4RLQA 1B2RA 2X0KA 3X1WA 2I87A 4HN2A 4AZ0B 4GAEA 3HDTA 3DFMA 4AMVA 3ZKAA 2MYUA 4PLPA 5IP5A 5DM60 2QMZA 2AN5A 2ZYRA 1KDOA 4WW0A 2OQIA 2CLCX 3HRHA 5H3HA 5IVDA 5KVQA 4ES6A 1N2CA 2HWYA 1LDGA 4IDHA 5FBLB 2O4CA 1UK7A 2R6CA 3MFQA 2C4NA 1XRRA 2OZEA 4H4CA 2P41A 4LJ9A 1AU9A 4P80A 1C3LA 2OBXA 2BFEA 4LSMA 4MS4B 4BUJA 1C7FA 1QBKC 3NVMB 3K2IA 4GLJA 4L5YA 5IF3A 3MCAA 4WOKA 2H17A 4EG0A 1ZBDA 5B6IA 1APBA 3WLPA 3TTXA 2D74A 4HPXB 4MGYR 4OXNA 1Z0ZA 3F0TA 3CVUA 4ZVUA 5E7JA 1Y98A 5ABPA 4YPVA 1ZYUA 1Y6JA 2H51A 3D4LA 4LDQA 4RIHA 1PIWA 2CBGA 3O6VA 4TL8A 2B8NA 3D8BA 2ZIAA 1J4AA 4GNKA 1NQTA 4IMRA 2OA0A 4AP6A 1KBZA 1KAQA 5DHQA 3H3XA 3WK7A 1ICIA 4F8JA 4ND3A 1VL6A 3OURA 4C01A 4AS1A 1XQ6A 2DM6A 3U1BA 4BEBA 2G1UA 2V7WA 3OHMA 3W79A 1E99A 4ENTA 3RUCA 2ZM6B 2VT2A 3H2GA 4CIYA 2AXQA 3EVBA 4A5OA 2VWHA 5CXSA 1VLVA 3WNBA 4NENB 3NP7A 3B5IA 2ZTHA 3T3HA 3V7UA 2JJ8A 3QWHA 4XJSA 1ABBA 2VTDA 5KSPA 2JRLA 3W4JA 1M1XB 5LBUA 2QR3A 3BXFA 3WA6A 5K8VA 3HBJA 4AJ1A 3K9WA 4RDIA 4KLZA 5BSUA 4E7OA 2VRNA 2WA2A 1QHNA 1E5XA 1S96A 1JSLA 2GPBA 2XNJA 4ZDWA 2G1AA 1FLDA 1GG8A 2HAEA 1U7XA 2HT6A 3BREA 4ER6A 5BT8A 3PF9A 1SUFA 2FWNA 3FR7A 1IJKA 3V55A 2Z9BA 2RH9B 1EJBA 1AK9A 3ZLTA 3D4PA 4WBSA 3SHWA 1JKJA 2D3TA 3CZAA 5IC5A 4F8EA 1CEEA 2W71A 3GT3A 5HZMA 4EJFA 2FV8A 1BROA 1IEWA 3FVTA 4RSMA 3WRXC 4UAVA 5FADA 5JZMA 2R7NA 1V0JA 2WTAA 3EZ9A 1UXJA 1WW3A 3ACBA 3M6FA 1QV9A 3MCTA 2RSLA 4NC9A 4YGYA 4OLBA 2JBAA 2RHTA 1XDSA 3G9ZA 3HXLA 3JQ7A 4PYMA 5JVDA 2XQJA 2JB9A 2GK4A 4X8MA 3E3LA 5L4SA 1P80A 2WJZB 4QYMA 1SZJG 2ACEA 2QI9C 3E15A 2NXEA 2BF7A 3EZLA 3F5FA 3KSDO 4XI9A 2PT9A 4AG6A 1HV8A 3KXDA 3I2IA 4QQ8A 4I9GA 3IP9A 3HJFA 3KYJB 4BNIA 3HA7A 1LPSA 3L43A 1YR3A 2D06A 1ZINA 4QGSA 2VTBB 2GZHA 1NNI1 2ZSAA 3QKSA 3DLBA 4RZXA 3EN0A 2I2BA 1V25A 1W6UA 4OSPA 2GEVA 2AYZA 1UC9A 3EXFB 4L8WB 5EP3A 2A0UA 1CQIA 4S2UA 2NUTB 1MNAA 4RD1A 3F73A 1N5KA 2XSZD 3UJPA 4TTIA 4G6ZA 3O31A 5DXJA 4M9RA 1KIAA 4NR0A 2OGTA 3UFXB 4EDHA 1L6IA 1WKBA 5KOJB 1O95C 1IBLB 2XOEA 3MVEA 5SY4A 3WYEA 3ZWQA 7MHTA 1DBSA 1WABA 1Y6QA 3KYDB 3NWEA 4RELA 4URHA 5KAMA 1VE7A 4IDCA 1RXIA 1KEPA 2PFKA 4A2PA 3ZLBA 3OBBA 1KI6B 4ZEWA 3LUKA 4ZTUB 2BLNA 1HNWB 4QFDA 2BEKA 1ZVJA 2VAWA 4R8MA 5ECGC 4N7JA 3FOEC 5BUSA 4RLSA 2C2YA 3UIEA 1MAHA 4EF4A 1DMSA 3P27A 3DBHA 2QX9A 1RI4A 2JNWA 1SU7A 4DUGD 4BKPA 4DTIA 4ZO8A 3MM4A 1XRPA 3EXHB 1JG4A 2JHFA 1IM8A 1LD3A 4FMDB 4GWLA 5CTAA 2ZWVA 1N0UA 2WDZA 4EB3A 1E9SA 3RIGA 1Q83A 4C0XA 5HCUA 2WTUA 1W2HA 3OLZA 5WRFA 4ESHA 3AB8A 2F1IA 3ROQA 4PYNA 2QSUA 3RTAA 1F06A 4HNAA 4AJEA 1ZMRA 1IQ0A 4JLPA 4KQ1A 1DFIA 4F9GA 2WVJA 3TOVA 2AN1A 4P3XA 4MJ3A 4R9VA 2YV5A 4Z49A 3ZE9A 4BN0A 5FWNA 1WXHA 5KVAA 2PZEA 3H2JA 1H6BA 1YQUA 1NKVA 1IN7A 3L1VA 2QQEA 2HSDA 5TT0A 3G5AA 3TLYA 3M4XA 1CIPA 1UT8A 4FUTA 3ETCA 3HUFA 4KFTA 1Q2XA 3LTNC 1SMKA 3P9CA 5FTWA 3KSZO 1WVMA 2D1FA 3MELA 5EIXA 2OO5A 3DD1A 4LW8A 4MUMA 5E7QA 5BXYA 1DRWA 2BFDB 1E0DA 3AF3A 2D7CA 3SEFA 4ZAYA 4DVJA 4MVJP 1WPXA 4Q7KA 2JIPA 2XQKA 2YRWA 3HEAA 3UH0A 3PTAA 2FGKA 4TKZA 1UBTS 1E1NA 1VP3A 2ISQA 2XIJA 3EIHA 2EZ4A 5A4DA 1GZDA 1MGOA 1JEDA 4FMDF 2JFZA 3RIYA 3TCKA 3VU8A 3MW8A 4HEA6 1RHMA 3ILHA 5IJ0A 1RRFA 3UTDA 2J08A 4OJMX 4XPZA 4D4GA 7REQB 1ZL0A 2IF2A 4U9HS 5JCJA 2EZTA 5CT5A 1K7CA 3SQLA 1A9XA 1O1YA 3E22B 3VHXA 4N82A 4C20A 2QUKA 4MVJF 3SZGA 2IEGA 1HDOA 2EKDA 3KVRA 3CMMA 1RWOA 4UOZA 3IIMA 4L5IA 3BCSA 5FEMA 3PKZA 2IPLA 3TNYA 2ZWIA 1A9TA 4W5OA 2VJOA 1XMXA 1XZHA 2PG3A 3BMOB 1FJHA 1VG1A 2DHCA 3DYBA 3PFBA 2FX5A 3R44A 3KZCA 4ITUA 2J32A 1LNQA 1PJ3A 3I2JA 4J75A 2C2ZA 2XYVA 5GOZA 1U2SA 2GAIA 2XB4A 1DAKA 4JL6A 5K3FB 2PEYA 2UXCB 1E1CB 4N3GA 3KD3A 1MRSA 2WOJA 3O75A 3V2HA 5IWAB 4CCSA 3QHQA 5AK4A 2YWRA 5CVEA 1V8FA 2DLCX 2B4YA 3D3QA 1KMNA 5KYYA 5LDDC 4EATA 4XIIA 3WSTA 4FEAA 3BL8A 3RHFA 3VPHA 3A2NA 3CNLA 4B3TB 4GL2A 1P1JA 1E1KA 2KM1A 3KOMA 4DR6B 2GK7A 2PFGA 5T4HA 4DM4A 3QUQA 4D3ZA 5DEIA 3X1XA 4K9RA 1X7XA 4P2BA 1S9DA 3DMDA 1KI8A 3R5XA 1XL1A 4IIFA 1LCIA 1ZN2A 5IBRA 3UAYA 4C4OA 1E96A 2SHKA 3EGOA 3G85A 3PXXA 4MYUA 5KYWA 4ZAXA 1BCSA 2RHOA 4YP9A 2OKCA 4R2MA 1HG0A 1PWZA 3KPJA 1TZCA 3MS2A 2G80A 3I6BA 4P93A 5DIZA 1Q20A 1A77A 1G5PA 1B73A 1RKBA 3G8AA 1G9SA 4WZZA 5BR1A 2GGSA 4ENUA 2BHSA 4MA5A 2ZIWB 2WJ4A 3PXBA 4KXFB 1OFTA 3AZOA 4P53A 5EHGA 1ND5A 1Z25A 2O8BB 4EI7A 1A9QA 2UZAA 3LYAA 3GOHA 3L7MA 3QEMB 4N7BA 3A7EA 5CA1B 4J3JA 2O52A 1RQGA 4BJ1A 2PUGA 4A1OA 3G6KA 1C50A 3I09A 3O8QA 3GJZA 5BWLA 4A6DA 2Q99A 2P9QA 1FYVA 3CR8A 1BVUA 4PLZA 2W9XA 4IDNA 1XTPA 3R0XA 2LBPA 2B5OA 2FW8A 1WUTA 1FXWA 4OQFA 1W0JA 3IEKA 4IHKA 2P69A 4N5MA 3COSA 5LC1A 2RHCA 3V8QA 1YZUA 4YUZA 1T8YA 3SD7A 1A9SA 1TO1E 1AKQA 4N54A 4WESB 4V3CA 2WT9A 2MR6A 5NULA 2Z9CA 3KPWA 1B42A 5BN1A 1R0BA 3IQEA 4Q7EA 4H7HA 2GUGA 3L3BA 3W3AH 2A33A 2UXDB 4RV4A 1X8XA 1WSWA 3DT8A 1ODLA 1EWYA 4LDRA 1VXOA 3WS7A 3R41A 1E6LA 5IM5A 4WCVA 2W2KB 3QUTA 2VUTA 4DADA 2WABA 1G21E 3S8EA 4Y2UA 3S3TA 3E7DA 3QFSA 4JI8B 4ASUA 1EDBA 3IYLW 5FBHA 1Z29A 3COVA 3DXZA 1QIGA 3DCYA 1HEUA 3ZS9A 3S68A 3DDWA 3ZE0B 4DLPA 5MN4A 3N59A 3AIIA 4ERXA 1W5SA 5ALRA 5FO1A 4EHIA 4B3MB 5F77A 3DBOB 4YV7A 1ORTA 2IV2X 2XVXA 2UV8A 4BFTA 4Z3KA 5CNKA 2WF8A 5CDSA 1XF9A 2GD6A 3AR9A 3RSQA 4IXNA 2IY8A 4C6RA 4CTNA 3FHCB 2CLEB 2A67A 5K5EA 1FDIA 3R74A 2TMKA 1IOWA 5TB5A 3WKCA 3FVRA 3MTIA 3A3NA 1IZ7A 4C30A 1GQOA 2N0SA 5G3ZA 2QLFA 5ALYA 4BL5A 2NZUG 3RBZA 1V9CA 1Z6QA 1KK3A 3LX4A 3TJRA 3VJRA 3UG7A 2GZRA 3CINA 5KS2A 1THTA 2Q9CA 5CDTA 2ILTA 3ZU5A 2C2MA 2QUAA 3ZV5A 1U7ZA 4YCAA 2V98A 3EVZA 5FUBA 1C3VA 3MPUA 1PR6A 3R6DA 4IX1A 4LOLA 4BQEA 1J39A 4JI5B 3ZTYA 4O4JB 3PT5A 2H9IA 5CURA 2AX3A 2BZGA 2BSAA 3AH8A 4PIVA 5CB6A 2EC5A 4I1PA 5KHLB 4AY3A 2B3DA 2EEPA 3AWIA 3NQ41 3ACDA 3NHBA 5BQFA 1ANKA 3JR3A 4ZVNA 4G0MA 3KVVA 5ILQA 4CQMD 3ZHZA 3QJGA 3Q9NA 4JU9A 5K6AA 1OU0A 2XUDA 3SNHA 1NP7A 2Z04A 2RIPA 1FRZA 3REFA 3LH5A 5JYEA 3WSVA 1H4QA 2Y1DA 1AHPA 4LDNA 4Q48A 2VJAA 3IMFA 2I66A 4YB8A 4HX5A 5D5PA 1RLTA 2POCA 3W90A 3OE1A 3TL2A 4WNIA 3WXBA 5JJBA 4UC0A 4RIGA 5DNCA 1N5LA 1NPDA 3RO7A 2DP4E 4D9BA 4MXDA 5KHOC 4PN3A 1KAGA 1FVXA 1UK9A 2PYIA 1RKVA 3LNCA 4MVJE 3CF0A 2PX5A 4QTZA 3QP9A 5DN6A 4AJIA 3M1AA 1J99A 3NV9A 2G67A 3AJRA 3ZY6A 4MI9A 5B4VA 5TGDA 1NVKA 4AZTA 1GRVA 3ASZA 4D9MA 2X7JA 2QX4A 4MVJI 3TVYA 3LBAA 1G7SA 2GHTA 4ID3A 4GOMD 1UBUS 4R9RA 4CIWA 1ADFA 3C43A 1UAGA 4AD8A 1P0MA 1MOQA 1XA3A 3C3JA 1P4AA 4EMSA 3PGLA 2YQ5A 1TYCA 4RVHA 4X45A 5BUQA 3GJTA 1DTEA 3GMIA 1GG9A 1TFRA 3SXUB 3AILA 1U0RA 2FYTA 2Q1SA 3C0KA 3IPCA 3HXOA 1PZGA 5EHIA 3IILA 3U3MA 3GLUA 4TKUA 2YWGA 1VHWA 1K8YB 1S7GA 3JD4A 4E12A 1Z34A 3V97A 1TC2A 4IJMA 1W35A 4ZRDA 3WA7A 3NNSA 4DLRA 4EG3A 1LVGA 1U31A 4KMRA 4YCJA 4GMKA 5F2EA 4KAJA 2R25B 2G0NA 4BEWA 3VKGA 4OFZA 4NE9A 1G4HA 3GD7A 2X7HA 3BTUA 5TPZD 2P2NA 3UNXA 2D1TA 1AQ6A 1O4VA 2NPIA 1XZEA 4OHOA 3SHTA 5JVDF 4U63A 1WCV1 3UHJA 5CPBA 4LJLA 4OAQA 3C5EA 3FMOB 3OOWA 4J0IA 4GMGA 1A82A 3VU0A 2NUPA 3QVGB 5F4BA 3T06B 4I6GA 1WUYA 2QTFA 5HF9A 3LVFO 1D6JA 1U6IA 4CBVA 2VRBA 2B8EA 2R8XA 4RK6A 1FJGB 5DM0A 4JX9A 1H4VB 4FK8A 4PX3A 4U2FA 3HXMA 1D7OA 4M1EA 1JL3A 2BL4A 3AKEA 3GUHA 4UVDA 4ZZ2A 2NAPA 4OSOA 2B36A 3NAMA 3W34A 1ODFA 1G38A 3OLQA 4TL9A 3ZE6A 4HNSA 1JE0A 4IG9A 2AJCA 4MCHA 3DCJA 4Z9XA 5HDQA 5IW8A 1E2EA 1NKSA 2PMWB 2WUWE 3K6SB 4HEA1 3DQZA 4IILA 2E5WA 4WL0A 5F9HA 1XMVA 2FZLA 5F7XA 5IKEA 4ZK2A 1R0LA 4JUFA 1FA9A 3ZV6A 3H87A 1YQDA 3UK7A 1VZ3A 521PA 121PA 5K3BA 3F7OA 4RH0A 3SHOA 3R9WA 1C1DA 3GL9A 3O1LA 4LGCA 2EIHA 3RAPR 3LOPA 1XTTA 4MK4A 2FPXA 4CODB 3OPYI 5J5AA 4LYHA 3L6UA 4IIVA 4Q4AB 1O0SA 3W9YA 3QKTA 1JTVA 3HCCA 3BDIA 4JB8A 3TGWA 3LWZA 1GIAA 4EHDA 3IQDB 4JLWA 5C4IA 5C37A 2X0RA 2PZFA 5LJLA 4N5HX 5DN9A 2ZSKA 4NYIR 3IALA 5EXDA 4W9MC 1OH6A 1NDUA 3EDCA 3FG9A 4PCVA 1M83A 5SICE 1H2FA 1QHSA 3D6TB 4R1PA 5FWYB 3BRQA 2OOSA 1CDZA 1WWKA 2PLNA 3HC7A 3ZX5A 4B6JA 3TAXA 3C16C 1JT9A 3NHKA 2YMQA 3UMYA 5I4BA 1KDTA 1UMCB 4YRCA 3ISJA 1IWBB 1DB3A 1FXUA 1ES9A 4QTXA 1JPUA 3HV0A 4QE3A 4AN4A 3IEVA 4BMPB 5AW3A 3BJZA 2EX1A 1P0PA 2SKEA 3GEHA 3NBUA 2V8BA 5AW6A 3AOEA 3DM9B 2HSEA 1GKUB 4UPEA 2HA3A 5A4JA 2UDPA 4DILA 5HS4A 1QH8A 1Z9BA 1A4RA 4M8NE 2GDJA 4FYXA 1JAIA 1OWMA 2JZCA 1QZZA 3ND7A 4WXYB 3Q9SA 3IVAA 5F1PA 5G4LA 4BRWA 1MW8X 4GFDA 3VPDA 3CWQA 4CN9A 3EQZA 4KYVA 1R5OA 3WDLA 2QTNA 3CSDA 3NH6A 4B3HA 1ZDMA 2QZJA 3LF2A 2G76A 2BMDA 3KYCA 2B1JA 2R3SA 2WG1A 4DLNA 4EQ6A 1LRKA 4RD0A 2FVXA 4MLCA 4XPIB 3ZCUA 1DBPA 1ABEA 2V6MA 4WFJA 3SP1A 1CS4C 2GM3A 2BEWA 4JXXA 1DC6A 1P1IA 2X5KO 1JSXA 3GFSA 4UHCA 5CH8A 2JLXA 1SHUX 3H04A 3TI9A 2ZJOA 3PR1A 3BWCA 4EF6A 3J80A 4EFMA 4B47A 1DRKA 2ZE6A 1MQAA 4H7JA 3PYXA 1YZTA 4N7RA 5JXIA 3OE4A 4ZO6A 1YJBA 2B92A 2DZDA 4O4IF 4P3PA 3OC0A 2VTKA 3PQDA 3O2QB 2BCEA 1M8KA 2O2IA 3I3OA 4BGVA 1E8MA 1NM5C 3RYCB 4IIJB 3SQNA 1DC4A 2YH2A 1YVEI 1PG5A 5L8VA 2O6HA 2HCTA 3L8EA 3EIOA 4RVDA 4EZBA 4EAAA 1CY1A 4IINA 1KAOA 13PKA 4RKQA 3RM3A 3ZHVA 2GFIA 2VA9A 2Y8EA 3OD5A 4CJXA 4QAJA 2XDQB 4F9EA 3NHFA 2ATEA 1UM9A 1E8DA 1ZKMA 2Q5OA 3FFAA 5EOVA 5KSOA 2OESA 1E58A 2H7YA 3BORA 1SHKA 1JECA 4YROA 1XQ1A 4K9PA 1W4AA 3NIDB 1RBQA 3OPXA 2BKAA 3WLEA 5ELXA 3B8EA 2NU7B 2JC3A 4QDXA 5ESWA 4RULA 3BCUA 2GFQA 3FFWA 3KB2A 4BLTA 4RE5A 2Q5CA 1TAUA 2ONZA 3OD1A 4TKUB 4GZ5A 4W5WA 2B0CA 2P65A 3G23A 1AXGA 4Y8VA 5E3JA 1DXYA 3I62A 3GLHB 1NP6A 4J16C 1XJ0A 2FZ4A 3WQRA 3U5TA 1LB1B 4BV3A 2CV0A 3WADA 3TSOA 3ISVA 1NC3A 2ZWPA 1B6RA 3A9UA 1JAXA 5LL6P 1TPYA 5KNDD 4P86A 3HVJA 2Q2VA 1TECE 3FH0A 3IUEA 3K2QA 4B6EA 4EGSA 1SQ5A 5B4UA 4JVLA 4BC0A 5DLPA 2C2KA 3RH0A 1KIFA 3EGDB 4UZFA 3ZWXA 2XWPA 2B4KA 2DBZA 1FUKA 5HM6A 1A2OA 5T3YA 5FTLA 5DBGA 3FHOA 4AJNA 4Y0NA 1PSWA 2X9GA 3W8FA 2GD2A 3MC1A 4AZWA 1OXSC 4YX9A 1ZFNA 2J0UA 1V96A 3RS5A 2ORED 4KO1S 4P34A 1TM7E 3HY3A 4OHUA 3PUYA 1U0GA 1OAKA 2H7XA 2QP4A 4TUYB 5D01A 1RMQA 2KJQA 1ILWA 4RZQA 2PKCA 5CH3A 2AFIB 4IEIA 4B6SA 3IKVA 1GKKA 3E0XA 4FS3A 3VR6D 5JZ9A 3NM5A 1HQYE 1T2DA 4D80A 3ZQUA 4O0LA 2JK0A 4QPDA 5H3CA 1A5SB 3RFXA 4H3HB 1KMCA 3ZY5A 2J9FB 4TV8A 1B8PA 1E1CA 3LLMA 4UDNA 5DHUA 3ZI0A 3JATA 3EAGA 2YV1A 3ITKA 4MX8A 1MVNA 1YKGA 4X8OA 5D87A 1G8GA 3E9QA 4GOLD 3S8MA 1BE8A 1F2UA 1Q1AA 2GPTA 3OCCA 1J2TA 1LC0A 2HJRA 1EFAA 5L45A 1KERA 3QOXA 2VFAA 1QYWA 3JAMA 5JCPA 3L7BA 2H2DA 2B8TA 1IQUA 3WRYA 4X54A 4BZXA 2Q4TA 2XY4A 4ZCRA 5I8PA 3R6LA 5AKLA 2WILA 5HS6A 1LTQA 4OLAA 4IZOA 3PUVA 4MWTA 1GXSA 2ZRMA 1RRGA 5GONA 1QAOA 4B85A 1VB5A 1EQUA 3C41J 4ERNA 1JWLA 4DXHA 4X95A 2HPVA 4W63A 1AZTA 4PSAA 3ML1A 4MSUA 3RGWS 5HJ7A 3TE6A 3A06A 2IYSA 4PYJA 2BGKA 4XIGS 2XBMA 3SZLA 1K27A 3P9QA 3QW4B 1KI2A 1HDIA 3FSRA 4QUBA 3BIXA 2WFMA 3V1LA 1ITZA 1EFVB 4HEQA 3STHA 5LYJF 2CJWA 2PKRA 1PW5A 1U7DA 3S7ZA 2FUG6 3SDZA 4O4HA 4J16A 1I10A 1RU3A 4N39A 2PH5A 3HKEA 4HATA 2XA2A 5CNIA 3V1UA 3B2NA 2NMVA 4LJ8A 1B8OA 1Y34E 2O20A 4L07A 4IIGA 1E9EA 3UJ3X 2GZMA 1XVVA 3DP7A 1ESDA 3UHFA 2GN8A 1E7QA 1NW8A 3KIPA 4UQOA 4OX9B 4EL0A 2O8FB 1X8JA 4FOPA 1DL5A 2WWXA 5K8JB 3BCHA 8AT1A 3OZFA 3N6XA 4P7FA 1GNVA 3L8HA 1W75A 1O5IA 2OCIA 3D3EA 4Q5IA 5CXXA 2QTZA 4QOFA 5HJ5A 3PJGA 2F2TA 3SX0A 5IZ4A 1C4KA 3MF4A 5FTJA 4PANA 1P91A 1RABA 3FFBA 4GC9A 2Q6OA 1TYZA 1OWNA 2W43A 4MV4A 3JYNA 2P9BA 2IXAA 2OO3A 3JQ9A 1D0SA 1RAIA 2CZCA 2FDRA 2BEJA 4Q3AA 5T6BA 3L0PA 4FYMA 5TMBA 4PNZA 3SFTA 1N7JA 4QT4A 5KBYA 3Q3GE 5JMPA 4BMVA 2VZLA 2FWPA 1EFDN 4YCCA 3KU4A 3U7FB 1F8YA 2ODNA 3RVJA 3TR0A 2XIQA 1IE3A 3IS3A 1A50B 3Q7EA 1U9YA 4Z6KA 5BN3A 4W5NA 4QUDA 1T2UA 1Y4UA 1CRWG 2AQHA 3VVMA 2CFRA 4A8TA 1QHFA 4J94A 1CDOA 1NV8A 3IA2A 4FVTA 4U0KA 5B3JA 3W1VA 2J33A 4U7DA 1W46A 1FFWA 1A5TA 2J4CA 4G1EB 4CM6A 3COPA 1AXEA 1H2WA 3U9TA 1MW9X 3DEZA 3V3TA 5C32A 3FF1A 2QRJA 3LL7A 2R7MA 2ID4A 3EEIA 2BBWA 2CNOA 1IK6A 1YB7A 5LXTF 1J2JA 1EGMB 2OK7A 4GMHA 4ICIA 3FDZA 1YR1A 3PNKA 3KQWA 2OXTA 1NBMA 4ZYLA 3CNNA 4LYGA 1NE2A 2OV1A 2W5UA 3O3CA 1KYYA 3NWJA 2A78A 2F67A 3ROEA 3TQFA 2HIHA 2PWAA 1RJEA 1UKAA 2UZ0A 2HDOA 2QRHA 3P2MA 4I4IA 3TPFA 3RRYA 4YLYA 4YRQA 2QRVA 5B64A 2ZRKA 3H11B 4X1YB 5DHRA 4ZVQA 1QCYA 3OMLA 4P4LA 5B3KA 3DV9A 4CCYB 1T25A 1CUIA 3CZPA 3ONDA 3SQXA 4QSMA 5AESA 1CPYA 1G6KA 3LU1A 1LFAA 3MNFA 5C8YF 4TMVA 3JVUA 4ZZ0A 5C7IO 4BGDA 1O2DA 5SZKB 2VAVA 1M54A 2RFLA 3GYBA 3SDSA 3T4EA 1P7VA 2H4ZA 4BNWA 5FTNA 1GAJA 1NUQA 4F38A 2P11A 3OM8A 4QDKA 4PLWA 5D3MB 4R9SA 2FPMA 1TUBB 3EGXA 2BKXA 2DX7A 3PYLA 4XGIA 3S1SA 5ED4A 1IJBA 1RYNA 2R2GA 4YTEA 4LX8A 1UWCA 3LO8A 1PJRA 1BC5A 1X7ZB 1IZ9A 2FZCA 3K92A 3M6WA 5IU6A 3K15A 1ZQ9A 5LQNA 1A7UA 4E32A 4EX7A 3AVYA 1XPUA 3ZDEA 1FP4B 4XUCA 2WT8A 4YAUA 1UJ4A 3G1TA 1NR1A 3LP5A 1WXQA 3LE8A 3S4YA 1E6UA 3VR2A 4NZNA 3L7LA 1T1SA 1QIKA 1L8LA 4OJYA 3QYFA 4GX5A 1TE2A 4J0JA 2BDEA 3OT5A 3UJ8A 4DRYA 2AQIA 3L7YA 4TSRA 1KPHA 2GUWA 3HZZA 5C5EA 5FLKA 5H4HA 1RKXA 1TQ2A 3I2FA 4BKMA 1FUIA 3RVOA 4B82A 1HNNA 3GVXA 5FAXA 4GZ3A 3DNPA 2NU9A 4CNBA 3GARA 1USVA 2VDMB 2ZVPX 2DE0X 4FE7A 1RVDA 2OAGA 2V55B 3UVEA 4QXPA 1U02A 4JUCA 3VO1A 1E9AA 3UKDA 4C88A 4Q9KA 3DWEX 5COBA 2CXNA 4ZAFA 2FJUA 1VIAA 3PFFA 3AVTA 3KFXA 4WJLA 1XPOA 3PIDA 1QGAA 3GGSA 3ZQKA 4YV1A 2OR3A 4KMSA 2PKEA 1NG1A 1ILEA 1CWUA 4NJEB 4Y9UA 4L4ZA 1NPYA 4EG6A 4GQBA 3ACCA 2BVNA 4BEVA 1TT7A 2I80A 3A1VA 5CVDA 5AVOA 4K5QA 3FYHA 4OIMA 3BMXA 2FWIA 4ENWA 1EVIA 3NAQA 1F2TA 5ERGB 4DV2B 2VDJA 4LDPA 5DZSA 5AYVA 3WK5A 4EHJA 3PD0A 1EU1A 4WWHA 4XARA 1SC1A 3UV6A 2WKQA 3LA8A 4LJSA 3K5HA 2X2EA 2ZE7A 4NICA 4X44A 5T4EA 3SR4A 1OX4B 2GEDA 4CIDA 2VAXA 2Y0EA 3G7NA 1YQXA 3MJCA 1ECCA 4NNOA 4Q1VA 5IJ9B 3FCCA 4MJ7A 1DI0A 2RI6A 4LXTA 4BJ3A 1TW3A 1XRSB 4XDHA 5J63A 4C0JA 3ZDZB 2IYFA 3W0LB 3WGJA 2VK1A 5BMVA 1HDRA 3KVYA 1PEYA 4R81A 2AG1A 2VR1A 2F1RA 3FTCA 1X9IA 4NBVA 2GBPA 1T3GA 1LQUA 1ENYA 1A8UA 1E2QA 4PTYA 1AD2A 3PRKE 5CCDA 3OO1A 2EFCB 3ZIAD 3EX7C 2V9ZA 4ZEMA 2H29A 1O94A 2QVGA 3AY3A 3NCHA 2V0NA 4QDZA 4H1HA 3TPZA 2ALJA 1A96A 4B0PA 1JIUA 4MKXA 4TVKA 2Q8QA 3VSCA 5E0KB 2OZLA 4KUGA 2AUMA 1S5PA 4QASA 3RS8A 2HPHA