3I6QA

Structure of the binary complex leucoanthocyanidin reductase-nadph from vitis vinifera
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
307
structure length
291
Chain Sequence
b'GRVLIAGATGFIGQFVATASLDAHRPTYILARFKALEDKGAIIVYGLINEQEAMEKILKEHEIDIVVSTVGGESILDQIALVKAMKAVGTIKRFLPSEFGHDVNRADPVEPGLNMYREKRRVRQLVEESGIPFTYICCNSIASWPYYNNVLPPTDFFQIYGDGNVKAYFVAGTDIGKFTMKTVDDVRTLNKSVHFRPSCNCLNINELASVWEKKIGRTLPRVTVTEDDLLAAAGENIIPQSVVAAFTHDIFIKGCQVNFSIDGPEDVEVTTLYPEDSFRTVEECFGEYIVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative leucoanthocyanidin reductase 1
publication title Crystal structure and catalytic mechanism of leucoanthocyanidin reductase from Vitis vinifera.
pubmed doi rcsb
source organism Vitis vinifera
molecule tags Oxidoreductase
total genus 96
structure length 291
sequence length 307
ec nomenclature ec 1.17.1.3: Leucoanthocyanidin reductase.
pdb deposition date 2009-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05368 NmrA NmrA-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3i6qA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3i6qA02
3KSUA 3PZBA 1U3UA 1R6DA 2I67A 1GD1O 3H5AA 4A7PA 3EVTA 4R54A 3KSDO 1KVSA 4MVJA 1MA0A 5AOVA 2FR8A 1IPFA 4GVXA 2C20A 1FDTA 3HN7A 5KKCA 3KZVA 1F12A 4ZJUA 2QRJA 1NWHA 1NR7A 4WCFB 3R1IA 4GL4A 3BHJA 1KEWA 1BTOA 1JDJA 2JJYA 3S55A 3DZKA 3JQCA 1C3VA 2B83A 4P22A 3AUTA 3RU9A 5KJ6A 2Q4BA 2PKQP 5IAAA 3K2BA 1XQ6A 1YBMA 4XB2A 4BNHA 5IDXA 4OOFA 5AXDA 1LDBA 4BNYA 3QVXA 3F47A 2A94A 3JQAD 1V0JA 2AG8A 3KYDA 4JROA 1VSUA 1JKJA 1HETA 4N5NA 3F4LA 4BO7A 4BMVA 4L76A 5AXCA 3ZWYA 4F3YA 1O9BA 3G3EA 3GPDG 3C3XA 1VE9A 1WLYA 5KOIA 1UDAA 1D1TA 1KVRA 2GR9A 3M1AA 1ULSA 1ONOA 3ZCXA 4WASA 3X2EA 1YL6A 1PL8A 2ZYGA 4O6VA 2WD7B 4CM9A 4YACA 2PZJA 1RM3A 4GX0A 4CM7A 2NWQA 5F3RA 1K0UA 2G1UA 4PLWA 3OBBA 1X0XA 3S2FA 1WAMA 3EC7A 1DO8A 3BMQA 2WYUA 1GZ6A 4RVSA 3GZNA 5DF1A 2X22A 3DOCA 1P0FA 4M49A 4PLTA 1ENPA 3DBVO 3LF2A 4WUVA 3JQ7B 3WLEA 5TQVA 1IB6A 2A92A 4A0SA 4J91A 2NVBA 1UZMA 3DOJA 2PLAA 3H6KA 1PGNA 4HWKA 4OL9A 3RU7A 2FOIA 1FDUA 5HTOA 3A28A 1FF9A 3U9LA 3F1LA 1D1SA 4RF5A 1DHRA 3VPXA 4R69A 2O7SA 3GFBA 2B4RO 4IZIA 4WLEA 4IINA 4MJLA 3I6IA 4F6CA 2VWQA 3DEYX 3PGJA 3S2GA 3PPIA 3TFQA 4CV3A 4TWRA 3K2EA 1N7HA 5G0SA 3FI9A 4PLYA 1JKIA 1U1IA 5EN4A 3ZU3A 3INRA 1U7HA 1N9GA 4EDFA 3ZI0A 2HK8A 2G82A 1GQQA 3WMXA 2HQ1A 5CPFA 4AJHA 1MV8A 2OXIA 2QX7A 2FRDA 4IQ0A 4MKZA 5ER6A 1PQUA 1QORA 2IYPA 4QEDA 3NKLA 5T6BA 4J2OA 2D5CA 2OUIA 5A3JA 4AJ2A 2WD8A 2G0TA 3FD8A 3Q9UA 1HTBA 4WLUA 4PG8A 1GPJA 1PX0A 1U2DA 3BMNA 1B15A 2A35A 3ZWOA 2JFHA 4XCVA 4FD3A 1SZJG 2UAGA 1LRJA 5CG2A 2EWMA 3ITKA 3SC6A 2NQTA 3MOIA 4OYRA 4BV8A 2DC1A 4CPDA 1BW9A 1CF2O 3B6ZA 4WGGA 4XB1A 2C59A 1JWBB 2C7GA 2EKLA 3RUDA 3TNLA 4CV1A 4DGSA 1OC4A 2X0NA 5TSDA 1GR0A 2VN8A 2Y1CA 3BMQB 1U4SA 1UAGA 1OBFO 4L8VA 4NDNE 1BWSA 2OORA 3GPIA 3ZHYA 2JHGA 4PZCA 1GUZA 4N5LA 2ZQYA 4YQZA 3K8ZA 3JV7A 1DSSG 3TF5A 1QRRA 4W6ZA 2ZYDA 4YJGA 3PGXA 4CL3A 1R4MB 1C1DA 3ITDA 1LDGA 3D4OA 5FI3A 1BGVA 3ZWVA 2OGUA 3QA9A 1PZFA 3HJAA 4R9SA 3GVXA 1UZNA 5CHEA 4G81A 5JXWA 3TL3A 1X7HA 5KVSA 2OP0A 4D44A 1Q7BA 5ER9A 1DIHA 1PWZA 3S2EA 4BKQA 3PYMA 2EW2A 5EL0A 1DBVO 1N9GB 4PG5A 3KLPX 4CUKA 1V8BA 1SB9A 3NDRA 1Y5RA 3QQPA 1WNTA 2CSUA 4N7RA 2NVUB 1P1HA 1NQAO 1IY8A 2X0JA 3INGA 3PQEA 2BH9A 2NVWA 4J0EA 1YO6A 3ZZNA 1SEVA 5EPOA 1I3LA 1ZXLA 3VH1A 1I33A 1WW8A 4XX0A 1FDWA 2VWGA 4UULA 3BMNB 4QSMA 4BMSA 1GZ3A 3AI1A 4F46A 1K6JA 3GDGA 1LSOA 1UP4A 3QVTA 1HSZA 1LSJA 1LX6A 4I5DA 1DFHA 4NU5A 2BELA 3VH2A 5K6AA 4OOEA 1BW9B 3V2GA 3MJ4A 4TVBA 3DQPA 3QWAA 4GX5A 3ONFA 5TJHA 3LLVA 2BFOA 3GR6A 2LDXA 1M66A 1X1EA 3DZFA 4YBZA 3I9NA 4EYEA 2VWPA 3F3SA 1UH5A 5EJ2A 4ND2A 1ZK1A 4UUPA 1B16A 5I8ZA 2X5JO 2BHLA 4TZTA 4Z0HO 4BNTA 5L40A 1P33A 3NJ8A 3M6IA 1HDRA 2DPHA 5BT9A 1E5LA 5KIAA 4BGUA 3JQFC 1NVGA 1XR3A 1R66A 3L9XA 4CQMA 1C1DB 3PVZA 3N74A 4JXKA 3U0BA 1BDMA 3X2FA 4XJSA 4MVJD 1HE2A 1PR9A 1A4UA 3UGKA 2CDAA 3I23A 1HDZA 4N54A 1VC2A 1UXJA 3F9IA 3TZCA 3PIIA 1SC6A 8LDHA 2B4QA 2V6MA 2NLOA 3WBBA 2UDPA 3OIFA 3HB4X 3ZU5A 3F6YA 3QVWA 3WGQA 2O2YA 4Q3AA 4KUEA 4J9UE 5JYEA 1N7GA 1E3IA 5B1YA 2TMGA 3DAGA 3L4BA 3GF4A 4FQ8A 3WGIA 4PG4A 4PLZA 4EJ0A 3GN1A 5H83A 3DR3A 2Q50A 2GZ2A 1P77A 2CVQA 1MXFA 2VNAA 1FMCA 1Q7CA 2Y0CA 1DLJA 3IOYA 4FPXA 2YHUA 2B0JA 3A4VA 3KYBA 5THKA 3WDSA 1ISJA 3D5TA 4IDEA 3OECA 2CZCA 2ZK7A 4XZ3A 1Z7BA 4AJOA 4ESOA 2WSBA 1YBVA 3Q2KA 1J5PA 4RPLA 3PJDA 1Z75A 2PFGA 2W98A 2JKVA 3ZV6A 4CM9D 1DEHA 4GSKA 3GN2A 3E5MA 4E2WA 1NFFA 3I9JA 3O03A 1I10A 1ZCJA 1KVUA 1DPGA 1UXKA 1YRLA 4PVCA 5AYVA 3U49A 1RM0A 4NK5A 3WTCA 3HDJA 5IZCA 1UR5A 2IXAA 2NU7A 5FEUA 5HA5A 2Q46A 1O94A 2YV1A 3H65A 3GDOA 1AHIA 4UUNA 3GEGA 5TT1A 2O3JA 4Y8VA 3SXPA 3DBHA 1ID1A 4CQMB 4CJXA 3KTDA 5DP2A 1R0KA 3FTPA 2UV8A 5GY7A 3KO8A 4FFNA 5COAA 4PZDA 2YW9A 3WFJA 4BNFA 3HG7A 3WICA 3PZRA 3OEYA 4HKTA 4G65A 4Y6SA 1MUUA 1NYTA 4ZICA 4DC1A 3OMLA 4DIFA 3RFVA 3KEQA 3D1LA 5EMHA 2J3IA 2J6IA 3D3WA 4YT2A 4NQZA 1ISGA 1GEEA 5JCXA 5KJEA 1VRWA 1EVZA 3KYCB 4RVDA 1H6AA 4OMUA 4CMIA 4ZQEA 4ND5A 2DKNA 1E7WA 3B1KA 4IDAA 1JW9B 1YB5A 2R00A 3DBRB 4L75A 3RKRA 1O6ZA 4P4LA 4WOKA 3WSVA 1Q0HA 1ZNQO 1U9JA 4BNWA 3MJTA 3OQBA 4YPOA 4OXYA 5FI5A 1QLJA 3QRWA 4JCOA 1B3RA 3GH3A 4IGEA 4KQWA 1WDLA 3K6JA 3QVOA 2VTDA 2GGSA 4J1SA 5JDIC 3AOGA 1TT7A 5L7TA 1GL3A 3NGXA 1N5DA 2WMDA 3QWIA 4LK3A 3FWZA 2O48X 3P2OA 3QWFA 4GVLA 4YB8A 1EDOA 2HRBA 5B37A 1PS8A 3SEFA 4B3HA 4DIBA 3JYLA 1KEPA 4J3FA 4IPTA 4RLHA 3BTSA 2FR1A 3WLFA 1RYEA 4BQPA 3ADOA 4TSKA 1PJ4A 4CM1A 2HRZA 4YT4A 3WR5A 2VHXA 5F21A 5DBGA 4CLHA 1KETA 4MIOA 1VLLA 1M6WA 3ZW8A 1ZFNA 4LVCA 1H5QA 3GK3A 3UCXA 1XELA 4FCCA 4QX6A 4ZHSA 3RI3A 4AJ4A 1PSDA 1FK8A 1TB4A 2I3GA 1YDEA 3W8DA 2VOJA 2VUTA 5ITWA 1XU9A 4XR4A 2YV2A 3L0DA 4DQXA 1DC4A 3CKYA 3ZHBA 5U1PA 3K92A 3NTOA 2C0CA 3WNQA 3DZGA 3W8EA 3VOSA 3L77A 1EFKA 4U6QA 2ZCVA 3ULKA 4XQCA 1EFLA 2P91A 1CDOA 3D3WB 3C24A 3M2PA 2Y1DA 2DTDA 1EBFA 4IXWA 4U0KA 5A5EA 2CUKA 2JL1A 3TFOA 3H9QA 5KVCA 4NNJA 2E48A 3KETA 3DOOA 2H1SA 4E2XA 4XYGA 2DAPA 2FSVA 3DMYA 1DIBA 3HN2A 1VJ1A 2EHDA 4FS3A 5IZ4A 2AEMA 4D46A 1LLCA 4W9NC 5JYDA 5CG1A 1EZ4A 1W8DA 2AXQA 1XEAA 3GVHA 3B70A 1LDNA 1NXQA 4NBRA 1HZZA 4II3A 1ZUD1 4UAGA 1XCBA 3VTFA 1MGOA 2G5CA 1E1KA 2WEKA 2RHCA 1XYGA 3OFSA 1HF3A 1JA9A 1C1XB 1UXIA 5A9RA 2FPGA 1RKXA 3EK2A 5THQA 2RCYA 3DAFA 1EEHA 3EZLA 3PLRA 1IULA 1QMGA 3HDQA 4R5MA 2WDZA 4JK3A 3ZWPA 4NMHA 4XYEA 4Q3BA 3PFFA 1J49A 1NTOA 5A4DA 1ZMTA 4L0QA 2HO5A 4ILKA 3V5NA 1B7GO 4KZPA 1DAOA 1HDYA 3KRTA 4A73A 5C7IO 1AGNA 5AQ1A 2DFDA 3C1TA 5DN9A 4IY1A 3PJGA 4E4YA 4TRRA 2ZATA 4P8RA 3GUCA 1MFPA 2P2SA 2Q1WA 2EG9A 2PGDA 4OSPA 5G0TA 2VUUA 5LDGA 4CQMD 1CERA 2HAEA 3EW7A 5ILOA 4MKRA 4XEHA 1GPDG 3GGGA 5HBRA 4BNUA 3O26A 4INAA 1H6DA 5L7YA 4YAJA 3LZ6A 3NT2A 3EGOA 3MTGA 4UEJA 3U3XA 4D3SA 3NTRA 3VZSA 3RD5A 2X86A 5C5IA 1A27A 2IE0A 2XXBA 3H9EO 4MVJF 2NU9A 4WLFA 3JQ9A 3T7EA 4XIJA 2PKQO 4Q3EA 2X6TA 2I5PO 4Q9NA 5JC8A 4DMLA 3KHUA 4B7XA 2IEBA 5HRUA 4ND4A 2CNBA 4K28A 3OIGA 3BXXA 3AM4A 3DZJA 2NSDA 2GN6A 4XQEA 5DCWA 3WWZA 4BNLA 2FWMX 5I7EA 3LT2A 4BO1A 2HJSA 2VHZA 4IGFA 4E2ZA 1J4AA 1U5CA 1GUFA 3LC2O 1PJTA 1T24A 2JHFA 3DMTC 4YA6A 3RUCA 4B8ZA 4R01A 1XA0A 2AE1A 3JD4A 5KVQA 1YQXA 3I3OA 1DC3A 4ALNA 4Z9FA 3ANLA 4TZKA 4BIIA 2VHYA 3GLQA 5DP1A 1I24A 2HSDA 4IJUA 4R1SA 4QECA 3HNPA 5JAQA 1TEHA 2OZPA 4NIMA 5H81A 1LU9A 3RASA 4UREA 1QLHA 4RL6A 3RCBA 1GQYA 2HK7A 5ES3A 3WIEA 4FJ1A 4EEXA 4GAEA 3PTZA 3EAGA 3VDRA 1HYEA 1E3WB 1KEUA 4DPMA 3E6AA 1DDOA 1R4NB 2CVZA 5JC1A 3HE3A 2HMUA 2PZMA 3CH6A 3DL2A 2YQ5A 2PZKA 4K6CA 1TXGA 1K6XA 4BO8A 1X7DA 2DBQA 4YAEA 3ANNA 3F5QA 4D41A 4XYMA 3PI7A 3GY0A 1DOHA 4FDAA 2EGHA 4ALIA 1UDCA 4YT8A 2YYYA 1E3EA 4WCFC 4Q3CA 5K0ZA 2P9GA 3AM3A 3U4HA 5IFLA 2IXBA 3GA0A 3I9KA 1NBOA 1HXHA 1SO8A 1T2DA 3U4IA 4G2NA 2C54A 3WXBA 3JYPA 5CP8A 4WNCA 2HU2A 3I4CA 3KM0A 4OKNA 2Y1OA 4QO7A 2EJVA 2GRAA 3SBOA 3CZRA 4J49A 3W6UA 1OC2A 2Q49A 3RUEA 1OAAA 4IUYA 3BAZA 4I9HA 3FSRA 3BTOA 2D0IA 2H5LA 3JQGB 1ML3A 4D0RA 3VZRA 4UVDA 1E6EA 3PQDA 3U4CA 1L7DA 3L4SO 1U2GA 1C0LA 3DZIA 3BMCA 3SJUA 3V2HA 3I6QA 4ZU3A 4CR6A 4OQYA 3OA2A 4RPHA 2GF2A 4A27A 4CV2A 2POQX 4ZN6A 4J4BA 4PG6A 5G0WA 3AFMA 1MG0A 4CL8A 1NM5A 4XKJA 4A2CA 4BKRA 3H2SA 5JE8A 1Z82A 2HMWA 3F4BA 3LC1O 5TF4A 4D0SA 1YQGA 1YXMA 1GCUA 2Y0EA 3ROQA 5JAZA 3HFGA 2IODA 5T8KA 4NBVA 3PJEA 4OH1A 3BTVA 5J23A 1LSSA 4E2YA 5HS4A 2W2LA 2RIRA 1O89A 3G1UA 3AOEA 1H2HA 4IXTA 3TZ6A 1QV6A 2GNAA 4IQ8A 5EESA 3MCVA 3STHA 1H6BA 3WWYA 2OMEA 1YL7A 4RV9A 5KJ1A 2V6BA 5G4KB 1PZHA 3U5TA 3GEDA 1I36A 1Y8QA 1JQBA 1A71A 1T2AA 1V3UA 1ZJZA 3CTMA 4J9VA 1QKIA 1QYDA 3ZNNA 2GD1O 5JDCA 1FJHA 3PWKA 4A26A 1I8TA 3WIDA 4DUPA 2QYSA 3JQ8A 4W7HA 4B4OA 1XWFA 1Z6ZA 1EUDA 3MOGA 2QZZA 1ISHA 4HY3A 1HE3A 4IDDA 2E4AA 3ZGYA 5JS6A 2X9VA 4MOWA 4CQLB 5I9MA 3JQ6A 3AU9A 4GQAA 1SCUA 3E1KA 4XIYA 3OEWA 4YXFA 2EXXA 2FN7A 1QR6A 1K5HA 3ZWWA 1PGJA 1HDOA 2JD1A 1LNQA 4L74A 3TOXA 1LLUA 2Y66A 3U4DA 4U7WA 3CZMA 2UYYA 3BMCB 2W2KA 4J7UA 1P1IA 4EBFA 4B8WA 5CFZA 2BMAA 1H6CA 1KOLA 4I9NA 5BR7A 1E0DA 5ENDA 3ZU4A 4R3NA 4ZRNA 3C7AA 4BQRA 1CWUA 1DB3A 2DTXA 3T7CA 5DULA 5A9TA 1E77A 2YY7A 1I2CA 1PS0A 2X8LA 3N58A 5TS3A 3T4XA 4Z0TA 1N2SA 3ASVA 3NTQA 4R51A 3RROA 3WYBA 3BYZA 3KVOA 4E0BA 2FPPA 1O5IA 1MLDA 3H9GA 4JBHA 4DL9A 4E32A 3KYDB 4N18A 2I6TA 3E03A 4EEZA 3FCOA 5A9SA 2UUPA 1YH3A 1LDEA 2DM6A 1NR1A 2D2IA 3K5PA 4B7UA 1P44A 1Y8RA 4C4OA 3TRIA 2Q4EA 4MIEA 3H8VA 4EUHA 1GTMA 1ENZA 2V6GA 4MP8A 1PL6A 4M86A 3RC1A 2BI8A 4R1TA 4KOAA 3B1FA 3W8FA 4CUJA 3C7CB 2B37A 4FC6A 1ISIA 1SEPA 3FF4A 5TX7A 4Y9DA 4J4TA 2GLXA 3ORFA 2NQ8A 3PDJA 5JCJA 2ZB8A 4NR0A 3TZQA 3JQ8B 2VNSA 3AI2A 5DDIP 3UH1A 4DMMA 1E1MA 3GZNB 1X7GA 2BGKA 4XGIA 5JFOA 4IMPA 4XYBA 2B36A 5DNAA 3GGOA 3CXRA 4PIVA 1G0OA 4FBGA 1YGYA 3GG9A 4I5FA 1K89A 1OOEA 2NV6A 1AN9A 2WE8A 4F6LA 5T57A 5KVVA 1QSGA 1ZXBA 2PR2A 4RPKA 3FBTA 3TQHA 1PQWA 4KQXA 2B5WA 3ROMA 2C29D 3OF2A 4Q3NA 4AJIA 2V6FA 1TI7A 3H3JA 1ONNA 3JTMA 3H5RA 3O8QA 3QVSA 1E5QA 5LC1A 4E30A 4M89A 1JWAB 4KUHA 4YR9A 3P19A 3WYEA 1DLIA 2DPGA 2DUWA 3VHRA 3R0IA 1YBAA 3H9JA 1XG5A 4UUMA 4ITUA 4QO8A 3IMFA 1AHHA 4NZ9A 4OAQA 4HXYA 5CPBA 4CR7A 4IMRA 4LRTB 2VYNA 3OHSX 1ADFA 1HDGO 2I9PA 1W73A 4AVYA 4XGNA 3UCFA 1GADO 1RPNA 4IJKA 2Y1GA 2WYWA 2W4QA 5TGDA 4AJJA 3N7UA 2PZLA 5A9SB 2HLPA 2WJPA 2GYYA 1Y1PA 4TVOA 4D42A 1ZW1A 1PJ2A 3C8MA 1SOWA 1D7OA 3DZBA 4E5KA 3GNTA 4IQGA 5HM8A 2DVMA 1IZ0A 1EBUA 2HMVA 4C7JA 3IDSA 3ZNQA 1V9LA 3ICCA 4U6SA 1T26A 5GZ6A 3ABIA 1ZSVA 2CY0A 4UVEA 1ENOA 1CETA 1O8CA 4NHEA 5BNFA 3GVCA 1GYQA 4H16A 3M2TA 3MJCA 3TPCA 3BIOA 3ROPA 1MC4A 1XU7A 3P7MA 3CMMA 2VT3A 1ISMA 5C7LO 4XRRA 1ISFA 2Q1UA 2HMTA 3INTA 4XRGA 4J1QA 5DZSA 3RC7A 2LDBA 1GZ4A 3Q9NA 4YJGB 4P4GA 1VKNA 3A06A 1PJSA 3H4VA 3DXFA 1U4OA 4BNVA 4TKLA 1CEQA 1JAXA 3RVDA 5K6AC 1EE9A 2YDYA 1HWYA 1YDWA 3O8QB 2R6JA 3KSZO 4L4XA 4W99A 4CLXA 1SNYA 4Z3KA 4CMGA 3GG2A 3V1UA 4J0FA 1SMKA 3V1YA 1NP3A 1ZEJA 3ZN2A 3KEOA 1X1TA 2YDXA 1ADGA 3Q11A 3NT5A 3ZNOA 3JQEA 1A5ZA 4E21A 1D4FA 5I9NA 2XF8A 3JYNA 4WOJA 2NM0A 2O3TA 3WG9A 3H9UA 1GEGA 1YOVA 3R3JA 2JD2A 2W2LD 1ZEMA 3AK4A 4J16A 5I7VA 1SBYA 1IUKA 3DZHA 2H63A 3QWHA 4AG3A 1T4BA 3E18A 1MC5A 3AFNA 3IS3A 2C82A 2JAPA 5FWNA 1HEUA 1S7CA 2JFFA 3WOHA 3VPHA 1WDMA 2FSSA 4TRMA 4EJMA 1EMDA 4CMHA 2P68A 3QP9A 1DAPA 2FR0A 4ND1A 2CFCA 3K9QO 2I66A 3UUWA 1IE3A 1NVTA 4I08A 2YHIA 4TRJA 2I76A 3CEAA 3TJRA 3GRKA 3VTZA 1X15A 2H9IA 2PA3A 1ZKMA 2EERA 3AWDA 3CUKA 1G6KA 2VUSA 3LYLA 4R16A 5IXYA 3D64A 3PXXA 4MPDA 4GMGA 3L4BC 4CLRA 3WMWA 4NBUA 1KIFA 1BG6A 1QV7A 4XWYA 2D3TA 3WSWA 7MDHA 4EZBA 3LQFA 4HX5A 4WLVA 2W8ZA 3MWEB 3MWDB 1NQOA 3WFIA 4IZHA 1I3MA 3DC2A 5B4UA 4DBZA 2VRCA 3E82A 2OL4A 4WJZA 1NHGA 4ZQBA 1U5AA 4D7AA 4DVJA 1GV0A 1JKFA 1G0NA 3TWOA 3VC7A 3WGGA 3BA1A 1TT5A 4YEDA 4AJKA 4YRAA 2XAAA 1DRUA 2GDZA 2CDBA 4GH5A 4M1QA 4IBOA 4WPGA 3ZWNA 2RH4A 3RSHA 1HL3A 4PRKA 1SPXA 4AJ1A 4BS9A 4J7CA 4BGIA 4MVJH 1GV1A 2GASA 3GFGA 4J1NA 2PGJA 4MVJP 1ADBA 1D3AA 4XDYA 8ADHA 5IZCC 1UDBA 4MKXA 3G0OA 3AUUA 4HFMA 3DO5A 3LT0A 2G76A 4DQVA 2DBZA 5TLSA 5C37A 4P38A 1IL0A 1E3LA 3I9MA 4RPGA 1BXGA 3PIDA 1V35A 5JLAA 4HV4A 2NTJA 3NRCA 1LEHA 1Q2XA 2GZ1A 2Y1FA 2EGGA 2RAFA 3W1VA 1UAYA 3ZH2A 3AW9A 1YJ8A 4PFJA 4L4SA 1N92A 3JD3A 5HWSA 4L4RA 3KV3O 1HKUA 1EQ2A 3AM5A 4GKVA 4OXKA 4D43A 2X5OA 3NX4A 4OKIA 4RVGA 3ZV5A 1H9AA 3OA0A 1KVTA 1LC3A 2D4AA 1ZO8A 2Y67A 5EINA 4B79A 4GWGA 2FHSA 3RIHA 5ENVA 2AHRA 4HFNA 4CLRB 3C1AA 1DRVA 1QYCA 1GQ2A 4YCAA 2R00C 4G5HA 2I3AA 2BRUA 2D5AA 4HADA 2Y93A 4U8GA 4BNZA 3VH3A 4AJPA 1PTJA 2GCGA 1PQPA 3ZU2A 3JQBA 2Q1SA 3OJOA 4A5OA 4FOOA 3DHNA 4B4WA 3DBHB 4D45A 1E7MA 1E3SA 4DC0A 2IZ0A 3DONA 4J2HA 4YTEA 3WS7A 2CMDA 3PJFA 2EP7A 3FNHA 4Y6RA 5FF9A 1U7TA 3W6ZA 2YFHA 3E8XA 1M2WA 2P4HX 2CDCA 2PGLA 3FR8A 1HDXA 2OBNA 3G49A 3OP4A 1HT0A 3CSDA 3LC7O 3GHYA 3MEQA 1WDKA 2Q99A 3IUSA 5A3VA 3A9WA 5JY6A 3JQAA 3AU8A 3EYWA 1H93A 1PJLA 2GSDA 4PLVA 3HDHA 2QHXA 2X4GA 1NFRA 5F1KA 5F5NA 1XHLA 2EKQA 2OP1A 1Q0LA 3HUDA 4CMIB 2VYND 6ADHA 3GUYA 3H5NA 3LK7A 1LUAA 4YT5A 5L4SA 2Q2WA 1C0IA 3RFTA 4NBWA 3ZW9A 4DLAA 5A06A 2DBVO 2HUNA 4E13A 4D79A 2NUAA 1V3TA 3ETEA 1V3VA 4XQGA 1XIVA 4BGVA 4I5GA 5L53A 3O4RA 3HDYA 5DBFA 1VL8A 3PWZA 2QG4A 1LJ8A 3COSA 4ALLA 1YONA 3VAZA 3FN4A 1SB8A 1DFGA 2DBRA 2VWHA 3ZWCA 4BL5A 5GZ1A 1ZJYA 5JMPA 1TLTA 2DTEA 2HK9A 3EVNA 1HE4A 3C85A 4YAGA 5JAIA 1PZEA 1I0ZA 4NFYA 2B35A 3RC2A 2ZIZA 2ZYAA 3BMOA 1GYRA 2O2SA 2RH8A 4RORA 3MJVA 4MP3A 4U5QA 4YJFA 4B3JA 3WGZA 5F5LA 2QW8A 1UP6A 4R3WA 2ZJ1A 4X54A 4R1NA 5DT9A 4BNIA 2ZTLA 1AUPA 1O95A 1LRLA 1H94A 2AQ8A 1FDSA 3CMCO 3Q0EA 2Z1MA 4BKPA 1T1RA 1C0KA 3KLMX 1UXHA 2C7VA 4R9RA 3EY4A 4BUCA 3HB5X 3SJ7A 4MVJI 1YVEI 1DJQA 3PYXA 4FIZA 4YYZA 3UKOA 2BD0A 1MFZA 4IS3A 1PZGA 1ULUA 2P9EA 1KC1A 4H3VA 3OJEA 5IXSA 2BKAA 1FXSA 2FPIA 1GDHA 3O9ZA 3I83A 3EDMA 1U8FO 3HSKA 4IDGA 1I3KA 1I5RA 2R2GA 3JD1A 1NAHA 4AJNA 4C7KA 4IS2A 2BI7A 3OH8A 5KJFA 4DA9A 2OOSA 4ID9A 5EQFA 1M75A 2FP4A 3E9QA 1LI4A 4BO9A 2RBEA 1XKQA 4R1UA 4ALKA 4E31A 4NJOA 5I9LA 2BFPA 1KY4A 2DFVA 3WYCA 2F1KA 4A10A 2IDZA 2EKPA 3GMSA 4LCJA 3UVEA 4BNJA 5CDYA 1A4IA 1I32A 4E5NA 2ET6A 3IJPA 2Z1NA 3DFUA 1P31A 4HP8A 4PLHA 1EVJA 2YQ4A 2VYVA 3P2YA 4NU6A 5IN5A 2DT5A 1CYDA 5IDYA 4AFNA 4LW8A 3W4JA 1Z73A 1KS9A 4CLDA 1Z45A 4R4JA 4NFSA 1BSVA 1LQTA 1LA2A 4PRLA 2NU6A 3JQ9C 3K73O 1ENYA 1PJCA 1VL6A 1XLTA 5H82A 2H6EA 1B2LA 2O50A 2F00A 3LVFO 4J7XA 3R6DA 1FDVA 2DQ4A 1LBEA 3E9MA 4KDEA 4CLEA 2O4CA 1F8FA 4CMEA 5BSFA 4D3DA 5KWEA 2B4TO 4YJHA 2J3HA 3OQ6A 2A9FA 2X58A 2HDHA 4LSMA 4RLSA 4FFRA 4PCVA 4IIVA 4Q3DA 5KNLA 3D7LA 4FFPA 5JMWA 3FNGA 4QT0A 3CINA 4E5PA 2HJRA 2VRCD 1M76A 3DTTA 1P74A 2VHVA 3HQ4O 3EZYA 2OBYA 4GBJA 4WECA 3E9NA 4GKBA 4JJIA 4ALMA 3GRPA 4I8XA 4LN1A 4NK4A 1K6IA 3NV9A 3ZHXA 5CDUA 2ZTMA 4QFCA 1LRKA 1ZK3A 4HNHA 2NADA 4PN3A 4M55A 1HYGA 3W4IA 2X9NA 2YV3A 3U09A 2PH3A 3BHIA 1T2EA 2GUGA 2X23A 4NFHA 4PLGA 1J6UA 4ZD6A 4H7PA 1VJ0A 3ICPA 5DCYA 4DWVA 4ROSA 1A72A 1Y81A 2HCTA 1NAIA 2GZ3A 4RF4A 2G17A 3R3SA 2X0RA 3KB6A 3QIVA 5U4QA 5CEEA 1Y6JA 4GX1A 4LGVA 2O3UA 1YKFA 5A05A 4RDIA 5ILGA 3NDIA 3B1JA 4LSWA 2PD4A 4RQUA 2GN8A 3H3FA 3PYLA 4JNKA 2WD7A 2ZJ0A 4YWJA 3D4PA 2VRBA 5JSFA 2BGMA 1F17A 3V1TC 4FJ2A 3A1NA 1DC6A 2OFPA 2JCXA 5DOZA 3NT4A 1NNUA 5DCUA 4BO2A 4M54A 1JVSA 3VVBA 1YB1A 4UVHA 5IN4A 4YVFA 4LISA 3H7AA 4GLOA 3UICA 3IAHA 9LDBA 1GAEO 3PQFA 5LDHA 3GC6A 3ANMA 4H15A 1WZIA 3PP8A 5COQA 3VPFA 1VSVA 1PU2A 4YJHB 3UN1A 2VHWA 4DXHA 5AXBA 4BKOA 3ETDA 2IEDA 3RAJA 2B5VA 3GVIA 2C5EA 1ZIDA 4GGOA 4S1VA 1MB4A 1E7SA 9LDTA 5COBA 3PEFA 1JLLA 1YJQA 2IYOA 2IZ1A 4IIUA 4YJDA 5JO0A 3WX0A 2QYTA 1V6AA 1J0XO 1ZK4A 4M87A 4O5OA 2JD0A 3QW2A 4KWHA 3PHGA 2PH5A 3QHAA 1BMDA 1X14A 1DHTA 2X5KO 2X0IA 3MTJA 3L6OO 3PHHA 4QFDA 4FOSA 1HLDA 3JD0A 4RQTA 1E6WA 5EERA 1NPYA 2Q1TA 3VZQA 4CM5A 2V7PA 2J3KA 5GMOA 1OMOA 4O59O 2I65A 4JBGA 2VOEA 1A9ZA 1QXSA 1ZZEA 3WTBA 3S1LA 2PKRA 5BNIA 7ADHA 5T8KC 2TMDA 2GPTA 4NPCA 3PHJA 1HYHA 4CMAA 4M8SA 1HZJA 3L9WA 3S2IA 2Q2VA 3GHHA 3QV1A 1WMBA 1NX6A 1N8KA 3AOEC 4KTTE 2BFMA 1E92A 3AUSA 1AE1A 1Y5MA 1DIAA 3RJ5A 5TNXA 1PR3A 3GMDA 4DIOA 3DFZA 2J5KA 2JAHA 3O38A 2ILTA 4ZVVA 4KTVE 4FJ0A 1XGKA 1ZVMA 3LSYA 4Z9XA 1E1NA 1N1GA 4RPJA 1Q7GA 2YZ7A 4II2A 4ZGWA 3G1TA 2ZTUA 4PVDA 4OJNA 1CQIA 1BXZA 4YAKA 2VQ3A 1JTVA 5JDCC 5TRTA 2EIHA 3SC4A 4GPD1 5A02A 1A9YA 1B8VA 1HE5A 4Z6KA 3IC5A 1DIRA 3NAQA 3M1LA 2PD6A 5L51A 1ZK0A 2CF6A 3UFXA 3UF0A 2WWRA 1LC0A 1IZ9A 1R4MA 3ONDA 3ETGA 2GO1A 4WKGA 2JCYA 5MGBA 4OSOA 3EMKA 2O7QA 4N5MA 1YQDA 1B8PA 3PRJA 4XQ9A 1EUZA 1Y7TA 4ND3A 4BKUA 3PFWO 1A7AA 2WYVA 2ZB3A 4R41A 1P3DA 3A14A 2UVDA 3OSUA 3I52A 5DBIA 3RBXA 4BNMA 1U3TA 4OXNA 1MP0A 4MINA 4R68A 2AW5A 1Y8QB 2J5RA 5L3ZA 5CEFA 3NUGA 3Q3CA 1H9BA 3WB9A 4PLFA 1EUCA 3OJFA 4ONEA 1W4ZA 2NVUA 4BNNA 4CODB 1AXEA 1DJNA 1R12A 4OIMA 1EK5A 1PWXA 4BO6A 1KBZA 1VI2A 3G17A 4FFMA 5JW6A 3ZHZA 4JN6B 2NU8A 1B0AA 3IKVA 3OQ1A 1DIGA 4Z3DA 3AY3A 4J6FA 3NYWA 2AA3A 3TZHA 4K6FA 5TJ9A 1RWBA 4JBIA 4OO3A 3JYOA 1GFSA 3VPSA 2X9GA 3LU1A 4TKMA 5B4VA 2EP5A 4RZHA 4XDZA 4BO4A 4TRNA 3F46A 4CMCA 1P1KA 2NNLD 1ONPA 4J1TA 4R5HA 3QY9A 2W2KB 3RBZA 2VYVD 4OGWA 4L9RA 4Z0PA 3TSCA 4WEQA 5I7FA 4W7IA 2VZ9A 2YJZA 4AL4A 1IOLA 3QJ5A 4OHUA 3AY7A 4BVAA 3GVPA 1Y9AA 3DHYA 1Q1NA 2PNFA 4XGKA 4DYVA 3K31A 4RF3A 1VJTA 4KMSA 4OQZA 1XDWA 4NJMA 1HLPA 4DQUA 1RM5A 4Y67A 2A4KA 3VKUA 3WQQA 3AUAA 3DAPA 1YE3A 2VCYA 3FPLA 3FR7A 1P1RA 4YRDA 4D3FA 4EUEA 5C3MA 4CM8A 1KYQA 5I8WA 3H2ZA 3NEPX 1DRWA 1NVMB 3BTUA 1CRWG 3ENKA 2CVOA 4IDCA 1G1AA 2NTVA 4ZQGA 4K9DA 4TMFA 4E6PA 1HSOA 1NPTO 2FY8A 1Y8RB 4J90A 3VZPA 3VVCA 2EJWA 4BGEA 5TC4A 4YQYA 1BHSA 4URFA 2ZTVA 4J43A 3FPCA 1SOVA 4WK6A 2Q45A 5AVOA 1MX3A 1NHWA 1NFQA 1LDYA 3RFXA 4IM7A 3RBVA 2AEJA 2C2XA 5JO9A 3TN7A 4IDFA 4K26A 3UHAA 4GWKA 3SVTA 3K96A 1M67A 4GX2A 4UVIA 1EVYA 3ZWBA 4CM4A 3JQFA 5IG2A 4JP2A 3TL2A 3RUFA 5A1TA 4RDHA 3WBFA 3JD2A 3PLNA 4FW8A 4E33A 1QP8A 2XPCA 3ENNA 4PLPA 4HNGA 5KJCA 2J8ZA 2O3RA 5A03A 5CEJA 2ZCUA 2DU8A 1NQTA 3EHEA 2DLDA 1M6HA 4WCDA 4A03A 2UUOA 2Y68A 4Y6PA 3Q1LA 3ST7A 1ZSNA 3T4EA 2PD3A 1R16A 4QXMA 1P1FA 3GAZA 5FFFA 3Q6IA 3L6EA 4DPKA 3C1OA 2WE7A 4JGBA 1EVIA 1YS4A 1GUYA 4JJFA 3OM9A 3RUAA 4DRYA 1WXDA 4QTZA 1F8GA 4RVFA 5F1PA 4PGFA 1NQ5A 5BNTA 5EQDA 3WGHA 3L07A 4PG7A 4NJMB 3PDUA 4JQCA 1ZH8A 1N1EA 1WMAA 2NACA 2PV7A 2GN9A 5KCZA 4LRSB 4ZRMA 4CM8B 1BXKA 1T2CA 2P5UA 1VL0A 2QRKA 2QRLA 1TVEA 1U3WA 4NI5A 5JBIA 1ZSYA 2OHXA 1XQ1A 1IYZA 2AG5A 2DUUA 3IQDB 3JQDA 4FSHA 3KYCA 1NPDA 4O63O 2FZWA 3HADA 3RJ9A 5G4LA 2BFAA 1PIWA 3GNQA 3DBRA 4EUFA 1R15A 5T5QA 1PGOA 4RO0A 1OZAA 3PK0A 1K3TA 4WLOA 1DXYA 4CM4B 3RKUA 5IF3A 3LLSA 4XA8A 5ICMA 1CQJA 4KUGA 2O4UX 2C07A 3FNEA 4LMRA 5JNLA 1I30A 4FC7A 4DBVO 5KTKA 3DTYA 2NTNA 1D8AA 2WTBA 3AI3A 3E5RA 3GZ4A 3IKTA 2EW8A 4BNXA 2Y0DA 4P4NA 1T1SA 4E5MA 5IDWA 4FFLA 4WLNA 3UAGA 1I2ZA 1NWCA 4CMBA 4E3ZA 5BSEA 3ON5A 2E82A 2OO5A 5ICSA 2Q2QA 2PWZA 1B8UA 4LMPA 3B20A 1BVRA 1LQUA 2IZZA 5JPIA 1GYPA 5MDHA 4GGPA 4JX8A 3F5SA 1GY8A 1QYVA 2D1YA 4Y98A 3I9LA 1BRMA 5LCXA 1YWGO 1KY5A 4MVJE 1WP4A 4ALJA 3PHIA 5EIOA 4E5YA 5CDTA 1BVUA 1I2BA 4TROA 4BB6A 2IRWA 4GMFA 4K1LA 2VZ8A 4CLOA 2EEZA 1YOVB 1C0PA 1JVBA 4JP3A 3FRJA 2AQIA 5G2OA 1H0KA 3RUIA 1IPEA 1LTHR 4RCVA 3SX2A 1Z7EA 5IJZA 4QQRA 5JDIA 4HFRA 1UZLA 4XD2A 4OM8A 3ZWXA 3GNSA 1YB4A 2XOXA 3LDHA 2X7HA 5DOVA 1UUFA 2FMUA 3ADPA 1C14A 1LDMA 2YHIB 3VPGA 1UJMA 1ZMOA 3OETA 1U8XX 3UW3A 4EW6A 3VKVA 5BSHA 1RJWA 3QE3A 1WVGA 1KERA 5JCJD 5GZ3A 3WNVA 4EI2A 4BO5A 1EDZA 2PY6A 3RC9A 4BV9A 4XYLA 5G0VA 2AQHA 4WNIA 3FHLA 1R37A 3CPSA 3HFSA 4KDFA 4L73A 5L45A 1BDBA 1C1XA 2AEFA 2EF1A 3IP1A 1PJBA 4BHTA 2XXJA 3G79A 4I5EA 3WGOA 5L4LA 4JIGA 1IHXA 1GCOA 2QIOA 1MG5A 3S8MA 1W6UA 1TT5B 3V8BA 4FGSA 4W4TA 5KKAA 5C7OO 1Z74A 1Q0QA 2VZ0A 3I1JA 4I1IA 3KUXA 5JY1A 3QSGA 1OFGA 3PWSA 2P9CA 5JAMA 1WWKA 4KP7A 3F1KA 2QQ5A 2ZB4A 3ZWMA 4MIYA 4QUKA 4AJEA 3W4KA 3D3EA 3WQRA 4BNKA 1ZBQA 1WPQA 1O0SA 5T67A 3RWBA 4CMJA 2D8AA 1KVQA 1OI7A 3WGYA 1ARZA 3WJ7A 3DWFA 4W9NA 4AJLA 2BGLA 3GEMA 1CIVA 4CLOB 4CV0A 3DDNA 2O3SA 4E12A 3JQBC 1RYDA 2AE2A 4DLBA 3U62A 4IJWA 1BXGB 4EJ6A 4DLLA 4HUJA 3I9OA 2O3QA 2PK3A 4Q39A 5ADHA 1UP7A 1W0CA 1H2BA 1AXGA 3JYQA 3HZZA 4J4HA 2SCUA 1VKOA 2FZEA 4NH4A 1WZEA 3TZKA 3OICA 5L9AA 1IHYA 3TOZA 1PEDA 3DBLA 4I9UA 4O0LA 1HRDA 5FYDA 1NASA 2CD9A 2B69A 2Z95A 3QWBA 4FFOA 4BMNA 2HMSA 1SAYA 1P45A 2D59A 1QYXA 3GAFA 4S3MA 1T2FA 1PL7A 3IJRA 2V65A 2JFGA 3D4NA 4UEOA 4BO0A 4U0JA 3NDJA 4DPLA 1X13A 4ZQHA 4GSLA 4LCEA 4MO2A 1PGQA 2ZQZA 3QLJA 1GU7A 1JAYA 1U3VA 3ASUA 4O1MA 3RQSA 2AQKA 3RUHA 5T64A 4XJTA 1B3BA 1E7YA 1T25A 1ORRA 2PTGA 3AJRA 1R0LA 1S6YA 1YL5A 1RM4A 4FR5A 4FB5A 4YDRA 1F14A 1LLQA 4LVUA 4B7CA 4ZQFA 3ROKA 4BB5A 2P4QA 1ADCA 4RF2A 4BNGA 3FNFA 1B14A 4DTIA 4AICA 5L4NA 4HFJA 3EUWA 2W90A 2ZB7A 4W82A 1KEVA 3OJ0A 5U9CA 4WE3A 2QZ9A 1L1FA 4MVJM 1LXCA 3JQAB 3JSAA 1E3WA 2RHRA 2C5AA 1R4NA 4FGWA 4MVJG 2Y1EA 1E6UA 4DYDA 3FWNA 3D5QA 3DHEA 5G0UA 3SLGA 1DC5A 1DFIA 1JN0A 3FBGA 5A5FA 1F0YA 2J5QA 2C2YA 2EV9A 3DMTA 1EQUA 3UOGA 4PLCA 3CIFA 4CR8A 4PZEA 2CF5A 3VH4A 3ZDFA 2E6UX 1I3NA 2BLLA 2Z5LA 5L95A 3LF1A 3KBOA 4CM6A 3IP3A 2BF7A 4Z9YA 1Y9EA 1CJCA 4IJVA 2O23A 3HHPA 5ITVA 3CE6A 3DBLB 4UEKA 3K30A 4MP6A 3OIDA 3KXDA 1EE2A 5I7SA 3IL2A 4GLLA 1U28A 1L7EA 4UVGA 3FTNA 4FN4A 1I01A 1KC3A 3I4FA 3ONEA 1PGPA 3ZNPA 3BMOB 2WM3A 5AXAA 3Q2IA 4YJFB 3SLKA 3LT4A 1UXGA 5B4TA 5A04A 2X1HA 4CM3A 3JQGA 1P9LA 1F06A 3D0OA 3IIEA 1K2WA 5IDQA 5F1OA 4CMKA 2YUTA 1LLDA 3WGTA 4RGBA 1E7RA 4RVHA 5K9ZA 4RJTA 4DREA 5CDGA 2VT2A 2I99A 2YFQA 4KWIA 3UXYA 2ZKLA 3DB2A 2E49A 4B4UA 3GOHA 1A7KA 5B12A 1QYWA 4WCFA 2GN4A 5BQFA 4EITA 1X0VA 4JJGA 4TQGA 2P5YA 5TIIA 3ZV3A 1R0SA 3C7DB 1TA4A 1MXHA 3NJ4A 1PJ3A 3AY6A 1PS9A 1QG6A 3WJAA 4UUOA 3E48A 4IDBA 3VDQA 1EK6A 3GQVA 1E1LA 4ZA2A 1ZK2A 3KOUA 2JCVA 1HDCA 1PJQA 4CMEC 4JLWA 3P5SA 1T4DA 4MDHA 3ZV4A 4BOYA 1VPDA 5L7WA 3UCEA 4NG5A 3V2UA 4RZIA 2AMFA 5BSGA 2Y05A 5G4KA 1LSUA 3LT1A 1P1JA 3JCZA 4NBTA 5CAEA 2Q3EA 3GGPA 1B26A 3BZUA 1E7QA 4YRBA 3NGLA 1XSEA 3HWRA 5CDSA 3WQSB 3GDFA 4XR9A 2E37A 4RVUA 3I5MA 2J3JA 3MJSA 4WEOA 4F45A 4HBGA 6LDHA 3OJLA 3MZ0A 5HS6A 3TDKA 5TT0A 3BHMA 4GI2A 1P0CA 3MJEA 2Y99A 2GERA 1VM6A 2HKIA 3L6DA 4CQLA 4B4VA 3GT0A 4BO3A 4YAIA 3PHLA 2VTEA 3IUPA 1E3JA 4EGFA 3JQ7A 4B3IA 3ZWAA 4CUZA 1JU9A
chains in the Genus database with same CATH superfamily
3VPCA 4IRMA 2QZJA 3QYPA 2FFHA 3V46A 1IK4A 1U3UA 2XT0A 1R6DA 1GD1O 3H5AA 1A9XA 2K5UA 3A05A 3KSDO 1II8B 1D5WA 1N5RA 1WXFA 5H3CA 1I1QB 1MA0A 2B1GA 2W5UA 3KUKA 1MNQA 1BZYA 3PEVA 3DLHA 5BNWA 2M98A 1OFUX 4GVXA 1CVRA 1WY5A 2W48A 2FWAA 4IV8A 1OXXK 1R64A 4CKZA 1OFVA 2QRJA 1UM8A 3DOEA 4YCCA 5C81A 4ARIA 1KEWA 1JDJA 2JJYA 3DZKA 3OY7A 4M0PA 4YJ2F 2Z6AA 5EHIA 1BCSA 5KTMA 2Y27A 2XYVA 2Q4BA 5I4CA 4TMVA 2PKQP 3WIUA 3QG5A 4RE6A 1JDZA 2ZXUA 3HA2A 4WH0A 3WGVA 2JRLA 3HU5A 4X61A 2RH5A 2V0NA 1T3LA 1D0VA 4QLOA 3C43A 1EHCA 1EU1A 3QVXA 4WY2A 2F62A 3FYCA 1UEJA 1K75A 2AG8A 1J99A 2H06A 4JROA 1JKJA 4J6EA 4PNPA 4TN1A 2IITA 1QYRA 4F2DA 1XTZA 4N5NA 4Q3KA 2CUNA 1U1DA 4HTFB 5AXCA 2POCA 3WL4A 2WP8J 4NCNA 5LZ7A 4L0MA 4JUBA 1JEQA 3GPDG 3EPHA 1WMEA 4B85A 3AVWA 1QPBA 3R9WA 1VE9A 2A5LA 1WLYA 2OG1A 3IQEA 2PT7A 3CW2A 2X15A 1N2EA 2WIDA 3M1AA 4GWLA 4K2HA 4LOKA 4WASA 5AVKA 5GVSA 2R4UA 3IELA 4O6VA 4X65B 1WBBA 3B7PA 4GX0A 1VXRA 1ZC4A 1RRKA 4GZMA 1RZRD 4TYWA 5F3RA 4B0OA 1YR1A 2P2NA 2H5JA 2VEDA 2XVXA 3M5DA 4JJEA 2C7RA 3SHVA 1YMQA 2XZDA 3MLAA 4OXRA 4W5HA 1WAMA 3EC7A 1DEKA 3VOBA 1G4AE 2WYUA 4WAUA 3ZK9A 1DKNA 2AJCA 3GFQA 4HN9A 3H0CA 4RVSA 4ZOCA 5DF1A 4DLYA 2X22A 2CNDA 2QRGA 1P0FA 3GJSA 3GJ8A 1AUVA 3R09A 3UYKA 5GIOE 2PUWA 3LLUA 3DBVO 1L5QA 2A5FA 3DCNA 5BMVA 3IH5A 4UBNA 5B3KA 2ZRMA 4UNSA 2O7VA 3RU7A 4NXNB 4OL9A 4FYKA 4A6XA 2FOIA 4B1FA 1E3MA 3A28A 3CUTA 3N2GB 3F1LA 3U9LA 3BFKA 3VPXA 4EHDA 1O95D 4R69A 1JLLB 4DEXA 2O7SA 1YS9A 1QG2A 1LJLA 3LP5A 4IINA 3SYRA 4MJLA 1O2DA 3PGJA 1ZOOA 3Q3VA 4Q9LA 5EJGA 2B6HA 2LXNA 3S2GA 3TFQA 3H86A 3WRXC 1XJ0A 5FBKA 5G0SA 4CV3A 3FI9A 4MQEB 2XIJA 5EN4A 1U1CA 1IWBB 5AK5A 1F3OA 2YXDA 3ZI0A 1DEAA 3CT6A 2QMUA 1R0YA 2A14A 1IN5A 2G82A 2YC4C 3O9VA 5ALYA 4EPWA 4AJHA 3IE1A 4BXOB 3SQWA 1WXXA 1N5LA 1M7BA 2H5IA 2OFWA 4IQ0A 1JEDA 3KEGA 3TNJA 4MKZA 2UUAB 3OOWA 3IO5A 4ISCA 1OH8A 3VHQA 4QEDA 3WIOA 1JX6A 4YPFA 3GOQA 5IC4A 5J43A 2QBYA 5HCUA 4BCBA 4AJ2A 1U3FA 1I4DD 1JQAA 2WD8A 3EPPA 3LUDA 3MUEA 4KXFB 4ZCRA 1C4WA 2JPDA 1W4LA 2ZPTX 2DT8A 4X95A 3L7MA 5TE9A 3PC8C 3VC3A 3UWDA 2A35A 1ODLA 3KCQA 3MTEA 2VPXA 1W8IA 2XNSA 2UAGA 3BUSA 3BWVA 1H66A 5CG2A 4GFDA 1COWA 5JSQA 4GM1A 5CA1A 2EWMA 2LE0A 2NQTA 4MGYR 4TVKA 1KP3A 5KX5F 1LV8A 2Y6UA 3LMKA 5CA0A 2NSLA 1CRQA 1S2IA 2CJPA 3M4NA 1K68A 5E2AA 5GJBA 4O4JF 4QPCA 3RUDA 4CV1A 2P69A 1OR8A 3EJWA 3PQ6A 1N0WA 2GJ8A 2DPLA 4RH0A 1YA4A 2Q41A 2Y1CA 3BMQB 4L8VA 1ZD8A 1OBFO 2VZEA 4W1RA 1EXWA 5JWHA 3ZHYA 3R8FA 2WHEA 1FIUA 5BN3A 1Y6GA 4RIFA 4N5LA 5TR9A 1B00A 2ZQYA 1X1CA 1E6CA 2DUMA 3C15C 1AMUA 4E4TA 2RARA 5CTAA 4DCNA 3HDVA 4AYWA 4P0QB 4E94A 4HUQB 4K05A 1NR5A 1K88A 1Y1RA 2P6RA 1HQCA 4ESHA 3U4AA 4I3FA 4NZPA 4X97A 3SDBA 4PNEA 2G5PA 5AICA 2J9ZB 3UUEA 5C32A 1NJSA 5CCXA 4M0DA 1LBHA 5H4GA 5M7EA 3ZBUA 2ZRNA 3JY6A 4Y6GB 3E22B 2CXUA 3SICE 1GZ7A 1UZNA 2OGZA 4CT0A 4G81A 1W93A 1L5HB 1X7HA 3WGJA 1XTSA 2FUKA 2HBQA 3EASA 3WK8A 4X90A 3MJFA 2OP0A 4R83A 2RKWA 5ER9A 4GDFA 1PWZA 2RDMA 4BKQA 1BMTA 3PYMA 1JHOA 2H85A 4JOBA 5EL0A 5EXEA 1N9GB 4H1HA 3AQ4A 3L7LA 1CF9A 1AUXA 1SB9A 1DO2A 1DADA 1V8BA 3D2CA 1OGIA 2OYSA 1Y5RA 4L02A 2XD9A 3MCUA 2GEUA 4HDQB 5DLDA 1W25A 1WNTA 4FN5A 1ZI9A 1I4EB 2E9SA 5CVCA 4WBNB 1NLYA 4N7RA 5I47A 3C6XA 3SF0A 5AP9A 3PNSA 1NQAO 1P6UA 3LDGA 2Z57A 3N8GA 3R0XA 1JPUA 5K2MA 1YO6A 3CGGA 5EPOA 2FN4A 5FOWA 4N01A 1FDWA 4UULA 3BMNB 3OO0A 3E9YA 3KX2A 3JXEA 3NBAA 4QSMA 4FZ3A 3S29A 5KAPA 1LSOA 1P1BA 1QR2A 5E0OA 1UP4A 2A0FA 4BE7B 3CF2A 2QRMA 3CZAA 5FWXB 3R77A 2C4WA 2ZUEA 3G2KA 5K6AA 2RG1A 3D8RA 2Q6LA 3LYUA 2IPNA 4MMYB 5DHPA 3BGIA 4QJIA 3GLGE 3DQPA 3AETB 3AHGA 4OUDB 3QFFA 1UOEA 2AR7A 1RKBA 4LXGA 5DHTA 2XY4A 4EYSA 1AB6A 3I9NA 1JSLA 4BEWA 2VWPA 3CBGA 3F3SA 1UH5A 4M36A 1ZBDA 4MARA 5IAJA 5LN1A 3BKWA 1Z36A 1ZICA 1WETA 1VMKA 4EY8A 1CIPA 1LF0A 1H42A 1JF8A 3CGWA 5IVIA 2DPHA 1AZWA 2QT0A 1Y4DE 2LUOA 4BP3A 4CIDA 1A9OA 5BT9A 2BDUA 3D6HA 1E99A 3PD1A 2PBZA 4PQRA 3T5CA 4IX1A 4KPEC 3RKSA 3GD5A 4UQOA 1C1DB 1GUAA 3BE8A 4HAVA 1PFQA 2J7KA 1LQ2A 2PEZA 4IWYA 2OOKA 3Q5EA 4PHTA 4WT7A 1X9GA 1QQ6A 2QM7A 4GSYA 3V3TA 4MVJD 2B25A 4BGPA 3VVMA 4DA0A 2PUAA 1PR9A 5LU9A 2FNAA 3UGKA 1JTEA 3ZY5A 5IX8A 4H1UA 1Z47A 5HRCA 4QVGA 2O14A 5K0EA 2VHTA 3RU2A 3VNQA 1Y5LA 3I1IA 3TZCA 4GP6A 4RV4A 2HIMA 5ED4A 4UAUA 3KTAA 2GN0A 1NLZA 4QTUB 1Z35A 3N6XA 3PE3A 4F85A 1XZFA 3BL6A 3NDBB 1CCWA 3WBBA 2UDPA 2AC2A 1TTHA 1IJEA 2FCAA 5KNBH 4PSVA 3AJ8A 3AL3A 4B6OA 4CU2A 5JYEA 2Z56A 3EGVA 1FPMA 4PQYA 2XQIA 3WSTA 1JQ5A 4FQ8A 4H7IA 4PG4A 2PKYX 4PLZA 4QGSA 2XYHA 3GN1A 5H83A 2EQAA 2GZ2A 1P77A 2Q50A 1YRAA 1BHJA 3I5XA 2A5YB 3QBTA 4LTNA 2B1IA 2O7NA 3H6HA 1MXFA 1PJRA 2DHCA 4B6PA 4ZHQB 5GM2A 1U7DA 4BQEA 1FMCA 4QUEA 3CVXA 1E6LA 1FRNA 3DLIA 3ORQA 4GXRA 2JJ2D 1M2FA 3N7TA 3CKLA 4HUTA 1A98A 2JLXA 2YHUA 1V6CA 2B0JA 4RK7A 5EUMA 3U81A 3PJRA 1Y37A 4KSCA 3GLIB 4DV6B 3A4YA 2PTHA 5E1DA 2VYFA 3MQ4A 4Y7DA 4D8XA 3Q2KA 1Z8NA 1J5PA 3ONNA 3PJDA 1Z75A 4RPLA 4K9OA 3ZR4B 2AMVA 1K4YA 4ITRC 4UM8B 1DEHA 4CM9D 1RBZA 1GU1A 3GARA 3GN2A 1CR1A 3E5MA 3QMVA 4K8OA 1KVUA 1DKLA 3EOAI 4PVCA 4MMXB 4NCXA 4RYLA 2I03A 4AZTA 3SYTA 2R6CA 2ZXFA 2VP9A 4NK5A 1SXJC 3G13A 2BC9A 1U2RA 3B6EA 3LPCA 4N5DA 2NU7A 3NEYA 1B8NA 3FOZA 1G19A 1W35A 3BEOA 1XKXA 3BSYA 2OV4A 3K6SB 1DIOB 4HEJA 3LUAA 4I1PA 1O94A 5AJZA 1P7VA 2YV1A 1VP3A 4H6VA 4V2UA 5C31A 3SXPA 3DBHA 4CQMB 4FTWA 4Q7EA 4F60A 3QEBZ 4LYHA 2QW1A 3IAFA 4U00A 3BXZA 2UV8A 1G21B 5ERGB 5IT9A 4FFNA 5DWQA 1AKVA 1OH6A 3F73A 1IHPA 3H1TA 1JUDA 2FEKA 5CIQA 4F0JA 3HG7A 3IEIA 2WHXA 5LXTF 3DXZA 4HKTA 1R00A 1NULA 1SVUA 1JPJA 4X3CA 2I2AA 1XROA 2Y9MB 3Q7RA 4OV6B 3EWNA 2X8BA 5LP6F 4DC1A 2BYTA 2X1LA 4R6XA 5HVNA 1G8YA 1T3SA 3O5AA 2OO5C 4PAGA 3B9PA 2GN2A 2E0IA 3D1LA 1O9HA 4JHLA 4OHWA 1YVRA 2J3IA 5EMHA 4JI0B 1EFPA 5JCXA 4UBIA 4JV5B 2O1EA 3HMKA 9MHTA 3SKVA 5GTDA 4RVDA 2ORVA 2HA5A 4OMUA 3SZOA 1KYTA 3AXTA 3MGAA 3PFCA 4ND5A 1M2OA 1Q7EA 3O4JA 4PAQA 1ABBA 5DI3A 1YB5A 3JARB 3T5BA 4L75A 3RKRA 1O6ZA 5KU1A 3WSVA 2QZSA 1G6OA 3ORSA 1ZNQO 3O8RA 4H77A 1ACJA 4O4LA 4LOAA 4BZZA 1U0GA 2JFVA 5JG7A 3LCMA 3QVGA 1QNLA 5FI5A 1QLJA 1B3RA 4B09A 3V7NA 1BJKA 1RQPA 4HAUA 4WIAA 2HJVA 2HU5A 3BZWA 3TLBA 1L3CA 2JIDA 1ES9A 1VMIA 1YR9A 4Y6OA 1Z26A 3K6JA 4Q1DA 3QVOA 5EZSA 3WKBA 2PPLA 3QX7A 4UHHA 1RLJA 1MKYA 5JDIC 3AOGA 4QPPA 4B35A 1VE7A 2WMDA 3CZ5A 4L5JA 3FWZA 2O48X 3P2OA 4IJMA 2J9GA 1C8VB 4CL2A 5F78A 1GM5A 1PS8A 3U3MA 1I1HA 2QVZX 2E6KA 2CNKA 5TPWB 3JYLA 3LKBA 5ELMA 1CJTC 2VH2A 3RVNA 3UAVA 4RLHA 4MUNA 2G09A 4QYXA 3AF4A 3ADOA 1P9RA 1AHNA 5B1SA 3HWX1 1H2EA 2MIIA 4EPRA 1KRXA 2X2FA 2IIQA 1LW6E 3KQKA 2VA8A 1FJ2A 1KETA 5JMTA 1AQIA 1DBIA 3HCAA 1C9YA 3HEAA 3ZW8A 5CDFE 4KHPB 2GD0A 3PB3A 3IB3A 4AG5A 1L5KA 1XELA 1KOFA 3RI3A 5LP6A 2GHIA 1Q3TA 3W8DA 1P2UA 2VUTA 3ZTTA 1XU9A 1LJUA 1Z6QA 5AUQA 2YV2A 2W2NA 5CIWA 5GJCA 4YRRA 1UODA 4YMVA 1ULAA 3NTOA 1U0EA 1RLTA 4RHUA 3ASZA 4QG3A 2PRSA 1CNMA 3L77A 1PYGA 3R7AA 1CUSA 3UNXA 2XGSA 4FFBB 4KDRA 2QMZA 1II0A 3D7KA 3P9KA 4JI2B 4RD4A 1EBFA 1CB0A 5A5EA 1GGKA 3U3RA 3B1WA 4ILEA 2Z6VA 5K0NA 4MV6A 3OEED 4G9EA 2VHCA 3GDWA 1WKCA 4NNJA 4BKOA 2A2ZA 4E1AA 1Q15A 1Y82A 2YNMD 4X84A 4E2XA 4B43A 5C52B 2WUVA 3DMYA 4FS3A 4S1NA 2EHDA 1BA3A 3AF5A 3E15A 3I2IA 3JQPA 3Q98A 5JYDA 3C3AA 3E1SA 3IQHX 3PXCX 4G4SP 1DKUA 4I55A 1KF0A 3FPKA 1M2GA 4RHCA 4AZSA 5LOVF 5LSAA 2HLNA 2JHAA 3GVHA 4M9RA 4PX3A 1LDNA 4WV3A 2IYRA 2FRXA 4FU0A 4LZLA 1ZUD1 3LK6A 2DWCA 4NJEA 2R4TA 2H1OA 1L6RA 4YRCA 2D2FA 4J0HA 2G7MC 2AOTA 1HF3A 1EJ6A 2CXHA 1C1XB 3Q15C 5J5VA 1UOOA 5BV7A 1TJNA 5A9RA 5JI2E 2F90A 4B3CA 1T3ZA 2FEPA 2RCYA 4DSOA 2HWXA 3LDAA 3EZLA 3AERB 5CT8A 1IULA 1S0UA 2WDZA 4R5MA 2UXDB 3VO2A 4LMAA 3PX3A 5JVDA 4XSVA 4ENPA 3CCFA 1D7AA 3BOSA 3ZTWA 1ZVVA 2UZAA 1ZH6A 4L27A 1NTOA 4KQ9A 3N75A 1U0FA 4WDRA 1JSXA 5AW2A 4M6WA 3ZC3A 4RA6B 1A1SA 4NZNA 3ZLBA 5FPPA 2BR4A 2H18A 3KLOA 4U2KA 3KRTA 3ABSB 4A73A 1P91A 4E51A 5I3CA 3ET5A 4LXTA 1AGNA 3P45A 5FULA 5JQGF 2DFDA 3C1TA 3Q9LA 4IY1A 3PJGA 2FWRA 3RV3A 3L8FA 3DEFA 1KGDA 3BAFA 3HBFA 1QTQA 2P2SA 2Q1WA 4AW9A 2EG9A 3ILYA 4HZUA 5E6RA 5IBQA 4D8TA 4CQMD 1SWVA 2WG0A 4DJJA 4MKRA 1IHUA 3GGGA 1V26A 4U1RA 3UMMA 4V03A 5BR8B 3HABA 1RZUA 2HSGA 4INAA 4KRXA 1TJ3A 3NBXX 1NKSA 1NDUA 2NZVG 3HXKA 4QTYA 4YAJA 1VPWA 3NT2A 1KI6B 3IV9A 3MTGA 4UEJA 3UJAA 3U3XA 5J59A 3VZSA 4Z49A 2HMYB 4RV5A 4ZO9A 3HV0A 2O6LA 4D0LB 2LD4A 2XUKA 2Z98A 1A27A 1E20A 5HJ5A 5LDDC 4LFCB 1B0UA 4B7AA 5DLYA 1RAIA 2BEUB 2NU9A 1E1YA 3ONVA 2ZBUA 3D6TB 1V5WA 3JQ9A 1OVGA 3VDXA 1W59A 2I5PO 5ILQA 4Q9NA 4DMLA 3IUYA 5K20A 2IEBA 3KPVA 4IGAA 1YDGA 1Z7WA 3EFBA 2Q5HA 2ZU0C 1SHJA 4Q4DA 4RAOA 1RC8A 4XIGS 1JXQA 2JRCA 4ND4A 4X1YB 5GAJA 3FKSA 4XARA 3RRMA 4BEJA 1DARA 3K5IA 4IVRA 3AM4A 3WLHA 1P5HA 2OO7A 5LQDA 3FMGA 4KQMA 3KLNA 4PC3A 1BCRA 2NSDA 3HPQA 4XQEA 4R2LA 1ZD3A 4F5DA 4ENQA 2J9XB 3QPDA 2QNBA 2HJSA 2QVYX 3EAFA 1JDBB 4E2ZA 1U5CA 1FUEA 2WZQA 1AGXA 2JHFA 3AKYA 3NNDA 3H18A 4B8ZA 1TAGA 3ZJTA 1WW3A 3W5VA 4IIJA 2C92A 3UMCA 4FYJA 3ETHA 1LS1A 3PCXA 3AHDA 4W9MC 3FUVA 1Z6PA 2CW5A 3KNZA 4WFQA 3T6KA 2A84A 5K0CA 4LZOA 5JAQA 3HNPA 3MB8A 5FTKA 3O4VA 3EIEA 4JR0A 2OZPA 5H81A 1OV6A 1LU9A 2YASA 3G5MA 5CGZA 3NAMA 2J0SA 2V7TA 4UREA 5DU2A 1GAJA 4MS3A 1F4LA 4RL6A 1CNFA 1OROA 4TTSA 1XRLA 3H83A 3AYXB 1JU4A 1KO1A 1N0IA 4GAEA 4R2KA 3C6BA 2HV9A 3AR2A 5TDHA 3S99A 4DZTA 1XK6A 4EA6A 3ABOB 3E6AA 1DDOA 1CE8A 3NTVA 5JNSA 3HE3A 2PZMA 3CH6A 3T7RA 4CW7A 2OZEA 2R7NA 2PZKA 4A15A 1ZCBA 4ZCPA 2Q8NA 2XZOA 4BMZA 3ORYA 3HUEA 1JHPA 1XA4A 1SC4A 1C9KA 1G7CA 3E9CA 3NRBA 4XYMA 1QO9A 1YRYE 1DXHA 3FH0A 1C81A 2BISA 3GY0A 2OQIA 4FDAA 4M9ZA 3L82B 4QXOA 5FOUA 1UDCA 2QMYA 3ID6C 2VKTA 4A2QA 4PYJA 1LBIA 4DCUA 4GMKA 4OFXA 2DQKA 3HDTA 1E3EA 3MIZA 4Q3CA 3GUUA 4TM8A 4HDNA 5CT6A 5JT1A 1Z15A 4WTOA 2OA0A 3VU9B 2IXBA 1DINA 3BXOA 3CTPA 4FYHA 1OQAA 1E59A 3G8YA 3SQLA 5HGXA 1OB5A 1HYQA 4G2NA 3SNKA 3HEMA 4WNCA 2ZCJA 1GAXA 3RPEA 2OLEA 2BGTA 4ECAA 2XCTB 2HC9A 1M1NB 4OKNA 4TM7A 1DTSA 2IBSA 4LRWA 1PR5A 2PYIA 2IZ5A 1AKQA 3IMEA 4QJ5A 4U63A 5G3ZA 3WHLA 1GGMA 1OYYA 3LE8A 1ID8A 1ZD9A 3PSHA 5AWFC 1OC2A 3RUEA 5HJEA 1X7WA 1M7HA 2XTZA 2Z2XA 3ND5A 4YAOA 2PJUA 5GOZA 4AMBA 4ENUA 5C8YB 1EDDA 1UPBA 2H5LA 4YFYA 4S2EA 3W3ZB 1NXSA 3ZGNA 2H00A 1L7DA 2QK4A 1EX1A 2F43B 3DZIA 1MO4A 2HOQA 2JK1A 3BMCA 4AI6A 4MLDA 1G3RA 1Q84A 4RZUA 4ZU3A 4CR6A 2BFDB 4PZPA 2IKQA 1KQFA 3IVRA 4OQYA 2NZ2A 4GU5A 3PDIA 2O8EB 2BR3A 3A4LA 3D6AA 2PKCA 4MGKR 4UUAA 4XKJA 4BKRA 4GBGA 3K0SA 1YFLA 4NCJA 3D8TA 3RVJA 5HKBA 4REOA 1H8ED 3CRQA 5KYNA 5FXMA 1AKNA 1GCUA 1YXMA 1TTPB 3ISTA 2IODA 4I0WB 4TT8A 1LSSA 3N86A 4E2YA 1I2MA 3BH7A 5HS4A 1HI9A 2VK2A 1D0IA 2RIRA 4JI1B 1UDRA 3G1UA 3AOEA 4W5TA 2YZMA 1H23A 4AXBA 1ZCZA 1QV6A 3CJRA 3OT4A 3VR2A 4C6HA 4HDSB 2IFTA 1EUYA 1X3SA 2WICA 5LYJB 3SDSA 3FYUB 2FR8C 2HJHA 4GE3A 4LJ4A 4GZ3A 3T5PA 4M1ZA 1AK9A 4PICA 5TPZA 2VHJA 4QM7A 5KJ1A 3S2ZA 1NNEA 4TQ9A 1LFDB 5CAEB 4DB2A 1Y8QA 4R9NA 4ZV9A 3F5FA 4MWBA 1VJCA 4NE2A 2TSYB 3O8LA 4EO9A 3KVYA 4D4MA 1XYYA 3CTMA 4QRDA 3DHWC 4NULA 5CB6A 3LCUA 5JDCA 2PHZA 2GDJA 3WIDA 3HJHA 3QVJA 4B6SA 1PO7A 1TYCA 2MU1A 3VYSB 2D1FA 3HZOA 1TQDA 3T7JA 3JQ8A 2DFKB 3E3NA 1QF7A 1XWFA 1JDVA 2BKEA 4W7HA 2UYQA 3VQTA 1QFJA 1Y3HA 4HY3A 1HE3A 4EFLA 1GSHA 4R05A 5IT5A 5JS6A 4RH1A 3TW0A 2X9VA 3O74A 4MOWA 3UKDA 2SKDA 2IH4A 2XVZA 1O5TA 4WZAB 3DT8A 1YI0A 4XE5A 5I9MA 4C4TA 3QU9A 2C00A 1ZGHA 2AK2A 1W36B 1YZLA 3E1KA 1G8HA 4XIYA 1EE1A 3OEWA 2GCNA 4YXFA 3AVYA 2Q9CA 3NOVA 1QR6A 1UKBA 1XZBA 2JD1A 4TTJA 1C1YA 3WK5A 2EFDB 4QOGA 1A9XB 2Y66A 3VVLA 4HEQA 2OKCA 2WMNB 3TLEA 3WAGA 4BFYA 4DV7B 4NMMA 5AKJA 1VGRA 3IAM6 2R8RA 3MT8A 3RYTC 1SKYB 2NOAA 1MW9X 3OZUA 4B8WA 1I7QB 3KFLA 5LNK1 1U0LA 2Q5LA 1PV1A 3ZCUA 3JYHA 2UKDA 3M6WA 4I9NA 4N03A 1C2YA 1WLSA 3LPDA 1E0DA 5ENDA 2ES4A 1GKKA 2AC4A 3IPLA 1NIPA 1YMVA 2QP3A 3NB0A 1CWUA 2DTXA 1BCSB 3HZRA 5DULA 3C16C 1Z5WA 4LTMA 4TWIA 4C5BA 1OIVA 2ZBGA 1Z16A 2VFAA 2YY7A 4LX8A 4HEA6 4A0RA 4Z99A 1DKOA 1YIDA 3A1UA 3NTQA 3PENA 1KH1A 3WYBA 3KVOA 3IEPA 2W70A 5CJJA 4G85A 3H9GA 1GTRA 4KQKA 1NJ8A 2PSFA 2PL9A 2RSLA 2ZYSA 3UJHA 1KOGA 2WV7A 2AW3A 4LC0A 2P5SA 4FDMA 4EEZA 3DYBA 4O2AF 2WTUA 1ZCFA 3RRYA 1LDEA 1IAQA 3HLYA 3LNTA 2X41A 1D6SA 4KN9S 2ID7A 1Y8RA 4N3NA 4F96A 1TEXA 4P54A 2Q4TA 2Q4EA 1ORWA 3A10A 4JGGA 1ENZA 2AMLA 4U9UA 4GRDA 4MP8A 4KKXB 2GQ0A 2W2XA 3W8FA 3W7VA 4CUJA 3NIBA 4OPMA 2PBRA 1L4HA 3C7CB 3A58B 4KR6A 1SEPA 1PFUA 2XMPA 5TX7A 2H5EA 2R5WA 2WNHA 4Y9DA 3ROEA 3H99A 4HH3C 2JCGA 5E2BA 1WCYA 2GO7A 4RK1A 3IT0A 1K4MA 4AT1A 2WQ6A 5JU6A 2H29A 3AVOA 3BH0A 3OZFA 3EXIA 4HJRA 3O95A 4TTVA 2JZNA 3PEEA 2XSZA 2BGKA 4XGIA 1CQWA 3AEQA 1E2GA 1NUHA 2B36A 3D0QA 1PHRA 4OH7A 1Q44A 2Y9PB 4TYQA 3FOFC 3FNBA 1ULZA 3EQ6A 1W0KD 3GFRA 1LPAB 2CXSA 1FW6A 3SEQA 4OFZA 3G9XA 3QUAA 4I5FA 3UB2A 2NV6A 2XB8A 1GFZA 4TLLB 3L8ZA 1HEIA 4JLNA 5FA6A 4C21A 3IBYA 3IURA 3LPLA 4G36A 5FR2A 4TLCA 3L8HA 5CNIA 1SG0A 4PRZA 1D0SA 1NUTA 4UDNA 4O4IF 3RF6A 3U37A 4CI0B 1HA3A 2O7RA 3A6FA 2WIFA 3WP0A 4MH0R 1VIYA 1JWAB 2IQIA 4KUHA 4M89A 3SC3A 4CDGA 4E70A 3W6OA 5BT8A 2N1MA 3IAAA 1DLIA 4UU0A 5LNK6 3VHRA 2B61A 1XVLA 1Y33E 4B75A 1UL1X 1FFCA 1ZS9A 2IY9A 2R3SA 4ITUA 5A6SA 4GOLD 5KDDA 1AHHA 4CR7A 1UBTS 1JRLA 3DMPA 1M34E 1IIRA 1OFUA 3L7AA 3H1GA 2JFQA 2NO1A 2JZOA 4IEEA 4OQFA 2I9PA 5B2EA 2D2EA 3NQ41 2WDPA 4AVYA 4EKDA 1N77A 1QVZA 1BDHA 5EZYB 3UCFA 4IJKA 1RPNA 3N28A 2W4QA 2FX3A 5TGDA 2QBYB 5IKOA 2I34A 2VSFA 2JHPA 4KWEA 2PJRA 3HXPA 1NX9A 4TVOA 5KVAA 4HQ6A 2XH8A 5IUNC 3BB4A 2B21A 3JZDA 4NZZA 3WHPA 3DZBA 4QGBA 3WV5A 3GNTA 4IJ6A 4B6EA 2R5NA 4WN9A 4V0ME 2DVMA 3RVBA 9GPBA 3EG9A 1IZ0A 5HM8A 4R2MA 1VJRA 1AGPA 1CQXA 4EW2A 1UAAA 1T26A 5GZ6A 1ZSVA 1WUTA 2GYVA 5AH0A 5CA0B 5EIWA 1IY2A 2HPAA 3TLCA 1ENOA 2Z09A 3EQ9A 2QE7D 1CETA 1O8CA 4NHEA 2Z4TA 3ZGVA 2IKSA 3ZPXA 1Q7TA 1HMPA 1GYQA 4BQSA 5DXFA 3TE7A 2ZUFA 1QP4A 2XF2A 2HIHA 3LPAA 4H60A 4I4CA 1MOSA 1N8TA 3H3XA 2A58A 5A3SA 4OGKA 1IN7A 3DEKA 1X9HA 4BNDB 2CXTA 3P7MA 3CMMA 2VT3A 2CLKB 5C1DA 5HMMA 2WV9A 2B8WA 2CVHA 2XWPA 2QTGA 4FLFA 2D74A 2XCUA 2V5UA 4YCLA 2HMTA 3INTA 4LJ9A 4ZVTA 1AQJA 3RC7A 4JNGA 1MO5A 4HG2A 4WXHA 3USZA 1W36D 5AUNB 1GZ4A 4B33A 1JBEA 4ZT5A 1PLKA 3EPJA 5BORA 1YNOA 3EZNA 3TZEA 1VKNA 3X3HA 1JAIA 4ZALA 3H4VA 2JG3A 3DXFA 3F7NA 3T3DA 4BNVA 3PR3A 1WDTA 5JTTA 1OKKA 4KFTA 2ZI7A 1QVAA 1CEQA 1U0SY 3EVCA 4HGOA 4IOMA 4YCDA 1GPBA 3MBIA 5AI5A 3RVDA 4MAFA 3T7IA 1ZAYA 1IFXA 2ZIEA 1CUYA 1CUFA 3O8QB 1LW7A 2VXYA 4P33A 3A9VA 3IT3A 3AB7A 4G01B 3S2YA 2HXSA 3IVXA 3E4DA 1V1MA 3SYLA 4Z3KA 3OFKA 3GG2A 5H7XA 3RF7A 1PCXA 3GUVA 3V1UA 2QJOA 1SU8A 2ZT8A 2PXHA 1NP3A 3BBPA 3GEPA 4K6KA 4NOMA 1X1TA 3I58A 2YDXA 5GGYA 2V3CC 3AF1A 4LEIA 1Z08A 2Q5JA 1N6IA 3KU4A 4QBIA 3PC2A 4E2FA 4DSUA 1CJMA 1A5ZA 3RTBA 2YJ6A 3CURA 3DVRX 4O2BA 1BN6A 2O3TA 3HP4A 2Z6QA 1MV5A 5KNDH 1E5TA 2W2LD 4KO1S 3N8HA 4J16A 5I7VA 2HM7A 3L0YA 1D6MA 1I3OA 3D1VA 3LBFA 4EPTA 4AG3A 2ERYA 4M98A 4JDPA 1HEUA 3EBLA 1WM1A 2G40A 4X7MA 3VPHA 1WDMA 2VJLA 1EMDA 4RZSA 1CLUA 1XEFA 2XTAA 2NMVA 2PLWA 3KQYA 1LF5A 2FR0A 3EH2A 2CFCA 1UPXA 3K9FC 1V5IA 1WOYA 3UUWA 1NVTA 3MBOA 1JIQA 1U1EA 2YHIA 4I08A 2NN3C 3NYQA 2I76A 3CEAA 4TVSA 2EAUA 3ROTA 3VTZA 1X74A 3H87A 2H9IA 4EY5A 1CJSA 1UPFA 5F35A 1ZKMA 3UJ7A 1OBOA 4F1JA 2H3HA 3CUKA 3LYLA 1IRIA 2Z2IA 1WU8A 2ZSUA 3D64A 4KACA 2A5DA 2IUUA 4G67A 4NBUA 1H2FA 1BG6A 3U19A 4E7PA 3VZBA 7MDHA 4CQNA 4ZI3A 3A2LA 5BYBA 4FVTA 3DVLA 2W8ZA 1U3DA 4D92A 1UOQA 3HVKA 2F7SA 3V8MA 3W7BA 3FZGA 1S96A 1Q1AA 3OZTA 4PX2A 8AT1A 1NUAA 2M6LA 2WF6A 2XHZA 3I34X 3PNPA 1NHGA 4WJZA 3EZ2A 3I9V6 2AIRA 4B83A 4KXXA 1JKFA 1G0NA 3RODA 5DNVA 3C3BA 1UBOS 4PYLA 1CW2B 3IEMA 1UFOA 4MW6A 1H3EA 3ZDAA 2GDZA 3QKRA 4GF5A 2WRZA 4M1QA 2CYCA 1IATA 2FPWA 5C5DA 5CB4A 1X70A 2ODWA 4ZCSA 1EFCA 1R6VA 5LA6B 1O54A 4LQDA 4TYMA 1RXCA 2C9DA 5E2IA 3OD1A 2O5CA 2IYLD 1K8XB 1L5FA 3DULA 3PUYA 2GASA 4J1NA 4MVJP 1TM5E 1MHTA 4XDYA 1IHOA 8ADHA 1ZW6A 3I53A 3AR3A 1UDBA 4MITA 3NANA 3SHFA 4QGHA 1ICEA 3G0OA 3NBYC 3VKGA 2V9ZA 1OB2A 3LT0A 3EN0A 4MNTA 4RWEA 4N41A 1DMRA 3BK2A 1TZ2A 2DUNA 3MJHA 3EWIA 1C0EA 1ADJA 1E3LA 2QENA 1BXGA 2J48A 1VLQA 4R2HA 1AVTA 2NTJA 4K9QA 4N3AA 3Q7PA 3NRCA 1LEHA 1Q2XA 4RKEA 1UAYA 2FWJA 1FXUA 1RFGE 3AUXA 3OIVA 3PF8A 3ZH2A 5EHZA 3HCOA 3DFIA 1RYBA 2X76A 2W22A 2YWGA 1TYEB 3OSZA 4UMFA 5E8JA 2DJ5A 3KV3O 1C3EA 1EQ2A 4HMOA 1IAVA 4N39A 1B73A 5L3RA 5C8DA 2X5OA 1ACMA 1DBSA 4URXR 4PS1A 1ABFA 4REQA 4MR8A 3WHKA 5CYGA 5IM4A 4H7DA 2GA9A 3PFHA 5B58T 1C30A 2AZ4A 4CEHA 1GZ5A 1H9AA 3IILA 3OMXA 1DQSA 4MV5A 4PSUA 4MWEA 1Z4LA 3QUQA 4FR2A 1LC3A 4B79A 1ZO8A 1WCIA 1EH5A 1LTQA 1DV2A 2WJHA 3FLMA 4GWGA 4PZAA 3HKDB 3FDFA 2HB6A 5ENVA 4EGSA 1UBRS 1QHEA 2G83A 4AS2A 4CLRB 4KYIB 3AV0B 4YCAA 3RC9A 3GRRA 2R00C 3MTDA 4RTPA 4HADA 4U8GA 2NU7B 1TCBA 1Y1KE 1EHIA 3RTCA 2R2AA 4CGYA 4L8WB 5KYYA 1NVDA 1PYDA 3NBFA 4YRJA 2GCGA 3COPA 3R8XA 3IBCA 1GFIA 3OJOA 1WSWA 3DHNA 3DBHB 2OD7A 5CYFA 5JCOA 4D45A 1E3SA 1T8YA 5HZKA 4M9CA 3ICOA 4J2HA 4YTEA 4C01A 3PJFA 1UBUS 4CN9A 3FNHA 3NM5A 1BGWA 5AI0A 2YFHA 3E8XA 4B2LA 5T7BA 4J94A 5LB4A 5ALKA 3A27A 5EI5A 1CY8A 5FIUA 2ODQA 2GI4A 3B3QA 3IQWA 4I9FA 3A26A 4EG6A 1I80A 4TUYA 1WDKA 4K03A 3V1MA 4HDCA 1STOA 3B5IA 1U02A 1M1UA 4LWQA 2DFLA 1CR4A 1SUBA 1I5OA 3O3MB 1WW2A 3SIRA 5KINB 4RKQA 2OCXA 4JA0A 3R5KA 2V59A 5I6DA 2CV1A 1EFPB 2GSDA 3NALA 4GI1A 2FMKA 2G06A 2VAVA 4LUCA 1NFRA 3DGEC 1E1RA 1VTKA 4ZYUA 1IXYA 2PS1A 1YIOA 3F7TA 1DE0A 4P08A 1J2UA 1GKUB 2P7IA 3C3KA 3DOUA 1M2OB 1JR3A 1F6WA 1T5OA 1UWCA 3DTNA 3EQ8A 3H5NA 3PR2B 2FW9A 1ZIYA 2FZGA 1PBTA 3R0ZA 4WBXC 4YT5A 1OAOC 1TAQA 4NBWA 3BULA 1C2TA 2HUNA 2YWRA 4DLAA 1QVRA 5K3CA 4X64B 4O4LB 3V8VA 1C4XA 1Q21A 5H3LA 3QVGB 5IJ9A 3LXUX 5DBFA 1DMSA 1UT5A 1VL8A 2XQGA 1S2LA 1U7WA 4JUCA 4NP6A 5GOTA 4ZOLA 1EI9A 3EA0A 4LNUA 4ALLA 3CXUA 1E9SA 2VWHA 2QYHA 1PTKA 1NNLA 1SG9A 1VBMA 1N5OX 3LXRA 3RYHA 3WB0A 1S4QA 4RZ3A 3RK0A 1W48A 1SBIA 1XQ9A 4W8GA 2HK9A 2P4UA 3M83A 5JNTA 5IF9A 3PUHA 3CISA 4YAGA 3FW1A 5BPFA 3TVTA 2IVZA 5J2UB 2FJ0A 2Q6VA 2IDJA 2O2SA 5FUBA 3MJVA 4BBPA 4ZEVA 2F3PA 2MYPA 3K72B 3WGZA 1DG1G 5HIAA 4IVQA 2ZUCA 5JJIA 1GPYA 4YCNA 3OOHA 1J56A 2FSVC 4U2BA 5K1ZA 2O59A 4J1JA 2YCLA 3OLQA 4I7EA 2GBPA 2IHTA 5ETJA 2CLHB 1FDSA 1K98A 1JSZA 3IOEA 2DF8A 3S44A 2QPTA 3GEBA 4YRLA 4GMDA 5JD3A 4B6GA 2H8GA 1FDRA 5A2GA 2PX3A 4QUJA 1UC8A 3ITEA 5AVRA 1UXHA 3EY4A 3O0DA 4BUCA 4R7ZA 2X14A 3HB5X 4C4ZA 4EHIA 5LFAA 4HL6A 1BC5A 2RGAA 1P19A 1T5LA 2W83A 2HYDA 3R7BA 1FYXA 1L7QA 4IS3A 5EIEA 2P11A 5D84A 2EF0A 3PLAE 1G7SA 3HUFA 3OJEA 1J70A 2GARA 2DBYA 4N9QA 3AVUA 3FIJA 1QVWA 1L1RA 2OECA 1X1SA 3I83A 2WWIA 3NHLA 3RS0A 2B6NA 1I3KA 5KEIA 4QTTB 4ER3A 2COEA 4KIWA 3TEJA 4AJNA 3E9DA 2BL4A 2CXOA 2JI6A 4KNYA 1XTRA 2Q7OE 1YIAA 5CBPA 3NATA 4MQ4A 1LBQA 2E7ZA 1GKIA 1N78A 4YC7A 1NXTA 4R1UA 3W1EA 1V7CA 2Y1LA 1ANKA 1YZKA 1G7RA 2DFVA 3WYCA 4DWWA 9ATCA 4H18A 2CBXA 4I55B 2RG7A 3GMSA 3BD9A 3IJ5A 4WXYB 1VL5A 4F8YA 2ZVQX 5CDYA 2Q3HA 4C5AA 2KI5A 1A4IA 3GLHA 1YC2A 4YP1A 1MEEA 2IIBA 1N6NA 3ZZ0A 1MABA 4AN0A 2Z1NA 4HP8A 1QE3A 1TUBA 3RNOA 4RY9A 4F4UA 3BB1A 4NJEB 2FP3A 4CXMA 1RLMA 4NU6A 5IN5A 2UUBB 3W06A 3D6JA 1N25A 2G28A 4LW8A 5IJ0A 2Q9AA 1VGQA 3DR5A 4R4JA 2H1LA 1LQTA 1X86B 5C8VA 3K73O 1C9DB 4C4YA 1T8TA 2IUTA 1I4LD 4CBVA 4DA8A 1B2LA 2JKZA 2F00A 2ZR7A 2ZWMA 5JVDB 2ODTX 2MHCA 5B7NA 4P1ZA 2NYRA 2VJCA 3OTOB 1CJUC 1LX7A 2DQ4A 3QMPA 2O4CA 1F8FA 4M6WB 1XCGB 1JHVA 4LE1A 1H0SA 3LFTA 3BJIC 4P7BA 1KKLA 1UBKS 3NPAA 4V0RA 4ARVA 2A9FA 1RBYA 2QORA 1DG3A 2X58A 3KQHA 2V7UA 1TTTA 3ZX5A 1I6LA 2I4IA 3QITA 4H7HA 2W6NA 4RLSA 5HF9A 4F56A 1H1LB 2FWNA 2W6JA 4OX9Y 1LI7A 1OBHA 2A59A 2IYAA 3D7LA 4HZUB 4QT0A 4ZK2A 3DTTA 2QN9A 3QXSA