3I6QA

Structure of the binary complex leucoanthocyanidin reductase-nadph from vitis vinifera
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
307
structure length
291
Chain Sequence
GRVLIAGATGFIGQFVATASLDAHRPTYILARFKALEDKGAIIVYGLINEQEAMEKILKEHEIDIVVSTVGGESILDQIALVKAMKAVGTIKRFLPSEFGHDVNRADPVEPGLNMYREKRRVRQLVEESGIPFTYICCNSIASWPYYNNVLPPTDFFQIYGDGNVKAYFVAGTDIGKFTMKTVDDVRTLNKSVHFRPSCNCLNINELASVWEKKIGRTLPRVTVTEDDLLAAAGENIIPQSVVAAFTHDIFIKGCQVNFSIDGPEDVEVTTLYPEDSFRTVEECFGEYIVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative leucoanthocyanidin reductase 1
publication title Crystal structure and catalytic mechanism of leucoanthocyanidin reductase from Vitis vinifera.
pubmed doi rcsb
source organism Vitis vinifera
total genus 96
structure length 291
sequence length 307
ec nomenclature ec 1.17.1.3: Leucoanthocyanidin reductase.
pdb deposition date 2009-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05368 NmrA NmrA-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3i6qA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3i6qA02
3DZFA 4WECA 3H2ZA 4AJ4A 4IJUA 4OIMA 3C1TA 4N5NA 3S55A 5C3MA 4ALKA 1LXCA 1X7DA 3ITDA 1EZ4A 3ONFA 2E6UX 9LDTA 5G2OA 2HUNA 2NU6A 3Q1LA 5T8KC 2Z95A 5BT9A 7MDHA 4F3YA 4YT4A 1UR5A 3DFUA 4BNHA 4PVDA 1E1MA 2Y0CA 1VM6A 4M8SA 1B0AA 5L4LA 3K6JA 1FXSA 4BNMA 1MLDA 3F4BA 4NPCA 3ZH2A 3WDSA 1ORRA 4PG7A 4R41A 1YH3A 5TC4A 3TDKA 2YFQA 4J9VA 4PLTA 1O8CA 3AI1A 3E03A 2GSDA 2VWHA 3O8QB 4GGOA 4S1VA 3SJ7A 5A9SA 3BA1A 1Z74A 4MVJP 2AA3A 1B8PA 3JYPA 2AEFA 4ND2A 4W7HA 4CUZA 4E5KA 2D59A 3IOYA 4BNNA 3H3FA 1OBFO 1UXKA 4FJ0A 5F21A 1EUDA 8LDHA 3D0OA 1PWZA 1A7KA 1C1XA 3MOIA 5B12A 4FBGA 4CM6A 2J5RA 3Q3CA 1Y9AA 2HMSA 5B4UA 3TZHA 2B69A 5DN9A 3O38A 1N5DA 2OZPA 1LRLA 1R0SA 4WLOA 7ADHA 3AUSA 4RCVA 5DBGA 2OXIA 4UVEA 5KJ1A 1YQDA 1C0LA 5JAZA 1NFRA 3NEPX 2YQ4A 1VLLA 1ZCJA 2EKQA 5ES3A 3CXRA 5CDTA 5K6AC 2DU8A 2IZ1A 4BOYA 4QX6A 2B35A 1DIAA 4RQUA 3Q9UA 3JQAB 4IIUA 1P9LA 1GYRA 3GNTA 4CQMA 3VDQA 5KJCA 3GY0A 1D1SA 1JA9A 1TVEA 4ND5A 4E13A 1PJTA 1O9BA 2RCYA 1ZIDA 3DAGA 4UVGA 5KIAA 2Z1NA 4H7PA 4YA6A 4XB1A 1I36A 3BTVA 4WOKA 1W73A 3U9LA 3W4KA 3GEGA 3FWNA 4NG5A 4GAEA 2P2SA 1UDCA 5MGBA 2HRBA 3BMQB 3RU7A 3HDQA 2PK3A 4B7CA 1P74A 5DOVA 2GUGA 3S2IA 3ZNOA 4WLUA 3VTZA 4NI5A 1NR1A 1UP4A 1NP3A 1NASA 4WLNA 4DLAA 1DFHA 3RROA 1DO8A 4LSMA 3FBTA 3CZRA 4AJLA 2V6FA 3GZNA 1P77A 3FHLA 3OP4A 2WE7A 1IB6A 3AFMA 3GGPA 3ZZNA 5A3JA 1I2CA 3UAGA 1B7GO 1H94A 3QWFA 2O50A 5T67A 4JCOA 3L0DA 3GG9A 4NQZA 3SJUA 2PD6A 1U1IA 4DYVA 4D79A 1LSOA 3WGZA 1YJ8A 1I30A 1K2WA 1HE3A 5ER6A 5IDXA 4PLHA 2CDBA 3HN2A 2VHWA 1WWKA 1JKFA 1XWFA 3KB6A 2GERA 1L1FA 4WLEA 3GFBA 2VHVA 1RKXA 4MVJG 4NIMA 3T7EA 4BGVA 3BXXA 3KBOA 1XG5A 4TRMA 4XQGA 3W6ZA 4BMSA 3KYDA 4CL8A 4OSOA 4BO6A 5BNTA 4P22A 5EQFA 1PU2A 5JDCA 1UJMA 3AUTA 2GASA 4URFA 3TWOA 2JAPA 4ZN6A 2ILTA 3VH3A 2X8LA 1YDWA 1ZK2A 4IDBA 1EQUA 3DR3A 3PXXA 4JJGA 1IZ9A 4RF3A 5J23A 3MJ4A 3C24A 3AM4A 1DOHA 2EEZA 4J1TA 4J0FA 4NBVA 3VVBA 2FY8A 3H8VA 3KZVA 1E77A 1B16A 4Q3BA 1MG5A 4IS3A 3A28A 1PS0A 3WMWA 3DWFA 3PDUA 1WAMA 4XYEA 1ISJA 4Z0HO 5A02A 3PZRA 2FR1A 3PP8A 4J43A 1JKJA 2Y93A 3DDNA 3WOHA 3AM3A 3HB4X 1UXJA 1P44A 1N9GB 3I4CA 4B4VA 1P1FA 4OSPA 1WZEA 4P4GA 1DLJA 1TT5B 2C5EA 1U5AA 2WD7B 5KJFA 3OJOA 3JQCA 1PJ3A 1FDUA 2D2IA 3BTSA 2VNAA 1XQ6A 4GH5A 4Y9DA 4XYMA 2BHLA 1ZJZA 4J9UE 1HE5A 4HWKA 2DFVA 3TNLA 2W2KB 4U8GA 3DBHA 3CZMA 4FSHA 1EFLA 2YFHA 3DZHA 4ND1A 1SEVA 2YY7A 3TL3A 3QVXA 3QV1A 3INGA 3QHAA 4J1QA 4DWVA 5IXYA 4BNVA 4DYDA 3L4BC 1E7WA 4Z6KA 3E5RA 4A2CA 1VJ1A 3PWSA 5EJ2A 4JBGA 4YJFB 1KBZA 2FZWA 4R4JA 2GN8A 2Y1CA 4DLBA 3F47A 2PD4A 3HDYA 4NFSA 4CM3A 3LLSA 1P3DA 4LN1A 4ND3A 3TL2A 3AY7A 4EGFA 3E9NA 1ONPA 2NQTA 4R51A 4XQEA 4W4TA 4E2ZA 1GYQA 1IZ0A 1N2SA 1E7SA 5A05A 3VDRA 4ALJA 5L7YA 3ZWYA 4HX5A 5COBA 4PN3A 4H16A 3F1LA 1BTOA 1XQ1A 3ZHXA 1GY8A 4OXYA 3ANNA 3RIHA 2YHIA 3GDGA 1U3UA 1RJWA 5BSFA 3DMYA 1GZ6A 1E3JA 1PJBA 2D3TA 2E4AA 3AU9A 5CP8A 3WIEA 1ISMA 4PZCA 4MVJI 4DC1A 3QLJA 1H6BA 3FD8A 1NNUA 1PJCA 4IDAA 4OJNA 4WEQA 2EJWA 3EDMA 3HADA 2I67A 3Q11A 4I08A 4CM4A 3GPDG 4PRLA 3NDJA 4E5MA 1I0ZA 1E3LA 1WDLA 2DAPA 4TKMA 4OM8A 3OICA 1E5QA 4KQWA 2QZ9A 2WDZA 4D3SA 2E82A 4R3NA 5EL0A 3SXPA 1HSOA 4RVDA 4QTZA 2AEJA 4J1NA 1DRVA 2AXQA 3TFQA 4K6FA 1RM0A 3B6ZA 3HJAA 3PI7A 1ZSVA 4E5YA 2EV9A 2J3KA 4J7CA 1U3WA 2AQHA 3OJFA 1RYEA 4KWHA 2E49A 3MTGA 4L8VA 4CLRB 3KYCB 3JYLA 4XIYA 4R5HA 2VUSA 4RLHA 4LK3A 1MC4A 1K5HA 1TI7A 1T2CA 3ANMA 4ALLA 3GZ4A 4OKNA 2VWPA 1JW9B 2UUPA 2ZCUA 4GVLA 4CUJA 1GUZA 1Z45A 2ZB7A 1AUPA 2Q99A 4BNYA 4B79A 2X1HA 2X9NA 4MPDA 1DC4A 2CMDA 3N7UA 3Q9NA 1JVSA 2HMTA 3ASVA 4AJEA 5ENVA 2AQIA 1H2BA 3SLGA 1ZSYA 4XDZA 3VZRA 3W6UA 1I01A 4RVSA 1UDAA 3WX0A 2CDCA 3RUIA 2JHGA 1VL8A 1Z75A 2BFPA 1RM4A 2EP5A 3LZ6A 5ICMA 4F6LA 3DZJA 4ZQBA 4QQRA 4MVJA 4E32A 3WQSB 1ZBQA 4LVUA 3QSGA 3PWKA 2ZQZA 2R6JA 2PWZA 3MEQA 5A3VA 3AJRA 2HLPA 3HE3A 1Q7BA 4YACA 1W4ZA 1E92A 2Q2QA 4TRNA 4DPMA 5L7WA 1OOEA 2W2LD 4FS3A 4GX5A 2NVBA 4FFOA 2OO5A 3R6DA 4YRBA 4XZ3A 3CH6A 1QR6A 3CUKA 3BHIA 4LVCA 3LC7O 3P2YA 1NFQA 3C7DB 3JQ6A 1GFSA 2DTXA 2Y68A 3ENKA 4Q3EA 5IN4A 4DGSA 3SBOA 1HL3A 3PVZA 3PLNA 1UH5A 4L4RA 1ZMTA 2E37A 4UUNA 3QWIA 1CWUA 3H9QA 2WYUA 3WBBA 4WEOA 2AEMA 3UCFA 2DM6A 3NX4A 1PZFA 5TJ9A 3CMMA 3I6IA 3H4VA 4N54A 2P5UA 3U09A 3R1IA 3QVTA 4JBHA 2ZTUA 3JQFA 3OJLA 4CLDA 2JCVA 5A5FA 3D1LA 1EFKA 1F17A 4RPLA 2BMAA 4CMAA 5HS6A 4WCDA 1Y8QB 3QVOA 4BO4A 4BNIA 1H6AA 4A5OA 2VYVD 2BH9A 5DZSA 1O0SA 2WM3A 4F46A 3GFGA 4IMPA 4XR9A 5JPIA 3C7AA 4D44A 3JQ7A 1PGJA 1VI2A 3V5NA 2EGHA 3AY3A 3ZWBA 1A7AA 3UCXA 4XJSA 1TEHA 1DAPA 2ZIZA 4BO7A 4UUPA 4ZA2A 3SC6A 2OP1A 1O95A 3IJRA 1ZK4A 1Q0LA 2PGDA 3I9OA 3IC5A 1KVQA 5CHEA 1PS8A 3EZLA 1E3EA 5AXCA 4CPDA 1P0CA 2Y1DA 1R16A 4GVXA 3COSA 2B5WA 4CLEA 2PZMA 3LLVA 1EBUA 4W7IA 5A9SB 3ZGYA 4IBOA 4B7XA 3RWBA 4XYLA 2GRAA 3L07A 5U1PA 1LDBA 3RAJA 4D42A 3DBRA 1P45A 4LISA 1LEHA 1HLDA 3M1LA 4RVUA 1MA0A 1ENYA 3HNPA 4BS9A 4XR4A 4GX2A 2P9GA 4GMFA 3VH4A 2PFGA 3K9QO 4BNGA 1TB4A 3ZU2A 5JMWA 1ID1A 2YHUA 4A27A 3GGGA 1SB9A 4G81A 4I1IA 5EINA 1R4MB 1HXHA 4CR8A 1YOVB 4DQUA 3VPHA 1MFPA 1DRUA 2CFCA 4CV2A 2CD9A 5DULA 1ADGA 3W1VA 3ZWNA 4OL9A 2IXBA 4LMRA 1X1TA 1YS4A 3DZBA 4PLPA 4U6QA 4G65A 1EE9A 4DBVO 4EITA 4ZQHA 3ZV6A 3ZWXA 1RM5A 4CQMB 4DA9A 5IAAA 4ZU3A 1E5LA 4J4TA 3RKRA 3U3XA 1DJQA 1QP8A 1LJ8A 3G17A 4YPOA 3OHSX 3ETEA 3MJSA 3MJVA 4LCJA 3VAZA 4XCVA 4H15A 1ZNQO 4PZDA 2IZ0A 4MIOA 4BNZA 1LSJA 4GX0A 2A92A 3SEFA 3HQ4O 3OQ6A 3LVFO 4AFNA 5ICSA 3PLRA 3DTTA 3WWZA 2PY6A 4HP8A 3OSUA 1U5CA 1I2BA 1XU7A 3TJRA 1Q2XA 3DL2A 4RF4A 1E7YA 3BYZA 3IKTA 2FOIA 1HZZA 3DBLB 5L3ZA 1H9AA 3G1UA 1DHTA 3IIEA 4OQYA 5TRTA 5BQFA 4TRRA 3ASUA 3GF4A 3GOHA 4IJVA 5JCJA 3PHIA 3WS7A 4BO5A 1YBVA 1QORA 3AK4A 1PL7A 2UUOA 2WYVA 3KSDO 1ZFNA 2J3JA 3GA0A 5BSHA 3LSYA 4U5QA 3KRTA 1KVTA 3KEQA 3QA9A 1M67A 3M2PA 2Q1WA 3GRPA 1MG0A 1HYGA 1XU9A 5FI3A 2X6TA 4KOAA 1A72A 2Q2WA 5EMHA 3WYCA 4J3FA 3TRIA 3PJFA 4BMVA 3GAZA 4J7XA 1DSSG 1QV7A 1SC6A 2VT3A 4TKLA 3L9WA 5GZ1A 4KP7A 4OXKA 3FPLA 4R9RA 1S7CA 2LDBA 1U9JA 1IY8A 2X86A 3IDSA 1GD1O 1GZ3A 1MV8A 3AY6A 2Q4EA 1HDOA 1CQJA 1PGPA 4PG6A 4CMIA 1TA4A 3BMNB 4DIBA 4KDFA 4EEZA 3CIFA 4FOSA 5KVQA 5CAEA 5JAMA 3W4JA 2H1SA 3PWZA 4HADA 2CF5A 1P33A 4TMFA 1NTOA 5JCJD 3RUEA 4MINA 4Y6RA 2CDAA 2X0IA 3JV7A 4GGPA 4E21A 1QSGA 3WJ7A 1ONOA 3I3OA 3KUXA 1I3KA 4CV3A 2JL1A 3CTMA 3KVOA 1HWYA 3WFIA 2R00C 1CF2O 3MJCA 2H6EA 1E7QA 4W82A 3GEMA 4OAQA 5B4TA 1GV0A 5HM8A 2AG5A 2V6MA 2YQ5A 4K26A 3WGTA 4AJOA 1BXKA 1G0OA 3WTBA 4E5NA 2Q50A 2WJPA 3NDIA 1HKUA 4EJMA 1GYPA 5GMOA 2ZYDA 4WLVA 3PDJA 4D0SA 2GZ1A 1KC3A 1X7HA 4R1UA 5JDIC 3E48A 3ZN2A 2NUAA 2NVUA 2JFGA 2X0NA 4CMGA 1T2DA 3H6KA 4WCFA 3KSUA 1CIVA 3DAFA 1LRJA 3NT4A 4Z9XA 1CYDA 3DBHB 1JKIA 1Z6ZA 3KM0A 1Q7GA 4WE3A 4BKRA 4FJ2A 4IGFA 4NBWA 4NJMA 2OL4A 3I9LA 2WYWA 1W6UA 3TOZA 3ULKA 1RYDA 1N1EA 3OBBA 2RHCA 4WJZA 3AOEA 3U49A 2ZATA 4D3FA 4RJTA 1V3UA 1HYEA 4FIZA 4NDNE 4IY1A 3EAGA 2GGSA 1XIVA 1BXGA 2JJYA 4L4XA 1GR0A 4Q3CA 1D7OA 3A14A 4RZHA 4ZVVA 1DRWA 4R1NA 4RORA 3GLQA 4CM8B 4E31A 1MB4A 1NQTA 2D0IA 2HK9A 1B15A 1R0LA 1OZAA 1PL8A 2VUTA 2HU2A 1F0YA 1EK5A 3DC2A 4FD3A 2V6BA 4B3HA 3H5AA 5AVOA 2CZCA 3C3XA 4KTTE 1PJSA 4DC0A 1KVUA 3NJ4A 5JW6A 1HLPA 1E6WA 4E4YA 3BMCA 1GL3A 3LYLA 1H2HA 2NTNA 1JAYA 1VKOA 1IUKA 3PQEA 3UKOA 5G0TA 4M86A 1BMDA 2PLAA 3D5QA 2FHSA 3HUDA 3WTCA 1XKQA 5KCZA 1U7HA 1BWSA 1U7TA 2QW8A 3K2BA 3ICCA 1K0UA 1AHHA 5FYDA 2JCYA 2G0TA 3DZIA 2VRCD 1R0KA 1A9ZA 2O2SA 1U3TA 4I5DA 1Z7BA 4J2OA 4PVCA 4Q39A 4CM4B 1N7HA 4YAJA 1IHXA 4F6CA 2Y99A 2X9GA 2GNAA 3DOJA 3C1OA 4BMNA 1S6YA 3K92A 2DBQA 4BGUA 2OHXA 3FNEA 2J8ZA 3F5SA 3MJEA 4CR7A 2VZ9A 5DP2A 1ZKMA 2I76A 1CJCA 3AI3A 3D64A 3VH1A 1GDHA 4KZPA 4ZQGA 4GKBA 3ZI0A 4Q9NA 3HN7A 3WYBA 3CKYA 3ROKA 1QYWA 4BO8A 5IDWA 2B0JA 4AJIA 3DXFA 3C85A 5A1TA 1JQBA 3AWDA 4FPXA 1HDZA 3Q2KA 4ALMA 3RD5A 1H5QA 3M2TA 4R54A 1IPFA 1V35A 3GR6A 5G4KA 1MXFA 1UZLA 4IIVA 2RBEA 1DC5A 5JCXA 4E0BA 3CINA 4ZRMA 4JQCA 4P4LA 3QWAA 4K28A 1BVUA 3IAHA 4I5EA 1QRRA 3PQFA 4TVOA 3F4LA 5JLAA 3WQQA 3CE6A 1EMDA 5JDIA 1KETA 3QP9A 1LQTA 4TWRA 4ITUA 1YWGO 3WSWA 2BI7A 4TROA 2AHRA 3BZUA 1DIGA 3Q2IA 4BNUA 2W98A 5K0ZA 3SX2A 3NTQA 5KOIA 1V8BA 2GCGA 1TT7A 3FF4A 3GT0A 4ZD6A 4D46A 4NR0A 1N1GA 3FI9A 4D41A 3QVSA 1V3TA 3GVPA 1I3MA 2EF1A 5EQDA 2UDPA 5AOVA 3JQ8A 1P1HA 4DBZA 1NR7A 1BVRA 3WGHA 1ENPA 5KJ6A 4CQLB 3HB5X 2J3IA 3HSKA 4MVJF 3JQ9C 4MKZA 2NM0A 2B36A 3I9MA 1EVJA 4YT2A 2H5LA 4EUFA 2DFDA 5T8KA 3OM9A 4J1SA 5HWSA 4FGWA 1A27A 4TQGA 5CPFA 1B2LA 1Z73A 1UAGA 2BF7A 1NQAO 2D4AA 1OMOA 4JK3A 4CQMD 3FCOA 3I9JA 5I7VA 1PJQA 3BMOA 4JJIA 1ZEJA 4E6PA 3H9GA 2PTGA 3TF5A 4IJKA 5L40A 4NBUA 3LT1A 1ISHA 3UCEA 4DPKA 1I2ZA 4FR5A 4IUYA 1U4OA 4MP8A 1G1AA 3OECA 2O7SA 2EXXA 1LDNA 4LSWA 3X2FA 3BHMA 4J7UA 5CDYA 2CVQA 4M1QA 4WUVA 2NU8A 4B4WA 1LC0A 5H81A 3VTFA 4R16A 3IMFA 3KLPX 3A4VA 3OIDA 3L4SO 4D45A 2HK8A 2ZB3A 2IE0A 3JSAA 5C7IO 3WQRA 4DL9A 1IYZA 5AXDA 4E2WA 3U4HA 2QZZA 4BNWA 2IEDA 3ABIA 3JQDA 4Q3DA 4CLOA 4Z3DA 1IULA 4YRDA 1T4BA 3PZBA 4BNTA 1HDCA 2DC1A 4Z0TA 1GUYA 4CMHA 2EHDA 5JS6A 2WD8A 4O6VA 4RZIA 2QRKA 1N7GA 1R66A 2G17A 4OGWA 5KKAA 4B8ZA 4W9NC 1MFZA 5K6AA 1NPDA 2VT2A 3MTJA 3GC6A 4IDEA 1JAXA 2O3SA 5H83A 1D4FA 4TSKA 2NSDA 1PX0A 1GEEA 1O5IA 1O94A 4ZRNA 3PEFA 3ZW9A 2PR2A 1W8DA 1VJTA 2Q1SA 2Y0DA 3JYOA 4J4BA 4QECA 3KSZO 3WGIA 3RKUA 1T4DA 4XGNA 5COAA 4E30A 1IHYA 3BHJA 4MKRA 4MJLA 1N8KA 3STHA 5KVVA 1HYHA 3TN7A 1NQOA 4BGIA 5CDGA 5T5QA 5A4DA 3JTMA 1LTHR 4LCEA 2CVZA 1CEQA 3GVIA 5C7LO 1IL0A 5JAIA 3NT5A 5JO9A 3V2UA 3E9QA 3E8XA 4WASA 2Z5LA 5I9NA 1M6HA 3S1LA 1ADFA 5L4SA 1T1SA 4HNHA 2V65A 4NFYA 4BIIA 8ADHA 6LDHA 2CNBA 1HDYA 2GF2A 3JQ9A 4RL6A 4RGBA 3ROMA 4BQPA 4HNGA 3PHHA 1VL6A 3OFSA 4GQAA 3IQDB 4N5LA 4JGBA 5IG2A 4P4NA 3NT2A 3U4CA 2WWRA 4YT5A 3KHUA 5JC8A 4YJGA 4K6CA 3NGXA 4PGFA 3WGYA 1GTMA 1SAYA 5T57A 2WE8A 3VVCA 1FDWA 5TQVA 3RUDA 4BGEA 2EW2A 1T1RA 1C3VA 3VH2A 4IZIA 2FSSA 1EUZA 4XRGA 3ZU5A 1ZK1A 1PTJA 4PCVA 1KIFA 2GPTA 1J4AA 1DIRA 4RVFA 3ZWCA 1Q0HA 2ET6A 4OO3A 4CM9A 3LF2A 2YV2A 5ITWA 1QG6A 5G0SA 3VOSA 3AI2A 4J2HA 1QMGA 2JFHA 2QIOA 1IE3A 2DBRA 1K89A 1SB8A 1F8FA 4JX8A 4WNIA 4RPKA 4OKIA 4BHTA 2V7PA 3DQPA 1KC1A 4YAGA 2JD1A 2I6TA 3P19A 2NV6A 3FRJA 3OQ1A 6ADHA 1T26A 2PA3A 3E1KA 3CEAA 1EUCA 2H9IA 3DO5A 4QXMA 3ZNNA 5I7SA 5KWEA 5DDIP 4PFJA 2VQ3A 3QE3A 4ZQFA 3KTDA 4J16A 4BNJA 9LDBA 4OOFA 3BTUA 4NZ9A 3RC1A 2PKRA 1H6DA 3U62A 2I3GA 2GD1O 4J91A 1KEVA 4GL4A 3P5SA 5L4NA 3LDHA 2RIRA 3E82A 4J90A 3ROQA 1GZ4A 5L95A 2C07A 3PYLA 4YJHB 1K6JA 1AGNA 1Y9EA 3K31A 4GSLA 5KKCA 4BV8A 5DOZA 1HDGO 1DEHA 2PKQO 3I83A 2O3JA 5F3RA 1Q1NA 3WGGA 2D8AA 4YVFA 2PGLA 4DRYA 3UICA 1NAHA 3L4BA 3S2EA 1EE2A 4X54A 3FNFA 5ER9A 4D3DA 5JXWA 4BKUA 1JU9A 3EZYA 2I99A 4GX1A 4L76A 4CLXA 3DB2A 3BAZA 3F9IA 4YQYA 4LW8A 3JQAA 4CJXA 4QO7A 1D1TA 1BW9A 1RWBA 1CERA 3AM5A 5L45A 1WW8A 3ZWMA 1HETA 1YGYA 1EVYA 3M1AA 1B26A 4XRRA 3TZ6A 2QX7A 3DOCA 3I52A 1PR9A 1QLJA 1XR3A 2GLXA 2PKQP 3PHLA 3GGOA 4H3VA 3VZQA 3OETA 1PGOA 1UP6A 4FOOA 3E5MA 1M76A 4FFLA 5IZ4A 2I65A 3GK3A 4ONEA 1A71A 2I5PO 1E3IA 5JE8A 5CFZA 4MVJH 3BMQA 3IP3A 3ICPA 1UZNA 2NVUB 5FWNA 3EMKA 2ZQYA 4WCFB 5U9CA 1EVZA 1Z7EA 1SOVA 2O48X 2JD2A 2YJZA 4S3MA 3AUUA 1KOLA 1SBYA 3L6EA 4KQXA 4BNFA 2YUTA 4C7KA 3TFOA 1V3VA 5DCWA 3ETGA 4NJMB 5IZCC 4JROA 2ZJ1A 2UYYA 2P9EA 4QFCA 5F1PA 1FF9A 3I4FA 1H6CA 3EK2A 4LMPA 4CODB 4IM7A 5TGDA 3WNVA 1J5PA 1WDMA 2H63A 1KVRA 4R1SA 3RJ9A 3DFZA 4MVJD 3DBVO 2Q1UA 5C37A 1LLCA 2QYTA 5MDHA 3UFXA 1YVEI 3JD3A 3NDRA 4R1TA 4XB2A 3NAQA 3HDHA 2CVOA 3EVNA 1BXZA 4IXTA 3LT0A 1B8UA 5JAQA 1XLTA 1X7GA 3V2HA 1B8VA 2O23A 2OGUA 4W99A 3HDJA 2AE2A 4B3IA 5JYDA 1B3BA 1ZK3A 1H93A 3R3SA 4A03A 2EP7A 1WVGA 1PZHA 4NFHA 2A4KA 1Y6JA 4UEJA 5KVSA 4YRAA 2HK7A 3PK0A 1ZH8A 4J4HA 2EIHA 1FDVA 3E18A 2Q2VA 3QJ5A 3GHYA 1MX3A 1PIWA 4JP2A 2DBZA 1V0JA 1YL7A 1UP7A 2YDYA 1XDWA 4WLFA 4E3ZA 4HFRA 3IL2A 2PH5A 1X13A 2C7GA 3PHGA 2VCYA 4KUEA 1F12A 4HXYA 4QUKA 5G4LA 3G0OA 1VL0A 1ISGA 4DQVA 4NNJA 4BO0A 2EKLA 4KTVE 3NUGA 1XCBA 2C59A 1QV6A 2IEBA 1LU9A 1C0IA 1C1XB 3GDFA 1YONA 5TNXA 3FTNA 1DBVO 5JNLA 3DTYA 4I5GA 1TT5A 2NTVA 4E5PA 2X5KO 3HFGA 2DT5A 2OFPA 2JD0A 3INTA 1GQYA 2BGMA 3RI3A 4J49A 2JKVA 5G4KB 2W90A 3UHAA 2Y05A 2DLDA 3NTOA 3UN1A 1FMCA 5DP1A 4CMEC 1PJLA 1QYVA 4FB5A 4UVIA 3RUCA 4HFMA 1LX6A 2VYNA 5DT9A 2DKNA 3WLFA 2VHZA 5JY6A 2NWQA 5HS4A 1R12A 1ULUA 2ZB8A 1SCUA 2EWMA 3PGXA 4IQGA 1R6DA 5G0WA 4G5HA 4U0JA 4HUJA 4YJFA 3JQBC 2JFFA 2E48A 3VHRA 3G79A 3WLEA 2Y1EA 5IZCA 5FF9A 2Y1GA 4HKTA 4A73A 3JD2A 1ZO8A 4D43A 3NV9A 3E6AA 2P9CA 1ISFA 3ZV4A 2G1UA 5HRUA 3D3EA 4AJPA 1GUFA 4E12A 2ZTVA 4JIGA 4IDGA 1DJNA 3LT2A 1LLQA 2ZCVA 4FFMA 1LLUA 3H5NA 3V1UA 3WYEA 3JYQA 3PIIA 2D1YA 1NVMB 3GPIA 4GPD1 3KLMX 4PLVA 2R2GA 3ZHZA 4GWKA 4NU5A 3QRWA 1T2AA 4IQ0A 5DCYA 4XIJA 4HBGA 3GZNB 3FNGA 1JDJA 2DPHA 2PNFA 1U28A 1DIBA 2VN8A 4UEKA 2QG4A 5DF1A 4AJKA 1J6UA 1AE1A 3H2SA 2BD0A 4JXKA 1P1JA 1X14A 4WKGA 3JQEA 3OJ0A 3D3WA 2PH3A 4TRJA 5A9TA 1GQQA 2AW5A 1E7RA 1Y7TA 5THKA 3PQDA 4UREA 5AXBA 5F5NA 3ZW8A 3PJDA 1NAIA 2HJRA 2HCTA 2AQKA 2Z1MA 1NFFA 2IYPA 3O26A 3RUAA 5F1KA 4D7AA 4A0SA 3OA2A 4EUHA 3N58A 4OYRA 3KYDB 4IJWA 3HWRA 4QO8A 3T4XA 4M89A 1SMKA 3I9KA 1NXQA 1Y1PA 2BKAA 2W8ZA 3GN1A 3OA0A 4JNKA 4Q3AA 4DIOA 2FR8A 3INRA 1ARZA 2AQ8A 1WXDA 3NGLA 2VZ8A 1YB1A 3ZWPA 4BKQA 2DTDA 3ENNA 4DVJA 1Y8RA 5U4QA 2I9PA 2WSBA 3JD0A 4QFDA 5F1OA 4RQTA 2XOXA 3GUYA 3RC9A 1F14A 3DZGA 4XKJA 4YTEA 1PL6A 1YXMA 3V1TC 3OJEA 4PIVA 3GUCA 1T2EA 2C54A 2HO5A 4O63O 3KXDA 3H5RA 2UV8A 1CQIA 4YJDA 3FNHA 3MOGA 3VPGA 1HDXA 1NPYA 2X0JA 3M6IA 3UF0A 1YDEA 4L73A 2D5AA 1VSUA 3JQBA 5C7OO 2YW9A 3EW7A 2VUUA 4NBTA 1QYDA 3CPSA 2Y1FA 3UUWA 1JN0A 3W8DA 3IP1A 4NMHA 1XSEA 1K6IA 4UAGA 2X9VA 3SC4A 5FEUA 3W4IA 1PQPA 1HTBA 3FWZA 4EUEA 2X7HA 4M87A 3DZKA 1ENOA 3ZV5A 2FN7A 3TQHA 2G82A 2OOSA 2VWGA 4RLSA 3GQVA 4MKXA 3H9UA 3QW2A 3VKVA 1T24A 3TZKA 4P38A 2Q4BA 4MP3A 3GMDA 4A10A 3GNQA 4UVDA 2HAEA 1GQ2A 2EGGA 1U8FO 1MC5A 1BRMA 1EQ2A 2O4UX 4Q3NA 4GWGA 3BIOA 1U2DA 2XAAA 4YJGB 3SLKA 4NK4A 4RF5A 5KTKA 4ALNA 5CG2A 1ML3A 2GZ3A 1U8XX 2IRWA 1UXHA 1B3RA 3I9NA 3U0BA 3D4PA 5ENDA 3GAFA 3DONA 2P4HX 3C8MA 3QQPA 1NPTO 2GYYA 3GH3A 2PGJA 3V1YA 2C7VA 4IMRA 4QEDA 3C7CB 3WJAA 2CY0A 3X2EA 1I8TA 1OI7A 3GN2A 2YHIB 3ONDA 5DBIA 3KETA 2OBNA 1C1DA 1KY4A 5TSDA 1GAEO 5IN5A 3TOXA 3A9WA 1O6ZA 1NYTA 1TXGA 4PLWA 1ONNA 5LDGA 2W4QA 3ROPA 1D3AA 2EKPA 2XPCA 1KEUA 1UDBA 4AICA 3RFXA 1K6XA 1RM3A 1FJHA 4XQ9A 4GSKA 5A03A 5GZ6A 1H0KA 2QRJA 3C1AA 4FFPA 3A1NA 4RF2A 1OFGA 4MIEA 3L6OO 3GVCA 5TS3A 2P5YA 3S2GA 5DNAA 4BKPA 4GKVA 5L51A 1ZW1A 3P7MA 1I3LA 4J0EA 4AL4A 3PJEA 4PLGA 1SPXA 5BNIA 2WMDA 5DBFA 2R00A 1LSSA 1WMBA 3AU8A 1DPGA 1SEPA 3ZU4A 4DREA 3JQGA 1PS9A 4XYBA 3PHJA 4FGSA 4Y67A 5DCUA 1ZXLA 3H65A 3AFNA 4GI2A 3S8MA 3ADOA 3ZWWA 1ADBA 2Y0EA 5JDCC 3WR5A 3PRJA 1PZGA 4FDAA 3ZWAA 2DBVO 3QVWA 4UULA 4AVYA 1ZK0A 1WP4A 4O5OA 3JYNA 5TLSA 2DQ4A 3S2FA 1XEAA 3E9MA 2Y66A 2C5AA 5ILGA 4GBJA 4EDFA 1GPDG 1R4MA 1E6EA 4II3A 3UGKA 1DAOA 4P8RA 5I9LA 3WFJA 5CEFA 1YOVA 1PJ4A 2OORA 4KDEA 5GZ3A 5TF4A 1ADCA 1ZXBA 4N7RA 5IFLA 3FTPA 4YXFA 1DHRA 4DQXA 2Y1OA 2B4TO 5TIIA 3ITKA 3HZZA 4Z0PA 4MOWA 4BNKA 1HZJA 1I33A 4RPJA 1H9BA 1Z82A 2ZYGA 3ON5A 1C0PA 3RBXA 4EBFA 3VPSA 3W8FA 4O0LA 2GDZA 3P2OA 3R3JA 1JWBB 1HE4A 4A26A 4AG3A 1BW9B 2YV3A 3PJGA 4R5MA 2DVMA 4CMBA 3G49A 1VC2A 5LC1A 4B4OA 1V9LA 1AXGA 2FRDA 4JJFA 2HDHA 2X5JO 4KMSA 1EK6A 2OP0A 3O4RA 1SZJG 4OH1A 2LDXA 3WXBA 5BR7A 3ZDFA 5C5IA 4CMJA 3RFTA 5F5LA 4YAKA 1PWXA 1B14A 4CM7A 2C82A 3OEWA 4OOEA 4CL3A 4BNLA 1LC3A 3V2GA 4I8XA 4L9RA 1VSVA 5B37A 3DBLA 1NWCA 5CDSA 1I10A 2QYSA 2NU7A 2TMGA 2BFMA 4XYGA 3ZU3A 4A7PA 2IODA 3EUWA 2YV1A 2RH8A 1PGNA 3LQFA 4L75A 4E2XA 2P68A 1VKNA 3ZCXA 5I7FA 2NNLD 4RVGA 3VPFA 1KEPA 4AJHA 2BGKA 3NTRA 1T2FA 3RBVA 4EJ6A 4FFNA 3ZHBA 4DIFA 3PYMA 3WB9A 2OBYA 2RH4A 2DUUA 4N5MA 4YEDA 3D5TA 4LRTB 4XWYA 5ITVA 3TZCA 4ND4A 4YT8A 1BGVA 3JQ7B 5L53A 1E3WA 3NYWA 4YQZA 3VZPA 1GCUA 3RC7A 3G1TA 3TPCA 1XELA 2Y67A 1NHGA 3F5QA 1WPQA 4IDDA 2HRZA 4O59O 4YB8A 4HV4A 2A9FA 3ZWOA 3HG7A 2G5CA 3RFVA 1YL6A 3IJPA 3BMNA 2C2YA 2I66A 1LLDA 3B1KA 3KYBA 2C29D 4ALIA 5FFFA 5ADHA 3FBGA 4CV1A 1X0VA 1UAYA 4OXNA 3HFSA 1C0KA 3B70A 4DUPA 2VOEA 3MZ0A 1EVIA 5LCXA 3DBRB 2J5QA 3DHNA 5L7TA 4M55A 4L74A 2J3HA 1JLLA 1SO8A 4PLYA 4E33A 1DXYA 3D7LA 5JO0A 4NH4A 2VTDA 4J6FA 1X0XA 4IZHA 1IOLA 1QLHA 1YL5A 1EDZA 4MVJM 3FSRA 1LDGA 4FQ8A 1PJ2A 4FW8A 2JHFA 4MO2A 4GMGA 1BHSA 5IDYA 2BGLA 3EVTA 3NJ8A 3RUFA 1NBOA 4HY3A 1Y81A 4QSMA 4ZICA 4G2NA 3RSHA 1L7EA 4IPTA 2EERA 2P4QA 4K1LA 4II2A 1R4NA 1YBAA 4B7UA 1A4IA 5HBRA 1LUAA 3FR8A 3RU9A 5EPOA 4RV9A 1LNQA 1E1NA 5CDUA 3KOUA 5KVCA 2B5VA 1BDBA 2BLLA 2GN6A 2X4GA 5THQA 1A4UA 2GN9A 5I8ZA 2UVDA 2A94A 4FJ1A 4M49A 1LRKA 3UOGA 4CV0A 3LU1A 1ZSNA 1YBMA 4OQZA 3WSVA 4M54A 4CM5A 4PG4A 1HDRA 1PR3A 4RDHA 2NADA 3H3JA 3F3SA 4E2YA 3PGJA 1KYQA 4RO0A 3OMLA 1I24A 4AJNA 3K5PA 1GEGA 4CM8A 3MJTA 1KY5A 3A06A 1JTVA 3WWYA 4R69A 4YCAA 3H7AA 4QT0A 1ZJYA 2PV7A 3AOGA 4XGIA 4CM1A 4IDCA 3K30A 3KV3O 1VRWA 1NHWA 4KUGA 2G76A 3MCVA 2QRLA 4PG5A 2O4CA 3U4IA 2NLOA 4BQRA 3UH1A 3V8BA 1PQWA 1T25A 3K96A 1WDKA 4B8WA 4DMMA 2FZEA 5EERA 5AQ1A 1LDMA 4EI2A 3G3EA 2J5KA 1UXIA 3UXYA 5ILOA 2X58A 1YJQA 4XGKA 1A9YA 1YB4A 1I5RA 1LQUA 1PZEA 3D3WB 2SCUA 3JQFC 2VTEA 3O8QA 4MVJE 4W9NA 5CPBA 4BL5A 4F45A 3U4DA 1XGKA 1J0XO 2BRUA 4IXWA 2OMEA 5HTOA 2WEKA 1GU7A 2PZLA 2CSUA 1QXSA 3PPIA 3OF2A 3QY9A 5T6BA 2NQ8A 4XJTA 3VZSA 1DC6A 2AE1A 3RUHA 4EW6A 3DEYX 1DDOA 2HQ1A 5G0VA 3O9ZA 2GZ2A 2HJSA 3VC7A 4BO3A 1ISIA 4INAA 1MXHA 4PZEA 4EZBA 4IINA 2B83A 5G0UA 4HFJA 2IXAA 2W2LA 3F46A 4CM9D 2O3RA 4CMIB 1DB3A 3L77A 5I8WA 2B37A 2DUWA 4YWJA 3B1JA 3DMTC 5A04A 4DPLA 3WNQA 1ZZEA 4GLOA 4WOJA 1Y8RB 4CLHA 3WIDA 3N74A 1G0NA 3IS3A 1OAAA 4ROSA 5JC1A 4XQCA 3RASA 1VJ0A 1P31A 2NVWA 4PLZA 3EYWA 1GPJA 1M66A 5BNFA 1P1RA 5TX7A 4EJ0A 1YB5A 3WGQA 4WGGA 1LA2A 1DIHA 3K2EA 3OIGA 4YAIA 2HSDA 1FDSA 4BNXA 1P0FA 3IUPA 3VKUA 4RVHA 4UUOA 4JBIA 3GNSA 4AJ1A 3DHEA 1KS9A 1A5ZA 1DFIA 1QKIA 1XA0A 3ORFA 4XA8A 4XX0A 4JN6B 5L9AA 3LC1O 2VYVA 2ZKLA 2DTEA 1NWHA 1NM5A 1HSZA 2OUIA 1AN9A 1PEDA 3EY4A 2F1KA 3CMCO 5BSEA 4MP6A 4CQLA 1ENZA 4UUMA 1D8AA 1RPNA 4Y6PA 1L7DA 1NX6A 3MWDB 3FPCA 1SOWA 1PSDA 2C2XA 1ZEMA 3I5MA 5EN4A 5I9MA 4XD2A 1EDOA 1BXGB 2UAGA 3RBZA 4C4OA 2ZK7A 2GN4A 4XDYA 4WNCA 4B3JA 5IF3A 2O2YA 3ST7A 2O3TA 3EC7A 4KWIA 3JQAD 4PLCA 3ZWVA 1W0CA 3ZHYA 4EYEA 3T7CA 1I32A 4KUHA 1DFGA 5TT1A 4NU6A 1X1EA 1WNTA 4O1MA 1PQUA 5FI5A 4B4UA 5CEEA 3I1JA 1M75A 3H9JA 4IDFA 4R3WA 1Q7CA 3BMCB 3GVHA 4IQ8A 1P1KA 1ZMOA 2ZTLA 4L4SA 3DAPA 1K3TA 1P1IA 3ZV3A 4C7JA 5AXAA 5B4VA 1HE2A 3ADPA 1QYXA 1C1DB 4U7WA 3AUAA 4FC7A 3FR7A 1BDMA 4CMKA 4BV9A 4Z3KA 1JWAB 1O89A 1KVSA 3GHHA 2JAHA 3QIVA 5I7EA 3DMTA 2O3UA 5IJZA 2ZYAA 2EJVA 2EG9A 4WK6A 2VWQA 1DC3A 3U5TA 3JD1A 2Q3EA 4NK5A 4NJOA 4D0RA 3K8ZA 3WICA 3RQSA 1U4SA 4R01A 5JSFA 4DMLA 1BSVA 4GLLA 4YDRA 2NACA 4BB6A 1N9GA 1SNYA 4LRSB 4FN4A 3TZQA 3UW3A 4OMUA 4BO2A 1E0DA 2EW8A 5LDHA 2WD7A 4UEOA 5CEJA 1ZUD1 1EBFA 3K73O 1E7MA 1VPDA 4TZKA 4RPHA 4Y8VA 2ZB4A 5KJEA 3JQGB 4BUCA 3ANLA 2VHYA 1I3NA 1LSUA 2VNSA 2BI8A 1BG6A 3MWEB 4FC6A 3IUSA 1NVGA 4ZJUA 2IYOA 3I6QA 1JVBA 2W2KA 2X22A 4NHEA 3HHPA 1VE9A 2QQ5A 1YRLA 2C20A 3WMXA 4BO1A 5JY1A 5T64A 4IGEA 4ZHSA 3GEDA 2POQX 2C0CA 4OHUA 4BKOA 1UXGA 1UZMA 2V6GA 4ID9A 2PD3A 1YE3A 3W8EA 2XF8A 2FWMX 1F8GA 1LDYA 1HEUA 3H9EO 4XEHA 5JMPA 4ZGWA 1AXEA 3PIDA 4K9DA 4R9SA 4DLLA 4YR9A 3JQ8B 1FDTA 3QWHA 3OEYA 3DOOA 3LT4A 3B20A 4L0QA 3UVEA 5TT0A 1HT0A 3OH8A 2HKIA 4ESOA 1F06A 2CF6A 4WCFC 1MP0A 4RPGA 1LBEA 3ONEA 5CG1A 2GO1A 2PZJA 2FPPA 1XHLA 3PTZA 4DTIA 1Y5MA 3IKVA 1C14A 2VYND 4YYZA 1U3VA 3LC2O 3WBFA 3B1FA 1YQXA 3AOEC 2B4RO 1DLIA 1WMAA 2Q45A 3GDOA 2VZ0A 1IPEA 2XXBA 1YKFA 4MDHA 3F1KA 2D5CA 3BMOB 3RVDA 5A5EA 2JCXA 2NU9A 5JBIA 1Q0QA 4W6ZA 2HMWA 3GMSA 1MGOA 1FK8A 2VRBA 1ULSA 1KEWA 2AG8A 2DPGA 5EIOA 4ILKA 1NVTA 3QWBA 1G6KA 4R68A 1CETA 4TVBA 3GVXA 1PGQA 4BO9A 4PRKA 3OQBA 2J6IA 2FSVA 3OIFA 1KERA 2F00A 3RC2A 1GV1A 4CLRA 3L6DA 2TMDA 3KYCA 4EEXA 3SVTA 1CRWG 2Q49A 4JLWA 1E3WB 4Z9FA 5COQA 1LI4A 1EEHA 2IDZA 3NRCA 3RJ5A 4CLOB 1MUUA 4BB5A 1NQ5A 4AJJA 2BFAA 1QYCA 2VHXA 4YJHA 3FN4A 4CMEA 1TLTA 3EGOA 1YO6A 2A35A 4NBRA 4Y98A 3PFWO 1E3SA 3NKLA 1OC4A 1U2GA 3WG9A 5BSGA 3PFFA 5B1YA 4CR6A 3F6YA 3R0IA 1HRDA 2Q1TA 5A9RA 2B4QA 3LF1A 3L9XA 5JYEA 4CUKA 3D4NA 2YDXA 3RCBA 1OC2A 4Z9YA 2HMUA 1R37A 5JFOA 2ZJ0A 4RDIA 2PZKA 3O03A 5IXSA 2QHXA 4MIYA 5K9ZA 3ZNQA 1UUFA 2RAFA 2P91A 4Y6SA 4IS2A 2WTBA 2XXJA 3JCZA 1R15A 4AJ2A 4TZTA 1XYGA 3VPXA 2X23A 1GADO 2FR0A 1LDEA 3AW9A 2HMVA 4FFRA 4UVHA 1M6WA 2RHRA 2ZTMA 3KO8A 4I5FA 5H82A 5GY7A 3T4EA 3CSDA 3TSCA 4PG8A 1E6UA 4LGVA 2VOJA 3Q6IA 2YZ7A 4FCCA 1R4NB 1M2WA 2FPIA 4I9HA 2BELA 1AHIA 3WGOA 4U6SA 5EESA 4YBZA 1X15A 3EHEA 1WZIA 2IZZA 3I23A 2GR9A 3PYXA 5TJHA 1N92A 2AMFA 1E1LA 3ZNPA 3Q0EA 4CMCA 2O7QA 2VRCA 3JD4A 5KNLA 4HFNA 4YAEA 3GG2A 4ZQEA 1HF3A 1J49A 1V6AA 2CUKA 2X5OA 5HA5A 3GRKA 4BVAA 4N18A 5A06A 4PLFA 1Y5RA 3D4OA 1GCOA 2Q46A 4U0KA 4I9UA 2X0RA 2O3QA 2FPGA 1E1KA 1CDOA 4I9NA 1WLYA 2FP4A 4JP3A 3BTOA 3ETDA 3LK7A 5IDQA 1Y8QA 2YYYA 1YQGA 2BFOA 2I3AA 4DXHA 2NTJA 3KEOA 4WPGA 1ZVMA 5AYVA 2FMUA 3DHYA
chains in the Genus database with same CATH superfamily
3DZFA 4EUNA 4JVLA 5FCDA 5I7RA 3NTLA 4R8RA 5EE3A 5KQGA 3TUJC 5BYKA 3OE4A 3S55A 4X94A 1DGQA 2IPNA 1C3XA 1EHCA 1NC1A 5GONF 2A0KA 1ZCAA 4OXQA 2B98A 4M8NE 2YY6A 4P92A 5DHQA 3ONFA 2FPSA 1Q19A 2NO7A 2XE6A 1C8BA 3F2IA 5T8KC 1TTTA 4AN4A 7MDHA 4V2IA 1T36B 4YT4A 2C4WA 4H35A 5MN6A 3AETB 4K9OA 4A92A 5EKTA 1E1QD 1B0AA 1RWPA 4Q1FA 4BNMA 1JI0A 1JHRA 2IELA 1ORRA 5F1YA 3QX3A 4PG7A 5TC4A 1NVDA 3EIXA 3LCUA 4ETIA 2J48A 2SCUB 2VWHA 5JCOC 5JT1A 4KLAA 5GJBA 3BA1A 1SD5A 3QVJA 1WHTB 1B8PA 1QR2A 1L5SA 2JCGA 3Q12A 4CKEB 1PQYA 4IYJA 3FNRA 4L28A 1XRQA 2AEFA 4ND2A 1MPXA 2QMUA 3PGLA 4GI5A 3QE9Y 2COUA 2Y1WA 2DUMA 2PXHA 5E9QA 3QX9A 1DV1A 1VSBA 2W48A 3G9QA 3IXLA 1I2DA 1ZH4A 4D4LA 1ZIOA 4L4YA 5F21A 4F4CA 2F8LA 3R7NA 3D0OA 4F85A 2V58A 5BUQA 5B12A 3CX6A 5AOCA 2J5RA 4CM6A 4ILEA 3UAOA 1R50A 1Y9AA 2OGWA 1W96A 3AR9A 3PNSA 4Q7MB 3V4VB 3W78A 2QSUA 4CI0B 1TM3E 5BOSA 3HXLA 1R0SA 6REQA 7ADHA 2V7VA 3RT9A 1O4VA 2DQSA 4QYXA 4BFSA 3Q5EA 2WMYA 1JQKA 2OXIA 2NZJA 4IG4A 1JLMA 4KO1S 4WZAA 4IJ6A 3AUJB 1S96A 4D8UA 5I7OA 2HA6A 4R40A 1NFRA 1FP2A 1CQZA 1GNPA 1YUBA 4H0CA 1LFDB 3HVRA 1VDZA 2B8TA 1ZCJA 3AONB 2XKJE 4OK3A 1DJLA 3CXRA 2IV7A 3QKSB 3T38A 2QAJA 2DU8A 2VYCA 2BY4A 3LT5A 3CR3C 2XNHA 3FM9A 3ZL9A 3NR2A 5I5EA 3JQAB 1SCKA 1W0JA 4S12A 4XD7A 3ZIUA 4G0UA 4GMXA 3VDQA 1OTHA 5KJCA 1BEEA 4LQ4A 1V9CA 3B1XA 4K9RA 1TVEA 1JA9A 1SR8A 3N2LA 4ND5A 5EG5A 4BYGA 3JAKB 2DECA 1UADA 4E13A 4YMVA 5AJXA 2V9ZA 1ZIDA 2YJGA 3C16C 1TRHA 4UVGA 1WULS 1NBIA 1XMIA 3UO8B 4H7PA 1FP4A 1MC1A 3O4GA 5EFOA 2PEZA 4Q7JB 4WOKA 1W73A 4F3RA 1Z83A 1T9AA 2AK2A 4GAEA 4TKUA 1R0WA 4NZYA 4KN8A 4LBZA 2R7MA 4B7CA 2GUGA 1C5KA 2QW0X 4HXGA 5DX0A 4P4SA 3H2HA 3U40A 3VTZA 5ITZB 1NASA 4G56A 4MULA 1XPOA 1NZFA 2FAXA 3N05A 4DG8A 1T9BA 1JT9A 2JJMA 3MTAA 1DX9A 1BDHA 2H17A 3IHLA 4DM7A 1DO8A 2V7WA 5BSUA 4P80A 5TEWA 1ADYA 2A8YA 3CZRA 4HRXA 4X45A 3GZNA 4AJLA 4KXYA 2XMSA 2I7CA 1QPBA 2EQBA 2Q0HA 3FHLA 3OP4A 1IB6A 1SOMA 4V0OA 5DBHX 4BFUA 4F21A 5CJPA 3UBTA 3DD1A 1H94A 1NKVA 2ALJA 2O50A 2RD2A 1NJSA 4M0FA 2QJFA 3LXXA 5MN4A 2VNJA 2YIMA 3Q4GA 1LF5A 1KFJB 4UBMA 5JVDA 3RAGA 2P3OA 4NZZA 4YMWA 1DWOA 1U1IA 4D79A 1RFGE 3DYBA 1LSOA 4XIIA 3CWQA 1I30A 1K2WA 1JLHA 2BM9A 2CLEB 2C88A 1ZUIA 3MD9A 3ZZUA 3MQ4A 4CEHB 1K7CA 4FYHA 1AOXA 1LBSA 3MTQA 4ENQA 5LIRA 1LY1A 1YZLA 2NYVA 2UZIR 1J06A 4BP9A 1QQAA 2VQDA 1PTJC 1XP5A 1HLFA 2GKSA 3MUNA 1R0CA 4IO0A 3DLBA 4RCZA 16PKA 2G70A 1TUBB 2N1MA 2Q3FA 1PG2A 3H9CA 3U31A 1T4GA 4XQGA 2RSLA 4CL8A 3CE9A 4BO6A 2V0NA 5BNTA 1QPZA 3RVSA 1PU2A 3N2ZB 1UJMA 3BD6A 4ARBA 5B3JC 1GSHA 4RHEA 2A1UB 1PWEA 1JIKA 3EQ2A 2IOQA 1I5OA 2JANA 3AZQA 2ZE6A 1W76A 3W3AH 3PU6A 2ILTA 2X8LA 1RAHA 4JI3B 1JFRA 4QWWA 3PXXA 4RFSA 2VAWA 3HGQA 1CUXA 2G67A 4RF3A 5J23A 3MJ4A 4Q9DA 3C24A 1PK9A 3AM4A 2EEZA 1VB5A 4FGLA 4J0FA 5A0FA 1L8QA 2CFTA 2FY8A 2O0JA 3H8VA 4RX1A 5HMMA 4ZHQA 2Y4NA 5CB4A 1ZJ4A 4IS3A 1US8A 1PS0A 2FPXA 4YCJA 3NHAA 2P0YA 3WMWA 1L5FA 5DW3A 3PDUA 5CB6A 2YJTD 4YCDA 1ISJA 5DXFA 2XVMA 5HQ3B 2CLHB 4B6SA 5BV0A 3Q8LA 2RAPA 2FR1A 3BE5A 1Q3HA 4MUFA 3OWOA 4D8VA 4TSRA 2AR7A 2H16A 2WF7A 4ZRDA 4ARSA 4D0NA 1N9GB 4B4VA 4M6WB 1QONA 1XZIA 2ZIXB 1WZEA 4B3MB 3SOZA 2H1HA 4NCNA 4P4GA 4DJAA 2VK4A 1DLJA 2C5EA 3EZ9A 3LAWA 2PPVA 3LOPA 4RTQA 2G9QA 3QUTA 3EMBA 1TVKA 3VV3A 1YRQA 4YRJA 5IVHA 3A70A 3I9FA 3JQCA 3ZXXA 2B78A 2KB0A 2IOFK 1FDUA 3MFYA 4XFJA 4RH0A 2PRKA 5AUQA 2IEAA 3WLQA 3DVRX 1HTTA 3SXUA 3ZE0B 2BHLA 3O6VA 1VKHA 3HJBA 2FWIA 1I4OA 4ZODA 3RFUA 2JBWA 3CRVA 2KS6A 1E9AA 3TNLA 4LWPA 4U6NA 1V11B 4U8GA 1EFLA 3DZHA 2QTGA 3ZIDA 5AW6A 3WL4A 3MB8A 2YY7A 4OA5A 4GNRA 4GEGA 5B1HA 5H0IA 3QHAA 3N07A 4X97A 3EE6A 4J1QA 3ZXYA 2XADA 1J70A 3L4BC 4DYDA 2NUTA 4DWVA 4Z6KA 1ZAYA 2PJRA 1YHYA 3OCCA 4OTZA 2NPFA 3SR0A 2WWIA 2GFQA 3PWSA 3G9XA 1S7GA 4P82A 3RIEA 3UUEA 4AK9A 4AO8A 1G3RA 3KHTA 2GN8A 4H27A 4DLBA 2VBCA 4B6FA 4QM6A 1Z4OA 2P4EA 2Z6AA 3CR7A 4GO1A 5TQ0B 2DWQA 5JRZA 3K2QA 1YZGA 2GNOA 2WHPB 3P9NA 4LJSA 4LN1A 4ND3A 3TL2A 4CQNA 2I1LA 5E1MA 4HXFB 4R51A 2A9PA 4MYSA 1I1NA 3O1HB 2HT6A 3KWFA 1N2SA 4XFKA 5ICCA 1O0BA 2Z4TA 3H11A 1QVWA 1GPH1 5L7YA 1LGYA 2RGEA 1L5VA 3KPWA 4PN3A 1QHGA 3O47A 1JG6A 1IFXA 1M73E 1XQ1A 2P65A 3F1LA 3GJZA 1GY8A 3NTXA 4ZQCB 5EJAA 3SMQA 3J7AC 3TLGA 2Q62A 4EEKA 2CNOA 3RIHA 1AGYA 3GDGA 1AQ6A 3FMGA 3DULA 4FWIB 2O0MA 2F43B 1DPFA 5KNDD 4WAUA 1ETHA 1PJBA 3AU9A 4KH0A 1ODLA 3GLFE 4FFBB 5KX5B 4HDMA 5K8UA 3G2KA 3QLJA 3FD8A 1NNUA 4OJNA 4ENUA 2K87A 1Q15A 1U8ZA 1L4NA 3G5UA 4CM4A 1SQSA 4I08A 1SC3A 4N5DA 1JHUA 1I6KA 3GPDG 5AKEA 4B85A 5F9HA 1E3LA 1WDLA 1A5BB 4OM8A 1RQXA 2W6MA 3H7IA 4FUTA 4KE7A 1C7RA 1IJKA 3DL4A 3IQIX 4MZDA 5KSPA 4D3SA 4R3NA 3GFTA 3SXPA 1NQUA 3L8HA 2BMWA 2OKCA 1TW3A 4JJAA 1K88A 4QTZA 3V8QA 1QCYA 4U3JB 1G5IA 1FMJA 1TM7E 1IJBA 2ZUEA 2EQAA 3LL4A 5C8ZA 4P83A 4FMPA 5K45A 4GQIA 4E5YA 2DWUA 2OB1A 2BDTA 3O31A 2J3KA 4JYPA 1VYVA 3REQB 2MDTA 1G8FA 1VMDA 1HY3A 1MD9A 2H92A 3KYCB 4OHCA 5HJ2A 1WUKS 1WZNA 2VUSA 3TSYA 3KAQA 5ALTA 4A82A 9ABPA 2QAIA 1RYBA 4F0JA 3FKQA 2HA0A 1RABA 2AK3A 3D6MA 1TI7A 3S68A 3U80A 4ER6A 1K3FA 1P7VA 1AK1A 3E22A 5AI0A 4L6CA 3S1AA 3LJKA 3TLAA 1JW9B 4RKWA 1B42A 1H0SA 2I8CA 2ZCUA 2CLIB 3B9BA 2BMFA 1Y33E 5BW6B 3K71B 5GTDA 1WM1A 1Z5GA 2W4IA 5BYJA 2XLCA 3IB6A 1F0PA 1KMIY 2FFBA 3DYVA 4B79A 3EGWA 3ETJA 2V1UA 1TE2A 4DB2A 4MPDA 2COKA 2HJHA 4LAFA 5CTJA 1KEEA 3QYFA 3OQPA 4YRIA 4AJEA 2A0XA 1H2BA 1T2NA 3G59A 5CYOA 5EIBD 2X4DA 3OI7A 3B48A 4QOSA 1EP1B 2IIVA 2EP5A 2WTMA 1IZ8A 4KR0A 4TVSA 2AJLI 3DZJA 4QVGA 4MVJA 1VRCA 1PTKA 3E9ZA 3QFSA 4E32A 5AM4A 1M8FA 3WQSB 4NDAA 2KLBA 3I73A 5LQKA 4HMOA 3N6RA 3T41A 3QSGA 4GHWA 5KDDA 1E8NA 2ZQZA 3T06B 1ESCA 2R6JA 1N2ZA 1Z0JA 5FNVB 1IMOA 3EVDA 2QRGA 4YACA 5L7WA 1E92A 2Q2QA 4DPMA 1OOEA 4A16A 5B5SA 4FS3A 4GX5A 2NVBA 1QC5B 2WPDD 3H8SA 1M1NB 2GEVA 5DM4A 1F8UA 4BLQA 4BU0A 4E88A 3OT5A 4OREX 5AVTA 2WT9A 2J1LA 2FI1A 3K8QA 3C3KA 3P2YA 3C7DB 3JQ6A 1T4CA 4OIFA 3WIBA 1WSWA 1NVAA 1SIBE 3ENKA 4GRAA 5C80A 4DGSA 3SBOA 5MF6A 4BDSA 1HL3A 2M6SA 3PVZA 4YWHA 2CYCA 3PLNA 4Y6OA 4CCYB 5FNVF 3D6NB 4L08A 3QWIA 3H9QA 3TXXA 1BJKA 4OGGA 4DNPA 2WYUA 4YP1A 1PD0A 3OT4A 3DTVA 5LYJF 2JAOA 1SXJC 2JASA 1QHNA 2PRIA 2WU0A 3COWA 3JXEA 4KX5A 3UCFA 3EGXB 4N54A 2RKBA 1AIPA 1JJIA 1TUEA 3CEPB 3G2IA 3QVTA 1QRSA 4I6JA 3JALA 5A7FA 5JQGA 2ZTUA 4MTLA 5KTSA 1UJ2A 3JQFA 1CRPA 2HQBA 5F51A 3URMA 5BN4A 4CCAA 5HFJA 4ZVNA 2JCVA 4BRWA 3FJ1A 3E3AA 1W85A 1F17A 1EVEA 3C98A 4D3YA 4GMKA 1KOFA 2BMAA 1U5BA 3PQ6A 4MGHA 3LQYA 5DNVA 3FJOA 5ALQA 5HS6A 3ABSB 3EXIB 4UM9D 1Y8QB 1M0WA 3HA3A 4QBTA 4BO4A 2BH9A 2JS7A 5DZSA 1GQOA 2BKXA 3GFGA 4IMPA 4M0MA 4XR9A 1TAGA 4IMIB 5HUHA 4D0LB 2RH9B 3A36A 4LXXA 2ZWAA 5FNZA 3JQ7A 2JJQA 3NIDB 5ELLA 3QVGA 3IPYA 3ZWBA 2CK3A 1TM5E 1DUIA 2NV2B 1IG0A 3UCXA 1TEHA 3GJ6A 4GNKA 2C2WA 5CLJA 2ZUSA 2OP1A 3SC6A 5DBOA 1O95A 1XLWA 3A37A 3HYSA 3IJRA 1MOZA 1MOPA 2GILA 3IUNA 2I71A 4RE6A 4JWKA 1ZU5A 4ZT4A 3RGGA 5I4IA 3HVHA 4D74A 4B6QA 3I9OA 3ZKAA 2ZU6A 3T1VA 5J3JA 1S5PA 1WD7A 3M9XA 4TX1A 5JS8A 1E3EA 4EUSA 3HYNA 2FPUA 2XGOA 4CPDA 1R16A 4W5QA 3MBIA 4M7PA 4B45A 2B5WA 5BRAA 1H05A 2PZMA 1R0XA 1XI2A 2TMYA 4BLWA 2A86A 2WHRA 3CBQA 3HO8A 4GYJA 2BFEB 3ZI4A 2VQSA 1MH1A 3ZGYA 1IEVA 1K8QA 4YFYA 2ZIUB 2GRAA 3L07A 2POCA 4IIDA 4OHMA 5DGIA 4AY4A 4DDUA 5FO0A 2O8BB 1LVGA 2Q41A 3ZEIA 1J2EA 4B3FX 3BH7A 3I39X 1MA0A 3H1PA 4WSOA 5FA5A 5AW9A 1FFXB 3SD7A 4EAQA 2X4IA 1VCHA 3C5HA 4GX2A 4PTZA 4P7BA 2P9GA 4ECAA 4IG9A 4EVQA 3KAPA 4PZ9A 2PFGA 4YXWA 3VH4A 1EUDB 1XKLA 4QDZA 2V5AA 2H7CA 4MGIR 3UK1A 2ZXUA 1FSPA 3BF8A 4V1CI 2QUBA 3PICA 4A27A 4D1YA 3LDAA 3F3MA 1SB9A 4G81A 5EEGA 3VR2D 4Z3OA 3USCS 5EINA 2HCFA 3T15A 4D9HA 3ZZ1A 2FKAA 1AB5A 3HL0A 3NONA 1K3UB 4UEQA 3N86A 5A4FS 1RE0A 1DKQA 1SIUA 1AU9A 4K3VA 1HOTA 4HPJB 4R2XA 1XRNA 3OQIA 1KZ4A 4B3CA 3OLQA 4S35A 1X1TA 3T6KA 4F91B 1WL8A 2IVZA 5SZHB 2D8MA 2IHJA 4PLPA 4G67A 1WPGA 2JB9A 5LQMA 4EKNB 1SVKA 1QVAA 1YS9A 4DBVO 4EIWA 1OR8A 3FIUA 4HQ0A 3GFVA 4XLTA 2CDNA 4XUDA 4IDOA 3VSEA 5KBYA 1NZDA 3C5VA 2J4CA 4J4TA 3RKRA 3U3XA 1LJ8A 3OHSX 1KSJA 2GEJA 3T34A 1ZMRA 4LCJA 5EXDA 5ALYA 3T7JA 2WICA 3BH0A 4PZDA 4FBLA 4MIOA 2PT7A 3WOVA 5FO1A 3OQ6A 1CU1A 2PSDA 2P6MA 5ICSA 3H5WA 1NVWQ 3OJWA 3PLRA 2FK8A 1O2DA 3RIGA 1JDZA 1K8YB 3FPJA 3VPBA 1ZH6A 5BVHA 2QR2A 3S5UA 2YNMD 1JALA 1I2BA 1UJCA 3BEDA 4Y9TA 5K1ZA 1XL1A 2EOAA 5K4GA 2FCAA 4LWOA 3QI7A 4P7KA 1OSNA 1X9IA 2OSVA 1EH5A 2P2CA 3FG9A 3BYZA 5DK4A 3TKYA 3DBLB 1QHYA 1EFCA 2GMWA 1H9AA 2P30A 4OEHA 1C7IA 3IIEA 3F6SA 4LBYA 4V0QA 1CKEA 4TTVA 3GOHA 4QEKA 1EWYA 2RGGA 4ER7A 1J00A 2EDAA 1W49A 3LOQA 4RTPA 3I2HA 4ZDWA 5MN5A 1WETA 1PL7A 1YB6A 1B0ZA 2VEOA 5E2IA 1DRKA 1U0JA 5BSHA 1MAAA 1JPNA 4U5QA 3BXGA 3KRTA 4ENRA 3EVEA 3REGA 1JLRA 3R3HA 2Q1WA 1XU9A 3FTDA 4LXQA 2CT8A 1P73A 4JI8B 4KOAA 2OVFA 1WB9A 4CFYA 3HCCA 4J3FA 4BMVA 3T3NA 2R65A 1N5OX 3GAZA 4J7XA 3DV2A 4MWBA 1Y6GA 6NULA 4TKLA 1GXSA 1S8OA 4EHKA 4D3XA 2OQIA 1ZMBA 5GZ1A 3NS7A 3SP1A 4BZWA 4MA4A 4R9RA 1QE0A 2GHRA 4DGQA 1GZUA 2YS7A 3RSLA 2HLDD 4GYWA 4HWRA 3PR3A 1ILEA 1GZ3A 3W5VA 1SD2A 3AY6A 3KT3A 4F2GA 3FBWA 1F4LA 3NYQA 1DEKA 2HFJA 2XEXA 4CMIA 4ZDKA 3NIGB 2PGNA 3AVQA 3BMNB 3GJ4A 3KT6A 4Q37A 3PWTA 4X3OA 3ZQ4A 3K8OE 5BUSA 4E14A 3CIFA 4RESA 4ZAWA 5KVQA 3Q2OA 4KU4A 5CAEA 1CEXA 5JWHA 3TX2A 1J9EA 3W4JA 4ZI2A 4FWTA 1JIQA 1V7ZA 1PR1A 1U2TA 3QJGA 5D84A 1P33A 5D5HA 2YC2C 4LTNA 1EIWA 3ZUGA 4TKVB 2DR3A 2X0IA 3WLJA 3JV7A 4WJLA 4OV6B 2J4FA 1DAMA 2QOEA 2MHCA 4X6XA 4ZV7A 5B6IA 3HCBA 1RYYA 5JAHA 3BGWA 2A9RA 4ZAGA 2ZJ2A 3MJCA 1E7QA 1VGRA 2GCIA 9MHTA 4EHLA 5EGNA 4TLEA 2AG5A 2NOAA 3QE4A 5ALJA 4OQFA 4RGYA 1IN1A 2G0NA 5CLHA 1G0OA 2OC9A 1QO9A 5AI5A 1M2EA 2Q50A 3MHPA 5TMDA 4EJMA 4EHFA 1GYPA 3ED1A 4J7AA 3SC3A 3LIPA 4JLJA 1RD4A 2P2DA 3KJIA 3PDJA 2GZ1A 1KC3A 5DSZA 1NRIA 3AM1A 2AUMA 3E48A 3L92A 2NUAA 4YQEA 1YJXA 1L1QA 4O4IB 2XHZA 3IEVA 1IUNA 1ZRNA 3KNZA 3UJNA 1LRJA 4ITRC 4XVQA 1CYDA 2ZREA 3BE6A 4O8CA 1RS0A 1Q7GA 2FWNA 4ZTBA 3I8XA 3ZD6A 2JH8A 4OAOA 1UKAA 3SDSA 1IJEA 5T4EA 1JFLA 1ZWLA 2OL4A 2WYWA 3ULKA 5KTYA 1RYDA 1TJPB 2HRRA 3AOEA 1JIVA 2ZATA 4KAXA 4G23A 4YRMA 1V1RA 3NJRA 3CPEA 4FIZA 2DE0X 3UG7A 6AT1A 1FNSA 3B9PA 1T5HX 4PIPA 5BMVB 6YASA 1MDBA 2G6BA 2EDCA 3WAJA 1DE0A 3ZS9A 2Q1YA 2APJA 4O4IF 2H51A 3SMVA 3VDXA 5KNBH 2FG6C 4DV5B 2EU8A 3A14A 4U2CA 3SQMA 4ZVVA 4KR6A 3TLKA 1DRWA 1K86A 2Z98A 4RORA 3W79A 3SAJA 2C2OA 4CIBA 4RTJA 1IWOA 1KWKA 5A62A 2GNPA 4DJFC 1QOPB 3VR0A 1OZAA 2CJWB 5HRCA 2HLHA 1F0YA 4YUYA 4HX9A 1MJGA 4G4SO 5LDDC 1W36D 5BMVF 1BDJA 2WJWA 2E4UA 2WM2A 3A1SA 3M9WA 4FD3A 4CIYA 1UL1X 3B8EA 2ZW9A 3I0ZA 3PKIA 4TUYF 1PJSA 2QX6A 4IV0A 5EIFA 5LQSA 2VHCA 1DWPA 1E6WA 1XALA 4WERA 4AY2A 4X71A 4UU1A 3BMCA 1GL3A 1X9GA 4Z1MD 1X3LA 1VCIA 1VCMA 4OHKA 3PQEA 3RANA 2FCRA 3OD1A 2IOFA 2KQUA 1MRSA 5LQNA 4BLTA 2E55A 4AD8A 1GDTA 3Q0IA 3G1WA 4H1UA 3H86A 2G9VA 2QW1A 3QW4B 4EHHA 3AVWA 3E1SA 1DG3A 1GRVA 2GN1A 2ZYSA 3V33A 5DN6D 1BU8A 4KAFA 3D59A 1BWSA 1TJ5A 1KMCA 1CUBA 3KAKA 4YNBA 2WFMA 5M3BA 5JLJA 1AHHA 5FYDA 2MU1A 4QELA 3DZIA 3N2KB 3LWBA 1A9ZA 10MHA 1Z7BA 1IXKA 4YAJA 4DRXB 2Y1XA 4F6CA 1JHOA 1X80A 3DOJA 3R3ZA 4ARUA 3C1OA 1ITZA 4BMNA 2OILA 3FLEA 3QGMA 3UY4A 1CR4A 1KTVA 2IHYA 4ZEOA 2J8ZA 4ZYLA 1P2VA 4RW0A 5AKJA 5BXQC 3W2GA 4OHWA 2GESA 3AI3A 2E6KA 1L7RA 2QTHA 3VH1A 2UXBB 4ZQGA 4GKBA 4UOQA 3I37X 3HN7A 3TQOA 4YUAA 5JFTA 2UYHA 4P0PB 3ROKA 1WKCA 4BO8A 1UBRS 2Q3HA 4A8PA 4FP9A 4CNQA 4FPXA 1Q95A 1HDZA 2VKQA 3OP1A 3Q2KA 4NONA 1H5QA 3RD5A 3GROA 4ALMA 1U6KA 1F3LA 2X3YA 4OI0A 5BUZA 4WHMA 1MXFA 1QQ5A 1J0DA 4IIVA 5G4KA 3V2IA 3A04A 3AEKB 2O2JA 3E2IA 4C2AA 3H0CA 4NBSA 3DL7A 4ZRMA 1M7HA 3ZU6A 1IZZA 3T3GA 3IAHA 2GCOB 1VYUA 1QRRA 4PYLA 5D5PA 5AKKA 1NXOA 2AZDA 3WQQA 1EMDA 1X19A 3CRQA 1I80A 4ITUA 4QPNA 3WMGA 4YJ2F 1QS0A 3WSWA 1SBTA 3A1UA 3ABZA 3OZRA 4JU9A 4EVIA 2ZSAA 2HPAA 3OEHA 4C20A 3QU7A 1EVQA 4RH1A 5EJMA 2ARKA 3OF5A 4OI4A 4HVTA 3KYIB 5JDCA 1F5SA 1VHJA 5IABA 4DLZA 1V8BA 2WYIA 2NP6A 1IXZA 4TOIA 2C1XA 1Z4NA 2PLNA 4QTTB 4ZD6A 2VYFA 1WTAA 3UA3A 1M0EA 1E2PA 2O52A 4MQMA 2DKFA 2Q5JA 3C4QA 1J24A 2BEWB 4DCJA 3AGPA 4DCCA 4HN9A 2XR1A 4A15A 2WIGA 1DKLA 3EVAA 3AFOA 1V3TA 3GVPA 1I3MA 1MEEA 1FXWA 3G0CA 4LTMA 5BQPA 2UDPA 2LZ0A 3M7IA 4FD2A 2CNWA 4W8HA 1KSHA 1BVRA 2JFZA 3IEUA 4OBWA 2Z58A 1AGRA 3WGHA 4ADSG 4DT1A 5KJ6A 1GM5A 1W0KA 5KPDA 3EGCA 2ZJFA 5K5EA 3HSKA 3U9TA 2DLCX 1GPUA 1GN8A 2DBYA 2E85A 4INOA 1ISSA 4YV2A 2FSGA 2P0EA 2RK3A 2M6KA 4DEVA 4YT2A 2C8KA 4BMPB 3QXSA 1KRHA 2UZ1B 1KY3A 3I0MA 1GKLA 5HWSA 4GLJA 3WBKA 5FQOA 3KDAA 4WKOA 3EXEB 1A27A 4TQGA 2B1GA 5CPFA 4N7BA 1OE0A 3NNDA 4UE3S 1Z73A 4Q3LA 2I4RA 4JK3A 1QGZA 4X1YA 5I7VA 3GCWA 4B1FA 2DPXA 3OEHD 3OQHA 5GVSA 1ZEJA 4E6PA 2PTGA 3TF5A 1RXEA 2QSZA 2B94A 1V7CA 1ISHA 1MB2A 3DOEA 3L1KA 3ZY6A 4E07A 2RGRA 3UCEA 4ZREA 5HM6A 4DPKA 3OZFA 4Z4GA 1O58A 1I2ZA 4QFMA 3H5LA 3LCRA 4MKFA 3RNLA 3OECA 4OQXA 1W581 2QTZA 4AZ0A 2WLTA 2ZRJA 2B30A 4R8MA 1AZSC 3X2FA 3BHMA 3DO8A 5CDYA 2R84A 4EKEA 1H2RS 2YVLA 4R8SA 5H81A 5JAPA 5HKAA 3U4GA 4D26A 4MS1A 3WGKA 1J09A 2BZSA 3A4VA 3L4SO 1P9NA 3OO0A 1H5NA 5K3FA 3JSAA 5A5GA 5K0FA 2ZUUA 3OZCA 2FK7A 2DY0A 4MQFA 3UHJA 5JZVA 5LXTA 1W0KD 2B82A 3ICEA 4KQGA 2X0DA 1H23A 1WO8A 2IEDA 3ABIA 3JQDA 4BNWA 1IBSA 3X1MA 1BFDA 3LQ4A 5TVKA 4LHXA 4DF3A 2IEGA 7MHTA 3PZBA 2Z57A 1LVHA 1JG1A 1B6TA 3PI6A 5HEKA 2X14A 2X1LA 1DRJA 4JFRA 2KMLA 4KQ1A 2WD8A 3ESQA 5CLGA 1N36B 3K32A 4O6VA 1FSFA 2QRKA 3VX3A 2WFLA 5KKAA 1R7RA 1J20A 2NXWA 4ES6A 1IBKB 2Q5QA 4W9NC 5K6AA 2VT2A 3G5MA 4IDEA 2O3SA 4KXQA 1D4FA 3A6ZA 3WLOA 5DHFA 5K8IA 1GEEA 2OFOA 1O94A 3S28A 3PEFA 3DLCA 1W8DA 1XX6A 5K6TA 2Y0DA 1QRAA 3JYOA 4HWSA 4QECA 1EFVA 1AZTA 2WWXA 2YKGA 1C3OB 3RKUA 2HBQA 4P58A 1FFDA 5DM0A 2JK0A 2P1ZA 1VKRA 2PQMA 1Z2OX 121PA 3BHJA 3EWAA 4RM3A 1AO0A 3OF3A 4I4NA 3LBAA 4YX9A 4EUKA 5LLSA 3EQZA 4BX3A 3ZDAA 2FVYA 2NZUG 5J47A 1T3GA 3DVQX 4WFJA 2FX3A 4L9WA 4HGRA 4H1TA 5JS7A 4R2HA 4HDCA 3JTMA 3Q3VA 4KWCA 2XDYA 1RHKA 2FX2A 5I4KA 1IL0A 3RSQA 3ZD9A 2VJMB 1A82A 1TZBA 1OI4A 1P8JA 4ZEWA 4ACAA 5JO9A 5IULC 1AH2A 1RI4A 1OXKB 5JEEA 2Z5LA 5D85A 1ID8A 4B8YA 5JIBA 5L4SA 1TLFA 5CM2Z 2ONCA 4A6DA 2C9CA 1UFQA 4MVCA 2GF2A 5HIJA 3X44A 1FQJA 3UXEA 4R9VA 1VL6A 3OFSA 4QJBA 4WBNA 3BWXA 3R5TA 3VNUA 2A3NA 4N40A 1RP1A 4BVHA 2ONZA 5IG2A 5LZ9A 4P4NA 4YT5A 3KHUA 2ATXA 4K6CA 2IYRA 2J9ZB 3SQLA 3UMGA 4OHRA 2ZBQA 3ESRA 1M8JA 2X1VA 4A8HA 1IY9A 3EG9A 4YUXA 1N5RA 3P9XA 5BPHA 1EXWA 3RUDA 5CXQA 1QAQA 3DKVA 5DM1A 1UODA 1JMYA 3VH2A 2PUGA 3V3KA 2FF7A 2RE8A 2H3EA 3I09A 3KOZA 1CUVA 3LY5A 4XRGA 3NAGA 1Q7EA 1ZK1A 4TWJA 2O8CA 1KIFA 1A3CA 2GPTA 2EKDA 2C3PA 3BJEA 3N1UA 2D06A 1J4AA 5FDFA 1OB2A 4MS3B 2R7NA 2OXFA 3QOFA 2OFXA 1UBJS 1Q0HA 5JJIA 1XEXB 2EFHB 2ET6A 2I34A 2YV2A 4IP0A 5ITWA 3EGVA 3L7KA 2YZ2A 3QPCA 2ADMA 2LD4A 4MQEB 3QBVA 4MQ4A 3SZLA 2DBRA 4PEVA 4M8IA 3CX8A 4ZO9A 4HEA1 4CXMA 1SB8A 1N8NA 1XFDA 4FDMA 3N70A 4URUR 2XMPA 3PEUA 3OCYA 5EYPB 1BIFA 1WMSA 4K81B 5AM1A 3S4YA 2V7XA 1KC1A 3TD6A 4R83A 3D2AA 3VJLA 4WZBB 4OCZA 2ISCA 2JD1A 5HFAA 3P19A 2RBKA 1T8UA 2JFPA 3S44A 1BE8A 3TIGA 3ZE1B 1Y0BA 1Z07A 4DJDC 2FQWA 4BMYA 3KKLA 4L15A 4PR3A 4QXMA 3AR8A 1V1MA 3V48A 5KWEA 1EFUA 1GL6A 5I3CA 1T6YA 3ELUA 2JAWA 5KSYA 4PFJA 2VQ3A 3O8DA 3BTUA 2GLUA 4YCLA 1NW7A 2I3GA 3N75A 1F38A 1C29B 4LECA 3MTDA 3LDHA 3TRKA 2RIRA 4KBFA 1PJ8A 2VSXA 3ROQA 4EZIA 1L7MA 2FHPA 3MS7A 1GZ4A 1U8TA 4KCGA 2SKEA 1YMUA 3KWJA 1ZM3A 2AYZA 2I6SA 1K6JA 1O6FA 1AGNA 1SOUA 1J23A 1ZISA 2PXCA 4PX5A 3RYHA 4MW4A 1OLSB 3LX8A 5KKCA 4BV8A 4P7JA 4U1RA 1PHPA 2G9NA 1TZMA 4LDRA 2O8NA 1YACA 4XWAA 1P6XA 4KQFA 2C3YA 5GM1A 3C6YA 4YVFA 2BM8A 3DLAA 3UICA 4YS6A 3CVYA 1EE2A 4UQOA 2QPTA 3SYKA 4JBNA 3W5IA 4BKUA 2PSFA 1TQ8A 3STXA 5SY9A 2CZQA 1CS0A 3C3PA 3QENA 1P4GA 2NPOA 4L76A 2YJ6A 1C4WA 3F9IA 3I12A 3CLRC 4HGQA 4TLCA 1G9XA 1ZQ1A 3A1VA 5EZ6B 3K0AA 3UMBA 4M88A 4QNNA 1IUPA 3QTTA 2WAAA 5JNUA 2GPWA 2QX7A 1PR9A 3LS2A 3U60B 1SN7A 1UKYA 1A9TA 2PKQP 2QV7A 2YZGA 3EIQA 3GGOA 4H3VA 4YASA 4ZVQA 3OETA 4MW9A 5C5EA 3E5MA 4DN6A 3VJKA 2XNDD 4ONEA 4PQYA 3MG9A 4M1OA 3ZJVA 2ZJBA 3KT0A 3R9IA 3BMQA 2QX8A 4N12A 1SCBA 1CZUA 4NMLA 2ZQYA 2JEOA 3FCAA 4MW5A 4PAMA 4RK0A 4XJVA 4HLCA 1FYWA 2P79A 1LH0A 3C3BA 2YJZA 4R8LA 4RVOA 4YP6A 1Z6XA 3AUUA 1EPUA 1SBYA 2GCNA 2Q1XA 1GQRA 2YUTA 3JQPA 3ESZA 4C7KA 2J46A 1V3VA 2BONA 2R7KA 1Y3BE 3QY0A 4Q15A 4GWLA 4JROA 3ZY5A 2UYYA 2C8LA 3FUWA 2AMLA 1ZNYA 2BJWA 4N9QA 4KE6A 4PS0A 5DLYA 1L7NA 3IT0A 1PRYA 4Q7LA 1P72A 1ZA2A 2JIBA 1D8TA 3D5EA 1QMPA 3FVRA 3KU4A 1SUPA 4IM7A 3ZLVA 4N3NA 4ZVTA 1KVRA 3RJ9A 3RB8A 4KQ9A 4B7AA 3DBVO 2FP4B 1JILA 4RPCA 4WX2B 4BN0A 2RI1A 4GYYA 2J5BA 3IBYA 1K4MA 1TUIA 5FEMA 3VQTA 5C1OA 3NG1A 4DBLC 1YV9A 1NBME 2EWVA 3ZDCA 3EVFA 3TNDA 1UM9B 1YZQA 4XB2A 2P40A 2JI6A 2ZULA 1KQOA 3NAQA 4TTAA 3EVNA 1BXZA 1X7WB 4PCLA 3B38A 3TECE 3T1HB 2IC5A 1FRQA 2ZE7A 1XLTA 4LXIA 4N0MA 1U63A 1B8VA 5K4AA 4W99A 5CX1A 1U28C 2X2PA 4G9EA 2AE2A 5KYXB 5JYDA 2B4YA 1G7CA 1UPTA 1ZK3A 5EHNA 3DDZX 3OZSA 1OZGA 3LYUA 3RS2A 3WMFA 4XM2A 2A4KA 4L4UA 4UCFA 4NV1A 1F48A 3VPDA 3TGLA 4TQUS 4YRAA 2HK7A 1YDFA 3LQ2A 5ALWA 4CG1A 4J4HA 1YI1A 3E18A 5CA0A 4EO7A 5EVJA 3QJ5A 1K7XB 2LIVA 2GO7A 5DLQC 2AF3C 3AWIA 1RXIA 3AJDA 5FBQB 3A2KA 3KXIA 1T5BA 4WLFA 4R0VA 2PT9A 4HFRA 1D0SA 2C7GA 1W44A 5K6RA 3EIHA 1TFUA 2XUJA 1NKTA 1F12A 1H5UA 5ALKA 2DERA 2IZOA 2QIPA 1YD7A 2C96A 2QN2A 3MM4A 1Z7YA 4OHBA 3EUAA 1H22A 1HDIA 4JB8A 4L3WA 4NNJA 3KVVA 1LPNA 1MQ9A 4KO4S 4KTVE 3FGZA 4R2IA 1FPMA 4BO0A 4C4RA 3Q7SA 5DX8A 5IWCA 3O1JC 2C59A 1X7ZB 3T7TA 3RK1A 1ECJA 3DWEX 3AF6A 4N39A 3FTNA 3VNRA 4Q9IA 3W5AA 2WJHA 2FJPA 1SBZA 4E5PA 4LX8A 3FKJA 3VTAA 1PDWA 1PF7E 4CN8A 3RS3A 2NXCA 1V5WA 1NBMA 2JKVA 3M6MD 4J49A 3NKFA 3U13A 2RI0A 3UHAA 1MDFA 1WDTA 5TY0A 4CIWA 1C1HA 1JYSA 2DF8A 2DLDA 3QXCA 5F12A 2R4QA 5DP1A 3L0ZA 1PJLA 4FB4A 3Q1KA 1DAKA 4UVIA 3TAUA 2W2NA 4RV5A 5CK5A 1SVSA 2VYNA 2I4IA 2VHZA 3RODA 4GOMD 4IIGA 1ULUA 2G5PA 1K5DA 4RC9A 1NNEA 4PHGA 3U37A 2DFLA 2XAUA 3LY8A 4NYIR 1P2UA 1RRMA 2EWMA 3PGXA 3ZY3A 4AWAA 1QF9A 5G0WA 2ATCA 2E1PA 2VQ6A 2QAGB 1R27A 4H3KB 4L22A 1M34E 5FBKA 1E2LA 2O8DB 2GBGA 3BWDD 3OOSA 3CUWA 4HUJA 3GUVA 4JJ6A 4KAJA 3T9DA 3VHRA 3G79A 4YUVA 3WLEA 5FF9A 1JJFA 3GWZA 1DO2A 3CSSA 2LGJA 3RT1A 5K8LA 4KAAA 1FJ2A 1E1CB 1LPSA 2FW9A 3NV9A 4QIHA 4V3BA 1OYWA 1JVNA 3ZDDA 3DMGA 2G1UA 4AJPA 1PYDA 3SYLA 4E12A 4F9EA 1Q3KA 1N0VC 2ZTVA 4JIGA 4IDGA 1YIAA 4FFMA 3H5NA 3WYEA 4DLKA 1KRXA 3JYQA 4F6RA 4YCSA 2HZ7A 1X9HA 3GPIA 4AX8A 4DR1B 1X1RA 1ZM2A 2H54A 2R2GA 4ZCQA 4CF6A 3QRWA 4GE3A 1QJ4A 5JJBA 3CF4A 3GEBA 5EIXA 2HBZA 2PKYX 3NQ41 3OPMA 1LD3A 4JEMA 3H5IA 3VSDA 1JDJA 2DPHA 1P80A 1ML4A 3S7ZA 2P4SA 2YWCA 3L06A 1JSXA 4G5QA 4LOJA 2BFBB 3VKWA 4YV1A 3AVUA 2CJXA 2XUOA 2QG4A 3PNQA 1YA8A 4O4JB 4NENB 1J6UA 1AE1A 4KNYA 4TV8F 1P1JA 3SN6A 3IIMA 4WKGA 2XY4A 4O4LA 5B6PA 4QJ4A 1OYYA 1L5HA 3D3WA 5LOVB 5DNWA 3BL8A 1G3UA 1FFYA 1GQQA 3CV3A 3C8UA 4ND8B 3UKDA 3PQDA 3LCMA 5JANA 1VQ1A 1ZUHA 2GZDA 1TEZA 5EMNA 4JVSB 3U7QB 1WY5A 1VP3A 1OLXB 4FIDA 4HNTA 5IYZB 1Q2UA 4MUGA 3V1MA 4O4JF 4QLAA 2IYPA 3EXHA 4D7AA 1EDEA 5F1KA 3HR4A 3OU2A 4R2KA 1JEQB 4LVNA 5LOVF 1U0OC 4DWJA 4EUHA 1P0IA 4OYRA 2FWPA 3ABRB 4NJEA 1E5XA 4F1WA 3BILA 5CNJA 2AOUB 4FMBB 4ATNA 3BJRA 3GRUA 5E8RA 4FUQA 3ZDXB 5IBPA 3VI3B 2JJ2A 1IWPB 3LZCA 5IUJC 1IN6A 2OECA 4PYRA 4DVJA 1I9GA 1YUNA 4QUEA 1M1YA 1GGVA 2I9PA 4QFDA 3AUKA 2JLUA 4IOJA 4YV7A 1F14A 4DV1B 1HV8A 1T5DX 221PA 3DD5A 3DZGA 2IZ5A 1PNRA 1ZNWA 4YTEA 1PL6A 1RQ7A 3V32A 3L7BA 4M7WA 4CKWA 1YXMA 1JGTA 3EHDA 1S8FA 3LH5A 2G4CA 3GUCA 2HO5A 4PIVA 4QU8A 4P3KA 2XD4A 3IIKA 1QH1B 3H5RA 4KXNA 3LO5A 5DSTA 2OT3B 4WY8A 2HYDA 4P93A 1H4SA 5EXSA 1NPYA 3MPUA 3KJZA