1NXPA

Micarec ph4.5
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
118
structure length
118
Chain Sequence
b'KKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIILDLMLPEIDGLEVAKTIRKTSSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-binding response regulator
publication title Crystal structure of the response regulator 02 receiver domain, the essential YycF two-component system of Streptococcus pneumoniae in both complexed and native states.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Signaling protein
total genus 40
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2003-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1nxpA00
1LJUA 3IP7A 4G0OA 2QR3A 1QO0A 1SRRA 3MYYA 4Z4CA 3RVLA 4YV7A 1QP0A 1D4ZA 2PUAA 1JHZA 5KC8A 2I6FA 3EQ2A 3T95A 1RXEA 3W9SA 1HEYA 4YLEA 3N0WA 1Z18A 4M88A 4XFKA 5FWXB 3HO1A 3CKMA 3CTPA 3O75A 2FQXA 5ED4A 3QEKA 2ID7A 1ZESA 3HVRA 4OLAA 3GYBA 3M9WA 3QLUC 4P98A 3MA0A 3H5TA 2PL1A 5C5CA 1PHRA 1P8AA 2E4YA 2QSJA 3IP6A 3KS9A 4MR9A 1L5ZA 4MS1B 3RVRA 1ZAYA 3Q7SA 1ZGGA 2R47A 1A0OA 4JASB 2PE5A 2R4QA 4WXMA 5FWYA 4N0QA 4IILA 2X7XA 1BDJA 1YS7A 3FFTA 5IUJC 1SD5A 1QP7A 1ZH4A 3KJXA 1E6MA 1C4WA 4LE2A 5TPWB 4JA2A 2F8SA 3RVSA 2WJWA 1QPZA 4MGEA 1PNTA 4PICA 2NT4A 1EAYA 3TO5A 3GBVA 2PUDA 3F7NA 3LUFA 4O1IA 4IRXA 1PNRA 4TLMB 1B00A 4OG2A 4L85A 1BDHA 1XHEA 1ZITA 3IP5A 1P6QA 5BQ3A 3O2JA 5GOTA 4XXHA 2VUIB 2E4WA 1I3CA 3LUJA 1PEYA 1KRWA 4Z4HA 3H75A 3H5LA 2LBPA 3FGZA 3I42A 2R25B 2LUOA 3RVOA 4L4UA 2FN8A 1NY5A 3KSMA 5TQ0A 4GNRA 4NV3A 4YP9A 1MVOA 1XWWA 5KQPA 3LTEA 3IPCA 4MQEA 1Z15A 3RVJA 1H9CA 1LJLA 1ZGZA 2WJAA 4KK3A 1JLKA 1ZH2A 3UK0A 3H1EA 1JF8A 1DRJA 2A9RA 5DLEA 3BRQA 2WMYA 5T7BA 3B2NA 3HDGA 4RK1A 3Q7TA 4MS1A 2FN9A 2ZAYA 4XARA 5GQSA 1JX6A 1T34A 5T3YA 3A10A 3NBMA 1Z2DA 5HSGA 3FMVA 1JBEA 4D6XA 3LUDA 3OQMA 3TB6A 3Q41A 4MQFA 4WWHA 5TPZA 2GKGA 4G0ZA 1JYFA 5EWMA 3HEBA 1USIA 5TE9A 5TPWA 1APBA 1USGA 1DCKA 4KPYA 5KQGA 4EYKA 4RZSA 3QX9A 4QPJC 2CWDA 2MYTA 1SXHA 3N53A 4UHKA 4JOQA 1USKA 1Z2EA 1YTUA 3NNDA 3GRCA 5B3JA 4ZYLA 1KMIY 3EDCA 2FVYA 1FSPA 1TM2A 2FEPA 3CNBA 4TMYA 2PUBA 5IUNC 3RVQA 1TLFA 1VRVA 1DBPA 2NT3A 4MR9B 3MIZA 1ZDMA 2FQYA 5FBKA 5FWYB 5KC9A 1RNLA 5PNTA 2FQWA 2PUCA 4ETNA 4KMRA 1E6LA 2IYNA 5JNSA 3OLVA 3SQNA 3OQOA 2E4ZA 3KYJB 3OMXA 3OLZA 1VLZA 4H3KB 3C6QA 2P9HA 1NATA 2FKAA 3DBIA 3URMA 3KHTA 2RJOA 2RGYA 1MB0A 2MSWA 4F8JA 1BAPA 3CLKA 1ZVVA 3UUGA 1SXGA 4KV7A 3CHYA 1ZN2A 2AYZA 4P1ZA 2H3HA 2V0NA 2L2QA 3BBLA 3GV0A 2HQBA 2PL9A 3H5IA 3OLWA 3QX8A 3H5VA 4N47A 4EVQA 3I09A 3E3MA 1Y1LA 2HJ9A 3JVDA 4N41A 1PUXA 5TQ0B 2H0AA 3LUAA 1D1QA 1XHFA 3HCWA 2QW1A 1JDPA 1DRKA 1YVUA 4HYEA 4MQEB 2NZVG 1K68A 2P4UA 3C3KA 3BRSA 1RZRA 3LKBA 2F8TA 5TQ2B 1J56A 1ZY2A 4NCAA 4RXUA 2CHEA 4Z9AA 4D74A 2W42A 3LUHA 3GL9A 4OATA 1IIBA 4ML3A 2NZUG 1DZ3A 1GCGA 2MYUA 1W25A 3CS3A 4HNQA 2FEKA 1DP4A 2LPMA 2L17A 4HNSA 1F4VA 5JS2A 1DBQA 1QMPA 3JPYA 1W9HA 2B1JA 5KQMA 3H6GA 3HZHA 1OXKB 1YIOA 3O2QB 4MQFB 4KFCA 4N76A 3KG2A 4W5NA 1LBHA 2L18A 4G0PA 5EWMB 2FEWB 2FTKE 5DTEA 1D2AA 2IPAB 2IPLA 3IP9A 3K4HA 3LOPA 4RS3A 3ROFA 4B09A 4EYGA 1DCMA 4G0MA 4LZLA 2FXIA 3CZ5A 3JPWA 1TMYA 4PEVA 2RJNA 1KGSA 4ZMRA 1P2FA 2N9UA 3F6PA 1JH9A 1P6UA 2GBPA 3I5AA 4WZZA 1BA2A 2B4AA 4KQ9A 3RVNA 3SNKA 1EFAA 3M6MD 1ISSA 2J48A 3EQZA 3EAFA 2R48A 4LRQA 3UKJA 4W5TA 2PMCA 3TMYA 3D02A 3KYIB 5F64A 5HQJA 4YS6A 1E2BA 4DQDA 1JWLA 5JNVA 2QVGA 4Z9BA 3IDOA 3R0JA 2CD7A 1R8JA 3C97A 3VNBA 4EGSA 1NXXA 3A0RB 4MRMB 2IPMA 5TQJA 1QO0D 3CG0A 2HSGA 4F11A 1TVMA 4O5AA 2FMIA 4Z4EA 5JS1A 3K9CA 4PZ0A 4MS3A 2WB4A 5TQ2A 5CHYA 7ABPA 1Z26A 3O1HB 2CHFA 1QQAA 3JTEA 2GI4A 3C3MA 1A2OA 1ABFA 1UDRA 4RY9A 3OQNA 4G86A 1U0SY 4PE5B 2OQRA 4XAQA 5EWLB 2JRLA 5B3JC 4RY0A 3OM0A 3C3WA 3MF4A 4JB2A 1FFGA 3IPAA 4LX8A 4EVSA 3QEMB 2O20A 4RK0A 4UHJA 2FSPA 3MQ4A 3QELA 4QICA 2FMKA 4XASA 1YK0A 1NXOA 2WRZA 4PYRA 1GUBA 3TD9A 4DN6A 4YR7A 4YWHA 8ABPA 1FFSA 3FFWA 4QYWA 4Z4GA 3HM9A 3DGEC 3OMWA 1F51E 5IX8A 3CG4A 2PKXA 5BR1A 3G85A 5IEBA 3HS3A 1DC8A 4KNYA 2IDMA 5IEJA 4MR8A 9ABPA 1U04A 2DRIA 5ABPA 1GLGA 4Z4FA 2VK2A 4F12A 2FMHA 4MLDA 4N03A 3CRNA 3S99A 1ZHHA 3KLOA 3EODA 2GWRA 4FB4A 3HK2A 4G0YA 1JFVA 5BRJA 3JVIA 4EYOA 2PLNA 1DC7A 2MSKA 4MRMA 3KCNA 2AYXA 3CZCA 1NXTA 3N0XA 3QLVA 4IMIB 1JDNA 2A9PA 4ZPJA 4WXEA 1D5WA 4E7OA 3ILYA 4Z4IA 2A9OA 4YGXB 2JVIA 3OO0A 2IOYA 4E7PA 4EVRA 3DLBA 4F3TA 3MM4A 1CYEA 1DBWA 1OXBB 1URPA 4NICA 3MMNA 5DGCA 5BRAA 3T6KA 1DG9A 5EWLA 2KYRA 5KI6A 1WETA 1EWVA 1EWTA 3ILHA 2VYCA 4MPTA 2QVCA 1Z17A 3O1IC 4KVFA 2HPHA 3F6CA 1FFWA 1PEAA 5CNKA 3HJFA 3QEMA 3O21A 5DCLA 1QKKA 4MS4A 1DJMA 1LK0A 1DCFA 1E6KA 4Q6WA 3OLXA 4G0QA 1JFSA 3RVMA 1KRXA 1QNLA 4ETIA 4ZJPA 1FQWA 2PUFA 1AB6A 3JS5A 2OENG 3GA5A 2QZJA 3DZDA 3Q15C 3NNNA 2E4XA 4OTZA 3I45A 4MS3B 3HUUA 5TPZD 5CNMA 3A3KA 3H6HA 1YMVA 3SAJA 1CEYA 3KLNA 3CFYA 4Q6BA 4IMJB 1VKRA 3LUCA 3HUTA 4HNRA 3N8IA 3A0UA 4OLBA 3QLTA 4RV5A 3JY6A 1SXIA 3HV2A 3QELB 1EWKA 3LMKA 2ID9A 3Q7RA 4Z0NA 1JL3A 2JB9A 3LKVA 4O1HA 4WUTA 4IGAA 4Y9TA 4XLTA 4RK7A 3QK7A 2IPNA 4G0XA 3RH0A 4QYMA 2FLKA 1U8TA 1JYEA 1NXSA 1U2PA 3N6VA 3NNSA 4EY3A 4RK6A 1RPJA 2LP4Y 3P9YA 4MR8B 3LFTA 2JVKA 3GWGA 3O74A 2QV0A 2JK1A 4JAVC 5EWJA 2FW0A 4IF4A 2MYPA 4FE4A 4MR7B 3BILA 3H1FA 3H5OA 3T38A 1ABEA 5CNJA 3QLUA 1NXPA 4Q7EA 1BVHA 1MAVA 2E4UA 1U2QA 3HSYA 4N0PA 4W5RA 1YS6A 3NHMA 4LDZA 2QU7A 4H60A 4YO7A 2TMYA 2WY2D 4TLLB 1M2FA 5IULC 2XDYA 1M5UA 4KRFA 3OO1A 1D1PA 1AB5A 4G97A 4LDAA 3F73A 1BDIA 2PUEA 3O1JC 2PAFA 4LE1A 1RXIA 4JB0A 4KQCA 5KQLA 4MAAA 1Z16A 3BREA 3O2SB 5C5EA 3Q9SA 4KK4A 5JNTA 4YCSA 1VPWA 4Z99A 4RSMA 2QXYA 1GCAA 4MLCA 2M98A 1L5YA 1RZRD 2A9QA 2WWVD 3RVKA 3L6UA 2PUGA 3SG0A 2GX6A 3LUKA 3TX6A 2JBAB 1NXVA 3M9XA 4MS4B 3VNAA 5FWXA 3G1WA 4OBBA 2PJUA 4RK5A 2NUBA 1TJYA 2JVJA 4H3HB 4JP1A 3ROTA 1CHNA 4EYQA 3EJWA 4DADA 4RXTA 5HM6A 3CU5A 3T8YA 1QQBA 1M2EA 5IC5A 2E4VA 3OM1A 5IUKC 3EGCA 1S8NA 1EHCA 2IKSA 3KTOA 3FFXA 1K66A 3QLVC 4RK4A 6CHYA 2MSLA 5I4CA 1A04A 4MR7A 4RU1A 4GPAA 3GBPA 2FMFA 1GUDA 2MYNA 3GT7A 4CBVA 5HKOA 4KREA 1MB3A 4RXMA 1NXWA 2JCGA 1NTRA 3RVPA 2HQOA 4D6YA 3SY8A 3D8UA 2M1ZA 1LBIA 2ZWMA 4ZMSA 4MYRA 5E3JA 4S05A 4FE7A 4RWEA 1MIHA 3EULA 3RQIA 5JNWA 3HXMA 4RKQA 3E61A 1YMUA 4W5QA 4EUKA 1QP4A 5FBHA 4NQRA 2Q5CA 4RDCA 1Z12A 3KKEA 3NHZA 1ISRA 2YHAA 4WT7A 5KWSA 4S04A 2BGGA 5EWJB 4YRZA 5D2CA 2HQRA 5DKFA 4KZKA 1C0EA 2L19A 4TN5A 5IBQA 3LUGA 4F06A 2RDMA 4RKRA 4NCBA 2FLWA 2VUHB 5JNUA 3L49A 3N75A 2JBAA 3OLYA 3DLHA 1YK1A 2YHBA 3N0RA 1Z25A 4ETMA 3FDFA 6ABPA 3H1GA 3H5WA 4RY8A 4LE0A 1Z13A 3SM9A 5JNRA 2LIVA 5CNIA 1M5TA 4W5OA 1JFTA 3DGFC 3HDVA
chains in the Genus database with same CATH superfamily
3HI6A 3H2KA 4HB4A 3VBCA 3W2GA 5CB0A 2BI7A 4B2YA 2W6NA 4NSNA 4Q9AA 4GRAA 3KBOA 3K0CC 4BV3A 1DQZA 3ORQA 1FJ2A 4KUHA 5ALEA 2I78A 1A4IA 4X62B 221PA 4JLOA 1W0CA 2IH4A 1ZJ6A 2PPVA 4JA0A 5K0FA 2ZE6A 1XCMA 3GLFA 4QAJA 4D42A 2VBFA 1TTQB 2GFHA 2IP4A 2R00C 4WNAA 4BBPA 1R1DA 3EGDB 3FNHA 4C1BA 3VAAA 2G80A 1N9KA 3G0OA 4PX5A 1VJDA 4MWCA 3WNBA 1Y1TA 2C2GA 3CWZA 4C7BA 1RXWA 3M9WA 2QUBA 4P98A 1IY9A 3HRIA 2PKRA 1QRRA 4KRXA 4WXRA 5EVJA 4CQNA 3KQHA 1UMDA 5HF5A 2MT9A 2QSJA 5KWVA 4MR9A 3RVRA 1EVYA 2HRDA 2BM8A 1VLMA 2HJSA 3QA3E 4IGKA 4O2AB 5LQNA 2QE7A 2VR1A 2PWYA 3AHCA 3GUUA 1ELOA 4UJ3A 2YV1A 4WA7A 4ZVRA 5TX7A 1JIUA 5LYYA 2OEPA 3QITA 1GDDA 4WOBA 1L5RA 2DVMA 3TMAA 1YZLA 1L1FA 1WNTA 1HL3A 1P2VA 3RVSA 1NN3A 1QPZA 1KI8A 1Z2PX 3FX2A 4IKPA 4HGNA 4HEHA 3E35A 5KTNA 4F2GA 4XEUA 4EHBA 4KRGA 3CXUA 4KQ1A 4QYXA 2HU2A 1ZGCA 4CKBB 1BDHA 2QROA 4JN6B 1T1SA 3SF8A 5B4UA 4OH7A 3H11A 1BRTA 3AEQA 4LNHA 2P78A 1SXJE 4N7RA 5HG0A 3DO6A 1BHQ1 2VPZA 1BMDA 2ZQ5A 4Z4HA 3AB8A 3C70A 4MHTA 3FGZA 4HGQA 3HL0A 1N8NA 2NO5A 3ECSA 3L9XA 1FRQA 2C84A 4IP0A 4BFXA 4ZCMA 2JEYA 1OC2A 3TKAA 1XDZA 5JARA 4GX0A 5MN5A 1KFJB 4YP9A 4MA4A 1JDBB 5DCUA 1PNVA 2OCKA 4Q1BA 1YRLA 5ALVA 1W1WA 1YHZA 2H4XA 2QLTA 2X6QA 3RVJA 4UNIA 3EGDA 2P6MA 2PMDA 2A6PA 2PY6A 3PUHA 1XEXB 3GCZA 4IIBA 3NVKI 4LXYA 5FUVA 3KDAA 1JF8A 2GAAA 4G3XA 2ZB2A 4H1HA 4U39A 4CIXA 4NJOA 1X94A 2ZSDA 2G9UA 4BQPA 5HOQA 1YZGA 4XX0A 1HDXA 4H15A 4O2AA 3ISVA 1Q0PA 3CWCA 4JIGA 2LIPA 3TXXA 4EYEA 4QHTA 1PFYA 2CMDA 4H4EA 5MDHA 4LXUA 5TPZA 4OHYA 1NFQA 1Q0HA 3FOEC 2PR7A 1CJSA 2BVNA 4BLPA 1USGA 2AVNA 3GUZA 3K0SA 2JS7A 1G19A 5CCBA 1Y3AA 1GG9A 4NENB 3ZBQA 4CT0A 3EUWA 5JD3A 5EJ2A 4NONA 1NZDA 4CKBA 1USKA 1UC5B 1K3UB 1DJLA 4UNNA 1YS1X 3K96A 1ZU5A 3C4JA 1NVFA 4JJEA 5ER9A 2WT4A 3WHKA 3AEYA 3K6RA 1ZSVA 3HB4X 4YT4A 1ZDMA 2Q62A 1KHHA 3EEYA 5FFFA 2CLLB 1XU4A 1FP6A 2C4KA 2WTNA 2JJ2D 2XTJA 4PPYA 5FUYA 5CB8A 2PT5A 2PKWA 4PFSA 2ALJA 2JJ8A 4BS9A 3GGOA 2PVCA 4DRYA 2OESA 4ZGGA 5JNSA 3JYLA 1ZAKA 4IX1A 3AEUB 2GXUA 2IEAA 1X74A 2BGLA 4HXFB 5E8RA 5A71A 1P61B 1N5RA 1I2ZA 2QX9A 4WTOA 1PVVA 1UK9A 2X8JB 4O33A 4U6NA 3WWCA 4DPLA 4CE6A 3G8YA 2P79A 2AEEA 4I9HA 1Q1EA 1OGJA 3TVDA 2XBMA 2BEVB 1NI4B 1SXGA 3KSAC 3L0SA 5KTTA 3KYDB 3PDIB 4D3DA 2H65A 3HWX1 5JYDA 3EH2A 1N8SA 2E3JA 3QX8A 5AI9A 3WIVA 1N2OA 2BR5A 3G3EA 3A6PC 1DEXA 3EFBA 5LCXA 4DQLA 4OHUA 5BWBA 2R86A 3HCAA 1IRXA 4XR9A 4RELA 3U7RA 1JV2B 1MRNA 1Z4NA 2Y1LA 1JDPA 1B15A 2ZRMA 4XOUA 4NENA 1NMQA 2V03A 2CWWA 2P67A 2WJZB 3O8QB 4PNHA 4KDRA 1Z8NA 3ENNA 3QYFA 4JMPA 3H7IA 2P2ZA 3PUJA 4JUCA 4P2BA 4BV9A 2QQFA 3RS4A 2JLCA 5I7RA 4A2QA 1SVLA 2A9KA 6AT1A 3AR6A 2XTZA 5B2FA 1LPOA 1W25A 4UNSA 1PR6A 4RSHA 2E7ZA 3PE3A 3RSOA 3GGSA 4NAVA 1QHYA 1F4VA 1ODKA 1Z8FA 2F43B 4R8VA 3ZTTA 4C0BA 4F5YA 5JH7F 3M3HA 1GDTA 4J16A 2AXQA 1MJHA 4PANA 2WINI 1LBHA 4J9VA 4K1LA 2BZSA 1O6ZA 3D4NA 4RIHA 4OXNA 5HKKA 3DONA 3MJCA 3O95A 3VR2D 3ZX5A 5FTLA 4TKUA 4WXHA 1WPXA 5FBVB 3D5QA 1M0EA 1CUWA 3C8ZA 2HIGA 4OCZA 4RKYA 5ALNA 4B3IA 1N2XA 4JBNA 2BEVA 4OD0A 4R16A 2OGZA 1A27A 2J5KA 4OP2A 3ZDZB 4LF4B 5LB4A 4LRQA 2VIIA 1Z6ZA 4WFIA 1OLOA 3NBAA 1M1XB 1Z0AA 2JIBA 4NHEA 4P84A 2JLRA 4PYIA 4M53A 4C4SA 1NSFA 2E1PA 4HVLA 2W7TA 5CBKA 3PQ7A 2H6EA 3WI7A 2J4FA 1QZTA 1XQXA 1TT5B 1GKIA 4P92A 4RVGA 4OU5A 5CGZA 3L1KA 4JLAA 4GKJB 1NC3A 3NBKA 1D2NA 4PYNA 1X1TA 2WQZA 1CS0A 3LY5A 3N7UA 4BNFA 1C7QA 1Z56C 1XK6A 1DKOA 2XA1A 4DL9A 3PX3A 1ADJA 2O52A 3QMPA 4KIJA 5JXWA 5EP4A 3WE7A 3JYOA 4KFSA 5ED0A 3T5PA 4U8HA 5AQEA 1DJQA 2QDKA 3HNRA 2C8KA 2GUGA 4FMDB 3RC9A 5HHTA 3H04A 2ADOA 2OHHA 4MJ3A 3HVIA 3U9TA 3KZNA 1K4KA 1Q50A 1ZN8A 3AYZB 2PLRA 2F43A 5AVOA 4YXWA 2NLOA 3DHWC 3Q7QA 4HWRA 2AFVA 2WR8A 1TKAA 4HAOA 2QN1A 1YFZA 2OD2A 5EKUA 3BGIA 4UCWA 1J25A 4ERNA 3G0GA 4D8XA 3U3OA 3IUJA 3EXHC 3QELA 3RU9A 1GPUA 3ZG6A 1MOQA 1W5BA 2G72A 4L5YA 1BEZA 2GOYA 5BSVA 3DDZX 3IHWA 1C0PA 4PRZA 3GLFE 4XPIA 3B8EA 1XZIA 4GGPA 4DN6A 2BI4A 1GZ4A 3H5RA 3NBYC 3ZWPA 4LFBB 2DAPA 3ZY6A 1PI3A 1U6IA 1WU7A 1YQUA 2CUZA 3RAJA 4ALMA 1R0SA 4FN4A 5HJEA 3G85A 1VJGA 4R1MA 2HUPA 2IYFA 5FA6A 2EHJA 3ILVA 3QW4B 3BEOA 4O4IB 5JDIA 2WWXA 3A6KA 4TYNA 5LSAA 5JFTA 3ZGOA 3NCTA 3PV0A 1KY5A 3CN9A 4GVLA 5AP9A 3KWLA 5I5GA 3WL5A 1PKEA 2H00A 3I9NA 1P39A 2P65A 4Y9UA 5T8KC 5KZMB 2B4QA 3W2IA 4YAFA 3SQLA 1Z63A 3EVFA 4RJJA 4G5OA 2DFNA 4ROSA 3K7EA 4H1VA 1T3LA 1DC7A 2MSKA 2OBMA 2Q5HA 2YW2A 3BFJA 1W0JD 4FZRA 1QZZA 4MUHA 2HAEA 4ZAVA 3ZV5A 1A9XA 3QPAA 2WHPA 2FOXA 4RABA 2H3EA 3O8OB 2CY0A 1Y8RB 4HDCA 1WDMA 1TF7A 2YUTA 4ARAA 3ZD7A 3C43A 4LQCA 4V0SA 4PONA 4JVLA 2GDZA 1R4AA 3HMKA 2IX3A 1BKSB 1J0AA 3VAYA 4F3TA 1KDTA 4KI0A 4DWOA 3NEAA 2DWPA 1AKVA 3C14C 4JC5A 1Y1QA 1QYCA 2X1HA 4C76A 3H8JA 1Z17A 3WRXC 5JI2E 1N92A 1G3MA 1GITA 3F6CA 1PJQA 1VQ1A 5JNLA 1RHKA 2VAWA 4EECA 2YHIB 3F47A 3QVTA 3AY0A 5HIIA 3NJ8A 2VDKB 3OWOA 2CMHA 5BUSA 5DHUA 1WBDA 1DOAA 5KTYA 3PC4A 2CL7X 2YL2A 4ZU3A 2B21A 4TSRA 1BWQA 4PTZA 4A82A 2YASA 5JZ9A 1DEOA 4RNCA 3R0QA 4I9FA 1N5JA 3C3YA 3LKDA 1FTYA 2BHSA 5BNWA 4BNHA 4QDOA 1XFAA 3USZA 1CJKC 2BR4A 2G28A 1Z7GA 4HATA 4M9SA 5GP1A 5EJ9A 1NVXQ 2G09A 4EHKA 4CRWB 3LUCA 2R7LA 2GCOA 3O94A 2GPNA 4HZUA 4TKMA 3A0UA 4BYGA 2XRZA 4OLBA 5F2NA 4TV8A 1E3IA 2B20A 2HK7A 3NQ41 2QE6A 3RYFB 2V7QD 1GAJA 2XWQA 1JR3A 1OFIA 4TWZA 3SZOA 3WK9A 4CQMA 4YP0A 1YZ3A 2JATA 3WOVA 3AT1A 2P2GA 3P71T 4RVFA 1E3JA 2EGUA 1ZN9A 4XWOA 1JG7A 4K9QA 3SKYA 2IELA 5BVHB 3PTAA 1U3DA 5J2TF 3WGKA 4CM4B 4DVGA 2ZB4A 3JWEA 2ZVDA 4G0XA 4FM9A 5JPCA 2VHVA 2FLKA 2LKDA 4G4GA 4HB0A 1GTRA 2JG3A 3Q98A 1AQIA 4HP8A 1MJ5A 5G0TA 3KZ1E 2AT1A 4YJHB 2OUKA 2G77B 3SI7A 4H7KA 1DE0A 2ZS9A 3KZMA 2ACWA 2ZI5A 3EEFA 4A36A 2KSQA 2AZDA 4PCUA 1O4WA 1ZLYA 3PGMA 4HDKA 2HA4A 4OKIA 1NXPA 3F9CA 4HDRB 4X24A 1BD3A 3IQHX 4GPD1 1OWMA 3WISA 1JJ7A 1TZCA 3V9AA 2O54A 1KZYC 1RYNA 4LZOA 3WLFA 1BKYA 1K7FB 1YZVA 4LV5B 3O1JC 4DR5B 4MGKR 2RFLA 4JB0A 3LLCA 4KQCA 4N8SA 4W8HA 5EMKA 5J5VA 4BO0A 4G5FA 5KTOA 1E5TA 2HMTA 1JQEA 1Z16A 1HQKA 5IP5A 3PEYA 1DBIA 2CFOA 3N0TA 5HQTA 2GJSA 5EE0A 4G0VA 3IS3A 2VP9A 4X41A 3F6SA 4JT9A 5FTKA 4IHQA 1WP4A 3CLUD 3RUEA 2ZBQA 2F1OA 2ENWA 1H4VB 4U7DA 4P7JA 5LZ4A 2FSVA 3RU2A 4R8MA 2F48A 3PXUA 2PX6A 3L8ZA 2GX6A 4TMZA 5HQ3A 3T0FA 1MDBA 4RK5A 4EDHA 1ZJZA 2BKXA 3HR7A 4JQSA 4D9IA 1GRCA 3H7AA 3H9UA 2CLCX 3GLTA 3PFHA 2G3YA 4NJMB 5LBIA 2O8BB 2WM2A 3EK2A 1VHQA 4V0MA 1KPHA 3PB3A 5FI5A 2R5NA 1G2QA 1I3OA 3QVOA 1G21B 2DKOA 2QTTA 4IJUA 4CLEA 3UAOA 2P77A 4BZPA 1DX6A 4JVMA 5I7HA 3QF4B 1YR7A 2ZTLA 4CDNA 1S8NA 4YJHA 4EGCB 1JGTA 1L7MA 1Q22A 4B3DA 1IB0A 2J5RA 2JHAA 3GEDA 3IAXA 4D81A 4ZZ0A 2MYNA 4L0MA 4IDGA 1A8UA 3IBFA 2JKVA 2GMWA 3DFZA 3FUWA 2APJA 2QPAA 3IERA 2OHJA 4OHVA 2HQOA 5WRFA 4CMHA 3IUEA 2Q8QA 3L7KA 4GVXA 4E5MA 4OM8A 4NMHA 4I3GA 3AWDA 4DMKA 1VBFA 3JR3A 4N6NA 4G2TA 3R3HA 1P77A 5ITSA 1MIHA 1VG0B 2P9EA 2GT1A 4AKGA 2RBGA 4DSAA 1HYBA 4UAGA 1WZUA 3DV9A 1GOTA 1JXMA 3L1JA 2QW8A 1L3BA 3HKEB 3QYJA 1J33A 5KQSA 4LRTB 1L9KA 1BW9B 2H1LA 2YICA 1GNRA 1ZXXA 2NVBA 3NWEA 3DHYA 4Q03A 3QKSB 4QL3A 4CM8B 3TRKA 3WGVA 4DGQA 4EI7A 2Y6UA 3KPWA 1IM2A 4UAJA 4KZKA 4BVHA 1DNPA 5BSTA 2RONA 3O4IA 1JALA 3VZRA 3ZWBA 3A6JA 4HXYA 4UFNA 1AM4D 4BRWA 2GPAA 4LBZA 5JNUA 5EUCA 1CLEA 2RBKA 4HR7A 1UBOS 3OA2A 3OP4A 1R9NA 3VHXA 4TMXA 4P0TA 2X3UA 2FR8A 1K86A 3IDSA 3ORHA 3FW1A 5I6DA 3HGTA 2Z6UA 1QDLB 2O3JA 2XIQA 3BDVA 1RC1A 1DELA 3AU8A 3N8DA 5BMVB 1GUFA 2HDWA 3DMYA 1COZA 2GPJA 4ISCA 2J30A 4DPMA 4GD3Q 3E9QA 1AN0A 4IKEA 1FBNA 2PM8A 2QSUA 1JTFA 3DGFC 3K2IA 4PXAA 3W6UA 4CIVA 2H17A 3PJGA 2VT2A 4BOYA 4E6EA 2IUEA 5HW0A 3F1LA 4B7ZA 1QV9A 1YB2A 2P5SA 3MJFA 4BU1A 4DCSA 2ZIZA 4E1VA 2VXBA 3AXTA 3OCXA 3HADA 1GLVA 2B7LA 1H6AA 3PGLA 1KRWA 2ZQYA 4KPUB 3H2ZA 3D7MA 2ZBRA 1AQUA 4PLYA 2G9RA 2FEAA 3E5NA 4L1KA 5HFJA 2YQ4A 2JGKA 3HUDA 2NYRA 2CCGA 3MK31 4IQFA 1SPBS 3RCBA 3E58A 1F2TA 4MKGA 2EZ9A 2ID7A 3LRPA 3MS4A 1FVFA 3QLUC 5AICA 1XDGA 1INLA 4JEUA 2QI9F 1XEFA 2DT8A 1NZFA 4U2BA 4UBKA 1T0HB 5TY0A 3GCDA 1CSEE 5FOSA 1ZUD1 1GQRA 2WU0A 4NBRA 4M46A 2QQ5A 3FTCA 3FYUA 3TE7A 2PGNA 4WXMA 5ICMA 1I80A 2VEOA 2Z1DA 4CM8A 1SOVA 4MRRA 5JCPA 1W0KA 4BBAA 3MFYA 2JFFA 4CLDA 1VKNA 1CR1A 3CM0A 1H0KA 3RWOA 4RTMA 3WL7A 2HO5A 4LE2A 1KAMA 2B6HA 2ZJ3A 4JA2A 2B92A 3WBJA 4C5BA 1CR0A 2FPKA 5K7SA 4PO8A 3D6JA 3T9DA 4H1WA 1UCFA 1GILA 4M0UA 5DNCA 3S2YA 2QIOA 2VJMA 4RVDA 4HN9A 3ND6A 1P6QA 1P3DA 4KQEA 2OMEA 1SBHA 3HKDA 1QXSA 3HHEA 2J59A 1IZYA 2ZR7A 4ZYUA 3Q5GA 1E2IA 4K81B 2HIMA 1WA5A 2DMRA 3MWDB 5FWNA 1Q7GA 1AF4A 1S8FA 5JS8A 2R6DA 4IOLA 3H75A 5EP1A 3OKCA 4XB6B 3DDOA 5T4FA 1GD1O 4PTLA 5LXTA 3IEIA 3IUPA 1K6XA 3B85A 3QBJA 4UU8A 4ONEA 3V1TC 4IFTA 2XW6A 2YC4C 5CA1F 1GKYA 2WG2A 1BYIA 1F12A 2WV9A 3LPMA 1RRMA 2ZATA 4NMXB 5BOVA 1J20A 1DIOB 1I9GA 2ZBFA 4G5YA 5FPYA 3WJ1A 4A23A 3TTSA 1GWNA 4CF4A 2ZYHA 5IVIA 1B2RA 4F3YA 3I2HA 1MX1A 1X7DA 2JIZD 1FYDA 2XGMA 4Y3UA 2PQMA 1ZW1A 2XUQA 1BROA 3A26A 3A6HA 3NIWA 4QKQA 1T0BA 3EDYA 3OEWA 3L1IA 1W73A 2QDXA 2X2PA 3M8KA 4MWSA 4RK1A 2EX0A 3CVXA 1L1EA 2I3GA 4LYEA 5FR2A 1JX6A 5E9JA 4BAGA 5EJEA 5JMWA 4DR3B 3TZKA 4CKCB 1PF7E 1Z2DA 2YWHA 1L6RA 4EHIA 3AF3A 4FR0A 2B0JA 4Z86A 3Q1KA 4OL0A 5C3MA 3JU3A 4YRAA 1HMPA 3FHOA 1F2UB 3MUNA 4QOJA 3A28A 4FS8A 4B17A 1I3LA 4G0ZA 5CLLA 1HKUA 1LJ8A 2NZ2A 2ZPAA 3KKMA 3Q11A 2JIQA 5I7VA 1VCHA 5DV9A 1J24A 1DCKA 2PRZA 3DV0A 5D87A 1LSJA 5BSRA 4MXDA 1R66A 3FPLA 5JYCA 1AKRA 1O95A 3G0DA 2RKBA 3CRW1 1H6CA 4ND3A 2YZMA 2V45A 4HLQB 2C2YA 3P0FA 3B38A 1FU8A 1EX7A 1T26A 2FEPA 2D3TA 2J3IA 2J9XB 3PZRA 4YJ2F 1DU4A 1LBTA 1NTOA 4Y6SA 2D2FA 5LB2A 1BGWA 1G3RA 3G8AA 3JALB 3ZVMA 3K0HA 1DBRA 2FQYA 3FTEA 4JI0B 3X2FA 4DYDA 1FW6A 1OOEA 3WRWA 1S1MA 1YKFA 1BJKA 1FSGA 5JCJD 3I6IA 3ND9A 1DSSG 3BFXA 4R2IA 2V9ZA 3HCFA 3SC2B 3TLXA 4KQKA 5AW6A 2A33A 1GQFA 1KBQA 5K3BA 3F2IA 4R83A 1YDHA 2FRXA 2HA6A 4DMFA 2OD9A 1RRPA 1L7EA 3MMXA 3KSRA 4UQOA 2NU8B 1YGYA 1J1IA 4M9QA 4AM8A 3N1UA 3R6WA 4N82A 3ZJTA 1I5OA 5ES3A 2VRCD 4M8IA 1S7CA 1ZGJA 2H5LA 5HKAA 1IN7A 2JRCA 3QX7A 1ZVVA 1NAHA 2V7TA 1AGYA 1AURA 4YMWA 5JU6A 3HO6A 1EBFA 2XOKA 4UUQA 4XWGA 3RC8A 2PL9A 4PAWA 1W47A 4TKLA 2ZRJA 2I1QA 3S5UA 1TIPA 3RAEC 5EEHA 4KCGA 1JDSA 2PD6A 1F2UA 3OJXA 1Y1LA 2G9ZA 3E84A 3T5AA 5L6LB 1YO6A 5ALQA 1KJIA 1RAFA 4BE7B 4Q1FA 4P81A 4TXMA 1CC1S 3P2YA 1QZ3A 2VH2A 3LP6A 3Q40A 3S81A 3F6BX 3HFSA 1B4DA 2ZIWB 3GN2A 4HYEA 4KQIA 5K4AA 3WK7A 4LC1A 1G8KA 2AV6A 2FN3A 3QFSA 1VCIA 4HDAA 5G3ZA 4UJ5A 5HMLA 4EZBA 1N6LA 2FSFA 2NVWA 5TQ2B 3QX3A 2NW6A 2XDAA 3HWSA 3ME5A 1R2QA 3K8YA 3AZPA 3L0DA 4Q01A 1ECJA 1G63A 5IC4A 1MT0A 1IBKB 4FSDA 4ML3A 3D59A 5D3ZA 5ALFA 4BVLA 4F7WA 4Q1CA 3HB1A 4I4NA 2Q5IA 3ZW9A 4OSPA 3EPJA 3AHGA 4OFWA 1JIXA 2C9YA 1R10A 4NNOA 3P4XA 4X8LA 4F3CA 3R74A 2QMOA 2XD9A 4BJ6A 4DLZA 2PA3A 2WJJA 3NKFA 4KR3A 2FEWB 2GAFA 2IY7A 3CVJA 1P81A 3ABOB 3PWZA 1Y1PA 3UO8B 3R76A 1Z37A 2WJHA 1QG4A 3ZN2A 4CF3A 4O4HF 4R8SA 2NU8A 1KMNA 1J0EA 2JFOA 3VRHA 1VZ2A 3LP8A 3W3AH 3RSZA 2Z8YA 3MQFA 3LW8A 2OUIA 3PWKA 5I7UA 1VFPA 4WNIA 1SXQA 3DDSA 1OREA 2Q1XA 1XEAA 2GTPA 2GCGA 5KJEA 1I14A 1O0SA 2IDZA 5ALHA 3UKJA 1L7BA 4LOIA 4X8MA 4U7HA 1P29A 4JLSA 2PD4A 1NDQA 2AK3A 3DEJA 1QUFA 4QGGA 3RRMA 2PS1A 3AVOA 3HHPA 4Y8VA 4D44A 3NKLA 3Q6IA 1E2BA 2VF2A 1LLUA 4I50F 2OV6A 4EA7A 2JLXA 3OTHA 3ZXXA 1R8QA 1SKUA 1CUJA 2RHGB 3E0QA 4O4JA 4QBIA 2VYNA 3WGHA 3A36A 4BP3A 3I53A 2A67A 2OKGA 1NF3A 1TD1A 4PX3A 3IMEA 3A3YA 3KJEA 1D7OA 1T9AA 1I0LA 3K9CA 4QSMA 4RE6A 3LV8A 1FFYA 5ETJA 4FHDA 4F2HA 2Y93A 1ITZA 2HCTA 5TQ2A 1KAHA 1PX2A 4NZPA 4MYSA 1WNFA 2W83A 3JQEA 4MKIA 3HRHA 2O3SA 1YE8A 2PR2A 3HCDA 1G5QA 2C54A 3JAWB 2IIPA 4B3FX 3ZHZA 4RZHA 4CG0A 1D2MA 2HIAA 1XTTA 1UPBA 3G88A 4F96A 1NKVA 2NO1A 3O83A 1SG0A 2P3SA 5SY9A 1TQ6A 4D9KA 5B3JC 5KO2A 3PU6A 4BPRA 4WW0A 5IANA 1P60A 4DLNA 1UDAA 3J81k 4Q3NA 3P9RA 4EARA 1UDWA 2VK8A 3PSHA 1ZVQA 1ZGAA 2QUZA 5C7IO 3VR5A 3FCSB 1GCOA 1R37A 1FDSA 3K1AA 5AI4A 3M4XA 5AK5A 2BCJQ 3V4PB 4CZ2A 4PYRA 1RQLA 3T34A 4ESHA 5D7NA 1N0UA 5BSEA 2TMGA 1FFSA 1Y7IA 3PR1A 1GTZA 1RXCA 3A2LA 4QUAA 1LX7A 1NRIA 1BCSA 2PGJA 4X66B 4BLRA 3C6MA 4XJSA 4JXXA 3F7MA 3SBDA 3GEPA 3HTXA 3PF8A 1QPGA 1SBIA 3NTXA 1B8PA 3IMGA 4U7JA 4ZZIA 3TLEA 5IVPA 4ABTA 3QOYA 4GPEA 3RQSA 2VHCA 2QY6A 2VWHA 4AUKA 4OQZA 1UM9B 2O2IA 2XX3A 2ZDQA 3BTVA 1GNPA 4R54A 5IYZB 1M54A 3ZHQA 4IZOA 5I9TA 4MUBA 1C50A 4ENVA 4UU1A 1ZRMA 4MVJI 3WIDA 3BMQA 3PC3A 3ZHTA 2PL5A 3EDMA 4PSCA 4OIMA 1QIIA 1YI8A 1JDZA 3FMOB 3ZZMA 1RW4A 1AXEA 2REXB 3D7LA 3TQTA 3CRVA 1E7WA 5JD4A 5DH9A 5CH8A 1A82A 1OWOA 4NFSA 2EDAA 3AFIA 2B4RO 4D9HA 2ZSKA 1H8HA 4HN4B 2ZSUA 2ZZKA 4IUDS 4CLOB 3EBPA 5K3OA 3OEED 4BXOB 4MCJA 3MMNA 3L5KA 1BEUB 4WCVA 3DHNA 3ROEA 3AHIA 1S4QA 3IHTA 3OQIB 5EZYB 3F7OA 4ZT7A 1GFSA 4ZQFA 2JW5A 1NV8A 4AKEA 3TM5A 3UFXB 2N42A 2X40A 2N0SA 1RBMA 2BMEA 2G40A 4AY3A 1ZWLA 4IIFA 3U7HB 1E1RA 4EA8A 3OLXA 1KRXA 4MW7A 4N3GA 2WUFA 1KFEB 5JEDA 1U8ZA 1VIVA 4JI3B 2CVOA 3GCGA 2Q07A 1B3BA 1ECPA 1Q0UA 1RWXA 1Y63A 3ML1A 3IO5A 3NTVA 2YVQA 1P19A 4OTZA 3VR5H 3D3JA 2IHYA 5K3AA 3GJYA 5FEUA 3AHJA 1Y8QA 3INTA 4JUFA 4BNKA 2YQ5A 5BW4A 3QKIA 2Y4OA 3W5SA 1TIKA 4BGDA 4OJMX 5EPOA 3CLSC 3HA7A 5DK6A 1WZNA 3OTWA 4LHYA 4AXBA 1RE1A 5AJVB 2DQKA 3TLAA 1EFKA 1TO2E 2IHVA 1GEGA 4QVGA 2P9JA 3ANNA 2UYHA 4AMGA 2MMGA 4RV5A 4MDHA 1FMCA 2O8DB 4FZ5A 2V7VA 2PUWA 1C7JA 1WW8A 2DKFA 3NUQA 2JHGA 1LI4A 1MTZA 1O6FA 4FNMA 5LZ2A 1WMEA 2H06A 4DLBA 1KOGA 5I4BA 3K0CA 4O2LA 4K9DA 3WGLA 1OCEA 3CURA 3GPLA 1UJNA 4LJ7A 4B84A 5L8VA 2Q4OA 1IHDA 4FFWA 2PWBA 4XRRA 4EI2A 3AVVA 1B0UA 1Z5NA 3UJCA 2R2GA 3HP7A 4I1RA 5AM1A 4IDFA 4XCVA 4MR8B 2R00A 4BBJA 2FPWA 3UJ3X 1IHYA 3VH4A 2JIPA 4RNDB 3LBFA 1PK8A 3V1NA 3QU7A 2MSDB 2IHBA 2TYSB 4LXHA 4TRMA 5CNJA 4G81A 3CC8A 3U56A 1MO6A 1SCUB 2OHFA 3NHMA 4S3MA 1BHJA 1DT5A 2EKQA 5DTIA 2FUEA 2BEJA 2VO1A 1KI7A 2WJIA 4BKPA 1CF2O 3M7IA 4HD8A 4IAOA 3VYRB 4MMYB 1W36B 2AN1A 5JVDB 3NW9A 1DAGA 3DAFA 3BIFA 4M0DA 4B31A 1F9EA 2GPBA 3D5TA 2QD2A 5KQLA 5LQJA 3IIIA 5D3MA 4BQIA 2G5PA 2V6JA 1WABA 3KFVA 3T5CA 3M1IA 3LRTA 3MOSA 3I64A 1EXWA 1ZQ9A 1DO2A 3GPDG 4WPGA 2OO5C 4ZV7A 3Q12A 1XDWA 4QVIA 3RVKA 5KYNA 1DXYA 4D80A 4DLVA 4TWRA 4V3CA 1X77A 4Q1VA 4AICA 1ULSA 4K2HA 1UBGA 5B1HA 1NJFA 1K6MA 3PQ5A 2PSDA 3VPGA 4IJ6A 4RDXA 1I7SB 1KH1A 1TJYA 1ESEA 2P5UA 2J3KA 1SB9A 3E5RA 5ALIA 3S7ZA 2WM9B 3T3IA 3CEMA 5FNVA 4CR7A 1J22A 4X3PA 2JIMA 1CUYA 1KK1A 3FPHA 1U0FA 2AW5A 2ZWVA 4OK6A 3QVGB 1SKYB 1RI1A 2JHFA 3HWWA 2YKGA 3AKEA 1HQYE 4FFMA 2GN8A 3D6FA 4HTFB 3FFXA 5FHQA 1IB6A 4QOHA 4PWYA 1HT0A 4LDNA 2XVXA 4PCVA 4QXRA 4KMOA 1JMYA 4L8VA 1SMKA 4ZEOA 3OE7A 3FWKA 4JBWA 4RM2A 4JFAA 5CVCA 3TIXB 1SCUA 3VR3D 4J2OA 1GT91 3C2QA 4D6YA 5TNXA 4F6RB 2QT0A 3ACBA 1X7HA 4URXR 5LL6P 3PCTA 3B9BA 1AQJA 3T7EA 2B7BA 3B89A 3WRYC 4JI4B 4Z7NB 1RFLA 5DPMA 4C4OA 1R74A 1TM3E 2CJXA 4G5GA 4J94A 2JLSA 4IR7A 1NMSA 5D5PA 3C48A 2MJLA 4I1YA 1EJ2A 3HXTA 3O3MB 2ZU0C 5HE9A 3WMXA 1S8AA 3GJ7A 1G1AA 4RC9A 1U3UA 1G2IA 1H2FA 1V8ZA 3LWZA 3P9PA 4Y1FA 1GSAA 3JYHA 1QE5A 4IIEA 3ZOKA 2X2FA 1T6BY 4IIJA 4KYTA 3ZTWA 1EVJA 1HE3A 4FDAA 1UODA 3UMJA 4UEKA 1SGWA 1V4NA 2FRVA 2JEOA 3BULA 3PQEA 5FBLB 5IBQA 1JQ3A 5LDHA 3F97A 4LJ9A 4XCQA 4ZI7B 5FPTA 3UKOA 3B52X 3DLHA 3IBSA 1YK1A 1BXZA 1JPVA 4LY9A 5IKXA 2A1TR 2GFQA 3GP3A 2M32A 3K9NA 2XF2A 3KRTA 3M6LA 4JI1B 5BN5A 2P3OA 1RHQA 2N46A 4C21A 4AY6A 1SG6A 1KSHA 3FZYA 4KWEA 1Z13A 3SM9A 2J0VA 1ECFA 2QWXA 2GM4A 1PYOA 3D7KA 1PQUA 3M3DA 1SIWA 3MFQA 1PFGA 2FFAA 2EZ8A 4HTFA 4RBNA 2BE7A 4Z4CA 2I9PA 4HZGA 3B5IA 1JHZA 4QGAA 4ZHQB 1UFRA 3VPAA 2W43A 3G5AA 2YV4A 2HF9A 1BS1A 4Q05A 4CU2A 2VTDA 3HC7A 1M72A 1RZVA 2C4MA 3BXPA 3VZPA 4ZICA 5EJFA 4F6RA 5JSKA 1HEYA 1TAUA 3W4JA 1MJGM 5AW4A 4EJSB 4HDNB 2OZLB 4KMSA 5EUQB 2YCBA 4V03A 1XLTC 3CTPA 2RG7A 4NCHA 2KM1A 5HZGA 3AX6A 4NEHB 3I1YA 3QY0A 3I12A 2VP3A 3NRCA 1FYWA 3U1VA 2RE8A 1M0TA 2JGAA 2WDZA 3EZ2A 3V8EA 2AHOA 2DHEA 1C2TA 4NJEB 1GTL1 3UEOA 3X1JA 1QF7A 2IVFA 2O06A 5DXFA 2DFVA 2XXAA 3BMNB 1ZGGA 2CLIB 5GPBA 2EWVA 4NCIA 2AL7A 3W6NA 3P9SA 4Y6RA 1IPFA 4RTNA 3JSAA 3UB4A 3MBIA 1LV7A 3HUEA 3VOTA 1SD5A 5KCZA 3X1DA 4Z3DA 4QTXA 5ALLA 3T5MA 1XAIA 1C41A 4LY0A 4UD6A 1SBYA 4PR3A 5JWRA 2XAAA 1HZJA 2HKIA 4W8OA 1WM1A 4CHGA 4GPTA 1GPMA 2Y0EA 4IRXA 3B9QA 1FDIA 4FUTA 4KO1S 2CXUA 2OCGA 1M9NA 5JWHA 1IZ0A 2JBHA 4L5CA 2GD2A 3UGKA 3LBYA 2C2HA 3CKLA 3C5VA 1GPAA 2YFHA 3EQ9A 1PFQA 5BR7A 3EXHB 4FKMA 2QMHA 4UTNA 3EXIA 1MB2A 1OWPA 1ZNWA 2NSDA 3WK8A 4XIGS 5FR1A 1U7DA 1G8JA 3F78A 2WUGA 3IDZA 1V3QE 3KT3A 4OUDB 4PAMA 1P5ZB 4JOSA 4GZ3A 4WLOA 5CDSA 1Q12A 2JCBA 1E58A 4RGVA 3UMVA 4FGUA 4A1OA 4TQUS 4KV9A 4QXQA 3JZMA 1Z15A 2OZLA 2PX5A 4BV8A 1NUHA 1NW3A 3GAFA 5BQ5A 4NXNB 1Y48E 2I8LA 1N8TA 4WBXC 3ERCA 2GBGA 4G9BA 1PJAA 2NTEA 2GN1A 4FOLA 2I2DA 1XRQA 4MQLA 1G5FA 2WPDA 5MFPA 4R51A 4J91A 1A7JA 3MTEA 4UVGA 5HSGA 4MV9A 4FP9A 4D6XA 3OQMA 3QWFA 4R3WA 2J5XA 3H0KA 2POQX 4NYIQ 2C2KA 2HSJA 5IU6A 6ADHA 1RQ2A 1X7ZA 4WWHA 3VBEA 2CYCA 5BOSB 1UBKS 2I22A 2I2AA 1HORA 2JLAA 5TE9A 3ITDA 3IEPA 3FVWA 5EUMA 3U2QA 4RZSA 1Y8CA 4I81A 2MYTA 2WU3A 5HCIA 4Q3LA 2DWOA 3V9PA 5AI8A 1KGDA 2QRNA 5HGJA 2Q3HA 3H3XA 3OFKA 1ZRHA 3BTSA 3GVCA 1UK6A 1W5TA 2Z6VA 2PUBA 4AKHA 4JI5B 2V7GA 1ISIA 1ZXBA 2WMNB 4B85A 5JAUA 3PQ6A 3EXHA 4HDQB 3WYCA 2C61A 5KVCA 1WSWA 2ZRQA 4FILA 4C1NA 4KVAA 4RH3A 1XQVA 1T2VA 1CQIA 4CDMA 3D6MA 4J90A 2Q1TA 2GERA 4MYTA 3O92A 2FNAA 2PX2A 3X1XA 1CQJA 3GRPA 2P5YA 4L15A 4B4OA 2OG2A 4DNFA 2FSIA 3PP8A 1WR8A 2JFWA 4KDCA 1MORA 2G1JA 4LBWA 1TYCA 3JD4A 2RGYA 2JGRA 1GGHA 3H1PA 5T8KA 1P4HA 1L4GA 2HU8A 3HH8A 3KFLA 1MIOA 2AKYA 2GEKA 3GJ6A 3RSGA 4DCCA 1ORTA 1ZH0A 2Y66A 1UFKA 1QDUA 2H2GA 4X7PA 2GBFA 3T5TA 2P0AA 3ONFA 4MULA 4AJKA 4E31A 4MV5A 4G25A 4GYKA 1L5GB 3VU8A 4WBNF 4Q1EA 2VXCA 3GFVA 2VRWA 4H7JA 4OQLA 4W82A 2ZB8A 1RLMA 3ER6A 4L8FA 4EVQA 2ZDHA 1QR2A 1YZUA 5ILQA 4Z7JA 2W70A 3ESDA 3CKKA 3ESQA 3UXMA 4RGBA 2IH2A 5AJZA 4EI9A 2H2DA 4EG3A 4D4GA 4QT4A 4PZZA 2REOA 2COEA 5IJAA 2P41A 2XMPA 4QIHA 1E66A 1KC3A 4C5AA 3ZZUA 1RZRA 2WHQA 1J00A 2PAAA 4LSGA 1RMYA 1GU1A 3A1DA 2ECKA 3H8WA 3DPSA 2V6BA 4QO8A 1XKXA 1L4EA 3WRXA 5GJBA 4XIJA 2CHEA 4A8TA 1KEWA 3T5GA 5L7WA 2XAUA 3WXBA 1YRYE 3A4LA 1M75A 4Z8YA 5IVDA 2O2EA 4AG6A 1SBZA 4S12A 3VR4A 4LA4A 3KQUA 1XZEA 5KQRA 1IUNA 1XPRA 1MABB 3MUEA 3TLJA 3VSEA 1FYEA 3A11A 4JGGA 4B8WA 1NN1A 3JPYA 2HNAA 2B1JA 4LFCB 5EJ4A 3Q7EA 3O2QB 3HL4A 2QX7A 1VHLA 4B6QA 3BHNA 4MHSA 4RV4A 5DEIA 4V0OA 3BM5A 1FK8A 4QX6A 1U0EA 4BTEA 4JD5A 2O7VA 1ZOOA 3DMPA 3CIFA 3VI4B 4LQLA 1QHSA 4WDQA 3IAAA 2QTVA 4GGMX 1KZHA 1A5ZA 4ARCA 3EZ7A 3M82A 4IDOA 4IZHA 1ZOLA 4EATA 1XFDA 3F6PA 4LHWA 2I6QA 4KTVE 2EBHX 4F4FA 1C9NA 3ZV6A 5IAJA 5KNCA 4BNVA 1BJTA 3UBMA 1PFWA 3OM9A 1OI4A 1EK6A 2HA2A 5HUJA 2JH8A 4JUAA 3DLCA 1XD2B 3D02A 3KYIB 3MWGA 1JR6A 1IXSB 2WSBA 3CTMA 4L5BA 1WMDA 2QVGA 4UUMA 4F45A 1VKOA 2OCLA 5AJYA 4G1MB 4PLWA 3IKVA 1N2ZA 2CXSA 4TT3D 3C8HA 4JUDX 3UUFA 3ZLTA 4C4ZA 1TNDA 3RUHA 3FOAA 5AW3A 2XUJA 2IUUA 1J4AA 1FQKA 3IV7A 3DEZA 3T7AA 2JCXA 4Q1AA 2XEXA 5CFPA 2ORWA 4MI9A 4A4DA 4MVCA 4LI0A 2BM1A 4F4IA 2X1MA 1P7ZA 4IS2A 4ZCQA 1X0XA 1ZL2A 2P0EA 4R1SA 3ND5A 3ZGXA 5ILOA 5TMEA 3A3PA 3OJFA 5K0TA 1AZLA 4H7DA 1SKYE 4NE9A 3IE0A 4RY9A 3RK1A 1JSRA 5A5EA 1NF2A 2BEWB 5K20A 3P9IA 1VYUA 1MABA 4MPRA 2ZRFA 2I2FA 1BH6A 2EV9A 2JFPA 3EVGA 3QMVA 5JDCC 5IDXA 5CCXA 4EWLA 2IXEA 4BX9A 4EHNA 2GJAA 2V6GA 2X42A 3VR4H 5TR9A 2ZPTX 1VI6A 1DXHA 2GS9A 3KB6A 2YJ5A 3DG9A 1LDGA 2ZI9A 5YASA 2OFPA 4YAEA 1MMFB 1RCTE 3LE8A 2VQSA 4C2UA 4PPGA 1SY7A 2BKUA 2HCJB 2OHOA 3AQIA 3PQ2A 3RHTA 1A2KC 3WZLA 1W2HA 3CB4A 3TD9A 4UPEA 4AWXA 4FZVA 3RKSA 1CHDA 1RWKA 2R7MA 3WV5A 5I7SA 2YC2C 4QGBA 1A69A 2ISCA 1PQYA 4QQNA 5FADA 1AZSC 4IFEA 1OH5A 4KNYA 1O6BA 1BQEA 4FIZA 1C81A 3RVBA 2AB0A 3ZLBA 4L8YA 2KW5A 4WIAA 1U04A 2PRIA 4G8DA 1K6IA 5IXYA 5K0LA 1XT6A 2BTOA 3V1YA 3BRCA 3KELA 4QU8A 4YRQA 4CT5A 1TUIA 5KNCH 2WYHA 3DE2X 2EFEB 4HAWA 2EKBA 3L6CA 4LAFA 1FUKA 2AIRA 3D6TB 1SKQA 1XYVA 2IYAA 2Q28A 3GEHA 3HJAA 3UXYA 3P0JA 4H7PA 5DEOA 3WXMA 2VRBA 3B6IA 2QRJA 3R5FA 4RVNA 1NAIA 4L16A 4ZAWA 4ZXFA 3I2YX 5HWSA 2CJPA 4TLEA 4QJ4A 3VSDA 4TTSA 1D5WA 3BEDA 1ODLA 3BERA 3HNPA 3BWMA 1WZEA 4CL0A 4YBZA 4C3UA 3DB1A 4HX2A 3A05A 3OU6A 4UHDA 1DBWA 1R12A 1AQNA 1XU9A 2IKQA 1XNHA 2PBRA 2OHIA 2NZJA 3CLUC 3I9FA 2BEWA 4WZAB 5E4YA 3ZDYB 3MCVA 4AJOA 2KYRA 3AV0B 1YQTA 1XTQA 1N5MA 2EFCB 1E3WB 3PNOA 1W30A 1T5LA 4MA5A 3M6UA 3LPNA 5H8WA 3G8BA 2FPRA 4P3OA 5GGXA 4DIUA 3VNQA 1B8NA 1YCFA 1DCFA 3NVMB 1NBHA 1E7RA 3K5PA 4G0QA 4DA4A 1SUIA 2ZM5A 4ETIA 2Q27A 2J6HA 5I7AA 2PH5A 2IF0A 1FZQA 1Q57A 2OO7A 1VSTA 4ZV9A 5ERYA 3MTJA 3AI3A 3LBHA 4MW5A 1EPUA 3FPSA 1P33A 3CVOA 4GOXA 3ZPXA 5EE3A 3H6HA 3VO2A 3LBNA 5LMZA 4UFOA 1Z36A 3GAAA 1RRGA 1C3OB 1AG9A 4EG6A 3AUUA 3PEEA 2YWEA 1LBSA 3VKWA 2G70A 2B8TA 3E22A 4KKVA 4QXOA 2CYBA 5H16A 2Q21A 3SIPA 3WQRA 3E4DA 4ZI2A 3C7TA 5AVXA 3IBGA 1UKAA 4PS1A 3CE6A 1L5QA 3VVLA 1EZ4A 4UC0A 3NATA 2GM9A 4RQUA 4OXXA 2ODNA 3DTYA 2FEOA 2JGNA 2QM8A 4FFLA 4QAQA 2C92A 3DZ8A 3H4MA 4Z0NA 4Q5IA 4FCWA 2PV7A 4R8RA 4EY6A 2I7VA 4DW8A 3CN7A 4D1YA 2BGMA 1NW9B 3K6JA 4J49A 2G4VA 2GAIA 2QD4A 4ZCSA 1Y9ZA 1Q19A 1EM8B 4J1QA 1II8A 3RH0A 1OJLA 3W9UA 3WA7A 3A1FA 4HC4A 5C5IA 4CDGA 1PT6A 4UE2A 5L7YA 4A0QA 2BW0A 1J9ZA 4UHHA 4LECA 5J2UF 2YQZA 1L7AA 3FCYA 4UZFA 3ACDA 4PHFA 1NLFA 2GEVA 2YJ6A 1E3WA 3PFWO 1MU0A 5I9IA 3QLUA 5TSDA 1OX4B 2RGCA 1P3JA 1RRVA 1ZL0A 4JC4A 4AN4A 4TYYA 4M49A 1J2TA 2I3BA 3EMBA 3U60B 3JX9A 2OL4A 4MWDA 2PMKA 4LDZA 3IEUA 3U3DA 4EFLA 3DVSX 3CH6A 3RYIB 4PIVA 5BW6B 2ON6A 4CL2A 2EZ4A 5DNAA 3JQFA 4AWBA 2H7YA 4HSGA 3V6LA 2CE7A 1GNSA 3IGFA 5JY6A 1F6WA 3C5HA 3PQ8A 3PXEA 4RGQA 2XWJI 5JNTA 1SFRA 5C1IA 2WC1A 2AG5A 1L4UA 3I2GA 3H1BA 4FSHA 3V2UA 2QGNA 5FOVA 1EZZA 5TGZA 4C78A 4DQXA 4M1QA 4J29A 1TGYA 2BISA 1YI0A 3FFAA 4BE9A 3PE6A 2GXSA 3TZEA 1VSUA 1OV4A 3L6RA 1SR8A 4MAFA 3VNAA 2GN6A 4F2DA 1ADFA 2IUYA 4C7OB 4K28A 2JK0A 3ICWA 4C29A 5EGNA 3GP8A 3ZDXB 3SS9X 4HNAB 2J41A 1N25A 1VCMA 3BGSA 5F1PA 5TMBA 4DV7B 4YQZA 3EJWA 2GBCA 1R4NB 4DADA 3ZD9A 2Y71A 2HMSA 5FX2A 3M49A 5HA5A 1CNFA 1H94A 3IBCA 3KR2A 2IEYA 5JCZA 4WEOA 5DM60 3O8CA 4KAXA 4IV8A 4DA0A 1QH8A 2D1FA 3N05A 2Z43A 1E3LA 1EFCA 3FOCA 3ZY4A 4B3BA 3U31A 1P4GA 3GD5A 4FZJA 1IC6A 1KO1A 1OX4A 2GD0A 5E1DA 3M89A 3E18A 1QO9A 3LECA 5SYMA 4DLRA 1UMKA 4EM6A 1CY2A 4QDZA 3RVPA 1UPAA 1Y4AE 4LTMA 3BKXA 3F98A 4A8HA 4EYSA 2BFCA 1UWVA 2HRZA 3HYLA 3CJQA 4RANA 3I4LA 3RYIA 3WP0A 3ZOZA 3R5SA 1IUOA 2M6RA 2P4SA 2W11A 1JHYA 3MT0A 2O1SA 2ZJ2A 5JQWA 1PWZA 3CJRA 2Q5JA 4POAA 4HNVA 1YMUA 2KLHA 2I4MA 3L7AA 4G07A 3WJ2A 4D0GA 4ZK2A 3G2OA 1GGVA 4NZNA 3T61A 4DABA 3JQ8A 3LI2A 1QP4A 2UUPA 5FUMA 5JO0A 1IXYA 3U4IA 4E32A 4BNYA 4OVKA 3BT7A 4MINA 1Z12A 2QD5A 4DCTA 1SC4A 4DRXA 2DHDA 5LD2B 2GYVA 4F5DA 4MJXA 2GDJA 1P1FA 4PC1A 1C0EA 3UMRA 5CDFE 2GLUA 1GKKA 5D8DA 4F06A 2FJUA 2GN0A 1UADA 5FNZA 4KR6A 2EAUA 3AW9A 3K0FB 1DG3A 1KOLA 4TTQA 1M8FA 1P74A 3R6LA 1UXJA 1Y9EA 3OZSA 3I01A 1P4SA 2E89A 1TJ5A 1VE9A 5BV0A 3LQYA 1YQXA 6ABPA 4A26A 3NGXA 3H5WA 4ID3A 2E4AA 2RSLA 1FP2A 3GW8A 1R4NA 2QSZA 4GPBA 1LLCA 4RY8A 1W88A 3DKIA 3E1KA 4Y9RA 2W5UA 3KKQA 1RC8A 1UZMA 3IUNA 3KR0A 4IDCA 3ROZA 3UC9A 2WEKA 1SCAA 4QEDA 4S1OA 4O4LB 1I51A 1WBBA 3MYYA 5FJIA 2WYOA 3UHAA 4KO4S 2O2ZA 4M54A 4QUGA 2I1WA 1J7JA 1E0AA 1VLJA 4KQ2A 4UM5A 7GPBA 3AKZA 2QAJA 4L3WA 4TLAA 1Y6ZA 4Y2PA 2YMPA 2HADA 3LPCA 3EA5A 5C53B 3FSRA 1PQWA 3G1TA 2RHJA 1B8OA 2PTGA 2V6FA 3LPDA 5K8CA 2WSLA 1GIAA 5I4IA 1OFTA 3FBTA 4XI9A 3U6KA 3PGVA 4PGGA 1EFTA 4MQ5A 2BGIA 5AXCA 2PVPA 4LW8A 2A1TS 4JEIA 1S2MA 1FX0B 3NVDA 4ZT2A 1YJBA 4C7KA 5BNTA 2HU5A 3AUKA 4OLAA 3ZU3A 1O89A 5BV7A 4MTLA 3JTMA 2OPBA 1CDZA 2PYIA 3H2SA 3NU1A 4IXDA 1VE5A 1TEXA 2B37A 2F4NA 1EGAA 4MS1B 4NBUA 4ZO9A 1Z5OA 1NMYA 4Q00A 3KYCB 2Z6AA 3MD0A 1CNEA 2W2PA 3QU2A 1IVNA 1Z88A 3N8HA 3WSVA 1P1HA 2GILA 4KO8A 5GMOA 2I62A 3S8MA 1X9HA 1K6EA 2ZVJA 3ZZ1A 1U2DC 5EQTA 4ZARA 4L5AA 2VL7A 3VZCA 2FWBA 1YJQA 3FIJA 1B93A 5C8YF 3RS7A 2BWJA 2QPOA 1T1GA 2FDXA 2C7VA 1QCZA 4MP8A 4D3XA 4J7XA 1N57A 3KSDO 4KWCA 2GBLC 3R7DA 2DLDA 1VDZA 1ZZEA 3AOEC 3TRIA 2Z8XA 2WAMA 2CCKA 2A7XA 5LKAA 1SA0B 4MA0A 2C5BA 2FZCA 4NHOA 2RMKA 5F76A 1U8CB 4U2KA 1XN1A 2SNIE 2PZMA 3KD2A 3W5IA 2D5IA 2QN8A 4XXHA 3E9YA 1IK6A 4O4LA 1OXXK 3SVLA 1OKKA 2KB0A 3G5UA 3Q9NA 1Q20A 4RAQA 2XT6A 2IWRA 1LDNA 2CDAA 4UHEA 1A7UA 1F2DA 3WLNA 1R9MA 4WK4B 3K71B 4QUKA 1NKSA 4ANFA 5I9LA 5DMHA 3SEAA 1VPDA 4YAWA 3ADOA 3OH8A 4AS3A 3HM2A 4DLYA 4HUJA 4B33A 1TLTA 1DG1G 1VPVA 2ZITA 3GARA 5A5DA 3CX3A 4QWMA 3TWOA 3M81A 4JQCA 3X2EA 3G2QA 4CCYA 2BLNA 4FJ2A 3VGPA 3ZWQA 1KY2A 5ENDA 1FX0A 3F6RA 2FDRA 4OFXA 4PG4A 2F67A 4G5XA 1ULTA 4B8ZA 1IM8A 3EXFA 1QIDA 3EEBA 4OSOA 4CVNA 1GHTA 2CDNA 1E1QD 4N12A 4BLWA 2AQKA 2V3CC 1E2HA 2DBZA 2XGGA 4MS1A 4LDQA 4RHUA 4I6GA 4C4PA 3LWDA 5I5EA 1V35A 4LHSA 3JQGB 1QS0B 4UASA 3KYCA 1YJ8A 2WUEA 3KD3A 2ZWAA 4PWZA 3UG7A 1H23A 4L0DA 1SD2A 1OE0A 4OA5A 4PQEA 5B7QA 4B81A 1E6UA 1ZSYA 3RIHA 1LPPA 5L3RA 2WSMA 2D2IA 4Q34A 1MHTA 2IYYA 1H2EA 5DT9A 2D2XA 1R16A 4BGUA 1NUTA 2PQ0A 1ENYA 1RYZA 1V7ZA 3NXSA 1QM5A 1F8YA 1KMHA 1SXHA 2HQSA 4MUEA 4LY6A 4QU5A 5HPYB 1FFEA 3LY8A 1SA0A 1ONNA 1OFVA 3GZNB 4LUCA 5B3JA 1L7XA 3EDCA 3QTLA 3RGGA 2V59A 4U7GA 1WMAA 4JT8A 5BNFA 3TSOA 1TLFA 2IZ5A 1S2DA 1ZK0A 1DKRA 2MSCB 3RHZA 4BLTA 1EIWA 4YCDA 4QHSA 2E37A 2F00A 4N0EA 4RA9A 4YJ3B 1QYRA 2C78A 4P53A 2JJYA 4B2PA 2VYFA 3I39X 1QV7A 1JQBA 2I6TA 2XUFA 4KMRA 3WNQA 4AROA 3UHPA 1P4JA 2P0YA 3EVTA 1FFXA 1LBQA 1TDJA 3HCNA 2CXXA 1C30B 2ENUA 4IUBS 4II7A 4D82A 1SWVA 4RH0A 1ZJ4A 3KHTA 3LC2O 2QQGA 4ISBA 2QMQA 1MB0A 4Y7CA 3T12A 2Y27A 2VDRB 1JH8A 3CLKA 3EFEA 4M1YA 4UQPA 2BP7A 3SXPA 2BN4A 1SC3A 3RBZA 2Q6TA 1VSBA 1ZN2A 4YUWA 5KYXA 3IPYA 1VGQA 1CD5A 3JQGA 1QS0A 2CXQA 3G8DA 2HQBA 4QBFA 2GYWA 1MC4A 1KIFA 2MTBA 2CZGA 3OZVA 4JCOA 2WFMA 1LW7A 1Z6TA 1QQ7A 2Y0BA 2K7ZA 3M5WA 3MIIA 5A3VA 1UH5A 1HRKA 4N41A 2VLBA 3HYRA 3IDQA 4TT8A 2FMUA 4A0GA 4NMLA 3PUKA 4LVCA 5DM1A 3UK1A 5D01A 1R0KA 1XHFA 2RHCA 3G0IA 1BSVA 3IE2A 4KBYA 1WCXA 1H0RA 5CU7A 5H7XA 3Q0TA 1I9CA 4NG5A 1Z8DA 3NBZC 5AM0A 3T4XA 2P4UA 4BFZA 4ZU1X 2HW8A 4PQYA 3RK4A 5LP6B 3GZNA 1XMPA 1ZY2A 1DARA 1J8QA 1J9GA 2C2XA 3LXXA 4KOAA 2PU5A 4RJ2A 2WIKA 4X3CA 1B6GA 3LUHA 2EC5A 4OATA 2VJOA 1DQRA 3AR4A 1EJ0A 5A9TA 3TI7A 1JR2A 3FB4A 4OXIA 3ABQB 3AKDA 5DBIA 3U1TA 1Y34E 4TUYB 1ZMOA 3JQAD 2L17A 3JD1A 2PX8A 3I3OA 1MX9A 4GLOA 4D9FA 1ENZA 3OIUA 3ZKWA 5C0OE 2SKEA 2ZTVA 4FMDF 5LA6B 5NULA 3R3ZA 4P34A 4YT5A 1T6ZA 4R0VA 5C7LO 4UM9D 4RM3A 4AZTA 2J6CA 1C30A 5BYJA 3DAYA 2HA0A 1JQDA 2G0NA 3Q3GE 4RA6A 3V34A 5A62A 5A3QA 2K7FA 3QBTA 1DB3A 4LHVA 4GMGA 3E53A 4B73A 3Q5EA 2LD4A 3FLAA 4RMHA 4BVFA 1WZ2A 2JZOA 2VUUA 4EHAA 2J8ZA 2C3UA 4HDMA 4EJFA 5AOAA 3WAGA 1XTJA 3VM6A 2YYYA 1O0BA 4LNUB 1QANA 1VG1A 4ZQCB 4KWHA 2BYTA 1XWIA 1W2WB 2YBDA 3IXQA 4BC0A 5IJ0B 5LJIA 2B5VA 1XXHB 2D7CA 3BA6A 4YIHA 4I1PA 4O4IF 1FFAA 4EQZA 4Z9BA 3K1YA 3V4LA 4DLWA 3H6KA 1JG3A 3L1HA 2NQTA 4IDHA 2Q9AA 3NETA 4GE0A 3AR2A 3HJUA 3ZYZA 2HSGA 1E2NA 1DAEA 3M4ZA 4LYDA 4UUAA 1G42A 4EFMA 1H5QA 2XA2A 2CDRA 2QVLA 4OQDA 1UBTS 3U81A 3L41A 2CHFA 3DOFA 1DJNA 2DUNA 1WSDA 3DBOB 3H99A 3ZIAD 2A0XA 2GI4A 3C3MA 3KR9A 4BV2A 1R6DA 4YPFA 2WG1A 1W2GA 3OE1A 3V4ZA 2A9VA 2JRLA 3KSUA 4JYMA 4ZK6A 3J7AC 1OX6A 3EG9A 5DI9A 1G6OA 2A8YA 3LK7A 3ABSB 2ZXUA 2J1LA 1XQWA 3BHMA 3QEMB 3QWHA 3MJDA 3NGLA 4M1ZA 4RQTA 1SQ5A 4TN1A 2C9OA 4FNAA 2VT6A 4HXEB 2MCFA 5INTA 1EA7A 3RYTC 1M74A 3PGXA 2FMKA 1DAKA 3LKZA 4A5SA 4BFCA 5A0VA 4GR4A 4XTRA 1K88A 1NMEA 1YC5A 2XRFA 1HDCA 1LVUA 1TC1A 4FFOA 1DBVO 3FFWA 4DMCA 5C5DA 3PRJA 2OO5A 4RKWA 1M1ZA 3OMWA 3OU2A 5AHXA 3TR0A 2XITA 4RTQA 5GZ3A 4FFRA 1Y3BE 3VPHA 1YT5A 2HMAA 4II3A 3BE6A 1MEJA 1DAHA 4S1WA 2GH1A 2PXHA 1I4OA 2QRPA 2W37A 5A05A 2Y0PA 4NS1A 4HDSB 4Q3OA 1CUUA 1I30A 3PPVA 1Z0FA 1QRAA 3LXUX 3P2OA 1XXHA 2IZZA 3V8QA 2HHJA 3OX1A 5TEWA 4OOFA 3KU1A 4D2IA 2VN8A 2PLNA 2YWFA 1W94A 3H3FA 4H0NA 4XTCS 3QU9A 1JLLB 3KKPA 2ODTX 4CV0A 2C2ZA 2GTIA 4J3FA 3AM3A 1YV9A 2HWXA 3QI7A 4H35A 1WBJB 5CT5A 1T5BA 2A9PA 3MWLA 5FULA 5H83A 1IN5A 3ZVRA 4B7AA 4E30A 4I5DA 2QZ9A 2J3EA 5KUTA 3U1BA 2ZTHA 1H05A 3YASA 4AMUA 1DWQA 2IOYA 5DZSA 4YRBA 1CYEA 1HT2E 4ODIA 1NR1A 2Y0CA 3D81A 4MLPA 3U4QB 2O7NA 4BQQA 2AX3A 4D9CA 3G17A 2F3QA 5FT9A 3WRYA 3GJQA 5CLQA 1EWVA 2VZ0A 2RGUA 3R7SA 2VYCA 3UN1A 2QVCA 5BMOA 2I3DA 2HU7A 3QXGA 5C1BA 4YAKA 3IT3A 3O84A 3HJFA 3QEMA 4D4MA 3FE2A 1DOZA 1E6KA 3LDAA 4E5UA 1JFSA 2YYAA 4MZDA 4BB5A 4FTWA 3WLHA 4F9EA 4EJ2A 2Z4SA 4K7JA 4ZDWA 1PU2A 2CXRA 2Y05A 5BW8A 2X9NA 3GVIA 4AJNA 4LOHA 3E82A 4FDLA 1P0IA 1HNZB 3F90A 2EWMA 4G9EA 2ET6A 4N7JA 3ZYCA 3CUEF 1FU7A 4L9AA 4IHAA 1RHRA 1YXMA 1T1JA 3TW8B 3FHTA 3KHSA 3NWBA 1C9JA 3D5EA 1Z5VA 1K08A 3U3ZA 1JZSA 1VKRA 3ZE6A 1I6WA 1PZNA 3U3JA 4PBTA 4PVCA 3FRHA 1FDUA 2VZ8A 3HBFA 1MD9A 3ZJ4A 4B1FA 3FGPA 1XRPA 3NWJA 3PTZA 1T6XA 1TM5E 1XV5A 4YDSA 5F21A 4AQDA 4U7WA 4Q4AB 3SEQA 3M34A 4ZOQI 4A6DA 4RTSA 4RMIA 4BFUA 3ZH2A 5HUQA 3D0RA 4UW9A 3Q8KA 1NVEA 4GAEA 3EMKA 3GRRA 3STUA 2ZANA 3K8QA 4IXWA 4X64B 4AXXA 4HVCA 5IDWA 2D2VA 5JBQA 4M0LA 5HOEA 1YFJA 2IIVA 2OHVA 5AVUA 3SICE 1I2DA 2PCLA 4RK7A 3SHQA 2G0AA 2F90A 1PX0A 3PFGA 2ZUBA 4R1LA 2OBXA 1Z4QA 4PTYA 3GZ4A 3SQOA 4AZVA 1ZBQA 1U5BB 3N5CA 4JLKA 2R6JA 3V3TA 2WVHA 1J07A 3CH7A 5CFNA 3U4QA 4Q66C 4NS4A 4ZAGA 2AOWA 5ECYA 1QJ4A 1XLTA 3VNUA 2PBZA 1JPUA 1U7PA 1UJMA 4RDIA 3FGNA 3IAEA 5CMLA 3DHVA 1YZTA 5K99A 2Q9BA 4GMFA 3ZXUB 1IBMB 1GADO 2YXBA 3A9UA 2CNOA 2HWYA 3DE7X 5LYJA 1ZKMA 4E3ZA 5LBUA 1UP4A 1QLHA 1OWLA 5D7BA 4YO7A 1N4AA 4DARA 5K0SA 4LGCA 2G88A 4N7MA 1Z75A 2JJ2A 2SBTA 4CMEC 2CUNA 4XRGA 1PEDA 3HU3A 4YH1A 5AXBA 3M9LA 5C31A 5U4QA 1KYVA 2VCEA 1JIJA 4O59O 1MDFA 4I6EA 5KTKA 5JALA 1OZFA 3EH1A 3MWYW 1OVGA 2PGOA 3WLKX 4EPRA 3D7NA 3KOZA 1TUGA 2P4QA 1P9RA 2XCSB 1DXOA 1P9LA 3DO5A 5I7WA 2YWBA 2WQ6A 3HR4A 4GI2A 3VPXA 5KHOC 3TUJC 3RS8A 4YFYA 3R0IA 1X1SA 2V3WA 4FHZA 1TVKA 2HJGA 1GSIA 5KJ6A 1N6PA 1TRKA 2OBNA 2X4DA 1Z0IA 1B6RA 3L6UA 3GLIB 1E1YA 3D1LA 3F4BA 3LUKA 3WL3A 4MS4B 4XWYA 3ITKA 3O9ZA 2V54A 4FHGA 4UARA 3FTDA 1CE8B 5HDBB 3E9NA 4XDHA 4AO8A 3GNQA 2IZ0A 1PNOA 4F04A 5DK4A 5FD8A 5B1SA 5H4GA 1KSGA 2PDAA 3B8HA 3IDAA 4P3NA 2PK3A 5DHRA 4RORA 4YRTA 2RAFA 3IL2A 3LIPA 2DHQA 1KH2A 5E8JA 1N2EA 5A03A 4WE3A 4TZTA 3EHDA 4YAIA 4R9SA 2XYHA 1FFHA 2ZXEA 3UVEA 6REQA 1H1DA 4IGIA 4XVRA 5BMVF 4HGYA 4L8LA 1YFLA 2W6ZA 1IXKA 4HN2A 4N3AA 2E2WA 2OBFA 1AVTA 1BHSA 2EL9A 3JD3A 5CFMA 1SELA 3GC6A 2AQIA 3ONWA 4LJSA 4O3MA 1J0XO 4MYRA 4QQ8A 5IMBA 4AX4A 2C0QA 1LS6A 1X80A 4W1RA 4XM0A 1CQPA 2LZ0A 4ZO8A 2QTAA 3E61A 4LYJA 2QX8A 5H80A 1E2UA 1OXUA 3NTQA 1QFYA 3DUWA 3KPYA 4OIFA 5G0WA 4CV3A 3P5SA 1T43A 3VR2A 4UVDA 4YDRA 2FA9A 1N3YA 1ZH8A 3QUQA 2YHAA 4PIMA 4WT7A 3E8SA 2Z8YM 1I1OA 1ZX1A 5IABA 7AT1A 1P1CA 1LS1A 1XZNA 2ONYA 1JHXA 4WKOA 2BFFA 4FMPA 3GMTA 5CEFA 4GX1A 3TECE 2HRQA 2G06A 3GLIA 2PX0A 3KB2A 1TLLA 3N75A 1JA9A 2XECA 5JAMA 3FUCA 2BBOA 1ZNQO 3D4OA 3WWOA 3ODPA 4X00A 4E4YA 2CV2A 3HCPA 3U40A 4TXJA 3RKUA 3ENZA 1JBQA 4ETMA 5K0JA 4IQ4A 2P9YA 3K2BA 3MT8A 1PUIA 1ZRNA 3DZBA 2QENA 4O25A 1YQDA 1U3TA 4QRHA 4BCBA 5JPDA 1NBOA 4X1KA 2VSYA 1B42A 2W6OA 2WIAA 4ZPXA 2Q3BA 3KAKA 1O9GA 1A9TA 3GQVA 2CJFA 3QU4A 3ZHBA 4F84A 3FOBA 5K0CA 2FPPB 1Z3IX 2O59A 1MAAA 1LFDB 1EX1A 2J5QA 3DTVD 4CTJA 4NXMB 2Q49A 3WKEA 1AHIA 1LEHA 1RPTA 1FVHA 1IOLA 1RXEA 5EYPB 3KDPA 3OICA 4R1UA 3RSSA 2A84A 3ZY3A 2Q2WA 4LZAA 3OOSA 4ER5A 4CIDA 1U81A 5L6MB 4MIYA 3N0WA 1BA3A 3DOJA 1LTKA 3S68A 3L7IA 3PICA 4NCNA 4PPQA 4DBZA 3F6YA 3O75A 2V7UA 3FRIA 4GZ6A 4JU8A 3DOIA 4YI3A 3GLGB 3PXGA 4A2CA 1SHJA 1V1RA 1ZOPA 2CHUA 2XMGA 1JA0A 1TT7A 4YRSA 2P62A 4Z53A 1L5FA 4UHCA 1DFGA 1P8AA 3SQDA 3ZTYA 4NYIR 1P9OA 4B8YA 4HMQA 4TGLA 5BP7A 2XXBA 3GGGA 4GWKA 5KYKA 3ZGLA 3B12A 5M7EA 4IILA 4X60A 3K70C 4JJAA 3PA8A 2JAUA 1TYEB 3WMRA 2NO7A 2W6ID 3IDFA 3A4IA 1T2DA 2VHYA 4LHXA 3KJXA 4ZGWA 4RWZA 4X44A 1XXHE 5CFLA 2F2TA 1SG9A 2FW1A 1DJPA 4XWWA 1EU1A 2QMYA 2FZLA 4QHYA 2PLAA 4F5EA 2WTAA 3UUEA 1B43A 1E7MA 5BR8B 1HOXA 4TLMB 4BP9A 3EEOA 4TL8A 1EUYA 2VP4A 1S3SA 1ZCJA 2DJIA 1LI7A 1Q0QA 3G7UA 3QYPA 3RADC 2YXPX 2Z1NA 3DOOA 4XIFA 2C5AA 1HX7A 1W5SA 3L8CA 1Y81A 2A0FA 4NR0A 2N75A 1I3CA 2ES4A 3UW3A 1W0JA 1XB2A 4XR4A 1E92A 2ZRAA 3B6ZA 5EE5B 4NCJA 1UIRA 4HEA6 1SUCA 1WCYA 3DZIA 4B74A 1R5BA 5AYVA 1NY5A 4G6ZA 5KNLA 5FORA 4HEA1 1MVOA 1WD5A 1KJ8A 2XMDA 3QWAA 3KSZO 3JQPA 1Z2NX 3UV6A 1Y5NA 3ZLUA 1KI4A 1IOVA 4E2ZA 2XNDA 5HXAA 1LJLA 3ZGNA 3ES9A 1XBTA 4HRYA 5GJVC 3H9QA 4PV7A 1P2DA 1ZK1A 1PGPA 1Y37A 1YKSA 5EAIA 3UK0A 4QLBA 3GLGA 4HS4A 1L4KA 2JLWA 5AVYA 2JGMA 4ZJZA 4LI3X 1YL5A 2Q3CA 2V3VA 1JPJA 2WIBA 5IF9A 4AULA 1H0SA 4F38A 1KO5A 1EFPB 3RC2A 3FMVA 1P73A 3E9EA 3A2NA 1HK7A 1OX5A 4L7QA 2FUG6 4JQOA 4HFNA 4WLVA 3RRFA 1WTCA 2CKDA 2PLWA 5J40A 2ZSHA 3DKPA 1QLWA 2FUG1 2Q9UA 1SKBA 3GA0A 5AVRA 1KBZA 4GBJA 1EQAA 2NIPA 4ENPA 3AYXB 1A8PA 3EQ7A 3WFZA 4JFRA 2DCMA 5LZ8A 2OSVA 1PSDA 4YHHB 5CAEB 1EGMB 1MCZA 3VR0A 1GPYA 2MOKA 1TCUA 2GKOA 3O91A 3WBKA 3OC0A 3MVEA 5JDCA 3R7WA 4UTZA 4Y1EA 3O1LA 2E48A 2V7QA 4DUYB 2YJGA 4JI8B 2WWIA 3RVQA 1YGPA 1ZMTA 4R0NA 4CJXA 2P2YA 1SKMA 2P11A 4E5VA 4CLXA 2XQIA 3NOXA 4JKYA 3UM9A 1KVSA 5L7TA 3FDZB 2V4ZA 1I4TD 2W2TA 3A27A 1FY2A 4L3VA 4NU6A 1RNLA 4YCJA 3BWCA 1NN0A 3RBAA 4RTJA 1SUDA 3BAZA 3NC4A 4ETNA 4BZXA 1MOSA 2QM0A 4G9GA 5T3UA 2A5JA 3WFJA 4AG5A 4DWWA 2HK6A 4K6CA 5B37A 2WIFA 3M5PA 3CVYA 1P8JA 3IX7A 1U63A 4C08A 1YBMA 3C6XA 3KWMA 3QE4A 4BRSA 2P9HA 2R8OA 5BXQC 4BO6A 3RJTA 2IIQA 1PQ4A 3CXRA 2ZR0A 1YDMA 5AMXA 1GV1A 2R9VA 3RJ5A 2EJCA 5JH7A 3AFGA 1LNQA 1BAPA 2P3QA 1RABA 3WLIA 5JR3A 4J6EA 2FUKA 3KV3O 3SCZA 3QJ5A 1FTGA 4D9MA 4YRKA 3GJ3A 2RIRA 2H3HA 3MCAA 1EFPA 3CZ9A 1SU6A 1Z62A 2L2QA 2QF7A 4GEKA 4DM3A 4B9EA 5IM4F 1E4EB 4GOJA 2L82A 2FGKA 1NQAO 2EHDA 2YOHA 4OMUA 3H9GA 5DCYA 2POCA 4TMTA 4OGLA 3DT9A 3LUPA 2PEYA 3ZI7A 4KE9A 1WXHA 3HCWA 2VAXA 4FWIB 3TDNA 3UHFA 3NALA 3ZHYA 1JEYA 2OT3B 3DH0A 3LDGA 1RD4A 3BCUA 3ZGZA 4QREA 5CAEA 1NE7A 2HSEA 1DL5A 1K68A 1KA9H 1W1IA 3C3KA 3DCYA 1ZO8A 3E6AA 4AYTA 3UT0A 2W90A 4DDVA 1E2DA 3OBIA 2E0IA 4HZIA 2PXAA 4RKFA 3DBVO 3QWBA 1FDTA 3ODGA 2WAYA 2G9NA 1DP4A 2LPMA 4GLFA 5E4TA 4DQ0A 1RMQA 1U0GA 4I1VA 2AMJA 5G4LA 1N6IA 2J9FB 1OXKB 1YIOA 4KJXA 4MQFB 3O4VA 4OXRA 1AY0A 1K7XB 1P7WA 3NIBA 3USCS 4F21A 1EQ2A 1OJ7A 5EA2A 3RS9A 4BATA 1SKAA 3UTCA 1ADYA 1JT2A 2J31A 1XZJA 5EKDA 3JQ7B 1ZVJA 2B9VA 3VVMA 1MO5A 4YUZA 3C3JA 2HGZA 5DULA 2AFIB 3A1EA 1B14A 1VYTA 2W00A 2YTZA 2ZXFA 4XIIA 4A0SA 3P32A 4YCCA 2IYOA 2QP3A 3I5AA 4KQ9A 1TZMA 5DYGA 4YAGA 1UZAA 3W3AD 5H02A 3DMGA 1H2ZA 2CC2A 2UYQA 3MC1A 1E4EA 2G5TA 3P1JA 1YE5A 3EFOA 3EZ9A 1XTPA 3CQ9A 1QFSA 1K8XB 4OO3A 4WJLA 1GZ7A 2DECA 2OA0A 2V1XA 5KOJB 1YB6A 4RYDA 3C97A 3RO7A 3GLIE 4WK6A 5EJIA 3RS0A 4YRCA 1GUAA 3M3PA 3FNBA 4HPWA 1RZUA 2ZYSA 2DPGA 3G6WA 1GRNA 5IYZF 1RQ7A 2PZLA 2WB4A 1X6VA 1IBRA 1CS4C 4HX5A 2WW8A 5KBYA 4JLMA 2XMCA 4TRNA 1ZW6A 2IYLD 4NVRA 4YFVA 3ADDA 4XLZA 2JIOA 4XB1A 3P2MA 1K5DA 2VTKA 3UCEA 1A2OA 1NBAA 4TL7A 4UOQA 3VI3B 3VYUB 5A0TA 1U0SY