1NXPA

Micarec ph4.5
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
118
structure length
118
Chain Sequence
KKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIILDLMLPEIDGLEVAKTIRKTSSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-binding response regulator
publication title Crystal structure of the response regulator 02 receiver domain, the essential YycF two-component system of Streptococcus pneumoniae in both complexed and native states.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Signaling protein
total genus 40
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2003-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1nxpA00
1JWLA 5B3JC 1L5ZA 4Z4GA 3MF4A 3JPWA 4P1ZA 1OXBB 2LPMA 5CNIA 2MSWA 5FWXA 3MIZA 4MR7A 4YS6A 4NQRA 1U0SY 2PL9A 4O1HA 1SXHA 4XXHA 6ABPA 1GCGA 3F73A 3OO1A 1F4VA 1YK1A 2FEKA 3I45A 4QYWA 3H6GA 1FFGA 4TLLB 3DGFC 4KNYA 3RVJA 4CBVA 3H75A 1URPA 3M9XA 3DGEC 4XAQA 3CTPA 2FQXA 1USKA 4W5NA 3LUJA 5HSGA 2PUEA 1JFVA 1HEYA 3LUAA 2PAFA 2JRLA 4MYRA 3IDOA 4RXTA 1PUXA 4OBBA 1W9HA 4MQFA 4TMYA 3B2NA 3Q7RA 5KQMA 3RVOA 3E61A 1FSPA 1LJLA 2DRIA 3ROTA 3O74A 3TB6A 3UUGA 5CNKA 4F12A 3QLVA 1QMPA 3SNKA 2WJAA 2PUFA 4JOQA 4NV3A 4OLBA 5IULC 3MYYA 2FMFA 2I6FA 2FEWB 3T6KA 1PHRA 4XFKA 2GI4A 1R8JA 5JS2A 4MR8B 4G0OA 4EYGA 3KKEA 1NXVA 4ETNA 1TLFA 3O1IC 3KG2A 4NCBA 5BQ3A 4YV7A 4EGSA 1JLKA 2HQRA 4RKQA 2JK1A 3H5IA 1EWVA 5C5CA 3FGZA 1ZAYA 2A9OA 3C3MA 1DRKA 2NT3A 2E4VA 1BA2A 4TN5A 2HJ9A 2VK2A 3BILA 3LKBA 2FMHA 2FW0A 4H3KB 3OLWA 4ZJPA 1RZRD 3CFYA 3GYBA 1PNRA 2NUBA 2AYZA 4KK4A 3D8UA 6CHYA 1MB0A 2L17A 4PYRA 5IBQA 3MQ4A 2IOYA 2P9HA 4KMRA 2NZVG 4KQCA 3EDCA 4RXUA 4KREA 5E3JA 3CZCA 3I09A 1DG9A 3A0RB 2FLKA 3H5VA 3URMA 1EWKA 2MYTA 3LFTA 4RK1A 4MQEB 1NXOA 4YCSA 4Z4CA 1BDHA 1QO0A 1Z2EA 1W25A 1GUBA 3ROFA 1L5YA 1UDRA 3O2QB 3QELB 3H5LA 1ZH4A 2FN8A 3GWGA 2ID7A 3I42A 4G0PA 2CWDA 2X7XA 1DRJA 4P98A 3LUKA 3OQMA 2VUIB 5ABPA 1ZVVA 3IP6A 1QQBA 1XHEA 1QKKA 2IDMA 5KC9A 3Q9SA 2E4WA 1JBEA 2J48A 5C5EA 4EYKA 3HZHA 4PICA 5HM6A 2IKSA 3Q41A 3QLUC 1T34A 3RVLA 3N0XA 2JCGA 1LJUA 3HV2A 1ZDMA 4MR8A 2QZJA 3KTOA 3O75A 3H5TA 1E6KA 3C3KA 1K66A 4LX8A 4MGEA 3KHTA 4WXEA 1JHZA 1LBHA 2LUOA 5BR1A 4QICA 2FEPA 2YHAA 2WJWA 3HCWA 4LDZA 5B3JA 1B00A 1PEAA 4RK7A 1IIBA 3HUTA 1E6MA 4W5RA 4MS3B 1M5UA 4G0YA 1BDIA 5CNJA 3JY6A 4HNQA 2BGGA 3L49A 2FKAA 5CHYA 3HJFA 1BAPA 3M9WA 1SXIA 1ZGGA 1GLGA 3GV0A 3S99A 2FSPA 2QVCA 4FE4A 1YMUA 3LMKA 1TJYA 3HS3A 1QQAA 1D4ZA 3CG4A 1RXEA 2F8TA 1F51E 4ZYLA 2MSKA 1ABFA 4Z4EA 4F11A 4MPTA 4RK0A 5IEJA 2FMKA 4YR7A 5HKOA 1NTRA 4MQEA 1JFTA 2HQOA 1QP4A 3L6UA 1DZ3A 4IF4A 3LTEA 4XASA 3UKJA 3QELA 3HDGA 3RVKA 1Z16A 2L19A 5DKFA 4O5AA 1QP7A 4YWHA 1JH9A 1YS7A 2RJOA 3LUFA 1JDPA 1YMVA 1EFAA 3CS3A 4OTZA 3RVSA 4EY3A 3BBLA 3VNBA 4EYOA 1CEYA 1DC8A 1AB6A 4LE2A 3R0JA 4B09A 2PKXA 4RU1A 5IEBA 3MMNA 4TLMB 3A10A 2L18A 3HEBA 2L2QA 3MM4A 4E7OA 3SY8A 2FN9A 1WETA 3M6MD 4HNRA 3EULA 3OLXA 2OENG 5IUJC 3DZDA 4EVSA 3F6PA 3OO0A 1U8TA 4G86A 1ZITA 3GBVA 1DCMA 4E7PA 1ISRA 4WWHA 4RKRA 1JF8A 3KCNA 1DBQA 3TO5A 4S05A 5EWJB 5JNVA 4W5TA 4OG2A 3RH0A 3EJWA 3O1JC 3ILHA 4WZZA 4YLEA 4ETMA 4JB0A 5JNRA 3HM9A 4MS3A 3NBMA 4ZMSA 2VUHB 4RK4A 1DP4A 5TQ0B 3OLYA 3CLKA 5F64A 1P8AA 4RXMA 3W9SA 3FFWA 2P4UA 4H3HB 3OLVA 4OATA 1LBIA 1D2AA 1A04A 1BDJA 4JASB 4MRMB 3DLHA 5JNTA 4Z4FA 5PNTA 4YRZA 4KV7A 3OM1A 4JAVC 5EWLB 2XDYA 4EUKA 1JYEA 4YP9A 5D2CA 4RDCA 1Z12A 5TE9A 1RPJA 2CHEA 2E4UA 3JVDA 2JVKA 3H5WA 4WUTA 4ZMRA 5BRJA 2HQBA 3OLZA 4NCAA 3N75A 1USIA 3LUDA 5TPZA 4D6XA 3A0UA 4Y9TA 3RVNA 4MLCA 1TM2A 3KYIB 4N03A 3N6VA 4Z99A 2GKGA 1MB3A 4LRQA 4IILA 2FMIA 3QLUA 1NATA 3SQNA 3QX9A 3RVMA 4KVFA 2RGYA 2NT4A 1APBA 1XWWA 3QK7A 3Q7TA 4RK6A 2R48A 3QX8A 1FFSA 5ED4A 4N76A 1P6QA 2QV0A 3F7NA 4JA2A 4MS4B 5DTEA 5T7BA 1Z2DA 4G97A 3BREA 3T95A 3HDVA 5TQ2A 5IC5A 4G0XA 2IPAB 1KRXA 1GUDA 4EYQA 2FLWA 4F06A 3LKVA 3KS9A 4O1IA 3QEMB 1ZGZA 3IP7A 4FE7A 3HSYA 5EWJA 2R4QA 2PUAA 1M2FA 3GL9A 3OM0A 1FFWA 4M88A 2GX6A 5IUNC 2MSLA 4EVRA 1SXGA 3RVPA 5KWSA 3D02A 3DLBA 3CKMA 4W5OA 1BVHA 2V0NA 2JB9A 5TQ0A 1FQWA 5GQSA 2OQRA 4JP1A 4D74A 3G1WA 4MS1B 4ML3A 1VKRA 2HPHA 4N0PA 4EVQA 2ZWMA 5JNUA 1YS6A 2E4YA 3TD9A 4F8JA 4MRMA 3H5OA 4DN6A 3FDFA 1D1QA 1KGSA 1XHFA 2TMYA 3CZ5A 1Y1LA 3EQZA 5EWLA 1U2QA 3LUCA 2ID9A 2PE5A 1H9CA 4Z9AA 3N53A 1RXIA 3JVIA 3KSMA 4LE0A 4LE1A 5I4CA 1QO0D 3CHYA 2ZAYA 3QEKA 4IGAA 3VNAA 2PL1A 4PEVA 3OQNA 2QU7A 1DCFA 4ZPJA 1K68A 2IYNA 1DBPA 4GNRA 1P2FA 2FQYA 2PLNA 3K9CA 4RY9A 5EWMB 2KYRA 5IX8A 4MR9A 2GWRA 2MYNA 3HUUA 4QYMA 2O20A 4Q7EA 4HNSA 5DGCA 2E4XA 2IPLA 1DJMA 2M1ZA 5TPWB 4FB4A 1P6UA 1NXPA 1ZHHA 2FVYA 1NXWA 4PZ0A 1U04A 3SM9A 4G0MA 4MS4A 1KMIY 1D5WA 5IUKC 3LUGA 2QVGA 1CYEA 3FMVA 3CNBA 8ABPA 1TVMA 3GT7A 3H1GA 4KZKA 5DLEA 4IRXA 4QPJC 9ABPA 1JL3A 3I5AA 3QEMA 1U2PA 1Z15A 2JVJA 4WXMA 3EQ2A 3BRSA 3RQIA 5TQ2B 2H0AA 3JTEA 3OMXA 3Q7SA 1NXTA 3A3KA 3KLOA 1RZRA 4G0QA 4ETIA 4OLAA 1JX6A 4Z9BA 3OQOA 3MA0A 5KQLA 4N0QA 4MS1A 1KRWA 3BRQA 1Z18A 4Z0NA 4NICA 1VLZA 1M2EA 4LDAA 3GBPA 1PEYA 1ZESA 1JDNA 3O1HB 2IPMA 2GBPA 3KJXA 2Q5CA 1VRVA 1A0OA 1AB5A 1EWTA 3IPCA 1RNLA 4RWEA 2CHFA 3SG0A 4JB2A 1YIOA 2A9RA 1CHNA 4UHKA 5T3YA 4KFCA 4F3TA 3EODA 3OMWA 5FWYB 1E6LA 2VYCA 1ZH2A 1C0EA 3IP9A 5KI6A 3DBIA 1I3CA 4XARA 3CU5A 3F6CA 1EAYA 5EWMA 4RY0A 1MIHA 3E3MA 3IPAA 1NXXA 4KPYA 1LK0A 3P9YA 3RVRA 3ILYA 5TPWA 4RY8A 2JBAB 3QLTA 2M98A 5JNWA 1SRRA 4L85A 3QLVC 3T38A 5CNMA 3O2JA 3H1EA 2A9PA 4RS3A 4KRFA 4MR9B 2LP4Y 4Z4IA 4YGXB 1A2OA 1J56A 3KYJB 5JS1A 1ISSA 4GPAA 4D6YA 2QR3A 3G85A 5KQPA 3Q15C 3UK0A 4UHJA 1YK0A 3NNNA 2W42A 2RDMA 2WY2D 4RZSA 4WT7A 3HVRA 4RSMA 2FTKE 1E2BA 3NNSA 5TQJA 3NNDA 1NXSA 1OXKB 3K4HA 2MYUA 1ABEA 3NHMA 2QSJA 3GRCA 1MVOA 1ZY2A 3HXMA 1YTUA 1VPWA 5HQJA 1Z13A 4H60A 4IMJB 4N47A 2N9UA 5FBKA 7ABPA 2QW1A 2PUDA 3HK2A 2PJUA 2WMYA 4KQ9A 4Z4HA 2WRZA 3C97A 5FWXB 2WB4A 1SD5A 4MR7B 4YO7A 1QPZA 1DC7A 4RV5A 4MLDA 5JNSA 2PUGA 1GCAA 2RJNA 2R25B 1Z25A 3TX6A 3IP5A 1Z17A 1ZN2A 4RK5A 2IPNA 4N41A 3LUHA 4DQDA 1D1PA 3RVQA 1Z26A 3TMYA 2F8SA 3C3WA 1TMYA 3C6QA 1C4WA 1M5TA 1NY5A 4LZLA 4Q6BA 5FWYA 3H6HA 1DCKA 4L4UA 2A9QA 1DBWA 3N8IA 3HO1A 1S8NA 4MQFB 5TPZD 2FXIA 4XLTA 2NZUG 3N0RA 1QP0A 5KQGA 2YHBA 3KLNA 3O21A 3GA5A 5FBHA 5GOTA 2JVIA 5DCLA 3FFTA 2WWVD 3N0WA 5BRAA 2LIVA 1JFSA 1YVUA 2JBAA 4IMIB 4KK3A 2E4ZA 2QXYA 1USGA 5KC8A 2LBPA 3CG0A 3JS5A 1JYFA 3SAJA 3T8YA 2PMCA 3NHZA 2R47A 2HSGA 3H1FA 3EGCA 3LOPA 3EAFA 3FFXA 4G0ZA 1MAVA 2MYPA 3O2SB 2B4AA 2H3HA 3JPYA 2PUBA 2AYXA 1QNLA 2CD7A 3CRNA 4DADA 2B1JA 4Q6WA 4MAAA 2FQWA 1PNTA 4PE5B 4W5QA 2PUCA 4HYEA 1EHCA 4S04A
chains in the Genus database with same CATH superfamily
5CXUA 4JIGA 1PRYA 1OFGA 3BBPA 4ZZ2A 1RBYA 2YJ3A 3TWOA 2KBEA 3KJQA 2GBLC 2VZ9A 4P2BA 2ZXUA 2WJ4A 5TGDA 5EP3A 2Q0QA 1X8JA 3OFVA 3P9NA 2GKOA 3OU7A 3PGVA 5JAOA 1UPCA 4WXRA 1YKGA 1OBOA 3IAM1 4MUFA 4QA9A 1C8BA 3DE3X 5BNFA 4QOFA 3HH8A 5CB6A 1LF5A 3NBYC 4A3SA 5FLEX 1KEEB 1XZ8A 4X7PA 3BORA 2HTEA 5CM9C 4EO4A 1GUYA 1P73A 3LY5A 4GS5A 4RWZA 5L4SA 1EFRD 4Y67A 2QTBA 1Z4OA 3QXXA 1UINA 1ENOA 2BSXA 3FTNA 5KREA 3P71T 3WDLA 1HTBA 1QKIA 5HSGA 3UMSA 2ZUBA 4N3BA 3ZGVA 5LQCA 4WX2B 1TC1A 4X60A 2CNDA 4RXTA 4U1RA 2XT9A 3M6WA 4CFZA 4BKOA 3ER8A 2IHUA 4YJGA 3STTA 3UG6A 1KI6A 5KQMA 2VJLA 4I9NA 1LRJA 1VXRA 2G0TA 1CIPA 1Z28A 4I9HA 4EJSC 4IGEA 2I1QA 4I9FA 4U2KA 1G8AA 4EHLA 2P8JA 3L1KA 3DF7A 4F7WA 3NLLA 1WP4A 3M4YA 2P3QA 3CH4B 4K9OA 4YRGA 3LPAA 3IEIA 4K3UA 1CE8B 1FTWA 4M1YA 2XD4A 2JJMA 3PP8A 4RLFA 2ZPUA 4RVGA 3WLNA 2ETXA 1TYZA 1IQUA 3FB4A 4G0OA 1GUAA 2VOJA 1GLVA 3A4NA 3QSGA 4URWR 3TOVA 3UNXA 1SBCA 5LFAA 2FSGA 1T3GA 2QM3A 4DLBA 4UPEA 2R6ZA 3ZHSA 1D4AA 1ZCAA 3HYRA 3WLHA 1SQSA 3JQGB 3GLGA 1GSAA 1X1CA 2O2SA 1QH9A 2WIFA 4R1TA 5SZIA 5JAIA 4CG2A 3P0FA 4C29A 1UJBA 2Q50A 2WFAA 4QBKA 4YJ3B 3TL3A 4XWAA 2JCXA 2OL4A 3DCIA 1UFVA 5BPFA 4C7VA 1KI4A 1JKFA 5M5BA 4QO8A 3I62A 3LKBA 1BQEA 2NUBA 4R9RA 4JVMA 4MAMA 1O0BA 4HNAB 2DUJA 3GJ8A 2YW9A 4L8GA 4HWPA 3TDMA 2V54A 4L78A 4BAUA 4YACA 3A27A 1ZONA 5L51A 1KEEA 5HQTA 3BXEA 3KZCA 1JG3A 4FS3A 2Q46A 3I2IA 2WSBA 3M5DA 2AQ8A 5JAUA 3CF6R 1KAQA 3PYLA 1O87A 5HBRA 2O07A 3W1EA 5MF6A 1FFHA 4EGFA 4K0KB 4RZIA 4K9QA 3D5QA 4B4KA 1TEHA 1ZH4A 3W7AA 2PKEA 1RD4A 1U7ZA 3IULA 2FB9A 1OLOA 4G89A 1NRJB 1ZK3A 4QGAA 3NAGA 4QXOA 4QYSA 2IYTA 2GOYA 1GGMA 1FMJA 2ZBFA 2PLFA 3FPGA 5GGXA 5KSYA 1AV6A 1EWRA 5B2EA 2XODA 1JPJA 2BFMA 1EE1A 1XHEA 2PBZA 1R66A 3ZVKA 4D9HA 4I1PA 2BMEA 3CX3A 4R51A 1HG1A 1XDUA 1A5AB 4IQ0A 2QW0X 5H9VA 3WIVA 4UJ5A 2W22A 4C0AC 3G2NA 4NE9A 2R60A 3MGAA 3GVCA 4MINA 5JTUA 2DXIA 1I32A 3WLKX 5IK2A 2I29A 1CE8A 1JSCA 2UUPA 1JIXA 1T9KA 4YJKA 4A2WA 5JAHA 3TOSA 2EW8A 2YYZA 3KDAA 1WNTA 4MWTA 3I01A 4Y9RA 3V8NA 2X42A 2BFPA 2B0JA 2VR1A 5K3CA 1GNQA 3TAUA 2AZ4A 3JQGA 4KIWA 4NBUA 3RRJA 1E3TA 2YHAA 3CQ9A 3L7BA 4L4ZA 1A9ZA 4MV8A 3SBDA 4WRRA 3LA6A 2BELA 1WRBA 4ZPXA 1H2WA 3BQMB 4YJ3A 3LKZA 1H65A 4GSYA 2R8PA 4KXYA 3EY4A 3FKSA 1EK1A 3FNEA 1KVSA 1NN5A 3CWQA 2V7WA 1YGPA 2JA2A 4ZYYA 2H2IA 3HXTA 5AJHA 2W90A 4Y2GA 3QE2A 3DWFA 1GLGA 3AB7A 4HNAA 1L5KA 3SS8A 3QQPA 1YMUA 2Q07A 4LJ8A 1XNHA 4DR1B 5JPCA 1VLJA 3ELDA 1RXEA 3WL6A 2WKRA 1XU7A 1DEAA 2PS0A 3E1KA 1VA4A 4WJZA 4YONB 4BNWA 3EEOA 4FWTA 2OY0A 1EM8B 1R6DA 2D2XA 2XUOA 4LFCB 3AMVA 2WVGA 4TV9F 4P3YA 5LU9A 4TYYA 3LPLA 2C5HA 1KF0A 2GQ0A 4DNOA 4TTIA 4YRIA 4QVGA 3UH0A 2VT3A 3CA8A 4EI7A 4HTAA 3F1KA 2NYUA 4WTOA 1QIIA 3KQLA 2X3FA 2HUPA 2ZSEA 2FEAA 3DUFB 4R41A 4C5AA 1S01A 2C97A 3L6CA 4QNRA 3MQ2A 4YDSA 3VJKA 1YS4A 3G89A 3HEBA 3FIJA 6AT1A 4KR7A 3HJAA 1VYUA 5HFJA 1GTSA 4S1PA 4DDVA 4MX8A 1MB9A 3ETNA 5H59A 2LR0A 3PEFA 2YV3A 5GVSA 3DZDA 1X77A 1DAEA 2R79A 3AG5A 3OCCA 3E3NA 1NSYA 4R1OA 3DFFA 3KEFA 2X4GA 1ZITA 2NM0A 2C04A 3GBVA 1BWPA 3IIIA 3S2UA 3HDJA 1SHUX 3JQDA 4PNZA 4RFLA 421PA 3DDUA 4UATA 1ENPA 4DRZA 1PW7A 1QVWA 2DUMA 3OJWA 4WASA 4XVHA 4BNJA 3LFHA 4XM0A 5C4IA 4HRAA 3EDYA 2XXAB 4S1WA 3AVOA 4IDAA 1DIBA 2PYZA 2P27A 2YRWA 3ZWQA 3RKSA 4HKTA 2K2QB 4ZI5A 1HLGA 2WP0A 2FY8A 1QCYA 4OMFG 1ZGAA 3AM5A 4RXMA 5JQGF 3BH6A 1V5IA 1EUDB 4PHTA 4CCYB 3R9XB 2Q5HA 3FPCA 1HYQA 3I9FA 2HFKA 3L8MA 3R5HA 2VXBA 2UUOA 5ELLA 4LYHA 5DN6A 3HJNA 5CU7A 2IP2A 1NA5A 2CV0A 5C35A 2V6BA 1NJ6A 3KCQA 3ZG6A 5J3JA 1JG2A 3M83A 1QH8B 3M6IA 2SICE 2XDYA 3IMFA 1CP3A 5F76A 3ZZMA 4RY2A 4BDTA 3TFOA 1X1BA 1EM8A 1SC3A 1NULA 2E4UA 3GP5A 2X86A 4PQYA 1NBEA 3E7XA 5CFRA 4TYNA 1S2IA 2JLYA 2QROA 4HYQA 3WAGA 1IHDA 1XCGB 3O3NB 4Q3NA 2ENWA 3K0AB 2VPXA 1Q2UA 3MRXA 4KOAA 3RYHB 4HFJA 4DCVA 2JFXA 1TPZA 4TKZA 4ZCMA 1EZ4A 3DBRB 5D5PA 3DUFA 3GEPA 2G77B 4ZT4A 3Q7TA 3NYQA 4Q3AA 1PEKE 2PRJA 3LCVB 4R2XA 2DWQA 1CNMA 1EM6A 2X5NA 5FRDA 2FRDA 1GQ2A 4RKYA 1RKUA 3C3PA 2G4VA 3BIWA 4B40A 3U3OA 5FL3A 4FJ0A 3W79A 4K40A 2I2AA 2Q4RA 4LDNA 4OQYA 3LL7A 4OHKA 3WP0A 3PIDA 3RARA 1GPMA 2P5UA 2ZBRA 3UHAA 4OD0A 3G8BA 1RWBA 4BFYA 2V7BA 3KS9A 1XEFA 1SRQA 3GLQA 3OFKA 2EWVA 4BQIA 5LNK1 3RUCA 3M0EA 2DERA 4FQ8A 4RO0A 2IYZA 4WUVA 3WWYA 3QLEA 3FAKA 5G0UA 1Y1SA 2J5RA 5ED0A 2XXAA 1Y8QB 1RLTA 3PQ5A 3L6BA 5KNDA 3FWNA 4TROA 5FI0B 4HVCA 4L8LA 2HL6A 3OESA 2F43B 2QL7A 4GZLA 2AC4A 4H3VA 3R9XA 1IHPA 4CCYA 1EUDA 4Q05A 4TN1A 1ISPA 5DDIP 3KZNA 4K86A 5JNUA 6YASA 3VKGA 3CSUA 1CZRA 3O8NA 3SVLA 4KSYA 2D2EA 2OHGA 4AG5A 1M1NB 1AKEA 2Q1YA 3G23A 3LBAA 1KO7A 4YPFA 5GIPE 2E2WA 3HXQA 1QH8A 1SBIA 3CVVA 3OKAA 3DMFA 4C0JA 4QE3A 2CKDA 2ZREA 3KZXA 4ACBA 4ME6A 3KL4A 5JRJA 2WZDA 4F71A 4YC7A 5KVVA 1MXHA 1JPUA 1A9QA 5EG5A 3ZDZB 4JI4B 1ADGA 1K6JA 3NT2A 4QOSA 4QULA 1LDGA 2A7XA 2H7XA 2AG6A 1OXUA 4W63A 1K68A 3K0AA 3KVRA 1ZD1A 3W5UA 4CIWA 1N9KA 3RYHA 2ODBA 4XWKA 3PF9A 2KYRA 1L7XA 3F96A 3IOCA 4P7GA 1U0BB 3DBRA 2QSYA 1TW2A 3ZV6A 3G2QA 2NSHA 3MGKA 2M1ZA 1WY5A 4LXQA 2IV3A 5JAZA 1WVMA 1E8DA 1O89A 1PD0A 1R9MA 3CLVA 3TOZA 4HGOA 1T1RA 3TYXA 5I01A 3MTGA 3UH1A 2GLUA 5IK2D 4L5AA 2CVPA 2ZDGA 4E5DA 3VDRA 4PO9A 3ZZTA 1JHMA 2YVUA 3MLAA 1Z4NA 2GT1A 3H9CA 3S5UA 2D5AA 1W88B 3NWPA 3PUJA 1BWQA 1GFWA 1QYWA 4IVNA 2XLBA 5DHPA 1ISHA 2RK4A 4JC0A 3AEXA 4YRTA 4REMA 2J4DA 5BWMA 2XYRA 1FFYA 5CEJA 1TJ3A 2OC9A 2IUYA 1OE0A 3C6ZA 4XDYA 4BAZA 2E5WA 1P4SA 3GHHA 3TLMA 4DC1A 1Y8QA 2G1PA 3KK0A 3JQQA 1L5NA 4HDQB 4J16C 1F9EA 4QGGA 4D3SA 3GJ6A 1PFKA 3ZJ5A 3IV9A 1F9AA 2RKWA 1T9CA 5A4AA 2F43A 3FKSD 3NIDB 4MYUA 3NKLA 1DEKA 5HKAA 1EXNA 5JH7A 3C6YA 3PHCA 3C5WP 3DYBA 3U80A 3ZCQA 4XZ3A 1QCCA 3H86A 1QLHA 1M1NA 1PGOA 4AK9A 4QPNA 5BNZA 2VDOB 2Z9DA 4S2EA 5K0FA 3K1ZA 1A95A 1R6XA 3LPDA 2JG3A 1FDUA 1AGPA 3ENWA 2J3EA 5FWYB 1E0DA 1LC0A 2VJQA 2CZCA 3L7KA 3RI3A 3SWWA 3HB4X 1SKMA 3QEJA 3MTDA 3H9GA 4Q9JA 1XALA 3PXAA 3KR0A 4G3XA 1I3KA 2P6NA 3P27A 3RF6A 5JO0A 4XARA 4ZMBA 4ESVA 3MJCA 3SHOA 3BAFA 1YUNA 1XCBA 1JR4A 3WRXC 3QBTA 2XNSA 1HTTA 2X14A 3R9IA 3ZHRA 4J43A 1LK0A 4P5DA 2GA8A 3P2JA 2O2CA 4X97A 5LOVF 1EK0A 2HHJA 4I46A 1GTRA 1VMIA 1E5XA 5CVDA 5JHHB 2O7QA 4OFBA 1YSCA 2VTBB 1JAYA 1RQXA 2RH4A 3TDKA 3VU0A 4G1BA 4GPAA 5CD1A 1RT9A 2HK7A 1W88A 1CQWA 1F8GA 1X2BA 1YS9A 5B30A 4GPTA 3TEJA 3ZNOA 2IC5A 2E48A 2H7YA 1I33A 2IXAA 3A8TA 3MTEA 3X3HA 1LEHA 1QBGA 4JJKA 4CEHB 1ODLA 1T13A 4I3GA 4DIUA 1PJRA 1PJ8A 3WWDA 1KAMA 4E22A 4TYWA 1Q44A 2W2VA 5FX2A 1QFXA 2FFQA 1SIWA 3GRCA 1Q0TA 5IM4A 1H5NA 4TSKA 2HQ1A 2GO7A 5IVKA 2WSIA 2QUJA 1TC2A 3NV7A 5FUWA 2IXDA 2NV0A 2I91A 1EZZA 1VLVA 2Q5JA 4EPTA 3JARB 2P5YA 4DCCA 4KL8S 4J7UA 4YRAA 2XMZA 1GTG1 2HWWA 2JAQA 3C7CB 1XZEA 2RHMA 3QUQA 4IO1A 4MGIR 3OC0A 2EBUA 3QXCA 3R9KA 1J2JA 5DN6D 2XGMA 2I3ZA 3LX6A 1RAAA 2IK8A 3QBJA 4DQDA 2ZTVA 4Q7QA 2PH5A 5T64A 3C3WA 1CUGA 4X61A 5K3FB 5HTOA 2AOXA 2GESA 3T4PA 1DKNA 5FWYA 2NUAB 3DT9A 4HL6A 4ROTA 1N32B 5KTOA 3KE9A 3HO1A 2IEDA 2ODEA 3ZWYA 1XXHE 2Q3EA 5HFNA 3C3XA 3AERB 2R87A 4U0KA 2FFAA 4Z54A 2YXBA 1QG2A 1C0LA 1VLMA 1ZGCA 2AC2A 4WH0A 4C7OB 4IM7A 2HA4A 1C1YA 2PA3A 1WJGA 2G9UA 3EOZA 3L04A 4IDCA 4TQGA 2H2HA 3G0HA 3F7OA 4TT3A 1QWOA 1ZOSA 3SYRA 2NU9A 4B71A 3AEQB 1G0NA 3ROXA 3ZEIA 2VBCA 4FQ7A 1JJ7A 1Z06A 2LZ0A 4TLEA 1V43A 2VTBA 1DWUA 4IIJF 2IYAA 2WSSA 2NUTA 3TNJA 3K6RA 3IBFA 1FMFA 3W5DA 3R7WB 3ZU3A 4ZVLA 1DEOA 3RASA 2AYXA 2QRVB 2B1JA 4CEHA 1NZDA 1UPAA 4HLQB 4M1SA 4UMDA 4HQ0A 4WEOA 4CI0B 1XF9A 3PXXA 4W5HA 4AN1A 3IBSA 2ZUUA 4Z51A 5KNDD 3K9NA 3T1YB 4B8WA 2M6SA 1E1YA 2ZS9A 4FZJA 1YDGA 4BP3A 4PNEA 1NPTO 2HX1A 1E77A 4LHWA 4D8XA 1XRJA 3JARA 4C30A 3P94A 5IC6A 2R7KA 4FIDA 4TKVB 3I6IA 1MJNA 5EY5B 3GUUA 3GQBB 2PPLA 1B8PA 3NS7A 5DTQA 1FOEB 1M33A 3IB3A 3H6GA 3M6FA 1N1GA 4P3KA 3UG7A 1VJRA 2RH8A 4FDLA 4X84A 4GNKA 3RS9A 1CRWG 5CW2A 1Y98A 2Y1OA 5K3FA 3ZWWA 3LUJA 4ZO8A 1ZR2A 1Y34E 1MZVA 3HBMA 5FJJA 2C4TA 2NUAA 3D31A 3M3HA 2JRLA 3P0EA 2QUBA 2JLRA 2Y1FA 2B25A 4OBBA 3W7VA 1S5PA 4NPCA 4YQFA 4G4JA 1RMTA 3AERA 4MEAA 1KZ9A 4DLRA 1RPTA 4FYMA 1PR9A 2XYQA 1X70A 3ETDA 1MU0A 3HJHA 4FM9A 1JI0A 1SVUA 1GTVA 3LQRA 4B45A 4P8RA 2ZI5A 1UK9A 3GRPA 2ZRFA 5FA8A 1CJVC 3ND5A 2IWHA 3STUA 1W4BA 4B4VA 4V1CB 3HCNA 4H7DA 2OZLB 1C4KA 2VXYA 2FRVA 3DL7A 1XGKA 5AM0A 3AEQA 3JRWA 2OCYC 4B32A 3AZPA 4TSRA 5ALDA 2A59A 4CQJA 2UZAA 2G67A 4IZ6A 4MRSA 4TWJA 4IH4A 3F97A 4NOMA 3EZ9A 2R1VB 4MWDA 3R7WA 2NW6A 2XECA 2PGOA 4IPTA 2ZJYA 1WA5A 2QRVA 4FC6A 2GZSA 2ZRKA 1P3DA 1OF1A 1UDCA 1R7RA 3H04A 1ZD8A 5FQOA 3FD8A 2BE7A 3NJRA 4RKQA 4WK0B 3RTEA 4F3CA 1JDZA 3OH8A 1PFUA 3ELBA 3ZS8A 1ZAYA 3D7NA 4NLLA 1I1NA 1R4NB 2GHTA 1YQWA 2NT3A 5ESDA 4QATA 2P2LA 2C8KA 4NESA 4TN5A 3ROEA 5SY9A 4E12A 2VK2A 1CR6A 2O7SA 3GOQA 4JGBA 3FJ1A 5FWAA 5B53A 5KOHB 3CFYA 2OGZA 3PI6A 4M9UA 3ZQUA 1RM3A 3K72B 3QXSA 5KJFA 1MB0A 3ORRA 3PUXA 4PS0A 1KWGA 5DU2A 2HJGA 3MQ4A 5CLFA 4TKVA 4R9SA 1CDEA 4IDGA 3GQBA 1UDBA 3BE4A 1EVYA 4BGVA 2HU7A 5F7ZA 3FUUA 4FYXA 2JJ1A 5JYEA 1TMGE 4JBHA 4YCSA 3R20A 1QO0A 2IZZA 3AW9A 1EFLA 1PLLA 1RYBA 4OFXA 3KQVA 3HZRA 2ZS8A 4PZCA 1E9BA 3ROFA 3UXYA 2OCKA 2I7TA 4Q1VA 4WBNA 2WTEA 3ODPA 1ZCFA 2FN8A 4HEA6 5C52B 4WLUA 1DRJA 1N6OA 3EWIA 2B1QA 4GRDA 3LUKA 1RHQA 3M6AA 4BX2A 3IP6A 3NBUA 1M2JA 2H6EA 1OFTA 2NO1A 3GJ0A 3TQOA 3V2GA 2AJLI 4B2YA 1YQXA 2A3RA 1PL8A 2PIAA 1H9AA 3INNA 3V8EA 1FPMA 2QYSA 2W93A 5BSEA 1T34A 2NU8B 2OZLA 4NL4H 1SFRA 4F21A 1BXGB 3BK1A 3K7EA 4G4SP 4PG7A 1IBKB 3HRKA 3I61A 1ZIOA 4U9UA 3FXAA 3IQWA 2AUTA 2A88A 4KN6A 5DIFA 5FADA 4EY8A 4F5ZA 5LYJB 2DYKA 3OOSA 4LNUB 1NMQA 1U2GC 4PCLA 3SJCA 2PEYA 3U7QB 2R1VA 1M7BA 3JYNA 4UEQA 1EHIA 3BHJA 1A7AA 1TF7A 2LUOA 2OBBA 1QPGA 1TCAA 2YJZA 1ULZA 3B85A 3LSTA 5G3ZA 3QKTA 4DLZA 3HCWA 4M99A 3HXPA 1Z8NA 4RYLA 5COQA 5GWXA 3LK6A 5K09A 1MPTA 1Q7RA 1ZSVA 1QHHB 3O8CA 3VGPA 1H1DA 2QNBA 5MN5A 1R4NA 3E2IA 1Q50A 1UBSB 4Q66C 5F35A 1ZI9A 1KDYA 1FBTA 1PSDA 3O0DA 1MNAA 5KOHA 4H6VA 5DLDA 2MOKA 4HNQA 4YJ2F 4PX2A 4E51A 5CHYA 3LHDA 4AYWA 1JZTA 4L2IB 3WWCA 2EG5A 3L5OA 3TF5A 1OWNA 3VDMA 5C8YB 3LMKA 4YPVA 1CJCA 1R6VA 1E2UA 4FZRA 3JASB 4F5YA 1F48A 3HS3A 3AKDA 3GLIE 5LQKA 1JBKA 1GSHA 5EQFA 1AS2A 1DIHA 3PV0A 4G0NA 4ZYLA 1FP4B 3VKVA 1TX4B 4Y0VA 2FMKA 3DDCA 1P2TA 4UULA 4BO3A 2H2DA 1AF7A 3L6UA 1DZ3A 3Q2KA 1K3FA 3PT5A 5IMBA 5FPHA 3C8UA 4XQCA 3V7WA 4IZOA 2AEFA 1LFAA 2FLVA 4JB3A 1QP7A 2FZEA 3QMPA 4CNBA 2WIGA 1HPLA 1YMVA 2QD1A 4MULA 4WHMA 1G5IA 3MRTA 3CS3A 1PWXA 4KLRA 3CRRA 1TDJA 4L8FA 5IKOA 1N2IA 2Q62A 2VPPA 3IC5A 1Z0ZA 1GWNA 2HK8A 3IUQA 1PBTA 1ZH8A 5A7GA 2R97A 4MP3A 3L1VA 1A9TA 1Y89A 1UFKA 3S7TA 1GIAA 4EGAA 3ADCA 4TRRA 2YY5A 2NU8A 2CKMA 2L18A 2EL9A 4GDFA 1BXGA 1UEIA 3BT7A 3MHPA 1DV1A 4TT3D 3REGA 5KNCA 1EFUA 1IEQA 3C7DB 1H3EA 4OL9A 2XZDA 1PJCA 2AN4A 2OENG 2AE2A 2H5JA 1DG3A 2WLSA 2OORC 5LYJA 3TN7A 3PFBA 4LNUA 4E46A 2OYCA 2GNOA 1II0A 2WSSD 1IU9A 1TIBA 2XZPA 4JLJA 3LGXA 3U7QA 2EX4A 3ET5A 2H9AA 2BFCB 1IAQA 1VHDA 2QLMA 2CLSA 3KVVA 1MVNA 1W19A 4GPZA 2WA2A 5EVJA 4D4KA 4K81B 5FEUA 1P3JA 4OG2A 4Y2UA 3BX1A 3BDAA 3R09A 5BWNA 1QHHA 4EBBA 2AUMA 1DAMA 4P58A 5AHXA 1EX1A 3FCYA 5JPDA 1W4AA 1I7PA 1WZUA 5DYIA 2NO9A 5AK3A 4PZAA 1TF2A 1NU6A 5L7YA 1H2RS 2HMSA 1OIWA 3FGPA 4WY8A 3VH1A 3W9SA 5JTTA 2PD3A 1FDVA 2XVMA 2XMGA 4L2IA 4BTLA 4EQZA 3OY2A 2PZKA 4DILA 3IAAA 1WQ3A 1ORHA 2GRAA 5C8YA 4LVCA 2W6IA 4B44A 2H1IA 3JASA 4A26A 4RD3A 5AR1A 3T0IA 1R18A 1CUHA 3MB5A 2B8NA 3WL7A 3IQEA 1LPMA 3INTA 4S0ZA 2D62A 4QO7A 5AHKA 2V7VA 1C4XA 4TMTA 2WR8A 1S6YA 2IEAA 3RVBA 2JEYA 3WRWA 1S4QA 2B7CA 2NAFA 4XUCA 4ZMRA 2ZW9A 4CF7A 4AJIA 5IWCA 1JMKC 3H16A 4LRUA 1NG1A 2WE8A 2EGHA 2P9ZA 4C6RA 4RLQA 2HV8A 5BSMA 1FQJA 3U6BA 3HCCA 2GBFA 2X8WA 1GPH1 5AKIA 3KOXA 3HVUA 2I65A 4TZ0A 1XWWA 1P17A 1RWWA 1Z45A 4C7OA 3A26A 1TCUA 5JEEA 3D4BA 4EY4A 1X2EA 1GDDA 5DNWA 5IARA 1Z5UA 2DJ5A 4MS4B 3RFUA 2AZMA 1C9YA 1KDOA 5WRFA 3OFSA 5DCWA 3GUVA 3H2ZA 1ZU4A 4X8LA 1XP5A 1SWVA 2PMKA 3GDOA 3BB1A 4IBOA 3A4MA 2IIQA 3RRBA 2PR7A 5CYPA 4LUCA 5AQEA 1AQUA 3ITEA 1VP9A 4MRPA 4F4FA 4Z1MA 4D9FA 2BFCA 4XLZA 4YREA 2IXBA 1N6HA 2GCOB 3HABA 2RGWA 4TTSA 3DEHA 3JV7A 2W2LD 2R4QA 3BWDD 2O0HA 3GL9A 2QIPA 2VRCA 3QPDA 1THGA 2TS1A 3BWVA 2DWPA 1XTQA 4MW4A 6GPBA 3D02A 4L0CA 4P53A 1KZ1A 3QE0A 3T3HA 1E2DA 2CXXA 2LD4A 2JFVA 4TRMA 5EE3A 3ZE8A 3EGVA 2R8RA 3SJ7A 1JEQB 4EMTA 4N0PA 5CFNA 3EPPA 2BDEA 3O6VA 1OT3A 1SKYE 4BNZA 3RK4A 3CF0A 1USWA 3NETA 2YC2C 1XTIA 2VCEA 1IK4A 2PS1A 3EAGA 4ZK6A 4QBIA 4KO8A 2NZXA 5AVQA 3O9MA 4DWVA 1K5GA 1K8RA 2JJ1D 4QZVA 4A5SA 2XDWA 4Y6QA 1QO0D 2VJAA 3TQSA 4UUNA 3ZQJA 2QMYA 2I71A 4LS3A 4Q82A 3O2NA 4DSTA 2Z95A 2PLWA 4NSNA 4JJAA 3AB8A 1FVHA 1ODKA 1JW9B 2FQYA 1JFLA 1UJ2A 3JD3A 1D3AA 2P2GA 3KLBA 1N8KA 2CXRA 3TFQA 2X6RA 2OXCA 2XKAA 5LC1A 5DK6A 3R4CA 5EJ5A 4RIIA 1WOYA 3QYAA 2OD7A 4QNMA 5A05A 3QA9A 5IKXA 3OIUA 3JWEA 4MS4A 4YLGA 3V1NA 5KQRA 2JIRA 1ZW6A 5EIOA 3SC4A 1BXZA 2GJKA 3DPIA 5KINB 3ESXA 2Z6VA 2IOFA 1QVRA 3GT7A 3KSBC 2AXQA 4GLBA 3VRHA 3WHLA 4DFDA 4XR4A 2AXEA 1TYAE 1HYEA 1NT4A 2HLNA 4E03A 2NP7A 3RYIB 2JF0A 1MR3F 2N47A 2HMWA 3L02A 2P2SA 5CLIA 3G0IA 2GCOA 2WSMA 3JQ6A 2HRQA 3O83A 3I4FA 2XCSB 1DRVA 2H0AA 1PK9A 4NBWA 1B14A 1YIAA 2HLPA 3F90A 5K20A 1U3FA 4LMPA 1PWYE 3DG9A 2C94A 4UBJA 1DTWB 1J2TA 3C6XA 1TA0A 4BP8A 3MA0A 2AR0A 5C1PA 3DJFA 4WNAB 4B4OA 1EGMB 2A67A 1JR3A 2WK1A 3W3ZB 4F97A 1Y4DE 1JEQA 2X6QA 3IIEA 1IVNA 1PGJA 3ODGA 2EOAA 2GHRA 1ZO8A 3W9BA 1QH1B 1TEVA 2KB0A 2GVNA 3GEEA 5AJXA 3PENA 4KXUA 3I05A 4PAMA 3U0VA 3B7GA 3CUYA 2VAVA 2WT8A 3NW9A 4YI3A 3CVUA 4I55F 2HU8A 3P0IA 1YF3A 4EWLA 2B4TO 1KH1A 2GN0A 3K1TA 3COJA 1IH8A 5FT9A 1CFJA 1C2TA 3HFGA 4NONA 1A7JA 3HUEA 3O26A 3UXHA 5HP4A 3R3SA 2HM7A 5K3BA 1ZX1A 3IRUA 4Y3UA 1R4MB 2ZVDA 4I5IA 4C5CA 1QE5A 1V41E 2V03A 1MP0A 3G9UA 1G3UA 2V58A 1P1FA 4KN9S 4ZI7B 2Q8NA 2VTDA 3E3MA 3W5IA 5BURA 5LLDA 3GJYA 5ALLA 3NIFB 1R0BA 4J2OA 2OFFA 5KKCA 1N0IA 4FFPA 4WBSA 3T7IA 2YVAA 1A71A 3ED5A 1ADBA 2Q3FA 1ZGHA 3JQ9C 4EUNA 3SZRA 5A6VA 1YZUA 1RVV1 1V3QE 3PFKA 3U9TA 2AKAB 1J56A 3PQ7A 4CKEA 3NGXA 4DQVA 5KNCD 2JHGA 5K0ZA 3FIUA 2I3DA 4B3GA 2WF7A 3BJRA 1MH1A 1FCJA 5CH8A 1XA0A 3BULA 2DHQA 5LKAA 4P5PA 3RYIA 1UZNA 4IWXA 5JCOA 1GA6A 4EMBA 4NATA 1H1LB 4WT7A 1KR2A 4JUCA 3GFPA 3F74A 2YYAA 3QHPA 3V00A 3DFKA 1V4BA 3B38A 4UW9A 4AN0A 2VSNA 1UOPA 1U3UA 4I50F 1NKVA 1G9TA 4TRJA 4UAVA 4GF5A 5K6AC 1UZUA 2AJTA 1V45E 2N9UA 3QVGB 3IBYA 4QUEA 1NMXA 1DTWA 2PJUA 3BN3A 3GVIA 2WRZA 2QSZA 1Y3BE 3K8ZA 4WNAA 3BGOS 4Q34A 1I01A 3GAZA 3KQSA 5ALYA 2FX3A 4F3YA 2H48A 2YICA 1OQAA 3TLCA 4JLKA 1N9ZA 4HMQA 3PPVA 2OD9A 2DMRA 1QH1A 1Z17A 1ZN2A 1I2MA 2W6ID 2WA1A 3LF1A 1OJ7A 4QOIA 4XUEA 5J4HA 3CVYA 4EI9A 2V1UA 3UJPA 4N41A 3G2JA 5HDBB 1OWLA 2FHSA 1MAUA 3PTLA 1I36A 3HA5A 3KVNA 1KAEA 3WS7A 1IJFA 1H22A 3OICA 3WGGA 4LI3X 1BGVA 1K6XA 2FE1A 4RLHA 2CDAA 1BJTA 2EBHX 1QK4A 2ZIAA 4NU5A 1USVA 4N5LA 4F6RB 3UJNA 1U5CA 3EUWA 3VR5A 1R4MA 3TLAA 1VJGA 2FXIA 4XE5A 2YRXA 1G5HA 4ZI7A 5FBHA 1ZM9A 1W5FA 2MU1A 2RARA 5GOTA 1OXXK 4JGGA 2B9VA 5F3WB 1K7XB 2XZLA 4H15A 2LIVA 4G09A 2YV4A 1TYEB 4UCXA 2C4WA 5AW2A 3EC2A 3ABQB 3JQAB 4JP8A 4MVJP 1XI2A 4JEHA 3L7DA 1I94B 4KPFC 5A3JA 3CG0A 2G5TA 5AW6A 3EH2A 3IYLW 2ORED 2PYIA 3UTCA 5JC8A 3JCZA 4UXHA 4G0ZA 1FDSA 5P8WA 1PV2A 2MYPA 3KHUA 3QP9A 4L72A 4YYZA 1OMOA 5B6IA 3ULKA 4PNPA 1OREA 4BC1A 3ACDA 1TRKA 2O1WA 3H2JA 3ZE9A 2RH9B 3DEIA 3AEKB 4TL8A 4FR2A 2AMLA 1WXDA 1H1LA 3BZBA 3IDAA 1H2YA 1A50B 2DWOA 1JV2B 4Z1MD 4NRDA 3N8DA 4DA4A 3VU3A 1KYVA 3WZLA 3VSEA 1Z7BA 3FJYA 1KQPA 1VGVA 1W49A 2C2YA 1X0VA 2M9MA 2VRCD 1UXIA 3BGDA 3AP2A 1AUQA 1FY2A 3QVGA 1T8WA 1Q84A 3I37X 3ELUA 4A0FA 5CXQA 4FCVA 3EXHC 5EMKA 4BKRA 1YDMA 2ECFA 1SC1A 2FGKA 2QM7A 4GT1A 2DKOA 4IAOA 4N8SA 5DGIA 3WLSA 3SDBA 2YN2A 3FNRA 4ODIA 2WAXA 2BZ0A 3DEZA 1XPRA 1A4IA 5HJEA 4ZO4A 3R76A 2ZRCA 3U40A 3GD7A 2GAAA 5SV2A 1HKUA 3CVJA 5KKAA 3SJZA 4P4SB 2H54A 1NBAA 2Q4DA 1ZK4A 4ZT5A 1OI4A 4I19A 2YV5A 3H5AA 3SKVA 2BKEA 1JFVA 2CHVA 3JQEA 3CX6A 4F6RA 2RGBA 1XTZA 1KZ7B 4B6GA 1J6UA 1BDMA 4B5KA 1LZLA 1GYPA 4YR9A 1D6JA 2ZJ1A 2VT2A 1SXJC 3K4QA 3MHTA 2VOEA 3B3QA 3G0BA 3FM9A 2PQ6A 1N34B 5KJ1A 4JH0A 4J9VA 4Y2RA 1A9PA 4P7BA 3FNHA 3JQAA 3SGLA 3ZV3A 3L1IA 2ZJOA 2GRUA 3MPUA 4YP0A 5GZ6A 2IH2A 4KDCA 4CMBA 5LZ9A 3PXGA 2BGKA 5GM1A 1U1CA 3U09A 3NTXA 1IHYA 1NXVA 1M2GA 1DEXA 4NE2A 4L0MA 1JQ3A 1I7QB 1BCSB 3C8DA 2FWAA 4EGSA 2YJ5A 5ADUS 1JHPA 3IBTA 5HRAA 2W2PA 3WG9A 3AEKA 3H5IA 4D1YA 2Y4OA 5L6MB 1DRKA 3KLMX 3WMRA 2V9PA 5KIAA 2ZZMA 3WGJA 4BATA 2C7GA 4MITA 2QUIA 2ZIFA 3CLRD 1U02A 2AYZA 4QGHA 2QPTA 1F38A 3NHYA 3PX2A 3OHPA 4PZ9A 5FYDA 3CIFA 2WWHA 3U3JA 1U8ZA 3WYBA 5LB4A 2FW1A 2HWYA 4J7XA 4EW1A 1QIJA 3ZWNA 1JR3D 4EX7A 2GK4A 5HGXA 4HG2A 4RXUA 2HBRA 4TMVA 1V8DA 1QGDA 5DXAA 4YRJA 3L0BA 3PNQA 1L1EA 4BJ5A 4XEHA 2CCJA 4MV3A 4PGFA 3VMMA 3WOVA 1ZR4A 4P4SA 2BFBB 2QRZA 2BGUA 3LVQE 3O2QB 3N8NA 3H5LA 4HY3A 4KDEA 3TZBA 3V2UA 4ZCPA 2AEEA 2HRBA 2HW8A 1E20A 3AONB 5FJIA 3S44A 2Q6TA 5FPQA 1F2DA 1WPRA 1U9YA 3C6BA 1E64A 2ZT5A 5A3VA 1QKKA 2D13A 4CFSA 4R05A 4HZUB 5BR7A 4Y8VA 3GJZA 4WVFA 2GWHA 3QUSA 4B34A 2ZITA 5T4HA 4EGJA 3AR9A 4N8DA 3T5AA 1I4OA 2AJBA 2VSQA 3RVLA 4BNIA 1PS0A 3V1KA 2O6HA 3FRJA 4J1TA 3ZD9A 3HV2A 4BGEA 4HVLA 5IZCC 3A1FA 4GPD1 3N39C 5LSAA 5LN1A 2DY0A 4D3XA 5KNBA 2V55B 3PNPA 4JUDX 5FWDA 1MGPA 4LX8A 3TTVA 2IY9A 4FOLA 4RIFA 1JKJB 1B16A 5E3IA 4DBZA 1BCSA 3QPUA 4R83A 3V1MA 2A4KA 1JIQA 1TJNA 3IR7A 2ZIZA 3EIWA 1NC3A 2CUTA 3PBKA 4GW3A 3ZJVA 1Y1QA 2UVQA 4HD8A 5IHPA 4IDBA 1Z4KA 2ZUWA 2QTAA 3MS7A 3PJGA 1HQYE 4J4BA 4I4TF 3LL4A 2O23A 1KDTA 1KU0A 1SCJA 4WNIA 2FWRA 3B1ZA 2G71A 2XPCA 2O8BB 1MX1A 5JFOA 5LQMA 5IDQA 2HFJA 3S99A 3DW3X 3UV6A 4HNTA 1O08A 2FOLA 4JDUA 3OP4A 3VR4H 3AJAA 5IHXA 1FJ2A 2F8TA 1LJ8A 3DXZA 1WDKA 4B4DA 5TS2A 5BOSB 3RAGA 2BMDA 3H3XA 1FUUA 1ZSYA 1NTRA 1VJ1A 1AHPA 2PSHA 2ZPTX 2GGSA 3N05A 4Y6RA 2BFBA 3N8HA 1PP4A 4GHWA 5FNZA 4WY5A 3I6MA 1T8RA 2YOGA 1KEZA 1QKJA 4YWHA 3ZNQA 3ZH9B 3OZRA 2NTEA 1JG6A 1N6RA 1XZDA 3PFFA 5ERXA 4Z4QA 5AIAA 4N7MA 3VR5D 1THZA 1ECPA 3NVDA 1RSZA 1QV9A 2O2DA 3SPXA 1SKUA 1T4DA 3GH1A 3ZZNA 3A4YA 4LE2A 4D41A 4HZUA 4BIMA 2WZQA 4YPOA 3EPKA 4TQAA 4DSNA 3M5CA 2FPPB 4B3JA 3OZWA 2J9XB 5EFOA 3DNMA 3ZDAA 4MQ6A 3OP1A 3GEDA 5DP2A 3WBKA 1LLFA 4MUHA 2Z6UA 3DV2A 3OWHA 3M6MD 2RONA 2CY0A 3I83A 4K9MA 2CCKA 3EVDA 1MAWA 3FZEA 4CJXA 2Z3VA 1C7EA 3TCKA 3OO0A 1EQAA 3HP1A 3TUIC 1KQGA 1DC4A 2ZYDA 4AFNA 3F98A 3C4VA 3DOIA 3IUYA 2QUAA 3FZQA 1CYDA 1HLFA 4U7HA 1FIUA 4FNAA 3WK4A 1Q22A 2V7GA 3ANYB 3DKIA 4U6SA 3SDSA 2ST1A 4HB2A 4BMYA 4GKKB 4J3JA 5JI2E 3Q6MA 4UM8B 4A9AA 4L9SA 4Q3LA 3FTFA 4U5XA 1QG4A 4IHJF 1C14A 4RMHA 1MX3A 1RXYA 1MT3A 2PPVA 3WZ2A 2FPLA 2WG0A 2O8BA 3CLUD 2CLIB 2IDKA 1P9NA 4R69A 3OLVA 5DNCA 3VH3A 2NV2B 5LZ7A 2P5TB 3FDZB 3HY6A 4EA8A 2Q7DA 2FK7A 1SUIA 4FFOA 1DNPA 2G4LA 2H4JA 1JDJA 4ZARA 3ICEA 1Q0LA 4HQLA 2CMHA 2WF5A 5BOSA 1GFIA 3TM5A 1K0FA 1TT5B 2FETA 4RFVA 5KWEA 5LDHA 2AQHA 1SB9A 5CM8B 2DULA 1U2RA 1NW8A 2I8CA 3F6BX 5ESXA 5TPZA 1Q0RA 3D8BA 2H1WA 1WG8A 4MKRA 3V80A 4NDNE 4BO5A 4CCWA 4F4DA 4JNCA 5CFOA 2GKGA 3KVYA 1L7BA 4OUKX 1B4DA 1E7SA 4FDVA 4JI0B 1PJAA 2AX3A 2Q28A 4K0RA 2C3YA 4ICIA 3WOHA 1ZICA 2PZJA 4MV0A 1V48A 2NT4A 2R6DA 4ID9A 5F1YA 3TLGB 4MUKA 4CL2A 1V71A 4M0PA 4WZAB 2FPPA 3BFJA 4LQCA 4PG5A 3FYUB 1VYVA 1V8FA 2FR8C 1H8EA 4IDHA 4JZYA 1T1EA 2ZFUA 3JQAD 3TCXB 1RYDA 2PBRA 1N3YA 4FDMA 4G56A 4QVIA 1FQKA 2FR1A 2PWAA 1BJKA 1J5PA 4DJAA 3AF0A 5ITSA 1PNQA 3D4LA 3VR6A 2WJZB 4IUCS 1FLDA 1G6HA 3LKVA 3SC6A 1AD2A 2QIOA 2HIAA 3LXXA 2FW8A 4M1MA 4RVOA 3WNCA 1JQEA 4IHAA 1VA5A 4ZVPA 1HFKA 3D2BA 1SBNE 1DJNA 3LVBA 3IURA 2OZEA 5CB4F 1CZOA 3QOXA 3U4DA 1EVQA 1L7NA 3ZK7A 3FPHA 1NJ5A 3D3NA 3GH3A 3JZDA 3DAOA 4MV6A 4Q21A 4L5YA 4WOCA 2EDAA 2VK4A 4UVGA 1DT5A 1TT7A 3RANA 1HETA 4CUJA 2JARA 1XRPA 4G5GA 2H1SA 2H00A 4WZBE 1E3DA 9LDTA 1ZJ5A 1VSBA 1XTSA 2R00C 2GFHA 3H2HA 4EHJA 1OH5A 4IGFA 4QLAA 3SHVA 3FDZA 4MVJE 3C1AA 4GBMA 2VF8A 3H5OA 2GHIA 3ZHCA 3D8RA 2TMYA 3BWMA 3B6ZA 3VVMA 1Y6FA 2CMKA 3UMMA 1TT5A 2FXVA 1VMEA 1DC5A 2YINC 3OOJA 4O4IF 1YE3A 4RELA 1WCV1 1N0UA 1N2CE 2I2FA 3HKDB 4L95C 3C4QA 1FNNA 5DM0A 2DT8A 3EHEA 2XCQA 4PEVA 3UOGA 4UU1A 1IZZA 4D9CA 5CA1F 2PZFA 5HGJA 4RQAA 1ZUD1 2C3UA 2QRQA 3FB1A 3NEJA 1RXVA 5J4LA 1MQ8B 2XBMA 4MR9A 1LDBA 4C22A 1UL1X 3C39A 5BT9A 1GTZA 2AF4C 1ECFA 4QDUA 2E4XA 2HHAA 5DGCA 5BSRA 2Q5FA 3WB9A 3TLGA 4FB4A 3KSRA 2O5RA 5GAJA 4WZAA 3UK2A 4BB5A 1Z3IX 3FYUA 4GVXA 3R75A 3ZJUA 2EZ8A 3HWX1 5JSQA 3VZDA 4H9GA 3FMVA 1FSGA 2HTFA 1RKVA 2R2AA 3NOQA 4RJJA 2UUCB 5KNBD 3A1SA 3WMXA 1ARZA 4OYRA 4B87A 1LVGA 3OZCA 4LF4B 4DLUA 3KTAB 2F3TA 2C1ZA 1FDTA 5JXWA 3MGCA 1IUNA 4WMLA 1OAOA 4IRUB 3SYMA 3LHSA 3OMXA 2E1RA 1EK5A 4NU0A 1O9BA 1NXTA 4GVLA 3SE0A 4DEYA 5K5EA 1YKSA 2XGOA 2OHJA 1XAGA 2Z2JA 3PGA1 1G3QA 1V35A 1F2VA 2F8LA 2R6R1 4WNYA 2EBFX 1IZ0A 4LISA 4Q1CA 4PLGA 1QO9A 4DJEC 2HU2A 4MHTA 2E37A 3TR6A 5JMPA 1CP2A 3GLRA 1A8SA 5ES4B 4BMCA 1ZESA 1P1IA 3QUAA 5I9TA 2D2IA 3V48A 2EX1A 3EA5A 3QENA 2VUSA 3KJXA 3RSSA 2IH5A 2BMFA 2YYSA 4L50A 4X63A 2OSBA 2G06A 3NC4A 1HEUA 1DGQA 2Q49A 2VP5A 1BKDR 3EA0A 4YCBA 4DG8A 5DMXA 3Q6NA 2HWUA 2VWQA 4OI1A 2AI2A 3LXRA 1KC3A 1UXKA 2JW5A 2V7PA 4X5OA 1K5HA 2BMJA 3VTAA 3SVTA 3BL8A 3HKDA 4OBEA 4HH4A 3PGKA 3SSNA 3GPLA 2RHTA 3GLFE 2HJHA 2JAHA 3PDIB 1E3QA 4LQ4A 1U4SA 2LRHA 5H83A 1U3VA 1NBIA 3HR8A 2IHYA 1U9ZA 2BF7A 3WJ1A 1JFFB 2NSLA 1T9GR 4A8TA 1TOAA 4GMXA 3INGA 3R8CA 3X2FA 3GZTB 2D0OB 2CVQA 3HJGA 3WLTA 2R9VA 1NXXA 3KJIA 4MYCA 4AI6A 4FHDA 4GP6A 4H59A 3RVRA 4NK4A 4X85A 3KFLA 3SQMA 4KWCA 2RD2A 2FZ4A 1T5LA 2OO5C 3C5VA 4DLPA 3ZE1B 1K5PA 3V97A 1FXWF 4I1OA 1KSGA 4WN3A 1X14A 2ZGVA 3JQBC 2A9PA 3RAEC 5EFZA 1FTNA 3ZDRA 4JKYA 1X0XA 5HPYB 4DYDA 1XDGA 1Y6QA 1Y81A 3A1WA 4N4AA 4FUTA 2JKVA 4D8VA 3TMAA 4U8GA 1A96A 3DO8A 4WPGA 4X92A 4A0GA 1C3LA 5I7FA 5JUWA 1OW3B 5L95A 3DONA 4WOPA 3UAVA 3NNNA 3KTAA 3TVYA 3BXGA 2FZWA 3D6MA 3IDFA 3UJ3X 1VRWA 2XE6A 3G8YA 3H05A 1CNFA 1YQDA 3NNSA 1XLTC 3IAM6 4LV5B 2X7HA 1NGSA 3E35A 4W6ZA 5TQJA 2RGDA 3PC4A 1NASA 3GVPA 3TI9A 4DLVA 2PT6A 3L40A 1QE3A 5AI5A 3AHDA 1NVTA 5E6SB 3LBHA 4KUHA 2ZUFA 1GGFA 4NZPA 5BV2P 4ZAXA 5AICA 5LQDA 1QYVA 1F8XA 3OQ6A 4LY6A 1NVDA 4RGQA 5ALKA 1N2JA 2GB4A 2P2ZA 4N5DA 1SOMA 1MENA 3LX8A 4BRWA 1IJEA 1JDUA 4ZOQI 1RKXA 1RCFA 4H0NA 4E30A 1E7RA 3KEMA 1C4WA 2F3PA 3WO0A 1L8QA 2BFAA 4LJ5A 5AYVA 3N7TA 3H6HA 2E21A 3A7EA 2JZCA 1K86A 5JR3A 1U0NA 1LLCA 1ZA1A 2WPNA 1WNFA 2PX5A 5JVDB 4IIGA 1LTKA 2ZDHA 2VNKA 3PDIA 4G5HA 2FKNA 2BIFA 4X9XA 5TPZD 1EFDN 1E8NA 3N0RA 3W1VA 3L06A 3OPQA 1JFFA 3QIAA 4KUGA 1RQRA 5HMMA 3V8QA 1KDRA 5D3QA 1EGHA 1V9CA 5IFLA 3FFTA 5LQJA 1T0HB 3I3OA 2X5KO 3TE7A 3L0OA 1QHIA 3F9IA 3NEYA 4G63A 1LX6A 1T6YA 1QVAA 4LC9A 4OP2A 1XIVA 2FUNB 3QVTA 5FTKA 1GAXA 4DUZB 4P38A 4RH0A 4BO0A 4NHOA 2CFTA 3WZMA 1G5QA 1NQOA 2PMCA 3OJCA 1L4EA 1TLTA 1Z0KA 2H16A 1H8ED 2R47A 2RMKA 3OIVA 2A92A 4XDGA 3K9LA 1PQWA 3MWDB 4A0HA 1BS2A 2E49A 1Q16A 4PPGA 2RGUA 3UMGA 4DA8A 6NULA 4CTJA 3DFMA 3RRNA 3UAWA 1THTA 1UMDB 5GONB 5DF1A 4RF2A 3TW8B 4W5QA 1QMGA 1YONA 2DQYA 4OFZA 4ZICA 1NUSA 5IUNC 1L5QA 3V7FA 3CV3A 4WA7A 5JASA 2G7MC 3NH9A 1YCDA 4MGHA 5BOVA 1Y8RB 4J2TA 3IBGA 4JYMA 1N5JA 5E6SA 1O4WA 1DV2A 4DCNA 4DYVA 1IG3A 4D92A 4ZFNA 2V6GA 4GYJA 1JS1X 2PL3A 4TQUS 4DNFA 3PYXA 1M1YE 3DTYA 1GSIA 1TL7C 1Q0PA 2YV2A 3ABRB 1E1MA 5DNUA 5IJZA 2GPTA 4EG6A 3HYCA 2FEKA 4WGFA 1XZJA 2J9FB 3U44B 4Q9AA 5B1SA 4QQNA 1K97A 2VI5A 1BG6A 2OHHA 2XW6A 1F60A 4QGFA 5ICFA 4ESOA 3J80A 1C80A 1M67A 1RWOA 2QGZA 5DBOA 5HW0A 3S1SA 4BFTA 3P2YA 1OB5A 4LPKA 2PUEA 4TS4A 4B75A 4R98A 3OPYB 1CZNA 3GNLA 3UT0A 5K0CA 2PSEA 4YCDA 1EX9A 3PEWA 3O95A 2XOEA 5DCYA 5JVDA 2BKAA 1W9HA 2SNIE 4EKYA 4RANA 3UYLA 3QH4A 3Q7RA 1ZN9A 4X7MA 4X65B 2O1SA 1LDEA 1A4RA 3E61A 3VAZA 4RF5A 3N76A 2B5VA 5MFPA 2J4CA 2F00A 3DLAA 4DLAA 5JHGB 1RQ7A 1WPGA 1EE9A 2XHZA 3DP9A 2RHGB 4GOND 3OE5A 1E9EA 1TO6A 1QU3A 2BLNA 1KNQA 2ZB8A 3K73O 3KFXA 3AGPA 4UZSA 1KI2A 2Z8YA 4Z0HO 4DQXA 2GMWA 2BVNA 3NAZA 3Q0EA 3PWSA 3FMGA 4I6GA 4WGGA 5IDYA 1CJTC 1ZCZA 3CN7A 4H7KA 2D8AA 4GZMA 2AX4A 2FMUA 3MWDA 3VU1A 1QGED 2EJWA 4DCUA 2XUAA 4LQLA 3AR5A 3TIIA 1UMDA 2W2MA 1V37A 2YWXA 5GONA 1EA5A 1PGQA 2VYQA 3HPQA 1DFIA 2VNHA 3BERA 3CUUA 1GVNB 4L0DA 1T35A 4Z9XA 5C1IA 2XMBA 3C3MA 1W8DA 3LW7A 2EP5A 4HNVA 5FDFA 4DRXB 5J2TB 4XM2A 3IAFA 3UHJA 1BA2A 5EXSA 1GKUB 2AMYA 2BYTA 4DVGA 1Y8RA 3IUPA 3AVXA 1Q57A 1NUAA 3WSVA 5K0BA 3TTYA 1ZU5A 2IKQA 1R6BX 4GX1A 2DFKB 1SVOA 2WC1A 3VHRA 4NBTA 1RMYA 5C8VA 3ZYCA 3PI7A 1FFBA 3H8WA 3DP7A 4L08A 4NMXB 5E3JA 3J81A 3OHMA 4AMVA 4D43A 2J9FA 3TEFA 4IZHA 5GY7A 4D79A 1HOTA 5TLSA 2ERCA 3MMXA 3R24A 2Q1XA 4HAVA 1Z2EA 2PG3A 3H2YA 4WEQA 4TTRA 3U5ZB 5LZ2A 2K7ZA 7REQB 2KQUA 4EL0A 3OPYA 4OVKA 4RD4A 1RHJA 3EEQA 1KBQA 3DNPA 2HDOA 3EH1A 3H4VA 1M7GA 4R0VA 2P69A 3HDQA 3UV3A 1QRUA 2I76A 1UFRA 5MGBA 3LGSA 5CVJA 1KEKA 2J4FA 3C16C 4UTPA 2BDTA 2P90A 3JAWB 4G8DA 4L75A 2VDKB 5J2UF 2O3SA 1MO2A 1F8UA 2Z5GA 1ZJZA 2D2FA 1KJQA 3BM5A 1AVTA 4FGUA 2G9RA 1JT2A 1X7YB 2IX9A 2Y1WA 2ACEA 3ND7A 5DRYA 5JIBA 2QRNA 3CZ4A 2YQZA 4S1NA 3GRZA 3N0XA 1EPUA 2JCGA 3RS4A 4YRDA 4R8KA 4BTVA 4ENVA 4HJXA 1UODA 1NBME 1GSOA 2XUQA 3L0SA 2FRDC 1M2NA 1W4ZA 4LCEA 4QBFA 4RZQA 2A5YB 1LLQA 3UF0A 1KKUA 1PJBA 1R74A 2PMWB 4DMHA 3V5NA 3K70B 1ETUA 2O8DB 4BMDA 3E6AA 4M87A 3AHJA 3E5RA 3BF8A 4JJ4A 5AK5A 4BBJA 2A1TR 1QTQA 5HJ5A 1VE1A 5DGHA 3X1KA 1B00A 2VJKA 4B4WA 2D0DA 3GGPA 4Y98A 4B3DA 1INLA 3DEFA 3MERA 2ZYAA 2ZCJA 1C41A 2Y9PB 4Y9SA 3A9VA 4B6QA 4DRXA 5J2TA 2V97A 2I55A 5JAQA 2OBMA 4DXHA 1E1RA 2V74B 1DBIA 4GMDA 1NV9A 3TEMA 2VTVA 3P52A 4MUYA 4OOEA 4ZVRA 4RGVA 5LQSA 2UYGA 1IRIA 4INPA 5KVSA 5TDHA 4Y6PA 4B7ZA 1DBSA 1ZGGA 4CIBA 1NV8A 2FWIA 2FSPA 1BS1A 4PO1A 4IDPA 5K4AA 4AZSA 3D54D 4YCJA 1EJBA 1D8TA 2QG6A 2IGTA 2JFZA 3HHPA 4ZO9A 2CHQA 3MRVA 5AOVA 1W87A 1WXIA 1SCUB 3FN4A 1AGXA 3KPJA 4Q3DA 4RCVA 1AA6A 4IRMA 4F3KA 2V0CA 4JJEA 2PY6A 4XASA 3IHKA 3UKJA 1PWHA 1UZAA 2P2NA 3H5RA 7REQA 3FAZA 4MVYA 3OX4A 4ENTA 3LQ4A 5C8XA 4Q3BA 3TQQA 1KEVA 4B73A 2CD9A 3FDIA 4C0KA 2XWPA 3I04A 1PR4A 4CKBB 4ZXFA 4L3OA 4EYOA 3JAWA 5SY6A 4HYYA 4HEJA 4B09A 1JSXA 3IOMA 4ALMA 4ZYXA 1L7QA 3ME5A 3HU3A 4RHCA 4IXNA 4OKNA 1FFEA 1JTFA 5C51B 1X7YA 2VBFA 1X1RA 4CW7A 4GL4A 2D1RA 4BN4A 5LNK6 1SWWA 4NK5A 1DLJA 3OTGA 3M1AA 3PVCA 3WAJA 2E6UX 2HBYA 3LS2A 2P3LA 2IUEA 2QD3A 4KU4A 1ZEMA 2WU8A 3RJZA 1HRKA 1IPFA 4JR1A 1W30A 2O8DA 4FHZA 3LF2A 1XZBA 2YIVX 1FDIA 2QAJA 3ORFA 4O4LB 3TO5A 1OYYA 3EGOA 3ROMA 3TRKA 4QHTA 5JNVA 1U7WA 3ESAA 4W5TA 2FPOA 5IABA 2VEDA 4TUYB 3NCTA 4LMAA 2HI0A 5IXSA 3LQFA 5JNRA 5F2KA 5KTNA 3HM9A 3VR2A 1PYDA 4NV0A 5J58A 1NHGA 2G9ZA 4YAFA 1ECCA 3KJEA 4M38A 3F4BA 4UHDA 1OLUB 4UBMA 3F5FA 1EB9A 3OZBA 2FYTA 3P19A 5AHOA 5G4KB 5FUMA 3FFWA 3G5MA 4CU5A 2ZSAA 1FJGB 1IOZA 1Z0DA 2PS9A 2YY7A 1UBFA 3DLPX 3FLEA 5E4TA 1W5BA 1JXQA 3IMGA 4N9QA 3VTKA 1KFJB 1IHUA 5PNTA 1LDNA 2JIZA 4M8KA 1O54A 3EQ6A 2V6FA 2R5NA 4KE9A 3V1YA 1RU3A 3VOSA 2ZKIA 1SCUA 1TECE 5D1HA 1JPNA 3OCZA 4P32A 3D59A 4PZDA 5JH7B 5H0IA 3RVDA 5I7HA 5K8TA 1ONSA 5BRJA 2YDYA 3ZX4A 1JHAA 4NCAA 3ZWKA 3IH5A 1YJQA 2G4CA 2TSYB 1G17A 1KVTA 5EUQB 1WLYA 4R8RA 4XB2A 5IASA 1WXXA 2R4UA 4LZAA 1SJ9A 2OPBA 2DETA 4LXUA 2WUDA 4QBTA 3TXYA 3AUFA 1T9HA 4EP1A 4CKBA 3FSJX 3IHWA 4GGMX 4U0JA 2NTVA 1SOWA 2EFJA 4KQEA 3PJDA 4ZD6A 2WE7A 3NOOA 5LZ8A 1DVRA 3DFUA 1QGAA 1M7HA 2ZBDA 2OYRA 1CVRA 1QX4A 4ADSG 2NTNA 2QWXA 4ZJZA 5B6JA 3IE1A 4TX1A 1BJRE 2IZOA 5BW8A 1J0DA 4MGKR 5EQTA 1LRLA 1OFVA 3B1JA 3FNIA 3EGWA 4UU0A 5EHXA 4H08A 4G0XA 4NTZA 1GUDA 1UWKA 4GECA 4JENA 1P1BA 5IXYA 1A7UA 3SHWA 4DNXA 1L8XA 3QA3E 1GZ3A 2G1KA 4BKUA 4ROSA 4O4LA 3QEMB 3GGGA 4ZODA 2HV9A 4GC5A 4NEHB 4XIIA 4EKNB 1IUPA 2RGNA 2OUIA 4TUYA 4ZCTA 2WKPA 2W2OA 5AVUA 4JY7A 4KE7A 1I2DA 5GVRA 4J1QA 5CFPA 3FI0A 5KWSA 4W5OA 1HKHA 1VPLA 3E7WA 3GNQA 5G4KA 1OLUA 4DDTA 2JJ8A 3G1WA 5C18A 2QM8A 1P0PA 4HNHA 5JO9A 1E5TA 1YVDA 3MUFA 5CH5A 3M81A 2Y1KA 2PEZA 4HXEB 3I5XA 2GN2A 2RCNA 3KQWA 3EIFA 2C7PA 2CEKA 2IIVA 1QX3A 2XE7A 5H4HA 3EPHA 3LCJA 4JZKA 1T6ZA 2ZAIA 1G66A 4G81A 3H4TA 4EARA 3IEXA 1R0XA 4RH1A 3BXPA 1TLLA 2QQGA 4DIDA 4INOA 4V0OA 1Y4UA 3KKNA 1B8OA 1JKMA 2IF0A 2PCJA 1QDLB 3D3WB 4P5EA 1J97A 1U6IA 2JD0A 5IJAA 1SCQA 4BMVA 5IDWA 3QEAZ 2D7DA 3QYFA 2UYOA 3MW8A 2ZTSA 3FYHA 4PPFA 2W6QA 3L7AA 5LQAA 4E2FA 4KX3A 2EHJA 4PO3X 4C07A 1VKJA 5F2NA 3GI1A 5U4QA 2B92A 4B35A 4JYZA 4GI5A 3HEAA 4MJ7A 2P4EA 3DOJA 1YR1A 3ANLA 3L1UA 4BGIA 2GWRA 4K9KA 4MVXA 9MHTA 1JALA 1B6TA 4HLDA 4HNSA 4CTKA 4QKQA 3KE8A 2ECPA 3ILXA 3NALA 4LZOA 2AL7A 1DQSA 1CNEA 1IZ9A 1P45A 3UVEA 4DMRA 4RJTA 1MGOA 2DFDA 4M1TA 1J8VA 4YDRA 4M1QA 3EZ7A 4ZO7A 2CLFB 3FBTA 1LNSA 4IG9A 4ZQGA 4MMZB 1XELA 4G8BA 3RHFA 1N2BA 2EW2A 1OC4A 3VZSA 2CFOA 1P1CA 1Y9EA 4ARAA 1X87A 1VG0B 3HGTA 1KJIA 4LWPA 1VCMA 2QX8A 3BWYA 1TCCA 2DPYA 2ZM6B 2ZJ4A 3QEMA 3TCNA 4ZKDA 1G2QA 4C2UA 4D82A 1EUQA 3OEYA 1QDEA 3W8NA 3L7LA 1AUVA 1JPVA 4D9KA 4CIDA 1RLIA 2OB1A 3DF9A 1T0JB 1E63A 1PJ3A 1GD1O 1WUKS 2QT1A 1CDZA 4OLAA 3FDJA 1IMOA 1BRTA 2H92A 3ZDYB 1E1RD 3I2JA 3JALB 3NHPA 1P44A 1XFAA 4Q16A 4AZWA 2R7NA 2OMEA 3LY9A 3GBPA 4LDAA 1MEOA 2B5WA 2PBLA 3EBLA 3HV0A 1K5DA 3DZ8A 1BX1A 3ONWA 4B43A 4D3YA 3IMEA 5CVUA 2REBA 3HR7A 2BAGA 1H3FA 4X6XA 4CIVA 2GEBA 2WSLA 3V8PA 2WP8J 3GN1A 3ZD7A 5DHFA 2ZCUA 3DLCA 5EZSA 2ZAMA 5TMDA 4ETIA 3D3WA 1G38A 3FTDA 2GZ1A 1U3GA 4HAXA 4S3MA 5F33A 4HNUA 4RMNA 4F7DA 4S1TA 3FOFC 1IJBA 4MVJM 4A03A 1YQQA 1KI7A 1XA3A 2COEA 2WM3A 2BPOA 5DZSA 5KI6A 3OUTA 1VHTA 3K6SB 3N2GB 1KIFA 3Q12A 3SKXA 2CW5A 3QVKA 3E0QA 4UMVA 3DH0A 3SE7A 1MIHA 4AJKA 3HSSA 4Q00A 4KPYA 3D6AA 3Q40A 4MNTA 1J22A 4MUMA 2FSVC 3WSTA 5C4MA 2DSNA 3A25A 3AI3A 3FY4A 3FYDA 3H1BA 5EZYF 3U26A 2GCIA 1W52X 4R2IA 4NQZA 5BW6B 3HG7A 3EZNA 3S2EA 1DQRA 1QYCA 3EAQA 4EA9A 4NI5A 3JR3A 1V9SA 3MWJA 3KKKA 1Z0SA 3G85A 5DI3B 4AIRA 3QX3A 1YZYA 5FI3A 3UK0A 1L1RA 3LOUA 3R7FA 1FL9A 5JISA 3PCRB 3MUEA 2Z43A 4UTRA 3K70D 3ZD6A 3I6YA 1KVQA 2E89A 3ZCTA 2XB2A 1C7QA 3QOYA 5CJJA 2UZ4A 4C87A 1DAHA 5DSZA 1E79A 5HVNA 4IMPA 1NE7A 1LNZA 3N86A 4DR5B 4FOPA 2O8NA 4H60A 1Z5VA 5C3UA 1GV1A 3SEFA 2QW1A 3V8MA 3VR2D 1FC0A 3NH6A 4LYDA 1TCBA 4CM3A 1RACA 1KZGB 3JALA 5EXTA 2FSSA 4EA7A 1NUPA 4IS3A 4PYOA 2WFLB 3PF8A 1YDHA 4JBIA 5EE5B 3DMTA 3HLYA 2MWMA 1UBRS 2V4UA 1GL7A 2JHAA 4NAVA 2ID4A 1FMTA 4M2LA 3T7DA 1VL6A 4GUDA 1AK2A 2QPOA 2JIZD 2PBFA 1D0IA 3BAZA 1K6EA 3IEKA 4BFCA 3U56A 5C4GB 1ZPDA 2Q3BA 3UK6A 2ZB4A 4UNPA 4FFDA 4J0IA 5J9FA 3P1JA 4FGSA 3TSOA 3EFOB 4CWAA 3OZXA 2X4IA 3MUNA 1KAOA 2IE0A 4JHXA 1GPBA 4QEDA 3RNLA 4WOKA 3K6SA 2D06A 2QGFA 2GCEA 1BDBA 1A72A 2ADFA 2AN5A 3N2GA 3G13A 3OIYA 4HQFA 3GA5A 3VHLB 5KWVA 5CVVA 5EKTA 2VLIA 4Z8YA 3WE7A 4ND6A 2V9ZA 3AIOA 3EOBI 3LK7A 1UKEA 4FFVA 1QYXA 3U17A 3FROA 3VA7A 4UBKA 4UTZA 4IUBS 4F4JA 1EXMA 3LUPA 1JYFA 4B83A 4E13A 1XXLA 3T8YA 3ZHYA 5KUTA 4RUKA 1HYHA 2YS6A 3JQRA 4JJIA 4JYBA 3H1FA 3M34A 4JL8A 1EP9A 4QODA 1K7FB 1OUMA 2I9PA 1GTJ1 2PK3A 1PFWA 5DI3A 3UPDA 3GJ5A 4OHOA 1QNLA 2PT9A 4E6EA 1UT8A 3JQ7B 4IDOA 4CQMB 1SUWA 1G20B 4Q6WA 1LUAA 1LA2A 4C20A 3EFBA 2NVWA 3KOOA 3QHAA 5EMMA 4HYEA 1R9JA 5IN5A 3ZGLA 2VQFB 4S04A 3MYRA 4LZJA 1CETA 2WWGA 3FVVA 4B8ZA 4PSUA 2WIDA 3WHKA 1OA1A 5IBPA 1CK4A 1HM5A 2B8EA 3LT5A 3MF4A 2X0IA 2LPMA 4QTZA 1FNSA 1NLZA 2BL4A 4ZCLA 5I8WA 3QLJA 2NOAA 1O0CA 1RZUA 1Q5PA 3OKCA 3ZW7A 1H2HA 4KQWA 4PM4A 4DQUA 2IDZA 4RAQA 4TL6A 1RQLA 4L02A 1NXQA 4OHWA 2WFLA 3HP4A 3F73A 1G8MA 3OO1A 3AESB 2MR6A 4XTCS 1C9KA 1PQ4A 1YUMA 5CT6A 4KNYA 4H35A 1JVSA 4PTLA 1YVEI 4W6QA 4ZEMA 2AVNA 4MAFA 1W581 1T91A 1DINA 1YB6A 3G7SA 3ZCRA 5EE0A 1ZP6A 1QG0A 2IU6A 4YCNA 2WYHA 3AIIA 3GDHA 1KBZA 3BTVA 3EFOA 4GH5A 3VISA 2YASA 5C7LO 5ICGA 2OBXA 2ZK7A 3OECA 3O9ZA 1H94A 2ZSFA 2G36A 3C4JA 3D6JA 3TW6A 2FUKA 2HIHA 3FVQA 1JA0A 2K2WA 2A33A 2G1UA 2ZSKA 5TJ9A 3UN1A 3UUGA 5F23A 5KYWB 2VS1A 1EWYA 1ZUWA 3ZHOA 5CFQA 1T25A 1Z74A 1RWNA 4OAQA 2H4FA 3IOBA 3TSCA 4F04A 3TQHA 3VUFA 4NCKA 1IG0A 4Q9DA 5ENVA 5JD6A 3FTCA 1GU7A 2G17A 2HNKA 1RQNA 2ZATA 3Q0IA 4KR9A 4GOOD 4IJUA 2W2TA 3RIMA 4RNDB 1SC9A 4ETNA 3OZEA 3GJSA 4HHEA 2K6GA 1GT91 4MMYB 4PYMA 3QVLA 1L3BA 4PINA 2ZUVA 3W5CA 1RI4A 3JQ7A 1YFZA 3KB1A 1G59A 2A14A 4CQMA 1G20A 2N46A 1GUFA 5FORA 4LF5B 4OHZA 4LW8A 3QBEA 4EPWA 2XUHA 1VZ2A 3U3KA 2I4OA 3VR5H 2QY6A 4H7PA 2J5QA 4XRRA 5CTJA 4O4JF 3V4RA 4OX9Y 1I30A 2XQFA 3TFWA 5DM70 4IIBA 3BILA 4NEQA 3WIBA 4D5GA 1EVEA 5COBA 1R0WA 4UXIA 1T3ZA 1BQ4A 1L6RA 1C7FA 1JQ5A 5JALA 2CL7X 3KWMA 2VF7A 4OB8A 1SKAA 5E6UB 3DZFA 3CPEA 3M4ZA 1OXSC 3OZIA 4QD3A 3CNNA 1EG2A 4KREA 1VFNA 2Z3ZA 1SUDA 1L9KA 3R7NA 4Y0AA 4BNNA 1YRAA 4H27A 2JGFA 4DCOA 1CS0B 2AOWA 1MFZA 2VWPA 4F8YA 2GD6A 2IYUA 3ENZA 3LFTA 4LBWA 4Z4CA 2BISA 1T15A 3LC1O 3BYZA 4D3DA 1XTBA 1W25A 4XB6B 3EIOA 1BE8A 1GUBA 1S2NA 1UKBA 5ENDA 5B3AA 3MJDA 1DKLA 4B48A 5BR4A 3UWKA 2O59A 4G5XA 4I6JA 1E6EA 1S8AA 2V5AA 5ER6A 2XGGA 2Z9CA 3GWGA 5FHRA 1P7VA 5HIJA 1UWCA 2X7XA 3VNQA 4AZVA 4JLVA 4WINA 3V1UA 3HWWA 2VDLB 5JSFA 1PL6A 1Y1KE 3BB4A 4CQNA 1SH7A 4IP0A 4K87A 2XNDA 3T7KA 3KAQA 5KYWA 1VMAA 2EYQA 3ONNA 3RU3A 4UFNA 4Y2XA 4ARIA 4PICA 3TJRA 1GAEO 5HK9A 3MLEA 4IV0A 2M2IA 5ICMA 5FUQA 1L4NA 2EX0A 2QMQA 4NZYA 2EFDB 4RTOA 2QTZA 4HN4B 2PL5A 5K0TA 2J6IA 4QASA 1YBHA 4TTTS 3RSHA 1ZDMA 1CR1A 3JYHA 3SBEA 3EGEA 3QG1A 4QXRA 2WAMA 3W3AA 2X58A 3HCDA 2WABA 4R84A 2F1RA 4B6PA 1RHUA 3LAWA 4WECA 1TPYA 5JMWA 4DANA 1JIKA 3FYSA 3VZRA 3FYTA 1F3LA 1H6AA 5EERA 5K2OA 1WBDA 2HDNB 1N2EA 3IPRA 1NQTA 3ZEAA 3ZKAA 1SPBS 1VZ3A 1M8FA 1C1HA 3ROZA 2PZGA 2JEZA 3G0DA 1S8FA 4C03A 4MCAA 1A97A 1IXYA 1NM5A 2EW1A 1YXMA 2OTCA 1E79D 3CRQA 2KLBA 4HX2A 5BXQC 1IBLB 2H1RA 5CNJA 3VFDA 3ZDFA 4C0HA 3KU4A 4CGZA 1U3WA 4LBZA 1U99A 2OP1A 3AUKA 3FH0A 3T3EA 3CNOA 2HGZA 4UREA 1S1MA 3PDCA 5E6UA 2Y1GA 1AZTA 3WMWA 3O03A 5IDXA 1E7QA 4QXQA 4WN9B 2WB2A 4KQMA 3S4YA 3T35A 4A5OA 1AGNA 4A6PA 3RRFA 4MOWA 3JWGA 4MPTA 2FDXA 3BIFA 3T1HB 3BSSA 4JOSA 4PPQA 4D4GA 4P84A 1BHJA 2V96A 1NR1A 2ZRPA 2OV1A 2GH1A 4RM2A 4X1KB 3EXAA 1PR2A 2C4KA 3BQ9A 3DBOB 3HDGA 2I1VB 3A9TA 1K63A 3PL1A 3KJFA 3K1YA 521PA 2RJOA 2VTKA 5B4TA 1DXQA 1E2IA 2W2NA 2V59A 5A4KA 3VSAA 2B0CA 4LF8B 2RC6A 3QYJA 4G1FA 1DC8A 1J90A 3P0RA 4BVAA 3TG8A 3NBZC 5E2IA 2EV9A 2GNAA 2V7XA 4GLJA 2HMTA 3TZQA 4GZ6A 3VC2A 4F5DA 4TLMB 3RSCA 3VU8A 5FLKA 2RI6A 5JJLA 4EHBA 1QAQA 4RD6A 1NJ2A 1ID1A 1UXHA 2C8JA 2N0SA 4XSGA 4XI9A 1CJSA 1MAAA 4MQ4A 3GMIA 3CZRA 3U7JA 5JECA 2NVOA 3SP1A 3MN1A 4E7PA 2VBIA 1ISRA 5KAMA 4AJHA 1IC6A 4HC4A 5I7RA 4TKUB 2XZTA 1GM5A 3KQUA 2I7VA 1KGDA 2X40A 4KO2S 3RR2A 3PC8A 3ZI7A 3S1LA 2IL1A 1HT0A 5C31A 2ZSUA 3NHJA 1Y3FE 4AJEA 4UASA 1CUEA 2O8EB 4NZNA 2QZ9A 5CM2Z 2C96A 4HUJA 2EU8A 1GZVA 1CUWA 4O29A 1P29A 3ZKWB 4BBZA 3CLKA 5E2BA 4CLOB 4QARA 1P0IA 1WZEA 1XDWA 1OH7A 2P4UA 2PJRA 4KX5A 2HWKA 1YBFA 2H0QA 2QY9A 1WV0A 2F6RA 4A10A 2M32A 2WVHA 1RDFA 5FOTA 1PLKA 4FMDB 2WTBA 4WN9A 4PX9A 5EHZA 4JAVC 1JYEA 1E2BA 2BT4A 2YS7A 1AMOA 1Z12A 2IXFA 3KC2A 1CWUA 2QRMA 1EXVA 1PT8A 4X1KA 3AUUA 5TF0A 4MQUA 3NRBA 5DT2A 4UUQA 2WJYA 5FO0A 4U39A 4L8VA 4AP9A