1NXPA

Micarec ph4.5
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
118
structure length
118
Chain Sequence
KKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIILDLMLPEIDGLEVAKTIRKTSSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the response regulator 02 receiver domain, the essential YycF two-component system of Streptococcus pneumoniae in both complexed and native states.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Signaling protein
molecule keywords DNA-binding response regulator
total genus 40
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2003-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1nxpA00
4B09A 4Q6WA 1L5YA 4G97A 4OLAA 4IILA 3O1JC 3S99A 4O1IA 3O2QB 4OBBA 5EWLB 1WETA 4QICA 1Z16A 5CNKA 4YR7A 1OXKB 4JAVC 4KQ9A 3CS3A 1JDPA 5D2CA 3MIZA 4EGSA 4Z4GA 3BREA 4KK3A 1APBA 1BDHA 1H9CA 4RK6A 1ABFA 1NXWA 3L6UA 2M1ZA 1BAPA 5KWSA 9ABPA 4N03A 4D6YA 4HNQA 3H1FA 5C5EA 1DBWA 4EYQA 1P8AA 4RZSA 1BDJA 4MR7A 4EVRA 1U0SY 2ZAYA 4YCSA 2CHEA 1A04A 1GUBA 3EODA 5EWMB 1J56A 3LUHA 2FKAA 3RVSA 2Q5CA 1FSPA 2RJOA 3CKMA 4G0QA 4JA2A 5FWYB 3EQ2A 5ABPA 3A0RB 4EVSA 1EAYA 3F7NA 4IF4A 3CZCA 4RV5A 1YK0A 1PUXA 3IP9A 1NXSA 2FTKE 2PE5A 4TMYA 2B4AA 4RU1A 3QLVA 4Z99A 3HUUA 3TMYA 4E7PA 1ZVVA 4HNRA 3LUGA 3RH0A 1CEYA 1DRJA 2I6FA 5JNRA 3CHYA 5TQ0A 1NXVA 2R25B 4YS6A 4KFCA 4PZ0A 5GOTA 6ABPA 1PEAA 3URMA 3UKJA 4Z4FA 3CFYA 3A10A 1JH9A 1NXTA 1DP4A 4LRQA 1QKKA 5TQ2B 2W42A 3JS5A 4Z9AA 3HCWA 2MSKA 2MYUA 3SQNA 4RXUA 3MQ4A 3A0UA 1BVHA 5IUNC 3RQIA 3GT7A 2E4UA 3R0JA 1PNRA 3EGCA 3F73A 3DLBA 3KG2A 1JYFA 4NCAA 4MRMA 1PHRA 5CNJA 1DCFA 1IIBA 3HEBA 3C3MA 5EWJB 2CHFA 3D02A 3LKBA 3LUCA 2AYXA 3SNKA 2FQWA 3T95A 1URPA 2E4WA 1LJUA 4N0PA 2JB9A 5DKFA 1ZGZA 1E6LA 3OMXA 4QYWA 3HDGA 1DBPA 2LP4Y 4Z0NA 3RVJA 1JL3A 4XFKA 4DQDA 4G86A 4O5AA 1UDRA 4RS3A 1VKRA 2WJAA 1YVUA 1T34A 4PYRA 4NQRA 3CG4A 1DBQA 4YV7A 1MIHA 4D74A 5JNUA 3O1IC 4N41A 3BRQA 4YP9A 3HS3A 4H60A 4KRFA 4FE4A 4IMIB 3DBIA 2KYRA 4XXHA 3IDOA 5TPZA 4W5OA 1JX6A 4LE1A 1DC8A 5I4CA 1DRKA 1RXIA 1ZH2A 4TLLB 1NTRA 1D2AA 2FN9A 3NBMA 4NV3A 3IP5A 1Z2EA 1Z18A 1YIOA 3TB6A 4WUTA 3H5IA 1TMYA 3K4HA 5FWXB 2LPMA 3NNDA 1EHCA 3DGFC 1QNLA 2ID9A 2WRZA 1NY5A 2QVGA 3RVLA 2GI4A 2QZJA 3N8IA 3O74A 5BRJA 5JNTA 3HVRA 1JBEA 5KQPA 2FLKA 3H5LA 1M2EA 1USKA 3JVIA 3KYIB 2HQOA 4NICA 4MR8A 4KNYA 2FSPA 4RKQA 2V0NA 1Z2DA 3H5VA 1M5UA 2IKSA 3ILYA 1JFSA 1MAVA 4G0PA 3SM9A 5IBQA 4RK4A 1Z17A 4KPYA 3CG0A 3OMWA 4JP1A 1E6MA 2NZUG 4GPAA 1W9HA 3NHZA 5JNSA 4ETNA 2IPNA 4OTZA 4MRMB 3QLUC 5BQ3A 3TO5A 4F12A 4RK1A 2PUFA 3N75A 5DGCA 3O2JA 2JCGA 2NT4A 5IUJC 2M98A 1DCMA 2RGYA 4HNSA 1GCGA 2FMIA 3Q41A 1D1QA 2CD7A 5FBHA 3LUFA 2R48A 2YHAA 5ED4A 4RXTA 3B2NA 3CRNA 3L49A 2VUIB 1FFSA 2FW0A 2H0AA 3BILA 3QEMB 4ZMRA 1JWLA 3LUAA 3QLTA 2ZWMA 4MAAA 4QPJC 2PL9A 3EQZA 3OLZA 3QEMA 1YMVA 2DRIA 5DCLA 4JOQA 2HSGA 4Q7EA 3ROFA 1LBHA 3Q7SA 3TD9A 4YRZA 2JVIA 3JTEA 4MR9A 1F4VA 3HUTA 1Z13A 4FE7A 2B1JA 3HK2A 2A9PA 1VPWA 1KMIY 5TQJA 3RVQA 2FXIA 4N0QA 3Q7TA 4YGXB 4OG2A 3DLHA 3MF4A 1E2BA 2PMCA 1BA2A 3HSYA 3N0XA 4ZJPA 5TE9A 3CU5A 3KKEA 2NUBA 5KC8A 4F06A 5E3JA 1VLZA 1P6UA 3GBVA 3NHMA 2X7XA 4Y9TA 4N76A 4MR7B 3BRSA 1A2OA 5B3JA 4S05A 4OLBA 1TJYA 1XWWA 3QLUA 5IC5A 5IULC 3H6HA 3KSMA 4MQEB 5TPZD 3LTEA 4RXMA 1NXPA 1NATA 2A9OA 2OENG 4KMRA 2WY2D 3GV0A 3C3WA 2LBPA 2QU7A 2PUBA 2WB4A 1PEYA 4E7OA 3OM1A 4RKRA 1DC7A 1YK1A 1FQWA 5DTEA 2PUCA 3FDFA 1I3CA 4OATA 1EWVA 3Q9SA 4MLDA 1RPJA 2VUHB 4MQEA 5FWXA 7ABPA 3N0RA 4EUKA 1FFGA 3RVMA 3QELB 4HYEA 4WWHA 4LDZA 1RZRA 1MVOA 4EVQA 2FEKA 4MS3B 1U2PA 4JB2A 1M2FA 3FFTA 2A9RA 3DZDA 3GWGA 4XAQA 1L5ZA 2FMKA 3KLNA 3Q15C 4LE0A 4RWEA 1USGA 1AB6A 3EAFA 3OM0A 2MSLA 4MS1B 1ZN2A 2R4QA 1KRXA 1K68A 4MR8B 2L19A 1ZH4A 4UHKA 1JF8A 4YWHA 2FEWB 2PAFA 3VNAA 4W5TA 1ZITA 3O2SB 3H5TA 2IYNA 1FFWA 2FVYA 3MA0A 3NNNA 4G0MA 5GQSA 1SXHA 4O1HA 2QW1A 3OQNA 3M6MD 4MR9B 3SY8A 4W5NA 4LZLA 4KV7A 3QK7A 2CWDA 4ZPJA 3FFWA 1M5TA 3T38A 3OO0A 5FBKA 4XARA 4W5RA 1Z26A 5T3YA 3RVKA 5B3JC 3CNBA 3EDCA 3H6GA 3IPCA 4ZYLA 2IDMA 3HO1A 2QSJA 1C4WA 2E4VA 3LUKA 3E3MA 3FFXA 1NXOA 6CHYA 1DCKA 3E61A 3O1HB 4IMJB 2LUOA 1QQBA 1W25A 3IPAA 3LMKA 1JLKA 4KQCA 5KI6A 2P4UA 2MYTA 4LX8A 1DG9A 3HDVA 5HSGA 5KQLA 1D5WA 1PNTA 3O21A 3LUDA 1TVMA 2HQBA 2IPLA 2F8TA 4MS3A 4IGAA 3HXMA 5IEJA 1QQAA 3IP7A 3JPWA 2A9QA 3ROTA 5T7BA 4NCBA 1R8JA 2PL1A 4KREA 1USIA 5PNTA 1QP0A 2IOYA 2LIVA 4WXEA 2PUDA 5KC9A 3HJFA 1Z25A 1ZESA 3FGZA 3LKVA 2HPHA 3ILHA 2H3HA 2AYZA 1P2FA 1SXGA 4JASB 4GNRA 1YTUA 2YHBA 4RK0A 1QMPA 4WT7A 1ZDMA 1E6KA 4MS4A 1VRVA 5IUKC 3SG0A 2PUEA 1QPZA 3QX9A 1SD5A 3KLOA 1XHEA 2NT3A 4Q6BA 1QP4A 4N47A 4LDAA 5FWYA 4G0YA 2MSWA 3I5AA 1DZ3A 4QYMA 5JS2A 3F6PA 2IPAB 1EWKA 2L2QA 3KYJB 1NXXA 3OQOA 1CYEA 1JHZA 4Z9BA 3QELA 4WZZA 3RVNA 4ZMSA 2FQYA 3VNBA 1JYEA 4G0XA 1ZY2A 3F6CA 3MYYA 5TQ0B 1ZHHA 4H3HB 1TLFA 1EWTA 3N53A 4MPTA 1F51E 3I09A 3HM9A 3N6VA 3T8YA 5KQMA 3LOPA 2GX6A 1D4ZA 2E4XA 3H1EA 1TM2A 4EYGA 4MYRA 3OO1A 4KK4A 1D1PA 4P1ZA 4KVFA 4UHJA 4W5QA 4G0OA 1EFAA 3JY6A 2F8SA 3BBLA 3UUGA 3A3KA 4TLMB 2GBPA 1YS7A 4L85A 3GL9A 4PEVA 2QVCA 2JK1A 2FN8A 3D8UA 5EWMA 3QX8A 4YLEA 1MB0A 1SXIA 2O20A 3EJWA 3FMVA 2L17A 3NNSA 4G0ZA 1S8NA 2FEPA 2QR3A 2XDYA 2FMFA 2WJWA 3I42A 3KTOA 3GRCA 5CNIA 5IEBA 3JPYA 1GCAA 4ML3A 3RVOA 3M9WA 4Z4IA 4S04A 3EULA 3RVRA 1BDIA 4KZKA 4TN5A 3M9XA 3G85A 3Q7RA 2R47A 3OLXA 5HM6A 4Z4CA 3DGEC 4M88A 5CHYA 1CHNA 3LFTA 4Z4EA 2N9UA 3MM4A 1OXBB 5BRAA 5KQGA 1JFTA 2WMYA 1YS6A 1ISSA 2PJUA 5TQ2A 5F64A 4F8JA 2PUGA 2NZVG 2E4ZA 3OLYA 4ETIA 3IP6A 4RDCA 3K9CA 2J48A 4RK7A 5BR1A 5JNVA 3KS9A 1LK0A 4D6XA 3KJXA 4EYOA 2PUAA 3H5OA 2MYNA 1ISRA 3RVPA 4F3TA 1ZAYA 5TPWA 2GKGA 3GA5A 1Z15A 1YMUA 1U04A 2IPMA 2RDMA 1GUDA 2E4YA 4MS1A 3W9SA 1QO0A 3H1GA 2RJNA 3CZ5A 4DN6A 4XLTA 2P9HA 2PLNA 2JBAB 4RY9A 1RZRD 4PE5B 4XASA 4L4UA 1JDNA 4MGEA 1XHFA 3N0WA 1LJLA 3KHTA 5JNWA 4F11A 2QV0A 5DLEA 1ABEA 4RY8A 1A0OA 5C5CA 4EYKA 2PKXA 1C0EA 2JVKA 3TX6A 1QP7A 3H75A 2ID7A 4MQFA 3O75A 4ETMA 8ABPA 3KCNA 5HQJA 1KGSA 1Y1LA 3CTPA 3QLVC 4RY0A 3LUJA 4IRXA 1RXEA 3P9YA 2TMYA 1JFVA 4PICA 2FLWA 2MYPA 2OQRA 1HEYA 3T6KA 4P98A 4MS4B 4CBVA 2BGGA 2HQRA 2VYCA 3I45A 4JB0A 2JVJA 2FMHA 1U8TA 1KRWA 1Z12A 5EWLA 2L18A 1K66A 1U2QA 2GWRA 4MQFB 5HKOA 1AB5A 5IX8A 1P6QA 3OLWA 2WWVD 3UK0A 4RK5A 2QXYA 5EWJA 3CLKA 3MMNA 3C97A 2VK2A 1ZGGA 1RNLA 3GBPA 3H5WA 5CNMA 3OLVA 5JS1A 4MLCA 3C3KA 2JBAA 4LE2A 1SRRA 4RSMA 1B00A 3G1WA 3HZHA 3JVDA 4EY3A 4WXMA 4H3KB 3C6QA 3GYBA 3HV2A 2HJ9A 4DADA 1LBIA 4YO7A 4Z4HA 1DJMA 2FQXA 3QEKA 2JRLA 3SAJA 4FB4A 1QO0D 3OQMA 1GLGA 1MB3A 5TPWB
chains in the Genus database with same CATH superfamily
2PUHA 3N2LA 2NACA 4BX3A 1Y5NA 1HT1E 3IDAA 3EWAA 1SB8A 1O97D 5JPIA 3HDTA 4BFLA 4D9BA 5AWFC 5EQDA 4AG5A 3LQYA 3IRVA 1N3YA 3KKPA 3NBZC 1PZHA 4HN9A 5TNXA 4AO6A 2ZULA 3PFKA 1IBRA 1Z16A 2B8EA 2AGVA 2Z2YA 1ZU5A 2ZK7A 3KAJA 4OA8A 5AR1A 3OU7A 1JDJA 3TD6A 3ZU5A 1ELOA 1EVIA 2JRCA 2X77A 1ST3A 3BOSA 1SG6A 3PXDA 4FYKA 3VR4H 5H4HA 1CJCA 1VJ1A 4MW9A 4HS9A 2N1MA 4K81B 2FFBA 4LJLA 5I3ZA 4I5IA 3VH4A 4BQNA 4BXOA 4CR8A 2PIDA 1JBKA 4LAFA 5IC4A 4RZSA 2H6EA 3MWEB 3NC0C 4EHFA 2D1QA 2ZAYA 2NSJA 2XQGA 3VPXA 3NBFA 3KJNA 5T64A 1ATZA 1ZOPA 3U3XA 4GMKA 3TCNA 4N8SA 3RFXA 4TTRA 2VP9A 2WZDA 5EJ6A 5F52A 2RJOA 1CJBA 4DCVA 1Q7GA 4N18A 5D84A 4JOBA 1O9HA 3KNZA 3SF0A 1GA1A 2EX1A 2GVNA 4NOJA 4TLCA 3KJGA 4NEGA 3EAGA 3W5AA 4PIMA 4R8MA 4G4SP 4PGAA 1UQTA 4Y2VA 1I7LA 1N2XA 1KR5A 4C7VA 2UYCA 1HUQA 1JEYA 6REQB 3ZJ5A 3HUUA 1XEAA 1ZS9A 1P5JA 4G5QA 2I03A 3N8NA 3QPCA 3RH0A 4DMUB 1FS4A 1H69A 4HPWA 4R9NA 5CVDA 2QRQA 5BNIA 1Z0SA 2WG1A 2VI5A 2O7QA 4I3FA 4F5YA 4FDVA 3R5SA 4B8YA 3TS1A 5ALJA 3OZGA 3PXEA 3DE4X 2JAHA 3KPYA 4IDQA 3HBJA 1F20A 1K86A 1L7VC 3ZVLA 4R1NA 4EB0A 3A10A 3D8HA 1ZLYA 1Q0RA 1K5HA 3ROPA 4A0HA 1KI6A 4K26A 3BN3A 4MV9A 5FQNA 1G9SA 4R2WA 4Y2YA 4TM7A 4L16A 1VSVA 2V1UA 3SDBA 2FSVA 4NAUA 2V8OA 1Z68A 1JAYA 1L7OA 1EDOA 2WTAA 1WP9A 2WVHA 4MWTA 1R12A 3GT7A 4L78A 4J91A 2GPNA 3CCBA 4CM7A 1Q1ZA 3F73A 1PQWA 1IUOA 3Q9NA 2DWCA 4OM7A 4MVJM 5G53C 3OBBA 1SC1A 2LW7A 4EARA 3AVUA 3DXYA 1ZJYA 3HLYA 3UMFA 2E4WA 4M0FA 4C2UA 1UKEA 2HWWA 3CUVA 1EYZA 3PUKA 2ZRGA 2I9PA 4I46A 1N2ZA 4YA6A 4L4RA 3GOHA 3VDNB 4A4DA 3QEJA 4UBLA 1SOMA 2HK8A 4E94A 1DS6A 3RANA 4BMPB 4UW9A 4EZEA 1CUJA 3EC2A 2O8BB 1JIQA 2VS1A 1XX6A 2UYYA 3BWDD 3DVLA 3QG1A 3N2KA 3HVUA 4MINA 1TPZA 4MXDA 3UWDA 4DVGA 2ZCVA 4TKUA 3AFGA 2X15A 4RF4A 4U6SA 5EIWA 4NESA 2GZAA 3OVMA 4KHPB 4Y6LA 1KO1A 3CEMA 1BC5A 3WRYA 2QDKA 1CUUA 3CTMA 1LK7A 1LRJA 1OTXA 3S8MA 5CT6A 5J4KA 1XVTA 5J47A 5K8CA 1VZ2A 1RXSA 4JQYA 4QODA 4F5WA 3PUVA 4Q1FA 6Q21A 4CTJA 1E7QA 1U7ZA 1SUWA 3A1CA 2GQ0A 3CX6A 4FOOA 1IEXA 2NAPA 1QYIA 3NIFB 5KTYA 1IG0A 3DLTA 1T2VA 4DIKA 3IE1A 4R1UA 2XYPA 2Z2ZA 2QD3A 4QHTA 1XHLA 4H1UA 1GDTA 4NFYA 3RS2A 1CVIA 1LDBA 1YQDA 3EUWA 3IPLA 3LY5A 3QXCA 1KMNA 1U3WA 4OI2A 3M3DA 5L3SB 4KYTA 4XGQA 4CF3A 1OT3A 5B7QA 4DB4A 1G20B 1SQFA 1E1QA 3FNEA 4ZAXA 3LX6A 3R5HA 1OV6A 1SHTX 1XD9A 4GM0A 2OBMA 4C2BA 5FTJA 1RLJA 3PTAA 1Z2DA 1VKOA 3K2EA 5ECDA 3S29A 1GHTA 4WBSA 1T4CA 4QXQA 3A4MA 2ATIA 2ZPTX 3KKOA 3SYLA 3UJ8A 4PG8A 2XUFA 2C2WA 3OQPA 5LZ8A 2VHEA 2QJRA 2IUTA 1QIHA 4YJHA 5JBNA 1YFZA 2CW5A 2P2YA 2VHQA 1OLOA 4URFA 1J7KA 4P0PB 1ODLA 1D04A 1JLLA 2NYAA 3FTQA 1E9CA 4EI9A 2H2AA 3E03A 5EHGA 1UP7A 3PFCA 3P2YA 3QM1A 3TXAA 5ILOA 4WGGA 4W1SA 4B4DA 2O2SA 4AX8A 1JQKA 1GCGA 4YAOA 1RPTA 2GUGA 3Q2IA 2NV0A 1T0PA 1RLUA 3TXYA 4TL6A 1EB9A 5E3IA 4L5YA 2PUTA 3OZEA 1UPBA 4OQEA 1P0MA 1GZ5A 2FXVA 2GEFA 1LY1A 3QEMB 5ICEA 1TK9A 5EJ9A 2IS4A 3B8EA 5TF4A 3F9CA 3P1JA 5ARCA 3AF5A 4LKRA 2DRIA 2ZE6A 2JI8A 4HWSA 2MMGA 2PMFA 2BZGA 1PKEA 1CE8A 1X87A 4L8GA 1YZNA 3VBEA 4QXAA 1E9RA 1PJBA 5CT4A 1JMKC 2XJ9A 1N8NA 2P30A 2WDZA 1MABB 6YASA 3WVNA 1U0NA 3MCZA 4XR4A 4KR9A 5CJPA 1JIVA 1XZJA 2CWWA 3FSGD 4RQBA 4F2HA 1V3TA 1NLYA 5CYPA 1ZRNA 4DMMA 1L4NA 2RGRA 2QYTA 2XE4A 4AJNA 3OE7A 1NYTA 1I3KA 1K7SN 1PR1A 1Q1EA 2EKPA 3F49S 3KR0A 3W9YA 1MO5A 5B1DA 4DCCA 4N0EA 4V1CI 4IGKA 4TWZA 2GRJA 3W9UA 3G7UA 3G2LA 3U09A 3LF1A 2W58A 1KYQA 2Y3IA 2QTMA 2QVXX 3PX2A 1KY2A 1R4MB 4YUWA 5A1TA 2EGGA 2B1GA 3EIHA 2ORVA 1COZA 4BZQA 5TPZD 4MI3A 1C3VA 1QTNA 1Z82A 2E55A 4NECA 1DC5A 4XJXA 5DHQA 5BYKA 2A9OA 4CMEA 1RTTA 1VSQA 2WY2D 2HD4A 3GV0A 2FPUA 2N1BA 4MA0A 2OHIA 5K2MA 5C18A 2C61A 4QWWA 1G8JA 4Y18A 5E0KB 1YE5A 2CF5A 4K40A 3VZRA 4ARSA 4QDOA 1MC1A 4LHEA 1I3CA 4ZHQA 1E1CA 3MWDA 1QKIA 4PTYA 3KALA 2JJ2D 3LIIA 1RW4A 3BRWD 2OBYA 4AQYB 2RI0A 3FDIA 3AIOA 3ZDDA 3S1LA 2PWAA 4HN4B 1MVNA 5JJIA 2PSDA 1L5VA 3G2IA 2XCUA 2Q3DA 2XNCA 1IWPB 1Y6RA 2VSXA 2WF6A 4RKFA 3WB0A 2ZJ2A 2C07A 4UDYX 4AT1A 4RWEA 1QVRA 5AIBA 2XOEA 3I0ZA 5H80A 3L7MA 2W4IA 4PX3A 4L6IA 2DH6A 3R6WA 4MR8B 5ALOA 2Q4EA 3EMDA 5EIBC 2ZIXA 2IZ6A 3VZQA 3HI4A 4LJKA 4TXHA 1YVDA 4XR9A 3ZGNA 3X1DA 1ECFA 2VYVD 3AR2A 5E4TA 4G89A 3RJMA 1UP4A 3I58A 5E8JA 4KLZA 4FD3A 1F38A 2H08A 1F2TA 1F6BA 1X1CA 2Q0XA 1J90A 2XQIA 4XCXA 3BXEA 4PLGA 3SEFA 5TV2A 4CUJA 1B23P 5KTPA 2P1RA 4WDRA 3KVOA 2X8JB 1FUKA 5LVAA 2IYLD 2AKAB 1CB7A 4K6MA 2Q6TA 1MHTA 3EDCA 2CJYA 1H2YA 2WKRA 1NNLA 1JECA 3WBBA 3ZV5A 1YR6A 3QKUA 2OILA 5JAPA 3KCQA 2Z8YM 4LXIA 4P3PA 3G9UA 4DG5A 1YZVA 4JDPA 3NQ41 1PIWA 2NVUA 4HUTA 1UOOA 3NWOA 2FWMX 4KWIA 2AK2A 2JZOA 4RV9A 1CEXA 5E1BA 3L82B 5CDSA 2OQVA 5KQLA 3MCUA 1CF4A 1YCFA 3PBKA 3ROXA 3LUDA 4DC0A 4RADA 1GL7A 5JSHA 5ALTA 1EM8A 2XYHA 1WQ4A 4UCXA 1QQAA 1LS1A 4CKXA 2GK7A 2R4TA 3ZN2A 4YJFA 3TNJA 1Z07A 4KI0A 1B2LA 3AUXA 3M5WA 1L4HA 3E4DA 4ROSA 5IKMA 1S89A 3A3YA 3S27A 3ZJVA 1XLTC 4JLJA 4DV6B 4EJFA 1JLSA 2AG5A 3TUJC 5FBQB 3IRUA 1E4EA 3BWEA 3L6DA 3MLAA 4BAGA 1E1MA 3GQVA 4DA8A 1JZSA 1O2DA 4HXYA 1C9DB 4EG3A 2RHBA 3T5CA 2I7VA 3E8MA 1L5OA 3UWMA 3KU1A 2GF2A 3DFUA 4JP2A 1F6WA 1QANA 1IONA 1G7CA 2DPLA 2HSEA 1I5OA 3FHLA 4PO9A 3RRZA 1F1BA 4DQUA 3WTBA 1H6DA 1WOYA 4PO8A 7GPBA 4KR2A 3WLKX 3FYUC 5FWYA 4HFJA 4ZO9A 3P9PA 2QHXA 3N86A 3NAMA 4G0YA 1OFUX 2YWXA 3ZY2A 3LX4A 5JCZA 2WIBA 2RH8A 3ONWA 4WH0A 1P9NA 2XCSB 3SD7A 1FLDA 1EWKA 3ECAA 4AIRA 1NXXA 1AE1A 1UQUA 3K94A 4ALLA 1CQZA 1JB1A 3OQOA 1H1DA 4P36A 4EAQA 5AUOB 3E1SA 2VSNA 1T6ZA 1L1QA 4G0XA 4HAUA 4OHZA 3FUCA 4X24A 1ITZA 2M9MA 2QE7D 2XTJA 1L4FA 3DAPA 3DEYX 1DOAA 3N8KA 1ZL2A 3L92A 1EWTA 2XMSA 2QK4A 4AZ3B 7MHTA 4JXZA 1F51E 1KWGA 3D1LA 3HR7A 3O26A 3JRWA 1R4NB 5DNCA 5IH3A 3MXOA 2FV8A 4CIWA 1HSZA 2EIHA 4KFUA 2EBHX 4IJWA 4LF7B 1VKJA 4JNCA 1OFTA 1JRLA 2C5SA 3UJ7A 2OR3A 2WHRA 4MI1A 1Z7YA 1ES9A 1YASA 3O9ZA 4MYRA 5FI3A 3DLAA 2PWYA 4S2EA 3BBLA 2I2WA 2J6IA 2NNWB 3DL2A 2QJOA 2F8LA 1KU0A 4UE6A 1U65A 2GBPA 3Q2KA 4WK2B 2KWIA 3TOSA 4L85A 3GL9A 1VHTA 4BDTA 1GQYA 5JOQA 5EWMA 2G4CA 4Q4HA 1SXIA 3LDGA 4FNMA 4Z1MA 4MYUA 2ZUFA 2WKSA 2XDYA 3SHWA 3ZCUA 1PD0A 4C4AA 1ACMA 3JPYA 3P71T 4WKPA 1IVSA 3GFRA 4LXTA 3ABRB 3UICA 4E21A 1U81A 2XGMA 3PQ8A 5B58T 3R76A 2Q41A 1IQRA 3V4PB 5C35A 5HM6A 4B9AA 4HYYA 2HLHA 3OCUA 4KIFA 2AMLA 3LFTA 5FR2A 3BX1A 4O25A 2EEPA 3W3AD 2QYSA 4BBZA 2EF1A 4N40A 4RPHA 1QGYA 4XIJA 1ADJA 3ZDEA 5BWLA 4IG4A 1V11A 3KTFA 2WMYA 4Y8VA 4DMLA 2ZFUA 4JP8A 2DQ4A 3ST7A 2PUGA 4HXFB 5AKJA 4YRNA 4XRGA 3MLEA 4F1JA 1XQYA 2OK8A 5E4JA 1WSWA 3B52X 3HRHA 3OPXA 1NXQA 1WQ1R 1CU1A 2ZJZA 1YONA 2PZKA 3VMMA 2FWIA 2JCSA 2F3SA 3CVXA 3SYMA 1DQYA 4G63A 4M98A 4OKNA 4N01A 5EE0A 4B32A 5AVZA 4KWCA 3B36A 3VUEA 4XWWA 4L07A 4RGBA 1DDGA 1NLZA 1R0BA 2R1VA 3I8XA 1M1NA 1LSJA 3G9QA 2C4MA 2VL7A 3LT5A 1WE2A 3CZ5A 3FCSB 4ONEA 4PVDA 3ROEA 6REQA 2PLNA 1D6NA 4IIJB 1ORHA 4CDMA 4IHAA 3I53A 3A9WA 3ZDBA 2WD8A 1L4GA 3KPWA 1XHFA 1A9XB 1HNXB 1TUGA 3OAAA 2P9FA 2Z95A 4L5BA 3LSYA 1TI7A 3MT7A 4EJ6A 2R11A 4W5HA 5FB3A 5HE9A 1JFRA 4BFXA 3FGPA 3RSOA 4YDQA 4E08A 3W2TA 4YRBA 1CK4A 1Q19A 4I99A 1WHTA 2HPZA 3CF0A 4DNFA 4JS0A 1QTQA 3F97A 2YBDA 4MB6A 4NNPA 1UKYA 5F12A 5F5LA 5CPBA 1ZD1A 3E58A 3A6ZA 2OO7A 1NA5A 2IU6A 4A2WA 5FH9A 5TT0A 3ZW9A 3A36A 1AN0A 3SSNA 3AXTA 3KJQA 4PINA 5I8WA 5EZ6B 4DDTA 4YQYA 4DJJA 5JR3A 2ISSD 5LZ4A 2ZJOA 2ZJ0A 4LK3A 4RULA 4RTKA 2EWMA 2GCEA 2L18A 1W0KD 1RQPA 1W2GA 1AB5A 1HT2E 3CY6A 3GLKA 4IX1A 5IAJA 3HB0A 4CMHA 2GN4A 4R3NA 4EJSB 4RHYA 5AYVA 1QRSA 2WHXA 4G37A 2BTQA 4NDNE 3SBDA 1IM2A 1ZGGA 3GBPA 2XTAA 4F3YA 3UMJA 5CNMA 3CISA 4LPSA 2H2WA 2Z2JA 3DH0A 3MCVA 1YC5A 2VHVA 2ZIXB 3C3KA 3GA0A 4KV9A 5IFKA 2E85A 4PZLA 4H77A 2FSUA 1VIVA 2VJMA 4ZJYA 1YB5A 1YJCA 1PJCA 3OY2A 3BJMA 4FPXA 1O94A 1J0EA 5ETJA 4YV2A 1O0SA 1Z63A 2CSXA 2JRLA 3SGLA 4UEKA 3UJHA 3NCTA 4MKZA 1G63A 4DWWA 2Q9UA 3OQMA 4OF4A 3NHYA 2HSZA 3S68A 2XQVA 2AN5A 3IXQA 3R23A 4JN6B 4BNMA 4LBVA 3C7TA 4H6PA 1BU8A 1T6XA 1YB1A 4F9FA 2GBCA 3FUWA 3V8QA 3S8YA 1GKUB 4RNCA 1QO7A 1P0PA 4O4JA 3JWGA 3M4XA 3VMFA 4ZCTA 3FMIA 2DAPA 2PD6A 1E4YA 3WMRA 3EFEA 5H1YA 2X0EA 5BMVF 2OHOA 1JDPA 4DJ5X 5TJHA 4ZVKA 1IE3A 2CB9A 3ER6A 4Z4GA 3M4NA 4YCMA 2JFXA 4IUBS 5I7OA 2M1ZA 4BN5A 2HHCA 4JJEA 9ABPA 1I7SB 4ZWNA 3OUTA 2ADMA 4TN1A 5DXAA 4EABA 4EYQA 2QRGA 4G8JA 4ZYLA 1K3UB 1Z22A 1Q3KA 4QIHA 5HKKA 2JG3A 1A04A 2GD1O 3WK4A 3JVUA 4D8YA 4J1TC 3WG9A 1G1MA 2UUBB 1UKAA 2FZKA 4K2AA 2Q5CA 4BEJA 1FSPA 2JJ8A 1NQUA 3D4OA 3QA9A 2LWIA 4G0QA 4JA2A 4K46A 5A4DA 4EVSA 1BEUB 4I1VA 5ALMA 3F7NA 1N6RA 2RBGA 3DLPX 3HZRA 3PS9A 5HF9A 3WDKA 1K97A 2Q5FA 3GUVA 4O2BF 3STVA 1I4WA 1TKRA 4J4HA 4YMIA 1R6AA 1T1EA 1IZ7A 1U0GA 4HL6A 2GNAA 4B2YA 2Y27A 3BFXA 1FFAA 2YV1A 4NMXB 2YIMA 2DUNA 3DKRA 1MO6A 3R3WA 4I1RA 4C05A 4D0LB 4WUVA 3L4BC 1BOOA 1GNPA 3EZNA 1NRIA 2ZQYA 3BC1A 5CFMA 4EW2A 1BMTA 1CE8B 1T0BA 4ZCIA 1NXVA 4RF5A 5CXQA 4UQPA 2R25B 4UXIA 3VH1A 4PM4A 5I6DA 3PNPA 1WCIB 4G5HA 4F96A 3A05A 3EF0A 4RIEA 4D4MA 5M29A 1Y7HA 1QHIA 1E9SA 1ZCFA 2Q0SA 2QLBA 4AM8A 5I51A 5M5BA 1D2GA 3S4YA 2MMCA 3NWBA 5H82A 1EFPB 1RMQA 3W7AA 4EY5A 1SJ9A 4P38A 2P9CA 3WBFA 2IYEA 3HGMA 5K8TA 5EJ4A 4EKEA 4F91B 2YMMA 3NHUA 3TEFA 2AXEA 4RQUA 3GLFB 2CXXA 4U2CA 3ABQB 4U2DA 4NCHA 4YACA 1JJIA 1KNXA 1H66A 3VJLA 5K0EA 4LF8B 5L51A 5IUNC 2J4CA 4X44A 4M54A 1VE6A 1U2DC 1EK0A 1GLNA 1WNTA 1BCRA 1YU9A 4KPUB 3GZNB 1EJ0A 4WNCA 1O6BA 2FPXA 1PYDA 3T7JA 3K05A 4A8TA 1V47A 3T4XA 2FRDA 3ZLTA 1N5MA 3LUCA 5HG0A 2YHIA 1PGPA 4BB0A 3GD5A 2V8BA 5AK3A 4JI4B 2WWIA 1TK3A 4KIUA 3JTMA 4S1WA 2XHEA 3FZEA 5PGMA 4BV3A 1NM5C 5FI1B 4HAOA 4BUZA 3CZ9A 4WK6A 1LJ8A 2BMEA 4REOA 5FULA 5L45A 2H1WA 3VVLA 2LP4Y 2P27A 2G63A 1EXNA 1U9IA 4H7DA 4HGYA 3N1UA 2PS0A 4XFKA 2BHNA 5GTDA 3BZBA 5G4KA 4C76A 4RY2A 4EZIA 3GEDA 4EJ0A 1RC0A 1PZNA 3KPVA 4TPKA 1OB2A 1X74A 3KQVA 4LY6A 2EP5A 3KEOA 5A4IS 1D8TA 1A5BB 2V7QD 1U1FA 5CA1B 5JZ9A 1I36A 4G1VA 4K9OA 2KYRA 2IYZA 3DBLA 1LTHR 3KJHA 1MX3A 1TYAE 2PSJA 4JY7A 3W6UA 1B6SA 5AHRA 2E1RA 2XMCA 3F5MA 1QF6A 2G36A 2B4QA 3F1KA 1Z7BA 4AB1A 3KQUA 1FLAA 2YVLA 3W6OA 5ADWA 3FFAA 2AD1A 4RTMA 4S3MA 5CVVA 4N5IX 3I37X 1CUAA 3RDPA 1T9DA 4NKRA 4E88A 1CF9A 3ISTA 4BQEA 3MPOA 1L5NA 5C51B 1SUAA 1LNZA 1EHCA 1Y6ZA 3TLJA 1G19A 4OFZA 4ZXFA 3U48A 4B46A 4CM1A 3DR3A 4RVSA 2EJVA 2YV2A 1ZUNB 3R7AA 1Q2XA 1W4RA 2XA1A 3FPLA 3EXEA 5M04A 1PVDA 2W11A 1NFFA 2AF4C 2G0TA 1J6UA 3B6IA 1USKA 3IMFA 1U2RA 4TQUS 3C39A 4BBJA 1IXRC 4QUAA 3VDXA 4F1KA 2CBZA 4NICA 4HNAA 1OI4A 3SNHA 1E63A 1UXJA 3Q3CA 2BD0A 3LT2A 4ZOEA 3TR0A 5KYWB 1AGXA 1F8FA 2PCJA 2W93A 3IPYA 2XNJA 2UYHA 1DWQA 3EPLA 2IUFA 3GAAA 3OMWA 1L8AA 4Y6OA 2R7LA 1CSEE 3DZ8A 3K0AA 3N3BC 1AX9A 3JW8A 2EP7A 2XWJI 4F9GA 1PZFA 4I50F 4GNKA 4TT3A 1UANA 1YV9A 3HUDA 1MAUA 4WK0B 1JP7A 4C9BA 3ECSA 2XGOA 4QO7A 1EFRD 3A26A 3ICPA 4G84A 5DLQC 3DPUA 4HFNA 4FGZA 1T5SA 5LMNB 3DS8A 2I3GA 5HILA 1V45E 2IX3A 2CD7A 2DZDA 1QBGA 2R48A 1CJMA 2X2FA 5ED4A 4JBYA 2WAMA 2RHRA 4RGVA 1KYVA 1OV4A 3AWDA 1VHWA 2GN8A 2GXQA 3BILA 4Q4AA 4XEUA 3W7BA 1P5FA 2IVZA 3EBPA 1XAGA 4OJKA 3IKTA 1MR3F 1MB4A 2ONKA 4KYIB 5DI3A 4AS2A 1NI4B 4LBYA 2BFEA 2HSGA 4NTZA 4OI0A 2NUAA 5DK6A 3W6PA 1TQDA 1RRMA 4P4SA 5F7JA 4YIKA 3UC5A 1N2GA 1P39A 2JGLA 4LRYA 3AM4A 2B0JA 1A5ZA 5DGIA 4P7BA 3F6SA 4RHFA 1NJ8A 4ZOCA 1EFLA 1LFDB 3OM8A 4MKRA 1X1EA 1ENYA 4YRCA 4F93B 5EHXA 3C4JA 3Q7TA 3GLUA 2HMUA 3MT8A 2NM0A 1QAQA 1KJIA 4WY5A 3LTNC 1IEWA 2FPMA 2PMCA 3JYOA 3U7RA 4BZWA 3KQYA 2QL5A 1R0WA 4Y0AA 1W5TA 2PUWA 3H99A 4XDHA 3IOYA 2PGLA 1D9ZA 1O95C 1VLZA 4HDKB 3GBVA 1NQWA 1RWMA 2XDAA 2HXGA 1JQJC 3S7ZA 3TM5A 4WGFA 2G88A 2YFHA 3BMXA 4GC5A 5D51S 3ZJYA 1ZIPA 2I22A 3KSUA 3MWEA 4HQOA 2VRCA 4Y98A 5HGXA 1LVUA 4I3GA 3SX4A 1YJ5A 1MH9A 3IT1A 4DCMA 5EPOA 3VKVA 5BV8A 3CKKA 1R66A 1XZAA 1OFIA 2C58A 2WILA 4ADSG 5JANA 1Z06A 4P5DA 3DBVO 3QE0A 1XNHA 3C3WA 4K28A 1E3SA 2C8LA 4ZHQF 2GARA 2B37A 2Q4TA 2VAVA 1LZKA 4OB8A 1OGYA 1U02A 4L2IB 4TUYB 5JCJA 2Z1DA 1E4EB 2IODA 3LGXA 6GPBA 2UUPA 5DTEA 2JLAA 5IBRA 3AYXB 4DA7A 2FPWA 4KR6A 5JYEA 2GM4A 1H93A 1FYVA 1N5IA 1FYXA 4CV0A 3ADDA 5AVSA 4EHJA 4BNDA 3QMVA 3BWVA 4JVMA 5CB8A 3DPIA 2PX2A 2W2TA 2XMQA 3BXZA 2YY7A 3I4CA 1P2VA 3Q72A 4IO0A 1SR8A 1V2HE 3QTBA 4M0UA 2V6BA 3C8DA 3PCTA 4AJLA 3EAFA 2WSYB 1ESZA 3G13A 1Q1QA 4O2BA 3DEKA 5JYCA 3EVNA 1DPFA 1ESCA 5EIFA 3WK5A 1JJAA 4RTOA 1A1SA 2PHZA 4DB2A 3MGBA 4KE8A 1DIAA 3ZE1B 3OE4A 3SPXA 3WHPA 3MJ4A 5ADUS 3AM3A 1XP5A 3D6FA 5JDCC 4CM4A 4YYZA 1N2EA 1Y34E 1I33A 1Z28A 1XTQA 3CWQA 3AI1A 1GP2A 2H0RA 3KT6A 3VR0A 4MUFA 4OYYA 4OLJA 1VTKA 4DXHA 5T6MA 2YIDA 2YY5A 4YAIA 1EX7A 1O0BA 1F2TB 3U9TA 1LLDA 3UB4A 3CO0S 3IBCA 4IUYA 2EJCA 3FZYA 4RZHA 4PNEA 4O33A 3LUKA 1U8FO 1XQWA 1QLWA 4HI0E 3KB8A 3GVXA 1C80A 4CT4B 1QQBA 3PYLA 1MGPA 2B1IA 4EMBA 4CMCA 3GJ8A 2R79A 3MUEA 3LUBA 3WFIA 1X0VA 3M6XA 4JJ6A 1NLFA 3ZE7A 2XCRB 1J00A 2OCXA 4M0LA 4Y7DA 3JPWA 4IRMA 5BR7A 5T7BA 2PL1A 1TEHA 3VGJA 1RBMA 2V9PA 4J75A 4YRIA 5CK5A 4CKYA 2CLEB 4LGMA 2X86A 3WGUA 1P4JA 2R97A 2E0IA 1JDUA 3K15A 4ZU6X 2FUG1 3U60B 2GJAA 3HA2A 4L3WA 1KEUA 1QYRA 4QX6A 4HNVA 3EY4A 5B4TA 1ZONA 2Y0BA 4MS4A 1X39A 4MMYB 3DLIA 4ZRDA 1TNDA 5F9FA 2MWMA 4EGAA 3PUXA 4O4IB 1XMVA 1CNEA 3QX9A 5LU9A 1GZUA 1SD5A 4OMCA 2IZ5A 1OY1A 5DJ5A 5KNDH 5EMNA 4LZWA 3AF2A 1QP4A 3FXAA 2A1TS 1II8A 3T3MB 2IEYA 3OA0A 5KKAA 1KZHA 5T67A 1QX4A 2Q4BA 3CRZA 3L7OA 4ZPXA 1TO2E 1PEKE 4YWJA 1B7GO 5HEKA 5KSPA 3RSSA 4CMIB 5CT5A 3F5QA 2BUCA 4ZYWA 1AJEA 4DJAA 3DYBA 4ACAA 4JBGA 1FSZA 1UWCA 3A1SA 1COWA 4B4OA 4C03A 4YJ3A 1GVNB 5EEHA 4MITA 3RG8A 2J33A 3MYYA 1K0UA 4YQZA 1KK3A 1WXQA 3HCEA 2PH7A 2RGXA 3FTPA 4ND1A 1X3SA 1OAOC 4NZOA 4JSYA 4RZQA 3W6ZA 5G1NA 3F4KA 3QFCA 2QGNA 3AONB 3W4KA 3C45A 5C31A 1C5KA 1KI4A 1SCIA 2B3DA 3OT1A 2A7QA 3MJSA 3K3PA 3AR9A 2BMAA 3N87A 1YKFA 3OKCA 4P1ZA 3BWCA 1EFAA 2EX0A 3Q87B 2IOQA 2I4NA 2BFPA 1M8FA 1AQUA 1FTQA 4NV0A 1G21B 1LVGA 2G5CA 2IGBA 2JK1A 2YC2C 4J43A 4YLEA 3IODA 5T8KC 4F8YA 2I91A 1VLVA 3K0BA 3NNSA 2WTXA 1S8NA 2Y1GA 1HDZA 1OHHA 3EVBA 3NDPA 4GYWA 4MKGA 3WV5A 1ZEJA 5GGYA 4C4OA 1OYVA 3ABSB 4AYWA 2HHJA 4F6RA 3OQIA 1LB1B 1XVUA 4ZAFA 1Z4PX 2BMVA 2GTPA 3FTCA 4Z51A 4DUYB 4OQYA 1GSOA 3F6EX 2I7TA 3CCCA 3GC6A 1NMZA 3FPGA 4HZIA 1KIMA 2DBVO 5EQTA 3P27A 1VI2A 3GU3A 4INJA 4RMIA 4DYVA 3EY9A 4IKPA 1N6HA 4E5NA 4WBNB 2XZTA 2PJUA 3K1TA 1W0JD 4R1QA 2W6JA 5LZ2A 5LDGA 1QHSA 3I6ZA 1D1SA 2IDZA 2O3TA 1BOFA 3OZCA 3QWBA 2C3MA 1KR2A 2A5FA 4R2MA 4TL9A 1L5HA 3WIOA 5L9AA 4EYOA 3AR6A 2FSHA 3GEEA 2RG1A 2J0UA 4PS1A 3HL4A 5BPFA 1A4UA 3RVPA 1FNCA 2GKGA 1F9AA 1PT7A 1PSDA 5HBGA 1I7NA 1R6XA 2PX5A 5FBZA 2RDMA 5C4GB 3C4VA 3K5IA 3GCGA 1NLMA 4MS1A 4W9MC 3PT9A 1SCDA 3A6HA 2YDXA 3DMPA 2LNDA 4HDSA 5COQA 3T15A 4DR4B 1GAEO 2O19A 4UBIA 3L05A 5DP2A 1NKSA 3CUUA 3HA7A 2Z83A 2O0KA 4XASA 1TUBA 1I0ZA 2BMWA 2EW8A 3CNLA 4HAXA 4O2LA 2PT6A 4EEKA 5K0GA 2OV6A 1RACA 2R1TB 5LP1A 1KI1A 1ABEA 2B4RO 5ALQA 1JHPA 2H2GA 3AF3A 3P2EA 4BQQA 4OQLA 4YK7A 3LWBA 3VYVA 3FCUB 5JXHA 5LR6A 1UDWA 5B6IA 1ZOIA 2CFTA 3QLVC 1Q15A 4IDGA 5ITZA 3EPHA 2D3WA 2GM9A 4UNPA 2GEUA 3HWWA 4J4TA 1B73A 1FFXA 1D9XA 3CZQA 1X7ZB 3R5KA 1G42A 4G8CA 5FHQA 5AD1A 5P21A 2EG5A 1QU3A 2HYDA 4KMMA 5L7WA 4LHZA 5EP3A 3ROKA 2I55A 4QVIA 4YALA 4B3MB 4AJ2A 1U8TA 3JD1A 4IV8A 4GGOA 1CUVA 1Z12A 3DV2A 3QWAA 1M5RA 4CEIA 1F14A 1PE0A 1CULC 3UVEA 3VH2A 5I9LA 4WX2B 4I1PA 3CH7A 5A3RA 2V96A 3KUDA 3DHNA 1QKJA 2K7ZA 3INRA 4KYVA 4PSCA 3G02A 3WJ7A 4DCNA 2H18A 3V4FA 4A26A 4MVJH 1G8YA 1P72A 3HFRA 1QGUA 3HB7A 3QNUA 3WWZA 1NE7A 4CM8B 2QSZA 1SUDA 4DEXA 2Y2UA 3L8ZA 4N5MA 1XVAA 2GN1A 2R8PA 3EBOA 1VFNA 2A14A 5KOYA 2QAGA 1GITA 1PBNA 4OX9Y 2HT1A 4OJYA 1EQAA 3EQ8A 5B7PA 2C20A 4C3OB 3G0IA 4PG5A 2WTNA 1CUYA 4ZICA 5A4JA 3IEVA 3F67A 4TWJA 3EIXA 4YRAA 1O96B 4F5DA 4DR6B 4FE3A 3W3ZB 5BUZA 3NRJA 1ZISA 3AI3A 4PN7A 1ADCA 3BXFA 3PGLA 1LC0A 2LXNA 2A4KA 4X97A 1BHQ1 1BNCA 1Z8NA 1QMGA 2PU7A 4CKWA 2FEMA 4HEJA 1BD4A 4JAVC 1R27A 2YJ3A 4FHCA 2R6R1 4YHHB 4KLAA 3H4TA 5JWOA 4PLTA 1VFPA 2H5LA 2QG6A 2ZYAA 5AKZA 1APBA 3O4FA 5DW0A 3K0HA 1NURA 4TQGA 4KI7A 1CUSA 3PLNA 4DZZA 1M7HA 1UC9A 4OREX 4HDOB 3U37A 1EUQA 1LBTA 1P8AA 1Z5UA 3TBFA 4DLVA 2QM0A 3GHHA 5IYZB 4R7GA 3DVRX 1CZHA 1JDBC 3V1MA 2FKAA 3D0QA 3RVSA 3K20A 5I7VA 1JG2A 2CB0A 3H2HA 1V37A 4E31A 1XMOB 2WUVA 3DR5A 3NIBA 3ONFA 1UBCA 4V3BA 4WOBA 2JKZA 1ACJA 4HB0A 1P3Y1 4HATA 4RV5A 1P29A 1L5GB 5TRTA 5L6LB 1XQXA 5B1EA 1KI2A 3BMOA 1L9KA 4DMKA 1Z56C 3J7TA 1KDTA 4BGVA 4DIDA 3ZK7A 4REQA 4L5CA 2XMGA 1XRQA 3JAWA 5DSXA 1ZAYA 3TMYA 1DIRA 5BXYA 4ENQA 4GF5A 2QN8A 1WB6A 3JQAA 1HLDA 1DVRA 2VRBA 2X5KO 1CDDA 1E2GA 2P68A 3TZ6A 2PGIA 4S12A 4X6XA 4KFCA 2V5UA 1GDDA 1U5CA 5GIOE 4FLEA 4C0BA 1PEAA 1NX6A 5LOVF 5FLKA 2J0UB 5U1PA 2J9XB 2OPBA 2QV7A 4QYIB 5CURA 4N3CA 4CEJA 4R01A 2JLVA 2A58A 2HIMA 4V0QA 4HWOA 3EPJA 4DV2B 4YEDA 1Y3AA 3HBMA 3GUYA 4GDMA 3A1NA 5FKJA 3FCCA 3Q3IA 4A8PA 4OQXA 3QV1A 1TQHA 6NULA 2WVAA 3ADPA 1SN7A 2E4UA 3H86A 3OZAA 4KMSA 2O59A 3ECCA 4N8EA 4UM8B 3IBFA 5HTKA 3VSBA 3IGFA 4B3CA 4P4NA 3HGTA 2GS9A 4NBKA 1R7RA 4JUAA 3NH9A 1WA5A 5I3CA 4WFIA 3MHTA 5C7OO 4P4TA 2XZLA 1WXWA 4FUTA 2Q07A 3AJAA 2FQWA 3VTKA 5CB0A 3OPYA 1DQPA 1CIVA 3IBSA 1J5PA 5ERGB 2GPJA 3WSWA 4ERNA 4I8XA 3E2IA 4BVHA 4Q24A 1V7QA 1XLUA 1GD1O 3UJAA 1E6LA 3AY0A 5EP1A 1KKLA 3RVJA 1HC7A 3ZWAA 1OX5A 4O5AA 5CLHA 4EUHA 2ENWA 2WUEA 4KN8A 3CH4B 3N05A 5HZKA 2AKEA 2AW3A 2XNDA 4NQRA 2PEYA 4OQMA 1LBEA 1ZXBA 1LW6E 1P9LA 1T9HA 3O4IA 5FUVA 2OA0A 4NCNA 1PJLA 2EDCA 3H18A 4DR5B 3KUKA 2NO4A 4W99A 5TR9A 4KRFA 2RBKA 4E3WA 5BSKA 1HE8B 1LK5A 3AJRA 1DAKA 4MKIA 1C7QA 1Q95A 3RUCA 2ZR0A 3KSZO 4YT4A 3QKSB 4CI0B 4K0KB 5LBUA 1M8PA 2V6IA 3IQWA 2O23A 2PZJA 3KT0A 3OKPA 2OSVA 2FW8A 2EW2A 4ZRMA 4DRZA 1D0SA 3H2IA 2ZVJA 1JZQA 2IT1A 2BF4A 4LHSA 3KBBA 3LVRE 1HFKA 3JALB 1AZSC 3NNDA 1WSBA 2NQTA 2JFUA 3ETEA 1QNLA 2ID9A 4YRQA 1BFUA 1M33A 2YS6A 5IWCA 3BDAA 3Q9UA 4HXEB 3H11A 4DAEA 3N8IA 2X7JA 1VIMA 3RBVA 5KWVA 1PKXA 3PD1A 2IXBA 4KDFA 4Q47A 3KOXA 5KDLA 3TTTA 1P7WA 2IYSA 3LVBA 4BO3A 4UAGA 4JEUA 1THZA 4NYMQ 3L4BA 4C08A 3D6NB 3O8QB 3HVKA 2IKSA 2XIJA 3UH1A 3KDSE 3NBXX 2WFLA 3K9QO 3CQ9A 3EIQA 4B84A 5IABA 3RC8A 3CG0A 3PXGA 2CF6A 1FNDA 3CWCA 4K88A 2BHTA 4UNIA 1C9KA 1NL3A 1PSZA 1Q1NA 1AKQA 1UMBA 3IQFA 4KBGA 2GEJA 3B9PA 2BSAA 3IA2A 3EIWA 4KQHA 4MPDA 2FP4B 1V8OA 4FOSA 5EMLA 1BDBA 2IX9A 3QVSA 1Q0ZA 3F46A 3LLUA 5LQJA 2YZGA 1YA6A 1EUDA 2OLKA 5DGCA 1VECA 3WK6A 4N6NA 3CN9A 2GBIA 2AMJA 4IYJA 3WYGA 4EMSA 5CCXA 2W37A 3LBYA 2ORED 5CH3A 4GECA 4RVGA 4IFEA 2YHAA 1GRNA 3MTIA 1E3DA 4G1CA 4EELA 5JFGA 2Z9BA 2X3YA 4A7PA 3B3AA 1FNNA 1XCJA 3KZXA 1NN3A 3L01A 2OV3A 3AILA 3PEUA 2LR0A 5EHIA 4FN5A 1IBLB 1LQ2A 4LJYA 4Q7EA 1DLJA 1UC4B 2I7XA 1Y1RA 3S2EA 3T1OA 3UHAA 2X0NA 4QRIA 4A9AA 2WUFA 3A4TA 3JD2A 3LAWA 4MNTA 1JVBA 1LUAA 1Z0AA 2VF4X 4PNHA 4IDHA 1A50B 3UTDA 1VPWA 5C5DA 2WUGA 3A70A 2PV0A 1SKMA 3H9EO 3WJ1A 2MSEB 3BFVA 3JZDA 3QTLA 4IYRA 3ZI0A 1ZMXA 3ORQA 2XDQA 4TWIA 5DT2A 3RR2A 1N2CE 4WLUA 3U3DA 2O8FB 2FFRA 4KPFC 3TSOA 1PR0A 3IALA 5AJUA 4B2IA 1VL2A 2DJ5A 4D4HA 5JZMA 1UEJA 5B1YA 5HTOA 3P32A 3QENA 5JG7A 2ISQA 5EFZA 2A30A 3C3PA 4GPTA 3NZEA 1RADA 1KAGA 3B1FA 4JHXA 3UXHA 4MUKA 1I2MA 4J0JA 4OLBA 4ITRC 1J33A 4PZAA 2I0FA 4LYDA 2X8WA 1HQCA 1VMDA 1BMFD 1XZIA 1L7MA 1AKVA 2AFIA 2MJLA 2Y6UA 2ZRLA 3EUAA 3FMFA 4QHYA 1CZUA 3W5VA 4D9JA 5EEGA 3PITA 1QH8A 2LBPA 3HUEA 2QAGC 2ZLBA 2Z5LA 4WESA 1X1SA 3RSFA 3TAXA 5KTOA 3OIDA 2QTLA 3OZTA 3KYDA 4RJJA 2JFOA 2OORA 1XTIA 3Q9SA 1B0AA 1JQAA 1T6NA 2YWBA 5FWXA 1QONA 1J2UA 1XAHA 2IH4A 1YCGA 3OIVA 3QELB 4Z4QA 3I9MA 3G8DA 2XXAA 3BVPA 5JMTA 1IOZA 1VLLA 4BAZA 3RC3A 3QVVA 2FP3A 1ST2A 1THTA 4V0RA 1V4BA 4ZVVA 1PJ4A 1B0ZA 1UFKA 2J87A 2GSDA 2QNRA 4DEVA 1EPUA 4ZVMA 1SHUX 3B6EA 1OQAA 3IAFA 3A4VA 5GPBA 1QOQB 2MSLA 2R7KA 1HG0A 2I8CA 3CZMA 1QPGA 1U7XA 2A0FA 5ALSA 3FR7A 3UENA 4XOIA 1HL7A 3TL6A 3KV1A 1E3WA 1EXWA 1XTUA 4FFLA 4U4AA 3SS9X 5IAOA 1YBHA 2BEKA 4JD5A 1UBSB 4ZKEA 4E07A 4ZT7A 1N4DA 1SXHA 4YFVA 3AGQA 4E4YA 4AWXA 1FFDA 2IH2A 4O4JF 3DO5A 3H3XA 1CJTC 2BJHA 3W8DA 3EX7C 2JIQA 4KV7A 3UG6A 3VA7A 1M1XB 3QK7A 5M2QA 3UH0A 3VU0A 2P7IA 1PQ4A 2FF5A 5C3UA 3QOFA 2Q29A 5ELXA 4GUDA 1N36B 1WF6A 1UAYA 2IC5A 4A73A 3PFGA 3R6TA 4XYMA 4X7BA 1AGNA 2GEKA 1RAIA 2EBWA 3AJDA 1C4WA 2A78A 2XR1A 4Q9HA 1E3WB 2XI4A 2O07A 3AUJB 4EVIA 5IZ4A 4TGLA 4D25A 3NYRA 4NARA 3SC2B 1S9DA 5F5XA 1R5BA 4DR3B 1OWNA 1WVMA 4B47A 2X41A 4TV9B 5K1ZA 3GJ7A 1P2TA 4A0RA 3BF7A 3HY6A 4TKVB 5DHUA 2OZLA 1R0YA 2FQQA 4I14A 4LCEA 5J40A 4ZEOA 3Q3HA 3GUHA 2COKA 1IOWA 1OGJA 3IB3A 2AEFA 4X66B 3D7LA 5J5CA 1P4RA 3P8ZA 4CWAA 4ND5A 1SVOA 1ESNA 2J5BA 1ADYA 2C4KA 4W7IA 1S1MA 3HB4X 1PGQA 1N9ZA 2HEGA 4WXEA 5C8XA 1KTIA 2PUDA 3V8MA 2XXBA 4DNXA 4EY4A 3GMIA 2I8LA 1QOPB 1EE1A 4N0DA 4EFKA 2H3HA 5K3AA 4E3ZA 3SZOA 2SBTA 4EUSA 2WI8A 1JH8A 1PFYA 5KX5F 1DNPA 1GR1A 1E6KA 1U3GA 1XP8A 4MYDA 3DZIA 3JARA 2OGWA 2DPMA 2VDQB 1AKYA 4JL6A 5LXTF 2VNKA 3F0TA 5K8LA 2ECFA 3EXEB 5CBKA 4C78A 3OF5A 4G23A 4EKIA 1AK2A 1SQSA 3FIJA 2CLKB 1YFKA 3W1VA 2JHGA 4E2ZA 1J20A 1GNSA 5FADA 3I8OA 3I9V6 4QOGA 3ONVA 1ENPA 4YQEA 1H8HD 5GVSA 5DSTA 2WAXA 1MB9A 2QTGA 2ZBFA 4XM1A 2HRBA 1XD2A 3FOFC 4EF4A 3C14C 5KYTA 3DDCA 3ZBQA 2REXB 2X2EA 3PNYA 2W70A 1X6VA 1UEXC 2H4WA 2HCJB 5TQ0B 5ABPA 5IJ9B 3T5AA 1LQUA 3F3SA 3NT2A 2QN7A 1KDOA 3W9BA 4NBLA 4N54A 4P3KA 1FRFS 1HE3A 2WWHA 3EVCA 3T8YA 5CA1A 5A5FA 2FJPA 2GX6A 4U2FA 5ALVA 4RQAA 3ZU2A 3UXYA 4DCUA 1A77A 1T36A 2JFQA 2ZE8A 4M38A 4PLVA 3D7NA 3O91A 4ZTBA 4A0SA 3E22B 3H13A 3OUUA 2DPYA 4H4CA 1ZIDA 1VL1A 1NT4A 1T0HB 3PZBA 1JTEA 3N2EA 1J9ZA 3LVFO 4XTRA 4FMCB 2FPGB 4ZYXA 4FFDA 4V02A 4O4HB 1I5RA 4LV6A 3TSYA 3OICA 1QFJA 1XXHB 2IP1A 3P52A 5CAEB 1JTVA 1G64A 4WADA 4PHCA 4HDRB 4JFRA 4E1AA 3K2IA 2Q5HA 3MJRA 4EL0A 1HE2A 1IBKB 2PLWA 4R40A 3K9HA 4HRAA 4PO1A 3VFDA 1W73A 4DPKA 3BGWA 2WZQA 3FHTA 1NV8A 5D3ZA 2GAAA 3DGEC 4YMVA 4PQEA 4AMVA 2D59A 2A94A 1C81A 1I6MA 1YQ9A 1Z0JA 4R81A 4D57A 4F6RB 4PWZA 1XJQA 2N9UA 2WJPA 5AHKA 3C74A 1PJ2A 3C3DA 4QARA 2D2EA 3TNFA 2C5GA 4JEHA 5BVHB 2YX1A 4ITVA 1SA0A 3VDMA 4CFSA 4C7XA 2ACWA 3ETJA 1GVHA 4FDLA 2GZRA 2JIMA 2O5RA 3WIEA 4X8MA 1QDLB 4BKQA 1Q1BA 1K3TA 2N75A 2NSYA 3MEQA 1IQPA 4JENA 3FUUA 4B6EA 4BU0A 4KX3A 3LCRA 4CKCA 4IG9A 2J3DA 1JEAA 2P4QA 1SCAA 5C1BA 3NS7A 5LP6F 5ES4B 2N47A 1E6CA 1TT5B 2BGKA 3PKZA 3PR1A 5LOVA 2ZITA 5DLPA 4E2YA 1H42A 4BFCA 3EN0A 3NATA 5A3JA 4KGVA 4BTEA 5FA6A 3V9PA 3U5ZB 1T6YA 1KK2A 4Z53A 2V7GA 1BGWA 5DLEA 2QPOA 3PWKA 3FJ1A 2JFNA 4ZVOA 4B48A 4YRFA 4CG0A 2QTVB 4QU9A 2Z58A 1SZPA 4GR9A 1E2PA 3QKSA 3QYFA 5FUYA 2EZ4A 3OAAD 3NV7A 1RYEA 4AWBA 3TPFA 2VZEA 3CEHA 4MGKR 5AW6A 3H9CA 4PRYA 1H2XA 4OFBA 4ZIRB 3LUJA 1Q0TA 4XWYA 2D13A 1E2FA 1NT2A 4LC1A 5IWAB 2CMDA 2R9VA 4B4WA 2DM6A 4PICA 4MP3A 3DOHA 1ND5A 5AI5A 1PJAA 1GPJA 5K4AA 3O8LA 3T5MA 4BLRA 3VPGA 1JALA 1E66A 2XAUA 3BTSA 4OYLA 3SJUA 5JS7A 2JH9A 3SVTA 2ZI7A 5EJFA 2Q2VA 3AI7A 2A33A 5JSFA 1G7RA 3OF2A 4B6QA 1BO6A 4UU0A 3STHA 4ZT4A 1K66A 1KKMA 1WZUA 2XF8A 2FPOA 3IJEB 4QVGA 2QW0X 1F7VA 3E2MA 1RI1A 3CUYA 4P81A 1PO7A 4A1FA 1NDUA 4RK5A 1QK3A 1FMJA 3MMNA 3C97A 2QD4A 4AKEA 1ONNA 2CZCA 4CNQA 3AQIA 3DBRA 1LDYA 3ES9A 3AFMA 4FBLA 5E6RA 3OLVA 1RKVA 3EMVA 1GKLA 3ZOZA 4REMA 2J0QA 1LLQA 3JR7A 4QOEA 2JIZD 3LZ6A 3C4QA 4J4BA 5JEEA 2PRJA 3HZHA 1ZM2A 4ANFA 4Z7OB 1NVMB 4H3KB 4DADA 2OYRA 4Y2QA 4JK3A 3SAJA 3ZIAD 2JIZA 1FDOA 4QYIA 4Q0MA 1XZHA 2V9ZA 1CEQA 3HH8A 4OIFA 3I83A 4L0DA 3L46A 4UE3S 2AMYA 2HUPA 2JCBA 4YJGB 4YAUA 1QH1B 1T36B 3PI6A 3HCBA 4IILA 1QCDA 4BV8A 5JC8A 5L3QB 4RPKA 5HOEA 3OFJA 3OFKA 5FOWA 1RM4A 3JYLA 3R4CA 3CVWA 3AL0C 1YI8A 2IL1A 3ZQ4A 1G38A 3GZTB 1XDZA 4LXXA 3NBUA 1Y9ZA 3L06A 3T0IA 1HORA 4GL2A 3FJYA 2ZWAA 4S1TA 5ICCA 2D06A 3JQBA 4CU2A 4RGYA 1ABFA 1J2JA 3NX4A 1YRYE 2ZTMA 1HE5A 3ASVA 5CYFA 3I9LA 5EHNA 1SVLA 3PEWA 2GZ3A 2DSNA 1B0PA 4I9UA 4B87A 2VDWB 4F1WA 5TMDA 4X5OA 5A2GA 1DG1G 1N2SA 2Q7OE 2Z98A 3O5AA 2RHJA 3EUFA 1PJTA 2B0CA 4WL0A 3ZX5A 1XYYA 1GLVA 1U9ZA 2RAVA 2EQAA 3LUHA 4GP9A 3JWHA 1GOTA 4DIEA 3GZ4A 2XEDA 1GTG1 1NJSA 2VDRB 3JXEA 1B16A 2NO7A 3A0RB 1XRRA 1Y1KE 3I30X 4D8XA 1EAYA 2X23A 2YWHA 2M6RA 3UAOA 1H6AA 1YK0A 3HC7A 1E3MA 1YRWA 4M1SA 2PE5A 3JARB 1W5EA 3MYRA 5MGNA 3DCIA 4D3ZA 3VR4A 4P53A 1WCYA 5GJVC 4OLFA 2DFVA 1FS5A 2F2TA 1ZICA 2YWFA 4GVXA 4RV4A 3MUFA 4CKWB 2JJ1A 3V34A 1Y7LA 1F9EA 4AF8A 1CY2A 3S44A 3PSAA 4M8KA 1NGSA 3MW8A 3B3JA 4PANA 4TV8F 3ZHCA 1BS1A 2JARA 1T9ZA 2BKVA 2WZCA 4PC6A 4BOYA 3F7MA 1P1BA 3T12A 1EXMA 5JROA 1VYVA 1DADA 2CT8A 3LBAA 4BMDA 3CPHA 3W2IA 1PS8A 2R66A 5EFOA 1W5SA 1IPHA 1C30B 1AKNA 1BCSA 2G1AA 2GWHA 3CUKA 3G8BA 4GG1A 1F7UA 1ESDA 1FU4A 5ILQA 3BJIC 5F4ZA 4ZQCB 5LQKA 4JYBA 1BRMA 1J9GA 1UJ6A 3HADA 3FRIA 3OHMA 4WZAB 2W42A 1Y4SA 4TV9A 2MYUA 3BK2A 3FNBA 1CDEA 1XF9A 1REQA 3W3AA 721PA 1Q6ZA 3HCRA 1P7CA 1EDEA 4KGDA 3T99A 3KOOA 4QU8A 3TRIA 1MJGM 3R0JA 2JW5A 1T2EA 1IZYA 4FX2A 4XX0B 5DH9A 1HYQA 3SDZA 3VVMA 3WK8A 1ODCA 3FB1A 1K8ZB 2O0JA 3QVGA 3UO8B 1X2EA 5FIUA 3D8SA 3GDWA 3L18A 2ZUCA 5C7YA 3PYXA 4QOSA 3M4JA 1N0IA 1RQ7A 3PLAE 1EX1A 1WL8A 1J1UA 4A92A 3A9CA 1NSTA 5DKFA 1G2OA 4OXYA 1RJWA 3PFHA 4CVNA 1F2UA 1DBPA 4DQDA 3ZHRA 2G9RA 2YWDA 1UOEA 3L5KA 2H17A 1X7ZA 3DDSA 3HA3A 2I2CA 2WF8A 2I2AA 1UDRA 3CJRA 2WJ3A 1CQJA 4QTXA 1L7DA 2AG1A 5E9AA 3C98A 1MIHA 4N41A 1J97A 1XI2A 2VP2A 3CLVA 4JZKA 1ZW1A 4R8SA 4H60A 1BKSB 4LMAA 1IWOA 3PQEA 5AM0A 3L0PA 2RGDA 3ZK9A 1O0CA 4LE1A 5JH7A 2RHDA 9GPBA 1DRKA 2H48A 3M6IA 3QKTA 4TLLB 4PW0A 5AKEA 1RM5A 1XC7A 4B43A 5AUPB 2GYUA 3GPBA 1HZJA 1OX4B 1PNOA 3MINA 4TYNA 3DP9A 5MN6A 4B6RA 4DNQA 5LUBA 4I9NA 3CYFA 2CMGA 2BRUA 5FWXB 4LZNA 3M3PA 1JHVA 4MKHA 1TW2A 4WKCA 1UAGA 1V9SA 2IZ0A 2HCTA 5BO5A 3RNLA 3L4SO 5KSYA 1RE0A 1EHIA 4OSPA 2ZEJA 3FZQA 2HA2A 4KQMA 4RCZA 1RRGA 2GI4A 2O2XA 3B7WA 2XIQA 1EFTA 3H4MA 5AVJA 4FMBB 4U1RA 3Q1KA 3BIWA 1ZVMA 1WWKA 2FLKA 1R0CA 1A82A 3LVQE 3N2GB 3UK7A 4B74A 4DBVO 5KQPA 3EW9A 3WHIA 3GDFA 4N8DA 3M6WA 5I4BA 3A37A 4E6PA 1ORIA 3TOXA 5DBIA 3G7NA 2EDAA 3JWJA 3OLQA 4IW3B 2B92A 1HYGA 4B7XA 5K6AA 2P9JA 1U7DA 3JQ8A 2Z4SA 5EA2A 1N5JA 2V7WA 1QB8A 1RI3A 1Q92A 5G40A 4PC3A 1JTFA 3S5UA 4MRNA 4X8LA 3R6GA 3AU9A 2P40A 3LYLA 4G9BA 3KJEA 2Z6AA 4UFOA 5LKRA 4N6OA 1LC3A 1UL1X 2V7EA 4NL4H 4DR7B 4GBJA 5C52B 2UZ1B 4U7FA 3KIPA 4EKYA 4INAA 4EO9A 3SSMA 1I9GA 3FETA 3LQQA 3L7KA 2IYAA 4H0NA 4AECA 3G68A 2M98A 1DJQA 2W6PA 1UXOA 2VP0A 2QTWB 3Q41A 3WZLA 4UVIA 4GKJB 4LDPA 1CUBA 1R2QA 3HKBA 3EIOA 1Y5LA 2FN3A 1WU8A 3L49A 4RNDB 5AVWA 2YVQA 1WW3A 3GFGA 4JC8A 2AFHB 2FDCA 1HQYE 3DEHA 1P0QA 2I2BA 2PM8A 3LC7O 4QBGB 3OT1B 5HX7A 1HGXA 2D7CA 2H1VA 2CL5A 4O2RA 5KOHB 4Q3NA 2ZYRA 2JFBA 5F77A 1MT3A 1T9KA 3WLPA 2YNMC 2OO5C 3G5AA 3ZI4A 1M1UA 1QQ6A 2ZAGA 4N3BA 5HBRA 3RYHB 4ZDJA 4UBMA 4YJ3B 1VGRA 1Z4KA 3G88A 2CV2A 4YGYA 1T5HX 4I5EA 1Z38A 5FBWB 2QF7A 3K0EA 1QYVA 2CFOA 1KAEA 1X13A 1ZNQO 3HSYA 4ZQHA 4ZXPA 1X1RA 2VPYA 5A62A 2IV2X 3U9LA 4CMIA 3WY9A 2DEUA 5DNDA 3AUTA 5JQGB 5DNAA 1WXHA 2ZWOA 5EJGA 4JT9A 1Z5GA 1N6LA 1T15A 2FN4A 2J32A 4XCQA 4IVRA 3TINA 1V9CA 4U2KA 4E0BA 1K8YB 3BZWA 3I92A 4FFVA 2AZDA 3R5FA 5AK5A 1XWWA 2BI4A 1Z4LA 1RJGA 2BFFA 3DVAA 1U9JA 3ESQA 3KLPX 3MWDB 4F4CA 5AW7A 4UHCA 1IUKA 3O6VA 4KO3S 1YJBA 3DNPA 3I4FA 4KODA 4Q82A 5H16A 4QDKA 1E0SA 3ML1A 3OIGA 1IZZA 1MG5A 3WIUA 1ADGA 5KWEA 2HYIC 4U0KA 1DC7A 3HYRA 4KPGA 3VSEA 3JALA 3EVFA 1WQ3A 3GFOA 3WFJA 4GOXA 1RPJA 2VQ3A 4TTVA 1S0UA 4XWKA 3IT2A 5CEJA 3QFRA 4EUKA 5CITA 2AOWA 1FFGA 4JXXA 4ZO8A 2HQSA 4M9QA 2VXCA 5K5EA 3E9CA 2CUKA 2OP1A 2SICE 4LOKA 1MOPA 2G9ZA 4R8VA 2DHRA 1ZH0A 3DZDA 3MRTA 4OHBA 2AOVA 2V7PA 3DDNA 4LYAA 5L4SA 4UASA 3RU7A 1FTSA 2VXOA 3AR8A 4KJXA 2GBLC 1ODSA 1H9AA 1F3LA 4RUKA 4E4TA 2VUTA 1CQIB 3RAFC 2NPOA 3VYRB 2CJWA 4CIVA 2BHLA 2ZS9A 3FY4A 2HTFA 4UHKA 3WYCA 2W2VA 3KP1A 3YASA 4D92A 2O7VA 2JIDA 4PLPA 2NWQA 5GV8A 3JSAA 2G77B 5KU7A 3UGJA 2DU8A 1LDMA 4G0MA 4JI6B 2ZUSA 4Z0NA 2YCBA 5T6BA 4G2NA 3X1WA 4HS4A 5YASA 3PHCA 1P5ZB 1P2GA 1ISMA 2FPIA 2X13A 3K1JA 4UHEA 3T4PA 3IPCA 1YS1X 3F9IA 2YVAA 3HWSA 4H35A 2IEIA 1TYZA 2OD2A 2UDPA 2TRSB 2VQDA 4KIJA 2WM2A 1V2GA 1D0IA 3CONA 1AQ6A 3WDLA 4AJHA 5KREA 5FNZA 3H1BA 2EGHA 3EXHB 3M8KA 1QYWA 2I78A 3OZWA 4KRYA 3VM6A 1W25A 2XD9A 4FOLA 3I01M 3VNRA 2A0UA 3EDRA 3EE6A 4BMCA 2OVFA 4M2LA 3GCXA 4HZUA 4CE6A 4A91A 4RM2A 2G4VA 1SG9A 2RH4A 3K35A 4LNHA 3C85A 3WNBA 1S8OA 3NLLA 1P9WA 2DUUA 2VA9A 1XTJA 1JV2B 1SNYA 2YMPA 1DCTA 2O2CA 4NI5A 2WSIA 4O4LA 1CY0A 2GEDA 4XB6B 1M34A 3WSVA 2AV6A 5KZMB 1X42A 4KEAA 1RFLA 1YAJA 3FYCA 3KWFA 1U2SA 1SVIA 3DOUA 2XOXA 3K2QA 1OC2A 2IZ7A 3JASA 2PWPA 2I65A 2J8ZA 2PA3A 2WWGA 4CTNA 3PX7A 4DMGA 3QPVA 1E2HA 5JXWA 2YHBA 4TS3A 1JDVA 3L02A 4FCWA 1CJKC 1VXOA 2ZXFA 4BWYA 4R2LA 4NXNB 1DTSA 1Z0UA 2RK6A 3VU9B 1A4IA 3ICWA 4I55F 4LVUA 4OI4A 3HJHA 1JILA 3BUSA 1XU4A 3PKJA 4YV0A 1CQPA 2WHQA 3FAZA 1ZSVA 1C29B 2ZRKA 1Z0DA 2EERA 2IV3A 4IJQA 3GLHA 3WYDA 3DUFA 4RD2A 1HY3A 2B7CA 1X9IA 2D62A 3I9OA 5KYKA 1E9DA 3VDQA 4DBZA 3IP8A 1RYDA 2EFGA 4LZJA 3RKSA 3U5TA 1H85A 2OB1A 4LRUA 5JJCA 4KVGA 1AUOA 4FYHA 1O6CA 4C89A 5CIWA 3Q3GE 2WP0A 3GDOA 4FFBA 4PGFA 3HPQA 3HBNA 5A0FA 3TW8A 4UFPA 4B71A 3H05A 1L6RA 4NAHA 5JE8A 1QVVA 3QJYA 5EJMA 2PRZA 3QPDA 4B73A 4A2CA 2NUAB 1NI4A 5I48A 5E38A 1T5IA 2BGUA 2IYYA 2C5FA 4PHTA 2Y4OA 3M7IA 3JY6A 4QECA 3SFTA 3ZHUA 1WRBA 2F8SA 1T8TA 4GHWA 3B1JA 4ZOAA 1UIMA 3WK7A 1RJDA 2F43B 3HO6A 3MJVA 1YS7A 3P9RA 5COAA 2QRZA 1OBCA 2YR0A 2Z3WA 2CCKA 3L8MA 3R5JA 4JX8A 4KKXB 2PLFA 3SJZA 3DHWC 5IFLA 2AMFA 2EFDB 2PFSA 2L17A 4IEIA 1O08A 1N2OA 2V7BA 5HIJA 1SD1A 4HWGA 2QAGB 4Y7CA 4I81A 2JDIA 1YCHA 3ENNA 1LF0A 2B8JA 2DPHA 2PS1A 3H2JA 1YBVA 3AUAA 1BEZA 4AUNA 5IAAA 3ZHXA 4OHKA 3RPEA 2C4HA 4D42A 2BFNA 2R44A 4Z4CA 4AUEA 4LF9B 2ZBRA 4J7AA 3WGLA 2SECE 4MEBA 1SBTA 4TKMA 4ZI7F 2C7BA 3RYCA 3FW1A 3ZJTA 1KHHA 4WOKA 4NOMA 1Z2AA 4LC0A 5EIXA 3SE0A 4DCPA 5TY0A 4Q4HB 4GU5A 2NZVG 3ZHYA 5DHAA 4F8JA 1AG9A 4ARZB 3K9CA 4C7JA 1VJGA 1QGED 1BGXT 3FOBA 3U56A 3V4RA 1LK0A 2D5LA 3CB2A 1NKVA 2EP8A 2CXSA 3PJFA 1KI9A 1K98A 5ALYA 1UZMA 2XPCA 3BB4A 4M46A 5HUJA 1KK1A 2JJ1D 3F3YA 4QUGA 5HWSA 4NZMA 4V0NA 1YIDA 1FMLA 5LYJF 3SJAA 4YREA 2FWJA 3NDBB 3C3XA 3TW8B 4HX2A 5HS4A 2I66A 2FJUA 2HJGA 3NOOA 4I6GA 5DBHX 4EFDA 3PQ2A 4DMRA 4Q05A 5KNCH 1Y6JA 4E46A 3PHJA 4YCCA 4ZEVA 1FX0A 1SKQA 4L4UA 4MGEA 1NBAA 1ZJJA 3KHTA 4YH1A 5MGBA 4BN4A 5CDFE 1QE5A 1H0RA 5HFNA 5KJEA 4EYKA 2A0XA 3ESZA 3H75A 1OYOA 3GLGB 1RLIA 3T1QA 2PPVA 3NP7A 4U7DA 1JFFB 3H2ZA 3HVJA 4PPNA 4HDCA 4BMVA 4RAOA 2EFHB 3QFFA 4RETA 1BXRB 4HDSB 4OBXA 1YZGA 2ETVA 5CW2A 4RY0A 3KM0A 2OO5A 4TRRA 3S0JA 2PLAA 3P9YA 1QZXA 1TB4A 1QZTA 1QHNA 3UIEA 4ZREA 4R0MA 2VQFB 3KB2A 4ZOLA 1HEYA 1XMPA 2GPSA 3KAKA 3GVCA 4OU5A 3SQMA 1W47A 4RYDA 2CXOA 3ZZMA 2QUHA 1UC5B 1L5HB 1T6BY 3ZH9B 2H4ZA 5FAKA 4U7TB 4ZCSA 3SYTA 1YULA 2DFLA 2GCOA 4X1OA 5DV9A 1W85B 4LYFA 1P6QA 2BIFA 2V3VA 2BW0A 1SIOA 1UKZA 2OC4A 3PFWO 1Z8DA 1WDMA 3REGA 2HDWA 2VK2A 4Q7KA 4YJFB 3ORYA 3A04A 4LWOA 4BPBA 4V24A 3HCFA 4UZSA 1G2IA 3EOBI 2FR1A 3M2TA 3RK4A 3RS9A 4C6SA 4HZUB 2H52A 1PRYA 4WVLA 1Q0PA 3THWB 1HDXA 4RPGA 3D4PA 5IDQA 2IYOA 2WNHA 4WJLA 3H2GA 4O8CA 4AJ4A 1SPBS 3GEMA 1TM7E 2C4UA 2HMSA 3ZKAA 5JFTA 1V4NA 4PIVA 4BFUA 3QEKA 3PE3A 2BFBA 1EFPA 4UTNA 3HFSA 1DRUA 2NU6A 3CVJA 1MVLA 3PHHA 1ESMA 4LISA 1L5KA 2YHSA 3KWLA 3AHEA 2WEKA 3E70C 4RKWA 4G97A 1TDJA 3WWDA 4OLAA 3M6VA 4N39A 4HC4A 1S3GA 1OBOA 2ORWA 3HB9A 2VPQA 5K01A 1TQ8A 4NU5A 3WL5A 4OBBA 3N74A 1W6RA 4UOEA 1Z3CA 4IO1A 4G5XA 3RCBA 1QF9A 5BW5A 2JATA 3EDYA 1Z45A 3SS8A 1L3BA 1MNAA 1EWYA 1NOKA 4PCAA 5E4YA 3VOTA 2E49A 3LQ2A 4ES6A 4CZ2A 4CEHB 4C22A 1PZGA 5DI9A 2P8JA 3JQFC 4HNQA 3AV0B 5LWQA 4XA8A 4R6XA 4EI8A 5BSHA 2VWGA 4LG1A 4QBTA 1S96A 2YRXA 1A8UA 1Q7EA 1ZA2A 2GHQA 2JIOA 3IMGA 5I9SA 821PA 4YRLA 4PIPA 4ZQFA 2RB4A 3AVQA 3FGOA 4Q1BA 8GPBA 1AGYA 4ZQEA 3JYQA 4DKXA 2EOAA 2R1UA 3SU8A 1II8B 4DSTA 1EBFA 1UKBA 4BIIA 4CGZA 4LVCA 2ZUUA 1DJPA 1CUXA 2E82A 1WOMA 1J22A 2WK1A 2Z56A 3ZLVA 2O3RA 3ACCA 1IL0A 2QTZA 4MQMA 3USES 1JIKA 1DFGA 3P45A 4DBLE 4WK4B 2OKGA 4ENSA 4KAXA 3ICEA 4F9EA 2LGJA 4NCKA 5B6PA 1IHPA 5IDWA 1D6JA 5ENDA 1HDOA 5J59A 2BKXA 2PQMA 3FDZA 1FJXA 4JI3B 1YD7A 1GPUA 3COWA 1Y3IA 2OBFA 3KVRA 1E7MA 1SULA 1GEGA 3Q0EA 1E5XA 5IG2A 1P61B 4FJ2A 1G60A 4R2KA 1T8WA 4TM8A 4D3SA 5DB4A 5AFSA 2QP4A 1N5RA 3C0KA 3OFND 1H22A 5AVUA 4IQGA 2IHKA 2Q28A 1CRWG 3FAKA 3Q8XB 3ZBTA 1VG0B 1OIVA 4QGHA 3SQNA 5DRYA 2W0SA 3LU1A 4C6RA 3LXUX 2I3DA 3UFXA 4ZV4A 3MT0A 5CJ2A 1EFVB 4B0PA 1LPSA 2QTAA 3KZNA 1NQ5A 4EO4A 3T61A 3J81k 4YPOA 1AQIA 1PJZA 4EA8A 2V58A 5JNLA 2QL9A 3OCJA 5ANRB 5AVQA 2J5KA 4FHZA 1HBJA 3ZTWA 4DV4B 1SHLA 4TXMA 1W4LA 4Q37A 2HADA 3OZRA 2IU4A 5AJHA 3QOXA 4HEHA 1MG0A 4YFYA 2JEYA 1JR6A 3OIWA 4PTLA 4B7UA 1S3IA 1NFRA 1LJUA 4URVR 3O73A 3QU7A 3T94A 1M2WA 4KQ2A 2XB2A 4PRLA 2ZSKA 4I5DA 3OD5A 1F2DA 2DR3A 2NW6A 2I71A 3VZPA 1X7DA 2ZROA 5AVVA 5KYGA 4TSKA 3EQ9A 3WDMA 1TYEB 1H5QA 3QBTA 2WJAA 4AKTA 1V8BA 2BFBB 4O2BB 3HKBB 4MUEA 5A6SA 3LHDA 4MGIR 5EXXA 3UW3A 1UADA 2B4YA 1WKBA 4FGJA 3SZMA 4RA6B 2QN1A 4FE4A 3TKLA 2XYQA 4GZ6A 1JX6A 5BW4A 1FRVA 2W6IA 2D7JA 1ONOA 2GUWA 4D4IA 2XUDA 1C0PA 3SF8B 1A96A 1OJ7A 3D8TA 3PPVA 1JZTA 3MTDA 1SKYB 4MV8A 4BNDB 4KKVA 2FU5C 3RRBA 3EIFA 2WV7A 3ONEA 5A5GA 3KWMA 4L76A 1V6CA 4DQKA 1UFOA 2DKNA 3NH6A 3L8EA 4GOND 2OHHA 4K9RA 1N6IA 4UXHA 3PUHA 1Y1PA 1VIYA 1D4FA 1BHSA 4RZIA 3EGOA 2YWEA 4M60A 3C16C 4LY0A 4EJ2A 2A0KA 4L2IA 2ATEA 3JQ8B 3JQEA 1TW3A 3EZXA 3OX4A 1V0JA 5AOBA 4X94A 3ROMA 4RPIA 5FYQA 4OQFA 5K51A 3WICA 1L4BA 1A5SB 3VPFA 1EFDN 2G9VA 4G85A 4JU8A 3TH5A 5LBTA 4EK9A 1P5HA 4M7OA 4CQMD 1E1YA 2WPDA 2NO6A 3H5RA 4JJZA 5DYTA 3T5DA 1RHJA 3I2GA 1XTPA 1L6IA 2FSPA 2G5TA 2IF0A 4EJSC 3RADC 1Y0BA 3D7RA 3EG9B 4UMDA 2NXEA 2R751 3D3NA 2B4TO 1JFFA 2ZJ3A 1D2HA 3ZU4A 1HRDA 4QZVA 4LV8B 3GLGA 5DLYA 1RKBA 3RU9A 3L43A 3FPAA 4DNOA 3OEHD 4G56A 4ETNA 2CKMA 5GVRA 3DD5A 4HYTA 3EEQA 1SUPA 5I47A 3ZY3A 2X14A 1RMTA 3L5OA 3R3VA 5AJXA 4BCBA 2D7DA 3I9KA 1XZLA 2NG1A 2NT4A 2JL1A 3WLJA 1W8DA 2RGYA 3GDHA 3UWKA 1OAAA 1V8ZA 5C8ZA 5HCUA 3V48A 4TRNA 4XQCA 5FBHA 3QHPA 1W29A 4HVAA 4G5OA 3BDVA 1QHYA 5DGXA 2QRUA 4H9GA 4KBYA 3RI3A 3HDYA 4DXDA 3ET5A 2E87A 3CEJA 3MD0A 3OLZA 4IDFA 4WPGA 5BQPA 5I4IA 4JOQA 1M7BA 2I62A 2VDOB 4KQGA 1KJYA 1Z4IA 1ZZEA 1U3TA 2XTZA 5JMPA 3TD9A 2CLDX 3TVDA 4HB2A 1F1JA 1R9MA 2JVIA 4U7GA 3MS2A 1P62B 1G9XA 5LA6A 3SJ7A 5F4BA 4B80A 4IFIA 2C59A 1EUZA 4WA7A 2QIPA 5HGJA 1AQYA 2QZ9A 2UAGA 4WCVA 5TQJA 4AZ3A 5JAOA 2HI0A 3DOFA 4X60A 5K20A 2DETA 3LC1O 1GILA 2WPNA 4MV1A 5DHSA 2J0VA 2O1WA 2C0CA 5E9JA 4FVTA 3D3KA 3SJCA 1N7JA 1NVBA 3DLHA 3ZV7A 3P4UA 1BA2A 3QGMA 2WABA 4HX5A 3T3NA 4ND8A 3D64A 5IT5A 4Q9LA 4QAQA 5IT0A 4DCOA 2HJHA 3LA6A 4F2WA 2RHHA 2R6CA 1T3HA 3HXKA 4S1PA 4BDSA 1IXYA 2F1IA 1P7ZA 4FYMA 5EZYF 4BJ1A 4ZN6A 2LKCA 4XGIA 3WRXC 4OOFA 1KWKA 4J1QA 5LD2B 2PO5A 4NNJA 2PZMA 2QI9F 4I50B 1RRFA 3JD3A 1U6KA 3PR3A 1AF7A 4RXMA 3NJ4A 3GI1A 3KK0A 3ZY4A 1SKAA 2JAWA 3PRHA 4H7KA 3WLTA 2D1FA 4J1SA 3MB8A 1ZUWA 4GYKA 1W1IA 2DQYA 4QWMA 5G41A 4FXOA 5LLSA 3ZVNA 1IQ0A 1FDSA 4L0CA 4XD7A 3TTYA 5IDVA 4CUKA 3H97A 5