3CM0A

Crystal structure of adenylate kinase from thermus thermophilus hb8
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
184
structure length
184
Chain Sequence
VGQAVIFLGPPGAGKGTQASRLAQELGFKKLSTGDILRDHVARGTPLGERVRPIMERGDLVPDDLILELIREELAERVIFDGFPRTLAQAEALDRLLSETGTRLLGVVLVEVPEEELVRRILRRAELEGRSDDNEETVRRRLEVYREKTEPLVGYYEARGVLKRVDGLGTPDEVYARIRAALGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylate kinase
publication title Crystal structure of adenylate kinase from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 68
structure length 184
sequence length 184
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2008-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13207 AAA_17 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3cm0A00
4P4TA 1TF7A 1XXHB 3AVUA 1M7HA 1V5WA 4XVRA 1E2LA 5JWOA 1XP8A 4V0MA 2DWQA 1KMHA 4O2RA 1KK2A 4BLOA 2WIBA 4EDHA 2WM9B 3QEOA 5KNBA 1E2MA 2J1LA 4HAXA 2REOA 3FTQA 3UWKA 4TT3A 4ILEA 1DEKA 2YINC 2DHRA 3TW4A 1W2HA 2BEJA 2X19A 3SNHA 4A1FA 1YVDA 2IWHA 4ZPXA 4U02A 5GVSA 4IRUB 3RS0A 4MKHA 8OHMA 5CDFE 2ZPTX 2IX3A 1DELA 2VYFA 3EW9A 4LPSA 1KSGA 4H9GA 5J5CA 1Z63A 1Y63A 3CRVA 2WKQA 4G5OA 1VPLA 3ZZ0A 5JZVA 1T5IA 5AJYA 3LQRA 3VR6A 4KSCA 2ZRLA 5HE8A 2OZEA 3QKTA 2O8BB 1YQTA 1TUEA 2OO7A 3EPHA 5JRZA 2QMOA 4ZKDA 2CXXA 3QF4B 2PZGA 3IGFA 4RZXA 2GK7A 2ZJOA 4PQFA 4Q7JB 3RS5A 4FMCB 4B43A 4IXMA 4W5HA 4JVLA 4EPYA 5TY0A 3R8FA 4D25A 1HT2E 4GI7A 4TT3D 4CW7A 2RGEA 2B8WA 4GRAA 3DMDA 4DDVA 2P5SA 3ZD7A 2GAOA 2H57A 2C96A 4EJSA 2HCJB 4CEIB 1KKMA 1SGWA 1T3SA 1W7AA 1HQYE 2OV2A 2H7VA 3GLIE 5BWMA 4EJSC 2HT1A 2QSZA 4BLTA 3R9IA 4BZQA 3NXSA 1OYWA 4MKFA 2VA8A 1PVOA 3FMOB 3QI2A 1WXQA 4RD6A 5FBRB 2JLZA 4WXRA 4QL3A 4DEYA 4DC9A 2DBYA 3D6TB 3PUZA 2GF9A 4M22A 2WJIA 2CJWA 3QNUA 2IC5A 2IS4A 3LRPA 4Q1FA 2XTZA 4A0RA 1EG7A 1G3RA 2D7CA 3P26A 1GTVA 1ZINA 2GXSA 3FE2A 4YMWA 2QP9X 2JLWA 4AWXA 2A5JA 5KUTA 4F4CA 3CPHA 2IYRA 5FUXA 2N42A 3DO6A 1JR3D 1N6RA 4LHXA 1U9IC 4DHEA 1R5OA 2DFKB 2ODBA 1JJ7A 3K8YA 1ONBA 2WWFA 3P1JA 1EXMA 1NF3A 3L0IB 2IA5A 2ZRBA 3Q9LA 5FBWB 4NU0A 3BRWD 3EIHA 3HPRA 4BFUA 1S0UA 3MWYW 4JT4A 3U6BA 1CJUC 1TMKA 2H16A 3GEHA 1NY6A 3LVRE 1BYUA 1S9HA 4X8LA 1E2KA 1RRPA 1IN5A 2B92A 2ZEJA 2CLCX 3A37A 3ASYA 3SU8A 1Z5ZA 1RIFA 6Q21A 4M53A 1KO5A 3LVQE 4Q00A 1T8UA 5JBQA 1LB1B 1DAFA 2ERYA 4G5QA 2O8EA 1R5NA 4FW9A 3W6PA 2C77A 3TVDA 3TSOA 2BM0A 4OQFA 3Q7QA 1JB1A 2DFTA 1BKDR 1G16A 1AK2A 2Z5FA 3BFKA 4D6PA 1Z6XA 1RRCA 1DG1G 3TR5A 2QP4A 4HLQB 4G0NA 1NP6A 5EP1A 1R0YA 1WE2A 4TMVA 4JLNA 3RWMB 1P2SA 2ZTSA 4CT5A 1YR8A 3EC1A 4AKEA 4PQYA 2R8RA 1RRGA 2F43B 3IQXA 1I4TD 1MABB 5JCPA 2BMEA 4U7DA 4MUAA 4EPWA 3D8BA 2ZS8A 3T35A 1XFAA 2IYSA 2ZRPA 4B47A 2WJJA 5KNDA 2WJYA 1E1QA 5LPNA 5EXSA 4C30A 1DAHA 1J2JA 1D9ZA 2RGGA 4KV9A 3CRQA 4YMSA 1II9A 3QOFA 1EX6A 4KVGA 2YOGA 2GXAA 2FFBA 4LX0A 4XJXA 1IJEA 4YMUA 3ETLA 3R7WA 2C9CA 2ORVA 1W36C 5KTYA 2V1XA 1UKZA 3BORA 3KKMA 3P4YA 5DE3A 2QENA 1AGRA 1VMAA 2VO1A 3JZMA 1GG2A 4JLJA 4OK3A 3C15C 2C2HA 2J9RA 3WRYC 4OI0A 2XTMA 2EWVA 3B8HA 1E99A 1EK0A 1K8RA 1ZC4A 4KI0A 1ZUNB 2O8DA 2R9VA 4TLCA 5CJPA 2AKYA 2EYQA 2VQSA 3GJ6A 2OILA 2WHXA 2MSCB 2OCBA 3F8TA 1E1QD 1G5RA 3OESA 2V54A 2JLYA 4CEHB 1NL3A 4KSBA 2O8CB 3AKDA 3QEJA 4HZIA 3GLGB 1W1WA 3CR8A 2NO1A 4C0JA 2RGAA 3KKOA 4EPRA 1G8PA 5EXTA 1FQKA 3W6OA 4DT1B 2FEMA 4F92B 4TQ9A 5G3ZA 1XXHE 1DO2A 4LUCA 4V0LA 2EFGA 1JBKA 2C5LA 4URWR 4BRUA 4C3ZA 3KQHA 4BZXA 1PUJA 2F3RA 4O3MA 3CIOA 5DI9A 4QHYA 1KDTA 2RGBA 3EZ6A 2FSHA 5JI2E 4AKHA 3KQNA 4IOLA 1NN5A 1KDOA 2VHJA 1CXZA 3BS4A 4TL8A 3O8DA 3E1SA 4DLTA 3ADBA 4JKIA 5EZ6B 5KSOA 2J59A 1E2HA 4CGZA 3D7MA 4YC7A 1FX0A 2CL7X 2QA5A 3ADKA 3REGA 3IEVA 5HCIA 3THYA 2WSMA 3U61B 3K70C 4CVNA 1QRAA 2PJRA 3DOEA 4PR0A 3HYTA 1NN1A 5L3RA 3FHOA 4PANA 5HZKA 3CF2A 5K8TA 4F93B 1W4CA 2VEDA 2HCBA 1TPZA 2CEAA 2RGXA 1EFUA 1F60A 1KSHA 2VBCA 3NDBB 1GKYA 1UDXA 1P9RA 1YE8A 2IYVA 3EZFA 3A58B 2XNDA 4TLBA 5LD2C 1J8YF 3LBIA 4FD2A 4RZ2A 3RLFA 3HU2A 1E9BA 3OFNA 2BKEA 4PC3A 2Z4RA 1VYUA 1Z8FA 2Q9AA 3KJGA 2DPXA 4DWJA 3THXB 4Z1MD 2GEUA 3I8SA 4EUNA 2V6IA 1OKKA 3GLFA 2GBLA 2OLKA 1FNNA 3K0AA 3CPJB 1Z0DA 4HZUA 3RSOA 2JLSA 5CB8A 2WWYA 4QJ5A 1NBME 4DZZA 4G1UC 4GPTA 2E1RA 1SQ5A 3UIEA 3U6KA 1ZCAA 1US8B 1ZCBA 3U3MA 2ZJYA 3MWLA 4CDGA 5CYPA 3ADDA 4Q1DA 5C18A 5JWRA 4G5RA 4MDEA 1HA3A 1P62B 4JSTA 3IHLA 3WXMA 4DIDA 2X77A 3BXZA 4OQLA 3TE6A 3ZIAA 4QBHA 3FKQA 1Z2AA 1N6OA 4B44A 2J7PD 3RNLA 1IOZA 1KI6B 4GP7A 1WCV1 4US2R 2FNAA 2I1VB 4MH0R 3ASZA 3W34A 4UXHA 1GIAA 4YQFA 1R0ZA 3B85A 1G21E 5CIQA 1SZPA 2ZUDA 2XZOA 4BLRA 5A0FA 3CONA 2GRJA 2DYKA 3EIQA 1CLUA 5C4MA 1QHGA 1KJWA 3I62A 1D9XA 2FDCA 2J0SA 1RFLA 1XPOA 3IDQA 1KY2A 3PITA 4DIEA 4URZR 2RKOA 3FHTA 1XCGB 4LJAA 2VSFA 1N5LA 3PR1A 2ZRHA 4KXFB 4PTLA 4DLSA 621PA 1UKYA 4OBEA 1EWRA 1NNEA 2C04A 1G20E 2BJVA 1PV4A 3I1FA 1N6LA 4OHVA 4IEEA 4QXAA 3M6AA 3TUIC 1MO5A 1H8EA 1N6PA 5CLLA 4QGFA 1FW6A 3HWSA 2FFQA 3AV0B 3DMNA 1EFRD 4DUGA 1MO4A 1N6IA 2OXCA 3QKRA 4JS0A 4CT4B 3N70A 4ZCMA 2EW1A 2PLFA 3SHWA 5CITA 1OIXA 1CJVC 1M2OB 3TSZA 4K81B 5E4FA 1X3SA 1NLYA 1KMHB 4KFUA 3SJZA 3W90A 4DEXA 2QL6A 5IRCD 3B5JA 3CX8A 1IJFA 1NRJB 2W6JA 3BB3A 3C7KA 1T9HA 1R10A 2FN4A 4M1TA 1QHSA 4FMDF 4EFMA 2BJWA 3RC3A 3AVPA 5EE3A 2JEOA 4AG5A 3RRMA 1Z0IA 2KWIA 1E9AA 2WJGA 2YWEA 3PIRA 2KE5A 4KODA 4A8JA 3THWA 2XB4A 3TQCA 4OQXA 1ZD8A 1D5CA 2O52A 4RJLA 4OKSA 3ZVMA 4ZKEA 4HI0E 1N6HA 5DH9A 4A8JC 4CYMA 4DSNA 5HR5A 4LI0A 4Q1CA 5DHAA 2I4IA 2BKUA 2HUPA 1A82A 2XGJA 4PAMA 5FOXA 1G6HA 1HE8B 4C0SA 3IO3A 3AP3A 3OEEA 2CHQA 4DLXA 3K0SA 1GDDA 1GITA 1QVAA 1TU3A 2P3SA 1Z07A 1KO1A 4AG6A 1NVVQ 1ZU4A 3P4XA 5FUWA 3AVTA 4B75A 1FNMA 5KSPA 2QTHA 4ESVA 2D62A 2VH5R 4HDCA 4IVPA 4D0GA 4US1R 3QG1A 1P3JA 4NMMA 4J0QA 3K53A 2GDJA 1M8PA 1D6JA 5J4VA 4FXPA 2IS1A 2W6JD 4HAUA 4OHXA 3BOSA 4KBFA 1CF4A 1Z08A 4EFLA 1OHHA 1RZ3A 2OM2A 3N2EA 3ZJYA 4L9SA 4PZLA 3B9QA 4JKYA 5B64A 4M8NE 2G0NA 3O8CA 2EFCB 4EJSB 4Q4AA 5FR1A 2G83A 2QAGA 2WWIA 4V02A 5DI3B 3GD7A 2V4ZA 3EPLA 3RC8A 2QAGC 4M0LA 1ZRHA 2FEOA 5B57C 2DFNA 2OBLA 2GWHA 3LH5A 5KOYA 1TU4A 1WBDA 1XEFA 4AKGA 4Z8YA 3G82C 4BFVA 3CPEA 4RVCA 3IPXA 2CJWB 3RRYA 3OAAD 2ORIA 4EPXA 1Q57A 2ZR9A 1E1RD 3GLHB 4DVGA 1OFTA 3GLGE 2PT7A 3NH6A 2P2LA 1IXZA 2HF8A 1UFQA 4LSGA 2XOKD 1OF1A 4XD7A 1N6KA 3KX2A 3NVAA 2RGCA 4GZLA 3U2QA 3MMPA 2K5UA 5FTJA 2GAAA 3UG6A 3SC3A 3GJXC 2QNRA 2OCAA 3BK7A 3EA0A 3FKSD 2O0HA 3H0KA 4ON9A 3B82A 1UKVY 4C7OA 3U60B 2FSIA 2AKAB 1LTQA 4HEJA 2FZLA 4O25A 4NHOA 2CK3D 4P3YA 4IDNA 3B1XA 2FH5B 1OFIA 2ZITA 4Q9JA 5JECA 1A7JA 1J99A 4V0NA 4CEHA 3B2EA 1U0JA 4DSTA 3EZ9A 2DY1A 3LDAA 1J70A 1G8HA 1KNQA 1HYQA 2F1RA 1CR4A 4F4IA 3HDTA 4PC6A 1GRQA 3TMKA 4D4JA 2D2FA 4QJ3A 1M1YE 4E09A 3FHCB 1QHXA 1BO6A 1OXVA 3DEFA 1GNRA 1NIPA 1XB2A 2JCSA 3QKSA 4B33A 2C98A 2ZI5A 2CCJA 4M9XA 2CNWA 2YWGA 3KFXA 1UBFA 4BFTA 3K0CC 4AYWA 1WDTA 1IN4A 4B34A 2OFWA 1P6XA 1ESMA 2NO0A 3ZD6A 1TEXA 2JIZA 3DVLA 4GOJA 1CS4C 3KZ1E 4Q7KA 1QF9A 4Q03A 2FSFA 3UMSA 1RE0A 3AF0A 4LYFA 1FTSA 3X1WA 5AUNB 2AK2A 1KDRA 3KJIA 5J47A 3S1AA 2W2XA 2IXEA 2HF9A 3I72A 1AIPA 221PA 1T0JB 1JECA 4EPVA 1JR6A 1FMLA 4LYAA 1YZQA 1W36B 2ZI7A 4MRRA 4TLDA 5BN4A 4MKGA 4TL9A 1L4YA 4I99A 4Q4JA 3O8BA 2H17A 2A5FA 2HXSA 2PCLA 2PJZA 3LQQA 3ZVRA 5H8WA 1SULA 4D4MA 4LK2A 3AP2A 3VFDA 4QBGB 2CNWD 4A36A 1KSFX 1IN6A 3AVXA 1CEEA 2ZRMA 4Z51A 2ZRDA 4ZI3A 3Q3JB 4IDPA 3CW2A 1ZYUA 3GP8A 4ZDIA 1HEIA 4P0TA 5LB2A 1JALA 1M34E 5FBVB 5F3WB 2IYUA 3TNFA 2OHFA 2CMKA 1G19A 2O8DB 3ND9A 3FPAA 4MRPA 4W7SA 3A36A 1UF9A 3VMFA 4C0LA 2H1LA 1CRQA 2J0UA 4JT2A 4PPFA 1D8TA 4RZUA 3MGCA 5JWHA 1UPTA 3E5HA 3N2IA 4XWOA 1Y3AA 3NHBA 1I4LD 1GNPA 2ONKA 2XXAA 2MMGA 4B3BA 4W5WA 1R8QA 4POAA 2GILA 2JAQA 1KHTA 3SBEA 1Q12A 1TF5A 3I32A 4LY6A 2N46A 1DAIA 1VHLA 1K5DA 4HLUC 3SR0A 2IYWA 2IBMA 4V0ME 3UWOA 4B3CA 4CIDA 5DN6D 5HPYB 1QHYA 2VHUA 2ZU6A 4HLDA 5BYJA 4PC2A 4WZBE 1P5ZB 2DWPA 3HU1A 2BBOA 4XTCS 3HYRA 3FYHA 2B21A 4A82A 4S35A 1CIPA 5CK4A 4KLZA 3NTUA 4LV5B 2OFOA 4PZYA 4Q01A 3QJYA 5JRJA 2ODWA 2YV5A 3A1WA 4RZ3A 5EP4A 3K70B 4QM7A 1FX0B 3ZDQA 1Z2CA 3QVVA 4NYJQ 4Q1EA 3OEHA 4B76A 4QM6A 3PV0A 4W9MC 1NKTA 3THYB 3OIYA 1TTTA 1XEWX 3W8NA 3SFVA 2FF7A 1XEXA 3FB4A 1GOTA 5EE1A 3TK1A 4HUTA 2JJ1A 4RKEA 4BWYA 1KK0A 3EARA 3PUXA 3KTAA 4IFEA 5TARA 2WZQA 1DOAA 4Q4LA 1SVKA 4KAXA 2IUUA 1XZQA 2QE7D 3CKLA 2WKRA 3AF4A 4TQAA 4EQ6A 1JR3E 2JLRA 5TB5A 1RC8A 2AD5A 1Z0FA 2IYLD 4I1UA 1KAOA 4M1WA 5E3HA 1TUIA 1E9SA 3GLFB 1FUKA 3K0AB 2WMNB 2FOLA 4PAQA 3P32A 5JS7A 4JLKA 1VECA 4HZUB 4URUR 2V7QD 1RRFA 4PX9A 3TRFA 2FPKA 1TAGA 2IT1A 1GILA 4PQRA 4WBSA 2ZRFA 3DHWC 2W0SA 1ZJ6A 1Z06A 4NZYA 3R9XA 1XD8A 1OJLA 3AP1A 3R20A 5AUQA 4OYHA 2QMHA 3EXAA 1M7GA 3ZVLA 4ASUA 1BMFD 4P4UA 1Q44A 2QQ0A 2ZJBA 2ZJ5A 3B60A 1AN0A 4PHHA 1AS2A 1E79A 3SOPA 1OW3B 3EC2A 1E2IA 3VTKA 2DWOA 4DJTA 3GFOA 3ONWA 1G3QA 1S2MA 3UMRA 3K9NA 4V03A 4DB2A 4LJ4A 5HTKA 1G7SA 3DL0A 2VL7A 1XNJA 2Z4SA 2V9PA 3SHFA 2D06A 1YKSA 2HLDA 2R6DA 3LWNA 1A4RA 2V8OA 4LV6A 3KXKA 4Q66C 5KDLA 3KXLA 4Q5IA 4TWZA 2SHKA 3QIAA 2KSQA 4IOKA 1ODFA 4QBFA 4V0OA 4MQBA 3KQLA 3AVWA 3P20A 3C5HA 5DI3A 1F2TA 4JLMA 2RHDA 4NYJR 5FOWA 2GJ8A 2HXYA 4WZAE 3MD0A 2BMFA 2Q9CA 1W5TA 1P4SA 4DLUA 4ZDJA 3EX7C 3IIKA 2WMOB 4URYR 4AI6A 1E96A 2OLJA 3H1TA 1S8FA 3VR4A 4ZCIA 2WTUA 2Q9BA 1PJRA 3QKRB 4P4SB 2P6RA 3GLHA 3GQBA 3BC1A 5FBLB 2XB2A 1U9IA 2MMCA 4QHTA 3BWDD 5EE5B 4MGIR 1WP9A 1HQCA 1HV8A 3TAUA 4A2QA 4B3FX 5F9FA 1BIFA 1XMVA 5HKKA 2MSEB 2WAYA 3PUVA 1O3YA 2A5DA 2O0KA 2G1JA 1GUAA 3LLUA 4BGDA 3KB2A 3N5CA 5EP3A 2YNMA 4X8HA 2OUKA 1ZVQA 3CNLA 2ZRIA 4A8JB 3THWB 4QC2A 3IHWA 1AQUA 1ZNWA 4PPNA 2B8TA 1KO7A 4B3GA 1GKUB 1G18A 1MR3F 4OI1A 2OE2A 1HURA 3U3OA 1Z28A 4JVNA 3CX6A 4Q21A 4JIMA 2ZIAA 4HSEA 3ADCA 1ZNZA 3A1UA 1KZGB 2ZI3A 4LHYA 2EFHB 4A2PA 1DBSA 4LJ8A 3LV8A 4ESHA 1KY3A 1OE0A 2GJ9A 1VCIA 1UBEA 4NYIQ 1A2KC 1KZ7B 2Z0MA 2RGDA 1G3UA 1WQ1R 2AFIE 1U8AA 4PHTA 4TLEA 3V4RA 1NVXQ 3BERA 421PA 4B71A 3EPKA 3TR0A 5L8VA 1JQLB 2I3BA 2NO7A 3WRXC 2OXRA 5C1BA 4BPBA 4MA4A 1IONA 2OBMA 2ANBA 5SZHB 5FI1B 3R8CA 1E2DA 4PZZA 4WW0A 1Z22A 3C41J 3B7GA 3B78A 1XTKA 3C4JA 2IEZA 2ODNA 4URXR 3WYAA 1VYVA 3TH5A 5CM8B 1ZMXA 3M0EA 3SQXA 4Q4AB 3VX3A 1AKEA 3PCRB 1E2PA 2QAGB 1W4AA 2GVDC 2IW3A 1II8A 2O5VA 1AA9A 2F9MA 2R6CA 2YVUA 3VQTA 1QHHA 4JL5A 5CJ2A 1NJGA 2UZIR 3FFAA 4ZV4A 1XDBA 3QKUA 5H68A 1D2EA 5FTNA 4ITRC 1UKEA 4R2IA 3LBNA 5FR2A 4JVMA 2F6RA 2PZFA 4PPGA 3HR8A 4TZ6A 5CLQA 2Q3MA 5FPTA 1Z0KA 4PC1A 2YC2C 3BE4A 4AY2A 2BC9A 2BIFA 3L2OB 2ZRCA 5EE0A 4RD0A 2X2FA 2E87A 2GNOA 3QVUA 3MWJA 5GVRA 1OIWA 3IEUA 4PC7A 4UNNA 5CYOA 2WWGA 1E2FA 2BBSA 2IYXA 2LKDA 3U5ZB 3ZS9A 2YOHA 2BV3A 1T6NA 1T0HB 4OQMA 2UKDA 1UEIA 3LXRA 5L3QA 4KCGA 5J4KA 3BIFA 4C7OB 1AZSC 2R44A 1NKSA 3LD9A 4BLQA 4O2LA 5DYGA 2LKCA 3VNVA 3HU3A 4XTRA 2G9NA 4DB4A 3SQWA 3IUYA 3DKVA 4D4LA 1YZGA 3RYTC 3CF0A 1E9FA 3TIFA 3NG1A 3SYNA 4XIGS 1XEWY 3VKHA 4M1KA 5JMTA 2KBEA 3T1QA 4MYTA 5A4JA 2XEXA 1W36D 3PVSA 2ZROA 3FOZA 4JLVA 4ERNA 1FL9A 1YZLA 4Q9KA 1OV4A 2NO9A 1G5TA 4BFYA 2XSZA 3VU9A 1GP2A 3QKSB 4MRVA 4I1OA 5KDOA 5C46F 4N0EA 3DZDA 4FWTA 1XU4A 4C9BA 2ZYTX 1G7TA 3KJEA 1ZUHA 2IXGA 1OFUX 2L0XA 5KDDA 2PBRA 2ZE8A 3BFVA 5FOTA 1W4RA 3BH0A 4JLOA 4R71A 3K9LA 4KO8A 3LBHA 1S96A 1VYTA 3SEAA 3GLFE 3PEYA 1MOZA 3DKPA 4MUBA 4AK9A 2CHVA 1AJEA 4LOAA 1M74A 4NCKA 4UJ5A 4C4PA 4D81A 3S1AB 1K5GA 5TMPA 1JNYA 3FVQA 1GWNA 4BEJA 2BVNA 2IYTA 3T1VA 3X1DA 2IHYA 2QN6A 3BB1A 4LV8B 4TYQA 1XTSA 2ANCA 2VTKA 5E95A 3NBXX 3QXJA 4US0R 2EYUA 2LCFA 3MG9A 3CRRA 4FMBB 5L3VA 1P9WA 2JGNA 2GA8A 3U4QA 3B9PA 3NKVA 3WYGA 2FPMA 4Q4JB 1G6OA 4FMDB 4Q48A 1G41A 1R8SA 2QMEA 3BAFA 3WYFA 2PZEA 1VG9B 1E0SA 2CE2X 3L8YA 2AL7A 2YHSA 4L9WA 3T34A 4TQUS 3W5IA 3WY9A 4UNRA 1OH7A 3RS7A 2PT5A 3NBYC 4CRWB 3NWJA 1QG2A 4H1UA 5J4HA 2IUTA 2ZVPX 3DM9B 5IK2A 3VHLB 4C2TA 1OT3A 3U3KA 1IY2A 2F1JA 1W48A 2BCGY 3K70D 3GJ7A 4TLAA 4WXPA 1SHKA 3E70C 3B1VA 4D0NA 2J0UB 1Z6GA 3L0PA 4QKQA 1MV5A 1S1CA 4YDSA 1XD2A 2NOAA 5D3MA 4R7ZA 2JDIA 1NMXA 4P31A 3LO5A 4JLDA 5JSZA 3RWOA 3UPUA 2C9OA 2XXAB 4DKXA 2AWOA 1KJYA 4Y0AA 3AVQA 2ZRAA 4NCNA 5FOUA 4MDFA 1YZUA 4NCJA 2GCPA 3ZZTA 2NZ8A 1C1YA 2QM7A 2ZUBA 2W2TA 4DCUA 4PO1A 5KO2A 3EZ2A 2B7CA 2XNDD 2DCUA 4NP6A 1ZM9A 2BDTA 2FGJA 2PCJA 3K9GA 3CX7A 4LBZA 5EP2A 3AEZA 4XVQA 1NSTA 3OFND 1Q3TA 4V0KA 3A8TA 5FL7A 2F1HA 3I61A 5BW8A 1KTVA 1XTIA 2VLIA 2WWWA 1F2UB 1WB9A 1OKKD 2ZYVX 1DPFA 1IHUA 1Z29A 4I4LA 4C0AC 4IW3B 3BBPA 1F48A 2R6GA 4AD8A 3A1SA 2G0TA 2WPDA 1CULC 2JJ8A 5EUMA 5J4YA 1M6NA 3W6NA 2ZJZA 1MRSA 3T61A 4HDOB 3EA5A 4HUQA 3C16C 1ZW6A 1X1SA 2CVFA 2QSYA 2ZSBA 2C8VA 3GJ0A 4MYCA 3UXMA 4TYNA 3A6PC 4PSKA 2VSOA 3KDSE 1ESNA 1XEXB 5FOVA 4DCNA 1NG9A 4KBGA 3ZIAD 1ZIOA 4EIWA 1IM2A 3C8UA 4P4SA 1FUUA 5ANRB 1CR2A 2ZI4A 1KI8A 4N3NA 4OJQA 4CZ2A 3L0OA 2W6IA 4QRHA 2REBA 1T5LA 3KTAB 2X1VA 5FPSA 5TVKA 2J46A 4HAWA 1DS6A 2A5YB 3NBFA 1P2UA 4A92A 1E4VA 4BLPA 4EQ6B 5GJVC 5CK5A 2J41A 2F1IA 4L8GA 2ZR7A 4ZO4A 1LNZA 4Q9LA 3IIMA 3FGNA 5KSZA 1RYHA 1KI1A 1S1MA 4UXIA 5B30A 1FMJA 2Q3HA 2QY9A 3UMFA 5KU1A 4N0DA 4ZDWA 3VKGA 3O47A 2JJ2A 1PLJA 4BFSA 3BD9A 4JLBA 2IUSA 4TMTA 4N1AA 1XWIA 1H8HA 1R4AA 2NG1A 4Z8XA 4E03A 4JL8A 4FN5A 4HB3A 1Q3HA 3EG5A 1ZUIA 4UQOA 1H8ED 2GJSA 4RD4A 4CF7A 3LX5A 1KI7A 3U7HB 2AFHE 3LNCA 2ASEA 4A0GA 4AYTA 3QXSA 4DUGD 3KXIA 1RKBA 3CO5A 3UG7A 1EWQA 2REXB 1GL7A 2ZE5A 1OXSC 2NIPA 4HB0A 4EAQA 2BWJA 1XCMA 1OIVA 2W6ID 3W5JA 4BUJA 1G9XA 4QOSA 1D2NA 2WVJA 2ZRJA 3WMEA 1Q0UA 1AS0A 3KL4A 1Q20A 1QBKC 1MKYA 1WRBA 3LX8A 1GKIA 4RD1A 2FPLA 3SFZA 3UATA 3RDPA 2B7BA 4LJ9A 3LXXA 5HCNA 3SJBA 1TQ6A 2ORWA 4KYIB 3AQ4A 2GZAA 2HEIA 3T5GA 2H8KA 4A9AA 1VG0B 1KMQA 3IBGA 4JJZA 2VF8A 4MRSA 1UEJA 2XZLA 1F2TB 1YZTA 2VP5A 3TKLA 1AQYA 1KI9A 2ZI9A 3PENA 3Q8XB 4MGYR 5CB6A 5FTMA 1XJ0A 3QE0A 3GJ8A 2FV8A 2WJVA 2QROA 4YMTA 5P21A 4G5GA 3OEED 5AUPB 4XSHA 3K1JA 2EVWX 1LY1A 4C0BA 4MYHA 3B1ZA 4GFDA 1X8JA 2YYZA 4DBLC 1SXJA 1NLZA 1G7CA 1SVLA 2OT3B 1S3SA 1OXUA 1YZKA 2J45A 3NHAA 1SXJC 1N0VC 1E2GA 2JLUA 2CDNA 1JXMA 1OHHD 2BEKA 1HY3A 4DRZA 4HAZA 4PFSA 5EQTA 5JFGA 2ZRKA 1W44A 1VG1A 1TEVA 1AGPA 1G8FA 3IBYA 1YRBA 5KPJA 3AGQA 4RD2A 2GHIA 4Q9IA 3I92A 4NDZA 5FTKA 2F7SA 1W47A 2GKSA 2FX3A 2IXFA 2NTYC 3GPLA 1CR0A 4P33A 3VNUA 5JLJA 1VIYA 4E07A 2G3YA 4TMKA 2VHCA 4HB4A 2A2ZA 4BFWA 4M9QA 2F3TA 1TF2A 2N1BA 2AD1A 1TL7C 3O8RA 2F9LA 5AJXA 1NVVR 5AK0A 2G1KA 3QBVA 3GCGA 3U7EB 1U0HC 4XD7D 2QI9C 3VR2A 2QUZA 1E0JA 2PEZA 1DAMA 3K0CA 4TN1A 3W3ZB 1OXTA 3U7FB 4HAYA 4RD3A 4LJYA 3GFPA 4ACBA 1I4DD 2VP6A 2YC4C 3FFBA 3CR7A 3OIUA 1NN0A 2JLQA 5CIWA 1ZAKA 3SBDA 1FQJA 1MO6A 4JSYA 3E2IA 2GZHA 1N5JA 3RRZA 1DO0A 5IT5A 5F2EA 5KPDA 2ZM5A 3H86A 1FP6A 5H70A 4GBMA 3ND8A 1C4OA 3AKEA 1II8B 2KB0A 4Q7MB 3VAAA 1A2BA 2ECKA 4BASA 4JVSB 2ZSEA 4W5JA 2IF0A 3A4MA 4Q4HA 3LLMA 2WOJA 1QHHB 3L8ZA 4DLYA 4G01B 3PEWA 2FWRA 1E98A 3X1YA 1KNXA 2ZJAA 3ICEA 2OFXA 1KO4A 2RB4A 1W0JA 2ZRNA 2XX3A 2GTPA 1RJ9A 2G88A 3GEIA 1NIJA 3OZXA 4CEJA 1XJCA 4B3DA 4R2HA 1HH4A 4JYBA 1OYYA 4EPTA 4LHVA 1ELOA 4DLZA 1Q22A 4HYYA 1OSNA 1EFHA 4OQNA 3U7GA 2NPFA 4LDJA 3MJRA 1OB5A 1UBGA 4RFSA 1W4BA 1GZSA 2AXPA 4KFSA 1G291 3IQWA 5L3QB 1A1VA 1E9EA 4ZI2A 4KU4A 2JIZD 4OL0A 1E69A 1U0LA 1RVDA 2D74A 1R7RA 3DPUA 3KB1A 1T3HA 3TSWA 1B0UA 4QFMA 2OG2A 2EFEB 3TJZA 3FMPB 4O0MA 3EZ7A 2O0JA 521PA 2C9YA 2ZR0A 1TX4B 5H1YA 4DDWA 3WBKA 1GL9B 5DHFA 1X8LA 4GDFA 4F7WA 2FSGA 4M9ZA 4NL4H 4A6XA 3HJNA 4KFRA 4KLNA 5IF9A 3CWQA 2QMUA 1G7RA 3M1IA 3GMTA 5M04A 1JAHA 3PUYA 3SJCA 4AKIA 1GVNB 4HLUA 1ZNXA 3T12A 4B2PA 4Z54A 5LDDC 2LWIA 2BBWA 1QG4A 3QPVA 4XOIA 2ODEA 2IL1A 3VU9B 1II0A 4Q1AA 4LJ6A 1COWA 1XF9A 2KBFA 2RCNA 4LCBA 2J5XA 1Z47A 2D3WA 1JI0A 1OLOA 4B74A 1VIAA 1GRRA 1C9KA 5F9HA 4F4JA 2ATXA 1G64A 4TMWA 4LJ7A 4TSFA 4XVUA 1F2UA 5EUQB 4BECA 5FPHA 4HAVA 1HE1C 1PLLA 4DLWA 5FPYA 1R2QA 5DYIA 2UVQA 4M9SA 1G4UR 1NI3A 5LBIA 5JHHB 2QRNA 3I5XA 3WP0A 1VCNA 5J4LA 3TLXA 2DB3A 1FOEB 3WHKA 1HT1E 4A2WA 2XJ9A 2FE4A 2JA1A 1N5IA 2H18A 4HB2A 2P5TB 2AK3A 3LAWA 3VR3A 4TYYA 5IHPA 4BE7B 3U4QB 5LD2B 3NEYA 5LB4A 3WNDA 3WMFA 4A0FA 2ZS7A 3SDZA 4R9UC 1IN7A 3Q7PA 4Q18A 1UADA 2FMXA 4NCIA 1V43A 2BBTA 1J7KA 2AR7A 2D4HA 4X8OA 3U3RA 2IS2A 4IKEA 5E7IA 4IEIA 3H2YA 3SZRA 3GJ5A 5AJVB 3WNCA 1MH1A 5JI3E 3QPUA 3ZGXA 2FFHA 2FGKA 1U98A 4D0LB 3NC0C 1GM5A 1W49A 3QPWA 1VCMA 5K8IA 4WA7A 3KUCA 1ZM2A 4UNSA 5B2ZA 2X2EA 4RFVA 1QDEA 1WA5A 2RH5A 3QSYA 1B23P 3DZ8A 1Z0JA 3G5UA 4TYPA 4QNMA 2JLXA 3OEHD 3WHLA 1L2TA 5FUVA 2BMDA 1XD2B 5D3MB 3AM1A 2B6HA 2JLVA 1ZM7A 1A5TA 2GK6A 5JSZB 3NIBA 1ZNYA 2ZSAA 4LHWA 4L4UA 1N0UA 4DDUA 2JJ1D 2OAQ1 3OIWA 821PA 2Q3FA 3GLHE 2A9KA 1JAIA 4OHYA 5SZIA 1R6BX 2Z43A 2NO6A 3LFUA 3ICQB 2AWNA 4A6PA 1E94E 4NH0A 1F6BA 5FPKA 2C78A 5DSZA 2QQEA 3LA6A 3Q5DA 1CJMA 1WMSA 3UKDA 1KI4A 2CLDX 3CZQA 4Q1BA 1L4UA 1N3BA 4U00A 3KKQA 5G53C 1P2VA 1RW4A 1SVMA 2X8AA 4HUQB 1AKYA 2ZXUA 2Q21A 4QG7A 1FTNA 1IAQA 1JR3A 4II7A 2A7QA 4ASUD 1OFHA 2QAJA 2WICA 3CRMA 1LFDB 1E79D 4D26A 3RS2A 1GL6A 1KYIA 3HP1A 4LWZA 1P72A 1ZU5A 2VP0A 1IBRA 4IDQA 3WP1B 4E22A 1XMIA 2VIIA 4KITB 5CDFA 4NPHA 2EWWA 2H92A 1PUIA 4BLSA 4F38A 2QGNA 2HLDD 1IY1A 1UM8A 1Z3IX 4LYHA 1AM4D 2YJTD 4BZPA 4C0HA 2O8FA 5FTLA 3AVVA 2TMKA 3D3QA 4D4KA 1NLFA 1XPRA 4MKIA 1P75A 2V1UA 4OK6A 4JMPA 1Q1BA 1XBTA 1IXRC 3I8XA 1NG1A 1TQ2A 4IHQA 3Q5EA 2YOFA 2RHMA 1CJTC 3U44B 3BFXA 4DSUA 1E4YA 1G4AE 4YMVA 2HYDA 4JJKA 5DIFA 3OHMA 1BOFA 1GFIA 2VF7A 4UKDA 2QU8A 4NKRA 1R5BA 4OK5A 1KI3A 1E2NA 2CLSA 4D80A 2VSXA 3QF7A 2FJUA 4RKFA 1KOFA 5JJKA 4A0HA 1G8YA 2W83A 5FI0B 5UKDA 4E5UA 5HKKD 3CB4A 3JZAA 1LV7A 3GLIA 1LS1A 3D31A 2ZJ8A 2IYQA 2ZJ2A 3LW7A 5EZ5A 2XJ4A 2QG6A 5HE9A 1ZM3A 1NN3A 1BH2A 2HT6A 2P65A 2DR3A 3R9WA 1YR6A 2FFAA 1XX6A 3VR1A 1YHNA 4QHSA 1FP7A 3K0FA 2I1QA 1YJ5A 1PZNA 4EFNA 1SKYB 5BN5A 3SYKA 2EQBA 1OH6A 4B6EA 3ZZUA 2P6UA 3JVVA 4B35A 1T8TA 4OJKA 1OH5A 4NONA 5JS8A 1SXJB 1R0WA 5FFMA 5EXPA 4FMCF 2V6JA 1IQPA 4PSAA 1XZPA 2VP2A 121PA 4M1MA 2IYYA 4DLVA 5JHGB 3QY0A 2QPOA 1JQJC 2ZSFA 1KK1A 3FDIA 2GVZC 1W46A 3QXHA 5EXXA 3RANA 3RRNA 1O87A 4IVRA 2QPAA 1CKEA 1SKQA 4JBWA 1DG3A 2C95A 1P61B 3KKNA 4K46A 1VDZA 1E3MA 2Z83A 3EWSA 2JASA 3ZH9B 4G5SA 2QT0A 2WJHA 3BJIC 2P67A 4G3XA 5K8UA 1U8YA 1NMZA 2QTVB 1Z6AA 2BM1A 2CL0X 5C4GB 4ZIRA 3QG5A 4C0KA 3CBQA 3TUZC 1J8MF 2FA9A 3WBJA 1LF5A 2R65A 4KHZA 2AXNA 3EPJA 3CNOA 4NYIR 3TAHA 2ZETA 3NEJA 3IILA 2ZQ5A 1OXXK 3EWAA 2W2VA 1EFTA 3B6EA 3RS4A 4WOPA 4M1YA 4OHWA 3BGWA 4IFBA 2R6AA 2Y8EA 1JJVA 1FPMA 1CTQA 1S4QA 4LRWA 4UJ3A 4X8MA 3L43A 3W3AA 1WBBA 2ZI6A 3UANA 1DAKA 5K8LA 2GCOA 3CM0A 1S3GA 2BMJA 3RVBA 1YRAA 4QBIA 3KKPA 4RCYA 1YU9A 1H65A 3NC1C 2PX3A 5G40A 4BRWA 2R6FA 1T4GA 1W0KA 3OF5A 2WOOA 4QGAA 1HUQA 1TADA 3RS3A 2PX0A 4I1VA 2QBYA 4KJZA 2OESA 3PG5A 3REFA 3TUJC 2XAUA 1MO3A 3AF3A 4Q4HB 1YR7A 1KAGA 5G3YA 1EX7A 3G0HA 4BFZA 1DADA 1Q1ZA 3VHXA 2CL6X 3C14C 2RAPA 2ZYWX 2EU8A 1JXOA 4OHZA 3PXGA 1VHTA 1RJ9B 3RSLA 4Q19A 4I1SA 4LC1A 3V00A 5EJEA 4CEJB 2PLRA 3DDCA 1U81A 4DLRA 4FCTA 2QORA 4GP6A 4Z1MA 4B73A 3TGPA 4GSYA 3AVYA 3JVUA 1G17A 2IK8A 1E32A 3NDPA 1P73A 4FCWA 3L82B 3KUDA 1DVRA 4HDQB 5L3SA 2A5GA 2XSZD 2QGZA 4D2IA 4RFSB 1U2RA 2IYZA 1NJFA 4PHGA 2ZS9A 5E7MA 4BFXA 4TL6A 1GRNA 4UNPA 1G1MA 3GEEA 4Q7LA 4TYWA 5GJWC 3T5DA 4AIIA 1TQDA 1D2MA 1NSFA 2ZYUX 1W0KD 5J40A 1KK3A 2PL3A 1KKLA 2VP4A 2Q6TA 4MITA 4LC0A 1E2JA 2Z6VA 1KI2A 5IDVA 5SZKB 5JJIA 1U99A 4KVAA 2J7PA 4NE2A 1XXHA 2OCYC 1N2CE 2CBZA 2CCKA 4GT1A 4LBVA 3K0EA 3Q85A 3H4MA 2CHGA 5G41A 1IXSB 1QHNA 2BCJQ 2HJGA 4ZCLA 1ZP6A 4JBYA 3ZQJA 3EASA 2J7KA 2J3EA 1T3LA 2WAXA 4RCZA 1QVRA 3CRW1 5JCZA 3CNNA 3U3JA 1FZQA 1U8ZA 1YR9A 5BN3A 2D7DA 4PPQA 1W5SA 3W8RA 2HYIC 2V3CC 1Z0AA 3MFYA 1GNQA 4LPKA 2NQ2C 4FIDA 1BYIA 3NH9A 3AF1A 2GBLC 2NGRA 3KJHA 3GJ4A 2XITA 3A4LA 4JZKA 2MSDB 2G77B 1L7VC 1XMJA 3T06B 3MRSA 1E9RA 4DXAA 2WBLC 5BYKA 2H5EA 2QPTA 5IK2D 2VRWA 3AH8A 3HR7A 1EFRA 3MSXA 3I4LA 3QXCA 5FH9A 1KGDA 2OCPA 1J90A 2O8BA 2CE7A 4LHZA 2E9SA 2ERXA 1KIMA 2WWHA 2WV9A 1KJZA 2ZANA 3QF4A 2JDID 1G3MA 2CVHA 4L5BA 2QM8A 3P27A 2QTFA 4YONB 4ARZB 4B32A 3H84A 1L8QA 4JL6A 4WAUA 3IIJA 4IOJA 1DAGA 2KJQA 2ZREA 1MRNA 4LGMA 3SN6A 3AVOA 2GEDA 5AUOB 4HATA 1Q1QA 1T91A 2W0MA 1EGAA 4MRNA 4B2LA 4CEIA 1DARA 1E9DA 5ELXA 1NBMA 3MJHA 4AC9A 2VHQA 4AYXA 5FUYA 4PXAA 5FL7D 1NY5A 4QJ4A 5C2JB 2OBNA 3MWKA 3QBTA 3AF2A 1Q21A 5FBQB 1F5NA 2ZSDA 3FMFA 1E2QA 4PO9A 1KDPA 2WPDD 2GJAA 4FWIB 2A78A 5GJBA 1S9DA 2W00A 3PQCA 4A4DA 1XRJA 1SKYE 3CZPA 4YDHB 3A1TA 3BB4A 3NBZC 1UAAA 3U44A 2AHOA 4M4SA 3CUEF 3OIVA 4PSVA 3HPQA 2FU5C 1NMYA 1VCOA 3LW8A 4NCHA 2VPPA 2ZE6A 4LBYA 1SXJE 2NPIA 4M1OA 3X1XA 1ETUA 4TMZA 4TTPA 1LS6A 3FWYA 2ZVQX 3OE7A 3I3SR 1NBMD 4P32A 1EFCA 1WF3A 3SYLA 1QZXA 5CM9C 5TV2A 1AZTA 3L0SA 3SS8A 2PMDA 1E6CA 2R62A 2VP9A 2XNSA 3AKCA 5AJWA 3QENA 2J87A 1OB2A 3DOFA 4K8OA 4NBSA 2P6NA 1SVOA 4URVR 3TBKA 3AUXA 2OEPA 5AJZA 1JEEA 4XWKA 2JJ2D 3OAAA 1E1RA 4B48A 3PFIA 3F5FA 1H8HD 3ZLJA 2YWHA 2XOKA 5GJCA 1SVSA 1G5PA 4DCSA 5B58C 1KO8A 2XTNA 4PAOA 4UXJA 4LBWA 4PO8A 4D82A 1U94A 3B13B 4FINA 3TVTA 4QNRA 4ABYA 4H1VA 1X8KA 3FKSA 1P2TA 2BHRA 4M1SA 4XH9B 1CRPA 3OE7D 1CJKC 1E0AA 1VG8A 3K9HA 1R0XA 4LZZA 1Z6YA 2F43A 2A30A 1MABA 4DSOA 4GOXA 3VX4A 4TTQA 3KQUA 4S2EA 4Q02A 4L15A 4WIAA 1DTSA 5HZHA 2CK3A 4QGHA 4ACAA 4R98A 1X86B 4RY2A 3W9YA 3QXXA 4F91B 2O8FB 2QT1A 2HJVA 2GCNA 2GZDA 1XJQA 3QUSA 4MGZR 3FMIA 2GF0A 1QHIA 3A4NA 4DDTA 1XD9A 3MAAC 3CWZA 4UNQA 1MT0A 3AGPA 5JJLA 1ZIPA 3SI7A 1P60A 3EAQA 4EKDA 4GMXA 1G8GA 4LJ5A 1N5KA 4FCVA 4OI2A 5KNCA 1HTWA 4XWAA 3TW8B 3PEVA 3MCAA 1UBCA 1DAEA 5FOSA 2PEYA 1SXJD 5E7JA 3K09A 2ZAMA 3T15A 2NMVA 4AURA 1P7CA 1E2EA 3A1VA 4IDOA 3BH7A 1K6MA 4NTZA 2EFDB 3K09C 2QP3A 1YZNA 1LVGA 4IOMA 4NYMQ 3ZYCA 1XPUA 3GLIB 3UK6A 4OI4A 1BS1A 2F55A 5DGXA 4DCTA 1PLKA 5SZJA 2A3RA 2QZ4A 4MGKR 1RYFA 4B6FA 4BQSA 1ZD9A 2YKGA 1LW7A 2O8CA 2ZUCA 4JLPA 4DCVA 1DE0A 5KHOC 1UDWA 4LYJA 3VR5A 3K0FB 3GLGA 1N0WA 4IVQA 4IJMA 3EIEA 4KYUA 2O8EB 1KSJA 3CH4B 5DO9A 4DT1A 3GFTA 4FI3C 1OH8A 2ZRGA 4M21A 5BQ5A 2ZAOA 2G6BA 3BH6A 1OPXA 4GMDA 1SVIA 2FZ4A 3V9PA 4WZ6A 2R2AA 5JEDA 4GOKA 2QRZA 2VHTA 2OSBA 3V4FA 4B2IA 1CP2A 3TQFA 2YWFA 1Q1EA 4IDHA 5AWFC 1IY0A 2GETA 2RMKA 5TDHA 3AB3A 1ANKA 1N6NA 2HV8A 2ZU0C 3X1ZA 3I5YA 4A15A 3KFVA 2WSSA 1I2DA 4TL7A 1X6VA 1NVUQ 3DM5A 3GJ3A 2AX4A 2WKPA 4GZMA 2IHBA 2UZ3A 3ECCA 4KFTA 1EESA 1GAJA 2PMKA 4TTRA 1XMSA 4TZ0A 1G3IA 2V55B 2J0VA 1Z83A 4Q9HA 4JYCA 1ZC3A 1VKJA 4C0QC 1CBUA 3R7WB 4ZIRB 2OAP1 721PA 4GNKA 5FL3A 4Q47A 2GJKA 1SVWA 1CR1A 2KI5A 3B1YA 1W0JD 3WMGA 1E0KA 2W58A 5DN6A 1JPNA 1U90A 3CLVA 5TXGA 2QEQA 2IS6A 5GADl 1X1RA 2J0QA 3T1TA 2YZ2A 3THXA 4ZDKA 3RAPR 2WIAA 3PEUA 5KSYA 1ZM4A 4L16A 3J81k 4NYMR 2HDNB 1JEDA 5DLQC 2WSSD 3MLEA 4M2LA 3X2SA 2IEYA 2CCGA 2C03A 1XCPA 2NZJA 3IPYA 1IN8A 3MUFA 3KQKA 3F3YA 1LF0A 2ATVA 1UJ2A 2GCOB 2GEVA 4QGGA 3WNBA 1US8A 3PUWA 4IXNA 3RHFA 4Y0VA 2ZE7A 5A5GA 2FG5A 3LY5A 1TQ4A 1W2GA 4YXWA 5DISB 2QBYB 3ZS8A 4BEBA 1Z6TA 1RPZA 1F3OA 1XTJA 1AS3A 5AR1A 2Q0HA 5EE9A 3PJRA 1KI6A 4I81A 5BXQC 5F98A 3T1OA 2C99A 2GXQA 2QE7A 4C2UA 3SE0A 4PHFA 4ARZA 4MYUA 3F0TA 3CF6R 3I73A 1P9NA 5KYKA 3C5CA 2D2EA 5DNYB 4GL2A 1ZBDA 3QQ5A 5L3SB 5D3QA 3IKJA 1XTRA 4RSGA 2GXUA 3THOA 1TNDA 2GESA 3Q72A 2WWXA 1COWD 2V7QA 1ZD1A 3AKYA 4HLCA 2RGNA 2IF2A 3ZVNA 1CU1A 2ONJA 1XTQA 1NVWQ 2P0EA 4TMXA 1SHZA 4JLAA 2XZPA 4WVFA 4B3XA 5JEEA 3VKWA 1I2MA 3AUYA 1GSIA 2RGNC 3CH5A 4TSFD 2AN9A 1JPJA 1N25A 3B1WA 3M4YA 3RABA 3SJAA 4YLGA 2IWRA 4YXWD 2JATA 1VTKA 3IO5A 1FFHA 1M7BA 1BMFA 1E9CA 2BOVA 2PH1A 4XSGA 3ZQ6A 4U5XA 2DFLA 4JBXA
chains in the Genus database with same CATH superfamily
2HB6A 3G8AA 1TF7A 4P4TA 1GQ2A 3W4IA 5A02A 3UWSA 4V0MA 5EZSA 4EG4A 2Z5LA 1KMHA 4BKMA 4I6EA 5BUZA 2HQRA 4G4IA 1QC5A 1QP0A 4KGXA 1KK2A 1T29A 3IP3A 2WIBA 1O96A 3MFQA 4BATA 4EDHA 4H3KB 1LKZA 2J1LA 4HAXA 1TK2A 2QMYA 2JFQA 3FTQA 4JOBA 3UWKA 5BN3B 2YINC 3JSXA 3TW4A 3KKLA 1I1OA 4FHZA 3W4KA 3N8IA 4NLLA 1GTL1 1R88A 4O4LA 3D4PA 3GRUA 3UGJA 4ZPXA 4U02A 3CO0S 1BGWA 5A9SB 3WGZA 3I9OA 3T7AA 5CDFE 1ZDMA 1DELA 4OIMA 3OWHA 3NYRA 1LNSA 1ORRA 4CLOB 2I76A 4HDNB 1BEUB 4H9GA 5ES3A 1Y63A 1ZSNA 1CUGA 2PH7A 2B20A 2AUMA 2H6EA 2XDYA 3PGVA 1I2BA 1LGYA 4GF5A 5CW2A 1JW9B 5AJYA 4C43A 1F7VA 1G60A 4KBYA 2GLTA 5ADVA 2ZULA 1MC5A 1Y8AA 3GGPA 4KSCA 5HE8A 5HQ3B 1C8VB 1TUEA 3GH1A 1MJHA 2AXEA 3KPUA 3L1IA 1DEAA 2QMOA 3LM8A 4HGOA 1JZQA 4ZKDA 1XWWA 1DBRA 2CXXA 2BUBA 1R3DA 2A1TR 2JI9A 2XA2A 1CQZA 3EIWA 4RZXA 4LXXA 3RG8A 4FMCB 4IKOA 3TKAA 2W22A 4I7EA 3AFHA 2CB0A 2A9PA 4JVLA 1M1NA 4LRTB 4AS3A 1J1UA 2P1DA 5HUJA 2GMWA 2IKSA 3R8FA 2XMRA 4D25A 4HJRA 4DR3B 4TT3D 3LUAA 1V7QA 2JLAA 2W6NA 5JT1A 1UOEA 4UNIA 4HR7A 4KN5A 2EKZA 3HBJA 5AKGA 3IH5A 2Q6VA 3LSTA 3LUJA 2ZWMA 1IHPA 1SGWA 1VMEA 1T3SA 4JEIA 1HQYE 2OV2A 4WNIA 5C4IA 1V7ZA 3GLIE 1ZWLA 5IKOA 1T4BA 2CBXA 4BLTA 3R9IA 4BZQA 1JGTA 3PFKA 3U4CA 4YJ3A 1CS0A 4RD6A 1C9NA 1KZ6A 4HNSA 4RVSA 1JEYB 4F8EA 2DBYA 2I4NA 4CMHA 1KA9H 2WD7B 4K6GA 4I5IA 3AXTA 3IDAA 1E6KA 1C7RA 2XXBA 3BZWA 5AH0A 3CSSA 1G3RA 4A0RA 1Z45A 1SIOA 3WLSA 3PXCX 4FYIA 4XQGA 2CUZA 4UMEA 3SAJA 5FWNA 2JLWA 2A58A 2NXJA 2A5JA 5CG2A 1CQJA 1KBZA 2IYRA 2PKWA 2IIPA 3DO6A 5DOVA 3TPFA 1JR3D 5CAEA 4DILA 3H4IA 4PZ9A 2HUNA 1R5OA 4KREA 1TVMA 5IKMA 2ODBA 2YXNA 3E5MA 3K8YA 2DH5A 1DBIA 4HS4A 1ONBA 4OHKA 1RJWA 3VJKA 2ZGVA 1KVQA 5AW1A 3HCNA 5I7HA 3U1BA 4HHEA 1DQPA 3L0IB 2IA5A 2JAXA 2WUDA 1RRKA 3COPA 3EIHA 3HPRA 2QQGA 4ND4A 4E11A 1S0UA 2FPSA 1KRHA 3OQBA 5G0VA 1NOIA 4JT4A 3U6BA 3V6MA 2VDRB 1CJUC 3IR5A 4JAVC 4XQEA 5CDUA 4R81A 2YJ3A 1GUBA 2Z09A 4M6WA 4V1CB 1C3JA 4E32A 3LVRE 1NXTA 2PWPA 4IG9A 4YAJA 1PU2A 3JRXA 2ZJ4A 1EP1B 4JFRA 3SU8A 1BKYA 1U2TA 4IIUA 1WTAA 4RF3A 1N1MA 1XZEA 1K4MA 2KS6A 2CXPA 3A4YA 1RIFA 3KNZA 3L6UA 4O2BF 6Q21A 4DC1A 4M53A 2HEGA 2BHSA 4CPDA 1SBCA 4LJLA 3RTBA 2ERYA 1OVMA 5JD4A 1FTYA 2XBUA 3W6PA 2C77A 3EQ6A 1Z2DA 3D54D 3FZQA 3FVVA 1QS0B 2B1GA 2R8EA 2ZIEA 1FZTA 3Q7QA 4Y18A 4KO1S 1U0OC 3F7NA 2WSYB 3E8SA 3GT7A 4GWGA 4M89A 4U7FA 3MJEA 4EHFA 5HRCA 1HSOA 1Y3IA 2QZZA 5T8KA 4YAKA 2O2DA 2Z5FA 4JBGA 4RZIA 4Z0HO 2D5IA 1M6VA 4D6PA 3B51X 1Z6XA 3X44A 4ZVQA 5AFSA 3AJRA 4EO9A 4GYWA 4LJRA 2WRZA 3GUCA 3EQ8A 4UU7A 4OFBA 5IJ9B 3GW8A 1WE2A 4QYTA 3DWIA 1GQQA 1XRQA 4TMVA 4JLNA 5A4MS 3E61A 4O4IA 5F73A 1YR8A 2VAMA 2W4QA 4PQYA 5TPZA 4AKEA 5I7RA 3IQXA 4UM8B 5LBTA 1MABB 4K2HA 3C7AA 1HGXA 2ZS8A 3T35A 2JAUA 1JH9A 1EVLA 2WF6A 2ZRPA 3S2EA 1QLJA 1AB5A 2WJJA 3C3YA 3DHYA 4IILA 1E3EA 1E1QA 1L5HB 3HM9A 2W2KA 4QPDA 4BMZA 1T3TA 1D9ZA 1U7OA 4YMSA 3CRQA 1II9A 3DBOB 5LQCA 1E66A 3SDBA 2GXAA 3FOWA 4LX0A 3HRIA 1H2BA 5AKIA 1PQ4A 4MUJA 4F46A 4UE2A 5DHUA 2C9CA 1EZZA 2NYUA 4CR8A 1GNLA 1HYEA 1VC2A 4W9RA 1BD3A 1NU6A 4A5SA 3BORA 1B8OA 1RRVA 1VFPA 2EG9A 2QN2A 2OA0A 4ALLA 4PHCA 2I4OA 2ZJ0A 4LGVA 5J63A 1AGRA 1QIJA 2CC2A 3G0BA 4CKEB 1H6BA 5KTNA 3JZMA 1A72A 1N5RA 4OK3A 1VB3A 3AWDA 3A6HA 3PWKA 1FFAA 1YULA 3DWFA 3IBSA 4C89A 1EK0A 4N0MA 2NO5A 5J9FA 2FQWA 2H4FA 4KI0A 5E6SA 3AHFA 3C3XA 4TLCA 3FNFA 2O8DA 4BQRA 4GE0A 1YBFA 3BKXA 2AKYA 3L8GA 5DTMA 2VQSA 3GJ6A 3LKVA 1T9ZA 4YP1A 2OILA 3HTXA 3V8QA 1NPTO 4PNZA 2OSVA 3GLRA 5AVKA 3T3DA 4KNVA 1KQPA 2AT1A 4LAFA 4RELA 4JI6B 3ZE7A 2P5YA 3UA3A 1YVUA 3F98A 3HJHA 4X24A 3H65A 5HHTA 5K3SA 2V4UA 3CR8A 3PNBA 3WAJA 1GD1O 5EFZA 3W6OA 3AHHA 3K4PA 2P79A 4F92B 3O3OB 4RPJA 5G0TA 4JJ4A 4H6PA 1XXHE 5TMBA 3EFEA 3W05A 3NETA 2FEKA 4URWR 4C3ZA 1E1CA 3CWCA 3GGDA 2F3RA 1YT5A 4XIIA 4IIBA 4JEUA 5LWQA 2RGBA 4AKHA 4CKZA 3KQNA 2GYUA 2VHJA 4MR9B 2FMFA 4TL8A 3O8DA 4M7OA 1Q0SA 2N47A 3G2HA 3JPYA 4YAEA 5CB4A 5EZ6B 2CJFA 2FPIB 2W4IA 2J59A 1O5OA 1P31A 1QGYA 4CGZA 3AFNA 1ECLA 1JSZA 3V8VA 2MHCA 1A96A 3DLPX 1CQIB 2UZ1A 3WNZA 2Q5HA 1FX0A 5EJFA 2AJBA 4MAAA 1UBKS 5C8ZA 2W37A 4H7FA 3IEVA 2VNIA 4QD3A 3AVYA 3THYA 1LI4A 1X13A 3DOEA 1YB2A 1H6DA 1WUYA 3HJBA 1PEYA 3O82A 4I3HA 1J25A 4TWBA 4YRDA 3THRA 4BJ6A 4ETNA 3UPTA 4F93B 3VYWA 1YUBA 2DY0A 1NA5A 1USWA 2VBCA 5HZGA 3ZXIA 2YFQA 5JPDA 4QLAA 3EWNA 1P9RA 1YE8A 3P9RA 3P9ZA 3DT6A 1XRPA 2W2QA 1IUKA 1J8YF 4FD2A 4XYBA 3G0IA 4RZ2A 4XQCA 1PR0A 2I65A 2I3ZA 2XHZA 2XNHA 3BMCA 1VE1A 5IEJA 4ZXPA 1C8LA 1G9TA 1AKTA 2O2SA 5TSDA 5CBKA 1Z8FA 2Q9AA 4LF5B 2DPXA 1TMYA 2QN9A 4JQZA 3BWVA 2OCIA 3DBLB 3I8SA 4ZO7A 2VCHA 1YQQA 4Y1EA 3GLFA 1A98A 1FNNA 3N8KA 3TCKA 3EN0A 4HQ0A 1DC8A 4ETWA 2OC4A 1Z0DA 3IAUA 4HZUA 3D8SA 3U7RA 4QJ5A 5TRTA 4F5ZA 1YRHA 2H51A 4O2BA 2WWYA 2VWQA 1NE7A 3D6MA 3F7TA 1FUIA 2C9ZA 4M7WA 4UMFA 2GN8A 1XDGA 5CCDA 1KMNA 5AVQA 1OLUA 2HJHA 3U3MA 2ZJYA 4B3RB 2DUMA 1LSUA 5ALJA 3ILHA 5C18A 4P0QB 4IAOA 3I52A 1GV0A 4BJHB 1P62B 4DA8A 3R0JA 3VZRA 2P2ZA 3WXMA 3A9CA 3TE6A 2C82A 2X8LA 4G36A 4HQNA 3FKQA 4LDZA 4QBHA 1DXHA 4KYTA 3OLWA 3GJTA 2YIVX 4ML3A 1IOZA 1YBAA 1USKA 3G23A 1JSCA 1B14A 5HEKA 3T5TA 3DFMA 4UTNA 2ZIVB 1L1RA 5I4IA 4RXTA 4YUWA 4GDMA 1R0ZA 1ORHA 3ZCPA 2A67A 3P9IA 4QUGA 2BYTA 1ZJ5A 3HBFA 5A0FA 3CONA 5E1BA 2GRJA 1HDGO 2GCIA 1Z39A 3G9TA 3M3HA 1CLUA 3SQOA 1NC1A 2J3DA 4OUDB 1KJWA 1H6AA 2I7XA 1CUCA 1E4EB 1ZH2A 2L19A 5DBOA 3A7DA 5JXJA 1SVUA 3GXOA 4XQ0A 5LFAA 1H3FA 1HFEL 2FDCA 5I4BA 2HWYA 1T2AA 5KYGA 1KY2A 2OV8A 3II6X 1NXPA 1XCGB 1NMSA 4KMOA 4AJJA 621PA 2YZNA 2AR0A 1UKYA 3LDGA 4OBEA 5BMVB 3RJ9A 5EC8A 1BHQ1 3QYJA 3ST7A 1CHNA 1NNEA 2BH2A 1G20E 2GHRA 4FYXA 3PIIA 4ZU1X 5CBPA 1IPFA 4OHVA 4IEEA 2RI0A 1MG0A 1IVYA 3AR2A 4HXFB 3R7NA 2GF2A 2Z2YA 2ZIUB 4Y2RA 3RH0A 3UYLA 3HWSA 3VH2A 1QGAA 4CE6A 3AV0B 3DMNA 3OIFA 1AURA 2ZWIA 3O1HB 4DUGA 1N6IA 4CT4B 3ICPA 2BLNA 3H6KA 3PICA 2EW1A 3EBOA 3GQVA 2YJZA 4TRJA 2OWEA 4RA6A 3DW3X 3ORYA 4K81B 2MIIA 3MF4A 1NLYA 4JJ8A 4F2WA 4G65A 3M7IA 4PU0A 3SJZA 1UXIA 3IUSA 2QL6A 3CX8A 3KAPA 3LHKA 3G2NA 1R10A 1SB9A 4M1TA 2QTZA 3RVRA 2VAPA 4EFMA 4HO1X 3W2FA 4XB6B 4EF5A 3PHLA 2MR5A 2JH3A 4W8GA 1FNSA 3L02A 4F7DA 3RRMA 5EHGA 2E5WA 3OM0A 2KWIA 2CVQA 5C5EA 3OZSA 1EFVA 3QE3A 4PCVA 4ZI5A 2YV1A 3QWIA 3TQCA 5JD5A 5JVDA 4OQXA 1RTKA 1B8NA 2BEWA 3AIMA 2O52A 2VJBA 4HC4A 3FPBA 2HJWA 2XGMA 3EG9B 3GU3A 1UCFA 4ZKEA 3ZWDA 1N6HA 4G8DA 5DH9A 4CYMA 4YQYA 4DSNA 3LPCA 4LI0A 4Q1CA 3MMXA 3EEFA 4KRFA 1A82A 4ZQIA 1G6HA 3OEEA 1P45A 2JK0A 4QEZA 4OQYA 3H9UA 3ETDA 1G98A 4DWWA 2IV3A 3EF1A 1CDDA 1E3IA 2K2QB 3C48A 2I0FA 3FX2A 3O7WA 3WV5A 2AH5A 1ZU4A 4X61A 2UYQA 2ZUVA 3CLKA 5FUWA 3WGVA 3ROKA 3AVTA 3JASB 1FDWA 3GVXA 2Q07A 2Q6LA 3HJUA 4GICA 2XY4A 2V0GA 4HDCA 1EQUA 1XZAA 4MVJE 4W9NA 3QG1A 1E60A 2OYSA 3K53A 2Z2XA 2CT8A 1CZOA 3VVBA 3QBDA 4FXPA 1ZNQO 2W6JD 4ND8B 5HJ5A 4UPVA 4DE5A 3BIWA 4W9NC 5FXMA 4BLUA 3HV2A 3I45A 4L9SA 1MORA 3A6FA 3CMCO 3S0JA 4YXFA 2RGRA 1IHYA 4ZYTA 1BMQA 1GUFA 1XHFA 1LRKA 1Y6ZA 3RVOA 1TQHA 3QBJA 1JUDA 2Q2VA 1IB6A 2AJ8A 1V4VA 4QBTA 3V32A 4Q4AA 1NBWB 2D0DA 3H2SA 1F20A 1VHDA 3GD7A 2X9QA 1YS2X 2V4ZA 1CRZA 2H7CA 4YP5A 3U4GA 1RJEA 1BHSA 3RC8A 4IHKA 1E5XA 1RQPA 2PGNA 3QM1A 4C2BA 5CA0F 5CTJA 4B5KA 3TI9A 1FDVA 3OQPA 3Q6MA 4X7BA 5AKEA 2OBLA 2OXFA 4XGIA 3VZSA 1XEFA 3RK0A 1GPKA 1YFZA 1FA9A 2I2AA 4Z8YA 2P7HA 3G82C 3RAGA 1QHEA 1YMQA 2HGZA 1H1LA 2ZT5A 3KU1A 4G2NA 4LWPA 1XE3A 3OOWA 3OAAD 4EPXA 5TVGA 2ZR9A 3GLHB 1T9GR 1OFTA 4RHUA 4EI8A 1RPTA 3OQVA 3GLGE 5E2AA 2HF8A 1UFQA 4XW2A 1OF1A 5DHRA 1N6KA 3ROPA 5H4GA 3TE7A 3ETJA 5BT8A 4BNFA 2RGCA 4S1PA 3U2QA 3W79A 5FIUA 1SUSA 1FQWA 2F00A 2P0YA 3L6RA 3PC4A 4PLVA 3GMSA 3TMAA 3ZK9A 2WQ6A 3GJXC 2QNRA 4GZ3A 1WPGA 1IQUA 1X1TA 3BK7A 3EA0A 2O0HA 4EWLA 3H0KA 3V4ZA 2VJKA 3K9CA 3FUWA 3O5AA 4RQTA 3OPXA 2COKA 4ZTUB 4AZ3A 5KJFA 3EUFA 3BMOA 2B82A 5K8VA 1H0SA 2W4MA 4XRGA 4HEJA 3EEQA 3K20A 1K6JA 2C94A 4L7VA 3H3FA 3AUTA 3ELYA 2FG6C 4IDNA 4P3YA 5B1EA 1L7NA 1QIHA 4Q9JA 1NR7A 1V35A 4DYVA 1TB4A 1J97A 4WKOA 3GRRA 3GMIA 4ARAA 1K6XA 4JYMA 5DGHA 2DY1A 3WK9A 4FEGA 7REQB 3Q40A 1VI2A 1M2EA 1KNQA 4YACA 4Y2TA 1CR4A 1PR9A 3PGLA 3BPSA 3FF4A 3HDTA 3IIIA 3EDQA 2D2FA 3PFBA 1R9JA 4DQ0A 1M1YE 3EAFA 3RRFA 1M8KA 1PJQA 2HA6A 2PX2A 2VT3A 4C3OB 1CZNA 1GFWA 4C4SA 4COOA 2N75A 1GNRA 2G0AA 5KNCD 1ZH8A 1ES9A 1FMCA 2ZI5A 2NU6B 5KHLB 2YWGA 3GLVA 2RJ3A 3L0BA 1UBFA 3HXTA 4AYWA 1CP3A 1IN4A 3GEDA 4B34A 2NADA 5CA1F 5EJ9A 4KQHA 2I6TA 2NO0A 2XWPA 5D7BA 4BBZA 5JPCA 5ICGA 2PYIA 2HOQA 3DVLA 5H4HA 2H1FA 1WXIA 1X8XA 3MWGA 3GV0A 2XD4A 3PA8A 1PJCA 1QF9A 1GGNA 4Q7KA 4Z7OB 1RE0A 2IE0A 4BQOA 3HL0A 4J0JA 2GPTA 1FTSA 1J0DA 1WQ4A 2I99A 1L5FA 1KDRA 2V6MA 4CG1A 4UHKA 1P8AA 5SY6A 3PDIB 4PIPA 4ER6A 1C7ZA 4Y1RB 1ISJA 4J7CA 3KPVA 4PXYA 2JFOA 1N2ZA 5BSVA 4M8SA 221PA 2P9BA 2O8VA 5JQGB 1UC4B 1E3DA 1UP4A 2DUWA 3CLSD 5C31A 3WLRA 3ZHBA 4B2YA 1FMLA 3MHPA 2WEKA 4LKRA 2ZCVA 2VXOA 4LYAA 1HETA 2CDRA 1YZQA 3NOQA 1GPMA 2A94A 1TGYA 4MRRA 4DL9A 1ZQ1A 5BN4A 2IZ5A 4MKGA 3N0TA 3NNDA 3IX7A 5L3ZA 3H4TA 4I99A 3ENQA 1J49A 3E8XA 4EI9A 3FGPA 2Y9PB 5AYVA 1O97C 1SULA 1UM9A 3EMKA 3AP2A 5EKTA 4DPLA 4KR6A 1JEQA 2AV6A 2CNWD 1W75A 2W2LA 3GC6A 1KSFX 1IN6A 1Y5LA 3L1KA 2BF7A 2ZRMA 2J5BA 4K6MA 2XWJI 4IDPA 3CW2A 4K88A 3GP8A 1XA4A 3K2EA 3V4LA 5K3FB 2X6TA 4XCVA 2IYOA 5FJJA 3BL8A 3L1HA 4AJ2A 2AN5A 4BWVA 4BEWA 1SU4A 3N86A 4WACA 5LB2A 1ZSVA 3FPHA 4ZPJA 5FBVB 1CPYA 1X80A 1BRMA 3DLBA 4W7SA 3U39A 2Q50A 3A36A 3HCRA 5A3VA 5H3CA 1UF9A 1V6CA 4XA8A 5DP1A 4A6DA 3QNMA 3N7TA 2EATA 4I8DA 1UPTA 4RZUA 4DDHA 1XK6A 1EQ2A 1RADA 2ZFUA 2FX5A 4XWOA 5KTPA 1O4VA 1GNPA 2ONKA 1ZIYA 3UV6A 2XXAA 2MMGA 3O8QA 4B3BA 1R8QA 3A6DA 4POAA 3WTBA 3CGWA 4PX2A 1Y82A 3MIIA 4TTIA 3VVCA 3AI2A 3KSAC 1SUFA 1U3DA 2PUHA 2MOKA 3A32A 1S2OA 3AIOA 3SBEA 3MTIA 3ZGNA 4G0VA 2R6ZA 3I32A 1KEUA 4IGAA 3ESYA 3FR7A 2I1WA 2B3DA 4E6PA 1DT5A 1K5DA 2QT9A 3A3KA 2OZLB 3ABIA 5IZ4A 2IBMA 4V0ME 5DN6D 4PZDA 4L0QA 1AQLA 5HPYB 3WSVA 2O06A 3WOVA 4FUQA 5BYJA 2CV1A 5BP7A 1E2UA 4KQ6A 3FYHA 2ZUTA 4S35A 1TZMA 4DLAA 4OLAA 3NTUA 4FT4A 4LV5B 3NFYA 2WVAA 5FLEX 2YV5A 4MUKA 3K70B 1YFLA 1U7ZA 3QVVA 4Q1EA 4RY9A 3H1AA 3RFXA 5DASA 4QM6A 4W9MC 1LPAB 5AHXA 1EP2B 1TTTA 3L77A 2R1VB 3IT3A 4OQPA 5PNTA 1WVGA 2JFPA 4YJGB 4OXRA 5HA5A 4CDRA 1EA5A 5F5XA 3PA6A 4TKUB 2F1OA 1HI9A 5B7QA 3IOBA 5B3JC 2UZAA 1TD9A 4K6CA 2GHTA 3KEQA 4FE4A 4IFEA 2YS7A 2WZQA 1PGPA 4MIOA 2BI4A 3S27A 1SVKA 1Q77A 3N05A 1XZQA 2IUUA 3W7AA 4CBVA 1NJ8A 4N49A 3HGTA 2WA2A 1RC8A 1Z0FA 1OPRA 5EEGA 4I1UA 5EJ8A 4BAUA 1IZ7A 3WGMA 2J48A 1PT7A 3ULKA 4K6OA 4J90A 3EAGA 4I9NA 4XWYA 4CCYB 3KSBC 5IJWA 2FOLA 3N8HA 3E27A 1VECA 4X1KA 4C6RA 2FPKA 3MM4A 1Z38A 1UJCA 5EMNA 2PAFA 3EDMA 5KYXB 5A62A 2ZRFA 1P2BA 3CUWA 4P3PA 1Z06A 2FZCA 1M6EX 2OCDA 3BDVA 2WSBA 5AUQA 4OYHA 1KJQA 2BFAA 3OQ6A 3ZVLA 3OCZA 2BTQA 4YMLA 3LT4A 2QQ0A 2ZJ5A 1AN9A 4PHHA 1AS2A 1E79A 2RH9B 1NONA 1OW3B 2ECOA 3OETA 4GQIA 1E2IA 3K6RA 3VTKA 4GXQA 2G40A 2JLBA 3GFOA 4IPTA 4RAOA 5CA1A 1BXGB 3RQSA 5TIIA 1G8MA 1EUZA 3DL0A 3HJAA 3IHTA 4WEQA 4FYVA 2V9PA 4CODB 3SHFA 3CZ4A 1LK0A 5ALZA 2D06A 2HLHA 2R6DA 1A4RA 4BGEA 1IZ9A 4Q5IA 4RQUA 2ARKA 2SHKA 3M1AA 4IOKA 3SY8A 3RJZA 2NV0A 3C5HA 5ALVA 1W4ZA 1VIMA 3KYJB 2RHDA 4CF4A 5FOWA 3V1TC 2ZUUA 3PX2A 2FY8A 2IZOA 2HXYA 2POQX 3HP4A 3NRBA 3OA2A 3WKCA 2P9GA 3Q41A 5TT1A 1W5TA 2J9XB 1CY4A 2JIMA 5E6UA 3VPAA 4ZDJA 3IIKA 2WMOB 3IPLA 2YJGA 2XQKA 1C1DB 3P94A 4AI6A 1BA2A 1F0NA 3VH1A 4N7BA 4R2JA 1BAPA 1TZBA 2EDAA 3RIEA 3W1VA 4RWEA 4A26A 2Q9BA 4P4SB 4JBLA 4QSHA 1E3WA 3BC1A 1ISPA 2H29A 1U9IA 2HPAA 2MMCA 1UOOA 4QHTA 4MGIR 1WP9A 4R2LA 3E9QA 1JHVA 1F9AA 2VDOB 2Q1YA 1YL5A 3VPGA 3KZVA 2A5DA 2Q3LA 4FR5A 5HUQA 4JI8B 2H9IA 3LLUA 4BGDA 3KB2A 3N5CA 4G81A 4QICA 4CMIA 2W8BB 4YQEA 1HDCA 2OY0A 3AR8A 2ZRIA 3LUKA 2RARA 2IDJA 4RV4A 4UZEA 3BWEA 3DBRB 1KO7A 2WZBA 4B3GA 3WJ2A 3OT1B 4WN9B 3SS9X 2JFNA 1HURA 3EVCA 3U3OA 4JVNA 4EFDA 5KWJA 4NQZA 4Q21A 3G8DA 3MTBA 3KV1A 1ZNZA 3HSKA 2LCQA 3P2KA 4ENQA 3E05A 3P5SA 2H63A 2AQHA 1KZGB 2ZI3A 1F1BA 2VPIA 4ZYVA 4RJTA 1DBSA 1V8PA 1IYZA 4ESHA 1YE3A 2GJ9A 4HRVA 1VCIA 2RK3A 1KZ7B 3VR4D 1JIQA 2Z0MA 1AOXA 1FE8A 1CNEA 4FSXA 3TPCA 1U8AA 3QNWA 2H1RA 3P9QA 5JAQA 5K45A 4OX9Y 4B71A 1DGQA 2P9HA 1TEHA 3M5DA 1E58A 2P4EA 3CA8A 5L8VA 5ITWA 2NVWA 4EUFA 5SZHB 5E6RA 4X6XA 4UDYX 3UWPA 5IAOA 3B48A 3BGDA 2JIPA 3OEWA 3EUWA 4ZQEA 5IVHA 4OFZA 1KQNA 3B78A 1AMOA 4CUZA 3WZMA 1OILA 3C4JA 2IEZA 1OU0A 2WSLA 1QWSA 2ODNA 1FDTA 3HKBB 4FEAA 1PK8A 1VYVA 4F1KA 4DR5B 4LF8B 3VX3A 2QAGB 2L82A 3P9KA 3EXFA 5EUBA 2GPSA 2IW3A 1II8A 3QKIA 2IDZA 4XLZA 4L3VA 3CNEA 2YVUA 2XCLA 3VQTA 1MJNA 3E3AA 4GMKA 3F74A 4C6HA 4FGSA 1D2EA 1Q3KA 4S3MA 4L3OA 4ITRC 4K9OA 5EJ6A 1V71A 2P9FA 3K73O 2WE7A 1Y42X 1Q7CA 4LXGA 4PPGA 2YW2A 5BNFA 2C31A 1T9BA 4R54A 3L9XA 5FPTA 2YL2A 5CU7A 3WA7A 1Z0KA 3OKFA 3UAWA 2VAWA 2P6OA 3MTQA 4TXHA 3L2OB 3QEAZ 1NHWA 1XVIA 3MWJA 2DF8A 4K6KA 1Z56C 3RLIA 4PC7A 4ABTA 2FRDC 1DDOA 2JI4A 4U7WA 1RE1A 3CUKA 3D7RA 2WWGA 2GK4A 1EDZA 2YTZA 1OFVA 3NHFA 1G6Q1 1TRKA 2LKDA 5CNIA 4R9VA 4AZTA 2W6QA 3NONA 2YOHA 4FJ1A 2LVBA 5SV2A 3X1KA 3ZS9A 2AF3C 2EQ5A 4OQMA 2DE0X 3BD7A 5FBHA 4C21A 1I5RA 2HY7A 3FMGA 3H1EA 2YN4A 2PDAA 5DYTA 5ESDA 4DMHA 4C7OB 1PJLA 2CUTA 5TNXA 2H0RA 3G8CA 5DYGA 2JVJA 3VNVA 2ISSD 3MWFA 1UMKA 3HYCA 5CVVA 1D1QA 5LC1A 3ZNNA 4CJXA 3SQWA 4RM3A 4V3CA 3VSAA 4NZPA 2GDZA 3HR4A 3RYTC 3TIFA 3TOVA 4UARA 2VJCA 3A26A 3LY9A 3NG1A 3SYNA 3UUGA 4UBJA 3HM2A 3NDIA 1RYNA 5DCWA 4ZT4A 5J23A 3K15A 4JI7B 1NXVA 4N9WA 4PYKA 1CDEA 5KYYB 5FLYA 2KBEA 3K9WA 3N2GA 4MYTA 4O59O 1DEHA 1MNQA 4X45A 1W36D 3WLAA 4YCCA 4E5VA 3FOZA 1T0BA 4JLVA 4RHYA 3GFVA 4EHIA 1Q0QA 1FDOA 1YZLA 5F7XA 5L95A 2VDLB 4MUNA 1RAAA 1EVJA 4QEKA 2G9ZA 4N7RA 3RPEA 1KR5A 2QLLA 2ZYSA 1LLDA 3LOUA 3QKSB 1R9MA 3UV3A 3VU9A 2EG5A 2FUG1 4LWQA 4Y3UA 2CXHA 4NY1A 2QDXA 3GR6A 1GAQA 1VL0A 2LW7A 3RVSA 2PM8A 2DQ4A 1RYBA 2IPNA 5IVIA 3KJEA 3E3MA 4HDAA 4HPJB 4Z0TA 5K3DA 3V55A 2C1XA 1TTPB 3IL2A 1W2WB 2PBRA 2V5VA 4JC5A 2BZGA 1GL3A 1W4RA 3BFVA 1S7CA 4KO8A 3REOA 3ME5A 5JJBA 3GLFE 2J9ZB 2I6FA 2N3ZA 4P7FA 2RI6A 2CHVA 2Q6KA 4WESB 2NU9B 4UJ5A 5F51A 5E1MA 1TT7A 1Q0TA 3UUFA 1XT6A 2H2IA 4A16A 2HWXA 1ULHA 3MHTA 1GWNA 4LZJA 2JD2A 5DBHX 1CUWA 1OMOA 1XCBA 3HY3A 2DTEA 3CZ9A 4U2GA 3QUBA 3A9RA 1HTBA 4CLRB 2Q1SA 3VC1A 5E95A 3WO1A 4AQDA 2WUVA 3QXJA 1UDRA 3SDSA 4NZOA 2CEKA 5HDBB 2X15A 2X9LA 2WQZA 3SR4A 4FMBB 4W8HA 4KQCA 1BN6A 3GAAA 4ZN6A 3B9PA 4Q4JB 1L4GA 3SYTA 3WLNA 4LGCA 1VP3A 4X3CA 1FLAA 2QMEA 3WWYA 3BAFA 1VL5A 1VG9B 4WCFA 1RJFA 5EPOA 1LLUA 4RX1A 3QLTA 1PR4A 4A03A 2CE2X 1HDEA 4R1PA 4YJ2F 2YHSA 3T34A 4EEZA 4Y2UA 3MRXA 3BK2A 4Y6QA 3GBSA 1YQXA 2Q7OE 1VPTA 2ZYAA 4CRWB 1XCLA 1JVNA 2KW5A 2V6FA 1GGHA 2ZVPX 5IK2A 3DR3A 1B16A 2DPGA 1ITZA 4G2TA 2WFLB 3U3KA 5KU7A 3ZNOA 1F8FA 3A9TA 3M49A 4F97A 2BMVA 1A88A 3I62A 1SHKA 3GZNB 3J80A 2J0UB 1MV5A 1S1CA 4UOEA 1XD2A 3NGLA 4PG4A 4R7ZA 1E5QA 2JVKA 4LOJA 2I3DA 3QVOA 1YDFA 4JLDA 4GKKB 5HMLA 3T7TA 5JSZA 4HNAA 2AWOA 3IE1A 3DV9A 4CM4A 4Y0AA 5TEWA 1RDFA 4NCNA 4RBNA 1YOVB 3AIKA 3FJOA 1YZUA 4NCJA 4PBTA 4B82A 5HKBA 4MDFA 4L5YA 3PZRA 3E2PA 2ZUBA 1WLSA 2C0CA 4ZI7F 1JQAA 4EHAA 1F38A 1FY2A 2XNDD 4A0SA 4PG8A 1QFZA 4YT2A 1KWKA 3N2LA 2EGUA 3OFND 4RIFA 1YACA 3JQAD 1PDOA 1I3MA 3A8TA 4U3JB 4V0KA 4BX3A 2F1HA 3TGLA 2CD7A 5AW4A 4X63A 1KTVA 1XTIA 4JEMA 2WWWA 4Q93A 1OKKD 4HOYA 2BFFA 3MCTA 1XU7A 2FSVA 4LY9A 2X2OA 4I4LA 1T35A 4C0AC 5KVAA 4AD8A 2CLFB 1CULC 1DMRA 3IEPA 3TAXA 1I3LA 4IJQA 3NTRA 4P34A 5EUMA 2FQXA 3F6YA 2E6UX 4PLYA 5HJ7A 2FSVC 2XB8A 3VR0A 4R4JA 3P0HA 4DOMA 5BWNA 1TO2E 3NIDB 1NJ6A 4PLFA 5C8VA 1D0IA 3GJ0A 4CQLB 4HH0A 4MYCA 5EY5B 1I36A 1P4GA 4FZJA 4JUIA 2IOQA 5IH3A 4AO7A 1XEXB 5FOVA 3E82A 3KR1A 1XDWA 3NTQA 4EIWA 2ZBGA 1YBMA 1DJPA 1FUUA 3IAAA 4H7HA 1UC5B 1KI8A 4Y2VA 4OJQA 3VPCA 2W6IA 1Z6PA 4N82A 3WQRA 1GXSA 2XE6A 1HKUA 1AGXA 3KAJA 4TUYB 3BX1A 1AH2A 1TUBB 3FWPA 3D4BA 2DM6A 4BMPB 1BXRA 1P6QA 2UZ0A 2A5YB 1RC1A 2DWCA 2CF6A 2GYVA 3QVKA 1TJ5A 1JU3A 4GGOA 4CKCA 4EQ6B 2WIDA 4KXUA 3HO1A 2J41A 4L8GA 1UMDB 3NV9A 4EG7A 3HVKA 1CV2A 3CH6A 4H4CA 4Q9LA 2RHOA 4ZALA 1Z2NX 2VT7A 3DOOA 3FGNA 3IIMA 3Q11A 3SBXA 3UAVA 1RYHA 3FNHA 1S1MA 1ZLYA 4EITA 4RKRA 5KU1A 4N0DA 4YO7A 4HD8A 2RJOA 2PMBA 1XLTA 4TV8F 5FI3A 4MKZA 2UYGA 3S29A 4YHHB 1ZSYA 4JLBA 5I45A 2JI8A 2PRKA 2VYND 5G4KA 2QX6A 4LN1A 2NG1A 1R4AA 2YIMA 1G5IA 1P0FA 2WF9A 3KFLA 4KV7A 4KXVA 3ROXA 2ZAGA 2GPJA 4FN5A 4P2GA 4UULA 4KRXA 4CF7A 3A1CA 1H8ED 4RD4A 2R1ZA 4W63A 3EBPA 1AUQA 5AVXA 3LNCA 3GT3A 4MVCA 3CLUD 1JR2A 2PK3A 3QFRA 2A5LA 1FFXA 4Z7NB 1SQGA 1RKBA 2SKCA 3K5IA 3UG7A 1T4MA 2GFIA 1JHAA 2CHFA 1OXSC 2PLAA 1DJQA 4BUJA 2JW5A 3W5JA 1TD1A 2VSNA 4OMFG 3KLMX 3KL4A 4S1TA 5FKJA 2UXCB 1SUAA 4ZMSA 1QYVA 5IJAA 1AQ6A 4C7JA 1GKIA 4QOJA 5JMPA 3OCYA 4FNMA 1FRFS 1ICIA 1Z34A 3IBTA 3OOYA 3QP9A 2B7BA 3I34X 3O92A 5FFFA 1L4LA 3UATA 2EBWA 4LJ9A 5HCNA 2D0OB 4W5TA 2B0CA 4EY4A 4RK5A 1DOHA 2F8LA 3IC5A 3PRJA 4NBUA 4B80A 1J0BA 4TXLA 3BSWA 1EUYA 3GFGA 1VG0B 1MIHA 1THMA 1PBTA 2G25A 2VF8A 3DS8A 1JDNA 3ML1A 3OFVA 4JCOA 2Q3CA 1YZTA 1U3VA 2PO7A 2QVZX 2G1PA 2VP5A 3TKLA 2Z30A 4DAEA 2H4XA 4MGYR 5ITZA 4LDAA 1XJ0A 5FTMA 3SVTA 5DX1A 1PUXA 3FB1A 3NT5A 1U2DA 1WXDA 4GOLD 1QGED 3QWAA 2EVWX 2ZT6A 3PUJA 4MS4B 5F1PA 1TYEB 3B1ZA 5G0UA 5GTDA 1K7XB 1X8JA 4L9RA 1U2DC 3I9MA 4C4TA 2C88A 1G7CA 2IU3A 3R77A 2O6HA 4YJ2A 1YZKA 2XYQA 4V24A 2R66A 4M22A 2Y0CA 4RNDB 5L9AA 1I1NA 3KL2A 1FJHA 1FNBA 4QOHA 5TJHA 4ZO6A 2GWRA 3NEPX 1TIPA 1OHHD 1ZI6A 2LDBA 3AUAA 4GRAA 1EJBA 3KDAA 4L08A 1BS9A 3ISJA 5EQTA 3WL4A 2R47A 2VXYA 2ZRKA 1VG1A 2HIMA 4FONA 1TK3A 1P17A 1PK7A 5F7JA 1IPHA 5IFLA 1P1IA 3GP3A 4BBJA 1YRBA 5KPJA 5D85A 4YROA 4R8RA 1Z75A 1T3GA 3HC7A 3VYUB 1WSWA 3L04A 2F7SA 1F7UA 2GCGA 1E5TA 1V95A 3QPBA 2AZTA 4RKWA 3GPLA 2M2IA 3DDOA 1CR0A 4KI7A 4YJHB 5JLJA 4E07A 2PUDA 1VE7A 2O8NA 2VHCA 4HB4A 5GONA 4BFWA 1UXOA 1H9BA 2H4WA 4WUTA 4CTJA 4JB0A 3FR8A 4EHHA 5A7FA 5IKPA 5KS2A 4ZI7A 2I2WA 2BFOA 1BE1A 1TL7C 2REQB 1H2XA 4EVSA 8LDHA 1NVVR 4BNNA 3Q98A 4F1WA 1G5FA 4J03A 2G1KA 3BVPA 4TKZA 1SZJG 1OWPA 3OQMA 4G56A 1KJ8A 4GO1A 1AUXA 1JKFA 5LDGA 4K9KA 1DAMA 4F06A 1GPBA 2QXTA 1XAHA 1B8PA 4RD3A 1IY8A 1K6IA 1FVFA 3TSYA