3CM0A

Crystal structure of adenylate kinase from thermus thermophilus hb8
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
184
structure length
184
Chain Sequence
VGQAVIFLGPPGAGKGTQASRLAQELGFKKLSTGDILRDHVARGTPLGERVRPIMERGDLVPDDLILELIREELAERVIFDGFPRTLAQAEALDRLLSETGTRLLGVVLVEVPEEELVRRILRRAELEGRSDDNEETVRRRLEVYREKTEPLVGYYEARGVLKRVDGLGTPDEVYARIRAALGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylate kinase
publication title Crystal structure of adenylate kinase from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 68
structure length 184
sequence length 184
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2008-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13207 AAA_17 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3cm0A00
2BCJQ 3V4FA 2DB3A 3T1VA 4PO8A 4ZI3A 5LD2B 3F5FA 4LRWA 1WE2A 5A0FA 4DEYA 1CJVC 2WWHA 4EPXA 2NPFA 3UG7A 2FNAA 1PLKA 1FNMA 2A78A 3NEJA 4KFUA 4XTRA 3IEUA 2CLDX 3TUJC 3AKYA 2C9CA 3M6AA 1CS4C 2WIAA 1D2NA 1RJ9B 3O8DA 5DSZA 2DPXA 4RZUA 4Y0AA 5FTNA 1KI8A 2EYUA 5EXSA 1UM8A 2CHGA 1P2TA 1SZPA 3NBZC 2WKRA 4F4CA 1SXJE 1E32A 1Q20A 1RRCA 4OQLA 2ONKA 1MO6A 2Q3HA 4TT3D 1ZIPA 2V54A 2ZSEA 4BLSA 1KI6A 1R4AA 1XXHA 3SU8A 2BKUA 2CDNA 4DC9A 3FHTA 1CR2A 1SHZA 4BZPA 1M7GA 3GMTA 3MSXA 5FOSA 1KJWA 1GVNB 2IHBA 1DPFA 3WNBA 1A5TA 5H68A 3QE0A 2JEOA 1KAGA 1E2LA 2V1XA 2VHJA 3GLIB 3ZQ6A 4DIEA 1UDWA 2ZAMA 3GLHE 4C0QC 1KNQA 2Z4SA 3QI2A 2ZE6A 4PHFA 3W90A 2FOLA 4D0NA 1O3YA 1COWD 1N6OA 2FGKA 2IUSA 2PLFA 2WWWA 3QENA 1BO6A 4Z54A 2XEXA 4WAUA 5DN6D 1YHNA 2V8OA 1VCNA 3IQWA 4GOXA 4D2IA 1PLLA 4R71A 2G88A 2JDIA 1XD2A 2R62A 2ZE8A 1UKEA 1P2VA 1PJRA 4LDJA 1LVGA 3VNVA 2VHCA 2HJGA 4Q18A 1LF0A 1IBRA 5B30A 1ZVQA 2J0UA 2OV2A 4MYTA 1KO7A 4TMZA 2OCPA 1SVWA 2X19A 1XTKA 3I62A 4M9SA 3E1SA 3TKLA 1KDPA 5FPTA 3ZVMA 4KVGA 3NDPA 5SZHB 4QJ5A 2LWIA 2O8BA 4JBYA 4L9SA 2VF8A 3Q5EA 3L0SA 4HB2A 2HCJB 4WBSA 5FR1A 5LB2A 1U0LA 4TZ0A 3ZVNA 4BFZA 3ZVRA 4RZ2A 2V7QA 1C9KA 1DBSA 3HU3A 4LYAA 3U4QA 2KSQA 2D7CA 2CHVA 1GKIA 2RGDA 2VSXA 4PSAA 5FUYA 2E87A 4Q4AA 2RHDA 1Z8FA 2ZJYA 4FMDF 3EPJA 2R6FA 1R8QA 3CW2A 2LKDA 1BMFA 5E95A 5FOVA 1D8TA 3ADKA 1B0UA 3QEOA 1Q1QA 4LJAA 3CF0A 4XD7A 4U02A 3DM5A 1JR6A 5E3HA 2GJAA 3RHFA 4EKDA 1AS3A 1I4LD 5FOUA 1D2EA 4LI0A 2XTZA 5FPYA 1YR6A 2JJ8A 3DMDA 3EC2A 4MKHA 4C9BA 3DO6A 1W36C 1ODFA 1P9WA 3P4YA 2YWHA 3L43A 1AQYA 3AP1A 1JPJA 4DDTA 1HA3A 3RYTC 1D9XA 5HTKA 1E9BA 4DLWA 3VTKA 3CWQA 4TTRA 1GWNA 4A6XA 1U8AA 1MABB 3KL4A 3RNLA 1Y3AA 3WP0A 3W5IA 2JJ1D 3W5JA 3TSZA 4LSGA 5C2JB 5G40A 3LBNA 4JLAA 2IYZA 4LJ6A 3U7HB 4OKSA 3UPUA 2K5UA 3ASYA 4A9AA 1SXJB 3RS2A 1P61B 3QVUA 1S4QA 4RJLA 3T1QA 1XZPA 3RC8A 1ZM3A 4OHZA 1NN5A 4LBZA 3GEEA 4YMVA 3NH9A 5J4KA 1NG9A 3EIHA 4HYYA 2OBNA 3KTAB 2ZROA 1Y63A 4ZDKA 3UMSA 1CBUA 2Q3MA 1E98A 1E9FA 1DAHA 3DM9B 1Q1ZA 1F5NA 3KFXA 1GG2A 4AWXA 5JRZA 4P4TA 2QSZA 1G291 3K53A 2C9OA 3CBQA 3AQ4A 4YMWA 1IHUA 3WBKA 2QEQA 3VNUA 3HU1A 3EWAA 1S1MA 3W6NA 4C0LA 4Q7MB 2XNDA 3GLHB 3D3QA 3U3RA 1DG1G 1TUIA 2AWNA 3LH5A 4S35A 4I81A 4C0JA 4M1OA 1M6NA 2AFHE 4E03A 3PUXA 2JLUA 1GNRA 1T0HB 1N0UA 1OFIA 2ZRNA 4ZIRB 2OAQ1 1U9IA 3QQ5A 3RS5A 1IN6A 1W4AA 4RFVA 1AGPA 1NVVQ 1UBFA 4RKFA 4CEHA 5B57C 2ODNA 2GDJA 4V02A 3FFBA 2O0HA 3QG5A 4LZZA 3BB4A 1G5TA 1CP2A 4MRSA 2B8TA 1TF5A 2WVJA 4BFUA 5JSZA 1DAMA 5SZJA 4M4SA 1GDDA 3U6BA 4KVAA 1ONBA 2R2AA 1F2TA 1R10A 2YVUA 3QF4B 2BM1A 5AUOB 3DZDA 2V55B 3LBIA 3QPWA 4LGMA 5KSZA 1Z0KA 3ZH9B 4TL8A 2BDTA 4FI3C 3JZAA 4Q00A 4TTPA 2CCJA 4RCZA 4DIDA 1Z47A 4QG7A 1KO8A 3NBFA 3H86A 3AKCA 4QGHA 4AD8A 1KDOA 2Z43A 1K6MA 1UEIA 1WA5A 3FOZA 2XZOA 4TLCA 3AKEA 4A8JA 1E9AA 1H8HA 1S1CA 1U9IC 4IOKA 2P6UA 1AM4D 1QHIA 4EAQA 1NLFA 1Q0UA 1ZW6A 2EFHB 2OEPA 3EA0A 4B2IA 1E2MA 4QNMA 1N6PA 2Q9CA 3CRRA 3FKSA 4EUNA 2F55A 2BHRA 3OIYA 1Q12A 3QKTA 1T8TA 1ESNA 3A8TA 4UQOA 2ATVA 1TTTA 4XSHA 1I2MA 1D5CA 3FTQA 3SNHA 1CXZA 4TQ9A 4OHWA 2BMEA 2XNSA 3TMKA 2OFOA 1E96A 2PL3A 4EPVA 5EE5B 1J7KA 5EXXA 4C2UA 2LCFA 4Q47A 3UWKA 3BRWD 5L3SA 1RFLA 2RH5A 1NN0A 2VQSA 5A5GA 1D6JA 4IVPA 4CGZA 1H65A 3BIFA 2GCNA 3UIEA 3ZGXA 4A8JC 2AWOA 4CYMA 4HB0A 1Q1EA 4GFDA 3B1VA 1E9SA 3NG1A 1MH1A 2HJVA 3M4YA 2P5TB 3R7WA 5FUXA 2WM9B 3ZZTA 2YYZA 1ZRHA 4LWZA 1IQPA 5FUVA 5JI2E 3Q9LA 5BQ5A 3HP1A 3WBJA 4AY2A 3ZVLA 1R0ZA 1VTKA 5CLQA 4OK6A 1YU9A 1W0JD 4EJSA 4AKGA 4C2TA 2UVQA 1NSFA 2RKOA 1NN1A 2VP2A 5KYKA 1SULA 2NO7A 3BORA 5DI9A 1T6NA 2GKSA 3F8TA 2CNWA 1VG9B 1ZNXA 3CX8A 1NLYA 3U3MA 5FI0B 1P75A 4B44A 5KPDA 2ECKA 4GOJA 2D06A 1AN0A 2ZVQX 4KV9A 3X1WA 3IBGA 4NCHA 3QY0A 3B85A 2OILA 1GL9B 2R6GA 3GFTA 5J4VA 2JLWA 1AA9A 2XOKA 3EAQA 4ZDWA 2QSYA 4HLUA 2NZJA 3KKMA 2W6JA 3I5YA 4EJSC 5FTMA 1W48A 3KUCA 2VTKA 1OXTA 4ARZA 3MRSA 1ZINA 4PAQA 1KK3A 2ZSFA 4X8MA 3TR0A 1JQJC 2V9PA 1II0A 1UKZA 2C5LA 3MUFA 4DDWA 3S1AA 2ZRAA 1XEXB 5DH9A 2YOGA 5CDFE 3RS0A 5EXPA 4BE7B 3BAFA 3PXGA 4LOAA 5H1YA 1NKSA 5EQTA 4Q19A 1F2UB 2E9SA 2JASA 1S8FA 1TNDA 2QMUA 3VR4A 4HLUC 1G1MA 4E09A 1I2DA 3VQTA 1MO3A 2GCOA 1DOAA 3QG1A 1HYQA 4UNPA 1W46A 1JAIA 2VP6A 4M0LA 1TU3A 5FH9A 1QHHB 1VYUA 2D62A 3OIUA 3TAHA 2H18A 1Z6XA 1YQTA 2WKPA 4AURA 3KDSE 5TVKA 1P9NA 4DLSA 3LRPA 1PV4A 1WRBA 1HE8B 1JJVA 5LBIA 2P6RA 2MMCA 2YOFA 1EWRA 2NPIA 3WMGA 2ZR9A 3OFNA 3T5GA 2ZIAA 2BC9A 3EARA 1FP6A 2JLSA 2KWIA 4AIIA 2OLJA 4GP6A 5KNDA 3LX8A 4MGZR 4YMUA 1KTVA 3QKRA 2YWEA 1L4YA 4IOJA 2ONJA 3M0EA 3DHWC 4C3ZA 3FFAA 2ZAOA 2GHIA 4IW3B 3FMFA 3I4LA 4LV6A 1IN7A 4B74A 1FZQA 2QE7A 3C14C 2JLZA 2QP4A 5KSOA 2IXGA 3BH7A 4WXRA 1CF4A 1UF9A 5E7JA 4YONB 5DI3B 1DAKA 4BLQA 1Z0FA 1JBKA 2OUKA 4ZCMA 2QL6A 3LQQA 4GDFA 5HZKA 4EPTA 1TUEA 2JJ2D 1NVXQ 2IC5A 1Z08A 2OXCA 4BLOA 1Z63A 3ZD7A 3K0AA 5AWFC 3TNFA 4B33A 5GADl 4HAXA 3O47A 4DSOA 2O8DB 2XSZD 4DB2A 2W2VA 5HKKA 2I1VB 3I1FA 821PA 3V4RA 1ZP6A 3JZMA 621PA 4I1VA 4GNKA 1FPMA 2F7SA 2FGJA 2CLSA 4Q1BA 1T4GA 3CRW1 2OM2A 1RZ3A 5AJXA 1E79A 4HZUB 5EE3A 3SC3A 1W2HA 1TEXA 4URUR 4RCYA 2HLDD 1ZYUA 2VLIA 4IFEA 4JLJA 1MRSA 4QNRA 1EFHA 2DFLA 3HR8A 5D3QA 1E9EA 1FMJA 4XVUA 5AJYA 2ZRKA 1P2UA 3MGCA 2RGNA 3IHWA 2ZI4A 3VKGA 2AKAB 1GZSA 2VEDA 1GL7A 3CRMA 3K70B 3B13B 4JSYA 3TIFA 1Z06A 3BH6A 2J0QA 3BJIC 3QBVA 4NTZA 4JSTA 2PH1A 2XTMA 1EFUA 1HQYE 2RMKA 4RSGA 1DELA 1GP2A 3AGPA 4AYWA 1FUKA 4BLTA 1KO4A 1GTVA 3EXAA 1JR3E 4F4IA 4QBHA 3BK7A 2ZXUA 4POAA 3DVLA 4OHVA 3CH4B 2A5FA 4OJKA 3VKWA 2G77B 3D8BA 1AZTA 4P4UA 1L7VC 5JEEA 1VCMA 3WHLA 1AKYA 1E2EA 4MUAA 2CHQA 1UFQA 1R7RA 2WHXA 1ZNYA 1BOFA 4QJ4A 4NP6A 1OH8A 4TMKA 4F91B 1OKKD 3IUYA 5TMPA 1Q57A 3HYRA 5CJPA 4Q7KA 2AD1A 2IYLD 3SJZA 3RRNA 4MKFA 4XSGA 1N6RA 1EX6A 3QOFA 1T0JB 1NKTA 4NYMQ 5SZIA 2QBYA 3SJCA 1E0AA 1ZM4A 4CZ2A 2R6CA 3Q85A 1XJQA 2G83A 1NVVR 1S9DA 1R2QA 2HUPA 4JVSB 5HE8A 1A1VA 4E5UA 3NHAA 4NCIA 3PEYA 2WOOA 4CEIB 3TW8B 2O8FA 5KNCA 4TN1A 2FF7A 2ZREA 1KKMA 4JT2A 1LTQA 2CJWB 5BWMA 4Q9IA 3U60B 1KSHA 4ABYA 4ZKDA 4C4PA 1E69A 2VL7A 4F93B 1FTNA 4DUGD 3W6PA 3I32A 1US8A 1VG1A 3QSYA 1Z2AA 2AX4A 1NBMA 4B3GA 1YRAA 2FPKA 3IBYA 2ZRIA 1P9RA 3NDBB 3L8ZA 4TWZA 4N0DA 2P5SA 2VBCA 3KZ1E 3NIBA 4GMDA 1E6CA 2O8EA 2PMDA 1KSFX 3ZS8A 2X8AA 2PJRA 4IKEA 4X8LA 3AVQA 2KBFA 1XMIA 2OFXA 4IVQA 4CEJA 3AF4A 2HDNB 3ZLJA 1TAGA 1OB2A 1BH2A 2ANCA 3IEVA 1E2PA 4G01B 2I1QA 2ZRHA 3B6EA 2ODBA 5F9HA 3V00A 2F1RA 2WSSD 1E2NA 3GCGA 1LNZA 1CKEA 1OT3A 3TVTA 3A1TA 3QEJA 1GRQA 4Q4JB 4AYXA 1WF3A 1KMHA 2BBOA 5GJCA 3LO5A 4K81B 3WP1B 4KYUA 1ZUHA 4J0QA 2HXYA 4ILEA 3B82A 4DLUA 4M22A 1PVOA 4ZI2A 1AZSC 2GZAA 4JYCA 1E2HA 4O3MA 2KBEA 2PX0A 2E1RA 1IY1A 5L3QB 2ZS9A 3R9IA 3MD0A 5E7IA 1EFTA 1XXHE 1A82A 3E2IA 4LCBA 3HPRA 2ZR0A 3CM0A 4OL0A 4Q66C 5KOYA 3ADCA 3QKSB 3T15A 1FX0A 3I8XA 1KAOA 3A37A 2W58A 3FGNA 1S9HA 1VIYA 3K9LA 3MCAA 2XITA 4LHVA 3R9WA 1XMJA 5AUQA 4DDVA 2AR7A 1XMVA 5DE3A 2REOA 2HT6A 5B64A 1U81A 1NVWQ 1G9XA 4MKIA 4TL9A 5FBVB 1JJ7A 1Z28A 2DHRA 1YZLA 4KYIB 1XZQA 4US0R 1XJ0A 1NL3A 3CNLA 1XEWY 1VKJA 4PHTA 1RPZA 1OJLA 4LJ9A 3IO3A 3OAAD 1U2RA 2ZETA 1DS6A 3RWOA 2OAP1 1VIAA 4LC0A 3Q3JB 4JLBA 2EQBA 1YRBA 1NMYA 3THXA 1H8EA 4Q1DA 1ESMA 1E2DA 2YC2C 3IGFA 4LYFA 3CPJB 2IUUA 3KKNA 2XXAA 2ZVPX 1E4YA 4Q9LA 5H70A 3GEIA 1IN4A 3MLEA 2FSHA 4HUQA 2BEJA 3I61A 1QF9A 4BGDA 3C16C 3SJBA 1SVKA 4KBFA 2HF8A 5EP2A 2RGXA 5BN4A 4A0FA 4LJ7A 2BMFA 3HDTA 4H9GA 5CB6A 3AP3A 5HZHA 3IKJA 3UWOA 3L82B 5C4MA 4FWIB 5ANRB 3BFKA 3NEYA 3FMIA 4N0EA 4XWKA 4FWTA 1KI1A 5FBLB 1SVLA 2ERXA 4B47A 4A92A 1KY3A 4B2PA 2JLRA 2G0NA 3EASA 4G5RA 1VPLA 3A6PC 5JJIA 3PV0A 2ZE5A 4M2LA 3RS4A 3X1XA 3GJ6A 2V6IA 4Z1MD 4NKRA 1VHTA 1BS1A 1CR1A 4JVLA 3AVXA 3NVAA 4PC2A 3RS3A 2JIZD 1FQKA 3GJ5A 2Y8EA 3U6KA 2C96A 3RANA 1SVIA 4FMCB 1KO1A 4HDQB 2J0VA 1ZM2A 2FWRA 3W8NA 4DT1A 1KI9A 1Z3IX 1KDRA 5AK0A 3WYFA 4TLDA 1E2QA 1SXJD 2AFIE 5JI3E 1E2JA 4OQFA 5IF9A 3KQKA 1E2GA 3K9NA 4MA4A 4D4JA 3CR8A 5FI1B 1XTJA 2C8VA 2RGBA 2IYRA 2X1VA 3QVVA 4RD4A 3SR0A 3P4XA 3TH5A 4F7WA 2GEVA 2NQ2C 3AV0B 2QM7A 1X3SA 1ZM9A 3U2QA 2V7QD 2IS4A 3UXMA 1OXUA 3FB4A 3L8YA 2QNRA 1XDBA 1VG0B 3A1VA 1KI3A 2OG2A 4UNQA 4BFYA 1T3HA 4XVQA 2X77A 1KZ7B 1Z29A 3OEHD 5EP3A 1G7CA 2W6ID 2GWHA 5EZ5A 4D0LB 4NMMA 5IDVA 3TW4A 4ASUA 1EX7A 1GFIA 3A1SA 1XP8A 5KDLA 1Q3TA 2ZJOA 3H0KA 4TLEA 1KI6B 4A4DA 1XXHB 4N1AA 3LX5A 3OESA 3QXHA 1VDZA 4LBWA 2IYWA 4ACAA 2BIFA 5P21A 3LQRA 1U8YA 1RRGA 2H1LA 3UK6A 2RGEA 4Q1CA 3DKVA 2HCBA 3MWYW 2GF9A 1ZMXA 1EFCA 1LS1A 1N3BA 3NH6A 1XWIA 3O8BA 2C2HA 5JWHA 4DSTA 4LBVA 4P33A 3KJHA 5DN6A 1JXMA 3EPKA 3EX7C 3P26A 3NTUA 5E4FA 2D4HA 3FMPB 5CK4A 2VO1A 2PZGA 2YINC 5FL7D 5FPHA 3VAAA 4HUTA 4C0SA 2A2ZA 2FJUA 4ESHA 1G7RA 1UJ2A 4HB4A 3QXJA 4DCUA 1G8YA 3NWJA 2QP9X 2GETA 2UZIR 2PLRA 2WIBA 3RSLA 4A0HA 4Z8YA 2BM0A 1DEKA 1Z0JA 2FPLA 4WZ6A 2J1LA 4TMVA 4F38A 5FTKA 1G8GA 1XD2B 2QPOA 4A0GA 1KMQA 3WHKA 5SZKB 1G3QA 2WPDD 4BPBA 1N25A 2EWVA 3NBYC 2EYQA 3HJNA 1U8ZA 3RDPA 4V0MA 2ATXA 2WWXA 2A5YB 4DLRA 2J0UB 4V03A 1Z0DA 1CRPA 5HPYB 2A5DA 2C99A 4MQBA 4RD2A 3THYA 4URYR 1OXSC 1F48A 4NYIQ 3SYKA 1G16A 2VHTA 3I72A 2DYKA 1E2KA 3T1TA 1VG8A 2OE2A 2O8BB 1CULC 1VCIA 3SE0A 3X1DA 1ZD8A 2BJWA 3K9HA 5AJVB 1W36B 4LHXA 4GP7A 5G3YA 2FA9A 2GK6A 2BWJA 3ZJYA 2CBZA 2CVFA 4B75A 5IK2D 3UMRA 4KITB 3U4QB 1BIFA 2FSFA 3GFOA 4M53A 4UNNA 3OHMA 1GL6A 4D4MA 4JLPA 4TYYA 4Q4AB 4URWR 1G3RA 1CJKC 2NO0A 2FG5A 3PG5A 3WRYC 1A4RA 3EPLA 4GZLA 1XPRA 2R6AA 3CONA 4DLVA 1II8A 4G0NA 2ZRMA 2PT7A 3X1ZA 4NYMR 4XIGS 4HDOB 2ZI7A 2ZU0C 5L3VA 2WMNB 4B3BA 5JJKA 4L4UA 2DFNA 5BN5A 2NG1A 2A3RA 1FQJA 4LV5B 1XTRA 1S0UA 1N6LA 3K1JA 1OIXA 4DCNA 1FFHA 5EXTA 4NCNA 4MGIR 1K5GA 2ZE7A 1JALA 4B35A 4D0GA 2IF2A 3BB1A 2OFWA 1T91A 4UXHA 4AG5A 1M34E 3GFPA 3TE6A 5HR5A 5LB4A 4IJMA 3AVUA 1YJ5A 3H4MA 4II7A 4P32A 2NGRA 3Q7PA 3L0OA 2XGJA 4LY6A 5F9FA 1R0YA 2BEKA 1SQ5A 2RGCA 1E1RD 1M7HA 4Q4HA 3SFZA 4DWJA 4E22A 1G7SA 1XB2A 1FMLA 2V4ZA 2WJVA 4JJKA 4GSYA 2J46A 1G3MA 1AS2A 5KTYA 3PCRB 4DJTA 1IM2A 8OHMA 1XD9A 1YR9A 4JLMA 3CZPA 4QRHA 3I5XA 1EWQA 4JVMA 3PQCA 3D7MA 4YXWD 4B48A 3PUWA 4BECA 3U44A 2CL6X 3ADBA 2ASEA 2QPTA 3BXZA 4DDUA 4IVRA 3L2OB 1KK1A 5C46F 2MSEB 3GLFA 2BV3A 2XJ4A 3KKOA 3LLMA 1GRRA 3FYHA 3IHLA 1C1YA 2ERYA 1MKYA 3QJYA 4O2LA 1SHKA 5J4YA 3X1YA 4JYBA 2PCJA 1QHSA 4XH9B 2FN4A 4BWYA 4PQFA 4GRAA 1YZUA 4JBXA 1J70A 4IDQA 4A2PA 1E1QD 1OIWA 4TTQA 5EP4A 5K8TA 4QM6A 4MGYR 4JLKA 2N46A 4I1OA 2F9MA 4D81A 4TSFD 3SYLA 2FFAA 4QL3A 3AF3A 4PSKA 1YVDA 2QRZA 1SGWA 4NYJQ 4CEHB 1E3MA 2ZUBA 2ZU6A 4BFXA 1OH7A 4OI4A 4L16A 1DO2A 2ZRBA 4UNSA 1NNEA 2HXSA 2REBA 4YMSA 1AQUA 4M8NE 4B6FA 2GK7A 3OIWA 1YE8A 1XMSA 5JSZB 1A7JA 2F6RA 3A1UA 1F2TB 2RHMA 3ECCA 2FFBA 4P4SA 4PZLA 4OHXA 2IS2A 1W44A 1JEDA 1GKUB 1S2MA 3X2SA 1JPNA 2J45A 3BWDD 1CEEA 3DOFA 4K8OA 3IIKA 2HYIC 4MDFA 2Z5FA 1G20E 3K9GA 1WMSA 3PEWA 1IJEA 2Q9AA 1XU4A 1YZTA 3A58B 5FBRB 3EPHA 1W0KA 2GEDA 4GI7A 3UG6A 2XX3A 2P3SA 5TB5A 2Z0MA 3LNCA 1E9CA 4M1WA 4A8JB 2GCPA 4JLDA 1DG3A 1N6NA 2WJGA 4L15A 2ZM5A 3CNNA 2GF0A 1RKBA 1GRNA 4C30A 3PEUA 1N6HA 1VMAA 4DBLC 3GJ4A 4FMDB 4V0OA 4B3DA 1G4UR 3GJ0A 2DWQA 2XZPA 2OCAA 1XTIA 5IRCD 3ZIAD 3AP2A 2DCUA 4QFMA 1KI2A 1CR4A 2GBLA 3VMFA 4MRPA 5K8UA 5FTJA 5JECA 3U3KA 2QI9C 4PHHA 4XWAA 3ASZA 5L3SB 3LW7A 3CNOA 3DL0A 2IYVA 4KSBA 4BRWA 3PUYA 3JVUA 5D3MA 4EFMA 1ZUNB 4NONA 2EVWX 4ZDJA 4A1FA 1TL7C 4KFSA 3F0TA 1W0JA 1M74A 2PCLA 4P3YA 2F43A 2ORIA 3FWYA 3R7WB 3GPLA 1XPOA 1JAHA 1TMKA 4PFSA 3AF1A 3B9QA 3REFA 2A5JA 4Q1EA 3OFND 2IS6A 2D2EA 4EJSB 4TQAA 5EE9A 3SQWA 3RWMB 2IHYA 2GBLC 2XTNA 4BFVA 2ZJ5A 2ZITA 3CH5A 4A0RA 3K70D 2GZDA 4QGAA 3BH0A 2NO9A 5KPJA 1TQDA 2F1JA 3AB3A 2XAUA 2FZ4A 3CPEA 3PUVA 4MYUA 4Q02A 4OI1A 3THWA 5CK5A 3T35A 3QKUA 4HAUA 3FKQA 2YKGA 4DLTA 1G8HA 1Z2CA 1P3JA 3OE7D 2AL7A 2W0SA 4PAOA 1NMZA 1ZNWA 3H84A 3CLVA 2ZJZA 2DBYA 3KUDA 4C0BA 4NL4H 4OJQA 1OIVA 1R5OA 1FOEB 3CF2A 2H57A 2O0JA 2GTPA 3THOA 1D2MA 2Z6VA 1R0WA 1G4AE 1C4OA 2DFKB 2DR3A 2CEAA 1HQCA 3IPXA 3RRZA 3TSWA 1S3SA 2RGGA 1NRJB 1CJUC 4ARZB 4IDPA 4C7OA 1NP6A 2FSIA 1QHXA 2ORVA 2JCSA 4EDHA 2R6DA 2QMHA 3S1AB 4CDGA 3ADDA 1II9A 4U5XA 3DOEA 4OBEA 4GBMA 2YWFA 4KBGA 4M1MA 3E70C 4M9XA 4TMWA 1HT2E 4M21A 4OI0A 2G1JA 1DADA 1E0JA 1NY5A 4JZKA 2FMXA 4NCJA 1DO0A 1ZD1A 3N70A 2WAYA 3CRVA 4MDEA 1PLJA 2GCOB 1I4DD 2ZEJA 4JMPA 4AYTA 4DHEA 4MITA 1XD8A 4HLQB 4US2R 2BVNA 5J47A 5EUMA 2ZYUX 2G0TA 2I3BA 2WWFA 2OZEA 4DZZA 4AI6A 2GVDC 1VYVA 1FUUA 2WSMA 3A4NA 3NKVA 1G8FA 3REGA 1IOZA 2NO6A 3K09A 4HLCA 4TL7A 2BBWA 2J7PD 3T1OA 2G9NA 4HDCA 1NIJA 2WZQA 3KB1A 4XTCS 3VU9A 5K8LA 2HT1A 2FU5C 4D4LA 1B23P 4Q9JA 2HV8A 2IT1A 2O8CA 4EQ6A 5EZ6B 3GLGA 3KQHA 1NBME 2JLYA 1G21E 2P2LA 3QKRB 4NYIR 3VHXA 2JJ2A 3SEAA 5JCPA 3W3AA 2KB0A 3ND9A 4PPGA 1SKYE 3GJ3A 1KYIA 2G3YA 1FTSA 3LBHA 2XSZA 1R5NA 1W47A 4OYHA 2EFEB 3LA6A 5JWOA 1U90A 3K0FA 3Q72A 1CTQA 1YZKA 1X1SA 2G1KA 2R8RA 2YZ2A 2ANBA 3K09C 3LXRA 5G41A 4B3FX 2FDCA 4FD2A 3K0AB 2WJIA 1EGAA 2C77A 3MMPA 4G5SA 2A9KA 1HH4A 2HLDA 4IDHA 4RD6A 4KCGA 3AVVA 1TU4A 1JQLB 1F3OA 1FW6A 2YC4C 3IIJA 4ITRC 4NBSA 2FE4A 2J7KA 4CIDA 1W5TA 5F3WB 2FV8A 4HSEA 4TYQA 5DYGA 1JB1A 1X8LA 4DCVA 1KHTA 2ZJBA 4Q01A 5TY0A 3CZQA 4R7ZA 4BEJA 3VX3A 1ZCBA 3NC0C 2ZUDA 1M1YE 4HAYA 3PIRA 2QP3A 1XPUA 1XF9A 2NOAA 2VPPA 4ZPXA 1JR3D 3KXLA 1T5LA 2ZPTX 3T12A 1P7CA 2J3EA 1U0JA 1TF2A 3IO5A 2VP5A 3B1YA 4RFSA 4Z51A 5AR1A 1NG1A 1AIPA 2PZEA 2QAGA 1OFTA 4R2HA 4A82A 4QBFA 2G6BA 1TQ6A 1QHGA 1ZJ6A 5JWRA 3EIEA 4B43A 2YV5A 3OEED 1JECA 1N5KA 2Q3FA 3TUZC 1QG4A 1UEJA 2VYFA 1OSNA 3WYAA 2WJHA 1VCOA 4JJZA 3D31A 4L8GA 1SVSA 2FEMA 4FXPA 4IXMA 4LJ8A 3WMFA 1GUAA 2F1IA 5J5CA 1OKKA 2QMEA 3ETLA 2CCKA 2P6NA 1ZD9A 4LYHA 2W2TA 4DLZA 3U61B 2D74A 1L2TA 4LPSA 1QVRA 2J9RA 2ZRPA 3C5HA 2W00A 1T3LA 3LDAA 1NI3A 4OI2A 2F9LA 4NPHA 4OK5A 5FTLA 3ZYCA 4QHTA 1OHHD 3SHWA 1QHYA 2IYUA 3AEZA 2QAGC 4MRVA 2IL1A 4D26A 2IS1A 3Q5DA 4DSUA 2GXUA 3PUZA 4CW7A 3OZXA 2ORWA 3AF2A 2CK3D 2NIPA 5KSPA 2C04A 3UKDA 4N3NA 2H92A 2P67A 4C0KA 2C98A 3EZ9A 2QBYB 2N1BA 1Z0AA 5FL3A 1JI0A 4G3XA 4ZO4A 2MSCB 2WOJA 1IN8A 4NYJR 4I1UA 1G17A 3ZQJA 4DUGA 3AM1A 3BB3A 5CIWA 1HE1C 2ZSBA 3LVQE 2O8FB 1YKSA 3K0EA 4B32A 2QMOA 4W7SA 1EFRD 4OQMA 2QT0A 3BFVA 1OH5A 1K8RA 2AXNA 3AH8A 4R9UC 4KLNA 3UMFA 1J8MF 2GAOA 4U7DA 1RJ9A 1P73A 1US8B 3FDIA 1QBKC 2QORA 3IDQA 1H8ED 1J2JA 1ZBDA 2REXB 3B1XA 2CMKA 3TQFA 4G1UC 3AUYA 2VIIA 2WICA 2FX3A 4BRUA 2J59A 2XB2A 2PBRA 4CRWB 2O8EB 3TK1A 4QGFA 1SKYB 3B9PA 4OHYA 5KNBA 3ND8A 2GXAA 1EK0A 1ZC4A 3M1IA 2VRWA 4CEJB 3L0PA 2IW3A 3EC1A 3CKLA 5JBQA 3BERA 3I73A 1DAGA 3U7EB 1S3GA 4P0TA 2PEZA 2ZS8A 3P27A 4RD0A 3VR5A 1T9HA 4B34A 5LD2C 2JLQA 4PC7A 3KKPA 2ZRDA 4A2QA 2IYSA 2QROA 1R6BX 4PPNA 5CITA 1W7AA 3GLIA 2FPMA 2QRNA 3VR2A 4EIWA 4HAZA 2AKYA 1GSIA 3DKPA 4K46A 2OBLA 5KU1A 1KMHB 4D4KA 4MRRA 4IXNA 2EFGA 5GVSA 2B92A 1YR7A 1UAAA 3P20A 5FOWA 2ZR7A 2ZSAA 2WWIA 3LVRE 3F3YA 4KXFB 721PA 2PX3A 1CU1A 4IHQA 2HEIA 1W4RA 1MV5A 3IPYA 4LJ4A 3DMNA 2GILA 4NZYA 3WMEA 2WKQA 1FP7A 4JL6A 2EW1A 1KIMA 2OCBA 3LAWA 4QKQA 1RRFA 3CRQA 3SHFA 4FCVA 3IILA 1L8QA 3QNUA 3LW8A 1UKVY 2PT5A 1NLZA 1OXXK 3GJXC 3MWKA 3MFYA 4EPYA 2JGNA 1Q22A 2O0KA 4D82A 1FX0B 1HEIA 1KJZA 2JDID 5CM8B 1UADA 1ZCAA 2GVZC 3R8CA 1WQ1R 2PMKA 4PX9A 4O2RA 3OAAA 2H5EA 5BYKA 3KQNA 121PA 2A7QA 2AK3A 2V6JA 4ESVA 4CVNA 2CE2X 3GEHA 3I8SA 5FOXA 5M04A 3BE4A 2X2EA 5H8WA 4PHGA 2IYYA 4AK9A 3CPHA 3ZZUA 2WJJA 4RD3A 1IAQA 2AHOA 4E07A 2CL7X 1MRNA 4UXIA 4LBYA 4ASUD 4TYPA 2GJSA 4RVCA 4Q7LA 4M1TA 4LV8B 1RC8A 4KO8A 2CL0X 5GVRA 3MAAC 4QHSA 1W36D 4PPQA 4IDOA 4CF7A 3THXB 2ZI6A 2GESA 3OIVA 5GJBA 1RW4A 4QJ3A 2XXAB 4HLDA 1Z6AA 2JAQA 1CR0A 2I4IA 1J99A 4L9WA 4HUQB 1W2GA 4TT3A 3EA5A 1J8YF 2ZYTX 2MMGA 4V0ME 3R9XA 3C7KA 4PANA 4NH0A 4JBWA 3NHBA 3ZDQA 5HCIA 1FNNA 1OV4A 2O5VA 3FVQA 5JHGB 1N6KA 2IYQA 4B71A 1ZM7A 1BMFD 3VX4A 4AG6A 2B21A 4KFTA 2H8KA 2IYTA 3EZ6A 5EUQB 2EFDB 3TVDA 2IEYA 3U5ZB 4JLOA 3RABA 4Z1MA 4XD7D 5JS8A 2UZ3A 3I92A 1NN3A 5LPNA 1XEWX 3T06B 2JIZA 4TQUS 1GILA 4FCWA 5C18A 3VKHA 3CX7A 3HU2A 1TADA 1MABA 4UJ5A 3UANA 4IEEA 3B8HA 3VFDA 1R8SA 2X2FA 3SS8A 1MR3F 3TSOA 2OXRA 3TUIC 5FOTA 1YZNA 3C8UA 1Z5ZA 4RKEA 1I4TD 1W1WA 1WBBA 1COWA 1SXJA 5FPKA 4WZAE 1MOZA 1OXVA 1M7BA 1XX6A 2IUTA 1OH6A 2WAXA 5BXQC 2ZS7A 1LB1B 2CLCX 3NC1C 3B60A 1G64A 2IEZA 4GT1A 3O8CA 1GNPA 2ZUCA 2KE5A 1G41A 1NJFA 4DT1B 3KTAA 3CIOA 1A2BA 3EZ2A 5JZVA 2VF7A 4U00A 5E7MA 2OBMA 5DYIA 2XJ9A 2PJZA 2VA8A 3SFVA 1UBGA 5J40A 1E99A 1QZXA 1P4SA 2L0XA 3AGQA 3SZRA 4MUBA 3OEHA 4LUCA 4ZCLA 2W6IA 1F6BA 3WRXC 2PEYA 2YNMA 3GLHA 2H17A 5DIFA 4LK2A 5FPSA 2BBTA 2EU8A 1N5LA 4FW9A 3WNCA 3QUSA 3IIMA 4A2WA 1SXJC 4XOIA 2AD5A 5GJVC 2QQEA 4ZIRA 4YLGA 4DLYA 5AUPB 3LXXA 2XNDD 4H1UA 3W6OA 4G5GA 4ZV4A 1SVMA 1GM5A 2IBMA 3GD7A 2J41A 1U94A 2OHFA 4EFNA 421PA 2C95A 5JHHB 1OB5A 3QXSA 4B76A 3V9PA 1GOTA 4XJXA 1NSTA 3EZFA 3QF4A 4W5WA 5FL7A 1U0HC 3K0CA 2Q21A 3DEFA 1WDTA 5A4JA 3VR1A 3IQXA 5BW8A 3GLFE 4JS0A 4QHYA 1YZGA 4BZQA 5G3ZA 1W5SA 4JLNA 5AJWA 4G5OA 4URVR 1ZU4A 4I99A 4JKIA 4WVFA 3W9YA 1Z6TA 2VSOA 4LYJA 2ZJ2A 2B7CA 4DEXA 1DTSA 2ZQ5A 4QGGA 4Q03A 1KDTA 1Z6GA 2WPDA 2W0MA 4DLXA 3W8RA 5AJZA 1QG2A 1ZUIA 2JJ1A 1G3IA 3SJAA 2R65A 1H8HD 1T8UA 1NVUQ 3L0IB 4KLZA 4TLAA 5L8VA 4Q9KA 1IONA 1NIPA 2FH5B 3CUEF 3FKSD 3K0CC 4B73A 2VP4A 3B78A 4PQRA 2A30A 3A4LA 5HCNA 4JKYA 1IN5A 5JMTA 4O25A 3QBTA 1U98A 2GXSA 1XCMA 1N5JA 2RCNA 4TMXA 4F92B 3THYB 1PUJA 2QGZA 2P0EA 5IK2A 1SKQA 2JLXA 5JLJA 5EJEA 2BKEA 1KO5A 1G6HA 3B2EA 4Z8XA 1YR8A 3U7FB 5B2ZA 2A5GA 4TZ6A 1G6OA 1Z83A 3G5UA 1VECA 5TV2A 2BOVA 1KKLA 3RAPR 4HZIA 2D3WA 2ZTSA 1E9DA 2MSDB 4AC9A 4NCKA 1G3UA 2NMVA 2OESA 4PPFA 3AUXA 2QG6A 4HEJA 4IFBA 1TF7A 4LHYA 1SVOA 4US1R 2QN6A 3TLXA 3B7GA 4R98A 2OSBA 2VP9A 3QPUA 4ACBA 1II8B 4FMBB 3ZD6A 4IOMA 5F98A 2TMKA 2ZSDA 1GNQA 1IJFA 2RAPA 4RZ3A 1R5BA 1KJYA 2OT3B 4EPWA 2B7BA 4OK3A 4AKEA 1N6IA 3SYNA 4MYHA 1U99A 1W0KD 2BMJA 2F3TA 4LHWA 4YC7A 1E1RA 4MGKR 2CNWD 1KK0A 5TXGA 1P72A 4I1SA 5EE1A 3T5DA 1E4VA 3CO5A 3G0HA 2BBSA 2GXQA 1IXRC 1G18A 3B1WA 1WBDA 4B2LA 1DAFA 5DHAA 1MT0A 2QTFA 4YXWA 1GKYA 1X8JA 2CXXA 1R0XA 4DXAA 4Q4HB 5DNYB 4YDSA 3D6TB 1WXQA 2R44A 1X6VA 3BGWA 4FINA 2XOKD 5JEDA 3BC1A 1CRQA 4I4LA 4PR0A 2KI5A 3WNDA 2YOHA 1EESA 2CVHA 2ZI3A 3SBDA 1HUQA 4Q5IA 5KDDA 3DZ8A 1UBCA 2W6JD 5CYPA 2OCYC 2ZI9A 1VHLA 1Z6YA 4Q1AA 2ZRLA 3LD9A 4CT4B 1XEXA 1S96A 4FIDA 1KSJA 2Q9BA 3U44B 5AUNB 2ZI5A 1LF5A 2GA8A 5KUTA 5JJLA 3SBEA 2GJ9A 1L4UA 4IEIA 2XB4A 1AKEA 1F2UA 1MO4A 4UKDA 4A6PA 2GZHA 2QQ0A 5DO9A 2BMDA 4BZXA 4DCSA 1E1QA 3GLFB 2QY9A 3BD9A 3TBKA 2ODEA 1CJMA 4Q1FA 2QUZA 3KQLA 3NXSA 4TSFA 1UPTA 1V5WA 5FR2A 1ZIOA 1Z0IA 3MWJA 1BYUA 1N0VC 3LY5A 4HI0E 2C78A 4XVRA 1QHHA 1QDEA 4XWOA 1PUIA 4HAVA 5JRJA 3PITA 1DAIA 4KI0A 1E9RA 2FFQA 3A1WA 3CF6R 2D7DA 3KX2A 3TQCA 3I3SR 3KQUA 1ZAKA 1ZNZA 3CB4A 4JT4A 5FBQB 1XEFA 5ELXA 4QBIA 4WIAA 1UKYA 4UXJA 1ELOA 4W5JA 1JEEA 4Q9HA 1AS0A 4GPTA 1J90A 1KOFA 3AKDA 4GMXA 1NY6A 4PO9A 3K0SA 3PJRA 2Q0HA 1KNXA 3EWSA 1X86B 3WY9A 2GEUA 4PTLA 4PAMA 3K8YA 4MYCA 2F3RA 3QXCA 4P4SB 4QC2A 3U7GA 4WA7A 2ODWA 4ON9A 2J0SA 4MKGA 3TJZA 2DFTA 1Z07A 2WTUA 2XZLA 3P32A 1Q3HA 1X1RA 2H7VA 3TRFA 4F4JA 4AKHA 4QOSA 1MO5A 1HTWA 5UKDA 1XCGB 5DI3A 1D9ZA 2OLKA 4PC3A 3RLFA 2WBLC 4JL5A 2VHUA 1XBTA 2YJTD 3FE2A 3RS7A 3VR6A 3ZIAA 2B8WA 1W49A 2QE7D 3JVVA 2RB4A 3C5CA 2ZJAA 1LV7A 1Q1BA 3NBXX 1OW3B 2O8DA 1RIFA 3AVOA 3VR3A 4NHOA 221PA 1AGRA 1W4BA 4GL2A 3T61A 4BFSA 2IYXA 1OYYA 1M8PA 3SN6A 1DAEA 2QU8A 4M1YA 4JL8A 4M9QA 4H1VA 4HZUA 1ZC3A 3GLGE 2DY1A 4AKIA 5HKKD 2C9YA 1EG7A 1OFHA 1E2IA 3E5HA 4ZCIA 3U3JA 3LLUA 2BJVA 3ICEA 4V0NA 4EPRA 4WW0A 1N0WA 1RYFA 1KY2A 5D3MB 1E94E 3AVPA 1E79D 2DWPA 4FN5A 1XCPA 5CM9C 1P60A 4JVNA 2CE7A 4OQNA 5CIQA 4PC1A 2F43B 2QENA 2YWGA 4YQFA 2IXFA 1JNYA 3MG9A 2IX3A 1HURA 2IWRA 1M2OB 3HR7A 4O0MA 2QM8A 4LX0A 1Z22A 3B1ZA 2VHQA 1TQ4A 3HPQA 4KJZA 4MH0R 4WOPA 4KSCA 5EE0A 3MJHA 4HB3A 4BLPA 2JA1A 2Q6TA 2V3CC 1UDXA 2F1HA 1F60A 1ZU5A 2J5XA 1TQ2A 2ZRFA 3PEVA 1IXSB 1A2KC 1LS6A 3KJIA 3OE7A 5CYOA 3SOPA 6Q21A 4MRNA 5BN3A 5KSYA 5CDFA 4X8HA 4DRZA 1N5IA 4LJYA 3RRYA 5IT5A 1UBEA 3R20A 5C1BA 3THWB 3HYTA 1E0KA 5J4HA 4Q21A 1LW7A 1TX4B 3BBPA 2GJKA 4PC6A 3UATA 1XNJA 4D6PA 4WXPA 5JCZA 2HYDA 3PVSA 3R8FA 4IRUB 4UJ3A 5BYJA 5CB8A 4ZDIA 2R9VA 5F2EA 1Q21A 2D2FA 3AF0A 3GQBA 3DDCA 3T34A 3K70C 2SHKA 1T5IA 4BQSA 1OPXA 2IXEA 3PR1A 4OQXA 3RRMA 3EG5A 3HWSA 1XJCA 4M9ZA 3CR7A 1E2FA 3EIQA 5DGXA 1P5ZB 3FHOA 4TYNA 3RSOA 4LJ5A 4QBGB 2NO1A 4C7OB 3BS4A 1KZGB 2QPAA 3CX6A 3EZ7A 4QXAA 3QXXA 3WYGA 4CEIA 2JLVA 2VH5R 2FFHA 2RGAA 4NE2A 3FMOB 4YDHB 3ZZ0A 2CJWA 2W83A 4CT5A 4V0KA 3TAUA 1LY1A 4RY2A 3C41J 3WXMA 2OO7A 1GAJA 2GNOA 3QPVA 4NDZA 3FHCB 4LC1A 2WWYA 1T3SA 2ZRJA 1CIPA 1IXZA 3FPAA 4BUJA 521PA 1XFAA 3RC3A 5FFMA 3A4MA 1X8KA 3SQXA 1E0SA 1BKDR 4Q4LA 5L3RA 1HY3A 2FEOA 4KFRA 3PENA 4KHZA 3Q7QA 5TARA 3KJGA 1WCV1 1NBMD 4EFLA 5B58C 2J7PA 4PO1A 1OFUX 4FMCF 5FBWB 2ZANA 2W2XA 1PZNA 1OF1A 2IA5A 3AVTA 1XTQA 4Y0VA 2GJ8A 4TMTA 3QIAA 1LFDB 2PZFA 4QM7A 4W5HA 1HV8A 4DCTA 2NTYC 1YZQA 1O87A 2RGNC 4Q4JA 1CJTC 3C15C 4G5QA 4BFTA 4DB4A 4Q48A 2VP0A 2AN9A 3KKQA 3VU9B 3CWZA 3TR5A 5KO2A 4TLBA 5CJ2A 1NJGA 2FZLA 5HE9A 3C4JA 3ZS9A 4W9MC 2ZYVX 2AXPA 1AK2A 5GJWC 4M1KA 2O8CB 4EQ6B 2QAJA 5G53C 5K8IA 3GLGB 2WJYA 1IY2A 3GJ8A 4WZBE 5L3QA 5DISB 4PSVA 5J4LA 4ERNA 1KGDA 4IDNA 4BLRA 3OF5A 3KXKA 2QTVB 4B3XA 1ANKA 4URZR 4TYWA 4DVGA 3BOSA 5CLLA 4BASA 2EWWA 1VYTA 3BFXA 3TGPA 2GRJA 3K0FB 3QKSA 1RVDA 1W4CA 2QA5A 4FCTA 4DSNA 3DPUA 1RE0A 4UNRA 5TDHA 3LWNA 2IK8A 4YMTA 3GLIE 4V0LA 2P65A 2WMOB 1XTSA 2ZRCA 3PFIA 1OYWA 3ONWA 2AK2A 1OLOA 3MWLA 1G5RA 1XRJA 4PZYA 5KHOC 4PZZA 2HF9A 3VHLB 3SI7A 1P2SA 1JR3A 4C0AC 1G8PA 4KAXA 3AVWA 2NZ8A 1NMXA 5LDDC 3GP8A 4C0HA 3J81k 1JXOA 2FSGA 3N2IA 3P1JA 3KFVA 3A36A 1QVAA 1G5PA 3ICQB 1IY0A 5EP1A 4B6EA 5JFGA 1GITA 2KJQA 2ZJ8A 5C4GB 2BCGY 4TL6A 2DWOA 4D25A 4GOKA 3O8RA 3OEEA 3MJRA 2C03A 4RFSB 3H1TA 4KU4A 2EFCB 4URXR 1DE0A 2Z4RA 1QHNA 4RD1A 4A36A 4A15A 2CCGA 4HATA 3RVBA 1DARA 2ZYWX 3B5JA 1P6XA 1FL9A 2QAGB 1KK2A 2UKDA 3KXIA 1AJEA 3LV8A 4KODA 2N42A 1KSGA 3SDZA 1NF3A 4HAWA 2VSFA 2QT1A 2WV9A 1N2CE 1RYHA 5IHPA 1TPZA 4IOLA 1V43A 1G19A 1CLUA 3N2EA 1HT1E 1TEVA 1EXMA 1Q44A 2LKCA 2WSSA 4M1SA 1DVRA 2V1UA 3QF7A 3AVYA 2WWGA 4PQYA 4GZMA 1RRPA 3KB2A 3H2YA 3G82C 2JATA 4BFWA 5DHFA 3W34A 1K5DA 2GAAA 1OHHA 3GJ7A 3KJEA 1G7TA 2O52A 2J87A 5FUWA 1QRAA 1KI7A 2YHSA 2ZRGA 4L5BA 4PXAA 1P62B 1GIAA 2IF0A 3U3OA 4LHZA 4NU0A 2CK3A 4ZKEA 4D80A 3W3ZB 4JLVA 4B3CA 4R2IA 3Q8XB 2QZ4A 4JIMA 1ETUA 4LPKA 1WB9A 4DKXA 1OE0A 4BEBA 5DLQC 1WP9A 5KDOA 1KI4A 2QTHA 2H16A 4Q7JB 3EW9A 1EFRA 4X8OA 5JS7A 3N5CA 2B6HA 4P31A 2QGNA 2IWHA 1BYIA 2Z83A 3LFUA 4S2EA 4RZXA
chains in the Genus database with same CATH superfamily
4O8CA 3TIGA 2D5CA 2H1VA 5CURA 1TOAA 5ERXA 1WR8A 1SCKA 3F5FA 4OJMX 5BQFA 2WAMA 3HUEA 3S81A 4N7MA 2A78A 1FNMA 1T5DX 2XAAA 5KTMA 2WJ3A 2ZJ0A 3FFTA 3R0VA 4XTRA 4QJIA 4E3WA 5MFPA 4LK3A 1D2NA 1SIBE 4U2CA 4CE6A 1AA6A 2DPXA 2XUDA 3AU9A 4Y0AA 2Q41A 5IJXA 4N01A 4LOKA 5TQ2B 4C5CA 3KV1A 3EOAI 3QYJA 2EYUA 3IV9A 2WJWA 1C8LA 3NBZC 4JC5A 4NV0A 3HB9A 4XM1A 4F4CA 4FZVA 1RXCA 2LDBA 1U1FA 4OQLA 4AS2A 2B0JA 1EDDA 2GCGA 1MO6A 1LPAB 4WZBB 4B83A 4TT3D 4CTNA 1SEPA 3Q0IA 1KXZA 2GA9A 3NNDA 4ZHQF 1Q15A 1R4AA 1W88A 1XXHA 4MKRA 4UW9A 2CDNA 3USES 3FHTA 1CR2A 1SHZA 1QWOA 1CJCA 1X39A 1PBNA 1IY9A 1DPFA 1NU6A 3GXOA 1I24A 3WNBA 4PN3A 4AZ0A 4S1WA 4KN8A 3UMCA 1HKUA 2Q6KA 3L7YA 4BFCA 2EKQA 1LLUA 3HBAA 1Z33A 2WF5A 1O97D 3DYBA 1XRRA 3ZQ6A 1RABA 3WLOA 3ZUGA 3GLIB 2HC9A 4AN4A 1P1FA 1M8FA 1JPUA 5AVZA 4DV1B 1KNQA 3GI1A 3ZR4B 2YHIA 3W7VA 4ZC8A 5EJGA 3R1IA 4BVAA 4ZYZA 2FOLA 3FXAA 2ZYDA 4TLLB 1COWD 1IBCA 2FGKA 2WWWA 3QENA 5EINA 2IVFA 2R68A 3GDFA 3GQVA 4QOEA 5HOQA 2CDRA 1WPQA 4ZOCA 1PLLA 5THQA 2XXJA 1N1MA 4K6OA 4B4UA 2G88A 3IAAA 4TKVB 3F6PA 4ND2A 1YKFA 3ODGA 4BCBA 1P2VA 3UBTA 1LVGA 2H2DA 5H81A 2PUDA 4Q18A 1UWVA 2XCIA 3DNFA 4R0NA 1OLXB 1DTWA 4BP3A 1O5TA 3QUCA 4D5EA 4DSAA 2RG7A 2J6HA 1KR5A 3NAMA 4MYTA 1L7MA 1PWYE 3T3HA 5CDHA 1JHDA 3IULA 4F2HA 1GNVA 1GD1O 5FA5A 3D7KA 3WOHA 3QFRA 1N2CB 4K2HA 3KO8A 5AVXA 5GTDA 3ZVMA 1VE3A 5AK3A 3W2HA 3JAMA 1P0QA 5F64A 1RPAA 1DBPA 1PKXA 3Q5EA 1Z7GA 1IIRA 4HB2A 1O8CA 4HPJB 1Z5PA 4LHEA 4WBSA 3ZCUA 1XWWA 3ANNA 1ULUA 3PTZA 4PBTA 3B6KA 4BFZA 4UTXA 4WKOA 4MP8A 2I76A 3ZVNA 2V7QA 4GI3A 2A1UA 1P77A 1T13A 1DBSA 1QK3A 4LYAA 3OU7A 1JYSA 3GFRA 5LIPA 1HZZC 2PZLA 3GNSA 4KE9A 4MK4A 1LBIA 2PT6A 2RGDA 3HDGA 2KW5A 4PSAA 4HPWA 4Q24A 3UICA 1Z8FA 3AT1A 5JJBA 3EPJA 3G89A 2R6FA 2J48A 3E2MA 5EXEA 2Z58A 1PQ4A 4OH1A 1CFJA 2FRDC 3OZIA 5FOVA 2QJOA 5AQ1A 3HJAA 5J43A 3N8DA 5SYNA 4JI5B 1B0UA 1FIUA 4YHBA 3R9XB 1U7DA 1L7RA 4B80A 1J8QA 5E3HA 4BRZA 5KNLA 1C0PA 2AFIA 2YJ3A 1EAYA 3INGA 3EGWA 1D2EA 5AOAA 1PSDA 1JA1A 2H4HA 2XTZA 1QIKA 3RTCA 5FPYA 3TL6A 4J0FA 3JD0A 1Q84A 3Q0TA 3WGMA 4MKHA 1LVHA 3WSTA 3Q11A 3CG0A 4YJFA 3ZKWA 3AJ9A 1P9WA 1Y1KE 1L7OA 1DJQA 3EUEA 3AP1A 1ZRSA 1HA3A 2J3HA 5K4HA 2HN9A 4DLWA 3TRHA 2F3SA 5ALLA 2QW8A 2O0LA 1QMGA 5AK4A 3O3MB 4A6XA 1EVJA 3RNLA 1QP4A 3W5JA 3PFFA 1Z9BA 3OQIA 5G40A 3CSSA 2IYZA 1E5LA 1X15A 4I4TA 4ITUA 4JLAA 4RMHA 3K1ZA 1AX9A 2JD1A 2H1FA 3MJDA 4KQKA 4HT3B 3F46A 2VDOB 1HLDA 3QVUA 4Q6BA 5DM1A 4O63O 1SR8A 4N47A 3HL0A 3R6DA 2INGX 1V45E 4LBZA 1HNZB 4ZEWA 2K2WA 5J4KA 2M1ZA 2I3GA 1W9HA 3EIHA 4TKZA 4DJAA 4OMDA 3JQAB 2EAUA 1LA2A 2NTJA 4ZZ3A 3HCOA 3T1YB 1Q1ZA 1F5NA 5JRZA 3BMOA 4M7OA 4P4TA 4RXTA 1EP1B 2QSZA 4CMEA 3OOSA 5DBEX 1VIVA 3CBQA 3K53A 4DNXA 1SHLA 3KR0A 4NVRA 1LZKA 3VNUA 4IIXA 4BN0A 3D6AA 3U3RA 4UHBA 2B83A 3Q7TA 3AO0B 1EUDB 2QTBA 5CRIA 2LP4Y 3I4FA 1EFLA 3PE6A 4I81A 4R6XA 4NJOA 5B7NA 5CBPB 4M1OA 2WAOA 1AVTA 1AUOA 1P91A 2JLUA 3ZPXA 2H85A 1T0HB 2ZRNA 1YHYA 3PVCA 4DR2B 4YCLA 4R1NA 4C6TA 2O4UX 2GEJA 3OCUA 4RFVA 1NVVQ 1UBFA 2AC2A 2BF7A 2GK3A 2ODNA 3GMSA 3GYGA 4FILA 2OSVA 3LSTA 4V02A 1C0IA 2CFOA 3DUFA 2NO5A 2Q2VA 1P1JA 3WZ2A 1VRWA 4MRSA 5IT0A 2CMHA 4UOQA 1QFSA 1E3TA 2WVJA 3DF9A 5I7WA 5IJ0A 2IYPA 2Z1MA 3KUXA 2R2AA 3FDJA 3KPWA 2AW5A 5SYMA 1JFFB 3HBJA 3GRKA 3VOBA 3LBIA 5KSZA 5E1MA 1V11A 3D8NA 1Z0KA 3DD1A 1Y8QB 4TL8A 4BNGA 4D96A 1KKUA 4FI3C 4M1EA 4TKLA 4ZYUA 1VPDA 1G8AA 3KKKA 4KOEC 2GS9A 2CCJA 4D9IA 4RCZA 4DIDA 4DMHA 1CUEA 5B2FA 2YDXA 1NR5A 1U3GA 2RHGB 4N9QA 1WX1A 4QGHA 3NR2A 4ZEXA 5H0IA 3PX3A 4AD8A 3ZI0A 4AW9A 1UEIA 1U2ZA 1PJLA 4QVKA 3W05A 4JEUA 3EDQA 5GONB 5LOVB 1L4MA 1U9IC 2V9CA 2FPIB 2P6UA 2VKQA 4LZWA 5KI6A 4KK4A 2F8LA 2NYRA 2OEPA 2EFHB 3EA0A 4M99A 1VE1A 1L1FA 4QNMA 3FKSA 1ZK0A 1F6WA 5TQ0B 1V39A 4BN4A 1V8ZA 1RJFA 4I5IA 4C4OA 4OG2A 4C4TA 4XWWA 1FRNA 3NVDA 2I3DA 1Q12A 1IZYA 4LVOA 4RW0A 3WK4A 4B81A 5BUCA 4DR6B 3PQ8A 3EGDB 4UQOA 4BP9A 5LZ2A 1VHJA 3TG8A 4XSHA 1G9SA 4LF8B 1ZGZA 2R6ZA 4CKWB 1QRSA 2XLCA 3DMGA 1CXZA 1QB8A 2FWBA 3OM9A 5ALMA 1N2ZA 1NNSA 3CJRA 3RU2A 3T9CA 1M2HA 1QG6A 1PZXA 1ZIYA 2VDPB 3GRVA 3CLSD 3TLAA 3TMKA 3NJ8A 4HVAA 2C83A 3IP9A 4CKEB 1RYMA 4EPVA 1SBYA 4Q47A 3DFMA 1R4MA 3FI9A 2XQVA 1RFLA 1NVDA 3BDVA 1INLA 3EGEA 1CQIA 4M9UA 3OZEA 1U3VA 1X14A 2Z5GA 4FHCA 5HZGA 1VC2A 2ROQA 3K9BA 4IVPA 2X9LA 3MTEA 1GAXA 2VR1A 2IH5A 2PTGA 2FN3A 4D79A 4BTVA 5DYNA 4A8JC 2AWOA 5HW0A 1ZUNA 2I3AA 1X1QA 1HTTA 3B1VA 3OTGA 4GFDA 2NZ2A 1R9MA 3COVA 3NG1A 1JW9B 2IXTA 1GR0A 3LZDA 5FUXA 2JGDA 2H5LA 3ZZTA 1HYBA 1ZRHA 4LWZA 1IQPA 4NQRA 4R5MA 5IUKC 5JI2E 1PR9A 1RI4A 4XZ3A 4AY2A 3ZVLA 1R0ZA 4CGYA 3UYLA 1Y6FA 2J30A 5LC1A 4Z0NA 1RI1A 4C2TA 1I0IA 5BOVA 5KCMA 1NSFA 3G0BA 4YUYA 5AXCA 2P1DA 2WABA 1M10A 5AKYA 4TUYF 2LPMA 3PNKA 2OKGA 2NO7A 3BORA 1IBLB 4FOSA 3BWBA 4BBZA 2X0JA 3CX8A 1UWCA 1T25A 1VJDA 4PLCA 1U0NA 2XD4A 1GQQA 3GZJA 5KPDA 1J0EA 3H1BA 3B7WA 1HFKA 4UTOA 1MV8A 2BFFA 4NBWA 1PRYA 3TM5A 2I6QA 3DTTA 2CV2A 3HGTA 1CETA 3NORA 5E38A 4ZI7F 2OCDA 3KQQA 4NCHA 3MGKA 4UMEA 2G25A 3ILHA 2I4LA 2G5TA 4YJKA 3OJCA 1EB8A 1AUPA 2QVGA 3EAQA 1YMQA 5E9QA 4TWBA 4G1EB 4DYVA 5BR7A 3MGBA 3H42B 1EFPA 4XQGA 5KYUB 2WIFA 3DDUA 3E5RA 4EF6A 2W6JA 4RTKA 2P9BA 2C31A 2A9QA 3SLGA 1BNCA 4QRDA 2V59A 2VSQA 1OXTA 1LLQA 3NNSA 4RJIA 1ZINA 1ADFA 4PAQA 4WLFA 8MHTA 2ZSFA 5DNEA 2D0IA 2V9PA 5DK6A 1IEQA 2NADA 5EFZA 4OP1A 4H6VA 4UATA 1HNNA 1XEXB 3WYDA 2IEIA 5LQMA 4Q82A 4L5JA 4PW0A 3IRUA 2HPVA 4MJLA 3RD5A 4LOAA 3L4KA 5H1YA 3P0EA 1H2HA 1R27A 3LP8A 5DU2A 1F2UB 3C97A 2JASA 3RASA 1TM7E 2JBAB 1S8FA 2QMUA 1XVIA 2UVPA 3OU2A 2XQKA 2JANA 2WUFA 3VAYA 5B4VA 2F8MA 3TTYA 1TCBA 2EJWA 3IAS1 3VQTA 5T4HA 2PA3A 5C1DA 3L93A 3YASA 3DV0A 1F38A 2AQ8A 4KQ6A 4FFOA 4OATA 3P2OA 3ROEA 3BN3A 3OIUA 4DRXA 2GSDA 2GAJA 2H0RA 5JZMA 1AHHA 1DFGA 4MV8A 4QKQA 3TL3A 4AURA 3O90A 2RI0A 4QDXA 2UZ4A 1KHHA 1U7HA 3MCTA 3ANXA 3BMQA 5FHQA 1SXIA 3SP1A 3ROTA 1JJVA 1JNXX 2FUCA 5BSEA 3FPBA 2QYHA 3RVNA 1EWRA 1ZPDA 3D3WA 3N0TA 3W4KA 1G2QA 3QMPA 3WMGA 1N32B 2IY9A 2ZT6A 3EW7A 4P2BA 4KTTE 1UK6A 4ZQIA 4TN5A 3EARA 3FYDA 2JLSA 4MR9A 5M3BA 2GYWA 1FX1A 2YVKA 3TNYA 1J23A 1HM5A 4NMWA 1T5OA 1KDYA 3VVBA 3FHJA 2NV0A 2HMYB 2Q8PA 1CB0A 1DQNA 1BCSB 1KTVA 1IM5A 2YWEA 3GFBA 4MWZA 2VJCA 4R2KA 1PIWA 3M0EA 1L5KA 2GPYA 4XB2A 1URPA 5B1DA 3EFOB 4E7OA 5IFLA 4LQDA 4B74A 2JBHA 2HTFA 1A0OA 1FZQA 5EJ4A 3GELA 2HXGA 1DSSG 1P17A 1XNGA 5E7QA 4HWKA 3H19A 1CF4A 2KPOA 4YONB 4Y2UA 1ILWA 1DAKA 3EEOA 1RWVA 1JBKA 3RGWS 2ZDGA 2ZPUA 4X41A 4ZCMA 5E9WA 2PR2A 5HZKA 2GI4A 4CM8B 1ONSA 2JJ2D 1NVXQ 4HNHA 2BGLA 2EV9A 4MYDA 2JFXA 4RHTA 1IUPA 3WJAA 2A92A 2OXCA 5JCOC 4BLOA 4L50A 1Z63A 2I9KA 3HCBA 5I7OA 3K5HA 1RKVA 2VAXA 3B51X 5AWFC 4UEOA 3O47A 4LOIA 4DSOA 4KC0A 5EESA 4EKEA 4YJ2A 1PTJA 4RLFA 5JBNA 2OB1A 4X90A 3VR2A 1R5JA 3L4EA 3P19A 4OM7A 4OQZA 3JZMA 4ZXFA 3V4RA 2BCEA 1G20B 3ZGOA 3DWFA 2NV2B 2Y4NA 1DNPA 4GLOA 1Y6JA 4Y2HA 3QWFA 3ZCXA 1ECFA 5BOSB 3EBLA 3FGPA 1P74A 1ENPA 1T4GA 1O94A 1ZI6A 1N3LA 2OM2A 2QTTA 4J2TA 5AJXA 4DUPA 5EE3A 3SC3A 2XUZA 3X2FA 5GZ6A 3M9LA 4URUR 3V7YA 1QONA 3HBMA 3ILXA 4NBTA 5F4ZA 3IYLW 1XKQA 4B4KA 4MWEA 4DLLA 2BMVA 3FTFA 3TOCA 4QNRA 1IJKA 5IBQA 5DP1A 5EPOA 1BU5A 1U9CA 2IXDA 2V4MA 3AEKB 1SBHA 5D3QA 3LHDA 2GPSA 1PCXA 3FLAA 2OXTA 1I9GA 5K01A 2ZRKA 4NJEB 2H4XA 4OCZA 3GF4A 3RM3A 1I7NA 3M70A 3TQIA 1QYVA 3VPBA 2DOKA 3NHFA 2OL4A 1QFJA 4EGQA 4WN9A 3FYUA 1AG9A 4BNNA 1DKUA 3CRMA 4FYHA 3E53A 2OTCA 1JI3A 1UJ6A 4L75A 5ALVA 4HNRA 4GL4A 5I51A 5EHNA 1Q95A 2YIMA 4I9FA 4H27A 2GYYA 1SAYA 5SY4A 5D5PA 2A88A 1JJFA 5A04A 5IM4F 3HKEB 3V32A 2VBIA 1GR1A 1KO4A 3VYRB 4JT8A 4E6EA 2FEAA 5DNDA 4F4IA 1I4WA 3SZGA 1E89A 2HQRA 2I4MA 2OB2A 1J00A 1DAOA 1RHUA 1WSWA 2G77B 3D8BA 3GCXA 3DP9A 4P4UA 2CWDA 5LZ5A 5JEEA 1D8AA 2BKXA 1E2EA 2C7GA 4MUAA 5JYCA 4E2WA 2CHQA 1UFQA 5KYWB 3QZUA 1R7RA 4ZVKA 1ZNYA 2PM8A 4CQMD 3IKVA 4I8IA 1Y6ZA 3SF8A 3N2ZB 4F91B 1HLPA 5HGXA 2GF2A 6CHYA 4KDCA 1ZIDA 3SIPA 3CKMA 3DVQX 1YCDA 2GERA 2IYLD 3PZBA 5SICE 1KYQA 4MKFA 4R7GA 4ZVVA 3RSSA 4L3OA 4H2DA 4NYMQ 1TRKA 3PVZA 1JLMA 2QBYA 1UXIA 2WA1A 2VDRB 3I6ZA 3K6KA 2AOUA 1XTPA 4XGKA 4AF7A 1EJ6A 4JVSB 4HYEA 2HUPA 1A8QA 4IIJB 5HE8A 5TGDA 3VUEA 1OCEA 7REQA 1OA1A 4D9BA 4NCIA 5FWXB 2I29A 2WVAA 3BD8A 3N2GB 3JWHA 4FLFA 4TTTS 3ORHA 4X3PA 5DHRA 3TW8B 5ICMA 1FTWA 1N2HA 1N8NA 2ZREA 4GOOD 1FMCA 3T1HB 1EUYA 2O5EA 5FWDA 1MU0A 3T3GA 1ND6A 4X7BA 4XARA 1KARA 3BEOA 4RPLA 2CFRA 4GGPA 1JT9A 4ZKDA 1Z2PX 1OC2A 2OZKA 2VL7A 4AMYA 4F93B 2LGJA 2XWJI 4L9AA 4XPIB 1Z2AA 3QSYA 4WNYA 1NBMA 2ADMA 2FQXA 4KN6A 4LDZA 4RDXA 2ZRIA 1JQAA 1O0SA 1ONPA 2VNKA 2VBCA 3A10A 3KQTA 2IP1A 5CT5A 1EWYA 1UMBB 2EZUA 4PG4A 5AI8A 2O8EA 3ETJA 4O8ZA 1PV2A 4MJ3A 2UV8A 4RF4A 1XMIA 4IVQA 1BXGB 4PFQA 3D8HA 1ORIA 2CC2A 3O83A 4XM0A 1WDKA 1E5QA 2HDNB 3V9AA 4GOND 1IDN1 1BH2A 5C35A 2I1QA 2ZRHA 3I9KA 3B6EA 3O6VA 2EBUA 2BSQA 2BL4A 2WSSD 1OWOA 1GTZA 1C0LA 1E2NA 2N1MA 3E4CA 1LPNA 5KNBD 2J5QA 2K2QB 3HYNA 4OVKA 5K99A 3H4TA 5BT9A 3F6CA 1J97A 1ZVMA 3TPZA 5D7NA 1GRQA 1U3TA 3RJZA 3C6XA 3K7EA 1WF3A 3HO6A 3NTOA 4XCQA 2PQ6A 1JKMA 2EFYA 2BUBA 1LSSA 4N4AA 4KYUA 3RYCA 1ZUHA 3I04M 3GD5A 3EVAA 5BSVA 3EEIA 4W99A 4ROSA 1EU1A 1WTAA 2X58A 2ZAYA 3KCNA 3HI4A 2OBXA 3BWXA 2NUTB 3OX4A 1MB4A 3QOWA 4K1LA 1AZSC 4M22A 3ZQKA 4C08A 2D6FA 3Q98A 4YT8A 5B7GA 2V5UA 1TTQB 3EBPA 1THMA 2E1RA 2PX0A 3GLRA 4PHCA 5DGIA 5AKLA 3UOAB 1F51E 4CFZA 1RD4A 3MD0A 3TECE 4S1VA 3H5TA 1XXHE 4K6HA 1A82A 4GQAA 1N1EA 3HPRA 2ZR0A 1MW8X 3GU3A 1XWFA 4AULA 1Y4SA 3SIXA 2JGAA 3JYPA 2NU9A 3C6KA 5ITZB 3P8ZA 4DV0B 5F7JA 5JSKA 2W58A 4C7KA 3JAWA 3R9WA 1XMJA 2X0KA 1DX6A 1XZGA 5AUQA 3U7QA 5DE3A 2DR0A 5DWVA 3RVSA 3CTMA 4EUHA 3ENWA 2RFLA 3DB2A 2E4VA 4ZVMA 8AT1A 3H2KA 3OX3A 1G9XA 1U9YA 4JEHA 2QY6A 5LP6C 3NHPA 3HYSA 4GE0A 1ZKMA 1MXFA 2EEZA 4HWOA 5IG2A 3OZ7A 3CNLA 1NL3A 1XEWY 1VKJA 1GN8A 4YQYA 4D44A 1AU9A 3IUMA 2XMRA 5L9AA 3FWPA 2DM6A 1UPUA 1K1EA 5HF5A 3FY4A 3SXJA 2ZETA 3HXOA 2FPGA 1LPBB 3LLVA 4YJ3F 5EMKA 1CUZA 2W2PA 4Q3EA 3RWOA 5HUJA 4HN2A 3RREA 1X9GA 3Q3JB 2EQBA 2BUAA 1YRBA 1HG1A 3BCUA 4NESA 4Q1DA 3FTCA 5ER6A 3SEZA 4BMZA 4RANA 3OOWA 5AW7A 1JP7A 3OZTA 1NJ6A 2CLHB 2ZVPX 3AHCA 2QR2A 4KMSA 3GEIA 3QLJA 1PFWA 1N4AA 2W6OA 6REQB 1N77A 2N75A 2PPLA 1TYBE 2YWDA 3RBZA 4BGDA 3OP1A 3C16C 1LBTA 2AI1A 3ETHA 3O3OB 3UJAA 2PXCA 4YVFA 4O4HF 5HVNA 2HF8A 3N28A 5BWOA 2ZXEA 2H08A 3OOJA 5BN4A 5HNKA 5IJWA 4G0QA 2BI8A 4LJ7A 1YQQA 3DEHA 2BMFA 2ZSHA 4B4OA 4ZMSA 3X1JA 4H9GA 4MI6A 1G60A 4QWMA 3AP3A 3L18A 4KXNA 3W04A 3IKJA 5HZHA 4KQHA 3HDQA 3PGLA 4FWIB 5T64A 4A27A 2XLBA 5ANRB 3BFKA 3FMIA 4FWTA 1C7QA 4YGYA 2OZLB 1SVLA 3OTQA 3EWNA 4GRIA 2K4MA 2PL1A 3HEAA 4RKYA 5DPMA 3CZRA 3RO7A 1GZ7A 2ZATA 1R8XA 2FAXA 2X9GA 4G5RA 3ZE0B 3PTAA 5JJIA 1X77A 1GEEA 4D74A 4OX9B 3ISVA 1IWOA 2BR3A 1I2AA 3TRJA 4JVLA 4MVYA 2QF7A 1A96A 2WLSA 3Q8MA 1C3OA 4YRNA 2IJGX 4EJ2A 2VJOA 3D8UA 2H5IA 1B93A 3T0GA 3C45A 5MN6A 4DBZA 3QX8A 2RJ3A 3FX2A 3QUTA 2D1RA 3RANA 5IULC 2QRJA 1KO1A 1RWKA 1XNHA 4FMCB 3MTJA 2IZOA 3VZRA 1XF1A 3HCCA 4P4LA 3W8NA 1KI9A 1Z3IX 1KDRA 1RAHA 5AK0A 4LZPA 3RWBA 3WYFA 3HC7A 1QU2A 2AFIE 3ETGA 2FXIA 2HA7A 3A0RB 3NTXA 3M5PA 2YZ7A 4QPCA 3DHVA 5IM5A 4UREA 2X1VA 3ELBA 2RGBA 3QVVA 5NULA 3NO4A 3CZ9A 4ZXPA 4C4ZA 2EL7A 3TH5A 3BXPA 4MULA 2QM7A 1X3SA 3JQAD 1SVNA 2KMLA 3WIBA 4CTOA 4PV7A 2Y1KA 3CSUA 1FE8A 2QNRA 3DT6A 3L8YA 1QIDA 2GN6A 3AINA 5A6SA 1VG0B 1VIMA 3EDMA 1KI3A 5EQDA 4YYEA 5LZ7A 3C8ZA 4WX2B 5BSFA 5HKOA 3PFHA 2X77A 4P54A 1Z7YA 2C4HA 3HNRA 1G7CA 2NZYA 2GWHA 5EZ5A 1N9KA 5KJEA 4FJ2A 4RLHA 5IDVA 3TW4A 5FLEX 1IBMB 1T9GR 4ASUA 3GP3A 3E2PA 3RIXA 3VJLA 2O3QA 3CGWA 2JL1A 3OQVA 3TFQA 4TLEA 4A4DA 1W88B 1XXHB 5T3UA 4LBWA 2FPRA 5HS4A 1M6WA 4L4YA 4FSXA 2B8NA 2JCGA 4NPAA 5FCDA 1I7SB 3G5LA 4WGGA 3SJ7A 1H4TA 4RL4A 3ESYA 1F14A 4AZ0B 2LD4A 1N3BA 1LS1A 3NVMB 2FW9A 5EWLA 4FEYA 4FYJA 2OYCA 3O8BA 1SCAA 5BR8B 2ZYGA 1AO3A 1UOOA 2RONA 3KJHA 1USUA 2RDMA 2MSNA 3MT8A 3EX7C 1N1GA 3NTUA 5HCUA 5BW6B 3VGJA 1XDDA 5FXMA 2PZGA 2YHIB 2XUPA 4HUTA 2P41A 4C0WA 3CTPA 3SC4A 2A2ZA 2FJUA 1YQDA 5BRAA 3DFZA 4ZT3A 2H52A 2JAUA 4YRCA 1IXYA 3DQZA 3MT7A 3NWJA 1RHRA 2GKGA 2QP9X 4HH4A 2PLRA 4NE9A 1U3CA 5CNJA 2C00A 2QLFA 3OZCA 1T9DA 1DEKA 5B6PA 1QDLB 5H3LA 2J1LA 3EJWA 4TMVA 4ADSG 1CQZA 1B2RA 2QPOA 2YQ5A 4QUKA 4A0GA 4EYEA 2G5CA 3WHKA 1C9DB 4IDBA 3ZK9A 2NMVA 1R12A 4JZYA 4BWGA 1DZ3A 2EYQA 1NFFA 3HJNA 5A3QA 4YO8A 1UJCA 5LBUA 4GZ5A 1DTWB 2BFAA 3IUPA 5ENZA 3RU9A 3VRHA 1A50B 3ZXUB 4V03A 1HE3A 4MVJG 2CZQA 4MV7A 1EHIA 3LUFA 1NURA 1QE0A 2A5DA 3LY7A 4MQBA 1D2GA 2CYBA 3THYA 3ASUA 4HEA1 4URYR 1F48A 2AG1A 2O23A 1N5DA 1VI2A 2VYVA 1I80A 2DYKA 3H17A 3HP4A 4UC0A 2OE2A 1GQ2A 4MW0A 3THXA 1GDHA 2XD9A 3R24A 4O5AA 4PBRA 3K9HA 4D8VA 1NHGA 5AJVB 3AOGA 1WAMA 8ATCA 1J21A 2V98A 4YRRA 3SBOA 2OGZA 2A1UB 2D1YA 3INNA 2BWJA 4EW3A 2VQ3A 1PZGA 3OQBA 1EXNA 1I3NA 2J31A 3UMRA 5G02A 1UQTA 2X8WA 2ISSD 1SCBA 1M2JA 2FSFA 3HKCA 3A3PA 3OHMA 3U1BA 1GL6A 3IOEA 3VMMA 4DMGA 2C2BA 3Q1LA 1G3RA 1LRJA 1PQUA 2FG5A 2NO0A 3PG5A 3WRYC 1AO0A 2GBGA 4Z5XA 1VLZA 2XUAA 4GZLA 2R6AA 3WTCA 2A6PA 5KS2A 2PT7A 3OLWA 1C9YA 4OFWA 1WXFA 1SD2A 2AFIB 4Z53A 3VC1A 4PYLA 4J7XA 2NG1A 2W2LA 3IA7A 1FQJA 2KLHA 3BE8A 1XTRA 1S0UA 1N6LA 3ABIA 3PNMA 4LVCA 1OIXA 4DCNA 5E4YA 1KPIA 2WZDA 1FSGA 2VDJA 4YJFB 2A84A 2ORED 3ZKWB 1K5GA 2ZE7A 1JALA 4LE2A 1T2FA 2IF2A 3UFXA 3VPHA 2ARKA 4D0GA 2Y3IA 3RVKA 1RWNA 3L41A 3F8SA 3KSMA 4OXNA 2P30A 3GFPA 5LB4A 3DR3A 2Y1WA 4XAQA 4R2MA 3EYAA 2ILTA 2LR0A 3Q7PA 4MWTA 4LY6A 5F9FA 4KE8A 4QSMA 3OQIB 2C5BA 4I4TB 4Q0MA 4BVGA 4DWJA 4QOGA 3SQOA 1G7SA 2FWPA 1XB2A 1FMLA 2GBCA 3JQDA 4LQ4A 4CF4A 4JBNA 4YR7A 3PQ6A 3EMDA 4EBFA 3NT2A 2P4SA 4TVKA 4CTKA 1IEVA 3KSDO 4QRHA 1JAYA 1EWQA 4JVOA 3D7MA 4YWHA 1X9IA 2PAFA 4GMFA 3G2NA 2G4VA 4ZEVA 4KO3S 4JX9A 4RACA 1LGYA 4IVRA 3L2OB 5BMVF 1KK1A 3BMOB 1YI0A 3EIFA 5DYWA 3UT6A 1Z62A 1X1DA 1ZXBA 2P9YA 2FHSA 2WAAA 3B2QA 3PE4A 3QJYA 4TXNA 4UHKA 4JYBA 5K5EA 5JQGA 3JQ7A 4PQFA 4GRAA 2HA3A 5ADWA 4PZ0A 1GXSA 1YZUA 3WJ2A 1J70A 4MVJP 2QUJA 1ULHA 1ZH4A 2AOVA 5K8TA 1JQBA 3DT9A 3PC3A 3RS9A 1S2NA 2IY8A 5EPUA 2ZBUA 2WP0A 5IFKA 5KOHB 2XW6A 1D0IA 4B7ZA 3AR4A 4I1OA 1JKXA 2FR1A 4C6TB 3QVOA 2FFAA 4RHUA 1OASA 3C3AA 3MWFA 3RPEA 3N76A 2H06A 4NYJQ 2C4NA 4RMIA 5CBKA 3DMTA 2GEKA 3DUFB 3PC8C 3QJGA 4H0FA 4L16A 6NULA 2FQQA 4M0KA 1OH7A 1IYZA 2HXSA 2REBA 4C6SA 2PZJA 3TW0A 4HNGA 2O7VA 2AIRA 1JG1A 3LSYA 1TJPB 5TE9A 4DG8A 5IJ0B 1VZ3A 3BGOS 3SWWA 4ZT2A 3IALA 3IQHX 1AGXA 3VI4B 1K7XB 2ZZMA 4P4SA 5JNSA 1C3JA 2IX9A 1V11B 1JJIA 1RWWA 1T1GA 1JB9A 5ILGA 3UJ8A 1FUYB 4ZAYA 2J45A 3VZQA 2LNDA 3KV3O 1R6TA 5G0SA 1CEEA 4DVJA 1XQ6A 1GT91 1WMSA 2PANA 3K9GA 4LE1A 5DTIA 3GCWA 4CNQA 1C8VB 4ER6A 3PEWA 2J4CA 3W6UA 3TZLA 2IU4A 3UT0A 1WF6A 2Z0MA 5TB5A 5CGQB 2ADFA 4PSCA 1E9CA 4M1WA 1JHOA 4JLDA 2ZM5A 1DG3A 2YYYA 4JFRA 4AECA 1R6DA 2ZSJA 4LY9A 2Q3LA 1IWPB 4XOUA 5D84A 3M6WA 4HOYA 4ND3A 1C5KA 2YJZA 3GJ4A 4DRYA 1KVUA 3TD9A 5TMBA 1VL5A 1YRYE 3K3PA 4WFIA 5LU9A 5EPEA 3KEGA 2VT3A 3UUWA 4Y1GA 2DFVA 5IVKA 3AHGA 2CUKA 4JBLA 1Z4MA 4QFMA 1CR4A 3MBIA 3QK7A 4CQLA 4G65A 2GBLA 3SFTA 3VMFA 1O0CA 5FTJA 2O14A 3A6DA 3QITA 3TOZA 2PUWA 4NENA 4RDIA 1QANA 3P96A 4KQFA 5A9RA 1BA3A 3WLAA 1XLVA 3CNOA 3VR4D 1CVIA 1U2SA 2Q6LA 1CQIB 1C7JA 2VH1A 2YFKA 3DH0A 4L6AA 3V1NA 3VAZA 4KSBA 4CR6A 4UTRA 2XRZA 3JVUA 1SH7A 4OHMA 1XAGA 2NUAA 4OXRA 2AVNA 2QD1A 3F74A 4JMLA 3ABQB 5IVDA 3ZU2A 4WKGA 9ATCA 4YUVA 4S2UA 4QYXA 1ZUNB 4ZDJA 3CURA 3M9WA 1J0AA 1TL7C 2X13A 3F0TA 1OGIA 3DC7A 1GAQA 1Z2DA 3KELA 4UUQA 2H9YA 4EI8A 1CDEA 2JGDB 4KAJA 2XDYA 5F78A 5IW8A 3PWSA 2DT5A 1JAHA 4CHTA 1PR5A 5IAAA 1E8NA 3ETCA 1SU8A 4OMFG 2K87A 1KQNA 3DAYA 3OFND 4FIZA 3WGJA 4TQAA 2K6GA 4KTVE 4Y2YA 3QWBA 2IHYA 1CPYA 4BFVA 4MWBA 2BZ0A 4INPA 1K6EA 4OA8A 4Q37A 3CH5A 3FOZA 1L6RA 1VHWA 1AUQA 1U31A 4IJ5A 1H9AA 1ZHHA 3BH0A 2NO9A 2VCEA 2ZTHA 2F1JA 2HU7A 3HBFA 1Z4IA 3OT1A 1KYXA 3PUVA 4Q02A 1PL7A 4GKJB 3NYWA 4X6UA 5FA6A 5CK5A 3TZEA 4DADA 3IP8A 4GVPA 1KVTA 1F0KA 4QELA 1H66A 1G8HA 1JJBA 2BFFB 1P3JA 3AY3A 3HXKA 2WKWA 5I8ZA 2W0SA 1ZNWA 3OO0A 1RM3A 4F2PA 5BURA 1EPUA 2QX6A 3ORQA 3Q7EA 2VCYA 4NH4A 3RODA 2AE2A 1SU7A 4X1YA 4DV6B 4OJQA 1OIVA 4ZRDA 2W8ZA 1TLFA 2EIHA 3QUAA 3DGFC 2WMYA 2H57A 1GFSA 2O0JA 2NN3C 1EFPB 2DMRA 3GUZA 2IZZA 2AN3A 4M8KA 4R1TA 3ZV6A 1R0WA 1G4AE 3KPJA 2CEAA 2XH8A 3IQIX 3W77A 1HQCA 3I2JA 3VVMA 1W52X 1HDIA 2QQ5A 1J39A 3BMCA 3TSWA 1S3SA 1Z25A 2RGGA 5F7OA 3CE9A 1RZUA 2ZB4A 4IDPA 3EF3A 1NP6A 2QJWA 4UEJA 2ZVDA 3LC2O 3WLIA 2FSIA 1ZH2A 1Y8RB 4OQEA 2ZBDA 3NYIA 1PW5A 3ZKAA 1NVEA 5ESDA 1PDOA 3QFCA 2R6DA 1NNUA 4EDHA 2ZYHA 4GPZA 3A1DA 4CDGA 1YK1A 2HDOA 3GVIA 3KSUA 5A4IS 5BR4A 5IASA 4GM0A 4RGVA 4UVHA 1CUFA 1VDMA 3ZQ4A 1KMNA 3G0IA 3O7MA 4MR7A 4OBEA 4R9RA 2YWFA 3BJMA 3PI7A 2Q1YA 4R81A 4M8SA 4UHJA 4UM8B 4DM4A 4N40A 5I47A 5E2BA 3NV7A 3L1IA 4HNTA 5HSGA 4OI0A 4R8RA 3UV3A 3TOSA 2UVPB 2GPAA 3DEZA 1BD4A 1NY5A 4MW9A 2FMXA 1AURA 1DIAA 3OLCX 4RELA 1HGXA 1FFBA 4HAOA 1EE9A 1JSLA 1X42A 4MDEA 3NASA 2ZEJA 4HQOA 4WLEA 4AYTA 4M87A 3DV0B 4A5OA 2HZBA 4PGFA 4MITA 4UUNA 5I9LA 2A9FA 1POWA 1LDYA 3DZIA 4LISA 2Q3CA 5J47A 1WDWB 3LHIA 1A7AA 1VYVA 2OHJA 2WSMA 2OC9A 1ORDA 3I5MA 1G8FA 3BMQB 3NKVA 4K87A 3REGA 3RTAA 4F71A 1N0HA 2R8XA 4C43A 5C5IA 4BO1A 1SRQA 2BBWA 1GU0A 2YXLA 5CHYA 5GPBA 3D3WB 3G1WA 2ODPA 2OMKA 2AUTA 1B23P 2X3UA 3HGMA 5A2GA 3T5TA 4MR9B 4PS1A 5ITSA 1F0NA 4OQPA 2QD5A 1AK1A 4DRZA 4ZN6A 1NBME 4W82A 3TUZC 4TTIA 2XRMA 1Z6ZA 3RRBA 3VHXA 1A4UA 3LF1A 1DKNA 3AJ8A 4N8SA 3FJOA 2KB0A 2XF8A 1EM6A 5CVVA 5A3SA 4U8HA 3KQYA 1YHZA 3S2YA 2C2KA 5EVJA 1ZMOA 2G3YA 1M0SA 2I65A 3BREA 3KZMA 3LBHA 4IWNA 1SKUA 6GPBA 1A8PA 2MINA 4OYHA 3A2LA 4HWTA 3ROMA 3KK0A 1SOAA 3LUJA 3JASA 1X1SA 2Z4TA 3BIJA 1IOVA 2ANBA 3TLJA 3L6BA 1F0PA 3JQ8A 1W96A 1RADA 3VU3A 3QWAA 4U1RA 1EGAA 2IKQA 3A1CA 1I3KA 4JJ6A 3MMPA 2HK8A 4L4ZA 4YJ2B 4BNFA 5LKRA 5TRTA 4RD6A 1OZHA 4GM4A 1TU4A 1J4AA 3LDHA 1FW6A 2WIDA 4ITRC 5DLPA 3G49A 5IABA 1W5TA 5TSDA 4ZVOA 2Y0DA 3MUOA 1I1HA 3V4PB 5ITVA 1IQRA 1P3DA 2F67A 3DXYA 5EEHA 3CZQA 3H7AA 1X92A 3NC0C 1EK6A 5C4IA 4BX3A 1A9RA 2XKAA 2YWCA 1WNFA 3KWLA 2DTEA 3ZE2B 5AJTA 1UDCA 3RYFA 1P7CA 1YAHA 4MINA 2WU1A 4RFSA 1J6UA