3LECA

The crystal structure of a protein in the nadb-rossmann superfamily from streptococcus agalactiae to 1.8a
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
227
structure length
225
Chain Sequence
NAMDLQLSKRLQKVANYVPKGARLLDVGSDHAYLPIFLLQMGYCDFAIAGEVVNGPYQSALKNVSEHGLTSKIDVRLANGLSAFEEADNIDTITICGMGGRLIADILNNDIDKLQHVKTLVLQPNNREDDLRKWLAANDFEIVAEDILTEKRYEILVVKHGHMNLTAKELRFGPFLLSNNTTVFKEKWQNELNKLTFALNSIPNSKMEERAILEDKIQDIKEVLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structure genomics, unknown function
molecule keywords NADB-Rossmann Superfamily protein
publication title The Crystal Structure of a protein in the NADB-Rossmann Superfamily from Streptococcus agalactiae to 1.8A
rcsb
source organism Streptococcus agalactiae
total genus 76
structure length 225
sequence length 227
ec nomenclature
pdb deposition date 2010-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04816 TrmK tRNA (adenine(22)-N(1))-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3lecA01
1P1CA 3LKZA 3M4XA 3BZBA 3MGGA 2XYRA 3GNLA 4YUWA 7MHTA 5CUQA 5T67A 1KIAA 1PJZA 1RJEA 4L7VA 2C7PA 2IBTA 3KPUA 1L3IA 3FUUA 2ERCA 1YZHA 2BR4A 3CBGA 4R6XA 5GP1A 1V39A 1RI5A 4RSRA 2O06A 4E33A 1NT2A 4OX9Y 2YTZA 3SM3A 3MAGA 3SMQA 3FTEA 4YUVA 3RODA 3G2PA 4DCMA 5EHIA 4P7KA 4DMGA 3UJ7A 2AOTB 2P3QA 3R3HA 1G55A 4KIFA 3FYDA 3G8AA 4EKGA 2ZIEA 1H1DA 3KQPA 2IFTA 4Y30A 3F4KA 5T64A 2HR1A 3A26A 3KU1A 4M38A 3OZSA 4HC4A 3IYLW 1INLA 2PY6A 2XYQA 3HA7A 5FULA 1G8AA 3TMAA 4YV2A 3MTEA 3SVZA 5ERGB 1VP3A 3JWHA 4GC9A 1RI3A 2PGXA 3G5LA 4PYMA 2ZVJA 4P58A 4C08A 5KQRA 3KQYA 3G88A 4PYKA 4ATNA 2CKDA 4QPNA 3G2MA 3SGLA 4PIMA 4OA8A 5EEGA 4PYOA 3NW9A 3CJTA 3MERA 2OXTA 5FA8A 1P91A 1YZ3A 4PINA 4RTPA 5D1HA 5EVJA 5HIKA 1B42A 2H1RA 2Y1WA 1QANA 1M6YA 2FHPA 2PX8A 5GM2A 1IM8A 3P71T 2G72A 3FPHA 5U4XA 1QAOA 1O9GA 1NW3A 3PS9A 3AJDA 2ZWVA 5EZSA 4RTSA 3M6WA 2C7QA 3DLIA 3TKAA 3R6TA 1IXKA 2GB4A 3P8ZA 4HSGA 3TPZA 1D2HA 1DCTA 3C3PA 3DMGA 2N47A 5GOZA 4NECA 5GM1A 4DF3A 1L9KA 2VP3A 5DM0A 4PGGA 3AXSA 5DLYA 2AOTA 3FRIA 2H11A 3EGIA 3C6MA 1RJFA 2O05A 2PLWA 1G6Q1 3LX6A 1NV9A 3TRKA 3BKXA 3UJ8A 4AUKA 1JG2A 4IKPA 4E32A 3ORHA 5EKXA 2XBMA 2FYTA 4E2YA 1M6EX 4FZVA 1I9GA 5E9WA 4BLUA 3BGIA 3P9KA 1SQGA 4C4AA 2HTEA 2V74B 4P7FA 4YMHA 3PX2A 2ORED 1EG2A 3KHKA 5C0OE 1EIZA 4ER3A 2B78A 1NW8A 3HVKA 2AOUB 3SSNA 2AOVA 5K0JA 2JHPA 2Z6QA 3OU2A 1RI2A 2AN4A 1VP9A 1HNNA 2PWPA 3MCZA 5EEHA 4R6WA 4B17A 2R6ZA 5E1BA 1AQIA 5M5BA 5K05A 3EPPA 1R18A 4QDJA 1I4WA 3O31A 1QAQA 5E2AA 5EZQA 4WXHA 3C3YA 4OBWA 2UYCA 4RYLA 5K0FA 1JSZA 3H2BA 3TLJA 4XUCA 2ZZNA 3NVKI 3P97A 5DT2A 5BXYA 2EJTA 5EMJA 5HIJA 4GBED 4GUAA 4MTLA 1NE2A 3NJRA 3QOWA 2IBSA 2GH1A 3OPNA 1WZNA 5HOQA 4U7TB 2XVMA 4HG2A 3UBTA 2VDWA 2FRXA 1X1BA 4HH4A 1XCLA 3UA3A 4G56A 3EGEA 1KHHA 1TW3A 3K6RA 4LECA 3UJAA 2GA9A 4YUYA 4DA4A 3BXOA 3OE4A 4LG1A 1O54A 2FCAA 2PKWA 1L1EA 1D2CA 2NXNA 2I9KA 5FQOA 1R74A 3GRVA 3TKYA 4PYQA 2ZBRA 3B3GA 1XCJA 3KQOA 1X19A 5KYGA 2ADMA 3PFGA 4GOMD 2JG3A 3KQWA 2NXJA 1EJ6A 1KYZA 2B9EA 4FSDA 3HVHA 1BOOA 2AOUA 3MTIA 3SR4A 4QPPA 3G8BA 2ESRA 3S68A 1NW7A 2OPBA 4PYJA 4RTNA 3T7RA 4GOND 1SUSA 4IV0A 3GWZA 3BKWA 3LCUA 2ZBPA 2P40A 2WK1A 3LDFA 1SKMA 3MCTA 1VIDA 3NDJA 2HNKA 4OA5A 4X63A 5DRTA 1UIRA 2AN5A 3QOXA 4YV0A 4HRAA 5CIYA 1WY7A 1XVAA 4BY9E 1KPGA 1WXWA 3UWPA 5DRYA 1UFKA 5E9QA 3LDUA 3TOSA 3HTXA 3DXZA 4R8RA 3HCDA 5DTMA 1XDSA 1X1CA 1YUBA 3EVBA 1T43A 5JUWA 1M0EA 4ER6A 2GPYA 3GRRA 3FPEA 3O4FA 4GOOD 3T7SA 2ZCJA 1L3BA 4RVFA 4GEKA 2YQZA 2ZIFA 5F2OA 4RTMA 3ERCA 1EJ0A 1TPYA 3HCCA 3PFHA 5LQAA 3NWEA 2IH5A 1EAMA 5EGSA 3DXYA 5HIMA 4QVGA 3ER8A 2VZ9A 2CWWA 1KPIA 1O9HA 3I64A 2PVCA 3FTCA 5EC8A 3EVCA 3THSA 1KYWA 2QRVB 3BWYA 1JSXA 3BUSA 3KQVA 3GIWA 3EVDA 3TM5A 3RIEA 4A6EA 4AZTA 5FUBA 4E70A 4BLVA 2B3TA 3G89A 3DMFA 3I58A 5FA5A 5EKUA 2ONZA 4QDKA 4FS8A 5HILA 4E2WA 1KXZA 2IDJA 1JTEA 3EEOA 1Q0TA 3NMUF 3GXOA 1JG3A 3KQQA 5CVVA 1NBIA 1P1BA 4DKJA 2F8LA 3BT7A 1R6AA 4BLWA 3G2QA 5K8VA 1FJXA 1I1NA 1VQ1A 3HA3A 3DP7A 5DM4A 2NYUA 4EK9A 5GINE 1DUSA 2ZTHA 3ELDA 4IV8A 1JR4A 2PXCA 1VL5A 3EMDA 5KQSA 4PYIA 2UZ4A 3GU3A 2CMHA 2BM9A 2ZFUA 4R8SA 1KP9A 1PRYA 3UJCA 1NBHA 4CKBA 1F3LA 2ONYA 2IP2A 5EMLA 4GQBA 5BW4A 2UYQA 4LWOA 5E9JA 2PWYA 3PB3A 10MHA 5LQUA 4YMGA 3EVFA 1JG4A 4YUXA 4MQ4A 2UYHA 2Z6UA 2QE6A 2WA1A 2XYVA 3FUVA 2JH9A 3SSMA 2P35A 2AVDA 3DR5A 3GCZA 3LCCA 1NV8A 2OB1A 2LD4A 3VC2A 4CKCA 2ZZKA 3M70A 4PNEA 2H00A 5EPEA 4M7RA 3B89A 4EQZA 1ORHA 2AOXA 1YB2A 2PBFA 4Z2YA 1OR8A 4RVDA 1G60A 3A7DA 2JHCA 3HP7A 4HTFB 3SXJA 3PTAA 2GAFA 3GJYA 4CWAA 3WSTA 5CVUA 2ZW9A 1AF7A 3E8SA 3KR2A 1X1AA 1ZGAA 2YVLA 4FT4A 5F2NA 3ELYA 5E1DA 5EG5A 2GLUA 2PT9A 4R05A 5D1NA 3HA5A 3KR1A 2ZZMA 3UJBA 5K0EA 1N7IA 3NVMB 3DTNA 1BHJA 2P3LA 3DLCA 5K09A 2PXAA 4YUZA 2EX4A 3HCFA 2ZSUA 4FSXA 4KDCA 1QAMA 5ICGA 3D2LA 5F2KA 4WVLA 3LSTA 1EQAA 2CMGA 2PV0A 1ZQ9A 3I5UA 1SQFA 2PX5A 3EEYA 3A4TA 5IH3A 4DZRA 1G38A 3NDIA 1DL5A 5ICFA 3MHTA 2G8NA 3REOA 3CVOA 3HEMA 3M33A 3OZRA 4CTKA 3CKKA 5DM1A 3DULA 5H02A 5FWDA 4FT2A 4E31A 3ELUA 4EKIA 5HZMA 2AR0A 2IH4A 3FUXA 2E5WA 5KVAA 8MHTA 4PWYA 3BWBA 3ANXA 2EFJA 4X1OA 2Y1XA 4MHTA 1MHTA 4CTJA 2FK8A 3FUWA 4EMSA 2JJQA 4QVKA 5FTWA 5CCBA 3HCBA 1X1DA 2QYOA 3Q87B 2IIPA 3DH0A 3LKDA 2HV9A 5E1MA 5FADA 4PIPA 3ME5A 2BZGA 3KPJA 3PLAE 2PXXA 3CJRA 3P9NA 4AZSA 4RTKA 3LHDA 5B1SA 4KDRA 3RW9A 4KVZA 4C03A 4PYNA 3KQSA 1R8YA 3LCVB 5CVDA 5G02A 2A14A 3P9CA 1JTFA 4CKEA 4ER7A 3VC1A 5IKMA 1YFLA 3LPMA 4Y2HA 5E1OA 2NNWB 3VSEA 5CVEA 5DX8A 5EOVA 3E7PA 3GRZA 4YV1A 3A27A 2I6GA 4BP1A 3KR0A 3R0QA 3OCJA 3KQMA 5ICEA 2JHAA 2HWKA 2AS0A 3FPJA 4QQKA 2C7OA 4KRGA 4BP3A 3BGVA 4UOEA 4QTUB 4KIGA 2NP6A 2I7CA 5DTRA 2ZULA 4ZTBA 3KPYA 3HVJA 3AY0A 5K0BA 3G2OA 3C6KA 2FK7A 4E30A 1BKYA 3HCEA 4V0RA 5K0LA 4C04A 3ER9A 5DTQA 5CCXA 1RI1A 3FRHA 2V7EA 4QQNA 2YR0A 1N2XA 4C05A 3TQSA 2P8JA 3NWBA 4XUEA 5GWXA 3M6XA 2UYOA 5E2BA 2O57A 3TFWA 3ID6C 1RI4A 3DXXA 3KPWA 5DXAA 5C9ZA 5ICCA 5LQCA 3K0BA 3A25A 3OFKA 5E8RA 1JQ3A 1TW2A 2DULA 3EVEA 1KR5A 2OZVA 3T0IA 2OO3A 5DM2A 1Q0SA 4IWNA 5BP7A 2XVAA 2OKCA 2B2CA 1XXLA 1R00A 2G70A 3LBYA 2IDKA 5KS2A 2PX4A 4K6MA 3R9XB 2G1PA 3EVAA 2B25A 3I9FA 3E05A 2IGTA 2C7RA 2ZWAA 4PGHA 2OB2A 2BR5A 2PSSA 4GF5A 1NW5A 9MHTA 3EGVA 2BM8A 3B3FA 5LQKA 3IHTA 3E23A 3MQ2A 3HCAA 3DOUA 3P9IA 3HVIA 2OBFA 1IY9A 5JR3A 1AV6A 5CD1A 5P8WA 4AZVA 5DWQA 5T6BA 5K03A 1AQJA 4OBXA 5HEKA 4GC5A 3L8DA 3T7TA 3UJ6A 2P7IA 2QY6A 2YX1A 3KQTA 5CM2Z 3GDHA 2IH2A 2K4MA 4V0QA 2G71A 3PX3A 2BH2A 1RJGA 5LQJA 3V97A 1R8XA 2I62A 3C0KA 1WS6A 3DMHA 3FTDA 3CC8A 3I53A 4M37A 4QTTB 1ZGJA 3FPFA 3U81A 3OFJA 4RV9A 4X41A 1VPTA 4X60A 2PJDA 2Z6AA 1BC5A 1Z3CA 3TR6A 3B5IA 4XCXA 1UWVA 2QRVA 1VLMA 3SX0A 4POOA 4ISCA 3UA4A 2AVNA 1VBFA 2YXLA 3LGAA 1ZG3A 4LWPA 4M36A 3LL7A 1NW6A 5FWAA 3DUWA 1NKVA 2ZBQA 4OQEA 3FTFA 3R24A 3LBFA 3BWCA 5LQRA 1XDUA 1WXXA 3KR9A 4KW7A 3GRUA 3OZTA 2OYRA 5GIPE 2QM3A 2YUIA 3HNRA 4MWZA 4P7JA 1U2ZA 3M6UA 2Q41A 4RX1A 3FZGA 2YXDA 4RTJA 5EHGA 2NP7A 4RVHA 4C07A 3HM2A 3IEIA 3OE5A 3CCFA 2ZIGA 3AWIA 5LSAA 3BGDA 3M6VA 4HGYA 3JWIA 4FP9A 4MIKA 4P7GA 4AZWA 5K0GA 1YFJA 4HGZA 4GOLD 4O29A 2FPOA 2NXEA 3EMBA 1MJFA 4CXMA 1WG8A 2R3SA 3FYCA 5EIFA 2PX2A 5EIWA 1KPHA 5HFJA 1SG9A 3JWJA 3X0DA 2NXCA 2VDVE 3ELWA 2EJUA 2VS1A 5CVJA 5FQNA 4RTLA 5GIOE 4KWCA 1N7JA 2CL5A 1FBNA 4HTFA 3PVCA 1XTPA 3B3JA 3GGDA 3KKZA 2IPXA 2P41A 5EMMA 5K01A 4FGZA 3FUTA 4RTRA 3OU6A 3OU7A 5E8JA 5FHRA 3UJ9A 4C06A 3EVZA 3B7PA 2KW5A 2O07A 4OQDA 3A7EA 5FHQA 1D2GA 3UZUA 4F86A 4PCLA 4ER5A 3V8VA 3IV6A 4JXJA 5DX0A 5DXJA 5LQNA 4FR0A 2VDUE 4E2ZA 4A6DA 1FP2A 1ORIA 1QZZA 5EQJB 1Y8CA 3JWGA 1YF3A 2O0LA 3CGGA 1JQDA 3EVGA 4F84A 5K0NA 1FPQA 3CJQA 3P2EA 2HMYB 3FPGA 3GRYA 3QV2A 4PYLA 1L3CA 3NTVA 3GO4A 1ZKDA 5DX1A 4DQ0A 2AN3A 4DM3A 3THRA 2GS9A 2P7HA 3MB5A 5BW5A 4PCAA 4PONA 5EMKA 4DCGA 4EVIA 3UFBA 1F38A 3LDGA 3P2KA 5MHTA 2P1DA 1HMYA 2PT6A 1ZHFA 2BR3A 3P2IA 1RJDA 2OY0A 1FP1D 3O7WA 4RWZA 4U7PB 4ER0A 4F85A 1P39A 5LR6A 3Q7EA 4E2XA 3PT9A 5DPMA 5HIIA 4RTOA 2WA2A 2P3OA 5FCDA 3LECA 3TM4A 3AXTA 4AX8A 2YXEA 3KPVA 4RTQA 1SUIA 3VYWA 1XDZA 2ZLBA 3SSOA 2DPMA 1XJ5A 4XUDA 1QYRA 5C1IA 2AOWA 5DSTA 2EG5A 2AZTA 5DSXA 1JG1A 1VE3A 2JH8A 3G5TA 3UJDA 5K0CA 1JQEA 4RVGA 4X61A 1G8SA 4H0NA 3G7UA 3BWMA 1SVUA
chains in the Genus database with same CATH superfamily
1XPRA 2ATCA 1CIJA 3I0NA 2X1HA 2M1ZA 4UHKA 1I1QB 3VPFA 3TTUA 1E9CA 5T67A 1E18A 4ZXFA 1W49A 4JV5B 1KO5A 4WOKA 3KTFA 1SVOA 4LHVA 2XD4A 1UZAA 4PZ9A 5IDXA 4Q4CA 4P5EA 5CIWA 4XPZA 2D2FA 3FYUA 3N5KA 3SMQA 1VPDA 2JAHA 4LBZA 2B36A 1P1KA 2ZSIA 4DCMA 4EZBA 1YOVB 3QVJA 4ENQA 1PNVA 4WH0A 5DHAA 4N65A 5JTTA 1G55A 1FK8A 2RJOA 2QBYB 4H15A 4EHIA 3BH6A 4RZQA 3TL2A 1T4CB 4O4JA 3OAAD 2ZSJA 2HR1A 1V0JA 4K81B 4R1QA 2SCUA 2IHZA 1SJ9A 4HEHA 1Q0UA 3AGPA 4PSVA 4S0XA 3PQFA 2VAPA 4D26A 1YUNA 4IWXA 3GGPA 2VBIA 4NV0A 1SFRA 1N2HA 2IYQA 4A27A 1TL7C 2PGXA 3G5LA 2WUFA 2IYYA 5AVYA 5TB5A 2KHZA 5C4MA 3K9LA 5B2FA 5IUJC 1W4RA 4LFBB 1KEPA 2QVLA 2ZBFA 4J6FA 4OA8A 4PIMA 4W63A 3L6CA 2JLWA 3MERA 4NY1A 3L02A 1VJCA 1E1CB 2AI1A 5FA8A 2CXNA 1YZ3A 2H5EA 5A05A 3B9BA 3M4YA 2HO4A 2WYIA 2QUAA 2ZE5A 3MM4A 4PPQA 3T3MB 3EPKA 4GW3A 2XKKA 2Q28A 4BTEA 3AR4A 2J07A 1RKBA 4GL4A 2JAPA 3A9RA 5C7OO 2AMLA 1GIAA 3EFBA 3L6RA 1D6SA 3B1KA 5FBVB 3GR6A 3FUCA 2FUG6 4IDDA 3VR0A 1IIBA 4RQUA 2IPMA 1Z4JA 4IQGA 2A94A 4DLKA 4PSAA 4FKZA 2DY1A 4L8WB 1VHTA 1XNRB 4HDAA 1ZM9A 2QEQA 2Z6VA 1YOVA 3QHPA 2WUDA 1M6NA 1UMKA 4KU4A 5SY4A 3GFFA 3NHRA 2QBYA 4LBWA 2P75A 2IEDA 4GAEA 1N0WA 1T4CA 3NH9A 4LMBA 4LRTB 4EGJA 5B7NA 3P9RA 4W9MC 2WYWA 5E9WA 1Y4AE 1P7VA 2N1BA 4PN7A 2BFAA 4C5BA 4FQ5A 4MP3A 3NNNA 1WDMA 2VATA 1HYQA 2ZJ2A 3BXZA 1NDUA 3GEGA 3RU3A 4CKWB 5AVRA 4EGSA 4FHZA 2AUNA 2EW8A 3ZWAA 2ODPA 3BRWD 3D6FA 1VE7A 1NW8A 2HF8A 1THGA 4FK8A 4NI5A 1U0RA 1V2GA 1AURA 2AOVA 3AJ8A 3AW9A 3N87A 4Y1RA 3SIXA 4HHEA 5ALUA 4DJJA 2Z3VA 1GSOA 3D8NA 4JITA 1E1CA 2G4VA 3ZWKA 4EI8A 2MYTA 5K05A 1KFJB 3KXKA 4I8DA 3G0GA 3FW1A 4O4IB 5DT2A 2JJ1A 1OYWA 1W2GA 3RHFA 2R86A 1Z6XA 3BTOA 4J4TA 4F6RA 2EX1A 2ZEJA 3T9CA 1JWAB 4TTVA 3MYYA 1O94D 2XRYA 4U7TB 3EMKA 3UT5B 3OOWA 1FUKA 3OZDA 4Q9LA 3VVLA 2YNMA 4NZYA 2QRGA 1IUKA 5EQFA 3HB7A 1SXJC 1JHAA 2XMSA 1N77A 2JL1A 5A4DA 4N3BA 1HR0B 5D51S 1L5RA 2OUIA 2PRKA 1WB5A 4EUHA 1XL1A 1LPOA 1OX5A 2IVZA 3JD2A 5JNLA 1L1EA 2F8SA 2OWDA 1II0A 1V8PA 3W06A 2VHJA 2X41A 2A88A 1OZHA 2B61A 2QSUA 3E9YA 2IUSA 4WLUA 1C7QA 4JVSB 2OD9A 2HPZA 2XCQA 2AXEA 2HIGA 3B3GA 4B9AA 4D6YA 7ABPA 3Q3VA 4CKWA 4Z99A 4G65A 4PSCA 3TNLA 1DLJA 2OBMA 1KR2A 3BDIA 3C3CA 3HU5A 3EN0A 2G0NA 3NKFA 1RBMA 4GOJA 4QPPA 4YJKA 3JTMA 2QSZA 3PUKA 3UMGA 3MTGA 1ZGGA 3ONDA 4YP0A 2FWPA 5AHWA 3S7TA 2Q3DA 4MR9A 1OFIA 2HMUA 3A3KA 3DPIA 1HX7A 3IPLA 3MXOA 1SKMA 1QIJA 1XMJA 4MXDA 3B1WA 2NO7A 3BGWA 2FMKA 2KB0A 3K1AB 4CQJA 4GSKA 4Z3OA 1U8AA 4EWLA 3DMTC 1Z6AA 2NNLD 3OEED 1R0KA 3DNMA 4TTIA 4EJSC 3IH5A 2A59A 4ZOCA 2WD7B 4OP2A 1KKMA 1N2ZA 1VFPA 4CKBB 3LDUA 4DWOA 1ISSA 2JI6A 3LY8A 4DLXA 4R8RA 3UT5A 5DN6A 2V1UA 3EVBA 1U99A 3D2CA 3HB0A 4Q4AB 1HG1A 2CVZA 4Q7JB 3W2HA 1QORA 1VGQA 1C30B 1O5OA 1WB6A 1OWLA 2BH9A 4HAOA 1G3RA 4JQZA 5SYNA 1ORRA 1TQDA 4MPTA 2XVXA 3A32A 4OI1A 4XWKA 3V34A 3PC2A 1ONBA 3IT2A 1P6XA 2ZP1A 4AMZA 4KE9A 1QP7A 3NWEA 3P96A 4H0CA 1E77A 4G9BA 3CHYA 4DYHA 3TIXB 4QPCA 3IT3A 2N75A 4A6EA 2JLAA 4XASA 1VYHA 1BNCA 1RAIA 2G76A 2I6TA 4YQYA 1T0BA 4TSKA 5FUBA 3FMVA 1U3FA 2JA2A 2ZRBA 4FNAA 3REQB 3QOFA 2RHBA 3ZU3A 4BNIA 3EGDB 1FYXA 4M0KA 1SOAA 4L73A 4RMHA 3LUHA 3C85A 2OC9A 1TA4A 3OIFA 5EN4A 5K3CA 4DPMA 1MW8X 3B36A 1IN4A 1N1GA 4JEUA 4BQIA 3TLCA 1OBHA 2H5LA 4YRFA 5JJIA 4OHXA 4Z9FA 3WB9A 2PRZA 3CF2A 4F4IA 3AI2A 4KR6A 1ZK0A 1YRLA 2QL7A 4ZVVA 2WD7A 4MCHA 4RF2A 4CKBA 2ETVA 3EDOA 2X7XA 1OQAA 4MPJA 4YONB 4GQBA 1O57A 5AR1A 4JLBA 2KPOA 1A2QA 4IICA 4RHYA 2OHJA 3R0JA 4Q4AA 4IDHA 1BDHA 1SU8A 3U2QA 1JHOA 1Z08A 1C30A 1R4AA 1L5WA 3FA2A 1O5TA 3IVGA 3SSMA 3BCHA 3ENWA 3S81A 1IOLA 1NUPA 3CVYA 1Y1TA 2LD4A 2MCFA 4CM8B 1GG5A 2P6RA 3OECA 4CV2A 2A0FA 1CUXA 3CW8X 1SG6A 4QGHA 2QSJA 2F3RA 3DEFA 4GP9A 3C3KA 3VR2D 1OR8A 4G8CA 1LX6A 3UH1A 4XGIA 3JAWB 5AI6A 4K1XA 4FDMA 3OPXA 4H7HA 2ZW9A 5CVUA 2B83A 2INGX 3REQA 1ZGAA 1KO4A 5IT9A 2H3HA 3MRXA 2ST1A 1JIVA 3E8MA 3EGDA 1TNDA 3OF3A 1NHWA 2WTMA 3R7SA 1T1SA 4CF5A 3R5HA 5EJ7A 4RFVA 2VSNA 5A7GA 2WNHA 5JVDB 2ZK7A 1K9SA 1DIHA 3L8CA 1VSBA 2CEKA 2WRZA 5TARA 3D0OA 3WZLA 1TFRA 3HR8A 4DUYB 4RWEA 3CLUC 3D2LA 3VH4A 2J8ZA 5ICGA 1YKFA 2F7SA 2J9XB 4UBKA 2Y1EA 1T13A 3L49A 1JI0A 5P21A 2PQ6A 5HCIA 3EEYA 2F3QA 2V9ZA 2OQRA 2HXYA 1ST3A 3LPAA 2NWQA 4KH0A 4MIOA 4REQA 1SRQA 1I36A 4TXMA 4ENPA 3I34X 1CQZA 1PTKA 2JFFA 3HB5X 3PEVA 4MK4A 2VBFA 3X1YA 2C00A 4YC7A 2IDMA 5CRIA 3KK0A 4QSMA 3ELUA 2XEXA 3WLPA 3UJNA 3LBAA 2FQWA 3WQHA 4KO1S 3AT1A 3T06B 2IEYA 4CM8A 1RHJA 3PL5A 5FI5A 2IW3A 4ZAYA 5KWJA 2EFJA 3VSDA 2DFTA 1N1MA 1P0QA 2FK8A 3EIFA 3FUWA 3HJRA 3KS9A 3PZRA 4O2LA 5TV2A 4AJPA 4HN4B 1V8DA 2Q4OA 2Y66A 3JAWA 3GLKA 5I4IA 1X9GA 4Z3KA 1R9MA 4D92A 2CLKB 4A15A 3LD9A 4JB8A 1SC3A 4RPKA 3ER6A 3P9NA 3RREA 3E2MA 3HXOA 4C2TA 4A1OA 4YCBA 3A6FA 1UBJS 3RQIA 4GEGA 1UUFA 1ZKMA 2VJKA 3RSGA 5BV8A 5IKMA 1I33A 5E3JA 1FRZA 1H6BA 2QW1A 3IP9A 3K0CA 5DX8A 4ALIA 1YR2A 4CFSA 1DMSA 1X94A 2I6GA 4OV6B 3KM0A 3DKRA 5TMEA 3KQMA 4QFDA 3W1VA 2XPCA 4UATA 5FT9A 1H0HA 2ZVDA 5D6OA 4MAMA 2IS1A 5BUSA 1I3CA 1Z62A 3EYAA 4N5HX 4KRGA 3SJUA 3K8OE 2A9QA 4ZYWA 3L6UA 1JPNA 1ZJ6A 3I04A 1BIFA 1EMDA 2AE2A 3AY0A 4YLYA 3IBFA 2W71A 3K5HA 5K0LA 3WHPA 1HDZA 4C7BA 2ACEA 1A9PA 1RYNA 3WLTA 1Z4KA 4W82A 5L3RA 4E22A 2VH2A 2WUGA 1FQWA 1BE8A 1QC5B 1V47A 3BULA 2CL6X 2P8JA 3PUXA 4JA0A 4JUAA 1TGVA 2Z08A 1JFFB 4KMMA 4XUEA 4C4TA 1TXGA 3ZGYA 2HLDA 5J3JA 1K98A 1E7WA 2ZB2A 3FBGA 3HYCA 4Y98A 4YLGA 1JLLB 2QVZX 1FPMA 4B4KA 2A9OA 4UQPA 2LZ0A 1L5KA 2B20A 1NULA 3CWZA 4IWNA 4PPFA 3OP1A 1Z8NA 2O8CB 1X42A 3KVRA 3F7NA 4TKUB 4DLYA 3VO1A 3AVPA 5IG2A 1GU0A 4ZYZA 2ZDHA 1RHKA 3QVGB 3SCZA 3EVAA 4KMOA 1JJIA 2EC5A 2IGTA 1EVEA 3FXAA 3Q9LA 3GGJA 3H1TA 4HAXA 4K05A 3HCRA 2CUNA 1B3BA 1CG6A 1NZDA 1GCGA 1Q5PA 3AJRA 1FZTA 5HUHA 1GQOA 3EGVA 4AY3A 4PLGA 4PC7A 4JMPA 4EARA 3S40A 4WN3A 3HCAA 2QQ0A 1EVKA 4UVGA 3LLVA 1IY9A 5FXMA 4I55F 1UKCA 4W5JA 3QEOA 4YXFA 1WDLA 4D8UA 5LMZA 2PJZA 2XUDA 2QAIA 3BIJA 3U62A 2GPNA 4RSMA 4C4YA 3I62A 3T7TA 3NPAA 2WB2A 1RT9A 3GJTA 1M9NA 3EC7A 3KQTA 4KH1A 3TQFA 5JQWA 2W2PA 1TZKA 1TGYA 1ML3A 1QC5A 3TX2A 1I10A 1DIAA 3W5IA 1JFFA 2GX6A 2BLNA 4D9MA 5EJ8A 2CC2A 2QZSA 2QX6A 4Q66C 4ZRDA 4ZZ2A 3NALA 4QDTA 3EZFA 3WYFA 4ALLA 4U7JA 2V6BA 2YH2A 1CYDA 1QHFA 4PVDA 2F8TA 1NNUA 1P29A 1RRFA 2HOQA 4KAFA 4FN4A 1QPBA 2VQSA 3KLNA 4TYWA 4IVNA 4HAUA 4FGUA 5J47A 2O8CA 3IUYA 3AUKA 1PJQA 1PVVA 2C3PA 4TKUA 3I9JA 2JJYA 3V32A 1GZDA 3IKVA 4OHWA 1QB8A 2ZRJA 3BCRA 2PYZA 3QVGA 3E7DA 3OIWA 5FWAA 2ILVA 4US0R 4TLCA 4CM7A 3HH8A 5L3VA 3SDSA 4FTWA 1JDPA 3EXG1 5FWXA 3ZCPA 3NFYA 4M87A 2N3ZA 4D42A 1T6XA 4G85A 2WU4A 1XDWA 3GRUA 5LZ8A 2XNDD 2OFWA 2XB8A 1ISRA 2XRFA 1XMIA 4LPSA 2OO5C 5TC4A 3F67A 3TJMA 3IQIX 4P0QB 3GJXC 3H2YA 4J3FA 3M3DA 1CS0A 4MX8A 4QU8A 3V4SA 1L5YA 3CCFA 3OOHA 4EI9A 3D9QX 5G4LA 3WV5A 8LDHA 5JS8A 2ON6A 4GLFA 1KVUA 3NTUA 4MKZA 4AZWA 4AURA 5C53B 1SVKA 5ES4B 3HYLA 5ITWA 2SNIE 3KHUA 5DOZA 1MJFA 1ZD2P 4ZYUA 1EEXB 3M83A 1PJ3A 1TLFA 1BXZA 2VWHA 3GDWA 4M7OA 4NBNA 5BWBA 3TSCA 5MN6A 3H4TA 1JB1A 2VTVA 2H48A 3NC4A 4FE4A 2WSBA 1GZUA 5K0ZA 2FN7A 3LP6A 5JDCC 1KDVA 2C5BA 3CXUA 1T2VA 1CY6A 2GZ3A 4GYYA 2CHEA 4KWCA 2G08A 4CCSA 1E6EA 2VKQA 1XJWA 3MEQA 3BL6A 3CN7A 3HBJA 4YT4A 4A10A 1IXRC 2YZ7A 3N0VA 5IULC 1P7YA 3RYTC 2WFLA 4DA6A 1FX1A 5BR8B 3MJ4A 4CLRA 2QF7A 2CDCA 3ZCXA 4AY6A 2Z2ZA 2WSLA 2LRHA 4UNIA 4LSMA 1CUGA 1T6NA 3B85A 1MX3A 3EQ8A 3OI7A 1XRMA 4DADA 3E35A 4PYLA 5IJAA 4AUMA 2DY0A 5ECYA 2ZTVA 5FTMA 5BNWA 4IJ5A 4ZA2A 1AGPA 3PWKA 3GZJA 4NZ9A 3THRA 2OHVA 1PKXA 2R79A 2OO7A 3TYXA 4W7IA 1Q74A 3AC0A 3AY6A 4Q03A 3BF8A 5KVQA 1OGIA 1YCDA 1DBSA 1HMYA 3R3UA 5THKA 3CX3A 2A92A 5AKGA 3ESAA 2CF6A 1G6HA 1KC3A 4Q00A 4ZO6A 3UW3A 3FWYA 5LP1A 5LR6A 4ML3A 4N3NA 5EMHA 4QA9A 5ALXA 3SYKA 2P8SA 1QH9A 1EUDB 2W83A 4FDVA 4LRSB 5A6SB 2CY0A 2O5CA 4MHOA 4A2WA 3C6BA 1YI8A 4UU7A 1ST2A 4AKSA 3DCNA 3AUSA 1KDOA 4Y7DA 3FCCA 5DGTA 5KU1A 2GM4A 1AK1A 5K0CA 2KE5A 4DSZA 2BEUB 2JEZA 2EWMA 1P0CA 1Z2EA 1G8KA 2H7YA 2P4EA 2Q3FA 2VJMB 2ZIZA 3DL4A 4LYDA 1KI7A 4ZCQA 3UAOA 4D9GA 4YUWA 1TEZA 1OZGA 2QQFA 4QYXA 2OD7A 2IBTA 4Q3DA 3UJPA 4X7BA 2VYNA 3V1TC 3NWJA 1LTKA 1OT3A 2DWPA 3KPUA 4K6FA 5DHUA 5I9TA 3WRWA 1DDGA 5JARA 5CJJA 3Q8WA 1OMOA 4DJTA 4NBLA 5AOCA 2WSIA 1E66A 1NGSA 1TIPA 4OX9Y 3SM3A 2PG3A 1U6IA 3QBJA 4D0RA 1TK2A 1ZD4A 4NBTA 3B52X 2OD2A 3KJNA 1DJLA 1ISFA 3ROTA 2QYHA 1UANA 4B40A 2PHZA 4P3XA 3PEYA 2Z2JA 2GRAA 2R87A 1GFZA 1NT4A 3HYSA 5BRNA 2G25A 2P90A 3DCYA 3IP5A 1JFLA 4M38A 4U2FA 4UMFA 4UUNA 4V39A 1INLA 1MNAA 3JQ8A 3DCIA 3VDQA 1F0NA 5IAOA 5LQDA 2C03A 3BILA 3DC7A 4WCDA 4M2LA 4BVHA 3I73A 3DT9A 5IYZB 2V59A 2A35A 4KO2S 4P58A 3VTKA 4WZ6A 3WB2A 3WLNA 2HUPA 3ZNNA 2I99A 2NZWA 2FUCA 3F8TA 1GU7A 3CNOA 5TRTA 2CMKA 3A9VA 5EEGA 1BD4A 1NURA 1Y6ZA 2AH5A 2YWBA 3D0RA 1CD5A 4J0CA 5ED0A 4MO2A 2HSGA 3KOWA 1W73A 3TQOA 2J3KA 2JLBA 3KYJB 4MYSA 4EI2A 1ENZA 1SBIA 1RAAA 2BEUA 1GD1O 5KQGA 2OFXA 3RUPA 1A4IA 2VJMA 3R3SA 1BSVA 2R44A 1JPUA 3GJ0A 3KV1A 1FYEA 5GM2A 3UXEA 2RHOA 1QAOA 3I1YA 4EABA 1RACA 4NARA 3FSRA 4N8EA 2VH5R 4Y2YA 2NO4A 3D3NA 2PU5A 2R6GA 1HDCA 1TYBE 5GZ1A 1N0VC 2R6AA 4R4JA 4XWOA 1PDWA 2ZS9A 4UW9A 3WAKA 1QYWA 3PCRB 1T2DA 4FB5A 1KDTA 1W75A 4AWAA 2FP4B 2OTCA 3ORHA 2R8XA 3TE7A 3QPBA 3ZBPA 3VHXA 1ADCA 4K28A 1PD1A 3IXQA 5KHLB 1UJMA 2Z3ZA 4NNJA 5LXTF 1UBUS 3OTWA 2O8BB 3L0CA 1NVDA 2KSQA 2W42A 4UARA 1P8JA 1AUPA 1R0YA 2Q5IA 5IYZA 4OHCA 1I13A 3NHZA 1QVVA 3V8EA 3DZ8A 4JGIA 1F7UA 1JI3A 2Q3CA 1VP9A 3N74A 5LB4A 1RKUA 3GEEA 3WRXA 2BDTA 1IN5A 4D3ZA 3FGOA 2UZ3A 5M5BA 1N8TA 5EZQA 4PYRA 4RIHA 3IE1A 4HWTA 3HDHA 1P1FA 4MV8A 3H2BA 2ZXUA 2BTQB 3HJTA 1E4YA 2DBRA 4YDSA 4OUDB 1RM0A 3ZWBA 2ZM5A 1C8KA 3SE0A 1JFSA 2VXOA 1EK2A 1QO7A 3D1VA 4MA4A 1ZICA 3NVAA 3UV7A 5CFZA 4J9VA 1QHNA 2FRXA 2J30A 2ZOSA 1XCLA 2QTZA 5EI5A 1Z0UA 1O0CA 2VH1A 1GPLA 2IZ6A 4YRPA 3QELB 3EFHA 1LEHA 4QXQA 3SF8A 1GZ4A 1R6VA 3BFPA 4LC0A 3ZR4B 4F9TA 1QRAA 4GBMA 4H60A 2FP4A 3CLTC 1JIJA 3S3TA 1ZN9A 2DTEA 2VUIB 2YS7A 2ZBDA 3IDFA 5BV2P 2VP2A 3QPAA 4B0OA 5JXJA 1E3WB 4RY9A 1HNXB 2WUWE 2ZU6A 4L6CA 2O8BA 4NYJQ 1PTJC 4F4JA 2HSDA 1UFRA 3CUUA 5CD9A 2NXJA 3GT0A 2Q21A 2WIFA 4BMCA 2Y67A 2BJHA 1PQPA 4MVCA 4ZKDA 2WU3A 3DVLA 1IY0A 1R50A 1Z4MA 3CNEA 4CQMA 1R9GA 2VIIA 1NBEA 3ONFA 1IDN1 4YV0A 1PBTA 1GPDG 2JKYA 1G18A 2BTQA 1T5BA 5E0OA 3KWFA 4DKXA 4OUDA 2Y92A 1PZGA 3GJ5A 1BYUA 1V9LA 5CM8B 3OY7A 4QEKA 3MS2A 5E9QA 4DSOA 1GITA 4KMSA 4KQMA 4D9CA 1MN6A 1EK5A 3GCDA 2O5RA 2PPLA 1M0SA 2ZTSA 3BXXA 3HCDA 3Q10A 4GYKA 1XQWA 4P4TA 4E09A 1YUBA 4YMWA 1MO3A 1U8XX 4C0QC 5BVGA 2IX3A 1TJ5A 3NONA 1BG6A 1ZWLA 3G68A 1EGAA 5JG7A 4Z1OA 4CQNA 1K8XB 2ZATA 4KN5A 3T7SA 1NNEA 2JLQA 2ZCJA 4JB3A 3T4EA 3T38A 2XB6A 2J9GA 4IBOA 2DETA 1TPYA 3DVRX 4B6QA 3MWYW 1VL6A 1D07A 1RLJA 1Q20A 1LV7A 2XV1A 5KYXB 4HNVA 2D6FA 3LLMA 1R1DA 2VZ9A 4FYPA 3ZHUA 4HN9A 2PMKA 2REBA 1DZIA 4CF3A 1SCKA 2GD0A 1E3WA 2IH5A 2OMEA 4KPUA 3KELA 4JUCA 4P4GA 4KQ9A 1Q92A 4U7FA 5CYFA 1KOJA 1G6KA 1MOQA 1DKNA 1M8PA 1PKEA 4B31A 2JH3A 1KXZA 1CFJA 3S1AB 4Q3OA 3KQQA 1P33A 1GTZA 1NTRA 2P2YA 2XWJI 2YIDA 1IHUA 3OT5A 4I08A 1PNOA 4LTNA 3ZI0A 4EY3A 1U9JA 1EAYA 1A1SA 4TTSA 2NYUA 3UPDA 5KTKA 5KOHB 4LVCA 3O83A 4N5NA 4ZVTA 3C7CB 2WTAA 3PEFA 2V3CC 1U0NA 4R31A 4YECA 1AHPA 1I14A 2ROQA 3FWZA 4ZQGA 2DFPA 4RENA 2WHRA 3TDMA 3IEPA 1DEHA 2IY8A 1V11B 1XRPA 2Z8YA 3GY0A 3QVKA 4J2OA 4OGWA 4YCSA 1OA1A 4M8KA 4DBLE 1AKYA 1EXMA 4B6FA 4GM1A 3QE4A 2UYHA 4MVJI 1U28C 4DV5B 4LDRA 1DZ3A 3S1SA 4N03A 1SBZA 5KBYA 2PMCA 4H1HA 3CONA 4YX9A 1LSOA 3C4QA 3ILHA 1TOAA 2C2OA 4M1OA 4LJ4A 4M7RA 5KYXA 1SQ5A 3MBKA 1W88A 2R60A 2ZSEA 5B7GA 2IE0A 4GZMA 1G60A 2JHCA 2IIQA 3PTZA 1RXWA 3ZY3A 2DWCA 2JRLA 3IBGA 1GQYA 4JXXA 3M34A 3HN7A 2CWDA 1HK7A 2RHRA 3C98A 1RQPA 1W5TA 3DAGA 4D7AA 1QU3A 4LQ4A 1VHLA 2O8VA 2PAFA 2PZBA 1U0LA 2QD4A 3WFJA 5KEIA 1E4EA 3JD0A 5YASA 1JAXA 1N7IA 3F2VA 4DXDA 1XPUA 1F1BA 1X8XA 3G02A 1ICEA 2XADA 4MWBA 3HCFA 3D59A 5J5AA 16PKA 3KZKA 2W93A 1H2ZA 4B3SB 4CKXA 2GJ8A 4WVLA 3L7BA 4L8YA 3L7NA 1AKEA 3SBOA 2FFRA 2FLVA 2O2EA 1CUAA 4IUYA 1O3YA 4MW4A 2VZEA 1V11A 4RM2A 2Y4OA 4FFWA 4NMWA 1KOLA 4HT3B 5J2TF 1I3OA 3NDIA 3IAXA 5EE0A 1VSTA 2FFJA 3C6YA 3ESZA 4FWTA 1OGJA 1F4PA 1YI1A 3IT0A 1J2TA 3HZOA 1WKVA 4AXXA 4ZTUB 2I3AA 5H02A 1E2DA 2CLIB 3VZSA 8MHTA 2P5YA 5CT8A 1Q15A 1C0PA 3SXUB 5KVAA 1TAGA 1TTTA 4XEUA 1OROA 1DEKA 2CFTA 4RPLA 2EFDB 3DZBA 3HS3A 4CTJA 4M9RA 1QGED 2QW0X 2ZJ5A 3SHTA 3QUTA 1QTNA 3QNWA 3IIIA 1RWMA 3NB0A 1CQJB 3CVJA 4RK5A 4OI2A 3QENA 2IYSA 3HU3A 1VMDA 2YY7A 4QTYA 3ZVMA 4TRJA 4RTKA 4BJ5A 4M9ZA 2O1SA 2WT9A 3RW9A 5JAHA 2UZ0A 2FQYA 3OQ1A 1P7CA 5CVDA 4WK6A 1BDBA 5G02A 1Q11A 3TW0A 1GTMA 4DIEA 5J2UF 1RKVA 1Q16A 2JCGA 2NNWB 3MT7A 3O93A 3B9QA 1ISPA 4KQGA 4TZTA 3R7WA 5FO0A 3VISA 4FDAA 4FPXA 4AFNA 3PNLA 4AWXA 3KR0A 5KWIA 4GMHA 1QO9A 2JHAA 3UY4A 1OU4A 4XM0A 1R15A 1I7SB 2I22A 5LWQA 2CB9A 1NI4B 4BP3A 2VTEA 3SFZA 2UYGA 3V80A 4RL6A 4JH0A 3ZY4A 4A8TA 5EYPB 4C3OB 4N76A 3DMYA 1I3KA 1ACJA 5A71A 3ANSA 5IBPA 6YASA 5JQGB 3RC1A 2R1VB 2GERA 3T15A 1L8LA 1NMEA 1NVBA 3DOCA 3ABZA 1GOTA 4XYBA 4Y1EA 1R4ZA 1RC0A 4OD0A 3RDPA 3I52A 3ZV3A 1HYEA 4KKXB 5LYJF 3ID6C 4PO8A 4ZAFA 3KPWA 1MA3A 3TOXA 3OLYA 4TYNA 2V45A 4HQKA 2NZJA 3ELBA 4BWGA 1K2WA 1I4LD 2BGIA 2P0AA 3IAS1 1CQJA 2R0QC 2OO3A 4JEHA 3ZHOA 2CYBA 2A9FA 2AW3A 3IDSA 4KLRA 4X0EA 2BW0A 3DZIA 4CQLA 4K6MA 1XT6A 4MCJA 3VNQA 5L8VA 3R9XB 1GKUB 3K05A 4PG7A 1DINA 4ZQHA 3SF0A 3ZU4A 4IG9A 2H08A 4P22A 2JI9A 2V97A 3F74A 4GPAA 2IYZA 4XYMA 4NBVA 4C7XA 3QLJA 4D02A 5TSDA 1QGUB 3LT5A 1JVSA 5DBHX 4RJKA 2DUUA 3LPDA 4QUIA 1RZRA 3QMVA 4RPCA 1HXHA 1H3NA 1M2NA 4J43A 3T7AA 2I76A 3MTAA 5A5EA 5MN5A 3U4QB 4AAYA 1AV6A 2QUIA 2WP8J 3TSOA 2PS1A 2CBXA 3KEOA 2WBLC 3H11A 1DC6A 3AY7A 4G0YA 5EYPA 4MW2A 4CM1A 5CG1A 4JI5B 4NV1A 1QDEA 1R8QA 5JQGA 1POWA 2FWAA 4OLBA 2C9DA 1CRLA 1RVDA 2CN1A 3UH0A 2GF9A 3GDHA 1REQB 4FGWA 3VR5D 2BMDA 3DHEA 1FJ2A 4MIYA 4BO4A 8ADHA 2BGRA 3RUHA 5TIIA 1Z33A 4JCOA 2E4VA 4XB1A 3B12A 5F64A 3SQOA 3NIFB 3NASA 1Z7EA 3K70D 5C1PA 1CETA 3OJWA 4FZ3A 4GKAA 1JKJB 1HLGA 4PZ0A 3LFTA 3UF0A 3GDGA 1GYPA 5GZ3A 1KI2A 3ADDA 1Z2NX 3WLSA 1RU3A 1Z88A 2OCGA 4YRDA 1SB8A 4KXQA 3JYQA 1I51A 1H8HD 1TF7A 3SBXA 3NHFA 3UA4A 4DLTA 4PX3A 5LPNA 4PLPA 3R9XA 1BTOA 3ZI4A 2TMYA 4D4IA 4Q3KA 5FR1A 3FI9A 4ZMRA 3BWCA 3NBQA 1T8SA 2Q1UA 2YIJA 3SICE 1YVPA 3MAAC 2GILA 4BQPA 3JVIA 3PFIA 2CHFA 3UO8B 3G0HA 1JFRA 2QROA 2F59A 4LA4A 1C7FA 2OCAA 2Q41A 2O2ZA 4GZ3A 1NVXQ 3TMKA 5DI9A 3TZQA 3U4QA 2C4KA 1L7PA 2Q2VA 3D2BA 1DUVG 1P3Y1 2P2CA 1E32A 2VYCA 3M6VA 3IVRA 1PYDA 4YAFA 4KR7A 1CQPA 1CUJA 1NIPA 3ZXYA 2G9VA 3OHSX 2FLKA 2VKTA 4RV5A 1TLLA 4EL5A 1NVKA 1D2AA 1REQA 1CUBA 2L69A 2NSYA 3TNFA 4DYDA 3GLVA 5FKJA 3F47A 2FSSA 2ID9A 3WJ7A 3B6IA 1NW4A 5E6RB 4WADA 2I3GA 4DLLA 2A86A 1MAUA 4WINA 5BT8A 1G63A 1VLHA 2FUKA 4Q3NA 5CGQB 1W36D 1O87A 3TNDA 4DR2B 2FRDA 4CR8A 2NXCA 1JKJA 5FQNA 4D9KA 4LNUA 3ZWYA 1ZUHA 2FOXA 1FFXA 3W9YA 1XLTA 1UQRA 1LZLA 3KJHA 3B3JA 4BL5A 1P4AA 1Z2CA 2QGFA 4XVUA 1OCEA 2WUEA 3Q2KA 2QRJA 4HBZA 2Y3IA 1G2PA 4TMXA 4XIJA 1T5TA 3ADPA 5B36A 1EDEA 1QU2A 1Z6GA 2O07A 1U98A 3GFVA 4P1ZA 3PDIB 5AM1A 1EFKA 3L84A 1PG0A 5FFMA 5CYOA 5IAGA 1TECE 4QELA 2NUBA 2WJWA 3MT0A 2FE4A 2H1IA 4GSYA 3UKDA 4OEHA 1FPQA 4PAQA 3BYZA 4JBHA 4D5GA 2I4IA 1OXBB 1VE9A 2BDEA 3WTBA 5IJZA 4LZLA 3LK7A 1U8FO 2ZJOA 4DLZA 4PZUA 5IDWA 3ZCSA 5IH7A 2ZAOA 1ECGA 3G7SA 3MTDA 4Q01A 2GHRA 5CURA 3SHVA 4AKEA 1FOEB 4JBWA 3OFND 1H5UA 1L5MA 1M2EA 1FP1D 3SQXA 1AS2A 4N7MA 5U4QA 4CEJA 5DBIA 3B78A 4M1SA 4E2XA 5E6RA 2UUPA 1W30A 4YHBA 5KTRA 5FJJA 1I5RA 1AXRA 2VNJA 1RWOA 3O84A 2ALJA 1SKUA 3A58B 4KWEA 4IHJF 1WCIA 1Z3IX 5ALHA 2ZVQX 2QN6A 4AX8A 1RABA 1ZL0A 4DVGA 2P4QA 1PQWA 2BLLA 3BSYA 3EZNA 5H0IA 4CJXA 3TXAA 2OHHA 4F06A 4JFAA 3I9LA 3A8TA 1CW2B 5BSGA 2DFNA 1ZEMA 1JWBB 1LQUA 5FOXA 1PL7A 2VJQA 3LZCA 1JIIA 4PFKA 4WESA 2GRUA 5EIEA 2DBZA 1UMDA 1VIMA 1QZ3A 3EG5A 3MGGA 4E5YA 2XYRA 3JQDA 1FFSA 2QV7A 2R7KA 4NIMA 1U90A 2YIMA 1YFZA 3GRPA 2PUTA 3PGVA 4G89A 5BUQA 3PDIA 3GVPA 4DILA 5KPJA 1B23P 4HRYA 2NAPA 4XYLA 1H3EA 4EHBA 3S5UA 3UHPA 1KSHA 2G77B 2YTZA 1RTTA 3JZAA 4L6AA 3WHKA 3FTEA 3RODA 3ITDA 2QL9A 1FTQA 3U13A 3BAZA 4PQEA 3SJAA 3E7WA 3PNOA 2XWBF 4N0EA 4NAHA 4ZDIA 5M34A 2VA9A 5JHGB 1SU7A 4IYRA 3QWHA 3IAAA 1A9QA 4TKLA 1O5IA 3KU1A 2JIBA 4EJSB 1HZZC 1E4OA 3QFRA 3FR7A 3HA7A 3H2GA 4PFJA 5CVCA 4F1KA 2O2IA 1G41A 3QHAA 1QVAA 3ECCA 1S4MA 1TQ4A 1MZVA 3JWHA 3ZLJA 2CLCX 3N2YA 5EMNA 5F5LA 3C74A 4C08A 1EP1B 3M2TA 1BXKA 3NBXX 4QBGB 2OV1A 2GEBA 3AEXA 4PRLA 2OORA 2PRIA 3FVQA 4M0MA 2BKAA 3PPXA 3EHDA 3LTEA 2BEVB 2DFKB 3QQ5A 2KQUA 3EVNA 1N9GB 4IMJB 5B3LA 1E5LA 2CW5A 3D02A 3LGSA 4RM3A 2C5GA 2PMEA 3SFTA 2EJCA 1AA9A 1GSIA 2I1LA 2FEWB 4LGVA 4XRRA 5BW4A 1ICIA 3MN1A 1K1EA 3NHWA 2AKYA 2XMPA 3OX4A 3EFEA 2G72A 4IX1A 4YMLA 1L7BA 1XZLA 4L22A 1CR6A 1O94C 1AHIA 3V1KA 5A4MS 3NIGB 4MROA 5FLYA 1ONNA 1YS1X 2ATXA 3ZNOA 5ICMA 2JIPA 4BGIA 2XD9A 1DCTA 4JT8A 2XF2A 1KIFA 1HT3A 2N47A 1OFVA 4DNFA 1JU3A 4TLDA 2QNBA 3VC3A 5EJ2A 2VN8A 4K2AA 1UKVY 4JHXA 4K40A 3PC8C 4IKEA 1R27A 5CCEA 3DEAA 3RFCA 1TC1A 2CXSA 1PFQA 2HSWA 4HS4A 2XUOA 1QE0A 8ABPA 4BYGA 4PXSA 1P0MA 4A4DA 1HE3A 1G8HA 2AFIA 3EIQA 4TROA 4C4AA 3U9SA 3QA9A 2P4UA 4PRYA 1BHQ1 4KGZA 5JO9A 4HQRA 4TS4A 3W6UA 3KHKA 4Y2RA 1TZCA 3AM5A 3T1VA 1YJXA 4XLTA 2QR3A 1BGWA 1Q1BA 1VIYA 4A82A 1YCGA 2VSOA 4BRWA 1P7WA 3AF5A 5K6TA 1KQNA 5AO9A 4RHCA 2OCBA 3LMKA 5JD5A 2BEVA 1EYZA 1ND5A 1R18A 3LGXA 3LY7A 1ZK2A 1N9GA 3F1KA 4KN9S 2EW1A 1IXYA 2DLCX 2BI8A 2VNAA 4N8DA 3EUWA 2FPRA 4K9QA 1CRZA 1V4VA 3JTEA 3NJRA 2R1TB 4M6WA 2IBSA 4ETWA 4Z7JA 2PD4A 1UBFA 2Y8EA 2G4LA 3NX4A 2AXQA 5DEOA 1RMQA 4U3JB 1E1RD 1MENA 2JW5A 3PQ6A 4KWTA 3HDVA 4US2R 3KQUA 5HZHA 3P4UA 1GR1A 3RUAA 3O1LA 3TFQA 3NOXA 2P62A 3U7FB 2AFIE 2A4KA 1K66A 1C1XA 2V3WA 3BD8A 4V03A 1RPTA 3N2ZB 5KNCD 1ZN2A 3BXOA 3FWNA 4Y2TA 4DA4A 4Y9UA 1A97A 5A1TA 4Q1VA 2I55A 4UTZA 3EK2A 3USCS 4KCGA 4AP5A 3EX7C 4OGKA 1HYHA 2DPXA 4JBNA 4YRTA 1V7CA 1TTHA 3WDKA 3T7DA 2YWRA 3MTQA 3K8YA 4ZDJA 3N58A 4UVHA 4XWGA 3LC0A 4GMGA 3NTQA 1UPCA 2BE9A 2WOOA 4HPXB 2CB0A 2CJYA 4RYDA 4ARVA 2HA0A 3OTIA 1JS1X 4EENA 1N92A 1N8NA 2O0MA 2VDOB 1FE8A 4ZT3A 4TQGA 2FSVA 4BNWA 2GK3A 3QNUA 4IQ8A 5DRTA 4A9AA 4JLUA 4J76A 1LVUA 4RK1A 4EYKA 1WXWA 4EG5A 2O6LA 3SVLA 2R1TA 1LA2A 1QBGA 3LYHA 3ZXUB 2HJWA 2IV3A 4N82A 3PI6A 1LF0A 4U3JA 3BEDA 4WOJA 1QYCA 5BN1A 4KSCA 1T1EA 3ONVA 1T43A 1DLIA 1F2TA 1GPMA 3CWCA 1KZ7B 2HF7A 4EW6A 2VT6A 3O4FA 2JKZA 4D1YA 2XR1A 1CZKA 4C3UA 5J2TA 4CMAA 1CE8B 2CNLA 4FXOA 2CV1A 3NAQA 4H3VA 3MFYA 1GRNA 4TLAA 4YRKA 3L4EA 1J2EA 1KPIA 1R16A 1W5AA 4GRIA 2QU7A 4JP1A 4LK2A 1PJAA 3BE6A 4MGYR 4RKYA 4Z8YA 4AJNA 3BWYA 2JHGA 1KP3A 1NYLA 5FWNA 3M1AA 1VHWA 2G40A 3T0FA 3O2SB 1OH7A 1M73E 1CHNA 3DMFA 4PZEA 1Y6FA 3SR3A 4ARUA 1W4ZA 5HS4A 1EUYA 2O59A 4WLFA 3H8WA 2EL9A 5D01A 4XX0B 1Z4QA 3WV4A 3JQPA 1TF5A 3QBEA 4YNBA 3Q4GA 2B1IA 1SUDA 1RRCA 5KX5F 4CR7A 4EJ0A 4NHEA 5AW0A 3KSAC 3PC3A 4MKFA 3TTVA 3RQSA 2ISQA 4ZVOA 5CNMA 2Q8PA 5HTKA 4LV5B 3RO7A 4BFYA 1FVXA 1PRYA 5JVDF 4RAOA 3OCCA 3L0ZA 4NOJA 521PA 2OCXA 4OK5A 2COKA 4OSEA 4D3FA 2VSYA 3A1TA 5KTSA 4WLNA 1ZVMA 1CIPA 5KTTA 2C2XA 5LQUA 1ZU4A 1KZ6A 3EOBI 2WWTA 3FTQA 1U9YA 3EWNA 5KHAA 2PGOA 2W2MA 2IXBA 2NVBA 1P8AA 3QZUA 4P35A 5KOIA 4DOMA 3QSYA 4JLJA 1CE8A 4NBSA 3ASVA 1RJWA 3D6HA 5I9BA 1Y7PA 3IQZA 1K8QA 1CJTC 3QVUA 5G2OA 2FPIB 3HKEB 3ZU5A 3KJEA 4EA6A 1VXOA 1WHSB 4EDFA 3A7DA 4GU5A 4L51A 4JODA 4PSDA 1IHPA 5EKTA 1E3LA 3KRTA 3VJLA 1TM1E 1T9ZA 3IV9A 3PDWA 5F2NA 1S02A 2H1HA 4OJTA 3TH5A 1FLDA 4XX0A 1FNMA 1PD0A 1HURA 2DE0X 2Q1YA 3S70A 3HBFA 1BHJA 4CKEB 3ZHVA 1JEQB 5AHXA 5FOSA 1PR3A 1JN0A 1GRRA 3PQEA 4IO1A 4EMBA 1E2LA 1PSZA 3DG9A 3ZTTA 1PW5A 1ZJ4A 4ZEVA 3CT6A 1M66A 4TS3A 4LJ5A 4JIMA 1J23A 5EJ6A 2WTUA 4YGYA 5EQTA 2EBHX 5BMVB 4BNNA 3VU9B 3WYBA 1SQFA 1CLUA 1CUHA 3H2IA 5JMPA 2EW2A 1YB5A 2D7CA 2C8VA 2XRMA 3REOA 3T34A 5TPZD 4WGFA 1PZEA 2XI4A 3RVBA 1W0JA 4CTKA 5CB0A 4F5EA 3CEMA 1NQUA 4UJ3A 3VV3A 2PFSA 1ZWKA 3DULA 4EY4A 1HNWB 2DX7A 2EL7A 2AR0A 2ZPUA 3OZUA 5KYTA 4EA8A 4Y6LA 3WQSB 3LWBA 4BEWA 4KAXA 3VKVA 1UCFA 5FR2A 1JXAA 5AIAA 4QQFA 3RUDA 4TWBA 5BYBA 2FPIA 3HKEA 4NK4A 1X7ZA 2HQRA 2XCUA 2E4YA 1U8ZA 1NE7A 1SD5A 5K3BA 4L78A 2ZXEA 1T91A 3E3AA 4TMKA 4QNRA 1RVV1 3CJRA 3ROXA 4MUFA 3K94A 5BSKA 1H4TA 2AJLI 5L9AA 2P9YA 1DT5A 4EVQA 2DTDA 4FYWA 3CM0A 5FUXA 1DU4A 2R11A 3OCZA 4DLAA 2RGUA 1J24A 1NKTA 2B34A 5KCMA 4CKEA 4YUAA 1LVHA 2CLSA 4XIFA 2IWHA 3DAOA 1OYOA 4AL4A 4ENUA 1OASA 3AU9A 1XTUA 4UU1A 3UKJA 2Z0MA 4M55A 2VYVA 3IJ5A 3NYQA 3TW8A 1UKAA 3VU9A 3M9LA 4B43A 2I3ZA 3NOOA 4QTUB 4YP6A 5CFOA 4ZTBA 4C04A 1Y3DE 2PQ2A 1SKQA 1YBMA 2WTXA 4N39A 1D4AA 3D43A 1JVBA 3MW8A 2WNSA 4LNHA 5H8WA 1YS9A 2YN0A 4TRRA 3TQSA 1WCXA 3AU8A 1ZH0A 3CISA 3UANA 4E5VA 1AUQA 4YJ2B 3LPNA 4WZAB 4K2HA 3ZGLA 2EGHA 4BE7B 2VF7A 1PT7A 2UXCB 2R6CA 1TVEA 4DR7B 3VYUB 2WAMA 1QNFA 1VMAA 2H2WA 1ZLXA 2NTVA 2GVDC 3OA0A 4GXQA 4JT4A 4TKVB 3VZQA 4EJFA 1AKQA 4ZOLF 1ISHA 5I9NA 1U3DA 3IEMA 4CFZA 2I0FA 5ALOA 1I2DA 1TMOA 1RM5A 2IZZA 3ASYA 3Q3IA 4AG3A 4C0SA 3N8NA 1PO7A 4D44A 2VBCA 5EJAA 3P0JA 5G0TA 1RXIA 4Y2XA 1X9HA 2C42A 2QTBA 2D1SA 3FNIA 4OGLA 1IN1A 2KYRA 3W8FA 4H6PA 2ASEA 1AGNA 4DJDC 3VO9A 2FN3A 5ESRA 3IHTA 4AJOA 4KPGA 5TX7A 1WBDA 4F3KA 3HDGA 3LIIA 1EWVA 5LMNB 3AZPA 3OQVA 4YT5A 4F56A 4UQLA 1XZMA 3UNXA 3DMNA 2W37A 2O48X 4ZVSA 3OM9A 2IBMA 4FONA 2BFBB 1DRWA 1S8AA 2P7IA 2D0OB 2QM8A 2QLMA 3R0VA 2K4MA 4M21A 3IVAA 3CFYA 3V48A 5A04A 2NSHA 2IH2A 2ET6A 1RYEA 3BK2A 1FBTA 4MTCA 2AJDA 1YRYE 2OBNA 2V1XA 5A0FA 2IXFA 3IGFA 4YJ3B 5HHTA 3FTDA 4JENA 4AROA 3VAZA 1QUFA 4YJ2A 4DV7B 1IMOA 1ZGJA 3ABRB 2PRYA 3D7MA 1D1QA 3DJYA 3PUVA 4BGUA 1COZA 2DUMA 2E4UA 1TYAE 2PR2A 2QWXA 2X7JA 4WVFA 5KNBA 1Z3CA 2GJSA 3U4HA 1XNQB 4TKVA 2V55B 3GOHA 5AQ1A 4C4OA 3PPIA 1D9XA 3JQFC 1XK6A 3HZZA 5DH9A 4IHJA 1Y4DE 1Y9ZA 5LQSA 3UWDA 4AJKA 1G291 4L02A 3HY4A 4G4IA 3L82B 4OH1A 1KRHA 1GGKA 1NKVA 2HTFA 1KAEA 4LYYA 4ETMA 1YZGA 4D9FA 5H70A 3MXTA 4FFBB 3R0IA 3LZ6A 4EW1A 2V6FA 5I9MA 1MX1A 4X3CA 1CY4A 5CLFA 1FNDA 3J81A 1ENOA 2C5SA 2XXJA 2FG6C 3HNRA 3OUTA 4IJKA 1UKZA 3IMKA 5HFAA 5AIBA 2IODA 3SIRA 2DPYA 1C4WA 3LVQE 2AR7A 4LHWA 2EHDA 4MIKA 2R00A 1VJDA 3I5MA 4YYEA 4UM9B 2BFBA 3K9QO 1QGAA 1HFWA 3UWKA 3GLGA 2Y9PB 1ZK1A 3EMBA 3U80A 4KQ2A 1AZLA 1DC5A 1DAIA 2GYVA 2MMCA 4UCFA 3WKDA 1ZCAA 3CNQS 4YJ3A 1CZLA 2P0YA 5TY0A 4AM8A 3KVOA 2SECE 3M5PA 1L5FA 3AKYA 2I4TA 3RIYA 3U4CA 4C29A 2NU9B 2GT1A 4QZVA 2IXGA 1J00A 2GLXA 1KC1A 2VDPB 2YJGA 3B6EA 2AA3A 2V7BA 2WMOB 2F64A 3ELWA 2VDQB 4R54A 1HGXA 1POXA 3QKIA 5GVSA 4M54A 3OEHD 1M8FA 2ECOA 2HQSA 4IDQA 5IBCA 5HRUA 2PLFA 3E5RA 3UK1A 3C3AA 4F8JA 1BMTA 2PWZA 4MEBA 4RIEA 2ZSFA 4C06A 4Y0AA 4ZK6A 1TC2A 2VF8A 2OHOA 2P6OA 3EVZA 1P4GA 2Z8ZA 3QLUA 4NPHA 4OQDA 3NHJA 3S27A 1D2GA 4O2AB 1FDSA 1WDTA 4TV9B 4MCIA 1VGVA 3IV6A 1L7VC 5DKFA 2GEJA 4FFBA 3BHMA 2RIPA 5DX0A 4ZCLA 1FUIA 4K9LA 5WRFA 1QG4A 1GA4A 1QLJA 2YW2A 1F0PA 4TWAA 3UAVA 1OW3B 4I36A 3PC7A 3GLGE 5EIAA 4J2TA 2O23A 5G1NA 4BE4A 4PZAA 4DQ0A 5C32A 1EFCA 1M5RA 5A4FS 4QGBA 3KALA 5BW5A 2VJDA 2WILA 3ND9A 2C57A 3LDGA 3R3YA 5MHTA 2VHCA 4I7EA 2QMOA 2PT6A 3F8SA 3ZQ4A 5JIBA 4KIJA 4WOPA 4LOKA 5ICSA 3BGSA 1P39A 1VL0A 3EZ7A 1KVRA 4AQDA 2XJ4A 3EPJA 2F4VB 5HIIA 4DCPA 1EX9A 5FLXA 4ME6A 1EUCB 4HMPA 3H5TA 3ICCA 1B6GA 5JNRA 1GP2A 2GEUA 2HA7A 4FMDB 3RTDA 2NU9A 1CIVA 3UTDA 1Z47A 3AXTA 3CIFA 4TMZA 4YMIA 1XMVA 1MABB 1SUIA 4GI5A 4G0XA 2O2GA 1EWTA 1H6CA 2ZLBA 2LPMA 3BSFA 3Q15C 4RGVA 3S8EA 1OLXA 2VVTA 1L7MA 5C1IA 3O9ZA 1LBSA 3N2KB 4HVLA 3QXXA 3IEVA 1KZ1A 4O0LA 1M6WA 1G8SA 4G2TA 4HWKA 3GI1A 3W1WA 1B8UA 1R6XA 3ZU2A 7MHTA 2X22A 4HNAB 4O2AA 3LDHA 5DBGA 4FQ8A 4UNRA 1A27A 2JI4A 3U6KA 3HKCA 4HX9A 4B4OA 1RZUA 1BOFA 2BR4A 4ZK2A 3ISVA 4KITB 4HH0A 3D4PA 3OOEA 3R4VA 1J99A 4CEIA 3GLUA 4B0PA 3EA5A 4R1LA 3HK2A 1YZTA 3G2PA 1B2RA 5EHIA 3WGYA 1Q84A 1YJAA 2RGGA 3D8UA 3CWQA 3STYA 1E69A 4ZANA 5K0SA 2X4LA 2QORA 2X3YA 4P3YA 4PLTA 2FCRA 9GPBA 3TBKA 5JSFA 3MNFA 4TL6A 4ZQIA 1SC9A 1G8AA 4XVHA 5DHPA 2H5JA 5ENDA 2Q4TA 5AW2A 4ZVPA 4CF6A 1SRRA 1Z8FA 2JVKA 1I7NA 1E0KA 5AJVB 5I7AA 1H2WA 1DBRA 2C04A 5AI4A 3BOSA 1G3IA 4IEIA 2NU8B 5ESDA 1JHXA 3GVIA 1OAOA 3BAFA 3DTVB 1P1HA 2WOJA 1K88A 2OZEA 2PJUA 3I32A 1XEXA 4HS9A 2EERA 3N2KA 5FNVB 5D00A 5D1HA 2NTYC 4A0GA 3E58A 2AG5A 4HYQA 3ZQ6A 2EIHA 3ULKA 2G3YA 2FHPA 2E6KA 4JI4B 1GUZA 3P71T 4HNAA 1LBTA 3WSVA 4RF4A 1NX6A 1XG5A 3PF9A 3RCBA 1YC5A 3D2AA 3QFSA 5TQ0A 3ADKA 3VKUA 3EQ9A 3OETA 1QPZA 1SUCA 4DR1B 3IRUA 3UOGA 2V6IA 5LP6B 1M5UA 2GBCA 3NWOA 3PEUA 1JILA 4GPTA 1BEUB 3IB3A 4TWIA 1YTLA 2XOEA 4R69A 1HLDA 4TMVA 3C6MA 4TRMA 2V7QD 4K26A 5FI3A 1KEVA 1ZHHA 4PRZA 2XDWA 5F77A 4MRVA 3RM3A 5IXYA 3QEBZ 4XE5A 3B6MA 1OXXK 3IE0A 2BGNA 2JJ1D 2FG7C 3M7IA 1YBVA 4O63O 3H6KA 2HTEA 3E6AA 1RQ7A 5LNK6 5HTOA 2RAPA 3NP9A 3P9YA 2HU7A 2WYOA 3BFKA 3P27A 3BXPA 4J90A 4MVYA 3SIPA 2NU8A 3T9AA 4D97A 4XGRA 1UC8A 2G5PA 3S1LA 3X2FA 2E37A 2YOFA 4BO9A 2N1MA 4HMOA 5FNVA 5C8XA 1L5VA 5DE3A 4MWEA 2VJNA 4XUCA 4DRZA 4EPVA 2OCLA 5IZCC 1O7JA 1L5HA 4B4UA 4EUKA 1K9VF 3QLEA 4JGGA 4JYPA 4Q4JB 3WXMA 2VNHA 3KWJA 4DEXA 1CERA 2Y1GA 4MLDA 1UPUA 2CXOA 2JEOA 2LR0A 2XTZA 2XVMA 4UDOA 4XM2A 1R5BA 4MJXA 3K5WA 4XTCS 4EHJA 4IKOA 4B6EA 5LP6A 4YR7A 1RQNA 3THXB 1FFHA 1S6YA 1Z5WA 4CT5A 2BKLA 1IZ9A 1XVLA 3FSEA 5FUMA 3ETEA 1OIVA 2Q9UA 4B73A 1DS6A 1XZQA 1YL5A 4M88A 1O54A 1UBCA 1ETHA 2PKWA 1IY2A 3HBNA 1MNQA 1S01A 1HQCA 4FGJA 5EESA 2BM0A 4RDXA 1X7XB 1ZGCA 2DJIA 3QX3A 2A78A 5JLJA 4QBTA 1S5PA 2JCXA 4L4ZA 1LPAB 4RLHA 4KLZA 3OX1A 4LTDA 2HA5A 2OAQ1 2VPTA 3KQOA 1P1IA 3B1XA 5GGXA 1YZKA 3NPMA 3FMPB 4HP8A 1UP4A 4RVNA 3SYMA 2XDQB 3VKFA 3HGMA 3I01M 3VHRA 3LP5A 2CVFA 3I6IA 1OXVA 3V4OA 4PYJA 1E5DA 1H0SA 1ADBA 1M34B 4PCVA 2WDPA 1I4EB 1QZTA 2FF5A 3DNPA 1L7RA 1USIA 1R6UA 1T9BA 1ODJA 1OLOA 3KT0A 3OKPA 4H4DA 1E61A 2PCLA 4YAKA 3V4RA 2G63A 1FW6A 4XDZA 1R0RE 2WK1A 3MWEB 3QOYA 4BKPA 1Q77A 1QYDA 1LC0A 3EH1A 4HPWA 1PEYA 4BY9E 1JQ5A 4PWZA 3SS9X 2QV0A 1M1XB 5A3JA 4M89A 3UWPA 1JJ7A 3K30A 4FD3A 4ND6A 4QDUA 2E7ZA 4Q4JA 4A5SA 1W8IA 3UUFA 3DZFA 3EAGA 3VZRA 4NE9A 3SZOA 3VNRA 5F9FA 2Z4SA 1SK8A 2I6QA 1AV7A 4N6NA 3CLRD 3P9PA 2H1FA 2J3JA 3ENQA 4HH1A 4BNHA 5JJ5A 1ZMTA 3THXA 1IULA 2CNBA 3LM8A 5IKEA 3WKAA 5IARA 2YQZA 1H8EA 1RCUA 1OA0A 1NN1A 2IQ5A 5DLPA 1PQ4A 4EB3A 1V26A 5EXTA 3FWHA 1PFYA 3PQ7A 4NABA 4X64B 3Q3HA 3A05A 3AB7A 3F96A 4KXNA 4OYYA 5ELMA 2L42A 3UAWA 1XC7A 1UM9A 3EVCA 1QJ4A 1XZHA 2VJYA 4CM9D 2NO6A 4I9FA 4R3UC 2HU5A 3LY5A 1BJTA 3GIWA 3TAHA 3K9NA 1AB5A 4G1FA 1RPNA 3U48A 3SVTA 3H0KA 2XDQA 2QPTA 3NJ4A 1XDDA 2YRWA 3KVYA 4TM8A 3NMUF 4S1NA 1M34A 3GXOA 1KJ8A 3INYA 4J16C 3HGTA 4Z1MD 2FEOA 3WWOA 4YRAA 2WV9A 2ES4A 1XKXA 3MWEA 4XDGA 3AI1A 4NDZA 3ZJVA 4TKZA 1RKQA 1YAJA 3PDUA 4LPKA 4OGGA 5H16A 3RF6A 3ROPA 4CM6A 2GN9A 3RF7A 1NFFA 2LBPA 1V6CA 3DWFA 1SY7A 4MV6A 1IVYA 4JLWA 2JGRA 2CUZA 3CMMA 3EUFA 1CJVC 3GEMA 4HH3C 1JHRA 3IE2A 2PKQO 3AOEC 3B51X 4EY6A 3W4JA 2GVNA 1B1AA 5LA6F 4JQSA 1N2CE 1XLWA 1GV0A 4OL9A 4P93A 3ZLBA 1E3IA 1L5ZA 1M8JA 1ORTA 1XJCA 2P9GA 1JEJA 1Y42X 3RIMA 3PR1A 4BO3A 6REQB 4GDFA 3IMEA 1Q2XA 1QK3A 3U40A 3GD7A 3CZPA 3SC4A 2B98A 1NXVA 3OZGA 3H9EO 4P34A 1U4OA 5JCZA 3K2QA 4J1TC 3HI6A 2ZXFA 3IUEA 1OREA 1O95D 4NX2A 2GETA 3SPXA 3VM6A 4ICIA 1XVTA 1RMYA 1Q22A 3U9TA 4TT3D 4WCVA 2V6MA 5EP2A 2Z5GA 3PNSA 4AG6A 2DWQA 3IDOA 3QYJA 1CJCA 4H6VA 4HWGA 1T15A 4EHHA 1FUYB 2I4MA 2LDXA 1AQ6A 5EG5A 1LI5A 5TF0A 5TPWB 3U44A 2BPOA 3M6LA 3H87A 3LX4A 4JJAA 3KR1A 1Q21A 5K0EA 4CV3A 4JJ4A 4X6YA 5BV0A 3DLCA 1N6PA 1W5SA 4JKYA 4IRXA 1U8UA 4ZO7A 2RONA 5K8JB 1NJ2A 1OOEA 3G6WA 1BVRA 4H17A 4R9VA 1XCGB 3WWZA 3LYLA 4BP8A 2H1SA 4U6QA 1RXUA 3VR3A 2IE8A 3PBKA 4I3GA 2E2WA 2VYFA 2W2NA 4GZ6A 4RMNA 1ZQ9A 2L18A 2VDRB 3KTDA 1CZHA 3A4TA 1QK4A 4MDYA 4RJJA 4CTOA 1HTTA 5GONB 3ZS8A 1H22A 1R0WA 4YPOA 4COKA 2VQDA 1H2XA 3NANA 3KUKA 5AP9A 1FTGA 6REQA 1VCNA 1N33B 3KJIA 1E3TA 4GXTA 1MT0A 2GUGA 4GQAA 2OG1A 4BO1A 2E5WA 4L9RA 2PA0A 1M0TA 4U1RA 4BLOA 4PWYA 4ZT4A 3VSEA 2RARA 3U7JA 3ANXA 3N3AC 5JNVA 2XNJA 3HJHA 3FKJA 621PA 4BS9A 1JHUA 3ZBTA 3T5PA 1XRRA 1EFHA 2QVXX 2YN4A 2R4UA 1SUPA 1TJPB 4TYQA 1KEWA 3ESXA 1PFWA 3ME5A 1WJGA 3OZBA 2C3YA 4PIPA 4BHTA 2B0JA 4LTMA 3S99A 3ADBA 2D2EA 1Q12A 1PYOA 1N2JA 3TJRA 3LHDA 4GS5A 4HADA 5TPWA 2R97A 4AB1A 3GLIB 1YKGA 2HDHA 2RHLA 5KSWB 3ILSA 4DJEC 2B5VA 1MAWA 3QUAA 3LRTA 5CPFA 2A14A 3P9CA 3UUGA 4L07A 2F1KA 1HE4A 1X0XA 1P2BA 2OXRA 4EA7A 4WKBA 2HLDD 4LCJA 1RRPA 1UEXC 3K0EA 5DXFA 3ZWVA 3JR3A 1V5EA 3C7KA 3RKSA 2PZGA 1G0OA 3ZEIA 1FNNA 1XN4A 2CLFB 3DHVA 3HSKA 4UAVA 1P9NA 2OBLA 3H05A 4M1EA 2ZTMA 5F5NA 4TX1A 1C9JA 2PZ8A 1E2GA 2YHAA 3VC7A 2YUTA 3JV7A 4V0MA 4DG8A 4WEOA 1KU6A 3QRWA 3C6KA 4X54A 3WXBA 1GPBA 3HCEA 2ZBVA 4YALA 1HTBA 1HKUA 4E1BA 1J5XA 2OXFA 3MS4A 4M60A 1Z28A 4QQNA 4WE3A 4BKOA 1TMKA 2ZYUX 7REQA 3ZE2B 2I9KA 1U0SY 1YCFA 2P77A 3KX2A 5E2BA 2E9SA 3DXXA 4UCWA 4UTOA 1WVIA 4IR7A 4FC7A 3V4LA 3OFKA 3TMYA 3CS3A 5ALZA 1XMQB 4EO9A 2Y6VA 4R81A 3K35A 1Z29A 5FP0A 3SHFA 5EJEA 2VJCA 1PSWA 2Y0EA 4LXTA 4RPJA 1YR9A 4QATA 1A5ZA 1X1RA 2A5FA 4NTZA 4P4SB 4ZQFA 3SKVA 2HKIA 3QEJA 4ZZIA 4BNXA 2Z83A 1HBJA 2HYIC 1BGXT 1PLJA 1M54A 2R1UA 4C01A 4YRZA 4MUAA 2XIJA 1BDIA 2W6IA 4J0EA 3AHJA 3QG1A 4UDNA 4V0ME 2J31A 1V9SA 1AUXA 4FMCF 4ALJA 1YMQA 4AG5A 5C3MA 1B00A 2PSSA 1WZUA 5K8UA 4FSHA 2OCKA 2P0EA 3B3FA 2GZDA 4E03A 4IPTA 1NYRA 5J23A 1JFTA 4DABA 3P9IA 1ANKA 4FXPA 3P7MA 2XQGA 4UNPA 4BNGA 3DEKA 4QBKA 4CRWB 5D7BA 4D25A 1RHRA 1A8IA 1KFEB 4LDQA 3EPRA 3IBSA 1QDUA 3WJ1A 2PNFA 2HJ9A 2YX1A 4JJ7A 2W70A 4MUNA 2R25B 1ZVVA 3PX3A 3GGCA 1JSRA 1L0BA 4KV9A 1QRRA 1R9JA 1XF1A 3KOMA 4OX9B 1I9CA 2BUBA 4NFYA 1CNMA 5IP5A 1WS6A 3QWAA 3W2GA 2NQ8A 1PUJA 1ZC4A 4IILA 2MSDB 1TA9A 3NTLA 4LF9B 3OQIB 3O3NB 3W2IA 1JFVA 1Z12A 1NA5A 5JZOA 4XQCA 1OBVA 5I5EA 3L0OA 2H0QA 4P4SA 3TB6A 1CZNA 4POOA 4JQYA 4WZBE 4MKIA 3I3OA 5BQPA 4D80A 5F5XA 4I8XA 1T9CA 1WKCA 1JA1A 2CXPA 4X1IB 4PR3A 3ZUGA 1L1RA 4Q19A 1MT3A 2B1RA 1AN9A 1MC4A 4LGYA 1KMCA 1GWNA 4WI1A 4JI8B 3OBIA 1JIXA 3G85A 5CB4B 5FA6A 3EG9B 1JBEA 4WKOA 2PGLA 1YQUA 3KE9A 3MC1A 4IIJF 2O4UX 2WHYA 2WKRA 1ODTC 1U8TA 3K1ZA 3VZCA 1WDWB 3T9FA 5AHOA 3G0BA 4LRWA 3BGDA 1DJNA 4G86A 2RH8A 4QREA 5BOVA 3RWBA 1M5TA 4WBNF 1FP6A 1FDVA 3HDJA 2VHYA 2FPOA 1F8GA 2A9JA 2IYEA 4BAGA 5GVRA 1GQFA 2C2ZA 4DSAA 4DS3A 3COWA 4I1UA 4AP9A 2VWPA 4GI3A 1J8FA 1KJQA 1XZNA 3JQGB 4HDCA 2H6EA 2IXEA 3SOZA 3GG9A 1CF4A 1SG9A 4EKEA 3ROMA 2CDRA 4AF6A 4M76B 2VQFB 1L4GA 4JLMA 1RBZA 3OQIA 4GVLA 4HQNA 4M8NE 5D7NA 4F86A 3CLSD 5GJCA 1ZNYA 1XTPA 2VFAA 3EHEA 3IR5A 4B32A 2J3QA 2WP0A 1BVUA 4Y67A 1UF9A 1Y3AA 2BAGA 2OZPA 3I5AA 1VCHA 1MQAA 3L8HA 4TXNA 3S8MA 1PS8A 1YJ5A 5HKAA 3STVA 2PZMA 4TTRA 1U0OC 2XUPA 3PRYA 2ILTA 5ALIA 1ADJA 4BFXA 4CNBA 1FYDA 1BDJA 3WNBA 4DT1B 1QF7A 4W5NA 3DO6A 2OLJA 3CGGA 1OZFA 4TVSA 3EG9A 1W35A 2B4YA 4ASUA 5CB4A 2HHHB 3RV4A 3A3PA 5H7XA 3ZQKA 1TK9A 5IC6A 1TVKB 1D0VA 1P44A 4D8TA 1T8RA 5FOWA 3KQKA 3ES9A 3KFLA 5DW3A 4FCTA 1N8KA 1SVNA 2EJVA 1MC8A 3SNHA 1PG2A 1K7XB 3DT6A 3GBSA 3RIEA 4ER0A 1IJFA 4LV8B 4F85A 1A88A 3KJGA 1OTXA 2XE7A 2R8OA 3JQGA 1HLFA 1W9HA 5FO1A 4U7GA 5CLQA 5A7HA 4PQRA 3LECA 1QV7A 2P9QA 4II2A 3EWSA 4HDRB 5DTJA 5DHTA 1AIPA 1AN0A 1IHXA 2EZ4A 1DGQA 1YDMA 4TSFD 1TAQA 3HBMA 4P83A 4XIIA 3CSDA 2JLZA 2EKDA 3WYGA 2PR7A 4GYJA 5IZ4A 4JUFA 5DSXA 4B2LA 3U17A 4PO9A 3R6LA 4E3WA 3G7UA 1OZ0A 1XVVA 2FDXA 1RQRA 4BLTA 2HMWA 3C5WP 1CZRA 1O08A 1V6SA 1XAIA 4MINA 5CUQA 5K8CA 4AJLA 1LKZA 1DWPA 3AINA 1U7DA 5GOTA 2P65A 5IJXA 1RBQA 1WNFA 3LXRA 4R6XA 3ZWDA 1WPRA 1RI5A 3PFWO 2OHGA 3PWSA 1WV1A 5KDLA 3EB9A 5DTIA 3AF0A 2IYVA 3G17A 3H17A 3K9CA 1YMVA 3QPWA 3R3HA 5KU7A 4P7KA 1TVKA 3EQ6A 3PNPA 4NCAA 3DTTA 4IJUA 1C2YA 1ZU5A 2HH9A 3FFAA 4ZHQF 3WP0A 4BVGA 4R8LA 4XVCA 2GYYA 3D0QA 3GZTB 1GUFA 4MHSA 1BHO1 1P2SA 2PY6A 2VHQA 2ZRIA 3ZHYA 4EB8A 1EA7A 1FLVA 2RCYA 2J87A 2JFUA 1GQQA 2J9ZB 4GC9A 4H16A 2YL2A 5MGBA 2G83A 1C4OA 1ETUA 1DQNA 2R5WA 3MS7A 3AMVA 4GI2A 1UBTS 4KUHA 2CKDA 3JQ9C 1CR2A 4GM0A 4UBIA 5HF8A 1LJLA 3PNQA 4J75A 3NW9A 4K87A 1E9DA 1ZRMA 2CHUA 2W2KA 4CI9A 1E6CA 2D2XA 4W9NC 1QONA 2CVQA 1M2VB 3BH7A 1SOMA 4D3DA 1G9TA 4NPCA 3AVUA 3PYMA 4M86A 1M10A 3AR7A 1BD3A 4I50B 4TN5A 4B3CA 3IVCA 1RFGE 4ZAZA 1IMJA 2PQ0A 4GT1A 2DKFA 3R8CA 3HE3A 1YSCA 4MW5A 3ROQA 4BMXA 1QG0A 4HYYA 5TJ9A 3H9GA 4Z4QA 4II7A 2C8KA 3RLIA 3HUUA 4V1CB 5KNCH 3I9V1 4BB9A 2C7QA 3TKAA 2C07A 3R6TA 5B6PA 1JHQA 1D2HA 5I7OA 1LW6E 4UM5A 1YJBA 3NYIA 2P69A 1A04A 1Y1QA 1ZUNB 4LVOA 3AG5A 4DF3A 1BA3A 4F4FA 2QJWA 3TRIA 3AHCA 4R7TA 2H4XA 4ND7A 2RGAA 1DKPA 2HB6A 3IPCA 4AUKA 2G17A 5BSVA 1P5ZB 1KBQA 5JCOC 4Q3AA 2VJLA 3FETA 4MUJA 3LRXA 5BWNA 3K0SA 1Z34A 1I9GA 1KVQA 2I66A 3MRVA 5JV5A 2VDJA 1T8WA 1SXQA 1E58A 3L8MA 4P7FA 4UU8A 2NPFA 1JLRA 1Y4UA 3KXDA 2XH8A 3CRQA 4F6RB 3GPCA 3OOJA 3ZBQA 2XA2A 2VNKA 3HMKA 5J4LA 1O4VA 3CR7A 3F6SA 3NHUA 4YJDA 2Q1WA 4J1SA 1TZBA 2A2ZA 3CPJB 4GBJA 4P36A 4YQZA 2UZAA 4L16A 5E1BA 2VQ3A 5GPBA 4F04A 5AI8A 3KAKA 3L18A 4ENSA 5DMXA 2R68A 2V7GA 4C2UA 3V8NA 2V54A 4I50A 5BXYA 2MR5A 3HP1A 1LB1B 4FEYA 1D6MA 2X4GA 1MDFA 5EIHA 3L79A 4EI7A 4DV2B 3C3JA 4Q4DA 3FG9A 4Y18A 1DKUA 2GD6A 2RGNA 1Y89A 2IEGA 2WG2A 3AB3A 3GH3A 4V1CA 5KAMA 5HJEA 1X38A 5E4YA 1DAHA 3LV8A 4GWKA 1GNQA 3BMNB 4RVSA 4GPZA 2AQ8A 4EF4A 4G56A 1O6ZA 1ZUNA 1VHDA 1YA4A 4XD2A 3HWRA 2EX0A 1GFIA 1M2HA 1AQLA 4FFDA 4HEA1 3H0CA 4IVPA 4R83A 1B8NA 4WV3A 5B4VA 1NN0A 2W7TA 1T3LA 1G4UR 2ORWA 3ESRA 4J7AA 1SURA 4RHTA 1KSGA 3T1OA 4EFMA 4MMZB 3L9WA 2G80A 3GCGA 1TO2E 3BF7A 3NIBA 2CNWA 1ULAA 2ZBRA 3TLGA 2LCFA 4Q4HB 2OYSA 1N2BA 2ADMA 1YD7A 1IPHA 2RBGA 2TYSB 1KMNA 3DZJA 4LFAB 1J4AA 2WZBA 4GLOA 1DJOA 1H69A 1G5TA 4B2YA 1FNBA 3CZ4A