3LECA

The crystal structure of a protein in the nadb-rossmann superfamily from streptococcus agalactiae to 1.8a
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
227
structure length
225
Chain Sequence
NAMDLQLSKRLQKVANYVPKGARLLDVGSDHAYLPIFLLQMGYCDFAIAGEVVNGPYQSALKNVSEHGLTSKIDVRLANGLSAFEEADNIDTITICGMGGRLIADILNNDIDKLQHVKTLVLQPNNREDDLRKWLAANDFEIVAEDILTEKRYEILVVKHGHMNLTAKELRFGPFLLSNNTTVFKEKWQNELNKLTFALNSIPNSKMEERAILEDKIQDIKEVLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of a protein in the NADB-Rossmann Superfamily from Streptococcus agalactiae to 1.8A
rcsb
source organism Streptococcus agalactiae
molecule tags Structure genomics, unknown function
molecule keywords NADB-Rossmann Superfamily protein
total genus 76
structure length 225
sequence length 227
ec nomenclature
pdb deposition date 2010-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04816 TrmK tRNA (adenine(22)-N(1))-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3lecA01
5K05A 2AN4A 4AZSA 3O7WA 4C08A 5EMKA 3I9FA 3MERA 2P8JA 3R24A 4M36A 3RW9A 3NJRA 1NW6A 4DMGA 2C7PA 2JH8A 2PGXA 2ZIGA 4R6WA 2IDJA 5CM2Z 1SG9A 4F84A 2QE6A 2AOVA 2IGTA 3PFHA 2UYCA 1KYZA 3E23A 4KIFA 3UWPA 4CKBA 3LKDA 1P39A 2O57A 3A27A 2ZTHA 3ME5A 4QPPA 5EOVA 3SSOA 5K09A 5FCDA 3P9NA 3VSEA 3FYCA 3NTVA 2XBMA 2P3LA 3NW9A 2VDWA 2AOUB 2PY6A 3FTDA 2WK1A 3ID6C 4ISCA 2C7QA 5FULA 3GRYA 3AJDA 5FA8A 3M6XA 3SXJA 5HIIA 4POOA 1I9GA 3PS9A 5DX0A 3DLIA 1XCLA 2JHAA 3OU2A 5FA5A 3ER8A 2BR4A 2EX4A 2QRVA 3BKXA 1T43A 2B3TA 3BWBA 3TKAA 3FPHA 7MHTA 3GJYA 3JWJA 1JTEA 3OZTA 4Y2HA 4EKGA 4IV0A 3FZGA 5U4XA 3P8ZA 2I62A 4XUCA 3TR6A 3C6MA 4QQNA 2HTEA 1RJGA 2PBFA 1VL5A 3DR5A 3CJTA 1N7IA 5C9ZA 3E7PA 4DCGA 3GO4A 4R05A 5T6BA 3TRKA 2YUIA 1XDUA 3G8BA 1NT2A 3L8DA 5DXJA 3G2MA 3BT7A 5F2KA 2NXEA 3FRIA 2I7CA 1VP9A 4X41A 3R6TA 3LL7A 5EVJA 3LDUA 2EG5A 1QAQA 5ICFA 1VBFA 2G8NA 2B9EA 2GS9A 1BC5A 5LQKA 5CCXA 3KQOA 5DSTA 2OY0A 3SMQA 2IH5A 3CCFA 3G2OA 3P9IA 3X0DA 1TPYA 2FHPA 2HR1A 2IBTA 4L7VA 3LPMA 5P8WA 3PX3A 1QANA 3VC1A 3OU7A 2V7EA 3V97A 2A14A 2ZBQA 4CXMA 1R74A 3LCCA 3OFJA 3SSNA 2I9KA 1L1EA 4E70A 4BLUA 2H1RA 3OZSA 4HC4A 2YX1A 5EKXA 2UYQA 4QVGA 4HH4A 4QPNA 4PGHA 3BKWA 2O05A 4RVDA 4QQKA 3EVCA 5DPMA 2ZULA 3EVEA 5EIFA 1IXKA 2ZVJA 3RODA 5FHQA 2VP3A 3P9KA 3OCJA 1AQIA 1FPQA 5BW5A 1BOOA 2JG3A 4K6MA 1RI5A 3AY0A 3LDGA 1XDSA 1RI3A 2XYRA 3LECA 1HNNA 4PYNA 1VPTA 5DTRA 2YXLA 3HA5A 5BXYA 5F2NA 1RJFA 2OB1A 2Z6AA 1AF7A 2IDKA 2P3QA 3GRVA 1P1CA 4GUAA 5FWDA 3KHKA 2QRVB 1IM8A 1XCJA 2NNWB 5EIWA 1EAMA 1SQFA 2R3SA 4QTUB 2QM3A 3PLAE 2AN5A 1AQJA 4KRGA 5DWQA 3B3JA 2ESRA 2P7IA 3KR2A 2CKDA 3FPEA 3P9CA 2AZTA 5FADA 3O4FA 1JSXA 3QV2A 5E1BA 1EJ6A 4QVKA 2AVNA 3DMHA 2WA1A 3M6UA 5CCBA 2GH1A 3QOWA 1DUSA 1Z3CA 1YB2A 2BZGA 4GOMD 5HIKA 3I53A 3KPJA 1VP3A 1QZZA 2PWYA 4PCAA 3B89A 3NDJA 4X63A 3EVDA 5DM0A 4DQ0A 3GGDA 2G1PA 2BH2A 4OA8A 4M7RA 1RI2A 1WG8A 2DPMA 4P7GA 3HA7A 1I1NA 1KPHA 3UJ7A 1JSZA 4YUYA 2UYOA 4ER0A 1B42A 3B5IA 4WXHA 2JHCA 3VC2A 3V8VA 2XYVA 1QYRA 3BGVA 5HIJA 4GF5A 5K0LA 4YV2A 4X1OA 5EEHA 3DXZA 1WXWA 2C7OA 5KQSA 4HGZA 3K0BA 4B17A 2O0LA 5D1NA 2VDVE 1WZNA 3BUSA 4GOOD 5DSXA 1JTFA 1YZ3A 4OA5A 5M5BA 4EMSA 3LCUA 3GCZA 3EVZA 5CUQA 4DF3A 4YV0A 3B7PA 2P35A 2AN3A 3G2PA 5ERGB 2JH9A 5EZQA 3FUVA 2ZIEA 2QYOA 3A25A 2PSSA 4FSXA 4P7FA 4PINA 5D1HA 4DZRA 5ICGA 3HVHA 3HVKA 4E33A 1JG4A 2FYTA 3UJCA 4YMGA 2ZFUA 2ZBRA 2ZW9A 3HCDA 3FTCA 3OU6A 4QTTB 5HOQA 2FCAA 4RTOA 5E9QA 1O9HA 1SKMA 2PXAA 1G6Q1 4A6DA 1V39A 4RTQA 3FTEA 2JHPA 3ELYA 1ZHFA 4BLWA 5CD1A 2ADMA 5DRTA 3K6RA 3MAGA 4YUVA 1ZGJA 3CGGA 5DRYA 1G55A 3HNRA 4FT2A 3EVFA 3A7EA 3C0KA 5CVVA 2CMGA 2JJQA 4HG2A 1QAOA 3BWMA 3ER9A 2FPOA 3KQVA 3M4XA 4KIGA 1L3BA 5E8RA 5GWXA 5EGSA 1JQ3A 2IBSA 3UFBA 5GOZA 1X1DA 2IP2A 2P40A 3CVOA 3HM2A 5HEKA 2P1DA 4RVHA 5IH3A 3THRA 2UZ4A 2ZZNA 4P58A 4E31A 3HVJA 3KQSA 5E2BA 5IKMA 3JWGA 2R6ZA 4QDJA 4RWZA 3DMGA 4RTKA 5KS2A 3GRRA 2H11A 5KQRA 2EJTA 4FR0A 4DKJA 1D2HA 3FPFA 4LWPA 4MQ4A 3HCEA 4F86A 1TW2A 2I6GA 1EJ0A 3KR1A 3OPNA 2ERCA 3AXTA 4FGZA 4KW7A 4DA4A 2NP6A 3UJ6A 3KQYA 1X1AA 3MTIA 5CVJA 1RI4A 1DCTA 4PONA 2FK7A 3DULA 3DXXA 2B25A 5FTWA 1YF3A 3GNLA 3EVAA 5BW4A 1QAMA 2WA2A 2N47A 2Q41A 3E8SA 3R0QA 4PYLA 4RTMA 3SM3A 4BP3A 5CVDA 2OPBA 4GEKA 4ER3A 1EG2A 3KKZA 3G2QA 4MWZA 3GU3A 1FP2A 5LR6A 3FPJA 3GIWA 4HTFB 2AR0A 3HCFA 3KQPA 2IH4A 4JXJA 1WS6A 5DTQA 3EMBA 5EMJA 1SQGA 4H0NA 4KWCA 1U2ZA 1XJ5A 3MTEA 3MB5A 1JG1A 2Y1XA 4KDCA 4RYLA 3UJAA 3QOXA 5K8VA 1RJEA 1BKYA 3P97A 5MHTA 2PV0A 2PKWA 1VIDA 5EQJB 2PLWA 3A26A 3M70A 4PYMA 2NXJA 3FTFA 2ZBPA 3A7DA 3PT9A 3R3HA 1NE2A 2NYUA 3PX2A 3FUTA 4FSDA 4GOLD 4XUEA 4Y30A 2OYRA 5DLYA 4YUWA 5K0EA 2OBFA 1R18A 4FP9A 3TKYA 4BY9E 3FRHA 4OBWA 4O29A 1IY9A 2YQZA 3G5TA 5E9WA 5HFJA 3SX0A 1H1DA 4C05A 5JR3A 2PWPA 3C3PA 4UOEA 4RVFA 4GC9A 3PB3A 4ATNA 4P7KA 3ELUA 8MHTA 2AS0A 3HEMA 2BM9A 4E30A 4U7PB 5FQOA 2QY6A 3MCTA 3UZUA 2AOTB 3KR9A 3MQ2A 5EHGA 3UJ9A 3VYWA 3TOSA 3EPPA 4C04A 4V0RA 4HSGA 4U7TB 5K0GA 1UFKA 1XVAA 2FK8A 4FT4A 1JG3A 2GAFA 2O06A 4M38A 4A6EA 3UJ8A 3KPWA 1UWVA 4FZVA 2ZLBA 3EEOA 4OX9Y 2CMHA 4BLVA 1ORHA 1KYWA 4DCMA 1HMYA 1PJZA 2GB4A 5H02A 5FHRA 1N7JA 2GPYA 1RJDA 3C6KA 3P2EA 2HV9A 2ZSUA 5EC8A 4YV1A 3DP7A 1M6EX 1YZHA 3P71T 3DMFA 4XCXA 1YFLA 5CVEA 5DT2A 5EZSA 1R8YA 3GXOA 4YUZA 4XUDA 1KIAA 5G02A 1P91A 2Z6UA 3EEYA 1R8XA 3ANXA 5GP1A 3B3GA 4AZVA 4OQDA 3NDIA 5DX1A 3B3FA 3LKZA 2LD4A 3EVGA 3F4KA 2AOUA 3REOA 1N2XA 3DXYA 1G8AA 5K03A 2YXDA 2B2CA 5CIYA 3M33A 2XYQA 4CKCA 1TW3A 4M37A 5K0NA 4EKIA 3D2LA 3THSA 1JQEA 2P41A 4EVIA 5E8JA 2XVMA 4LWOA 3S68A 4C4AA 3HTXA 3NVKI 3SSMA 3Q7EA 3WSTA 5ICEA 5K0CA 4DM3A 4MHTA 3I64A 4PIMA 1ZKDA 2ZWAA 3LX6A 1Y8CA 3PFGA 2AOXA 5BP7A 2PJDA 3ORHA 1INLA 2BR3A 4GBED 4KVZA 5E2AA 4IV8A 3GWZA 4ER5A 2KW5A 2ONZA 3UJBA 1KPGA 4RTLA 1G8SA 3TFWA 1KPIA 3EMDA 1P1BA 1WXXA 4WVLA 3CC8A 3R9XB 5FUBA 1L3IA 3IEIA 2PVCA 2CWWA 2EJUA 3G8AA 3AWIA 3CJRA 1ZQ9A 3GRUA 3KPYA 3SVZA 3U81A 5DXAA 4P7JA 3GDHA 4G56A 4C06A 2PX2A 1G60A 1D2GA 2CL5A 3KQTA 4HTFA 5GIOE 3TMAA 3IYLW 5DM2A 2GA9A 5C1IA 3KU1A 1KHHA 3KPUA 1R6AA 4E2WA 4ER7A 2AVDA 2PX5A 2HWKA 2XVAA 3BWCA 5FQNA 5JUWA 4IKPA 5E1OA 4FS8A 2NP7A 1I4WA 2VZ9A 3TM4A 4X61A 5LSAA 1YFJA 1NV9A 1VQ1A 1FJXA 4RVGA 4PYJA 5KYGA 1JG2A 2OXTA 3MGGA 4RX1A 4HRAA 3P2IA 4AZTA 2UYHA 3FYDA 5HZMA 10MHA 3M6WA 3KPVA 2Z6QA 2AOTA 4R6XA 3DUWA 2P7HA 4IWNA 4AUKA 5K0FA 2EFJA 4PGGA 1JR4A 4BP1A 4E2XA 3HCCA 3T0IA 3P2KA 1NBIA 1VE3A 2FRXA 3SR4A 5EMMA 3HCBA 3TLJA 5T64A 3BZBA 3LHDA 3TPZA 2B78A 2F8LA 2HNKA 5HIMA 2G71A 2DULA 3NMUF 2ZZMA 4PYOA 3UA4A 3RIEA 2Y1WA 3A4TA 2YXEA 3KR0A 3LCVB 2C7RA 1X19A 5LQUA 1YUBA 3BGDA 4LG1A 1OR8A 3HP7A 3HA3A 1KXZA 2NXNA 2BM8A 3DTNA 1NW8A 3LGAA 3HCAA 4RV9A 2O07A 2BR5A 3LSTA 1VLMA 2ZIFA 5E1MA 4RTSA 3T7RA 2G72A 1Q0SA 1NV8A 1XDZA 3ELDA 2PT9A 4PYKA 3MCZA 5LQCA 2HMYB 1ORIA 3OE4A 1X1BA 4GOND 1EIZA 4PWYA 1NW5A 4PYQA 2ONYA 3G5LA 1SUSA 1SVUA 2NXCA 4AX8A 1RI1A 2P3OA 4C07A 1G38A 3CKKA 5GINE 3EGVA 3KQMA 4AZWA 5K0BA 3TQSA 2V74B 2OKCA 1F3LA 4LECA 5EMLA 4RTPA 3ELWA 3EGEA 4OQEA 3G7UA 5E1DA 2PX4A 4EQZA 2OZVA 1L3CA 3OZRA 1WY7A 1SUIA 1NKVA 1NW3A 1UIRA 4PIPA 5GM1A 5ICCA 2GLUA 2YTZA 4MTLA 4C03A 3LBYA 3PVCA 5KVAA 4PYIA 5F2OA 3UA3A 4QDKA 5LQAA 3DLCA 5EHIA 1Q0TA 2IFTA 4RSRA 4E32A 4OBXA 3H2BA 2ORED 2YR0A 4ER6A 2IPXA 5DX8A 1KP9A 3HVIA 5FWAA 5GM2A 5LQJA 3EGIA 5K01A 2ZCJA 2E5WA 4ZTBA 1AV6A 3T7TA 3JWHA 3C3YA 4PCLA 5GIPE 5K0JA 4RTRA 3I58A 4PNEA 2IH2A 3CBGA 3OE5A 1X1CA 2IIPA 3GRZA 4GQBA 5CVUA 9MHTA 4Z2YA 4CTKA 4HGYA 3G89A 4RTNA 5EPEA 2PXXA 5DM4A 4E2YA 4KDRA 3BWYA 1MHTA 3ERCA 1PRYA 4MIKA 2ZWVA 3E05A 3M6VA 4GC5A 4R8SA 2OB2A 2G70A 3FUUA 3T7SA 4F85A 3G88A 1O9GA 1KR5A 3IV6A 3SGLA 1FBNA 4X60A 3UJDA 3KQWA 3BXOA 3BGIA 5B1SA 2PT6A 2OO3A 5T67A 4CWAA 3PTAA 2PX8A 1XTPA 3DOUA 5EEGA 4YMHA 5EG5A 3FPGA 3I5UA 5LQNA 3MHTA 2AOWA 1M6YA 4EK9A 3FUXA 3OFKA 4R8RA 5DM1A 2K4MA 2VS1A 3IHTA 1NBHA 2YVLA 3LBFA 1XXLA 3NWEA 1NW7A 1L9KA 4RTJA 1D2CA 3NWBA 2VDUE 5DTMA 1EQAA 3KQQA 3FUWA 3Q87B 1DL5A 3UBTA 5C0OE 5LQRA 1F38A 3JWIA 3DH0A 4V0QA 1ZG3A 2ZZKA 3CJQA 3NVMB 5E9JA 4E2ZA 1O54A 4CTJA 1M0EA 4NECA 5EKUA 3LDFA 3AXSA 1R00A 2PXCA 4CKEA 1MJFA 3O31A 1FP1D 1BHJA 1JQDA 4YUXA 2H00A 3TM5A 3EVBA 5HILA 1ZGAA
chains in the Genus database with same CATH superfamily
2RH9B 1WD5A 2WAMA 3GARA 3MERA 4H3HB 1XQXA 4LC0A 4QBHA 1L1FA 2Y1LA 1Q16A 3QX9A 1VC2A 3TL2A 2OBBA 4RF5A 4X3CA 1KBQA 2VHUA 2DY0A 1V0JA 4LI3X 2BI7A 3R9XA 1H9CA 2R47A 1E2DA 5DNWA 4DBZA 2B6HA 3Q15C 2QVBA 2E48A 1K63A 2VJBA 3GAMA 4QDTA 2O2JA 5EXTA 4BCBA 2C2ZA 4LDQA 4NCAA 2A0YA 3B1VA 3UCFA 1GUBA 1VXRA 2ZAOA 2NWQA 4YRLA 2XE8A 3MT7A 3H9JA 1MD9A 1KMNA 3WQBA 1AGXA 2PL1A 1TO1E 3AHJA 4KUEA 4LZZA 4YJFA 3MT8A 3IPCA 3NYIA 1ZW1A 3R20A 1CDZA 1E9VA 2J3EA 1I9GA 3FWNA 4ZPXA 3ZZMA 2JHAA 1YRLA 4NF2A 3W7AA 1OB5A 3V1YA 5JLAA 3DOCA 1PU2A 2QRVA 1GZ3A 3FFTA 5NULA 1H4QA 3QNUA 4E5VA 3LFHA 1VSVA 1KSJA 5JCOA 1WMAA 2ZJ7A 4ZD6A 1UP6A 3O91A 5TVKA 1RC0A 1GEEA 1CUFA 3S2YA 3RRZA 2HTEA 1HSOA 1Y1PA 3ER8A 3V4OA 2I1QA 1HFKA 2R8XA 3KELA 2QRLA 1MA0A 4DCGA 3CXRA 2BWJA 1RCUA 2YUIA 4LCBA 4R05A 1JVSA 4XVHA 5KYVA 2YY6A 1TADA 3TF5A 4RADA 1I5RA 4I9NA 1USGA 2X77A 4ZFNA 2F7SA 2XCSB 2C03A 1A5BB 2G8NA 2I2DA 4JKYA 5DHTA 1BC5A 2YHUA 2O2CA 5IEJA 1ZUD1 3NJ4A 4ND6A 3ENNA 2A3RA 1CVLA 3CR8A 3P9IA 5H4GA 1TPYA 2A88A 4OHVA 1KF0A 3TDMA 4F4UA 1Z5OA 3UK2A 3WK7A 3W5JA 2DBQA 5JWHA 1WSDA 3CQ9A 1ZJYA 5EY5B 1PQYA 2WU4A 3NI2A 4ZVSA 5TSDA 4Z7QB 5B5SA 4Y2TA 1A9PA 2Q2OA 1EG7A 3NHPA 3PC7A 2JCYA 2AKAB 3QWAA 4J49A 4TZKA 5ALNA 3Q9UA 4EB3A 4EH1A 2EX1A 2FUKA 4CL0A 1T3ZA 3DZBA 1YB1A 4QO7A 3VR5D 4B73A 4WXYB 1DWOA 2TRSB 3K30A 4QNNA 4HEQA 3A4VA 3G2KA 5BW5A 3UG7A 2P9EA 2JG3A 3U39A 4RPHA 2DLNA 2Y76A 3EISA 4WXRA 2L69A 1KU6A 1QXSA 3L5KA 4RTJA 2AI3A 4DQKA 5F2NA 4BJ6A 4OSEA 1WTAA 4COKA 3BXEA 3N8DA 4ETNA 1AF7A 1GPDG 4ID9A 1UXKA 1Y6RA 4GLJA 1UDCA 4K40A 2QP9X 4M53A 5HKOA 2NNWB 1Y5RA 4H31A 1Z6YA 2VF2A 3VVLA 4BE9A 1P19A 3B3JA 2WHPA 2P7IA 3HYCA 1EK2A 2HQOA 2ODWA 1GG5A 1W25A 3PGVA 2PU7A 3EEBA 2ZP1A 4QPCA 1P2BA 5I9IA 3DMHA 2QSZA 4AECA 1E89A 3PDIB 4BO7A 2IS4A 1Z5VA 1WM1A 3IEPA 1KMCA 1A95A 1XHEA 4KLZA 1QZZA 4HNAA 2C2HA 2AMFA 4OOFA 1CW2B 4RY9A 4URYR 1SCAA 4CRWB 3RADC 2FA9A 3K8ZA 1EU1A 3CX7A 3ZZNA 3I4FA 5KJFA 3FVWA 5TPZA 4P2GA 4N03A 2QUAA 4B7AA 2HSGA 3UJ7A 1AGNA 4DV4B 4P81A 4C0XA 1N6LA 4WXHA 4XLLA 3U48A 4Q18A 3IPLA 1SB8A 2LW7A 3BH6A 1ZAYA 4MKZA 1YXMA 1Z4LA 2C5LA 2QW1A 3IEUA 1WXWA 1B8UA 4MV4A 2A2ZA 4PFJA 4ZGGA 4RXTA 1YDEA 1T0IA 2X0EA 2HCBA 3D5EA 1YMQA 1QQ5A 4KAJA 3JD0A 3L7DA 3TZ6A 2Q3CA 4AYTA 2XYGA 4WBXC 4EHAA 2QPTA 1D6NA 2J32A 2EKQA 3LCUA 4YFVA 1C3VA 4KPYA 3EXHB 4ZO9A 4EEZA 3WWDA 2AF4C 3CEMA 5LP6F 1DEKA 2P62A 3NIBA 3FUVA 5AKHA 3VNVA 3A25A 2V6MA 1UBSB 3B9RA 5MFPA 4LFBB 3CPSA 4IFTA 3HVHA 4JLPA 5K3DA 3GP8A 4N48A 2HK8A 2GCOB 1N2EA 1X8JA 3EULA 4OK5A 4YJGA 1J06A 4B33A 4WBNF 5KWIA 2EGUA 4LDJA 4R71A 5IVDA 3GT7A 5EAIA 4ASUA 4GBMA 2R8OA 3T54A 4H0CA 5K8IA 2PXAA 4WN9A 2FZEA 2H07A 4XE5A 5JAOA 3UAGA 2OVBA 1NW9B 3EBPA 5F4BA 5EZ6B 3UTCA 1IWBB 1KIMA 3DLTA 2JGFA 5ARCA 3FR8A 5KCZA 1HLPA 2E4AA 3CGGA 3LAWA 1G55A 2X4LA 3U4CA 3KLBA 3ONEA 3EVFA 2CDNA 5K2MA 4DM4A 2QN6A 2CMGA 1OOEA 3K4HA 3OLQA 4LE0A 3VTZA 5JW6A 3JQBC 5IZ4A 3VR6A 1XDWA 5CLHA 3SC2B 3AERA 4RK5A 3T6KA 5H81A 2XECA 3IX7A 5H0IA 3E3MA 2W6ID 1NJSA 4DLBA 2GCOA 1PLKA 4NAUA 1PJCA 2XTZA 3PGJA 1XD8A 2A33A 4JQZA 1OWOA 2BFEA 2JFPA 2C31A 1AT1A 4RWZA 4CN8A 2BHRA 4ES6A 5KQMA 4ZYWA 2OPHA 4REQA 4L78A 1FDRA 2BMAA 3C45A 4TXJA 3WJ2A 3GN1A 5I7EA 2R8PA 1A9XB 1D7AA 2H2IA 2YMQA 3LUPA 3PDJA 5LLSA 3PQ7A 1Z07A 1J0BA 1JHUA 4A0SA 2C57A 2XI4A 2VKTA 3F3MA 1ETUA 3RTBA 1QYVA 1WQ4A 3CPHA 2OFWA 2Q0HA 3PVSA 2CXUA 2B25A 4FEGA 5FTWA 2XYHA 4BYGA 4LXUA 4IIJA 3PTLA 4X97A 4NJEA 5THKA 3QA3E 1CR4A 3R4CA 4GPD1 3PQDA 2D4HA 3C15C 4K88A 4I50F 2OPBA 1YE5A 2C96A 3H9UA 1BEEA 5FKJA 2A86A 1U9IA 1A2KC 3GU3A 3ND7A 2IEGA 4JAVC 3UBMA 1FS5A 3V6LA 2PE5A 2IDMA 3ICCA 4QGSA 2QRUA 1K86A 1T9ZA 1WCIB 2QNBA 1WOYA 2VWHA 1TYDE 2YVAA 3BCSA 3LW7A 3MB5A 3ZD6A 2VSFA 2AK2A 2J6BA 3GJ8A 2R8YA 3ZNOA 2P2YA 3H9BA 1GSHA 2D59A 2PV0A 4US0R 2AZ4A 3FTNA 5IM4A 1FLDA 3AFHA 5E6SA 2QD5A 3L7KA 3OCZA 2D1YA 1SHZA 2G1KA 2GNAA 2Z8YM 4HP8A 4JLAA 5BQFA 3FTFA 2C3PA 2XRYA 4DLKA 4EG7A 1Y82A 1EXNA 3A3YA 4DNFA 2B20A 4YUWA 5LWHA 2ZYWX 5FOXA 2QTMA 3UG6A 5AI0A 4K0KB 1T9CA 4W6QA 1TO2E 4FS3A 1M6HA 5DI9A 3ZWAA 3I30X 3NBMA 5AJUA 5EZYA 2OHXA 5EZYF 3DOJA 5BOSB 1ONBA 1C29B 1R4NB 4C43A 4JI8B 3QQPA 2FZ4A 3HEMA 3R0XA 2NQTA 1E2BA 3UMGA 4LJRA 5C53B 4WL0A 2HMAA 4GMXA 2B4AA 3RAEC 3SOZA 1LU9A 3QQ5A 1ULAA 1Y8QA 3PXAA 4HSGA 3QVUA 4UD6A 2J7KA 1O4VA 2EEZA 1U3UA 1ZITA 2O2HA 4YN3A 2QJWA 2J3JA 5IM4F 2CFTA 2FMFA 2JCXA 3FZEA 1HNXB 2NV6A 1J56A 5HRUA 1XSEA 3M3PA 2FH5B 4ZC8A 1FS6A 3C6KA 1CUDA 3SJ7A 2VK8A 1NVVR 4L95C 1DADA 2GZMA 2JAHA 1RQRA 1ZIOA 4MVJD 5JMTA 1EXWA 2EDCA 2FW6A 1OJ7A 1W0KA 3IKMB 4RF3A 1PFKA 3RG8A 2VP2A 2AG1A 3AOEA 1SZDA 4RDCA 2AWOA 2CMFA 3KZCA 3RC7A 4B3RB 3KTAA 1J0AA 2XQJA 1I32A 3AK4A 3GA5A 3WRWA 3QKRA 3F8SA 1Z5UA 1E1RA 5CA0A 3BMQA 1W2WB 3FCAA 1MG5A 1R9NA 3VPHA 2J3QA 1VBMA 3QW4B 3R9WA 1ZK2A 2GM5A 3RTGA 1L5HB 4QBIA 5I8PA 4GD3Q 4ZKDA 4RKQA 4H3SA 4DQUA 4R54A 3IV9A 4UTPA 1IDOA 4LZPA 2R6HA 3V4FA 1VLZA 2HIHA 4G8JA 4MMZB 3ZYZA 5ADVA 4EVIA 1GILA 3ZU3A 4G23A 2AJTA 3LI2A 4MV1A 3NOVA 4NJMA 2F43A 5CP8A 1EDEA 2PBRA 4QA9A 1FF9A 3A3KA 3GMTA 3QU4A 4ZJPA 5KU1A 5KCMA 3BMOA 1H0KA 2O8NA 2Q3DA 3M4NA 1Y4UA 3B51X 1XL0A 3AV0B 3DBVO 4J4TA 5ENDA 4KXXA 4RF4A 2XZLA 2Q5QA 1VLQA 2C7GA 5TF0A 2Q5EA 2XE7A 4XWWA 2RAVA 2H7CA 3O9MA 3D5TA 4LJ4A 3IV7A 4BGEA 4PGFA 4TL9A 2H5LA 1D8TA 1PGNA 4KITB 3NRBA 4C06A 2GCGA 4ILKA 3X1KA 1TD1A 1DBRA 2WF8A 2CL5A 4UHCA 4CF3A 1ECJA 4NZYA 1KMHA 2XNCA 3C8UA 2Y1CA 4HTFA 3R9IA 1O6CA 1L4NA 4BE7B 4TS1A 2EP8A 3JQAA 4O4HB 4IXWA 1E79A 4FFDA 1U94A 5JUWA 3JQFC 4LNHA 4D3FA 1T0BA 3UVEA 2B36A 2PMWB 2JJMA 1E62A 2J9XB 3CSDA 2D74A 3OHMA 1E92A 2I6UA 3VZRA 2H1OA 3KWJA 1E6LA 3ZHRA 2W6OA 5JAZA 1C50A 1G63A 2WKQA 1QG0A 2LWIA 3AJ9A 1M1XB 2J9GA 3M6WA 5ECWA 5JISA 1KAMA 1LDNA 2I1LA 2P7HA 3QOFA 1HTBA 2A1UB 2YH2A 2AFIA 2LKCA 4N40A 3ROPA 5I4KA 2ZUVA 1T9DA 4LYFA 1P9RA 3IQWA 4KXMA 2FPSA 4U9HS 4XARA 1VE3A 4Z4CA 3D7LA 4XX1A 3C6YA 1NX9A 2DFVA 3EF3A 4NBWA 3TLJA 5JDCC 2GHQA 4NBNA 3EB9A 2JH3A 2F8LA 1GPUA 4PRKA 1P5HA 4DBLC 4LXTA 4UPVA 4PYOA 1UT5A 2H1FA 4A4DA 1G6HA 4RH0A 2XWBF 3CLVA 1XMSA 4NMWA 3EDRA 4P4NA 3BL5A 4Q1VA 5AJTA 4LWQA 2Z4SA 4NFSA 3HYLA 1IE3A 1CQJA 3D4PA 3GQBB 1XQ1A 3LSTA 3EIEA 3IDZA 1PJTA 4KWTA 3MJDA 2C2YA 3MS2A 3WWCA 1KEEB 2B5OA 4IIFA 5AHKA 1Q0SA 1FZTA 5BSTA 1YKFA 1C2TA 3I9OA 1BH6A 5LQCA 1NXPA 2HRBA 1U1IA 1Y1SA 4MUBA 3SYKA 4URXR 2ZRCA 2A9OA 1KAGA 3FSRA 1WF3A 1V11B 2QD1A 4MO9A 4C07A 1KKUA 3A3NA 3E9CA 3C8DA 2WAYA 3IP8A 3ZTYA 2LPMA 4RCYA 1XP8A 4N3BA 3B82A 1RRMA 3IMFA 4I6JA 3SEAA 2BCGY 4CF5A 5KWVA 1Z4MA 2Y1FA 5HQTA 2R48A 4COOA 3U26A 4D96A 4HB0A 3M0EA 3K05A 4M2LA 3S55A 2V6IA 3GGJA 2OZVA 1ISSA 2ZSFA 1S02A 3CGWA 2XDWA 3PQ5A 4KLNA 4MGYR 3TEMA 4FB5A 4UEQA 4Q9DA 3A10A 3DDZX 3GJSA 4RUKA 1VDZA 1DHRA 2UXCB 3UA3A 3W5BA 4W1PA 2OZPA 1E2NA 5EHIA 1QJ4A 3QY9A 4D8YA 2F2TA 4EI9A 1FMJA 1VSBA 4LZLA 2YR0A 1N2CB 4OP1A 2HJ9A 5DX8A 5GM2A 4CBVA 2QIPA 3K96A 3UW1A 5JI2E 4MJ3A 3TTVA 3W5VA 1RKBA 1QF9A 1N7HA 5KHLB 1H8ED 1Y1TA 2J5BA 2YJNA 1S3SA 2ZCJA 5LOVA 2RGNA 3AHFA 4U8GA 1R88A 2C5AA 2G17A 5KWEA 2IIPA 1YR3A 4OHZA 5DMXA 3N0VA 4I1SA 1RABA 1LB1B 5FYDA 3KCQA 4BP9A 2COEA 4J3FA 2NZ8A 2X9LA 5G2OA 2OAP1 2X9VA 1RCTE 4MWTA 4WLUA 4LIPD 1KWGA 2CHVA 3DGEC 4CUJA 4LNUB 4FGLA 4QUGA 5B6IA 1TF2A 3AL2A 1XTBA 3ZXIA 5BMVA 1QIJA 5JZSA 1H3FA 1MAUA 2VC2B 4PAOA 1ESCA 2QLFA 3SGLA 2P3SA 5D5PA 2RGEA 5ALWA 1E58A 5E6RB 3T1HB 1MU0A 5F9FA 1I9CA 1CY4A 1YNOA 2ZJ2A 5L8VA 2H7XA 3GHYA 1HEYA 3FSEA 4JB0A 4TSFA 2WJHA 4Y9UA 3MJSA 5EWLB 1SKYE 3RS4A 1LRJA 5LD2B 2Z04A 2GTIA 3FZQA 2M32A 1HYBA 2QIOA 1EQAA 4M8SA 4F2DA 3OQMA 1V5WA 2V65A 3AF2A 2JA1A 3N8HA 2I7VA 4DMFA 5REQB 3JWIA 3U2QA 5LQRA 1TKRA 3QVOA 2XT9A 1NXWA 2WD9A 3OUTA 2BFMA 5FYQA 2D4AA 3FF1A 1HDGO 2Y9PB 4MA5A 1L7OA 5LVAA 1T4MA 2D2EA 2DPHA 4NU0A 3HFRA 4D4GA 1BSVA 1KZ9A 1MJFA 1FP1D 4YRZA 4TSRA 3K0SA 3DT9A 3V3TA 2QN1A 4JYMA 3RJMA 1OZ0A 4C1NA 1M2VB 1OXKB 1T5OA 2Q3BA 2WNHA 2A67A 3G5UA 1E1YA 5LP1A 1GZUA 4LTDA 4Q93A 1KEZA 4C08A 1QH8B 2Z8ZA 4Y2VA 1H2WA 1WCIA 2G5TA 3NJRA 2OCDA 3I4CA 3O84A 4K2HA 3A36A 1RE0A 4ZCMA 1NHWA 1MC4A 3NLLA 2YHAA 3KSUA 2C5HA 2DHRA 4M98A 3ZU2A 1LSSA 3HUUA 3ZBQA 2RHCA 4OMCA 2ZTHA 2OV3A 2YFKA 4YJ3F 5CM9C 2B99A 3E5HA 3MZ0A 1IY1A 1M83A 2C7QA 3JVEA 4DV1B 4B4KA 2GEFA 4GOJA 5BSUA 1RJ9B 3EG9B 1LRKA 3OQIA 4A82A 4GR5A 4AJ1A 1PGQA 4GPBA 4D0LB 2VHTA 4MIYA 5BNIA 4ZHSA 2HK6A 4HAZA 4RPKA 4Q9KA 3E2MA 1NNSA 3BMNA 3KAJA 1GY8A 1SXGA 4I9UA 2Z56A 3ZE8A 1VE6A 1BJRE 3KHTA 2HDOA 5BNFA 1DB3A 4PTZA 3FZGA 3DAHA 4KWHA 2H4YA 2QTVA 5BQ5A 4XUCA 2H2DA 1YI0A 2X0JA 1Q11A 4N3GA 4MPDA 621PA 2VF4X 5I9NA 4GZLA 3GP5A 2CN1A 4NARA 4CLOA 3KVYA 4EWLA 5EESA 1YZGA 2FRDA 1YZFA 4QVIA 4TVSA 3W90A 3AEZA 2Y6VA 3ANLA 1Y3CE 4FLFA 4WLVA 3EF1A 3HCRA 4NZZA 5IXJA 2O8CB 1SUCA 1ZCAA 2HAEA 4R16A 3RVSA 2V54A 2WJ4A 4QXOA 1WCV1 2NV2B 1J20A 4K9SA 4D4IA 2TSYB 1H93A 3ILHA 2GLTA 3R3SA 3TQRA 1NUPA 1B00A 3DPIA 1KOFA 2GS9A 3ZY6A 4I55F 1P2VA 1XDGA 5I5EA 2P0EA 3N53A 3W8EA 5D5QA 3ZY4A 1WUHS 4MIOA 3ZHSA 4Q3DA 2CLDX 1EJ2A 2YZMA 5MN6A 1WHSB 1GAXA 2HWYA 2FOXA 3PX3A 3QV1A 5LYJF 3OFJA 4TTIA 3DKVA 2CDCA 3C4VA 4CLOB 3FNHA 3CBQA 1K8XB 3H8WA 3FOFC 3GUCA 2O05A 2H17A 2HZBA 2OAEA 3GEEA 1ZI9A 1Y1QA 3KD2A 3QHPA 3DA8A 1BXRA 5KJEA 1T1IA 3OEHD 4J90A 1YS9A 2O3RA 2JJ2A 2IUFA 4IUCS 4JQCA 4L4RA 4KFCA 2FG5A 1Z5PA 3GAAA 1QYIA 1Z6AA 1EKXA 2FGKA 1UKAA 1KKLA 1Z6XA 2FUG6 2I8AA 2YASA 1RI5A 2YWJA 2YWHA 3ESQA 1E6UA 1O5OA 2FUNB 2ZYSA 3GLTA 3J7TA 5DWVA 5BSGA 4QM6A 3EFHA 3NJ8A 1TA9A 1FRNA 1P1CA 4XI9A 2VEOA 3KHKA 2OQ2A 3D9QX 4Z8YA 1O5IA 2HLDA 1L5WA 2Q1SA 2VI5A 4OU4A 3CUTA 3E5RA 3U1VA 1J0DA 4X00A 1A2QA 2IXTA 5AIBA 1H0SA 2AYYA 5TQ0B 1P5ZB 3FIUA 9LDTA 1YJBA 1GT91 1ZN9A 2AZTA 4MYSA 4Z3DA 4HDNA 4IOKA 5G4LA 2VYQA 5D87A 3V34A 1CF4A 3QWIA 5CDFA 3K6JA 3I8OA 5G0TA 5AIAA 5A0VA 1YDMA 3FPSA 4URZR 4EMTA 5C52B 3PUHA 2CLMB 4MRPA 5DM0A 3WGGA 1XVIA 1P74A 4LY9A 4RPGA 1TYBE 1R6DA 2X5OA 3KFXA 4WOJA 4XFKA 4I81A 2YICA 3FZYA 4K05A 3S4YA 3K31A 4CQLB 4ZCTA 1E6EA 1KQ3A 3A2MA 4KXUA 4CKCB 1FUEA 5TGZA 3TGPA 2ILVA 3ILYA 1B42A 1RWNA 2I6TA 1D0VA 5ELLA 1WLYA 3DEYX 3OMLA 1D2AA 1ADCA 3HDQA 4N3NA 1F0NA 1M34E 5FOWA 2Q99A 3EPJA 4N5MA 3A06A 1DBWA 4D46A 4UM9B 1OD6A 3P20A 1AUQA 2AFIB 7ABPA 5KI6A 3B8EA 3V1MA 2VEDA 2OQRA 5G0SA 2X5JO 3DYIA 3EH1A 3LLSA 3OOHA 1DKMA 4P53A 4Q9HA 1FSZA 5FPHA 3WGTA 4CDRA 4DF3A 3GPLA 4N5NA 3T8YA 3CNLA 4LK2A 4FSXA 3KUKA 3NC1C 4HK4A 3BAFA 1WQ3A 3PRJA 3VR4A 1YZVA 4HH0A 3N39C 1OXUA 1HORA 3IXMA 4NU8X 4RD1A 3JYQA 3KL4A 4I08A 1NJ8A 3SFTA 2X8WA 4OM7A 2Q8QA 4P0PB 1U0SY 4KV7A 3G0CA 3HRHA 3HZZA 2R2GA 5DW3A 1FMCA 1K6XA 2XSZD 2HMVA 4PC6A 3ML1A 4F38A 1DT5A 4HWGA 3WWEA 3OTOB 1VJTA 1UPFA 1U90A 3M4JA 5DRTA 5F23A 4H7KA 4YALA 2AG8A 1KZ4A 1NDUA 2O9JA 3QU5A 1TCAA 1XTIA 3H97A 4OHCA 1ZYUA 3VSCA 2VXYA 4ASUD 2B7LA 1VZ2A 3LQRA 1CVRA 4LYYA 4YJ2F 3M4XA 1ZD4A 4B6RA 4FFBA 3HM2A 1QFXA 3DZJA 4RQTA 4OQMA 3ZU5A 4MQFA 4AWXA 4FZ5A 4UCWA 2H5JA 4OJMX 3RYCB 2HU7A 1PZGA 3LDAA 5EZ5A 2HCTA 4ZT5A 3KKLA 1ZO8A 5FR2A 1SIOA 2N46A 2EJTA 5AJHA 5JBQA 3FB1A 1PD0A 3REFA 3OX3A 4L0CA 1TW2A 4M8NE 1SH7A 2DWOA 3LOUA 4Q9NA 2VYNA 4C2TA 2RHRA 1DAEA 1CUWA 2XA2A 3AC0A 3GFOA 1R0YA 2QRPA 4CIAA 2G9RA 3IEVA 1D4FA 3N7UA 1C7QA 1VJDA 4DLPA 1SC9A 4KQGA 1PEDA 1KJQA 1L5RA 1TJYA 2WHYA 3IQFA 3KZKA 4WESA 3W2HA 5K9ZA 4D2IA 1RWKA 1FUIA 4QOHA 4DLLA 1OZGA 3KKZA 2E9SA 4RPLA 1YZNA 2QOEA 3FPJA 4GYWA 1LX6A 4M7PA 3V8PA 1XMXA 1XG5A 2PUFA 5DHPA 4A2QA 4X84A 3PNMA 2H65A 4RIHA 4DUGD 4KN6A 2WYVA 4PX9A 4DSUA 3NHZA 3WLLA 3K9BA 3M4YA 2Q4TA 3VMFA 3HO1A 1GTRA 2WTBA 3FDFA 3PA8A 2I22A 4RELA 3C48A 2QEQA 3ZHVA 1QV6A 2QJTA 4ABYA 3DFZA 4C5BA 2WJZB 4D6XA 1ZJ5A 2PKWA 1ZNXA 4DCSA 2EERA 4UMVA 1CQWA 4LXXA 4PYMA 5JNSA 4OX9B 4F56A 4MKRA 2RK3A 1Y3DE 3QNWA 5JFOA 3TH5A 3F73A 1E3WA 2OBFA 4LY3A 4LV6A 4X8MA 4ZIRB 1U4NA 2YJTD 2XJ9A 3TKYA 4DRYA 2AWNA 2OV4A 4IDOA 3RT7A 2WZDA 4J4HA 1SU6A 3CW2A 2WSYB 3RFTA 5EJ7A 1WP4A 2ZIAA 4CNQA 4O63O 1MIHA 3H7AA 4EG5A 4KLRA 5ALTA 4F97A 5EHGA 2YDXA 4C04A 2GERA 2UUBB 3DD5A 3DDHA 4DIUA 5FR1A 2A3NA 3WLNA 3W6NA 3EFBA 4EPWA 2OFXA 5HJ7A 2HU2A 4NYIR 3EWAA 4ZEOA 4GKBA 1VYHA 1CS4C 1AKUA 3JYLA 4MUMA 5CIQA 4BMPB 2A30A 3SXPA 4CU2A 1EHYA 1KORA 2O7RA 3D7MA 2GK6A 3D7KA 2QAJA 2OXIA 5KDDA 2IYOA 4GM1A 1M1YE 2VXCA 3K7EA 2W4QA 4M1MA 2GXQA 4YMIA 3MTDA 1U0HC 3MD9A 4CMJA 5C7OO 5BNTA 4TYWA 5CCDA 2OLJA 3NOXA 4TV8A 4MWDA 2FSVA 4TS4A 5DI3A 2C92A 4FOOA 4NV1A 4L8GA 5BNZA 2PFSA 1B43A 5EERA 4ND2A 3P2OA 1CX9B 1CJCA 1NYQA 3E9DA 4XJTA 4OHUA 3T7EA 4JJZA 1PEKE 2XCUA 4KUGA 1NXOA 4P4GA 1NMYA 2C5FA 2FFRA 4EMUA 5FUMA 1G8AA 4DQXA 4XTRA 5HVNA 5JXWA 3H83A 3WKCA 4K9QA 1RPNA 2FDRA 4CG0A 1TEHA 2FPKA 1XAIA 3E7XA 5TPWB 2IKQA 3VYVA 2Z2JA 3FMOB 1TLFA 2MCFA 3WFZA 4EYSA 3WSTA 3MWLA 3BF7A 4K81B 1V9LA 5IN5A 1IJEA 4MQMA 1FC0A 3OJOA 1QIKA 2SNIE 3QKSA 3B1ZA 3LLMA 5E2AA 1RC1A 5CK4A 5E4JA 4YRAA 3UJHA 3F5DA 1FB5A 1VE1A 3NGMA 3VOTA 3IE1A 1B8VA 2ZJ6A 4ZRDA 2DEUA 2VPXA 3W4JA 4FZJA 4MA0A 1E7RA 1KEPA 1RWMA 2FEPA 2W7TA 3GCWA 4D79A 4JHXA 3DC7A 1GA6A 4TRJA 1OU4A 3KTAB 4TVKA 3JR3A 2AG0A 3KZVA 1QC5A 3NTXA 5DXAA 2V98A 1FW8A 3KQTA 1CBUA 3BE4A 4I1IA 2E89A 2DQ4A 1EFVB 4EVRA 4Q1FA 4KMRA 4JR1A 2Q07A 4LRQA 1AUOA 2HWKA 2ZU6A 5F1KA 4ZGBA 3GLHA 4MUGA 4ZT2A 3NYWA 5B7GA 1E1DA 3RKSA 3A58B 1CF2O 2ZBFA 1YTUA 4TV9A 2QUJA 4BX9A 2WWXA 5DNYB 2QPOA 3K9HA 5JCJD 5C4IA 1KZ6A 3CIOA 1SC1A 1WCXA 2J30A 3M6LA 1GPWB 4DTIA 5GONB 2UZ3A 3AJ8A 4A8JC 2HV8A 5AHXA 4FIZA 2K87A 3ZDXB 3PXBA 3V00A 3N2GB 2V96A 4QATA 4AI6A 4PO3X 1H0RA 1TVEA 2GTHA 1TMGE 1Y3HA 1RRFA 3LHDA 1QGYA 2QTTA 4Z1OA 3BJRA 4BNHA 4OKIA 1OWLA 1XZIA 2QTRA 4HGQA 4P08A 3NMUF 3VR3D 1EINA 2HK9A 2G08A 1GITA 1Z2OX 3L7JA 4WINA 4EHFA 4U9UA 5G0UA 3GVCA 3EUWA 4K1LA 2Y77A 4KI0A 3MWEB 5CX1B 3UANA 4A0QA 5K4HA 5LWQA 2CVPA 2FXVA 4UBKA 3JU3A 1XOIA 1NDQA 3DDOA 4ND1A 2WQ6A 3CWQA 1Q3TA 1AY0A 1TQ8A 2CHQA 3A1FA 3IMEA 2O2IA 4KRXA 5EIHA 2RH4A 2QR3A 3CFYA 3D3NA 4IAOA 1GU7A 4R8MA 1MLDA 1XNQB 5LXTA 4UNNA 3I6YA 1WLSA 1NW4A 3RT9A 3K4QA 4HB3A 1GHTA 2IU6A 1ISFA 1NX6A 3E84A 5B2ZA 3WAKA 2V0GA 2LZ0A 3OM8A 4HXEB 5H3LA 2R0QC 5FBZA 1X86B 5EWMA 4X54A 4REMA 1BCRB 1CDEA 2GXSA 2C83A 3C74A 3BWXA 3SE7A 2MIIA 1ECLA 4HQ0A 3WICA 4UCXA 1GDTA 2WYIA 1P77A 1W9HA 1PR4A 2VYFA 1JT2A 3OZRA 3PDIA 4UUMA 3RARA 2XDQA 3L8MA 3ZK7A 3G1UA 5M34A 3Q40A 4B2LA 3L41A 4GZMA 5F2OA 3GVHA 4US1R 4B5LA 2AZMA 3FJYA 2ZRKA 2Y66A 3U4IA 4EX7A 4YRCA 1P81A 4BWFB 1CRLA 2ORED 2E6KA 1C9NA 1IRXA 1SD5A 5LQJA 2IYSA 5FWAA 4R0NA 3RK4A 3FYUC 1MOSA 5CNJA 4AX4A 3K0CC 3DZ8A 3TLXA 4W1QA 1D7OA 1YCHA 4MLDA 1BEUB 4DIOA 3P2JA 4PCLA 2VT6A 1RQ7A 3I58A 1ELOA 1UDWA 1K75A 2DUWA 4Q3AA 4Z2YA 3EYWA 4WECA 1XQ9A 2ECOA 4TWIA 5IEBA 1D9XA 3QVXA 3AIKA 2EZ8A 4CQJA 3DL2A 3JRXA 4XCQA 3OM1A 5DN6A 1VMKA 3AT1A 1PG2A 1ORDA 3CRNA 1AXGA 3HJNA 2XUQA 5CGQB 5CDGA 5JALA 5KWJA 2X5XA 4ZAGA 3T9BA 2JGJA 2H31A 2OO5A 3FF4A 5DCLA 1NI4B 4ZHQF 3A6GA 3PCTA 2PO7A 5CH5A 4JD5A 2A9RA 3ZJ5A 1UBHS 1Q91A 4DT1B 1LTHR 3FGZA 1EUDB 2N0SA 2HIGA 3D7NA 2BKEA 1U0JA 2G07A 1CIPA 1M6YA 2FUEA 3N2ZB 1LDGA 1FU4A 1KJWA 1L0BA 1TTHA 2ZE5A 3C1UA 5DM1A 3ZEAA 1K5DA 3NWEA 4J9VA 4BMDA 2OZLB 3JWEA 4W7SA 4FPXA 1JFVA 2OFPA 3PGMA 1UM8A 2MINB 2ZUUA 4FGWA 3UAVA 1JIJA 1E1MA 3TOVA 3U13A 2PQMA 2BUAA 3T3IA 1WXQA 1XROA 4MP6A 4OUDA 5K99A 4GI3A 2OFOA 3WK8A 3ESDA 2D7CA 3LTNC 2Y67A 3KK0A 4KXFB 1ZH0A 2BEVB 4XASA 3DLHA 3PI6A 1LNQA 5KQPA 2V7WA 5BSMA 3UGKA 2UZAA 1CUCA 3DB2A 4KR2A 4Z4IA 4Q12A 1U7WA 1RYHA 5KHAA 2H00A 3K53A 3NETA 4MKGA 3BXPA 4R1NA 4M60A 2BHSA 1DJQA 1P1FA 1VE9A 1EGAA 4EABA 4EHIA 2AN4A 1TL7C 2NW6A 4ID3A 3F6SA 3MC1A 1KETA 3Q8KA 4B74A 3DZKA 4CR6A 2HX1A 1G5FA 1IB6A 3IIIA 5A6VA 5AOAA 3E70C 1EEHA 1XT6A 1KO1A 1AGPA 5JCZA 3M1LA 2OR3A 5CPBA 1R0LA 3AR2A 2IV2X 4KIFA 4Q47A 4XD7A 2JJYA 3W05A 2WUGA 2HJVA 1KZ1A 2OM6A 5CW1A 1CUIA 1JLHA 1N0HA 2QMQA 5CCBA 1EX9A 5A0FA 4DG8A 1J7KA 1HRKA 3ZZTA 2FOIA 3RUHA 3HB5X 3EXFA 5B37A 1L4KA 1TA4A 2ZTSA 2PZFA 5FULA 5FI5A 1R10A 1LWNA 1XZPA 3E1KA 3UTDA 4ZYTA 3PPYA 2EX0A 3OETA 3D7SA 5AUQA 5C8ZA 4TMXA 1FSFA 1PL7A 4TT3D 4BIMA 3UPTA 1NMXA 5AW8A 3FHJA 1DQZA 3TKAA 2B3TA 3V8BA 1UT8A 2FZKA 1WZCA 4JC4A 5I9BA 4DQLA 4F12A 1K27A 1JNYA 1SY7A 5FI0B 3RHTA 1XTRA 2BFPA 1T9GR 3GDOA 1OLXB 1QDLB 4EVSA 1X7DA 5B2FA 2EW1A 3EQZA 2I65A 3OSZA 4H0FA 4CEIA 1YRAA 2JASA 3AEKA 1XZHA 3BTOA 5C9ZA 2PIAA 4J07A 1OWNA 4M88A 4AB1A 4IHQA 1K8YB 1Z0IA 3HRKA 2O8FB 1EA5A 3CF2A 3ZNPA 5C8YB 4BO4A 1RXEA 2EP5A 3DWIA 4BFWA 3E0XA 4ND4A 3A9TA 3KVNA 3SZGA 3LL7A 1P5RA 2EG5A 1OFVA 2ZRBA 2DFPA 2VP5A 1TE2A 2G04A 4QJ5A 3FJOA 4TV9B 2CMKA 3WGVA 5A4DA 3HGMA 5IUJC 1LI4A 5JQGB 2FZ5A 4G6ZA 4QC2A 3QVLA 3SMQA 3Q85A 1M33A 3K09C 3Q7SA 4A2WA 2QUZA 4M0KA 3G13A 5GONA 5A3SA 5MDHA 5FNVB 1EFVA 4F5WA 2Z4TA 4DJTA 2A14A 3FYTA 4W9RA 3LUBA 3SSNA 1T29A 4D0NA 5BY2A 1NNEA 1UJNA 3WDKA 2ISSD 3OEED 2ZIUB 1YS7A 2UUAB 4YAFA 4KXYA 4HH4A 4PLZA 1ZD5A 4Q05A 2D5AA 4XVRA 3A1UA 3K6SB 3NVAA 3VYUB 4KQXA 3ZE6A 3T94A 1JHPA 2FY8A 3MLAA 3P9QA 1URPA 5AVOA 2QTWB 4LVNA 3WFJA 3QMPA 4NH4A 4DUPA 1QS0A 1XDSA 1RI3A 3OEWA 3AYZB 2B61A 2FSUA 3A14A 3M5WA 5EGNA 5IYZA 3GLQA 4LYHA 5CT5A 2DG2A 3RBVA 3RSLA 2WRZA 3GEMA 4MHSA 2ZRJA 2EV9A 2KYRA 3EXIB 4M22A 4S04A 3D4NA 6NULA 1TOAA 2R6AA 4N8DA 1DP4A 1XK7A 2ATVA 4II7A 5TPWA 2E55A 5K2OA 4CVNA 3AKYA 2P4SA 4AY5A 3EGOA 4DNOA 1JSXA 3G2IA 3QV2A 3KB1A 4BHTA 2VF5X 3I76A 4B6GA 4OHBA 1KZGB 1ILEA 3DMYA 2A1TR 3AEUA 3QOWA 3HV0A 3VVCA 3LQ4A 4F1KA 1RPJA 2HOQA 1J39A 2PWYA 4BAZA 3B89A 3H8JA 4D92A 1I2MA 2PZEA 2WD8A 2AI2A 2Q27A 3ZV4A 2PS0A 3T1YB 2FP3A 2GUWA 1DGQA 2C9OA 3K1YA 3C7AA 3LVRE 2HB6A 4KPFC 1I1NA 2EAUA 3I9LA 2PD6A 5DP1A 4X24A 2A4KA 4TL7A 1SK8A 1BXRB 5EUBA 2YNMC 1CZRA 1M2FA 1UZMA 2HADA 3BD9A 1R5NA 2RI6A 4ZVQA 2VAXA 2DQKA 3GMIA 3IT0A 3JZAA 4YAIA 4HGZA 3L1UA 4LJLA 1QQTA 5HCIA 1AGYA 4AG5A 2CV2A 1AKNA 3U4GA 1DZ3A 7GPBA 1N5DA 4OA5A 3QEOA 3RE1A 3EY9A 4DXAA 5CNMA 1TC1A 2VIIA 4TQAA 1CDDA 5EJFA 4JXXA 3PX7A 1GJRA 3LXMA 4XSHA 1EZ4A 4Z5XA 2OCYC 2PTGA 2QBYA 3M49A 4KO2S 2CJYA 5T6MA 4NEGA 3U9TA 4UUQA 1R6UA 1JFLA 2IYXA 4CEHA 1UBRS 2FPUA 2FYTA 4HNHA 1KVSA 4ZO6A 3QMMA 2QNRA 3AERB 5DI3B 2A1IA 1WSAA 3UPUA 3I1YA 1VE5A 4M87A 1EFRD 2JAOA 3WR5A 4N0EA 3CNOA 2I2FA 5F73A 3CLKA 3RVRA 4K6FA 3MRXA 1MA3A 2JIQA 2JHPA 1ZHFA 1V41E 2ADMA 1MDBA 1ONOA 3TEJA 2ZS9A 1X3SA 1ZGJA 3R3JA 4FT2A 3KSRA 1HT1E 1GLNA 2OC4A 1K92A 1V3UA 4GVXA 5D3MB 3RIMA 4J0CA 2RE8A 3AIIA 3DKKA 2V45A 1EWKA 3NAZA 1SQ0A 2IP4A 1PWHA 2X5KO 2XMRA 3I1JA 1MNAA 2VJAA 1HKHA 5GOZA 4FW9A 2P40A 2UZ4A 2L17A 2ZZNA 2H9IA 5IDWA 4E31A 3U7FB 1N2CA 1KXJA 2OO7A 3CKYA 2CNBA 5EIOA 2A92A 3JYOA 3NTQA 5SICE 5JEEA 2J9RA 4FQ8A 4BJ1A 5I45A 3H1PA 3WNVA 3W1VA 4E1BA 5IJ9B 3QBDA 5KQRA 5E7IA 3HCEA 5TARA 2FTKE 3WFIA 2AD1A 5A4JA 1ZVMA 1ZL2A 2CZCA 2IXEA 2RGRA 1M8FA 3OJXA 3HJFA 4BV2A 3P96A 1DPFA 3OQBA 4OIMA 1X1AA 2HJGA 4FD3A 4ZVUA 3TGLA 4ILEA 1HE1C 2VWPA 3TD9A 1FX0B 1E79D 1ONPA 4DQDA 2EJVA 1M1NB 1Y1LA 5KU7A 3GLSA 5EQTA 5C5EA 4U5XA 4DMRA 1C9EA 4MGHA 3PSHA 1YE3A 1H6AA 1WVIA 1EWQA 4JB8A 4ER3A 5FBRB 1NXQA 5GOTA 1AOXA 1RM3A 3P7MA 4HTFB 4ZMSA 1XZQA 2CZGA 2DE0X 3MF4A 1O94C 4ALMA 2JIMA 1S9DA 3KQPA 3EZ2A 1R5BA 4JLSA 4U1RA 3VSAA 5CDTA 2O19A 1UPUA 4YJKA 5L53A 4N18A 3F3SA 5CLIA 3U4DA 1GSAA 2CKMA 2Y1XA 3NH6A 3NHWA 2TMDA 3E53A 5D3KA 5DBFA 2RGCA 5A7FA 2L82A 4JUFA 1AKQA 1VM6A 2IOHA 2PDAA 3PNSA 5IRCD 1C1DA 1W49A 2D13A 4FXPA 1QQBA 1H2XA 3RREA 4QU8A 1L5MA 2HD4A 4RS3A 1HE8B 1D6MA 2MSCB 3CNEA 1R8QA 1RPAA 2VAWA 2FRDC 3LVFO 3DT6A 3QKUA 4BX3A 4G4JA 1LK0A 4OLFA 4B6FA 1HG0A 3I1FA 1BGVA 3IVRA 4FP9A 3QE0A 4JFAA 4RAQA 1JEDA 3RG2A 5CG1A 2X1VA 4XD7D 1MEJA 4E6PA 2YJ6A 4A91A 3R09A 3PEVA 2GCPA 4L8WB 3BZUA 1N78A 3BGWA 4PLTA 1XZNA 3IHLA 1GG9A 1YBAA 2QJFA 3ZI7A 4LNUA 1RVV1 4OTZA 4CF6A 1HXHA 1QCDA 4MVYA 1ISRA 4BX8A 4C7BA 5C8VA 2HO4A 3S2EA 1WBBA 2FK8A 4UVIA 1T25A 1QGOA 3HL0A 3AG6A 5CA0B 5C18A 3OT5A 2NSYA 3DE2X 3EEOA 8AT1A 4MICA 1HR0B 4JI5B 4JC8A 3CUEF 2VHJA 3EFOB 5BSWA 1G8HA 2I80A 4LSGA 4BMNA 3VX3A 2QT0A 3BH7A 1PJZA 1IHDA 4NHOA 2QD2A 2VBIA 2H63A 2KS6A 3FDIA 5FPQA 1M6EX 1ZFNA 4WERA 1W75A 1Y8RB 3IVXA 5B4VA 4B43A 1E2FA 4ZZ3A 1KOGA 2ONJA 3W7BA 3AJEA 4FX5A 1P60A 4MEAA 4CLDA 4GXRA 4UNRA 2CFOA 2EEPA 2I9PA 3B3GA 4WDQA 1QIEA 3B3FA 2A8YA 4G4SP 2FZWA 2JBAB 1ZC3A 3JYNA 4TOIA 3QLVA 4FEYA 8ADHA 4H1WA 2FFAA 3CN7A 2G77B 4KXQA 4Z49A 1OXTA 2N1MA 4D4HA 2CD9A 2I3AA 3KZXA 2XR1A 2I03A 2WHPB 3LG2A 4IXMA 2H4JA 4KI7A 1FNDA 1M6WA 2MHCA 1C4KA 4R5MA 3SEZA 2Z3VA 3NVKI 1SBCA 3V1NA 4EUFA 4IVNA 4YLEA 5I7FA 5HRCA 3ZU6A 1MX3A 2BI8A 3KYCA 3LYAA 4LQ4A 2VPPA 2YHIA 4QAJA 2ZWAA 1FFBA 3H84A 1J8QA 2NO6A 3LZ6A 3KIPA 4E11A 2I55A 1S2NA 4NMLA 1YULA 4MW5A 3GA7A 3O90A 4FN5A 1IVYA 1EBBA 2WUDA 1BHQ1 3NWJA 5B64A 2OD7A 3OPXA 5A71A 4DNQA 1OH6A 1DUVG 1KPGA 5KTYA 3PJRA 3GVIA 3JY6A 3EMDA 1VIYA 3MJ4A 2P2SA 1JJAA 4JYBA 4LF9B 3ABSB 1T4CB 3Q2KA 2EJUA 1W1UA 4AXBA 4FZRA 4EYOA 2PKEA 1P45A 3TCXB 4KIWA 1FJ2A 3N05A 3LK6A 4FOTA 4TUYA 5EXEA 5BQOA 1K3TA 4GSKA 3C7DB 1HA3A 1HTWA 1Z56C 3PLNA 4L4SA 1W52X 3ECCA 3OLCX 4LDPA 5IJXA 3DDUA 4G8DA 2GEJA 5KTPA 4HAVA 2Q4RA 4EQ6A 3ABOB 1P33A 2ORVA 5B1IA 3S8YA 2YJZA 1DIRA 1H9AA 1EDBA 1U3WA 5AM4A 3QU7A 3HZHA 1U4OA 4D25A 2DJ5A 1SUAA 2AUMA 2ENWA 2ZRAA 3HY4A 1BXZA 3QFHA 3FYDA 1C3JA 4HRAA 4JGGA 4URFA 3TTTA 5LMUB 1SULA 3K70D 3K6SA 4CGZA 1WKVA 1GL6A 3ELBA 4A7PA 4AF8A 4ZDJA 1ZK0A 2BFDB 1NIPA 3H5NA 4HPXB 1MVLA 1ZGHA 4EIWA 5K0FA 4B4OA 3LKBA 2ACKA 3L7AA 4HLUC 4RNDB 2J31A 2AFHB 3O8OA 1HLGA 4XIFA 1NBIA 4PM4A 1PZNA 5CXXA 5DOZA 2AF3C 4IJWA 4XKJA 4OL9A 4YWJA 3B13B 2JEOA 3KV3O 1YVEI 4TROA 4H4CA 4H6XA 5FX2A 1H3EA 3H8VA 3DTVD 4Y6LA 1EBUA 3TUJC 4CQLA 4IDEA 3QHQA 2NU7B 4HDOB 2Y3IA 1XRSB 3THXB 5JSUA 5LQUA 4I14A 3LQ1A 4DJDC 1TUIA 5EE3A 4CN9A 2NXNA 1LGYA 1PWXA 1U9YA 2NO5A 3GJRA 2JIOA 2FEMA 3W2IA 1ZHHA 3UJ3X 2QL9A 3UY4A 4CR8A 1SHJA 4RORA 1EHCA 4X1YB 2I3GA 4QHYA 1LI5A 4RZQA 1LLUA 1Z29A 5I8WA 5ES3A 4V0LA 5DNAA 3H17A 3WOVA 4AM8A 5J4YA 2B3DA 2XDQB 2ZYAA 5IXSA 4GKKB 3MCZA 1N9GB 4KAAA 3X3HA 3N58A 4PYQA 4WZAE 4PANA 1TJNA 4UM9D 5AKXA 1MORA 2OQVA 1KJ9A 3WGZA 3IPXA 1BKSB 1PUJA 3HJCA 2VHXA 4IIXA 2X0FA 3ADKA 1E7QA 1OFUX 5CDUA 4EL0A 4HWRA 5D84A 4OQEA 4LSMA 1K2VN 2HF7A 1XNHA 2IU0A 4D9NA 1NJGA 1MC5A 4OM8A 5IZCA 1N4AA 5TPZD 1ZIYA 1DKLA 3OM0A 3PVCA 4OP3A 3S1AA 1WXFA 4DLTA 4RSRA 1PJQA 5H9VA 5EPUA 2AXEA 4U2DA 2KM1A 3R7AA 5JAIA 4ER6A 3U4MA 1Z5ZA 3PBKA 3L0IB 4M7OA 2Y71A 1A9YA 3OZVA 3JARB 2L42A 2CB9A 2HIAA 2BP7A 2Z30A 3C3YA 3NBXX 4DDVA 4JT2A 3OE5A 4JYAB 5IYZB 2UAGA 5EWLA 4AMZA 2P79A 1GDHA 4DLZA 3NVDA 3WMGA 2OG1A 3D2CA 4GS5A 1XZLA 4RZXA 4JLOA 1Q6YA 1KDPA 5EPEA 4UNSA 2ZSIA 1MHTA 4HBZA 3M3HA 1NN5A 1Y4AE 3FUUA 3OIGA 1ETHA 3NNNA 1OC2A 4RDIA 4S2EA 4LBVA 5HKBA 4QGGA 5AQEA 4BO6A 3ZCSA 2FSFA 4ZZ2A 2HLDD 1VZ3A 5TC4A 4MDFA 1QS0B 3MG9A 4P3PA 4BIIA 2E4ZA 1ML3A 4FMCB 5KTRA 4DAOA 3EC1A 2NPOA 4EL5A 2WAAA 3I04A 4J0HA 5ILOA 1FTWA 3TLYA 1TK2A 2ZJFA 2IWRA 4DPMA 3II6X 4PSUA 4A23A 2BVNA 4JLMA 4CM4B 2GVDC 2QMZA 2IPAB 3GRKA 5AJVB 3BCRA 4KVFA 1JH9A 4C7JA 3TZCA 2QYTA 1KQOA 3PE4A 3LDFA 4Q82A 1UKBA 3BMCB 3ENZA 2FB9A 3O6VA 3O31A 1OI7A 4FFOA 3TINA 2B8TA 3BGSA 4KODA 4BMYA 5C35A 2OMEA 2J3IA 3DFMA 1T36B 4K28A 4MULA 3EXIA 4EUHA 1EFDN 5KREA 4JUCA 3LZCA 4FB4A 4PN3A 4YUAA 2XZOA 1NMQA 1U8FO 1SG0A 4R6WA 2IW1A 2O1XA 4GH5A 5CM2Z 4OHRA 1DRUA 1UC5B 3DOHA 3ZWCA 1GR0A 4Q37A 3PFHA 1LWOA 2IGTA 2XAUA 2H4ZA 3C98A 4ERNA 4CQMB 1QLHA 1YZQA 4FKBA 3DLPX 1J42A 1P39A 2M2IA 3CW8X 3ME5A 4J1SA 3QPAA 4JEIA 4K6KA 1ORWA 1RSZA 2Z95A 1J4AA 5FCDA 5TEWA 1GQFA 1OXXK 4AJLA 3SZUA 5LDHA 1OI2A 3N1UA 1EA7A 4KR6A 3KEQA 1U9JA 2F3TA 4ME6A 5BR8B 2WKRA 1NBMA 1Z13A 1GXSB 3CLRD 3U5ZB 1N3IA 2YRFA 4GL2A 1IZZA 2EQBA 1NSFA 1V11A 1PG0A 2C0PA 2HWXA 3DLIA 3PS9A 4P8RA 3RS9A 3O8RA 4Q21A 2ZROA 3HB0A 2WBLC 4A8TA 4R0VA 3U80A 3D0KA 4RPIA 1NR5A 1K9SA 4M46A 1FNCA 3TDNA 5C34B 3L93A 5DOVA 3T7AA 4QQNA 1QONA 1DINA 3S8MA 3DYVA 3SEQA 3DT8A 4Y1RB 4DZZA 2HY7A 1QHHB 2P1ZA 3UYLA 3K9GA 3E7PA 4IZHA 1Q2UA 1UMDA 3I5MA 2J3DA 3TRKA 3OOYA 4BVAA 1CUEA 4NYJR 3TXXA 3FRIA 4ZT7A 4O2RA 4NOMA 2YFQA 4IQFA 2MSLA 3ZGVA 2W6JA 3G0IA 3KUXA 3GK3A 4C14A 2HBZA 4LJKA 4PLFA 4TN1A 2IUTA 4TMWA 2WVGA 4RSMA 1VBFA 4B3XA 4C0WA 1AVTA 1GNRA 4FHDA 1BWQA 1R0ZA 1D2EA 4F3TA 3HCPA 4G9EA 4DIKA 1SBTA 4OLBA 2FF7A 5LZ9A 5CHYA 1D4ZA 3ZHOA 1AHHA 4P4UA 5KPDA 2WMOB 2ZYUX 1NP6A 2WUEA 4C4SA 1SCNE 1JF8A 3K5WA 3VKUA 1U5BA 1ZOIA 1ZK3A 3CF4G 1PT5A 2YW2A 4OAOA 1KS9A 3ZDFA 1VJ1A 4BMXA 3C5WP 3FLEA 4D9KA 2B5WA 3MFYA 3NTUA 3TW0A 5HM6A 3WA7A 1WBJB 5EKXA 2UYQA 3KYIB 3DAOA 3ESRA 4J1NA 3OOEA 1JA9A 3ZGOA 4RVOA 3N7TA 4MWSA 2NZUG 3G0BA 3GF4A 3VTAA 4JP3A 4CG2A 3WYDA 2GWHA 2C58A 3NAQA 4JL6A 4E0BA 721PA 5D86A 2CYAA 2AG6A 3GGGA 1JAYA 4B76A 4YXFA 2JLVA 1Q77A 4ZDWA 3FBGA 5EA2A 3QKIA 3RU2A 1U9IC 2IUUA 3VVMA 4KC0A 1YQEA 3AW9A 2VWQA 4FLEA 4UXHA 4H9GA 4D81A 4RMHA 1SXJB 2EW2A 3V8MA 3RVKA 1B3RA 4N41A 1GGEA 4P4SA 3T95A 2G36A 2P77A 2R2AA 3TXYA 4CODB 4FFVA 2ZUBA 4QFBA 1XZDA 2FR8A 4BNLA 4I1YA 4XGRA 1XU7A 5ERXA 3C1OA 2PH3A 1AQJA 5AKIA 1JB9A 5AW4A 3EIHA 3HHEA 4INJA 2PRZA 3DV2A 2O7NA 4YPFA 1G3MA 1YOBA 4LBWA 3KTFA 2PO5A 2G82A 4RIIA 3FYSA 1Q7GA 2IEYA 3BCHA 1M1YA 1VIVA 1W5EA 4EPTA 1M7GA 4NU5A 2FPGB 3QXJA 3BMQB 4R81A 1FMLA 4ZU3A 2QORA 2CCGA 3UKOA 1HFEL 1V6CA 2DWUA 2WUWE 2AI1A 3GT4A 2A5GA 3NPAA 3DSRA 1LLQA 3RYIB 5B1YA 2WY2D 3ENWA 3B5IA 1F8GA 2XYVA 3BGVA 5BWBA 2OHGA 4NNPA 4X1OA 1BGXT 3IVAA 3DXZA 3PNKA 1DZIA 1NWCA 4EKDA 1Q0RA 4O1MA 1L7EA 1Z2AA 2F67A 4C6TA 3CNQS 4AU1A 4O2AF 3LHFA 3VOBA 4DREA 5C4GB 1XAHA 5DV9A 1J9EA 4B79A 5M5BA 1O9BA 4LZNA 1XJCA 4AJNA 5I7UA 3B7PA 3N0TA 3QUAA 3L7BA 3LJKA 3H5VA 2QYOA 2UUOA 1K5GA 3STWA 5ALJA 1JIVA 1T4DA 1GT6A 2F3PA 2ORIA 3EGCA 4TWJA 5H16A 5T4EA 4HJRA 4AJ9A 2DRIA 3CRZA 1W5BA 2RHBA 2ZU0C 5DHAA 1C81A 3ZV7A 5IT9A 3HN7A 4O2BF 2XNSA 3AUXA 3H6HA 4K9DA 4KYTA 3VV3A 3U44A 1SKMA 3K35A 1PWYE 1J5EB 2VRWA 1ENPA 1P7ZA 2XGOA 5HQ3A 5DCUA 4X1YA 3WKDA 4AG6A 1JAIA 4UAGA 1DC5A 4AUMA 1KTIA 3H16A 3ZBUA 1HPLA 1Q0PA 1Y9JA 1B6RA 1XTUA 3GVXA 3EEQA 3SZMA 3I2KA 4C89A 4EJSA 1NM5C 4CKXA 4TMZA 3DNPA 3T12A 4KNVA 3RHZA 1W36D 4MRMB 1O6BA 3OKPA 2FW1A 1L6RA 3OD5A 5K51A 3SX4A 2A9JA 4QBFA 4R2MA 4WEOA 2UYGA 1VRWA 3BIOA 3DTTA 4OMUA 2WV9A 4FEAA 4QDJA 3C4QA 1ZY2A 1YHYA 1BCRA 2H11A 1G21B 3CTMA 1IY0A 4HNQA 3TJMA 3WBJA 3WMFA 4W6ZA 1THGA 2Y2VA 1ZJZA 3G8DA 1YUNA 2CVZA 1EK1A 5L4LA 4QUHA 3ZH9B 1GP2A 2JA2A 4MB6A 1GKIA 1JPNA 4RD6A 4V3BA 2X9QA 1N77A 3SYTA 4CL2A 1BNCA 1C1DB 1TUGA 3S1AB 1HZZA 1QG2A 5LKRA 3GUVA 3AF3A 4LF6B 4XGQA 4JB3A 3KZOA 1VJ0A 1XL1A 3AF6A 4YRNA 4NNJA 3HVRA 2FE1A 1WB9A 1Y6FA 1CEQA 1FVFA 3EMVA 1NAHA 2YXBA 2V6GA 5A9TA 2GBFA 4MWZA 3W1WA 2YQ5A 3NWPA 2IHBA 3Q6IA 4L6AA 2D1RA 1R0XA 3T1OA 2OV1A 2AR0A 5AK5A 3P4XA 2PZBA 3S2ZA 3VU1A 2B9VA 4KU4A 1P3DA 5EMJA 1B6GA 3PTZA 2EFDB 3QX7A 2V7BA 4G41A 1DQPA 1BE8A 1FQOA 1T36A 5DT9A 1YE8A 5GONF 1L5HA 2B1IA 3I6BA 4WAUA 1BN7A 1PLLA 4PHFA 1NG9A 3LSYA 4DPLA 3QG5A 3E22B 4AJJA 3W9YA 3CIFA 5JV5A 5IK2A 2NADA 2PN1A 3HXLA 3RYHB 5A4FS 1DMSA 2CZQA 3CU5A 1FFGA 3EZYA 1N5LA 3W0LB 2NU8A 3L0DA 4Q4HB 4BY9E 1NU6A 1QRUA 4O4LF 3OVMA 1XZKA 3T7KA 3TX2A 1R0WA 4CDMA 3D31A 4C05A 4A03A 1CKEA 1VJGA 1A9XA 2XRFA 3W2TA 2C2WA 1M2HA 4QPDA 2QL7A 2AS0A 3UK7A 1EXMA 2PK3A 4PX5A 3QEAZ 3UAWA 1QO0D 5DSZA 1KMMA 2R1TB 4PCVA 2P9QA 3TOSA 4HFMA 1GFWA 2WEKA 3H5OA 3AYXB 3Q8WA 4JYCA 4GWGA 4OAPA 3MEQA 3I0MA 3LUFA 4E5DA 2YWBA 4KHPB 1NKSA 1DQNA 1Y8QB 1ENOA 1XVAA 4GICA 4QUAA 4B3JA 4EX6A 5BQ3A 1F60A 1T2AA 4M38A 4RHCA 5KMGA 1UWVA 3PK0A 5IAGA 4K1XA 4S0ZA 1ZCFA 3EXG2 3RYHA 3H11A 3TTWA 2IK8A 2C9DA 3GBPA 1DIAA 3GLUA 5AVZA 1A9OA 4PZUA 1HMYA 5C81A 1P8AA 3R1IA 2ZQ5A 2HC9A 2XJ4A 5CH3A 3Q88A 1ZNQO 3GJ3A 3I73A 1PR0A 4KE6A 5DT2A 1CZNA 1M9NA 1II8B 1W0KD 2QI9C 4MTCA 1LDBA 1O5TA 3JW8A 2ZUSA 2O0HA 1DDIA 1PJRA 1DLIA 1YQWA 3U3JA 4YP9A 5IABA 3VTFA 3GFPA 4P34A 1YA6A 3PP8A 1W5TA 2GQ0A 3CPJB 2GEBA 2PPVA 3UMSA 1BAPA 3LKZA 2WDZA 4AJOA 2V7VA 3RSCA 4MCAA 1C9KA 3DE4X 1KK3A 2B2CA 2ZI5A 3VYRB 3ZK8A 4BNGA 3BB4A 1O4WA 1RFGE 3MXOA 2REBA 1S3GA 3M6AA 4PR3A 3T15A 2O54A 3A4YA 3M83A 1J2RA 1HO3A 2BEWB 3D8RA 3TZLA 1DO0A 4MV3A 2GM3A 2K2QB 4GWLA 3ON5A 2I1WA 1BDMA 2HA5A 2RKWA 3A4NA 3KJGA 4JB2A 4NJOA 5C51B 1F7UA 1Y8CA 2CUKA 4QICA 3OCCA 2LDXA 2VDWB 2R6JA 3E6AA 5SYNA 1Z4NA 4OHXA 3SQOA 5BPHA 2ZBEA 2P2CA 5B6JA 1W7AA 2FPGA 3O2NA 3WLQA 2V6BA 1MIOA 2I4TA 2X42A 1NVVQ 3AHEA 5D01A 3SQLA 4UOZA 3U19A 2XGMA 3WB0A 3CC8A 3LT2A 3FHLA 1GA4A 3PCRB 5FUBA 5BVGB 4PAQA 4WOCA 3B2QA 2FSHA 2CXXA 3AWIA 1MTZA 1ZQ9A 2HIMA 2Q50A 3G8AA 2WWYA 4P7JA 4UHKA 3NHFA 2GBCA 2GXAA 5KVSA 2PL9A 2WWTA 3PNOA 4A9AA 2XXAA 4TLDA 2V4UA 2GETA 5AW5A 4F60A 1ZZGA 4EBBA 3IJRA 2AYXA 1AB5A 5CYOA 2AB0A 2V7QA 3FFWA 4Y98A 4YROA 5DLQC 4ENRA 4F3NA 1IQ0A 1JPUA 1W5FA 3ONVA 4NICA 1HEIA 2AC2A 4FHEA 4ZARA 2F8TA 4CTOA 1Z8FA 3V2GA 2WIFA 5ED4A 5JOQA 2YZNA 1WDKA 3B48A 3KD3A 4RVGA 5JPCA 5FUXA 1B0UA 1KZHA 4RX1A 2B30A 2UYHA 1TJPB 2NZWA 2YXNA 1W4BA 1QHXA 3L4EA 4J0GA 4KH0A 3TCKA 4ALKA 3W6OA 1IY2A 1ZMOA 2Z6QA 3HXTA 4OJQA 4W63A 2LCIA 1Z62A 5AVRA 4TL6A 1JP7A 4PZZA 1S89A 3TJRA 2HU5A 3A05A 5AJXA 4BZZA 4DCTA 2Y1DA 5BT8A 4KQFA 5J4KA 1FLVA 5DLPA 3D6JA 4EFKA 1XRJA 2I4MA 2XVXA 5TT0A 4YP5A 1DXOA 2A5FA 4P35A 4PPYA 3HRIA 5E6UB 4FE7A 1ILWA 2GZ2A 1LQUA 1L8OA 3P52A 1LVGA 5TJ9A 3IVMA 2CSUA 2R1ZA 2WKWA 3EOBI 2CXRA 3P32A 1RP7A 4QAQA 4OCZA 2WD7A 4X65B 5IF3A 4C88A 2WWFA 2ZZMA 1ISHA 3JRWA 5FDFA 1OLSA 3CR3C 6PFKA 1YUBA 4RENA 1OR8A 1B23P 1PDWA 1Z0DA 4YDSA 5LP6A 1NW8A 2QLMA 3HKDB 2WUFA 5FUWA 1K7FB 1YMUA 1QORA 1NBMD 4F2HA 4QG3A 1CY8A 1U31A 3VO1A 3JYPA 1OLXA 3DWFA 3NHAA 1JDTA 4GMHA 1ONNA 3KFLA 5KAPA 4Y9RA 4CG3A 3E35A 3GEHA 2CLKB 2NSHA 1NYLA 4ON9A 4Q0MA 4IDFA 2CJWB 3SI7A 4BNVA 1LXCA 1U11A 1YV9A 1Z7WA 2C5GA 2YMMA 5AI4A 1G38A 1GAEO 1RXYA 4I1OA 1NQXA 4FHZA 2VUTA 4TYMA 2B4QA 1WSWA 1UK7A 2FAXA 4Y67A 3IUJA 2Z0MA 4FOLA 2WMYA 4NJMB 1U6JA 1U7OA 2BEWA 2ZYHA 3AKCA 1WXEA 2WU0A 4GP7A 3B2EA 1XNRB 2WSMA 3F6PA 4P54A 3EVTA 5KYNA 3U09A 1RWOA 2GKGA 2PUJA 2ZYRA 3CW9A 3UAXA 1G0OA 4WZAA 5T5QA 4BBZA 1XEWY 3LU1A 4UHJA 2W2VA 1SOVA 3DQPA 3QLTA 1N2SA 2YWEA 2CLCX 3H2BA 4O2BA 3RRYA 4ZRMA 2C8JA 4OQYA 4GPZA 2WIKA 1HL7A 1U0OC 3I8SA 4MW9A 5AM1A 1Q0UA 1U98A 2DFDA 2PG3A 4JI1B 3T7TA 3WQSB 4NCIA 4RGBA 1AXRA 2IH2A 1KAOA 4BNDA 1QFMA 4Z4FA 3O0DA 2FSSA 3RRNA 3JYHA 2CFIA 3U7HB 2ZT5A 4HWTA 1KVTA 1BRMA 4YLGA 3KSZO 4E46A 4RE6A 1E77A 4WOBA 4CFZA 2O1SA 5LA6B 4CM4A 3P5SA 5L95A 1JXAA 1PI3A 2CE2X 3KNZA 3ZLVA 5CBPB 3K0FB 1R9JA 1C7IA 5JJCA 2YS6A 3A32A 3DONA 3NDRA 4L4XA 1KP3A 4OJKA 3GDGA 3LUCA 1L7NA 1N0IA 2VQSA 2YZ7A 3QUTA 2PKCA 1NMZA 3UF0A 2GK4A 1WUYA 2PT6A 3AU9A 4MWGA 2DZDA 2FSGA 2CJFA 4F6CA 5EG5A 3DE1X 3FPGA 1KK0A 1QE3A 4NAHA 3E8MA 4IH9A 4EK9A 3FUXA 3TSAA 1U1EA 2Z1DA 1NW7A 1HBJA 4EYQA 3CZAA 4FXOA 2DETA 1GZDA 2RHHA 3AX6A 4D97A 4EY3A 2X2OA 1SWWA 4MW6A 5T8KA 2FXIA 3AQIA 3DBRA 3EDQA 4BNKA 4HS4A 4V0QA 4Y2SA 3ZK9A 2ZZKA 2A0KA 2O3JA 3JX9A 2ZWIA 4E2ZA 3AP1A 2VJKA 4H59A 4FHGA 3S29A 1YT5A 4BEWA 2YOHA 3HCWA 1K6JA 1EXVA 3HA2A 4UEJA 1P72A 4EO7A 5C1OA 1DVRA 1QZUA 4FFSA 5LBTA 2VP9A 1DPGA 4ZMBA 4R2IA 3PPVA 5HILA 5IM5A 2AXNA 1ZXBA 1HFJA 4MWCA 2Y6UA 4J03A 5A4AA 2CFRA 5TNXA 4YMTA 4LHVA 4AZSA 5B6PA 4L6CA 4G0WA 4K6OA 5HDBB 3NXKA 3JQPA 3QSGA 5TY0A 4GYJA 1RWBA 1MW8X 4Y6PA 1GGKA 2OSVA 4A16A 8OHMA 5F51A 1ZDMA 1ZRNA 1LCIA 2VCYA 1GRVA 4NAVA 1Z0KA 1R37A 4ZOQI 3A6HA 2C9BA 3E23A 4PVDA 1N5KA 2VJLA 2VNSA 1J99A 3T0FA 2Q21A 3DL4A 2GI4A 1UP4A 2HJSA 2O57A 3N75A 3KBOA 1RP1A 4QTXA 3K70C 5THXA 3HLTA 1ODCA 3FTDA 4V38A 2YNMD 4PTLA 2XWJI 5KOJA 5KTMA 2FP4B 1ESMA 2YVUA 1E98A 2ZSHA 5CFRA 4KG7A 4B3CA 1Z83A 4XPZA 5CHEA 1P3JA 3VZSA 4QUJA 1L7DA 2Q2NA 3ZJTA 1SBYA 3FPHA 2GN6A 4EG6A 3LGXA 2ZRHA 3NCHA 3T7JA 1IZ8A 1ZD9A 3M4ZA 2IXBA 1YONA 3GCGA 3X44A 1FDSA 3PEEA 2RB4A 3NYQA 2C07A 4PR0A 5L9AA 3PEWA 1C0LA 2O7SA 4JDPA 2PS3A 4K9KA 3C6MA 4QDOA 1JQBA 3TR6A 4ESHA 4FDMA 3C4JA 2CUZA 4CLRA 1V8PA 5KNCH 2ZSEA 3U3DA 3KVRA 4DLSA 2GZ3A 2QR5A 3PFFA 3QPVA 2YDYA 5BO5A 2ZVPX 1VHDA 5T41A 3RV3A 1T3TA 1DC4A 4KBFA 4JUDX 5HF5A 4BLSA 1K7SN 5JCXA 2NXEA 4JLKA 4DLRA 1HUQA 3U6BA 1IUNA 4K8OA 1XQWA 1FL9A 4BFYA 1UOOA 4IQ0A 1NQVA 2QN7A 4EJMA 3S2IA 3ZTTA 5ITSA 4ND5A 3U60B 4I55A 1AHIA 2QAIA 1HQCA 4S1TA 1VMEA 2FW8A 4JLUA 3LVBA 5M7EA 3W77A 2HSJA 3W5DA 3IRVA 1NSYA 4LSWA 1WY5A 4PV7A 3AR3A 4L7VA 2BI4A 3EPKA 3KEGA 3WLHA 5BWCA 4EHJA 1F8YA 3PXUA 4UAVA 2BW0A 2LTAA 1ZN7A 2R9VA 3IIKA 4WX2B 4YRBA 5G1OA 4Y2QA 1ATZA 2P11A 2MMCA 1I3CA 1RLIA 3NTOA 1F6DA 2Q6VA 4A92A 5DM60 4DV7B 3KLMX 2DBVO 4MPPA 3H2SA 4J0DA 1PFGA 1JFFB 1TYZA 5BV0A 4OQ4A 2F1JA 4O8ZA 2F1IA 1RHQA 2BFNA 3ZV3A 3RODA 3GPDG 4DIEA 3DMPA 1YBFA 3BMNB 4XYBA 3R7LA 3H99A 3DFKA 4G5YA 1B1CA 1ZVJA 3DUFB 5C31A 1J21A 1EUDA 3NIWA 3ZWYA 2JGLA 4I4IA 3V7FA 3LDGA 4QEDA 2BEJA 5G02A 2HJRA 3BBPA 3M89A 3AKZA 2C84A 5H3CA 3G7SA 2OB1A 2JLCA 3LWNA 5BSVA 4J76A 2G4LA 4JBIA 1LW7A 3ZTWA 1G7SA 3G8CA 4G4SO 1W88B 2G9UA 3NT5A 4Q7LA 4G0QA 4OVKA 2OYCA 3PQ6A 1T24A 5EWJA 3SHVA 1Z9BA 2HA2A 4YCAA 4I1RA 4NQZA 3FPEA 4Y0VA 4Z4EA 1NDHA 2DF8A 2H1HA 3BFJA 4RYDA 4UNIA 1S01A 5E1BA 2IV3A 3HO6A 3A9VA 4AROA 3RDPA 4G1FA 1DUSA 2ZBDA 4L2IB 1P2GA 2C5EA 2ZUCA 4S1OA 4U2GA 2W9XA 2YHIB 1EUYA 2WKSA 5AK4A 1KNQA 1VP3A 1WUTA 3PRHA 1XEFA 4L8YA 4NENA 4X63A 4D7AA 3ENVA 1H5NA 4LY6A 2NSJA 2X23A 3M9WA 2FEOA 2VHCA 5DIFA 1BVHA 9ABPA 1SELA 4R1OA 4XIYA 4DXDA 5JD6A 2R5NA 4C4PA 5K0LA 3SIXA 3C8ZA 4QXMA 3MPUA 4MPJA 4WJZA 3WMRA 2WABA 2VR1A 2D00A 4G1MB 1G5QA 1YAHA 3QTLA 4X92A 1H2FA 3SYNA 4A1FA 1LH0A 1GZHB 5F1OA 3N76A 1OZAA 4Z7NB 5HTOA 4FOPA 3FM9A 3V6MA 1BXGB 1RAAA 2FN9A 4XGNA 3PPWA 5EZQA 3NHUA 1AK9A 1G8JA 4PPFA 4FNGA 1A7AA 4DZRA 3UPDA 5IVPA 1U81A 3FNFA 4OAQA 4R2JA 5FD8A 5E4TA 5JMPA 1EP3B