3LECA

The crystal structure of a protein in the nadb-rossmann superfamily from streptococcus agalactiae to 1.8a
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
227
structure length
225
Chain Sequence
b'NAMDLQLSKRLQKVANYVPKGARLLDVGSDHAYLPIFLLQMGYCDFAIAGEVVNGPYQSALKNVSEHGLTSKIDVRLANGLSAFEEADNIDTITICGMGGRLIADILNNDIDKLQHVKTLVLQPNNREDDLRKWLAANDFEIVAEDILTEKRYEILVVKHGHMNLTAKELRFGPFLLSNNTTVFKEKWQNELNKLTFALNSIPNSKMEERAILEDKIQDIKEVLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADB-Rossmann Superfamily protein
molecule tags Structure genomics, unknown function
source organism Streptococcus agalactiae
publication title The Crystal Structure of a protein in the NADB-Rossmann Superfamily from Streptococcus agalactiae to 1.8A
rcsb
total genus 76
structure length 225
sequence length 227
ec nomenclature
pdb deposition date 2010-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04816 TrmK tRNA (adenine(22)-N(1))-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3lecA01
1P39A 3UJ9A 4ER7A 5HIKA 3GRYA 4OQEA 3NWEA 2P8JA 1SQGA 2BM8A 3FPHA 5E1MA 3M33A 3REOA 1XCJA 2V7EA 5EVJA 2NXNA 1XXLA 3DXZA 3MCTA 2PXXA 4QVKA 5EMMA 3TLJA 4MIKA 2PXAA 2VS1A 3P9KA 2XBMA 3HA7A 5K03A 4E2ZA 5DX1A 2PV0A 4U7PB 2IH2A 4M36A 5CCXA 2PX5A 3CCFA 4GBED 3OPNA 3DLIA 2OKCA 1R8XA 1X1DA 1YZHA 2DPMA 3B5IA 3Q7EA 3HEMA 3KPYA 4KW7A 1XDZA 5FQNA 4LWPA 5K0NA 3UJ6A 4EVIA 4QTTB 3HCFA 3LHDA 3EGIA 3EEOA 1RI5A 1VLMA 3HCEA 4X1OA 1I4WA 1JTFA 2ADMA 5EZQA 4EK9A 2VDUE 4LWOA 5GOZA 10MHA 4PONA 1DCTA 1G8AA 3PFGA 3EVAA 2P7IA 5K09A 1B42A 5FADA 1JG1A 3G8BA 4P7JA 5LQCA 3GRZA 1NW7A 3UFBA 2NP6A 4OQDA 1WG8A 2CL5A 4CTKA 2Y1WA 2C7QA 3V8VA 2ZBPA 2ZVJA 4GQBA 4BLUA 1NBIA 4PCAA 2PSSA 4DMGA 3KHKA 4FSXA 3LKDA 4IV0A 3IEIA 2ZLBA 2C7RA 4WVLA 5ICFA 3VC1A 2O06A 5P8WA 2PGXA 1NW6A 3KQTA 1FPQA 3ER9A 2DULA 2AR0A 1L3CA 5E2BA 1XTPA 2K4MA 3QOXA 2GAFA 2OXTA 3A7EA 5JR3A 4RTMA 3EVFA 4UOEA 2AOTB 3ID6C 1ZGAA 3HM2A 1QYRA 1RI2A 5DX8A 3FUUA 3PS9A 4QQKA 2AN4A 4IV8A 4V0RA 5E1BA 5EGSA 2AS0A 3ELUA 5BW5A 3BGDA 3CGGA 3I9FA 2EJUA 5DPMA 3BWBA 1NBHA 1R18A 3NJRA 3P97A 2PVCA 4P7GA 1ZKDA 3DXXA 2EG5A 4OX9Y 2XYVA 1JQEA 5FWAA 2OBFA 5DM0A 3LGAA 4C05A 2AVDA 4GOMD 2YVLA 3ME5A 2ZULA 3SR4A 4RSRA 2EJTA 3NMUF 1SVUA 3PFHA 1X1AA 1I9GA 4XCXA 3TKAA 3EVGA 2CMGA 4DM3A 4GOLD 4MTLA 3P9IA 4KWCA 1AF7A 4IWNA 4CKCA 4QQNA 4PGGA 4H0NA 5EMKA 3GNLA 4YUVA 3DXYA 1VIDA 2VDVE 5MHTA 4EMSA 4DF3A 5F2NA 4E2YA 4F85A 3BZBA 2OB2A 4PIPA 4U7TB 4XUDA 3BKXA 1SG9A 3DMHA 3NVMB 2ZZNA 4LECA 4LG1A 2PLWA 2PXCA 4FSDA 3UA4A 1KYZA 2IDJA 3G89A 5EQJB 1TW2A 2PJDA 3C3PA 3K6RA 1FBNA 2IFTA 3EGVA 4PYJA 3R24A 1TPYA 3CJTA 1FP2A 2FHPA 3NTVA 4O29A 3UBTA 1JR4A 1FP1D 1SUIA 5K05A 5LSAA 2R6ZA 3KR0A 3SXJA 4ER3A 2ORED 1EAMA 2GB4A 2I6GA 4R6WA 4PYQA 5FUBA 3VYWA 4FT2A 5K0GA 1EJ0A 2JH9A 5GM1A 4C07A 2AN3A 2O05A 2QY6A 5K01A 3VSEA 3FTFA 2B9EA 2ZIFA 4E2XA 3ELWA 2YR0A 1NV8A 1KPGA 3DUWA 5CM2Z 5FTWA 4A6EA 1SUSA 2C7OA 5FHRA 5EIWA 4MHTA 2I9KA 2PX4A 3P2EA 3ERCA 2NP7A 2EFJA 2B78A 3LDGA 2V74B 3LECA 3BGIA 2YX1A 4FR0A 5DTMA 5FCDA 5FA5A 5GWXA 3KQYA 4CTJA 2ZIGA 4GC9A 4X63A 3GIWA 4OA5A 3I64A 3KQSA 3LSTA 5T67A 5ICGA 1NT2A 3P2IA 2PKWA 5DM2A 1SKMA 2H00A 3T7TA 4QVGA 3MTEA 1Y8CA 4HTFA 2HMYB 2P3OA 3E7PA 4IKPA 1H1DA 2NXEA 3CVOA 3BT7A 3LDFA 5DM1A 4RV9A 4RX1A 5DSXA 5E1DA 5FHQA 5U4XA 4ATNA 4CKEA 1AV6A 2NNWB 1JQDA 1O9HA 1KYWA 1X1BA 3A26A 1JG3A 1YFLA 2IP2A 4FT4A 3SSMA 3B3JA 5EHGA 5FULA 4RTNA 3R0QA 3KQWA 2NXCA 5GIPE 1YUBA 2WK1A 1M6YA 1N7JA 3FTDA 4XUEA 3BWMA 3HA5A 2CMHA 4L7VA 5DTRA 4RTQA 1X19A 1OR8A 3GGDA 2Y1XA 4C4AA 4DQ0A 1IY9A 3TFWA 5K0JA 3MGGA 2Q41A 2BZGA 3G7UA 5BW4A 2E5WA 3MQ2A 2PX2A 1XCLA 1N2XA 3G2QA 4RVDA 5EZSA 1DL5A 1NV9A 3BWYA 4K6MA 3EVCA 3LKZA 5E9QA 4YUZA 4QTUB 4CWAA 5KYGA 3KQOA 3IHTA 3OE5A 2F8LA 2O57A 3HA3A 5HEKA 4OBXA 1I1NA 2GPYA 3EMDA 1EJ6A 2AOWA 3B3GA 4AZVA 3JWJA 1VL5A 5EOVA 5EEGA 2YTZA 1EIZA 1RJGA 3MAGA 5EMJA 1R6AA 1D2CA 1BC5A 1G6Q1 1WY7A 2ESRA 1JTEA 3KQPA 1RJEA 3M6VA 3EMBA 4C08A 3UJAA 4MWZA 3SM3A 4PGHA 3LX6A 3H2BA 3FPEA 1NW5A 2PWPA 3V97A 3BGVA 3F4KA 3EGEA 2YXDA 3L8DA 1NE2A 3O7WA 2Z6AA 2YXEA 2C7PA 3OZTA 5DXJA 4Y30A 3GRUA 1ORIA 3OZRA 5BXYA 4POOA 5E8JA 2B2CA 3EPPA 2VP3A 3FPGA 4A6DA 4HH4A 1VP3A 3A27A 5EG5A 3NDIA 3KQMA 3M6UA 5DX0A 3EVDA 2OZVA 7MHTA 2OPBA 4F84A 1WZNA 5K0FA 3AY0A 3KU1A 4PNEA 3T0IA 3NWBA 3UJDA 1VPTA 3P8ZA 5E1OA 2AVNA 3G5LA 2ONZA 4KIGA 4M7RA 4BY9E 4PYNA 3EVZA 4KVZA 3JWIA 3A7DA 1YFJA 1KHHA 3TQSA 1JG4A 2VDWA 2AOUA 5C1IA 1WXWA 1L9KA 1SQFA 3TMAA 1KPHA 2H11A 3RW9A 3UJ7A 5GINE 5F2KA 5GM2A 2HV9A 5HIJA 3KQVA 1Q0SA 1NKVA 4RTJA 1IM8A 5K8VA 5D1NA 2AOXA 4Z2YA 5HILA 3WSTA 3HP7A 1PRYA 3OCJA 3TKYA 1N7IA 2JHPA 5ERGB 3Q87B 3SMQA 3DH0A 8MHTA 3M6XA 3JWHA 4PYIA 4C04A 1KXZA 1JQ3A 2KW5A 1R00A 3FZGA 2GA9A 4BP1A 1IXKA 2XYRA 3KQQA 5K0EA 3OFKA 1ZHFA 3PT9A 3LL7A 1ZQ9A 3K0BA 2VZ9A 3JWGA 4M38A 4P58A 3NW9A 5LQAA 1KP9A 2P41A 3CJRA 3G2PA 3GO4A 4OA8A 5DT2A 3UA3A 4DCGA 4RTSA 5HZMA 2OO3A 3B3FA 3EEYA 3E23A 3KR9A 2P3QA 3E05A 4KRGA 1HMYA 4ISCA 1XVAA 1XJ5A 1QANA 3HCAA 4WXHA 5HFJA 4ER5A 3BUSA 4V0QA 5LQUA 5LQRA 3GXOA 4HGZA 4PYOA 4RVHA 4B17A 4YUXA 2ZSUA 3THSA 5E2AA 3BWCA 4G56A 4MQ4A 1FJXA 1WXXA 2JH8A 1F3LA 3GWZA 2PBFA 3MCZA 1JG2A 4EKGA 4X61A 4JXJA 3TRKA 3PLAE 4HGYA 3R3HA 2LD4A 2IPXA 4RVFA 5DRTA 3G2MA 2ZW9A 3MTIA 3LPMA 1DUSA 2ZBQA 3CKKA 4NECA 3UJCA 5GIOE 3PVCA 4P7KA 4P7FA 4FP9A 3E8SA 3RIEA 3U81A 3GJYA 4KDRA 4AX8A 4E31A 2JJQA 5DSTA 3UZUA 1JSZA 1MJFA 1UFKA 2UYQA 2YQZA 1G8SA 4PCLA 2IBTA 2JG3A 4R8RA 1G60A 2OYRA 1KIAA 2ZBRA 3R6TA 2NYUA 4OBWA 1RJDA 3IV6A 4PYMA 4KIFA 1D2GA 3X0DA 5KQSA 2ZWVA 4BP3A 5BP7A 1F38A 3DULA 3PX3A 4YV2A 4DCMA 4DZRA 3SX0A 5CD1A 3HTXA 4YMGA 3QOWA 3LBFA 4RTOA 2CKDA 2PT6A 1XDSA 3ELDA 3KPUA 4R8SA 2AOTA 3DP7A 4YUWA 1R8YA 3AWIA 5M5BA 4R6XA 2FCAA 2HTEA 4QDJA 1MHTA 1M0EA 5EC8A 2ZZKA 3B89A 3NDJA 5E9JA 3FTEA 1L3BA 2BR4A 4PYKA 1T43A 3DMGA 4RTRA 1M6EX 2ZTHA 4ZTBA 5LQJA 5LR6A 1VBFA 2O0LA 3GCZA 4C06A 2NXJA 2AOUB 3FUVA 3P71T 4GC5A 2IH4A 5LQKA 4FGZA 2FRXA 5EPEA 1X1CA 2UYHA 1V39A 5LQNA 2QRVB 3FUTA 1YF3A 2ONYA 4E33A 2FYTA 4HC4A 1P91A 5B1SA 2BR5A 2ZZMA 3HVHA 3B7PA 3HNRA 3MB5A 2I7CA 4AZSA 4E2WA 4E32A 3CBGA 4RYLA 2I62A 5CIYA 3HCBA 1KPIA 2QYOA 4HTFB 2IIPA 3FYCA 1UIRA 3HVKA 2FK7A 3O31A 2G71A 3OFJA 2PWYA 4DKJA 2IDKA 3D2LA 3SSOA 2IH5A 2CWWA 2GLUA 3VC2A 3P9CA 3THRA 2ZWAA 2BH2A 3LCCA 1RJFA 4PINA 3KPWA 1EQAA 3C3YA 1VP9A 2OY0A 2P35A 3AXTA 5CVVA 2G72A 1ZGJA 5DWQA 2PY6A 4Y2HA 9MHTA 3ANXA 4RVGA 2JHCA 1Z3CA 3FPJA 1ZG3A 2FK8A 3OU7A 3PB3A 1QAOA 3ORHA 4PIMA 5CUQA 5T64A 3UJBA 2Z6UA 1BOOA 3C6MA 3GRVA 5JUWA 4DA4A 1RI3A 3T7RA 5IH3A 5HOQA 1NW3A 4FS8A 5EKUA 2GH1A 2ZFUA 3C0KA 5F2OA 3GRRA 5T6BA 4QPNA 4X60A 5G02A 1QZZA 3ELYA 3PTAA 1BHJA 3BXOA 2XVAA 3FYDA 1EG2A 5FA8A 3HVIA 5K0LA 4PYLA 3RODA 2AZTA 4GOND 3CC8A 3HCDA 2OB1A 4GUAA 3GDHA 5D1HA 4PWYA 1XDUA 3UWPA 3DMFA 5CVEA 4GOOD 3A25A 5C9ZA 2QE6A 4AZWA 2ZIEA 3FRIA 2FPOA 3OU2A 4F86A 3G8AA 4CXMA 2B3TA 5EIFA 3SGLA 3MHTA 4AZTA 1RI4A 1WS6A 2QM3A 3O4FA 2HR1A 5KS2A 2A14A 5EMLA 2O07A 3CJQA 2P3LA 4HG2A 4GEKA 1U2ZA 1L1EA 2P1DA 3I5UA 3LBYA 4M37A 1AQIA 2BR3A 2R3SA 5EKXA 1QAQA 1G55A 3QV2A 1HNNA 2JHAA 3HCCA 3OZSA 5DTQA 5HIIA 1P1BA 2N47A 4R05A 5HIMA 5K0BA 4YUYA 3C6KA 2EX4A 3NVKI 3KPVA 4E70A 5K0CA 3G2OA 5CVDA 5CVUA 2XVMA 3SSNA 1VQ1A 4YV0A 2G1PA 5CVJA 4RTKA 3FUXA 4ER0A 4XUCA 3LCUA 3IYLW 2UYCA 2YXLA 3KKZA 3A4TA 2PX8A 3TM5A 1JSXA 5GP1A 2Z6QA 3LDUA 1L3IA 3HVJA 2B25A 3BKWA 1RI1A 5ICEA 3ER8A 2IGTA 2YUIA 3M70A 4RWZA 5DXAA 3EVBA 2P7HA 3G88A 4EQZA 4E30A 1R74A 1UWVA 1QAMA 5FQOA 1ORHA 3KR1A 3P9NA 3FPFA 5E9WA 3UJ8A 2HWKA 1P1CA 3LCVB 4HRAA 2H1RA 4AUKA 4BLWA 5EHIA 1KR5A 4GF5A 3TR6A 2AN5A 2AOVA 1VE3A 3TM4A 2QRVA 1NW8A 5DM4A 2PT9A 2UYOA 4EKIA 4BLVA 5CCBA 3DLCA 3DTNA 3FTCA 4RTLA 5KVAA 4FZVA 5H02A 1YB2A 2WA1A 3PX2A 1O9GA 3EVEA 3DR5A 3SVZA 4CKBA 4YMHA 4YV1A 1YZ3A 3G5TA 2ERCA 4QPPA 1G38A 2XYQA 4C03A 3T7SA 1D2HA 5DRYA 2HNKA 5EEHA 2IBSA 1O54A 2ZCJA 1INLA 4ER6A 3TPZA 3S68A 2GS9A 5E8RA 3I58A 3TOSA 3OE4A 1Q0TA 1BKYA 3KR2A 1PJZA 3M6WA 4HSGA 3I53A 3GU3A 5C0OE 3FRHA 3AXSA 2G70A 3R9XB 5KQRA 2UZ4A 3DOUA 2BM9A 3KPJA 3OU6A 5ICCA 1TW3A 2P40A 3M4XA 4KDCA 4X41A 3FUWA 5IKMA 3AJDA 2G8NA 3MERA 5FWDA 1AQJA 3P2KA 4RTPA 4QDKA 5DLYA 2WA2A
chains in the Genus database with same CATH superfamily
3B1YA 1KFKB 1UDCA 4N5IX 1KEEB 5AM5A 1U8YA 3GRYA 4ER7A 1YQUA 4ND1A 3WI7A 3B8HA 4EEKA 5F5NA 5CBPA 5DSZA 4LEIA 5AJVB 5ITZA 4D0NA 3TS1A 1GGHA 2C9DA 5CURA 4ZQBA 4CMKA 3NOXA 2YHUA 2C4HA 5DE3A 2EP8A 4GYWA 2YJ4A 1JMVA 2DLDA 3FCUB 3IVMA 1T3TA 1GUBA 1LX6A 1YZYA 4KBGA 1YOVA 2N3ZA 1CIJA 3JQAD 4WZAB 5FBWB 4HAXA 5JADA 5KQGA 4WOPA 1REQB 1XDZA 2G5CA 2J7PA 2ECPA 5AJYA 2NMVA 1S0UA 2PGDA 3HBLA 4LK3A 1ZH0A 5THKA 5EZQA 1SBIA 2ZWMA 2BY4A 1T2EA 2JKYA 1T34A 4MUYA 3EVAA 4YN3A 2EOAA 4H6XA 1B42A 1U2GA 2EX0A 2Z2KA 4KLAA 3OESA 3K73O 2G1AA 3MIZA 1M1YE 3HU2A 2Y1WA 4LNUA 4F5WA 4N41A 2BWJA 2QV7A 4MS4A 1C7FA 1NVMB 4I55A 1L8OA 1N75A 1UBGA 4HEA6 4IJKA 2GD2A 2HBZA 2A0XA 3IT3A 4D9EA 4DSTA 4F5YA 3MD9A 2GZHA 1DNPA 3TNFA 2SKEA 3DL0A 1XK7A 4UBKA 1GNRA 3TF5A 1V1RB 5HVNA 1IU9A 3W6ZA 1MPTA 4TL7A 1NUQA 2Z9CA 3ENNA 4B84A 3HSSA 1PWHA 2QRGA 4D9FA 4MYHA 3ZI4A 4EB6A 1P7VA 5CH5A 3ZQJA 3MWDA 1B23P 1ZGAA 3K2BA 3SYLA 3WB2A 3FBTA 5F21A 1PT8A 5E1BA 4L5YA 3A9UA 4BE4A 1PL6A 1G3UA 2FEMA 1GLNA 1ZFNA 3BXGA 2VJAA 3EXEB 3KCNA 2P62A 3WL3A 3ZUPA 1QWSA 2Z0MA 3AF2A 4I0WB 5KU7A 1N8KA 1L5RA 2D1FA 1P18A 1J8FA 1E7YA 1NGSA 2MHCA 2UZ3A 3EF0A 3P4UA 4ITUA 1BX0A 4O4LB 4A8TA 5C8YF 3R5TA 1V3QE 4I8IA 4KWTA 1APBA 2HT6A 1EHIA 4U5QA 2A92A 3JAMA 3EXIB 1NYQA 1A9XB 3HXKA 4I1RA 3DP9A 5EWMB 4M3NA 4BQPA 2J3HA 4M8KA 3FR7A 2C42A 4PTYA 4KMRA 4NYIR 4B8YA 2QBYA 1SVKA 2FSUA 4OHFA 2H57A 3N86A 3OI7A 4IQ8A 3NM5A 1CIPA 4IOLA 4LXGA 5EMKA 4A1FA 4X93A 1VIDA 3ZV6A 3OPYB 1VZ3A 5JTTA 1U8FO 4JUIA 3VPHA 3R6LA 1Z5GA 4G23A 8AT1A 1I94B 5FBLB 5JDIC 1SG9A 2JA1A 4RMGA 3UXEA 4AQDA 1I8TA 4QYXA 2IYOA 2P1RA 3F2VA 2PLWA 3TN7A 5FUQA 3SYNA 2PAFA 1B43A 3T4EA 3ZE0B 1H3FA 1HPLA 2NZVG 3R09A 2WMNB 3VNAA 4DZZA 1E9RA 1FUIA 1JZSA 2J3KA 4AG3A 4I14A 3ROEA 5A05A 5DBFA 1YK1A 2NO0A 2PU5A 3WGVA 2VATA 4UVHA 2XGSA 2KWIA 3KSRA 2H5JA 2Q8PA 1T8RA 4NDAA 2R6ZA 3GDGA 1J33A 2OXFA 4PPQA 2ZJFA 3FPSA 3MMNA 3MINB 1XYGA 4KQCA 5GM1A 5HBRA 5K5EA 1DAMA 1GA4A 4JIMA 1K2VN 1IBMB 5CLIA 3OWXA 4K9NA 3HCOA 5DASA 5FTWA 2I7DA 4OGLA 1L7OA 1SUSA 1UZMA 2H52A 1FNNA 3NM6B 5FHRA 2W2XA 4YMVA 4YA6A 1XRSB 2CVQA 4R40A 1ZK0A 1ATZA 4GMDA 4BCDA 5IFLA 3PWSA 5G3ZA 3KQUA 3V2UA 3CH6A 3BGIA 4EFDA 4BLTA 1FXUA 3OAAD 4G0PA 5CRIA 5KHAA 2OILA 2ZIGA 4GC9A 1N34B 4PNPA 5AVKA 1LU9A 3MRSA 3WKBA 2AYXA 1L5KA 1UJ4A 1K8ZB 2CLKB 3KZMA 4OQ4A 1XEXA 1HQKA 1QH0A 3OD1A 4DCOA 4IX9A 5JQGA 1XQ1A 1XIVA 2O2YA 1CY8A 2OHVA 3EH2A 5E7MA 1V4BA 4RV9A 5LD2B 2QD2A 1E2QA 4DN6A 2I4NA 1MO2A 3CLSC 4CNQA 4Y2XA 5DYGA 3E70C 4QUKA 16PKA 1YFLA 1XZHA 2WTNA 1VJGA 3I12A 1TECE 3NXKA 2HI0A 1H8ED 4H35A 1B3BA 3FVQA 2CHUA 4YQYA 5EUCA 1SOMA 2FQXA 1MZVA 2OC9A 3TEMA 5IPFA 2BH9A 1LLDA 1PR3A 2Y1DA 3BB4A 2Q3EA 4O2BB 1U9IA 4J0JA 2NPFA 3N58A 1QIHA 3NYRA 4B3IA 2IVFA 2O6LA 5FNZA 3RYCA 1IYZA 2P1ZA 1OFUX 5AT1A 1VGVA 4YXWA 2VHQA 5FOXA 5ALNA 3WADA 1RHMA 5KKNB 4M98A 2G80A 2OCLA 5AXDA 4HX9A 1G16A 1QYWA 3WLMA 5C1PA 1V96A 2WRZA 2VXOA 4NBVA 5EJ8A 5IXSA 1VPEA 3ESXA 1I2AA 1JVSA 4QARA 1FS5A 3HA3A 4NV1A 4X9XA 3ZI7A 1GZHB 4ZDJA 5J2TF 4W5WA 2ISCA 2W83A 2R8XA 3KK0A 1CXZA 1WTAA 4MRMB 3WSWA 2FEKA 4U63A 4WPGA 4LS3A 5CLFA 1QR2A 5ECWA 3H9QA 2QF7A 1EIZA 3EPHA 3MAGA 2XMDA 4MPDA 1W4RA 2Q1WA 2ID4A 4EYGA 3K0FA 1X14A 2HU8A 1KY3A 1UKEA 2C3OA 2WTUA 5FFFA 4CN8A 5K6AC 5KC9A 4FYKA 1YE8A 2OAGA 3FBWA 2GVDC 3UN1A 1RMTA 1GCUA 1KK0A 4ENUA 4CGYA 4WGGA 1GPDG 3ZE1B 2C2MA 5G0WA 1NXSA 4OFZA 2ZRDA 3OZTA 3CE9A 3CMMA 3H8WA 3VBCA 4J6FA 1PT9A 1XMXA 2QS9A 5JSUA 3BQNB 3M3PA 2B2XA 3ABOB 4FFPA 2F43B 3FNQA 3RTGA 3T8YA 5HRCA 2WICA 1NX9A 4XYMA 7MHTA 1R5NA 1N3YA 2ZSBA 1UDRA 5JE8A 4A91A 2X22A 3FIJA 1GNTA 1MO3A 1WD5A 1YFZA 1YZTA 5K0FA 3ZQ4A 2JHFA 2AJCA 3UMJA 4ND5A 5LMCA 5KTTA 2PG3A 4OG2A 1Y0BA 4RLSA 3HZRA 5ED4A 3IJRA 1KZ9A 3AM5A 3V34A 1FS6A 1Y1RA 2GJKA 3J7TA 5BWBA 4Q9NA 1L9KA 3SFVA 3RC8A 1SQFA 3HDYA 3RW9A 1U7PA 1YI1A 2BMWA 4PWZA 5ALSA 2HV9A 1M1XB 3K5WA 3TL3A 2I99A 3HP7A 4KR2A 4I46A 5KSYA 5B3LA 4RENA 3Q87B 5KUTA 1Z8DA 2VTDA 3D9QX 3GFFA 4PYIA 4Y6QA 2CEAA 5CB6A 4WQMA 3ML1A 1R00A 4IVPA 4K9PA 4X8LA 5TQ2A 2XYRA 2AEFA 5EUBA 4CZ2A 1WIWA 1XWWA 1Y1PA 2R2AA 5BYAA 2CDBA 2IEYA 4MPJA 2POCA 4NEHB 1MQ8B 2PL9A 5ERYA 3VSDA 1DG9A 4LYGA 4RDIA 1TI7A 3GJ0A 2X0IA 3L7JA 4GMGA 2JVKA 4GSKA 2XBLA 4H7HA 5CJ2A 4ENRA 3VTKA 1ZN8A 2BEWA 3K70B 3I3OA 1QANA 1USWA 4BV9A 5BN5A 1U0BB 1KIMA 1J0CA 5AVXA 1D1TA 3E9ZA 3THSA 2DQ4A 4EFMA 5AFSA 5ALMA 4CGZA 1DINA 2HU2A 3CX4A 3PUHA 3QPCA 5CP8A 3CLRD 2UDPA 1NQTA 4X61A 1I1QB 5I9TA 2JKZA 5CLQA 5B6PA 2C2ZA 4MLPA 1O95D 1U8ZA 2P77A 4GRIA 5E0KB 2IPXA 5SY6A 4MX8A 3G2MA 4FNAA 4L2IB 4P34A 2OCYC 4G89A 2CHQA 1OZHA 2PM8A 1OBOA 5TIIA 3E6AA 4F2PA 2GILA 1COZA 1J7KA 4RO0A 4P7FA 3C45A 2X0DA 1Z16A 3HDJA 1CQPA 4KAJA 1L7XA 1K8QA 1B8OA 1Q19A 2Q0SA 3HZOA 4FE3A 3R6WA 4ND6A 1KK3A 3Q9LA 1P0CA 5AM4A 3LF2A 4DJEC 1HK7A 1I0ZA 3D6AA 4L6CA 2OGUA 4PANA 3RKRA 3U49A 1FUKA 3QU7A 4C43A 1W6UA 4WK0B 3TLKA 4WHMA 2XQFA 3SY8A 5ESWA 1MG0A 5EN4A 3X0DA 3KRTA 3DJFA 1DQNA 4RK6A 2OO7A 2JIMA 1CVRA 1XTIA 1M2JA 1PW5A 2PWBA 2XGJA 3GZJA 3AVUA 2BCGY 3W3AH 1G6HA 2C5BA 4QXMA 4R1MA 3KFVA 2O8FA 3Q72A 2BVNA 5LZ8A 1XA3A 3CNEA 5I3CA 5BNIA 4B09A 3D7NA 1TO2E 5JARA 2GESA 1WMBA 4A3SA 4OBBA 3RUPA 2OUKA 5JLAA 2BELA 3GT7A 4ZU6X 3TIVA 3QENA 1TTTA 1DAIA 1DIOB 5HF6A 3KJQA 4UPEA 1SR8A 3GC6A 4JSTA 4XJSA 1G59A 1NFFA 3ANYB 2CHFA 2W98A 5LQJA 1P5ZB 1Z6AA 2B9VA 2G06A 4KE6A 3UTDA 4GI7A 3ZK9A 3R3XA 5LR6A 4NYJR 4IG9A 4CMEC 3R4CA 2BGTA 5ALYA 3P71T 1UDXA 2H8GA 2FRXA 3DEFA 3O2NA 2YZMA 4B7ZA 5IVPA 1V39A 2X6RA 3FDZA 3OHMA 4YRDA 1N2OA 1OLSA 5J4VA 1N0HA 1PV2A 3ENKA 1V37A 4MUHA 4S35A 2J0VA 2J8ZA 3G5AA 3IPAA 3LVBA 1X7HA 2UVDA 1HX7A 4AZSA 1DTWB 3F47A 2BZSA 3V2GA 2I62A 2FW1A 4WOJA 1B1AA 1F4PA 4K1LA 4J1SA 1JJVA 1KL7A 1Q6YA 5JNLA 2IIPA 2FPKA 2P67A 3FYCA 4TLDA 4BQOA 1S1MA 2EGGA 2FSHA 2PGOA 2X4IA 4G1FA 2D6FA 1TX4B 4QYIA 3BBLA 1UPAA 3N2LA 1ZSYA 2OHXA 3NLLA 3QJ5A 3RYFA 2C1ZA 3P9CA 5I7EA 3ZE8A 3O9MA 5EINA 1XUOA 1T91A 1RXSA 3C48A 4DJFC 3MGAA 2M9MA 5IUJC 1UKBA 2P6MA 2ZSJA 4QJ5A 4TYPA 3GLGA 2WIFA 4MP8A 1SJ9A 4DA7A 5JD4A 2GKSA 1BFKA 2BF4A 3PB3A 3QYFA 2NO6A 1WWKA 2XUDA 4PC7A 5G40A 3UJBA 1MLDA 1RBYA 3T7RA 1ZO8A 2W2MA 1SBNE 4XI9A 2Z04A 3H1GA 4ZRNA 2B37A 5LQSA 4D42A 1ZIYA 2AT1A 5I9NA 1VFNA 1D1QA 3R0IA 5A0VA 4XFKA 3LPNA 1MORA 2HREA 4ALMA 3GRCA 1C3JA 2DR0A 2RBEA 1QF6A 1ORWA 3F5SA 1K6JA 2P9FA 3S1AA 4C21A 4LJKA 2IW3A 2J9XB 3ILVA 1MXFA 4Q1CA 4N65A 2C3UA 3JTEA 3TZCA 1JHZA 2BP7B 3QEKA 2JNWA 2Y8EA 1G3IA 2G4LA 4Q15A 3OIFA 4XE5A 1A04A 1OYYA 2E89A 2F7SA 4J07A 4QECA 4Y2RA 3B60A 5CX4A 1WM1A 3TL2A 4BMSA 1JLKA 3CTPA 1YA8A 5AUPB 2QMOA 3DF9A 4IS3A 4GDMA 2PMKA 3BZWA 1QIGA 2J85A 3LUHA 2A84A 3NXSA 4BJHB 1JEAA 3I04A 4LRSB 2YQ5A 4RHTA 4BO5A 2WHPA 4D9KA 3BM5A 3GLFA 2ZCVA 2IYFA 2OGSA 3WQRA 4BMPB 2SICE 1XD2A 2EVWX 4EYOA 3I76A 5C4IA 2VSFA 3VISA 2J41A 3GQVA 3STTA 1J0XO 3IPXA 4NX2A 5DGCA 3U48A 5E3HA 3GLHE 2H2AA 3RVBA 3IEXA 4TL9A 3V6LA 2XNJA 1FFXB 1XNJA 1GSIA 1Z88A 2GCOA 2J5RA 4D97A 5KAMA 2C5LA 2C2HA 2IYXA 4E15A 2YZKA 2VYVA 4PC1A 1ZS9A 2R97A 4ZZ2A 1ZRMA 3F5DA 5H0IA 4IHJB 4LJ8A 4PG8A 1H2BA 2DPLA 4OH7A 3C6XA 3KKMA 4LYAA 1C0LA 2D1TA 1RAEA 1B2LA 2I6XA 3F97A 4EQZA 1U3GA 1WMDA 4O2AF 2D1SA 3H1AA 1W581 4NWIA 1Q1BA 2AJBA 3BILA 3HFRA 2ET6A 1MENA 3CT4A 5T4FA 1K6EA 2XOEA 5JEDA 4NAUA 1VE3A 5JW6A 4RW0A 5DM4A 1OWNA 2PT9A 2BTQB 3L4SO 3NAZA 4JQOA 4RAOA 5JMOA 3RVMA 2GCPA 1R10A 1Q83A 3VKHA 4KQWA 2X1MA 1C30A 1AS0A 4B1FA 2JHGA 1N6LA 1UPCA 4QRDA 1LA2A 1O9GA 3QOFA 3IAUA 5CT5A 3PEWA 5JVDF 1ZITA 4MAAA 1I2ZA 1I32A 1XCMA 4ON9A 1HKHA 6NULA 1II8B 1EUYA 3BFPA 1M6VB 3SMVA 2Y2UA 1O54A 5CFLA 1Q11A 3S68A 5CXSA 1XZQA 3H1TA 4UUAA 5EGNA 4GDFA 1K8XB 1M8GA 4PZZA 5I9LA 4HSGA 4EZIA 1PT5A 1GRCA 3QVGA 3F9CA 1OI4A 3DOOA 3JQ9A 5IX8A 1U7HA 2YH2A 1GNSA 1HWYA 5CA0B 5EIEA 5KQRA 5AJWA 1PCXA 3COPA 3SC3A 3UYLA 2UZ4A 3L6DA 5CMLA 3NONA 2FFRA 2P40A 3WJ1A 4BRZA 1T9KA 1H4QA 1GZ7A 3P2KA 2PUTA 1OPRA 2WF9A 3FOFC 3R1IA 1FP6A 1KK1A 2IY7A 2XE7A 4HDRA 1HUQA 2BHTA 4RKWA 2HA6A 4K9RA 2H1SA 1XCJA 4BXOB 3VOBA 5KZMB 5KYTA 4JITA 4H1TA 3AH8A 3ITEA 5AMXA 1J06A 1HTWA 1WPRA 2ZUDA 3K6JA 1LJLA 3MRXA 2CLMB 4F60A 1Y5MA 1U0OC 3RUAA 3WJ7A 2C97A 5K3CA 2IH2A 2QXTA 4BNUA 5JAOA 5CDHA 4FYWA 4O02B 1WQ3A 4M9SA 4ALLA 1THMA 3LHDA 1V8DA 1YB7A 1ZBQA 4NZ9A 5COBA 4BLOA 2RHWA 3H4VA 4G81A 4KE9A 1QZXA 2ZBEA 1M6WA 1QRRA 5HUJA 2FWPA 3S3TA 2ZI4A 3KSZO 3GEIA 2AMFA 2D8AA 5JZVA 3A4MA 3QTBA 5AJXA 3TLCA 2EKQA 3OWOA 2Q99A 1PU2A 2BHLA 3IUYA 3HB9A 3BICA 3QXCA 4IILA 3MCVA 4IJQA 5TT0A 1X8LA 1F6WA 2X3FA 5KAPA 3VHXA 4CL8A 2DFLA 1U5CA 2QEQA 3G0CA 1P1KA 3NP9A 2JFPA 4R2WA 5CFMA 3I1FA 5J40A 4IV0A 5BNWA 2PHZA 2XUAA 4Y9UA 2H7CA 5D3KA 3FMVA 4AY6A 2H4JA 2NVUA 1G20B 3Q88A 2JJ1A 3QWIA 4Y9TA 4YONB 4MRAA 4ARAA 4YO7A 1LK7A 5B64A 2I4TA 4V0OA 2JD2A 3MJRA 2JCBA 3AR8A 2ADFA 3A7EA 1T3ZA 2Z30A 4D3XA 4NR0A 3FJOA 2XCIA 3C3WA 5AOBA 3H4TA 4QLOA 4AO7A 1E3WB 1RRPA 4KACA 2XEXA 4IV8A 5HR5A 3OBIA 4YROA 3WDSA 3DYVA 4I9UA 3VBEA 2A9FA 4Q4JB 4D46A 3DFUA 2DERA 1W0KD 2VNHA 2J0SA 1KH1A 5TVKA 5AI0A 3J80A 2FRDC 4LYJA 4QDZA 1T9ZA 3LGAA 2YWDA 4NEQA 3PXXA 3KWMA 4W82A 4V3CA 5JI2E 4E5PA 1UXHA 4GPTA 2QL6A 4NDNE 1COWA 2DTXA 3HS3A 1BVRA 5SYNA 3GHYA 2BSXA 3DUFA 3WRVA 1R6XA 5AJUA 4GOLD 1ZU5A 1Z7BA 1X8KA 1DFGA 4YAJA 3W05A 1TM1E 2QI9C 4C4TA 3V55A 1HTBA 3B1FA 1JHVA 3FVTA 2R7AA 3I72A 5DHUA 2AQKA 3W2FA 5I8PA 1QE0A 1M74A 4E2YA 4GGPA 1O94A 2XZLA 3ZX5A 1PGOA 3UMFA 2AFHA 3H4IA 1ORRA 1S9HA 3NIFB 2XUHA 3QVSA 4IY1A 4NBNA 4BFYA 1T9CA 2UAGA 5JU6A 3QG5A 3P0IA 3NBUA 3SBOA 3VR3D 2BP7A 1FX0B 2JLCA 2Y67A 4BAUA 1UC8A 5AOCA 1QS0A 1RQRA 4N8DA 2RK3A 5D3QA 3N39C 3R0JA 3QE9Y 1NRJB 2WB4A 2OWDA 3V6MA 4FPXA 2PJDA 3U1TA 1JWLA 1OU0A 1SXJE 1E7WA 1H8HA 1FBNA 3C3PA 3D54D 1FTNA 3L8EA 1SXHA 3TCNA 2Y1CA 3NZEA 4F2DA 3FDJA 2BEKA 1SUIA 4Z4CA 1NNSA 3DLHA 4IUDS 1GO2A 2GFIA 2ORED 3X2FA 2PJRA 2ZZNA 2X1LA 4HS4A 1U3UA 1TCAA 1V8BA 2A67A 5K0GA 3DR3A 3UAYA 4I99A 1CUZA 2YN2A 1T4GA 4KBFA 5A4IS 3QVMA 3RS8A 2EKBA 2FDRA 2O5VA 5D6OA 1OKKD 1NVUQ 3LPDA 3AR2A 4A6EA 2Q7XA 3KS9A 1RKVA 2YY6A 1LDEA 4TYMA 5EIWA 1XFAA 2OFOA 1UZUA 5E4JA 1U6IA 2EGHA 3TG2A 4H6WA 4IHQA 4CQMA 2GN4A 4DIOA 1IAVA 5DTMA 5FCDA 1RD4A 4E1AA 1GTJ1 2YXPX 4M8NE 1ULTA 5DVZA 3U7QB 3ZJTA 1CUXA 3GIWA 4Z3OA 2FF7A 1BD4A 2EWMA 4H1HA 4ZQFA 3BTSA 2QV0A 3PYXA 5EJ2A 3SBEA 2VTVA 2WM3A 1QVVA 1NT2A 1F2TB 2OC4A 1C9NA 3QW2A 4QVGA 1DTWA 1IPHA 2HMYB 3KNZA 3VJKA 2NXEA 2W6PA 1R4MA 3DT8A 4KQGA 1B3RA 1A8UA 3BXXA 5D01A 3RRXA 1FBTA 3D3WB 4RX1A 4U2FA 5J4YA 4OPMA 4CKEA 4EMBA 5DGDA 2V4MA 2YQ4A 2F55A 1LC0A 3F3YA 3H1FA 2PMDA 2IWRA 4E46A 4Z7OB 2FZKA 1V3VA 3F98A 4Q05A 4L5JA 2ZDQA 2ZUVA 4UE6A 2RI1A 3MD0A 4L7VA 1E3QA 5IH7A 3OJFA 2OECA 1A4UA 4Q4JA 4NOMA 1E5DA 3SHTA 3ZVNA 4HPXB 3TNLA 1ZCFA 3GG2A 4P84A 3CRRA 2HWXA 2O5CA 2RJNA 3MQ2A 4JT4A 1XAHA 3NHZA 4KPUB 1XL0A 1TM5E 2YVUA 3I8SA 3WIOA 3PGJA 4EFKA 4PPGA 4BEVA 2AF4C 4D6YA 1OMOA 3GAZA 3BVPA 3TCKA 5DLQC 1OREA 5CVVA 3U6BA 1BA3A 1Y98A 3JWJA 4ERXA 4AYXA 3HZHA 5FKJA 4CEJA 1CY4A 7YASA 3FTQA 4XX1A 3A6DA 3VDNB 4AMGA 2VYQA 1XB2A 1LF5A 2O0KA 2ZRKA 4J4TA 2FV8A 1G5RA 1CJTC 4RDCA 4HLDA 4XRRA 1B6TA 3MOGA 4RE5A 4ZVLA 4C0KA 2LDBA 4GL2A 4TS4A 2VN8A 4LKOA 4K3UA 1V2GA 1Z4MA 3FFAA 3D4OA 4DAOA 5GY7A 5A4FS 1DJQA 4RVNA 4DLTA 5AHRA 1E4VA 1DIBA 1ZJZA 1SKBA 2P91A 2W4IA 3HRIA 4ZVKA 3WTBA 1BMDA 3TYXA 2B35A 3ZG6A 1NP3A 2ZTUA 4OIFA 3ANLA 2BFOA 2FW7A 2AGVA 5B4TA 4O25A 1XEWY 1KEKA 5C7OO 3ZGXA 4HNAA 5BUZA 4I2NA 1AY0A 1R6VA 3Q1KA 3ZGZA 1E0DA 3OIDA 3UWSA 2ZB8A 3ISTA 4A23A 1ESEA 3PV0A 2J7KA 2FETA 4LK2A 2EZ8A 4FYIA 3FOBA 4GPZA 4MSUA 4Y2SA 4EPTA 4M7RA 4MUIA 3KUXA 1TUBB 4LF6B 3LA8A 1VBMA 2OBNA 1A9SA 2QVYX 1EUCB 4HPJB 2AOUA 1EK1A 3DF7A 5C1IA 3TJZA 2ZPTX 3ETCA 4LQDA 3I5YA 2ZJ7A 4UCQA 4DRXA 1GDDA 3UK7A 5JJLA 4RV5A 5B55A 2KBFA 2RG7A 3UF0A 4BNYA 4D02A 4PNZA 3JQBA 4R2KA 5K8VA 4W5NA 4UU0A 3OCJA 1E9EA 1SUFA 3CN7A 3IAS6 1N7IA 1ZUNA 5A1TA 3SYKA 5B7PA 2J7PD 2OUIA 3RNLA 3AUSA 2JAUA 3A6EA 3Q15C 2QQ5A 4Q6WA 1DKUA 4M76B 4DV4B 3LRXA 2I9PA 3V00A 2IU6A 1CYEA 5H5JA 2EFDB 3FOCA 2IUSA 1C0EA 2C3YA 2ODQA 3TLXA 3ZH9B 3DZIA 3AHEA 2IPLA 3FNIA 2V4UA 2V59A 2WYHA 1P8JA 3BB1A 3KYJB 3CVYA 3DA8A 2VJMB 2J5BA 2YXNA 5JROA 5JRDS 1VMDA 1R27A 3JD3A 3GUZA 4LPKA 1RMQA 1RWVA 2PGIA 4MWOA 1KS9A 1YWGO 5DYIA 4ER5A 2CB9A 5LQRA 4V0QA 4F3TA 3CLSD 3CRQA 3HKCA 1YTUA 4JVLA 4N0EA 1RJ9B 3SHFA 3WRYC 4IH4A 1T3SA 2LRHA 3DBVO 1M1NB 4QULA 2HLPA 5EAIA 3TRFA 1OXVA 1QCZA 2C0PA 1Q3TA 2OK8A 3NTOA 3GWZA 3KTOA 3BQ9A 4I7EA 3SEQA 4TXNA 3VH1A 3WIUA 2O8BA 3QPUA 4J3FA 3HEAA 2XITA 1QDUA 1W88B 2HU5A 2YWHA 1U2QA 1WF6A 3M2TA 3WLFA 3ZDEA 1G9TA 4NCNA 4B4DA 5F3DA 5JXJA 3AEUB 4RVFA 4JI8B 2P9JA 3U3XA 4NECA 4O4LF 2WVAA 3O4JA 3RGWS 3UJCA 3SE7A 4O2RA 3UB4A 5JNSA 2WFLB 1NI4A 4CLXA 2EYUA 4IICA 3U81A 5LJLA 1PDWA 1T4MA 1VG9B 1TAQA 1QH8B 3AP2A 1DRUA 1B6SA 2QX7A 5IBQA 4EB8A 2X8JB 1I14A 1MJFA 2X1VA 3EDOA 4CIAA 2Q45A 2REQB 2WIAA 1OCEA 2IIBA 4NS1A 2O1WA 5ITSA 3T1TA 2BN4A 4N6GA 3G0GA 4KIFA 5G3YA 2FUNB 3BL8A 3K0AA 3OEHD 1YOVB 3PWZA 4MCAA 3ZIAD 5LWHA 3I5AA 2CJFA 2HWWA 4ALJA 2ZE6A 3MFQA 2J6BA 4R3WA 3ZWBA 3O8QB 4K3VA 2CKDA 4D0LB 1DC7A 2AD1A 3A4NA 1OXXK 3BERA 3C7KA 1L7MA 2AOTA 2HF9A 3P2MA 4S12A 4CUKA 4TYWA 2Q6OA 5FXMA 2HTEA 4YAKA 1H2AS 1X0XA 1KI6B 2XUIA 3NDJA 1GDHA 4LYEA 4WEOA 3W0LB 1FUYB 3OF3A 4QTYA 5LYJB 3I9V6 1RVV1 5AP9A 1EHCA 1RACA 1LK0A 2IGBA 3GCZA 5JD6A 1A9PA 2AOUB 4UPDA 1OY1A 4MWCA 1C2YA 5DHAA 4MS1A 5TV2A 4ZT2A 4WESA 3EASA 4PZYA 2YIDA 4RKEA 4BV2A 1YKSA 1JH9A 4YRRA 1EX6A 1UL1X 2D1YA 4G0UA 3Q3CA 1JA9A 4O3FA 1YHZA 3N2ZB 3O82A 4PO8A 1JPJA 1JAXA 3LLMA 4XVHA 1FRZA 2VAWA 3AQ4A 3ZZUA 4DLLA 5A4DA 5BQ5A 1Z7EA 3DDWA 3GCXA 3F73A 3ESAA 3TZQA 4C7XA 2A30A 1YA4A 2D1RA 4ZEXA 4RKQA 1P74A 1NVGA 4X62B 4H17A 3O31A 4XWOA 4AWAA 4YMSA 5TQ0B 3KYDA 2L82A 3QH4A 3BL6A 3DKVA 4LYFA 4BNMA 4TMWA 3DVAA 4BQFA 1FZQA 4OLAA 1OHHA 5J23A 2BH2A 1H2XA 2OBXA 2WKPA 2OY0A 1L5HB 1UBHS 2G72A 1G8FA 3DZFA 2A5JA 5BMVF 4MVCA 4M9QA 4MUXA 9MHTA 3BRQA 3ANXA 1PX2A 4OGGA 1ZH8A 2ZI9A 2UZ1B 3N5CA 1Y3BE 3B8EA 4BVFA 1YR1A 2NXWA 5FFNA 4IWYA 3E9EA 3O75A 3N7TA 3LQYA 4DNQA 4DMUB 3WGOA 1NOJA 1M2EA 3M2PA 1MCZA 4X71A 3RIXA 5BT8A 2C92A 3PRYA 1P62B 1G3RA 4TUYA 2XVAA 5GONB 1EG2A 5K51A 5TMBA 2IIVA 1SCQA 3BF8A 5TY0A 1RE0A 3CC8A 4YX9A 4V0SA 1V7CA 4D4MA 2F1HA 3OE1A 3FAKA 2JS7A 3PGXA 1DZ3A 4JZYA 4C2AA 4BO7A 4L22A 3KQNA 2TMYA 3DT9A 3FSJX 1GNVA 1HORA 1N0IA 1KTVA 3FKJA 2HF7A 2HJHA 4I50F 3EVTA 1JSRA 4YXWD 1KERA 3HPQA 3VR5D 4B4UA 2J32A 4YWJA 2V65A 3WGGA 1WCIA 3I01M 5IARA 2WMYA 4RSMA 3RUIA 1P6QA 1MN6A 3CJQA 3WQSB 3X1JA 1CR0A 1CZLA 4D96A 5C52B 3MC1A 1Z63A 2IU4A 4Q4DA 3A4VA 1QAQA 3N59A 4FZRA 2PEZA 4ZV4A 4MICA 5EJ7A 3HBFA 1TA9A 1RAHA 3D6TB 4P4SB 4OP3A 2E3JA 3DBLB 3HCWA 1QG4A 3PT5A 2F6RA 3IIMA 4HFNA 4JYBA 4MOWA 2ZBVA 2BUAA 4TTJA 1ONSA 3LUBA 2JI8A 4L8VA 4W8OA 3IVAA 4G0VA 3SZUA 4QUBA 1LPOA 4BX9A 1FJXA 1K5GA 2IUUA 1MIOB 3GRAA 3CZQA 3WP0A 1JSXA 1B0ZA 3RRJA 4BWFB 4IEEA 4R9VA 2G9ZA 4BTEA 1YGYA 5DTJA 5LKAA 3JQQA 3W9YA 1J20A 4C78A 1VSTA 1MB2A 5EIBD 1S3FA 3MWDB 1C4OA 1QAMA 1S01A 1Z36A 5FFMA 3U9LA 2HWKA 4Z4HA 4XWKA 1RAFA 2CXUA 2BFMA 3FWHA 2EZ4A 1R8JA 1N2ZA 5JPCA 3GJ6A 4JLWA 4UOQA 1TJ3A 2IYUA 4FFVA 2ZRBA 1SBQA 3RBAA 3R3UA 3R76A 5CCBA 4EW1A 1XAJA 3OQJA 1UJ6A 1Q92A 4IMIB 2VBIA 4HX2A 4YFYA 2GO1A 3KP1A 3OM9A 2QN7A 2PANA 3A9RA 4MQEA 1AG9A 5DMXA 3ZHSA 3N70A 3OCXA 1CDEA 4DIBA 1EBBA 2A33A 4RGVA 4JLAA 1BJKA 2NO4A 5I9SA 1CR1A 6REQA 2HJ9A 1INLA 1A5SB 1ZN2A 2H7YA 5EESA 4DMLA 4FFLA 4KL8S 3VV2A 5EJFA 2XT6A 4MGHA 5D87A 4ZCQA 2XCTB 1EFPA 4PF1A 3R9XB 3W2EA 4GRDA 4YP1A 1OX4B 1K6MA 2GBGA 4HWKA 4IDOA 4RZXA 1RAIA 4WINA 5ENVA 4G37A 4MVWA 1YHNA 3K1ZA 3AEQB 3Q0TA 3N0RA 4JSRA 5BSTA 3UFXA 4MB0A 4B0OA 2WE8A 4BATA 2JVJA 1HGXA 4K87A 1PJCA 3CVUA 3EDMA 1SA0A 3CSDA 4X65B 3BULA 1HE5A 2C54A 1U8TA 2OM2A 3MJSA 1VIVA 3LXXA 4D4LA 3TMKA 1R0XA 3QYJA 2VYFA 4RELA 5L3QB 1KMIY 3TLJA 3UY4A 4LYHA 2PJZA 3HA7A 3UHPA 5L95A 2D00A 4P0PB 1HE2A 2AR9A 1ULZA 4Z0NA 2FXVA 1UMBB 1LV7A 3SE0A 4TLMB 2PGLA 4C07A 4BU1A 2CNLA 4LWPA 3HKEB 4DQUA 3PNPA 5AQ1A 3RC2A 4IZOA 5E4YA 4B32A 4G0MA 4IIJA 1VHTA 1X1TA 2VEDA 1Z8NA 1VHJA 2I55A 1KF0A 3NYQA 4N40A 4Q4LA 4CMJA 4YRNA 1W4CA 5EMNA 4CCAA 3EOBI 3K30A 1F8FA 2P6OA 2YRWA 4O0LA 5AXAA 1DDGA 3DBLA 4KSYA 3ZY5A 5FEMA 1NW7A 2VQDA 1GZ6A 3A1VA 4FHEA 4B46A 2GF9A 2RKBA 1N0VC 2C61A 3GEDA 4JN6B 2QENA 4OVKA 1XQVA 3TDMA 4BS9A 5K0CA 3U3ZA 5IJ0B 3ICOA 4PCAA 2PSSA 2PNFA 3FETA 3U17A 4UKDA 2E85A 4LDJA 4TYNA 2NZUG 5B2FA 4YACA 5TB5A 2G17A 4QDOA 3GEMA 1WDLA 4JX8A 5T4BA 5JRJA 2FEWB 2PGXA 5HTOA 1T5HX 3DKPA 3NGMA 3RGGA 1DRKA 4DG9A 4GKVA 1RZUA 1CQIB 2DY0A 1OA0A 4J7CA 1X38A 2P27A 1TLFA 2WUVA 2AOTB 3HLKA 4GMHA 1YA6A 4KDEA 3L1KA 1G21A 1GQRA 2NVOA 3EE6A 4HDSA 3A6KA 2YZ2A 4LWQA 5G0VA 4ZAVA 4CMIA 1YVPA 2QVGA 2HRQA 4NH0A 2PZKA 3IDZA 2X0NA 2XODA 2ZQYA 3ON5A 4JP3A 1KEPA 4WAUA 4JQSA 3G0IA 1EUQA 4TXJA 4E2FA 5NLLA 4ZDWA 3ROMA 4AP6A 1PD0A 4MHOA 3PXDA 4DNPA 1IRXA 5C4MA 1J4AA 1EWRA 1QHXA 4XVRA 2ZT8A 4FUQA 2I6TA 1J22A 4IJUA 3U4CA 2X6QA 5HTKA 4RSRA 2ZYHA 2BFWA 4JWTA 1QQBA 1TE2A 4HVTA 4XQGA 4RD1A 3TE6A 4OYRA 3VYSB 4BRSA 1UAAA 2JGLA 2P6NA 2QMZA 2C94A 3WGZA 3K2IA 2YUTA 3S2EA 4I1UA 3JQFA 1TQHA 4U2CA 4ZCMA 1LRJA 2ZSFA 3KAKA 5MHTA 2ECFA 1N1EA 1XRPA 3MJEA 4XFJA 3O8LA 3IP6A 1HA3A 1K68A 3W2IA 4LF5B 1PTKA 3PD1A 3NATA 5LPNA 3K6SB 2J45A 1QMGA 1NBAA 4IDQA 3TO5A 1VJ0A 1BVUA 1NVBA 2J3EA 3HR8A 1UDBA 2V55B 1CUGA 2LR0A 3IESA 5JS2A 1I30A 1FP4A 2F48A 3AUTA 4CG2A 3IOYA 2EBHX 2QP4A 1S2DA 1TYDE 2JLAA 2V7XA 3NHSA 4PTLA 1QVZA 1TPYA 2H0QA 3JZFA 5BXQC 2BKAA 1FDIA 2DB3A 2Z8YM 3H9EO 4WD3A 1QU2A 4ER3A 2HM7A 1KJ9A 1UIMA 3QHAA 4XB6B 5DZSA 4V0KA 2GUGA 2AN3A 5FOQA 1G0NA 2CZCA 5BSFA 1SC4A 3THOA 2ZIFA 4YRKA 4OK6A 2EWVA 3HBMA 3NOQA 4S0XA 1LJUA 4FOTA 1U6KA 3R41A 1A97A 4H6VA 1A4XA 3V2HA 1B8NA 3UVEA 4YCCA 3ESZA 2IYVA 1Y48E 3VRHA 2QTWB 3S7ZA 3DDZX 4KHPB 2GN9A 5C18A 2PH5A 3NC4A 1YH3A 1T1RA 3BHIA 3K09A 3MFYA 4R1QA 1NN5A 5G2OA 2IF0A 2VAMA 4GWGA 4X20B 4XM1A 4IF6A 4AJ9A 3BJRA 4CI9A 1Y7IA 3L7BA 1SEVA 3UV6A 3WFZA 2IXDA 2FE4A 4HWGA 2WW8A 1VG8A 4J9VA 5HZHA 4IHJF 5HKBA 1EM8A 4DLZA 1Y8CA 4L57A 2QJRA 5GZ6A 4NY1A 4DBLE 1WPXA 2DPYA 2DU8A 2XADA 4LJSA 1C9EA 5DM1A 3PCXA 1LS1A 3VJMA 5K8UA 4G1UC 1XVIA 4MIYA 2GZAA 3VNQA 5GOTA 4FD3A 1U0EA 3TVTA 4TPKA 5AI4A 3ZY2A 1H6BA 1KZ6A 1Z5UA 3Q40A 3S4YA 5AW1A 2IKSA 1KO7A 2Y4OA 4H16A 4XUEA 2HEGA 3O8OB 2HDWA 5AUOB 4UHHA 5DEOA 3STYA 3SVTA 1QBGA 2YYZA 3K70C 1W36D 3E81A 2QZ9A 1WUHS 3VDXA 1YV9A 2HIMA 1WDKA 3W1VA 4WKCA 4A5SA 4L9SA 3TQOA 5FV4A 4IH9A 5TPWA 2PKXA 4UFNA 3I9V1 2CXNA 4DCCA 1YO6A 3BIJA 5DLPA 3ZWKA 2XSZD 4DEYA 1NQXA 1S2IA 5LU9A 3IC5A 1UJMA 2R68A 4R1OA 3SF0A 3S8EA 1V3TA 3HO8A 3UK0A 4NKRA 2EWWA 2BHSA 3QU9A 2VYNA 4AJ2A 4OBXA 4GVLA 2XCRB 4G0WA 4WZBE 5CM9C 2EBUA 5C46F 3DCNA 4QXPA 5JSZA 1T0IA 3BJIC 1JEOA 3OO1A 1BE0A 1JSLA 2QTGA 1Z38A 4LQLA 1MO4A 3L0OA 2AMJA 3FF1A 3MHPA 4H59A 5AXBA 2X19A 2HY7A 3VX4A 2VF2A 3BS4A 2Q3JA 1RPAA 5ECGC 4Q3AA 1IXZA 1V5IA 1RPTA 1WUTA 3GLGB 2YRFA 4G6ZA 3SP1A 3CZCA 4TX1A 3LX6A 5JALA 3IDFA 3IXMA 3CEMA 3KELA 3QP9A 4AYTA 1IUPA 2Q5FA 4JAVC 1C1HA 3OIYA 2PVSA 1WHTB 1PD1A 4HFJA 3UHOA 1CB0A 2CMFA 3C24A 3D8RA 3QXHA 1BHQ1 2VSQA 4TS1A 5HCIA 3U7EB 1QO0A 2Z1MA 3A2LA 1I2BA 1K63A 2C2XA 3EPPA 4KHZA 1Q0ZA 4CM8A 1AQNA 3IUEA 2G9VA 5GGXA 2QZZA 3I1JA 4FGJA 4EMUA 5HMLA 3UPTA 2A0KA 3CLUC 4ETIA 1G1AA 4PG6A 2QXUA 3R5SA 4WCFA 4CG3A 4PNEA 5CXUA 1XTTA 3D7LA 1DKLA 2AVNA 1JE1A 4M21A 3VDQA 1HDZA 3URMA 2JAPA 1UZAA 3BE5A 5DWDA 4QZVA 5LDGA 1GTSA 3T9FA 5BWCA 4HNAB 3CFYA 4P1ZA 4AKTA 2FZGA 3Q2OA 1RTTA 5DJ5A 4HN2A 1I10A 5F2KA 3K72B 2VDWB 2QVLA 4B3JA 1E2NA 1P1FA 2CGEA 1Q0SA 3P9ZA 2RH5A 5CDGA 4FM9A 3KYIB 5DULA 1TVKA 4MGKR 1FSPA 1HT1E 4WASA 3U9TA 1J25A 4Q12A 2P8SA 5ERGB 3I2HA 3TL6A 4Q39A 5LP6C 1HSZA 2VWGA 4HDCA 3I5XA 4G8DA 1N7GA 3DAGA 4C04A 1BTOA 4RACA 5JQGB 3ENZA 3EB9A 3ZIUA 3QLVC 4P32A 2H06A 1FFWA 1QKKA 2G83A 4HEA1 2BHNA 3TXAA 1ZHFA 1WU7A 4DIDA 1ZQ9A 2OOKA 3QBVA 2I54A 2G28A 4DHWA 4AYWA 5A03A 2BT4A 1JU3A 4ARBA 5AO9A 1YZQA 3I61A 5KKCA 4TMXA 1Q1ZA 4V2IA 3X1MA 1AE1A 4U7JA 1LTHR 2H2FA 4KRGA 3KD2A 5KVVA 1M1NA 4ISCA 2I1VB 4E09A 1UFQA 3F7TA 4EO9A 1M6VA 1W30A 4K9MA 4ZMRA 5LQUA 1S3IA 2FQYA 2V3CC 4Z53A 3SX2A 3E4DA 3DD1A 5DCLA 4DLVA 2QJFA 3GGJA 5AK0A 1Z2PX 4DWVA 1RHQA 4ZGGA 2D7JA 4ALKA 2EEPA 4ZPXA 4LZAA 1YR2A 3LHFA 2PBFA 3DVAB 1JG2A 4XSHA 1T8YA 3NDRA 2X9NA 4CFYA 1H2EA 3MJ4A 3QIAA 3HC7A 1TZ2A 4IR7A 5DRTA 1XMIA 3IJEB 3LPMA 1C3EA 2FN3A 3A6PC 4A15A 1XRQA 3B6ZA 4LZPA 1VJCA 4YEDA 2N1BA 3EJ6A 4W5JA 3RIEA 4N12A 4QYWA 4B71A 4QKQA 1TLLA 1ZRNA 1JYFA 3EOAI 4QATA 5LQDA 1RPZA 2FY8A 3MQ4A 2FZCA 1DXHA 3GOQA 1RBZA 3ZDAA 1UFKA 1Z4LA 1C3OA 2H4XA 2JD1A 2NU8B 2C29D 1ODFA 5LU8A 2BZ1A 2HCFA 1M0TA 4ZT7A 4OXYA 2JGFA 4W6QA 3HXQA 1LPPA 4LF7B 2ZRMA 3OT1A 1N77A 3A3PA 1MH1A 2IXGA 1Y42X 2JI4A 2P4EA 2QD5A 4WTOA 4YV2A 4MB6A 5H8WA 2ATXA 3ZDDA 4CG1A 2XX3A 5CD1A 1DKQA 3REQB 2HPAA 3NHJA 2BGGA 1QB8A 4OI1A 2Q5HA 5CXQA 1A9OA 3QQ5A 1FF9A 1Y3HA 3PUJA 1VJ5A 4M86A 1N2GA 3DEZA 3LUJA 1WZUA 2OLEA 2HZBA 1SCBA 5D51S 4F5EA 5JDIA 4PIVA 4BV3A 3Q12A 3AJAA 4QODA 2QZ4A 3ZLTA 1U9ZA 4BO3A 2Q50A 3ZEAA 3EDYA 3WMGA 5KDDA 3HP4A 1Y6JA 2WF5A 2YY5A 4RBNA 4PHGA 4RPCA 4X1YB 3BHJA 2DWQA 2FJUA 1ZJJA 3OT4A 1NN1A 1YR9A 4GH5A 4CQJA 2ODEA 1J42A 1L1RA 3T41A 1OGJA 1GAQA 1IEVA 1UMKA 2I7CA 2O14A 3FH0A 4IIYA 4RJTA 5CIYA 1FEZA 3B51X 1PQWA 3TUIC 3SIRA 4HB3A 3KYDB 1VJRA 2XTMA 3LUDA 2O2IA 3RAPR 4CBVA 3OIUA 2Q5QA 5HP4A 1AIPA 3O84A 4KVGA 4YYEA 4PS0A 1POXA 2YJGA 2XDAA 3OFJA 3K7EA 3PHHA 3DG9A 3ZU3A 5JZMA 5IYZF 4RJ2A 4TQAA 3SQXA 3K0SA 4FNMA 3OLWA 1ZKMA 3VC2A 1KORA 1Z0FA 4NCHA 1L1FA 1TQ6A 4RY8A 1UBMS 2MSLA 2OM6A 1XROA 3AFOA 3PGKA 3W5DA 1ZGJA 3L0ZA 2Z56A 3G1WA 1OC4A 4B0PA 4CKZA 4AS3A 1Z35A 4EHJA 5BR7A 4AWXA 1K4MA 5B7GA 5CG1A 1XDBA 3FFTA 2Q49A 3QPAA 1QRUA 2ZJ5A 3KZ1E 5DISB 1K7CA 1S6YA 4DSNA 3B3AA 3O0DA 1N5OX 1SVWA 1VKHA 1OLUA 3FVRA 3PQ3A 2ZVDA 1H3EA 1PJQA 2IEAA 1QFXA 3G59A 3PTAA 3BXOA 1I3MA 4NAHA 1YRWA 4L02A 1N6IA 5JYEA 1NFRA 4L9RA 2EYQA 4N3NA 1SCNE 1GPNA 5EWMA 5AVZA 5IN4A 2CFOA 2CK3A 3N8IA 3DNMA 5CBPB 3T38A 4M6WA 1NWCA 2C4UA 1C80A 1Q7CA 2FDXA 2W7TA 4MYCA 4C0AC 1Q1GA 1ZAKA 2VP6A 2H3HA 5EIFA 3RU9A 4DR7B 4QBGB 2VZLA 1PI3A 3NDBB 4WI1A 1W52X 2ODAA 3BIXA 4M37A 2I9KA 1G5QA 3RUCA 2Y92A 4G3XA 4G86A 4KQ6A 1I7QB 1G55A 3IV9A 3LZDA 1JEDA 4LXYA 4FE4A 1U8AA 521PA 4NCBA 1OIXA 4RHXA 2WIBA 5GGYA 3A70A 4CFSA 3VA7A 1C8BA 4DRZA 1WD7A 4QGGA 5LVAA 4RYDA 1C1DA 3MLBA 4FLEA 3R20A 3FUXA 2E82A 5L53A 3CUEF 3KAQA 4UVGA 1KQOA 2ZYDA 5LMZA 1KXJA 1YQQA 2YXLA 3DE0X 3LWNA 3A4TA 1OI3A 1JBKA 4R51A 1N78A 4F2GA 1O77A 1WZ2A 5A6VA 3RLIA 1RHRA 2ZU0C 1DE0A 1G64A 5FOVA 1JH8A 4EY4A 4U39A 4N7BA 2JB9A 3ONWA 3M70A 2SKDA 2HWUA 4N7MA 1KR2A 2APJA 4KQ2A 5F77A 4BP9A 2XNDD 1FMCA 5F4BA 5M29A 1SU8A 4FMDB 4PLZA 4GKKB 1PP4A 3MELA 2J0UB 1TK2A 2L2QA 3I3SR 1M2VB 3I4LA 3IURA 1R8QA 5CGZA 4RXUA 3JD4A 4KQHA 4OI4A 3FTCA 1Z2DA 3CG0A 1NN0A 4X6XA 3NBAA 3CW8X 5KB3A 2ST1A 3WHLA 1Z6QA 3CONA 3G79A 1Y8RB 1L7PA 4GUDA 2ZYRA 4H7IA 4M22A 4JI6B 3VQTA 1EDBA 1D8TA 1HYQA 1MHPA 1P3Y1 1VHQA 2C2GA 2XQGA 2H8KA 2F8MA 3AIKA 2WJYA 3DL7A 3NETA 4LQ4A 4TS9A 2VJPA 1GCAA 2AHRA 1OC2A 5DBIA 5DNWA 4IOJA 4C03A 1GN9A 2XUPA 4GWKA 4QIHA 3QI7A 1JDSA 2WOJA 1DJNA 2D5IA 4WLFA 8LDHA 3TOXA 4L15A 3BC1A 2FWNA 1SOAA 2N46A 4EJ2A 1YNSA 3LS2A 3RKSA 4R71A 2OVBA 3AEKB 1F1BA 1TM3E 2OHJA 4MQEB 1Z4IA 4YDSA 1EVIA 2B8TA 1O8BA 1E9AA 1PQUA 1A9QA 3KPJA 3M5PA 4N01A 2HQ1A 4TWAA 5ICCA 2OWEA 4ZIRA 4U9UA 2Q4BA 1P2TA 5ICSA 2VDRB 4F7DA 2HIGA 3OJEA 3VR5H 5B1YA 5K3DA 2FU5C 1M34A 3LUPA 3Q6IA 4FYVA 1NX6A 3L9XA 2XYPA 4OQEA 5FORA 4A27A 1NVAA 1SQGA 2P8JA 3I23A 2E48A 1B41A 1ICEA 5EVJA 3SN6A 4G5FA 4PLVA 4C0WA 2NXNA 3HN2A 2ORYA 3PUIA 2W2KA 1WSAA 1D6SA 2JL1A 4H77A 5B3KA 1CU1A 5DX1A 4ZREA 4LVUA 3T7JA 3D4BA 3ILXA 2WABA 1A7KA 1R0LA 5DW0A 4E22A 1KJNA 1SD1A 3H2SA 3HCFA 3FYTA 2H1HA 1IY0A 2B1GA 1SEPA 3CHYA 3RE1A 1A2BA 3A6FA 1OX5A 4I6GA 2HH9A 1NBOA 2OCAA 3H4MA 2DM6A 3LBAA 1O2DA 1OT3A 1GKUB 1KEWA 3D6HA 4UCFA 4PX5A 1L5WA 3BF7A 4FIDA 5IJZA 4RZHA 4JBIA 2RGRA 3WYNA 1A76A 1JLLA 1ZESA 3KE8A 4LFAB 4V03A 4PICA 4OQDA 5DF1A 1WG8A 4P4SA 2PX0A 2Z2XA 2I78A 3F3MA 4GPEA 1VJ1A 3QFTA 4AS1A 1NBIA 2B1JA 2WTBA 1JNYA 2VK2A 1Q74A 4NP6A 5IAAA 5LZ7A 4MHSA 5E4TA 1DQRA 5FYDA 2C7RA 1DIHA 2LGJA 3R7BA 1Q3HA 1XLTA 2PLAA 4JJAA 1XAGA 2RB5A 1NR1A 4QDTA 3FBGA 1KO5A 2B83A 2H4HA 1F0KA 3OQPA 1QX3A 1AMNA 1MC8A 1HDYA 2XZPA 1ZIOA 1U02A 3C7DB 1H2ZA 1P4RA 3PS9A 4DIEA 1A4IA 4QBHA 1O95C 3LQ1A 5AVRA 4YJFA 2P2GA 3AUYA 1PL0A 1UOOA 1KOJA 1LY1A 4NU6A 4RIFA 1J0BA 1GRQA 2FGKA 3PKZA 4WLEA 4XQEA 5KSPA 2XTAA 3TPCA 4C6RA 4EABA 1YB5A 4TN5A 1LX7A 1E8DA 1K1EA 2ZIZA 1U28A 3TTWA 1AV7A 4QFBA 3OCYA 3SI7A 4KIWA 1YE5A 3GDFA 4QREA 1QZTA 2UZ1A 3IMCA 2GHIA 2P9YA 3DE2X 3FYUB 3PFHA 4ZD6A 4BHTA 1ZEMA 7ADHA 1DC5A 1DAGA 2CMGA 2CJWA 3B1WA 5BNZA 1QXSA 5D3MA 1JG7A 2ZI5A 4H15A 3K9WA 1XKLA 1EVKA 4E5KA 1N5KA 4H0NA 4X97A 1KQ3A 4MR7A 3GBSA 2ZUFA 3DZDA 1SKUA 4YRZA 4XYLA 3BKXA 4G26A 5AI5A 3AF3A 2AEEA 5JZ9A 2I80A 1BH2A 3O94A 3CWZA 3UNXA 4D8UA 2WQ7A 1BJRE 4CPDA 1E8NA 4RAQA 5F7ZA 2GXAA 1E96A 1ESMA 2E2WA 3OKAA 3I6MA 5CU7A 4L74A 2QRPA 4L5AA 3PJGA 3AP3A 1VHDA 3EGVA 4IRXA 4R3NA 3R24A 4U8HA 3C3CA 3CKYA 2JGJA 4CIXA 4O29A 2IV3A 5ALEA 4EY5A 4PFJA 3NEYA 3SXJA 1WKCA 1EAMA 2AV6A 2PZMA 4BNZA 3QHQA 2C99A 1Q3KA 1XXHB 4MPPA 2QY6A 4DDTA 3DGEC 3O4RA 5EERA 2QP3A 4INPA 2XUGA 2B9EA 3KOWA 3NTLA 3TEFA 4RLQA 3WB9A 5JNVA 4MUKA 3IDOA 5KTSA 3DTVD 3AVOA 2QDXA 2VKQA 5JNUA 5L4SA 2YVQA 3FCEA 1V47A 3MBIA 4DDUA 4W1QA 1LPSA 2WHPB 4ENSA 1GPYA 3GZ4A 1GKLA 3IOBA 4C3OB 3FOEC 3BRCA 5BOSB 6LDHA 5LNK6 4CTJA 3LQ2A 1T5IA 1VRCA 2FR1A 1VYTA 4FZ3A 2QRHA 2V7BA 4TV9A 4Z99A 3K4QA 2IJGX 3VR5A 4PXSA 1NVTA 4XEUA 4CMIB 3B12A 4G36A 3JALB 3L41A 4CF4A 3MTEA 3V7UA 1P5HA 3M6MD 1F6BA 2BHRA 4HT3B 1HXHA 2UZ0A 4YRTA 5ES4B 3CS3A 4G9GA 3BRWA 3H3JA 1N6NA 4F1WA 1DDIA 4JP2A 2VAPA 3WQQA 1LBQA 3T1NA 3MTQA 2XJ4A 3INRA 2PUDA 1PZHA 4HLUC 1OA1A 2B21A 2Q6KA 2D5BA 3C6BA 1H2YA 3JQDA 3M49A 1GFWA 2GCGA 4XWYA 1W7AA 3T7IA 1CP2A 1J2UA 1YR8A 3CLTD 3HA5A 3IPYA 3N2GB 3PHJA 3QA9A 3WHIA 5T57A 4G4GA 2FUG1 4UM9B 4U2KA 3AINA 3W7BA 1QGYA 3R8XA 4AY2A 2Q41A 4KDFA 4WLVA 3ONNA 3PBKA 4NESA 3KZVA 1ZHOA 1CBUA 5HJ2A 4CMCA 4N5DA 3SDSA 1Z56C 2O48X 3FOAA 4IIXA 4XCVA 1C9YA 1Z12A 5K3BA 2QMQA 4N3GA 1VFPA 4PLHA 3F0TA 3E27A 4W8GA 2ZYSA 5FL7A 5HEKA 3O2JA 5GJWC 1I1NA 2EQAA 4L0DA 4HQOA 2QLBA 4QASA 3ZDQA 4TSFA 4IZIA 4W99A 4II3A 2EARA 1FE8A 2BKXA 1I3LA 1N6PA 2Q07A 4NBUA 4OL9A 2GK6A 4FFBA 2H31A 1E0KA 4EI7A 1T2UA 3ZC3A 5FX2A 3T3PB 1MAUA 5ILQA 3L4BC 4J0DA 5L3QA 2D54A 3F7OA 1YR3A 4P3KA 4YRJA 4E5UA 5BUCA 3N2KB 3K16A 4MR9B 5L3VA 1SULA 5BN4B 1V9LA 4TSFD 1SA0B 1ZD3A 3HACA 2AJ8A 3MWGA 4RDHA 4QWWA 4HNHA 3P4YA 5B4UA 4QQFA 4Y6RA 2DFTA 3MUOA 4ID3A 2V7QA 4KXXA 3BDVA 4BGDA 2X3YA 3HKEA 3VTAA 3MUEA 3HVRA 3ZKWA 3CPJB 1N5RA 2XRFA 2AUTA 2V9CA 5TDHA 3TBHA 2BV3A 2HMVA 4KOEC 2XMZA 1BW9B 1K5DA 4XX0A 3DBIA 4XTCS 3TB6A 3FFWA 2FFQA 3TDKA 5J4HA 1UXJA 4ALNA 2QN6A 2GI4A 2REQA 2YINC 4W5QA 5DU2A 4OMUA 5I7AA 2E9SA 2J87A 3R5JA 3SQLA 1VPTA 2ZK7A 3GFQA 4B3CA 1GAEO 2BGNA 1RLJA 2FPXA 1JLSA 1T13A 2Q1XA 1ADGA 3HUFA 2OHHA 3VR2A 2O8FB 4QAQA 1KHHA 2MYNA 3SX4A 3TIGA 1L7QA 2VDWA 1T2VA 2GYVA 3ND8A 1NF3A 3LGSA 1XN1A 1U7XA 1VL8A 2IT1A 1WMAA 2VVTA 3D02A 5AKXA 5JT1A 1SB9A 5LOVF 1NBMD 1FTGA 2GZMA 3IV7A 5GM2A 3JWEA 3LFHA 1DEHA 2FR8C 3KQVA 4YAWA 1NKVA 4AJ1A 4EY3A 1BXRA 3S44A 4D3DA 1AKMA 1TIKA 2AJDA 2XOXA 2IUYA 3BXZA 2CXXA 5HILA 5K4AA 3TKYA 3WSTA 4DMFA 2J4CA 5EJ9A 4PG5A 4BB6A 4RKFA 3SCZA 3ABIA 5CJPA 3ABRB 3D59A 3SHQA 3O9VA 5JCOA 1RQ7A 3D3NA 1NW4A 3LT4A 1OXKB 1NQUA 5BO5A 1T2DA 1MEJA 5DEIA 5LA6F 4G25A 1OPXA 1K7XB 2DC1A 2ZBUA 3OY2A 5EHNA 4MVJF 5KJEA 3ZZ1A 1NG9A 3LL7A 4MWTA 3ZCTA 5LCXA 3WBBA 1K6XA 2WJWA 5BSVA 4P58A 2P41A 2B82A 3L1JA 5AHXA 3WK5A 1NP7A 4OLFA 1T6YA 3OC0A 2UUAB 5F23A 3O4HA 3S6JA 3WOHA 2WNHA 1JDBB 4WNAA 1OI7A 1G7TA 1FTSA 3HCAA 1DBRA 2ZWOA 3BMNB 3BUSA 3CLUD 1XVVA 3OC6A 4HGZA 1U0HC 5F98A 2OOSA 5FPQA 1K08A 5KYVA 1ZEJA 2WT8A 4X1KA 2BDEA 3IFSA 2I2AA 3K71B 1ZAYA 4K6OA 3LLVA 2KBEA 5E9AA 4MVJH 2BFBB 3PPIA 1BWRA 4JKOA 3RJZA 5CM8B 4CV1A 4OOEA 2ZW9A 4EW2A 2WVJA 5J1TB 4D92A 1SHKA 3AW9A 1MJ5A 4GXNA 1QK4A 3W9SA 4D4GA 2WLTA 3GJYA 4KDRA 4BMDA 3BH6A 1LSJA 2WSBA 4PO3X 1H94A 2JW5A 1RSZA 3L4JA 5EE5B 3FYUA 2HCRA 5DSTA 2UYQA 1G8SA 1DDOA 3O92A 1RXYA 4BNNA 3SF8B 2J9YB 3UOAB 4UMFA 3OZEA 5IF3A 4F46A 4A8JB 4KFUA 1R0ZA 1FYXA 4OBWA 1SU4A 2DWCA 2P6UA 1FJ2A 2R96A 3B7WA 3L77A 4QOIA 4TUYB 1FRNA 4WLUA 2BBSA 4YGYA 5ES3A 1EE1A 4G0NA 5AKYA 3DZCA 3LAWA 1NPYA 3ZD9A 5BPHA 2P90A 1GPLA 2RKWA 1PV4A 2FLWA 3AIIA 3BSSA 4M0LA 5IXJA 1JQKA 2WZCA 3Q7IA 4N0DA 1QV9A 4LZJA 3L04A 3O0TA 4BIMA 3IVXA 3V1KA 2O7QA 3GG9A 3PL1A 1R8YA 4UAVA 2IWHA 1D04A 2WTXA 4DDKA 2ATIA 4MNTA 1M54A 2BLLA 4FOOA 4D4IA 1M0EA 3TW0A 4BFUA 1L3BA 4BUZA 3KKQA 4L51A 1NMXA 5BOVA 1HEYA 2EIXA 3M5WA 4PU0A 2JLUA 1USKA 3DO6A 1ODIA 4UHDA 3U7RA 1E5XA 1KVQA 1UF9A 4YRFA 3A4YA 2ZTVA 3CLHA 3DZGA 1DBIA 3FUTA 3K15A 4PEVA 4UQPA 3MSXA 2K5UA 3ABZA 1RXIA 3UQYS 2R7MA 1CEXA 1V16A 2A9RA 2I67A 4Q19A 3U0BA 2Z3WA 1TVMA 1O0CA 1LWOA 1KOFA 1XE3A 1GRVA 4RZ3A 4DJDC 4WOBA 4JHXA 3BEOA 5F52A 3OPYA 4CI0B 1PFWA 2HYIC 3KKEA 2NT4A 3PKIA 1QHIA 3KHUA 3T5DA 1TYCA 1TRKA 1YB4A 1UBUS 2XDWA 2O2XA 3NBKA 3QKSA 3GVCA 1MJNA 1P1JA 3LY7A 1LVUA 4ZCPA 3KTFA 2KX7A 4RORA 1VP9A 2P35A 1EU1A 2QIOA 2R1UA 3CN9A 4UW9A 4XQCA 3F7NA 4FS3A 4AT1A 4BNDB 3M3DA 2VXCA 1A9XA 4QX6A 2JHCA 4LC9A 4DC1A 3O47A 2VQFB 2WHRA 4JS0A 1ZUNB 3LQ4A 4BVEA 3IDAA 4OXKA 1JBQA 2PO5A 1Z06A 4I1YA 3M6IA 5H9WA 3FWKA 2CJXA 1SD2A 2JIPA 2PD6A 4X8OA 2WSYB 1MB4A 3WGQA 2ZFUA 3DPIA 3W90A 3BBPA 4EGSA 4X60A 4IVRA 3HCPA 4MWDA 1FNSA 4AL4A 2BONA 3AI3A 4D5GA 1RQLA 2W6OA 2J3IA 2MSWA 2SCUB 3QY9A 5FB3A 3VNVA 3F6RA 1PEYA 1Q20A 2R7KA 1AUOA 2GEUA 2Q4DA 4JSYA 4XGKA 5FA6A 5KDLA 4CQMD 4I36A 3F5FA 1SVOA 3LH5A 4D9HA 4RM3A 2A1UB 2B6HA 1NLUA 3UWPA 3GT4A 4AMUA 4JI7B 2CSXA 5DN6A 1PYOA 4BFVA 2ACVA 2PAAA 5EL0A 5F33A 2IOFK 2ZI7A 2GGSA 4WCVA 3UFXB 3NAMA 4Q9KA 2MYPA 2DHEA 4BDSA 5HYVA 4X6YA 3Q5GA 3SLRA 2BR3A 2P4UA 4ESVA 3HMQA 3AM4A 1SH7A 3RADC 5TNXA 3P94A 4Q18A 1BS1A 2BSAA 2CLFB 1NOKA 2OBLA 1DT5A 3AFGA 2DKNA 3D1VA 3ROXA 2AE2A 4RTKA 4G4SO 1KDVA 4Z3DA 5TLSA 4QT0A 1RHJA 1RQNA 4R1LA 5JHHB 3FNEA 4CDMA 4FEYA 2RFLA 3SJ7A 1KDPA 4M7PA 3HUEA 1REQA 4BBAA 3ETHA 4IFIA 3OE7A 2ZU6A 1C4WA 5HQJA 2C9CA 2C2WA 2UYYA 4UNRA 3CUYA 4XYEA 2BISA 3GAFA 2ENWA 2VHYA 4MRVA 2P2ZA 5FNVF 4BE9A 4BVBA 2G9RA 1GNLA 1U0SY 3L40A 4PZ9A 4XLZA 4M9XA 4D99A 3FXAA 2WB2A 3N0VA 4IIEA 2XKJE 3ZJYA 2PA3A 2BEWB 1KY5A 4NE9A 2C5SA 3QMMA 2WQ6A 3VOTA 4FMBB 3V8RA 3A9WA 3LRPA 4LX0A 3RBZA 4D0GA 2G7ZA 5KNDA 2UYOA 3GQBA 3NFRA 2V5VA 2Y6VA 2JFVA 2IOHA 3P32A 3OOHA 4RTLA 3KTAA 4YLEA 3VZPA 2YW2A 2WA1A 3DMPA 1VSUA 4IIUA 2IYYA 4F21A 2Q1TA 4P38A 2JATA 4TL8A 5ARDA 4MV1A 1YZ3A 4H7JA 1E2HA 5F9FA 2GD6A 3QXJA 3CRZA 3G5TA 1A9ZA 4FYYA 4RD0A 3KJIA 3DLTA 2IL1A 1QOPB 3BWXA 3CNHA 4TTSA 5K0ZA 3ANMA 2AC2A 3GLSA 3F6BX 3TPZA 3GFBA 1ISFA 2I2XB 3H9CA 1T4CB 2NU7A 2ZREA 4RFSA 1UBNA 3KR2A 1XL1A 4R54A 1SGWA 3WKDA 1MX3A 1D1PA 3H8JA 4JWKA 4ZPJA 4XLLA 3LQFA 2XQIA 5EFOA 3JXEA 3ESBA 4FC7A 3DCYA 4N0PA 4ZOBA 2HLDA 2WVGA 3DOUA 1DRJA 5T3UA 5AIAA 2OZPA 1WDWB 2AG0A 2ZRGA 3AEKA 3RWOA 2GYUA 3WICA 4QDKA 4XIIA 4BECA 4CU2A 1O7JA 2QUZA 1XTBA 2BFPA 3H5VA 1E5QA 1LNQA 1M5RA 2V7EA 4GX1A 5J59A 5ECYA 2XUZA 4MPTA 2GK4A 4NBKA 2NQ2C 3GAMA 4OP2A 2XBMA 2GJAA 5FNVB 2QZSA 4DILA 3TSYA 1DEAA 3ECCA 4KH1A 2OT3B 2WIJA 4RCVA 4EP1A 4W8HA 1TGVA 1B16A 2OKCA 3ZU4A 3THYB 1HNWB 4KW7A 3KZOA 1IOWA 3UJ6A 2YZ7A 2X7HA 4LOJA 4PQEA 4C29A 1TLTA 2ADOA 1ZRSA 1JTFA 4HX5A 3UXHA 2ADMA 1JXMA 4B2LA 1JLLB 2GHRA 2R6JA 3VJLA 4LRTB 3S5JA 4RLFA 3IAM6 3JX9A 4DXDA 4JD5A 4U7HA 1PVVA 5BUSA 2YCLA 1L0BA 5THQA 1CDOA 1JJBA 3AGPA 3G8BA 4CL3A 4E11A 2DSNA 3ZW7A 4GO1A 4JR2A 2ABWA 1T4BA 1KZ7B 2GEVA 2PUJA 4OHMA 3P0EA 3Q3EA 4Z0PA 1E0SA 1CY6A 2W2VA 2EU8A 5ADHA 5AJHA 5KDOA 4XDGA 1TMGE 5KOJB 4OKIA 3H16A 3CNBA 3WA7A 4HVLA 3WA6A 3WP1B 1LLFA 1I2CA 2A88A 3R3WA 2AZMA 2IHJA 4OK3A 3W3AA 1M83A 5FYQA 1DJPA 5BOSA 3AJEA 3RTBA 4EG1A 4RTMA 4FBMA 1L2TA 5JR3A 3EXAA 4PSCA 2QPOA 2DHCA 4XGIA 3CLRC 1MRSA 2QL7A 1G2PA 2W22A 4FDAA 1ECPA 1F2TA 3KETA 1E2PA 1H05A 3SXUA 1UBFA 2AS0A 4O2BA 2M6LA 4F4UA 1IHYA 4P82A 1ZVJA 4Q24A 1UMDB 3QM1A 4IUCS 4B76A 3K0CA 5I7WA 5DNUA 2W9XA 1Y4ZA 2XYVA 3NHWA 3RFTA 4A36A 1LS6A 2IZ6A 1V2HE 5DM0A 4AKSA 1ZOLA 2GHQA 1B1CA 2Q9CA 4LTNA 2VLBA 5JH7B 1Z0ZA 4YRQA 4PV7A 3SR4A 3TR5A 3OX4A 4C2UA 2A59A 3DOHA 3Q4GA 4QSMA 5KVQA 1WSBA 5A7GA 5G1PA 3ZD6A 1MT0A 3WGLA 1ZIPA 4IWNA 1ZN9A 4F4HA 3T4PA 4MKRA 1KDOA 2PQ0A 1Y5LA 2CCJA 4QYMA 2H9AA 2PSHA 5B1HA 3T3IA 5KWEA 3C8MA 1H0RA 3KEMA 4M1EA 1U0RA 5IABA 1G8MA 1UBSB 3GFTA 2OB2A 3UOGA 4D9IA 4C0SA 4KG7A 5LP6F 3S5UA 4MR7B 8GPBA 2M2IA 1GY8A 2ZVQX 3FNRA 3O91A 3H3XA 5D3MB 3L8GA 2A86A 2VUIB 2DT5A 1ONNA 1A7JA 3CPSA 1ELOA 4CDRA 5AD1A 3L18A 1GGVA 3TPFA 5SY4A 4YP7A 2FHPA 3WKAA 1NM5A 3GOHA 5E7QA 4NCAA 1G19A 4YIHA 1UXOA 1TUEA 3R3SA 4O4JF 4YJHA 3SZOA 1ZR2A 4IMPA 4WGFA 4CTNA 5K01A 5FI0B 1ONOA 4FEGA 1ISPA 3K9HA 4YS6A 2B36A 4QELA 2G40A 3OEED 1OD6A 1ZI9A 4QOGA 4DM4A 4Z5XA 2CUZA 1QP7A 1ZA1A 1X8JA 4PR3A 1WPGA 4ZCRA 4BP8A 2NW6A 4E5DA 1Z0IA 3VZSA 3NT2A 2PX4A 1UT5A 1CFZA 3LU1A 4AZ0B 3PGVA 3A3YA 2PBLA 1CQIA 2C0QA 7GPBA 5DHQA 5FUVA 1UUFA 1P7WA 4NZPA 1EM8B 4BFLA 4JEUA 4O4HA 1E4OA 4RA9A 1NVFA 1TZCA 2H48A 3TAXA 4ENQA 4QJ3A 3AVTA 3ROZA 1UBJS 2Q2WA 3NH9A 4GBJA 4GYJA 3S1SA 1JR2A 2DSTA 4DUGD 3L7KA 1AGNA 4WZBA 4XRGA 1XPUA 4IVQA 4P4TA 1RKBA 5H83A 4CL2A 1DX6A 3EQZA 4LSGA 3R7AA 3T94A 3ZXUB