4QPZA

Crystal structure of the formolase fls_v2 in space group p 21
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
563
structure length
563
Chain Sequence
AMITGGELVVRTLIKAGVEHLFGLHGIHIDTIFQACLDHDVPIIDTRHEAAAGHAAEGYARAGAKLGVALVTAGGGFTNAVTPIANAWLDRTPVLFLTGSGALRDDETNTLQAGIDQVAMAAPITKWAHRVMATEHIPRLVMQAIRAALSAPRGPVLLDLPWDILMNQIDEDSVIIPDLVLSAHGARPDPADLDQALALLRKAERPVIVLGSEASRTARKTALSAFVAATGVPVFADYEGLSMLSGLPDAMRGGLVQNLYSFAKADAAPDLVLMLGARFGLNTGHGSGQLIPHSAQVIQVDPDACELGRLQGIALGIVADVGGTIEALAQATAQDAAWPDRGDWCAKVTDLAQERYASIAAKSSSEHALHPFHASQVIAKHVDAGVTVVADGGLTYLWLSEVMSRVKPGGFLCHGYLNSMGVGFGTALGAQVADLEAGRRTILVTGDGSVGYSIGEFDTLVRKQLPLIVIIMNNQSWGWTLHFQQLAVGPNRVTGTRLENGSYHGVAAAFGADGYHVDSVESFSAALAQALAHNRPACINVAVALDPIPPEELILIGMDPFAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Computational protein design enables a novel one-carbon assimilation pathway.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
molecule keywords Formolase
total genus 186
structure length 563
sequence length 563
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2014-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00205 TPP_enzyme_M Thiamine pyrophosphate enzyme, central domain
A PF02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain
A PF02776 TPP_enzyme_N Thiamine pyrophosphate enzyme, N-terminal TPP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qpzA03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qpzA01
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4qpzA02
3AHIA 1ZPDA 2BFEB 2VBFA 2PANA 3D7KA 2QQGA 1RP7A 1O97D 4JU8A 4KXQA 3EXG2 4MPPA 4WBXC 4KPUA 3FLMA 1TKCA 5EXDA 1M2GA 3CF4G 5K6RA 1OLSB 1Q6ZA 4UTXA 5EJ8A 1OLUA 3EY9A 3ZGOA 1W85A 2X7JA 2NYRA 4JUAA 2BEWB 4GM0A 3F6EX 3M6LA 2YIDA 4FZ3A 2OD9A 2H2FA 1W88B 4MPJA 2H4JA 2BFFA 2Q28A 4TWIA 4C7BA 4MQ5A 1X80B 5K3SA 3CLRD 3CLSD 4IG9A 3HWWA 2H2DA 1SZDA 4RJIA 1NM5C 4F4UA 2PGOA 5MF6A 1ITZA 1YC5A 1V1RB 4ZP1A 2JIBA 2BFCB 4KXVA 5BWLA 2VJYA 2C3UA 2BFFB 1YNOA 1PT9A 4UUAA 4UTRA 1HZZC 4FVTA 2C3MA 5D7NA 1T9DA 5I4IA 4QQ8A 5ERYA 2BP7A 2UZAA 2JI7A 3AI7A 2XTAA 2QTCA 4K9LA 2IHVA 1GPUA 2WVHA 2Q5QA 3ZHUA 1JSCA 4KXUA 4JT8A 4O8ZA 1DTWA 1QPBA 3IAFA 1OLSA 5I51A 3EXIA 2Q5LA 4QELA 5HGXA 4RJJA 3ZG6A 3LQ4A 4KGDA 3LQ2A 1U5BB 1T9CA 4V1CA 2PGNA 1DJLA 1W88A 3GLRA 4GP9A 4C7XA 3ZHRA 4F56A 4XEUA 4R8MA 2FRDC 1X7YA 1YI1A 3EXIB 2NXWA 4C7VA 1D4OA 3ZGVA 1MCZA 3PDHA 2BFBB 1UPCA 4ZZIA 4JT9A 1UMBB 1YHYA 5FYQA 2BFCA 5EXEA 2YICA 3AHDA 4JUBA 2BRUC 4RMJA 1NGSA 3M49A 2JI9A 4L2IA 1MA3A 1UM9A 3RIMA 1OLXA 1V1MB 3IAEA 2A1TR 2BFBA 2W93A 3MOSA 4RMHA 3EXFB 2H4FA 4MPRA 3ZHVA 2BEUA 2OO5C 4BV2A 4FEEA 5HHTA 2JGDB 2VK8A 1SZCA 3KOMA 4X3PA 5EJ4A 3PKJA 2VBGA 1UM9B 4K9OA 4HD8A 1WCIA 3DUFB 1T9AA 1PI3A 5EJ9A 4J1TC 4K9MA 4MZXA 1M2JA 1YI0A 2BEUB 2O1SA 3AHGA 1TRKA 3AHEA 2JI8A 2VK1A 2C3YA 2OZLB 4Y6QA 4I5IA 4BVEA 2H2HA 4UTNA 2JLCA 4Q9DA 2OORC 1UMBA 1QS0B 1X7WB 2R8PA 2AG0A 2C3OA 2IHTA 2Q27A 5EJ6A 3U3DA 1U28C 1PO7A 1PVDA 4JSRA 1V5GA 1W85B 2FN3A 3DV0A 1S7GA 2BEWA 2H2GA 2UZ1B 2XT6A 1POXA 3EXFA 1X7ZB 3EA4A 2QQFA 4BUZA 4UTVA 2FWNA 4RJKA 2EZTA 3CLTD 2BEVB 1UPBA 2Q5JA 2H2IA 1OVMA 1YBHA 5DEIA 5IMSA 3EXHA 1UPAA 4UU7A 1T9BA 2IHUA 1UMCB 3DV0B 4V1CB 2BFDA 2C31A 3HYLA 4D5GA 2EZ4A 3UK1A 2FR8C 1X7XB 2R8OA 2IEAA 2A1UA 3PKIA 2C3PA 1NI4B 3LPLA 4BV3A 1ICIA 5C4IA 2EZUA 1PNOA 1V16B 1YD7A 4GG1A 3L84A 1Q1AA 1YC2A 1KEKA 3GLSA 4IF6A 5DGTA 2WVGA 3AHFA 3F6BX 4GPEA 1NI4A 3JR3A 2Q29A 5I5GA 3GLUA 1M2KA 4UTZA 1V5EA 2H4HA 1DTWB 3EYAA 1V16A 2WVAA 4Y6LA 1R9JA 1TKBA 3M34A 4KXWA 5MGNA 3EXHC 1OZFA 4RMGA 3OOYA 1OZGA 3U31A 2UZ1A 1U2GC 2G25A 2EZ8A 5K2OA 4JD5A 1OZHA 4K9NA 1U2DC 2HJHA 5ERXA 5BWOA 2AG1A 3ZHQA 1B0PA 1PYDA 1J8FA 1X7YB 2PDAA 1WCIB 3ZHSA 3DUFA 2VBIA 4QPZA 5I5EA 5HYVA 5EJ7A 4IAOA 3AHCA 2DJIA 3RIGA 4JU9A 1V11A 1Y9DA 5MFPA 5BWNA 4GM1A 3D4BA 4K9PA 1O96B 2VK4A 2Q5OA 4C78A 1XLTC 3DVAB 3UPTA 1V1RA 1QS0A 5MFZA 1POWA 1YHZA 4TWJA 3CLUD 4KXYA 4BVHA 3LQ1A 2QTAA 2OD7A 3OE1A 2EZ9A 4JUFA 3FSJX 1S5PA 2FSVC 1N0HA 1PNQA 3GLTA 2J9FB 5DGDA 4BVGA 1M2NA 4BVFA 3RIYA 3EXEB 3D81A 2OD2A 1Q14A 4V1CI 2E6KA 2B4YA 3M7IA 4BVBA 1UMDB 4UU8A 5ESDA 5EJ5A 3EXHB 1V1MA 1E3TA 4K9QA 4X3OA 3HWX1 3FZNA 2BFDB 1U5BA 3EXEA 1YTLA 2H59A 1V5FA 1X7WA 3E9YA 5EJAA 3AHHA 2Y0PA 1X7XA 1TKAA 1V11B 1PTJC 2JLAA 1X80A 4FEGA 4GM4A 2JGDA 2C42A 4BN5A 1UMDA 3EXG1 4L3OA 3AHJA 4HDAA 4K9KA 1M2HA 2G67A 5AHKA 4D5EA 1U31A 3K35A 2BFEA 3DVAA 5FEMA 1Z8NA 4Y6OA 1X7ZA 1AY0A 4JUCA 1QGDA 1L8AA 5HJEA 1EFVA 3JWPA 2O1XA 4COKA 3ZHTA 4JUDX 4KXXA 2BEVA 1Q17A 4RMIA 2G28A 4BN4A 2R5NA 5EJMA 2XT9A 4UUBA 2OZLA 2V3WA 2JI6A 2J9FA 4J16C 1IK6A 1OLUB 1OLXB 1UMCA 1BFDA 4G1CA 2BP7B 5K6TA 1EFPA
chains in the Genus database with same CATH superfamily
1QWOA 1C9KA 1QZXA 2OHXA 2VBFA 4KYUA 4C6TA 4CF5A 3I4LA 1HC7A 1NIPA 1VFPA 1ZIPA 1CZHA 1M66A 3BDIA 4JY7A 4LGYA 3AF5A 1CIVA 2XZDA 3GVXA 1VPDA 1P8AA 3M4ZA 3CJTA 3CPEA 1D7AA 4O4HB 4YALA 4ATNA 3EHEA 3E22A 4AM8A 1QYXA 2EFCB 3PNOA 1A04A 4TXNA 4RTKA 2MYUA 4IDCA 5C9ZA 2YNMD 1JZSA 1HYEA 3OX4A 4DB2A 2JGEA 3KWLA 3ZGOA 3AETB 4DSNA 3A1UA 5B55A 1BCSB 2BJVA 2BI8A 2QA5A 4C6HA 1AC5A 4ZCTA 5K05A 5JQWA 1J0DA 2AA3A 2YIDA 3ETNA 1J0CA 3PJDA 1F12A 4IQ0A 4JP3A 4KDFA 2D3TA 3ZHBA 2UXDB 3QX9A 3I83A 4HEQA 1J25A 1W88B 1WDLA 1S8FA 2QN2A 4YRPA 4MQ5A 3UGQA 4E1BA 1KQNA 3L6RA 3TD2A 1JF8A 5FWYA 4URHA 4CIDA 3NRCA 1HE5A 1D4FA 3I1FA 4HAVA 2P9HA 1OXXK 2VTDA 3VC1A 4Z7OB 1X1DA 4RJTA 2UU9B 1M7GA 1HQDA 3LL7A 3PHIA 2O0MA 4HH4A 2QTZA 4MQUA 4ZPJA 5FCDA 1CEEA 3IDFA 1QIKA 3DBRB 5HTKA 4HNAB 1NM5C 1TU4A 4RHXA 5DX0A 4F4UA 1NF2A 1ITZA 1M6EX 2XUOA 2ZE7A 3TKLA 5F78A 2BTEA 2W6MA 4MS1A 4EG0A 1WJGA 5KYUA 2FW1A 4GBGA 1M6NA 1VA5A 2W8BB 2Q6LA 3NOXA 1YNOA 2QPOA 2QM7A 2WM9B 5DSXA 3QEBZ 3O4VA 4JIMA 1FNSA 1C1XB 1Q0HA 1P4RA 1SAYA 2C4KA 2XV1A 3DSRA 5IH7A 4WNIA 5ECYA 4DV4B 2UZ3A 3S28A 3OTOB 3HJGA 2JGRA 3SP1A 2HA0A 3LU1A 2IYUA 3R7LA 2WW8A 1EP3B 3QVVA 1PKEA 2DP4E 3D1LA 3D6VA 4LDQA 5ALDA 5LQKA 1TLTA 1MRSA 1MF7A 1WXDA 2A57A 2D5AA 3HYTA 4PAOA 3SIRA 4IXWA 4LE1A 2E55A 3WIVA 2IVZA 3WKBA 1U0NA 3PFNA 3TFQA 1EPUA 3DW3X 1I01A 2Z1MA 3JQRA 1D6MA 4KVZA 3W2EA 1DBPA 3I53A 2YHIA 3I39X 1RPTA 3HUTA 3U6KA 1QBKC 1GIAA 1QCZA 3CJRA 4P86A 4QOIA 2E4YA 1T2UA 2PS1A 2ZU0C 3D31A 1FRQA 5FR1A 4LZNA 5AW1A 4R4JA 5I51A 2P78A 1DG9A 1W6UA 3DLAA 3ZHXA 4I8DA 2ANCA 2NADA 2Q5LA 3EIQA 3IEKA 2DERA 5HKKD 3ZG6A 4KXNA 1JSXA 3BSSA 3VTKA 1T2NA 4D4IA 1V8DA 4LE2A 4S0ZA 5EP4A 1V26A 1T9CA 2XCTB 1ACLA 1CXZA 1J07A 4ZC1A 4PZLA 3RUPA 4NYIQ 2XQKA 4WSOA 2VUTA 5LZ9A 1OGYA 2YNMA 4YUVA 1Y1LA 2FUCA 4FHGA 4OQYA 2WILA 3M9LA 2GK3A 5HA5A 1Q0LA 2J5RA 2JGKA 3HJCA 3K1YA 2ZRDA 4BMNA 4QM6A 2ZIXA 3QKRA 3NYWA 4K6OA 3NM6B 4R8MA 2QTVA 2FLVA 3HRKA 2VZ9A 1F3LA 2UVPA 4LDNA 1MCZA 2XNDA 4JR1A 3PDHA 3CY6A 2JCBA 3JCZA 3GFSA 3T4XA 1Z4IA 4JT9A 8LDHA 2R751 4BLPA 4DVGA 1EK1A 4KRGA 5EMMA 4BMYA 3KETA 1QRTA 1XF1A 5HRUA 1P17A 2OB1A 2RH9B 5H82A 1P19A 4RFSB 3TZ6A 2PJUA 2ZJBA 3GRPA 3DFKA 2C7QA 1QOPB 5HCNA 4YVFA 5JMPA 1Z7BA 3LUGA 3BDVA 3H11B 4L5IA 4TVKA 1TD9A 2J5XA 4Y67A 3F2IA 4M37A 3VJKA 3K2EA 3JZDA 3W5SA 4UDNA 2XUJA 4KIFA 2VJOA 3ZVRA 1NR7A 1E20A 3ADOA 2NU6A 1MAUA 3VUEA 4F0JA 5J2UF 2NP6A 4KQMA 3G5UA 5SZJA 2QT1A 3LYLA 2ZKLA 3RYIB 1NXTA 4B33A 2PE5A 2IYTA 1GLNA 5K0BA 2WTEA 3ONEA 2GBCA 2PVSA 4TUYF 2BEUA 3DZBA 4OXQA 1F9AA 1H1LB 4OB8A 4IIJB 1DQYA 4QEDA 4U9IS 5DPMA 3VR4H 3WMGA 2BAGA 4IHJB 1IY1A 2BHTA 3LLSA 2IIVA 2ZYRA 4M0CA 5IM4F 1IJFA 1J8VA 3HPRA 3Q9NA 4RHFA 2V03A 4B82A 2XD4A 4HDKB 3OIGA 4Y6GB 2FMXA 4F60A 1NUAA 5I7WA 5KPJA 3RFUA 4EB8A 4IH1A 1R8SA 1VMDA 2VPWA 1FX1A 3A9CA 1DZIA 3ZLUA 2RB5A 4GMKA 2GCEA 4EG4A 3NAZA 3TLEA 5J1SB 1PZMA 5CW1A 1XCJA 2IW1A 4FBGA 4H6XA 3RVPA 1BVHA 3E2PA 1P9RA 4R7ZA 5DXAA 1QK4A 4EHBA 3NEPX 3OJWA 3RS0A 1RYYA 1YMVA 5ULLA 4I50F 2OZEA 2XGOA 2JS7A 4QBTA 1HLPA 1FLAA 3OP4A 5EGNA 1K06A 3G2IA 4F2GA 3U16A 3GP5A 1DI0A 3OQIA 4WV3A 2PUEA 1V4BA 1PG2A 5KTOA 1G4HA 4F06A 1TTHA 1XA4A 2VRCA 2VVTA 1N9ZA 3V8BA 4ILKA 2BV3A 2QAIA 3ISJA 4WKBA 4GVXA 1DS6A 3TLMA 3LO5A 1JPVA 2RC6A 3MRVA 1JAYA 3BK2A 3E5NA 4NNPA 3SU8A 4D81A 2G7ZA 5KBYA 3LE8A 3CF2A 1UBOS 5DH9A 1V8PA 2H0AA 1USVA 4G5HA 3EYWA 1EE9A 4AZVA 4ETNA 2RBEA 1WCXA 2CUKA 4CM9D 4KR3A 3WLPA 5CFOA 4JLAA 2PJZA 3EH1A 2G4VA 1OGJA 4MB0A 1LS1A 5F4BA 3MTDA 3L1IA 4IRUB 4M1SA 4D98A 2RD2A 1AG9A 1UWKA 2J9ZB 1T13A 4HATA 4WERA 5CGZA 4PGGA 1I13A 1FLNA 4CM4B 2GPSA 3OT5A 4AUMA 1Z2CA 1ZBQA 1PGOA 3EEQA 1XZDA 1N5LA 2HJGA 5AESA 1PYOA 3IDOA 4CEIB 3K7EA 1V6AA 4HO1X 4MVJI 2N9UA 2NTVA 4R6XA 3UIEA 2P27A 2HT6A 2Z8ZA 1L6RA 4MVJP 2ZIZA 1FTSA 3R3UA 2RK6A 2AMFA 3MCTA 4R2HA 3WLNA 3CN9A 2H2GA 1AMUA 1ZVJA 2X9QA 2G0AA 4N9WA 3PE4A 1O03A 5JIBA 1DUSA 4KE7A 2Z57A 2JAOA 4FQ8A 2VEDA 3DFZA 4U39A 1TUIA 3M4JA 3EZYA 4XOIA 4YMGA 3LZDA 1Y3FE 3UFBA 1T3SA 3UK6A 3I3SR 1RQNA 1U1GA 2BR4A 3H3JA 5ENZA 4XJVA 1OVMA 1QIJA 1V35A 4O4JB 4BMDA 1JSZA 4G8DA 4OGGA 1J06A 3BCUA 1V4NA 3SSAA 4B76A 4GZ5A 2PA3A 4MTLA 4AMUA 3PFWO 1SY7A 3N0TA 1GZDA 4MCHA 4EY5A 3DV0B 1NNUA 3E7DA 3KKZA 1VQ1A 4E12A 1KQFA 3ROPA 1U2SA 2NU8B 2HMWA 3N5CA 1A9XB 4B4WA 2C9YA 2BH2A 5D3MA 3P2JA 1J1UA 1YVPA 3OPNA 4PRKA 5BW8A 3KZMA 2CBXA 1E1RD 2R8OA 1B1AA 5IRCD 2ZJ3A 4DEVA 1SBIA 3B2NA 1N6NA 2YL2A 4N5HX 5MDHA 2R7LA 1R3DA 2YIJA 4QSHA 5JZ9A 1E5TA 2FDCA 5ALUA 4IIEA 2G9ZA 4IICA 3SF8B 5CB4A 4YCDA 4OIMA 1GXSB 1GYPA 4V0QA 5HBRA 5HRAA 4N18A 4DIFA 3WV5A 4CGYA 2NU7A 1E1YA 2Q3FA 1A3CA 4I1OA 2BWJA 3M82A 3LVBA 4QDTA 4R84A 4DUGA 4PYMA 3K09A 1NW8A 4FLMA 1YC2A 4DE5A 2JKYA 2IXTA 3WY9A 2JFXA 4KK4A 1SC1A 3N74A 3LTEA 3I6MA 3OAAD 1LY1A 3WMFA 4KPGA 2RHBA 3PEEA 2VOJA 5JY6A 1W0KA 3AERB 3KVRA 4UVHA 4OYYA 1V41E 2WC1A 4AJKA 3ZQ4A 5BV2P 2O8BA 1Y8RB 3MXOA 4MWSA 1JQ5A 5ALGA 4EHLA 1Z0JA 4N0EA 1R9JA 1U7UA 3CKLA 3GRYA 1Y5IA 3GLKA 5FDFA 5CA1A 1TVCA 2FKAA 3KXDA 4KXWA 2XQJA 3FFWA 3GJRA 3EZ7A 3GT7A 4GXRA 4OXRA 4GRIA 3IOEA 4IQ8A 5AKIA 1SN7A 3PG5A 4HXGA 1HLDA 2XW6A 2Z8YA 1BHSA 3SXUB 1Y0BA 2XNCA 3X1KA 1S0UA 4Q7KA 4G1VA 2EZ8A 4A6PA 4KPYA 2Q41A 1JJFA 4R1LA 1H9AA 1UXJA 3TAXA 3WOVA 4AG6A 4ZDKA 3E18A 1KNQA 1KFBB 3AFOA 2PT9A 3PE3A 1J49A 1B0PA 3DC2A 1RJGA 1QGZA 3I04A 3MJCA 1BE1A 4IQGA 4GVLA 2YXLA 3RT9A 3WKCA 2IHJA 2DBRA 4KCGA 4DSOA 1CDDA 4KV9A 2Y0DA 3DE0X 2FEWB 3H13A 2GKOA 3RT7A 3ASVA 3LZCA 3UKDA 1SUBA 4M8KA 1UCFA 3NGLA 3GJ3A 2CYAA 4RY2A 4AO6A 3IP5A 1NFFA 1SKAA 1NMZA 4WXEA 1JFVA 2Q6KA 1C1YA 3JATA 4TKVA 1KY3A 4QBGB 4GMGA 3UV3A 1E32A 1TZ2A 2P3OA 3FRHA 1XJ5A 4PQFA 4QBHA 5A9TA 3CUVA 3VKUA 1EA7A 2YWJA 4P58A 1C8LA 2EP7A 3IAS1 3CKKA 1KZHA 3V2IA 2PPLA 4XYLA 4B8YA 2UYQA 4J6FA 3VR3A 3RS4A 4XYMA 1GNVA 5E3IA 3VH1A 5BYKA 5JBNA 4ER0A 3BH0A 2J0UB 3U4CA 8ADHA 1TK9A 3B6JA 2BZ1A 2D0PB 4A23A 2CL5A 4H1UA 1RJFA 3C5HA 1FP7A 3GEPA 4A8JB 3UPUA 3THXA 3MERA 1A8QA 5BY2A 2X8WA 1SUEA 1QP8A 1GYRA 1QFSA 1TM4E 2C0CA 2IIQA 4FHZA 1Y7LA 4N0QA 3I2GA 1SBQA 3LA8A 5MFZA 3TTUA 1POWA 5F52A 2O57A 2FCAA 2ZRNA 5JJ5A 1MABB 2JLQA 5HIMA 1Z5OA 3L6BA 1VRVA 1NFQA 5FBHA 1OIXA 5F9MA 4A26A 4DLSA 1ZMBA 2AOUA 4HJXA 5AW5A 1L5HB 3BD8A 3LBIA 5KYWA 2EOAA 2HH9A 4KQHA 5J9FA 2DWUA 5DGDA 2C8JA 5AI5A 1WQ4A 1A4RA 1Z45A 1VOTA 2WD8A 2Y27A 3ORFA 2WF5A 1DEOA 4AF8A 5J5CA 4JUIA 3O1IC 1M34E 1ESEA 4PWYA 3PVCA 5D51S 2VR1A 3L07A 4FI3C 5JI3E 3D81A 1E6WA 1E96A 3MPUA 1FDUA 5CD9A 4PQRA 1ZI6A 4V2UA 1MJHA 1QWSA 1L1RA 3C6KA 1AHNA 3DZHA 3DXZA 1TEZA 3T4EA 3L18A 3CB2A 1I3MA 2XADA 2SBTA 1OH6A 2QG9A 3F9IA 3RS5A 1G8HA 1SA0B 1R8JA 1SD1A 2FMIA 4LI3X 1C0LA 2V3VA 2GXSA 4KZKA 4TM7A 2Z8YM 4GKVA 1UOQA 1C50A 4F5DA 4MPTA 1E8MA 2EFGA 4RK0A 4EATA 1K97A 3OIWA 2DFKB 4K9QA 4KW7A 1ZGZA 5E3HA 5KCZA 4L5BA 4FKBA 2BFDB 2RAVA 3Q5GA 5DULA 4BLWA 2GQ0A 4A0RA 1U6IA 2ISQA 2JB9A 3LLUA 1X15A 3IE2A 1X7WA 2ZJFA 3LK6A 3NBQA 3OLXA 3PGXA 5A3RA 2ZR9A 2ZJ6A 3AWDA 1VECA 1Y8QB 3F5DA 3IT2A 4AUEA 2XTNA 2HXSA 3BTOA 4IFEA 3W4JA 1N1EA 2AOTA 1DLJA 3A58B 3HKDB 1UPXA 1XG5A 2F1HA 4MDYA 5IJWA 1EWKA 2AUNA 1TZBA 2FPSA 2O23A 2YWCA 4Q3CA 4JI5B 4B75A 2ZTUA 5CVDA 3NOVA 3ZH2A 3UB2A 1SRRA 4BQEA 5FTKA 1UBCA 4RORA 4N3AA 2FMFA 2CV1A 2NAPA 4UZEA 2A9OA 5L6MB 3PQ4A 3RBXA 4B83A 2EHDA 1AKVA 2QJOA 4EUNA 1YDMA 5KMGB 4D25A 2ZBFA 5DEOA 5MN5A 2R1UA 3K9GA 2QJFA 1EWVA 3N2EA 2H3EA 1YIAA 4MEBA 4B45A 2IQ5A 4QXOA 4C6SA 2OK7A 2E6UX 4TTAA 4FC6A 3C5CA 4YLYA 5KNDA 2NYAA 2PUWA 4DLUA 3DCIA 4FGJA 5IJXA 4B81A 4JQZA 2BEVA 3OY7A 4DSUA 4O5OA 1VPLA 3GROA 1FVOA 1G8YA 1NYLA 1YDFA 4M7PA 5F2NA 4YNBA 3PGMA 3GLGE 2WFMA 2O4CA 1Z38A 2G0NA 1ZD2P 4ROTA 5ELLA 3R9IA 4J0CA 5LVAA 1U7OA 3GJ4A 1VMIA 4JXZA 2OBXA 1N8NA 1KA9H 4CW7A 2H7YA 1Z35A 4KO1S 3WGQA 3QOFA 1U3WA 4FUTA 4ZU6X 3WGKA 1VE7A 4MS4B 1TVMA 4QRDA 4YYEA 1MGOA 1ULZA 3TQSA 5E8JA 3ZW9A 4ZXPA 5K09A 3UYKA 4H7HA 2O0KA 5FWYB 3SR3A 4MCIA 2O2EA 3WDMA 5DT9A 2XQGA 3FX2A 3P8ZA 2WSMA 3WWEA 5D84A 4FINA 4PM4A 1PV4A 2E0IA 2JFVA 1RPZA 1W87A 4FHEA 5LOVB 1JDJA 4LWZA 1L4FA 1EG2A 3B9PA 4NHEA 3C7CB 3M6LA 4X41A 3FDFA 5FRDA 2UKDA 3TG8A 5HMMA 3DF7A 3QLVA 1M2OB 1IPHA 1JQEA 4IX9A 4WBNF 4EUSA 5JASA 4JDPA 4DHWA 3B9BA 3BG5A 3E0XA 5BOSB 4M4SA 4WTOA 4YPOA 2ZBQA 4GUDA 1AGXA 1E9VA 4KPUB 4MI1A 3CH5A 1W6RA 5J4VA 3CV3A 4QNRA 4PYRA 5K3SA 1UJCA 2GEFA 5ENVA 4B6RA 2O8FB 3W7VA 1YJAA 3FNRA 1Q11A 3ZLTA 1M8FA 1QGED 5CBKA 2ZI7A 1G41A 1SZDA 1XZBA 4YGYA 3NIFB 2C98A 1NJ5A 2DU8A 4ZDWA 1YZYA 1N25A 4OOEA 2QRKA 2V98A 1KI2A 4M9QA 5TGTA 5H68A 1KXJA 4J7CA 5EN4A 2AQHA 2EJCA 2YBDA 5EIHA 1OIVA 3R4VA 4KOAA 4LHWA 5EUBA 5DHFA 3AKDA 3N28A 1K7XB 3ORSA 2LCIA 3HV2A 1ISMA 2BFFB 4KIWA 3DTNA 5L7WA 3IUBA 3REQB 3P2MA 1R0WA 1R18A 1XYGA 2GETA 1SUPA 4INPA 2E4WA 5CFPA 4IILA 4P0TA 3JQAD 4M76B 2FFHA 4MI9A 1FFGA 3RC1A 3IJ5A 2P2GA 5F33A 1DG1G 4CL0A 1XQ1A 2A9RA 4A82A 1G9SA 3ENWA 1T5BA 5HS6A 4Z4CA 5ABPA 5H3HA 5LP6A 1HH4A 1FXWF 5AWFC 3W1VA 1ZOPA 3CH6A 3MS2A 4GX2A 4MKFA 3UV7A 5EMKA 2L82A 4XARA 2AN3A 1E4YA 3WIDA 1TJNA 3IBYA 5JVDA 3DPIA 2A9FA 3EC2A 3WDKA 1QKIA 4E5UA 1E4EA 3I28A 1PDOA 4RC9A 5JLJA 1BEZA 3O4HA 3ZEAA 3SS8A 2Q5QA 1JIUA 5KOHA 1ZH2A 4DWWA 5A71A 4JODA 3TAHA 5A4KA 4N48A 2J7KA 3ZHUA 4JT8A 1LBIA 2NUTB 1MZVA 4FFPA 4Q7MB 3N8IA 1EHCA 5IDVA 1Z0IA 1W4ZA 1R9NA 3ETHA 5C53B 4CR6A 3S8YA 6AT1A 1A8SA 5AKYA 1Y34E 1M67A 3DE1X 5LQUA 1KP3A 2BBSA 5I7EA 2XYHA 1IZZA 4K40A 3PQ2A 3AM1A 3OC0A 4YMTA 4RAQA 2PGNA 3ZXYA 2BUCA 2XE4A 1W1IA 2YXPX 1CX9B 3C6ZA 3EY4A 1SCDA 1SIUA 3HXMA 3TMAA 4REMA 4E51A 1DC7A 2AR0A 2JH8A 1ZBDA 4FBLA 4EYEA 4GIBA 4LW8A 1DP4A 3B5EA 3EPRA 1W30A 3V1UA 2C5SA 2FPPB 5G2OA 2YJ5A 4I50B 4KN5A 1Q0RA 5LNK6 3EG5A 3OLZA 2BFBB 2QYHA 4MS3A 3RE1A 1GGNA 1KU0A 1V7CA 2YZKA 3NBFA 4PRZA 5DBFA 4BNNA 4CWAA 4YMUA 1L7BA 3E2IA 4GNRA 2QGZA 4I08A 1TM2A 3W8DA 3VPBA 4FB5A 4URXR 1AQJA 4AQYB 2CCGA 2AOVA 5HW0A 4JENA 4JUBA 5LYJA 2SKDA 4F1WA 3CVYA 4C3VA 3FGNA 2FN7A 4GGOA 3M49A 4F4JA 1CB7A 2PUAA 1VGRA 1UK9A 2P9TA 3EBOA 3I8SA 3OPVA 3WMEA 2VT2A 4HVAA 5J4LA 1SH7A 2P9QA 3X1YA 3MT7A 1MA3A 1OA0A 4IHJF 2PQMA 3M3DA 3TL3A 1JLLB 2WK1A 3MCUA 1VYUA 1ID1A 1Q1GA 2A1TR 1PS0A 2HD4A 3FHLA 3JD3A 4LS3A 3BL5A 4MVJM 5K1ZA 3TW8B 5ER6A 3HU5A 4EUEA 4F12A 2Q3MA 3TUZC 1ZJZA 1GPMA 3ZWKA 5E2AA 1M3SA 5IJ0A 1RJ9B 1U81A 4BO0A 5FNVB 2KHZA 2V7TA 3ILVA 3Q8XB 1MX9A 4PZAA 3OZIA 4HQRA 5ALQA 4IUCS 2RHHA 2ADOA 1IL0A 2HCRA 2XVMA 4EL5A 1VLLA 1PW5A 3H8VA 1RCTE 3FWPA 4X20B 1IN5A 1PEYA 3Q3IA 3E7WA 3KLNA 4YQYA 4D9NA 1MV8A 2ZRKA 4RUKA 3RPEA 3JD0A 3VR6H 4F1KA 1GWNA 1UDBA 3ITKA 1LDMA 2O3RA 1L5WA 3GT3A 2BR5A 2XE8A 2GN6A 2J9RA 5FHQA 4HNTA 1LTHR 2PZEA 1VKZA 2ZE6A 3EG9B 1FUYB 1T9AA 2VHQA 2JFHA 1JFFA 3TR5A 5JCJD 3W3AA 4ZJPA 2BGKA 3B60A 3JD4A 4FZ5A 5U9CA 2D7DA 4HVTA 3D3WA 4RPLA 5JFTA 3T61A 3TLGB 3A1VA 2WSLA 3L05A 4Z4QA 4O1MA 2DUWA 1YI0A 3CF4A 2ZR8A 3QF4A 1WHTB 3ANTA 3VNSA 1V9CA 1T29A 4PGAA 5L3SA 3QYJA 4TOIA 1CQWA 4P4UA 4F11A 3GJTA 1F20A 5KJEA 1E2BA 1WXXA 3AHGA 4X97A 3UAYA 3GJYA 4A8PA 2G04A 4M9UA 4K0RA 5A5FA 1QVAA 1HEUA 3DKVA 4IOJA 3JD1A 3PXGA 1GNQA 1YK1A 2W9XA 3WLAA 2QMHA 1ZK1A 1OIWA 3PQDA 4PG6A 4UTNA 2XKKA 4K46A 3EGEA 4MW6A 1RBYA 2W00A 4E70A 5HUHA 5E2IA 1P1KA 2PMBA 3BJZA 1P1RA 3G02A 3S70A 1F14A 4EIWA 1AHPA 1YB5A 1SXGA 3OZRA 3JD2A 2HMVA 3NP9A 1R0CA 3D6MA 1U9IC 4LG1A 4K6GA 2YFYA 4YI5A 3K4HA 4JX8A 4ECEA 4R71A 5E9JA 4RO0A 1CDZA 1THTA 3LRTA 5B2EA 1WZ2A 4IF4A 4OG2A 2AN4A 2O14A 4YP9A 4FNAA 3TECE 1NLFA 1TYBE 1BS1A 4MUNA 1U80A 2IYXA 1I32A 5HOEA 2C4HA 1VJTA 2WY2D 1W581 2ZJ4A 1W8IA 3DAGA 4ZEWA 1KFCB 2ZRJA 2E9SA 1Z5GA 5J1TB 5M3BA 2NO9A 3UJ3X 1HL7A 2Z1DA 2Z1NA 2J4CA 4PQYA 4QDKA 4TMFA 3DV0A 5BR7A 3B12A 5A4DA 1JQBA 3K5IA 4H16A 4B31A 2PKCA 3PZRA 4JC4A 4DLRA 2VG8A 5JDIC 3SF0A 1WOYA 3DMDA 3E70C 4NVRA 3PUJA 3ADCA 1POXA 3KCQA 3KLOA 4QL3A 2WICA 4ND8A 3GZNB 2PN1A 1DRVA 2IZ0A 3NVAA 4BUZA 1OQAA 4CNQA 4HEHA 1WOMA 1FFBA 1A98A 1ARZA 1C3VA 2GAJA 5AVUA 1WDTA 4UHJA 1YSCA 3R20A 2A5DA 4FGUA 1ISRA 2CGEA 4INAA 1FYWA 3LKBA 2IS2A 5HFJA 5BVGB 3ONVA 3Q7IA 1Z4PX 3MN1A 3T3DA 1H1DA 4L22A 4O2LA 2XCUA 1TEXA 4RL6A 4YWHA 2ZPTX 5FNZA 4NPAA 1SM4A 4KN9S 1NU6A 2O20A 2W42A 3LG2A 2V58A 1HFKA 1UODA 4KGVA 2NUAA 2G4CA 3JQAB 4QO8A 4Y6RA 4IJUA 4QJIA 4TWRA 4ESHA 2IEAA 2YS6A 4LHYA 3TNJA 4D9CA 4EHJA 2CNWA 3PNMA 3DGFC 1GGMA 1E60A 2O8BB 2I6XA 2E1RA 3JQQA 5CM2Z 4OM7A 3ZR4B 5KVSA 5DBEX 2QTFA 3ZCTA 3P1JA 4IOKA 2HA6A 1U9ZA 2DPLA 1EUDA 5F3DA 4DW8A 5LP6C 2VS1A 1BYUA 1FP4B 5AK5A 3KXPA 1JE1A 1Q1AA 1FVHA 1YAJA 2FX5A 3IUNA 2GCNA 4JGBA 3H6HA 2P77A 1SQ6A 2CHFA 3HDGA 3NRJA 4JCOA 4QPDA 2O7RA 2V74B 3EBLA 2A5JA 1JDUA 5HE9A 2G5CA 4Q1FA 3F6BX 5HX7A 3UHFA 2CMHA 1HX7A 1S2IA 3R40A 5I5GA 2Q1XA 3RSSA 4Z2YA 3O9VA 2I55A 4ZVQA 1J5PA 1CR1A 2HFJA 3DEHA 1V5EA 3GCGA 4L2IB 3HB0A 3RF7A 3RSGA 3ET4A 3L0IB 3NHMA 2IF2A 4O0LA 4EHNA 4PXSA 3HUUA 4ZWNA 3M2PA 4J1NA 2ZWOA 3ZYCA 3PRHA 5BR4A 4RV4A 1TKBA 2QD3A 3M9WA 3UAVA 3ZE0B 2NZYA 1O6FA 3BXPA 4N5NA 3A3KA 4PGMA 4MLDA 3FPLA 3V7YA 4MWGA 3GP8A 2FMKA 1NDHA 1RWXA 2G83A 2J30A 3LF1A 3O94A 4NC9A 3D6JA 4ROSA 2HHAA 1JJBA 3FXAA 4P4GA 5DOVA 1SVUA 1UDWA 4HDNA 2VYCA 1W73A 4OH7A 3S29A 2GXAA 5LN1A 1VRWA 1LI7A 2HF7A 3TNFA 4RTOA 4J2OA 3AL2A 2YMPA 3K0CA 2ZSHA 4OIFA 4RD1A 2VSYA 4H1VA 4ALNA 2QAGB 2NQ8A 3E6AA 3NBUA 2NSJA 3T5TA 5GONF 4CMAA 1Z7WA 1BROA 1DX6A 4EW2A 3N2NA 3ZIDA 1ADYA 2OZPA 3UOGA 2ONYA 3FOAA 1I4LD 3EC1A 3WAJA 4IIHA 4PIMA 2CNNA 2A9QA 2GHQA 2NT4A 2QPLA 1AK1A 3DFFA 1G3UA 4JIGA 3EZLA 2WMYA 3DE2X 4RE6A 4AECA 2RJOA 3WWZA 4IAOA 3DPUA 3JZFA 4B3BA 2C58A 5EFZA 4BIMA 3D2CA 5HILA 5DM70 3TJZA 1CULC 1E1DA 2B30A 1T0BA 3OZBA 5FXMA 3IERA 3KTFA 3SMVA 4E2WA 4XQGA 1X14A 3RNOA 3SX4A 2YDYA 1VL1A 1VXOA 2A0KA 2H54A 2HO4A 2ZB4A 3HMQA 1SHLA 1WF6A 1XQVA 3JTMA 2EWMA 1RI2A 2GZSA 1NBOA 4FZJA 4J75A 4LY0A 1RKQA 1L5HA 3FWKA 2ZJ7A 5FLEX 4NOLA 1ODLA 2JPDA 1YCGA 2VCHA 1VLVA 3EGDB 3OZVA 3UZUA 4MVJF 2G07A 5HKLA 3TZQA 3OKPA 4O4JF 3V8VA 5ICSA 1MT0A 2EHJA 3CEHA 3DZIA 5CDGA 3COPA 3OQVA 1ECJA 1M8KA 2E1PA 3I0ZA 5F2EA 1GPBA 2QPAA 1YCHA 3DVAB 1Z0ZA 2G88A 2YVLA 3UCXA 2WYUA 1KP2A 3ZZ0A 4BNDA 1CLEA 3C24A 3GG2A 3E5RA 2R8EA 1XEFA 3GFFA 5JDCA 1Y6RA 5EKTA 1J2UA 4ZQCB 3D5TA 1B6RA 1YASA 4M0PA 4WADA 1KDYA 4ZTBA 1RWKA 1Y4ZA 4BIIA 1YVUA 3LBHA 5K20A 3UAWA 4IWXA 5TXGA 1OTYA 1CUWA 1CZRA 1G2IA 1NT4A 4DV0B 1ZD9A 2ZPUA 4XH9B 1NQUA 2ODPA 2WT4A 4YUYA 4EKGA 5BUQA 1A1VA 1M2NA 4OXNA 1WA5A 2DFVA 4KL8S 1KH2A 2PM8A 4N0MA 3MJTA 2WP8J 3CNBA 1SUCA 1XFDA 2GK4A 4FYHA 4O0MA 4PYNA 3UKJA 4BRWA 1RVV1 1KWGA 1XVAA 2LXNA 1JH9A 1TUBB 1YA8A 3NH9A 1HBJA 5BVHB 1Q1EA 4V1CI 1MW8X 4CMEC 5REQB 4FW9A 2QN7A 5A9SB 2E5LB 3Q87B 5JBIA 4HGYA 2AOTB 3HKDA 4DR1B 2GPJA 2J5BA 3OE5A 4DZRA 1HDIA 5FWNA 1LFAA 4GLBA 2G1JA 3NHSA 3FA2A 1J70A 5E6RA 3K1AB 1FFAA 5LQCA 1I4DD 4CM3A 4FTWA 1IAQA 1VLHA 2WV9A 4FDVA 3UGKA 1G20E 2I6UA 1YKFA 4U2BA 3FZNA 2DQKA 2PG3A 1MQSA 3CWCA 5EKXA 3TI7A 3TRIA 3UJCA 1X1SA 1XCPA 2QMYA 3EASA 3STUA 4DCUA 5AHOA 5KKCA 3B1ZA 4DANA 3AQIA 1Z8DA 1GRVA 1K0UA 2POCA 5KTYA 3KOOA 2C9OA 2QQEA 3CINA 3PS9A 4JDUA 5BW6B 1J0AA 4XCXA 2CEKA 5LUBA 2JLAA 1NMQA 5CX4A 2IDMA 5AJYA 1NNI1 4DA0A 3UWMA 4CE6A 4FOLA 5EP2A 3CO5A 1WABA 1F6BA 1EUCA 1NR5A 4X8OA 3HJAA 3S2UA 4OB6A 2PKEA 3RUHA 1PL6A 4L3OA 4YJ3B 4H4CA 3COWA 5G3ZA 5LMCA 1LTKA 4AZSA 5KPDA 1UOPA 4IS3A 3EDQA 4KAAA 4WCVA 5K0CA 4ZYXA 3IKJA 1DEXA 3SS7X 2BFEA 4G5YA 2G1PA 1L4MA 2OY0A 1C1HA 3W2FA 1QLWA 1MAWA 4RYLA 2HQ1A 3E9CA 3JRXA 1CZLA 4LHZA 1TO2E 3F1KA 4M8IA 3OOWA 1GGVA 4AJ9A 5CXUA 1DHRA 2VKQA 4I4IA 1TMGE 3WRYC 4YRFA 1EX9A 3CX7A 3SR4A 5DHAA 1JA1A 4FDUA 4M0LA 1IBCA 2HA7A 3IV6A 4N5MA 4L75A 4MGHA 1JT9A 4NENB 4IG4A 1JS1X 1SCQA 3UJNA 4IX1A 1BKYA 4TRMA 4PG8A 2NO0A 1VBMA 5AJWA 1OLUB 1MO5A 2BZGA 3RTCA 4IIVA 1K8XB 4PY2A 2QRHA 3CT6A 2BP7B 1NXSA 3HN7A 4JHLA 4W5WA 3WGTA 4ZCRA 4NEGA 1W5FA 2RHWA 3FFTA 3OTWA 3QWIA 5DASA 4C4SA 3C85A 4JOBA 2WLTA 4Q9AA 4CLRB 5JC8A 4BX3A 3PFHA 1T6NA 2QN1A 4I3GA 1EK0A 1F8GA 3RYTC 4GOJA 2NSDA 2RC5A 4WZ6A 1A69A 4PXYA 2O52A 3F5MA 3KT3A 4HWOA 1PFUA 3VDQA 2ATEA 3K9NA 3PFIA 1E94E 3GFOA 4CKXA 1MX3A 4QHTA 5A0TA 2WJ6A 4TTSA 5K5EA 1N9GB 4U6SA 1VSUA 2VSOA 4YMLA 1ZLXA 1ZO8A 1QK5A 3G2LA 1EA5A 1W85A 1KI7A 3KBBA 1L4NA 1JMYA 5CHEA 4S04A 1LPOA 1EVJA 4NZYA 1EM8B 5LQRA 3ET5A 1G20B 4EGCB 3FG9A 3HSYA 1GNPA 4YAOA 3R5SA 2RGNA 2AV6A 2XYVA 3QKIA 2DHDA 4UM7A 3ROZA 1AQYA 4JYBA 5AIBA 1SOAA 4P9NA 1KEUA 1KOFA 1TA9A 5JFGA 5J2TB 1D4AA 1PR9A 1Z17A 3RUFA 1AA9A 2BFFA 1OSNA 1VYHA 4I9UA 4JBLA 3DE3X 2QY6A 4TWIA 5D5QA 3W5VA 3G0DA 2WFAA 5CVVA 1E0SA 5DISB 3DTVA 2DH5A 1GILA 3K8QA 4PFKA 3TL2A 3ELWA 1G5RA 3UQYS 3P5SA 3HO8A 3GI1A 3HCBA 3ZBTA 1O96A 1TK3A 4C89A 3TDNA 1WXWA 5I8WA 1BCRA 3KZOA 4WA7A 2CXPA 1UPUA 1RBMA 3BCSA 2YRXA 4OXYA 5FLKA 3T41A 3DZFA 3FPCA 3ZZUA 5JXJA 1QR2A 2WFLA 4QJBA 2G63A 1V1RB 2VHEA 2A5FA 2PXXA 2YJ3A 4PHFA 1ODTC 4EY6A 3THWA 2IF0A 1MQ8B 3BILA 1RTKA 2DWQA 5BN3A 1FNNA 1NV8A 2C78A 4UBJA 2JGMA 5FBVB 1X38A 5H4HA 1PT9A 3OUTA 1SIWA 4LYHA 2BH9A 2Z98A 1VKHA 2JK1A 1HZZC 1E7RA 2RGXA 3HPQA 4OF4A 3TLAA 4CQMA 4YT8A 1OXUA 1U7WA 3GRFA 4CIBA 5EMLA 2R1TA 4GBED 2JAHA 2NXCA 1GTZA 1N2CB 4FU0A 5HCUA 2AW5A 5IJ9B 3EUWA 1PQYA 5A6SA 1SVIA 1X1TA 3PD1A 3HJNA 4IZHA 4DDMA 2GGSA 3DHNA 1SCUB 3C16C 3QUBA 3Q8LA 5IX8A 2P41A 4LDZA 1N2SA 3QYFA 4MRNA 5KOIA 8OHMA 1YULA 1YS9A 1GZUA 2BEJA 2NZ2A 2Q2OA 2R84A 4O25A 4HNRA 4PAQA 5BSMA 2JI7A 3SSMA 4Y3UA 4AY5A 3U17A 1MV5A 3KT8A 4K9LA 1RQLA 3RADC 5KZMB 1I4TD 1QH8A 1P6XA 2B7LA 2R2GA 2X4GA 4LOLA 1IZ9A 2EARA 1CRQA 3E22B 3GA0A 1NP7A 4E2ZA 5JQGA 4X71A 2WSSA 4MQMA 1DTWA 3IP3A 2WJYA 3KX2A 4KUGA 4JI7B 4LZJA 4DYHA 5EXPA 3AYXB 2P5TB 2XUPA 4YJGB 3VC7A 1P5JA 1ZZEA 4QELA 3RKSA 3TR6A 3RVDA 1KORA 1L6IA 3KEFA 3NEAA 1YL7A 1KVUA 3O9ZA 4RD2A 5EIBD 1WUKS 2V7EA 2X5OA 4FFWA 2LV8A 4F8JA 1OU4A 4MLZA 5TARA 4G1UC 3ETCA 2QZZA 2NO4A 1U1FA 4WZBA 5TGZA 1M7HA 3IBTA 3OOEA 4G97A 3RKRA 2DFPA 3D02A 3ND9A 3RG8A 1W88A 3WKDA 3GUVA 1YR7A 4IDEA 2V4ZA 3ENZA 5EE0A 2G09A 3FR8A 1P5FA 4D8VA 1AV6A 1E9SA 4KLNA 1AZLA 5EMHA 5KNDH 2VWQA 1UM8A 1U04A 2BMJA 1KYVA 4M55A 4EQ6A 3QSYA 4J4BA 4BQSA 1NE2A 3KVYA 1NF9A 5COAA 5DW0A 3ZNPA 4QOSA 3IQEA 4JYZA 1PFVA 2HRZA 3NOOA 3BIWA 4EF4A 3BT7A 3L4SO 1RKUA 4BNLA 5DTRA 1TMYA 3D4IA 1FDVA 4Q4JB 3KSMA 1UZMA 1KDTA 4EAQA 1FBNA 1K6MA 1VCMA 3A28A 4LOKA 4BX9A 1O54A 4OI0A 3ESXA 3N8HA 4LSZA 1TCBA 1YB4A 4IDGA 3FRIA 2BHLA 3M70A 4M83A 4ZQEA 4RTMA 5HKOA 4LZAA 1D2RA 3W2TA 1Q7BA 1RDFA 1A9QA 4URYR 5KNCA 2F67A 1K4MA 2H06A 1JAHA 4FZRA 4V3BA 4CTMA 2ZZMA 4ZI7A 5EL0A 2EKPA 1A82A 3HUFA 2EDCA 1T5SA 1R0XA 3ADPA 2PUFA 4X1OA 2WOOA 5IZCA 2P7HA 4XDYA 1YRHA 4P53A 3IA2A 3MHTA 2CCJA 4Y9UA 4YR9A 5K03A 3S99A 2MSLA 4AK9A 4Z2AA 1AN0A 2O8VA 3O6VA 3SY8A 1L9XA 5KDLA 6NULA 3AM4A 1R6BX 1GOTA 2CJWB 2EFYA 4TS9A 1ZU5A 4JGGA 5A3VA 3RG2A 2AYXA 1FB5A 1Q91A 3R24A 3IODA 4F2WA 2XUAA 2HA3A 1KY4A 2CWDA 5A4IS 4HD8A 5HQTA 1BXZA 1AHIA 3CEJA 4MR7A 3SOZA 4MIYA 1N6PA 3VJRA 4G4IA 1UBRS 3Q9UA 3QM1A 1YTUA 2CZGA 3TBFA 1VKOA 3BFVA 4B3DA 4EFNA 2W4IA 3HU3A 1EFKA 4YP0A 3SHWA 5H83A 2LCFA 2DUNA 3BRSA 3G7UA 3L7DA 5TMDA 4CTKA 4ES6A 1A72A 4MP6A 5CCBA 2GHTA 1L8QA 2WE7A 1ZDMA 5EHGA 3PC6A 4UW9A 3AKEA 2G5PA 3TB4A 3H2YA 1QG4A 1ZK0A 4M22A 1T1JA 2HMUA 1QHGA 3CZRA 1BD3A 2NG1A 3GD5A 4Y7CA 1N6OA 4CLOB 2EQ5A 1KMHA 3SFZA 3UFXA 4EI8A 8ABPA 4PZZA 4I5IA 2HL6A 4BB0A 3KVOA 3RVKA 3R7AA 4TVSA 1G7CA 1GPH1 2GBPA 2JLCA 1Y42X 3P2KA 5DNWA 4XVUA 3TLJA 3TGPA 2OCIA 4QODA 4DLPA 3VDMA 2FWMX 2FEXA 3VVLA 2Z2IA 3EEOA 1SKQA 3HVIA 2ZR0A 3DNFA 5CT5A 4DA4A 5AVSA 2AG0A 3WRXA 1UJ5A 4NL4H 4B3TB 4KQ9A 5AVKA 5JG7A 2JJ8A 4P0PB 4LHEA 1B15A 4A5SA 2WKRA 3DJFA 1G8MA 3E5HA 3UWOA 4FFSA 1FFHA 2P7IA 3JYPA 4AB1A 5CYFA 4F9GA 3HBFA 4EECA 2RHDA 4R8RA 1PO7A 1RRPA 3WGVA 2PH1A 4AQDA 1PVDA 4UVDA 3WLQA 2MTBA 2JAXA 5IARA 5FADA 1TO1E 2CDRA 2BE9A 4Q9KA 2H5LA 1T43A 5FAXA 3T94A 1KO5A 3WLHA 4D4HA 4LC1A 2OPBA 2ZM5A 4MQFB 2NO7A 2VH1A 1ZH8A 3IP8A 1ISSA 1N2BA 4ND6A 4JI6B 3RSFA 2EEPA 3V4PB 2V6MA 3L8ZA 3RS3A 1PR2A 2GM4A 4EG3A 3U7EB 2A0YA 5CX1A 1EXMA 2W2KB 3K0AB 3I01M 2G77B 3GNSA 4GXNA 3R5HA 5GAJA 5J59A 2A9KA 4ZRNA 4CM8A 5IKOA 4JI8B 5LDDC 3S8MA 3AEQB 1S2OA 4AL4A 2I66A 5DM2A 1IRXA 1T9BA 3GCDA 3D3JA 3IAUA 2P2CA 3FDZB 2EFJA 1QTIA 1WPQA 2UZIR 3OP1A 4HNAA 5D2CA 4HS4A 3ACDA 5B3AA 5LBIA 5KSOA 3U4GA 5DSTA 3MWEA 4LZPA 4DV6B 1EFPB 4DNOA 1FMLA 3OD5A 1KARA 1OLOA 4MQEB 3HYLA 2PYDA 3V4ZA 4L8YA 3HB9A 1M2EA 1X7XB 2A1UA 2AZMA 4LRXA 4OBWA 5FNVF 2C3PA 5F7JA 4EO4A 1JDPA 4CIAA 3ZJTA 1FX0A 1IFXA 3IQGX 3HBMA 2XNHA 1L1EA 1PTKA 2X19A 3HQ4O 3LS2A 4TLMB 4WZAE 5DNDA 4DADA 3QVTA 4BNTA 4YT4A 2EKZA 2IOQA 2ZIAA 3D8NA 2Q4BA 4BL5A 2CLCX 2WAXA 3IAAA 2XKJE 1P1HA 3K09C 1TJ3A 4ND7A 3BE5A 4NTZA 4E6EA 2QF7A 3HCEA 1ZIOA 4AXXA 1PEAA 4EGFA 4DV1B 4OMUA 4AQ7A 1OYVA 2Z58A 3PR2B 3L7BA 1UOEA 1EWTA 3JZAA 4U7FA 5E6SA 4D3XA 2NUBA 5DGHA 3RFXA 2X8JA 2DKNA 1EP2B 2YASA 3JYQA 4JMPA 4M9ZA 3UK0A 2FHPA 4D9KA 1NFRA 1VPWA 3ZHYA 4LJ4A 3FCAA 2MSCB 3VPDA 2HLPA 4FGLA 2AVDA 3RRBA 2VAWA 5THQA 3S3TA 4HRVA 4UTZA 2GEDA 2H4HA 3BORA 3CUWA 3CCBA 4LGMA 2D54A 3T5DA 2NVWA 3L6EA 3ABZA 3WIUA 4Q1EA 5BSWA 1BTOA 1X9HA 1NPYA 4YP6A 4DARA 3ASZA 4DCOA 3QUCA 2W2QA 4CPDA 1UK7A 2ZM6B 4U8HA 1L7XA 1E2UA 5MGNA 1XVVA 2IITA 2WMOB 4FFRA 4IDHA 5AW8A 1SRQA 1ZJ6A 2P62A 2RHCA 3GFGA 1X86B 3KDSE 1BOOA 5FFMA 2WSSD 2YIMA 4LI0A 2HK9A 4RQTA 1YB1A 5L9AA 2NSLA 4HZUA 3ZHOA 5K2OA 2ZIXB 2AEEA 1FFXA 1WZCA 2ONJA 1BDMA 3P97A 3MWDB 1HMYA 1ZL2A 1C3JA 1R6DA 3ONNA 4DC0A 4JOCA 5BYAA 1XRMA 4G0XA 4IM7A 5CIQA 1H69A 4JR2A 1XZ8A 3RM3A 3BE6A 1OB5A 3QJYA 2JIQA 1NX6A 1QFMA 4LSGA 5I5EA 1LD3A 4MLPA 1MJGM 1TM5E 4NYIR 4L6CA 1CR4A 4NBLA 4ANFA 3X1XA 2VOEA 4UC0A 1QU2A 2HB6A 4RBNA 1C3LA 3WHLA 1JFSA 4L16A 3BMCB 4YECA 4LXYA 5LKRA 3VSCA 4FHCA 3HO1A 1OBVA 2BTQB 4WZAA 5AKJA 4KAXA 3COZA 2XBMA 3LUCA 3WQBA 4F8YA 5FOXA 3ZDXB 4WW0A 5AXDA 4F6LA 2Z83A 3QQ5A 4H7PA 3CHYA 1ZGAA 1H42A 1FP2A 3LCVB 4H3HB 4REOA 2IJGX 5BQOA 1NKSA 2WSIA 3DOCA 1I4OA 4BLUA 4D4KA 5KDOA 1ZITA 4V0KA 3ITDA 1QNLA 3SIPA 4KFCA 1ECPA 1MX5A 3QX8A 1XJQA 2P5YA 4U9HS 5T64A 5BVHA 1BH2A 3HXPA 1BW9A 4OHCA 5LA6F 5ADHA 1VLJA 2QW1A 3BSYA 1DADA 1RQRA 2BPOA 2GN4A 4GRAA 1GG5A 1R10A 2QG6A 3LQ1A 4IOMA 1CJSA 4P4SA 4QPCA 4YRKA 5JPCA 3JASA 4IDOA 5GZ6A 5I01A 5J4HA 1ORHA 1XXHE 1WB5A 13PKA 2HLDA 3BE4A 3EWIA 2FSVC 1XN4A 2ZYAA 5E7IA 4E15A 5C2JB 1PNQA 3KQYA 4U6NA 4NBWA 3SNKA 4PYJA 1NVXQ 2BY4A 2XYGA 1X6VA 3EOBI 1AUQA 3SYTA 1K6JA 2IH2A 1S9HA 1HG0A 3CEMA 3V7FA 2ZRLA 4A0SA 3DZCA 1SQFA 3JQEA 3K2QA 5JXHA 3ZCXA 2X2EA 5AP9A 1QO0A 4MV4A 4ZMBA 2ISSD 2RG1A 2OD2A 4AURA 4DR3B 3UQZA 2DCMA 3NALA 4EFMA 1N0WA 1DQPA 1VSQA 2Q4EA 1QV9A 4QTZA 4QHSA 1RFLA 1FP6A 1RM3A 3AIKA 3N75A 4BMCA 1IHYA 4R1MA 3R3HA 1PQ4A 3LY9A 4BBZA 4EI7A 5IN5A 1H2YA 1I36A 4XB1A 5D85A 3L93A 1KRXA 5EJ5A 5HMLA 1YDGA 1GQ2A 3JAKA 3T5BA 2Z6AA 3QXXA 4HLNA 3L92A 5AKGA 3EGXB 3A1SA 2BZSA 4AG5A 2BM0A 4BO3A 1KMCA 4KH1A 2ALJA 1K1EA 1CZNA 2NYVA 3NHUA 1NONA 1TCUA 2PBRA 3N3AC 3GBPA 2VXOA 4C0XA 3DEKA 4RAOA 4Z1MD 1GGHA 2I1LA 1C30A 1MQ9A 2V65A 3AHHA 3LHFA 5EJAA 3PC4A 4IMPA 1BFKA 5G4KB 5AXCA 4ZD6A 1IWBB 2FLKA 3QX7A 1SBCA 2Q5CA 1X80A 3Q85A 1B8UA 1C2YA 2VJAA 2RGNC 2FWIA 4DMFA 1M1YE 3NVKI 2CLLB 1RI1A 2VP5A 7MDHA 1J0EA 1GN8A 3PGKA 1MNQA 2WMDA 4CKEA 3STHA 1VDZA 2L18A 3N6RA 3C1OA 1NN0A 1EGVB 2XVZA 1I1OA 3AJ8A 3R23A 4K9KA 4CKYA 1DXYA 1WS6A 4OO3A 4TXHA 1E7QA 4DY4A 3A25A 3OZEA 3CRNA 1V6CA 4Z7QB 5KHOC 1Z2NX 4EUKA 4MROA 2ZREA 1MABA 2IC5A 2HO5A 1FFSA 1YR8A 4AYWA 2ZT6A 1GO2A 4E46A 5I4CA 1Z0SA 4MX8A 3A0RB 2ZI5A 3IIIA 4IXNA 1PW7A 3U9TA 2REXB 1OXKB 3N8GA 3ZUGA 1L1FA 3UUWA 1YB2A 3NHRA 1RIFA 4OKSA 1UMCA 1L4YA 1XDUA 2IPOA 3VSEA 1RWNA 4L74A 4DTIA 4IJMA 1LC3A 2R4UA 1G20A 1QX3A 1OBHA 2XUZA 1B2RA 3PUWA 4HFJA 4RKRA 5GJVC 4ZI5A 2NU8A 1A9XA 2QIOA 2QR3A 3F78A 2BOVA 1HFEL 5ALFA 5A03A 1O97D 1IBMB 4CNBA 1VHJA 4HTAA 3UMGA 1C4OA 1E1QD 3EXG2 2TS1A 1QIFA 1Y8AA 2W2XA 4J0DA 1NLYA 1CS0B 5C4GB 4OM8A 1AKUA 3GJ6A 3DLHA 2V0GA 3OPYA 1YJBA 1C7EA 3ZIAA 2X6TA 3Q72A 1HEIA 1GZ6A 2D4HA 3TUJC 4C0BA 3FUVA 4Q21A 1Z56C 4M54A 1GFZA 1OOEA 3S1SA 4WFQA 3Q6NA 1YUMA 4CUJA 7GPBA 3BGDA 1FXWA 3EVNA 2GJ9A 3D43A 1MXFA 3KR2A 2OD9A 5K3FA 3DO5A 1U7DA 3GC6A 2IXFA 4L4YA 1Z18A 5AKLA 5U1PA 5DFAA 3ZVMA 3KE9A 3E3NA 3W3AD 4OKNA 4BAUA 1DBQA 3F9CA 4E14A 3UV6A 2VT7A 1IXZA 3TBKA 3TSZA 3K6SA 3SZMA 4TTIA 3I4CA 3MOGA 1Q2UA 1JZQA 2L17A 4HOYA 1A8PA 2BKUA 1RLTA 3ID6C 4FYPA 4ZAWA 5IUNC 2Z9BA 3K2BA 1NDQA 2QTWB 3CLSC 1RZ3A 4IG9A 2HCTA 1S1MA 1E2GA 4DQ0A 2FVXA 2ZAGA 5EAIA 1AK9A 1T2CA 4RJIA 2RMKA 4XRGA 5CA1B 5JSZB 3HU2A 2V3CC 5CAEB 2D1TA 5MF6A 4QYWA 1RABA 1Z75A 1ZJ5A 2BT4A 2C97A 4DHEA 1F6WA 1AUXA 2OQRA 3DBVO 4Q66C 2WJIA 1IEQA 2HF8A 5ALMA 1E58A 1RLJA 3MWYW 1EFDN 2J3EA 3GLFB 2IGTA 4LKOA 2IZOA 4BKUA 3AU8A 4AP5A 4XDZA 1IUNA 2BMFA 2IDKA 1F5SA 9ABPA 4IZIA 4QZVA 3IP6A 3LDHA 4L85A 4LNHA 3FCXA 3C5WP 5JZSA 3L7JA 3IQZA 2B3TA 2CCKA 3MYYA 1YR2A 3Q9LA 4UEQA 4OX9Y 2H1WA 1GYQA 1HDOA 4EYOA 4NABA 3G2QA 1JEQB 3FPHA 2NTJA 1JIKA 1RIIA 1EFTA 3T12A 5EQTA 1J33A 4IJVA 4YIHA 3OCWA 1S8AA 1ZD5A 2VPPA 1RZVA 4OHOA 3IDQA 4JI4B 2XTAA 2HQSA 1PHPA 1TU3A 1NI3A 4YXWA 1JJVA 4EJ6A 3GGCA 4HGQA 5I7AA 3FNBA 1DMSA 1R0SA 2WU1A 3WOHA 3VI3B 4P31A 1E3SA 1TGVA 3QELB 1JSCA 3ZE1B 3NAQA 4BQRA 1MENA 3QY9A 3FTEA 1ORRA 5A4JA 2GA9A 1DKUA 1WEHA 3U3RA 4EQ6B 5IWCA 3N05A 5CH5A 3RUDA 1JIVA 2XCLA 3GDHA 1XPOA 4M7RA 4NE2A 4G2TA 1FZTA 3PQ3A 5LU9A 2GJ8A 4RLSA 4KTVE 3H5AA 2HU8A 2Y99A 3HV0A 3IVAA 4TV9F 5DM4A 3TLCA 4XJTA 4DCMA 4X44A 1ORVA 1SK9A 4L08A 4BFCA 3QA3E 1HNWB 3GFBA 1RR6A 5JYBA 1W2GA 3BWVA 3JWHA 4J1QA 4RD4A 2XGJA 1OE0A 1GPLA 3FSRA 1R5JA 2HJSA 5GVRA 4NZ9A 3R6GA 1VG1A 4QDZA 2Y4OA 2FQXA 3UXHA 3U7QA 2Y68A 4IUBS 1U5CA 3OE7A 5DP1A 3EVFA 1E1KA 4UPVA 3REOA 3SHOA 5JH7F 3ER6A 4XWOA 3WLLA 2R62A 2B5WA 1P31A 3A8TA 2ZSUA 4FONA 1PZHA 5UKDA 3U56A 3J7TA 1DPFA 1XRRA 4BE7B 4MHTA 3MPOA 2D59A 5EUQB 4EUHA 4BWYA 3OFND 1FC0A 4GI3A 4RIHA 2CJWA 2EJVA 1DFGA 3G2KA 1L5NA 1GPYA 1YXMA 2HXYA 2QLLA 2QRUA 1TFRA 2GHIA 4KX3A 1JIQA 4OQMA 4ZI2A 4W5OA 2VN8A 4BZXA 4PIPA 1EXNA 1OI2A 3SQNA 5AJVB 1UH5A 2XXBA 4D9FA 3OBIA 5H02A 4EG5A 4UFOA 4G2NA 3GZ4A 1SG9A 4DEYA 1ZMXA 4CT4B 1I4WA 4ZCIA 2Z4RA 4M9CA 1MD9A 5H59A 5LP6B 1TLLA 3P4UA 5E1BA 1AF7A 1L8OA 2IOHA 4OCZA 3FN4A 3FETA 3DONA 3OCUA 5EA2A 5IAEA 2CLMB 2FXIA 4PSAA 3G6KA 4UEWA 1O5TA 5AH0A 1CY8A 2CXHA 4DWVA 2VLBA 3F2VA 3K1ZA 4RZXA 5IH3A 1MAAA 1MVNA 1CHDA 2FE4A 3PXUA 4J3JA 4PCAA 4TX1A 3QFFA 1GU0A 3SSNA 3W06A 3ZJ4A 4C2AA 5EJ4A 3TF5A 1UM9B 2YFQA 3PHJA 4PCUA 2PKRA 3K70C 1OAKA 4RV5A 3F7TA 3NNNA 3DCJA 1RI5A 2YXBA 1AKQA 4JA2A 4Q1DA 1JLSA 4IXMA 5AQEA 1Z2OX 2XUDA 3R6WA 3OF5A 1QBGA 1UBEA 2X23A 1UBFA 3RREA 5KMGA 3I5YA 4DKJA 5HIAA 3V9AA 3COVA 1Q7CA 5IUKC 3AY0A 3ZE7A 5JU6A 4BEWA 1RC1A 2ODWA 2OFFA 4PTYA 1G6OA 2C84A 5LMZA 1PZNA 2AWOA 2G76A 1WVIA 3GXOA 4QUIA 2AMJA 4PTZA 4XA8A 2MSKA 5CK4A 1OAOC 1FF9A 1XMXA 2HRBA 2ZSAA 2VUSA 1YE8A 2BUBA 4XIFA 1I7SB 5I8PA 2DHQA 2OZLB 4BVEA 3H2JA 1VYTA 2JFNA 2WUEA 1IONA 2P4HX 1GVHA 4QULA 2XYQA 4AMGA 1UMBA 3BWCA 4MQFA 3HCNA 4F3NA 4EY4A 5TQJA 4OUDA 1QLHA 4MA4A 1Y4SA 5AD1A 4KLRA 1TC1A 1KO7A 2XKAA 3MAGA 2H7VA 5DF1A 2JL1A 2R1VA 2W2KA 4H4EA 1K7YA 3Q12A 3FCYA 1QH1B 1JG4A 4BMPB 1PJBA 2B1QA 1U3UA 2R11A 3B2QA 3IXMA 3EDCA 4E5PA 1YZLA 2FSVA 1TXGA 1JLLA 5H5JA 3IHWA 5F73A 2FEKA 4DZTA 1LSSA 4ZV9A 3G5AA 1NBWB 2W2NA 4JL8A 3TW8A 3R7BA 4EG8A 5DLEA 2POQX 1GNRA 4RLHA 3K05A 5JUWA 1D03A 1M10A 2BFOA 3H2HA 4R2WA 3JQ7A 2WWFA 3KHSA 3HYCA 3HY3A 4OP1A 2OBNA 2BELA 3DBOB 6Q21A 2JAPA 4XVRA 2NT3A 4YFYA 3RRJA 1V8FA 3OIVA 1R37A 3BEOA 3CLTD 4FX5A 4IUDS 5ILQA 4B2YA 1KI8A 4DBLE 3V80A 4KE6A 5KYXB 4DN6A 2AD5A 1EGHA 3FVQA 3ROQA 1CBUA 3LPNA 2BKVA 3PC2A 1OJLA 4Z9AA 4I5FA 2QR2A 4G1BA 3R2JA 2C2BA 3JYHA 3AEZA 3H8SA 4MO9A 5E6SB 4F97A 2CLDX 4ENTA 1KS9A 4IIJF 3ROFA 3TLGA 5C7LO 3UK1A 3IIMA 1O5IA 1ZI9A 2PD4A 3WGLA 2YV5A 4RF5A 4CU5A 5NLLA 4ZAFA 1N3LA 4HH1A 2PEYA 4ZIRA 1BU5A 1GQOA 4MDHA 4OQXA 1WE2A 3IV7A 2C7BA 7AT1A 4G0PA 5C4IA 4HEJA 2OP1A 5TJHA 3SHQA 3WLFA 4C4AA 3SG0A 4XVQA 4Y0VA 1R5OA 3FVVA 1P0FA 2GYWA 4LJYA 4UCXA 1GQQA 4Q6WA 1T1SA 2WU3A 2B5VA 3GH3A 3KQVA 3TQHA 4BP3A 1QHHA 4DEXA 4TYWA 1ZJYA 3CR8A 4M87A 4XTRA 3TEJA 1NW4A 2Z30A 5ALEA 1CK4A 2H1SA 3KZXA 1FUEA 3TD9A 4TTJA 1KAMA 2PJDA 3E7XA 2OV8A 1E99A 2ADFA 2XWBF 3GLSA 2REBA 2KMLA 3CLTC 4QPJC 4R1PA 1N6KA 5L3QA 2H17A 4DM3A 2PGLA 1L7NA 4GPEA 4MQBA 1T5LA 1XA0A 3CXRA 4GLFA 2W83A 3BGOS 2VDJA 3U9LA 2ZRIA 2A0FA 1NW6A 2FWAA 1BEUB 3IAS6 3K9BA 2IYSA 3RIXA 4AWAA 1II0A 1L3BA 2QPTA 1X1BA 2X13A 1P3JA 2FI1A 4XJXA 4BQNA 3K6JA 2HM7A 1V16A 2FU5C 3EC7A 4TZTA 3KSDO 2ZQYA 3CNLA 4R8LA 3WFJA 1FSGA 3WLMA 3OF2A 4EW6A 2QVGA 1KEEB 1O5OA 3AGQA 3PNVA 4R2KA 3KYDB 5E7JA 4JLPA 1FTWA 3HJTA 5ICEA 5IC4A 2IIBA 1OZFA 3PP8A 5IYZF 4X61A 2IZ1A 3NONA 3TZLA 3RANA 2IYAA 4FNOA 1VC2A 2A33A 2JATA 2MHCA 1JG1A 3K96A 1PJZA 3K4PA 3PD0A 4MUAA 3DBHB 3X0DA 2R9VA 1YZVA 4WLVA 4FOOA 1C14A 4J76A 1SHJA 4K9NA 1ML4A 3WB2A 3S40A 1P9LA 3UAZA 3ZGXA 4DA8A 3STXA 3QE4A 4IZOA 3T3MB 1A9TA 1Z16A 4C5CA 4FIDA 1NVVQ 4M49A 1N0VC 1W49A 3BB3A 4B74A 2ZB3A 1GDTA 2H0QA 5BVGA 3ADDA 5EOVA 1JDBB 3L82B 2V9ZA 4TUYB 5JPIA 4HL6A 3RVNA 2TSYB 2HADA 5JV5A 4C88A 5JY1A 2XGGA 4ZVRA 2JIRA 1J5EB 2HNKA 3OU2A 5HKBA 3GGGA 3KOYA 2Y92A 1WV1A 1RYDA 2Y3IA 3CG4A 2ZJ1A 2ON6A 4ENRA 2M32A 5KUTA 1QE5A 1WUTA 2DJIA 4KIJA 1RMYA 1XBTA 1ZN2A 3UK2A 2B0JA 3C6YA 4JU9A 4UQPA 2PMEA 1EFUA 1BXRA 3IQFA 2OO3A 2WAYA 2GWHA 1CY6A 1GG9A 3RU3A 2PV0A 2Q99A 5E1DA 1YKGA 3STTA 1G17A 1MIOA 3N2KA 4WJZA 1LK7A 1YOVA 4EPVA 1AJEA 3LT4A 3K70B 2JBAA 4UE6A 2AZTA 5TF0A 1I5RA 2VRNA 1IMOA 3V4LA 1WB9A 1OILA 4YCSA 4AZWA 2BDUA 2W6IA 4R2XA 1NBMA 2JJ1D 2VHTA 5AVVA 4I9FA 4Z0TA 1CSEE 2HRCA 1JHYA 4UQOA 4E2YA 1BX0A 1YHZA 2C8VA 4P81A 2EQAA 2IU6A 4WCFB 3N6VA 5T4EA 3NC0C 4M53A 3RWOA 1X39A 4G41A 1N57A 3SCZA 4O2AB 3BMOA 3SX0A 1GRCA 4L07A 3ZDFA 2WZBA 4KQJA 3OFSA 1DQZA 3A6ZA 3AY3A 3I2YX 4XEHA 4LYYA 4ZAYA 3T9DA 4BP8A 1NXOA 2P0EA 1WWKA 2O06A 3WWOA 4NOKA 5FD8A 2E4UA 3QUSA 4BVGA 4CHTA 2TMYA 1ZJWA 2RKOA 2R66A 2V7WA 3R0ZA 2VC2B 4KMRA 1OWOA 2R25B 4PX3A 4LOJA 1YQ9A 1VBFA 3FY4A 1V96A 4Q1CA 5CB6A 5IAJA 1P73A 2WMNB 4OHFA 1PT5A 1B41A 1I2CA 1M83A 2A3RA 4KQFA 3R8CA 3RIYA 3RSHA 3WRXC 3F6RA 1U3DA 1VSTA 2OWDA 1Q14A 1DV1A 1UBGA 3I05A 3N7UA 1QIHA 1QB8A 1JFTA 4P36A 5L95A 3PDCA 3R0QA 3KAPA 4AY6A 1WU7A 3QKUA 5FFFA 2GZMA 1Q3HA 1F3OA 2GJAA 2V7PA 2VJDA 2TRSB 1D0SA 1UXGA 4JGIA 5ESDA 2E85A 1QQTA 2GAFA 5B7QA 1XN1A 1YI8A 4PONA 3MGKA 2WD7B 4PHCA 4PG5A 3AM3A 4QYSA 3DCNA 2R6DA 1IVNA 5IBRA 2J6IA 2G5TA 2RHGB 4NNJA 3DB2A 2J3IA 1PIWA 1K6IA 2PAAA 2RAFA 3P20A 2AI2A 4NAUA 5PNTA 5DYWA 1R6VA 2MU1A 4W5JA 2GBLA 3AOEA 2XX3A 4NXMB 4F5ZA 3WGMA 3OU7A 3A2NA 1HM5A 5DCWA 3ZJ5A 3L6UA 1U2QA 4MRRA 3BSFA 4BN5A 1VJCA 2WIFA 1YZQA 2QDXA 4ENWA 2CYCA 2QUKA 1SK8A 3AQ4A 4WCFC 4TLEA 3ZN2A 4HH3C 4LV6A 2IHBA 5L3ZA 3ROKA 4N7RA 3UJ8A 3ITEA 3VH4A 3GG9A 4N82A 2VXYA 1WB4A 1CJKC 2B69A 3L4BC 4OL0A 4Q47A 4XD7D 2K5UA 4QDJA 5GV7A 3VSAA 2JAUA 2YS7A 4G8CA 1T1IA 5BRJA 1GDDA 2X9NA 3WE7A 1E2HA 1KAQA 1Z8NA 3KCNA 3BN3A 3WMRA 1Q95A 1U0RA 2NPFA 3T1TA 1AY0A 4FFDA 3RARA 1QGDA 5THXA 2DM6A 2J32A 1D2NA 4XCQA 4DIDA 1EFVA 4HN4B 4U7PB 4U00A 4XUGB 1A5ZA 4JLVA 4WPGA 3JAMA 1WW8A 4KXXA 1KBZA 3MF4A 5EJMA 2A9JA 2WV7A 1AT1A 2ZWAA 3M89A 1A5SB 1AX9A 2XT9A 1H94A 2VO1A 2FWRA 3A1CA 5AKHA 3ZNNA 1XLTA 1YR6A 5JANA 3GPIA 1MFZA 2NU6B 3LI2A 3MTBA 3QWHA 4G1CA 5K8VA 4HKTA 3VZCA 4RF2A 3ZY3A 1WMDA 3JZMA 3H17A 3EOZA 3UJ7A 2P5SA 1RP7A 3L7OA 2XDYA 1EFHA 4N6OA 1ZK3A 1Z6GA 4Q4AB 1OKKA 4X6XA 1CJCA 3IS3A 1YBMA 5TY0A 1T3HA 1STOA 1XLUA 4F4IA 2NV2B 1M54A 3BHIA 4TMYA 2XVXA 4IHJA 3QWBA 2P4EA 3ZOKA 1OLSB 4D8XA 2JAQA 4EF5A 2ATIA 1Y6GA 2G9UA 3GJ0A 2M6KA 1M1YA 2ZYHA 4E2FA 5AW0A 1QU3A 4LJ9A 2GX6A 1XWIA 4HWSA 3E05A 4J0EA 3K30A 4QE3A 5E9QA 3ZWMA 3F8TA 1J5XA 3MT9A 3U39A 1NQTA 3FDXA 3V8PA 4CM5A 2FW0A 2A4MA 1PJTA 4DOMA 1NXQA 5FTJA 2BEWB 1AF4A 1UXKA 4JNKA 1PV2A 2A67A 4O4IA 4CKBB 1KSFX 2MDTA 3O7WA 1K86A 2V8BA 1LPNA 1GD1O 1DKNA 4RQBA 1VA4A 3K9CA 4HQKA 3RAPR 4BUCA 4YJHA 1JR3E 1W96A 3ORQA 2HDWA 3HRIA 4P8RA 4YRAA 3A37A 3I73A 1G21B 2QN8A 2EGHA 1TQHA 4PRLA 1Z8FA 4QHYA 2DMRA 1EHIA 1LDYA 1M72A 2V7XA 3LRPA 1TA4A 4NJMA 4OU5A 5E1MA 5FTLA 4JWTA 4QXRA 4H7EA 4X8LA 5ED4A 1EVKA 1R4MA 3KJZA 3EFEA 1WY7A 4M1MA 1F17A 1XQYA 1Z3IX 1L7MA 2PGOA 5I4KA 1D6SA 3T3NA 1WPRA 1L2TA 3PPIA 5FYDA 3C70A 2D0IA 3ZKWA 2XRYA 1LNSA 1C0IA 3LSYA 3T3EA 3DMFA 5EIEA 2P65A 3R4CA 3UB4A 3T7IA 2Y05A 1Z22A 2IOYA 2PLNA 5FUWA 1Q1ZA 1CG6A 2P6UA 2GFQA 1K92A 1S96A 2Z3ZA 2VRBA 3F67A 3NGMA 1NULA 5KDDA 4RTRA 2VHUA 3A32A 4EVRA 4EVQA 1QF7A 3JPYA 1R15A 1XXHA 2P2DA 3DDUA 2A7QA 2GUGA 3MUNA 5LR6A 5HKAA 2PHZA 3DCYA 4ZU1X 3SE7A 1DWQA 3ANYB 2ZUEA 3KQOA 4EB0A 2JBWA 3Q4GA 3ZDBA 1GLGA 4YV0A 1QUFA 5DIZA 2BP7A 2E37A 4KHZA 4JI2B 3ETJA 4EJFA 3MMZA 4YAGA 1EX6A 4H7JA 4F92B 2BM9A 3M2TA 4QD3A 2O8NA 1WPGA 4EY8A 4BFWA 1A77A 4IYJA 4U5XA 1LDGA 4G07A 2V54A 4I5EA 5BV8A 1JPNA 2ET6A 3I5UA 3RSCA 4PHGA 1A7AA 4D8YA 3GLGB 3MZ0A 1BE8A 3NCHA 4G63A 4N3NA 3IAFA 1W75A 1IHPA 2NUPA 2UDPA 3C5EA 3QLVC 2ZUUA 4BX2A 3DZKA 4PSUA 3WNVA 2AN5A 2WG1A 2SKCA 2AJCA 2L0XA 3U44A 5JD3A 2WTXA 1I94B 2PL9A 4U7JA 4RZ2A 3RJTA 3HZHA 2PSHA 2YOHA 1XKXA 4NMXB 3AJ9A 4OJQA 2PU7A 3WKEA 5DGCA 5AVTA 1N1MA 1ILWA 2HMYB 3HY6A 3B38A 2CVQA 1DT5A 4X95A 2O2XA 2V9PA 3B6KA 4HI0E 1XLWA 1AUOA 1J0BA 4DMGA 1T2EA 3KD2A 1C5KA 2IQIA 2WUGA 3HHPA 1BMFA 4RCZA 4OQQA 3F9RA 1DCMA 3EOAI 5BMVB 4J07A 3LW8A 3DL7A 3R09A 1XZFA 3OAAA 5AKEA 2OYRA 1YI1A 4Y2RA 3WADA 2QYOA 4MDFA 2PNJA 2O5EA 4OHVA 3RBZA 1MA0A 1E2LA 5AVRA 1B42A 1PVOA 4F5WA 4O6VA 4J90A 1DO0A 1EFCA 1T10A 4F91B 1MR3F 4PVCA 3UEOA 1XDZA 2RI1A 4RQUA 4WY8A 3LFHA 1XPUA 2QIPA 2MYPA 3QVUA 4NBKA 4KBYA 5A9SA 5C8ZA 3A9RA 2IEBA 4KFSA 4QRHA 3E1SA 2BD0A 2CLKB 1PFKA 3H75A 4WLUA 4MV0A 3RDPA 3WGHA 5B1IA 3PF9A 2BGGA 1N5MA 1GCUA 4GWKA 1I0IA 2R1TB 3S44A 4AJ4A 1ZN7A 2OGWA 4ZQIA 4I1YA 1J90A 1V48A 3UBMA 2XYRA 2I33A 4DLVA 2AKAB 3WA6A 3HKBA 4UNQA 1BQ3A 2W93A 3PUKA 4F9TA 3E48A 1TF2A 1R1DA 2OAGA 3EDOA 3MOSA 5SICE 2YYSA 1DJMA 1EAYA 1NF8A 5H0IA 4LXUA 2H4FA 1XAJA 2GUWA 4KG7A 3VDXA 5BQFA 3U4QB 2E4AA 1EJ0A 3UICA 5DCUA 4B84A 4G65A 2VQEB 3KG2A 5F76A 2RONA 1TPZA 4KMMA 5GJWC 5HHTA 1P9NA 1X2EA 3UG6A 1C1DB 2WRZA 3PFCA 2OT3B 3BGSA 4B4VA 1ZGCA 4JQSA 3DMTC 1KI4A 3HM2A 1ZONA 1N8KA 4R2MA 4BRZA 3AMVA 3IQXA 1ODFA 4H35A 3DUWA 4G5GA 2DBYA 1RZRA 4WN9B 3HU1A 3IDSA 4FX2A 1S2LA 3Q5EA 4IO0A 1QZTA 5K51A 4DNFA 2ZYDA 1RCFA 1HTWA 4MP3A 1JG3A 1JVNA 1K6XA 2CLHB 3KYIB 3EIOA 2VUIB 3H9EO 1E5VA 4Y18A 3KK0A 4IBOA 5CM8B 2BZ0A 2HSEA 4S1OA 3TTXA 1G6HA 1KQOA 5BW5A 1QF6A 3V97A 4WGGA 4MGEA 5AHXA 5FBKA 4YCJA 1MB0A 3QY0A 3G9TA 1W5SA 5HVNA 2JHAA 1TRKA 3IEXA 2OECA 2ZUCA 3OETA 1N3IA 2AUMA 1SXIA 3BGWA 5GONA 3NTUA 1CUFA 1CP3A 1JQ3A 3MWLA 1WBJB 3C3JA 4JBXA 4L5CA 3W0LB 3L46A 1CB0A 2PUHA 1XHEA 1I6WA 2V59A 2VP4A 3N8NA 4JBIA 2GNAA 3ZS9A 5TQ2B 4GC5A 5J2TF 2PIAA 2P2SA 2DJ5A 4CLRA 4PPQA 4RACA 2ZJ5A 3Q7RA 5CB4F 3CX4A 5HF8A 1T0PA 4FHFA 2C3OA 5AW6A 1WUIS 4OLJA 4XGNA 3RRYA 1B43A 1FTNA 1P7CA 4IW3B 4E08A 1KO8A 4KQKA 1Q77A 4QTTB 1SG0A 1U2EA 1PQPA 3EIUA 3EW7A 1EG7A 4LGCA 2O8CB 1IN1A 3COSA 1N9GA 2GLXA 2WJ3A 2BM1A 4PGHA 4W6QA 3TK1A 1UP4A 3DGEC 3LHIA 3HBNA 1RQGA 3K4QA 3UJ6A 5EXTA 4F1JA 3VYUB 3AFNA 1LB1B 3NHBA 4DKXA 1QQBA 3TMKA 5L51A 1XQ6A 2UZ1B 1B8PA 2BJHA 3I2HA 1ACJA 1XD8A 2A6PA 1I3KA 3EA4A 3EXFA 1G5FA 1YRQA 1QZZA 3THRA 3EIFA 2YUIA 1M75A 1GV0A 1P5RA 3Q98A 5L4NA 2VTEA 4G4SO 1XDDA 3BBLA 1AQLA 2ACWA 2MIIA 2WF8A 3BB4A 1Z29A 2GN0A 3GFQA 4OQDA 4CMBA 2VQ3A 3C14C 4RDCA 2E49A 3O4GA 4TLBA 1C9MA 5CFLA 3QTTA 5LYJB 1ZCFA 2DUMA 3E84A 4KR7A 1II9A 3PXDA 1SOMA 3KUUA 3LC2O 1MGPA 1PN3A 2HWKA 2IHYA 3NHZA 4QPNA 1QHHB 1F60A 3TIVA 3F3MA 2DSNA 1IXSB 3D7SA 1JKIA 1JSRA 4HQFA 4MYDA 4N4AA 4KK3A 3L43A 4RIEA 1QIIA 2I3AA 4XD2A 2AXQA 4YCNA 1ZUNA 5D86A 2ID7A 1XU4A 5EKDA 2QUAA 3ESCA 3MS7A 3TCNA 1KMMA 2KLBA 4X60A 5HF9A 4ZHQB 7REQB 3H1GA 4MVJD 5K3EA 3KSBC 1XQXA 1CUHA 2ESRA 2I2DA 3NC4A 4JEUA 4ND3A 4WL0A 1GZ5A 1IH8A 2K2WA 3SZ3A 3TSYA 3A70A 3OESA 4FB4A 3IC5A 3KS9A 1FCJA 4LBZA 2I1WA 2K7ZA 3ZLBA 4ZDIA 5TMPA 1JR6A 1R0KA 4IR7A 4RKQA 1V16B 4BCCA 4UMVA 3Q5DA 2VF2A 3OQBA 2ZSJA 4GR9A 1U90A 3D6HA 3NEJA 2OLJA 4PC3A 4XB2A 4DCCA 3G68A 3FGPA 3QFHA 1RYBA 4FDLA 4JITA 5IMBA 3IEMA 1K5GA 2XNDD 5IEBA 2QRZA 3I5XA 1GQSA 4WH0A 5FBRB 1T5DX 3PL1A 1XUOA 5GQSA 1GQFA 2CHQA 4GYWA 4KB5A 3JR3A 2GMWA 3X2EA 3D7LA 3FUCA 2BVNA 5GIOE 2C5LA 2JHCA 2J87A 3SZUA 1IZ8A 3QBTA 5JTUA 1DZ3A 1AGPA 2NO6A 2X4LA 2ODEA 3F3YA 1LLCA 3S2FA 4AMVA 4EVSA 4NPHA 1TJYA 5HF5A 1KC1A 1Z06A 3D2BA 4B4UA 2GYYA 1ZUHA 4FN4A 2J09A 1PJ4A 2RGEA 3M34A 4WLNA 1EB8A 1LGYA 2Q3LA 3MXTA 5T4HA 1SHTX 3VR2A 1GGKA 1C9NA 1ULAA 2R87A 3W6ZA 1AA6A 1F1JA 4RCVA 3OQPA 5HKKA 1TE2A 2CF5A 2XMDA 2B8EA 4WDQA 3ZWOA 5LYJF 1IJBA 3BKWA 3EQ9A 5JTTA 1JI3A 1V95A 3O83A 3T5MA 1L1QA 3Q3VA 1K5DA 1N5IA 1TM1E 1XEXA 3QXGA 4CKCB 1YL5A 4P98A 2AXEA 2AG1A 2GTHA 1LDNA 2ZI4A 4OREX 2GAIA 1X8LA 3ACCA 4TKZA 2ZUFA 3VAZA 2JBAB 3N39C 1J2YA 1JWAB 4K28A 4RZSA 3U3ZA 1ZEJA 2JI4A 4GSLA 2VBIA 3RVOA 4BLQA 1TYDE 4A8HA 3Q3JB 5LOVA 1F9EA 5J63A 3TOVA 4OJNA 4IMJB 3N3BC 3AHCA 5HGJA 2EW8A 4NZPA 3B53X 4KQ6A 1O0SA 2PZMA 1TCCA 2LVBA 4ZV4A 1W5AA 1V3QE 2CJPA 2W98A 4LEIA 1P60A 1B7GO 4Q9LA 3T1HB 3BA6A 1FX0B 1UJ4A 3BVPA 3GMTA 3N86A 1JT2A 4CBVA 4G4JA 4Q9JA 4KR9A 4EWLA 1TB4A 1CC1S 4RHEA 4Z3DA 3PEYA 2FPRA 4A03A 4AG3A 5KNCD 1CF4A 2VJPA 3RGWS 3W6OA 2QSZA 3SN6A 3KALA 2M6SA 4LRUA 5D5HA 2NACA 3LYHA 3WYNA 2IYLD 4JN6B 4Q05A 5CBPB 3KPUA 1U7HA 1QOQB 3FUXA 4BKRA 3BAFA 2HCJB 1IVSA 4ZYUA 1X1AA 2G7MC 3V3TA 4J7XA 3WYFA 5BPFA 3HEBA 3CNQS 4DC1A 1OH7A 2OAEA 3RU2A 5BMOA 4HBZA 5CCXA 1EK6A 2IYRA 2O1EA 3D3QA 3OCCA 3QKWA 4AW9A 1K68A 2GK7A 1UKYA 5DLPA 1HNXB 3SAJA