4QPZA

Crystal structure of the formolase fls_v2 in space group p 21
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
563
structure length
563
Chain Sequence
AMITGGELVVRTLIKAGVEHLFGLHGIHIDTIFQACLDHDVPIIDTRHEAAAGHAAEGYARAGAKLGVALVTAGGGFTNAVTPIANAWLDRTPVLFLTGSGALRDDETNTLQAGIDQVAMAAPITKWAHRVMATEHIPRLVMQAIRAALSAPRGPVLLDLPWDILMNQIDEDSVIIPDLVLSAHGARPDPADLDQALALLRKAERPVIVLGSEASRTARKTALSAFVAATGVPVFADYEGLSMLSGLPDAMRGGLVQNLYSFAKADAAPDLVLMLGARFGLNTGHGSGQLIPHSAQVIQVDPDACELGRLQGIALGIVADVGGTIEALAQATAQDAAWPDRGDWCAKVTDLAQERYASIAAKSSSEHALHPFHASQVIAKHVDAGVTVVADGGLTYLWLSEVMSRVKPGGFLCHGYLNSMGVGFGTALGAQVADLEAGRRTILVTGDGSVGYSIGEFDTLVRKQLPLIVIIMNNQSWGWTLHFQQLAVGPNRVTGTRLENGSYHGVAAAFGADGYHVDSVESFSAALAQALAHNRPACINVAVALDPIPPEELILIGMDPFAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Formolase
publication title Computational protein design enables a novel one-carbon assimilation pathway.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
total genus 186
structure length 563
sequence length 563
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2014-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00205 TPP_enzyme_M Thiamine pyrophosphate enzyme, central domain
A PF02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain
A PF02776 TPP_enzyme_N Thiamine pyrophosphate enzyme, N-terminal TPP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qpzA03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qpzA01
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4qpzA02
3PKJA 3L84A 3EXIA 4UU7A 4BN4A 2C42A 5IMSA 3HWX1 2C3UA 1YC5A 2C3YA 1YHZA 4GM4A 2AG0A 3ZGVA 2UZAA 1ZPDA 3JWPA 4WBXC 1X7YB 3D7KA 2FSVC 2H4JA 1M2NA 2JI9A 3U31A 2BFFB 2Q28A 2NXWA 2VBFA 1YBHA 3UK1A 1DJLA 3AHHA 1TRKA 2BP7B 4BN5A 4Y6LA 4GM0A 4GP9A 5EJ7A 5MGNA 4RJJA 3M6LA 4MZXA 2Q5QA 1YNOA 1AY0A 5ERXA 1OLXB 3EXG1 3ZHRA 5DGTA 4X3PA 4Y6OA 4UTXA 5K6RA 5ESDA 2FR8C 5DGDA 3ZHVA 2WVGA 2BEWA 1TKAA 2Q29A 1X7XB 2JI7A 2Q5OA 2JGDA 4QELA 3CLUD 3U3DA 1V1MA 1NM5C 2R5NA 2BEUB 2C3MA 2QTCA 4K9KA 2E6KA 1OLSA 2OZLA 2WVHA 1UMDB 5AHKA 1XLTC 3AHDA 2BFDB 1Q6ZA 1PO7A 4ZP1A 2NYRA 1OZGA 1WCIB 4BVGA 4UTZA 5K6TA 1B0PA 4BVFA 4X3OA 4GG1A 1U28C 2H4HA 5MF6A 2VBGA 4QPZA 5HJEA 1UMBB 2Q5JA 2PGNA 3AHJA 1DTWA 2BFBA 2FWNA 1UM9A 1UMCA 1W88A 5EJ4A 1X7WA 3ZGOA 1X80A 3EXIB 4UU8A 4F4UA 3CLRD 5FEMA 3LPLA 5EXDA 4K9MA 2G25A 2IHUA 3DUFB 2Y0PA 3GLUA 1U2GC 3CF4G 3HYLA 1MCZA 5K3SA 2JIBA 3FSJX 2O1XA 2WVAA 1EFPA 5FYQA 4K9PA 3AHIA 2QQFA 4JUBA 4TWIA 3EY9A 1YTLA 1UPCA 5I4IA 2OORC 5DEIA 1U5BB 4UTVA 2C3PA 2UZ1A 1PNOA 2VBIA 3EXEA 1PYDA 3AHCA 3PDHA 3DV0B 3ZHSA 4J1TC 2C31A 1OZHA 2PANA 4IAOA 2PGOA 3ZHQA 1OLUB 2JGDB 1GPUA 1QS0A 1PTJC 2VK1A 5BWOA 3ZHUA 1SZCA 2BFCA 4FZ3A 1QPBA 4RMHA 3EXFA 4JUCA 4K9NA 1POXA 1N0HA 4FEGA 5HYVA 2BRUC 1W85A 1V11A 3UPTA 5I5EA 3EA4A 1V1RB 2G67A 1NI4A 1M2HA 2EZUA 1YHYA 1J8FA 1X7ZB 4UTNA 2PDAA 2YICA 1V5FA 1V16B 3E9YA 1BFDA 2H2DA 4R8MA 4UUAA 2H2IA 2H4FA 2BFEB 4IF6A 3EYAA 3AHGA 2AG1A 4F56A 4G1CA 2BEVA 1ITZA 4JSRA 2H2FA 1UMCB 1UM9B 4HD8A 1UPAA 2JI6A 1T9DA 1X7YA 3IAEA 3CLSD 4V1CA 3RIYA 1SZDA 2A1TR 1L8AA 2JLAA 4D5EA 4L3OA 2BP7A 1PNQA 3DVAA 1OVMA 1MA3A 3GLTA 2H59A 4RMIA 2H2GA 5ERYA 1PVDA 1OLXA 3EXHA 1Y9DA 2EZ8A 2OD7A 4RMJA 5MFPA 4MQ5A 1NGSA 3FLMA 1X7XA 4BV2A 3EXEB 4GPEA 4RMGA 2DJIA 3LQ4A 1YI1A 2IHTA 1E3TA 5D7NA 4Y6QA 2BEUA 1QS0B 1V5EA 4C7VA 2FRDC 1V5GA 1UMDA 1T9AA 2BFDA 1JSCA 4JUDX 1W85B 1O97D 1V11B 3OE1A 1RP7A 4BV3A 2C3OA 4D5GA 1WCIA 2VK8A 4L2IA 2JI8A 2XTAA 2G28A 3IAFA 1M2JA 3F6EX 2BEWB 2FN3A 1TKBA 1D4OA 3M34A 5EJ8A 3D81A 1UMBA 1YC2A 1O96B 1Q17A 5HHTA 2H2HA 4BUZA 4JD5A 2JLCA 4BVBA 4JUAA 4QQ8A 1V1MB 2Q5LA 2XT6A 4JT9A 1Z8NA 2R8OA 1T9CA 2BEVB 1OLSB 3RIMA 3M7IA 1YD7A 1S5PA 2OZLB 3DUFA 1KEKA 4KXVA 4XEUA 2OO5C 4KPUA 2QQGA 1S7GA 4V1CB 4KGDA 4K9LA 2IHVA 3GLSA 4C7XA 2EZ4A 3PKIA 3DVAB 4JU9A 2A1UA 5I51A 4TWJA 4GM1A 3AI7A 4O8ZA 2YIDA 2J9FA 5BWNA 3EXHB 2EZ9A 1DTWB 4FEEA 5EJMA 5I5GA 1U5BA 2BFBB 1ICIA 3D4BA 2O1SA 1W88B 1X7WB 3DV0A 1X80B 4UUBA 3F6BX 4K9QA 2X7JA 4KXWA 4JU8A 4KXYA 1OLUA 1YI0A 1HZZC 2BFFA 4JUFA 4JT8A 3M49A 4BVHA 4KXXA 5HGXA 4RJIA 4I5IA 1QGDA 2Q27A 4ZZIA 1V1RA 4IG9A 1TKCA 4MPJA 3ZG6A 5K2OA 4BVEA 4FVTA 5EXEA 4K9OA 3LQ1A 1X7ZA 2W93A 4MPPA 4KXQA 3HWWA 2R8PA 1PI3A 1V16A 2XT9A 3EXG2 2HJHA 4HDAA 3OOYA 1UPBA 2UZ1B 4RJKA 3LQ2A 2BFEA 4MPRA 4KXUA 1Q1AA 5EJ9A 5EJ5A 4Q9DA 1IK6A 1PT9A 5EJAA 2VK4A 3AHEA 4C7BA 5C4IA 4J16C 2EZTA 1U2DC 2VJYA 3JR3A 2BFCB 5MFZA 1EFVA 1U31A 3EXFB 1Q14A 3GLRA 3CLTD 1R9JA 1NI4B 3MOSA 3EXHC 5BWLA 3AHFA 4UTRA 2OD9A 2V3WA 4COKA 3ZHTA 1M2GA 2B4YA 3RIGA 2QTAA 2IEAA 1POWA 2OD2A 1T9BA 3K35A 4V1CI 3KOMA 5EJ6A 4C78A 3FZNA 1M2KA 1OZFA 2J9FB
chains in the Genus database with same CATH superfamily
1G8GA 2PXXA 1UUFA 1S0UA 3JZDA 3VZDA 1LH0A 2NYAA 1C9DB 5EQDA 3ZE2B 1FS5A 1QGOA 2YN0A 3EB9A 4F71A 4Y98A 3EULA 2XCOA 2VS1A 1I6LA 1SKBA 1SM4A 2C3YA 3H9GA 3KT8A 3NM6B 1D4ZA 4P32A 4EELA 3WL6A 1H66A 4FFPA 5TIIA 3MGCA 3N05A 3R6WA 4X1KA 4ZO6A 3L2OB 4C04A 3W04A 4ZK6A 1JYFA 1KYZA 2AB0A 2CJWA 3MUOA 3A4NA 3TS1A 5FFMA 3DE0X 4YJ2F 2H4JA 4MLZA 3HCNA 1H42A 3OTIA 1FLNA 1RYNA 4LZPA 3WLJA 3U31A 1S1MA 3NKLA 2H1CA 9LDTA 1JI0A 1DJLA 3S3TA 2XNHA 3PFBA 2PKYX 3W05A 3O8OA 4BJ5A 2IUTA 4EY3A 1KWKA 4B44A 3P32A 3KKZA 2COKA 1YZTA 2VCHA 3QI2A 4Y6LA 3ZUGA 4PTLA 1LW6E 1WWKA 1I8TA 2Q7DA 5IVHA 2V74B 3CZCA 3UK2A 4RTQA 3AR4A 2K2WA 1SN7A 4X7BA 3IMCA 2XWJI 3R24A 4GOKA 4IHAA 5IC6A 1XQ1A 2C0QA 3ZHRA 3NHRA 1BW9B 4WKPA 2IV3A 1H1LB 2OAP1 3RC2A 2JKYA 2AEJA 2AUMA 4F3RA 3FR8A 1ZIYA 3CKKA 3QNUA 4HNRA 2WTBA 1J2EA 1X15A 3T3GA 3EFEA 2G07A 4DQDA 5IT0A 1G5HA 1R8XA 5CVDA 1XXHB 3F47A 4B0PA 4D7AA 4DHWA 5LMZA 2ZM5A 3RYCB 3LC1O 3QEOA 1B3BA 1A9OA 2D2XA 4XYMA 4RO0A 2Z4RA 3P9NA 4UEQA 5FWXA 4CHGA 1QVWA 4X60A 1KK3A 1CJCA 1AXEA 4TVBA 2FWRA 4CIXA 5L95A 3G8CA 4G4IA 1TT5A 3VHLB 4MWEA 2I2WA 4R7TA 3HY4A 3F7OA 1BOOA 2IDKA 3G6KA 3FJ1A 4MH0R 3WKCA 1MAAA 1QCDA 1JLLB 1N75A 5I7WA 2WP8J 2RSLA 3CNBA 3NWBA 1SCKA 3HRKA 5TARA 1DCMA 3X1DA 2O8DB 1XAIA 4LJLA 3GU3A 3UMBA 2GD2A 2HUNA 2YZ2A 2KI5A 4ZOLA 2RIRA 2HWXA 1XTIA 2B4KA 3OZXA 2BFDB 3IEVA 3QSYA 3MWGA 2QRMA 4YGXB 1NUTA 3K30A 2EYUA 4HFJA 1DCKA 2J9RA 1XCBA 5BORA 3NC1C 3CISA 2M98A 4WNYA 5L53A 3QVGA 3R0XA 1GT6A 1Z8HA 2YIMA 5IXYA 4O4JB 1B42A 1BD3A 1BDBA 3QEMB 1WRBA 5DI9A 1FLDA 4CMHA 1AJEA 2OAGA 4P3OA 5BYJA 2VP9A 2Q50A 3DTVB 3ZWNA 3T9EA 4C0JA 1ZNZA 2UDPA 1V1JA 3BWCA 2BGTA 2P9YA 1EA7A 4DWWA 1RM4A 4TM7A 5JFTA 4CMAA 3GROA 4FGWA 3KL2A 4UATA 4AM8A 2RCNA 1E6MA 4KDCA 3K2QA 1RM5A 4DR3B 1KK0A 1Z74A 5EIOA 3D8NA 1FTYA 2HXGA 1ISPA 1YGPA 1RIIA 4FMDF 3V48A 4TMFA 4RMNA 2DBYA 2KHZA 3VYRB 4BCBA 2AXPA 3RJTA 4D8VA 1U1EA 5A1JA 1Z2NX 1EXNA 2RB5A 3AKCA 3T3OA 1PSDA 5EUBA 2O7QA 1XAHA 2IW1A 1Y4SA 4M0CA 4BMDA 4DXAA 1ELOA 1U1IA 2FUG1 3GOQA 2O7VA 3OE7D 4MWZA 2QXUA 4ND1A 1X0VA 3U0VA 1U2GC 2XUAA 1RCUA 3LYUA 5EESA 3W5IA 3ZJ4A 2X9LA 5DTEA 5DYNA 1ZVJA 1QVAA 4OMFG 1KXZA 5A4MS 4BGEA 4E5KA 2FEAA 5FBWB 3G2JA 1VMEA 1E0DA 1T8TA 1Y1PA 2V6GA 4F93B 1EXDA 1YIOA 1VDMA 4I1OA 5I4CA 4G0UA 5A4IS 2WIFA 2DHQA 1XN1A 1XF1A 2X14A 5CNKA 1ZH2A 3WK9A 4J1QA 3I5XA 5EOVA 2CHEA 2W7TA 5JO0A 5L4SA 2WKPA 1IXRC 3EY9A 4BO4A 1EFTA 1A8PA 1RJGA 1VPLA 4M9XA 3ZW9A 1VIAA 5DEIA 2QBYA 4UTVA 3O82A 3PXXA 3BREA 3ABIA 1HPLA 2B9VA 4B7AA 4LY9A 2Z3VA 3WGTA 4PG7A 4YMGA 1FFGA 1OZHA 1DXHA 4IG4A 1TJ5A 2AOXA 1RKBA 1F17A 4O29A 4B6FA 1NU8A 2JJ1A 2O2EA 2WRZA 4CODB 3D3NA 1KVRA 4XJSA 4GZ5A 4MKXA 1GO2A 1CZKA 2R5FA 4U8GA 2OA0A 3WLQA 1FS6A 4XWOA 4YRNA 1BJKA 4TZ0A 1P33A 2EG5A 2XMQA 5G1PA 4QOFA 3PUZA 4J3NA 4MVYA 3V4FA 3VI4B 5IT4A 4H1UA 1LLQA 3F2IA 2ZBEA 4IINA 3EISA 4LXTA 2HMSA 5C5DA 2C2XA 4ENUA 4Q9AA 2FH5B 1Y82A 2HA3A 3N8KA 1ZWLA 1NY5A 3NHPA 1ZN2A 1KJZA 3MLEA 1D9ZA 5EJGA 4MUEA 1U0HC 2E6UX 3TOVA 2DKNA 4C0BA 1H2XA 3A36A 1J8FA 2XXAA 3Q72A 1EX7A 5B6PA 5LQSA 3KUCA 3ZY2A 3HKDB 4PAMA 1KIMA 4PE5B 4OK5A 3PUXA 4ZKEA 2VQEB 2XA2A 2QV0A 4JUIA 4A2WA 1WETA 4LE0A 1OFUA 5DIZA 5J4YA 2EIXA 4FK8A 3TUZC 2MT9A 4PCAA 2BKEA 2UV8A 5M34A 3WB0A 1ZM2A 3L49A 3AZPA 3P2MA 3THYB 2C9BA 2PYIA 4EW3A 4PSCA 2J1LA 4PYNA 1JWBB 2PWZA 4KNVA 5CR9A 3W5HA 4IQ0A 2QTVB 2VLIA 3L0DA 4BLVA 5KNDH 3AL2A 1MQAA 2ZB4A 1MO6A 1R12A 3O7MA 4ZJYA 1V45E 2WHEA 4ZFNA 2ODBA 2X9NA 2CB9A 1E9SA 2XCUA 3FM9A 1F2DA 3KV3O 2VH5R 2NYUA 1XLVA 1XOIA 1OE0A 4LYAA 3CVUA 3ABZA 1SC9A 4WACA 1GGJA 1Q74A 5JD5A 1UPAA 4YROA 2JI6A 1EE1A 2X42A 2H5LA 2A33A 1OAKA 2XA1A 4O2BF 5CH8A 3ZHCA 3ZK7A 4OQMA 4L8WB 2ZRHA 3LUKA 5JBQA 1JNXX 3C8DA 2F00A 4LZZA 3AYXB 4RENA 3DMTC 1NYQA 1MG0A 3HDGA 4CQLA 4ZMSA 5K99A 4OYLA 2DPGA 2L69A 1FNNA 1T1RA 1JXMA 1L5QA 2CHVA 2VKTA 3HDVA 1ZRSA 3VKUA 3GMTA 4WZ6A 4YMVA 5JRDS 1VECA 4YMUA 4FOLA 3KKLA 3OCYA 4XQEA 3C39A 5JJCA 1Z6GA 2CJFA 3LHDA 4J94A 1VXRA 5D85A 4CQJA 1CUCA 3VAAA 4IZIA 1D6JA 4ERNA 3WYCA 3IQHX 3UTDA 3WX0A 1UBNA 1Y9DA 3N2EA 5I8PA 3IHWA 1QG2A 4ARBA 4AYTA 1LK5A 1HXHA 3FUCA 3GXOA 1RC1A 4MYDA 4ZOBA 3VNSA 4CT0A 1W581 1TEZA 3HJFA 1PQ4A 3EIWA 3B85A 3P2KA 3ADDA 1E9RA 1T5TA 3IBGA 2V8OA 1CY6A 4QNMA 2ZS7A 1RQLA 3WYBA 4D43A 2AL7A 1C1XA 2ZSFA 4YYZA 3QLJA 5CXQA 1F51E 1S4QA 3BE6A 3DFMA 3G8AA 3KDPA 2MR6A 3WLSA 1HF3A 1G7SA 4X94A 4DWVA 4PN7A 2C5EA 1Y7HA 4FNAA 2O8FA 1ZKDA 3PIIA 3B53X 1HDXA 1VPEA 2EW1A 1T6ZA 4I19A 3RGGA 5DN6D 1RYZA 5LWQA 1M2WA 5AK5A 3PEEA 1XZQA 3QELA 2EP7A 2XNSA 3FVRA 2H1SA 1M6EX 4D57A 1DFIA 2VXOA 1P4SA 4W7SA 4F5DA 4LFCB 3KSBC 4BLRA 5CNMA 4NBKA 1ID8A 1XVLA 4Q05A 3H5VA 3KK0A 1O97D 3UNXA 3OE1A 2XDQB 3KD3A 3NRBA 3U7IA 1P3DA 5H16A 3PV0A 3W2FA 5HM8A 4KE9A 2WC1A 4AY2A 4GI5A 1JHVA 3H5LA 3MGKA 3HJAA 1H4SA 3I62A 4AKGA 2C3OA 2XDWA 4YECA 2AQKA 4AP5A 2P79A 4GYWA 4QFCA 1MF7A 1YIDA 3QKSB 2HREA 4K6HA 2IWRA 3RKSA 2LV8A 4KQ1A 3VHXA 3BMOA 4UMFA 2A86A 4HLDA 2DR0A 2Q62A 2VNAA 5D7BA 3UOAB 4BRSA 1IQPA 3GPDG 4JVSB 1ODLA 3F6EX 1X39A 2WYIA 4WZAB 4C0LA 1CUJA 1UJ2A 4D56A 3T5PA 4ZU6X 1Y4ZA 2PS1A 2R8RA 4F97A 3I9OA 2LGJA 4KR6A 1A8IA 3QM1A 4GICA 1MQ8B 1J0XO 1NJ6A 4DV3B 5GTDA 2C61A 2VZLA 2Z5VA 1V1MB 1FNCA 1IZYA 1QBKC 4LZJA 1I3NA 1NHWA 1GAQA 3QJGA 3SDBA 2I78A 5INTA 1O0SA 1ENPA 1DHRA 3L6BA 3A37A 1YL5A 3BBPA 1R6VA 4OVKA 1ESZA 5CJ2A 4C7OB 3KPJA 1VLMA 2H0AA 5GQSA 1YZHA 1KH2A 4LPSA 3LD9A 2RGWA 2J7PD 2OHXA 3SXPA 3RJZA 1YR9A 1M8FA 1XJCA 2ZT6A 4OI0A 2EWMA 4HDSB 2YL2A 4KGZA 5M7EA 4LISA 3DOIA 4MVXA 3KAQA 1DKNA 4UJ3A 5LUBA 4PVCA 4FCCA 1YFLA 2QY6A 4K9LA 2MSWA 3TAXA 2ZZKA 2P6MA 2I6QA 2NNWB 3D2BA 3STUA 2VZ9A 4JBGA 4O4HF 1QANA 2EXXA 3IC5A 3KVVA 1P4HA 1S4MA 4NARA 1V4BA 1X3SA 4LSGA 1HI9A 1X7DA 3R1IA 5CX1B 1TYZA 1G4UR 2HSDA 4CN9A 3V32A 1WTCA 2EQAA 2FETA 3OX2A 1KJ8A 5DNYB 3C3WA 1GQ2A 4JJZA 3WBBA 4G2TA 2AHRA 2EZ9A 1D9XA 1YRAA 4IJMA 3ZCQA 1SHKA 3HP1A 4AS3A 3N7TA 5DM60 4CCYB 4MP3A 1M54A 3AI1A 1UL1X 4PXSA 4UVGA 3G7NA 4XYBA 2O1SA 1CF2O 1W88B 2JH9A 2I7TA 1GD1O 1P73A 3LT0A 1P6UA 2XXJA 3G2MA 4ENRA 3M6VA 4IIJA 3D6MA 4R2JA 1MOQA 5ALWA 4LCBA 4TX1A 2NZUG 4JI5B 4AJ4A 1ID1A 1GPMA 2X7JA 3LT2A 5IF3A 3L1HA 1UBSB 5GM2A 3RS0A 4WOJA 2R1VB 2VDQB 5I9BA 4BP8A 1XZLA 5J1TB 3WHKA 5JI2E 1PUIA 2EJBA 4DF3A 4Z0PA 4KFUA 1CJSA 2C20A 3H8JA 4U02A 5IT9A 4IS2A 1GA1A 2O7SA 2QI9F 1JT2A 1OFVA 2JFZA 3H8VA 3OX1A 3T3MB 5E3JA 2N1BA 4EI9A 1DARA 2WIKA 2AZDA 3Q8KA 4Y6PA 4UFPA 1ADBA 2EW2A 1J1UA 2MSEB 2GAOA 3HRIA 1YDMA 2VDVE 2ZI3A 3DO6A 3I2IA 3K53A 3L7BA 3C87A 1UBHS 3JYNA 3QX9A 3R40A 4GGMX 1XMXA 3R0ZA 4ZT4A 4ZI2A 4Q02A 4A5SA 5IVKA 4LJ5A 2N9UA 4K9OA 2ECFA 3QPDA 2I3BA 1C30B 4OXQA 4MI6A 4QOEA 2ZKIA 2Y71A 2VJLA 1M73E 4LRTB 1V96A 3HSKA 4N8SA 4AUEA 4RD3A 3A9RA 5IW8A 4A82A 3AR7A 2WLTA 5BVGA 5F9FA 3RYFA 1H3NA 3KPUA 3GG2A 1QF9A 3GHHA 3HBMA 4FKMA 2RHDA 1ZAYA 3NX4A 1OBCA 1QJCA 2ZPTX 3GVHA 3JQFC 1P2FA 1E61A 1RRFA 1G3QA 1YVDA 2BM9A 3G13A 4KXUA 3I34X 3PFGA 4RIGA 3IAXA 4QLBA 2GUGA 1I6KA 3BE4A 4LDRA 2VHVA 3GRVA 4X95A 1W94A 3L7AA 1RYHA 4JNKA 4DJ5X 1U2DC 4C21A 5LSAA 1ML4A 1S3IA 2BZ0A 2C1EA 3AY3A 4KACA 1LLFA 4P83A 4BFWA 2W90A 3FDZB 2B5OA 3FLAA 3NW9A 5AI8A 4EGQA 4U0KA 2IIBA 2X1HA 4DQ0A 5JAZA 1DC7A 2E9SA 2C9YA 3PFFA 4DCCA 1UDCA 1SCUA 4Z9XA 2XVAA 2VPXA 3C41J 4IKPA 4RZIA 4NCAA 3EUWA 3KQOA 1KORA 1E7MA 2Z1MA 1KI1A 2OY0A 3SIPA 1OH6A 4Q4HB 1ECPA 1MDBA 2P2CA 4L3VA 5DLPA 4QJ3A 1OVGA 2HBZA 4KPFC 5I7UA 3O3OB 3OIVA 3NHMA 1XTTA 1WPRA 3ICVA 4AAYA 5B3JC 3QX3A 2GRJA 3G85A 2C00A 2I6XA 4D0GA 5DX8A 4ETMA 1YCHA 3LAWA 2FPUA 4EKNB 2XY4A 2H0RA 3GLHA 4DV6B 5DH9A 1RABA 6REQA 1UKYA 2GK7A 1NVXQ 1VYTA 5H68A 3NEYA 3JATA 1PJ8A 4A7PA 4XFDA 3G1WA 3PICA 1I3OA 2C4KA 2VHZA 2WJZB 3L84A 4LBZA 4YJDA 5EMJA 3SHOA 4DKJA 4URHA 2BOVA 3CSSA 3ROFA 1C9JA 2C4WA 5GJVC 3UH0A 3P9CA 1HE1C 2QW8A 2LCQA 1NLUA 5GOTA 3OCWA 1WEKA 4ZT6A 1P4RA 3BFVA 2VTEA 4GOLD 2R68A 4RL4A 4BFSA 3CUWA 5FO1A 3M4NA 1IBCA 3RW9A 3QA3E 3L46A 3SY8A 3SSNA 5T4FA 1JEAA 1VHJA 4EGAA 3MTGA 5FIUA 1MG5A 1H8ED 3IP1A 4Y2SA 2B7CA 2Y8EA 4BFVA 3K1JA 2NXWA 3FSGD 3RC3A 1HO3A 1IZZA 4O0MA 1Y9JA 3DEHA 4UUQA 5EHZA 1VOTA 1B8NA 1FK8A 2ZB7A 4IV5A 3J80A 1TB4A 2WF7A 1N0VC 4K3UA 5DM4A 4MVJM 2INGX 4Y2YA 1LTHR 1XCGB 2WHRA 3BB3A 2H1VA 5FPQA 2ID9A 3KQHA 4R8LA 4R2HA 5AKLA 5B36A 1HZZA 2YOHA 2ZB8A 2GCOA 4QU8A 2D7CA 1IBRA 5ESRA 5CDFA 2QG6A 4UZFA 1XRLA 1QRDA 4LBWA 2BKLA 2VT6A 3O93A 2YYYA 3USES 2QP9X 4K1XA 4N0DA 3J81A 4GI7A 4U2EA 3RYHA 4JMLA 2WVGA 3GFBA 4WZBA 1T2EA 2E4ZA 4TOIA 4BLWA 3X0DA 3ID6C 1VMKA 4DMUB 5K8IA 1V48A 3K0HA 4PFJA 4PLFA 4XD7D 2VTKA 3JQPA 4IHKA 4RZQA 1ZBQA 1KETA 3KQUA 1N2BA 3S2GA 1U9ZA 3BDIA 3GPLA 3L07A 3C98A 3QBEA 3F9CA 4L15A 1AXRA 1KTIA 1QCZA 1MABB 4B3FX 1UBUS 5FPHA 1KZ4A 1FP4B 4HLUA 1DTSA 2C3MA 3O7WA 2QX6A 1T15A 1Y3CE 5C53B 4BCDA 2ZUFA 2BGIA 3F3MA 2R00C 1PWYE 3QV1A 2PLFA 3ILHA 3PC7A 5CVCA 4BLOA 1DXOA 5LXTF 1VG8A 1U3UA 1HTBA 3WWPA 2RJ3A 2R6HA 1KF0A 5DBEX 4BKMA 4JK3A 3ZWAA 4RTJA 5DNWA 1YE5A 4DANA 4NZOA 2BFNA 3TL3A 2JIQA 4E6EA 4FQ7A 3AU9A 1LBTA 5JH7F 2R6DA 3DTNA 1Y6QA 2E2WA 2WSYB 3IT2A 4M7RA 3VSBA 4BVGA 2OV4A 5JALA 4TPKA 1W5TA 2CLKB 3RSFA 4M8LA 3S1LA 4JLVA 4X91A 3GZNB 3NLLA 1T0HB 3IBCA 1U8FO 1CYDA 2P69A 1I4TD 1WA5A 4X8HA 4JOBA 4B81A 3PL5A 3NBZC 2ZP1A 3Q3CA 2I7VA 3DKRA 3TOCA 1SXJB 1U8CB 2PXCA 4GHWA 4CKBB 1DTWA 3Q41A 3HDHA 3MYYA 4LHYA 3WDLA 5KYXA 5FUYA 2D2FA 2Q4RA 3T8YA 4ZQFA 4C6TB 4OHOA 2P3SA 2QKYA 4U7HA 2QRPA 1WDWB 1DX4A 4WA8A 4FNOA 1IN7A 3S1AB 3E35A 4PO3X 3AY7A 2FOIA 1R3DA 1M1NA 2ILVA 3GGGA 3LPLA 3TXYA 1ZLXA 1Z7BA 4OAPA 4R0NA 5CD9A 1BROA 2QRNA 2H18A 4HI0E 4TMYA 5FPKA 5IUNC 3TAHA 1BX1A 4EABA 1J23A 3R74A 1BC5A 1HMYA 4OL0A 1U7PA 2I87A 1SWVA 3I6QA 3PVSA 4PHFA 4P5EA 5EP1A 5E6RB 5HF8A 4GRIA 4C01A 4PU0A 3K9HA 5EFZA 3HBAA 4PR0A 1PUXA 1MP0A 4F9GA 3GELA 3BWVA 1AUQA 1BXGB 5JSZB 4W5HA 2R1TB 3R23A 2WIAA 1Z5WA 2YS7A 3OU7A 2WTAA 4IIDA 4KLRA 4CVNA 3TRHA 1L5HA 4GL2A 1DFGA 1T3LA 4L4RA 2ZVJA 5L9AA 3ZCUA 1T8WA 1IULA 4YDRA 2OYCA 5IM4F 2ZUBA 1NPDA 1C3OB 2WIDA 2WU4A 4XPZA 4YN3A 3FZYA 4DLSA 2Z8YA 1W36B 3U9SA 4BNIA 2VYNA 3PP8A 4ZVTA 2FV8A 4E2XA 2PBLA 4CMCA 3QUBA 4MA0A 4HJXA 5K3OA 1S3FA 5L7TA 5DGCA 2VPTA 2R8EA 1FL9A 4HS4A 3GJQA 4JQOA 1TK9A 2YWGA 3LOUA 4Q3EA 3JQDA 4Y2HA 8MHTA 2O8NA 3GVPA 3DV0B 4G5XA 4NYMR 3AKEA 4I9HA 3I42A 4CTJA 3G9QA 1NFFA 4MOWA 2WG0A 5CW1A 1YQ9A 5ANRB 5KJ6A 2C7OA 1RCTE 4LQLA 3WGUA 4BVJA 1BDJA 2GK3A 3K2EA 1MAWA 4GLFA 2GJ9A 5T4HA 3I45A 1ZUIA 3T35A 3HVRA 4I55F 4PCLA 5F77A 3ZNQA 1VYVA 2QOEA 1I94B 3LY8A 2PKQO 4EYQA 3PVCA 1AU9A 4Q4LA 4RS3A 5EQTA 5KJCA 4QWMA 3A1FA 1PLKA 4JUCA 5FXMA 1DKOA 2PT5A 3FHJA 4HNQA 4NV3A 2B0CA 1VMDA 3W7AA 4CQNA 1XF9A 3C3BA 1ZH6A 2V7BA 5ALEA 2VTVA 3AR2A 4MVJD 3IUPA 1M2HA 4B3GA 2OCBA 3PA6A 3Q1LA 4TXJA 2GZAA 4WUTA 2CVOA 3FRIA 4XX0B 4TMWA 2XOKD 2UZ4A 2EWVA 2QX7A 3OQHA 4MQFB 3RS4A 2FX5A 4KWIA 3DE4X 4HDNA 2XWBF 4B3DA 4IDFA 3Q7PA 4QDJA 5EL0A 1Q2XA 3HL0A 2OFXA 4QGFA 4GKKB 1ZQ9A 4JX8A 3PJGA 3NTOA 2QJWA 1MVNA 3DDZX 3NETA 1GU1A 1FJGB 3UXMA 3OOWA 2LNDA 3P4UA 1DBQA 1PL0A 2ZJ5A 2A4MA 1EB8A 3GN1A 2D5AA 3PUWA 1OFHA 2D2EA 3ETLA 1IZ8A 1Q2UA 4CCAA 3NVAA 3P0RA 3FMIA 4A9AA 3DCIA 3LRTA 2VI5A 3LK7A 3A3OA 3D7RA 1AGRA 3FOAA 4DCJA 3W7VA 2NTEA 3K16A 3RIHA 3TVYA 4CTNA 3BICA 1S8NA 5AM4A 4HVLA 1DEAA 1UM9B 1NULA 1C1DA 4IDHA 5CFQA 5LA6A 1WUTA 4RPCA 1M33A 1T9DA 1KRWA 3MWYW 1J9ZA 2VH1A 3KEQA 5FUXA 3WMWA 5JS2A 3ZHBA 4CG3A 4B6PA 1WABA 2OXTA 1I7DA 2AOUA 5EQFA 4BRWA 5K3FB 2CKMA 1T2FA 3V33A 2KM1A 2OXCA 4MQUA 5DHPA 1JHZA 4AC9A 4E51A 2PMEA 3ZW7A 2IHNA 2DWOA 3OSUA 5JU6A 2MOKA 3VPDA 4GWGA 3CVXA 1XCOA 4WPGA 4ZRMA 2XNDA 2FSPA 3IA7A 4OQQA 3TW4A 3OJXA 3VHQA 1CJMA 2XIQA 1HYEA 2GN2A 3HADA 4B40A 5E1OA 5ELXA 2P90A 5JSFA 1YO6A 1I4DD 1V4NA 2WJVA 1UQUA 2FJUA 2IPXA 2D2VA 4KQ2A 4X20B 1N8TA 5B5SA 1YAJA 5KQMA 4HBGA 2X6TA 3CZQA 4HAOA 3NZEA 1YS2X 3L6UA 3WOHA 1EX6A 5BUSA 2XB9A 4L08A 4FGKA 4FN5A 5SYAA 2RGXA 1DJQA 1J49A 4Y9RA 1Z33A 4KQGA 2UYOA 3AEYA 4YJFA 2B4AA 1QG0A 3AY6A 1HNXB 1O3YA 4L0QA 3V1MA 4NK5A 1Z06A 2IPOA 4CIYA 4RETA 2R44A 4N6NA 4RZ2A 2AMLA 4L75A 4LDAA 4XGIA 2WMDA 4II3A 1JBQA 3WNBA 3ZQJA 2HPAA 2Z6VA 3LQ4A 2I9KA 5I48A 2MTBA 1JQDA 2FQYA 4A8JA 2YQZA 3CRW1 1VE3A 1F8XA 3A6HA 4PO9A 5DV9A 4F21A 1B6TA 3NBUA 3WK8A 5CFLA 2ZETA 3GBSA 3NU1A 4OJQA 4DILA 2AOTA 3HKCA 4ZGBA 4G1EB 1X77A 4LE2A 1JTVA 2AXNA 1RLUA 1V43A 3DZHA 2XODA 1UXKA 4NEQA 4EDHA 4DLUA 1E0JA 4AJOA 3W78A 4JA2A 1FZQA 1TA9A 3BXOA 3G2OA 2V7QD 2EX0A 3LO5A 3O91A 4J1TA 3TTSA 2YFQA 1JNYA 4JUDX 3FUXA 4KPEC 5JTTA 1OX4B 5JNUA 5CDHA 1QVRA 1PL8A 1PAUA 3T0FA 2P9GA 3DQQA 3HJUA 2O6HA 4FMCF 4RGBA 4NCKA 3E70C 2Z5LA 1SUAA 2ZYUX 4QUDA 2RGYA 2CLFB 4XA8A 3HCWA 5DVZA 4JI3B 2ZANA 1Q50A 2VK8A 3D6TB 4MUJA 3H9QA 1I4LD 1P80A 4RPGA 1CS4C 1J2YA 1YUMA 1P45A 4UHHA 1VE6A 3KJFA 4Y2JA 1QH0A 5FOTA 3HN6A 4BNHA 1C8BA 3RHZA 3MGBA 4OKNA 1E6UA 1KVUA 2GBCA 2XMBA 3MJDA 3R6TA 4RSGA 2H00A 3GZJA 4W9MC 5EIBD 4DG5A 5AW7A 3EN0A 4OF4A 4LNUA 2KBEA 2X8JB 1R9MA 5TJ9A 4EUEA 2VJMA 3K0SA 1F2UB 3R20A 5SZKB 4HEHA 2V4ZA 2QP4A 4JL8A 4EA9A 1ZA1A 5CITA 3F6CA 3SDSA 1JS1X 2D5LA 2PZFA 2XTMA 3GEGA 1JF8A 2XGOA 4TSRA 3CLUC 3IV7A 3QMWA 2XE6A 3QF4A 4MX8A 5FHRA 1S2NA 4DA8A 4N12A 3U44A 5F3WB 2BZSA 2VH2A 4FILA 2HW8A 4BFLA 2J3HA 3OUUA 4HWSA 3ZDZB 4GR5A 2H85A 1UOOA 1IRIA 1RYFA 3EARA 4NBSA 5K1ZA 4Z51A 5KYGA 4X84A 3H7IA 2ZJFA 4FWTA 4LHZA 3M1IA 4O4IB 4UHCA 3R9KA 3GLIA 3AI2A 1T43A 1CDZA 3Q0EA 4AMBA 4ZCIA 1JWLA 2I4LA 5CJJA 1W46A 2HJ9A 2XRMA 2X8BA 3EBOA 4IDOA 4IXDA 4NIMA 2ZQZA 1EFDN 3VO8A 3QVXA 4Y6SA 4B48A 4B3HA 1TTTA 2VAPA 4YCJA 2D4AA 4K6FA 1V7CA 5TS2A 3WL5A 2GVDC 4QRHA 3ZV5A 2AD5A 2A1UA 1YSCA 3B48A 4MVJH 4RESA 2WF8A 4ZYVA 3QXSA 3OF2A 2C8VA 3B3JA 2Z2IA 3GVCA 2GKSA 3M4YA 4LYEA 5DOVA 2ZRCA 1SVNA 3HGTA 2J85A 4PPYA 5DHRA 3OA0A 2Y77A 4NDNE 4TS9A 5DNDA 1VFNA 5BWCA 1UAGA 4FFBB 1EUQA 3C7KA 4OJMX 2EJTA 5EZ6B 2M6SA 3CPSA 3U40A 3PS9A 3CZ9A 1HLGA 4QBTA 1CNEA 3PHBE 2BE7A 5EEHA 3RRFA 3W1VA 4CM3A 2AN1A 3ZU2A 3BD8A 1R4AA 2CJYA 2CLIB 1O95D 3G5AA 2P9EA 3OAAD 3ZKWB 1N6RA 1TO6A 2RG7A 3M49A 4TTQA 3DTVD 1TPZA 2J5BA 2CJPA 2LPMA 4LHEA 4HNVA 2N47A 5U4QA 2ZJ1A 5AXCA 4EG5A 4B3CA 5MN6A 4Q39A 4DDMA 1GZ5A 2F3QA 2XSZD 5HGXA 3JWHA 5J2UF 1GYQA 2WJPA 1YA8A 4JLAA 4UAGA 4EHNA 1IZ7A 1E9BA 1GL7A 2X1VA 2OCDA 4Q6BA 4QPDA 4WW0A 1JVBA 4Q01A 3RYTC 3HB0A 2A1TS 1IE3A 4N7JA 3RS8A 3SZ3A 1AGXA 3OD1A 2ZFUA 1L4LA 5CFOA 5K2OA 4GMHA 2EQ5A 1GWNA 4MULA 4M7PA 3W6UA 4D79A 1N7IA 3G02A 3S81A 1ZWKA 5KX5A 1COZA 3E0XA 2BHNA 4TYYA 3VPXA 1G20E 2PH5A 1CERA 3EZ7A 1KZHA 5AVUA 2IYRA 4QD3A 5DT2A 5AJYA 4AJ2A 1KO4A 1VHLA 4RJKA 2D59A 2ZTVA 4RK0A 3M9XA 1L5GB 5A0VA 1ES9A 1Y34E 5BT8A 4OP2A 5FD8A 3PQ4A 4PX5A 5DGIA 4OIFA 4JT2A 1D4FA 3NTLA 2JPDA 4QXMA 3GRUA 1F9AA 4P7BA 3RO7A 3A6FA 3AVVA 4C7BA 5E2IA 1N78A 3PQDA 3DZBA 2DT5A 3P19A 4CKEA 4XR4A 3HA5A 1FVHA 1BQ4A 4M8KA 1EESA 1PR5A 3T7KA 1P39A 2IYFA 4CG2A 2GM4A 4BNMA 3GGCA 5ER9A 2EWWA 2FQQA 3OECA 4G4GA 1BHJA 3ZBUA 2NSHA 2B2NA 2FA9A 2ZIXB 3IPYA 1MJHA 3PKZA 1L7EA 3UC9A 4D74A 1W9MA 4RTRA 5LQKA 4UM9D 5JSHA 1GY8A 4KE8A 1CZHA 4FMBB 4LHSA 3EXHC 1CUXA 1BE0A 5HIIA 2P40A 1DPFA 3HZZA 4O3FA 1G66A 1VKOA 2G8LA 3ZVKA 1BKDR 1Q7EA 2QLBA 1YDWA 4M49A 4Z53A 1U4SA 2I2FA 3ROZA 3H9BA 4EJ6A 3RIGA 3T1NA 2QTAA 1RPTA 1LI7A 3STWA 4IFEA 3IUNA 4NMWA 1DOZA 4ZXPA 1N5MA 1YS7A 3KXIA 1KI2A 4UBLA 5KYUA 4C20A 5HXAA 4WADA 1J8YF 4FJ1A 4M0EA 4URWR 1DRKA 3PVZA 4C78A 5CB4A 1ZOIA 2G71A 1OZFA 2BUAA 3IDZA 4MQEA 5F73A 4N0PA 3AO0B 1ZMBA 4DLNA 5AJZA 4DEXA 1AM4D 1JQJC 2WWRA 4M53A 4WAUA 4UQLA 1G4HA 2C42A 5KU1A 3O8LA 3OT4A 3HWX1 3EGXB 2QSJA 1E0KA 1ZL2A 1Q3TA 1NOJA 4NU5A 1HMPA 4EL5A 4PGAA 1RQRA 4GM4A 4QARA 3ZBQA 1UEIA 5ALKA 2FRXA 5DYYA 3TOSA 1OSNA 2V4MA 3R5KA 3KAKA 2C07A 3PCRB 4E4RA 2PQMA 1PEKE 2HA0A 3TBHA 1A9PA 1RWOA 1U2SA 1I3CA 3IURA 1KDPA 1UODA 3NOXA 1YJBA 3QX7A 3P9KA 1UBLS 4B3XA 1DGQA 2PZGA 3TM5A 2FB9A 3OESA 3R7AA 2HJRA 2CNKA 4EHFA 1E1NA 2AMVA 2QTGA 4JHXA 4L85A 1Z6QA 2KSQA 2PZEA 3PTAA 1ZC4A 2EERA 2IUEA 4YMIA 2B4RO 5JXJA 4D0NA 4WZZA 1K86A 4AUNA 2A5GA 1A5TA 1VCHA 5J2TF 1YRYE 2J5KA 2XB8A 1LCIA 4H3KB 1XLUA 2GQ0A 3TLBA 4AS2A 4YUYA 4FN4A 2WMOB 1OLXB 3PJDA 1TMKA 2O48X 2FGJA 3EUFA 3RARA 4ZC8A 3U19A 5JJIA 1UDRA 3N3BC 3YASA 1PN3A 1E1RA 2BDTA 1BXRA 3U1BA 4L4ZA 4HNGA 3RWMB 5JASA 3K9WA 4GVLA 3DLHA 2C5GA 4LJ9A 1LSJA 1DIHA 1RI3A 2ATIA 4C6RA 3I05A 1RRMA 5COQA 3IXLA 3ZK8A 3TUJC 3GFRA 5K8JB 1SVSA 3BQMB 4EMSA 1AF4A 1QLWA 3W90A 4RKRA 4B8ZA 2R6R1 3WIVA 1V5WA 2ZQ5A 2OFOA 5HKLA 2ODEA 4D9CA 2OCKA 3GLIE 2E6KA 3C6BA 4BB5A 3OH8A 4GUDA 1MFZA 3PXEA 4P7GA 5EGNA 4JJ8A 1UMDB 1A04A 1YRBA 2IZ7A 2PS3A 5AHKA 5B58T 3G9ZA 4NHOA 2JLRA 1V6AA 2X3YA 4E08A 4JI4B 3C8ZA 4YFYA 3TZQA 3ZLVA 3IEXA 2ZITA 1LBIA 1UDBA 4B7UA 2ZUUA 4I50B 1NQOA 1DQYA 1I3LA 2SKDA 3OLXA 3QBVA 5TPWA 2R6GA 2Q7OE 4DT1A 4EP1A 1XVAA 1XJ5A 2WJIA 5D3MB 5G0SA 3KQSA 4MRPA 3GJ0A 3WBKA 1MJ5A 1DELA 2GETA 4XCQA 5FPTA 3U2QA 4HJRA 4BOYA 2O5RA 5K6TA 2QRUA 4Y9TA 1ENOA 5GIOE 3JAMA 1TQHA 3ORRA 4OH7A 4UOEA 1XDBA 2FG6C 3PLNA 3TZEA 1HBJA 2FK8A 1PWHA 2Z8ZA 2WE7A 4CGZA 4GLJA 5AW9A 1R0BA 5FLKA 2B82A 3E9DA 5FLEX 4WWHA 4UHFA 4FKZA 5HIMA 4ENPA 4BJ6A 4LMBA 2XUHA 2EJVA 2FWNA 3F97A 3QITA 1UMCA 1EUCA 3UGTA 3FTFA 1MC4A 5DHFA 2Y0CA 1H2AS 1LSUA 3LWBA 4TMZA 1TU0A 5FX2A 5KTNA 1JEJA 1FFXA 1OWOA 1D6SA 1VHTA 1P9OA 2B6HA 3IKJA 3KHKA 3Q4GA 1EFRD 2QV7A 4MUGA 1BMFD 4OB7A 3U4QA 3O84A 4G0WA 2HQ1A 3FZEA 1Q7RA 1W47A 2CYAA 2DQZA 1T6NA 3HBNA 3LP8A 2WM8A 2PT6A 3R3WA 4BQSA 2WIBA 1T36B 4H3HB 4JVLA 2NMVA 2W6QA 1NJGA 2UZIR 2QYTA 2WAYA 1D07A 5AI6A 4DRYA 4M6WB 4WK4B 1UIRA 4HFNA 4Z3OA 1QF6A 1Y5IA 3NIBA 1Q0PA 1QH1A 4ARZA 3ZQ4A 4DC0A 3IYLW 1B93A 5IHXA 4DOMA 5BN3B 1JXAA 4D44A 1GFWA 1FDIA 2OVFA 1YB5A 4WCFB 4G01B 3L9WA 4QJIA 5M29A 2WU3A 3A7DA 1GGMA 1GZ6A 2WTMA 4B76A 1CYEA 4G1VA 4BVKA 4JASB 2NM0A 1QUEA 1XJ0A 3GFVA 2O0MA 3S6JA 1LFDB 2W2PA 3O8QB 4C0HA 5COBA 2P75A 1DAOA 5DNAA 1ANKA 4EVQA 1ND5A 1WHTA 3CE9A 4D9JA 3PHJA 3MZ0A 4DUPA 2K4MA 4FYMA 3VSEA 4XWKA 5E7QA 2CHUA 1P2TA 5FAKA 3LI2A 2PANA 3COJA 4GX1A 2YJGA 4BLPA 3KWFA 4E5VA 1CZLA 3DAGA 4CLEA 5BSVA 1YB7A 1W4CA 1XD8A 3U4AA 1KVSA 3BD7A 4WA7A 4KNYA 3N8DA 4NOKA 4AG5A 4U39A 1P4GA 2H11A 4GD3Q 4DA6A 2AYXA 1QPBA 1EM8B 1YB6A 2VNKA 4WNAA 3WQQA 1FTGA 4XSGA 4J0DA 3G1UA 1ODSA 1YVEI 4FEGA 4J43A 4P4NA 3EMKA 2QR2A 1HDRA 2H48A 2NX2A 3GJ8A 2WKRA 4MNTA 2G67A 1Z5ZA 2AFHB 3IAM1 3LDUA 3FPHA 4P7KA 2JANA 5LDGA 2EZUA 3Q3JB 4NYJQ 4WBNB 3JD4A 1B2RA 1L7MA 4JB3A 3T3HA 4FHDA 4CV3A 1HC7A 2QX9A 3DXYA 3M3PA 1JSZA 3WS7A 1X7ZB 1VLLA 2H51A 4PZLA 1AQ6A 1FNMA 2QJTA 121PA 4Q1EA 3TD6A 2A14A 3WL8A 2CNNA 1SA0B 2VDPB 4A0RA 4CN8A 4PG5A 5CM9C 4A8TA 3NP7A 1CUEA 1D6NA 3JRWA 5B3AA 3JQAA 2ZUTA 2AA3A 5FLYA 5FLXA 4H1TA 1VC2A 1PJSA 4CMEC 3JAWA 4BNJA 2C7QA 3EVNA 2GD6A 3GRYA 3BGOS 4KOAA 4OK6A 4AT1A 2XJ4A 2HLDA 1E99A 2DWQA 3EVDA 3DBRB 3GEIA 3N2ZB 5AR1A 3AF6A 2JLBA 4B80A 2QIOA 3ABQB 4FW8A 3EGVA 4A6XA 4RA9A 5EZQA 1B0UA 1S89A 3Q12A 1BE1A 2PBZA 4REMA 1WAMA 3V9AA 1XVVA 1TCVA 2OMKA 3DZGA 4BWFB 4D4JA 3G3EA 2XH8A 2ERYA 3K4HA 3EGCA 1RCFA 3KTAB 3W0LB 2WINI 1Z3CA 3KZOA 4M0KA 5BSRA 3WGMA 4DR2B 1X7YA 4CE6A 2BMWA 4X45A 4NBUA 3VU9B 1JLRA 3CLSD 1KDYA 5BNFA 4LJRA 2IYUA 3IEUA 1JYEA 2HRZA 2ISQA 2RBGA 3H75A 4RNDB 3WLMA 5SICE 5HWSA 2QD1A 521PA 4NJMA 3O94A 4LEIA 2O23A 2OO7A 4X5OA 5SZJA 2ODTX 3PQ6A 1R5BA 4MICA 3S2UA 3VR0A 1QPZA 3N53A 4ILKA 1Z2OX 2P4HX 1PNQA 4LK3A 1U63A 2XGMA 2ZBGA 3T7TA 4I8DA 2J0UB 3C7TA 3WYFA 3KTOA 1UZMA 3VU3A 4ZQBA 1L7NA 4EKGA 5GOZA 4TWAA 1T35A 4M87A 3BGWA 2JK1A 1TUEA 3HA7A 1V3QE 1PR4A 2ZDGA 3EDCA 3OPQA 3HDQA 4GSLA 1W6UA 2D54A 4ESHA 3VISA 5IYZA 5KS2A 2Y2VA 3QHQA 4ZAGA 2W00A 2X8LA 4KFRA 1JALA 4MK4A 4QYWA 3MA0A 2IP1A 4YJ3F 2ID8A 5BQ5A 2OZKA 5GIPE 1TQ8A 3WY9A 2G3YA 3W8EA 3LDFA 1GTVA 1VRCA 4E4TA 2Q6VA 5IWCA 2OBFA 2VRCA 6ABPA 3GY0A 4DE5A 3MCTA 1TCUA 1SULA 1Y3BE 3GX1A 4MQLA 1OD6A 2HO5A 3TTVA 2WWXA 3UC5A 1E3TA 1NRJB 1LPPA 1RRVA 3FMVA 1JZTA 1DKUA 3R3VA 1QHEA 2J8ZA 4JI6B 4DRXB 3X43A 1PW7A 4DR4B 1RVV1 3UICA 1NVKA 5CHEA 2WAMA 3C3DA 1GZHB 1KJIA 2GD0A 2GSDA 4D8TA 3BD6A 4Q12A 1KQFA 4D0LB 3GEBA 5KDDA 3UO8B 2WIJA 4Y2PA 3W5VA 5HTOA 3PQ3A 1ZNXA 3F98A 6LDHA 3WKBA 2BSQA 2H4ZA 3WGLA 2PKEA 4Z99A 3GQBA 1I30A 1JG2A 2BJVA 3DDNA 3ONDA 4PIMA 4UE2A 5E0OA 3ZOKA 1JUDA 1QFJA 1BO6A 2HAEA 3L06A 3ROKA 3M2PA 1ZJ5A 2PXAA 2PY6A 1F48A 3RAJA 5DW0A 4C08A 2AK2A 3CQ9A 4MR9A 3JQGA 3KD2A 5GONB 2BJWA 4LECA 1H4TA 3CMCO 1DBRA 2ZIVB 4GE3A 4CLRA 4TYPA 2G4LA 2XQVA 3I64A 2PX5A 5C8DA 1I9CA 4HNTA 1H2ZA 2G36A 1U0SY 2BEWB 1P81A 1UKBA 2K2QB 3OPYA 3RVKA 5EJ8A 2QLTA 1UMBA 1KTVA 2GKOA 2PT9A 4HQOA 3A3NA 3VNBA 2GRAA 1CQIB 3P0HA 3ORFA 3RT1A 3V5NA 4E31A 2O3JA 3SXUB 5EWJA 5HOEA 2VAMA 2AI1A 2ON6A 3GFSA 3L7DA 1XQVA 2I4IA 4MI3A 1F7VA 3DLTA 1SUDA 3H42B 4IOMA 3U7QB 1N33B 5A4JA 1D2GA 1OLSB 3RIMA 3RCBA 4HB3A 2VRWA 5T57A 3KOZA 2Q3MA 4CKZA 1E3MA 4MKGA 3Q6IA 4WGFA 4MTCA 1WHSA 1NN1A 5FWNA 3AF0A 1H5UA 5TLSA 3RDPA 1YL7A 2IVZA 3QWAA 4R9UC 5KAMA 4PZEA 1FRNA 2WA1A 1FTQA 1TAQA 4U5QA 1WKVA 3G9XA 3LFHA 3P5SA 3PUKA 5IK2A 3VU1A 4DA7A 4DDVA 3K2BA 1O89A 2IL1A 3ZNOA 1PR9A 2DOKA 1Y9AA 1PQPA 4KBGA 3QG1A 4MROA 3PEVA 4WY2A 2UXCB 1F7UA 5EHXA 2OK8A 1PFGA 3O95A 5JEEA 3PKIA 5C8VA 1FUUA 2OGWA 4JU9A 4S0ZA 1AUOA 1C4OA 3H3JA 3FKSA 3TZBA 2ZJ4A 4P54A 2HLHA 2VNSA 2XECA 3ENQA 4LVOA 5BN1A 1CFJA 4TVSA 4KH1A 1QO7A 4UTPA 4NZNA 1IG0A 2P68A 3AFNA 2UXBB 2MDTA 3C3JA 5I01A 4CM7A 3JALB 4EJFA 1IHXA 2IIQA 2XUJA 1R0KA 1PKXA 3HXKA 3GLFB 3CBGA 4B1FA 2GPSA 3FPJA 3N28A 2OP1A 1PSWA 3F6BX 3I2FA 1YR7A 3DO5A 4KEAA 1TK3A 3ZK9A 3H99A 4QEZA 2PFSA 1JE0A 2ZAIA 4ZVOA 1K6IA 1RZVA 1OLUA 3GD5A 3OWHA 3MIZA 5CCXA 3IGFA 1HZZC 3LBFA 3E03A 1NVWQ 2AGVA 1XFDA 4LFBB 3JAKB 3DXXA 3RI3A 3TZCA 4EMUA 5EWMB 4A10A 3IAUA 1INLA 4AZ0A 1RM0A 3IJEB 4WXRA 4LSZA 2CVPA 4EHDA 3F8WA 1KOGA 4ZARA 1XVIA 4ZD6A 3FFAA 1SXJD 1T3GA 4IFBA 2CVQA 1N92A 4Z4EA 1E4OA 1UC9A 2ZUVA 5DRYA 4BMOB 1P2GA 4EFLA 1C50A 3DE6X 2OBMA 4NATA 1KMMA 1MAUA 2N3ZA 4HADA 2V7VA 4XVCA 3VU0A 4ZN6A 3B60A 4R5MA 4NP6A 4ZDWA 4KVGA 2C96A 1OIVA 5CT6A 4KXQA 4M1OA 2ZAYA 3CN7A 3LQYA 3ME5A 4XVUA 5B7NA 1FSPA 2CC2A 3S2SA 3L05A 2XT9A 4HLUC 5LQRA 2GPBA 3AVPA 2X22A 4RK1A 3ROMA 5J2TA 3W2IA 4DW8A 1LXCA 1KBZA 1NRWA 2F3RA 2REOA 1E2UA 3Q2OA 3ZLTA 2P67A 1O7JA 2O7RA 4WL0A 2IY7A 2BFEA 2Q3DA 3LYAA 3UMGA 4E15A 4PTYA 1W0KA 3DWIA 5AI4A 1XMQB 1KHHA 1U7OA 1XTVA 1Z0KA 2E4WA 2I2BA 3T4PA 2PD4A 4GQIA 1NVAA 4OHXA 2PM8A 2A0YA 4UW9A 5EJAA 5B1SA 2FLKA 3V3TA 3A1DA 1MOPA 1TW3A 2ZQYA 4P0TA 5K0LA 1GN8A 4TKLA 5I7VA 2W5UA 4KR2A 1TK2A 4J0JA 1U8YA 2QUHA 1M3SA 3CRVA 3FKJA 3I28A 4Y0VA 5LBUA 3ZNNA 4AVYA 2Z6AA 1PVOA 3NBQA 3ZD7A 1R8SA 1W36D 1SBHA 1U0GA 3ONNA 2C4UA 4KUEA 2PL9A 1GA6A 2PL1A 1T1IA 2QF7A 4HDOB 3D7NA 1EVYA 3ZZ0A 4FOSA 4ZI3A 4AIIA 1GTRA 1YHNA 3WWZA 4F6RB 4BLSA 2KLBA 2B8TA 5ILGA 2IHJA 1WDMA 4CTOA 1GCIA 3H5NA 3SMVA 4NYMQ 2HRRA 2XQJA 1KKUA 3B2EA 1OFTA 1ZEJA 2NZWA 2W2KB 5AJUA 3CH4B 1O9HA 4GMGA 3RVRA 3ZCSA 4BO8A 5A2GA 1SKAA 4ITVA 1E2LA 4TL7A 5F2OA 2V0CA 3ZDDA 3ORYA 1E94E 3BAFA 4F8EA 1QZTA 4AL4A 1EFCA 1HTWA 1NXWA 5HZHA 1P0PA 5TQ0B 4AQDA 2IOHA 4LXQA 2C78A 4Q3DA 4A03A 4B83A 2WM2A 1YR8A 3U4GA 1M2KA 1LWOA 1VIVA 3IXQA 4GBJA 2J9FB 2J46A 2FQXA 1AZWA 5T8KC 2XCSB 1NV8A 4BEWA 1LJ8A 1YR3A 5BR1A 1PSZA 5M5BA 4N82A 4LY6A 2LDXA 1WW2A 1W59A 3TK1A 4M0LA 3I0MA 5BO5A 4U7WA 3U7RA 1IJEA 1YHZA 3LF2A 3ON5A 2P0AA 3U4MA 5FORA 1NP3A 3PWTA 1WF6A 1EK5A 3NALA 2SCUB 2JHAA 1ZBDA 4RTPA 1KQ3A 4OD0A 3KETA 2EFYA 3PRKE 2OOSA 1CRZA 2ESRA 4C29A 4IF4A 1XPJA 1L1QA 3RASA 2LIVA 4L74A 1Z5NA 2QE6A 5BSUA 5ESXA 1CE8B 4RY9A 3NGXA 3RVSA 4GS5A 2DECA 2VQFB 1M5TA 2CNWA 2PSEA 3SGLA 1J8DA 1QE5A 2IOFK 2CFSA 4XWYA 1PJRA 1Q21A 1NMQA 3ZTTA 4BXOB 5H3CA 2FW0A 3M6LA 1JIKA 1WQ3A 4QBKA 3D6UA 3CT4A 4UCWA 3RG8A 3UFXA 4JQSA 4C7JA 1Q0SA 4RJTA 2PSHA 5KBYA 1J2UA 2P3LA 7REQB 4U1RA 2O3TA 2N46A 4G36A 4EENA 2Q0HA 1B8PA 3A8TA 4RGQA 5A05A 3ZV3A 4EUFA 1ZCFA 5JZVA 1I1OA 1FQWA 2CDRA 1YZFA 4NH4A 2P9BA 2G63A 4LJ4A 3U3JA 2JFBA 1WEHA 3D43A 1RHQA 3TRKA 2XMZA 3D2LA 3TVTA 1RQNA 2JI7A 2QT0A 4OH1A 3RU9A 4A2PA 4KQIA 5BSEA 4NFYA 3SJUA 3V8RA 2MYNA 2R7LA 4Y2RA 1BS9A 4MJXA 3IMKA 3IQZA 3U4CA 4S2EA 1D8TA 1OFUX 1M6WA 1SOMA 2Y66A 3A26A 3LW8A 4Z54A 4K05A 1NF9A 2P6NA 3D5TA 4ZHQF 4K9DA 1WB9A 2YWHA 5A9SB 1PG2A 1FXSA 5IXSA 1PEAA 3EIQA 2WWVD 4MV7A 3BXHA 1LKZA 6NULA 4GYYA 4BCCA 2VUIB 4CDGA 1H2FA 2HK8A 2R1UA 5FBKA 1K7XB 4MCIA 1G21B 2I7DA 3FI9A 1MX5A 3CTMA 4RIFA 4EYSA 2NP6A 2XNKA 3AIOA 1QXSA 5KDOA 4M0DA 5KYYB 4J16A 1W0CA 1NQAO 3IILA 3MAGA 3V42A 3UCXA 2BGKA 4PS0A 2J4DA 1LSOA 2BELA 2WUGA 4OK3A 3KHUA 1E20A 4PF1A 4HCJA 3W9BA 1U3CA 3INTA 4AIRA 1LJUA 4FINA 4DG9A 5BNZA 3CUEF 3HUTA 4KXLA 1NW6A 4DJAA 5IKXA 1XTRA 4PO8A 5IX8A 5MF6A 1U8EA 2C1ZA 3VAYA 1H2RS 1Z07A 3WGHA 1Y7PA 1II0A 3BF8A 2OMEA 1KERA 4L0DA 5JAQA 3PNMA 3OJLA 4OI4A 1H0HA 5F3RA 5T41A 4B2PA 2UVPA 3AZOA 4C3VA 1R6XA 1UQTA 4TTAA 3PEFA 1QG6A 4HDRA 4KFTA 2WTXA 3CUSA 3GIWA 4U3JA 4QVGA 1X7WA 1FXWA 2DY1A 3JVEA 3EXIB 3WSTA 3ER9A 1UBJS 3RABA 4MVJG 1ZD2P 1L4FA 3UGQA 2EG9A 1OFIA 5EXDA 5IJWA 1NDQA 3P0IA 2QLNA 2ZREA 5EVCA 3WGJA 2Z09A 2NP7A 4PFSA 5FQNA 1QQAA 1CY4A 2BHRA 4IXWA 3FOEC 1NXTA 4NCJA 1XU9A 2P9FA 3BGDA 1EK0A 1GNRA 1GZ4A 3D9QX 1GQRA 3A1EA 1K89A 3C85A 3P2EA 1PVVA 2JIBA 3H3XA 1PD0A 4OHKA 3HCDA 2HF2A 1S9HA 2AFIE 2E5FA 3NIWA 1N5OX 1JQ5A 1P18A 1ADJA 2X13A 4N54A 3GLGB 1KMQA 4JWTA 2K7FA 5EG5A 3EC1A 1K0UA 5I9IA 3NATA 5I9TA 5KNCD 2CD7A 1NVBA 4DV5B 3V55A 4BQQA 2W2QA 5JVDA 1YZGA 4M98A 3A6GA 3RC1A 4H1VA 4FYXA 2AG5A 4XTCS 4O2AA 4P38A 4LS3A 4DIDA 1W4AA 2GN6A 2OSVA 3C6YA 1YTLA 4XWAA 3KLPX 4KOEC 4ZPJA 4BECA 4HNUA 4XTRA 1CQPA 1JQLB 3FCAA 4PLPA 2UZ1A 5JWRA 3WGKA 3DHNA 5TPZD 2XADA 3W5JA 1Z63A 3FOZA 4J1TC 1JJAA 1MC8A 1O9BA 2NTVA 4IQ4A 3T3EA 2QI9C 5ECDA 2ATCA 1EHYA 1KGDA 1L8QA 3P4YA 4KLCA 5CAEA 1QAOA 1Y1QA 3H5WA 1HE2A 1AVTA 1G5IA 1HG1A 3SI7A 2XA9A 4M0MA 2PUVA 2JAQA 4AMVA 4BGVA 2O8EA 2V96A 1RBZA 2NSDA 1L7BA 4QOIA 1XTBA 1FQKA 2YOFA 3D8UA 3EEYA 5FOVA 1RXIA 2ZOSA 3I58A 2BFCA 5H70A 1NJ1A 1IBSA 3EXFA 2EW8A 3RFCA 3TCXB 2AHOA 4ML3A 1E5QA 4MYSA 4TV8B 3RRJA 2RH5A 3MQ2A 2O2HA 2Q4EA 1COWD 3DAHA 5F5NA 5KPDA 2ZZMA 5J4KA 2JVKA 3AP1A 1NI4A 4J07A 5FI1B 1T4GA 2QZ9A 2TYSB 3SC2B 5FTJA 4LN1A 4RHUA 1GNQA 2YHAA 2YXPX 4TMKA 5EJ2A 4AF6A 3Q88A 4EGSA 2PTGA 3I4FA 2A0XA 4GKAA 2Q5HA 3OE7A 1G8AA 1JR3D 2J09A 4QDUA 2F2TA 2PMBA 3IMFA 2HZ7A 4L9AA 3UHAA 5IKOA 1JDVA 1QQ5A 3FCYA 3ZH9B 1QQBA 3VJKA 5LN1A 2HK6A 3D2AA 1J0CA 2X9VA 4GQAA 4LXHA 2YC2C 2DRIA 4WT7A 1XLTA 1RWNA 3CJQA 3KYIB 3NBYC 3RRMA 1JG1A 3LL7A 4JBXA 4CMJA 2IKSA 2ORVA 3RSSA 1WVIA 2AS0A 1JFFA 1FVFA 1N6PA 1PDVA 4IEIA 5E7MA 4F9FA 1V8FA 4DZZA 5GADl 4GC5A 2YN4A 1ZK4A 2OAQ1 5J4VA 2PL5A 1RJEA 1TM3E 5HZGA 3LQFA 1NBMD 4G1CA 2I9PA 3NTQA 5HE8A 1CFZA 2BEVA 1BHSA 4PRYA 4CMIA 3EIOA 4QTXA 5JC8A 4WFKA 5KJ1A 2V55B 4XW2A 1NUPA 1SXIA 2BIFA 1JA1A 1ZINA 3RLIA 4N48A 1WUKS 3G7UA 4HB4A 3VZRA 2EKPA 4X62B 2EARA 1HLFA 4A27A 5I3ZA 1ZM4A 4YJHB 3V8EA 2I3AA 1KBOA 3CJRA 3DEZA 1UK9A 4XB6B 5H0IA 4HDMA 4AZ3A 4E5YA 3PLAE 2E87A 1FX0B 5LNK6 2ARKA 1T6BY 4OJYA 1G5RA 2FZEA 4ZZ0A 3N2KA 1OXTA 2VHUA 2Z83A 4ME6A 4D5EA 4E94A 1RJ9A 1T3TA 4IHJA 1MU0A 3SQLA 1KI3A 2F3UA 3U61B 4EHHA 1A3CA 4KKXB 3SJZA 3L6CA 3NI2A 4BNLA 3B2QA 2NUTA 3RTDA 4DFDA 4AROA 1EKXA 1FFDA 1VKRA 1ZGJA 3LCCA 2E1PA 1BOFA 4FDLA 1MT0A 1ZM7A 3BMNB 4NMMA 4QNRA 5TB5A 3WLIA 4YAIA 2PGXA 3ZGNA 5KDLA 1MB3A 2FWPA 1OREA 3ABSB 3SC6A 4E12A 4X8MA 1CIPA 3TSZA 5DTIA 4F3KA 5I7EA 5JDIA 1BA3A 1WD7A 4TUYB 5FPSA 1NKTA 1VLQA 1G3MA 1MB9A 2ZJAA 3JV7A 4JC5A 5IANA 3O21A 1XA3A 1IXSB 3HJCA 3I92A 2MMCA 2ZI9A 4S1OA 4WZAE 2UUCB 1XE3A 4L22A 4GX5A 5T6BA 2VSFA 4E1AA 3GFQA 3ABRB 4MLCA 3S55A 3ZTYA 1ISGA 5HFAA 3KLNA 4Y6QA 1JR2A 2BEUA 5HK9A 1KC3A 4CEJA 4H18A 1RKQA 3DDWA 4RTOA 3SEQA 4MPDA 3R75A 2QIPA 2AN9A 3A7EA 4X1IA 1C4KA 2KYRA 4X7MA 2IEYA 3TTTA 1UM8A 2B1GA 2YWBA 5B1DA 1PL7A 1I4OA 2WKSA 2A9VA 2GPJA 4XRGA 2HEIA 1JSCA 2ZRBA 4LDQA 3WADA 3FYSA 4GMXA 3V4ZA 3K0BA 3K9GA 4XQ0A 1NOIA 3WIOA 1JSLA 2B6NA 1LLDA 5EYPB 4OLBA 1QMPA 4JLPA 2GVZC 4FS8A 4I1IA 1QVVA 3B89A 1XDWA 2DZDA 2QPAA 4AFNA 3S5UA 1WV0A 1D4AA 1T5OA 2DFKB 3CJTA 3K1YA 5B6IA 4YRMA 1NJFA 3KNZA 4L0CA 3VZQA 4E5PA 3ZPXA 4NS1A 4QHYA 4HWTA 1VG9B 4FX5A 1KJQA 2BC9A 2YFYA 2QZPA 1SC6A 3HKEB 3OPVA 2W42A 2E1RA 3QP9A 3A2NA 5KNCH 1D4OA 1AV7A 3D81A 4OFWA 3FPLA 3DT8A 4OP1A 2YV4A 4PPNA 5DPMA 4YRGA 1AG9A 1JU4A 2ZBRA 2ZR9A 4OQLA 3TLZA 3WB1A 2FSHA 1HFKA 1W1WA 3IQGX 1J0EA 4R69A 2H2HA 2GM9A 4S1TA 2HTFA 3UN1A 4BUZA 4HXGA 1O08A 4EYGA 1KP3A 2MMGA 1CNFA 4RJ2A 3TL2A 4TV9F 1S3SA 5H82A 3DHEA 5CA1A 1A5AB 4AJJA 3OWOA 1PZGA 5ITZB 1Z82A 2I54A 3KBOA 4UVHA 5AM0A 2CNLA 2E18A 1L4BA 3MWFA 1RI4A 3OJ0A 1CJUC 4XSVA 1W0JD 3OC0A 3DUFA 3OP4A 2VSNA 2TS1A 3AERA 1KEKA 3K73O 3OT5A 4L7QA 1DE0A 2R86A 2AQHA 3G5LA 3ESBA 1N2OA 1K4KA 4F2GA 4RTKA 3FDJA 1GKYA 3V1TC 5C7IO 1Y1TA 3BJIC 4FT4A 1RQ7A 2V6IA 1C14A 1GZSA 1QHYA 3R6GA 5AKEA 4HMPA 3L7MA 3FUWA 1DBVO 2W2XA 3KDSE 3INGA 4QGHA 5BUZA 1OB2A 2DSNA 4PS1A 3ZHOA 3DVAB 2P9HA 1XWIA 3QVTA 1AN9A 3AI7A 4W9NA 2AG6A 3OBIA 1WP4A 4Y2UA 4MO2A 4X63A 3SYTA 1M1ZA 5BP7A 2RARA 4QJ4A 2L19A 4RH3A 3EVEA 3QU5A 2K7ZA 4S2UA 1V39A 1YZLA 5L7YA 1DKLA 4YAUA 2X0EA 3HMQA 2AI3A 3JYLA 1Q1BA 4HQKA 4W63A 1PUJA 5K03A 4QYXA 4CL2A 3D4BA 4RSMA 5JY6A 2JGMA 1KJNA 4FCVA 2QL9A 1K63A 4GW3A 3S8YA 3N8GA 3FR7A 2FSSA 1V9LA 2ZIUB 4UUBA 4UU0A 1REQA 2CE7A 2BKUA 5CLLA 4CL3A 4LGCA 4EG0A 5KINB 1A9XA 2JLYA 1X1QA 1Q0RA 1LC3A 4B4UA 4ZYXA 1CD5A 4BQNA 5D51S 3T5BA 3Q6MA 4MXDA 5K0ZA 5DTRA 1ATZA 4PC3A 3EZ9A 1KI6A 3JQ8A 3S7ZA 3WHPA 5KQPA 1JKMA 4AMGA 2KLHA 2BKAA 2C5LA 3LLCA 3QVOA 3S8MA 3HFRA 1V1RA 5E2BA 4J0CA 1KMHA 5DMXA 1N2CA 3N74A 3ESCA 3VR3D 4Q7LA 4JXKA 3OZSA 2G5TA 2ZT8A 3QYAA 4JJEA 5CM2Z 4BB0A 3ZG6A 4D9EA 3LDHA 1G8KA 1Y1KE 2JFXA 1DG1G 1VCOA 4MPPA 3MG9A 2J7PA 2IYLD 2YHUA 1PI3A 3DE2X 4M0FA 2AXEA 3HVIA 1O6GA 2GBFA 3ENKA 1CB7A 4AP6A 3EXG2 5FYDA 3PPXA 3NFYA 5KVSA 3KYCB 3U7GA 1EB9A 3KT3A 1F5SA 5JCOA 4NF2A 3UUEA 1AMNA 1XT6A 3UCFA 3D3QA 1NURA 4R7ZA 3L43A 2JIZA 3H16A 3SIWA 2DERA 3FYHA 1FY2A 1ZI8A 4D4GA 1AQNA 4II2A 2PTHA 2RJNA 3ANMA 1EX9A 2DBQA 4JV5B 3N86A 4F2WA 2J3IA 2NUPB 4MHSA 2VK4A 4QAQA 4JZYA 3A9CA 3WG9A 3Q0TA 3B6ZA 4I9GA 3M5CA 4C4XA 4UNSA 4NWIA 5AESA 1ZK3A 1XEXA 1QTRA 4P36A 3FWZA 4HEJA 2V1UA 3X1MA 4JH0A 1GITA 3CRMA 3DBIA 1XZEA 5GV7A 2FNAA 3GJSA 1ACMA 1N36B 2FPWA 3CURA 1U7HA 2V7WA 1BNCA 2QMZA 3CLTD 2M1ZA 2BZGA 2ZCUA 1RYEA 2A8YA 4LYJA 1OBHA 2EP5A 2JLSA 4XCVA 3SJCA 1NW7A 4ZHQA 8ADHA 5AKGA 2R11A 3T54A 4EZEA 3N70A 3N75A 4GOOD 3VO9A 3TEFA 4BRUA 4OBBA 4B82A 4FC6A 2V3VA 4PPFA 2O0JA 4UTRA 4ZVPA 3GW8A 1B41A 1B74A 4HGRA 4OGWA 4QGAA 1ZNYA 2H54A 4QYMA 3CO5A 5ALTA 4CDMA 5A9RA 3KE9A 1K3FA 2RAUA 3K0AB 2YNMD 4ASUD 4D3FA 1L4HA 3L01A 3EBLA 3TCNA 2PUCA 3SZRA 4XWWA 4Q1BA 3S27A 4I1YA 5AH0A 5IFLA 4HQ6A 1GNSA 3W5BA 4JB8A 2QVLA 4ZOCA 2WMNB 3MMNA 4HUJA 3TKYA 4C87A 2NUAA 4MRRA 3RU3A 1WKBA 1L5WA 3GRPA 3R3JA 7AT1A 5TMBA 1JEYA 1A50B 2QRQA 1WQ4A 2VHXA 3KEOA 3VTKA 3UMMA 1Q3KA 3U62A 4AN0A 5DWVA 3P8ZA 4G8BA 3MGGA 1WUJS 4RAOA 4W1RA 1TF7A 1V95A 2BAGA 1AOXA 1XQWA 2V7UA 1NUQA 1H0KA 1U2TA 2ZR7A 3B1VA 5G0UA 2UYGA 3A2LA 1ZPDA 3NJ4A 2VA9A 1JTEA 5ALJA 5TT1A 3D6VA 4C5BA 5IJ0A 5JTUA 3I9V1 2WB4A 3QYPA 3KXKA 2NU8A 4Q9HA 5GZ3A 2VHQA 4I3HA 1NONA 1L5SA 1A9QA 2GPTA 4U00A 3DA8A 2L82A 5NULA 4YDHB 3LYHA 4UJ5A 5EC8A 1IUOA 3NJRA 4BE7B 4FT2A 2OG2A 5AMXA 3SYKA 1SVKA 1CUHA 1OJLA 4HNSA 4XJXA 3V1NA 2X9QA 3CIOA 1O6FA 2YDXA 3SE7A 4JWKA 5AICA 2P5SA 5F23A 4L9WA 1E8DA 5EJ7A 1XIVA 4LTMA 4MCAA 2AJ8A 1OH8A 3B9RA 2JIPA 3SICE 4DV2B 2ZUEA 2ACVA 4PYQA 1DDGA 1HQYE 4LWPA 5FP0A 5KVCA 1JLSA 5K6RA 2BFPA 4B73A 2HF8A 4MKFA 3AOEC 3ZWMA 3TTYA 2AD1A 3C5EA 2JFOA 2EBWA 4LE1A 1YRQA 3NTRA 4X1OA 4EA7A 2WAAA 1V9SA 4O59O 1RPZA 2ZBVA 4PG8A 1BCSB 1GFIA 2FPXA 4WNCA 5CFMA 1YGYA 3RVOA 3S29A 2CYBA 3D3WB 3AOGA 2DTDA 3DV2A 2FP4B 2CXOA 2YZ7A 2Z6QA 1XMVA 4JCCA 5K0EA 1JJVA 4KODA 5LL6P 4L16A 1CY7A 3NOVA 4L73A 2WR8A 4MIKA 4OQYA 1XTQA 2EGUA 4B3JA 3MJEA 2AUTA 2OV2A 4NSNA 4DBLE 5HKAA 3TYXA 2FZKA 2O5VA 2ZTHA 4JLBA 4KIWA 1GL6A 2OZLA 1QH8B 3GH1A 4OSOA 1WKCA 3IIMA 2D0IA 5L6MB 4ZZ2A 1LU9A 4GDMA 5LQCA 5JYDA 3OSZA 2HIHA 2PLWA 3AHDA 4JP8A 1A4XA 4RUKA 2B35A 5CP8A 1FSSA 2LDBA 1BWPA 2WMYA 4LX8A 5LQJA 4XI9A 3K9CA 4RABA 1QGZA 3RRXA 4CF6A 1FTNA 1OGYA 4FQ5A 1QRTA 1UDWA 1JSRA 3HHPA 3QIAA 4OHWA 2EAUA 3G5UA 3COPA 2OC9A 3MJRA 1LX6A 4RF3A 5K01A 3KU4A 2VZEA 1CC1S 4JKYA 4PSAA 3QOXA 1RRKA 2F55A 3IVMA 4EITA 1SKUA 2YY7A 4BVLA 5B2ZA 1GXSA 3CH7A 3NRCA 2V8BA 3WWEA 3UIEA 1M2VA 4URZR 3RUEA 3OZIA 4I4NA 4BP1A 2A92A 4E1VA 5L45A 1TL7C 4JP1A 1NJ2A 3FWPA 1KYWA 1ZL0A 2VTBB 2H7XA 1CF4A 4M0PA 2V54A 2C4MA 3LFUA 3T7RA 2HCFA 1RM3A 1VZ3A 3A6ZA 1H9CA 1Y5RA 1Y8QB 1KDZA 3TRJA 2C5BA 5KYVA 3HB1A 4OHZA 3VSDA 5IKPA 1TQ6A 5H02A 4ALJA 1K08A 5EE1A 3ELUA 1K8XB 1Z38A 4K6GA 1UZNA 4M1SA 3RTBA 1BEEA 2GDZA 1E2DA 4FOOA 4OFZA 5FEMA 5KYKA 4PHCA 1QH9A 1FFEA 1OPXA 2FSUA 1PEDA 4G4SO 4J9UE 2GVNA 3PGLA 3WK5A 1O6ZA 1Q92A 3UPDA 1T2CA 3T5DA 3X44A 2A84A 3I61A 2YV2A 3FPEA 4XD7A 5FI3A 2C99A 3HYLA 1MCZA 4NU0A 1PK7A 4UUMA 4YO7A 1QTQA 4Q9IA 4BO1A 1QP7A 3O1IC 2OHOA 1Q11A 4NZZA 2ODPA 4R1QA 2QGFA 1O54A 4CIWA 2G4VA 3NH6A 3EW9A 4D9GA 1CVLA 1VJ1A 2WVAA 4R0VA 5THXA 4AG3A 3DBLA 2X5NA 2RHRA 4NCNA 4EY7A 3BULA 4KQ9A 1Z56C 1SCBA 2O1WA 1NUUA 4UHKA 4TXNA 1TVEA 2D1FA 4K9PA 2X23A 5FF9A 1N7GA 3AHIA 1JH8A 1H05A 1SXHA 2X8WA 3O38A 1GKLA 4I36A 4RKFA 1VIDA 4ZT5A 4M9ZA 4CCSA 4AMZA 4TYWA 4KP7A 4QFBA 3PPWA 4MS3B 3KPVA 1TJYA 1XZJA 1YJAA 3NHBA 5ALUA 2PD3A 4MWOA 3RYIA 3COYA 4BQRA 4INJA 4KRXA 2GWHA 1U9CA 4UXHA 4CV1A 2AZMA 3BUSA 1G3RA 3A3PA 4P33A 1UDAA 2PVSA 2RAFA 3NEPX 5HCNA 5B53A 4B8YA 2ZGVA 3DJFA 3AHCA 3IBTA 4MV9A 3ZHSA 2XE8A 1PJ4A 4IPTA 4N49A 3SQDA 1XKXA 1QNLA 2YJNA 3C3AA 3KYBA 2IODA 4KQJA 5HBGA 4BHTA 4F5WA 4YXFA 3PXBA 5TMEA 1SFRA 2AOWA 1E2GA 4HR7A 1Z28A 1AO0A 4M1WA 3WJAA 2GGSA 3CNHA 3CXRA 4JDPA 4PIVA 1NQUA 2FLWA 1C7RA 2ZEJA 1XWWA 4HLCA 3D6JA 2MJLA 4H2DA 1IC6A 4IJQA 5ED4A 1SZCA 1IG3A 1U0BB 3SDZA 2OXRA 4M4SA 3UZUA 1XWFA 2PJZA 2Q49A 2Y05A 5IF9A 2OECA 4UDYX 1CK4A 3TN7A 2FW7A 3C8HA 4MS1A 4WFQA 2JBWA 5ITWA 5BXQC 2FPKA 2BKVA 1HYGA 1Z0JA 2C4VA 4HRYA 4HWKA 3IEIA 2EVWX 1VLJA 4M22A 5EEGA 5JRZA 2MIIA 1ENYA 4UZEA 5EWLA 2ZTMA 2WE8A 4JENA 4MUMA 4BVAA 3IBSA 1CLEA 1U8XX 1LS1A 1T5IA 3HB5X 1F4VA 1HDIA 3UYLA 4D4HA 6GPBA 4MJ7A 1M6VB 4FCWA 3GT0A 3H86A 1RYMA 1M0TA 2AN3A 1MRZA 2VJAA 3CNOA 2B4QA 1A9SA 5ICFA 4BQOA 3EG9A 2YVQA 1P72A 4Z7NB 1X38A 4TRMA 3TE7A 1CG6A 2BT4A 1LPAB 1W8DA 2ISSD 3PNKA 2QVCA 3V4SA 3VR5D 1D2RA 4FXPA 3BXGA 4G23A 4UNPA 5CT8A 3OPMA 2BWJA 2E21A 1K4YA 2NU6B 5IRCD 4ZAVA 2PLNA 2H4FA 4ZEMA 1VCNA 1Y63A 2B5WA 3EGIA 3QKUA 5GJBA 1VL5A 4LZOA 4MUAA 2Q3BA 1G38A 4KSBA 3WVNA 2GSWA 1Z2EA 1KSJA 1DVRA 2VLBA 3ES9A 3EBPA 3VKGA 2FWBA 1CR1A 1STOA 1VJ5A 1T25A 4YH1A 1JZQA 2GFHA 4PSKA 3HDJA 5BN5B 1GTJ1 2QL5A 3DLBA 2H16A 3KKPA 4HB2A 3TLGB 3M1AA 2RE8A 4AWXA 5IAOA 4TT3A 1ONSA 1VXOA 1W5FA 5BV2P 4MEJA 4PZ0A 2J6IA 2N1MA 5HJ5A 3A27A 4WD3A 2VPWA 1PBTA 4OKSA 4MPTA 3BA1A 3N9IA 2VRBA 2ZE8A 3DOCA 2GAAA 3MB8A 4ILEA 4J7CA 4LXGA 4EEZA 4V1CA 3CKMA 5J63A 1NBEA 2RC6A 4TROA 4NEGA 3LPDA 3Q7QA 1E6KA 1C3XA 3CH6A 3W8FA 5BURA 5FKJA 3DAPA 3W9YA 1QIFA 1GPH1 1XYYA 1E3DA 1WMDA 2IXEA 1U9IA 1VGQA 1MA3A 2B3TA 2XBUA 2JKVA 4PNHA 3VDXA 4TRRA 4BKOA 4BFYA 4AKIA 2H59A 1SIUA 1TIBA 3QWFA 1KOJA 2F9FA 1E7YA 1UMKA 2H2GA 2M2IA 2OHIA 4ED9A 4JJAA 3EYWA 1UT5A 4AG6A 4JOCA 2EEPA 1C8LA 5KREA 1N3YA 4MVJA 5JO9A 1RE0A 3LLUA 2DFVA 3MCZA 1R10A 4Q9KA 1WZIA 1DOAA 2W58A 3RT9A 4BL5A 2OD7A 1N5JA 3WK6A 4WMLA 3WA7A 2QN6A 5MFPA 3KKQA 4BAZA 3U81A 1SG6A 1I3MA 2QP3A 2E4XA 3KUUA 3W1EA 4B3MB 1V2GA 2MSLA 4W7HA 2F6RA 1SZJG 4WK6A 1C4XA 4OHRA 4NEHB 4TS1A 2D8AA 4X1YA 5K0TA 3AEQA 2HXYA 4YV7A 3UEOA 4FFLA 4QA9A 4ZVVA 4BIIA 5LQAA 2FEKA 1RXCA 4WY5A 1II9A 4L78A 2Q5FA 3I37X 3P0JA 2VOEA 1EGHA 3S7TA 1FOEB 3EZYA 1Y4DE 1PZXA 3E81A 3IDAA 4E09A 3E8MA 4OXRA 2OORA 4X6XA 3HKBB 4ZXFA 1JQ3A 2BMFA 3VYWA 1J8VA 3MPOA 3R5JA 1DKQA 4D82A 1GR0A 2NNLD 1RAFA 4J4HA 4QUIA 3BMCA 3CR7A 1HL3A 3HC7A 2J4FA 1MEOA 1KDTA 2X0JA 3SX4A 5HQTA 1LLUA 3LX6A 5TF0A 2PMFA 2JGFA 4OOFA 4TQGA 1MO5A 5CUQA 3GF4A 1M1YA 1KZ6A 2YASA 4K1LA 5KOHB 2Z6UA 2QRGA 2E89A 4FU0A 4LNAA 4QDOA 3BHNA 4L2IA 4QU9A 4RAQA 4IZ6A 1JQAA 2QTZA 5ENVA 3ZVRA 3AX6A 2CVHA 3ZE8A 4ZU1X 2GEUA 1P4AA 2TMKA 2I4TA 1XTJA 3O2JA 3FAZA 5LP1A 4GYKA 3KDAA 5HIAA 1QTIA 3VZSA 1M2EA 2CV0A 2JDID 3HO1A 3MT0A 4NECA 4P5PA 4NG4A 1Y1RA 5GZ1A 5TVGA 3GUCA 2IZ1A 1FRVA 3H05A 5F7JA 1OROA 3MHPA 3PWSA 4PINA 2UU9B 3GH3A 1Z29A 3QJYA 4Y18A 2HH9A 1LVGA 3PBKA 3E9ZA 3Q1KA 5K0CA 4UCFA 1FVXA 4JKIA 3A58B 1TT5B 4RQAA 3T3PB 3QVSA 1LLCA 5EKDA 3KC2A 2JCYA 1ORVA 2P9JA 3PUVA 3QU9A 5FOQA 3WB9A 1L8LA 1EG7A 4C1BA 2OWDA 3WGVA 4B31A 1VLZA 4YRJA 3AUYA 3RJ5A 4UEKA 1GEEA 2GESA 2CLDX 2YCBA 2E55A 1AHPA 1SJ9A 3IS3A 2FHPA 1EBUA 1LNZA 4RFSA 2UZ3A 4ZI7B 2QVZX 5K2MA 4B85A 3TX6A 2NPIA 4M88A 2W11A 5C81A 4BMPB 3OM1A 3JASA 2LVBA 3EC2A 1OHHD 4KQKA 1T8UA 4JGBA 2WIGA 1P5ZB 4G6ZA 1DS6A 5JADA 1QYIA 3OA2A 4QEKA 4G09A 5BWBA 5LD2C 5GJWC 1K9SA 3DZIA 5B64A 2BDUA 3KB2A 4TWJA 5CA0B 2XCTB 4UZSA 1GUYA 2PJDA 4IJVA 1IEQA 3HR7A 3PTLA 4YUWA 4XUDA 1P5JA 3PHHA 2WJ4A 1EAMA 3EXHB 5CGZA 2PUDA 2W48A 1U5BA 3QEJA 3AJDA 3A6JA 3KELA 1KYXA 4IIEA 3FYDA 4REOA 3TQSA 3DLIA 4MQ6A 1FJ2A 5KQGA 5LMCA 1D2HA 1AKYA 1JECA 3C7AA 1THMA 3EQ9A 2QW1A 2VZ8A 1BKSB 3I1YA 3OJWA 3H2KA 2XVYA 1RKVA 3I09A 1X1EA 3KX2A 2J87A 3B9BA 4DVJA 1DPGA 4KXWA 4DA0A 2JH3A 2PKQP 1NJ5A 2ECPA 1MJFA 2J48A 3E3AA 3FJOA 4JCOA 4JT8A 4LX0A 3GFTA 4PM4A 5CYOA 1UXIA 2NO7A 1SUBA 3ZHXA 4E70A 1IHPA 2QMUA 3BJRA 1GP2A 1PG5A 1DRUA 3H1BA 4JJ6A 3TZ6A 2O8BB 4EHIA 2EFGA 5J1SB 1A69A 2XNJA 1VP3A 3KZXA 3S0JA 4HS9A