4QPZA

Crystal structure of the formolase fls_v2 in space group p 21
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
563
structure length
563
Chain Sequence
AMITGGELVVRTLIKAGVEHLFGLHGIHIDTIFQACLDHDVPIIDTRHEAAAGHAAEGYARAGAKLGVALVTAGGGFTNAVTPIANAWLDRTPVLFLTGSGALRDDETNTLQAGIDQVAMAAPITKWAHRVMATEHIPRLVMQAIRAALSAPRGPVLLDLPWDILMNQIDEDSVIIPDLVLSAHGARPDPADLDQALALLRKAERPVIVLGSEASRTARKTALSAFVAATGVPVFADYEGLSMLSGLPDAMRGGLVQNLYSFAKADAAPDLVLMLGARFGLNTGHGSGQLIPHSAQVIQVDPDACELGRLQGIALGIVADVGGTIEALAQATAQDAAWPDRGDWCAKVTDLAQERYASIAAKSSSEHALHPFHASQVIAKHVDAGVTVVADGGLTYLWLSEVMSRVKPGGFLCHGYLNSMGVGFGTALGAQVADLEAGRRTILVTGDGSVGYSIGEFDTLVRKQLPLIVIIMNNQSWGWTLHFQQLAVGPNRVTGTRLENGSYHGVAAAFGADGYHVDSVESFSAALAQALAHNRPACINVAVALDPIPPEELILIGMDPFAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Formolase
publication title Computational protein design enables a novel one-carbon assimilation pathway.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
total genus 186
structure length 563
sequence length 563
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2014-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00205 TPP_enzyme_M Thiamine pyrophosphate enzyme, central domain
A PF02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain
A PF02776 TPP_enzyme_N Thiamine pyrophosphate enzyme, N-terminal TPP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qpzA03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qpzA01
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4qpzA02
2PGNA 4X3PA 5MGNA 1OLXB 2OO5C 2XTAA 2OZLB 1Q17A 4UTRA 3K35A 1J8FA 4D5GA 3EXHC 3D4BA 4FEGA 1V16B 4UU8A 2UZ1B 2JI9A 3CLTD 1OLSA 2JLAA 1DJLA 1AY0A 1W88A 1Z8NA 2BEWA 2H4FA 1W85A 5ERXA 2A1TR 3M34A 1WCIB 4X3OA 1X7XB 4RJJA 5DEIA 1ICIA 3ZGVA 1NI4B 5HYVA 4K9MA 4RJKA 1V5GA 4K9KA 1T9DA 2C3YA 1UM9A 1MA3A 5EJAA 3RIGA 2BP7A 3LQ4A 3RIMA 1V5EA 1EFVA 3DUFA 2O1XA 4MPPA 2IEAA 1M2HA 1YNOA 1M2KA 2FN3A 1X7ZA 2QQGA 5ERYA 2OZLA 2VBIA 4BUZA 5EJ5A 4J16C 2BFBB 1RP7A 1SZCA 4TWJA 2E6KA 2G28A 2Q5QA 1U28C 5MFZA 1X7WA 4FZ3A 5EXDA 1M2GA 1S5PA 1UMCB 1GPUA 3EXIB 2FSVC 1QPBA 4UTXA 4UU7A 3DV0A 4JT8A 1U2GC 4V1CB 5HGXA 3AHDA 3U31A 1NGSA 2QTCA 2VBFA 4MZXA 4KXVA 4I5IA 1D4OA 2BFCB 4JSRA 4KXUA 2DJIA 2JI8A 2QQFA 4HD8A 3JR3A 3LQ2A 3GLTA 3L84A 4IG9A 3HWWA 1POWA 3KOMA 2H4JA 4C7BA 4COKA 3AHJA 1BFDA 4UTZA 1X80A 3F6EX 4KXXA 2WVHA 3UPTA 1OLSB 4JU8A 4Y6LA 4V1CI 1W88B 2BEWB 3EXIA 1UPAA 1PNQA 1V1RA 2O1SA 1SZDA 1YI0A 2BEVA 4BV2A 1OZHA 3EXFB 2QTAA 4V1CA 1ITZA 5EJ6A 5K6RA 4Y6QA 3OOYA 1YTLA 1UM9B 2B4YA 1O97D 2C3PA 2BP7B 2H2FA 4JT9A 3DUFB 1XLTC 2BFCA 1X7ZB 1QS0A 4QQ8A 3ZHRA 3AHCA 1Q14A 3DVAA 2H2IA 2AG0A 4QELA 1IK6A 5MFPA 1NM5C 3EXHA 4K9LA 4UUAA 3AI7A 5HJEA 2Q29A 1X7WB 2PANA 3PKIA 2A1UA 3ZGOA 2EZUA 5EJ4A 2EZ9A 4HDAA 3D81A 1HZZC 3DV0B 2R8OA 3MOSA 1UMDA 3E9YA 1Y9DA 4K9PA 2IHUA 5K2OA 5I5EA 1YC5A 3EXFA 2C42A 3AHFA 2EZ4A 2JI7A 4JUCA 2C3UA 4JD5A 4RMIA 2R8PA 3AHGA 4QPZA 4RMJA 1PNOA 1JSCA 2R5NA 1TKCA 4UUBA 5I51A 3OE1A 3ZHTA 2Q28A 1X80B 4BVGA 5ESDA 1V1RB 2X7JA 4XEUA 2FR8C 2BEVB 1N0HA 2G67A 2Q5OA 2VK8A 5AHKA 1TKAA 3ZHSA 4GP9A 1YD7A 2G25A 2EZ8A 4GM0A 4BN5A 4K9OA 4FVTA 5I5GA 2H2DA 1EFPA 2OD2A 2Y0PA 3GLUA 2J9FA 4BV3A 2OORC 1QGDA 3JWPA 1QS0B 2JIBA 2BFEA 4JU9A 3DVAB 2PDAA 4R8MA 1YHZA 1B0PA 2EZTA 3EXHB 1KEKA 4UTNA 5K6TA 2VJYA 3AHHA 5EJ7A 4JUBA 1PVDA 2HJHA 4JUFA 5D7NA 1OZGA 2NXWA 1TKBA 4IAOA 1PTJC 3IAFA 2FRDC 4UTVA 5BWNA 2IHVA 2VBGA 3LPLA 3IAEA 4ZZIA 4K9QA 1UMDB 1T9BA 2BFDB 1PT9A 4IF6A 2VK4A 3EY9A 1R9JA 4F56A 1OZFA 3ZHVA 3ZG6A 1PI3A 1PYDA 2WVGA 3PDHA 4C7VA 3LQ1A 1DTWA 3CLRD 3M49A 3EA4A 2BFFA 4BVEA 5FEMA 2NYRA 2V3WA 3ZHQA 2H59A 4L3OA 1UMBA 1V11B 5FYQA 2C3OA 1YI1A 4GG1A 1OVMA 2H2GA 5C4IA 2C3MA 5MF6A 3EXG2 2YICA 4O8ZA 2BFDA 1Q1AA 4RMGA 4F4UA 1YBHA 3EYAA 4G1CA 3PKJA 2J9FB 3F6BX 2WVAA 4JUAA 2H2HA 3HYLA 2BFEB 1UPBA 5EJ8A 3FSJX 4BVBA 3EXG1 2FWNA 3EXEB 5I4IA 1O96B 4Y6OA 4BVFA 4L2IA 1V1MA 2JGDA 3CF4G 5HHTA 4RMHA 2Q5JA 1S7GA 2JI6A 5EJ9A 1OLUA 3FZNA 4MQ5A 1TRKA 1U5BB 1V5FA 4KXWA 2BEUA 1V11A 2OD7A 3D7KA 2IHTA 2Q27A 1T9CA 4KPUA 3M7IA 1X7YB 4GPEA 3AHEA 1OLXA 2JLCA 1U2DC 2YIDA 3RIYA 4MPJA 3UK1A 4TWIA 5DGDA 4KXQA 4KXYA 3ZHUA 3HWX1 1DTWB 4RJIA 2C31A 4JUDX 1V16A 2H4HA 4K9NA 3FLMA 2UZ1A 3GLSA 4KGDA 1E3TA 2BFFB 4GM1A 3EXEA 1U31A 1UMBB 1WCIA 2XT9A 5BWOA 1X7XA 1M2NA 5EXEA 5DGTA 1PO7A 1NI4A 2Q5LA 4D5EA 5BWLA 1U5BA 2UZAA 3CLSD 2XT6A 4FEEA 1YHYA 2W93A 3CLUD 1T9AA 3GLRA 1X7YA 2PGOA 2AG1A 5IMSA 4MPRA 4WBXC 4Q9DA 4C78A 1M2JA 2BFBA 2BRUC 3U3DA 4BN4A 1UMCA 1Q6ZA 1W85B 1V1MB 2JGDB 1YC2A 1ZPDA 1POXA 5K3SA 1UPCA 3M6LA 4C7XA 1OLUB 5EJMA 2OD9A 2BEUB 3AHIA 1MCZA 4J1TC 4ZP1A 2VK1A 4GM4A 4BVHA 1L8AA
chains in the Genus database with same CATH superfamily
4L3WA 2YIMA 3EUAA 1OT5A 5AKHA 4PF1A 1QGUA 2OXIA 2OZLB 3AEYA 3CZAA 3FTPA 4M9UA 1VI5A 3E70C 1DIBA 3CRRA 3JD2A 4YPOA 1E9RA 2FOLA 2GLUA 3PE4A 5L51A 1B73A 4MUAA 4QNRA 4EY7A 3U0VA 3ZCUA 5LZ7A 2AJBA 3BZBA 4K6KA 1S2LA 4US2R 5ALNA 3EAFA 4UM8B 2C9OA 1O4VA 2BJWA 3SJ7A 2CV1A 1BRMA 4Y9TA 2WKRA 4XLTA 1UBKS 4J7CA 4KRYA 3R3UA 3I1IA 1SIOA 3C5CA 3R0VA 2CBXA 2YRXA 4B3IA 3ORFA 4JLUA 2NVUB 4G9BA 5JR3A 2O5RA 4TSKA 1W6UA 3AL2A 3AFNA 3FA2A 3MBKA 1P1RA 5COBA 1IUOA 2P5SA 5F5XA 4O4HB 2GD2A 4ZC1A 4PZZA 1WXIA 2GZMA 4RK1A 4XIGS 4IIYA 4J4HA 4TTIA 3R5JA 2YV2A 1C8KA 5EUQB 3CCFA 1SCJA 1MAVA 4Q4AA 3GWGA 5DEIA 1CJCA 2AVDA 4IO0A 3BVPA 2Q9BA 3TQSA 3L6EA 3UWKA 5LSAA 2V8BA 3FNFA 2P1DA 2J3QA 3MJDA 1UM9A 4RF2A 4YUXA 3B1JA 2RHDA 4GXRA 4MCAA 4U2KA 2JGJA 3VAZA 1RE1A 4CM4A 4EAAA 4G25A 1EK6A 4CKZA 1ST2A 1W75A 1VPWA 4RNDB 3K4QA 5FFNA 3MTGA 4YV1A 1E9DA 3AKZA 1K7FB 3EVZA 1G8FA 2VDQB 5KDDA 1GT91 2CL7X 1YVEI 3W1EA 1E9EA 1YRAA 4D81A 2VSQA 1D1PA 4QQRA 2IDZA 1RQRA 1U0LA 1ZZEA 2R6R1 4GX5A 2FN9A 2V7GA 4TV9A 1E2EA 2MU1A 3O4RA 4FD2A 2XHZA 3IE2A 4LGYA 2OFFA 5SZKB 4A8JC 2G8NA 4N1AA 3F6SA 4PSAA 1Y3IA 3VU9A 4HQLA 4YEDA 3TW0A 1JEJA 4LRTB 3RRMA 4BEBA 2QM8A 1YVRA 2PWPA 1ULTA 4UTXA 2C5SA 5ICFA 3VKUA 2AN1A 1W5EA 4CQNA 2OO7A 3PEWA 3GJQA 3D2CA 4RZ2A 2QVXX 2ZSHA 3MB5A 4FFSA 1U2GC 2X9NA 1GY8A 1HL7A 1WU8A 1DPFA 2JK0A 3T7JA 3OQIA 4OA8A 2QQEA 1NXQA 1SC9A 2H31A 2ODWA 5IT5A 1F14A 3E22B 3AF2A 4BLSA 4MZXA 2R6HA 3PVZA 5CXUA 3OTGA 1ECPA 4GXQA 2G40A 2NUAA 4RANA 6ADHA 4MB2A 1U3WA 2EDAA 2PQ0A 4XOUA 1CNFA 2IPXA 1FNBA 1M8GA 4BWVA 5IN4A 1U0RA 1A3CA 2CMKA 1M34B 4IV0A 1UPUA 3AESB 1WP9A 5ILQA 1KFKB 2OXEA 1RC0A 2QN7A 5TPWB 3UB3A 3FUXA 2ZRMA 3WV4A 5A4MS 2CT8A 3ZE7A 1JFLA 2M6RA 2XOXA 4XIIA 3U6BA 3W77A 4FLEA 2WM8A 3OESA 5HF9A 3RU3A 3TSOA 1L3CA 2IX3A 4LMAA 3AF0A 4UFPA 1J2UA 1CY4A 2VHEA 3R5HA 5AJWA 1BDBA 3IUSA 4KLCA 2DFTA 3LK7A 2QIOA 5DCWA 1GL3A 3ZE9A 4AWXA 2ZOSA 3PEFA 1DUSA 1L7XA 1XYYA 1ZX1A 3NBYC 4NOJA 4RIEA 4MGZR 5H82A 1LSSA 1XA0A 2ID8A 1CQPA 1VKNA 5EUCA 5TEVA 5DM70 3JALA 4JC8A 3W06A 4Z4EA 2VJBA 5BYKA 3D3NA 2GM5A 1DUIA 2BEVA 3SNKA 3DL2A 4S04A 3GFOA 1P7ZA 4ACBA 2WSBA 2GA8A 3IUEA 2ZR8A 4OBWA 4NENA 1P6UA 4Y6QA 4UPVA 1ZUIA 2XF8A 5LZ8A 2FWAA 1Y1TA 2A92A 3GUZA 1QXSA 4H17A 4N3GA 2PE5A 3HBJA 4RDIA 4FR0A 3ZXSA 3A37A 4PS1A 1MA0A 4B45A 2AFVA 2H2FA 2QZ4A 3EHDA 3L6BA 3OIDA 4Z7JA 3HL4A 3I4FA 1X7ZB 3RIEA 2ZWVA 3FOFC 3LOUA 5I7WA 4KDRA 1TO2E 4B5KA 3OZCA 3D0KA 1Q0LA 3KQKA 4A10A 1SPBS 3PSHA 4AJEA 2Y92A 1ECLA 2BM0A 3ZVNA 2CXNA 4XQCA 3EODA 3USZA 4G3XA 2MCFA 2KWIA 3TM5A 2ZT6A 1QV9A 2NXCA 2OYCA 2AEEA 1NXPA 2K2WA 4B09A 1GITA 2F43A 4ZWNA 5AD1A 3OJFA 3WGOA 1CRWG 2FPSA 4JIMA 5ESXA 2P91A 1XCMA 3SLRA 4YPFA 3TSAA 5A5EA 2CXPA 4RZXA 2RARA 4XAQA 5JY1A 3RC8A 1TMGE 3ZD8A 4MO2A 1VSVA 1HDCA 1H9AA 2FPGA 3Q3GE 4HMPA 4Q1FA 4UHEA 2PS3A 5D84A 1N4AA 3QU7A 4L4SA 3TMKA 1VSBA 3EG9A 1H6DA 4CKCA 5IDXA 4KO2S 4OVKA 4KI0A 4LSMA 4CL3A 3DSRA 3AHFA 4JGGA 3NCHA 2E87A 5JNUA 2CLHB 2I6GA 3RS0A 1L7AA 1KOGA 2CVQA 2C3UA 3P26A 1ISFA 2GEUA 1FX1A 1M3SA 4GMDA 4BFCA 2H08A 4GBJA 2LZ0A 4ZYLA 4IH9A 3VRHA 4AJ1A 1T8WA 4ARAA 3UWMA 1CZOA 1QQAA 1GUZA 3OE7D 4G5QA 3LSTA 2QJFA 4AMVA 2PMCA 4FWBA 3QVGB 4V2UA 2IEYA 1BCSA 4CCYA 5J2UB 3KT8A 2CVFA 3EMKA 3PFBA 4FBGA 2WHYA 3RS8A 3PNYA 1YQQA 1E18A 1QMPA 2OK7A 3RHTA 2ATXA 3V55A 4AJKA 3ZDQA 3ZW9A 3P2YA 2NO0A 3EZNA 2D0DA 2AW3A 2VYCA 3I6BA 3NP7A 3PXDA 4RZIA 4ALMA 1A9ZA 2GBIA 1ADGA 3EIOA 4H7IA 3TUIC 4BE7B 3GLGA 1U0BB 3GRFA 3NEAA 2H3HA 3CM0A 1DINA 3UMCA 4OFXA 3LDGA 1G5HA 2HWXA 5CLHA 4D4HA 2GBLC 4MMZB 3TOZA 5GAJA 2CNDA 2OK8A 2XDWA 5JNRA 3ZZ0A 3BIFA 5CT9A 5F1OA 3ETCA 3MOGA 3R7DA 3LA8A 2J4DA 3PHIA 4MVCA 3EDRA 2IE0A 5BRNA 1X1AA 2ZXUA 4B6SA 1K8QA 3B82A 1RD4A 3KQLA 1P5FA 2JZCA 1ST3A 3SEFA 2H2DA 3B48A 2CJWB 2UVPB 3MCAA 4LHXA 3QW2A 4CLRA 3VR5A 2YW9A 1JVSA 3E5MA 3B8HA 3ND6A 4F2PA 4MQ6A 5JNVA 1GAJA 2BY4A 1NBHA 3ZIUA 1NAHA 2B5VA 3B1KA 4DA4A 1CZLA 4NEHB 3OHPA 3OY2A 4P81A 1B0PA 1H94A 3FMIA 5E95A 2DPYA 1KERA 4FGLA 2GPJA 4Z3DA 4F96A 1VRVA 3TJMA 4FB4A 3OA2A 3K70B 4LSGA 3GT4A 1Q0PA 4M98A 2AKEA 3AHHA 5CHYA 3EH2A 3F5SA 3V6LA 1ZQ9A 4ZJUA 3P4UA 4ZOLA 2NXWA 1O94A 3IIMA 4R2KA 3NBZC 3K5HA 1EGQA 3IUQA 2D0PB 4GIBA 1SM4A 2OQRA 4J7UA 4Q1CA 4A0FA 3L7JA 5AKKA 4DCCA 1NRWA 3F5QA 5DYNA 1ZXXA 3NOQA 3ULKA 2BCEA 2FQ1A 3HABA 4P0QB 2IT1A 3IP1A 5DN6A 3AG6A 5DXFA 4UAVA 4GEGA 1E2LA 1QJ4A 2Q6IA 4BKQA 2NMVA 1E1CB 5ITZA 5J47A 1RM3A 2IITA 4N5LA 4QJ5A 5EXSA 3ZDFA 3LJKA 3AEKA 3EY9A 3U7QA 1JG4A 1A2OA 1VP9A 3UH0A 5K8VA 2O14A 3ZHVA 1S4QA 1U8XX 3HO8A 2GVDC 2XVYA 1ESDA 2E1PA 2FSGA 4MARA 1QP4A 1AQUA 3QMVA 4AX4A 2D4HA 2Z04A 3IVMA 1RAIA 3LXXA 4CU5A 2CKMA 3IAXA 3WA6A 1A2KC 3IUNA 1IM2A 2GBPA 4G0WA 1YR2A 1YRHA 4PYLA 1OBHA 4Q34A 5CVDA 1KPIA 2FLVA 3NHKA 2OPHA 2EGHA 5CNKA 3JQFC 1PWHA 3KQWA 2ZRAA 3RTCA 1VL5A 2DR0A 3SEQA 1J42A 1NW7A 2NW6A 2VJMA 4X00A 1C1HA 1NASA 4IV8A 1NQOA 1I3OA 1QRRA 3B1YA 2JKVA 3GDHA 3ZBPA 5JNLA 2YOFA 3TH5A 2CLDX 2GT1A 1XN1A 1W19A 1Z8FA 2X7HA 2H59A 5AI0A 5F52A 2RCNA 2WJVA 5DLYA 3WGLA 4F11A 2P9FA 4Q9HA 4WZAE 5EE9A 4Y9RA 1Z18A 2YH2A 1XZPA 3KQPA 1JSRA 1Y1RA 1XPUA 4DMGA 4RKFA 1L5RA 4BRSA 2C3MA 4EL5A 2VP5A 1N8NA 3U1VA 4MHOA 3TIFA 3TRIA 5LXTA 4FJ1A 1NSFA 1YMUA 1KAMA 2J3LA 3TLYA 1W36D 1GVHA 2FWJA 4OBBA 4WWHA 4OXRA 4YLEA 3EA0A 4EG6A 2VPXA 4TM8A 2CNLA 3CVJA 2J9FB 2W6NA 4BVGA 4XA8A 3ENZA 4CHTA 3F6BX 4E5KA 1MC5A 5JDIC 2QTLA 3OTHA 3P9RA 1IUNA 2QVGA 3AV3A 2HRBA 2CW5A 1LDYA 3CUKA 4IMRA 1GCGA 1W5TA 2OXRA 2YZGA 5FPQA 3FYTA 3W7AA 4AF7A 1HE4A 1YA8A 3DE4X 3N87A 4W9NA 1DC4A 2VLBA 5AIAA 1SY7A 4OHUA 2Z1NA 3EASA 3OX4A 5HF6A 5DV9A 3ROGA 1QR2A 1U4NA 3GRKA 3KE9A 3OEHD 4BPRA 3MC1A 4A36A 2PRZA 1DWUA 1RWBA 4QHYA 1XAIA 4Z0HO 1P4RA 2UZ4A 1CRZA 1T8SA 4GYJA 1LDEA 5HJ7A 2FETA 1Z88A 3AOEA 4YYEA 2WTEA 2XTJA 4HDRA 3S8MA 3FFWA 1X0VA 4P58A 4X93A 1IEXA 2PLAA 5A3RA 4WDRA 1E5DA 1JA9A 1CQIB 3WHKA 1QYCA 1ZIOA 4Q01A 5K0SA 1KFBB 1B00A 4M53A 5PGMA 3UYLA 2P9CA 2NNWB 2GMWA 1UXOA 1MG5A 2CXSA 2Y71A 1C1XA 1U1DA 1G6OA 3BJZA 1NQUA 1Q15A 1QG6A 2PK3A 3HXTA 3JRWA 4JYBA 4B81A 1M6EX 1UK9A 2P27A 2WTAA 4L28A 1YKSA 3FPSA 4RLHA 5H16A 3KQTA 1E1DA 1QHIA 3CEAA 4KDCA 4RHFA 1Y7IA 4MRVA 1X9HA 2IYYA 4IUDS 1XF9A 4H1TA 3LW7A 4HQNA 4NG5A 5AWFC 5LQDA 1NVBA 3MUEA 5KQSA 4DCMA 4RJIA 1YB5A 1MV8A 2B0CA 2FXVA 2RK4A 3ED5A 2ZI6A 3ZBTA 3QGMA 1BOFA 2G80A 1NSTA 2OHIA 4FOLA 2C1EA 4ZT4A 1C9YA 4ZYZA 4U6SA 3R76A 2PLRA 1G7TA 4Y2XA 2GKSA 5AW5A 4J0QA 4QHTA 2H17A 2ZBQA 1HF3A 5LOVB 1OXXK 1OZ0A 3F6CA 4P3XA 1RHQA 4RIHA 1WCWA 2PM8A 4P83A 1YA6A 1UXJA 4C89A 3CF0A 1FZQA 3CTMA 2QX7A 1E59A 4FW9A 3VC7A 4ESHA 1L6IA 1PTJA 1T1RA 2ST1A 3RAFC 1Q84A 1J06A 2IDKA 3EZFA 4PXAA 4EHKA 2OL4A 3RFXA 4C6TB 5BWLA 2IHZA 5H3CA 1P1CA 2DPXA 1EDZA 2XT6A 2K87A 1J25A 1QCYA 3MWYW 4LBVA 1W49A 4PQRA 5CU7A 1ZESA 2N42A 2UZ3A 3SR0A 5HPYB 1QUEA 1XFAA 3G9TA 3MN1A 3NHBA 4AICA 2JFFA 1TYCA 1CDDA 2HO4A 1EWRA 1WY5A 4I6GA 4AP5A 5IMSA 1HT2E 1WBDA 3PC4A 1ZWKA 4EVSA 4Q9DA 1EM8A 3V4SA 2O2XA 1BMDA 2PL9A 1TU0A 4UEJA 2YZKA 3M4XA 5GMOA 4W9MC 4M0PA 5IJ9B 2NTNA 1UJ5A 1XEXA 3IDAA 4ARZB 5A05A 3QVVA 5HXAA 1PKXA 3B6KA 3ZU5A 5LBUA 3KLPX 4RABA 1GR1A 4BFSA 4YRSA 2ANBA 4IMJB 3D4OA 1E96A 4QGHA 3I61A 5KTTA 2PT9A 4NK4A 1DXHA 2HSDA 3I9JA 5IAEA 4I2NA 4DJ5X 5DI3A 1JE1A 4H4EA 2JAOA 3M6LA 4GSKA 4B7XA 1UODA 1W36C 5F7ZA 1GUYA 4O1HA 1TD1A 5ILGA 2X0KA 5I3ZA 2XMCA 2XGOA 1RXYA 1MCZA 1TCVA 2XRYA 4Q39A 3IP3A 5EWLB 3ONWA 4ZP1A 3ZK8A 4KR7A 2W6MA 5IKOA 3S3TA 3C3WA 2DUWA 4PZUA 3ZI7A 3B13B 3MCTA 4PYMA 2PGNA 4HUQB 2X3FA 1QFSA 1YQDA 1U5AA 2R7AA 3DS8A 3O2NA 3PHCA 4UUQA 3WNVA 2BELA 1K75A 2QXTA 2WSYB 2XMPA 2VKTA 5WRFA 2RGWA 2DHCA 3HN6A 4KUHA 1X1QA 3TGWA 3EXHC 3KYDB 2ZRPA 3G8AA 3FSGA 2EDCA 2XGMA 4G23A 1QO9A 1N0UA 4K9SA 2YN2A 4OSEA 5JRDS 3SS9X 4NWIA 3L6UA 4MIYA 1SBYA 4R31A 5IRCD 3MNFA 1DG1G 2HIMA 4LGCA 4BE4A 1NVKA 2BGRA 3RTEA 4KYIB 4LOAA 5BW4A 1Z2AA 1XAJA 4PIPA 4D9EA 1DJQA 4LZNA 1WX1A 3HNOA 1EBBA 1WZEA 2C95A 4AG5A 4FONA 1KK0A 4C4AA 4Z4QA 1M2OB 3IPXA 5JSUA 621PA 1EEXB 2B83A 3CLVA 3KXPA 3QVMA 4KI7A 4Y2VA 5KAPA 4DRZA 3E27A 1IXRC 4YRAA 2D1RA 4U00A 3M70A 3MZ0A 1Q95A 2C5LA 1YIAA 4CLOB 1OH8A 1S3SA 2GESA 2XTMA 2JS7A 3ORHA 2GPNA 2Z6VA 3PC7A 4I9NA 1E5VA 3LNTA 2FZVA 5ED0A 5F77A 4YRFA 2C3YA 1LRLA 2KLBA 1JV2B 1TIKA 2Y4NA 3G5UA 3KPVA 4GOKA 2HI0A 1A2QA 3BMXA 5DMHA 5FWYA 1Y8RA 3DONA 2NUTB 4ZAGA 5EKSA 1JXOA 4R68A 1RQNA 1Q0TA 3GT0A 4ZAFA 4MPPA 3PTAA 1JFVA 4M0LA 3BWMA 3P9IA 4WZBA 1NQ5A 5C8DA 5H8WA 2PX5A 3TVTA 1U2DA 5H4HA 4E13A 5DNYB 1G8YA 2FQYA 1QZTA 3HYRA 4EGAA 3DV2A 1RP7A 2PWZA 3KWFA 1K5GA 2ZUSA 1AMUA 2Z2ZA 1H6AA 4Z54A 3J80A 2JLQA 3VH3A 1EESA 3OCXA 2ECPA 4R16A 4YV7A 4IGIA 3VR3D 3KVNA 3WA7A 1U0TA 2GFIA 2NZJA 3QHQA 4B74A 5JVDB 4OI4A 4AYTA 4ZCIA 2B1QA 1LNQA 4PQGA 4U6QA 4YY3B 2E37A 3PF9A 1FLNA 2PLFA 4JT8A 1NJ1A 1UF9A 2BZ0A 3VO8A 1EKXA 2OCKA 1XDDA 4AKEA 3EGXB 1U5CA 3GXBA 1WXWA 4KE8A 4AVYA 3PXEA 2PY6A 1R2QA 2VBFA 3KE8A 4KBGA 5EVJA 1ZNQO 3BHMA 4HUJA 3K9WA 4BNXA 1ZSVA 1F4PA 4PBRA 4WKOA 1A9QA 1PJ8A 4XX0B 3W5VA 2XMQA 3DMFA 2ONCA 3NRBA 5TMPA 1P7WA 1RI3A 1WZNA 1ND5A 4IVNA 3DFFA 5JE8A 2ZU0C 1QP8A 3HBLA 3NB0A 5ALHA 4N0DA 3RUDA 5DXAA 4WA8A 2XWBF 3NEJA 4UNRA 3HJTA 3F6YA 3KWMA 4L5CA 4MUEA 2FX5A 3IBCA 4Q18A 4URVR 3C1AA 1AB6A 3TKAA 3ZGNA 3HCEA 2A33A 4OQDA 4TTRA 3T4PA 5LJLA 2FY8A 1ZD5A 1JFFB 2GVZC 1VJDA 2D13A 4MLCA 1T5DX 1ENOA 1T2DA 2GN0A 3COVA 3FCOA 4KAXA 5HF8A 4FSXA 3I39X 1CJSA 3NHFA 1US8B 1GGMA 4K40A 3TUZC 2XB2A 3VYWA 2G4CA 4BMOB 3LIIA 3PR2B 4ASUD 5FWXB 5E8JA 3GFPA 5G3ZA 2ORYA 3UKJA 1CB7A 4MMXB 4Y6GB 5TQ2A 3ILSA 3NWJA 4GO1A 4MUJA 5C18A 4WINA 3RC2A 4HTFA 2AUNA 4A6DA 1T0BA 1SXJA 1RIFA 3IUBA 4DYVA 3ZBUA 1YRYE 3DHYA 1AXGA 1YR1A 1T6ZA 2FMFA 4P86A 3WBKA 4LF9B 3WSTA 4LC1A 1N9ZA 2B4YA 4UXHA 3ZGLA 1GPLA 1M66A 3EGDB 4H6XA 3LHSA 4HLUA 5CM2Z 2BP7B 3HXLA 3QKRB 5GJCA 2ATCA 1V3UA 4J4BA 3SI7A 3JQAD 3WZLA 4DLPA 4RX1A 2ACEA 1CQWA 3KC2A 3STTA 2O5CA 3PB3A 1UDRA 2DCMA 3KOUA 1BU8A 4G2NA 4AN0A 3PXXA 3QBTA 1CP2A 4OKNA 1UXHA 4N7BA 4M6WA 1A95A 2B1IA 3L0DA 3MWDA 1IAVA 2YUIA 3W3AH 4OQFA 1AT1A 2JEOA 1FF9A 1MENA 1Y9EA 2VCEA 2GPYA 4CQMD 2PA3A 3BTVA 3QX9A 4RIGA 5BSEA 3DDCA 2VT3A 4LY6A 4RSHA 3FTNA 2YDYA 1IB6A 4YCMA 4JMPA 1OIWA 1NDUA 4TKVB 4B17A 4XH9B 2AD1A 3FLBA 1M6YA 3LW8A 1OCEA 4XW2A 2EX1A 4YAJA 2HEIA 4DWOA 1Z28A 2NZXA 2AEMA 2PX0A 1R6TA 1VMEA 3K9HA 4REOA 3BQ9A 3BTUA 3VDXA 4FCVA 3VR2D 3FUUA 4DC0A 2GILA 2FP4B 4TRMA 1DAMA 1XO1A 1YE5A 1YMQA 2PGDA 4X7BA 3WQHA 5LZ2A 3P9YA 5JG7A 4D8UA 5JQGA 3LYHA 3CG0A 4AMUA 4F4JA 5AVSA 2Z8ZA 2PL5A 2WIAA 1Y3HA 1J6UA 1IXKA 3FYCA 1T9ZA 1IY2A 1KNQA 1WULS 3N05A 3TTTA 3NIDB 3GP3A 3I0MA 2V1XA 4RA9B 3TO5A 2YOHA 5C81A 4IJ5A 5AW3A 1JG3A 5K03A 3WE7A 2WP8J 3NWEA 4X97A 4B2PA 4EKNB 2BBWA 2DOKA 4YWJA 4RMJA 2XNHA 1NX9A 1LC0A 1U99A 3UV3A 4FU0A 5DDIP 3G7UA 3DG9A 3B89A 4MVXA 2MOKA 2WZBA 4V03A 3PFCA 5K0EA 2B1GA 1LX6A 4KDFA 1C3VA 4LUCA 3ZWNA 1MJGM 3AB8A 5CLIA 3AKDA 4QO7A 1Q3KA 2Q28A 3WK8A 1NUQA 5IVKA 2IJGX 1GGKA 2G1AA 5DCUA 5DM4A 2ZJ6A 3WMRA 3OQNA 4EJMA 1WSDA 3OQHA 1Z0IA 4NYIQ 5MHTA 3A4LA 4B0PA 1O8BA 1SZPA 5EKDA 2FR8C 2Q1XA 1C7JA 1TUBA 2YY7A 3L0PA 4HGZA 5AHKA 1XMVA 3GJ6A 1X42A 4YCBA 3OPVA 2WDZA 2CYAA 3PHHA 4BO3A 4XGRA 3K2BA 4LYYA 1AHNA 2YC2C 1E62A 3ESAA 3GHHA 3PYXA 4KJZA 4INJA 1YQWA 3FCEA 5ALIA 5TGTA 1NMYA 1IM5A 3STXA 2NX2A 1NATA 1Q0HA 4J2TA 3LYUA 1WIWA 1MFZA 1YZVA 3FBGA 1QS0B 1SBZA 1F48A 2BD0A 3PUYA 2VRCA 3L8EA 5BRAA 1VPVA 4PLPA 4WD3A 3QX8A 2ENWA 2Z98A 3DVAB 1G0OA 3ITKA 1S0UA 2EVWX 1UEXC 4L15A 4RVSA 2VJQA 3GD5A 4X20B 2CJFA 3TBFA 4IDGA 4R1MA 1DCTA 4O4LF 3TJRA 1EUDA 1IEWA 4JNKA 4A27A 5I4KA 1SULA 4D4GA 4R5MA 4G56A 5DRYA 3ZDRA 3GJ4A 2WU8A 4CLDA 1NFRA 1ZUD1 4NPAA 2R5WA 5TRTA 1E0JA 2IPAB 4MSUA 4TMKA 5EJ7A 4EL0A 3VJKA 1HK7A 1DC5A 2QPLA 1TVKA 2WM9B 1UC4B 1L4KA 3NTVA 1XTSA 2ZCJA 3DLBA 1NLYA 2A5JA 2W0SA 2ZTUA 3CX7A 3E2MA 3IDQA 3LBAA 3SXUA 4P3NA 2FRDC 1MH9A 1X92A 2P90A 2VBGA 4XRRA 2PYDA 2VJPA 2ZW9A 2G83A 3ETNA 4GBED 3V1YA 4DUPA 4F4HA 4K9QA 3SXPA 2X4LA 4Z6KA 3DBHA 5IEJA 3V7WA 4ESOA 3COWA 4E21A 5LQKA 3K72B 3ROQA 2DQ4A 1XMQB 4M1WA 4H3HB 1RXIA 1GNRA 1I13A 3OLWA 4OD0A 3MWEB 1A9PA 3NYWA 5J1TB 4GL2A 4B4VA 4BMZA 4HX5A 1Q1EA 1F3LA 2GAJA 3U9SA 1XAHA 2C7GA 4I2VA 5DP1A 3RGWS 2C2GA 3C8UA 3AOGA 2G1PA 1ECFA 2R2GA 2QSYA 3GBSA 2ZI5A 3IGFA 1Y4SA 2HDOA 3K73O 3CBQA 3KYJB 1GXSB 1KU6A 1S96A 1XTVA 2ROQA 5B2ZA 4IHAA 3LHDA 1HEUA 4CF5A 1J49A 4Y1GA 3BHIA 3BEDA 5EOVA 1VI6A 1Y5NA 1FP2A 4BGEA 5AVYA 3KJGA 3VUFA 2RHWA 3IUPA 4R1TA 3NC4A 3T7CA 1E89A 2I7VA 1B8VA 2BMEA 3ZV3A 4LQCA 4FFBB 2NTYC 5TV2A 4DIDA 1CQJA 1DELA 3N6VA 4YIKA 3ZHQA 3PQDA 1UMBA 4TV8F 5AVOA 1OIVA 3FCUB 3ZLVA 1RBMA 3G2NA 1U2EA 3DOIA 3PTZA 1YI1A 2GUWA 4FFWA 5FPYA 4LBWA 3SSNA 1FCJA 4W7SA 1J99A 4JP3A 2Q3JA 2R1ZA 2XYPA 1NE7A 2WNHA 1XL1A 4M8KA 2C4TA 2XRFA 3FNEA 1YI8A 3LHFA 4RD1A 1M8KA 5DT9A 3RVLA 4KW7A 3ZW8A 5TLSA 4TYMA 3JQ9C 5EEGA 1ORVA 1LFDB 2FW9A 2KB0A 2O2EA 2WU3A 3C45A 3ET4A 1SUEA 1YZHA 1W6RA 2DP4E 1WV0A 2EBHX 2NU7A 2ONJA 4M9XA 3OMLA 3UMVA 3P32A 2XDQA 1HDYA 3OETA 2FZCA 3PSAA 2WKPA 4ZVNA 3HJGA 3L4SO 3KR2A 1T3HA 2X1MA 4DOMA 3A1SA 2VYVA 1R8XA 2PZFA 4QAJA 3L02A 3B3GA 4ETMA 5AUQA 5HCIA 1WMAA 3X3HA 3DBOB 1Y81A 4I08A 1T10A 2W2VA 4TXLA 4YAOA 5CDSA 2J4CA 2FMHA 2ZRQA 3BREA 1XN4A 3FKSA 4WH0A 4XM1A 3EIEA 5CTAA 3A31A 4C0HA 2YXBA 3JQ8A 1LX7A 4L22A 1FDTA 4KCGA 1QO0A 2JATA 3IKMB 4QXOA 3WIVA 4AJIA 3CRZA 4E2YA 1W4CA 4PSUA 1E3WB 1M67A 2W2OA 1K8YB 4MRPA 3UYKA 5BQ3A 2X15A 4BS9A 2SBTA 3WL4A 1D0IA 2Y9PB 2ODBA 3FMOB 1UJ4A 5JCOA 3IB6A 4MR9B 3K94A 4XLLA 5CT6A 4TSFA 1E9SA 1RRPA 4UBLA 3ODGA 1NT2A 3FG9A 4DKXA 3FMGA 1D07A 3DEFA 2WABA 3M7IA 1L5QA 1O0SA 4X45A 2P9YA 1KHTA 4FGSA 1AZTA 1F2UA 2RH8A 2VN8A 3KFXA 2CHFA 2P78A 1RQ2A 2H18A 3WGMA 2FOIA 1BYIA 3TNJA 3I01M 4PAQA 4PFSA 5HCNA 3CPJB 5LLTA 3BRCA 1VPTA 1ZG3A 2GD6A 4IIGA 4H08A 5ELLA 3TX2A 3CVXA 2L18A 1MN6A 3AQIA 1BXKA 2I9KA 4G1FA 1SUWA 2AZDA 2AJLI 1I3CA 4D4MA 4DRXA 3X1YA 4JLNA 3K0SA 1KVRA 2CLSA 3B1ZA 1QVRA 4YJHB 4KWCA 4Y98A 4ITVA 4AY2A 4BP9A 3T0IA 5CYFA 2RSLA 3QEKA 2D00A 3AF5A 1BOOA 4MV5A 3ORRA 2ZXEA 3QELA 2I7DA 5AM2A 1JLHA 1R4ZA 1BW9B 5BRJA 3ENNA 1M2NA 1E7MA 1EU1A 3UHOA 5EXEA 3VVMA 3MRVA 4OHXA 1SQ0A 2EP5A 1XNQB 3ZPXA 2H5JA 2EKDA 3LT0A 1IN8A 1WWKA 3A06A 3MA0A 2N75A 3GNQA 4FC6A 1KXZA 1S3GA 3IP8A 3TOVA 1ISJA 4I1RA 3OF3A 1ZYUA 1JF8A 2CJXA 4G0ZA 2H0QA 2HHHB 1JPVA 4X63A 4PX3A 2YXEA 3UHFA 5HILA 5B6JA 5FNVA 1ZU4A 1IUPA 3JAKA 4L75A 3UWOA 5D6OA 3RNLA 1PX0A 4ARVA 1RABA 2NAPA 4MIEA 5EIOA 2CZGA 2UXBB 1EQUA 4B9AA 1L9XA 3BA1A 4X1OA 4IOLA 2WNIA 1ZN8A 3TE7A 1N5KA 1FSFA 4HQOA 4BN4A 2B6NA 3PX7A 1WZUA 3L1JA 4W1SA 5CYGA 3ZXUB 4DAOA 4KMRA 1QIFA 2Y6UA 4LPSA 5IAAA 4P4SA 3W3ZB 1A5BB 1CQXA 3QFFA 1KY4A 3ROEA 1XLVA 1OFVA 2J46A 3QQ5A 2Q1WA 4EELA 4YAEA 2A5GA 3BGSA 3MPUA 4J90A 3UAZA 3ENVA 2GO7A 2WT9A 3E03A 3VZCA 4B3XA 3IOYA 1K5DA 5MN6A 3UMGA 4R1NA 2P6OA 5DWQA 4E2XA 2UYOA 4FDAA 2BEUB 1CF2O 3UT6A 4NZOA 2Q4BA 1T1SA 1TAHA 2PVSA 3NJ8A 3H5IA 4HDCA 4AKTA 3ZC3A 4KPUB 3K31A 5BQPA 1ULSA 5LDGA 1BJKA 2VAPA 4ECAA 2F1IA 4BZPA 3UF0A 5KBYA 1P44A 1GNQA 2X13A 4QE3A 3CRW1 2R1VB 2YQZA 2IWHA 4I3HA 2I71A 2IHYA 4RWEA 3WGJA 2XB6A 5JOQA 1RMTA 4KXMA 2GD1O 4YNBA 3B9QA 1ZW1A 3KR0A 2J7KA 1JFSA 2AT1A 3TOCA 1GNPA 2QTVA 2PCLA 2HA3A 3I6QA 5G4KA 4CF7A 2CFOA 3R8FA 2X42A 5BVHB 1B8UA 4TZ0A 2INGX 2O7RA 4DCOA 1FVFA 3IPAA 1X1TA 3VR5H 2CV0A 2FVXA 3KPJA 1ZR2A 1FP7A 3OHSX 8MHTA 4NONA 4DDKA 1SXHA 1N6OA 2H1LA 4ZGBA 1SVKA 4OHOA 5GM1A 2PKWA 3WNZA 4B3MB 4LDJA 4IQ4A 3WLPA 2QIPA 2WE8A 3JQEA 2ZANA 3SKYA 3IFSA 4D9FA 2OCAA 2JB9A 4ONEA 1EFDN 1JIIA 1GZ3A 5CGZA 3TEFA 2BH2A 4G81A 1BGXT 4F21A 1JI0A 2VUSA 3TINA 5AVVA 2XQIA 2Z9BA 1BXGA 3TZHA 3C24A 5LQJA 4GPZA 1FYFA 3T5CA 2NZYA 4K9MA 3UMSA 1S2NA 4M89A 1V8ZA 1IL0A 4I1UA 4CTJA 3BFPA 2X5KO 3H9CA 1D1TA 3JASA 4HC4A 4J75A 4UU1A 3SYMA 3RIGA 3RRJA 1RYNA 2HPVA 1JEOA 2P4HX 3BS4A 4BUJA 1JKIA 2OHXA 2XQKA 4OSPA 4DW8A 4D02A 2QS9A 4MI3A 3TDKA 2PQMA 1L7PA 1MGOA 2HSZA 4WCFB 2HV9A 3OKFA 2O0MA 1T6BY 4RCVA 1WHTA 3DEHA 4AJHA 4DTIA 2P6PA 4P2BA 3WFZA 4PXSA 2B20A 3OQOA 2FEOA 3GVPA 4GOLD 4KB5A 3NBUA 2OILA 1WXQA 1NBAA 2GX6A 3KJFA 2JHFA 2O7QA 3KUDA 4JB8A 2ZR0A 1N5IA 2FSVC 3CUYA 1XDUA 3LP6A 2NU8A 1P9RA 4CEIB 3PD0A 1ZMBA 5JS6A 3AVVA 1F8UA 2D8MA 1N2OA 2EJCA 3AW9A 1OVGA 4C0QC 1N8SA 2YY6A 2YYZA 5AQEA 1DL5A 4MHSA 4KV9A 1XCOA 2AQIA 4LC0A 2J85A 3COPA 4MUNA 2GZAA 2Q0QA 5DM0A 3BMNA 2G71A 4KRFA 2Q4TA 1COZA 1SOUA 3H9BA 2VA8A 2Y2UA 4D97A 2QMUA 1USGA 1U2QA 2ZPUA 3E5HA 4F9GA 2OO3A 1SU8A 2DQSA 2Z6QA 2BFCB 3HPRA 3R40A 4EATA 4KXUA 1GGHA 5KDLA 1U8CB 1ZK2A 4XWGA 3N5CA 2JAPA 3R20A 1VIMA 5FB3A 4C4OA 3MGBA 4ZT5A 3HCAA 2EX4A 4FGJA 1EXNA 2O3QA 2AYYA 3FWKA 4LRUA 4TRJA 5CA1B 4G8CA 4YDQA 1C4XA 1VL8A 3KB1A 3L84A 4MB6A 4WPGA 3SX2A 4CMHA 4N5DA 4OM8A 5FBLB 3DDNA 1OFGA 5P8WA 4D3YA 1JR3D 3TL6A 5I4BA 4HFJA 3H5RA 2NOAA 1RHJA 1S2IA 2VDWA 3AUFA 3KJHA 5FRDA 1FDRA 1DCKA 1VJ1A 2XRMA 3LV8A 2P5TB 1IBRA 1NVMB 2GTHA 2REQA 3P9KA 2MINA 4JC5A 4OQ4A 1X80A 4Q3KA 1DO0A 2ZSUA 2C5BA 3BRSA 1G6HA 3OX1A 2ODPA 4NZ9A 4R1LA 2VT7A 1KEZA 2B4RO 1RM0A 2ZJ4A 2FTKE 3EXIA 2JEZA 1P5RA 3COYA 3EARA 4BLTA 3NXKA 4RQUA 4XWTA 3T9FA 3DAYA 4GWGA 2RB5A 1WDWB 4ALIA 2P9BA 3EVNA 1OZHA 2CL0X 2UAGA 3I8SA 1SU6A 3KEQA 4HH3C 4MUYA 4BCCA 1Z5ZA 5CA0B 1ITZA 3VJMA 2C7QA 5L45A 5AKJA 2RJ3A 1E9BA 1F9AA 1PZGA 2DMRA 3KKKA 1FMFA 4Q4HA 2GM9A 2WYVA 1E6LA 3I1JA 1VECA 2C04A 3E18A 3ICCA 3Q12A 4QEDA 1SKAA 3GLFA 5BUCA 4FMPA 2W70A 5HZHA 2IYNA 3TKYA 4TWBA 1YZGA 1V26A 5EAIA 5LA6A 5CIWA 4OXKA 4YMGA 1AG9A 2V4UA 3HVIA 3RU9A 4EJ2A 2OO5A 2QA5A 4TMZA 1D09A 1XKQA 3KYCB 1QP7A 4F7WA 2AOXA 5K8LA 3TZCA 1E7QA 5JMOA 4BFZA 5MFPA 2R9VA 5HRUA 2ZYVX 1ELOA 3MD9A 1R8JA 3DPUA 4K9LA 5EXPA 1AGYA 4IYJA 1HT3A 3AI7A 3SJBA 1PJ4A 2FPIB 1IHXA 3I3SR 3OLXA 5KJCA 1I4LD 3H8SA 4LJLA 3K9BA 3PKIA 4IUBS 1EJBA 2E4UA 3AERA 4OJNA 5AI5A 4KO3S 5B1HA 5JU6A 5EJ4A 2RDMA 5ECDA 3DBVO 5KHAA 2RGNC 2GXQA 3L07A 3DE7X 1NBIA 1PV1A 1Y1SA 2VIIA 2W6JA 4L27A 4E03A 2JAQA 4HYYA 4UMEA 3ESBA 3U4DA 1UMDA 2HAEA 3BXXA 1PSDA 3EBLA 4FYJA 4X9XA 5EJGA 1JHRA 3RGGA 4QTZA 3MQ2A 4R3WA 3VPAA 1RZRA 2ZK7A 3NG1A 1VLVA 2C99A 2C42A 2AN4A 1R5BA 3O2QB 1N7JA 1PZMA 4YACA 3DL4A 4P22A 4U2BA 3O90A 3ZIAD 3HDTA 1AUPA 4JKOA 4DNXA 4NBNA 4W5NA 1ZK0A 2NTEA 2A6PA 4MWBA 3ILYA 4CL0A 2UXDB 3TRKA 4XB6B 5F3WB 1PNVA 4G0QA 4BCDA 3HEAA 1DBPA 4V0LA 3FLAA 1EA5A 3FOBA 3H8WA 4O4JB 4KKXB 1GZ6A 2MYTA 3PXUA 4RZQA 2YFQA 1G19A 1N2XA 3B53X 5M34A 4IIJB 2DERA 4IDHA 1QG4A 4MS4A 3ZK9A 4EF4A 3AL3A 3TTSA 1XOIA 5E1OA 1KR2A 2VHCA 3UT0A 1R4AA 3R9KA 2ZUBA 3IMCA 2OCYC 4RHTA 3W9SA 1P2UA 2EARA 1T3ZA 1L4BA 3L06A 5EMMA 1CUZA 1UQTA 3K0CA 4MQEB 4HG2A 3P9ZA 3NWOA 3PJDA 4XB1A 1V1RB 2JIZA 1YFZA 5K51A 3BXEA 5KNBD 1AN9A 2HMSA 1JYSA 3OD5A 4MV3A 3K7EA 3OUUA 3ZHSA 1CDZA 3LCMA 1QLWA 4LHYA 1ZD2P 2V6MA 4UDXX 1FP6A 3TIXB 3ZE6A 3ZWDA 1YQ9A 4EB6B 5FBQB 2GFQA 1EFPA 1VXRA 2XSZD 3H5NA 2A9JA 4X95A 4YXFA 1R8YA 2ZUEA 1HDRA 1WMBA 4QTYA 2YN4A 3E7DA 1QKKA 4G97A 4Q00A 5T8KC 4GX2A 4IJ6A 3UB2A 3V9AA 4YAKA 4K6GA 3R7WA 2B8TA 1RWPA 4AY5A 1SU4A 3R7LA 2XOEA 3GEHA 3Q5DA 5F1KA 1ZM7A 2AYXA 2I3ZA 4C4TA 4LMRA 3EZXA 4UHCA 4MPDA 2D2FA 2VJDA 1O96A 2ECFA 1D03A 4JUBA 1K27A 4JUFA 4HDMB 1GDHA 2GCIA 5A6VA 1STOA 3KUCA 3PU6A 1QYRA 4MS1B 3L1VA 3C8MA 4QSMA 5AW1A 1JMVA 3N8DA 3GEBA 2VSNA 5AKYA 1KK2A 2ZJYA 4CM9D 1VJ5A 2QRVB 4OFBA 1HOTA 4R2JA 3VTKA 5CFQA 1T9BA 4V38A 4WLOA 5FOXA 3C14C 4HPJB 4BOYA 3WFIA 3SBOA 1UOEA 2C54A 1HL3A 1OMOA 3HCNA 4ZGGA 3U4QA 2DWCA 2HTFA 5DBOA 4AJ2A 3TQFA 3OLCX 5ESWA 3VPBA 2YW2A 3G2IA 3A4VA 4PZDA 3PITA 2GAIA 1E92A 5DO9A 4TYWA 2GHRA 1F38A 2WVGA 3R2JA 3IURA 4HNHA 3LWNA 1JG1A 3P0JA 9MHTA 5B7PA 2JBWA 1OPXA 1Z5VA 3KUXA 1DJMA 1UWLA 3LUPA 2G9NA 2ZUDA 2FSSA 4RVGA 3ZV4A 2XKKA 1G2IA 1H2XA 3Q9UA 1Z56C 2HO5A 3Q98A 1MORA 2CK3A 2EKZA 5K6AA 2PUCA 5ILOA 3NDBB 1CTQA 1R4NA 3BIWA 2C5AA 1RS0A 1JJ7A 1NBMA 3B5IA 2H8GA 4JI1B 3Q0EA 2Q7XA 2ZREA 4CMJA 1SWVA 2H57A 1ZGJA 1GG5A 4FYVA 4JROA 1Q1ZA 1TXGA 1VRCA 5LJIA 1PFVA 2PKEA 4JI3B 1LXCA 2QWXA 2V3WA 3OJEA 4V0OA 4XGIA 2EEZA 3CNNA 3I01A 4TLLB 4MV8A 3KHUA 4A2PA 5LP6B 3FYDA 1VRWA 1RKUA 3PFGA 5D3MA 3SYRA 3BRWD 2H1OA 5TGDA 4B4KA 3JD0A 5CJJA 5BV1A 3IOMA 3WGNA 3TL3A 3VR6D 1UADA 2WYWA 2K4MA 3EXG2 2AH5A 4RPKA 5IBRA 4C7OA 1AVTA 1XNRB 5CD9A 1FFXA 5A9TA 4PVDA 2SCUB 1DC8A 3SZGA 4JXZA 1YO6A 1VXOA 5IUKC 2VKQA 4YMUA 3ETHA 1BVYF 1RR6A 2X8LA 3G2QA 4B3JA 2QN1A 2I29A 3BKXA 1TLLA 4EJSB 5C8ZA 3N07A 3PKJA 3PNMA 4GRDA 3D59A 3KIPA 2I65A 2OLJA 2Q45A 4IEEA 4E1VA 2Q3CA 1CUWA 2EQAA 2VTKA 2WJYA 1VBMA 2VHWA 2WYIA 3LX5A 3PYLA 4NMMA 1GUFA 3EZ6A 1I4OA 5KCZA 3RQIA 2YHIA 1U7PA 3FWHA 4Z9YA 2ZAGA 2C2HA 1S3IA 1G8KA 4E3ZA 2LXNA 3Q3EA 2X2OA 2PH7A 5CLLA 3GJZA 2ZIUB 4IFEA 5F5NA 2XDYA 3CF4G 3SQDA 1UKEA 1EFCA 2CL5A 2HNAA 5I7AA 5EJEA 3QIAA 4RS3A 5C80A 2JDIA 4O4HF 4BN0A 2QQ0A 2IA5A 2ZRNA 4FCWA 1OXSC 4PGHA 2A57A 7ADHA 5C7IO 2LIPA 4L8GA 2KM1A 4KVZA 4TKUB 1FVOA 2VYNA 3VUEA 3MD0A 5BMVB 4UATA 3HZOA 4HFRA 2IHTA 3QLTA 4KQCA 5DT2A 5BSVA 1M10A 1CUUA 1T9HA 4Y0AA 4CUKA 3BCHA 3H1TA 4HNSA 1ONNA 5ARBA 3LLSA 4M60A 1JWAB 3JQRA 4EYGA 5K8TA 4P32A 3K6RA 1E1QA 4K05A 4K8OA 2NWQA 3O8CA 4B43A 2DE0X 4AXXA 4U7WA 1H1DA 3QV2A 1Y89A 3TIVA 1A9RA 1E5QA 1R00A 2I4TA 2ZE7A 3KZXA 3T1OA 1UBMS 4QZVA 4RA6B 2FEWB 4Q9AA 3AI1A 3T6KA 1TYDE 1M8JA 1UEIA 1MOZA 1FFGA 3I09A 3PR1A 4YDRA 4ZCQA 1QC5A 4CDRA 1VI2A 4N5NA 2XE8A 3SIWA 3AZOA 3TQHA 4NPHA 2W58A 2JLWA 1ZGBA 4KGDA 2GHQA 1C2TA 2QPOA 4EMUA 2C9YA 2DY0A 2J6CA 2XB9A 3IPLA 3Q3HA 3C3YA 3GVHA 5GONB 2Z3WA 3UNXA 4QYWA 3VNSA 1ZZGA 2PLNA 3GO4A 5AI9A 1IZ9A 4KTVE 1N6RA 4DC1A 3QY9A 1UK7A 1VPDA 4R7GA 1HE5A 1V2GA 3UA3A 4CTMA 5LYJA 2GPTA 3U17A 3DBLB 3VU3A 3WTBA 4CW7A 1U94A 5AM1A 1SRRA 3F49S 4HBGA 4IJKA 1ILEA 3KT3A 4F06A 1JDVA 2UZAA 3KDAA 1DAOA 4ISCA 1EVLA 4PCLA 4PU0A 1L4FA 1Z75A 1UBTS 5JSHA 1HMPA 2ADOA 3AF3A 3CLUD 1IQUA 4HGPA 3JYLA 4DJTA 1U3GA 1EFKA 1VMAA 2GEKA 3L82B 1AKRA 3QLVC 1FSPA 5EL0A 4AZSA 1PGOA 4JXKA 1ZITA 4P98A 4B7ZA 3BA6A 1A0OA 2KPOA 3HDVA 3IODA 4Q7EA 2R00C 3K8ZA 2M6LA 2BFBA 3OEWA 3DDWA 1BGVA 4LXYA 2XD9A 3WRYC 8ABPA 1ONSA 5J5AA 3F0TA 5L53A 1D6JA 1UBCA 1TT7A 3FMVA 1ZC4A 3AF4A 4J3FA 2NPFA 1Z34A 4LE1A 2BKEA 3ILXA 2ZUVA 4CF4A 2VWQA 3KQYA 1GEGA 1U9CA 4RHYA 1COWD 3WXMA 2R68A 2R7MA 4BDSA 2QMQA 4NBSA 5JDCA 3EDOA 2C61A 5GIOE 1A8QA 1JI3A 1MUUA 4N6OA 4TZTA 1UPCA 2C7PA 1GAEO 3RSSA 4BC1A 5KINB 2R3SA 1Z6TA 1A8SA 1K5HA 1ZH6A 2X0RA 4I1IA 2VT2A 4MW2A 3QVLA 1FNCA 4RD3A 2EQBA 3UENA 4BX9A 5TC4A 1Z39A 4TTVA 1OPRA 2A0UA 5AKEA 4W5HA 5JO9A 2V55B 4PQFA 3MGAA 4LF5B 3PUIA 4GM4A 4A6PA 4CKWB 2ZYRA 3UM9A 4AG3A 1YHNA 3FOZA 1X7DA 2NO9A 4NBTA 4HL6A 1I1OA 1DARA 4FFDA 1P5ZB 1OTHA 2IYFA 2QVCA 3FYUA 4PLZA 4PPQA 2H48A 4GE3A 4P36A 4ZVKA 2ZJ8A 3UMRA 1I10A 2Y1WA 4PYJA 1ODLA 4D92A 3K70C 2NYUA 2C4KA 3WIDA 1BE6A 1EHCA 2FUG1 4X1YB 1XZBA 4BBJA 1FLVA 2XUQA 1ADFA 3BGVA 5HKAA 2BGUA 2Y67A 3O5AA 1YUMA 1TQ8A 4KN6A 5CBPB 4RV5A 1I7QB 2MYPA 5L4NA 3DQQA 1QTNA 1AKEA 4U63A 4ZCPA 3Q6NA 2R8RA 4LN1A 2EW8A 2SHKA 2YVLA 2AX4A 2XGSA 1CX9B 1FXUA 1P1IA 2HU5A 1DAHA 2WMDA 3DZCA 3C85A 3O94A 1R4MA 4U8GA 1NNLA 3E1KA 4Y9UA 3RRNA 4RFSB 4CLEA 4G41A 4QGFA 5JC1A 2H1HA 1GR0A 2OYRA 1THMA 1U7UA 1NMSA 1PJ2A 3PGLA 4JCCA 4RD4A 1G7RA 1ZKMA 2DRIA 4RZHA 3ZGVA 1UJ2A 3GUHA 3OCZA 2RGUA 3O4JA 2PKQP 3N58A 3RC9A 5KTSA 1F4LA 2X0NA 4PSCA 3V4PB 1RLUA 3KSAC 1W4BA 3DKRA 5EJAA 5AVXA 3U5TA 4CNBA 5BR8B 2FW6A 4X7RA 5KOIA 3BBPA 2R44A 1SBNE 5K0GA 1I3KA 1Z3IX 1M2KA 2GJ4A 1LI5A 1LW6E 4UEKA 2V8OA 1DRKA 1ONPA 1W0JA 2NV6A 4FFPA 3L5OA 3KHKA 4Y7DA 4LQ4A 2W7TA 3FBTA 5FULA 1JAXA 3WSWA 4D9GA 5KVSA 6CHYA 1JTFA 1YL6A 1A5AB 4NOLA 4TWJA 4XGNA 3HG7A 5A9SA 5J2UF 2GTPA 3P19A 4IIVA 4M9SA 1C7EA 3HLKA 3PQ5A 3BK2A 1GN9A 2UXCB 2OC4A 1ENZA 2DTDA 3COZA 1LLQA 1ISRA 2AFIB 3IP6A 2DY1A 2PKRA 2EJWA 2Y4OA 3A4MA 4BDTA 2EXXA 4NMXB 3IAAA 3PPVA 4M3NA 1RPNA 2HADA 3O4HA 5C7YA 1Y6QA 5REQA 3KDPA 4QYIB 3DDUA 3OTQA 3CJQA 2PR2A 2Z8YM 1G7CA 3AILA 3KAKA 3EZ9A 3AUJB 3I6ZA 1U8YA 4LHSA 1QH1A 2BGIA 1R8QA 3O9VA 5ECYA 4RKRA 3DYBA 3J7AC 1LNZA 3Q9SA 5EGSA 4AZ3A 1WM1A 3SM3A 5FI0B 4GF5A 1H4SA 3C3EA 1G5PA 4EQZA 1JH8A 3UQZA 3U7RA 1KARA 3TLJA 3ZH2A 3O7WA 1RJDA 1JR6A 5M3BA 3QE2A 3H7AA 4LMBA 4JEIA 4U7GA 3GL9A 1LY1A 1OI4A 4YQZA 1OV4A 1DE0A 4LY3A 5IJXA 2FSHA 1PFYA 3EYWA 1C8LA 1J24A 1RXCA 1ZGCA 5HWSA 1L0BA 2Q5HA 1AQ6A 3LHKA 3RHZA 5YASA 1DAIA 1SHZA 2QK4A 4M1SA 4ZVQA 5E9JA 3RBZA 4CXMA 2G04A 1OAOC 1P6QA 1XVVA 2HF8A 2QE6A 2WHRA 2WKQA 3GCXA 4LBYA 5CK5A 3TLGA 3VNBA 4COKA 1VIYA 1C1DA 3R9XA 1WR8A 1UPXA 3CQ9A 2BGNA 2D0IA 1JKJA 4F4FA 4DXDA 4LJ6A 5IBCA 1OLSB 3RPEA 3ZTWA 3LCUA 3A4TA 2EGUA 4V1CI 2QX6A 3OE5A 1LDBA 2XLBA 3T5DA 2FZGA 1YI0A 1WMDA 4ZI3A 3NBXX 4L0MA 1FUKA 2C8JA 1JDJA 3LIPA 4G85A 1V95A 2QSJA 2J0VA 1WMEA 4OHPA 2ONYA 3ZCTA 4OL9A 1KH2A 3PF8A 4IHJF 4MULA 3WHPA 2AR0A 3MJFA 2WQ6A 1VLHA 2J3DA 2QUBA 1CS0B 2UVDA 4E0BA 2BHNA 1IHPA 4NJMB 2Q3DA 1ORRA 1RWOA 3HNPA 1T36A 2ZZKA 3KTAA 3AZQA 3CNBA 3GQVA 3L4KA 5K05A 1XWWA 2J0UA 5FLYA 4NP6A 3ZY3A 1TF5A 1T29A 3REQB 3ZHRA 4DY6A 2QG9A 2JGRA 1P6XA 2H06A 3ON5A 2VWGA 2BIFA 2YIJA 1G2OA 3FCYA 1DEOA 3EIWA 1G4AE 4QBTA 5DHTA 4YPVA 1JHZA 4E1AA 4LFBB 4Q37A 1J2TA 2JD1A 3HI6A 2YY5A 1CDEA 3V5NA 3ILVA 2QTRA 1Y5RA 2OV8A 4EYOA 4DUGA 1NXSA 5HJEA 1QRSA 1Z0ZA 1E79A 3AI3A 1W9MA 3VR4A 3PENA 1REQA 5CCEA 4L5JA 4WJZA 4FJ2A 3BPSA 2RHJA 3D7SA 2W90A 3BB4A 5AJZA 4CQLA 1GCIA 1EWQA 3P52A 3E7XA 3H87A 1U6IA 2R8OA 1QIIA 4ZV4A 1M7BA 3E8MA 4JEMA 1HNXB 1EK5A 4YT8A 5ALLA 1CEQA 3IVXA 3GAAA 2YNMD 4ECEA 4EK9A 2QRMA 4EZBA 3G13A 1SUCA 3MG9A 5BSKA 1BWPA 2FFHA 1ZD1A 4M7PA 1W0KD 2RC5A 3DDOA 4NDNE 1OHHA 3AP3A 2VF7A 3R0ZA 4YJGA 3IR7A 1GYQA 3PC2A 4O63O 2OWEA 4HV4A 1OYVA 5ALGA 4UNSA 3TPFA 1XZMA 2JGFA 3RK4A 1TMOA 2R6FA 1JZSA 3U7GA 4UCXA 3ZTYA 1ML4A 2BM8A 3FAKA 1F0KA 2B8WA 4O2AB 4RMIA 4LJRA 5KOYA 2FPLA 2QYSA 1JNYA 3AG5A 3DOCA 1CWUA 4LVCA 1QAOA 4GZ5A 1O9HA 3T3OA 1R15A 3P4XA 3WYEA 2P69A 3IAUA 3D4NA 4KFTA 1IXYA 2RKOA 3CN7A 1DDIA 2O8CA 1R0LA 3NI2A 3S81A 2B4KA 3U26A 4B80A 5BO5A 1SEPA 1YFLA 1VQ1A 5BV0A 2AOUA 1M74A 4YCJA 2WY2D 2E4ZA 2OR3A 3DKVA 4MWDA 4O0LA 4ZRDA 1R50A 4IHKA 3QE4A 4GOND 4M1QA 3D6UA 3OUTA 1NV8A 10MHA 2PBZA 1A82A 3OKPA 3P2JA 3EF1A 1HNNA 5A5FA 3LTNC 4LEIA 2A35A 3PUWA 4RKYA 4E4YA 3CEPB 3LFTA 3EEYA 5KC9A 4Z99A 4RYDA 3JAWB 5FI1B 4ID3A 4MB0A 3TMYA 1P2SA 2HLDD 3QI7A 1XROA 4XVRA 2AF3C 5JHHB 4Y9DA 1CUFA 4EPXA 3MJ4A 2M6SA 3CLKA 4JYCA 5FAXA 3GOHA 4BV3A 1EDEA 2PJZA 2PZGA 2RBEA 4MR8A 2BFEA 3FJYA 2O3JA 3OZWA 4LYDA 1IMJA 3RCBA 4PQYA 3TK1A 4ENUA 1MAUA 3BMQA 4XGKA 5CCBA 2OPBA 1CEYA 1O6BA 3O8DA 3OI7A 4DT1A 1DHRA 1L5ZA 1QRDA 2NV2B 1Z6QA 4L73A 3U13A 1XKXA 1P0QA 2ZAIA 3JD3A 3RARA 2AFHA 5I7HA 4PGAA 3DMTC 3NALA 3C3AA 3QOWA 3M81A 4Q4JA 2A78A 1U3UA 1T34A 3I8OA 3GA5A 4GI3A 5J4KA 4WFJA 4OSOA 1JAYA 1K2WA 1KQOA 2ZT8A 5T5QA 5LOVF 4PWYA 3S70A 1KTIA 1HWYA 3UIEA 5D3KA 2A88A 4US0R 3D4LA 3LAWA 2NT3A 5FYDA 3SXJA 2QN6A 1ACMA 2CLMB 3I5XA 4YONB 3IAEA 4B48A 3SJZA 3WNBA 1N2HA 1KP3A 3FPEA 5BORA 2Q62A 4TVOA 2BFDB 3RJZA 4CL2A 1GU1A 2GEVA 3F2IA 3AVUA 3HKBB 1DADA 3KO8A 1EHYA 1A7JA 2ZI9A 4UHDA 2VNKA 3Q1KA 3GJ8A 4NK5A 1T0JB 3BD8A 4U5QA 5H9WA 1MO5A 1NI5A 4LRSB 2WWHA 4L5YA 4XSHA 3R5SA 3G17A 3RG2A 2GM3A 4M0UA 2OBNA 5DH9A 4MUKA 2X0FA 1QR6A 2A3RA 3U4GA 4S1OA 1QWOA 3KZNA 1U8FO 1E4YA 4Y67A 1PYDA 3LPMA 4ETIA 1WUYA 4ALKA 1IUKA 1XE3A 3EMDA 4DLAA 3QVOA 3DL0A 4PZYA 1X1EA 2WICA 4CHGA 4CEJB 1E2NA 4XUCA 4EHHA 5FDFA 4Y30A 1CZRA 3S44A 4OXNA 4BNFA 1M1YB 1WDTA 3JWJA 3N53A 4KR6A 1N1DA 1EXVA 2ZBPA 2EG5A 2D1FA 3R8CA 2ODEA 4G5RA 4ZRNA 1Y6FA 3BC1A 4OA5A 5TY0A 3ASYA 2FV8A 4RF3A 4W82A 2DX7A 1P81A 1TM2A 1K68A 3S99A 3IC5A 4PBSA 1H22A 2A4MA 3A28A 1I2MA 3EISA 4LXIA 4RY8A 4B8ZA 1NR5A 5DSTA 1SBHA 1PWYE 4RL4A 5FHQA 3PXGA 3EFOB 3VYVA 3LK6A 1L5KA 2PRYA 2TS1A 4LYGA 1HG0A 1W5SA 2J45A 4OQYA 4WL0A 5TGZA 1T1EA 2A86A 3ZW7A 4DSOA 1R6UA 1E6MA 1IY0A 2Z8XA 4OQLA 1YBAA 4DPKA 2VQEB 4QBKA 1R16A 4BIMA 4I1PA 3L7AA 3OWHA 4MA5A 4S1VA 1ISPA 4V3CA 5CIQA 5L3SB 5EZYB 3SQNA 1M2FA 2WMOB 3H2HA 2O8BB 3DDSA 2AQKA 4GSYA 1EUYA 1Q7RA 4M9CA 1P9OA 1E1LA 1EBUA 1I6LA 1OJLA 2ZETA 3GW8A 2B1RA 2P0YA 2Y68A 1KAHA 2ZIXA 3EGEA 2FEMA 2PZBA 1YRBA 5DBIA 3K6JA 2MSNA 5G0VA 1DAFA 1B0UA 1PR4A 4BAZA 4PGGA 5HM8A 1BA3A 1HO3A 4FYWA 4RADA 2FPPB 4NARA 4O2LA 5DIZA 1AIPA 1N6IA 4JJGA 4P5PA 1TJPB 4BVFA 4D3ZA 2Z58A 4IXDA 1OB5A 3LBYA 4PS0A 3THYB 1HY3A 1Z6GA 3LUFA 4HF7A 1VHQA 2IBMA 5CURA 1Q77A 2APJA 4MYTA 3IHTA 2JZOA 5AJXA 5CNIA 4ZOCA 5DPMA 3BL6A 1C9MA 1E2MA 2A1IA 1HI9A 2OVBA 2JFPA 2IXDA 5B1EA 2O0JA 2FZ5A 1DC6A 3BFXA 4INPA 5FF9A 4PQEA 1O94D 2NPIA 2CDBA 3NASA 2A5LA 1ZUNB 2JGLA 2NQ2C 4HXFB 1NA5A 2EQ5A 2C9CA 2XCUA 1DTEA 1F6BA 2XZTA 1MB9A 1NW3A 3RIYA 1I6KA 3G2JA 1G3IA 2A0YA 2ZKIA 5BOSA 1QZUA 4NCAA 3GI1A 2RI1A 1HLDA 1NIPA 3GDWA 4R6WA 1USIA 4PZ0A 3GEIA 4ZC8A 3EHEA 1I9GA 1KVSA 3WGVA 3Q7EA 1G59A 2W11A 4OP3A 4PZAA 1VLMA 2JK1A 5P21A 3N86A 3UH1A 4D9NA 5J23A 4CRWB 3R6GA 1CPYA 1GG9A 2V65A 2F3QA 1PR0A 2HQSA 3PICA 3VKFA 2CHUA 2FI1A 1FQOA 4JLAA 1H05A 4DDWA 1QIJA 1ZM9A 3NAZA 1DDOA 1W96A 1XRPA 2ZWPA 1XTPA 2H4XA 3K0FB 3G02A 3OE7A 4HWRA 4ZQIA 1BX1A 2FW8A 2XWJI 5FO0A 4CVNA 1W8IA 1SCDA 3PHLA 4KNWA 1VBFA 3RVKA 3OZIA 1MGPA 4JJ4A 4KAAA 2PMEA 1AXRA 4UVDA 1IY1A 1I7SB 2BFAA 4HN4B 3OO1A 4ZCLA 1MX9A 4IYRA 4Y9SA 1M5RA 1Z9BA 2R2AA 4HO1X 5T7BA 4DIMA 1ECJA 5LUAA 2F3RA 2PG3A 4UARA 1NVXQ 3MPOA 4AY4A 4F5WA 2QAGA 3LF1A 1S2GA 4M0CA 5E0KB 3UCEA 4MS3A 4BIIA 2P3QA 1FUUA 3HI4A 2PSEA 4L50A 4OGFA 3N6XA 1W1WA 2P67A 4BGVA 4BQNA 3VJRA 4Z3OA 3V4FA 1WLSA 4JLKA 4LTMA 2HQOA 3FVVA 5EZ5A 2XVXA 4NMHA 4WBXC 1O1YA 4Z4CA 5IHPA 4LE0A 1BN6A 2J48A 2QKYA 3HKEA 4RIFA 4OX9Y 2YX1A 3CKMA 3W04A 3O47A 1A88A 4ZI5A 5CX1B 1XXHB 3LVRE 2Y9MB 4XQGA 1EVEA 2IEIA 2I1QA 4F60A 1U4OA 4RCZA 3TLCA 4QVGA 1QHSA 2OG2A 3HKDA 3T94A 3J81A 1DXOA 1M6NA 2JGDB 1V8FA 4UHJA 3LCRA 4AI6A 4U7DA 2XZOA 3ZKWB 1IFXA 4C14A 2MWMA 3DZJA 2C57A 3SQLA 2ZB8A 2KW5A 1KI6B 1XI2A 2RHCA 4BNTA 2RGAA 1JEYB 4LDNA 1D2GA 3ER8A 3K1TA 3QMPA 3AFHA 3CRMA 2WF5A 1X13A 1T5TA 1HYQA 4B2IA 4CNQA 1PS9A 4S2UA 2OCPA 4KVFA 4ZARA 2DLNA 3AR6A 3K2QA 4RLSA 1NUSA 2MSCB 3UW1A 2FHSA 5TB5A 1BS9A 4L07A 1VG0B 1IJBA 1AK9A 2ZI3A 1V3VA 3TQIA 1T4CA 3BH6A 3GAZA 1LKZA 3PIIA 1CKEA 2IUUA 2DB3A 1KBOA 1IQRA 3UJHA 2BHRA 1TZMA 2Q0SA 3GQBB 4J6EA 1X7HA 4RVUA 2HX1A 1LSOA 1XR3A 1PUXA 2I6XA 3A6LA 4KJXA 3LF2A 4MVJF 3UUFA 2ZB2A 3KJIA 1Z8DA 2VDNB 3GPBA 3MW8A 1NT4A 1K97A 2DJ5A 5BUQA 4ZDWA 4XVUA 4Y2SA 1J5PA 1PIWA 2YWXA 3BCUA 3VV2A 5BSWA 4UU8A 5A71A 2WPDA 3UJ8A 1AX9A 2J0QA 1VE1A 1OFHA 1TUEA 1YK1A 1F2TB 3FZEA 2CD7A 1D6NA 4NDZA 4IH1A 1ESMA 3K6KA 1RXWA 4LJKA 1Q0ZA 2F1RA 1MPXA 2BEWA 2BR3A 1CNEA 4DMLA 4ZEVA 1YJ5A 5E3IA 3T3EA 4EY8A 3UUEA 1R0YA 2XYGA 3ZH9B 1O5IA 5KWEA 4MRMB 4GEKA 4MVJE 1KMQA 2BI7A 3GUUA 4QEZA 4REQB 4N76A 2O2GA 3MUOA 1SIWA 3HDYA 3L8MA 2A7QA 4FMCB 4RJKA 2I55A 2P6MA 1FXSA 1T0HB 1F7VA 2AWNA 1YTUA 3DB1A 4CM3A 1RTTA 4HEQA 4JS0A 2WIGA 1NJGA 2B2CA 1B6SA 4MKIA 1ZUWA 3QKIA 5KC8A 1EFVA 1LBIA 5B2FA 1H5QA 1DWQA 3BB3A 3TSCA 1EZZA 3LO5A 4F93B 1Z6ZA 2YMLA 3VI4B 6ABPA 1J97A 3HP7A 3QM1A 1JEYA 1UDAA 2UZ0A 2YQ5A 5F4BA 5BWCA 4CM7A 2P62A 2R4QA 3CVYA 3WRVA 4R69A 5ICGA 3QWAA 3EF3A 1W4AA 1XKLA 3BFVA 4WI1A 1BS1A 1N2EA 3DFZA 3R77A 4FXOA 4V0QA 1LPMA 3M82A 3TR5A 5A1JA 4OAPA 2E6KA 1G8HA 2GA9A 1J0DA 4JVSB 3NUQA 4LZAA 2IL1A 2QMOA 4G0YA 3B7GA 3VC1A 2QZ9A 4EF6A 4B4WA 3NDPA 5L6MB 3QNMA 3SC4A 4RY9A 1UAYA 1AQYA 3L7CA 3GFQA 4IW3B 1Q11A 2CHVA 2XEDA 3Q6MA 3X43A 3IOEA 3UKDA 4D0SA 2KMLA 1HYHA 1MX5A 1JHDA 4KQIA 5B1IA 3GRYA 3PWSA 3THXA 1NGSA 2VNSA 1FNDA 2X6RA 3GLVA 2HCRA 4C2UA 2OHHA 5JD6A 3K32A 3NYIA 2PHZA 4COOA 1KZ6A 1RW4A 1E98A 4HB4A 1PDOA 5KPDA 3SBDA 1HT0A 4ER7A 4BPBA 3DA8A 2ORIA 2FRDA 2B37A 2ZULA 3ITNA 2NU9B 4H4CA 1E2JA 3EGVA 3PI7A 4EZEA 4DR1B 1LRJA 4WFKA 1DB3A 3RABA 4OREX 3VR0A 4PBTA 1WOYA 2E21A 2VJCA 3L1HA 5HMMA 2HPZA 3IA2A 3LL4A 4DLWA 4CMCA 3PX3A 4YRJA 2AC4A 2VUIB 3GJXC 2AQHA 1E1RA 2X9LA 4WXHA 3KWJA 3WRXA 2QLMA 3D8NA 4OQPA 3OIFA 3A7EA 4UD6A 3LVBA 4XE5A 4CCAA 4RENA 3ZZUA 1L3BA 2GHIA 3ZVKA 2Z6AA 1UMKA 4EY5A 1P0PA 2MDTA 1ZCBA 3BSYA 4AN4A 3AHJA 3M0EA 4NNJA 5BQFA 3MJCA 2DCUA 2G0NA 3KU1A 1XQ9A 3DKIA 4IVRA 4H6VA 4YRCA 3S1AA 3NZEA 2Q07A 3NOVA 4FX2A 4G0OA 3I4LA 3NFYA 3LWDA 1XJ5A 5HK8A 1CJVC 1N25A 1C7RA 2RH9B 4RE6A 3AR3A 4C0XA 3C16C 1CFJA 2IHKA 1Z82A 2WJIA 1SZDA 2G7MC 4BNNA 4CIWA 2VNHA 4R40A 3WADA 3VYTB 3DHWC 1NTOA 3IB3A 3N6RA 2PTGA 4S12A 4V1CA 5EJ6A 4Q4AB 3K9CA 2BW0A 1WA5A 1KQPA 1X38A 3GRUA 5BQ5A 5JEEA 3QNWA 1YTLA 1LJUA 1Z0SA 1UM9B 2NSLA 3NH9A 1D2AA 1LS6A 3C3PA 3M4NA 4MTLA 2GLTA 4CM4B 5C5CA 1PQYA 1OBCA 3FTDA 3TQTA 4QYSA 2E55A 3D6AA 3V8MA 3GMIA 2W71A 2YXLA 3HEMA 1JLLA 1HPLA 4LTNA 4TXMA 3WGTA 4IWNA 4ZU6X 4BNZA 2B35A 4NECA 1GDDA 4AKGA 4ZI2A 1HE2A 1RHUA 4LJ9A 2H2AA 2EAUA 4D26A 1Q2UA 4TV9B 5AUNB 1P62B 1MF7A 3B3AA 3CZ9A 5EESA 1J23A 3KELA 4YQYA 3UT5A 3VU9B 4ND6A 1XCGB 1WNFA 1MU0A 2QMZA 3FPBA 1NVTA 4M9RA 1JQ5A 3ONEA 4X85A 2TMKA 1WB6A 2ZYWX 5I9LA 4KPEC 5AW6A 1YJQA 1AOXA 4CFYA 4R8LA 3NUGA 4HDAA 2EG9A 3D81A 4HGQA 4EY4A 3ZJTA 3DEYX 2QW1A 5C8YA 3OT4A 2XGJA 2G72A 3EVFA 5H70A 3OQIB 3NW9A 1Y9DA 2CFRA 3HXKA 4QFDA 2DQYA 2HA0A 2D1YA 4NBWA 1G98A 1NYLA 1ZL2A 2IHUA 1P0IA 1SHUX 3ES9A 3H9UA 4E51A 1WW2A 3IILA 3EXFA 3R3XA 1QRUA 1J1UA 3AEUA 1FRNA 1VSTA 2D8AA 3IX7A 3QUTA 3AKEA 4HI0E 1TK3A 2FQWA 2F64A 2GNAA 3UCXA 4B84A 2NUAB 5JCXA 1PLKA 3RBVA 4EHDA 2DUJA 3EZYA 1NULA 2RGGA 3L0YA 4JD5A 1PQUA 2VCYA 1JEDA 3VBCA 4LF8B 1O2DA 4E11A 3EBPA 3II6X 4G0MA 1XRRA 1WV1A 2W83A 1A76A 2F3PA 3PEEA 5J43A 1Z4LA 4ZA2A 1G66A 3RV3A 4BJ1A 3CO5A 4LVOA 1TKCA 2ZWIA 1FNNA 1EE2A 4O2BA 1KFJB 4TXJA 5DKFA 3NOXA 4ARSA 5AUPB 2GDJA 3C8DA 3DE3X 1NLUA 4MAMA 3ZCQA 4IIUA 1LU9A 3L6RA 2WUEA 4E09A 4EECA 2VTVA 4HS9A 1N5OX 4E07A 3T54A 3HYSA 2R1TA 3CSDA 4V39A 4XRGA 4H59A 2VBCA 1GPMA 2GTIA 2ZIVB 4MJ3A 5AXBA 3HL0A 3N2ZB 4XOIA 2Z56A 5I01A 3ZY4A 5ESDA 2ZIAA 1BAPA 4URFA 2V5VA 3P2EA 3N8HA 4GR4A 4B3SB 1CJUC 3FWZA 4JZKA 1WBJB 3OC0A 2CMDA 2BEVB 4JR0A 1Y8AA 3CEMA 4BX2A 3HO6A 4FLMA 4DKJA 4IEIA 3IP9A 3GY0A 4NENB 2P9JA 3CBGA 1W29A 4NPCA 3WIUA 2QN8A 3WK4A 4D96A 4EI8A 2EZ8A 2J6BA 2RJNA 4YHBA 4ANFA 3QFHA 1ATIA 5KWIA 2XA2A 3PUJA 1AZWA 3PYMA 4Q05A 1JAIA 5FOSA 1CUDA 1GYRA 3IP7A 4IOJA 3NTQA 1E2FA 2QVZX 6REQB 2IZZA 3VNVA 4YRGA 2GN8A 4G07A 2C2MA 3AC0A 3FVTA 1N78A 3CPEA 3ZXIA 1Q3HA 4B0OA 5L7YA 5KTKA 1PD1A 2GN1A 4G89A 4JU9A 2P0EA 1DWPA 1PFGA 1ZO8A 2DXIA 2DWOA 4ZJPA 2VZ9A 3O0DA 5HIIA 2IYXA 4R8VA 1YHZA 3RM3A 2IZOA 3UTDA 4WX2B 5LU8A 2PR7A 4EB3A 3DXYA 4OU4A 4ETWA 5TIIA 4OMCA 2OV6A 4RTQA 2G3YA 1AJEA 2PWAA 1DPGA 5C4GB 3SX0A 4C4ZA 3O92A 3KALA 3OJ0A 3TOSA 3EC1A 4BO6A 2QYHA 3HU1A 4F6LA 1Z26A 3I28A 3WSVA 5A02A 2ZJBA 2B8NA 2OKGA 2F43B 5CXXA 3NHMA 5BSRA 3EQ9A 4F8YA 4RGBA 4UOZA 1NDQA 1T5LA 4LK3A 5KYUA 1WTCA 5T57A 4MVJG 1I2CA 2IV3A 4WZ6A 3G59A 1KZHA 2GHTA 1M73E 2FPGB 2O2IA 1WO8A 2GZSA 5JI2E 2X22A 3T1QA 3EG9B 5AMXA 2P2LA 3JAMA 1RXSA 2IGBA 3VR3A 2VK4A 1V41E 3TSWA 1QYVA 4ED9A 1SHJA 4RQTA 4HDNB 1VJGA 2O3TA 3OOEA 3UGQA 4EJ6A 2GDZA 4WCFC 2IYTA 3M9WA 1U90A 1ECBA 1PI3A 1QMGA 4S1WA 3RUFA 2PFGA 2OAP1 3CSUA 3H2JA 5H9VA 5KZMB 2ZXFA 5ITSA 1J9EA 1DZIA 3ISJA 4NC9A 2IS1A 3IT1A 2IEGA 4MGIR 3TLEA 1BCSB 3EQ2A 4CCYB 2L17A 4UREA 2KX7A 3H19A 4I1VA 3FBWA 4YAFA 3UV7A 5DNDA 3PJRA 4HATA 2B21A 2O1WA 3H3JA 5JJLA 1FDOA 5IFLA 1GARA 4I1YA 4Y1RA 2HQ1A 1N6LA 2XWQA 4I36A 1F2VA 3F1KA 2BF4A 4KBFA 4MVYA 3GLGB 3MOIA 4OOFA 3F47A 1YGPA 3V2GA 1IRXA 1AURA 4KNVA 4ZI7B 2XUJA 3RUHA 1JHYA 4GG1A 1LS1A 2XHEA 2E3JA 1HZZA 4ZV9A 5LFAA 4EA9A 1YDFA 4IRXA 3DF7A 1RQXA 4C04A 3R3WA 1T3GA 3BGOS 3BBLA 1KEUA 2X8JA 4LDRA 5F3DA 1DCMA 3DZDA 3EDYA 3N0RA 4MPTA 2LP4Y 3RH0A 1PGJA 3DCJA 1JIQA 4F4UA 5K3FA 3ZWBA 4Y2TA 4ASUA 1H2AS 4F38A 4CLRB 4IJVA 5KNCD 3BXZA 3T9CA 2PYIA 3KLNA 5EA2A 4HJXA 1EDDA 3N75A 4GPTA 4MDHA 4OYLA 4ENWA 3KB6A 2B3TA 5EJ8A 1IRIA 1YZ3A 4WOCA 2BAGA 4NI5A 2IYQA 2GEDA 5TS3A 5EMLA 4B33A 3GFGA 3LQYA 2D5IA 5M2QA 1GTSA 3M6AA 2W2KB 5GTDA 1A4XA 4F2HA 3EXEB 3AR5A 2IYWA 4FUQA 3E3OA 4JNCA 3WB2A 1V1MA 1VMKA 1KNXA 3CCBA 4M76B 2H54A 8AT1A 1Y8QB 3HUDA 1Z0UA 3NNSA 1QYWA 3L0SA 2OZKA 4ZOLB 4YQEA 4XFJA 1TA9A 4E70A 1JN0A 4MA4A 4W7HA 1RYMA 4MKHA 1PSWA 4IS2A 4KR9A 3VZQA 1L8QA 4NZYA 1G2QA 3SC2A 2VL7A 1BE1A 1TJYA 4IX9A 1JJIA 3G7NA 4FTWA 4J0HA 5H80A 1RADA 3OFSA 4CQMA 4ZDIA 1L4MA 2X0JA 2ENUA 4K2AA 4H0FA 1SK8A 3FTCA 1WXHA 3NANA 1JFRA 4ZVPA 5ITZB 1MHPA 2LBPA 2PJUA 3OO0A 2VTEA 4LE2A 1QH8B 4LCBA 3S1LA 4C0BA 1X8JA 1W0CA 1WS6A 3AEKB 3U7QB 2AE2A 3DH0A 4TXHA 2VH1A 1KMHA 5ELMA 1B3BA 2RGXA 4RSRA 4GQBA 5HF5A 1JP7A 1XVLA 1QQBA 5BSFA 3VR2A 5AW9A 1JHMA 1G55A 3P0FA 4TT3A 3HKCA 4MYCA 2RMKA 2XYQA 1ZR4A 3SZMA 4A16A 1U9YA 1LRKA 4JUDX 5DHFA 2GM4A 1KBZA 3G2HA 2B92A 3FHLA 4GW3A 2LCQA 1A1VA 5EHXA 4N4AA 1GA6A 5CFPA 2VJMB 3MF4A 2CE7A 2ZZNA 3IRVA 4WXYB 1MO3A 3OM8A 1HE8B 3F4KA 2LR0A 4LJ8A 2Z5LA 4ZVMA 3QEBZ 2AVNA 4FSHA 2QYOA 1YIOA 2DHRA 5AW0A 2OP0A 5J2TA 3SDSA 5CIYA 1H4VB 1CQZA 4BNDA 2P79A 5CYPA 1ADCA 4YP7A 4CKXA 2KHZA 2C8LA 2WC1A 2HT1A 2I03A 2I91A 5CAEA 1XFDA 4XGQA 5JAMA 2KE5A 3HJFA 2KQUA 2O48X 1P1KA 3WHIA 5LXTB 4ZZ0A 1JDZA 3KT0A 1G1AA 3MGKA 2I2AA 2BBTA 1SHLA 1LI4A 2RB4A 5C3UA 2XX3A 3HWSA 3FHOA 2ZYUX 2QXUA 4K28A 2IV2X 2O8NA 1M8PA 3RSGA 5D85A 2QD2A 4EX7A 2ZE5A 3TRDA 4NG4A 5CA1F 4DC9A 1ADYA 1ZFNA 2XZPA 2HIGA 2NZ8A 1N5DA 1Z3CA 2ZTHA 1PFKA 4FFMA 1ABEA 3AGQA 1EFUA 4JOBA 2BRUC 1XDZA 4W63A 3V80A 4F56A 4GPD1 4MLZA 4RLQA 1DBQA 1QX4A 3M6VA 4BVLA 2JF0A 4NH0A 3A6ZA 1GAQA 3HR7A 1EAMA 1CJTC 1FRZA 3G85A 4FWTA 3C1OA 3FCXA 4J0DA 3S2GA 1YZFA 2CCGA 4NATA 4J3JA 4EOGA 4FE3A 2V7EA 1BCRA 1GFIA 1QYIA 2XUFA 4C7XA 3OQMA 2BGGA 2X8WA 3FGOA 4PSKA 2DM6A 3Q2IA 4HDRB 1Y42X 3V33A 1W4ZA 4B7CA 5C53B 3FKSD 2G6TA