1IUPA

Meta-cleavage product hydrolase from pseudomonas fluorescens ip01 (cumd) s103a mutant complexed with isobutyrates
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
271
structure length
271
Chain Sequence
NLEIGKSILAAGVLTNYHDVGEGQPVILIHGSGPGVSAYANWRLTIPALSKFYRVIAPDMVGFGFTDRPENYNYSKDSWVDHIIGIMDALEIEKAHIVGNAFGGGLAIATALRYSERVDRMVLMGAAGTRFDVTEGLNAVWGYTPSIENMRNLLDIFAYDRSLVTDELARLRYEASIQPGFQESFSSMFPEPRQRWIDALASSDEDIKTLPNETLIIHGREDQVVPLSSSLRLGELIDRAQLHVFGRCGHWTQIEQTDRFNRLVVEFFNEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords meta-Cleavage product hydrolase
publication title Crystal structures of a meta-cleavage product hydrolase from Pseudomonas fluorescens IP01 (CumD) complexed with cleavage products
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Hydrolase
total genus 102
structure length 271
sequence length 271
ec nomenclature ec 3.7.1.9: 2-hydroxymuconate-6-semialdehyde hydrolase.
pdb deposition date 2002-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1iupA00
4QA9A 2W6CX 2VAXA 4X3CA 4AXBA 1SCIA 3KSRA 4MYSA 2RONA 5H3HA 4CIAA 2HA4A 3QH4A 2CKMA 4NZZA 3VKFA 2DR0A 3FVRA 2O7VA 1EI9A 2XUFA 2Q0XA 5IVHA 3SC2A 2WG2A 3WK7A 4Y2VA 1J07A 2Z8ZA 4B84A 4FBLA 3HABA 5FP0A 1OXMA 2WG1A 4B85A 1E8MA 2Y1KA 3PUHA 4OUKX 1WCYA 5A7HA 5AK4A 5EIHA 5ALFA 4C6HA 3DYVA 1N1MA 4CCYA 2WHRA 3FLEA 1XZLA 2OCLA 3KDAA 2ZVDA 2O7RA 1EA5A 2HL6A 5AM4A 1GZ7A 3WKDA 3IIIA 4X90A 1CUVA 4UUQA 2HU5A 4K2AA 1YR2A 5K3DA 1JFRA 3T52A 1E89A 2PPLA 1FFBA 2I03A 4CIBA 4LXIA 5AM3A 2OGZA 2WLSA 1R4ZA 2VSQA 4XJVA 4MEAA 3NUZA 5JZSA 1CVLA 5C8XA 2HA3A 2C58A 3TJMA 4FLMA 5ALSA 5EI5A 3A2LA 4EY4A 5ALNA 4DMFA 4M0FA 3FCYA 4UBKA 1LPAB 4HAIA 2WIGA 3SK0A 4PSDA 3DOIA 5K3CA 4BCBA 4DSZA 4ARBA 2V9ZA 2WFLB 1ZD5A 2VJBA 2QXTA 4F21A 5CT5A 4GXNA 3CCCA 4Y2YA 3F96A 3GZJA 1HLGA 2I78A 1LZKA 4MWSA 4TPKA 4H7EA 3I1YA 3CCBA 5D6OA 1LPBB 1U65A 3STTA 1UKBA 3TRDA 5JAPA 4OU5A 1XRPA 1CUSA 4BP9A 3WQHA 5ISMA 5AOBA 4BP8A 1CRLA 1QIIA 4EY8A 5JANA 3MVEA 2HA6A 3ICWA 5AM1A 4P92A 3BF8A 1GQRA 4N5HX 4HXGA 1YS1X 3Q0TA 2ACEA 3W2TA 1GKKA 3HRHA 2VJDA 1R3DA 2PVSA 2XT0A 3WZLA 4B9EA 4PSCA 2VJAA 4LXGA 3A6ZA 1H22A 1UK6A 4Q3KA 4EHBA 2OCGA 4W63A 2XQJA 1F8UA 2PKYX 4UHCA 1UOPA 5AKEA 4FKBA 1BROA 5LZ9A 3WIOA 1MAAA 1VXOA 4GWLA 1DQZA 2HADA 1VZ2A 2BJHA 3K9BA 4Y2QA 3O4IA 3EQ9A 4JH0A 4Q3LA 5ALLA 1AX9A 1K63A 4FLFA 3AILA 5K3FA 4CFSA 5A7FA 2WTMA 5K3AA 2BUBA 1KU0A 2RHTA 4V2IA 1GPKA 4GHWA 3PDCA 3WWCA 2VT6A 1H23A 1LPNA 2G5PA 1JT2A 1XQVA 5JATA 2HA2A 3WKCA 4HVTA 1KU6A 3ESAA 4UBJA 2GBIA 1QFSA 1USWA 1XLUA 3D7RA 3AJAA 4QWMA 4CG2A 3D3NA 4I19A 3V9AA 2XLBA 6YASA 2QKYA 1IZ7A 2WFZA 1JU3A 1N8SA 4DSAA 2GYVA 4EUSA 5J3JA 2ROQA 1EDBA 4BB0A 3VJLA 4KAFA 1IUPA 2QUBA 4G8DA 4KEAA 4H18A 1QIGA 1R88A 3O4GA 4J0GA 5ESRA 5T4HA 1Y7HA 4U2FA 1ODCA 2FUKA 4HZGA 1EK1A 5JD6A 1XKTA 1YAHA 3PF9A 1HKHA 4ZI5A 2QJWA 5ALPA 4BTLA 1CUAA 1GQSA 1A88A 3A2NA 4BVKA 1ETHA 2OCKA 5FOQA 4B6GA 2VTVA 1H2ZA 4DM7A 5ALIA 1EDDA 2H1IA 7YASA 4FFWA 5LP1A 3SWWA 4OU4A 5JALA 3I6YA 1TQHA 3L1JA 2PSDA 4ZGBA 4H7DA 3F8SA 1UWCA 1YA8A 1QO7A 3H2HA 4MQLA 1E8DA 1JU4A 3G0CA 2JF0A 2HRRA 1AUOA 1UXOA 5KWJA 2WU3A 2WHPA 5CT8A 5FRDA 2XI4A 3BDVA 2PSEA 2DHEA 2WIJA 1MU0A 2XUOA 3RM3A 5HKAA 4E14A 1CUGA 1TCBA 2CZQA 3DNMA 3FCXA 2UZ0A 5JAHA 4QEKA 3WK5A 3BDIA 4EY6A 2B9VA 5AH0A 3WWEA 1JMKC 5ALUA 5CMLA 3DKKA 1RWQA 1Q83A 3ZI7A 4CI9A 3BF7A 2WFLA 3WK6A 3R3ZA 4H35A 3OG9A 3DLTA 1EVEA 4X71A 1WHTA 3ZLVA 3F97A 4IH9A 1QOZA 1DWPA 1UFOA 2RHWA 4AZ3A 3H1BA 2XUJA 4UBMA 1MO2A 2ECFA 5LYYA 2JGKA 3P2MA 4I3FA 5CT4A 4OB8A 2WJ6A 4Q3OA 2WFMA 4G8CA 2JIDA 1C4XA 1G42A 2XQIA 2XQFA 3NWOA 5CH3A 4C01A 4B81A 1XZHA 4AX4A 2HFKA 3TEJA 5AKKA 4FFVA 5C8VA 2PSFA 1W6RA 2C4HA 1LBTA 2WIKA 4BBZA 3M81A 4OB6A 1AC5A 1T2NA 4QDTA 2H7CA 4U2BA 3WA6A 1IVYA 5FUMA 2XUKA 3X3HA 2GBCA 4AN0A 5HF5A 1WM1A 5DYWA 1JJBA 1ZICA 2NW6A 4JYMA 2JGFA 4ROTA 4QE3A 4UPDA 3OOSA 4K6HA 1QIJA 4F60A 4DMHA 4QZVA 4BZWA 2R11A 2R8BA 1QGED 4J0IA 4MJ3A 4X6UA 4BYMA 5SYMA 3IA2A 5DJ5A 1ACJA 2XE4A 5LZ4A 2BGNA 3STXA 5ALVA 2BUAA 2OAEA 3H2KA 1CLEA 5AKHA 5I8PA 3UMJA 5JAOA 4JNCA 3STVA 3SX4A 4JEIA 1ORVA 3LLCA 2QOEA 5AOAA 3O95A 3BE8A 3C5VA 2PUJA 1H2YA 3BIXA 3ZLUA 2ZSIA 4HTAA 5E2IA 1ORWA 5IVIA 4QDUA 2JGJA 2C0QA 3VXKA 2Y6VA 4GDMA 5CH8A 5EHZA 1SFRA 4INZA 4OB7A 4UFOA 4J0CA 3FYTA 5CRIA 2WUDA 3ESCA 4HRYA 3IUNA 1W52X 4FBMA 2X5XA 4GEGA 2G4LA 1GPLA 4RE6A 4J7AA 1A8UA 3DOHA 3KOOA 3DCNA 1AURA 5AKLA 1XFDA 1BE0A 5EFZA 4B83A 1IMJA 1YB7A 1DTEA 2QUAA 5CW2A 3O9VA 3F98A 5LIPA 4UBIA 3GFFA 3YASA 3AUKA 5FKJA 3EQ8A 4UHEA 2HA5A 3DKRA 3HLKA 1RP1A 3N2ZB 1FFAA 2CEKA 1WPRA 1OILA 1Q0RA 3C6BA 1B41A 3HJUA 4UHFA 3LP5A 2C7BA 1QIHA 1ISPA 2QS9A 3QMMA 4H7KA 3G0IA 4HXFB 5BOVA 3QMWA 4N8DA 1ZD4A 5D7BA 2DSNA 3NOXA 4X85A 1JJIA 2XLCA 2RGUA 2XMCA 4PO3X 2WHPB 4PF1A 2VATA 4FOLA 2WG0A 1VA5A 1XRLA 1QIDA 3DL4A 3IDAA 3PI6A 2OXEA 3FLAA 4BE4A 3WJ2A 1R50A 3AIMA 4B80A 2JGLA 2DQZA 2ZYRA 1CUIA 1DT5A 4KE6A 4HRXA 2ZSHA 2J3DA 5CT6A 1L7RA 4OCZA 2K2QB 4AMZA 5ALQA 4YPVA 3B3QA 2XMRA 2O2GA 5DTJA 1GXSA 1ZI6A 2X8BA 3D2CA 2D0DA 5BWCA 1ODTC 3VVLA 3D59A 5JADA 4DTCA 3WMRA 4AN1A 2Y2VA 4BVJA 1W1IA 5AJHA 2GBGA 4UBLA 1QLWA 1LLFA 4E46A 1XQYA 3OTQA 4MQMA 3H19A 4IQ4A 2AJCA 1FJ2A 3QVMA 2D5LA 2VT7A 4DIUA 5ALXA 3AIKA 3I6MA 3L1HA 2JEZA 2YXPX 1UK9A 1BU8A 1R9NA 4UFNA 2XMZA 5ALDA 3FLBA 1CUBA 5YASA 3EQ7A 3STWA 3I2GA 5LKAA 4H77A 3H04A 4N8SA 1IUOA 2QRUA 3WK9A 5LZ2A 1XRQA 4W1PA 3KWFA 1ODSA 4B82A 4B0OA 2XUIA 1SCKA 2WQZA 4H7JA 2XUDA 3N0TA 1MX9A 2G63A 2H9YA 2WIDA 3A70A 4ITVA 4I4CA 2VF2A 1TIBA 1VE6A 1TK3A 2J4FA 2QMQA 2ZJ7A 4ZRDA 4A16A 2BKLA 4WCVA 3H2JA 4OYLA 2AJ8A 2XMDA 1Y37A 5AM2A 4J0KA 3D5EA 2JBWA 5EIAA 3H18A 1JKMA 2PU5A 2V97A 2Z3ZA 3D2BA 3PF8A 4H7FA 2OQIA 5AIBA 4P93A 4IHAA 1MX5A 5AK6A 4U2DA 1MPXA 2ACKA 3O4HA 2Z5GA 4ZREA 5HZGA 3D0KA 3R3XA 5JARA 3B12A 2ZJ6A 4G4JA 4RPCA 4G1FA 3F9CA 1Q0ZA 2WKWA 5EHXA 2XUQA 2OCIA 4J0HA 3I2IA 2H7XA 1N5MA 3R40A 5DYYA 3WKEA 3WL5A 4L3WA 4DNPA 3FOBA 1XZCA 2ZYSA 4AZ0A 3PUIA 4FDMA 2WHQA 1Z68A 1LPPA 1RYYA 2IX9A 4PW0A 4L72A 3QPCA 4Y2UA 5JZBA 2ZJFA 5HFNA 3KXPA 3RARA 1W4LA 1PJAA 3BIWA 3IULA 5DNVA 5DLPA 4BATA 3DDUA 1MNAA 2ORYA 4BRZA 5I7UA 2EDCA 4FHZA 5AK3A 3C87A 3E1GA 2OPHA 4UHDA 1K4YA 1I6WA 5JZ9A 3I2HA 3WK8A 4M0MA 3HC7A 4GBGA 5AICA 4W1SA 1X2EA 5ALZA 4KRYA 2WJ3A 3H2GA 1BEEA 4J0DA 1EB8A 1YAJA 3AZPA 4BRSA 1ZOIA 4X6YA 1LZLA 2PM8A 3ZV7A 4O08A 5C81A 3OC0A 5CBKA 5K3EA 4GLBA 4N5IX 1QO9A 1Q84A 2HRQA 2IITA 2HFJA 1U4NA 1JMYA 2PBLA 1UKAA 1CUHA 1BCSA 2CMFA 2GZSA 4MWTA 3G7NA 2XB6A 2X76A 2HDWA 1EXWA 3IUMA 5BV7A 4DGQA 4FNMA 4Z49A 2J4CA 4PNZA 4AMYA 1DU4A 1FFCA 3QMVA 1P0MA 3ZPXA 1F0PA 4MXDA 4FNGA 1XZAA 2QZPA 4EB0A 1XLVA 3DQZA 3ANSA 3G9UA 4G4IA 1XZEA 2VEOA 3MUNA 4Y9SA 4BC0A 3Q8WA 2WIFA 1CQWA 1HQDA 3B5EA 4IO0A 5CT9A 5AI0A 1J1IA 2C5FA 3G9TA 4GECA 5ALWA 1FSSA 3JWEA 4H0CA 1BN7A 3V1LA 4KRXA 1C7IA 1A8SA 1UK8A 1WPXA 4FWBA 4ZV9A 1DQYA 1ZGBA 3V1NA 4WJLA 4KE7A 2Z3WA 2PUHA 5A6VA 4RE5A 5KBYA 3GA7A 5ALOA 4NMWA 4Y2SA 4A5SA 4BAGA 5K3BA 4XIIA 5F4ZA 2YYSA 5CH5A 2GYUA 3GROA 3O0DA 1BRTA 3D2AA 4KE8A 5DNUA 1QTRA 2FX5A 3W04A 3HXKA 2BAGA 3EBLA 3WLAA 4DNFA 4L0CA 4YK7A 4EA6A 4XWGA 5AM0A 5HKBA 4XVCA 3IURA 4X7BA 3FWHA 2QTBA 5AHXA 4BCDA 4S0XA 2O2HA 2O2IA 1ZJ4A 1SC9A 1CFJA 1XROA 2WILA 1E8NA 2VAVA 1UOQA 4ZXFA 2QVBA 2DHCA 2GYWA 3IUJA 2Y6UA 5A62A 3AIOA 4ZWNA 3U0VA 4U2GA 1CUUA 2XMGA 2WUGA 5JD5A 3BWXA 3LS2A 5AKIA 1VA4A 1N5RA 3I2JA 4QLOA 5AKXA 5E4TA 1CPYA 3FYUC 3KD2A 1XRMA 2AJBA 3DD5A 1DX4A 1HL7A 2WTNA 2QR5A 1G66A 4F0JA 1CUCA 3CN7A 4Q34A 4UBNA 4YX9A 4KR0A 5LZ5A 4FMPA 5AI5A 1X70A 5DYTA 2GBFA 3GBSA 5JYCA 4Q82A 5AKJA 3WKBA 4PV7A 2WUEA 3WYNA 1ZD3A 4AQDA 2E3JA 3V1MA 2VJCA 2Y2UA 1O6FA 4RGYA 4C87A 4PSUA 1EINA 1K6EA 1LNSA 4XX1A 1TKRA 1ZIXA 2OLEA 2PX6A 5KREA 5FXMA 3S8YA 1XZGA 4E15A 3D4LA 1B6GA 4Y2XA 1IZ8A 2BFNA 1MX1A 4BAZA 4EBBA 2HU8A 2WM2A 1QTIA 5IH7A 1Y7IA 1LPMA 3I6ZA 4MEBA 3M3DA 3FAKA 3QYJA 3R0VA 4E11A 4MYDA 3FVTA 4G4GA 4QDXA 2DCMA 2XMQA 2JEYA 3ESBA 1CUDA 3AZOA 3IVMA 5LZ8A 1T4MA 1FFDA 3WWDA 4C89A 3C6XA 1XQXA 5JASA 4GI1A 1LPSA 1R9MA 5EGNA 1XRNA 3H0CA 3I28A 3HI4A 3VDXA 3GELA 5A7GA 1F0NA 3WI7A 3AZQA 2XMSA 1L7AA 1XZIA 2AJDA 5AOCA 3KWJA 5AKYA 1UT6A 1XZKA 1YS2X 1XLWA 1MJ5A 5AI8A 1CEXA 4G9EA 3HSSA 4TGLA 3WL8A 4P9NA 3L1IA 4HS9A 3U1TA 1GPNA 3WWPA 1E3QA 1F6WA 4KJXA 1MN6A 1P0PA 1YB6A 3STYA 5LZ7A 3ICVA 3G0DA 5D3ZA 1PV1A 3UUFA 2FJPA 1CV2A 3E4DA 4FTWA 2JGIA 2C5GA 2Z8XA 2PSHA 1K8QA 1VLQA 4HXEB 3ZWQA 2DFPA 2B4KA 2OQVA 1ZIYA 2V98A 5ALTA 1A7UA 4KAAA 1WHSA 3IBTA 3I2FA 2XDWA 1XZJA 1XRRA 4CG1A 3DJYA 3BJMA 4BZZA 3OM8A 1CQZA 5HK9A 2IIVA 1QJ4A 1H2XA 5IVDA 1BN6A 2HU7A 3RKSA 2PSJA 3DEAA 1X2BA 4QDOA 3DS8A 1P0QA 3QM1A 4WFKA 5C7YA 3WZMA 4PQEA 1AZWA 3M82A 2G5TA 5HK8A 1CUFA 3W05A 4RNCA 5AI9A 1UZAA 2BUCA 1VJ5A 4WFIA 5AKGA 3RLIA 1J2EA 2HM7A 3HYSA 5CURA 3WL6A 5ALKA 3CXUA 4M0EA 4Q1VA 1E66A 4G9GA 1GKLA 1THGA 4X94A 4C4YA 3FNBA 3LIPA 3T4UA 4EY5A 1EHYA 5ALHA 5JIBA 3MGAA 1WB5A 3C5WP 1DINA 1H2WA 4IH4A 2WUFA 1WB6A 1SCQA 3O9MA 3ZLTA 1TCAA 5SYNA 4W1RA 1ZD2P 4AO6A 4X91A 4BC1A 1L7QA 3DL7A 5HF8A 3QPAA 3C6ZA 2RIPA 4X6XA 2BGRA 1WB4A 3DYIA 2OGSA 5T4EA 1UK7A 3QPDA 3WWOA 1W75A 1PFQA 4X97A 4ETWA 4B9AA 1TRHA 2AXEA 3K6KA 2JGMA 2OGTA 3IUQA 1LBSA 2WJ4A 3WKAA 4BE9A 1EK2A 3UUEA 5T4BA 1UOOA 4KAJA 2W22A 5HFAA 5FPQA 5K5EA 3QZUA 3M83A 1XZMA 3I1IA 3OURA 1HPLA 3F67A 1VOTA 1KEZA 3K2IA 4QDZA 3G9XA 3I2KA 3PFCA 4ZV7A 5T4FA 2CB9A 3JYHA 1YSCA 4KYVA 2XUPA 4AB1A 5A2GA 3PFBA 1LPOA 5HQ3A 2XQKA 1CUZA 1UKCA 1QIEA 4CCWA 1MTZA 3C8HA 5BWBA 4B7ZA 5EHQA 1G5FA 4U2EA 2PU7A 4W9RA 4WFJA 2C0PA 1BS9A 5FDFA 2HHAA 3V48A 3O4JA 4J3JA 2DQYA 3VISA 1XQWA 5IKXA 1C7JA 1EVQA 3LCRA 5AK5A 4AO8A 1D07A 4DMCA 1CUEA 4X92A 4QNNA 2H7YA 1QFMA 3FYUA 4KACA 1VZ3A 3WJ1A 3G0BA 3PICA 4JUIA 4H7HA 1XZDA 3LIIA 4UFPA 1YASA 5KWIA 4BVLA 3G02A 3R3WA 3WK4A 3BL8A 5IVKA 4U2CA 3W9BA 2FJ0A 5JD4A 3VJMA 5JAUA 4UHHA 1CUXA 3HZOA 3OPMA 5AM5A 4NVRA 5I9IA 4JYPA 5ALMA 1NX9A 5AI6A 1QE3A 1ZI8A 1VKHA 1M33A 3EIOA 1FFEA 3JW8A 1W76A 3WIBA 4BDSA 3W06A 1AGYA 4J03A 1YCDA 4DYHA 2QJRA 3QITA 1GT6A 3G0GA 1VE7A 1SOMA 4Q05A 4B0PA 3BJRA 3WYDA 2ZYHA 3VJKA 4CCYB 1LGYA 4LXHA 3ILSA 1CUYA 4L9AA 4F5ZA 2BCEA 4NS4A 2I3DA 5E4JA 3R41A 1WOMA 2WSLA 2EEPA 1QIMA 4IH1A 2QXUA 4LHEA 5AP9A 3ESDA 3WA7A 4X93A 1A8QA 4WDQA 3BXPA 1AMNA 2RAUA 2P8SA 5EHNA 5EIEA 3C43A 1VXRA 2I3ZA 4N8EA 4LIPD 4C88A 4OPMA 2OG1A 4J0JA 5LKRA 2HIHA 2ONCA 4BTVA 3WL7A 2RI6A 1NU6A 4QLAA 5LLSA 2XUAA 4QWWA 1R1DA 5DWDA 3FSGD 4DNOA 1G4HA 3AINA 1TCCA 1EDEA 3CN9A 5CXXA 4Y7DA 1YA4A 3R3YA 2XUGA 2CJPA 1ZI9A 4UHBA 2XQGA 1DX6A 4LYDA 4Y2RA 4WY8A 5A71A 3C70A 2CBGA 3R3UA 4OSEA 4KE9A 4DNQA 4K5QA 1XZBA 3QBJA 1K5PA 1O6GA 2EDAA 3TGLA 4BDTA 1MAHA 1NU8A 4C4ZA 1JJFA 5ALEA 2PL5A 1BCRA 1AQLA 4P08A 1QZ3A 4A23A 4DMKA 4G8BA 3FBWA 3W9UA 4ARAA 3MUOA 1BEZA 4Y2TA 5ALJA 4G5XA 3C6YA 1CIJA 1ACLA 3E3AA 3HEAA 2HA7A 4YASA 5HF6A 3EF3A 4DLNA 2B61A 4LYEA 1XKLA 4GW3A 1J06A 4FLEA 3H17A 5CXUA 5HF9A 2HA0A 3C8DA 1QONA 3H2IA 2WU4A 5FLKA 3G9ZA 2JGEA 4Y2JA 3HACA 3C45A 2VQ6A 3STUA 3A2MA 2CUTA 1P0IA 2QT9A 2YASA 5DNWA 3PE6A 2B20A 5DTIA 1QIKA 1JI3A 3R3VA 4X95A 1IUNA 1E5TA 5HCUA 4K6KA 2ES4A 4W1QA 3S2ZA 1THTA 4UBOA 3ANTA 3G8YA 3H1AA 4Y2PA 5HQ3B 4D9JA 3V1KA 5AI4A 4BCCA 4EY7A 1MNQA 1MT3A 3FSGA 1ZJ5A 4LKOA 1OCEA 5AIAA 2YH2A 3VVMA 2VA9A 1CUJA 2LIPA 5C8ZA 1EH5A 5AO9A 2OAGA 1CUWA 3E0XA 2XUHA 4OD0A 4BAUA 5FPPA 2AJLI 5FV4A 1HBJA 1AKNA 3GUUA 4EZIA 1HDEA 2XMBA 3ED1A 1EX9A 5ALYA 4TVKA 5CTAA 2ZYIA 3IB3A 1XZFA 4K6GA 5K3FB 4WDRA 4AO7A 1ZGCA 4X00A 1EB9A 1DWOA 5AKZA 5E4YA 3FYUB 5D3KA 4C4XA 2V96A 2QM0A 3NGMA 5ALGA 1QIFA 2J3QA 1S8OA 1DWQA 4OYYA 3RK4A 2DHDA 1U8EA 1DT3A 4WY5A 2GZRA 1GGVA 3AFIA 5ALRA 1U2EA 4H7IA 1TAHA 1CR6A 4CG3A
chains in the Genus database with same CATH superfamily
1ZMXA 2MSLA 2QQ0A 4Q7EA 4R8VA 5CX1A 3L18A 2VAXA 4YRTA 1V25A 1WXWA 4X3CA 3O92A 4FJ1A 1U0LA 1E2LA 5H1YA 1G7TA 1Q7EA 1PYGA 1H0HA 4C4RA 3NORA 4OHMA 3KX2A 1ETUA 2BFDB 3ZWOA 1KS2A 4ERNA 2P9BA 5J2TB 4DUZB 1S01A 4RQUA 2CKMA 2E37A 3RYCB 5K2MA 3VKFA 1LV8A 3G2PA 3TRFA 2DR0A 5IWAB 2DMRA 2P6PA 2WHYA 2YOFA 4I50A 5FO0A 5HBRA 3IAS1 3SBEA 3K0CC 2G6TA 4ZCPA 4RU1A 3SC2A 1ZVMA 2WG2A 1TIPA 1YUBA 2RK3A 1BZYA 2X3FA 2YV1A 1SCNE 4PZYA 3JQPA 2OAQ1 4IWXA 3LHIA 4B84A 3WMFA 5IN4A 3IILA 2C9ZA 4LRTB 4GZ3A 2OFOA 3UWPA 4B85A 1VCOA 2I0FA 3RREA 1B0AA 2Y1KA 4ZPXA 1N3IA 2BCGY 4Y0NA 4DTIA 4OUKX 2IC5A 5BSMA 4C3VA 1K7EB 1PZHA 5AK4A 1P2TA 1GCUA 2BONA 1VJDA 2AYXA 3AF3A 2AKEA 1TJ5A 3BIJA 3UYLA 5BYJA 2R7AA 1VJ1A 1N1MA 4JSRA 1MRSA 2Y71A 4M6WB 2I7DA 1BRMA 3OWXA 4UNPA 1G20A 2ZYTX 3HN2A 1JYFA 5EY5B 4KIJA 1TNDA 2V58A 1IAQA 4WZBB 1TZ2A 1RPJA 5EVJA 3LPNA 1DRUA 5KZMB 2OCLA 3A7EA 1TRKA 2Q27A 3NDPA 4Z0TA 5COBA 2GAIA 2ZVDA 1T1EA 2OFPA 4EH1A 3SQWA 4JP3A 4GSYA 1SBNE 3ZWAA 2HL6A 5H5JA 5B58C 5AM4A 2CVQA 1XKQA 2QG9A 3LK7A 4J07A 5BXQC 4D45A 1UPXA 2VCYA 2QE7D 3ZWVA 2V5UA 4E5KA 1KBQA 2ONYA 4NPHA 5BXYA 3AL2A 3CQ9A 1W6UA 1G9XA 2AOVA 4LK2A 3X1XA 4HGNA 2C5AA 4ZAYA 1ML3A 3QVOA 1LQTA 1NZDA 1YZKA 4FHGA 1SXJA 4DRZA 1EGHA 4QM7A 1NASA 3I8OA 2XXAA 1YR2A 4CM4A 4E07A 2R3SA 2FU5C 4QYXA 4W5HA 5I9MA 4YPOA 1GDHA 1ILWA 2C4WA 3CUKA 3SSMA 5BQ5A 2DPGA 1FFBA 5CCDA 2I03A 1CC1S 1LU9A 3FHOA 1GTG1 3L05A 1G5IA 3RSSA 5AM3A 3KQPA 2GRAA 2PO7A 4CMIA 3KT3A 3M6VA 3RYIA 3IEXA 1Y8ZA 3U81A 4TMFA 4I5IA 1C1DB 4ZQBA 1RHUA 3AVTA 1E3DA 3BMNA 2Z6QA 2PKCA 2OE2A 3E9MA 3OIYA 3PQ2A 3EODA 1U2RA 2LP4Y 3P32A 2GYYA 2Y99A 1JBEA 3AEUB 4FN5A 2QPTA 4JN6B 4I5DA 3UOGA 1OYYA 2XYPA 3AERA 2YJZA 4FZRA 5EUCA 2IZ5A 4LDJA 2HQBA 2ODBA 5JZSA 1SMKA 1GYPA 5C8XA 1P4GA 1SG9A 2A0KA 2HA3A 2P9CA 4DV3B 3KSZO 1VRWA 4KNWA 4CLXA 3ROFA 3L07A 4H6PA 4ALMA 3E2PA 1OOEA 4X7RA 1DCFA 4WNCA 3R9IA 4CT0A 3V46A 4V1CA 4JK3A 3SY8A 5I3CA 3OH8A 4RCYA 4BL5A 3BH6A 4GMGA 1UMKA 2PA0A 4BMVA 5KTMA 1Z2PX 5FNVF 4H4DA 1QM5A 4PZDA 4LK3A 4RPJA 3OLVA 4L7VA 5ALSA 5EI5A 4EY4A 3FRIA 3GGGA 4B6QA 1P1CA 3MA0A 3GX1A 3MG9A 3O26A 3DHEA 3LVRE 4KHPB 1A4UA 2B3DA 1PT5A 2F7SA 3VU1A 3ZKWA 4FX5A 8ADHA 2YCLA 3A31A 1HNXB 2QRQA 3CT4A 4IRXA 1LPAB 4HAIA 2WIGA 3ZHZA 4QGAA 2NU9A 4MYRA 4WGGA 3UK6A 2BGWA 3SK0A 4PSDA 1US8A 3W9YA 2YWCA 2BISA 3ETGA 1DKQA 1BFDA 3ELUA 1WZCA 4QREA 5FTKA 4Q3AA 3ZQJA 2J48A 3NS7A 5FCDA 4ARBA 4EFDA 1T8UA 3TDMA 4JR0A 4TWJA 5F12A 1Q92A 4KNYA 4OGKA 5EJAA 5TGZA 3DE3X 4HX9A 4O5AA 5FPTA 2ERCA 2XB4A 2VJBA 3EAFA 3L01A 1UIMA 2P62A 3D6VA 4NNOA 4AJ9A 2ISSD 1EWTA 5A3VA 1NF8A 2ZBPA 5JBQA 4EMBA 2XB9A 2VSOA 4F21A 1RJDA 1MJFA 5TPWB 4GXNA 3TBFA 4Y2YA 4NHEA 5FHRA 4O1IA 1W85B 2FFHA 1Z0IA 2QX9A 1IIBA 1KFBB 4XCVA 2QHXA 4NAVA 3PSHA 1XDZA 4CKYA 3IOBA 3WXMA 5DLDA 3K30A 1X7XB 1BYIA 3S4YA 3OKCA 2IEBA 2OO5A 1AHHA 5TMDA 5LUBA 1NQXA 1EWRA 4BQNA 2J5KA 2WTUA 2I78A 1GSHA 1LZKA 1Z3CA 5EIBD 5EZYA 3P2IA 2VPXA 4MWZA 4E5MA 1ULTA 1NKSA 2C98A 5E3IA 5BQXA 1DAKA 2HYIC 3A6PC 1JN0A 4XIFA 4TN5A 3CCBA 2VHEA 1VIVA 1UBHS 4KK3A 2QROA 1JALA 2GXSA 2HDNB 1UKBA 3EHDA 3KOXA 3LDUA 3NYQA 3SBXA 2VNAA 4DDWA 1M72A 4BO9A 5KPJA 2Z43A 4D9IA 4MW6A 1KZHA 3IV7A 2CK3A 1QFYA 1YVDA 5IP5A 3HCRA 4CQMA 3ANMA 2GNAA 2JJYA 1TAUA 4UZFA 4ILKA 2ZE5A 1K8RA 4QLBA 3AONB 5HDQA 2M98A 5DM70 3IVRA 2D6FA 2X7XA 2G9UA 1OJLA 2FZLA 3N2KA 5DYGA 1FXWF 3WQHA 2HR1A 2FDCA 2OV8A 4G5OA 2FPLA 1GD1O 1S02A 1RMYA 3HYRA 3NC4A 2X86A 2GARA 3WMWA 3TTTA 3GEBA 4UULA 3ZHOA 1C0LA 2WT9A 4LHXA 3R8CA 4BEBA 2JNWA 2ZIVB 1GQRA 4KWCA 4N5HX 1WXFA 1EM8A 1KZ6A 2OBLA 3A4MA 3WO0A 4B44A 3OX2A 1AK1A 1X1AA 4ENWA 2NPOA 3NHUA 2ZRJA 3W2TA 3KV3O 2OYRA 1GKKA 3NEPX 4D79A 3EUFA 3N0WA 1NKVA 4YI5A 1VB5A 5JXWA 3ZGZA 1I7PA 3SXUB 4EPXA 2CZCA 2ZB7A 4ZU3A 1M7HA 2VDWB 2XT0A 1WPQA 4NMHA 1DKRA 4KQHA 2JBAA 4Y1FA 1ZM9A 3U7IA 3ZDZB 4CR8A 4CDRA 4F3TA 3WZLA 4O5OA 1PJZA 3W5JA 2JVKA 3JR7A 4TTPA 2GEJA 3ZCSA 1EP9A 1XEAA 4WLNA 2DTDA 3BK7A 4FFBB 3HKBA 4MITA 4BN0A 1EXMA 4LE2A 1OXKB 3NWPA 3M7IA 3D1LA 1JDZA 5BVGB 2E5LB 4Q3KA 4WV3A 4EHBA 3B2QA 4W63A 3GJ7A 4MRRA 4PBTA 1KJIA 4UHCA 2JKYA 3M49A 1NVGA 4EEKA 3B52X 4HQNA 4R7GA 4FKBA 4XOUA 5AKEA 5J59A 3MS4A 2SCUB 5DT9A 5EJIA 2GBLA 3CF0A 5KAMA 5BSTA 3K0FB 1LJ8A 1CR1A 2O52A 4TRJA 3V8BA 1CT9A 1TVEA 2JI8A 5K05A 1D0IA 3C1OA 1KI2A 121PA 1RYNA 1LSSA 2FQXA 2ILVA 2BJHA 2LCFA 2FW1A 2Q8NA 4M8KA 3SYRA 4P34A 5FI5A 3JQ8B 5FUQA 4NCBA 1A4RA 1IIRA 1K63A 1R0XA 4MW1A 1KIAA 5KYXB 4JFAA 2F1JA 3BYZA 2GTIA 2L17A 4Z8YA 2WTMA 5DWQA 2A94A 3VZSA 1DPFA 2DUNA 3JASA 4MV1A 4YS6A 5K3AA 1Q3HA 3WLOA 4K6FA 3R3HA 4KN6A 3A58B 2D7JA 4V0LA 2DB3A 2J31A 3A9UA 4RORA 2AMYA 3QUCA 3PJGA 3RIMA 2J32A 1TEHA 5GOTA 2IUUA 1ANKA 3L9WA 3WWCA 2DQ4A 2E6UX 3OIWA 1H23A 2P9YA 1W8DA 3H3JA 1J7JA 3RQSA 2G5PA 5JNSA 1DAPA 3F0TA 3LRTA 1JT2A 1RZRA 4DHWA 2VAWA 1PUXA 4YN3A 2A78A 3A1FA 4I1SA 3RE1A 3U26A 5C18A 1ZK2A 1YQXA 2ONJA 3KR9A 4CMEA 5HYVA 2WF9A 1G3QA 4PYRA 1V6CA 2DJIA 3ESAA 3OQVA 3QFHA 2YBEA 1WXHA 1MW8X 1TM4E 4HNRA 2QDXA 3GJ3A 5ESWA 1NM5A 2EKBA 3FJYA 3AI2A 1USWA 1H8HD 2IUFA 3WIUA 2VKQA 2B78A 3FH0A 1UBCA 2ZWPA 5I7VA 2H1CA 4KQFA 4R1TA 3NIFB 3DSRA 1XV5A 2B25A 3FFXA 5JBIA 1L0BA 1LVHA 2FGKA 2PGJA 1Z5GA 4I19A 5TEVA 4Y6OA 3W6UA 1MB0A 2P6OA 4RKWA 2JFFA 4JL5A 1T13A 3NJRA 6YASA 2ZJYA 3MOSA 2FCRA 4PHTA 4U2KA 4L5CA 1SBTA 1X7WB 1PJBA 2V6IA 3GT0A 3BERA 2IYLD 3D4IA 3QV1A 4CF5A 4F5YA 1J1UA 4RTLA 1PQ4A 3AHHA 3FCAA 4LSZA 2D00A 4WKPA 3V8EA 3VR4H 5ADUS 2XKJE 4IICA 1ISMA 5E1BA 4E31A 3AYZB 4GKJB 2DLDA 4F1KA 1U7DA 2PH5A 1WXQA 2J30A 4NMXB 1MC5A 1JHQA 2FEMA 1SVOA 1FW6A 1QHIA 4X45A 3V4LA 4FMCF 1DNPA 2I3AA 1DBIA 1V3TA 3VJLA 2XCRB 1IUPA 1XCPA 3JZAA 2B2NA 2DFVA 2DY0A 4C2UA 4G8DA 3MD9A 1K89A 2K5UA 2BH2A 1D2RA 4YV1A 3OM0A 3QKUA 1RJ9B 3FB4A 4DCGA 4EJSB 3USCS 3EDQA 2HJ9A 4JVOA 5IUNC 4XWTA 5T4HA 1M2GA 1FYDA 1KA9H 1VKOA 1XI2A 1Y7HA 4F4IA 2O1SA 4IFBA 1WD5A 4ZVPA 4ZQFA 2ZB4A 2FUKA 3ANXA 1KPGA 2Y1FA 2ZOSA 2ORWA 3IQEA 4IYJA 1LXCA 5EJFA 3V8QA 1IH8A 1XKTA 2Q8PA 5EGSA 5FADA 2PRZA 4I66A 3PF9A 1JP7A 3QWFA 2G88A 1AO3A 1Y48E 2XOEA 2OAP1 2Q1XA 3AV0B 4IIEA 1L8XA 1Z73A 2G08A 3C0KA 1J42A 5TARA 4FKZA 1CUAA 3FJ1A 3H4VA 3AR9A 5F1YA 1JA0A 3BH0A 2VRCD 1TM1E 3D0OA 2ALJA 3KZCA 2W2VA 3BHJA 3O9ZA 2QL9A 3ZWKA 4BEVA 4BO4A 1XWFA 4BVKA 1FTWA 2OCKA 1VHLA 3OUTA 3I5XA 5D5HA 5J9FA 4LTDA 4JI1B 2PLWA 4TL7A 5FOQA 3E82A 2VTVA 2ZIXB 1YI1A 5G3YA 2QY9A 3KU4A 1U0JA 3IBSA 1W73A 3BXGA 1BFKA 3FFWA 1PJ8A 5AVSA 4X60A 3VI3B 1EDDA 2H1IA 1S3IA 2OD2A 4CCSA 7YASA 4II2A 3KKEA 1J90A 1TQHA 1XFAA 2I8AA 3L1JA 4FVTA 3DP7A 5IJZA 3KG2A 3VSBA 5G0SA 3LOPA 3A05A 4G5RA 1YL5A 1W87A 1EZ1A 1YA8A 4ZO9A 1QO7A 1CY6A 1WE2A 2YCBA 3GIWA 5IKMA 3JWJA 2VSNA 1JU4A 3B6JA 2PY6A 3C3PA 4AYXA 2VK2A 4G1CA 2XDQB 3RUPA 4RMNA 4BKUA 1AGRA 1QS0A 4YRCA 1OC4A 4R1LA 3Q5EA 3WV5A 4MW2A 1F2TA 1GM5A 4LGCA 1C1DA 3U19A 5KWJA 1U80A 3C3JA 3TQFA 3LWNA 3CNNA 2YYAA 2JATA 3PLAE 4WKNA 5E9JA 3AEUA 3TIFA 4J1QA 5FRDA 1TL7C 5ERYA 2XI4A 3UT0A 1UXIA 3OA0A 3OU7A 1JIVA 3V00A 2P91A 3BDVA 4FZ5A 3L2OB 1BEUB 1PGPA 3T8YA 2AFVA 1N2EA 2MCFA 4L9SA 4PHHA 3EXEB 3CR8A 4PICA 4LDZA 4UUAA 3N87A 1VPVA 3ZY3A 4AFNA 4XPIB 1GSAA 4HDSB 1KQGA 2XUOA 1O0CA 4LZJA 4ARUA 1T1JA 2YUTA 1T2UA 3E3OA 2XNSA 2XE7A 3M5CA 3WGNA 3WLRA 2O2EA 1OB2A 1S4QA 1C9NA 4NSNA 2CFOA 1AU9A 2FEXA 3BDIA 4JLUA 4R1OA 4X0EA 4M8SA 1E7MA 1X6VA 3FNFA 3HP7A 3JR3A 4GBMA 4FCVA 3EJ6A 4GM1A 4YH1A 1NBIA 2B83A 4BQQA 1Y6ZA 3AVVA 1U5AA 1CZKA 2WC1A 3QTBA 3AOGA 4IVPA 3RFCA 4IWNA 2QLTA 5K0EA 2R96A 3CRVA 3RRBA 2OGUA 1ECFA 1GSIA 2ZR7A 1ADBA 2DTXA 3QU5A 3EGDB 4Z9XA 1C29B 2QDKA 2ZULA 3NGLA 1ZK0A 2GUGA 2HPVA 4WNIA 1X77A 4M1SA 4PG6A 3NVKI 3OF2A 2E18A 1QZUA 2GJ9A 1DUIA 2ZBRA 4CI9A 4DV5B 4JV5B 4D8XA 1USUA 3BF7A 1V3QE 3AF0A 3OZDA 3AOEC 1KYVA 2ZZMA 2YVUA 3L04A 4D44A 2QVGA 3SIXA 5IT5A 3DLTA 3ZS8A 4WJZA 2NU8B 4A2QA 3QYAA 5EQJB 2DPLA 2FF7A 3BXHA 3G59A 4RIHA 4BLQA 4CMGA 3EG9B 4CKXA 3ZLVA 4JLSA 5TPWA 2QRPA 2PXAA 4IEIA 1I8TA 4C9BA 1QOZA 3WTCA 3TNJA 3DBRB 2HXGA 2NO4A 4IZ6A 4BNZA 3VBEA 2G7MC 4IFTA 2DG2A 3Q6MA 3GRVA 1V7ZA 5DN6A 5TPZD 5C5CA 3O4FA 1QDEA 2FW7A 2CCKA 1JSXA 1EESA 1TW2A 3UTCA 4F04A 2ADMA 3KTAA 5LYYA 5JLAA 3L6UA 1DXOA 1VDMA 1YUNA 1J8VA 1M8KA 3S1LA 4EQZA 2GNPA 3IESA 4Y2HA 3GLIE 2CCGA 3W77A 2WJ6A 3KJQA 4Q3OA 3WDSA 2WFMA 5DSTA 1WJGA 5CYOA 3X1MA 5EPEA 3F49S 3THOA 1K3TA 1NW3A 3O3NB 2XRZA 2C1EA 4NNPA 2Q3CA 5CR9A 3IBFA 1QNFA 4J0FA 4N01A 3BL6A 4OQZA 3E5NA 3Q8LA 4QJBA 1PP4A 1FP2A 2ZI9A 4TXHA 3OBBA 3JARB 4QTUB 3C6KA 1JVNA 2FJUA 1F6DA 2J3MA 2HFKA 1XHFA 3JD3A 4YRZA 1M5RA 2DKNA 2OHJA 2IOFK 1C3JA 2PQ0A 3IKTA 5LYJA 1K7CA 5C8VA 1N9ZA 2XEDA 2PSFA 3R8XA 3KU1A 1NHWA 1RLUA 2DWOA 3WP1B 2K87A 3WRYA 4ZHQB 2HJVA 1H5QA 3SJUA 2HJHA 3VH3A 1RP7A 3I61A 1E1YA 4JLJA 5B2EA 3I37X 1O5IA 3NAQA 2JFNA 2R62A 1VECA 1Z35A 3R3JA 4TRMA 4XE5A 1FNBA 3W6NA 4BP1A 4EB3A 3Q1KA 2ODNA 2UYGA 3WQQA 4NATA 1HX7A 4QDTA 2H7CA 3CZQA 2AHRA 1G0NA 4AG3A 2GBCA 2O5CA 5ES4B 1UEJA 3O31A 1NUAA 1V1JA 1VPDA 3C14C 5CBPA 4LOAA 4DV2B 3DBHA 1OF1A 1Q15A 1ZICA 3SXUA 5KKCA 2LUOA 2P2GA 2VDWA 4G0PA 4PXSA 4EKNB 3PNOA 2REQB 1RI1A 2A1UB 2AC4A 3NYRA 4RTNA 4G0MA 1SUPA 1LI7A 3GFTA 1RI2A 2TMKA 4NFLA 4D0RA 4DMHA 1HKUA 2ZW9A 1ZXBA 4FFBA 1BDBA 3HO8A 4FMBB 5KOHB 1L4UA 1T43A 1O3YA 2R11A 5IBPA 1QGED 3DVRX 4UOZA 4X6UA 1YIAA 2QVYX 4PLPA 5BVGA 1D0VA 3B9BA 1TUIA 1YB5A 1FVHA 2ZBVA 1QXSA 3MW8A 1Z39A 3C1TA 4E1VA 1ACJA 1CB7A 2SCUA 2VRBA 2XE4A 3CR3C 3MJEA 3PDIB 2Y4NA 3CKYA 4BV3A 2BGNA 3K0FA 3MJFA 3L4SO 3MUFA 4D42A 3SBOA 2P41A 1HEYA 2DFTA 5AJWA 4RK7A 2BUAA 2OAEA 1L2TA 1HNNA 1VIAA 1MJHA 3EUEA 1J99A 2GPNA 5IBCA 1P7WA 1XMSA 2Q07A 3ONFA 1DBWA 4TX1A 5FH9A 3OCYA 4MO2A 3PRKE 2R5NA 4S3MA 3JQ8A 4B2YA 2HCBA 3STVA 1Y6GA 2VZLA 3LHFA 1Q11A 1SXPA 2HPZA 2PJUA 4OREX 5BWOA 1P3JA 2HV9A 2OLJA 1NFFA 1Q0SA 2Q6IA 4LSWA 3S99A 1CF4A 2DZDA 3PHHA 1KORA 4OAQA 3E61A 1KDRA 4RDHA 5JJCA 3PX3A 4WXEA 4V0SA 3QVJA 3G7UA 3H11B 1FZQA 4HOYA 4L5YA 1GAWA 3C5VA 2Q5FA 4M7WA 1NF2A 3DPIA 5G3ZA 3VSEA 1NI4B 2I2FA 2Q41A 5EPOA 4DQUA 3JY6A 1XCOA 4R98A 3RIEA 1FFWA 2WVAA 2ZSIA 3MSCA 4I4TB 4L75A 3OOWA 2O0LA 4HTAA 1NR1A 5A3RA 3ZZNA 1HI9A 3WJAA 1F7VA 3HFRA 1ZVKA 4RLQA 1ORDA 1N78A 3K5IA 3AUTA 3KXKA 3I42A 4IV8A 2JLQA 1JVSA 2FP3A 2X40A 1XCBA 2C0QA 4JEMA 1EXNA 1VSBA 1T0IA 3CLSD 2Y6VA 1UXKA 2ODAA 2OA0A 4A8PA 5CH8A 3WAGA 1RYEA 1QMPA 3GJ5A 1SFRA 4XWOA 2EFHB 4INZA 3ZDYB 4TTIA 4KSBA 1IZZA 2LDXA 1IG0A 4RHEA 1CQIA 1RQLA 3K8ZA 1CNFA 1I5OA 4KMSA 3WHIA 2KE5A 2EG5A 5HJEA 4MGIR 1UAAA 3RSLA 3RRZA 2V65A 5EMNA 4JU9A 1A7KA 3R3SA 4JODA 1X7WA 4L15A 2FXVA 1XK6A 4J1TC 4K46A 4XW2A 3SG0A 3KPVA 4H08A 1VE9A 1CR2A 1GRQA 2ODPA 4YNBA 1A8UA 3RU2A 2OCBA 2PUBA 5EWMB 2HIAA 4ZOLF 3KYCB 2ZB3A 2R00C 1X9GA 5AKLA 1XFDA 1AKWA 5EFZA 2PMDA 4L78A 2JCYA 4HDKB 4UNSA 1E7RA 4G56A 1RKXA 3CCFA 3TPCA 4B83A 2AFIE 1XMIA 1DCTA 2IYTA 4H1VA 1SC6A 1YB7A 3F73A 3C3WA 1ZNWA 1UDXA 2QUAA 1EGMB 3MJRA 3O9VA 3LG2A 3AHCA 4K6CA 4C2TA 1H1TA 3QFTA 1FP4B 4MGYR 3JQFC 3RVMA 5CLQA 1LBIA 3G89A 5BR7A 4DSTA 2B37A 1NSYA 2SKEA 4FYPA 4KJZA 4CHGA 4DV1B 1ZH0A 5LBUA 1OASA 4UEQA 2QJFA 3GEEA 3CKLA 2J1LA 4KRFA 1OXXK 2ATIA 2EVWX 3AUKA 3S2GA 1PG0A 5JY1A 3LWZA 3MWDB 1GPWB 1PAUA 5JS2A 1NJSA 2F90A 3EQ8A 3EPHA 4MYUA 4UHEA 4ZMSA 1KH1A 4G0UA 3PL1A 4N5LA 1CRQA 1GQQA 5LP6F 1NR7A 3GNSA 3C3MA 1Q22A 3KO8A 4CF7A 2PHZA 3EGOA 2IHJA 2NO9A 2CD9A 3DV2A 2V6GA 3N2ZB 3PUJA 3PQ5A 5LJLA 2BTQB 1GCGA 2HNKA 2BKEA 3OJ0A 4N0QA 1WPRA 3GFVA 4LF9B 3IQDB 1T4CA 3V7NA 1EGAA 5TT1A 1WCXA 3CMCO 3HJUA 1YCHA 1Z7BA 1DAMA 3GH1A 2QBYA 1JBKA 5HEKA 1JLRA 2IPXA 1YTLA 2CMDA 3JAKB 3CGWA 5J4LA 4QPPA 3QMMA 4QODA 4B3JA 1DDIA 2V4UA 3PNBA 4BS9A 2ZIXA 2RAVA 2VH1A 3QX3A 5JWRA 3BRWD 1ZD4A 4GO1A 2VR1A 1RYBA 1QH1A 4OBWA 1IRXA 5NULA 3NOXA 1AO0A 1U0EA 4L4SA 2P5SA 4ALNA 1O87A 3T1QA 2HGZA 3TTXA 4JC8A 2BWJA 2K7ZA 1A9QA 2RGUA 1TMKA 2ZYAA 4L7QA 4KXUA 3T35A 2FEOA 4P7JA 4W7SA 4CTMA 4ZYUA 3UB2A 3CLHA 1PZXA 2WHPB 3PD0A 1MIHA 4JI4B 1Z2CA 2XCLA 1DMRA 1J0CA 3RD5A 3F4KA 4FOLA 3FYCA 4MIYA 2CLLB 4MEJA 3RRXA 5LQNA 3H99A 3EDMA 4E1BA 4RQAA 3NFYA 3K09A 3GMIA 3U5TA 4H7PA 4LWPA 4Z4IA 1Q20A 4GGPA 1DC5A 2FFRA 1CIPA 2OXEA 5D3MB 1P2VA 1VE3A 1U1IA 2YXBA 1B3BA 2AEEA 4Z8XA 1J9EA 1U28C 2WE7A 2QW1A 3HUEA 3QOWA 3R0JA 5CM2Z 1DT5A 2L18A 4HRXA 2ZSHA 1TOAA 4MMYB 4LF4B 3EZGA 4D9EA 3H5LA 3EDOA 5FULA 2BH9A 3INNA 1TUEA 3AEKB 5IDWA 3K70B 2N9UA 5AUQA 2J5XA 3BBPA 3EXEA 2NGRA 2F9FA 3KQUA 1J5PA 2A5GA 3K92A 2HN9A 1L4BA 1Q0LA 1T4DA 2O2GA 3I01M 3LAWA 2ZJZA 4CEIB 3L06A 1P39A 3P94A 4AP5A 1QVRA 5CA1F 5BN4B 5CGZA 2ZSJA 6REQB 3NALA 2RKWA 4BN4A 5KSWB 5ECWA 3U4CA 3K53A 5JCOA 1P45A 3D59A 1QKJA 4M8IA 1M10A 3O84A 1BOFA 3WO1A 5B55A 4C07A 3GEMA 1R6BX 1THZA 2MSWA 2PH1A 2GK3A 4FIDA 4IZHA 3N2LA 4BX8A 4ZDIA 4WMLA 1RQNA 4BVJA 5MN6A 1QCCA 1W1IA 4D8WA 3ET5A 3RG8A 3JVVA 5TNXA 4LTMA 1OSNA 3KS9A 3ND7A 3H5IA 4M1WA 2DUWA 1JIIA 4IFEA 4P0PB 1IHOA 3VPHA 1XQYA 3OTQA 1EZ4A 3KNZA 4YRAA 1XN4A 1JR3D 3TQTA 3GH3A 3KJHA 5HW0A 2MMCA 2ZIAA 1JEAA 4L2IA 3VHQA 5HKOA 1PWXA 1H1DA 1ZUNB 2RJOA 3JQBA 2DPYA 3CTPA 3IOYA 3W2IA 5WRFA 2D2FA 5B4TA 3UHAA 3DDNA 3ZE9A 4P81A 3W79A 4OXRA 4P1ZA 2XJ9A 3EG9A 4K2HA 4R05A 2PZEA 5BSHA 3HFSA 1SH7A 2VT7A 1O8CA 3DHVA 5KQPA 5KNCD 1Y4UA 1YZNA 1IBKB 3GZNA 4DQDA 2OCYC 4FFOA 4KV7A 3AIKA 4R1SA 2H0RA 2BKUA 2GPSA 3OTGA 5C4GB 3MB8A 3CF6R 4FCWA 4CIXA 3L1HA 2FPKA 2WPNA 4RW0A 2ZRAA 2ZPAA 3OTOB 3FD8A 1R9NA 4M0KA 2JFPA 4UFNA 1YZ3A 3THRA 4DLTA 1OWPA 1SQSA 3HEBA 1OV6A 1CUBA 2C78A 3P9SA 4REOA 4LY0A 5GM2A 5JAMA 4WUTA 2EGHA 2GHRA 5K09A 1W46A 3EQ7A 3STWA 2VWGA 1PGNA 3MTBA 4MJLA 3B89A 3PQFA 3I34X 3IELA 2ZWVA 4KODA 4TYQA 3GGPA 2A3RA 5JPDA 1ZH2A 3H04A 4N8SA 4GC5A 3SNKA 2WVGA 4CM1A 1E4YA 1KJQA 5M3BA 3SS8A 4J75A 3I3SR 3LQ1A 2QRUA 4UNNA 2P69A 1ODSA 4ENUA 3ZW9A 4ZGWA 4CDMA 4LN1A 3V8PA 3PWKA 3N5CA 2XD9A 1QG4A 4KITB 2WZBA 1A5BB 4HXYA 2NXEA 4LMPA 5FO1A 5FOXA 3TVTA 1OB5A 1K9SA 2FPWA 4EX7A 3N0RA 3W3ZB 4H7JA 1VJTA 3P2JA 1WULS 3OLCX 3AY7A 2YXEA 5EMLA 4KWIA 2W5UA 1T1IA 1MX9A 2G63A 1MA3A 2PFKA 3JYLA 3LL7A 5DP2A 4D9MA 4QHTA 5CA1B 5JH7A 4ZHQA 5L9AA 1G7CA 2CXSA 1ZR2A 1G2OA 3VKWA 2R68A 2O57A 3E7XA 4UM7A 2RBKA 1NBMD 1T5IA 2FX2A 2IYYA 3BXEA 1TIBA 4I4CA 1Q0TA 1HNWB 1P8AA 2QUHA 3OQHA 1WMSA 4M3NA 3VHXB 3SHTA 1C0EA 1QZXA 1TK3A 1VE6A 1B6TA 3DLCA 2Q45A 5K0LA 4M9UA 3T06B 2H2IA 5FWNA 3VYUB 1KO5A 4MUGA 4XYEA 3H1EA 2VOJA 2JS7A 1K0FA 4DEXA 5DBHX 3OEHA 1OWMA 1FVOA 1OX6A 2AOXA 2UZIR 5HMLA 2F43A 3RHZA 1OKKD 2BEWB 2F9LA 2I71A 2ZJBA 5TF4A 3EG5A 4C3UA 2AQIA 1Y63A 4U0JA 5AM2A 3G2MA 5JNWA 1KJYA 2AC2A 5IFKA 4QBIA 1JQEA 2YHSA 3H1FA 4BZXA 4J0KA 1TJNA 3D5EA 2AYZA 3GLGE 3D8NA 1P18A 3I39X 3O74A 2YOHA 1BA2A 1XMPA 4O1MA 4Y3UA 1QX3A 5EIAA 1KYYA 2N42A 3GGSA 1ZOPA 2V97A 4B40A 2O0JA 4RLFA 3WLJA 1Q2XA 3NBMA 3SEFA 5KOHA 4YMHA 1E1QD 1SA0A 1UMBB 4X20B 1C9YA 4BNFA 5DX1A 4EEZA 2VP9A 3PFNA 4NNJA 5DOVA 3QLTA 2B5OA 3JZMA 3OCVA 4IHAA 9LDTA 2DLCX 5AK6A 2OBMA 5SZIA 3FTCA 3PDIA 2EKQA 3O4HA 3BDAA 1YOVB 2PEYA 4ZREA 1HYQA 3NYIA 3QXXA 2JIPA 3IODA 3D0KA 1YFKA 4C0KA 5JARA 5HJ2A 4ZTUB 5CJJA 3GCDA 2H1OA 3B12A 3PI7A 1NW9B 3RI3A 3OT1B 3CEAA 4D3SA 1BQ4A 3Q3EA 4ZFNA 3ZVLA 2BEKA 1UKVY 2LDBA 4HQ0A 4AF7A 4ADSG 2H48A 4DLYA 3R7LA 1EDOA 5J4YA 2IW1A 2EYQA 3GEPA 2YZNA 2Q0QA 3MPUA 3TTUA 4E03A 4RPCA 3NP9A 1W30A 4I46A 5HR5A 2PAAA 2ZSKA 2WKWA 2YWFA 5F76A 4ESOA 1NQ5A 3Q7TA 4JXZA 1E5LA 5M5BA 4MPPA 2B94A 3H11A 3HMKA 3EPJA 2FRDC 1CVRA 2F1OA 3DA8A 4ACBA 2I7VA 1Y4ZA 5JWOA 3LMKA 4TN1A 2PRIA 2HHCA 1IN6A 3HDGA 4MICA 3UMFA 3A1EA 3D3EA 3Q0IA 2HMYB 3R40A 5A5GA 2XR1A 1NI4A 3H86A 5DYYA 1O0BA 1KY2A 4I4TA 2OESA 1PFYA 1BDMA 3UBMA 2ZYSA 3VAAA 4M1OA 1RQXA 4JL6A 1X3SA 2WHQA 3EXAA 4R2IA 1Z8HA 4X8HA 2QJOA 4YAOA 5D86A 3MBOA 1LPPA 1R8SA 2B2CA 4OP3A 2ZREA 2B1QA 3V6MA 2BSAA 3QPCA 4Y2UA 4B4WA 4CYMA 5KX5B 5IM4F 3MWKA 1TT7A 1NRXA 2ZJFA 2IDZA 5HFNA 3RARA 1W4LA 5JNVA 2G04A 2JHFA 2Y66A 5DNVA 2XT9A 2ESRA 1MF7A 3LH5A 1OY1A 5EYPB 4BATA 5BNZA 5CD1A 3SZUA 1YFJA 4MUFA 3OC6A 5I7UA 1JB1A 3ZDXB 3EF0A 5ESXA 5C7OO 3TI9A 2EDCA 2OGWA 3IHKA 3NKVA 1XSEA 5JSZB 1JR3E 1UOEA 1B42A 3MINB 1C7ZA 4D8VA 3KPUA 4OA5A 4FS3A 2F1HA 4KLCA 1MRNA 1I6WA 4QELA 4Z4QA 2CV2A 4IJQA 4NV0A 5FWXB 1E2NA 1Y33E 5EWMA 1MAWA 1C41A 3Q2OA 5ALZA 4KRYA 4BMPB 1KSHA 2NO7A 1NNLA 3QPWA 4UHKA 2X0KA 4DV7B 4E3ZA 5D51S 1DE0A 1WXXA 2C5HA 4HDKA 4E6EA 4DR2B 3BFVA 2RCNA 3G79A 4Q4HB 1M1NB 2QR2A 5DTRA 1UBGA 3TH5A 5JS1A 1O89A 2IEDA 1HFJA 2O2XA 3B9QA 2CFCA 2QW8A 3IKMB 3PTLA 4MW0A 5GONB 2AOTB 1EJ2A 1NQWA 1ADYA 1AKMA 2ZITA 2WR8A 3NDJA 1FP4A 4FHDA 5EG5A 1NHGA 3HM2A 4I3GA 4C08A 2BFFA 2OXCA 3QLVA 1Q84A 3KK0A 4HMPA 2HSJA 3HPQA 3HY3A 1U3FA 2HFJA 3QNWA 4FPXA 3DZDA 4TKUB 4WJKB 1JMYA 2PBLA 3DFKA 3SSOA 3T4XA 1X7HA 5KQLA 4NAUA 1M73E 1E2HA 1DSSG 3SJCA 3HKEA 3PE3A 2CMFA 2GZSA 3PIDA 5IHXA 1LLUA 5EINA 2MINB 3A9VA 5PGMA 5KQSA 1C8BA 3R0QA 1XP5A 2VHZA 3JV7A 2X76A 2FE4A 2BM8A 2Q3HA 4DBVO 2HDWA 3KR1A 4LJLA 4P5EA 4XM1A 3PQ6A 1TZBA 1UBLS 5EZYF 1ZISA 3FZGA 4LJKA 4NKRA 5J63A 1M0WA 1G9SA 3R7SA 3USES 4MLCA 4CDGA 4DGQA 5KJ1A 1T25A 5B53A 3HWX1 3ZE8A 2QN1A 1YK0A 4J76A 1S89A 3F6CA 4D9KA 3JAKA 5CNKA 4GDFA 2R8YA 5EJMA 2R7LA 4YMSA 4AMYA 3KKKA 4BWFB 1F2VA 5H59A 4E5NA 2HT1A 5EWLB 2HV8A 2R8RA 4FDAA 1COWD 1P0MA 1Y34E 1IBCA 3ILXA 4RCVA 5MGBA 1NBME 2H2HA 2AE1A 2CMKA 5H80A 1B74A 3IPYA 3TB4A 3GNQA 4A8JB 3N86A 3HRKA 5CG1A 3X2FA 4JT9A 4FYYA 4PCLA 1XZAA 2H63A 4EB0A 3DQZA 4RLSA 3ANSA 3G9UA 3OETA 1KHTA 3W4IA 4LF5B 1AH2A 1E2EA 3MUNA 3G3EA 5I9SA 3Q8WA 4L22A 5EJ9A 2QYOA 4JZYA 4PLZA 1ESMA 3B5EA 4WXPA 5CT9A 5EN4A 4NRDA 1PK8A 1H5UA 4AYTA 1DEHA 4BWGA 1QGZA 3HBAA 4C78A 4D6YA 4KBYA 3COWA 1U1CA 2ZTLA 1PJSA 4CMCA 4LOKA 3VOTA 3CRRA 4IDDA 4FFNA 3AHFA 4U02A 2GXUA 4OHOA 3TCKA 1EFLA 1YV9A 3IALA 3LGXA 1EUCB 1XMXA 2W2MA 3K4PA 1L5KA 4S1TA 4OK6A 5D3MA 1QC5A 4YREA 4N49A 1O95C 3C74A 4QG7A 4WJLA 1R0WA 2IDJA 3E53A 1KDZA 4KE7A 3KELA 4QTYA 1E94E 4ML3A 4PG5A 4B73A 8MHTA 3GXOA 1IULA 4RE5A 1BAPA 2CGEA 5FTJA 1NXPA 4DC1A 2WM3A 1XVAA 3FXAA 4GR5A 3GA7A 5A4DA 1ZC3A 1TYBE 1CJMA 2W6JD 3S81A 1SQ6A 4ITRC 1OHHA 4YHHB 4R83A 3EXHB 4U9IS 1DKLA 3WV4A 4K8RB 5ALOA 4TV8A 4NV3A 3WYAA 6REQA 2Q1WA 4J1NA 4A5SA 2QTWB 2VDUE 1BMFD 1BMDA 1ZCAA 4JKYA 1DLIA 4R84A 4U63A 3IV6A 2AI3A 4G4SO 2GYUA 3ONEA 1VIDA 1M8FA 3EIWA 3OZGA 4IVNA 4NDNE 4Q1CA 2Q3DA 4YDQA 5KVAA 3NCTA 2A9JA 1IZ9A 2APJA 3PPYA 3AYXB 4K26A 1KBOA 1G98A 3HXKA 4IJMA 1YB1A 4LVCA 2NVBA 4DBZA 1J2RA 1G8PA 1OIVA 3JWPA 4L0CA 5JZMA 4W5TA 4FQ5A 5AM0A 2PQ2A 5HS4A 2GQ0A 2C8LA 3EK2A 1NBHA 2ZAIA 4FDUA 1QHYA 5FUVA 1ZUNA 4W8HA 1C1XB 1OH5A 2ZRDA 1I4LD 2V7XA 2QTBA 3L7BA 5ER9A 2E82A 4ETMA 3BFJA 4LDNA 4R8RA 5IBRA 2YV5A 1WBJB 3T1NA 2O8NA 2HREA 1ZO8A 2PT9A 1DIGA 3GQBA 1V6SA 2Q4RA 4IOLA 4QOFA 4TT8A 4BCDA 4CTJA 1TYZA 4CUJA 4E2WA 2O2HA 1DXQA 4F5WA 6ABPA 3ZWWA 4F3KA 5JVDF 2NXJA 2QA5A 5ITSA 4PAWA 1HETA 3ZE1B 4MJ7A 1WD7A 2Q2WA 4G26A 1H3NA 2P8JA 2J6BA 3AUXA 4BJ3A 1JEQB 1Q6ZA 3OHPA 3QP9A 3LRXA 2YY5A 4K1LA 2IXEA 4EMSA 2DHCA 4QPJC 3MWFA 3FCUB 2GYWA 1QYCA 3HWRA 1XTRA 1PJQA 1NAIA 2Y6UA 3OO0A 4FCTA 1OI7A 1V1RA 2FLKA 4L5BA 1SXQA 1SU7A 3MWYW 3WGTA 1T8RA 1I24A 4X9XA 3ICCA 4J2OA 4JJ7A 3LKBA 3AIOA 1XZQA 3ZHQA 4U2GA 3AJRA 3TKAA 3PLNA 5FIUA 4YAWA 3BH7A 2XMGA 3CPHA 4OMDA 4X62B 2DOKA 3UV3A 2BE7A 2EF0A 2I6UA 5C0OE 4E09A 1O1YA 3LS2A 3P9ZA 2JW5A 4POOA 5JS6A 3T5AA 1NOJA 1JQ5A 1N5RA 1U2DC 4HNTA 5AKXA 1I3NA 4OQQA 2XNDA 5HVNA 1SHTX 1GY8A 5AVOA 1Y3CE 3WIVA 1HL7A 4I6JA 3KJXA 3WQRA 3H5VA 3J7AC 2QM8A 4E5SA 1GTJ1 3P7MA 4Q9AA 5EJ4A 3L7MA 3NUQA 4G37A 3W6OA 3OESA 4RGQA 2N47A 1O03A 2YN4A 4KR0A 3BMXA 2HC9A 5C52B 3EZ6A 3BOSA 5DYTA 4N3GA 1Q91A 4MGEA 1PBTA 1GZ3A 2FN7A 5AKJA 3WKBA 3VH4A 3NI2A 1USKA 4IIYA 4XRGA 2BEWA 1UQTA 2VBGA 1ZD3A 4IMJB 4YA6A 1L5OA 2Y0CA 1ENZA 3VOSA 3WYNA 4AQDA 5AR1A 1IOWA 1P0FA 4XSHA 2GTPA 5IN5A 3F3KA 4AKIA 1DAEA 2ZM5A 4GG1A 1YKGA 4IKPA 4MVJI 4PSVA 4NBTA 4KDRA 1EINA 5AQEA 1K6EA 1TKRA 1C3VA 1KDTA 1ZIXA 3NTOA 4F8EA 2XODA 3ZNOA 5C5IA 1XZGA 3S8YA 3ETEA 4E15A 1S3GA 1SIOA 3R7DA 3KZMA 1LJLA 2FR8A 3BSFA 5D5QA 5IM5A 1ORHA 3E22A 2IV2X 1UMBA 3OF3A 4QQFA 1MX1A 2QW0X 3L0CA 4EFMA 1UM8A 1UBMS 3FR8A 3L7KA 4JJKA 2QRLA 4US1R 4DA6A 1SXGA 3FTEA 2JB9A 1YOVA 2PG3A 2RHRA 1RKVA 3I6ZA 1N7HA 1YZHA 3FAKA 2ZI7A 1PTKA 2JAWA 3HCFA 3PJEA 2VHQA 2C2BA 3AM4A 3I5MA 2VIIA 4E11A 2FUEA 3E9EA 3FHJA 5LCXA 3VHRA 1SAYA 4ZKEA 4G4GA 4QDXA 1E7YA 3OT1A 3ROTA 1N0UA 4GMXA 2O05A 3ESBA 1PYDA 3QSGA 1FRQA 2XE6A 3K20A 1VGVA 1CQJA 1MB3A 4EUFA 1REQB 3IIMA 4ZAWA 5I7OA 4C89A 1V8ZA 4LFBB 3H83A 3T9CA 2RG7A 1QG2A 1AD2A 1UXJA 4KP7A 1N5JA 1TW3A 3L4KA 1DRJA 5CJPA 3NIDB 1N57A 2FSVA 1CY8A 2QD5A 3CM0A 9ABPA 4QVIA 4YB8A 4GI1A 1TFUA 3PB3A 1CJCA 2ZWMA 4RK1A 5JXGA 5E7IA 4PLVA 2UUCB 2W71A 5HHTA 1H9AA 1XRNA 1H2FA 1Q21A 1YACA 3NPAA 4KN8A 1QYDA 3HA2A 2QTFA 4LBWA 5KTYA 2HO4A 3HI4A 3VDXA 2EP7A 1CS0A 1E3TA 3GELA 4IUCS 3FX2A 5E95A 5KYTA 4LRSB 5TV2A 4GPAA 1M1UA 1M8PA 1SVMA 3AZQA 3OZVA 4L4RA 5I5GA 4EDFA 2GN0A 3PA6A 5KYUB 3P9PA 2UUAB 7MDHA 1NUHA 5JRDS 4TVOA 3OJLA 5KX5A 3IBYA 4ISCA 1Q16A 2Q1TA 4OL0A 4AKGA 1KEUA 1PJ2A 1XZKA 2F3TA 4Q24A 4MTCA 1LSUA 1NVKA 3ASZA 2CVPA 3V4RA 4PGGA 3S44A 1MJ5A 2IUSA 2FPUA 1L7DA 2H4XA 4WEOA 1YR7A 3F6EX 2AE2A 2AEFA 3IAM1 1W93A 3MSXA 4YJHB 1JG3A 3UF0A 5ICGA 5DNUA 4G9EA 3HSSA 2P4HX 2J3KA 3UCXA 4EG7A 4P9NA 3UIEA 1U2QA 1E6UA 1M34B 2VXOA 2NSJA 3E23A 3BT7A 1R18A 1GPNA 1RAFA 2ZZKA 2WF6A 4PC1A 3V1UA 1Y0BA 3KJFA 4ZMRA 4REQA 4V0NA 5GV8A 1O96B 3UAGA 3PQEA 4GI5A 3NO4A 1DBVO 2I2WA 2GPTA 3QVGB 5GINE 1YS6A 4NU5A 2A9RA 5G40A 2VT3A 1P0PA 2WV7A 3AESA 4G0QA 2D4HA 3BPSA 3JWHA 2HMWA 5LZ7A 4S2EA 2JCXA 2M1ZA 3DHYA 5HZMA 3DOJA 1I2ZA 1SZCA 2REBA 2XWPA 5B12A 2PZJA 4BHTA 2Z8YM 2VLIA 1M1NA 1B8NA 4Q4HA 4BO5A 2W6MA 4MZDA 4ZCLA 3ZQKA 2R87A 2QNIA 4URYR 5JLJA 3PC3A 1XXLA 2AOTA 1RXIA 1S0UA 1ORRA 4PC7A 3H1PA 4PC6A 2CLIB 1O4VA 3VOAA 1ISRA 2PSHA 1K8QA 1OBFO 2LRHA 2MU1A 1IWBB 4TKUA 2EQAA 4WOCA 1XO1A 2A67A 3ZWQA 4EG8A 2B99A 2GSWA 2DFPA 1M6EX 2B4KA 1XDGA 4FGJA 2YJTD 2FB9A 4OATA 2BDEA 2EWWA 5ALTA 2MINA 1G9TA 2Q29A 2J5RA 3E58A 3PCTA 1C30A 2FETA 3OQIB 4WK2B 4DIDA 1TLTA 2ZQ5A 1IJKA 2FE1A 4ZT3A 3UJ9A 5M29A 3U1VA 4FEAA 4RM2A 2GWRA 3I2FA 3KT0A 3U3ZA 4K9OA 1CU1A 2Y4OA 2BMDA 5TSDA 1OI4A 3LX6A 2PMWB 1MVOA 3DJYA 2AN5A 3BXFA 3ZV6A 2VUIB 3G9QA 1BX3A 1NTRA 1CQZA 1II0A 3BD7A 3HA7A 3LFHA 4N5MA 4QUKA 3LQQA 5GIPE 4B3XA 4MCJA 1JPVA 5FPSA 4PIVA 4DDHA 3EZNA 1QJ4A 4DPMA 4TLBA 1X1RA 4A1FA 2ORVA 5EP3A 1WR8A 1NKTA 4EELA 3T3GA 1OXBB 4HAVA 4LV5B 2P4EA 3DWIA 4CMKA 4Z7JA 4D56A 3AI3A 2IYOA 2HU7A 1NW7A 1WQ3A 3R7WB 3U13A 4AJLA 4N47A 5LYJF 4HNQA 3TQOA 1SKBA 1AUXA 4E32A 4RAOA 2JZNA 3FPFA 5JDIC 2WYVA 3V33A 4H4EA 4MIKA 3PDJA 2O8CB 2PX0A 1ST2A 4RKQA 4EVRA 1L4KA 1YZUA 2C07A 4BFLA 5JPCA 4D9HA 1BVUA 4QDOA 3KQYA 4CIVA 5J1SB 1RZ3A 3UQZA 3EXG1 4G67A 1LLQA 1P0QA 1OZ0A 1SKYB 1Y3BE 4QUGA 1E1CB 5F1PA 3ULKA 1XTQA 4NH0A 4N76A 1EUCA 2VJKA 1T36A 1ZL0A 3B13B 5C9ZA 3HO1A 1X92A 4ON9A 3L8YA 1Z56C 3M82A 1DKMA 1QOQB 2R6R1 2JI4A 1Z2EA 1RD4A 3CVJA 4L28A 2YHIB 5HK8A 4ZCTA 5IYZB 3PDUA 4P32A 5TS2A 1GR1A 1XDDA 4HAYA 2BY4A 4KPUB 2YWDA 4KU4A 2ZWIA 4JB0A 5EVCA 1IN8A 3FWPA 3BE4A 3A4LA 3W1VA 5AKGA 5JCJA 1N2IA 4BGUA 4CETA 4ZRMA 4AF6A 2F1KA 5CYFA 3WL6A 4E13A 1VRVA 2O7SA 3LPCA 3DVLA 4G2NA 3LDGA 4JJ8A 4JOQA 5JI3E 3EVDA 2EARA 3EXHA 4C5AA 2D2VA 2VDQB 2LCIA 3D5TA 4PYLA 3CWCA 1SELA 2W37A 4MI1A 4U0KA 1L5HA 1G19A 2Z2JA 4ZEWA 3MHTA 3GFRA 2IYZA 5TQ0B 1GAXA 4ZQCB 1HDYA 4TSFD 4X94A 4OHYA 2DXIA 1E2JA 2RGNC 1J23A 4NBNA 3ROZA 1BH2A 3LIPA 4YUXA 4D4KA 1EHYA 1B3RA 3HR7A 3JQ9A 3URKA 3VR2A 2J0UB 4JB8A 3UENA 4M1MA 2HLNA 2EAUA 2J6HA 3EXFB 1XG5A 1A2BA 1EVKA 1FDSA 2Q3FA 2ZSDA 3VAYA 3D1VA 4HSEA 2QX4A 4OJQA 3TRJA 2BSQA 4S12A 3CINA 1D1PA 5THXA 2P9EA 1I36A 1Y8CA 2D13A 5KYVA 2MTBA 1A8HA 1KZ1A 4BTEA 1WB6A 3QY0A 4HGYA 1L5VA 2EP5A 4Q4DA 3EEQA 5IAEA 3UW3A 5K4HA 4AO6A 1JBQA 1V11A 3ENQA 1N25A 4FMDF 2FKAA 3OP4A 4QUJA 4RVNA 5ILQA 4E5YA 4ARIA 3PXCX 4WCFB 5KNLA 3JAWA 1B2RA 1TQ6A 1DTWB 1Z17A 2F8LA 2BGRA 3SS9X 4ARSA 2ISQA 2GEBA 3KAPA 2W4IA 2JFHA 3CYFA 4BLOA 3LD9A 4ZQIA 1GGNA 4FS8A 3W1WA 421PA 4GX0A 2CHFA 3TLJA 2Q8QA 1NNEA 3WWOA 1IVNA 2J3LA 4AUKA 3DFUA 521PA 1A2KC 3ETJA 5AJUA 1QDUA 4K1XA 1L8OA 1ES9A 3L0DA 2D3WA 4RA9B 3ZWBA 1T2FA 1WABA 2P67A 4TSRA 4B9AA 1Y1SA 4OX9B 2EWMA 2RH4A 1WF3A 4YAJA 4GZLA 4LZAA 2W58A 4KFRA 5HQJA 4C7OB 1UWVA 3B60A 1H5NA 5K01A 3K6KA 4JBNA 2V6FA 2QE7A 5LXTB 3JQDA 4R69A 5J2UF 3ZGLA 4EYSA 3B36A 3CVXA 3IUQA 2M6KA 4BE9A 3TEMA 3GVHA 3IEVA 2PQMA 3WBFA 1F17A 5HFAA 3J81k 5FPQA 1NC1A 2J5BA 3TK1A 3G5MA 3ROMA 3ZQUA 1J2YA 2FZKA 4D0SA 4BXOB 4KYIB 4XVQA 4YAIA 3LY5A 3KKQA 2WAMA 4XARA 3LXMA 1Y6RA 3OPQA 2Q21A 4MUNA 1TM7E 2MYUA 2W6IA 5ULLA 4WZZA 1MDBA 3I62A 1SC4A 4ZI7F 2Y0DA 5DEOA 5D8DA 4GUDA 4BQEA 2GJKA 5K7SA 3RS0A 3VU0A 4G5QA 3OUUA 4QXAA 5JJ5A 2VCHA 3P19A 4PZ9A 4LGMA 3KB1A 5KCMA 2FF5A 5AJVB 3HUTA 2FVXA 5BN1A 5A4AA 3DULA 2LKCA 2NUAB 4AB1A 4L1KA 3HXLA 1TPYA 1LPOA 2V7GA 4KXXA 3CC8A 3G2HA 2Q4EA 5HQ3A 3QBDA 2XQKA 3OD1A 4LDAA 4DDUA 4ZYVA 2A57A 2IHVA 3L0SA 3UM9A 2GN6A 5IX8A 2JLBA 3OQPA 3ZK8A 2PGAA 1KAHA 3CRW1 4KX5A 4CCWA 2H1HA 4MSUA 3GUHA 1N5IA 2X19A 2WPDD 3W7AA 2IE0A 4K03A 1GTZA 4UC0A 1L5RA 5FBRB 4YCSA 3K70D 4IDAA 1VG0B 4GL2A 4JMLA 4HADA 1XJQA 4XUDA 3IDQA 1Z07A 1SRRA 4WRRA 2Y92A 2DHQA 1K75A 3NHBA 4Z7NB 1W36C 2GUWA 4HQFA 2CT8A 2C0PA 1SU6A 2HHAA 1CRWG 2JAQA 3KKOA 2C4KA 3M6UA 4LECA 5DASA 2QG4A 2X41A 3VVCA 4DPKA 4J7CA 1ZNQO 2GA8A 1K9VF 1MABB 1X86B 1Z0DA 3LC0A 1NYRA 5DBFA 2W2QA 2X14A 3DE0X 1DG3A 3OY7A 5BUCA 2ATEA 3L8ZA 1P6QA 3RS7A 5IKXA 5A05A 1EVQA 4P80A 1RPAA 4BFTA 2SECE 1P72A 4R2KA 1ABBA 4HNVA 1ECJA 4C4SA 4RZSA 3IKVA 1YRAA 3ER9A 1LW7A 4HZUB 1QG6A 1YJQA 3VU8A 3OIDA 2FWPA 1KH3A 4ZANA 1R10A 3RTCA 4X92A 3AWIA 4QNNA 1GZVA 4R51A 4RNDB 2R6JA 3IDSA 3X1WA 1DJMA 1AT1A 2NYAA 4QUDA 3THWA 1VLVA 1BIFA 1QFMA 1GPH1 4C6SA 1REQA 1LC3A 2VTEA 1XCLA 4ID9A 3WJ1A 1XJ5A 3G0BA 2F4VB 1AQUA 4RAQA 4H7HA 4U4AA 2IODA 3LIIA 2GKOA 1RM0A 1ZFNA 2CXOA 2WWHA 3C48A 1NY5A 2X7JA 3C5EA 3LUAA 3N3BC 1WNTA 2JLYA 1GA4A 3SZGA 1KFCB 2PMKA 1ZH6A 2AEJA 3DTTA 4IVRA 3W9BA 4BNJA 2FJ0A 2HY7A 3VJMA 4ZK2A 1D1TA 4JNKA 5IDYA 3GUVA 3ABOB 3KLOA 3FYSA 1NR5A 3OQMA 2RARA 1FP1D 2FUG1 4WKBA 5GZ1A 2WI8A 3CIOA 3L40A 3BJEA 4OKIA 3UB3A 4YUAA 3MIIA 1GARA 5EQDA 5E8JA 3RKUA 5KYUA 3FI0A 4ZK6A 4NK4A 1QCDA 1D0SA 3SIRA 3VH2A 4GOOD 1E3SA 1TGYA 2OUIA 1JXOA 1TDJA 1IXZA 1J97A 4FYWA 4JYPA 4RJJA 5AI6A 4MWOA 3AF4A 5ALMA 4BNKA 4FYIA 2YNMD 4BQOA 1PQUA 4URWR 1M33A 1LD3A 4YJHA 3ITKA 4GKVA 4KX3A 4HUTA 2W7TA 4M49A 1P2DA 3PGVA 3RNLA 3K0EA 4BDSA 1AGYA 3I53A 3OX1A 4HPJB 2I8LA 1M34A 4HFJA 2XMPA 3RS5A 4S24A 3OWOA 1KI1A 2E0IA 5KTPA 3TZCA 1LEHA 4TMVA 5KKAA 2NZUG 1DJPA 1OMOA 3LVFO 1IDN1 1Y80A 4RL6A 4C6RA 1I7SB 1K06A 3QVGA 4FCCA 2C88A 3G0GA 4QHSA 4HRAA 4OJTA 4QFCA 1BQEA 3B82A 9LDBA 3ZX5A 5KQGA 3S1SA 3RJMA 4CM8B 3GRCA 1L7MA 4KXWA 4CCYB 1II8B 4ZALA 5BW5A 2K2WA 2BGMA 3VOBA 3T41A 5FEUA 2OVBA 2JEOA 3BGWA 3LA6A 4ZVQA 2QUIA 3DPSA 3SKYA 4BNDB 3UC9A 4O63O 2C59A 4D3DA 2ZFUA 2EQBA 2VPWA 5FORA 1II9A 3QOFA 4R3UC 4LBZA 1HV8A 2Z2XA 4V02A 4EL0A 4DAEA 2Z8YA 1L8QA 5E4JA 3WL4A 4WGFA 1PL6A 2H08A 1WOMA 4KB5A 1XF9A 1D4AA 3ZTTA 4MNTA 5B58T 2XDAA 4K05A 2J3EA 4BKQA 4DA9A 4DM3A 5CM8B 1JEYB 3U3KA 1N3YA 4HLUC 3AHEA 3MAGA 3U3OA 1ZCBA 2O06A 4FR2A 5IU6A 4WZ6A 3JZIA 1P4HA 1TAQA 2GBPA 1UZMA 1I4TD 2VHCA 3OQIA 1RLOA 2P4QA 2OBBA 4RUKA 3AR6A 3SOPA 3CVUA 1CDDA 3ZK9A 5FAXA 4DUPA 2XB2A 1Q1AA 3FNIA 1Z36A 2H16A 2Y1XA 4Y1GA 5HS6A 2FW0A 5KHLB 1E63A 4X93A 1IB6A 3IXMA 5KO2A 1JHMA 1R0ZA 1RWKA 3A9SA 2FW9A 1Z7WA 5ENDA 2YXLA 3GU3A 3U7GA 4P3XA 3BXPA 4YRSA 5IK2D 1AK9A 4D6XA 2D1QA 1AMNA 1N33B 4AVYA 3LSYA 3MD0A 2A4KA 1X1BA 1X1EA 3IB6A 3PDWA 1MP0A 2FAXA 4KGDA 5EIEA 3GUCA 3FGOA 4NABA 1O6ZA 1U7TA 2BL4A 2FK8A 2PAFA 1Q1BA 3LFUA 1VXRA 2I3ZA 1W5FA 1J1ZA 2WWYA 3T7IA 3M89A 4L6AA 2OG1A 4OPMA 3BGDA 2PKXA 3IYLW 4PQFA 3RF7A 3UAYA 5CB4A 4BY9E 1RRPA 1Q0HA 5LA6B 2FSIA 4MUJA 1F2UA 4D82A 4EA9A 4PRZA 1QG0A 3K1TA 3NTRA 3QFCA 5DH9A 1WU7A 2XVAA 3KZKA 5I7EA 5FOTA 1Y4AE 5JH7F 2FZWA 2HIHA 2XX3A 4IL5A 4MMXB 4N0PA 3WL7A 3ZVKA 2RI6A 3KLPX 2UAGA 4R1NA 5BY2A 4EHJA 4X44A 4C0XA 3O47A 4EKYA 3DYBA 4BMZA 2P11A 2CHUA 1OFGA 4IX1A 3DMTA 1YBFA 4QGFA 4QWWA 1IXRC 4TKVB 3WRWA 1NF3A 4DRXB 2PS0A 4V03A 4MAFA 1A76A 5E1DA 3DC2A 1RLJA 4NU6A 1H0SA 4DNOA 1E1CA 1G4HA 1A7AA 3MWEA 3VR6H 3AINA 3JQ6A 2HMTA 2GN4A 2HLPA 1EDEA 1HE1C 1PSDA 2BM9A 4EG0A 3KJGA 5CXXA 5DFAA 1CW2B 2RH5A 4NYIR 2HCFA 4AP6A 3DWGA 5IYZA 4EB6B 4RULA 4TQ9A 1EDZA 1FPMA 3GDFA 2CJPA 2CLSA 3LTEA 3C4JA 1NW8A 4UHBA 2A6PA 1O5TA 1SCUB 1X1SA 1F6BA 2H1LA 3GVXA 3N6XA 1CQPA 2V0CA 2R4UA 1A04A 5A71A 3LCCA 1KR5A 4FGUA 2A1IA 3K2QA 4OAOA 2AN9A 3SKVA 3EDRA 3PFGA 4GWKA 1XZBA 4DNQA 2JFQA 3VNQA 3FYDA 4FUTA 2MOKA 4RHTA 4HWKA 4KDEA 4KQEA 4B3BA 1ADCA 3FRHA 3U44A 2REOA 3TGLA 3T3NA 2XKKA 2PT7A 4XWWA 4C4ZA 2W2TA 3IQWA 3QEOA 4AMVA 5ALEA 2AVDA 1F9AA 2NO5A 1KWGA 2P4UA 2PL5A 1TJYA 1FTQA 1AQLA 3CNLA 3TVDA 2DM6A 2PZMA 3HVRA 2W2KB 3EXFA 2Q9CA 4KMMA 4KXNA 5KC9A 1PTJC 1KPIA 2CD7A 5EOVA 5GJWC 2ZIEA 5EUMA 2ONKA 2ZRMA 1CIJA 3C6YA 2VBFA 5AT1A 2E89A 5JI2E 4Q4LA 3PUVA 5REQA 3WDKA 1K4MA 3OWHA 5SYAA 3N8GA 4OYRA 5DLYA 2HA7A 5LOVB 1BX1A 1WSAA 1HEUA 3QF4B 4YASA 4PZLA 3NBXX 1R4MB 3EF3A 3W1EA 1A98A 3OMLA 2B61A 1WP4A 5DEIA 3A9WA 4DLNA 4WCFA 2OECA 3V2UA 3FIJA 5KOIA 1NMZA 1R6UA 2AWNA 1TEVA 2EFYA 3K9LA 3PZRA 4QPZA 3ZU6A 5JFTA 5CEFA 2GXAA 2UV8A 4J94A 5GZ6A 4M88A 5JXIA 2NWQA 2E4VA 1MORA 2WK1A 4WBNB 1RADA 3TIIA 4LZNA 1SVUA 3BSYA 2HA0A 2VP0A 3E7WA 2ZQYA 3SQLA 3WY9A 3C8DA 1RXEA 1QONA 2YJNA 1ONSA 3JPWA 3B7WA 3TR6A 4G5GA 4MKGA 1G5HA 3PUZA 3ZU2A 2JAPA 3G82C 3P0HA 4IJUA 4RA9A 2IWRA 3HACA 3THYA 4R41A 4RFLA 5FOUA 1VBFA 3S55A 4FOTA 4PBSA 3STUA 4PTYA 4MUMA 4C7OA 2O6LA 1TU3A 4MKXA 1QHHA 2QT9A 2YASA 1BXRB 2RIRA 1UL1X 3H87A 1NJ1A 2X0EA 3SHOA 1E69A 1YJAA 4X64B 5LXTA 1KWKA 3N2GA 4BGDA 4HUQB 3TZLA 5HG0A 4C0BA 3ADPA 3HLYA 1PR0A 1YQDA 3I8SA 1F5SA 3QKSB 3RBXA 1ZDMA 3PA8A 3ESRA 4BXOA 1U8ZA 2NACA 1XL1A 1VKRA 3QX9A 4IZOA 2HF9A 2LBPA 3PIRA 1K8ZB 4ASUA 2A9PA 3RANA 3VR5D 3RS9A 4M0UA 4Y2PA 1MW9X 3B38A 4D97A 2AMVA 2GZAA 4IJWA 4D9JA 2FPMA 4UU7A 5JZOA 2GETA 1W8IA 3V1KA