1IUPA

Meta-cleavage product hydrolase from pseudomonas fluorescens ip01 (cumd) s103a mutant complexed with isobutyrates
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
271
structure length
271
Chain Sequence
NLEIGKSILAAGVLTNYHDVGEGQPVILIHGSGPGVSAYANWRLTIPALSKFYRVIAPDMVGFGFTDRPENYNYSKDSWVDHIIGIMDALEIEKAHIVGNAFGGGLAIATALRYSERVDRMVLMGAAGTRFDVTEGLNAVWGYTPSIENMRNLLDIFAYDRSLVTDELARLRYEASIQPGFQESFSSMFPEPRQRWIDALASSDEDIKTLPNETLIIHGREDQVVPLSSSLRLGELIDRAQLHVFGRCGHWTQIEQTDRFNRLVVEFFNEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords meta-Cleavage product hydrolase
publication title Crystal structures of a meta-cleavage product hydrolase from Pseudomonas fluorescens IP01 (CumD) complexed with cleavage products
pubmed doi rcsb
source organism Pseudomonas fluorescens
total genus 102
structure length 271
sequence length 271
ec nomenclature ec 3.7.1.9: 2-hydroxymuconate-6-semialdehyde hydrolase.
pdb deposition date 2002-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1iupA00
1QZ3A 1XRMA 2IITA 1MT3A 5ALUA 2DCMA 3KD2A 5AM5A 5FV4A 4A5SA 5BV7A 1OILA 5LLSA 1ODCA 5DNVA 3RLIA 1ODTC 1U65A 4U2EA 1XRQA 5A6VA 3UUFA 3QMMA 3R3XA 5EHNA 4N5IX 1Q83A 2WTMA 4M0FA 3IURA 4EY5A 4AN1A 5ISMA 1W4LA 3PF9A 1MN6A 5AKZA 1O6FA 4IO0A 3WWEA 1NU6A 4F21A 1KU0A 3LLCA 4H0CA 3LCRA 3C87A 4EBBA 2XMDA 3U0VA 1GXSA 2OXEA 1R1DA 3C6ZA 3RK4A 5BOVA 1Y7HA 4EA6A 1MX9A 3HSSA 4QDOA 3OPMA 4DGQA 1MO2A 2VEOA 5ALKA 1AZWA 2R8BA 2WUGA 2ZSHA 1CUEA 4I4CA 5ALTA 5EFZA 2VF2A 2V97A 3FSGD 4WY8A 1VE6A 4AZ0A 3G0IA 2QKYA 3C8HA 1H2WA 5JD6A 4QEKA 4Y9SA 5HQ3A 3BJMA 5ALHA 4Z49A 3DS8A 5K3DA 4P9NA 1S8OA 2YXPX 5DYTA 5A71A 1TRHA 4S0XA 1CUVA 4OB6A 4HVTA 4FLMA 4J0JA 4BRZA 3WK4A 4L9AA 4WDQA 1U2EA 4Y2RA 2C5FA 3IDAA 5I7UA 3SX4A 3L1IA 3FVTA 4QWMA 1CUAA 2OCIA 3H19A 3PICA 5E4YA 3LP5A 1QFMA 3FYUA 1H22A 4E46A 3ZWQA 4ZI5A 1EB8A 1TK3A 1CPYA 4JNCA 3DD5A 7YASA 1DTEA 2ZYHA 2C4HA 3GZJA 4DMFA 3BJRA 2C0QA 3H04A 2HA0A 2O2GA 1LPMA 1CFJA 2VQ6A 5AM0A 4P92A 2V96A 3EQ8A 4KAAA 3OTQA 3HRHA 4FDMA 1T2NA 1R9MA 4J0DA 4M0MA 1WPRA 2WUFA 1JMKC 2XT0A 3VXKA 4C01A 4NMWA 1WPXA 3E4DA 5D7BA 2E3JA 5ALVA 5K3FB 2J3DA 1E89A 5T4HA 3C6XA 5H3HA 4QA9A 4DSZA 2OPHA 5D3ZA 2CBGA 2WIJA 1UKCA 1BE0A 2JGFA 4OSEA 3IUQA 4MYDA 3DNMA 1ZD5A 2VA9A 3T4UA 4DNOA 3G9TA 3STTA 1XZFA 3W05A 1ZI8A 1F8UA 2WUDA 2OAGA 2VAXA 3D2CA 2G63A 4MQLA 1W52X 5CT4A 4IH1A 3CXUA 2FX5A 1R3DA 3YASA 3H2JA 1PFQA 4NVRA 2XQIA 4C4ZA 3WWCA 4Q05A 1WCYA 3L1JA 4CG3A 1FFDA 4Y2JA 2AJDA 2WU4A 4H7HA 3D2BA 4YASA 5AM4A 1F6WA 4JEIA 3VJMA 1CRLA 4PW0A 2DHDA 5K3BA 3I6ZA 5JZ9A 2FJPA 2Y2UA 4U2BA 2XMGA 4FMPA 4KE8A 2ORYA 4AN0A 3KXPA 3AUKA 5AKHA 4X93A 4W1SA 4AO8A 4G8BA 4HS9A 2OGZA 3STWA 4ITVA 3SK0A 4KE7A 3WI7A 4A23A 5DWDA 1QOZA 3I6YA 3R3ZA 1JJFA 3V48A 5AM3A 4C88A 1K63A 2V98A 1LGYA 4K6HA 3MUNA 2QT9A 4B0PA 1TCCA 5KWIA 1G5FA 5AI0A 4RGYA 4G4GA 2K2QB 5AH0A 2G5TA 5CT8A 5AKGA 2I3ZA 2DHEA 5AIAA 3W06A 1VXRA 1L7RA 5JZSA 4DNFA 3G02A 3NGMA 5ALPA 2Y6VA 4UBKA 3K6KA 4UHDA 1DX4A 1TAHA 1CUWA 2RHWA 3VISA 4D9JA 5AI6A 1DINA 1Q0ZA 4AO7A 4Y2SA 4J0IA 2JEYA 1XZMA 4K6GA 1QIDA 1XQVA 4CI9A 4OU5A 4UFOA 1MPXA 5ALGA 1CUHA 1ZI6A 3WJ2A 1QIIA 1YS1X 3F8SA 1VA4A 1OCEA 1L7QA 2IX9A 4ETWA 1XZCA 3WL8A 2HA4A 5HFNA 1UOOA 4AXBA 4CFSA 5LYYA 3IUJA 4U2CA 2QS9A 2ZYIA 5DTIA 4UHFA 4C4XA 2C5GA 4IHAA 5AIBA 2WU3A 3WLAA 1IUPA 3EQ9A 2BJHA 1QIMA 1LPOA 3CCBA 4FFWA 2BGRA 2ZYSA 2XUJA 4KJXA 3V1KA 2JF0A 5DYYA 3FYTA 5JAOA 4DM7A 3FWHA 2VTVA 1XZKA 4J0HA 2AXEA 4PQEA 2EDCA 3B12A 3M83A 5AKLA 2GZRA 1UXOA 3FAKA 1P0IA 3BXPA 4X6UA 5C8XA 4WFIA 4X71A 2XUQA 4GXNA 4CIAA 2XMZA 4BVKA 6YASA 2GZSA 1LPAB 1KU6A 2DQZA 5LZ4A 4FLEA 5ALLA 4DYHA 3O9VA 5C7YA 2HU8A 4B84A 5CT6A 1CUFA 3WL6A 4AQDA 1ZJ4A 3ZV7A 5LZ8A 4ARAA 4DTCA 1THTA 5HK8A 1BRTA 2XUKA 2PX6A 5A7HA 4B83A 2VJBA 2O7VA 1XZGA 5SYNA 4GBGA 3TGLA 4QDXA 4H7JA 2ZJ6A 3QPCA 4ZGBA 4EY7A 4Y2XA 1ZGCA 4PSCA 2HL6A 2AJCA 3H2HA 5AI9A 4FBLA 1TCAA 1WHSA 3IUMA 3QITA 4Q3OA 4O08A 2WHPA 1EDBA 3PUHA 1C7IA 5AI5A 4BC0A 4DMCA 1B6GA 3O4JA 2GYUA 4MQMA 3G9XA 3AINA 2XUGA 2XDWA 4Q3KA 4IH4A 3G0CA 2XUDA 4X85A 2JGMA 2D5LA 3NWOA 2Z3WA 1DQYA 5HQ3B 3JWEA 1GGVA 3D59A 5BWCA 3X3HA 4QZVA 2CMFA 4QDUA 3ILSA 3WKDA 2WJ4A 2JEZA 2WKWA 3IVMA 2JGLA 3DKRA 4F5ZA 3C45A 2Z8ZA 3VDXA 1Y37A 4G4JA 2BUAA 2DQYA 1QTRA 1JMYA 4EB0A 3N0TA 4PNZA 4G8CA 2QMQA 5FOQA 2CUTA 1XRPA 1X70A 4FLFA 1QO7A 2XMCA 3FYUB 1XFDA 4WDRA 1CV2A 5HF5A 3DQZA 4B9EA 3ANSA 4CG1A 2EDAA 2HA3A 4Q82A 4X6YA 2OLEA 4CCYA 5HZGA 4LKOA 3OC0A 4BCBA 2Z8XA 5IVIA 3ZI7A 3R3YA 3HZOA 2PVSA 5E4TA 4H7EA 1AKNA 1JU4A 2W6CX 4BAUA 3I6MA 5LZ9A 1AX9A 3VJLA 2BKLA 1XRRA 3UMJA 3ESDA 3LS2A 1U8EA 4K6KA 4AO6A 4F60A 1WB4A 4B82A 4OPMA 1T4MA 3BDIA 1ZGBA 2XE4A 3BDVA 3TJMA 4KEAA 1AQLA 4X6XA 1LBTA 3S2ZA 5ALRA 4A16A 3I2GA 2CJPA 3P2MA 4U2FA 1HLGA 3QBJA 1ORVA 4EY6A 5AM2A 1VJ5A 1VZ2A 5ALYA 1VA5A 2HU5A 3BE8A 4UHBA 4G4IA 2ROQA 5C81A 1DWPA 3FVRA 3R41A 1MX1A 3WIOA 5CH8A 1VLQA 3DKKA 3STVA 3UUEA 1YR2A 1EX9A 4U2GA 3WA7A 1DWQA 4BTVA 1QIFA 1AGYA 1UWCA 2HM7A 2O2HA 4IQ4A 1YAJA 3DYVA 5AKEA 3FLAA 2RAUA 1CQWA 1QIGA 4MEBA 1DT3A 2WLSA 5JANA 5FDFA 1EH5A 2WQZA 5ALDA 4QWWA 2PSJA 4GLBA 3IB3A 2Z5GA 2V9ZA 3DL7A 3GROA 5ALOA 2BAGA 1XKLA 1FFCA 1N5RA 2VATA 5CT9A 1F0NA 4N8SA 2J4CA 1EK2A 2WIDA 3N2ZB 4P93A 3O0DA 5CXXA 3B5EA 5BWBA 3O4HA 4ZREA 1JU3A 2XUHA 5ALNA 4BVLA 4DMKA 3Q0TA 4EZIA 1XQYA 4PSDA 4MXDA 2DSNA 3W9BA 3C5WP 4TGLA 2PL5A 4W9RA 4L0CA 1IMJA 1C4XA 1ISPA 2ONCA 1ODSA 1XRNA 5FUMA 4HRYA 1E8MA 3A2LA 2C7BA 4KAFA 3WZLA 4EHBA 3H2GA 3C6YA 3KWFA 4J03A 5CH3A 4X00A 1WHTA 3VVMA 1R9NA 5JAPA 3D7RA 1CUBA 2VJAA 1GZ7A 4M0EA 5CURA 3DOHA 2J3QA 3IULA 5YASA 4P08A 4BCDA 5HF6A 1LPNA 4BE4A 2XB6A 1GPKA 4E14A 3TEJA 2X76A 1LPPA 3I1IA 5AOBA 1PJAA 2BFNA 1ZD2P 1CQZA 4N5HX 2PM8A 5FKJA 3GELA 1XRLA 4BP8A 1UOPA 4LXGA 4BRSA 1EHYA 1LLFA 2QR5A 1RWQA 4H7KA 5ESRA 4BTLA 2YH2A 3QMWA 2VJDA 2AJLI 5JIBA 1YSCA 1AMNA 1A8UA 3T52A 3ANTA 3CN7A 2VJCA 1G66A 3MGAA 4BCCA 4CIBA 3G0GA 4YK7A 4AMYA 5JD4A 2PUJA 2B9VA 2XUFA 1BEEA 1HPLA 4BP9A 1DT5A 4E15A 4JYPA 4Y2PA 2QJRA 2WG0A 3R3UA 4CCWA 4HXEB 5ALFA 1AUOA 1QIEA 3JYHA 3G9UA 3WK6A 1X2EA 2QM0A 5T4FA 3H18A 3RKSA 3ZPXA 3WWPA 1XZJA 1DWOA 4TPKA 1QJ4A 3HYSA 4PV7A 4BDSA 1ZI9A 1DX6A 1UFOA 4J0KA 3WWOA 4WFJA 3V1LA 5EHXA 2RI6A 5JALA 2HADA 1BN7A 3WWDA 1A7UA 1XKTA 5D6OA 3W9UA 3F9CA 3HEAA 4V2IA 5AK4A 4Q3LA 3SC2A 1YB6A 2XUPA 3C5VA 3WKAA 1LNSA 1XLWA 4LHEA 1H2ZA 2XQJA 5IVKA 2C0PA 4ROTA 3TRDA 5K3EA 1IUNA 2OCGA 4GDMA 2QXUA 2XUOA 4FOLA 3WK8A 5EIAA 4OCZA 1ZICA 5ALEA 3FBWA 5T4BA 2WJ6A 3A70A 2WIFA 4QDTA 1QIKA 1SCIA 1J06A 1E8DA 2VT7A 3D3NA 5KWJA 1XZBA 3SWWA 4FKBA 3IBTA 2QUBA 1W6RA 2PKYX 2WHPB 3R0VA 3O4GA 2HA5A 1N1MA 1MX5A 5ALQA 4XWGA 4XX1A 4DSAA 4Y2TA 2Y1KA 5EHQA 2PPLA 4EUSA 4HRXA 2WG2A 2ECFA 4B0OA 3DJYA 1MTZA 1BCRA 1DU4A 1JKMA 4RPCA 2QXTA 3D0KA 4UBNA 5A7FA 3O9MA 1EVEA 3R3WA 3DDUA 2HIHA 3A2NA 1E8NA 3PFCA 1N8SA 3C70A 3ZLVA 3G0DA 3A6ZA 1GPNA 3D2AA 2WJ3A 1CUCA 1XQWA 2JIDA 4C6HA 2GBGA 5E2IA 1VOTA 3QYJA 4MYSA 4UBLA 1UK9A 4G9GA 2I03A 5KBYA 1FFBA 1USWA 4YPVA 1TKRA 5LZ2A 5F4ZA 3QPDA 5LKRA 3H1BA 1CEXA 4CCYB 4QNNA 3QZUA 4GW3A 2WHQA 2ZVDA 3DL4A 1EXWA 3MVEA 2JGKA 5AI4A 1P0QA 5C8VA 1UT6A 4C87A 3EQ7A 4RE6A 1EVQA 1B41A 1L7AA 4UBOA 3AZOA 4MEAA 5JADA 3ZLTA 1H23A 5ALXA 3OM8A 3HABA 3GBSA 5AK3A 3D4LA 3WKCA 5I9IA 3PI6A 4HXFB 4N8DA 3AIOA 3FLBA 1W75A 3HJUA 5AHXA 2WTNA 1CLEA 2WSLA 4NZZA 4KRYA 1SFRA 5AKXA 2XMBA 4UPDA 1QONA 3WKEA 2WFMA 3VVLA 1LPBB 4ZXFA 1UOQA 4JUIA 3OOSA 1CUYA 5JZBA 5ALJA 2BCEA 3PUIA 2DFPA 3HI4A 1EA5A 1CUJA 4KRXA 3I2IA 1X2BA 3FCXA 1UK6A 3QVMA 4BE9A 4QE3A 1NU8A 3WIBA 1ACLA 4GEGA 1GKKA 1JI3A 1TQHA 2OQVA 4B9AA 4BVJA 2W22A 3H2KA 4DNQA 4Y2VA 1XQXA 1XZDA 3LIPA 2J4FA 5EHZA 4KYVA 2WG1A 4B6GA 2HDWA 1HL7A 1YCDA 4PSUA 3F97A 3RARA 3V9AA 5DLPA 3QM1A 1BEZA 3QH4A 2BUCA 1QIHA 5CT5A 2RHTA 1RP1A 3FSGA 4LYDA 4XVCA 3V1MA 2H7YA 1CUXA 3K2IA 5HKBA 1R50A 4YX9A 2OGTA 3IA2A 1GQSA 5A7GA 2IIVA 1D07A 4X3CA 5EIHA 5IKXA 2QTBA 4H7DA 4X95A 2HA2A 3S8YA 4INZA 2G5PA 4GHWA 4KAJA 3M3DA 1P0MA 1UZAA 4G9EA 4I3FA 1J1IA 2Y2VA 2CEKA 4BAZA 3AJAA 3E3AA 2ZJ7A 5DTJA 4Y2QA 4OB7A 3DYIA 4UBJA 3WK5A 2WUEA 2H1IA 5KREA 3FLEA 3NOXA 4B81A 1BN6A 5AOCA 1UKAA 3R3VA 1LPSA 1HQDA 4ZRDA 4WCVA 5IVDA 5DNWA 4H35A 5A2GA 2WIKA 3H17A 1R88A 3H2IA 2I78A 5CH5A 1YASA 5AK6A 3I1YA 3E1GA 1R4ZA 3ESAA 3I28A 2ZJFA 4AMZA 3FOBA 5ALMA 3W2TA 2GBCA 4X7BA 5AJHA 5EGNA 1KEZA 4LYEA 3WYDA 3HXKA 4BB0A 4WY5A 5CXUA 4BATA 4C4YA 1EINA 3B3QA 2H7XA 3WMRA 5FRDA 1QO9A 5HKAA 3G9ZA 1W1IA 1YAHA 1ZIYA 3U1TA 2BGNA 1SOMA 4J0CA 4BDTA 2OCLA 2JGEA 4H7FA 3OURA 4B85A 2HU7A 3O4IA 4UBIA 2WFLA 2QOEA 3A2MA 2XMQA 1YS2X 5LKAA 2YASA 1QIJA 2GYWA 3HACA 2XI4A 1CUIA 1GQRA 2OCKA 2RIPA 4KE9A 4WJLA 4H77A 1SCKA 5FPPA 2Z3ZA 5JD5A 4W1QA 1ZD3A 1BU8A 2XLBA 2PBLA 2HFJA 4OD0A 2DHCA 1Z68A 1CUSA 4LXHA 5ALWA 4OYLA 5FP0A 1J2EA 2QRUA 2DR0A 1NX9A 2HRRA 5FLKA 3HLKA 1CVLA 4UFNA 1BS9A 3BWXA 3ICVA 4OUKX 5FXMA 4TVKA 3G0BA 4XJVA 4GWLA 1QTIA 4JH0A 5AI8A 3IUNA 5EIEA 2JGJA 5AKIA 5A62A 5AICA 1MNAA 4UHCA 5JATA 2X8BA 3FNBA 1VXOA 4OU4A 1ETHA 3WK7A 1THGA 3F96A 3PF8A 1HBJA 3CN9A 1H2YA 1AC5A 1U4NA 1QE3A 4X92A 4OYYA 5HFAA 1UKBA 1OXMA 1LZLA 1QLWA 1MAHA 1ZOIA 5K3AA 3W04A 4K2AA 2WM2A 4PO3X 5AM1A 3VKFA 3WK9A 3LIIA 4X97A 1Q0RA 2WFZA 3MUOA 5AOAA 4LXIA 2B4KA 1XROA 1XZHA 3STYA 3ESBA 5HCUA 5ALZA 1EI9A 4UBMA 4AZ3A 4DMHA 2HHAA 4FFVA 2AJ8A 1EB9A 3AFIA 2PUHA 1IZ7A 5T4EA 4DLNA 4FBMA 5J3JA 3M81A 4ZV7A 1ACJA 3CCCA 1FJ2A 1H2XA 5CRIA 2XQKA 2G4LA 1VE7A 1UK7A 3I2JA 4FTWA 3WZMA 1DQZA 2WHRA 2GYVA 1XLUA 1CUUA 3DCNA 4J3JA 4X90A 1IUOA 3V1NA 1GPLA 4HZGA 2NW6A 4Q1VA 5AKYA 1N5MA 1YA4A 3C8DA 3FYUC 3AILA 2XMRA 2H9YA 5AK5A 5EI5A 1XZIA 3F67A 3C43A 2ACEA 5JAUA 4BZWA 4X91A 4KACA 2RGUA 1Q84A 3NUZA 3I2KA 5JASA 2PU5A 5HF9A 5LP1A 3G8YA 1I6WA 1WOMA 3I2FA 3L1HA 5LZ5A 2B61A 2O2IA 5E4JA 5HK9A 4BAGA 1CR6A 2PU7A 3VJKA 3QMVA 4J7AA 1MU0A 1J07A 2XQGA 2QZPA 3D5EA 4HAIA 3STUA 2VT6A 2BUBA 1JFRA 3O95A 3WKBA 2HA6A 1W76A 3H1AA 1BCSA 2LIPA 1K4YA 1MJ5A 1CUZA 1EDDA 2ES4A 2CZQA 2H7CA 1GT6A 3EIOA 3KWJA 1A8SA 5K3CA 1P0PA 2ZSIA 3JW8A 4WFKA 4I19A 5K3FA 4LIPD 1ZJ5A 1CIJA 3WA6A 1TIBA 3M82A 1E3QA 1E5TA 3OG9A 2ACKA 5I8PA 4UUQA 4B80A 1IZ8A 3WL5A 1WB6A 2OQIA 4B7ZA 2O7RA 3HC7A 5SYMA 3STXA 4HTAA 1HKHA 2UZ0A 1QGED 4C89A 3PDCA 2I3DA 2HFKA 2ZYRA 3WL7A 3BIWA 2P8SA 4FWBA 4KE6A 2QJWA 1O6GA 3EF3A 4GI1A 4CG2A 5C8ZA 1CUGA 3ZLUA 3GUUA 1JT2A 5K5EA 2AJBA 4JYMA 4MWSA 3Q8WA 2FUKA 3ESCA 5JYCA 5AKKA 1FFEA 4XIIA 2HRQA 4QDZA 5DNUA 3H0CA 4GECA 5AP9A 2OG1A 3AIKA 4K5QA 3KOOA 1Y7IA 2QVBA 2RONA 5ALIA 4ZWNA 1MNQA 4AX4A 1FFAA 3DOIA 2JGIA 2GBFA 4NS4A 1XZLA 2XUIA 2CKMA 1G4HA 4H7IA 5AKJA 5DJ5A 2B20A 1EK1A 3C6BA 4OB8A 4W1PA 1PV1A 1K5PA 2FJ0A 4QLOA 4L72A 3BF8A 2OGSA 1YB7A 4ARBA 4BC1A 3KSRA 1AURA 2YYSA 2PSEA 1WM1A 3KDAA 4EY4A 1ZD4A 3ICWA 1GKLA 2Y6UA 4IH9A 2PSDA 5JARA 1C7JA 4L3WA 1ZIXA 1JJBA 3PE6A 1HDEA 2XLCA 2WIGA 4AB1A 4HXGA 3QPAA 2XMSA 4BBZA 2R11A 4EY8A 4E11A 4H18A 1E66A 5IVHA 5LIPA 4J0GA 4RNCA 1F0PA 3GFFA 1TCBA 1G42A 1XLVA 4DNPA 4G5XA 3AZPA 3BF7A 1ORWA 2C58A 3WYNA 1K8QA 4W1RA 4FNMA 4QLAA 4ZV9A 3WQHA 4PF1A 1EDEA 2VSQA 2WFLB 2PSFA 1A88A 4G1FA 5D3KA 2VAVA 1VZ3A 5CW2A 1XZAA 3AIMA 5JAHA 3PFBA 4MJ3A 4DIUA 1BROA 3FCYA 3G7NA 3E0XA 1QFSA 5ALSA 2OAEA 4RE5A 4FHZA 5IH7A 2XUAA 3DEAA 4Y7DA 5CBKA 1M33A 4G8DA 5CMLA 1MAAA 2HA7A 3DLTA 5DYWA 4FNGA 3AZQA 4MWTA 3R40A 4BZZA 4UHEA 5CTAA 1UK8A 1SC9A 4N8EA 2JBWA 1CUDA 3WJ1A 3F98A 2PSHA 4Q34A 1JJIA 1FSSA 1VKHA 5HF8A 1RYYA 3GA7A 2XQFA 4F0JA 3ED1A 3RM3A 1IVYA 3EBLA 3BIXA 3K9BA 4Y2YA 1YA8A 2EEPA 1WB5A 1K6EA 2Q0XA 5FPQA 1A8QA 1LZKA 1XZEA 4X94A 2QUAA 2D0DA 2WILA 1SCQA 5AO9A 4BYMA 3IIIA 4UFPA 5LZ7A 4W63A 2GBIA 2X5XA 4U2DA 2CB9A 4KR0A 1LBSA 4Y2UA 4UHHA 3I2HA 3BL8A
chains in the Genus database with same CATH superfamily
1OBFO 4QUIA 1UZLA 1XL0A 5TGDA 1NT4A 1YVUA 1Y4SA 4LFBB 1RDFA 2JC3A 4PRYA 1GA4A 1S1MA 2ZSUA 3EA0A 5ALUA 2O1EA 1EWYA 2DCMA 3KD2A 3URMA 1NP3A 1T0BA 2JA1A 2VSYA 3VO2A 1FC0A 1I8TA 3F9IA 2ASEA 2EP5A 1PQYA 2WYOA 3ZJUA 4R9SA 2Z9DA 3KUXA 4DLUA 3RKUA 2DBYA 4OXYA 2DFDA 4GZMA 5LLDA 3DOOA 5CM2Z 2AZTA 1ZOPA 4NI5A 5KYUB 5JJIA 3PNQA 2H17A 3L4EA 4GFDA 3TTUA 1GIAA 4ADSG 3W79A 5J4KA 3CWZA 5BYJA 3DV2A 4Q7MB 3QMMA 3R3XA 5EHNA 4CMHA 3CHYA 1ISRA 1S8AA 5H4HA 1A95A 2QA5A 1NVEA 1FXSA 1AA9A 5DBGA 4ZQHA 3VO8A 2Y77A 4JN6B 4RZXA 1BFDA 3PT5A 4LQDA 1D7AA 3HBAA 4CLXA 3IOMA 4P7JA 2HJ9A 1VSQA 4C08A 2XGMA 2GPSA 8GPBA 1W4LA 3D6JA 3PF9A 4NK4A 4EGQA 1N9KA 4JA2A 2XCSB 3T5CA 4IO0A 3G1TA 1ZKMA 1PJ8A 2APJA 1RLJA 1FB5A 2X40A 3LLCA 4G0WA 3EASA 4YH1A 3CX8A 4WN3A 2Q9AA 3OQVA 3OMWA 3C87A 1XN1A 3ZWVA 1R7RA 4AUMA 3FTEA 3WYFA 4Z0NA 3OZWA 1JS1X 1QBKC 3WXBA 3U0VA 1UIRA 2GS9A 1YRWA 4J75A 4JEMA 1L4YA 1VL6A 4MZXA 3C6ZA 4P32A 1IPEA 3P52A 1DKUA 3GLFB 3CFYA 1WTCA 3JD0A 2HJWA 1X1RA 4M1QA 2FPGA 2HD4A 3PC7A 3OICA 2O3RA 1AQIA 4MTLA 1B6TA 1Y3AA 3ZCTA 2VZLA 4WXMA 2HWKA 2VEOA 3GNLA 4E4TA 3I09A 4L85A 1WDWB 4YV2A 3JZMA 4B4OA 4G01B 3M6FA 2YBEA 3L1KA 1CUEA 3C3BA 2PIDA 4OI2A 4I4CA 4ER0A 2CF6A 2FAXA 3KAPA 5G0VA 2FFQA 2REXB 5DLEA 3U7FB 4MR9A 2GCEA 3GEPA 2HC9A 3P96A 1DB3A 1BMFD 2AJTA 2HCRA 1D0SA 3L6BA 5CLJA 2QN1A 4KX3A 5KINB 1VE6A 1LRKA 3INYA 4WXHA 4X61A 4DQLA 3FUVA 4Z86A 4UM7A 1J9GA 1AKTA 1H2WA 3H8VA 3JQGA 4KSBA 4REMA 4BMPB 4DWOA 3FA2A 3MWKA 5HQ3A 1J2TA 4HEHA 2P67A 3JVEA 4OJTA 3AK4A 5FADA 3RUFA 4IQGA 4Z49A 5AUNB 2J5RA 1TVEA 8OHMA 1T8WA 5G41A 2V5VA 1XA3A 4RKEA 1S8OA 5DYTA 4YRBA 1PD0A 4NQRA 3QYAA 2Q2WA 3N0XA 1EUYA 2OLJA 4S0XA 3H5LA 1WUYA 1ZONA 4BKMA 1L4FA 3V7UA 4J0JA 1I0ZA 4BRZA 1C30B 2D0OB 5B1YA 3CR7A 1EP2B 1OWLA 1NUPA 1UADA 1V9CA 1YQUA 2OE2A 1K92A 2VF4X 5LDDC 4GRIA 3TW8A 4Z4QA 1YXMA 2QRPA 1N0WA 2I4OA 3HCCA 4Y2RA 3RC7A 3PEVA 2NVUA 5K4GA 4CL3A 2C5FA 4A0FA 1CS0B 3A6PC 1P2GA 4WNYA 1JHQA 2AS0A 3M2PA 2CE7A 2LD4A 4IJVA 4LZZA 2IWRA 1KI6B 4O4JF 3EMDA 4DA7A 4DYDA 1B8PA 3LGSA 2RDMA 1JR3D 2ORWA 4H17A 4QWMA 4RORA 1J97A 3WXMA 5D2CA 4EL0A 4FM9A 4CKXA 4BFXA 5B6JA 2JL1A 2L42A 2OCIA 3H19A 2C83A 4FINA 3HO1A 3AF4A 1KETA 3K9QO 3MWGA 4J1TC 2C9ZA 3TJZA 3V6LA 1AG9A 5GIOE 1SKBA 4K05A 2PZFA 5IT0A 3FWNA 3LP5A 2Z5FA 1R2QA 1RQ7A 1X6VA 2JFHA 3ZWQA 1QGAA 1N9GA 4TRNA 5CM8B 2IDZA 3GT4A 3WRVA 4AM8A 4CRWB 4CLOA 3OCWA 4RBNA 3I04M 5EJGA 1D03A 4MI3A 1U0TA 7YASA 1DTEA 3LC1O 2ZYHA 1VHDA 4TKUA 3KEGA 3QEBZ 3RBAA 3A05A 2F9FA 4XCQA 4G89A 3L9XA 1C7EA 5IU6A 2O2GA 1GG2A 4GPAA 2JLAA 4JU9A 4L4ZA 1SG0A 3S6JA 1ZVVA 3E84A 1CFJA 4IBOA 4YRSA 5AM0A 3TLGB 1NF2A 3D8SA 5ADWA 4DMLA 1MBZA 3OQNA 4EYSA 3LLUA 5J2UF 1F2TB 4HWPA 5TVKA 1BDHA 3GFGA 1T2NA 3A58B 3Q3VA 3RW9A 2JZNA 3RVLA 3MT0A 1G1MA 1YCGA 1Q91A 4UQLA 1SCNE 1BFKA 1TCVA 1NMZA 1ZMXA 5CPBA 1W1WA 5AQ1A 1VFNA 1FMFA 2D7DA 2FI1A 3ROQA 4G81A 4OOFA 1NJ6A 2AMJA 1P75A 1WPXA 3EOBI 4YJHB 5EPEA 3S3TA 2YQ4A 1G6HA 3CZPA 3EHDA 1L5RA 5ALVA 1LVUA 1XTRA 3D6VA 3I5AA 4A8PA 4UAGA 4IEFB 4ZCSA 5H0IA 2RJOA 4Y0VA 5T4HA 3P94A 2PE5A 1PR6A 3D0OA 3C6XA 1OAOC 4O4LB 3SPXA 3ZZUA 2DY1A 4J3NA 4ER3A 2W6QA 1AIPA 3KYJB 1RR6A 1WPQA 3DTYA 2FN4A 3HJRA 3QX7A 1U7ZA 3ORFA 2EFHB 2OPHA 5FAKA 5EFOA 2GXQA 2JGFA 2C7RA 1OPRA 4Q7EA 3NBFA 1Z6TA 1ULBA 3DNMA 3T4UA 4OH7A 3B2QA 3DXYA 2Y4NA 821PA 3SZOA 2B8EA 5AESA 3I37X 3E22B 5IS2A 2Y8EA 2NSHA 4FR5A 4RD2A 1UJNA 4FMDB 4Q9DA 1CJCA 1HZJA 1J22A 2VDPB 3ZD8A 1KKUA 3T3NA 2VAXA 3IV9A 4AMUA 2W4IA 3D2CA 2AW3A 4HAYA 2WVHA 1HI9A 1GFIA 3D6UA 5BVGA 4C2TA 1SU8A 4V38A 4DC0A 4OM7A 3ZH9B 1MG0A 1PQUA 2JGRA 5ENZA 4QGSA 3OESA 1QXSA 3QXHA 2QP3A 2EFEB 2KI5A 3ZEAA 5HM8A 1YZQA 1K7SN 5I45A 1TEZA 2JFZA 3ME5A 1HETA 1JDBB 5ILGA 5AVYA 2JVKA 4NVRA 2BFBA 2XQIA 3RAFC 4RZ2A 2FQWA 3KYCA 3OJXA 1JHOA 1FX0A 1Q44A 2I71A 5GONF 5EIFA 1DPFA 1PZMA 3REFA 4U8GA 1FFDA 1YZNA 3CT4A 4JL5A 4CQMD 2HPZA 4F56A 2YBDA 3E3MA 4KIJA 3CEMA 2Q6IA 1UBJS 4YTEA 4N5NA 4P58A 4HY3A 1NN3A 2VAPA 4QQ8A 5J2TF 2AJDA 5K2MA 2RGCA 3T3HA 1JFTA 2BH9A 1NV8A 2WJVA 2AMYA 2CJWB 1PZEA 4LY9A 4JI1B 3B6JA 2IYZA 2WU4A 3EIHA 2QVZX 2EBHX 1MRSA 3AUAA 4J4TA 4YASA 5TF4A 1WVMA 1M8KA 3QF4B 4LRQA 3EXIA 1JBKA 4MIKA 5EN4A 1FLAA 3ZY2A 4JEIA 1U2SA 1GGHA 5K0CA 4ZHQF 2AR7A 1T13A 1S5PA 1Y1PA 2FSUA 4AS2A 3VJMA 2PJDA 4C7OA 3UOAB 3MGGA 4ME6A 4L95C 4MAMA 1LW6E 1H4SA 1UDWA 4DA8A 2YNMD 5L3RA 1XRJA 4G5YA 4MS4A 5JZ9A 1H9BA 2GEBA 1X77A 3DEIA 1OB5A 3RD5A 2XMGA 3IO3A 4FMPA 4KE8A 1II0A 2FP4A 2NGRA 2ORYA 3FGNA 3GW8A 4KXXA 1G291 1SVIA 2A9OA 1PR2A 2OBMA 4Q24A 4X93A 5BSRA 1A9SA 1SIOA 3MC1A 2OBXA 2DHQA 2EJVA 3O3OB 4JEUA 4ZANA 9LDBA 1AUPA 4HS9A 5HE9A 3ZC3A 3X1ZA 1UAGA 3JQEA 5DK6A 1KAEA 3RYFB 1RPNA 1T9CA 2OGZA 3UJ6A 2INGX 4RS4A 2C8VA 4KE7A 1XKXA 2FVXA 2BEWA 2P3SA 3EOAI 4B3RB 1EHCA 4BJ5A 3FM9A 2HU2A 1F06A 4V3BA 2OM6A 2PL9A 3DGEC 3MJEA 5A3QA 3I6YA 5T64A 1JJFA 1YK0A 5AM3A 5K6AA 1RHUA 2BM0A 3UGKA 1VIVA 2VIIA 4I3GA 1UBKS 5CNMA 5DGDA 3QHAA 1RTTA 3ZHQA 4ETIA 721PA 1NHWA 1IATA 4NK5A 1OREA 4MIYA 5LU8A 3WS7A 2B2NA 4W5RA 1PWEA 1WDLA 2GZ1A 2RCNA 1TYAE 2H3EA 3KB1A 1WP9A 3H5WA 3D4BA 3OQMA 5AI0A 1OQAA 1P7CA 1I2ZA 1FFGA 1S01A 1C8KA 1L0BA 1RCTE 1O2DA 1U8AA 2A9JA 2GCOB 2P9TA 4XLZA 1ADGA 2XXBA 4U6QA 5AT1A 1DTSA 5AVWA 1K27A 1TZMA 2K2QB 3ITKA 4FCVA 3IE2A 4RZ3A 3DZFA 5AH0A 3L06A 3EAQA 1EMDA 1Y8QA 2X5NA 4O8ZA 3ADPA 4TSFA 3R7BA 3TQCA 4A8JB 1Z29A 1G0OA 2X4DA 4EZBA 3NHZA 3LWZA 4B4WA 1X80B 1EJ2A 4PBSA 1W4RA 1LTHR 2C2BA 2D7CA 2PZBA 4KQ1A 2XT9A 1DRUA 4YAJA 1U7HA 3W06A 3Q11A 5I9TA 3SFZA 2N0SA 5IYZB 3QGMA 3ILXA 1WDKA 4KH0A 3H2BA 1L7RA 1UBFA 2X86A 4Q4JA 4RHTA 1UBTS 3IHKA 3QX9A 2AFIE 1L3BA 3N2KB 4O5AA 3DEYX 2ERXA 3RFVA 2VDQB 5FNVF 3S55A 4CM5A 4CMIB 4OV6B 1VMIA 3DLAA 4NHOA 1TUEA 2FPWA 1M2EA 3T41A 4P5EA 2NZXA 4JR1A 3GV0A 1V5FA 2RHWA 3IQEA 4KBGA 5EMJA 2PRIA 2QD4A 3KLOA 2P69A 2PH7A 3AY7A 3G2QA 2HMWA 1Y80A 3ZE1B 2DBVO 4YCMA 2IWHA 4AO7A 2C98A 4RULA 2G71A 4J0IA 2IS1A 4PTZA 4PZEA 3TVDA 2X22A 3FKJA 4NYJQ 2PUTA 3JWHA 1ZI6A 3HCRA 4UC0A 3UAOA 2HUNA 5LPNA 4RIFA 4BWFB 4HUQA 3MJCA 2BLLA 1VA4A 2GBLA 4FR0A 5IBRA 1OCEA 3EIEA 3ERCA 1NR5A 2BFFB 1L7MA 2IF0A 4EMBA 3WYGA 3PTAA 4W99A 3CJQA 3VZQA 5C4IA 1UQTA 1M6VA 4E2WA 5CA1A 4C6TA 3CQ9A 2QSZA 4JT4A 1UOOA 2GN1A 3W7BA 3BC1A 3SX0A 1WMSA 4G1EB 4S1VA 3H65A 4DA6A 1A76A 2ZYIA 4C7XA 2GF2A 2WUVA 4OREX 3B85A 4C4XA 5L4NA 5CFNA 2C5GA 1NOKA 2VYCA 4IHAA 1RLIA 4TTRA 4UCXA 2HAEA 3EQ9A 1NHGA 1DRJA 2E4YA 1JEAA 1NZFA 3H9QA 3IEXA 4RA6A 2PYIA 3V48A 1FP4B 1QU3A 1CNEA 1TTHA 3CCBA 1JJ7A 4DSUA 1TA0A 2B4YA 4QREA 5F7JA 2BGRA 1R0YA 4IX1A 4KJXA 5KJ1A 1WPGA 3HADA 4LYGA 4CQJA 2Q3EA 2JHAA 1REQA 5DYYA 1IEQA 3MBIA 2AL7A 2VUUA 3NWBA 4N0DA 2BYTA 1FPMA 1VBNA 2DOKA 3ROTA 5JAOA 3WLOA 3OJLA 2VTVA 3KQMA 3IIEA 4IUBS 4OF4A 2RK3A 4R8SA 1I14A 4BNIA 3K5WA 1N3YA 3BREA 2F1OA 4FGJA 1T8RA 4GKVA 4C0AC 3B12A 5E9AA 1EKXA 1D4OA 1G8MA 1IY0A 1R8JA 2I4TA 3KEQA 4AQYB 3FAKA 4E4RA 4XDGA 2VDWB 2JLWA 3DHYA 2BH2A 1LWNA 5THQA 1E1KA 5IEBA 3RCBA 3WHPA 2MSKA 2JIBA 3H2SA 1T1SA 4ZAFA 1NW8A 3C16C 3LFTA 4WFIA 4L15A 2AZDA 1OT5A 2EKDA 4WBNF 4CIAA 2BC9A 4JXKA 4NH4A 1CX9B 2F4NA 3CBQA 1A9PA 1N7GA 2FKNA 4BVKA 4RTQA 3OA2A 1YVRA 4PSKA 1PVOA 1UOEA 2AG8A 3K0CC 2FPXA 4QEZA 5DBOA 1KU6A 3T0GA 2MMGA 5A1JA 1Q0SA 3BE6A 3OLYA 3SXJA 1KE1A 4FSDA 3OPQA 2J87A 2JLBA 4E09A 5HGXA 3WFIA 1J99A 1E9AA 1W5BA 3LBYA 3HXLA 3NIBA 3NIGB 1RXUA 3AF0A 3OEED 3O9VA 4YEDA 1E5DA 2EV9A 1PG2A 2VHXA 1H0SA 2A58A 1RRKA 3DKVA 3IT2A 3BWCA 3ZZ1A 1LBQA 3LL7A 2I3GA 1SBTA 1MC5A 3OOHA 3EJWA 3P9QA 2NOAA 3DO8A 3HVHA 3IE0A 2ECPA 4OH1A 2QTTA 3DL0A 3DUWA 4RADA 1N75A 1JDUA 4I1VA 4ARAA 4JBLA 2RD2A 2IXFA 3TCKA 2J67A 4AWBA 5BOSB 1E9FA 5L4SA 4MARA 1HLPA 1ZD8A 3DBHA 4O2AF 4TRRA 4ZAXA 5G0UA 1BRTA 3U17A 1X3SA 1G9XA 2AN1A 2XUKA 1P8AA 4M1KA 4U6NA 5IAKA 2I6FA 3UJNA 1C3OB 5TPWB 3ILVA 2QQ5A 2YS6A 4B83A 4IVRA 1N6PA 1AXRA 1X8XA 4O1IA 1P1HA 1XZGA 2XZTA 4YAWA 3KZOA 2Q6VA 4ZT6A 3T7CA 5K8LA 2ZSDA 4WXRA 3BJIC 3U6BA 1KH1A 4R5MA 4PPYA 5KWVA 1E1RA 2HCJB 2OA0A 1VIMA 1VCNA 2LKCA 4LYYA 3T4EA 1NUUA 1LV8A 3D7SA 1D4ZA 3KV3O 3WQQA 4A6DA 5HOQA 3Q7PA 1AMUA 4FEGA 4BO3A 3PRJA 1FMCA 3I1JA 3U3KA 3V8RA 5H8WA 4ZVPA 5LBTA 2NVWA 1HT2E 2A78A 4HJXA 3D31A 1ZD9A 4LBVA 4M89A 4Q9IA 4YDHB 1L5HA 3R7FA 4MKRA 2ZCJA 4WY2A 2AJCA 2PVCA 5F2OA 3KEFA 3GJQA 4A3SA 1NW3A 1TMYA 1KPHA 2Q3FA 3LKVA 4HDRB 3BMNB 3TX6A 5DM70 1IHDA 2GESA 3PUJA 4BFUA 1ONNA 4M1EA 3I83A 3R0ZA 1P1RA 5IJ0A 4NJMB 3Q9NA 3H05A 5DNDA 1BVHA 3HR4A 4R9NA 3SFVA 1XTKA 4QXQA 2IV3A 2XCLA 4DMCA 1NXVA 3O4JA 4EDFA 4MQMA 3WLFA 4BPBA 4NEHB 2Z09A 1G6Q1 1GQFA 2C8LA 2P7HA 5ES4B 2WF5A 1M8JA 3HDVA 2RK4A 2CHVA 2OZEA 3IL2A 4IH4A 3F6EX 3A31A 1XLTA 2XUDA 4GPIB 2NSLA 2EZTA 3PXAA 4R7TA 3OVMA 3NAQA 5JC8A 1YI0A 4PVCA 4A1FA 4N6GA 4IQFA 3WMWA 2XCQA 1AK1A 5K0NA 2ZIEA 3EZ9A 4X8LA 4ERXA 5JXHA 4WESB 1RRFA 2D5LA 1U2GC 1V6SA 3MELA 5IJ9B 5LUAA 4L8GA 1PG5A 3GRKA 1R9JA 3QLVC 3H75A 2AN9A 1Z5GA 1APBA 2C4VA 3P2EA 5HKKA 4RHYA 2AEEA 4C04A 3JWEA 1GGVA 1Y3FE 3MLEA 2VLBA 3UC9A 5A6SA 2BL4A 3FDZB 3GLHA 3WRXA 2VDMB 4PPGA 1W59A 2B34A 2WJ4A 3ILSA 3NI2A 4D3DA 2FGJA 3WGMA 2GXSA 2Q29A 4RJ2A 5FT9A 4ND7A 3HM9A 2JGLA 3DKRA 4MA5A 2V03A 1IPFA 3CUSA 1GFSA 3L9WA 4UTZA 4YRDA 2RGDA 1EEHA 1E1QD 4G1CA 4J76A 4TMXA 5IBQA 3AQ4A 3PE3A 4YUVA 4O4JA 3W9SA 2C03A 1LQTA 3VDXA 5JI2E 4QVKA 3I0ZA 2O5CA 2BEVA 3HXTA 2CKDA 4IDCA 4MW7A 4RWZA 4Z3DA 4JUBA 2R7KA 5JAQA 4DV1B 1QG4A 1I7DA 4CLRA 1LLCA 2ZBGA 2DQYA 3ABRB 3L0PA 3VNVA 2VNJA 2WTEA 3T61A 2PX2A 1D2GA 1JMYA 2DLNA 3QYPA 5DF1A 3FAZA 2IW3A 4PNZA 2WQ6A 1UMDA 6NULA 4NU8X 1E9BA 1M9NA 1XRPA 1IK6A 1S2GA 1ORIA 3LKBA 1O9BA 3OPYA 4HDSB 3RU3A 4UARA 4I5FA 4B31A 2Q0HA 2XXAB 2ZTSA 4FLFA 4LOLA 4P5PA 3IEVA 3RJZA 3FYUB 3CW2A 2YFYA 3S81A 1M83A 2D1RA 1X7DA 4QATA 5HF5A 5F7XA 2BDEA 1CW2B 2Q8NA 4LW8A 2FEXA 4DYVA 4QUDA 4NYMR 3ORYA 1DKOA 3KP1A 1JE1A 1OLSB 1PLKA 2AUMA 2H5LA 2WMYA 2ZE7A 1IHXA 3I58A 2GCIA 2OLEA 4CHTA 5I7OA 3AVPA 4IYRA 4XR4A 1UJBA 1EWRA 1JIVA 2ICAA 3OC0A 4IHKA 4LKOA 1SQ5A 2ENWA 4FMBB 3ZKWA 1M0TA 2MCFA 3ZI7A 3HZOA 5J2UA 3WB1A 1EFKA 1U2DA 3C3JA 1PZFA 5H9VA 1J0CA 4EGSA 1K7YA 1XELA 1PEKE 4F7DA 4PAWA 3ASZA 1JU4A 1ECGA 1CE8A 1O4WA 2W8BB 3ZV3A 2WABA 3IQIX 1EDOA 4COOA 4X1IB 1LK5A 3NHUA 2AF4C 3I4FA 2VBIA 2Y9MB 4MIEA 4L8WB 2I6UA 2FZ4A 5M29A 5IMBA 1TFUA 2PVPA 5D5PA 1Y33E 2ETVA 4HS4A 4K6KA 5T8KC 2R5NA 5CDGA 2NTEA 4R1OA 4W5WA 4Y2GA 1P1FA 3EOZA 2QE7A 3T5AA 3V3KA 4FXPA 4GH5A 4AO6A 3DDNA 4X7MA 5E7MA 2AI3A 1Z62A 2WRZA 3ZXXA 2P9FA 3AETA 4K6OA 1Y1LA 1YL6A 3U3ZA 4OQFA 2P2YA 3ZTYA 5JFTA 2J7PA 2JVJA 2BFPA 3GX1A 3SP1A 4EUKA 2BE9A 1ABFA 3QY9A 2I6QA 2GH1A 1ZQ1A 2X9VA 3EDYA 4ZVOA 2X5KO 3X1DA 4K88A 4IIHA 2YY7A 3WL4A 2YWHA 3KT8A 1AQLA 3HWSA 3WRWA 2XYGA 5DLDA 4DM3A 1QRUA 5B6PA 4X6XA 1U2RA 1K86A 2N9UA 4OHOA 3LM8A 4FQ8A 1IJBA 3AIIA 1U1FA 2V6GA 4MRPA 2ESRA 3I2GA 1WD7A 3AR3A 4L22A 2AGVA 2C8JA 5A9SB 3I0MA 1ZGZA 2EP7A 4W8GA 1Q5PA 1YS7A 1DAEA 2R96A 2HLDA 4L02A 3QBJA 1CU1A 2A1UA 4WOCA 4NDAA 5C7LO 1V6AA 3B6EA 3OBIA 3OFKA 3J80A 3BRQA 5AM2A 1VZ2A 3D6FA 1CR1A 3K9HA 4X20B 4GGPA 4ZOLB 5CFZA 3U81A 4FDVA 2XW6A 2IEYA 3LUHA 4RY9A 5ALYA 1TUBB 2HU5A 2B5VA 4B3HA 3DM5A 1QE5A 3BE8A 1E7RA 2R62A 1N2CA 3WTBA 4DJAA 1I94B 3P4XA 2BFCA 1FTWA 3P0RA 4KQIA 4LXXA 4YRTA 3M5WA 3R41A 3Q10A 4XDYA 2JCBA 1S96A 3H8JA 3QK7A 3ZX5A 1SHTX 1H2EA 1YR2A 2GPJA 4Y67A 5IBPA 2QX8A 2BFAA 3JQ7B 4QOFA 3W7VA 4BE7B 4D45A 5B64A 4BMCA 1U7OA 3B3FA 3E9DA 5GONA 2VN8A 2ZRNA 1SQ0A 3AG6A 3C2QA 1LJLA 4I2VA 3BXFA 5TC4A 1GTMA 3GH1A 4QTTB 3OTOB 5GINE 1P81A 3INGA 1OAKA 1WXDA 1Y8AA 2I1VB 1CZOA 4QXMA 3ANXA 3UBMA 4CQLA 2PS1A 5KTPA 4G09A 5J2TA 7REQB 2VWHA 1T9GR 2O07A 3PS9A 4G0PA 5LR6A 2QD5A 1G38A 3K53A 3G17A 4XRRA 3VNRA 1Z38A 2EKPA 3CRW1 3FIJA 3FLAA 3GJYA 2ZB8A 3MXTA 2RAUA 4S0ZA 5SZHB 1E7QA 1QIGA 3GC6A 2QX4A 4F9GA 5K6TA 2XRZA 3QKSB 3IVCA 3QOYA 1GAWA 1Q74A 3P9NA 4DT1A 4F04A 4ZHQA 3U3RA 4JDUA 3ZHUA 1EH5A 2AQKA 2WD8A 4QM7A 5ALDA 1W7AA 4WZ6A 3RYHB 4YR7A 2PSJA 4IOLA 3ANYB 3EDCA 2PL1A 3IB3A 3R76A 2W6JD 4Q4CA 3DL7A 3PJRA 4K8OA 3GROA 1Q1BA 1N3BA 5ETJA 5FOTA 4G1UC 4ER6A 5BXYA 2J8ZA 3ESZA 3EE6A 2FDXA 3NVAA 3I23A 4H0FA 2ZROA 4B3GA 3O8NA 4YT8A 1P3DA 3ZGNA 5DM0A 1F0NA 2EF0A 3UA4A 2ZJYA 2WAAA 4WV3A 4INJA 4Q7LA 1MR3F 2OENG 4LHZA 1PX0A 4HO1X 2PXAA 4M8LA 4LSGA 1EK2A 5K3SA 5B3LA 4MPPA 2I3BA 1KOFA 5E7JA 3KHKA 3GB9A 3B5EA 3O0DA 3WX0A 3RVDA 3G6WA 1VE5A 4ZREA 3NIFB 4E12A 3E35A 4FVTA 5C5EA 1JPUA 1ITZA 1WSBA 5E6UB 5JMTA 1TX4B 3TDNA 4LJKA 4J16C 5ALNA 3RRYA 1MZVA 3TLCA 4YS6A 5JDIA 4MIOA 4X41A 2IIQA 3LUAA 3TXYA 4BWGA 1SOAA 4DLPA 3Q1KA 1W5EA 2Z58A 4PSDA 4DJ5X 4B6FA 3V4OA 3RAEC 3VHLB 3ABQB 2ODQA 2PL5A 4RD6A 5JVDB 3BHMA 4L0CA 4W9RA 1GSHA 1Q11A 3LFUA 4CLDA 2F7SA 3ED5A 3S7ZA 4FHEA 4CR8A 2HSZA 5CX1B 1OFHA 2JFQA 1JDPA 3OJWA 2HPAA 2XNDA 4GDFA 1DLJA 2IK8A 1MO6A 5CG1A 1IZ0A 4A2CA 5BN1A 1GDDA 2FZGA 3A2LA 4U8HA 2FETA 2R1UA 3FSRA 1GUBA 2H2AA 1OH6A 4HRAA 2W2QA 4GL2A 1TU4A 2VAMA 2R9VA 3OO1A 4YAKA 1ZX1A 2H11A 1M2VA 4I55B 2CFTA 2VDOB 2BZSA 1U0OC 2EFJA 2F59A 2HCBA 3ISTA 5JQGF 4O33A 5FNVA 1Z82A 2PH5A 3V8BA 3JATA 4ZMRA 3KOXA 2QPLA 2VUIB 3P7MA 2B4RO 4ID9A 1GZ7A 2QLMA 2OILA 5E6RB 4Q48A 5KJCA 3EEBA 1UODA 2QY9A 3SQNA 2J3QA 4BNNA 1RQXA 3IULA 2MWMA 4CCAA 1YQEA 4ZCQA 3T3GA 4EECA 2YTZA 1OWPA 3DTTA 1CY8A 4LJ8A 4E3ZA 4E5MA 4EPYA 2HK6A 3EH2A 4CTOA 5YASA 4CEIA 2J0EA 4PLPA 3RUDA 3MJRA 4L28A 4P08A 3LCUA 3K9WA 3D7LA 4QTUB 1A4RA 5DDIP 1EJ6A 1U9ZA 1Z39A 1RRVA 2VYND 1LPNA 3HJCA 1XZ8A 1ZNYA 3P4UA 4P86A 3TWOA 4R2HA 1GPAA 2VQSA 3T5PA 2H92A 1L9XA 4CMCA 3N8HA 5B55A 1L4UA 3B60A 4NCBA 5KC8A 2YHIB 2I6TA 2D2IA 3RANA 1RYMA 3ZE2B 2HQSA 4XH9B 3TL6A 1V71A 1EXNA 3CGGA 3REQA 3SMVA 1PJAA 3WDMA 4B7CA 3ZCVA 4IZ6A 4RXUA 4GI5A 5MF6A 3ZHSA 3BWDD 1NT2A 1DADA 1QCCA 2QRLA 2WF6A 1DXHA 1I7QB 1EP3B 3HGQA 1KDTA 2GO7A 4DCPA 5I3CA 4N5HX 1SGWA 2GN9A 1AUQA 3QVJA 1XRSB 3M6WA 2PM8A 4Y6RA 5FKJA 1HTBA 3UEOA 4PBRA 5CDFE 3BMQB 4RTSA 1JFSA 1XRLA 3L01A 4BP8A 4BX2A 4GI2A 3M6LA 2ZPAA 3BN3A 1UOPA 4LXGA 4PZUA 3B36A 2G5CA 2ZBDA 5I9MA 2QI9F 1LLFA 4NESA 4AF6A 1V3QE 5BMVA 1TTQB 3EXHB 4MW0A 2R6FA 2JRLA 2JJ2D 4BTLA 2XB2A 3LDFA 5THXA 4E5DA 4MWCA 3BB4A 2PKWA 3FKSD 1R0LA 3ASUA 3AHIA 2A1IA 4GS5A 2AJLI 3VPCA 1CDZA 5JIBA 1VHQA 3LQ4A 5TJ9A 5B36A 1YR7A 1I1NA 1YSCA 4N82A 1KR2A 3S2UA 3HLTA 1JA1A 3G2MA 1XDWA 4D7AA 5HP4A 1TM4E 3EY4A 1GYQA 1V7CA 3E03A 1QKKA 1EUCB 3K0HA 3SLKA 5F5LA 4R2IA 4G3XA 1NI4B 2YZGA 5C0OE 4LF5B 4MPTA 3NP9A 3KR0A 4X1YB 4YK7A 4AMYA 1N5LA 5DU2A 1RJEA 2JEOA 3AUUA 3INRA 3RBZA 5KTOA 5HRUA 1RZRD 4DHWA 1TVKB 4EJSC 1TF2A 2Q5FA 1PJ2A 3HO8A 1EVYA 5IAOA 1HMYA 2XUFA 1KFJB 1AO0A 1B2LA 1BEEA 1N4DA 3EC7A 3PHIA 4G65A 4OKSA 4TKVB 2NUAB 3SZMA 1N33B 2GN4A 3W6ZA 2DFVA 2Y27A 4H3KB 4K28A 5BV2P 1E9EA 1YIDA 2WG0A 3O7MA 3D43A 4WBNA 2O14A 3R3UA 3WQRA 3KQKA 1JR2A 1N1GA 1O03A 1OT3A 4EVQA 4EO7A 4RX1A 2PZJA 3JQ9C 3RSHA 4LKRA 2HEGA 2IEDA 4EHDA 1NE2A 5L6MB 2VPZA 1E7MA 1BHQ1 3DBOB 1ZGAA 3F5MA 3N2NA 3BD7A 4FK8A 2QM0A 3V33A 3RKSA 3TQTA 4A03A 1SCJA 3H5IA 3WG9A 3B9QA 3ZPXA 4P3XA 4DSOA 3CTPA 2Q3BA 5G1NA 2IHYA 3DCIA 2OCAA 3PR2B 3TZLA 2X8LA 4AY2A 4RF3A 3W3AH 1QJ4A 1MDFA 4JSRA 3W1VA 3WGQA 4EG8A 3WGLA 1FS4A 1I80A 3IKVA 4L07A 4K1LA 2DMRA 4P0PB 1DHRA 1FK8A 1BJRE 4D96A 2VHJA 4WN9A 3HKDB 1BN7A 1T5TA 2XE8A 4HMQA 4FOTA 4JCCA 4L9RA 2CL0X 3MSXA 2VWGA 1H4QA 2J33A 2P35A 4O2AA 5A4FS 4HJRA 3F9CA 2PJUA 1E79A 3HUTA 1Q19A 1EBUA 3CBGA 3FDFA 4P7BA 3CRQA 3SC2A 3LYAA 3LW7A 4G24A 1OR8A 1PNTA 2V59A 3NEPX 3NJRA 3PUVA 2XUPA 3C5VA 1IY9A 3GFQA 4GGOA 1UJ5A 4D3SA 1OMOA 2GVNA 1BE6A 3CNQS 2FWAA 2XQJA 1GPUA 4CF4A 1S2NA 1FLVA 2YJGA 3D7MA 2EHJA 1RJ9A 3FBGA 2P6NA 1E9VA 1JQLB 1IUNA 4FYPA 4HWSA 4FYXA 2ZJAA 4PM4A 4YAEA 1ATIA 3IAXA 2IOFK 1Z5UA 4S1NA 3RTAA 2F3QA 3L7NA 3KSBC 2B3DA 2YR0A 3P5BA 3MS2A 4FOLA 3WK8A 2AG1A 5TT0A 4KOEC 4WOBA 1MV8A 3RLFA 3LHDA 3U40A 3ZU6A 5B4UA 4OFXA 5LVAA 1BJTA 1M1NA 4FFBB 4JL8A 2WJ6A 1NUAA 3BOSA 3HRKA 2BM9A 4O4HF 4YO8A 3X1MA 1J06A 4MUGA 1KOGA 4XLLA 3JALA 1FY2A 2B0JA 3OHSX 4MV9A 1QF6A 3D3NA 1XZBA 3DQPA 7AT1A 1VRCA 4KQ2A 5DM2A 3WJAA 1HNWB 2GCGA 3ENKA 1UH5A 1Y6GA 4FKBA 2RH5A 5E7IA 1Y3HA 1M2WA 4D25A 3OTGA 4K9MA 3GLGB 5LC1A 2PKYX 1CBUA 1A82A 1L7NA 4TLCA 4E33A 1Z6ZA 4RZHA 1Z2PX 2E85A 3NUQA 1RM5A 3O8DA 4LDAA 4LFCB 3TPCA 2PX8A 2HA5A 2NYUA 2J9XB 2DPHA 3VPAA 3DB1A 1WCIA 4GX5A 1N1MA 3GLHE 3ZU4A 4XWGA 3G23A 5HVNA 4QBHA 4YP9A 4AUNA 1Y0BA 2YHUA 1RPAA 4JMLA 2RJ3A 4N39A 1FEZA 4MKGA 2C5HA 2I4MA 4EUSA 5LOVF 3FZYA 3QNMA 2GETA 1PFGA 3HR8A 4HRXA 1PZGA 3FB4A 1VL5A 3O1JC 4AJNA 3IODA 5CJPA 4NABA 4HSEA 1V16A 4KUGA 4US2R 1CWUA 4K3UA 3X43A 1DU4A 1P8JA 2JJMA 3A1FA 3IAM1 1JKMA 2BOVA 3FWYA 4AT1A 3E7WA 3OF5A 5BNIA 4JI8B 1E59A 1XQ9A 2CXHA 1IQ0A 1XP8A 4FKMA 3UT0A 2H63A 2VRCA 5IKOA 5AJXA 1SPXA 1LDBA 2OK7A 3CLTD 3CJTA 3CVOA 3GH3A 3OD1A 3SVLA 1Y6ZA 4L2IA 1CB0A 5CPFA 2WY2D 3RVSA 3UJ7A 3VNAA 1L7DA 2CJYA 4NX2A 2MU1A 1NQWA 3EZ7A 1E8NA 4GKKB 1KOLA 1KXZA 3PFCA 1QFZA 2WU1A 3OEWA 1MOQA 1Y8RA 2C4NA 1CY2A 4UAVA 5CIQA 4DDMA 1WWKA 1KAOA 1HE8B 1U28A 2FEAA 1BVYF 4Q12A 3SE0A 3BGSA 5ESXA 3A6ZA 1GPNA 4AWXA 2A9VA 2IXDA 4LJ4A 2ZR7A 3KNZA 4U9HS 2V1XA 3O2SB 3UGQA 2WJ3A 2ATXA 1CUCA 4PEVA 5CNKA 3ZOKA 4EHAA 4EPRA 5EXXA 4HQKA 5JROA 4OLAA 2CD9A 3AOEA 4LMBA 2VTKA 2A84A 3PJGA 1D2AA 2RKBA 3PTZA 2UAGA 2NU9A 1XB2A 1FYVA 4MGZR 3HGMA 1MUUA 4H15A 4FJ0A 1L3IA 4LJAA 2YWBA 2BKUA 3TSYA 3UANA 4LZPA 1R6VA 4KZKA 1KZGB 2I03A 4QOGA 5GY7A 3QKTA 3C6KA 4MEJA 1C0KA 2QZJA 3F6YA 3LSTA 4RWEA 4AJKA 1H2BA 2RB4A 1NRXA 2EQ5A 3M4NA 2ZUCA 4R83A 1KK3A 3JWPA 3L6OO 4CIWA 4KPGA 3A8TA 3MBKA 5LZ2A 2KX7A 4G56A 1T1GA 2VDLB 1XG5A 2NU6A 2PS9A 3QTTA 2O3UA 3CPEA 1PEAA 4LE0A 3DL2A 3U26A 1A3CA 1S4MA 3KTOA 4JB0A 4CCYB 3AM4A 4V0NA 2JHGA 3DZCA 3D3EA 4ISCA 1Y5IA 2I6XA 3BFVA 2ONJA 2OVBA 1FZTA 4J2TA 4PX3A 4NSNA 2YOHA 2R4TA 3UMYA 2BGMA 2GM9A 1U8XX 3MVEA 4DZZA 3QSYA 4CTJA 4QVGA 4PR3A 4BWVA 2P75A 4KIUA 4G41A 4MWOA 3A4IA 4IF4A 2V8BA 4L9WA 5CAEA 5HUHA 5KKNB 5KO2A 3L4BA 2R7AA 3B1FA 5JRDS 2AT1A 3EQ7A 3L0SA 4RE6A 5TNXA 4F4DA 1B41A 1ADCA 1U8ZA 2BRUC 3AFNA 2RHOA 3IQDB 1YC5A 4MVCA 5FORA 4YA6A 2IPOA 2JFOA 3EVCA 4LDJA 4WZAB 1V8FA 1W2GA 4QBGB 2WYWA 3PEEA 5BSWA 3PC8C 2FG6C 2B5WA 1DKNA 1XHLA 3G0OA 4MEAA 4DBVO 5J23A 1JQJC 1BRMA 3ZLTA 4WK4B 1H2FA 2FK8A 5M04A 2C57A 3WWYA 1PKEA 1B93A 1USVA 4LRUA 4QEDA 1HEYA 2OHOA 1DJLA 1QHXA 2YV3A 3AERB 3GBSA 4RC9A 5AK3A 4FDTA 1TZKA 1J21A 1ZRMA 3QEOA 2UZ3A 2UXCB 1YNOA 5EXTA 4AXXA 4TXJA 3VC7A 1GZDA 1X0XA 4TV9F 3AIOA 5KDOA 3AI7A 5DSTA 1W36D 1N2CE 1T9KA 3G7UA 4R2LA 3OX2A 1DEXA 1LUAA 4EI9A 1OIVA 3A1DA 1MFPA 1GPH1 2O9JA 5FJJA 3RABA 1EFAA 3LC0A 4W7HA 1T43A 3F6RA 1F6BA 1UKEA 3V80A 3AOGA 1XX6A 3Q98A 4IS3A 3W6OA 1SFRA 2CNLA 4BO8A 1XEWY 2EZ8A 4Y2HA 5KX5B 1QB7A 1T6BY 2IYUA 1F6DA 5IKPA 3IS3A 1QONA 4O1HA 3TM4A 1V1MA 2V4MA 2WAXA 2IYLD 4U5QA 2X3YA 3GDWA 4F86A 2WFMA 3I8OA 1TLFA 1JEYA 3M4JA 2WC1A 3JY6A 4O5OA 3EPLA 2C9MA 3K8QA 3W78A 4V1CA 1CUYA 2CFIA 2YXLA 3QW4B 1HMPA 5ALJA 3FFBA 1P1KA 1PG0A 1ZL2A 3F3KA 3NEJA 2QTVA 1HYHA 4FHGA 2BP7A 2Q6OA 3ADOA 3MQFA 3PUIA 5FFNA 1O6ZA 2W7TA 1CUJA 4KVGA 4YIHA 1JLLB 2MT9A 3LX5A 4NAUA 1Z0AA 1XEXB 2YINC 1ZGHA 2QEQA 4KRXA 3I2IA 1Q50A 1J23A 4PE5B 1RZUA 4WCFC 3R8CA 3TLBA 4NULA 4X6LA 3DFUA 4FFRA 3RUCA 3QVMA 1YU9A 1JX6A 4PVDA 1T8SA 4LK3A 5BN3B 4A8JA 3DMTA 4EHFA 1KQNA 1H1LA 2IQ5A 1NX6A 3VI4B 3VR2A 2DERA 3C6MA 3ZQKA 1KI4A 2ZJ4A 5JNSA 2VPYA 1E0AA 3U4HA 4BFTA 1A5SB 3U44A 1JI3A 1NG1A 1NVDA 1SQGA 1XA0A 1II8A 2Y92A 4NMHA 5KQSA 2Y0CA 3ELBA 5L7WA 3LH5A 2VDVE 3SC3A 1KFBB 4N41A 4B9AA 4HDKA 2P6MA 5DNAA 4IQ0A 1R74A 4F84A 3MLBA 4O0MA 4DR4B 1HF3A 4NZOA 1NUQA 2IU3A 2UZ1B 1QS0B 3TMKA 3IHTA 4YQFA 4J7UA 3T0IA 1XQXA 5LP6B 5IJWA 4HPJB 3TQFA 5F23A 1M7BA 5FPHA 2I7VA 3GLIA 3WDSA 4MUBA 4GRAA 3E53A 2Q3HA 4IYJA 3MW8A 5IDYA 5A4JA 2GRUA 4KYVA 2G7MC 2B4AA 4F06A 2IYXA 3PPYA 4BNZA 4B73A 3TTXA 4UTPA 2IUYA 16PKA 3RC9A 4CV3A 1UKVY 3C74A 1B74A 5J47A 1FUIA 1RXEA 4MYHA 4B2LA 2GNPA 2BUCA 4P83A 4WHMA 3T4XA 4OA8A 3UPUA 1FYEA 1U0EA 4WINA 4DSNA 2BKXA 4RD3A 1SQFA 4GVXA 4TMKA 4GRDA 2IE0A 2IZZA 4X1KB 5C31A 2HHJA 2H5EA 4LYDA 1ATZA 1T9DA 4C4RA 4XVCA 3FOAA 4ZOBA 1DIAA 3JWJA 3AY6A 4EFNA 2PTGA 2I2XB 3ACBA 3BAZA 3M4ZA 5COAA 3V1MA 2H7YA 1CUXA 5HG0A 4EL5A 3G79A 1BOFA 1R50A 3NBZC 1XZPA 2OWDA 4NPAA 3OUUA 4QQRA 4DLVA 2C3PA 4G26A 1J8DA 2E2WA 1VKZA 3IA2A 3NYRA 3JQBA 4OXXA 4TZKA 4ZJZA 2PLAA 1W88A 3VJRA 1T2VA 1AKYA 1U7WA 4PHTA 2BFOA 2CL7X 4NC9A 4DLLA 1D07A 5CB4B 3U7QB 2NVBA 2Q3DA 4LY3A 4K81B 4CF6A 5EIHA 2PS0A 5IKXA 4BB6A 4KN5A 4YWJA 1II9A 4HMOA 1UDCA 1V8OA 1IOZA 3WNCA 2OR3A 1TK9A 2E9SA 3EWAA 4M0LA 3GCXA 3L0OA 4UEOA 3MJVA 4X95A 2O7NA 1G4UR 1KYWA 3FNRA 1GU1A 3PVSA 5DOVA 3T54A 1BS1A 1J00A 1W5FA 1WF3A 1VJ0A 2VQ3A 2PFKA 4G5FA 1Z25A 1MG5A 3BJEA 5JO0A 2CZGA 2F3SA 2G5PA 4B87A 5B5SA 5JQGA 5EJMA 5JHHB 4MQ6A 2ZIXB 4Z1OA 1P0MA 2G1KA 4G9EA 5GAJA 1LLQA 1TGYA 1XTPA 4EEXA 2VDWA 5FOSA 1QSGA 2GUGA 3ER8A 1UDAA 5BYKA 5LLTA 1MPTA 3D8NA 3H7IA 1TPYA 5DTJA 4UOQA 4D44A 2AXNA 2HQBA 2X58A 5K0FA 4UBJA 3EIWA 2R8YA 3EEYA 4LHYA 5KNLA 4R51A 1RLOA 4FT4A 2IRWA 2VC2B 3ZDEA 4B81A 2QX9A 4Z8YA 1BN6A 1WUIS 5CHEA 1WLYA 2HXSA 3COWA 4A0QA 1WXQA 3EY9A 3PD1A 2FA9A 4B3CA 2P41A 1LB1B 1Z12A 2Q0SA 5DM4A 3RYCB 2O59A 5CTJA 4I6GA 1W2WB 2W6ID 4AJ1A 1HQDA 1E4EA 5D5QA 4S35A 4W9MC 2J6HA 3OLXA 1FJGB 4XASA 3ZGOA 5IKEA 4R1SA 2R60A 5EJAA 5DNWA 3CZRA 2HF9A 2CV1A 4RDIA 2WIKA 3H17A 3HHEA 1VL2A 3OAAD 3UV7A 1DJMA 4N5LA 4KGXA 4PO1A 2PQ2A 3F47A 4RIIA 1X1EA 4AFNA 2F2TA 1CDDA 1AHPA 4HATA 2QTGA 1SBZA 1UXIA 4WGGA 4C5BA 1AF7A 2OSBA 1QV9A 3E1GA 3QOFA 4ZOCA 3UHPA 2HIAA 4HEJA 5KTSA 1VPTA 2YZ2A 3GEBA 2IEGA 2QYSA 3IIKA 3WQBA 3AVUA 1MH9A 1NY5A 2XSZA 4NYJR 4WQMA 4YREA 5C3MA 3M3PA 3CTMA 5HZMA 3ESAA 3NQ41 1ACMA 4B3BA 2H07A 5I51A 2H65A 3I28A 2HJHA 3WGJA 2ZJFA 4EVIA 5K0LA 1T36A 2JAWA 1L4NA 3AHGA 1CRZA 2A0WA 3MOIA 1ECBA 2ERYA 4N76A 4GPBA 4YPOA 5FLXA 1U5BA 2I67A 4QJIA 3ZBPA 3A3PA 4HADA 5JCXA 4MGEA 2WVJA 4GICA 1ULAA 3MXOA 1KEZA 2F3TA 2QDKA 3HWWA 3BX1A 1VI5A 2GSWA 3LKZA 3QQ5A 4P2GA 2Q7OE 1R6TA 3RVBA 621PA 3I52A 4LYEA 3WYDA 5FUQA 5BW8A 4JHLA 1EBBA 3FGZA 4BATA 4C4YA 3G8CA 2HMAA 3DMHA 4F1JA 3QP9A 3ILYA 4PBTA 2MR5A 2WMDA 3AJDA 3NJ4A 2I4IA 2RHDA 2Z56A 3WO1A 3IMEA 4KO8A 1NW4A 1YAHA 1GNQA 4ACBA 2WJHA 3J7TA 1JWLA 1P44A 5AW9A 4ZRMA 2BGNA 3BIFA 3M1LA 2Q5EA 1O97D 4FOPA 4HMPA 5CD9A 3L6CA 3CVUA 3OFNA 1JJVA 3KR2A 2IXBA 1T9AA 4ESHA 1G20A 3LPMA 5JJKA 1ZNWA 1OTYA 3T1VA 3UM9A 2BISA 5HYVA 3USES 2OCLA 3SHVA 2JGEA 4EHNA 3VC1A 5B1IA 4YRPA 1O54A 1JFFA 4XQEA 1K6MA 4DB4A 4UBIA 2B2CA 2FR8A 4MRAA 4BNJA 2GN0A 3PD0A 3VU9B 2GJ4A 3CE6A 3HCOA 2WFLA 2GZAA 1ZUIA 3UWOA 3PVZA 1DRVA 1SURA 4B4KA 2EYUA 1AQUA 3O90A 2XNCA 4LC1A 1PO7A 1IG3A 2F90A 2XMQA 3GEEA 3OEHA 4JVSB 4WADA 3VOAA 5IFLA 3AUJB 4K6MA 5BQFA 4ER5A 4R2KA 5L3SB 4NJEA 3ANLA 1OASA 4IMJB 3HACA 3OQBA 1WXEA 4M99A 1GQRA 2JLZA 1YJQA 3AGQA 3UB2A 3DOEA 4B17A 2OCKA 3BWBA 3ZE9A 2QTAA 1BD3A 3N87A 2VPXA 4XPZA 3LK6A 2C1EA 3SDBA 4BFCA 2ZBVA 2JCXA 1QX3A 3BRWA 4XSHA 4CE6A 2O3TA 1AKWA 3WIEA 3N6XA 1FUEA 5HILA 3W3AA 2IYAA 3C5EA 1TPZA 4UCWA 2I34A 1NPTO 1ES9A 3G2NA 2HFJA 5KEIA 5D1HA 4AVYA 1DG3A 1Z68A 1CUSA 3GVHA 1F2UA 3A36A 3F2VA 3EBOA 2VZ9A 3KKPA 3OLWA 5MN5A 3F7MA 1SA0B 2H4YA 3L7YA 3N59A 3NBMA 4PG6A 4GVPA 1TQ4A 2FOLA 3GOHA 4DCJA 4DABA 4E07A 2DR0A 5FLKA 2EW2A 1XE3A 2FG7C 3BYZA 3QBVA 3ZK7A 1ZK1A 1CVLA 3M6AA 4EYEA 2O3JA 2CLCX 1OBOA 2PKQO 4O4HA 1RLMA 4QIHA 3JZFA 2GJAA 2IYEA 4ZVLA 3BWXA 1ZMBA 4JUDX 4ALJA 2NU8B 5FXMA 2B69A 4OJMX 4L4RA 4YFVA 1QB8A 4JLAA 3QLTA 2Z1DA 4GWLA 5DGCA 5T57A 3X1WA 4AI6A 1OLXA 4UM8B 2J41A 1QTIA 1N92A 2RHHA 3KU1A 2H9AA 5CFRA 3G2PA 5DT9A 2JGJA 5F73A 1CETA 1RCUA 4UXIA 1GTVA 5J5CA 3DZIA 5H3LA 5H68A 2XE6A 4ZQFA 4UXJA 3ETHA 4ERNA 4Y1RA 4D8YA 5AKIA 5U9CA 5A62A 1GUDA 1DX9A 2QNRA 2P4EA 1OYWA 2VS1A 2O4CA 2RGNA 1VMEA 1YBVA 4QBTA 4S1PA 3FNBA 3TSOA 1UQUA 1VCIA 1ZXXA 1L8AA 1ETHA 2GPWA 2WWVD 2WAOA 3RJ9A 3HV0A 3AF5A 4NENB 5J4HA 4Z53A 1THGA 5IVPA 3OFSA 3OCZA 4PLWA 5LOVA 1HWYA 2ZB3A 4TTTS 3UO8B 4C0SA 4X1IA 4J07A 1A7AA 3ST7A 3FPJA 1H0RA 3VNBA 2AK3A 4LXUA 4Q02A 1O96B 1E2DA 2CMKA 4MICA 2Z1MA 3MJ4A 3VV2A 2REQB 1G21A 4OMUA 3WBFA 1RAIA 2EX4A 3CMMA 1KSHA 2PZMA 2Z8YA 4QBFA 1UKBA 1E94E 2FPUA 1NBMA 1LZLA 1OXMA 2OO3A 2GF0A 3HKBA 4XB6B 5DGIA 1FFSA 1NJ8A 1FU7A 2MINA 2XEXA 4JOQA 5K3AA 5IXYA 4LAFA 3ZBUA 4TWIA 5DP2A 4BO2A 2ZRMA 4PO3X 4Q1BA 4R0VA 5IAAA 3RIHA 5EAIA 5HRAA 4ZMSA 1XVLA 3FY4A 4NKRA 3RG8A 3HMQA 2AMLA 3KKOA 3MUOA 5AOAA 2G1JA 5FBKA 3M89A 2OY0A 3OKCA 1XZHA 3CG4A 1Z2NX 2ZS7A 3WGNA 2GPYA 1PR4A 4L08A 4XB2A 1VYHA 1RYHA 2EKLA 2LCIA 2UYYA 3ESBA 4YAFA 3STYA 2XYRA 4NV3A 3JQ8B 4BFYA 5ICMA 3HFRA 1Y6FA 4EOGA 5CYOA 2H2WA 4UBMA 3A4TA 4H1TA 3ENZA 3WBBA 1Z0DA 3DA8A 2JJ1D 3ZN2A 1NGSA 1YOVB 3KDPA 5AUPB 1I4DD 4JU8A 3UH0A 4E03A 5E2AA 1XTIA 5EIBC 3L7BA 4PCVA 4K87A 3C3EA 1BGXT 1BNCA 1AGRA 1DS6A 3M70A 3WFZA 4I1PA 4RMGA 4B4UA 1IZ7A 4DLNA 5J3JA 4NATA 2JG3A 4PXAA 4C03A 3WB9A 1P5JA 4ZV7A 1BXKA 2Y1LA 4K8RB 3SS8A 4MDYA 5A4AA 1O3YA 4NU5A 2OZPA 3I8SA 4Y98A 5HHTA 3OIGA 3EPRA 1ACJA 4JC0A 3TTTA 3V4ZA 4F3YA 2PAAA 3FNQA 4W6ZA 4FGSA 3LBIA 3OQ1A 2XKAA 1H2XA 4R8LA 5TT1A 3TUZC 3KCQA 2PBZA 4D4JA 3IV6A 4RENA 1C14A 1W8IA 1N5DA 4FYKA 5JMWA 2PO5A 4IFTA 5F77A 1PWHA 1VE7A 3M1AA 1NJFA 2A9PA 3BXZA 3EXEB 3WNDA 2XGSA 1FDIA 1KS2A 4HI0E 2TMGA 1DQZA 1C9YA 1L3CA 2WHRA 3GJ5A 4IKOA 1Z08A 2CWWA 3DMYA 2MSWA 2GYVA 3QEMA 1A2OA 1XLUA 1Z0SA 1I33A 1TM3E 4L7QA 5I9BA 4DUZB 1JVBA 3LZCA 4QELA 3UICA 4MWGA 2NADA 2O8EA 1GNLA 3F4LA 4ZQBA 4UUBA 4LTNA 4GI3A 3SM9A 4OG2A 5EE9A 1YDHA 4IDQA 4YUAA 5BWNA 3LE8A 3C6QA 4BXOA 4W4TA 2XITA 3O4RA 3GRFA 1ETUA 1GCGA 2FFHA 4I5IA 5AKYA 5KNCD 3C8DA 3P2OA 2YZ7A 4TV9A 4JJ4A 3IR6A 3G9QA 4RSMA 1RVV1 2DT8A 5LP6F 5AK5A 5EI5A 3U4QB 2L18A 4BQSA 1DQSA 2QT1A 4OQMA 5LU9A 2ZTLA 2GCPA 3HL0A 3IAUA 5U4QA 1EVIA 1GV0A 1OLUB 1V2GA 4CYMA 1CD5A 2QAIA 3NDJA 1P7WA 4QJ3A 5LP1A 5HF9A 1R4NA 1V8PA 3H6KA 3KDSE 4X7PA 2O2YA 4PNEA 3HMKA 3Q3JB 5EWJA 5AXDA 4KKXB 1JKXA 1M7HA 3L1HA 3WGVA 3QG1A 1P7VA 3P4YA 1Q3HA 5HK9A 1ZNZA 1NURA 4NZMA 2P7IA 5ITVA 2PN1A 3QMVA 4FNOA 2QRZA 3D4OA 2JHFA 2OFWA 3B6MA 4OXNA 5ADUS 3SAJA 4OYRA 4J7XA 1L8LA 1NVXQ 2I7CA 3L6DA 2XQGA 1T5OA 3ONNA 2W98A 1XXLA 2K7ZA 2YVQA 4LOKA 1YRAA 2YVKA 1J7JA 3GA5A 3Q7QA 2QZPA 4K1XA 1TLLA 4X62B 5CB4F 2A6PA 2PEZA 4II3A 3ZZNA 3Q8MA 1SXJD 2PX4A 5F35A 1ZK4A 1VCMA 3JQ6A 3ZQUA 3WKBA 4U9IS 4YALA 4HGPA 4TZTA 1VSVA 1MFZA 2WTAA 3JASA 2RC5A 1TRKA 3KJZA 4NBSA 5ARCA 2JW5A 1Z4PX 3DXFA 3EMKA 5J4VA 1BCSA 2FPPB 1XF9A 2TECE 1UFVA 2V7VA 1ZMRA 1Z16A 2C4UA 1RYZA 2JZOA 2ZUSA 2R84A 3DHWC 4B48A 2FW9A 1MJ5A 2FEPA 3W77A 4YUXA 1OSNA 3W7AA 5L53A 1NRIA 4M22A 2O0HA 1T3HA 2PA0A 3G1WA 3M1YA 4ZYTA 1YGPA 4C22A 1THZA 2E55A 4Z4IA 5K3CA 5CB0A 2ZSIA 3ZEIA 5FUYA 1AF4A 3RFCA 3GFRA 3A9TA 4Y8VA 1FLNA 1GCOA 2FFRA 3A4YA 3EDRA 3E3NA 3T3MB 1OFUA 4HNGA 3L8DA 3H42B 4HL6A 4M9SA 3S1AA 3UJDA 4DF3A 2PV7A 1TIBA 3VZBA 1Z17A 2HT1A 1XCGB 3TBFA 1E3QA 4FXOA 2JPDA 2NXWA 4R9RA 3WADA 5IUJC 2JFPA 4R81A 3KM0A 1NC3A 4R2WA 4LK2A 1Z47A 5I8PA 4FGKA 2XYPA 1WB6A 2NXNA 1E20A 2WJWA 3BGWA 2J45A 3LI2A 1KJYA 1NIJA 4A26A 1SNYA 1HUQA 1P1JA 2C2HA 2ZG6A 5REQA 5AVVA 3EVAA 3V3TA 4EG4A 1I7NA 2FZLA 4HTAA 2O0JA 4RPHA 5F9MA 3VTAA 4N1AA 4CWAA 2BGLA 5FJIA 5KPJA 3DF7A 4YJDA 2WWHA 2YY5A 3RODA 4L78A 1EE9A 3MTEA 4XSGA 3UCXA 1Y1QA 4BUCA 1O9HA 4ND1A 1EX6A 2FHSA 4QAJA 5EZQA 3AUSA 3OT4A 3GNQA 5TMBA 4I3HA 2QJWA 4GI1A 3TL2A 1IQPA 1VSBA 4CG2A 1GRVA 5C4MA 5FHRA 2O8DA 2R2GA 3LVFO 5JWHA 5JCJA 3GUUA 2I66A 5K5EA 1GTG1 1KZ6A 1PK8A 2ZT5A 3Q8WA 4MRSA 1R4MB 1DDOA 3Q3HA 3DE2X 4G0ZA 5LB4A 4MGYR 4J4HA 4HR7A 3SICE 2VJYA 1I4LD 2ST1A 2DPMA 4UU8A 5IAJA 1IRXA 4NBWA 4FEYA 4LF6B 1QQ7A 3IXQA 4XIIA 5HIJA 2PUVA 2UVPB 1WG8A 4QDZA 1ZBQA 2C9OA 5HZHA 2YDYA 5AWFC 4JKIA 4F85A 1J5EB 1WCWA 2VYVA 1GT91 4IIJF 3T06B 1POWA 1OBHA 2WV9A 3DXXA 3QELA 1E0JA 4WI1A 5B7PA 4K5QA 4NE9A 2V3WA 3KKZA 4CODB 5KVQA 3TQSA 1I10A 4ONEA 4UATA 2VL7A 3O3CA 4B79A 3IUSA 2FFBA 3AVVA 2C2KA 3NMUF 1NMSA 4LYAA 3C3YA 1NBEA 1CF2O 4AX4A 3B5IA 2AI2A 4FQ5A 1PR1A 1FYDA 2JGIA 1B1AA 2OV1A 3GCGA 4QQKA 4CDMA 4F6RB 5FPSA 1QWSA 1TM2A 2HDOA 4HVLA 3DVAB 4GNKA 5BSKA 2EW8A 3UVEA 5K6AC 3NHLA 1XZLA 3R8XA 4LZAA 3QX3A 5KHLB 2IS4A 3L46A 3TR0A 2XUIA 3BDAA 6REQB 5KI6A 3ZJYA 3I4LA 5JISA 2QUHA 1IZYA 1NOIA 4AJ2A 4BMNA 1E0SA 1TA9A 2I9KA 4BQIA 3V4PB 1PV1A 4KVZA 4RFSA 4MVJP 1QP8A 3K1AB 1K5PA 1R6DA 3PPXA 3S2GA 2HZ7A 1XO1A 5GVSA 5MHTA 4OL0A 2NUTB 4O59O 1COZA 3UJHA 3BMCA 2A1TR 3LTEA 1X86B 4AS3A 4V02A 3UV6A 3MQ2A 4D0SA 4Q7QA 4RY0A 4ARBA 4BC1A 5A4DA 4RESA 4DG5A 4AG5A 1NONA 2D1TA 1WM1A 3BCHA 3KDAA 4HN4B 1O0SA 2FQQA 2IZOA 5AHRA 1IG0A 4ZTZB 4HCJA 4XVQA 2Q5CA 3CX3A 3HWX1 3GJSA 3H4TA 1BFUA 1KGDA 4WXEA 3NNDA 5JARA 3P2IA 3TLKA 3LPDA 1XKQA 2XEDA 3I6QA 1JJBA 1G8KA 2UUBB 1HDEA 2K6GA 2JIOA 3HJGA 1GUFA 4H3VA 1DIGA 3G0HA 2AE2A 2WIGA 2OZKA 2Q99A 3G6KA 2HHHB 4JOBA 3FPGA 2DUMA 3SLGA 2AD5A 5C37A 1V2HE 4D82A 3LXMA 2JIRA 4BNYA 4ZI7B 5KIAA 2KBFA 2WTXA 4ODIA 5FTWA 4BBZA 8LDHA 3NONA 4EY8A 2KSQA 3WSTA 3EA4A 2ONZA 1TA4A 4E11A 1E66A 2I9PA 2HK8A 2MYUA 1DZ3A 3EXFB 1LQUA 4BLQA 4BMVA 3A9RA 1NR7A 3VH1A 1YJBA 2AXQA 5DP1A 4J0GA 3AHDA 4FYYA 4LYHA 1VBKA 3GFSA 4OXRA 3UKJA 1HT1E 3ZXIA 2TYSB 2DEUA 3WAJA 3PDJA 4LQCA 3QKRB 5DHTA 1EFVB 3SYLA 3ANMA 2GBLC 2ZU0C 1V26A 3D8RA 4QARA 5EUCA 4DR2B 2ANBA 1ZXLA 3IJPA 3ZWMA 3IIMA 1V3UA 1K2VN 3ISVA 3ZVNA 2GF9A 4OAOA 4YV1A 3THYB 5FHQA 2WBLC 3BF7A 2CZCA 3PHJA 4LJ7A 1IIBA 2C58A 3O03A 4L5YA 3T15A 4KR7A 2EERA 2CHUA 1DUIA 2C2GA 1DEAA 4GM1A 3RUEA 4RPIA 2WT4A 4FNMA 4DLWA 3RS5A 1R6BX 4AJEA 4IJKA 1O87A 2C0CA 4RZQA 3KSAC 1EDEA 2VSQA 1Y9JA 3LHFA 4DMUB 3CUYA 4C4PA 1X7ZA 1J39A 3H9GA 3L7AA 1ORTA 4CMAA 3H9JA 3LO8A 3ZCUA 3MSCA 5FEUA 4WLVA 4NBUA 2CNNA 3FFWA 4YMLA 1FNSA 3ZJTA 1ZG3A 1PJQA 2P9BA 2Q9BA 4QNMA 1BIFA 1NQAO 3DLBA 5JAHA 5DT2A 3R7AA 4K86A 4EJSB 2O2DA 4TN1A 3ROMA 1W25A 3UV3A 3FCYA 3USZA 1QC5B 2PGDA 3CKMA 3L84A 5GTDA 2R6GA 1NE7A 1GAQA 1YUMA 2XDQB 3R3SA 4RU1A 4S12A 3GVCA 1QFSA 5TQ2A 5ALSA 3RSZA 2HI0A 1KDVA 2EJCA 2JFGA 3IVGA 1K06A 2CB0A 4I36A 1A7JA 4KUEA 4MS3A 5JMOA 2XBMA 1CDEA 4J1SA 4TXHA 1QMPA 1TD1A 4KDEA 3DEJA 3GRUA 3OM0A 5CMLA 4FC6A