1IUPA

Meta-cleavage product hydrolase from pseudomonas fluorescens ip01 (cumd) s103a mutant complexed with isobutyrates
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
271
structure length
271
Chain Sequence
NLEIGKSILAAGVLTNYHDVGEGQPVILIHGSGPGVSAYANWRLTIPALSKFYRVIAPDMVGFGFTDRPENYNYSKDSWVDHIIGIMDALEIEKAHIVGNAFGGGLAIATALRYSERVDRMVLMGAAGTRFDVTEGLNAVWGYTPSIENMRNLLDIFAYDRSLVTDELARLRYEASIQPGFQESFSSMFPEPRQRWIDALASSDEDIKTLPNETLIIHGREDQVVPLSSSLRLGELIDRAQLHVFGRCGHWTQIEQTDRFNRLVVEFFNEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of a meta-cleavage product hydrolase from Pseudomonas fluorescens IP01 (CumD) complexed with cleavage products
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Hydrolase
molecule keywords meta-Cleavage product hydrolase
total genus 102
structure length 271
sequence length 271
ec nomenclature ec 3.7.1.9: 2-hydroxymuconate-6-semialdehyde hydrolase.
pdb deposition date 2002-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1iupA00
5LIPA 5T4HA 1LPSA 1AUOA 1WPXA 4AQDA 5JYCA 2D5LA 4X91A 5DTJA 1SCIA 1YA4A 1AZWA 1CFJA 1QO9A 1BN7A 3H2GA 2JEYA 5JZBA 2XUKA 3WL6A 3FVRA 1ZI9A 3AIOA 2VAVA 3D2CA 3QVMA 1XQVA 2EEPA 3DOHA 4J0JA 1EHYA 4CG1A 2J3QA 2HIHA 5AM4A 4OD0A 2XMBA 2J4FA 5AK4A 1XZJA 4UPDA 1TIBA 2PX6A 2OQVA 1K8QA 5JIBA 4A23A 2J4CA 4Y2PA 1EINA 4QEKA 3D2BA 4Y2JA 4B9EA 5AKJA 3KD2A 2E3JA 4M0MA 2G5PA 2HA0A 3D2AA 3IURA 4JUIA 4X94A 1XFDA 2VSQA 4BAGA 1X2EA 2X5XA 2GYVA 4CI9A 5LLSA 1VOTA 4IQ4A 5JD4A 4GDMA 4HRXA 2QJRA 5AM1A 3ZLUA 1J06A 1GKKA 1CUEA 3JYHA 1AX9A 1YASA 5HK9A 1QFMA 4HXFB 4HS9A 3FWHA 4BE4A 5K3AA 4H35A 1BEEA 1J1IA 1E8NA 2WTNA 5K3DA 5JZ9A 3QM1A 1W1IA 1FFCA 5LZ4A 3PF9A 3WJ1A 4G4JA 5D7BA 3ESAA 2QUAA 1HKHA 1BROA 3LS2A 3M83A 3STTA 4J0KA 2C0PA 1P0IA 2V97A 4JYMA 2WJ3A 3W06A 3KWJA 2OLEA 1I6WA 3FSGD 4DNQA 3CXUA 2WIJA 4K2AA 3V1LA 1DT3A 4UUQA 2XUAA 1E8DA 1B6GA 4NVRA 5ALOA 3PDCA 1UXOA 3V1MA 4UHCA 2OGZA 4DM7A 1CLEA 2ROQA 4KAAA 3V48A 1EK2A 4L0CA 1BEZA 2IIVA 2VTVA 3VKFA 4MXDA 3AFIA 2DQZA 5HCUA 1ZJ5A 1XZLA 1THTA 3C6BA 1XLUA 4RNCA 1MJ5A 2XQGA 1XQXA 4IH4A 2HA5A 1WM1A 3ED1A 3QBJA 4F0JA 5AOBA 2HADA 4MYSA 3F97A 3I2IA 3AZQA 3DJYA 5FOQA 1AGYA 3WL8A 1QIKA 4CG3A 1CPYA 3HJUA 1LPMA 5AI8A 4EY4A 5AHXA 3H2KA 3HRHA 1CUYA 1FFDA 2WU4A 3IB3A 5K5EA 3A6ZA 3FSGA 4Q1VA 2IX9A 4PSDA 3VXKA 3HLKA 3PICA 2W22A 4FFVA 3AZPA 5A7GA 2VF2A 5LZ9A 3ZWQA 5JAOA 1THGA 4GXNA 2XQFA 3WMRA 1PJAA 1J07A 4BVLA 5LZ7A 1MO2A 2GZRA 3E4DA 5HZGA 4ARAA 5HKBA 3HXKA 1GZ7A 3W9UA 2VJBA 5AI5A 1Q0RA 1ETHA 3ICWA 4PW0A 4C4XA 2DQYA 3RK4A 3H1AA 1QTIA 3DYIA 5ALEA 3H0CA 2CJPA 3C8HA 5IH7A 1O6GA 4Y2RA 1Y7HA 1A88A 4Q3KA 3QMWA 4UFOA 1KEZA 4EB0A 2FJPA 5DJ5A 3DNMA 2Q0XA 2VT6A 5AP9A 1ZD5A 4DNFA 5IVHA 5K3FA 2WQZA 4HVTA 2XQIA 2Z3ZA 3L1HA 4FBMA 2ES4A 2P8SA 3IVMA 4LYDA 5E2IA 2PSDA 3F9CA 4ETWA 2PSJA 1X2BA 1H23A 4J0IA 4FLFA 4GECA 3H2IA 2H1IA 4DYHA 4E15A 1CUZA 1UOOA 4GLBA 3VJLA 4G4IA 5A71A 4BRZA 1QIDA 1XZGA 1QE3A 2BGNA 4QZVA 5IVDA 2XMCA 2WKWA 3G0GA 2RI6A 2BUCA 1QIIA 2C58A 2J3DA 5A7FA 4GBGA 1R88A 1Q84A 4H77A 5FP0A 1VZ2A 1XZEA 2Z5GA 5CXXA 3GUUA 1SC9A 1QONA 4J03A 3SWWA 1UK9A 4ZRDA 1BU8A 1MTZA 5EI5A 2PUJA 2RHTA 5HF6A 3ZLTA 3C87A 4AN1A 2JGIA 2XI4A 5DNUA 4HAIA 3WIBA 4DTCA 5ALHA 4U2FA 2O7VA 1RYYA 1H2ZA 1VE7A 2BJHA 3D0KA 3G7NA 1TCBA 3IULA 1J2EA 4ZXFA 3WK5A 2XUOA 4KE6A 1CUHA 4X90A 3OC0A 2V96A 3QITA 5AKXA 4B6GA 1U2EA 2GBCA 4DMFA 3C45A 5EHXA 5SYMA 3STYA 4DSAA 5FXMA 2DHEA 2JF0A 3S8YA 4QDTA 4QDZA 4UBIA 2ONCA 4BP8A 1EDEA 5CXUA 2WFZA 4IH9A 4X7BA 2HM7A 4LXGA 3WZLA 4X92A 1WB4A 1LZLA 5ALPA 1K4YA 1R50A 4FFWA 5ALSA 4MEBA 1CUAA 1RP1A 3IIIA 5C8XA 3WWDA 3HABA 1ZD2P 2HRQA 2ZYRA 3O9VA 1IVYA 1F8UA 4B9AA 1A8SA 1DTEA 4OB8A 3KOOA 1ZJ4A 3DQZA 3BIWA 1NU8A 1EDBA 1EK1A 5HKAA 1JI3A 2I3DA 4CCYA 5DYTA 4X00A 4MJ3A 1W76A 1USWA 1QLWA 2G63A 2WSLA 1CIJA 4TVKA 2PSEA 3D59A 5ALKA 2OCGA 1FFAA 3PI6A 2WILA 4FMPA 2ACEA 4KE8A 4BTLA 3HACA 2DHDA 4XIIA 3ZPXA 1WHSA 1ZIXA 2PM8A 4P08A 3WWOA 1QIFA 5ALWA 5DNVA 2GBIA 4QA9A 3SK0A 3AIKA 4M0EA 3W9BA 4E11A 1GT6A 1LPOA 1XZCA 3OOSA 3ESDA 3G0CA 1K63A 3I2KA 3G0BA 2QJWA 5I9IA 3OPMA 3A2NA 5KBYA 1QOZA 1ODSA 2R11A 4D9JA 1SFRA 5CT6A 3FLBA 2XB6A 5JZSA 4Q82A 4WY8A 4NS4A 2IITA 2XMDA 4OSEA 1E66A 1ZOIA 2QS9A 4X95A 4Y2TA 1QIGA 1TQHA 1M33A 3W05A 3WJ2A 4WFIA 2WIDA 1XRPA 1ZGCA 2CZQA 3PUIA 4X71A 4UHDA 3H2JA 4XWGA 1LGYA 3DYVA 4BC0A 4W1RA 2YXPX 3M81A 3I2GA 3KDAA 1EVQA 5JAHA 2XUPA 1JMKC 3CCBA 5AI6A 4J0HA 1UKCA 2G5TA 4CCYB 4UBNA 2HDWA 1XRNA 4FKBA 4IH1A 2H7YA 2JGKA 1CUCA 1DWPA 2ORYA 3K6KA 4Q3LA 5CMLA 3C70A 3GBSA 3QPAA 7YASA 1MNAA 1DQZA 1FFBA 1XQWA 3FLEA 3MUNA 1CEXA 1XLWA 3H1BA 3I6YA 3EQ7A 2OCKA 3LIPA 1MX1A 4BCCA 4FOLA 2GBGA 4XJVA 2Y6VA 3R3VA 3TJMA 2PBLA 1RWQA 3NWOA 2HA6A 1A8UA 3QYJA 1UT6A 3AINA 2ZSHA 3JWEA 1P0QA 3EBLA 3TEJA 3C5VA 4FDMA 3WKCA 3C8DA 5AK6A 4RPCA 5EIAA 4OYLA 4FTWA 4EHBA 5AKEA 4G4GA 4X97A 5AJHA 1XRLA 5AM0A 4WY5A 2FJ0A 5AKKA 2WU3A 2RAUA 2B20A 2YYSA 5DTIA 2XDWA 4DMCA 2YASA 1EB8A 1YS2X 4MEAA 4W1QA 1WCYA 1QO7A 4BP9A 4C4YA 4MQLA 2VAXA 4QWMA 4UFNA 2DCMA 5E4JA 4V2IA 2V9ZA 1DINA 4H7EA 4OUKX 5AO9A 4N8SA 3QPDA 2GZSA 3FCXA 4L9AA 3FYUB 1YAJA 3B12A 1MX9A 1X70A 5AK3A 4Q05A 3UUEA 2GYWA 5ALYA 3QMMA 2CB9A 3R3XA 4XVCA 2CMFA 4YK7A 3DL4A 4LXIA 4BAUA 2BUAA 3WQHA 1G66A 4YPVA 1XKLA 3BDIA 1U8EA 2Y2VA 5A7HA 4AO7A 1F6WA 4LHEA 4U2EA 4E46A 3R3WA 3G9TA 1IUNA 2WIGA 3D3NA 3I6MA 2WUEA 2LIPA 3ANTA 4B83A 4OPMA 3WK7A 1CVLA 1F0PA 1LPBB 3VJKA 4FNMA 1L7QA 1XZKA 3G02A 3WK6A 1G42A 3BJMA 2OGSA 1BN6A 3A2LA 4A5SA 3FVTA 2QT9A 1EA5A 4OB6A 3PFCA 3U0VA 3D5EA 3R40A 4KE9A 3WLAA 2QUBA 1MN6A 1BCSA 1H2WA 1LBTA 2B9VA 3O4JA 5E4TA 1VLQA 1WB5A 1S8OA 3PF8A 3CN9A 4C89A 4PQEA 1U4NA 3FYUC 5LZ2A 5FKJA 5HQ3B 3VISA 1CUIA 5DLPA 4Y2VA 3C43A 2HRRA 3G0DA 4B84A 1GQSA 4XX1A 4JYPA 1BE0A 1C7JA 1ACLA 3L1JA 2OXEA 2C0QA 2XLCA 4OU5A 1LLFA 1VKHA 3UMJA 1R9NA 3VDXA 1AURA 2HA4A 3VVMA 1FSSA 2WG2A 3WA7A 4UBJA 2YH2A 4UBOA 4NZZA 2XQJA 1SOMA 3H04A 5FV4A 5CH8A 2H7CA 4H7IA 1BRTA 3I1IA 4CIAA 1DWQA 2D0DA 3N0TA 5DYWA 1C4XA 5BWCA 2HU7A 5HFNA 1EB9A 3ANSA 4B85A 5E4YA 5IVIA 1GPLA 5FRDA 5JALA 4G8DA 3R0VA 2DR0A 1SCQA 4DNPA 5AKIA 1ORVA 4MYDA 2QTBA 3AJAA 1Y37A 5C81A 2RGUA 3G9ZA 2QZPA 5ALNA 5DYYA 1QIEA 4P93A 4B81A 4Y2YA 2XUDA 2I78A 3EQ9A 4Y9SA 3JW8A 2JGFA 4J0GA 2K2QB 1ORWA 1HQDA 2WIFA 1IUOA 5I8PA 1R9MA 5A62A 4N5HX 1YAHA 1H2XA 4AZ0A 4IO0A 5ALMA 3O95A 4RE6A 4LYEA 2FUKA 5CTAA 3RARA 2XUIA 2WUDA 5EGNA 3L1IA 4EA6A 1MT3A 5JANA 1N5MA 3K2IA 4P9NA 2ZYHA 3DL7A 3WIOA 2QVBA 3PFBA 5LKRA 1W4LA 3GFFA 1A8QA 3WZMA 4QNNA 2JGLA 4G8CA 4FNGA 2I03A 3EIOA 1CQZA 4U2DA 5ISMA 2HA7A 1LPAB 1R4ZA 5EIEA 4GWLA 1K5PA 3AUKA 1GKLA 4EY5A 3WKEA 4HXEB 2PSFA 4G9GA 2Z3WA 2PKYX 3F8SA 5AKYA 2OCLA 5JAPA 1UK7A 3BDVA 4AO6A 5DWDA 4O08A 1QTRA 4UHFA 4KRXA 2G4LA 1DX4A 3P2MA 5T4EA 2PUHA 3BXPA 2BCEA 2JIDA 3KXPA 4Y7DA 1O6FA 5CURA 3IA2A 1UOQA 5D6OA 4K6HA 1YSCA 2DHCA 3O9MA 4EY8A 3WL7A 4Q34A 5JATA 2PL5A 1OXMA 2B61A 2NW6A 4J0CA 2HA2A 5EHQA 4U2GA 3H17A 4HTAA 1H22A 2R8BA 2X8BA 4U2CA 2GBFA 1WOMA 3HSSA 5A2GA 3DOIA 5ALQA 4OYYA 4YX9A 4EZIA 5SYNA 3VJMA 1JT2A 4N5IX 3STWA 1CUVA 4C87A 2I3ZA 4Y2UA 1BCRA 1W75A 4IHAA 3BJRA 3D4LA 3QH4A 4PV7A 1HLGA 2VJCA 1CUXA 3AZOA 5DNWA 1N8SA 1DWOA 3FCYA 4DMKA 4U2BA 2XMRA 4UHHA 2WM2A 4X93A 3R3UA 2HU8A 5BOVA 4Q3OA 3AILA 2AJBA 5EHZA 3QMVA 1CUBA 1CUUA 2XUQA 1AMNA 3STXA 1XZMA 3E0XA 1T2NA 1XROA 2HA3A 4I19A 2OAGA 1UKAA 4FLEA 3O4HA 4JH0A 4PF1A 1CUJA 1EDDA 2AJLI 4DIUA 5EFZA 2X76A 4ITVA 4WFKA 3U1TA 3M3DA 4WDRA 1F0NA 4BCDA 4RGYA 5EHNA 3I2JA 4BDTA 4BE9A 1XZBA 2WUGA 3FYTA 4K6KA 3C6YA 1Y7IA 1LBSA 1VZ3A 4BYMA 4X6YA 3PE6A 2OQIA 4OU4A 2AJ8A 4B82A 3H2HA 1XZHA 1YCDA 5BWBA 2O7RA 3OG9A 5C7YA 4C88A 5CT9A 1WB6A 3IUMA 4J7AA 1JFRA 5AOCA 4ZV7A 2OPHA 4NMWA 3I1YA 2WLSA 5JASA 4L72A 2QRUA 4BVKA 2Y2UA 5ALLA 1GQRA 1QIHA 1DQYA 3DDUA 4K5QA 5AI0A 1CUWA 3FNBA 5HQ3A 3WA6A 1VA4A 1TAHA 2WTMA 4RE5A 1OCEA 5IVKA 1ISPA 5A6VA 4ZREA 4EY6A 3HZOA 1JJFA 2WIKA 2AJDA 1TKRA 1IMJA 4H7HA 3WI7A 1CUFA 3R3ZA 4H18A 2RONA 2OCIA 3F96A 2HU5A 2DFPA 1C7IA 5ALGA 4DMHA 1XQYA 3LLCA 3F67A 1UOPA 1DT5A 1AKNA 3NGMA 3HC7A 1N1MA 1CQWA 3T4UA 1DX6A 3T52A 3W04A 4X6UA 4JEIA 5JD5A 1BS9A 2QOEA 4AMYA 3GROA 3ZLVA 4HZGA 3ZV7A 2ZSIA 3C6ZA 2XUHA 4QDOA 4QLAA 4FWBA 2PU5A 4M0FA 3I2HA 3GZJA 4F60A 1DU4A 3H19A 4PNZA 3R41A 3G9UA 3E3AA 3IBTA 5CBKA 1JJIA 4G8BA 4QDXA 2ZJFA 2QM0A 1MX5A 2HHAA 2ZVDA 3R3YA 1E5TA 3V1NA 4UHBA 2BGRA 5AKHA 5AIBA 4Y2QA 5ALVA 2XUJA 4B0PA 3KSRA 4WFJA 4BC1A 3TGLA 3SC2A 2WJ6A 2O2HA 4BZZA 3MGAA 4Z49A 4B80A 3RKSA 2Z8ZA 4G5XA 3HYSA 5CRIA 5AI4A 1ODTC 2RIPA 2C7BA 1LPNA 4MWSA 4J0DA 4CG2A 4UHEA 3VVLA 1SCKA 1W52X 4H7FA 4BDSA 1R1DA 4ARBA 4EBBA 4KR0A 4AXBA 4WCVA 4C6HA 4QWWA 1JKMA 2WHPA 1ODCA 2CBGA 2B4KA 3BE8A 4GW3A 3Q8WA 5IKXA 1YR2A 3DCNA 1XRQA 5YASA 4QE3A 2W6CX 4W1PA 3WK4A 2JEZA 2RHWA 3QPCA 4G1FA 1QIJA 2AXEA 4F21A 3DLTA 4W1SA 4DGQA 4X85A 5LP1A 1R3DA 2ZYIA 2HFJA 5HF9A 3WWEA 5T4BA 1P0MA 3G8YA 4BVJA 1Q0ZA 2O2IA 1FFEA 1TRHA 1ZICA 5K3BA 5CT8A 1EVEA 1L7RA 3S2ZA 1UZAA 3DS8A 2VJDA 3DKRA 1IZ7A 1AC5A 5KWIA 5K3EA 5ALFA 3BIXA 1G5FA 1LPPA 1WPRA 1ZD3A 5AM2A 1W6RA 5H3HA 3O4IA 1XZDA 2XE4A 3HEAA 3KWFA 1UFOA 1Z68A 3E1GA 3QZUA 2XLBA 3WK9A 5EIHA 3LIIA 5I7UA 1HDEA 2QXUA 2WFLA 3PUHA 5JADA 2XMGA 5KWJA 1GPNA 2QKYA 5JAUA 1MAAA 5ALJA 2OGTA 3G9XA 2JBWA 1H2YA 2H7XA 3V1KA 5C8VA 4BB0A 4AB1A 4WDQA 1JJBA 4KJXA 2QR5A 1UK6A 2GYUA 1ZIYA 5FPPA 1XZIA 4PO3X 4ZWNA 4KRYA 4TPKA 5AICA 1YB6A 3STUA 1JMYA 1CUDA 4GEGA 4PSUA 2CKMA 4CFSA 5AK5A 5CH5A 4ROTA 2HFKA 5FDFA 1E89A 4H7DA 5K3FB 4BCBA 3GELA 4CCWA 2WUFA 4G9EA 5ALUA 1WHTA 1VXRA 1XRRA 5LYYA 2PU7A 1QZ3A 1XLVA 5CH3A 2O2GA 1XRMA 2CUTA 3STVA 4PSCA 2QXTA 3MVEA 4FLMA 3IUNA 4LXHA 1B41A 3SX4A 3K9BA 1TCAA 4QLOA 5FUMA 1QGED 4INZA 3MUOA 5LKAA 4LIPD 4I4CA 1NX9A 5AKLA 4AN0A 4P92A 3V9AA 1JU4A 2H9YA 1CR6A 5LZ5A 4BBZA 4KYVA 1A7UA 2DSNA 2C5GA 4UBLA 1PV1A 3OTQA 1KU6A 1OILA 1VE6A 2C4HA 2ZJ6A 3HI4A 5ALXA 4BAZA 4HXGA 4ZGBA 2BAGA 3RLIA 5F4ZA 2WFMA 5KREA 2XMQA 1ACJA 2CEKA 2ECFA 4N8DA 1QJ4A 5AI9A 1ZI8A 1GXSA 5LZ8A 4B7ZA 2AJCA 2WHRA 1U65A 4FBLA 4BATA 2Y1KA 4BRSA 2VQ6A 2WG0A 3A2MA 4X3CA 1MNQA 1MPXA 5JARA 3UUFA 4I3FA 1L7AA 1UKBA 5ALRA 5AH0A 1XKTA 4Y2SA 4DLNA 1EXWA 5ESRA 1IZ8A 5CT5A 6YASA 4GI1A 5ALDA 4MWTA 3OM8A 3Q0TA 2HL6A 1XZFA 1JU3A 5D3KA 2QMQA 4KACA 4EY7A 5HF5A 4FHZA 4A16A 2WG1A 4B0OA 2WJ4A 3DKKA 5HFAA 2XUGA 5AIAA 4ZI5A 3WKAA 1VXOA 3B3QA 2OG1A 4WJLA 4N8EA 2FX5A 5J3JA 3FBWA 2XT0A 1E8MA 3BL8A 4AMZA 2WFLB 3WWCA 4MQMA 2JGEA 3BF7A 4F5ZA 5AM5A 3B5EA 4H0CA 3D7RA 4Y2XA 3FOBA 4DNOA 4GHWA 1CRLA 1D07A 1HBJA 2EDCA 3ZI7A 3IUQA 1YB7A 2OAEA 3RM3A 1CUSA 5ALIA 5HF8A 1AQLA 1G4HA 1XZAA 1LNSA 4K6GA 3ILSA 4C01A 2PPLA 1UK8A 4H7KA 5AOAA 3WYNA 1N5RA 2EDAA 3WK8A 2XMSA 5FLKA 4KAFA 2PSHA 3EQ8A 3DEAA 4AO8A 1CUGA 4TGLA 3C6XA 2XUFA 4EUSA 3N2ZB 5C8ZA 5ALZA 1TK3A 1LZKA 4KE7A 1MAHA 1YS1X 4E14A 2V98A 4W9RA 3BF8A 1TCCA 3LP5A 5ALTA 1MU0A 1GPKA 3I2FA 2ACKA 2WHQA 5JD6A 5BV7A 5CT4A 3X3HA 1T4MA 4BTVA 4ZV9A 1EI9A 2ZJ7A 1YA8A 4LKOA 5FPQA 4H7JA 3GA7A 1KU0A 1FJ2A 1EH5A 4AZ3A 3FAKA 3WYDA 3M82A 2XQKA 4J3JA 3WKDA 5K3CA 4UBKA 4X6XA 1ZD4A 3AIMA 1PFQA 3I28A 2JGMA 2Y6UA 2WHPB 2ZYSA 3EF3A 1ZGBA 1P0PA 3DD5A 2JGJA 3G0IA 2BUBA 5AKZA 1UWCA 4AX4A 1QFSA 1IUPA 3WKBA 4C4ZA 3ESBA 2BKLA 3A70A 3H18A 3F98A 4HRYA 1GGVA 3FLAA 1HL7A 1EX9A 4DSZA 3W2TA 3CN7A 4UFPA 4UBMA 3C5WP 4CIBA 4W63A 2VJAA 3CCCA 2VT7A 3ESCA 1HPLA 1ZI6A 3I6ZA 3BWXA 3FYUA 2UZ0A 1NU6A 4S0XA 1QIMA 4YASA 1VJ5A 4BZWA 4OB7A 3O4GA 3OURA 4JNCA 5D3ZA 2C5FA 2XMZA 4L3WA 1K6EA 2BFNA 3LCRA 3IUJA 1VA5A 3WWPA 3IDAA 2VEOA 5T4FA 3NUZA 2VATA 4KAJA 3YASA 5AKGA 4QDUA 2Z8XA 5CW2A 4KEAA 1CV2A 5HK8A 5AM3A 3WL5A 4OCZA 3TRDA 1E3QA 2PVSA 2VA9A 3O0DA 3ICVA 3NOXA 1Q83A
chains in the Genus database with same CATH superfamily
2H59A 5LIPA 3X1MA 1J8QA 1NN1A 2WTEA 4X3OA 5T4HA 3QKRA 1F7UA 3ROFA 3QVGA 1G63A 2EKBA 4K6OA 3GPDG 3ZCQA 3UVEA 5DTJA 5FI1B 3ITEA 4KKXB 1FS4A 3NG1A 1VP3A 1VYVA 2A94A 1AZWA 2BI7A 3HYTA 2RB4A 4WCFC 4E31A 4E08A 1TVMA 2H1LA 3FG9A 3OIVA 1AN0A 1NP6A 1VPLA 2AG0A 4L3VA 1YULA 3H2GA 3EHDA 1NLFA 5CVCA 1C7RA 5JZBA 3W5SA 1FVHA 3BCSA 4X65B 1IB6A 3DTTA 2M9MA 4WD3A 5T8KA 4YUXA 3OZSA 4NWIA 3SJBA 3GVHA 1M9NA 3TJZA 3J80A 3DB2A 5K3SA 3AKZA 4C2UA 1H8ED 3IBCA 2CVZA 1RE1A 1JAXA 1T8YA 2WYWA 2OA0A 2BR5A 4J0JA 2AHOA 2XKBA 3A4MA 1I01A 1EHYA 4ZKDA 4R8VA 1C9KA 1D6JA 3LKDA 2RH4A 2CF5A 2V7WA 4IIXA 5EE5B 1FXUA 2O2JA 1Q7RA 1VL0A 2WJPA 3H1TA 1LLQA 4P80A 3RT1A 2WA2A 1AQJA 1GG9A 4HQRA 4L51A 4OD0A 4ARZB 5LLDA 1Z0JA 4BFZA 4UTNA 1IZYA 4UDNA 1BH2A 1I1HA 3PTLA 2CSUA 1F8GA 2J3MA 1CE8A 1XZJA 2ZUSA 3GLTA 3AG5A 4FNAA 4CT0A 3QOXA 1ZM2A 2WOOA 1L0BA 3L7MA 3LSYA 5EWLB 4K3VA 1N7HA 3L8MA 3IUPA 4P4NA 3CO0S 3ECCA 4DSTA 1IOLA 3MS2A 5T8KC 1I1NA 3ESYA 3PI7A 4C29A 2WU8A 4L5BA 3RJ5A 1OHHA 2CUZA 2BKUA 4NYJQ 5TQVA 4DDVA 3H4TA 3WYFA 2JNWA 4IWNA 4JUDX 1Y9EA 3KLNA 4DW8A 3E7FA 1BMDA 2G09A 1Q7CA 2ZTVA 5KJFA 3MTQA 3MRVA 1N2HA 2PRKA 1P7ZA 3LOUA 3SZMA 2GN1A 4N12A 1LUAA 1UMBA 5EJIA 2BH2A 1F51E 3KD2A 3OM9A 3GVIA 3OLCX 1FOEB 1JAYA 4CMGA 3E7DA 4P3NA 3SBDA 5DYNA 3D2AA 1AHHA 3IURA 4RDHA 5PNTA 2X4LA 3RPEA 3X2EA 1URPA 2B8JA 3PEEA 3W6ZA 2CCKA 3L7DA 3RFXA 2VP2A 4LOIA 4CQMA 1XFDA 4P7BA 2W2PA 1C4KA 2FRVA 4IJKA 1PHPA 2AZTA 2F8MA 3GJ3A 1REQA 3CURA 1M5UA 1W9HA 4G1BA 1MC4A 1Z4QA 3GFOA 3EB9A 3DMGA 5FUXA 4RK1A 2FCRA 3IPXA 3MGKA 4JBNA 2IDKA 4X54A 4RVFA 1TTHA 2BGKA 1G5RA 1DIAA 2IPNA 4NY1A 4YLGA 2GPYA 2I62A 1KQ3A 1AX9A 1YASA 5TGDA 5HK9A 3FHTA 3R24A 5BW4A 3K4HA 2PKQP 1J2JA 1RFGE 3NX4A 2A35A 3EPRA 4TMTA 5H82A 4PN7A 4OI2A 2FWPA 2NV2B 2GOYA 2PS1A 4LTNA 2A84A 2FPMA 3NBXX 1E8NA 1QOPB 1FNCA 5GMOA 3HZZA 5TNXA 2R3SA 2G28A 3DE4X 5K3DA 3RYTC 5LP6A 3Q8KA 1AB6A 3DLCA 1F5NA 1ZH2A 4HJXA 1FFCA 4OK6A 3KHTA 1R8QA 5K7SA 2ATXA 3C4QA 4HUJA 1G6HA 3RU2A 2N75A 3TLKA 4TROA 5GONB 4Q9LA 3WYGA 1I36A 1P9LA 5B3JA 3CG4A 1GFIA 2F1HA 3IQEA 4KIGA 5AVXA 3WRYC 2O1XA 3BGDA 4QAJA 3C3MA 2V97A 4BFVA 1K7FB 2LVBA 4Q9AA 2OLEA 4LJ6A 1HYBA 1XA0A 2Q6TA 3LCJA 3IP3A 3KLMX 4NESA 4FCTA 3FCAA 3CXUA 3E3OA 3OZEA 4K2AA 3GRKA 1A5ZA 3E9RA 4XD7D 3UXYA 2JD0A 3OAAD 4LOHA 5D87A 2AD1A 4UUQA 1F38A 3NNNA 2Z6VA 3NDRA 4MKHA 4WZ6A 2NVUB 3WDMA 5MFZA 3WGKA 2YR0A 1BVHA 2C82A 2YHBA 1FW6A 2QZSA 1PDOA 2V0NA 3B9PA 3LXUX 2OGZA 4UHCA 4V0MA 1R4NB 1KMQA 2VBIA 3TB4A 3D7KA 1XTZA 2VDWB 2JANA 1G3QA 5LUBA 2ECKA 3OF2A 4LDQA 5JBIA 4DCJA 1TEVA 5K0FA 1E62A 1UAAA 4KAAA 1EK2A 2EGHA 2OO7A 3ANYB 4EO7A 3Q5DA 2IYEA 1CE8B 3L07A 1SKAA 2VTVA 1PK9A 1E6KA 4F85A 3JQQA 1X1DA 4TV9A 1BU5A 1FBTA 1TLLA 1ZSYA 3QWAA 4HDNB 2EF0A 1OREA 2G6TA 3MMSA 4Y6QA 2I66A 4F4FA 1NVVQ 2HWWA 3PVSA 1D4OA 4Q7KA 4B2PA 1YUMA 2JGNA 2A5GA 2CVPA 3B1WA 3DT6A 4FFDA 4AKHA 1MJNA 4X0EA 1XLUA 1MDFA 2VPTA 3BJEA 3C41J 3SNHA 3W90A 4E4TA 3ED1A 3WOHA 2NZ8A 3OPYA 3SIRA 3TQRA 2C8VA 1Q95A 4M8KA 4BHTA 4ER0A 3CVVA 1YHNA 3ZCSA 1UIMA 2C54A 2WABA 1WXFA 2HUNA 2XBLA 1E1RA 2CFIA 3W2IA 4Y0NA 5EJAA 4YR7A 1Y33E 2DF8A 3LGAA 4PBRA 5FX2A 2GD0A 1E6EA 2M98A 3RG8A 2Z6AA 4UNRA 2V03A 2I1WA 3H1FA 1NKTA 4ARZA 3DVSX 4X60A 4ZO9A 3ANXA 3I9V6 5AI8A 4EY4A 1TYEB 2B4YA 3ASUA 5AHXA 3SEQA 4ENWA 2PS0A 2AB0A 3HRHA 1HDGO 1KP9A 1WUIS 5A0VA 2YRFA 2D1SA 5CIYA 1YB2A 4C06A 1AQNA 5TPWA 1XCMA 3IUBA 2FEPA 1PDVA 1X13A 3JWHA 4EFMA 4JR2A 4GRAA 1QU3A 4Q1VA 1FMFA 1G8JA 1SCBA 2ZWAA 1T2AA 1H8HA 2B1IA 2TYSB 1HH4A 3PICA 5F2EA 1WQ3A 1H5UA 1U2SA 1G4UR 3SHFA 1C1XA 2EW1A 3WGYA 4D9IA 2G36A 4ASUA 1ZR2A 3H9CA 1KI4A 2F6RA 3T1YB 2NVBA 4INPA 5KTOA 1Z4MA 2HJRA 4PLHA 1GQOA 1HMYA 2OV4A 2ZE8A 4FMBB 1H69A 2GJAA 4PR3A 5JCJD 1BMQA 4DHWA 2O2DA 4UVHA 1EXMA 3MWYW 4GMKA 3FPHA 1Q1ZA 5FH9A 4MVJE 1PJAA 2XB4A 2G6BA 1RPJA 1J07A 2P4HX 3G6KA 5KNCD 3C3CA 1JS1X 4IFTA 4L15A 3Q88A 4L8VA 2GZRA 3IEXA 1VP9A 1TEHA 1WZUA 3ABQB 3OOJA 5IKOA 3FM9A 1GGEA 4ARAA 5KHOC 3RVNA 4AJNA 4PG6A 4Q3AA 5EUQB 1BQEA 2RH9B 2GTIA 3MWDB 3NHLA 4CPDA 6Q21A 3HRKA 2IHVA 4O1MA 2CNOA 2YHAA 1D5WA 4E1VA 3ML1A 5CHYA 2CCJA 4DB2A 1DELA 2A92A 3IOBA 1MV5A 2CLCX 3DTYA 2JI6A 3INNA 4PY2A 5AW1A 5FUQA 1Y8ZA 2DQYA 4KLAA 3V8EA 3BMQA 1M8GA 3CMMA 1N9ZA 3R5TA 4KTVE 4XZ3A 3H1AA 2C9BA 3LX6A 2XZOA 3KEFA 4LS3A 3VPDA 1D2RA 3E05A 4KN9S 3AFMA 2FFAA 2QW8A 3O47A 4NE9A 4UTZA 5F98A 1FDOA 4MI1A 1RPZA 3M7IA 4YAEA 1BXGA 1JWBB 5GV7A 5HS4A 1EAYA 2CJPA 1DAHA 4NQZA 4A2QA 5IH7A 1TEXA 1Y7HA 3ZVRA 3L84A 2P69A 4BRUA 4GZ3A 2CXPA 3I72A 2PMEA 1ML4A 1P2TA 4AK9A 1YZGA 3H65A 5AVQA 1HQYE 5BURA 4Z4EA 1RBZA 1YOVA 3JQAD 1EUCB 2P3QA 2YIMA 4GOKA 4F9GA 4ADSG 5JR3A 1CRPA 3W8DA 4L02A 3IQIX 1KPHA 5CFOA 2YWBA 2JAUA 2Q0XA 4BKUA 3V80A 4FFBB 3GJTA 4S0ZA 3D02A 3W78A 3DONA 1CJBA 1RYMA 2NXJA 2D1FA 1QP0A 4D3ZA 2EX4A 2VNHA 5K3FA 3CWZA 4UUPA 2XQIA 4M54A 3TW8A 5CYOA 3K71B 1IRXA 1D2NA 5FO1A 5HP4A 2ES4A 4C2BA 4XRGA 2WWYA 4A8JA 1EP3B 3THYA 3IBFA 3BRWA 3IVMA 5CBPA 2A2ZA 1PQPA 1JDSA 4HX9A 4YLEA 1GFWA 3G2NA 2JJ1D 2PX5A 5E2IA 4BNHA 1J5XA 2O7SA 2PSJA 1G59A 4LZNA 4J0IA 1QH1B 4HS4A 5CA0A 2CHUA 3FR7A 4GECA 2QTVB 4H0NA 3WL3A 4ZTZB 1ESNA 4GKVA 5C37A 5K0TA 1Z4JA 2JCBA 2C3PA 2OG2A 4DYHA 2ZE6A 1ZCBA 1FZTA 4NBKA 4E15A 1DS6A 5EXEA 1L1EA 3SFVA 2WHXA 1Z9BA 3TNDA 4GLBA 3T38A 4N76A 4R54A 5DBFA 1CNFA 1Z0SA 2JFHA 3AEQB 3PU6A 3JQ8A 4DUYB 2G9UA 2FDXA 2O9JA 1UBKS 1EWYA 1YZQA 2A9VA 3H0KA 1B73A 3ANLA 3Q3VA 1NBEA 4LRQA 4QZVA 5IVDA 2B1RA 2GCOB 3EVFA 3OWOA 1VHDA 3QEOA 1JGTA 2AX4A 4FE7A 4MPTA 4GMDA 2O59A 1OTYA 3C1AA 3T7TA 2JJ1A 2GN0A 5BN3B 5HX7A 2KW5A 3AUYA 4QSMA 3G0GA 2RI6A 3JSAA 4I50F 1N2JA 3RIGA 1O1YA 4HYEA 2C58A 2P1RA 1SOWA 3BCRA 3EVTA 3NQ41 1EFPB 2R86A 3DFFA 4GBGA 1R88A 2DR3A 3LWDA 2A88A 4IQ8A 4XYGA 3TGPA 4WMLA 5JYEA 4DV6B 2XXAA 1TAQA 2YJ6A 3VR3D 3PTZA 1L7EA 1S7GA 1V8FA 2XVYA 1E1LA 1SHUX 2B92A 3ND9A 5AVYA 2GPTA 4FB5A 2PS3A 5EP2A 5IUJC 1SD2A 3ZY2A 3ZJTA 3I6QA 4WN3A 3R9XB 4ZRDA 5LU9A 2Y77A 5EI5A 5C1BA 2W6JD 3ELDA 5KOJA 2FGJA 4G5HA 4KXNA 2QK4A 4Q12A 4R8SA 4PHTA 5HF6A 5BMOA 1DEKA 3SPXA 3TINA 1SMKA 3TDNA 1IHUA 1DO0A 2N0SA 4ISBA 1PR9A 4I36A 5CFQA 2IBMA 1N6NA 1HL3A 4QTTB 2QY6A 5TIIA 2F1IA 1U8ZA 4IWXA 5CLIA 3FWKA 2HV8A 2H08A 2G3YA 4JBHA 4DTCA 2JAXA 1SIWA 1JEJA 1QH1A 5CA0B 1F2VA 1M2VA 4U2FA 2GPBA 4B3FX 3BUSA 3CNLA 3LV8A 4BMCA 1S0UA 2A5JA 3MK31 4JENA 3D0KA 4RMGA 3ZI4A 4CM8B 3G7NA 4S05A 4L0DA 3FNQA 4GLLA 4GPIB 1JHUA 1YCHA 2ZCJA 1TCBA 2O8BB 5M7EA 2O5RA 1Y7TA 1IK6A 1IM2A 2F4NA 3H5OA 4IRMA 1CB0A 1SN7A 4ZXFA 1EK6A 4RFSA 4CMHA 2IHKA 4IOMA 1KH1A 2G08A 4IMJB 1YCGA 4J1NA 4N9QA 4MVJI 3AHHA 4FFBA 4X90A 4KP7A 3BK7A 2I65A 3OC0A 2NUTB 3IV9A 4TTSA 2BR4A 1B0UA 3STHA 4ZVVA 5AKXA 1T8PA 4JU8A 3UV3A 4BNFA 5I7HA 3A4YA 1BG6A 1R0BA 1YOVB 1U2EA 3ACCA 1EFRA 1RFLA 1T8UA 3IT2A 4R7ZA 3ZIAA 4DMFA 2FQXA 3C45A 1CZRA 3LYAA 4AJ9A 1GQQA 1T0PA 1N0HA 1YU6A 3H5TA 3S8YA 3D4OA 5LMUB 5KO2A 3DM5A 2D1QA 3Q3IA 5LP6C 2PUCA 3U48A 3W5CA 2XKAA 3ONDA 2DU8A 4PQRA 4PNEA 4GC5A 2C5LA 1L5RA 2Q9CA 3NUQA 2WFZA 1IAVA 4NPAA 3OZWA 4LBZA 4QM7A 1PT6A 3A31A 4B2IA 3P71T 1VMKA 1C29B 1LVGA 3PCXA 1LZLA 1FW8A 4E09A 3I5YA 1P6XA 2IQ5A 4XCQA 5IU6A 2OFXA 1GR1A 2H07A 2IZOA 2V7QD 1J42A 4PO8A 5L4LA 2Z98A 3OSUA 1J70A 1RKUA 2QZJA 5F1KA 5JAZA 3HCEA 2V6GA 1IL0A 4QVKA 1ZMRA 4PZAA 2IPMA 4G0PA 1QHEA 1GZDA 3DD1A 3HDVA 2AMLA 1DV2A 4UAUA 1CUAA 1QCYA 3AHJA 1XHEA 4CIXA 3AL3A 2JFVA 2Y1XA 3OLZA 2Z4RA 3LK7A 2W8ZA 1FUKA 2QEQA 1P3DA 1NR5A 2HBYA 1TK9A 1L7XA 4FSXA 4M87A 4FFSA 4OI4A 2IU0A 4EUFA 1K5GA 3L7JA 1FU4A 3AR6A 4M8IA 1TT5B 5IM4F 3IR7A 4CV0A 2CJFA 3MAJA 3ERCA 1Y1LA 4DDUA 3FI9A 3LXXA 2DR2A 1HFEL 4TKUB 1FFHA 1E9CA 4L27A 1E3TA 1J9ZA 1TK2A 3M89A 1ZJ4A 3ZIDA 4AKTA 5I5EA 1X7WA 5BSGA 1OUMA 1YZYA 3BIWA 4RA6B 3CRNA 3ULKA 4BU0A 5I7RA 3RVLA 2WIAA 5A0TA 2V55B 4JQYA 1LDGA 1H9BA 3CJQA 4EIWA 3U44B 1KAQA 3LPCA 1W76A 2X5NA 1QLWA 1QYDA 3R75A 4E5YA 2QPAA 4LQLA 1IB0A 3CRVA 2PXAA 4AM8A 4EGCB 2HGZA 1FQJA 1KJIA 4TT8A 4BO0A 3HDHA 3TSOA 1P29A 3Q1KA 1VRCA 2NG1A 3CE6A 2XOKD 2UYHA 2C4WA 2TMDA 4RIFA 1QHGA 1RJGA 3OMXA 2WILA 1RHJA 2GAIA 2MSCB 3HQ4O 3AEYA 5DIFA 4X62B 4LF6B 1QNLA 1JIUA 4DV4B 2GFQA 4KE8A 1CWUA 1H94A 3V32A 4XIIA 1SZCA 2AG1A 3M33A 4B3CA 4DCSA 1E32A 4TN1A 3WX0A 2XZLA 2QTMA 1RCFA 4I1VA 3GUVA 2PM8A 1U0RA 3L0CA 4NENA 4PZ9A 4HAZA 4NOLA 2GBIA 3SJZA 3UJ7A 2XNSA 1ZCJA 4QA9A 3TBHA 2GO1A 3KOWA 4UDXX 3LZCA 3AIKA 1I10A 3O8LA 4M0EA 1SPXA 4O1IA 2OYRA 1BGWA 1IXYA 4P1ZA 4IDEA 1GEGA 4D79A 4JWTA 1VJGA 2LXNA 1XZCA 2WYUA 2YWEA 4OYRA 3N3BC 2FH5B 2P3LA 2GLUA 3TTSA 3K6JA 1FSPA 1V6CA 3LF2A 3O84A 4TZTA 1K7CA 4BGVA 2NO5A 3ESDA 1J4AA 6CHYA 5DM60 3MGCA 4QAQA 3AVTA 1F7VA 1ZK3A 3WGVA 2X2EA 3RJTA 4E4YA 2W2KA 3AH8A 4UJ5A 4D56A 1AO0A 2ZXEA 1LI5A 4RH0A 5BSEA 5M5BA 3ETGA 4KXLA 4UJ3A 3BZBA 1J1ZA 1FB5A 3OPMA 1GNRA 1PBTA 4CNBA 2JPDA 4G85A 4P8RA 2VDWA 3F9IA 1UM9A 3TEMA 1SUIA 2A0KA 3OF3A 5IJ9B 3EVZA 5EKDA 1JR6A 1EPUA 1HNWB 4FHEA 1L5NA 1T9AA 1G18A 2G7MC 3R5SA 2WW8A 3UV6A 1VJ0A 3IAEA 4IUDS 2FWJA 1GO2A 2HK9A 2VQSA 4GQIA 4R84A 5BR8B 1X7YB 4Q82A 2BEJA 3JVDA 4ZARA 1XVLA 3EVCA 3JALB 3U1VA 2COKA 3ZY5A 5BPFA 4FPXA 4UE2A 4WZAE 3ZQ6A 3K8QA 5T7BA 1GAXA 2IITA 2FN3A 3HKDA 5JI3E 3A4LA 3SSAA 1Q1EA 2QYSA 5DK4A 1E66A 1LDMA 5EIBD 4B6RA 4YUYA 3AKCA 4G5RA 1U7XA 1ONNA 2CKDA 2QS9A 2FSVA 4P2GA 3A9UA 4O4JA 3OZGA 1I2BA 1YCFA 4NNJA 3LT2A 2RIRA 4ZMRA 1I8TA 2A0UA 3FTDA 4UCFA 3CNNA 4EGQA 7REQA 2WAAA 2JVKA 5AESA 3E1KA 3W05A 1XEWY 4EHDA 4WFIA 4P5DA 4XPIB 1BOOA 4UCQA 2QPTA 3PNMA 2AR0A 4G3XA 3EJWA 4M2LA 2XA1A 4RVUA 2WIDA 5IM4A 4QKQA 4O0MA 1USVA 1F9AA 4A8HA 2GERA 4GPD1 2CZQA 4UC0A 5JPDA 1W29A 3PUJA 3PQ7A 3SR4A 4X71A 2I91A 4Q1DA 2CXHA 1P1RA 3EDQA 4FFLA 1J0BA 2A57A 3GUCA 4NS1A 3AEQA 2AN1A 2CMGA 1KY5A 1ISSA 5IAKA 4X5OA 2YXPX 2PGJA 2FOLA 1KVQA 3M81A 4QGFA 3ZE7A 5C1IA 1ELOA 1P1IA 3KDAA 2W90A 3LVQE 4J16A 1THZA 4CQMB 5JAHA 1I3KA 1Q1AA 3R0IA 2DYKA 2E4YA 3DFMA 4MB6A 4ID9A 4XDHA 1L2TA 2G5TA 3OO1A 4P33A 3RYCB 1U2GC 4CCYB 1GQFA 4AURA 2XX3A 2DULA 2VTKA 2XIJA 3QUCA 4D5GA 4DUGA 1G7RA 2ZIXA 5LXTB 5I6DA 4GX1A 2Q5IA 4URXR 3C2QA 3K1YA 5B2FA 4ATNA 1JDZA 2PX4A 2XBMA 4EHAA 2LBPA 4CM1A 5FOTA 3S2GA 3TIFA 1NUTA 3V2GA 3S81A 1MAUA 2WSSD 4LVUA 2RKBA 3NCHA 2H17A 4YRTA 2FMIA 1E2JA 3HL0A 1VIMA 3PXEA 3D1LA 3FY4A 2FPIB 5CMLA 3GD7A 3EWNA 2AQKA 1E7WA 4KNVA 1P77A 4BQRA 4HV4A 2QVYX 3I9V1 5CB4A 5C5CA 2QAJA 3EZFA 1DHRA 1GPUA 1NX6A 2C03A 1F12A 3AG6A 3ZQUA 3WSWA 2Z8YM 1YJ5A 4P3KA 1QUFA 3PV0A 2C8JA 4YS6A 2YXNA 4TKVB 3ZDCA 1FF9A 2FZLA 1M6YA 1NBWB 2XNCA 4LCBA 4RELA 5JRJA 3VA7A 3IKTA 2VDMB 4R8LA 3RYIB 5TGTA 5TR9A 4BB6A 5DCLA 2YWCA 1H0RA 4FOLA 1AO3A 1X8KA 4GR5A 5L3RA 3UMGA 3TE6A 5LOVF 3PS9A 1XC7A 4RANA 1NUAA 1S4MA 4BFSA 4TMVA 1E79D 1MB0A 3R3VA 1IN8A 2OBLA 2PBLA 2WSSA 4M1ZA 1CRZA 1U9IC 1XD9A 1SVIA 4H6XA 2ZYAA 3QHPA 4EVIA 1N57A 1KH2A 3AINA 5DHUA 1L5KA 4QBHA 2OMEA 2CFTA 4LXUA 4WERA 1ZD8A 4EG0A 4YV1A 3JD4A 1BA3A 1ZITA 2VL7A 3QUAA 1EK5A 3AQ4A 3WBJA 1C8BA 2IYWA 1E92A 3EBLA 4UXIA 3TEJA 4R7TA 3PX2A 4IJUA 1IATA 1EQ2A 1TPYA 2AF4C 2VT2A 1RS0A 3MSCA 4X8LA 3AP3A 5UKDA 3T12A 3V5NA 4F7DA 1H2FA 2ZDGA 2VN8A 5KIAA 1LBIA 2OE2A 2Q2WA 3DC7A 1NBME 2V7TA 2DT5A 2HMTA 4NU5A 5AK6A 3T0IA 4XAQA 1SZDA 4A73A 4FYJA 4EDHA 3AUAA 3I8OA 4Y2GA 3QPUA 2X0KA 3ECSA 3CA8A 5CX1B 4B8YA 2OYCA 4BO9A 4CN8A 1KXJA 4C7VA 3BG5A 4R71A 1YDEA 5EJ8A 4G4GA 1XPJA 2YV2A 4M55A 3VR5D 4IGFA 3V6MA 1XRLA 2BKAA 4A10A 1INLA 3DZJA 1CIPA 3D6NB 3BFJA 4YA6A 5L53A 2FJ0A 4I14A 5U9CA 3CLHA 4DV7B 2QM8A 1NA5A 4CTKA 1NNSA 2CVFA 4WKPA 2B20A 2JBAA 1YZKA 4W4TA 1VKZA 1N3IA 1A5SB 2D5IA 1CXZA 2CCGA 4MRPA 1IBMB 1CEEA 3GR6A 4LSMA 2J7PA 4M1YA 4D74A 1JFSA 4MEAA 4IZIA 4W1QA 4C22A 1MJFA 3Q8LA 3GQBA 3AW9A 4W5NA 3QE0A 1OWPA 1JX6A 4Q4AB 2ZJ2A 1U2ZA 2V4UA 4BLTA 4EX7A 4YC7A 1AB5A 1I4LD 1V41E 2OV1A 4JI4B 3GMTA 4NJMB 1OMOA 2ZJBA 4G2NA 4K1XA 1WBJB 2YOGA 2X1HA 3HKCB 4KIJA 2UZ3A 4ZC8A 1V4NA 2EBFX 3V8QA 1CRWG 1C80A 3O3OB 4Z2AA 2YFKA 2VP4A 3LPMA 1G8YA 4X20A 3RIYA 2OL4A 3PCRB 3L02A 1DINA 1JV2B 1HZZA 1VMEA 3BQMB 3C15C 4YAWA 1HE5A 1QRAA 1X86B 2OHIA 3EIEA 3HEMA 5AO9A 4EEZA 4E22A 3SQLA 1K86A 4MW2A 1IVSA 2C20A 3EMVA 2IS6A 4MUFA 4OUDB 3TTUA 4DV3B 3F49S 3GF4A 2VOEA 3QTBA 5DIZA 4ZOLA 3W5DA 2UZAA 3L6CA 4NH4A 4ODIA 4JZKA 4JJ8A 2I29A 4MSUA 2O3TA 4MYUA 2RHCA 4PYNA 3PNYA 4J49A 5MF6A 4NBLA 3G5UA 4ZMBA 1OAKA 1MX9A 5LXTA 1BE6A 2XVZA 1UKZA 1C7EA 3IE0A 3M2PA 1KEEA 2XVXA 3TL2A 3UUEA 4DLTA 3TZKA 4TMXA 3S7TA 2FN7A 5ALYA 3U4QA 2C4KA 1JRLA 3OBBA 1ZOPA 3DNPA 4IINA 3QV1A 1P61B 4P0TA 1AUQA 2MCFA 5FV7A 2Z95A 1ADGA 2YJTD 2I3AA 2YINC 2QD4A 5IKEA 2AYXA 1U3VA 3QUQA 4UEOA 1V2HE 3LE8A 2PLRA 4BAUA 1R0CA 3S7ZA 3MTJA 4URWR 3DHYA 4CQLA 4Z8XA 3OOHA 3UFBA 3BN3A 5B53A 1MJGA 3WQHA 4PO1A 3IC5A 3DMFA 4NOKA 2XYHA 3TR5A 1QHIA 3NV9A 3QHQA 1YDFA 5LQDA 1JXOA 4P5EA 1TQ4A 4YECA 4AQ7A 3RQIA 1F6WA 1GKUB 1W8DA 3UKDA 4D9HA 5C2JB 4DR2B 3QPWA 4OAPA 3KETA 4BWVA 1QU2A 1PEYA 1QXSA 4U2EA 4DJEC 3D3JA 1K8ZB 4E46A 1GRNA 2BGIA 3W5UA 5LA6A 4RZXA 5JJLA 4P31A 2CLSA 4C04A 4PLCA 3S68A 1WVMA 2IDZA 4DUPA 2ZM5A 3D0QA 1P75A 3NUGA 1P1FA 3R4CA 3I42A 4J3NA 3SF0A 3I9LA 3U7GA 2YUTA 4Z9FA 4XWWA 3CZMA 3A3OA 4DADA 2DWUA 2XYPA 4UCWA 2X42A 2LIPA 5LMZA 2X77A 1G1MA 2A8YA 5AVTA 1TNDA 1G2IA 3GT0A 3VJKA 1MH9A 5BRAA 5EJFA 4KGVA 1U11A 4HX5A 1W0JA 3JQEA 4N49A 4Q4JB 4QECA 1ZXBA 4U00A 5A4FS 4JI2B 2ATCA 2GVNA 1L3CA 3R7DA 2H1FA 2FW1A 2HDOA 4AUMA 5FNVF 3BJMA 2HV9A 1BN6A 2OGSA 4PLWA 1OYOA 3PPVA 1YZUA 4PXSA 1V5GA 1ZRMA 4YJ3B 2ZB4A 2AFHE 1N6LA 4LOJA 3ZBPA 4BV8A 2G8NA 4UCXA 3U0VA 1SB9A 1G20A 3IRVA 2JRCA 1WTCA 2ZAYA 5DM4A 2KM1A 2ZJ5A 5CIQA 2QRVB 5MGBA 4EJSB 2J3KA 2Q46A 3HJRA 3IAUA 3D4BA 4D9CA 5HZKA 4ND1A 5BQ5A 1N8NA 4WBSA 4KFSA 4KQFA 5BV8A 3E3NA 1BCSA 1E0AA 3G2QA 1MIOA 2YWXA 1GPBA 1VLQA 1M2OA 4MRMB 1YC5A 2OZKA 5AHRA 4IJ5A 1QORA 1TW3A 4QX6A 3UN1A 4FJ2A 3RVJA 2QMEA 4ZCMA 5GVSA 1R9JA 5HQ3B 3KEGA 4BUZA 1T5OA 1UJCA 5CVTA 4ZYZA 1NY5A 1WCWA 4N7MA 1V35A 3VNVA 3WMFA 3OIUA 3QXXA 4CKBA 1N5IA 1N2IA 5J40A 4O29A 1E2GA 1VBMA 1QCDA 4OHRA 3NV7A 1BS2A 1EVIA 2MINA 2OZLB 2VP5A 4UAGA 2YHUA 3WLIA 2WQ7A 1MUUA 1BE0A 4JYPA 1TTPB 1ACLA 3OHMA 4KGXA 5KCMA 1TAUA 2JAWA 2C0QA 4H60A 4OU5A 5EWLA 3V4ZA 3LO8A 4GX0A 1EU1A 2AA3A 3ZVKA 3DMHA 4WXMA 1ZGGA 4DRXB 1AURA 2FRDC 4KPGA 3JAKB 1T34A 4A0QA 1FSSA 5KEIA 2Y1WA 6GPBA 5EIWA 1GGFA 3VPGA 1TDJA 4NZZA 5C8YA 3LOQA 1SOMA 3BTVA 5BVHB 1PZGA 5JQGB 3H04A 4D8UA 1Z2OX 1DIHA 5E3IA 4P81A 1T9DA 4B7CA 4DC1A 4LZZA 4H7IA 3UGKA 2JBHA 3AM4A 3I1IA 1LX6A 3CU5A 3PP8A 3H9JA 5BWCA 2PMKA 3DL2A 4FDUA 1K88A 4KO1S 4U9IS 3LCUA 5FTWA 1EB9A 1PI3A 3JVEA 4DLUA 3U44A 2FPPB 3MJEA 4MV1A 5DGDA 5DTQA 1Z45A 2HCRA 5ED4A 1TAGA 3KV1A 1L7VC 3O2QB 3Q7EA 4UASA 2XOXA 3TQOA 4YUWA 4G8DA 4F9FA 3R0VA 4IHQA 4BGUA 4ZOEA 5BQPA 1W88A 3UMFA 1W9MA 3CFYA 1QNFA 4JDUA 4F92B 1L4FA 2VZ9A 1SCQA 2Q50A 2VNSA 3VR0A 4QD3A 2E4AA 3SS7X 5AKIA 4DNPA 2VQ3A 1NJ2A 2P2ZA 4ZHQB 2PZMA 4MKFA 4RX1A 1Y6RA 3E2IA 3E8MA 1HZZC 5DMHA 1K68A 1L4BA 4JLUA 3SDBA 2K2WA 2WSYB 5C81A 2RGUA 3FKSA 3G9ZA 4OK5A 3DMTC 3QPVA 3ZJ5A 1FRZA 2PO7A 3CH5A 1UC5B 4NFLA 4CEJB 2A0XA 5ANRB 1N2CA 1NTOA 2HB6A 4C05A 4CCAA 3KOZA 2V59A 1QIEA 2WEKA 2WF6A 1DRJA 1YIOA 2XUDA 1TJYA 3EWAA 3E3MA 1OBOA 1PZXA 1S1CA 2AN4A 1NQUA 2I78A 3EQ9A 3JW8A 4TTVA 4Y9SA 4EHJA 4OHYA 5ERGB 2WJWA 4MS4B 4CU2A 1R74A 3TD2A 3Q5GA 1P4AA 1PJ4A 2K2QB 4XQ0A 4HHEA 4YAOA 4ZALA 1HQDA 3K0SA 1ZS9A 3HA2A 3U81A 3RANA 2R1TA 1U9ZA 2F1RA 2W58A 1F1BA 1VGQA 1DFGA 1OC4A 2C84A 4MIKA 4LYEA 2FUKA 2ZSBA 2PNJA 1KIMA 4QTXA 5H9VA 3FF4A 2Q2NA 2WUDA 3A6HA 1AZTA 4I4NA 1X80A 1A9PA 5JANA 3UPTA 1G0NA 4JC5A 3EZLA 4XXHA 3K2IA 4BNYA 4P9NA 2PRYA 1KMIY 4WLNA 3U6BA 1KBZA 4IDDA 5EYPA 3GLIE 2CK3D 4IJ6A 1UKEA 3WIOA 4AU1A 4YPFA 1HDXA 2HKIA 4WNYA 3PFBA 4LSWA 3VTKA 3FPSA 1V5FA 3NFYA 5GTDA 1QHXA 3GFFA 4OQDA 4NATA 1HWYA 1ZCFA 1A8QA 5CA1A 1JIVA 4LOAA 4B6FA 1QFXA 4HWOA 4G8CA 4N65A 1JIIA 1YE3A 3OUZA 2PD6A 3IVCA 4NCXA 4UREA 1CQZA 3VR3A 1QRUA 5A4MS 2I54A 1R27A 5JT1A 3MIIA 3TSWA 4F7WA 1G17A 1BSVA 5IH3A 2OEPA 1R4ZA 2ZS9A 2VRWA 1M34A 4RJIA 3AUKA 3WLEA 4KX5A 4IDNA 4HQNA 4WY2A 3UJCA 3AYZB 1RQLA 3K3PA 4JJAA 4MUGA 4R9NA 5REQA 3T35A 1VCOA 1U63A 1KO4A 3Q9LA 1I4TD 2I7CA 3TD9A 2IDJA 2QUZA 3H5VA 1GZSA 3DZIA 4WWHA 4MA0A 3E2PA 1CJVC 721PA 1PVVA 1O89A 2GB4A 3QXCA 3OQMA 2O52A 1R9GA 1ULHA 3GCXA 3TIXB 2G9NA 4C2AA 4C0AC 1ZVMA 4V38A 1NTRA 2X2PA 5KNCH 3SYMA 4CN9A 1J5PA 5BSWA 2QQGA 1DUVG 3HUTA 4Q3NA 1II9A 4RK4A 5EPUA 3S27A 1V7ZA 2A7XA 4YGYA 1SU4A 2RMKA 5KDOA 1XSEA 2VPQA 2BTQA 3E9ZA 4RL6A 4KV7A 3SHTA 3HE3A 5KYUB 1V4BA 1K1EA 1Z5ZA 1H6BA 2QRNA 4KRXA 1JN0A 3DBIA 4YO7A 3TRHA 3ZV6A 2HPZA 2PUBA 4FS3A 1C0EA 5T4EA 2X8JB 3I58A 2ON6A 4JOBA 1P4JA 4YV2A 4EP1A 3BXPA 3GLGE 2BCEA 3ZE8A 3MOIA 3KXPA 2Y1FA 3Q6NA 4I2VA 4YFVA 5IHPA 2CLEB 1E1QA 3E22A 5CURA 4ZHQF 1QGUA 4KN5A 4PZCA 2EFGA 4K6HA 2QTFA 4N5DA 3ZNPA 1DRVA 1LH0A 1YSCA 3RRXA 1QGZA 2DHCA 2IA5A 4N0DA 3O9MA 5CD9A 5DASA 4C0WA 3EODA 4IUCS 1UBOS 3AUFA 5LQJA 4W9MC 4JJEA 1IOZA 4JJ4A 1UM8A 2OXCA 5CDSA 3D7SA 4WKNA 3UUGA 4Z54A 5ABPA 5KQGA 1V1RB 3BM5A 1Y1QA 2A33A 3K6RA 4PZDA 2X0NA 2JD2A 4HMOA 4U2GA 3H17A 4Q39A 1H22A 5F7XA 2ODBA 2R8BA 1Y3BE 1JSCA 4BWYA 1I9GA 4GVLA 3RABA 1ZSVA 2R47A 5FNVA 5J59A 2CZGA 3Q7QA 5LWHA 1FRVA 3L0PA 3ABIA 3ZKWB 1DC3A 1KP2A 1NASA 2A3RA 3LQYA 3OEED 1D4AA 4FYHA 2Q8QA 3JWPA 3LBHA 2OQ2A 4P3PA 1L7NA 1B14A 4ZCIA 1XPOA 1O03A 2NO9A 5EJ2A 5G0UA 1LS1A 1GTZA 1E0DA 4Q66C 4HDMB 3TL6A 4EZIA 5KYXA 1ZR4A 2O48X 2DUMA 2XA2A 1RRGA 4BASA 4BVHA 4C87A 1WB9A 1RAGA 3DEYX 4L85A 4H1WA 5B1EA 1E0JA 2VRBA 4OL0A 4DA6A 5IBQA 1RCTE 3DCYA 3MB8A 4GBMA 2C5HA 2RHGB 3FPEA 4MQEA 4XVHA 5ELMA 1ZMXA 1U8FO 2AMYA 2I22A 4IHAA 1DQRA 4QYSA 2NTJA 3SSNA 1C3JA 4DLWA 3H8JA 2VJCA 4CF4A 1FYFA 3K0EA 4DFDA 5AUPB 2EJBA 1PT5A 4PN3A 2YJ4A 4YALA 5HWSA 4CM4A 2OXTA 2BRUA 1ZA2A 1JZQA 3PYLA 1AIPA 1VSQA 4Y6LA 2GQ0A 3CH4B 3TIVA 5JSFA 5JJIA 3R74A 4LPKA 2R7MA 3ZV5A 1DZ3A 1AKRA 1QBKC 1XXHE 3R3SA 4LRYA 1OA1A 2JC3A 1PJSA 3QVLA 2WM2A 1B0AA 1QRTA 4LPSA 3K1TA 2CEAA 2AWNA 3K8ZA 1YMQA 1DCTA 5TF0A 2HTEA 2IZ0A 1MOZA 3K0AA 4FSDA 4X93A 4YRRA 4CL0A 5I47A 3NB0A 5JROA 3FI0A 4HP8A 2GGSA 3L0DA 4O2AB 1UMKA 4TVBA 3ZH2A 3UJAA 4GKKB 3O4RA 2Z5LA 2QZZA 2VJLA 5KJCA 5EHZA 1XD2A 2FMUA 4CMAA 1RQ7A 3QMVA 4YI3A 1IH8A 1K0UA 3E03A 1K9SA 5JV5A 4BRWA 1CUBA 2QGNA 2Y0PA 3IEMA 2RGXA 2GJKA 2NU8B 2EYUA 2VSFA 2IZ5A 3ODPA 5EXDA 2O2YA 3EZGA 3H6HA 2Z08A 1K5DA 4WACA 1ESEA 3O3MB 3SYTA 4J16C 1XZMA 4DA4A 3G8DA 3PKIA 5I7FA 1TUIA 3DZBA 1GRQA 3IKLA 1ULBA 3IL2A 3NT5A 4HPWA 4NOMA 4B3TB 4BBAA 5ILGA 5H9WA 4J6FA 3WV4A 4LECA 5I7AA 4Y6PA 2Z2IA 4MH0R 5FQNA 5KWVA 1NI4A 2YMLA 5COQA 1A9QA 5JDCC 4LRUA 3TNJA 1XTTA 4BKQA 4WKCA 2AJLI 2A0WA 1PD1A 2REXB 3RUFA 5BN5A 5IJ0B 1N7GA 1JLLB 4DIUA 3M2TA 3ZNNA 2PUTA 4WFKA 1WXWA 3CS3A 1A7AA 3A9VA 3M3DA 4L22A 2FP4B 4AROA 3GEGA 1R66A 1RYHA 3GGGA 3CHYA 4G37A 2C2OA 3JQCA 1UBMS 1BDJA 1NW3A 3JQGA 3KSAC 2P2DA 1PZNA 4RKWA 3CUYA 3JRXA 4DARA 2BELA 2BF4A 4DIBA 2HLHA 3QX3A 1Q1NA 2Y67A 1DNPA 3NM6B 3ETLA 2FMXA 2IYYA 2MOKA 3C6YA 1Z6PA 3FYTA 3HBJA 3OZAA 3RUAA 1VZ3A 3KOYA 4BYMA 5JNWA 3D6HA 1XDZA 4B31A 4OU4A 3DF7A 4HEQA 4UM5A 5HM8A 2JFPA 2R66A 2I2WA 5HE9A 3UENA 2FUG1 4B82A 3H2HA 5L3SB 1QKIA 2ZPAA 4U7GA 1TU0A 5FEMA 4BZQA 1GLGA 1GRRA 1C4OA 4AJEA 4KRGA 3LCVB 4FXPA 1P60A 2P7HA 3MWKA 2VH1A 1PZMA 5DHAA 4K8OA 5G4KA 5IAOA 3OJOA 3OEWA 3QEBZ 4MUBA 1RADA 3PEWA 4URHA 1J0XO 4A4DA 3OMWA 1TE2A 1YZTA 2PJUA 1P2SA 4QEZA 1IBCA 4EYEA 3SKYA 3PHGA 1Z47A 3BPSA 2GUWA 4HLUA 5DI3A 4ZV7A 3JQGB 2GK3A 4KOEC 5BR7A 3MD0A 4B47A 4OQLA 3UH1A 1DEXA 1GAEO 2I2BA 4C0HA 5I9TA 1V3VA 5JASA 1WKCA 3L8ZA 4OKNA 3WAJA 3UA4A 1RVDA 3PIRA 3SLKA 4DV0B 1GQRA 1LWNA 1DQYA 4K5QA 4FFNA 4ARCA 3OJ0A 3OX1A 5ECYA 3AXSA 2BVNA 3N76A 5EAIA 2OMKA 3MA0A 3CLSD 2CLOB 4NKRA 4NCIA 4TQGA 1TAHA 3JD2A 4HDNA 3HPRA 4D8WA 1X9GA 3MQ2A 4JC4A 4TV9B 4QXQA 4ZAYA 4H3HB 4HGQA 3HY3A 2F17A 2HBQA 4RK6A 3ED5A 4AECA 3F3MA 3I76A 1NXSA 1E9FA 3IE1A 5I9LA 2ACWA 5L3QB 1D2GA 2E5LB 1DDGA 2MU1A 3R3ZA 4H18A 4IHJF 4DMGA 2Q1UA 3BFPA 3B2EA 3K0CA 1UBFA 3AEUB 5I9SA 2NOAA 4F45A 4IICA 3NXSA 5THQA 1BWQA 4E2YA 2DFPA 3EUFA 1JLSA 2GKGA 3JWJA 4YT2A 5CFNA 5ALGA 5JXHA 4DMHA 2B69A 3R6TA 3QVSA 1UPXA 2EL7A 4HI0E 5KDLA 4Q15A 5FWXB 4KNYA 1FDWA 3LQ2A 3DE3X 1UOPA 1DT5A 2JCGA 4IXDA 4ER6A 3EXHA 3II6X 3TCNA 1B8UA 4V24A 4YONB 4HOYA 3RUEA 1DAEA 3AJRA 1Z16A 3T4UA 2C07A 5HKOA 1O58A 2RI1A 4LRTB 1P1BA 4I55A 3TF5A 1PWEA 3O7MA 4BLWA 3W04A 2OSBA 2AVNA 2XH8A 4PSAA 3QU9A 1NMSA 4JEIA 4X6UA 1WUYA 5AJTA 5GONA 4TS3A 3TIIA 3GJ5A 1Y34E 2J0QA 3WMEA 3E0QA 4AMYA 3CZRA 5C46F 4FQ8A 4EFLA 3Q7TA 1UMDA 4LZLA 2VAMA 4Q4HB 2IEIA 1C3LA 2XUHA 2WM9B 4QDOA 1RWXA 2AMVA 5JE8A 4QLAA 2WAXA 1P7WA 5EJ5A 3DP9A 2PU5A 4OQQA 4M0FA 2BHRA 4F04A 3L4KA 3ET5A 2GDJA 4Z7NB 2ZTHA 2PQ0A 1ZN7A 4JL6A 2UXDB 1ZW1A 4BMOB 2BDUA 2C97A 3CRMA 3NP7A 3H19A 5F7OA 4FEAA 4PNZA 3D1VA 3QSYA 4MVJA 3GV0A 3P4XA 2AQHA 2GASA 3M4JA 3TZBA 5CBKA 1QZXA 4OHFA 4ZTBA 4LSZA 3GLRA 4I5IA 5GPBA 1L8AA 4O63O 3D5TA 1ZN8A 1JHYA 3GXOA 3I01M 4L4YA 3MT7A 4OXYA 3CRQA 3AL2A 3SD7A 3V42A 4NENB 4FEEA 1RZRD 1E5TA 1FVOA 1KO1A 4LJ8A 4Q00A 3ZGNA 5CNJA 5L8VA 1RXVA 2BGRA 1PTJA 2BBTA 2AR7A 3UOGA 3AW8A 5AKHA 2JI9A 3R7SA 4AJ4A 4IZ6A 4LW8A 2CVOA 2PNFA 2XUJA 3QKSA 4Y2QA 5ALVA 1JE1A 1W36D 3TXAA 2FWNA 1IN4A 1OFUA 4NQRA 3HS3A 3WLPA 3E35A 3EXIA 4HQFA 4RQTA 4Z3DA 4CQJA 3HN6A 1UMBB 1W0JD 5JJBA 3FGNA 2Q7OE 1E63A 4C7OA 3UHFA 4DAEA 1PKXA 4R1UA 2O2HA 1SXJD 1T8TA 3G88A 1SEVA 2X14A 3NZEA 4H4EA 4Z49A 3RKSA 4CUKA 1QGUB 5ICSA 3ZTYA 4FYIA 2HHCA 5A5DA 3BMCB 3FMIA 3H4VA 4GZ6A 3BC1A 4LQCA 2POQX 4N18A 5BV0A 3K96A 3SBOA 5LVAA 1IPHA 4MR8A 2ZUUA 3ICQB 4MLPA 4MWSA 2Y0DA 3B7PA 3CVOA 3QEAZ 1GZHB 1I6MA 2R8OA 4I1IA 4MAMA 4BUJA 4F71A 1KI8A 4YN3A 2X4DA 3QP9A 3ROPA 4KO2S 5EG5A 3SN6A 4I1RA 4EBBA 2JAQA 1SGWA 2OUIA 2WVHA 3AKDA 2O2CA 2D0IA 4BNWA 5AXAA 5DM1A 2OXIA 3RS0A 2I4IA 5BYJA 1FX0A 4CLDA 1S5PA 1H2RS 1HYEA 1KSJA 1ODCA 4UMVA 3WG9A 2APJA 2B4TO 1UL1X 3Q8WA 3CY6A 5F77A 3W7VA 1UWLA 1ZH4A 4H16A 5JRDS 1OX6A 3BMNB 5YASA 4MJXA 1OE0A 3RF7A 3DV0B 2WAMA 3KJGA 4MUHA 4L4SA 1EUZA 2J07A 2QGZA 3HU3A 4E30A 4F5YA 3ZHXA 2OK8A 5KYWA 3WK4A 2DBZA 4BX0A 2DMRA 3NONA 3VDQA 5K0GA 3QPCA 3TLAA 5E9QA 4XQGA 2VHWA 5EZYB 1FFSA 1ISHA 2QQFA 4PVCA 4W1SA 5I8ZA 5BN4B 1R3DA 2ZYIA 2C5EA 4Y2HA 5LDDC 2B82A 4PYQA 1I4EB 5HF9A 5B1SA 1P7PA 2VTBA 5EOVA 3BHIA 3R6DA 1E2FA 2HMUA 2R1VB 4OK3A 5A04A 4BTEA 4MRAA 3N8NA 2R7LA 8ADHA 1O54A 1SRRA 1TRHA 4HNAA 4RJ2A 1VFNA 4RF4A 4QJBA 1LLCA 1VG1A 4CKZA 1UQUA 2HSEA 5FL7D 2WZDA 1Z0IA 3OQJA 2BR3A 2OKGA 5DW0A 3QKRB 1OH6A 3GXBA 5GP1A 4WNAA 4CKYA 4P36A 4B3MB 2VJDA 1JE0A 3IMCA 1MP0A 2FV8A 3P9SA 1EA7A 2IZZA 3U3ZA 1NJFA 5ALFA 5K3EA 3BIXA 4EWLA 3PG5A 3QNMA 1FMTA 2AC4A 2WBLC 4V0QA 1R37A 2IYPA 5KU7A 2EP8A 4HYYA 4IGIA 1WPRA 2I2DA 3UWPA 3VYWA 4Z4IA 2H5IA 4GU5A 1R18A 3ZHQA 2HR1A 1ZD3A 4JEHA 3DE0X 3DAHA 2FF5A 3CLUD 4RKQA 5JYBA 1XZDA 3DOFA 2ZW9A 3VPSA 2BEVB 5JQWA 3UWOA 3L46A 2F62A 3QFHA 1GPYA 5DZSA 1Q5PA 3QZUA 2HTFA 3RADC 1XWWA 4EHNA 2X6QA 2JCXA 5F9HA 3ZZMA 4ND8A 3DR3A 2CFSA 5DB4A 4U5QA 5DE3A 4INOA 4V0NA 3WK9A 3AETB 1A4RA 3LIIA 5K0ZA 2OY0A 3WGOA 1HDEA 1OASA 2UV8A 3QFCA 2BMVA 3U61B 3UK7A 3ZHBA 2WFLA 4CEIA 2YV1A 3ZDQA 2YZ7A 1H4VB 4NZPA 3VZPA 3BXGA 1RMQA 2XEDA 1A9SA 2XMGA 1Q14A 1Z4NA 1C3OB 4G5OA 4ILKA 5KVAA 4O2AF 2GCIA 4ZQBA 1FFWA 1SKBA 5JCZA 3EXFA 5AW7A 5JAUA 3ZEIA 3EEFA 4M1QA 5AUNB 3SJUA 5JEEA 2JI7A 3P52A 1ZKMA 4L76A 4D82A 1O94D 3HVKA 1SHLA 1YJ8A 4BMXA 3KJNA 4Z4HA 5ALJA 3CE9A 1S89A 4HKTA 4G0YA 1QG0A 2C9ZA 2CNWA 1K3TA 3LHKA 2H7XA 4ZPXA 4QBFA 3LJKA 1FMCA 3EGXB 3KOXA 4KYTA 2NPFA 1MCZA 2FW7A 2YVLA 3L43A 2Q1XA 4KJXA 5ES4B 2V7EA 2ZRLA 3A1CA 3DPSA 1UK6A 1I5EA 4EQ6A 1PJRA 4NFSA 3EGDB 3E8XA 3PGA1 1ZHHA 2HJHA 1KEWA 1S3SA 3JAWB 4ZWNA 3KZOA 4S3MA 3L7AA 4US0R 2FMHA 1R16A 1CKEA 2H57A 1YB6A 1RRKA 2QD5A 4ESOA 2DFKB 5JH7F 4PZZA 4K9MA 3IESA 2ZAIA 4IZHA 5BV2P 3I34X 5K8LA 5EPOA 4GEGA 2WVJA 1XNQB 5A3SA 3WMWA 3ZW8A 2BKVA 1P5JA 1P5RA 2PVCA 3N2LA 5I7WA 4DJJA 3HA3A 4RL4A 1E1NA 1FL9A 4LN1A 4WKBA 1J49A 4MAAA 1V3UA 5A6SA 3SQOA 1E9EA 1RM0A 4JVNA 1ORIA 4DA7A 2I7TA 1NXOA 1E89A 4IP0A 1XBTA 2F1JA 4OHOA 3REQA 2DBRA 5LQCA 2M1XA 4UXHA 3OP1A 2JFYA 4XASA 1IY0A 3UW3A 4CCWA 1UXJA 2HPVA 3BHJA 1Q0TA 5B3AA 1O9GA 3HSKA 3S1SA 1AKTA 5B7NA 3W5HA 3LHFA 4D99A 4TS9A 5LYYA 2GZHA 3I12A 1GSOA 2AKEA 1D2AA 4HO1X 1A71A 3HMQA 2ZQZA 3OAAA 4ZT4A 3G59A 2DUWA 1K0FA 1U1DA 1L3IA 1Q6YA 3KTFA 4YRQA 4D8YA 5C4IA 4IIBA 3GFTA 3L04A 3AHEA 1K08A 1XOIA 4YRBA 3KC2A 3LPNA 5B1HA 2QMYA 3TECE 4RV4A 1ONBA 1Z29A 4JS0A 1GSAA 5LQAA 1RPAA 2A59A 3IUNA 4DWOA 3RIXA 1TTQB 1A2QA 1B41A 1T9HA 5DSZA 5AFSA 5MGNA 2G82A 4XLZA 4YUVA 1HLDA 1WV1A 1T0UA 4QOHA 3C3AA 1VHWA 1Z08A 1USUA 1E1CA 2GNAA 1RXEA 4MUIA 3WR5A 4OLBA 2DFVA 4DT1B 2EKZA 3UCFA 1Z2DA 3ZYCA 4IYJA 3AESA 2GEFA 4LIPD 4H3VA 3BSSA 4I4CA 5AVOA 5KYTA 1NX9A 4X1IB 3MAAC 4CKCA 1TCVA 4D02A 3QELA 5AKLA 1S2DA 5DW3A 2RHJA 1ECBA 4ZCQA 1V9CA 3DEJA 1JQKA 4JKIA 3I5XA 4DR7B 4DCNA 3HDQA 4GOLD 1FXWA 1JXMA 4BLRA 3BFKA 5IABA 4CEJA 1BCSB 3ZIUA 2WD7A 2VI5A 3TNFA 5JDCA 2IU4A 1IYZA 1G7SA 1NDQA 2PJRA 3MBKA 1W0KA 4ER3A 1A7UA 4J4HA 4IIVA 4UBLA 1NXXA 3LYHA 3BWBA 3P0FA 1W96A 3D7LA 3GA5A 3OTQA 1NLZA 1KJZA 3B1KA 1Q1BA 1MD9A 1OILA 1MB2A 1PS8A 1YDHA 1XTVA 4IIJF 5DI9A 5EESA 4JYAB 2IHYA 2I6SA 3IAM6 3TSCA 4PZ0A 3I8SA 4ABTA 2AOXA 2ZSKA 2O5VA 3HI4A 3KFXA 4ZGWA 2X8AA 4HB3A 4F4IA 4YP0A 3RC8A 4MK4A 1KK2A 3K5WA 3LPLA 4RD1A 2UYGA 3Q2IA 2WFMA 5KREA 1JR3E 2FSPA 4CT5A 4RHUA 5C3MA 1YS4A 2NO4A 3RAPR 1TECE 4HDAA 2I7XA 4IRUB 4YQEA 4NBSA 3LXRA 2Y0CA 4PONA 2GWRA 4GGPA 5BQOA 3PIIA 2PMFA 4H27A 4QUEA 1PR6A 1JG7A 1WS6A 5TARA 4DLYA 4F8EA 3R44A 4LJRA 3AVUA 3GCWA 2YS6A 2FGKA 3GAAA 2KHZA 3FVVA 1ULAA 3PC4A 1WL8A 2FFQA 3T1HB 2XTJA 5E6RB 2IYAA 2BBSA 2G71A 5CLQA 1YF3A 4ZQIA 4KR7A 1X7XB 2W42A 4K40A 1SIOA 4WLOA 2OBNA 4YP5A 3RBAA 1G20E 1IY2A 4U39A 5GIPE 3UUFA 3E3LA 3PQEA 4LOLA 4FEGA 4JKYA 1UKBA 2JLCA 3IT0A 3P0HA 4PIMA 2P79A 3H5NA 3SOZA 3G68A 3NVMB 1HLPA 1PQYA 2ZAMA 1KI6A 1TYAE 4DC0A 4Y2SA 4DLNA 2XNKA 1Q3KA 221PA 1FP4B 3PC8A 3IQFA 1YNOA 3OQ1A 4OQZA 4CDNA 2VZ0A 5EQJB 1P2DA 1FYWA 1ZJJA 1IAQA 3Q0TA 5GQSA 4HVCA 2FLKA 2HL6A 4Z1OA 1JU3A 2PXHA 3O94A 4ECAA 4M1MA 5CCEA 2QMQA 1ZRSA 2A7QA 3QE4A 4JLNA 4EA9A 4KACA 5B64A 9GPBA 4TN5A 4K9DA 3DDZX 3RU9A 3E9NA 3VYRB 2G1AA 2MSDB 3REFA 1U1GA 1H6AA 3B1ZA 3UOAB 4YCCA 4MGEA 4A16A 1MJGM 5IYZA 2BCJQ 1E4EA 4ZOAA 2P7IA 2CL0X 3IJPA 3UJ9A 5EHGA 5HCNA 3VR4A 4B0OA 4YRNA 4PLFA 1SKUA 4R2MA 3U49A 4OM8A 1L7PA 4NP6A 4UUOA 2J30A 3PLNA 2XUGA 5AIAA 5FR1A 1NQAO 1G8GA 5IF9A 2Z3VA 3TEFA 2FEMA 2G9RA 2FQWA 5DHPA 2IY7A 1AOXA 4O3MA 2JH3A 3BBLA 1KSGA 4BFYA 2VHCA 4PCLA 4UQLA 1KYTA 2ORIA 3UG7A 4P7JA 2WJIA 3PRHA 1KE1A 2OG1A 1W5TA 4N8EA 4FCCA 3SSMA 2NXWA 3WNCA 4BQQA 1BHQ1 3OE4A 2AC2A 3PZBA 3B6MA 3OO0A 2NPIA 1C3OA 4MQBA 1JR3A 4F93B 2QX8A 5DTEA 4A0RA 2ZULA 1VYHA 1W93A 1GGHA 2BFAA 1SNYA 2WFLB 4MVJP 5BNZA 3LBYA 2WD8A 1GCOA 4KPEC 4PVDA 3CRW1 1JH8A 1SH7A 3PRJA 2WT4A 4XYMA 4BNVA 4UHJA 3ND8A 2WR8A 4XWAA 5GGYA 1T3ZA 4DNOA 2AW5A 4MGZR 4Z4CA 1CR1A 4EQ6B 3LRXA 5DP1A 3MJDA 1NUQA 2BKXA 2YVUA 1HBJA 1V5IA 2EDCA 3EGXA 1G0OA 1R6AA 2BEVA 5TXGA 1RLMA 5JHGB 5J2TA 1TCUA 1A69A 2XW6A 4WT7A 1T5IA 1DKOA 3KUCA 5ALIA 4YRKA 1AH2A 1CS0A 1HDRA 2D2FA 5HF8A 3VR4H 3DULA 4JVMA 1OFTA 3LP6A 5EMJA 1G4HA 1LNSA 1EVLA 3C3DA 3A05A 3X1JA 4GVPA 4HYQA 5KTYA 1FSGA 5JSZA 1P1CA 1LLDA 1E2IA 2E4XA 5AOAA 1SG0A 2WU0A 4ENTA 2VBGA 2HF9A 3EUWA 3DLHA 4ZK6A 1FTNA 3WYNA 4KXFB 4TZ0A 3RTGA 5KQMA 3R6LA 1JEYB 2QQEA 1U99A 4V0LA 3MTGA 3AY3A 3GUHA 5A9SA 1EBFA 3KX2A 2YMQA 3UT5B 2V54A 3EQ8A 3DEAA 3OQOA 5FA5A 3C6XA 4EUSA 4HN2A 4D6PA 1GL9B 4D98A 1TA4A 1LZKA 1LDYA 3WISA 3ZWCA 1A50B 3NJRA 2BYTA 2V98A 5D3QA 3B3GA 3TLMA 2LGJA 3LP5A 3UJHA 2Y9PB 5ALTA 1T6BY 1OLUB 4KMOA 2AI3A 4R3NA 4YGXB 4BU1A 4MO9A 5J4LA 3AR4A 2ACKA 3O1IC 1BS1A 2PY6A 2R1ZA 2WHQA 2DPXA 4X1OA 4DKJA 1RWVA 1IONA 2D2VA 3F7MA 2PZBA 3M6AA 1VTKA 1YS9A 2HT6A 2JLQA 1T4MA 3X3HA 4GXRA 4MA5A 5BV7A 4DLBA 1A9XB 2NU7B 3UYKA 4Y6OA 1ESMA 3U3MA 2Z4SA 1P33A 5HDBB 1H93A 1BGXT 3ONWA 4BYGA 3OOYA 5F9MA 2OBFA 4HDQB 3TLEA 4TKVA 5LZ9A 4X1KA 4XDGA 1GV1A 3DAGA 3QV2A 1MB9A 3GA7A 2R1VA 2HZ7A 3ZWVA 4EG5A 1FJ2A 1N8TA 2JH9A 2I1LA 4WFQA 2QENA 4EUKA 4IDQA 4DUGD 3M1LA 4C5CA 4IJQA 4H3SA 5K45A 1GTSA 1WE2A 2X5OA 4FM9A 4OH7A 4MROA 3ZHUA 4AD8A 2JI8A 2OSVA 3FIJA 4XW2A 5FWYB 4DMMA 4F06A 4BKPA 9ATCA 4GM1A 5EC8A 2XQKA 1ABFA 3KL4A 4J3JA 4IEIA 2HSDA 5SZKB 5KWSA 1FFXB 4UBKA 1XEXA 5FA6A 3PNOA 1YVDA 1OBHA 2DFDA 3PNSA 3T1OA 1TMYA 5BVGB 3VV2A 1R8SA 3ASVA 2B98A 3V46A 2MWMA 5K8JB 4UD6A 3ZQKA 4FYPA 4EMBA 3ITDA 3OCJA 4IKOA 4JEMA 2WM8A 2CE2X 3JQPA 5EP3A 1GGMA 2HOQA 2CSXA 1HF3A 1P0PA 2ZATA 3FX2A 1PAUA 2PBZA 3L1VA 4G41A 1LXCA 4HRVA 2DPLA 3VNUA 5LBUA 3WWZA 1K98A 4OXNA 1OROA 2PH5A 3DFZA 2LDXA 3LWBA 1CQJA 4CBVA 2XWQA 1D7OA 2YHIB 5K51A 1X42A 1IUPA 2MYPA 1DDOA 1LLUA 3CTPA 3QKIA 4HNGA 2ZUCA 4MS1A 4RZQA 3WKBA 1GNSA 1CJTC 3L7LA 1NF9A 5JS2A 4BVAA 4YACA 3FTQA 2IS1A 1V6AA 2AOTB 3B2QA 3QFRA 1KOJA 3H18A 4ARSA 3BYZA 1N2OA 2IPLA 3AJ9A 3GJ0A 3EXEB 3TRKA 2FPKA 4YMLA 3CBGA 4KSYA 3EPHA 4QU8A 3W2TA 5JI2E 1U2DC 3P2IA 2K5UA 4MS3B 4C7OB 2QT0A 4CLXA 5DPMA 2XY4A 2HY7A 3CLRC 2O2EA 2EZ4A 4QRDA 4I1SA 1ZGJA 2Q6VA 3ZWAA 4B73A 4C3OB 2G77B 2WHEA 1DADA 1JIQA 3P45A 7REQB 4C6TB 5IJAA 4A1OA 2BGGA 1C8VB 1SJ9A 2NQ8A 2UZ0A 1K2WA 1I9CA 3GLQA 2XTZA 3C0KA 1W85A 3M4XA 3HXOA 3AF3A 3JARA 1SA0A 4CVNA 3C7TA 4OL9A 4YAGA 2PFGA 1UC4B 4L5AA 3C6QA 3VTAA 2FWRA 4JNCA 4DCGA 3F6EX 1SM4A 1W5AA 2JFOA 1E64A 5D3ZA 1O5OA 2IPAB 2WJVA 2XMZA 4YWHA 3WZ2A 5KAMA 1X94A 3MJCA 1G5HA 4RVNA 3WSTA 1PUIA 3DQPA 4D9GA 4PQYA 2BFNA 2F3UA 3NEJA 4JJ7A 3W1EA 2DLCX 3BILA 1M8FA 3IUJA 4EPWA 1WOYA 2DTXA 4I6GA 1JPUA 1RHRA 2JK1A 2VEOA 1NAHA 1W581 1XK7A 2VYVA 2YNMD 3ROXA 1L8XA 1ZLYA 3NYQA 5IFLA 1DBVO 1UM9B 1J23A 1G8HA 2H1CA 3PC7A 4PPQA 5EMMA 3WQSB 2VATA 4KAJA 5K3OA 2F55A 1AF7A 1N9KA 4IO1A 3OZRA 3NGXA 2PJDA 3UK0A 4IDAA 1GU0A 2ZJZA 4DG9A 2EP5A 4QDUA 2Z8XA 4WZBB 4C21A 1CV2A 3OTWA 3ZOKA 2WWGA 2CF6A 2AXNA 3QLUA 3SS9X 5HK8A 4I55B 1HT0A 2FWIA 3A25A 3WL5A 5AM3A 2HJGA 2IX3A 4OCZA 4AG3A 1M6VB 5CGZA 2GYYA 5A3QA 3KPWA