1IUPA

Meta-cleavage product hydrolase from pseudomonas fluorescens ip01 (cumd) s103a mutant complexed with isobutyrates
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
271
structure length
271
Chain Sequence
NLEIGKSILAAGVLTNYHDVGEGQPVILIHGSGPGVSAYANWRLTIPALSKFYRVIAPDMVGFGFTDRPENYNYSKDSWVDHIIGIMDALEIEKAHIVGNAFGGGLAIATALRYSERVDRMVLMGAAGTRFDVTEGLNAVWGYTPSIENMRNLLDIFAYDRSLVTDELARLRYEASIQPGFQESFSSMFPEPRQRWIDALASSDEDIKTLPNETLIIHGREDQVVPLSSSLRLGELIDRAQLHVFGRCGHWTQIEQTDRFNRLVVEFFNEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of a meta-cleavage product hydrolase from Pseudomonas fluorescens IP01 (CumD) complexed with cleavage products
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Hydrolase
molecule keywords meta-Cleavage product hydrolase
total genus 102
structure length 271
sequence length 271
ec nomenclature ec 3.7.1.9: 2-hydroxymuconate-6-semialdehyde hydrolase.
pdb deposition date 2002-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1iupA00
1Y7HA 2YH2A 1EB9A 3QPDA 4B0PA 5ALHA 4PSCA 2XQKA 2K2QB 1ETHA 2DFPA 4FKBA 4BE9A 4FMPA 3H1BA 4FHZA 3WJ1A 5BWCA 3NOXA 3W04A 2J3DA 3DD5A 1ORVA 4FBLA 1ZJ5A 5K3AA 3FVRA 4DMFA 4HS9A 4LXHA 2DCMA 5DWDA 5T4BA 4DNQA 1LPSA 1ODTC 3VJKA 4EY6A 4OPMA 3RKSA 1HKHA 4X90A 1FFBA 4Q82A 2PX6A 2JGJA 1VA4A 2YXPX 2WHPB 4BAGA 3TGLA 5KWIA 3IIIA 4AMZA 4UBJA 3FYTA 5A7HA 2BCEA 4FWBA 4UHEA 4X3CA 4G4GA 4GDMA 3F96A 1X2EA 4P08A 5AIAA 3LP5A 4G8DA 3GROA 3T4UA 3FNBA 3R3UA 4ZWNA 3G0GA 4BP9A 4JUIA 2AXEA 4UBNA 1EVEA 4KR0A 2ZYHA 2WJ3A 1L7AA 4KYVA 3BXPA 2H7CA 2QTBA 1YS2X 2Z3WA 3ZPXA 5BV7A 1LPMA 2QS9A 1Q84A 3QMMA 5ALEA 4IQ4A 1QO9A 2HA6A 5LZ9A 3H0CA 1UOPA 5JYCA 2WIKA 1UFOA 5SYNA 4FFVA 5ALJA 5DYYA 4U2FA 2WIGA 4C88A 2PL5A 3GA7A 4DNOA 4Q1VA 2JBWA 4DNPA 3GZJA 3KWFA 3GBSA 1UK9A 5K3BA 1ACLA 4J0JA 5AKGA 1MNAA 1AUOA 5AK5A 1RP1A 1H2YA 3FYUC 1CUCA 3PF8A 1UZAA 3C87A 2V96A 5FRDA 2DR0A 2ZYSA 5I7UA 3WKEA 1LNSA 2ES4A 2W22A 4MWTA 5AK4A 4P93A 3F98A 1MO2A 3STVA 1E3QA 1THGA 4UBKA 4H7HA 3G0CA 2Y6VA 4X95A 1BEZA 1CFJA 4Y2QA 4WFKA 4CCYB 2Y2UA 4GHWA 3B5EA 2B9VA 5IH7A 1C7IA 3FAKA 5BOVA 4BVKA 4UFOA 2BGNA 3RARA 5EHNA 3LS2A 1NU8A 1CUYA 3BE8A 4EA6A 2BUCA 2XMDA 1DWQA 1XQXA 3WWDA 4JNCA 4BC0A 4OB6A 2QMQA 5D3KA 5ISMA 1SOMA 2J4CA 1A8QA 3ED1A 2WFZA 4V2IA 4I3FA 4BDSA 4C01A 1LPNA 1TCBA 3H2HA 4GEGA 5A6VA 1EK1A 2WG2A 4NS4A 3WKDA 3QBJA 4AQDA 5AI6A 4JYMA 5AI0A 1GQRA 2HFKA 1LPBB 5LKAA 1RYYA 5FPQA 3BIWA 5ALUA 4UBIA 3MUNA 3R3VA 1A7UA 1EVQA 5CURA 2JEZA 1Y7IA 4OYYA 4IH4A 1XZEA 1AGYA 2HA2A 4W1QA 4H7DA 2QZPA 3I2HA 3I2GA 3PUHA 1YSCA 2I3ZA 3C45A 2C7BA 1EINA 3O9MA 2QJRA 3IA2A 3K2IA 1MX1A 2HL6A 3HJUA 2IITA 2WUDA 3R3XA 3V1KA 5CRIA 3FOBA 1CUDA 3NWOA 5EHQA 2O7VA 2B4KA 4A16A 4AO7A 1JJIA 1UKAA 4G8CA 3Q8WA 1VA5A 2QXTA 4K6KA 4KJXA 5A62A 5JAUA 3V48A 3I28A 4BZWA 3IURA 3AUKA 1ODCA 4OB7A 5HK8A 1GZ7A 4W1RA 1CQWA 4JH0A 2QVBA 1NU6A 2Q0XA 3I6YA 3QMWA 1QIFA 5EIEA 2ECFA 5ALGA 3DOIA 4BC1A 1WM1A 4J7AA 2NW6A 2CUTA 5DLPA 2XUQA 5YASA 5E4YA 1XZHA 4L9AA 5AKIA 3SX4A 3PUIA 5CXXA 1F8UA 2DHCA 4FLEA 4MYSA 1WHSA 4J0CA 2B61A 3S2ZA 1XZIA 3WI7A 1Q83A 5ALNA 5DYTA 2PM8A 4BP8A 6YASA 3D2BA 4TVKA 2XUPA 2Y6UA 1CUHA 2Y1KA 4DYHA 5AICA 2G5TA 5JZSA 2OCIA 5HF9A 1CUUA 4OD0A 4OB8A 1MNQA 4G9EA 5EI5A 1WB4A 4XIIA 1E8DA 1E8NA 3PDCA 5ESRA 2EDAA 4G5XA 5K5EA 1CUSA 3YASA 4LKOA 1N5MA 2I3DA 1YR2A 1OXMA 2RI6A 4N5HX 4KRXA 3F8SA 4QWWA 1A8SA 1VLQA 2GZSA 1JFRA 1VKHA 1CUZA 4BTLA 3A70A 3WZMA 1P0IA 1AC5A 2FJPA 3IVMA 4ZXFA 1EXWA 2HRRA 4Y2TA 3WK7A 1GGVA 3WWCA 2G63A 5AI4A 2R11A 1J1IA 4Y2JA 4GBGA 3F9CA 4B82A 1QIDA 2CB9A 2JGKA 2YYSA 5ALWA 3LCRA 1K6EA 3M83A 3PFBA 1WHTA 3DLTA 1L7QA 5C8XA 4RE6A 3E4DA 4DMCA 1BS9A 2XMQA 1LGYA 5AKXA 1BEEA 2QOEA 4UUQA 5ALXA 1CUGA 5AP9A 1U65A 4Y7DA 2HU8A 4YPVA 2EDCA 4MQMA 5FKJA 5JD6A 5A71A 1Z68A 2BGRA 1IUOA 5D7BA 3W06A 2W6CX 1E66A 2OCGA 4H7FA 2JGFA 3VJMA 4BB0A 2OAGA 4HXEB 3C6YA 4QDXA 5F4ZA 1HL7A 1YB7A 2BJHA 1QLWA 2WHPA 3V1MA 4X93A 1QIMA 2HA7A 2WTNA 3WIBA 4PV7A 4WJLA 5E4JA 3W05A 4BRSA 1ISPA 3BL8A 1CLEA 1YB6A 1WB6A 1CUVA 3RK4A 4MQLA 1H2XA 2WFLB 3D7RA 3WK9A 1UOQA 4Q05A 3WA7A 1DWOA 1TK3A 5HCUA 2XUKA 2WIJA 2OGTA 2WM2A 3C5WP 3PFCA 3C70A 4B85A 1HPLA 3G02A 5C7YA 3EQ9A 2PSEA 3DDUA 4C89A 3ZLTA 1BU8A 1SCIA 2Z8XA 3HC7A 5H3HA 1DTEA 2D5LA 1QIHA 1P0QA 2XE4A 4X94A 5J3JA 3STUA 4F21A 4XX1A 4BAZA 3DS8A 5AOCA 5AKEA 2O2GA 1E5TA 1TAHA 2ONCA 2PKYX 2GYUA 4J03A 2WKWA 3F97A 5FLKA 1D07A 3A2MA 3O9VA 3R3WA 1UKBA 1UKCA 3LIIA 1YAJA 1QTIA 1R1DA 3CCCA 5E4TA 3FBWA 2CEKA 5AK6A 3IUNA 5IVHA 2OGZA 2VJDA 1YA4A 3HEAA 3ZWQA 5D3ZA 2OCLA 2XUFA 4UBOA 2XMGA 1XFDA 2OG1A 3R40A 3M82A 3ESDA 3G9TA 2J3QA 2PPLA 3WWPA 4UHHA 3WZLA 2XUOA 3O4IA 2G4LA 2VAVA 1JMKC 5AM4A 5LLSA 3KWJA 1MAAA 3G0IA 2HU5A 1LPOA 1BN6A 2XMCA 4FTWA 4LXIA 3G8YA 5HF6A 1AURA 1UXOA 4F60A 4OU4A 2WJ6A 5K3DA 1CUJA 5DNUA 1F0PA 2ZJFA 4CG1A 2OLEA 1XZLA 3C6XA 4ZREA 4OCZA 4LYDA 1XZAA 4EY4A 5C8ZA 3H19A 3E0XA 5AJHA 3G9XA 4FOLA 2GYWA 2XLCA 3OTQA 3WKAA 1XLVA 2WG0A 4P9NA 4M0EA 5FXMA 4KE8A 1O6FA 1SC9A 1R9NA 1J06A 1QIKA 1FFCA 2QJWA 2IIVA 2HFJA 3D2CA 4BYMA 4MWSA 4H7JA 2RHTA 3WIOA 1C7JA 2DHDA 1JT2A 3HLKA 4X97A 1MX9A 4J0KA 4QDOA 2HDWA 5T4EA 3D0KA 4KACA 3AILA 3AIOA 2C5GA 1ZI8A 1VZ3A 2VA9A 2ZJ6A 3WYNA 4U2GA 3GUUA 3X3HA 2G5PA 2GBFA 1LZKA 3QPAA 4PNZA 5LZ7A 3G7NA 1ZIYA 1IVYA 4QA9A 3G9ZA 3WMRA 5AM5A 2XUAA 3UUEA 1TQHA 2WHQA 2WQZA 4H35A 5JAOA 2AJ8A 5JALA 4GWLA 3WKBA 2GBIA 5CH5A 4L72A 1AQLA 1Q0ZA 5T4FA 1Q0RA 3IBTA 3W2TA 5IVIA 5K3FA 3OC0A 3BJMA 4CCWA 4RGYA 4AXBA 2OGSA 1W6RA 2XUIA 4FDMA 5I8PA 2JEYA 2DSNA 3DL4A 1G4HA 1XQVA 1PFQA 4KAAA 3FSGD 3I2KA 4WFJA 5AOBA 2RIPA 3ESAA 5JIBA 1OCEA 2GZRA 2JIDA 1FFAA 3WQHA 4X00A 2PUJA 1DT3A 4KAFA 5AM2A 5DYWA 1E8MA 4E15A 3CCBA 2XQJA 5ALRA 4CG3A 2LIPA 1SCKA 5AKJA 3HSSA 1EH5A 2CMFA 1XRLA 2Y2VA 3IB3A 4BRZA 1WB5A 3C8DA 1XKLA 1QIIA 4ITVA 1GPKA 4H7EA 3JW8A 2JGMA 5C81A 4X92A 1ZI9A 5IVDA 1TIBA 3OURA 4DSZA 1XZMA 3DQZA 4QWMA 4H0CA 2PSJA 2VQ6A 4W1SA 1HBJA 5ALIA 2XLBA 4UBMA 3QMVA 4X91A 3FLBA 4OSEA 4NMWA 2PSDA 4W9RA 4B0OA 1JJBA 3WK8A 4CIAA 3M3DA 3PI6A 2WU3A 3WK6A 1XQWA 4FLMA 3STXA 2FJ0A 3AIKA 4DNFA 1JI3A 1VJ5A 5JANA 1HQDA 3ANTA 3C43A 4XWGA 3N2ZB 4X7BA 2H1IA 4BDTA 2EEPA 2ZSIA 4G8BA 3H1AA 3FYUB 3D3NA 1UWCA 1CIJA 5ALPA 5ALLA 1YASA 4PO3X 2HU7A 4BE4A 4U2CA 3JWEA 3BDVA 3RM3A 1GQSA 1W4LA 4X85A 4GW3A 3DYVA 1EA5A 1LZLA 1ZI6A 1KEZA 1JKMA 1BE0A 2C5FA 5AHXA 1BRTA 1N1MA 2O2IA 1MX5A 4CCYA 4G4IA 4UHDA 4E14A 1R50A 3C5VA 3WLAA 3V1LA 4BBZA 1VOTA 5HKBA 4OUKX 1VE7A 2QRUA 2XUJA 5AO9A 3PE6A 1USWA 3WYDA 2VJCA 4M0FA 1XQYA 5KREA 2RONA 3FCYA 1IUNA 2DQYA 4HZGA 1H2ZA 4Q3LA 1SCQA 5FUMA 1W75A 1JJFA 3FVTA 3WWEA 3ZI7A 1JMYA 3CN7A 2AJLI 4KE9A 1DT5A 5EHXA 1C4XA 1UT6A 1AZWA 3KD2A 4AMYA 5K3EA 5T4HA 2JGEA 1X2BA 2QUBA 3SK0A 4QEKA 1U8EA 2QUAA 4U2EA 1K63A 1XRMA 4WY5A 4LYEA 1YCDA 2WJ4A 4PW0A 1R9MA 3ZV7A 4EBBA 2WSLA 2AJDA 4AX4A 2ZYRA 1ZD4A 4K6HA 5AKYA 1WPRA 1GPLA 3VKFA 3WK4A 1EX9A 2O2HA 4BAUA 4AO6A 1XRQA 4WDRA 1G66A 5HQ3B 4L0CA 4YK7A 3DYIA 2QR5A 4OU5A 3PF9A 3AINA 4GLBA 3JYHA 4EY7A 5AI8A 5HQ3A 4EHBA 2Z3ZA 3OM8A 2Z8ZA 3A2NA 3GFFA 4N5IX 2XQGA 1K4YA 4MEAA 2XMSA 3FWHA 5KWJA 4K2AA 3BDIA 4KE7A 4ARBA 3TJMA 2HADA 1QTRA 3E3AA 1CQZA 3DCNA 4B7ZA 1TRHA 1EB8A 1ZGCA 1G5FA 5I9IA 2CJPA 1QONA 3G9UA 4PQEA 3R3YA 5EIHA 4KAJA 2VJBA 4PSDA 3H2JA 4C4ZA 1K5PA 2H7YA 3IULA 1QFSA 5LIPA 1CUFA 4X6XA 3B12A 2E3JA 1EK2A 5HK9A 1XZCA 3EQ7A 4U2BA 1XZBA 3WA6A 3WKCA 1XRPA 3HZOA 2RAUA 5ALKA 4Y9SA 2ACKA 3QZUA 4F5ZA 1VXRA 1LPAB 2HHAA 5HZGA 4HXGA 4H7KA 2QXUA 1R88A 3WWOA 4FNMA 2V9ZA 1WPXA 3K9BA 4DGQA 3ICWA 2WU4A 2BUBA 4KE6A 3RLIA 3WL6A 5AKKA 1IMJA 3V9AA 3FSGA 3QPCA 1ZD3A 3EBLA 1XZFA 4A5SA 2I78A 5HF8A 2FUKA 4X6UA 1XKTA 1XZKA 3AZOA 3DL7A 1CUXA 1LBTA 3HYSA 1CUEA 3VJLA 2ORYA 4WY8A 3A6ZA 5JD4A 3I6ZA 5CT9A 4HTAA 4JYPA 4CFSA 3TRDA 4BVJA 3QH4A 4W1PA 3FYUA 4J0DA 1QGED 5ALYA 3DEAA 4ZRDA 1DQZA 1BCSA 1R3DA 3IDAA 4X71A 1HDEA 3O95A 2PU7A 4UBLA 3C8HA 1U2EA 2ZJ7A 1CEXA 4UHCA 3WL8A 4EY5A 2J4FA 3OG9A 1AX9A 1NX9A 1KU6A 4P92A 1B41A 1AKNA 5KBYA 1FFDA 1DU4A 2OCKA 4DIUA 2XMZA 1U4NA 1EHYA 1W52X 2Z5GA 3VDXA 4AZ3A 5DJ5A 2R8BA 3AJAA 2WG1A 3PICA 5AM3A 3ILSA 1XRRA 1YS1X 2CKMA 5K3CA 4Q3OA 4MEBA 3ZLUA 3I2IA 2PUHA 4BVLA 2XMRA 4Y2XA 1EDEA 3R3ZA 7YASA 5A7FA 1A88A 4E11A 1WCYA 5FOQA 1KU0A 4TGLA 3WJ2A 4PF1A 2X5XA 3ZLVA 5ALTA 5ALSA 5IVKA 4J0IA 3BF7A 2WIDA 1QO7A 2ROQA 2BFNA 2ZSHA 1XZJA 1QOZA 3TEJA 1QZ3A 5CH8A 1GT6A 3KXPA 2WLSA 4QE3A 3O4GA 5DNWA 1W76A 4J0HA 5BWBA 3BIXA 4D9JA 3HXKA 4IH9A 3IUJA 3CN9A 1ZD2P 3S8YA 1TCCA 3D2AA 1CRLA 2WTMA 1XROA 2X8BA 4C4YA 2XDWA 1R4ZA 3MUOA 1DINA 5SYMA 3STYA 2XQIA 5FP0A 1MTZA 5CTAA 2VEOA 4O08A 1YAHA 4J3JA 3D59A 1XRNA 2WFMA 2V97A 3OPMA 3L1HA 2B20A 2OXEA 4RNCA 4XJVA 5CT6A 3HI4A 1QE3A 4H77A 4LIPD 5JARA 1L7RA 1FSSA 2QT9A 3AZPA 2BKLA 3O4HA 1QIJA 3DKRA 1T2NA 1P0PA 1M33A 3DOHA 3L1JA 3H04A 4H7IA 5JASA 1MU0A 2P8SA 1BN7A 2HA3A 4Y2RA 3WL5A 5LZ8A 5FV4A 4ZGBA 3GELA 4GXNA 3N0TA 1IZ7A 4MYDA 4Z49A 4UHFA 4F0JA 2XQFA 1QFMA 2BAGA 4M0MA 1F6WA 4B80A 1ZOIA 5CT8A 1GPNA 1XLUA 5CH3A 1IUPA 2O7RA 1CVLA 5DTJA 3L1IA 1P0MA 3IUMA 4ARAA 1DQYA 5AH0A 3KOOA 4EZIA 1CPYA 1ZD5A 3IUQA 3SC2A 4EUSA 4BCCA 4K6GA 1H23A 4AN1A 2WIFA 4B81A 1UOOA 5CT4A 5LKRA 1PV1A 3D5EA 4QLOA 3NUZA 1Y37A 3STTA 4FNGA 1CUIA 3LLCA 4C87A 4UFNA 2C0QA 2QM0A 3VVLA 2VT7A 4J0GA 4DMHA 1ORWA 3FLAA 4FBMA 4HRXA 4X6YA 2QKYA 1O6GA 2OQVA 5CW2A 2VATA 5AKHA 4UPDA 2D0DA 5EGNA 1ZGBA 1BROA 5HFNA 2V98A 1CUBA 1VXOA 4WFIA 3W9BA 3Q0TA 3BF8A 1ZJ4A 1VZ2A 2AJCA 4BCBA 4B9AA 2HRQA 4GECA 4C6HA 2PSFA 4B6GA 1B6GA 4FLFA 4B83A 3AFIA 2WUEA 1MJ5A 5ALMA 4MXDA 1LLFA 5DNVA 3BJRA 3R0VA 4ZV9A 2WHRA 2C4HA 2WFLA 2CBGA 2H9YA 3VVMA 3EF3A 2PBLA 2HA0A 4G1FA 1DX6A 5LZ5A 4IHAA 2UZ0A 2ZVDA 4FFWA 1CUAA 1AMNA 1J07A 3QYJA 2PVSA 1RWQA 2JGLA 4I4CA 2JF0A 2HIHA 2OQIA 1UK6A 3I1IA 4AB1A 2VSQA 5AM1A 1OILA 1EDBA 2GYVA 4ZV7A 3EIOA 5JATA 4H18A 1CR6A 2JGIA 4BATA 4N8EA 4LHEA 2H7XA 4DTCA 1MAHA 3VXKA 3O0DA 3CXUA 1GXSA 1T4MA 1ZICA 2RGUA 3STWA 3C6BA 2ZYIA 1N5RA 2BUAA 1MT3A 4BTVA 4MJ3A 4N8SA 2GBGA 1JU4A 3VISA 1DWPA 3I1YA 5ALDA 4CIBA 4HVTA 1BCRA 1H22A 1SFRA 4WDQA 2WUFA 1QIGA 1ZIXA 3MGAA 4ROTA 3DJYA 1K8QA 4XVCA 1QIEA 5AIBA 3HABA 2CZQA 4L3WA 5JD5A 1DX4A 5AI9A 4BCDA 4TPKA 2VF2A 5ALOA 4UFPA 1MPXA 3T52A 5AKLA 3AZQA 4LXGA 5ALZA 1JU3A 2XUDA 2VTVA 2XB6A 1EI9A 4KRYA 4UHBA 4HAIA 2DHEA 4Y2SA 5JAHA 2DQZA 1J2EA 4S0XA 2ACEA 3WK5A 2FX5A 4CI9A 3C6ZA 4OYLA 3U0VA 1S8OA 1UK7A 5C8VA 1FFEA 5FDFA 3K6KA 4Y2VA 1H2WA 1XLWA 4RPCA 1LPPA 1THTA 1QJ4A 4IO0A 4DMKA 4NVRA 5EIAA 4AO8A 1PJAA 2VAXA 3SWWA 4I19A 5IKXA 1UK8A 4BZZA 1CUWA 3D4LA 3BWXA 4A23A 5HFAA 4AZ0A 2VT6A 3OOSA 1ACJA 5A2GA 3H2IA 1X70A 2OPHA 1A8UA 2C0PA 1W1IA 5JAPA 3M81A 5E2IA 4N8DA 2HA4A 5ALFA 3ESBA 3DKKA 4EB0A 2VJAA 1VE6A 5LZ2A 2X76A 3QM1A 4QDTA 2C58A 3DNMA 2XMBA 3R41A 2XT0A 5CXUA 3LIPA 4B9EA 4NZZA 2AJBA 3EQ8A 4QZVA 3H2KA 5AKZA 5JZBA 1CV2A 3ESCA 3H17A 4Y2UA 2GBCA 4Q3KA 2IX9A 3U1TA 5JZ9A 3UMJA 1TCAA 1MN6A 4AN0A 5AI5A 4IH1A 3ANSA 3I6MA 5LZ4A 4INZA 4U2DA 5CBKA 4JEIA 2WILA 3H2GA 2HM7A 5HF5A 3P2MA 3KSRA 4ETWA 4K5QA 1N8SA 2RHWA 1GKKA 3AIMA 2WUGA 2HA5A 5DTIA 1HLGA 4G9GA 4Q34A 5AOAA 5LYYA 1IZ8A 4ZI5A 3A2LA 5EFZA 5AM0A 3V1NA 5ALQA 4G4JA 3KDAA 4DM7A 3FLEA 2XUHA 1TKRA 4CG2A 3ICVA 1I6WA 4YASA 5JADA 4B84A 4WCVA 1YA8A 4KEAA 5CMLA 3I2JA 2YASA 3G0BA 3W9UA 2PSHA 3H18A 3I2FA 4Y2YA 4W63A 3HACA 1F0NA 1GKLA 3QVMA 1FJ2A 5A7GA 1EDDA 4E46A 3E1GA 1E89A 5FPPA 4HRYA 3O4JA 5K3FB 2OAEA 2XUGA 4EY8A 3F67A 5LP1A 3HRHA 5AK3A 4HXFB 4DSAA 2PU5A 3QITA 4QNNA 4YX9A 4QDZA 1XZGA 5CT5A 4C4XA 1LBSA 4QLAA 3WL7A 3NGMA 3G0DA 5HKAA 2I03A 2XI4A 4GI1A 5EHZA 1XZDA 1ODSA 5ALVA 5D6OA 3FCXA 3UUFA 4PSUA 3MVEA 4Y2PA 1G42A 4RE5A 4DLNA 4QDUA 3B3QA 1WOMA
chains in the Genus database with same CATH superfamily
1PK7A 5FBKA 4DSNA 4DOMA 2I1QA 1URPA 3W3AD 2IPXA 4BJ5A 5C5CA 5ICCA 1RBQA 4D5GA 5K01A 5FYDA 5BURA 1LV7A 4D92A 5ILGA 1U99A 3FMGA 1QCZA 5GADl 4JYAB 1EB9A 2GUGA 3FOWA 3IQHX 4I8XA 2I2XB 2VRCA 1NVWQ 4TV9F 5FQOA 2ECQA 2Q62A 4UKDA 5ALHA 1YHYA 3R6WA 3ETJA 3UH1A 3AL2A 3PQFA 1LJUA 4AU1A 1KWGA 2K2QB 4H1UA 3W5UA 2ANBA 5EZYB 4BE9A 2ZIXA 1FDUA 1KO1A 1RAEA 2ZYAA 4E5VA 3H1BA 4JD5A 4NENA 4FHZA 4IZOA 4RJTA 3IPRA 5G1PA 1IEQA 1BDIA 1BYUA 3M6WA 3HJFA 3GRFA 1J8YF 1FOEB 2ZR0A 4GLLA 3TE6A 3DEHA 1P2GA 4NMMA 3ZCSA 3E8XA 5L6MB 4A8JC 2AR0A 3VKHA 4NABA 2FWAA 2C2GA 4I1YA 4GAEA 1P2TA 1L4LA 3A1TA 3GG2A 1KDZA 4YP1A 4FILA 1WDKA 4HLCA 1Z25A 5H8WA 1A2KC 1ZC4A 4DMFA 2ERYA 4LY0A 1IEXA 4LXHA 2CXOA 2DCMA 3ZCXA 1NP6A 4DAOA 3QY0A 3ZDRA 2EFEB 2HTFA 3C3YA 1J2UA 2W2TA 4OREX 1JXQA 4QU8A 4YP9A 2XQVA 2P68A 3BMNB 5KX5F 2H4ZA 2FP4B 3L8GA 4X90A 3A6HA 3SE0A 2VT2A 3BRWD 4R8RA 2E21A 4KQWA 4GFDA 2Y1FA 4CZ2A 3KETA 2WM3A 1RZVA 1CT9A 2XWQA 3O03A 4LRSB 4BFVA 4BAGA 3T3MB 1IY8A 2PMCA 3DZGA 3KHSA 3ZQ4A 3TGLA 2DKOA 4Q03A 3T3HA 5ICEA 4UBJA 3C74A 3BSWA 3TQCA 3UYLA 1L5FA 1ZAYA 1M75A 1AKYA 2BCEA 3T54A 3U13A 2DVMA 1UMCB 1V6SA 3QE3A 3QVUA 3ZU4A 4EPXA 4RBNA 4XFKA 1SC4A 3CKKA 5DN6D 1SQGA 1ECJA 1F48A 1UXJA 4DLBA 3H5OA 1O94D 4GDMA 2VH2A 3F96A 3FZGA 4KDEA 4P08A 5JNWA 4TMWA 2A0WA 2VP5A 5A9TA 2PMEA 3B2EA 5A4DA 3GY0A 2ZB2A 1PW5A 3GROA 4YLGA 4AVYA 3FNBA 1YL6A 3RFVA 3G1WA 5IWAB 3LPAA 2GCPA 4JC8A 1YRLA 5F2NA 3KEMA 1E2BA 4ZWNA 5G4KB 3G0GA 1U7UA 4H60A 3D6HA 2IW3A 4ALKA 2YWJA 1ZK3A 3W8DA 1XMXA 3MRVA 4OHVA 3HB5X 2VL7A 2FQYA 2XX3A 1BJRE 3BWDD 3IAM6 1SN7A 3DAOA 4L6AA 3BPSA 3OKAA 4L9RA 4B87A 4OV6B 4C2BA 3S0JA 1FA9A 2PCJA 3DCJA 4KYVA 3NVDA 2COUA 5CA1A 2H4HA 4LJ8A 1F3OA 2QTBA 4MVJA 4RNDB 4BO9A 1HFKA 3SKXA 5CFNA 3PFNA 1II8B 4ZARA 4KO2S 3H4TA 1XLTA 4BWVA 1JN0A 1FB5A 3T3EA 3ZPXA 2C7PA 1GCUA 1TXGA 1B15A 1LPMA 1H66A 4IYJA 3RVDA 4OKNA 1W25A 5AJYA 3TO5A 1Q11A 1IBSA 1SU6A 1GNQA 1T9GR 1VPDA 4DLWA 1H6BA 3I73A 3Q0IA 1X1TA 1DCKA 1K6XA 2C8JA 2O57A 2XRMA 3COVA 4ZYLA 5L4SA 3T1YB 3D6UA 3RUIA 2HA6A 5AVYA 1AXRA 5LZ9A 1P3Y1 4MINA 1SBYA 3BL6A 2H07A 1TTQB 5L3VA 3IRVA 2CDRA 2JGAA 1CIVA 1QKJA 2IE8A 4ZAWA 2OOKA 2QSUA 1NRJB 2WIKA 1Z28A 3H5NA 3ORRA 3RS0A 3TNDA 1AZSC 2VQ3A 5LB4A 4FFVA 3ZX4A 3O3CA 4Z2YA 3L04A 2ZJOA 2FUEA 4UCFA 2IOYA 4N6OA 1LF5A 3J7TA 5DYYA 1Z8FA 3K6JA 1QHIA 5EY5B 3UJDA 4FUTA 3HLTA 3PENA 3H2ZA 3ODPA 4DA0A 5JNSA 5EHGA 4MKZA 1BA2A 1QGUB 2PD4A 5AVVA 1L5OA 1PWZA 2I6GA 2JBWA 1X7YA 1BFKA 3FXAA 3ITNA 4GWGA 2BOVA 4M55A 1A5ZA 3L7YA 2CMKA 4JYCA 3X1DA 4DNPA 1I13A 4P84A 1IN8A 1UK9A 5FWXA 5M2QA 3U3MA 5H3LA 5K3BA 6Q21A 1COWA 1RMTA 3HGMA 2X5KO 4D8TA 1JAIA 1UIRA 1VIAA 3JZFA 1Z0IA 3LUGA 4LJAA 2O3QA 1N33B 5KU1A 2H2IA 1E2QA 4FOOA 5CCEA 2M1XA 1ISSA 4NBTA 1EFHA 2HX1A 2JLWA 4RA6B 1CUCA 1JEDA 2AMJA 2X1VA 1QX3A 2ILVA 1CY8A 4HATA 4ND1A 2ZZMA 1P33A 1KZGB 4AG5A 4QGSA 3I4FA 4KN9S 2CJWB 5KJFA 2DR0A 3OHSX 3H5VA 3VZQA 2ZREA 3U7QA 1W9MA 3DTVB 3ZOZA 4N9QA 5BN4A 1Q57A 4DV7B 1CQXA 1YQEA 2YN4A 3SQXA 4GMFA 1GAXA 3DT6A 1LNSA 2G7ZA 4L76A 3VYVA 3CX3A 5DF1A 3ZIDA 3VFDA 3PC7A 4GI7A 3OOEA 2EG5A 3DP9A 3R6LA 3LT4A 3PQ6A 3PFGA 1GAWA 1YFKA 3LV8A 4HNAB 4L3OA 4LFAB 2B4TO 4P4UA 4QM7A 1HF3A 1ISIA 5A04A 1OR8A 1YJBA 1NXQA 2Y68A 2ZGVA 4JIGA 4X95A 4IXWA 4ZI7F 1CFJA 1TUEA 1U2GA 4CQNA 5BUCA 3DLBA 3JARB 5FR2A 4JGBA 1LK7A 1MG5A 1H5UA 3QU9A 3WGLA 5C7OO 1EGAA 2PS1A 3B5EA 4GHWA 2ZRAA 3R5HA 5IH7A 2CDBA 4HEA6 1C7IA 3OEYA 3SJBA 2CLHB 2WT4A 1GTSA 2BGNA 2AR7A 4PXYA 4CIDA 1NU8A 4RZ2A 3HO1A 5ENDA 3BE8A 2QSJA 1N5OX 1M2EA 1ENPA 3HQ4O 4ESEA 3CNHA 1KRXA 2JCXA 2XMDA 1BC5A 3Q7TA 4AUNA 3GU3A 1B2RA 4DBZA 1LU9A 3GT0A 3HMQA 3QF7A 2VUHB 3KKPA 1Y3DE 2FP3A 2MHCA 3NEYA 4XSHA 3CVYA 4NCKA 4OX9Y 2IQ5A 2NUAA 3W4IA 1HZJA 1PJ2A 1T3GA 5F3RA 1UBNA 2C2KA 5D3KA 1Z0UA 3NQ41 1O9GA 3KKKA 2Q7DA 3THOA 2YV2A 3WRXC 3IMFA 3S1LA 2B36A 2OHFA 4C0HA 1A8QA 3TN7A 4ID9A 4ZP1A 1TYEB 4KVGA 4LYGA 1NAIA 1UEIA 3MJTA 3PWZA 1NY5A 4OMCA 3RWOA 3SDSA 2C92A 5J2TF 2XCTB 4U7PB 1ZRSA 2ID8A 4LJKA 3HXTA 5K4GA 4TZ6A 4L5IA 4M8SA 2PG3A 4KGXA 1FEZA 2HPAA 5IHXA 5H16A 2I6XA 2PO5A 2FEPA 4D96A 1DUIA 1O97D 1TCBA 2QMEA 2Z9CA 4KRFA 5AKGA 4GR9A 5ESDA 1XL1A 4O4IB 5BN3B 2AZXA 4QVIA 2ZIZA 4J1SA 4MZDA 2ZITA 4HB4A 4I55B 5A6VA 5BV0A 1WUJS 1K7XB 1EK1A 5DBHX 2DWPA 3UANA 2YV4A 2GJ8A 5BQXA 3FTPA 2QV7A 3HKBB 4JYMA 4UEOA 1PR5A 3WHIA 1GVNB 3OX2A 4BMVA 2HFKA 3R2JA 5AVZA 1XJ5A 2YVQA 3EEBA 3K8YA 2QW8A 2R47A 1T4CA 3QW2A 5KOHB 2XUZA 4G4SO 1N6LA 4AC9A 2AG6A 3S4YA 2VEDA 3O1IC 4N47A 5ALUA 3TOXA 1YCFA 3SF8A 3MUNA 1EQUA 2QQ0A 1NRXA 3HEBA 3CSDA 1C80A 5H70A 1EVQA 3PFKA 4H3VA 4ZVQA 3Q11A 3RVPA 9GPBA 1Y6GA 5FOWA 1YE8A 1LLUA 1X77A 5LQCA 2EATA 3ICPA 3ZWCA 1TZCA 4HDKB 4KQ1A 4BP3A 4CKYA 1S9DA 4IH4A 4DG9A 3HGQA 4FCCA 3W6NA 3CSUA 4CMHA 3P0EA 1DOHA 1XZEA 3CUEF 3GQVA 4DR6B 1PVOA 1W59A 4MV9A 2MOKA 4L0MA 5IBCA 4BZXA 1HDRA 2W7TA 3C8MA 1WMFA 1DXYA 2JFPA 3PFIA 3ZCRA 3O3MB 5KNCH 5KVAA 5LOVF 4U8HA 5F9MA 3N2GB 7MHTA 2NVBA 2OD7A 2WUVA 4XCVA 4EJ6A 1M7HA 1VIYA 4FGZA 3NONA 4AF6A 3R44A 5KWSA 3E8SA 1EEHA 3C45A 3G3EA 2GTIA 2NWQA 2C7BA 4ILEA 3KWLA 4JL5A 2V1XA 2FMIA 5EE3A 2W5UA 4HDAA 3TW8B 5FNVA 3X2EA 1DPGA 3UT6A 3T1OA 5DM60 2OORC 4WK2B 2FZWA 3K2IA 2F3TA 1KJZA 1GLVA 3LPDA 4KWEA 3UHJA 2HL6A 1TC1A 4DVJA 2FW7A 3VV3A 1WETA 1QGZA 2ZUSA 3GMTA 3TZLA 4KMSA 3W8RA 2EQAA 4Y9DA 3ANNA 3CNOA 1KXZA 3EY4A 1FDTA 5CRIA 4TKMA 1K2VN 2GA8A 5AMXA 1LRJA 1VB3A 4M9ZA 4P35A 4RGBA 2ZS8A 5EHQA 5BOSB 3ZV5A 4C43A 1S1CA 5FWXB 3UJAA 2XCSB 3LK7A 1JJIA 4JP3A 4IHQA 4G8CA 4MOWA 5JCOA 4YCLA 5KDOA 1PG0A 3HUFA 1UZNA 4ZOAA 4ZRMA 3P26A 2VAMA 4QNRA 5A62A 3X1ZA 3V48A 2IPOA 1T9BA 2C57A 1PT7A 1QG2A 1B8VA 1U6JA 3I28A 5T6MA 2OC9A 5SZHB 1GUDA 5JC8A 5JS7A 2OR3A 3FWKA 1E2PA 1QNFA 3KQSA 3LLMA 5B7NA 3PGLA 5F1KA 3AUKA 1J7JA 1N5JA 1ODCA 1HSZA 2BE9A 4CJXA 1K7CA 1XXHB 2WB2A 1RFLA 4I1UA 5FA6A 2R62A 1RPTA 3ETGA 3JQ7A 3OEHA 5DNCA 1CF2O 1H4VB 1ONOA 3LW7A 4NPHA 3Q7EA 4YAOA 3WYBA 4R0MA 1DG1G 4JA2A 1DV1A 1Z5VA 5H02A 1NI4A 5B1SA 4DHWA 3P4UA 4DWOA 1NV8A 2I29A 3ONFA 5FBZA 2J08A 1EVIA 1SCDA 2QLBA 2BC9A 1TD9A 3PJDA 1J0CA 4IXDA 1L8QA 4PYRA 4XIFA 2IIPA 3AR2A 4BC1A 2RGAA 1ZMOA 3K0AA 1SXJA 4MS3A 3D0RA 5G1OA 4NI5A 2WDPA 4ZO9A 1MFZA 2IYXA 1GDHA 2J0UA 1VRVA 2PKQO 1HE4A 4CIWA 1JYEA 2GASA 1VRWA 4NFLA 4DLPA 1KBOA 3GGGA 5JNRA 2XUQA 3DDHA 4BMCA 1XDZA 2DLDA 4S2EA 2F3SA 3DT8A 4GPIB 3ZCTA 4C4OA 3D4PA 1C1HA 1SCJA 4IS2A 2A1TS 1F8UA 2PZ8A 2ZFUA 3GEEA 4UQLA 2GX6A 4JSYA 1JLLA 5B1DA 3WGKA 1WHSA 4J0CA 2B61A 5C0OE 1K0UA 3VJLA 1LS6A 3WI7A 4MPTA 1Q83A 4BNVA 2ZVQX 4XYEA 5JR3A 3MQFA 4N7MA 4E32A 5EWJA 4CTMA 4OI0A 3HCCA 4V0ME 1ZL2A 3ENWA 1OC4A 5DYTA 4FGUA 1D8TA 5IUKC 4D8VA 3L0PA 3ZE1B 3DFUA 2NUAB 1J21A 1JRLA 4U7HA 2ZI4A 4KQIA 4HFRA 4CV0A 3UAGA 4U5QA 1TKAA 4M60A 4DYHA 4WV3A 5COBA 4KLAA 2D1RA 3HLYA 4OJQA 5GJCA 5HWSA 5JZSA 3GRZA 4EYOA 4A0QA 1RYNA 3QVLA 1GU0A 2LD4A 5HCIA 5HF9A 3HR4A 1IM2A 3OD1A 3K92A 1JZTA 4YRTA 2VPYA 4L27A 4OB8A 4QELA 4B6PA 5A1JA 4G9EA 4S1TA 4HR7A 2D62A 2PIDA 3B1YA 1HDCA 1GD1O 5EP1A 4YUVA 3PDCA 3NEAA 4Y9RA 4TMXA 3FZNA 1SXPA 3ID6C 1TYCA 3CZ5A 4G5XA 1Z2OX 3DLAA 1CUSA 3ISJA 4KWTA 4LKOA 5K5EA 4OATA 3DE5X 2Z4RA 4M49A 5H82A 4OGFA 4RIGA 3N53A 4JVMA 3MWDA 3PSHA 1BMFD 4KRXA 3PE3A 1U0SY 1WO8A 4O1HA 3T99A 1AV7A 4OX9B 1CS0B 2DTXA 1WL8A 2Y0EA 1MQAA 3QXXA 4QVKA 3D8RA 3ZI0A 2GB4A 4BQSA 4EKYA 1D4OA 2BY4A 4I46A 4M37A 4XJSA 2J30A 2OT3B 4BTLA 4ZYXA 3CF6R 3OTWA 3ZY4A 4RYDA 1M2GA 2NXCA 3QELB 1NN1A 4IDFA 3DOOA 4GBJA 1AC5A 3RF7A 3X0DA 2WWVD 2RGEA 1IM5A 1IXKA 2H2HA 2IOHA 5HIKA 3TDMA 4EFMA 5A1TA 5KOJB 4LWOA 4C6SA 2PL3A 1XMJA 1XELA 1E4YA 3AF0A 1YDEA 4ARVA 3WK7A 1TGVA 3NHMA 2DFVA 3RFTA 4BO7A 5CVUA 4LDRA 4K87A 5AI4A 3C16C 2ZWAA 3N5CA 3N6VA 1J1IA 1MRZA 1ODIA 2OV1A 3IBCA 2E4UA 3D2LA 2XKJE 4B82A 2IYFA 4MK4A 3NHJA 4JROA 1QIDA 1J9ZA 1RCTE 5FPSA 3UWPA 1PLLA 4OK6A 4BX2A 1MD9A 2ZXUA 5KHLB 1WE2A 3RAFC 3LDHA 2WYVA 4DMMA 3DLTA 1L7QA 4KKVA 2IYTA 3VSAA 3ESQA 3PR1A 3BK7A 2ZBVA 1BS9A 4F3NA 3K9NA 4FSXA 1LGYA 1QHHA 1EEXB 2BW0A 2YBEA 5AKXA 2F43B 4XB6B 4TXNA 1D4FA 4A92A 4UUQA 1C81A 2JIMA 2XGSA 4DA7A 4WK0B 5AP9A 2O0JA 4F6RA 5EQDA 1GAJA 5JECA 3TW0A 1H3EA 1JIKA 5K8IA 1TM5E 4HDQB 2GZ1A 1TZBA 5D7NA 4MQMA 3RSCA 1JLMA 3RYTC 4EGCB 3I9MA 1Z68A 3NG1A 1Z2CA 1U2GC 3LDUA 1KAHA 1Q0HA 5BSFA 4G0NA 2LTAA 5A2QA 1S2OA 2HJ9A 2WJJA 3BYZA 4E0BA 3AY0A 4I0WB 3KQLA 1BE8A 1OUMA 1T5DX 3T6KA 2DM6A 2OZLA 4JQCA 1Z45A 2Y4OA 1NN0A 3GLKA 5CX1B 4F1WA 1U8CB 5HQTA 4BB0A 1S3GA 2O0KA 4L4RA 1DXOA 4CKCB 3EXHA 4HXEB 2NP7A 1AKMA 3SFTA 3B3GA 3WDLA 3TFQA 3FGNA 2G88A 1QLWA 1AK1A 5G0SA 5EWJB 4YDRA 1WCV1 3GUYA 3CZ9A 4GF5A 5BSHA 5TDHA 1DJLA 3QNMA 3A7DA 5EUQB 1GILA 4URXR 2W4QA 3V1TC 4OBEA 4TMVA 3T3OA 1WLYA 2FUCA 3RASA 3S2EA 3WIBA 1D2AA 4M8IA 4PV7A 1M2VA 4G65A 4NZPA 4L7VA 4MIYA 3WR5A 1T29A 3QLEA 2HYDA 3QLUC 4BNZA 1GU7A 2VSOA 3QA9A 4Q37A 4TWRA 1D6MA 1R6UA 7ABPA 4HGPA 5DEIA 5JU6A 1MABB 1FRFS 3ICQB 3Q0EA 3H9JA 4G1EB 3AXTA 2GKSA 3AEUB 2BMFA 3PE4A 1VSBA 1EVYA 5MFZA 1CUVA 2D2FA 3L1VA 3ZNOA 1X7GA 2ZI7A 4NDZA 3ZWBA 4CU5A 3B5IA 2QX4A 4Z0HO 1EVZA 2WFLB 4G0VA 3V4SA 3EUAA 4BQQA 2VDPB 3LHFA 4OXRA 6NULA 5LD2B 5KKAA 2YS6A 3MJ4A 1CS0A 1RS0A 2HCBA 4HNHA 5HCUA 1T43A 4YCNA 4KXUA 4PLCA 1C3VA 2WM2A 3WHPA 3KKQA 4WVLA 4B85A 2XKKA 4QPZA 3ZI4A 5CFLA 3G02A 2NZ8A 4KX5A 5H68A 1CRPA 1SIBE 4DBLC 4JKYA 3RRMA 5B3JA 1FMTA 1AB5A 4LSGA 4N48A 4RV9A 3BT7A 4CEJB 1OHHA 3KHTA 1M8JA 3P52A 3ZLTA 4AUKA 4BPRA 3KSUA 1BU8A 4JBXA 2ATEA 4JLWA 3E9QA 2Z8XA 4LZOA 1Y89A 3AOEA 4EG4A 3AR9A 3TD6A 4G86A 3HC7A 1P2DA 1FSFA 3BK1A 1XLTC 2JAXA 2HMYB 3HVJA 5J3JA 2NU7A 1W7AA 4UE3S 4XPIB 1C3OB 2VAWA 2KB0A 3PQDA 4QUKA 1E2FA 3ODGA 1GUFA 4DR3B 5P21A 1SULA 2YC4C 2IS2A 2W8ZA 4XX1A 4NJMB 3EW9A 5DSZA 1GTL1 2H3HA 3FJYA 4K6OA 3LCMA 4L28A 4R0VA 3NEJA 1JP7A 3AX6A 2WDZA 1OZAA 2XBMA 4YIHA 3UCXA 2ODNA 4DR1B 2EFHB 1VSTA 1NF3A 2WJAA 3VR0A 4OK5A 3S2FA 3OJ0A 2NXJA 1BVYF 4EF5A 4QUEA 2ONCA 2NU9B 1XXHE 3D3JA 2PKYX 1Y9DA 3BKXA 4TM7A 1VCOA 3TVTA 2P2ZA 3AERA 1U6KA 1PX0A 3R1IA 4J03A 3ND7A 2WKWA 4ER3A 2QT0A 4Y6RA 4UXJA 3UG6A 4HBZA 1S8FA 2H08A 2VCHA 3BH7A 3H9QA 2FWJA 2IYZA 3O9VA 3R3WA 5F2OA 3T12A 3GCWA 4DIDA 3F73A 1UKCA 1EWKA 1FNMA 1CSEE 3K7EA 3WDSA 4CLXA 5BYAA 5HS4A 5LN1A 3K09A 4ODIA 3SQLA 1BE6A 1LX7A 2IE0A 3ETLA 4M88A 1ZWLA 2CCKA 1LTKA 3FNGA 1U63A 1EP1B 2GQ0A 2WZQA 4L08A 3EFOA 4V0RA 5DIFA 5E4TA 3VBEA 3W2FA 5I4CA 3FOFC 5AJVB 3OTIA 4P4LA 3E9ZA 4R51A 4O4JA 1PNTA 4W5TA 1A9XA 3PDJA 1SZJG 4QBHA 3WXMA 2YJ4A 2FVYA 5AK6A 4XUCA 3KZOA 1RU3A 3C85A 2A1IA 5CB4F 5IVHA 3R9KA 4S12A 2OGZA 2VJDA 4NJEA 5JMTA 1HO3A 4K0RA 2UUBB 8ATCA 2HSWA 4A73A 5A4FS 3I62A 1E6UA 5IDQA 4AJKA 3GA5A 4LJRA 3JALB 4RCYA 4UQPA 2XUFA 4B2IA 2V0CA 1AUVA 3TRFA 4R4JA 1XFDA 2ASVA 2O8CA 3AU8A 4WA7A 4FZVA 2YJGA 5JQWA 2C0CA 1AGPA 1T4CB 1LEHA 1D4ZA 2WJWA 1W44A 2ONKA 3E48A 4C05A 3OJOA 4UHHA 3TPCA 1OMOA 2XUOA 3O47A 1DC5A 5A5GA 1NSFA 1OFUA 3O38A 3ZY5A 4E2YA 3OICA 2XD4A 4KR7A 1LDEA 2C9YA 3G0IA 2PS0A 1DRUA 2HU5A 4Q7KA 1OBCA 4J2TA 5IAJA 2R86A 1XCJA 4DNXA 2BFOA 1JH8A 2EL9A 3EY9A 2ZUBA 4LJ6A 1KY2A 3CR7A 3O9ZA 3K70C 4UOQA 2NQ2C 3QYPA 2X42A 2GVNA 4ZPJA 4G2TA 1CUJA 4BZPA 3GBVA 3VPGA 1E0JA 4WKPA 5DX0A 1YC2A 1FNCA 3GUVA 1XZLA 3C6XA 3ZW7A 1ENZA 1PWHA 3KB1A 2HIMA 3D0OA 2CCJA 4MAAA 3NLLA 4IO1A 3Q85A 4OCZA 5HX7A 3V2UA 5K8VA 4CPDA 3FVQA 5JYBA 3BH6A 5KYUB 1MA3A 4Q4HB 4KFUA 1QLJA 2QL6A 2GBLC 4LQCA 5AJHA 4WK6A 3U80A 2FMXA 5EGSA 4RK5A 4D0LB 2GYWA 2FP4A 1KOFA 3OQHA 4CGYA 1XLVA 1FYFA 3EGDB 3V1YA 1G3MA 2VG8A 4IKEA 2B5WA 2AK2A 3KQOA 4J1TC 3CONA 1FSZA 2EAUA 1Z4KA 2QTHA 4WASA 4D42A 4E22A 3WRXA 3A11A 1EJ0A 3ROTA 3A4TA 1ISFA 3OUTA 3IAAA 2IXBA 3PD1A 4ZEOA 1WUHS 5A6SA 3E5HA 4HHEA 1XAIA 2LPMA 1P1KA 3M1LA 4BYMA 3PWTA 2G40A 5ES4B 1AU9A 3HKBA 3CLTC 5EWMB 1J8QA 2RHTA 3WIOA 1DFHA 4LECA 1K75A 5CB4B 5C52B 1IZZA 3U60B 1NXSA 2DY0A 4HMPA 2VZEA 2RB5A 1NUAA 1OYVA 2ZTHA 3AB3A 3DBHB 4OJMX 3WE7A 3THXA 3PR3A 2PZMA 4Z1MD 3QJ5A 1VKOA 5EA2A 4HD8A 1ICEA 2VT3A 3VRHA 3L0DA 4YDSA 4ME6A 1QVVA 4KACA 3T3GA 3P97A 3CNLA 2NAFA 2RGYA 2UZ3A 5EZYA 1SQSA 2PL1A 5E2BA 4ZVSA 1NJ2A 4PLGA 1ZI8A 2ZJ6A 2XYRA 3WYNA 2QZJA 2J9FB 3PNKA 4RJJA 3SYMA 5HYVA 1DQPA 1BX0A 3KSAC 2G5PA 4YRMA 3M1YA 1OV4A 3DQQA 3QENA 3CISA 2QVZX 1U1FA 3BKWA 1THZA 3LQKA 4QA9A 1ITZA 2XHZA 1H8ED 3PHHA 4MP8A 2XUAA 5AM5A 1D6JA 1VE3A 2NU7B 2PZAA 2XNJA 2ZR8A 4I9UA 5DULA 1CJMA 1WB9A 4QHTA 4OH7A 2DBYA 2AJ8A 1X1QA 3PEWA 3EVFA 5JSYA 1OD6A 1SBQA 4HGZA 4AKEA 5GJBA 2GBIA 3KLNA 1NRIA 3MYRA 5D3QA 1SWWA 1T5OA 1I33A 2XT9A 4EM6A 1AQLA 5T4FA 2B4RO 4HQNA 5KTPA 2QRPA 3U7GA 3IBTA 4LVOA 1OU4A 3UMYA 4RADA 2FMUA 4XYBA 2DR2A 1CZKA 2P9CA 2O06A 2FR8A 1YKFA 2XKBA 1NXPA 1PJ3A 1G6HA 4CCWA 1QYIA 1D0IA 4FQ8A 4OHOA 4RGYA 3TX6A 2DR3A 3LP8A 1NFFA 4X54A 4BFXA 5I8PA 2Q5IA 2XUIA 5CTJA 4P0TA 4ZO8A 2I91A 3VKGA 1Y1LA 1G4HA 1XQVA 2WA1A 3NFRA 2ZSBA 1SGWA 1PFQA 1ZN9A 2O07A 3GC6A 4GYJA 4NV0A 1EZZA 4IHJF 5CVVA 1VGQA 4BECA 1K6MA 3FSGD 1R00A 1U0LA 2AYYA 2HSZA 4EUKA 5KC8A 1ATIA 2P6OA 3FNQA 4F3KA 3DC7A 2H4WA 3HY4A 2FHPA 1DAPA 1E62A 1Z56C 4A0SA 1FS6A 2E9SA 3OQJA 5JQGF 2J41A 1J2RA 2GNPA 2VRCD 2XXBA 1TX4B 4HC4A 3E0QA 2BMJA 2F00A 3GPCA 4UCXA 1IG0A 1SUDA 2OMEA 1DDIA 5EERA 4EMBA 1G8FA 1LVUA 4ZA2A 3MJEA 2X9VA 2OEPA 4DCVA 1W4ZA 4H7PA 4EARA 2DEUA 4NZMA 4AJ4A 1TJNA 2CXRA 4JJAA 3WVNA 3WLKX 4FZ3A 5JXIA 1B23P 3U37A 4B3HA 1C9DB 3CCBA 4GGMX 4N0EA 2DMRA 3OZBA 1CXZA 1HK7A 5ALRA 3RVMA 1I4EB 1YDHA 4AZTA 1VDZA 4CVNA 2XBUA 1OYWA 1Q6YA 4YGXB 1SCKA 4BMZA 1G2PA 5IEJA 2RE8A 1H0HA 1U2ZA 5FNZA 1JTFA 4BL5A 4MCJA 1WCXA 2F48A 1Z6GA 4L2IA 1PJZA 1L2TA 4OFXA 1QZXA 2VLIA 2CMFA 3CO5A 1XDSA 4IJWA 3MAAC 1FSGA 3IB3A 4REOA 4I3HA 2QM3A 3QFRA 2DPXA 2GWRA 4KI7A 3DHYA 2X1HA 3JD4A 1CC1S 2JFFA 5JWHA 2F1JA 3C8DA 3DG9A 1XKLA 3ZGOA 3VYWA 4URHA 3OAAA 2H3EA 2QR2A 2TMKA 4KU4A 1GPKA 4J0FA 4QYSA 5KNCA 1FMCA 5HXAA 4D26A 3KUUA 4Q6BA 3LYAA 3CM0A 3I9OA 4MRRA 4NH4A 2ZVJA 2XRFA 3JW8A 1KQFA 4D0NA 3GRUA 1N6KA 4LVNA 5DBFA 2BGJA 1NTOA 1W8IA 4JJKA 2IP2A 3OURA 4S3MA 1OYYA 3HDGA 4JNKA 1ODJA 4UOEA 1KIAA 5FUVA 1CK4A 3DE4X 2VQ6A 2PUEA 3TNFA 3EQ2A 4MP6A 2WVJA 4B46A 1AKTA 2C59A 4LA4A 2C2ZA 2C5AA 4ED9A 2D7DA 5AT1A 3LH5A 1KS9A 1KTIA 3FHLA 3TPFA 1TU4A 3DZCA 3DFMA 4JKOA 5TT1A 2ZZNA 4UBMA 2PUGA 1XPUA 1RZ3A 3A1WA 3FLBA 4CHTA 2V7QD 1XWWA 4X1KB 4M99A 4B0OA 1CQJA 4I99A 3ME5A 2WWTA 1TIKA 1ZW1A 2BI8A 2MSCB 1YIAA 3HYRA 3MS4A 2ZKIA 4BNKA 5JLJA 3CF4G 3QEJA 3PDWA 3WK6A 2WVGA 3STXA 3GJ4A 2IZOA 2O4UX 3M8KA 3ZDXB 4EY3A 2XWSA 3QHQA 1VJ5A 1U9YA 4IIGA 1U7OA 5BUSA 2MIIA 5BSVA 1ZRNA 1QDEA 1C3OA 3C8ZA 3ENZA 2WZDA 4EEKA 4X45A 1X1EA 4YRDA 1Z0SA 1SVNA 4AI6A 3AEXA 4B3BA 3UXYA 1YCGA 2YZNA 3G2MA 2CHFA 2ODEA 3SXUA 4YT4A 3R9XB 1U9JA 2D8MA 5DHPA 1KDPA 3NDPA 2IHNA 3MOSA 3B38A 4XWGA 3IAM1 3N2ZB 4X7BA 1E20A 2H1IA 4IVQA 4BDTA 4F4DA 4LOHA 2GN9A 3GUZA 2CDNA 2PN1A 3GEGA 1NUSA 4L73A 5D8DA 1O0BA 2DTEA 4JP1A 1JEYB 3FYUB 1UBLS 4JS0A 1Q16A 2AFIE 3L7OA 1UWCA 2X0FA 2R00C 5EMJA 2O5EA 5ALPA 3QE9Y 2VBFA 2YNMA 1VQ1A 2CC2A 2WD7A 3IH5A 4KUEA 3SVLA 4PO3X 2HU7A 4EFNA 3OIWA 3LCUA 3P2YA 4XIYA 4U2CA 2VKQA 4EA8A 4E6EA 1NW5A 1NPTO 1P9LA 1E6LA 3VI4B 1U7ZA 5DPMA 1UR5A 4KNVA 4C7KA 2KI5A 4LF6B 3QLVA 3BULA 4UZEA 1GFSA 1ESNA 1HNNA 1W4LA 3WNZA 1U3FA 4I4TB 4NCAA 1M2NA 1IZ0A 1SO8A 3N0WA 1J33A 2B3DA 3OTOB 4KP7A 3ZJ5A 5KMGB 3ZVNA 1M1ZA 3B2QA 1KI2A 3OF5A 1ZI6A 3RS5A 1V45E 4BVFA 1KEZA 4BKRA 1P1RA 1WBJB 4S0ZA 1PR1A 5T57A 1DAMA 3FHCB 3OZDA 1TVCA 3BM5A 4AJPA 2OBMA 3WP0A 1NX6A 3KB2A 4CV2A 2DH6A 2O2IA 2HMUA 1JQ5A 4G4IA 1FZQA 2C2XA 2GN8A 1T9DA 3V5NA 3BCRA 2PBZA 3FCOA 3JTEA 1VE7A 3O8BA 4C08A 3BIJA 3WB2A 4D56A 4QJ3A 4Q16A 1NFQA 4EB8A 1V35A 1U3UA 1NZFA 1A9SA 2A5FA 1J2JA 2ISQA 2VXOA 3MK31 1MORA 3WYDA 4Y18A 1QYRA 1A4XA 2V59A 3N8HA 4JBWA 3FCYA 3IP5A 2ZJ5A 3MS7A 3WJAA 1CKEA 1TO6A 1IUNA 2WYUA 3GNTA 3QVGA 4M4SA 1H2ZA 4NX2A 4YT2A 1QTQA 3VR6A 5KSYA 2XTZA 4RD6A 4QUJA 1W75A 2BJWA 2AI2A 4IGEA 2G9ZA 1TKCA 1UMBA 3M34A 4JEMA 2I1WA 3FVTA 2J1LA 4XVQA 1GR0A 3UXMA 1W73A 3OZIA 1C50A 3CX7A 5TMDA 1VCMA 2O05A 1L3IA 3F6SA 2K5UA 5EZ5A 1P8AA 3FA2A 4I66A 3WMGA 1LK0A 4D3SA 1KZ6A 1IB6A 3ABOB 3OZAA 2R7AA 3PYXA 3AETA 3LQ4A 3OPVA 1C4XA 2YYYA 2YZMA 1A9OA 1HTTA 1QGAA 1AZWA 3DVLA 1ZD8A 4JVOA 3VHRA 4F04A 4E94A 4NDAA 4BGIA 1TCUA 3WAJA 3B1VA 4CODB 5J4LA 4QQKA 2ZJAA 5C18A 1AB6A 3U5ZB 1N3BA 3IDZA 1HRKA 2QUBA 3H9GA 1U8EA 1CBUA 3KZKA 1QVZA 5I9LA 2Y1LA 5KYGA 3AKZA 5I8ZA 1C3XA 1XRMA 2JCVA 5DNAA 1OBFO 1V7CA 1OFTA 4IXTA 1P45A 3ZGLA 3SZOA 4JJ8A 2GO1A 2WSBA 5GVRA 3P9YA 5I4BA 5JQGA 1JHMA 1ONSA 3GEDA 4R9NA 4WK4B 5CHYA 5MN6A 3TQIA 1LA2A 1MB3A 3KVVA 3UMFA 4EJMA 3L8HA 3OCUA 5JSQA 2E87A 4X62B 2Z4SA 2IHUA 1ESZA 4B73A 2VJLA 1NXXA 4K6HA 1O6BA 4H3HB 4RPGA 4P32A 4KYTA 2I62A 3TLAA 1WPRA 3U4QB 3VKFA 3WK4A 4QJ4A 4CFYA 4EJFA 1IBKB 4K9DA 3UTCA 3GAMA 1RYEA 4YJFB 3DB2A 3GH1A 4Y30A 4BAUA 5DEOA 1XRQA 3BXFA 2Z5LA 4FFPA 4WDRA 3U44B 4YJHB 1YCHA 2IDMA 5H4HA 4G1VA 1RPAA 1UF9A 3ADOA 2FOXA 2VDLB 3A27A 5DYNA 2XXAB 4RETA 5EKUA 1ZD9A 3TCXB 3U4GA 3DYIA 2QR5A 4OKIA 5TQ2B 1MJGA 1ZRHA 3BILA 3L41A 2J0SA 2H29A 4QGBA 4GLBA 1I3LA 1EWTA 1W85B 2FRVA 4PS1A 3VO1A 3ZE8A 5A4KA 2R8YA 2VA8A 1L9XA 1JR4A 5AI8A 2WZBA 5THQA 3COPA 4EHBA 5IM5A 2HLDA 4HQ0A 3OM8A 1ISJA 4ZCQA 3T9DA 5BVGB 2XADA 2XZOA 3OLQA 1K7EB 3EASA 1ZJWA 4IDAA 2PUAA 3PNVA 3K2QA 1ZUNA 2RC6A 1Z18A 3AP3A 2LRHA 4D6YA 2FSPA 3PPIA 1TQDA 1ST2A 3F90A 1RQXA 2XQGA 2G1PA 2ZYDA 3UW1A 3C98A 1QS0A 2P7HA 4MHOA 1QP0A 1XEFA 3GRCA 3AESA 3JQAD 4L75A 2FXVA 2Q0SA 5CM8B 4CF3A 4ENVA 3KJHA 5IRCD 2WSMA 5AW2A 3MERA 5E8RA 3LGXA 3P5SA 3RRXA 1Q1AA 2FLVA 1U7WA 2WJIA 4WXRA 1N2ZA 3S2IA 1ZR2A 3MQ4A 3JQBA 4L4XA 4ZN6A 2W6IA 1B7GO 1NE2A 2ZJYA 1E7SA 2Q4OA 2QJTA 1B0ZA 3E3AA 3O3OB 4OXIA 4JYZA 2A9FA 4IFIA 2BFCA 1CQZA 1HE2A 3SN6A 1YO6A 2C3MA 4LJ4A 2P65A 1NHGA 2PR7A 1FDWA 2XDYA 4QJ5A 4CEIA 4IF6A 3B8EA 2PUDA 2XE8A 4X65B 1LVHA 3R7DA 1H0RA 4RMIA 4WZZA 2VNAA 4M87A 4NCBA 2CJPA 2IPMA 1QONA 3EVTA 4RD2A 1Y1PA 1DP4A 1KKMA 1CDOA 1IHXA 2QG4A 3DMNA 3R3YA 4HNVA 5GOZA 2QU8A 1X14A 1K0FA 4HJRA 2PRSA 3BBLA 1VL6A 2YIJA 3PDUA 4Z86A 3KVYA 3MMZA 3ZJ4A 3ZS9A 4C4ZA 2R3SA 1L8AA 4QBFA 4RLQA 2WWRA 1SXJC 2Z98A 4WNCA 3TIIA 1PZNA 6REQB 2ZOSA 2H7YA 4CR7A 4RTNA 2OP0A 1GKYA 1XTPA 3R8XA 2JCYA 2JS7A 3G2NA 1QFSA 3CNEA 4UE2A 3OU7A 3SF8B 4TL7A 4U7TB 4YHHB 1FXUA 3PJEA 1AQIA 5HJ2A 2LE0A 1XZCA 3GJ6A 1PGJA 4U2BA 2NVUB 4B8ZA 2P75A 3I45A 3PC2A 3WA6A 1PEAA 4DPKA 3HCDA 2FWIA 1RXSA 1TUIA 2B21A 2ACKA 1HYQA 2GKOA 3LECA 2I6TA 3E1SA 3T7JA 2BBOA 3KKZA 5CCDA 4D9IA 1Z12A 3SEQA 4J4HA 2QY6A 2WQ6A 4IJ5A 4CDGA 5I7RA 3ZUGA 5DLQC 2EX1A 3ZHUA 5KQSA 3U7EB 4NBUA 3RTDA 3CVUA 2MINB 1I6KA 5BPHA 5M3BA 3F1KA 3T5CA 1IK4A 1KDOA 3Q3VA 3A36A 4MW4A 3GLQA 3ICWA 3PQ4A 2F8LA 4A9AA 2OCXA 1YKSA 4RV5A 2PYZA 4RZXA 1E9FA 1Q0TA 1IJKA 2V6FA 1VKJA 1POXA 2FG7C 3NKFA 1RRCA 2HWXA 3BORA 1ULUA 3HMKA 3KBBA 4KE6A 3WL6A 3RAEC 2FFQA 4MVWA 2GLXA 2RGDA 2GJAA 2O6LA 3B78A 3MELA 4KYIB 2YHBA 4MUAA 4Y1EA 4AS3A 1UPTA 1Y8CA 1XD8A 3S99A 4TV8A 4BE7B 3FSGA 3SFZA 5KOJA 4DV2B 1C7EA 2JFNA 1V8ZA 1T8YA 2IYUA 4WKOA 5BVHA 1W5SA 4KZPA 1PL8A 5CCBA 4J0QA 4D6PA 1QG4A 1ZD3A 5B30A 4C4RA 2B2XA 1P77A 1SVLA 2I78A 4A8PA 2FUKA 4JX9A 2XD9A 1RQGA 1TVKB 2HQRA 1XKTA 1PV4A 1DWUA 1XZKA 3PEVA 3A9SA 3M6LA 3GXOA 3N7AA 3DL7A 5TGZA 1CUXA 3FHOA 1Y80A 1RWXA 2QZ4A 4WY8A 1AKWA 3NHZA 2MDTA 2NN3C 1WXGA 3DULA 3ETDA 5JAQA 3SYKA 2FWPA 5C7LO 1DBRA 4JYPA 4CEJA 3T35A 2XVMA 3EA5A 5ECYA 4ZEXA 5J2UB 2Z95A 3I9LA 4OLJA 3O8LA 4Q18A 4EUFA 1EGMB 4S1NA 4XQEA 1IEWA 2QX8A 4ZCSA 2N3ZA 2NVOA 3FYUA 5EMNA 1QGED 1RHQA 1WY5A 2B7CA 3R7BA 1JHXA 2P9ZA 4MUIA 2YV5A 3IDAA 1RQLA 4PC6A 3I52A 3T5AA 1HDEA 2QE7D 4CM3A 2PTHA 5DK4A 2PAFA 2CK3D 1T1GA 4LBYA 1SKYE 1SZPA 4W7IA 3ZGYA 5CDSA 1RI4A 1T1EA 1VLJA 2ZJ7A 3ZIUA 2Q99A 4EKIA 4EO9A 3ENVA 3BN3A 4G26A 5JSFA 2BTEA 2O8FA 2PFKA 4K7JA 2G1JA 1SRRA 5IDVA 1CEYA 5I5GA 2I9PA 2Q07A 5G41A 1IN7A 1NX9A 5AW0A 3GEPA 3TUZC 2J87A 3D3WA 1ZUWA 4YP5A 3OY7A 2G1AA 5ECGC 2KLHA 3GNQA 3PX7A 3X43A 2X3FA 2JAQA 4PO9A 2HJGA 3V33A 3THWB 4RF5A 5E6UA 2NLOA 2OCKA 2QPTA 4P3YA 1E5QA 3AR8A 5FL7A 1U1EA 4DIUA 1LY1A 1EHYA 4C3VA 2Z5GA 4CFZA 2A3NA 3HHEA 1R0XA 2RGRA 1T0HB 4UVHA 4UM5A 1U2SA 3IS3A 3UHFA 4DF3A 1FIUA 5HIMA 4O4HA 3NCHA 1OREA 121PA 3TZEA 4Z3OA 4TWZA 4I9FA 3ZHTA 4PGMA 621PA 4WNAB 1RCUA 1EFTA 3ASVA 2WG1A 1XXHA 1I0IA 1TM7E 4ZAXA 5B6JA 1EFRA 4QOFA 1OYOA 3VMFA 2ZKLA 1VHTA 1Y4DE 2VZ0A 2YQ4A 3B60A 3FPBA 2I1LA 3WQRA 2OZLB 1GVHA 3PPWA 1HUQA 3EVAA 3G13A 2FE4A 3I2IA 2A4MA 3WLFA 2W0MA 2XMRA 3ZLUA 4BEJA 3OU2A 3G6KA 1K7FB 3A6KA 3RT1A 1E58A 2NSJA 1F1BA 2XAAA 3DDNA 3QKRA 5HKLA 7YASA 4IZ6A 4MX8A 3W3AH 9LDTA 3PVCA 2FB9A 2HJHA 5J4HA 4MA5A 5GINE 3QVSA 1JEAA 2W2XA 3UOGA 2VNSA 1GA4A 2OXRA 4I55A 1N6OA 1QLHA 3ZDDA 2QD3A 1HDXA 3QP9A 1E2JA 1PWYE 2F67A 2Y8EA 1V6CA 2C07A 4KGZA 2HBRA 4C21A 5J2UF 2FUNB 4L22A 4TGLA 2ATXA 5AVKA 2JBAA 4PPQA 4A2QA 5MF6A 5DO9A 3UBTA 3ZLVA 4I8IA 3ER6A 3ZR4B 5ENVA 2NSLA 2QRQA 4Y0VA 1RHKA 3TGPA 4OYHA 3CUWA 3ZOKA 1KK3A 2EF1A 4YO8A 5LFAA 4NFYA 5EZSA 1R5BA 3V4ZA 4N41A 1EQ2A 2AG1A 3TEJA 2FEAA 1QZ3A 2RG1A 3C24A 2O1WA 1IULA 1N9GB 3P9XA 3QBDA 3QWIA 5HKAA 5J59A 2YNMC 1CJUC 2CFIA 3KXPA 4S04A 1LFAA 3NYIA 2WAAA 3PGMA 3RYHB 1HE3A 5FBLB 1V3VA 2W58A 1P3JA 3LVQE 1C41A 1QCDA 3E5RA 1YC5A 4MQ5A 5HKOA 2P2CA 4XFDA 5PGMA 3EVBA 4L74A 4D9JA 1XRSB 4G8JA 1PJSA 2C61A 4CEHA 2YVLA 2FMFA 3CN9A 1Z3IX 3OM0A 1M1NB 2GEDA 3MC1A 4WQMA 3W5IA 4EGJA 3S8YA 5BNTA 1BXGB 1RYBA 3CNNA 3EZFA 4G81A 3O8CA 3DXFA 1S01A 3FKSD 1CNEA 3KR2A 4AMBA 4C4YA 4ETIA 4R9VA 3LD9A 1AUPA 2W90A 3ROMA 3SSNA 3ZS8A 3ZWYA 1FNBA 4Q93A 3C15C 2XOKD 1YH3A 4NG5A 2C5EA 3STYA 4R6XA 1DQRA 4EBFA 2J6BA 3S7TA 3WWYA 4WIAA 5IXSA 3TM5A 1JNYA 1GZDA 3OE5A 1E5VA 3DAYA 2YR0A 1QGDA 2FEOA 1BS2A 1MOPA 2QX6A 1P7PA 1N5LA 1VJ0A 3RS7A 4PY2A 1YAHA 2POCA 4TRMA 2V97A 4JQSA 1RLTA 3D1VA 4GI3A 2AXNA 1PG2A 3QMPA 4F2GA 3PPVA 2FZGA 2CN1A 3DZBA 3WBFA 2QD2A 3HI4A 1J2TA 2IIBA 1WHSB 3AVUA 3U3OA 1E9EA 3QVVA 4NNJA 4Q4AA 2JFQA 4Y9TA 5TXGA 1GZ4A 1H9CA 2Q46A 4C5BA 1Z06A 3COWA 4UZFA 1L7RA 1I2BA 4PLPA 5FBQB 2R1TA 4FM9A 5FFFA 1FNDA 1QCCA 3PUVA 2YIMA 1IE3A 2GJ9A 4UREA 2EWMA 4LRWA 4CLHA 1P0PA 4J1TA 4DCUA 2EJTA 3L1JA 2VP0A 2X9LA 2FOLA 3H04A 5T3UA 1CDDA 4B8WA 5K05A 2YJNA 1N8TA 4JP8A 4PAWA 3WYGA 5JI3E 2CWDA 4E4YA 5KNBH 3JV7A 3RUDA 1N2JA 4XLTA 3GGDA 4Y2RA 5IBRA 5TE9A 1BJKA 5EJ4A 5KZMB 2EZTA 5LZ8A 2JLUA 1UM9B 1I2MA 3HDTA 3RC9A 3TSAA 1YS6A 3M6FA 1SQFA 2RHJA 3IB6A 2A9PA 1VIDA 3QKUA 3DAFA 4QXMA 3ZZ0A 4HJXA 1NKVA 4MYDA 1L5LA 1Z5WA 4Z49A 3H4IA 4UHFA 3QXGA 1C1XA 2ZIAA 5C9ZA 4F0JA 1YOBA 3NHYA 4CF4A 1H93A 2ZBPA 3B3AA 4MV7A 4RYLA 3TMKA 3HVHA 3IQZA 4CN9A 1KY3A 1H65A 1FYVA 1Z15A 4FIZA 1BQ4A 2OKCA 3D6MA 3GGSA 4X60A 3S40A 4X7PA 3BE6A 2DJ5A 2ZJ2A 1Z29A 1T4GA 4LRTB 1XTRA 5CT8A 4FIDA 1TO1E 5I5EA 2ZWMA 3RLFA 1W87A 2R6AA 4G5HA 3SC4A 5THXA 1KO5A 4XJTA 2DQSA 2HMSA 3KU1A 2H0AA 4BVHA 3VVBA 1CVLA 3I3SR 3LTEA 2VNKA 4AP6A 2Y66A 3IUMA 2I2BA 4OMUA 4DA6A 2Z1NA 1JR3A 3A1SA 3BIOA 4TS1A 2XDQB 3B82A 3IHLA 3CEHA 3THWA 1KAOA 4KC0A 4YP6A 3LQFA 5LQJA 3T95A 2JIZD 3P0FA 1A3CA 4ZIRB 3VC1A 4K6GA 1JALA 3HKEA 4AN1A 1QC5A 3TZQA 2FK7A 1YZYA 2HSJA 5EJ5A 5H9WA 4MVJG 4KIUA 1GITA 1QJCA 4YJ3A 4C5CA 2WIFA 4CMEC 4MWGA 3Q12A 2X4DA 3EZ2A 2Q29A 1VJ1A 3IIMA 1WSBA 3HUUA 3DE3X 2PE5A 3SHVA 3AB7A 4ZZ0A 5LKRA 2ICAA 3LQ2A 3D5EA 4QLOA 5DKFA 2Z2XA 4RSRA 3L6RA 3UJPA 1Q3TA 4FNGA 3LLCA 4RGQA 4C87A 2DQKA 2IODA 4UFNA 3URMA 5IAOA 4INPA 2H51A 3VU0A 1QYDA 1W2GA 4WPGA 1H5NA 1FP6A 3QUBA 3T3NA 5AJXA 4JVSB 3E61A 1O6ZA 4C20A 1TA9A 1D0VA 2FF5A 3ZQUA 1F6BA 1E59A 2AZTA 1MXHA 2OQVA 3S6JA 3WBKA 1UKZA 2OO3A 4LXQA 1FUEA 1XFAA 1FP2A 2ZANA 4F5WA 4NMLA 3MBIA 3QLVC 3RFCA 3ZWXA 1UAGA 4ZHQA 5HNKA 1EESA 2CYAA 3VNAA 2O5CA 4M1QA 4QG7A 1B1AA 2ZRKA 1BROA 2FPXA 1X8XA 2IGTA 2GXSA 1G8MA 2IXFA 2CHEA 4KK3A 4RQUA 4MPJA 3GFPA 1NW3A 3NRBA 4WFIA 3W9BA 1UPFA 4CNQA 3IL2A 1GQOA 1PNQA 1I5EA 1TPYA 3NXSA 3CF4A 1ZJ4A 1VZ2A 2AJCA 3WP1B 4ZAZA 4B9AA 3E2MA 2RHCA 3WNVA 2BEWB 3R7WB 1F9EA 1G5RA 1Z0KA 4G2NA 1I1HA 2EZ4A 5G0TA 3NC4A 2PSFA 2WF6A 1ZO8A 1R4MB 3I37X 2A67A 2PZLA 4B83A 1HKUA 2OTCA 1R6VA 2UYQA 2DFLA 3EW7A 2WUEA 2AC2A 4DZTA 5DH9A 2D5BA 1NVMB 3IJEB 1NULA 1DHTA 2AEEA 1SUBA 2OFPA 3LSTA 1ZUHA 3QFFA 5TC4A 4HZIA 4LW8A 4FONA 4BKMA 1LLFA 1R0RE 3PNOA 4HNGA 2VBGA 1INLA 3GMIA 4F5EA 1JIUA 2OBYA 4UUNA 1QANA 2WHYA 1BKYA 1GY8A 3WMXA 3NS7A 3CRMA 2ZIVB 4LCEA 3QVXA 3FTEA 4AJEA 3VH3A 5IM4A 2GRAA 3OUZA 3IVGA 4GKAA 3KT8A 4FC7A 2WHRA 4P3PA 1OV6A 1I2CA 2ZRPA 4JQZA 4M7WA 1A2OA 1RJ9B 4RAQA 3UVEA 4C1NA 4CQMB 3K71B 4TV9B 2GM9A 1GGNA 1HSOA 2CBGA 2VWQA 3OX3A 4ZOLF 3I05A 3RJMA 3SEZA 4P0QB 1LJ8A 4OI4A 3JQAA 1J5XA 3HB4X 2W2VA 3EF3A 4YBZA 3PCTA 3LQ1A 4AKGA 4EG7A 2A0YA 2UZ0A 4YJ2B 1B0AA 2G17A 3BA6A 1BH2A 2E85A 4YUAA 1AMNA 3DH0A 3NIDB 4C0BA 1JH9A 4C7OB 3QXHA 2HLPA 3ND9A 4P5PA 1JR3E 1XEAA 1I94B 3R4CA 4KSYA 2X6RA 1QV9A 3UAYA 3CKYA 2FSVA 1Q74A 2GBLA 1TT5B 1UK6A 4X7RA 3I1IA 3IFSA 3IELA 3K70B 2Q1UA 5ERGB 5IYZB 1FQOA 3RNLA 1OILA 4XTRA 4MV5A 2ODWA 4V3CA 2CCGA 2GYVA 4ZKDA 4H18A 3QOXA 1CR6A 2JGIA 4BATA 1H9BA 4DLZA 3Q2OA 5K0EA 1KA9H 4LHEA 3R24A 3MPUA 2V03A 2L18A 3IBFA 1MAHA 3VXKA 1NJ6A 3PLAE 3KYBA 1CQPA 2AVDA 1T4MA 3O0DA 4UASA 3RANA 1QB8A 4R5HA 3EOBI 5DHAA 3A7EA 3CT6A 3GMSA 4H08A 2ZYIA 1N5RA 4JZYA 2PQ0A 4B6EA 1F51E 2WF8A 1DKUA 5HM8A 1MT3A 2P11A 3CR3C 3B6JA 2M6LA 3KJFA 4FFMA 5DGTA 4O3MA 2ZYVX 2GBGA 1IIRA 3OZSA 3X44A 1H05A 2Q41A 3A9VA 4MKGA 1DWPA 2DC1A 4BKOA 2AQHA 4B4DA 3DHNA 4L4YA 4ENQA 1BCRA 3SHOA 4NU0A 1YRAA 1ZOOA 4GWKA 4KXXA 3MRSA 4ASUD 1U7TA 2WAYA 2QRHA 4WDQA 3DDSA 2UZ4A 4N7BA 2H1FA 2XH8A 3WV4A 1CRWG 3Q2KA 3UMVA 3P27A 3FOCA 2WTAA 1H4QA 2DXIA 2P6NA 3BX1A 3G89A 3K5WA 3TSCA 4IOMA 5B7PA 1M8PA 3NIWA 2M6SA 3DBHA 4P83A 4V0MA 1SB8A 4INAA 5C3MA 2PLAA 2QGNA 4PCLA 2VQFB 1FJXA 4NAUA 1AS2A 2B98A 2W6NA 3CH5A 1KFKB 3JD1A 5EMHA 4L3WA 5C80A 1YR8A 2VQSA 1DX4A 2D1FA 4RLFA 1UWLA 5CYFA 4KQ2A 5H83A 2V3WA 5JD5A 5TS2A 1J2YA 3FNEA 3F6CA 4LDAA 1H85A 2J5BA 3NRJA 1MPXA 4J0EA 1E2GA 2GCOA 1XMIA 4QLBA 3N8KA 4WLUA 5DHFA 1V96A 3KM0A 3TFOA 1GPMA 5EJGA 3Q4GA 4PINA 1T4DA 1J8DA 4NPCA 1DRWA 1JU3A 1ZVKA 2GK4A 2P3LA 3DE7X 1D0SA 3O94A 4FFOA 4HZUA 4LC1A 3TG2A 2VTVA 2XB6A 2H48A 4PFJA 3H0EA 3AHJA 5CYGA 1CNMA 2G1KA 4HPJB 4Q39A 5KB3A 3FMVA 2XVXA 3HKCA 4WNAA 4QQNA 3X1MA 4KH0A 4HAIA 1E2EA 3LHSA 4RY0A 1L4YA 2DHEA 3RGWS 5BN3A 4NULA 5BR4A 4B3GA 3QKWA 5KSZA 1T2EA 1J2EA 2DQZA 2AR9A 3ANMA 1RC8A 1YB4A 3WLQA 1WEKA 3L0CA 2WTEA 4TLBA 3P5BA 3MWGA 4ZD6A 2OBNA 4IMJB 4L8LA 3NNSA 2RGNC 2DY1A 5IP5A 4CI9A 3DDWA 2FSFA 4FFRA 2FPPB 5L3QB 2PSSA 4G3XA 6ABPA 1XN4A 2OSBA 1JDNA 1T9AA 5C8VA 3HVUA 1G41A 3AUAA 3K6KA 5FDFA 1XMOB 5F7ZA 1XLWA 1G8JA 2V7BA 1Q5PA 2VWHA 3CNQS 1O95A 3NALA 1YVDA 4IO0A 1O0SA 3C3JA 4LGYA 5EIAA 1VSVA 1YMQA 2F3PA 4I4TA 5A3JA 1V25A 2PJZA 4D3FA 2XTNA 1X0XA 5T64A 1Y8ZA 1MJGM 1Q3HA 4HV4A 1EFVB 5IABA 3RVLA 4FW9A 7GPBA 3AC0A 1BRMA 5B1HA 4I19A 5IKXA 2YN2A 3IUYA 2GAAA 3CEJA 1JPNA 1UDRA 1N5DA 1YE5A 4DIEA 1JAXA 1CUWA 3PNPA 1OE0A 4NOLA 4I4LA 5KOYA 1QE0A 4FMDB 4LUCA 4U7FA 3BWXA 3NNDA 5HFAA 5I4KA 1U8ZA 1HGXA 3N87A 4AZ0A 2Z08A 1FFGA 1O9BA 1X70A 2J5XA 1NVXQ 3SY8A 4ZOEA 5A6SB 1KF0A 1A8UA 1PQYA 4IINA 5BT9A 4UTPA 2WINI 5BNFA 5EINA 1XVIA 2C0PA 2YNMD 5COQA 4YT5A 3R8CA 2IBSA 3ZW8A 2HA4A 4O4HB 4J9UE 1GTVA 5DXJA 5FJIA 1POWA 3DKKA 4FE3A 1OFGA 1WVGA 2J3JA 4D0RA 4EH1A 3MJDA 1VE6A 4C2AA 3AM1A 2NZUG 1IOVA 4BN4A 5CFOA 2FQWA 1SXGA 3HGTA 2V6MA 4QASA 4IVPA 1GV1A 2WM9B 3V8QA 1K7YA 4I50F 3VU9B 3ZBTA 3CVWA 1GFZA 4U3JA 1VPVA 3JWGA 2YCLA 2DRIA 4FHEA 2NU8B 4IOJA 5REQB 4OXQA 4F97A 3A1CA 3LIPA 4IZHA 4R2WA 4B9EA 4EA9A 4UUMA 3SHWA 4GPZA 1D2MA 1XAHA 2J9FA 3IHWA 4CUZA 4ZYTA 1E3IA 3SBDA 4WEOA 3SNKA 5JNVA 3DM5A 3OP1A 5ED0A 2BF7A 5FI1B 5ELMA 5AKZA 2C7RA 3GJ7A 3GK3A 1QHFA 1DTWA 2ESRA 4UUPA 2GN6A 1NR7A 5BW4A 3BFPA 2KWIA 4Y2UA 1PS9A 2OECA 4KPGA 5KCZA 1KZHA 4KV9A 5HP4A 4I5DA 4EHLA 4A8JA 1HQYE 2ZTMA 3LVFO 4L8WB 5FNVB 1XDWA 2G8LA 4OXYA 2GPTA 4CKWA 4HO1X 4F46A 2EX0A 1PV2A 2VXYA 1LQ2A 4WX2B 5AI5A 4AN0A 2YZ7A 4IH1A 3I6MA 4LDNA 3GQBB 4INZA 3WRYC 4R05A 4MKHA 2R44A 1ST3A 3JVDA 5JPIA 4HVLA 3F8TA 4PN7A 5BW5A 1I9GA 1YQQA 5HZMA 4QREA 1XA4A 1KVUA 4JBHA 3OFSA 2MMCA 4QUBA 3EIXA 3NUGA 3P2MA 1A82A 4FT4A 4OMFG 4DCJA 3RYCB 5JSUA 3NHFA 4BP1A 4K5QA 3F6RA 4PLTA 3RC1A 1FTQA 2GEUA 2AZMA 3WHKA 4MQFB 3QBVA 4NP6A 3Q7IA 5JV5A 1OJLA 2Q0HA 3KLBA 4P4SB 3ZHBA 1G8GA 3BRSA 1NDUA 4EB3A 4Q34A 4BZQA 1YWGO 2GWHA 2YWDA 1ZY2A 1TQ6A 4M1YA 1IZ8A 4GVPA 3UAXA 1OTYA 3O4VA 4N3GA 4HUQA 4KUHA 2FTKE 3U17A 1SVKA 1IBRA 1CTQA 1OVGA 2MSEB 3F7TA 1OXUA 3K20A 3VR4D 4D25A 4D2IA 3V1NA 3A04A 4R8VA 4G4JA 4BBAA 1RYZA 2D3TA 3W3AA 4NEHB 2Q45A 4Y6GB 4KIGA 4EVSA 3GFSA 3LCVB 5L51A 5FF9A 1UJBA 1QRTA 1ZJYA 2HRBA 4XX0B 1E3DA 2WJPA 2G9VA 2YHIB 1AY0A 3LPMA 3Q3EA 1E3WA 2NGRA 3ZBUA 2RHLA 1PNVA 2J07A 1I6WA 5F23A 2GPYA 1BDBA 4WZBB 3DMTA 4HAXA 4QU9A 2NU6A 3IQDB 4B32A 3D5TA 1VL2A 4MQBA 5JO9A 3I2JA 3MEQA 3MW8A 3EZGA 1SD2A 4LKRA 3G9QA 4NY1A 3ZWVA 2ZR7A 2ZK7A 2I4MA 4W6QA 2VF8A 2JK0A 4FW8A 3F9RA 2GF0A 3C3KA 4KZKA 1G8YA 1WXEA 3HY3A 2RHBA 3CJQA 2RCYA 2P35A 4CTJA 4L5CA 1G6OA 1NASA 4EHJA 4FMCB 4YV1A 4MR7B 1AGRA 3INNA 3IIKA 4AMGA 2PMBA 1PFYA 1FJ2A 1EWRA 3L6OO 2ZE8A 1EDDA 2OV2A 3AB8A 3GZTB 3C1UA 4OFWA 3HXQA 3EDMA 4E46A 1E89A 3CKMA 4HRYA 2DWCA 3TW6A 4ZHQB 3DMRA 1TYBE 3HU3A 3P94A 1AQJA 1QYWA 5FTNA 3FPKA 3LDGA 1R4NB 2F7SA 1ZVVA 4TMYA 5LP6F 4TRNA 3IV6A 3WY9A 2OAEA 3LY8A 1K4KA 4DN6A 5LP1A 3W4JA 3D1LA 4PU0A 4BU1A 2ZRQA 2PUBA 3HTXA 3DTVD 1JB9A 1CE8A 1KEVA 3QY9A 4HQRA 1YU9A 4MSUA 3E05A 5SV2A 4DYVA 1I7DA 1BQEA 1GTJ1 1H8EA 4TM8A 1GPDG 2ORVA 2BMAA 2PU5A 4PR3A 5FQNA 4ZC1A 2VYNA 1E1LA 2WYOA 1BEUB 1FSPA 2JAHA 3MWLA 1GZ5A 5IKOA 3RK0A 3FN4A 4TKLA 1Z0DA 5AVTA 1EFDN 1GPBA 1PJBA 2RC5A 1W5EA 4L2IB 4DJJA 5JZMA 2CWWA 1YULA 1YFLA 2HQSA 3HY6A 1TRKA 4RA9B 4TXLA 4E1VA 1OH6A 5LMCA 3BGIA 4X1IB 2E7ZA 4GRIA 3OJFA 1W47A 1KE1A 2X7JA 2NO4A 2IUYA 4MR8A 5U1PA 3TTSA 2GZHA 1X1BA 4OA5A 3FUXA 1GNLA 3A6GA 5EHZA 2ET6A 1XZDA 4A6PA 3OJCA 3ICOA 3OFNA 3W78A 5K6AA 5KO2A 2CLFB 1VHLA 2E48A 3RFUA 4KBYA 3UUFA 1SKAA 4DKJA 3MMSA 4QQFA 2IUTA 3L82B 3ZHXA 4Y2PA 1NBOA 1G42A 4RE5A 2ZPUA 3LPNA 5F52A