1IUPA

Meta-cleavage product hydrolase from pseudomonas fluorescens ip01 (cumd) s103a mutant complexed with isobutyrates
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
271
structure length
271
Chain Sequence
NLEIGKSILAAGVLTNYHDVGEGQPVILIHGSGPGVSAYANWRLTIPALSKFYRVIAPDMVGFGFTDRPENYNYSKDSWVDHIIGIMDALEIEKAHIVGNAFGGGLAIATALRYSERVDRMVLMGAAGTRFDVTEGLNAVWGYTPSIENMRNLLDIFAYDRSLVTDELARLRYEASIQPGFQESFSSMFPEPRQRWIDALASSDEDIKTLPNETLIIHGREDQVVPLSSSLRLGELIDRAQLHVFGRCGHWTQIEQTDRFNRLVVEFFNEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of a meta-cleavage product hydrolase from Pseudomonas fluorescens IP01 (CumD) complexed with cleavage products
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Hydrolase
molecule keywords meta-Cleavage product hydrolase
total genus 102
structure length 271
sequence length 271
ec nomenclature ec 3.7.1.9: 2-hydroxymuconate-6-semialdehyde hydrolase.
pdb deposition date 2002-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1iupA00
2VF2A 3GELA 2OCGA 3H1BA 2BUAA 4AO6A 3VJMA 1ZGCA 5BWCA 4K5QA 1Y37A 4W1PA 5AJHA 3FLBA 4Y2VA 3DL4A 4BVKA 4HS9A 1CUZA 2JGJA 3JW8A 5AP9A 3FSGA 2CEKA 1BROA 4BDSA 5AM1A 3O4JA 3L1JA 4WY5A 3AINA 3IVMA 3BF7A 4Q34A 2FUKA 1EDDA 3FYUA 4WFIA 2WTMA 5DTJA 3DKRA 1AMNA 3WYNA 1R3DA 4BTLA 3MVEA 4L0CA 1RYYA 4HRYA 1IUOA 3HXKA 1NU6A 4BP8A 1TQHA 4X00A 4MYDA 5K3EA 4RGYA 4UFNA 2WG1A 4L3WA 3EQ9A 4B0OA 5ALEA 2WG2A 1KU0A 2CZQA 4CI9A 4NMWA 3IIIA 4E46A 1SOMA 5DNVA 1XZCA 3NUZA 3PDCA 5AM2A 4G9EA 4ZV9A 4C4ZA 2HHAA 3BL8A 2AJ8A 4CG1A 1HKHA 1ZI9A 1GPKA 2HFJA 3AIOA 2XUGA 3HRHA 1I6WA 1Q0ZA 4PW0A 4BB0A 2YXPX 1HLGA 6YASA 1UWCA 4DMFA 4EA6A 1JJFA 4MEBA 1UK6A 5AICA 5IKXA 2QM0A 1VKHA 4OB8A 4EY5A 2DCMA 1FSSA 2R11A 1CUAA 2JGKA 3WKEA 4HXFB 1AZWA 1OXMA 3DD5A 1JU4A 3C43A 1AURA 3D2AA 1HQDA 1VZ2A 1W1IA 2DQYA 4EY7A 4U2BA 3OM8A 3YASA 1P0PA 2G5TA 4GDMA 2OPHA 2OGZA 4M0MA 3ZI7A 4OUKX 1EDEA 4C6HA 5T4FA 3SX4A 1BN7A 4YPVA 3M81A 5ALHA 1BRTA 3MUOA 2WJ6A 2JGLA 3ZWQA 3I2IA 4BBZA 3H2JA 1Q83A 4J7AA 4KE6A 5HF9A 1TKRA 3F96A 4QA9A 3G0GA 4I4CA 1JJBA 3STWA 2BGNA 5C7YA 2BCEA 2J4CA 1CUWA 1TAHA 5LKAA 4F0JA 2B9VA 2HRRA 5A7FA 3ANTA 3H2GA 2VATA 3ZLUA 3NOXA 2XUAA 1TCBA 5JYCA 1QOZA 2ZVDA 4AN0A 4XIIA 4G8CA 5ISMA 4CIBA 3W04A 3AFIA 5K3BA 5DNWA 3F9CA 2C5FA 4HAIA 4ZI5A 2WFMA 4B81A 1AX9A 3GA7A 2WJ4A 1DTEA 4WY8A 1J06A 2WIKA 2WUGA 3JWEA 5AK5A 3LIIA 4EY8A 5HK8A 5IVIA 1ODCA 4BC0A 3G9UA 1BS9A 5JAUA 1XZGA 3QH4A 4J0HA 1N5MA 2V9ZA 5ALJA 4FWBA 5AKYA 3C6ZA 2V96A 3STYA 1FFEA 2IIVA 5AIAA 4PSDA 4S0XA 1KEZA 2I3ZA 1XQWA 1LBTA 1S8OA 3AZOA 3LLCA 1M33A 5J3JA 4C4XA 5DNUA 3A6ZA 3NGMA 2XMCA 1ODTC 5DLPA 4BAUA 2XUFA 3R41A 1N8SA 1IZ8A 3G0IA 3QPAA 3D3NA 3O95A 2GBCA 4FLMA 4RNCA 2VAXA 3I2GA 4DNFA 3ESCA 3DQZA 4H7IA 3AZQA 5ALPA 4TPKA 1MPXA 1LBSA 5ALUA 3PUIA 1XFDA 1R50A 3A2LA 4AO8A 1L7AA 4CCYA 3R3VA 3QITA 1IMJA 5LIPA 4X94A 4P08A 1YS1X 3M83A 1VXOA 4DMCA 3QM1A 1CEXA 3C70A 5AKZA 3CCBA 5ALGA 1EA5A 4X97A 3WK5A 2PUJA 4UBOA 2X5XA 2Z8XA 5CT5A 4C88A 3GZJA 5CH3A 2YYSA 3TGLA 3D2CA 5YASA 5HZGA 5JZSA 1XZFA 4B6GA 2ECFA 4UBJA 1UXOA 1G4HA 5HFNA 1K6EA 4OPMA 1A8SA 1E3QA 1XZJA 5EHNA 3FAKA 1GKLA 1GXSA 2JEYA 2HA6A 4DNOA 4N8EA 1ZD4A 5CW2A 5ESRA 2X76A 1HBJA 1VXRA 4ZREA 3RLIA 2XUHA 5AI6A 3R40A 1CV2A 5LZ8A 2XMBA 4AZ0A 4E15A 4JEIA 4Y2RA 2QRUA 3KOOA 4Y2JA 1U8EA 3WIOA 3VDXA 2XMQA 1CUBA 1R9NA 3WL5A 1CRLA 1W75A 1XZDA 5A71A 4PV7A 3EIOA 5FXMA 5ALYA 2J4FA 3LP5A 4KE8A 5ALWA 4WFKA 5AK6A 1ZD3A 4CG2A 2AJCA 2XMSA 3GFFA 5AHXA 1G5FA 1O6FA 3K2IA 4O08A 3B3QA 2WUFA 1AGYA 1WM1A 4QE3A 5EFZA 3G0BA 1UK7A 1QE3A 4OD0A 2H9YA 2AJDA 4KRXA 1AUOA 5JADA 4JNCA 4J0GA 5HF5A 2DQZA 4GECA 4KEAA 1BEEA 1YAHA 1Y7IA 2G4LA 4UHFA 5ALTA 3KDAA 2BUCA 3H2IA 4AXBA 1EVEA 5CT9A 3T52A 4BRZA 1A8QA 4DSZA 2HM7A 4X85A 3WJ2A 2XQGA 1VZ3A 4Q3LA 1MN6A 1DWQA 1FFDA 5ALSA 4GLBA 3H2KA 4H18A 3I1IA 1UOQA 1CVLA 1FFBA 3R3WA 3FCXA 2AXEA 4ZGBA 1OCEA 1QGED 1XLUA 2XQFA 1DX4A 3AIMA 5CT8A 2O2GA 4G9GA 4XX1A 1EVQA 3PI6A 2WILA 3I2KA 1GPLA 1L7QA 5AIBA 1LLFA 1K5PA 1MU0A 4Q3KA 3WZMA 5FUMA 4Q1VA 3GBSA 2I03A 5C8ZA 3DJYA 1R4ZA 3HZOA 1Q0RA 3QMWA 1B6GA 5EHZA 5E4YA 1YB6A 1RWQA 3WKDA 4K2AA 1ACLA 3WK8A 4BZWA 1THGA 5AI4A 2WHRA 4Y2SA 2V97A 5AM3A 4X91A 1HL7A 2AJBA 4H7JA 2JGFA 4OCZA 5EHQA 5AM0A 5A6VA 1ZD2P 5T4BA 4X7BA 3BE8A 1QIMA 3OC0A 4EHBA 3C45A 3FOBA 4FFWA 3W06A 2PUHA 5JALA 4FDMA 5E4TA 1XZKA 1MAHA 3KSRA 4B83A 4NVRA 1E8DA 1QJ4A 2XB6A 4KAFA 5HKAA 2C5GA 3WA7A 4E11A 3E0XA 3QZUA 4U2EA 4Z49A 1XKTA 4EY4A 3WJ1A 2CMFA 1MX5A 4BAZA 5CTAA 3WKCA 1OILA 3A2MA 5IH7A 3PF9A 5SYMA 3K6KA 5ALXA 4CFSA 1D07A 2CUTA 1QZ3A 3WIBA 3QYJA 1DINA 2Z8ZA 1X2EA 4DTCA 2ZSIA 1PFQA 1K8QA 2C7BA 3G02A 4H35A 1QIJA 5ALOA 1CR6A 1WB5A 4LXHA 2HA4A 4MQMA 2QVBA 1JMKC 3O4IA 4BZZA 2GBFA 4IHAA 4H7DA 1CIJA 1EINA 3WK6A 4OYYA 4UHEA 3VISA 2PSHA 5DWDA 3MGAA 2Y6UA 5CT6A 4QEKA 5LZ5A 4BDTA 1CUUA 3WWCA 1CUSA 2GBGA 3U1TA 3D0KA 4WCVA 2C58A 1QIHA 1LPAB 2B4KA 4Y2TA 3F98A 3KXPA 5HQ3A 1DWPA 2ZJ6A 2WM2A 4ZWNA 1BU8A 1JMYA 1YASA 1SCQA 4RPCA 4LKOA 3VVLA 2WHPB 3QMMA 2QMQA 2XMRA 4GBGA 5KWJA 1XRQA 3WMRA 5LYYA 4UPDA 4PQEA 4PSCA 1QFSA 1WHTA 4MQLA 4AMZA 3WYDA 2QT9A 1TIBA 3W9BA 3STVA 3UUEA 3BJMA 3F97A 4EZIA 2HDWA 4ROTA 5AKEA 5HKBA 1AC5A 1AQLA 1ZD5A 5JAPA 3WWEA 3ZPXA 3TJMA 1XROA 2HA3A 1CUVA 2PM8A 4KE7A 5AM4A 1WB6A 3H04A 3DL7A 1R1DA 3OPMA 3WK4A 1YR2A 5K3FB 3CCCA 2XUIA 3WL8A 4ARAA 3H2HA 2VAVA 1THTA 5ALIA 5LZ7A 4WFJA 4Q82A 1LZLA 5FDFA 2WFLA 3AILA 4P93A 1ZI6A 4LXGA 4P92A 1ACJA 4KACA 2Y2UA 4JYMA 2DHCA 3V1LA 2HADA 3WKBA 2JBWA 3STTA 2PX6A 3Q0TA 5SYNA 3FNBA 4UHCA 1ORVA 1T2NA 4F21A 3OTQA 4AZ3A 2WFZA 1MAAA 4X92A 4GW3A 3FYUB 2CJPA 4Y2XA 4EB0A 1GPNA 3I1YA 1TRHA 4BP9A 2ONCA 2GYVA 1XQVA 3AIKA 5LP1A 3UMJA 3O0DA 3SK0A 2QTBA 2XMDA 3GUUA 3I28A 1MTZA 1ISPA 5BOVA 5JANA 2VT6A 1QTRA 1P0QA 2OXEA 4TVKA 2XT0A 4WDQA 5HFAA 2HIHA 1MX9A 5EHXA 2D5LA 1JJIA 3KWJA 4DMKA 3I2HA 4F60A 1YA8A 1X2BA 1BE0A 2H7XA 3FVRA 1QO9A 1QFMA 4W9RA 5LZ9A 5EIEA 3W05A 4LYEA 5D7BA 5I8PA 2RI6A 2XE4A 3ESDA 5E4JA 4K6HA 2JEZA 4F5ZA 3H19A 1L7RA 2RHTA 2O2IA 1XQYA 3C87A 2ZYSA 1DQYA 3IUNA 1DWOA 2K2QB 4V2IA 4AN1A 1DT5A 3B5EA 3U0VA 5ALNA 1LPOA 1WPRA 3PFCA 3AZPA 4B80A 4AQDA 4DMHA 2BFNA 2WHQA 2Y2VA 1QIDA 5F4ZA 3W9UA 2Q0XA 2JIDA 3STXA 4M0EA 2DSNA 2FJ0A 5D3ZA 5AM5A 3R3ZA 1H22A 5HCUA 3G7NA 4EUSA 1LPSA 1F0NA 5T4EA 2QKYA 3VJLA 4UFPA 1EB9A 2OQIA 1F6WA 1VA4A 5C8XA 5AKLA 4MJ3A 5FPPA 3O4HA 1CUGA 1GT6A 4UHDA 2GYWA 5DYTA 1CUDA 1U65A 4B0PA 3CN9A 4UBKA 1ZICA 3TEJA 3WL7A 1MJ5A 5K5EA 4W1QA 5BV7A 2PSDA 4CG3A 2Z5GA 4UBMA 1XZLA 2PKYX 3EF3A 2CB9A 1WB4A 4Q3OA 5DYYA 2OGSA 3IDAA 2YH2A 1F8UA 5ALDA 3TRDA 3FYTA 3FSGD 1CPYA 1LGYA 1ZI8A 4X90A 4ARBA 3L1IA 3KD2A 2B61A 2QJRA 1CUCA 1TCAA 2PSFA 3RK4A 1AKNA 1QIGA 1GKKA 4MYSA 3WK9A 1XZIA 2PU7A 5ALZA 1LPMA 3V1KA 2OAGA 5AOAA 3C5WP 5CXXA 3A2NA 2QJWA 2VEOA 4D9JA 4G5XA 3O4GA 1EK1A 1YA4A 3D59A 4Y2PA 4Y7DA 5A7HA 4Y2UA 5E2IA 4UBIA 5EGNA 3WZLA 4I19A 4C01A 1H2XA 2XUOA 1YSCA 3I6MA 3OG9A 4PSUA 3LIPA 2XLCA 4BCDA 1BEZA 5JD6A 1EXWA 3MUNA 2XMGA 4N8SA 5JIBA 1YB7A 2RONA 4UBNA 1GZ7A 3FVTA 1XQXA 1PV1A 1J2EA 3C6BA 3HJUA 2OAEA 1FFAA 5T4HA 4JH0A 4FNMA 2P8SA 2CKMA 4FBMA 3IURA 4Q05A 4KAJA 2J3DA 1USWA 2XUJA 4IQ4A 1GGVA 4QWWA 5IVHA 1VJ5A 1CUFA 4QDZA 1J1IA 2H7CA 1XKLA 3ED1A 4U2CA 4INZA 4Y2QA 3B12A 3I2FA 4FLEA 3VVMA 5JZBA 1W52X 3WLAA 4KE9A 2Z3WA 4UHHA 1DT3A 2XI4A 3X3HA 4HVTA 5D3KA 3QMVA 4IH4A 4X6YA 1ZIXA 1XZBA 4KRYA 3F67A 3DCNA 5D6OA 2QS9A 2WG0A 2XUPA 2OCKA 4G1FA 3I6ZA 3RARA 4K6GA 1LNSA 1U4NA 4BE9A 1VLQA 2XUDA 1IVYA 2XUQA 3RKSA 1JKMA 4XJVA 4MWSA 3WWDA 1BN6A 2EEPA 3G0CA 4L9AA 3V1NA 2FX5A 4QLAA 2JGMA 2PVSA 4B9AA 3EBLA 4LHEA 5A62A 1E89A 4OB7A 4FFVA 3PF8A 2WHPA 4NZZA 5EIAA 3DDUA 4HXEB 2HU5A 2VSQA 3ICVA 3WA6A 4J03A 3DYIA 5EI5A 3H0CA 1LPBB 4MEAA 2Y6VA 4ITVA 4N5HX 4A23A 5CBKA 3WWPA 1WOMA 4OB6A 4DNPA 5HK9A 5ALVA 3UUFA 5JZ9A 4FKBA 1ZOIA 3FBWA 4JYPA 3DOHA 1QIFA 2HA5A 3HABA 5HF8A 2FJPA 1Q84A 2OQVA 4BRSA 3S8YA 4M0FA 3DNMA 4N8DA 3ILSA 5AKHA 1K4YA 4J0CA 3VKFA 3BDVA 5AOBA 4QDXA 5KBYA 3K9BA 2RGUA 4DNQA 2G5PA 4H7HA 5BWBA 1IUNA 4W1SA 4PO3X 1UFOA 1A88A 5ALQA 1NU8A 1FFCA 2PL5A 5AI9A 1O6GA 4BE4A 1J07A 4OSEA 4ZV7A 5DYWA 1JU3A 1A7UA 2YASA 1MNAA 2NW6A 5ALKA 2QZPA 5HF6A 2XQJA 5CMLA 5ALFA 4DYHA 1ZGBA 3WK7A 5AO9A 3V9AA 3I2JA 2AJLI 4C4YA 1MNQA 1XRPA 5IVDA 4P9NA 3IBTA 1UK8A 3PICA 3RM3A 5A2GA 3N0TA 1QO7A 1EB8A 1F0PA 2OLEA 2ZSHA 1CUJA 1CUHA 2VJCA 2PPLA 3R0VA 2OCIA 1UOPA 4UUQA 4BATA 3OURA 4QZVA 5K3AA 4BCCA 3QPCA 1DU4A 2BUBA 1G42A 4J0DA 1VOTA 4TGLA 3OOSA 3G0DA 5CURA 4LXIA 1C7IA 4G4IA 1XRRA 1W76A 4U2GA 2EDAA 1TK3A 1XRLA 1H2YA 5AKKA 1H2ZA 4G4JA 3SC2A 2XUKA 1X70A 2RHWA 2DR0A 1R88A 1TCCA 1QLWA 2I3DA 1XZHA 1B41A 4X6UA 1QIKA 1H23A 2C0PA 2WFLB 4UFOA 4DLNA 4YK7A 2B20A 4HZGA 2OGTA 5AKIA 3VXKA 2GZSA 4AMYA 3T4UA 4GWLA 7YASA 4X3CA 4MXDA 3G8YA 5AOCA 3ZLVA 1G66A 3FYUC 3H17A 5JAOA 4U2DA 2RAUA 3PUHA 4QDOA 3VJKA 1HPLA 4X6XA 3R3XA 4X93A 1SCKA 5AI5A 2E3JA 5K3DA 1CQWA 2WU3A 3DEAA 3D2BA 1YAJA 1EDBA 1E8NA 1C7JA 2HFKA 1N5RA 1UZAA 2QR5A 5ALMA 4J0JA 3AUKA 5CT4A 4BTVA 3QVMA 4IH9A 4KJXA 1WHSA 1VA5A 4FOLA 2GBIA 3ESAA 4MWTA 2VA9A 2ES4A 1SCIA 4C89A 1ZJ5A 3HC7A 3IB3A 2D0DA 1JT2A 2WKWA 4H7KA 3QBJA 5C8VA 3ZLTA 1XZMA 1EX9A 3SWWA 5LZ4A 2HU7A 2WTNA 2WUEA 2IX9A 5K3CA 2VJAA 2R8BA 2WUDA 4AB1A 3C6XA 2ZYHA 1XRMA 2XQIA 4FMPA 5AH0A 2ORYA 1E5TA 4QNNA 5I9IA 3DKKA 5CRIA 1W6RA 4HRXA 1U2EA 1LPNA 2WIGA 3HSSA 3V48A 4U2FA 4W63A 4B7ZA 5LKRA 1QONA 1GQSA 4IO0A 2X8BA 4CCWA 3G9XA 5AKXA 3L1HA 1UOOA 3D4LA 4YASA 2QUBA 4ZRDA 3FLEA 4BVLA 1BCRA 3M82A 4DSAA 2PU5A 1H2WA 2QXTA 1DQZA 4XWGA 5A7GA 4BCBA 1XZEA 2QOEA 1KU6A 4QDTA 1SFRA 3FCYA 3E3AA 1XLWA 3LCRA 3G9TA 5FKJA 1ORWA 2I78A 2LIPA 3EQ7A 4C87A 5LZ2A 1CUYA 4FLFA 4XVCA 3PE6A 3C8HA 3BDIA 2VQ6A 5CH5A 5JASA 2JGEA 2JF0A 4PF1A 3O9VA 4HXGA 3EQ8A 2JGIA 4J0IA 4BC1A 4AO7A 2PSJA 4L72A 3D5EA 5HQ3B 1UT6A 4JUIA 4EBBA 5FLKA 1MX1A 4BYMA 1EI9A 1DX6A 1CQZA 5ALRA 1K63A 2DHEA 2ZJFA 3BIWA 4QWMA 5AI0A 1T4MA 2ZYRA 4W1RA 5JD4A 2XQKA 4X71A 1MT3A 5EIHA 2H7YA 2HA7A 2UZ0A 2BGRA 1GQRA 2OG1A 1QIIA 3N2ZB 4RE6A 4A5SA 5C81A 4QLOA 3IULA 4FTWA 4DGQA 5KREA 2O7VA 1JI3A 3BF8A 4B82A 1IUPA 3R3UA 2W6CX 1XRNA 3BWXA 2C4HA 1EK2A 3ZV7A 2O7RA 3KWFA 1UK9A 1CLEA 1ODSA 3DS8A 3S2ZA 4BVJA 5FV4A 2H1IA 4YX9A 4E14A 3WKAA 1CUEA 1CUIA 5AKJA 3R3YA 1N1MA 3V1MA 2C0QA 4CCYB 2VT7A 3NWOA 3C8DA 2DFPA 4BAGA 2WIJA 4FBLA 2WU4A 3ICWA 4GHWA 2ZJ7A 1YS2X 4NS4A 4KYVA 3FLAA 4OU4A 2VJDA 3O9MA 3CXUA 1UKBA 2ZYIA 4J0KA 2WIDA 3C6YA 3C5VA 4X95A 4H77A 4J3JA 1A8UA 3QPDA 3D7RA 2WSLA 5AK4A 4G8BA 1LZKA 4UBLA 1W4LA 3ANSA 2O2HA 3A70A 4DIUA 4ETWA 1ZJ4A 2BJHA 1QIEA 2Z3ZA 3GROA 2HRQA 4WDRA 2ROQA 1RP1A 3I6YA 2WQZA 2QXUA 5IVKA 4OYLA 2W22A 3BXPA 1VE7A 4B84A 1P0IA 2GZRA 5I7UA 2IITA 4K6KA 5JATA 2WLSA 4LYDA 5DTIA 3BJRA 3W2TA 4HTAA 5KWIA 2ACEA 3E4DA 1WCYA 3HEAA 4GI1A 4KAAA 2EDCA 1R9MA 3PFBA 4EY6A 1EHYA 5FRDA 1LPPA 3CN7A 3IUMA 3STUA 2GYUA 4GXNA 4WJLA 4ZXFA 1Y7HA 5JAHA 5H3HA 1XLVA 2XDWA 4PNZA 4N5IX 3IA2A 3M3DA 3DLTA 1E66A 3IUQA 4B85A 1E8MA 1UKCA 3H1AA 1PJAA 3P2MA 3WQHA 5FPQA 5CH8A 1ETHA 1WPXA 1XZAA 2J3QA 5CXUA 1Z68A 2DHDA 5K3FA 4G4GA 1C4XA 2XLBA 4QDUA 2Y1KA 4LIPD 3HI4A 3F8SA 3WL6A 4OU5A 4FNGA 4Y9SA 1BCSA 3HACA 2G63A 4H7EA 3JYHA 4G8DA 3AJAA 4I3FA 2VJBA 4CIAA 2HA2A 3Q8WA 2V98A 1CUXA 4GEGA 4AX4A 2CBGA 1FJ2A 3ESBA 1IZ7A 2HU8A 2PBLA 1CFJA 3IUJA 5DJ5A 2PSEA 3BIXA 5AI8A 5AKGA 5JARA 1VE6A 1NX9A 3HYSA 4A16A 2BKLA 2WJ3A 1JFRA 5JD5A 1P0MA 1UKAA 4IH1A 1YCDA 1HDEA 4FHZA 2HL6A 4DM7A 3LS2A 2XMZA 5LLSA 1SC9A 2ACKA 1QTIA 4UHBA 4Y2YA 4KR0A 5FOQA 1EH5A 2HA0A 3FWHA 3WWOA 2BAGA 3G9ZA 4RE5A 4B9EA 4H7FA 5FP0A 1MO2A 3WI7A 2OCLA 3HLKA 2RIPA 3H18A 2QUAA 2VTVA 1ZIYA 3E1GA 4H0CA 5AK3A 3DOIA 3DYVA 5ALLA 2WIFA
chains in the Genus database with same CATH superfamily
2VF2A 1EJBA 1CBUA 2OCGA 1V3TA 2BHLA 3GELA 3KWLA 3VZDA 2P9GA 2Q27A 3HJHA 5EWJB 3WE7A 1PJCA 2GAFA 1ZGCA 1Q0LA 2VTKA 3INGA 1P61B 2JFVA 4MQ5A 1L8LA 3INRA 1OFHA 1SHUX 2VDMB 1Y37A 3F9IA 4KLRA 3FLBA 1M74A 1RHUA 1M5UA 2RGNC 3MT8A 1PR6A 3NRJA 1NGSA 4R2KA 4E30A 1LRLA 3Q12A 1E4YA 3QFCA 4HS9A 4V39A 1O58A 1YH3A 2YWBA 3OTWA 3OHPA 5DHAA 3L8DA 4ZQFA 1YVPA 4CVNA 5CJ2A 3KOWA 2CEKA 1BROA 1XDSA 1J90A 3LQRA 2FSGA 1FUIA 1RRKA 1U1GA 3CZPA 3DO8A 2IK8A 2OGWA 3K15A 3QLVC 3ZNNA 3EVGA 5BQFA 1NP7A 2O8NA 3K09A 2O20A 1RM3A 4Y1RA 4DSUA 3L1JA 3D5QA 5F52A 4R3UC 1F4PA 2ONYA 1MDFA 3DTVD 4IVQA 1A9SA 5K01A 3ABZA 2NWQA 5E9WA 3IVMA 4D4HA 1T9HA 4DIKA 1JHYA 3BF7A 5ARBA 1EDDA 3FYUA 2IOFA 1MB2A 2I4MA 3O9ZA 1OX6A 4LXTA 2GDZA 5GGXA 2RGEA 3PV0A 2AH5A 4DMMA 3NKVA 3BFXA 3JVDA 4IDQA 5SYAA 2RAFA 1Y9AA 2H52A 3GRKA 3TKYA 5EUQB 5IHXA 1KYIA 3T4XA 3OVMA 1HE1C 5JJIA 3E03A 3MTIA 4LY3A 2P9QA 3TOSA 3KYDB 3MVEA 2AOXA 4R2JA 5EMJA 4ESEA 5K8JB 2XWPA 4ZCRA 3OM1A 4MAFA 1PK8A 2E82A 4K9PA 2GHTA 4HRYA 4O02B 4XPZA 4PZCA 4DC1A 2IY8A 3HXKA 3IV9A 2WSSA 1NU6A 5KOYA 5K51A 1R0CA 2WP8J 4CLOB 3PWZA 3AR6A 1JIVA 4HQ6A 3KPJA 1LJLA 3IQEA 4ZCPA 3PX7A 1HK7A 1P1CA 2BP7A 3NM6B 3X44A 4U7TB 2C97A 5B6IA 2HMWA 2XYGA 4L0MA 1UINA 4B31A 5FULA 2DR3A 4OM7A 1PG2A 2CWWA 4GZMA 3G17A 3KXKA 4J4HA 1B2RA 2JIOA 3CH7A 3JZMA 2XCQA 4L3WA 3TOCA 4CKWB 1BW9B 4ILEA 2XCSB 3MSXA 3U44B 3VSCA 2C8VA 2I1QA 3LWBA 4L50A 3ZBTA 5CEJA 1OI2A 1TUBB 4E2FA 1SR8A 3LC7O 4NK4A 4A4DA 1NLMA 1E2BA 4V02A 1NXSA 1SOMA 4KKVA 4ITRC 3CW9A 3SQMA 3TTVA 1C0EA 3IHWA 1SBQA 2DE0X 3F8WA 3NUZA 3WIVA 1VLJA 4QYXA 1B1AA 1VIVA 2P30A 3TQRA 4G0VA 4E3WA 5AM2A 1XCGB 4FJ1A 4C4ZA 5AVOA 3KVRA 4US2R 1FMFA 4NQZA 3A1NA 5AXBA 3LUKA 1OFGA 1HKHA 2V7WA 1PR4A 4CG1A 1SQ5A 1XLTA 3VDNB 5A1JA 3CNLA 2XA2A 4P6VF 1TJ3A 2BRUA 2HFJA 5IF9A 1SO8A 3L0SA 2FK7A 1ZDMA 2BFBB 4UULA 2PZKA 1W0JA 4W8HA 4WNCA 4AJKA 5JWRA 1OYVA 4ARSA 1ZUNB 4TKVA 4FK8A 4F3KA 4Y6LA 1HLGA 1GYPA 1QYRA 1VJTA 2WYIA 4G41A 3WRVA 1YDHA 3GRUA 4P3XA 3LFTA 1Y3HA 5AICA 3I23A 1MZPA 2C07A 3LECA 3A4IA 1A9RA 4H16A 2I4NA 1YT5A 5THKA 3UWMA 3SFTA 1CZOA 5CA0A 3P0RA 4RGBA 3WKEA 1RU3A 3G2QA 3E82A 1U99A 4LDZA 4Q66C 1WVMA 3KKZA 2GEUA 3QEJA 5F7ZA 3VYSB 3O38A 3DD5A 4OHBA 4IJ6A 4E6PA 3FOEC 4F3NA 4N7RA 4W4TA 1E6EA 2FE4A 5FR2A 1M67A 2GT1A 1Q14A 2W2LA 2WTXA 3Q7RA 4CM8B 2P2SA 3D2AA 4QYWA 1WDMA 4D80A 5BWLA 3CH6A 4BQSA 2AX3A 1FFSA 3OJOA 5K8VA 4HTFA 1P0PA 3C7CB 2XJ9A 3SXUA 3CG4A 2W2NA 4M1ZA 1NKSA 3SYKA 1B0ZA 3LKZA 1I9CA 2VWQA 4MMZB 1MEEA 3I9KA 4D4JA 1CVRA 3B38A 4Z4EA 4OUKX 4C6HA 3SX4A 4GZ6A 1FTWA 1BN7A 1CNMA 4YPVA 3M81A 3P9SA 3PP8A 5ALHA 4EO7A 5DHSA 3UJ8A 3IVXA 3DVAA 1MJHA 4IQGA 3MUOA 3EZ7A 2WJ6A 5A6SB 4HT3B 3GRVA 3I9OA 1GRNA 2YJ3A 1K3FA 1Q83A 3H2JA 4N18A 4PG4A 5HF9A 4JSRA 4ZI2A 1EX6A 1DKRA 4I9UA 4EJSA 5I9NA 3F96A 3NTQA 1OLXA 2BTOA 3EDRA 3S99A 4HVCA 1L5VA 3EGVA 1P4HA 4ZEVA 2BGNA 1U7WA 2FSPA 1RI4A 3DE2X 1F1JA 2GH1A 3M6MD 3MOGA 5HZKA 2DFLA 5FPTA 2F59A 4OH7A 5KKNB 1KZGB 4HUTA 3SZRA 1O94D 1GV1A 1UBRS 4F45A 2C2XA 3DC2A 3DM5A 3AEYA 3LDUA 3THXB 5A0TA 3DFMA 2HRRA 4CPDA 5BRNA 1VPDA 1MP0A 5A7FA 2XGJA 3H2GA 4O4HF 3EIQA 2CJWB 1H2HA 3L1KA 1B3BA 5BVHA 1F2VA 3QPUA 1WBJB 4X5OA 1Y6ZA 5KQPA 3T3PB 3IBGA 4YH1A 3THOA 3V2GA 2GCOB 2HJWA 4B79A 1PNQA 2G07A 2N1MA 3MJTA 3DEZA 4AN0A 4XIIA 2VUSA 4ZCLA 3RSOA 4DLUA 2I33A 4OJQA 3OQIA 1S6YA 4PO1A 1W6UA 4MUKA 3ER8A 1JL3A 3EISA 4HX2A 2IP1A 4L4YA 3R74A 2AN4A 2VUUA 1VG9B 1K9SA 1DAPA 1ONNA 4QYIA 1CR4A 1TLTA 1W59A 1A9QA 3GLHB 1EVYA 1SZCA 3KO8A 3L18A 3PU6A 1O4VA 5DNWA 4XEHA 3RSHA 1H3FA 3RUPA 3V34A 4B2YA 1TM7E 1S3GA 2C5FA 1E2FA 2ETVA 4IDBA 3GJ5A 3IUSA 1L4MA 2BM0A 4F8EA 4XDGA 1BQ3A 2DB3A 1OT3A 3CF2A 4Z3OA 5DBIA 4GS5A 4UCXA 1QBGA 1IN4A 3GA7A 4BMCA 1NPTO 4B8YA 1DTEA 3AEXA 3O8DA 2AE1A 4YJDA 2VXOA 1Z8HA 4PR3A 4JJ4A 2WIKA 5CNKA 2GNAA 1ISHA 3EGDB 1KI6A 3RSSA 3V46A 3DZJA 1MB3A 2VP9A 4PLPA 1YS4A 5LFAA 1U7OA 2QNIA 2M1XA 3O7WA 1MJGM 3A04A 2ZITA 3PQ3A 1U3FA 1UZUA 4XB1A 4XVQA 2QPTA 4BC0A 1UZNA 3BTUA 1FDIA 5EERA 5AJVB 5IXJA 1EP9A 2F00A 1A9YA 2EJVA 2FQ1A 1O97D 4ZT5A 5JAUA 4X54A 2HNBA 5HW0A 1KAHA 2R86A 3R8CA 1XZGA 3UB2A 4J9UE 4BKOA 2BGJA 1TOAA 3IESA 3M7IA 1T6ZA 1O94C 4J0HA 4BTEA 3KKMA 3SM3A 3OIVA 5DB4A 1Y4AE 4FZJA 4QFBA 4RD3A 3KV1A 4BOYA 2PGIA 3OESA 1B8NA 1IK4A 1V43A 2PX2A 5CYGA 3GEEA 4RW0A 5DK6A 3ZD6A 3KR2A 2QTWB 4U7JA 5HIJA 5ALJA 1ZRMA 4Z8YA 2OORA 5FA5A 4DA6A 1CQJA 3BGOS 2JANA 2HYDA 2CSXA 3D6FA 4HAVA 4BV3A 1EUCA 3LLMA 3QVKA 3A6HA 5L53A 1A1VA 3R0JA 1XK7A 5FNZA 1C0PA 1EZ4A 1M73E 5DBOA 4P54A 1SY7A 4X64B 2HB6A 1M2OA 5AW2A 1EQ2A 2QROA 1D2RA 2G9UA 4EA7A 2OILA 4PTZA 1BKYA 4TUYF 3O93A 4JOCA 2M6RA 3OKFA 4MINA 5FBVB 1S8OA 1Z0UA 1P60A 4NFLA 1Q22A 3AZOA 2GD6A 5C9ZA 5KYXB 3C3XA 1QB8A 4C4XA 2DERA 1R6DA 1RLUA 2HJ9A 1PO7A 5D01A 4OX9B 1GCAA 4NL4H 2QP4A 3VPFA 2XGGA 3LTNC 3CNHA 1JQBA 4RH3A 5J9FA 2XMCA 4ZVNA 2O9JA 1DDOA 1SA0B 1SH7A 3KK0A 4IXNA 2QIPA 3Q3IA 3QOYA 4BAUA 1RWNA 2Z2IA 1D4AA 1VL6A 4B76A 4EK9A 3E7PA 4ZXPA 3L5KA 4Z5XA 2XUFA 1IY9A 3IT2A 4AJ1A 1PHRA 4TS3A 1IOZA 1AY0A 2FZLA 4IFIA 2YJ5A 4ISCA 1ZH8A 3GJ4A 3GLTA 1ACMA 4KUHA 4MV8A 4PE5B 4R1NA 5TQVA 3U4GA 5HXAA 3O95A 2WD8A 3EVCA 3OZBA 4OSOA 5DO9A 2ONJA 1UAAA 4I1YA 4ZAXA 1XCLA 4FLMA 5FQOA 3I2GA 3ZHQA 4DNFA 2G83A 3CEMA 2OHHA 4KOAA 3EFOB 5I8WA 1IZ0A 3BD9A 1F4VA 3AZQA 3LSTA 5KS2A 4DY4A 2CY0A 1P75A 5ALUA 5E8JA 2P2LA 2O6LA 4YMGA 3HADA 3PUIA 1KXJA 1PFUA 3CLRD 4POAA 1R50A 3A2LA 5BUZA 1DAGA 2WR8A 3CW8X 3DUFA 2PZGA 4OKSA 3A37A 1WG8A 2RCNA 3A9VA 1F2UA 3DT6A 3BYZA 2H4JA 4JLBA 2IUTA 2OB1A 1IBMB 1W4ZA 2K7FA 4NCJA 4RL6A 3GCWA 1QH1B 1YS1X 2BDTA 2R1VA 3SSOA 3ZV5A 5CDGA 3LDFA 4LY0A 3SS7X 4G5FA 1WDLA 5JECA 3FCUB 1APBA 1AG9A 1RWKA 3U3KA 3D6JA 3REQB 3KKPA 3DP7A 2WKSA 4MK4A 4MUEA 2JIZA 3VZQA 3KQYA 1KSGA 2ZTMA 4RO0A 5ALGA 3WGVA 4AXXA 1XMIA 5J2UA 4Q7JB 5IH3A 1PV2A 3FTCA 3U37A 3WK5A 2OZLA 2Z8XA 2PJZA 3PDHA 2A7QA 2FPXA 5CT5A 3NHPA 2XBLA 3NC4A 4G3XA 3RIXA 3W4IA 4CLXA 2IV3A 5EJAA 1RQPA 1SIBE 1W34A 1WUKS 1ZITA 2JIBA 2ZYGA 1QH9A 3Q5DA 2BTQB 3D2CA 2QSYA 1KMHB 1V7QA 4L95C 3U4CA 5AWFC 1N5IA 4MLPA 1DL5A 4ECEA 1XZFA 4DLPA 1J1ZA 4PXYA 1EQAA 1KO5A 2QJTA 4DS3A 4XWOA 2BEJA 5IAEA 3JQAA 1Y34E 4FGWA 3ZK9A 1UXOA 3CU5A 2PKQP 4UTVA 4FBGA 4OPMA 2B37A 3AF6A 3H9UA 2O14A 4FN4A 1HRKA 3PQFA 3DH0A 4I4TA 5DU2A 4DNOA 3MWEA 1OA0A 2XDAA 1BA3A 4B73A 4DJEC 2Y0CA 5B6JA 3DDCA 2IS6A 2QSUA 2X76A 2ZUBA 1XNRB 2JD0A 1CR1A 3BZBA 3MW8A 4L08A 3W7BA 1PUJA 4FHEA 3CFYA 1N36B 4ZPJA 1HO3A 1OWMA 1GUDA 3U0BA 5AI6A 1WMDA 1OWNA 2IXAA 1RQLA 1GNRA 1G5HA 2BMAA 4R41A 3R76A 4EJSB 1TLLA 2IUSA 3HVHA 3ORFA 4GYYA 1CV2A 5HJ7A 3GLFA 3EEBA 2BT4A 3RJTA 4W6ZA 2OD2A 1UFVA 3O4RA 2JCSA 1MC8A 4QUKA 1R2QA 2CNNA 3T5TA 5IUNC 4CM4A 3A9RA 1H1TA 4Y2RA 4LOKA 1V11A 4Y2JA 3VDXA 4EL0A 1CUBA 1W75A 1N6RA 5A71A 3ZHZA 5E7MA 5EIOA 3PPWA 3NDBB 1CS0A 2FFJA 2OZPA 4NYIR 4Q93A 3P71T 4TTJA 5BT8A 3FOZA 3AUAA 5ALYA 5IBQA 1C1DB 5M7EA 3ETHA 4TYPA 2HMYB 1Z0JA 4LTDA 4QYIB 1R64A 3DCYA 3NOOA 4GMKA 4RJTA 1ANKA 3A27A 2O0JA 3OPQA 1N5DA 4I5EA 1NASA 4Z51A 3SKYA 4PEVA 1DJPA 2AJCA 4PPFA 1AXRA 2CHQA 5DBHX 2X19A 1PJ8A 3HXOA 2XMSA 1E99A 1U7DA 3MLAA 3GFFA 3RNOA 1L5HB 2V4ZA 1Z7BA 1EVJA 5KINB 3I9FA 1YRYE 1EGHA 3SOPA 4COKA 5J4KA 2AOTA 1L1RA 3LKBA 3VV2A 1V25A 4L8YA 2Q6LA 4CYMA 1TZMA 2PX5A 5E8RA 3HUFA 2PH3A 2HQBA 3SXJA 3AI1A 4HC4A 3BD7A 1WM1A 4EVIA 5EEGA 5EINA 1UKVY 4I5FA 2GHQA 5E9AA 4LFCB 4A27A 4P2BA 3HUTA 4ZI7A 1SXQA 2J1LA 5EZSA 3DL2A 4EKGA 1NOKA 3UYKA 2Z56A 3H8VA 4MMXB 1JSLA 4KU4A 1L5LA 1RLIA 4OD0A 4RA9A 2QN8A 3WV5A 2ZANA 4DARA 3IE1A 4XCXA 3RYCA 2AJDA 3FZQA 3IQFA 3UKOA 1VKNA 4KRXA 1AUOA 3W7VA 4BEVA 1ZVKA 2WJPA 4C9BA 4Y6RA 2DXIA 2WF5A 4R2IA 2RHMA 3KB2A 4MB2A 1RKVA 5JADA 1ORHA 1S5PA 1DKNA 1G8YA 2H4XA 2V65A 1LD3A 2KW5A 1TW3A 2MSWA 5G02A 3N2YA 2HMVA 4BV9A 1MV8A 5FTWA 3B3FA 2G4LA 3H1PA 1T43A 1M1XB 2PUVA 4K8OA 2BUCA 1GCOA 1SG9A 1P4GA 1EVEA 4QNMA 4DUPA 1P81A 3IB6A 3ZV6A 2VPTA 3L79A 1PL8A 1ZW1A 3QNUA 4UPEA 2ZLBA 3DAOA 1EFRD 3BCRA 3OCVA 1SKAA 2XQGA 4KYIB 2FJUA 4M21A 4R9SA 1AIPA 3RAEC 2HGSA 2WWFA 4RSRA 4WY2A 3QKWA 3LCMA 3DXXA 3F6YA 4P22A 4WX2B 3L92A 5ALSA 3RLFA 5C0OE 4LECA 1W48A 2Y67A 2CXNA 4ZZIA 2BPOA 3ZIAA 1I6KA 4KLAA 3GWZA 3UMVA 5DZSA 1FFBA 2NZUG 4QOSA 1P33A 1R3UA 1W581 1G5QA 1QGDA 5D2CA 2QTNA 5AUQA 4CV0A 4ZGBA 2PMFA 3PLRA 4DJTA 1C3LA 1DAEA 2NV6A 3P9XA 4JZKA 5TDHA 1TYZA 3IUBA 1KDRA 3NYQA 4F06A 1XLUA 3IAXA 1HV8A 1R5OA 2X2EA 2XQFA 4FHDA 3SHWA 3TNJA 3TR6A 3VZPA 3JRXA 3GVHA 2D7CA 3MRTA 4US0R 1A72A 4WW0A 4OO3A 1ZC4A 4I55F 4Q4AB 2I7XA 1TQ4A 2X9QA 4IIBA 1LKZA 5F2NA 3PI6A 5AW1A 1RZRA 2Q8NA 3N0XA 3V8EA 4LRWA 2VPIA 3BCHA 4KRGA 1SU6A 3BRWD 3Q9NA 3T1QA 3VX3A 2WWRA 1ZW6A 4OXKA 5AHRA 1YBHA 5DM4A 1MU0A 3JU3A 4Q3KA 3VO1A 1U0TA 2E2WA 3DDZX 3TMKA 2FNAA 3WZMA 1MO5A 2C59A 4NATA 3ZHUA 4Y9TA 1GAWA 1J25A 1K4KA 3A6EA 3R9IA 3GBSA 2J9XB 3UXMA 1ZMRA 4YBRA 1GG9A 3B6EA 3PPIA 2CLFB 4OFZA 4YJKA 5KYUA 2J6HA 4TV8A 3UHAA 2XF2A 1B6GA 4OJMX 3NM4A 4K2AA 2ZRLA 3EGEA 4GMFA 4MS4B 3WK8A 5B7PA 3GJ8A 5EJEA 1HTBA 2GBPA 2HBZA 4DT1B 2QRLA 1ZNXA 2ODTX 4C43A 1PIWA 1RRMA 1THGA 4YMHA 2D3TA 1G8PA 2WHRA 3BG5A 1NDQA 2R8OA 4B17A 4Y2SA 4EZEA 2XKKA 4PBRA 2V0GA 5JNTA 1XRJA 2FG6C 3DOCA 2AJBA 3VI4B 1PQPA 4K9MA 4MKFA 4OQMA 2R8EA 1YRLA 4BHTA 1E4OA 1XV5A 3ESXA 2IE8A 2QL7A 3CZAA 4YV2A 3EXIB 1MV5A 1RJDA 2CVZA 3NWPA 5EE9A 2A33A 2ZJBA 5JOQA 4GKKB 3VU1A 3L7DA 1G7TA 5T4BA 3VZBA 2AGVA 1QUEA 3BE8A 4BFVA 3OC0A 4E7PA 3WYBA 5DIZA 1TZ2A 1NMYA 1L5HA 3A3OA 1OE0A 3VJRA 4QECA 5CFQA 2JJ1D 3Q9UA 4KR9A 3VPAA 2R62A 2P2ZA 3L0PA 2C2ZA 2H4FA 4XAQA 3DEYX 5H02A 5JSFA 2UXBB 2OP1A 1E3WA 4UXIA 3UGKA 1NUUA 2XB6A 3IMCA 2ZJAA 4KAFA 5JH7A 2IZOA 4BGVA 3TZCA 4ZYXA 4J0QA 3GHYA 1LJ8A 4JP1A 4C4TA 1Z5VA 2PR2A 3E0XA 2V7XA 3NHRA 3NXKA 2DTEA 4OHUA 4EG0A 1ONBA 4IS3A 1PVVA 2IOYA 4Z49A 3QLUC 1USKA 2AFVA 1X8JA 3KR1A 3QU4A 4URWR 4Y6PA 2GTPA 1PGQA 3EA4A 3OPYA 5JZVA 3H5NA 4OLAA 4Y9RA 5FPHA 1HNZB 4M4SA 1NLYA 1S3IA 4V0MA 5T6MA 2ZJYA 1GGEA 1MX5A 2LW7A 3F6SA 2C4KA 1P1IA 3G1TA 4MIKA 5JISA 3FUUA 3T4PA 4EVSA 3EXEA 5HIAA 3H65A 4KXQA 3FNRA 1OILA 5CTAA 3WKCA 3A2MA 2PVCA 3EDQA 3PF9A 4A91A 1RZRD 1NQ5A 3EXFB 6REQB 4HUJA 3GEGA 1ENPA 2QX8A 2AXNA 2X1HA 4MRMB 5CXSA 3DV2A 3K6KA 5F77A 1Z6YA 1SUAA 1EDZA 4CWAA 4Z4FA 4JQCA 1NJGA 4Q6BA 2AFHA 5KVQA 4HPJB 5TMDA 4AUEA 5EWJA 4WWHA 1VJ1A 2CUTA 4WZAB 3WIBA 5IAAA 4PYQA 1BWQA 3GRAA 3VU3A 3S2EA 1X2EA 5FOVA 3A1CA 2GM9A 1X7GA 1FRQA 4BQPA 4KO8A 1K8QA 1YVUA 4TLBA 2KS6A 1LY1A 3NTXA 3O1HB 4AZWA 3VZCA 2ONKA 3QVLA 4CBVA 2DBRA 2OUIA 3DDNA 4Q21A 1Y8AA 5K0CA 3D3EA 5ALOA 3E3OA 3K1JA 1T6XA 4PYLA 2OL4A 1WB5A 3ROTA 4B48A 4EYOA 3QELA 1Z0AA 2VTDA 2V5UA 1BKSB 1NLZA 1CZHA 2BMVA 4NOJA 2O2SA 3RS9A 5JSYA 4FYJA 3SG0A 3SFZA 1INLA 4BJ5A 1Y8ZA 2QVBA 1I2BA 4MO9A 2JNWA 1GRQA 2P2CA 1XK6A 1Y6JA 5KCMA 3SQNA 3WGOA 4BZZA 3W7AA 4HGQA 1XEAA 4PZ0A 1BU5A 4BWYA 2CXOA 2F1KA 1OTYA 1P80A 4W5JA 4D02A 1OROA 1HZZC 1QFYA 1XDWA 2WJIA 3EXG1 4J91A 4WVFA 4A0HA 1H0RA 1CZRA 4RVCA 5DWDA 5JPDA 3Q8KA 1Q1ZA 2BSXA 3Q6IA 2SICE 4TMXA 5CT6A 2EBUA 1G6HA 5H3CA 1I33A 1IN1A 3GX1A 4JJIA 3OLZA 4REQB 2WDZA 5DM60 4EECA 1V6AA 4PZEA 4GBMA 3EJWA 5AJUA 1WD7A 5HA5A 1QCDA 5KVSA 1NUPA 1V9LA 2PK3A 1ORRA 3Q7EA 1QVRA 2JD1A 3IT0A 5D1HA 5F9FA 4ZYYA 5FBWB 1AA9A 1QH8B 1V9CA 1ZU5A 3L01A 5DHQA 4AJ9A 2GN9A 4CDGA 9LDBA 2RGBA 3IELA 4Y2TA 4CIVA 4XYGA 1Z2OX 3EXFA 1O3YA 3ZWNA 6REQA 1GPMA 4NCBA 4DNXA 1EFPB 1NVBA 2C1XA 2CC2A 1PE0A 1BSVA 2FHPA 3DHNA 4KO4S 2QTFA 4N7MA 3EWAA 1UADA 1SB8A 2NM0A 5A4JA 1Z0FA 3FIUA 1SCQA 3CLTD 3NEYA 4WNYA 1YFLA 2A67A 3LHKA 4RPCA 4YXWD 4ENSA 2R47A 3V3TA 3VVLA 2G80A 2RG7A 4W5TA 3ISVA 3QMMA 2AG5A 3HYTA 5IM5A 1ATIA 4TLDA 3UWKA 3AUYA 2OM2A 1Z0ZA 1R8QA 3U3MA 3ROQA 5KWJA 2C00A 2OLKA 5BVGB 3G5AA 3SPXA 5K1ZA 1WL8A 4C0KA 1BNCA 1BYIA 1Z4MA 5GZ1A 1G2IA 2F1HA 3LW8A 1B0AA 1X7WA 2XNCA 1U2SA 3PG5A 4JWKA 4O5OA 2J0VA 2BBOA 4UNSA 5EE1A 3FF4A 5I6DA 2FZCA 2WV9A 4OLHA 1UH5A 1RRPA 2JFNA 2J07A 1WHTA 1E9DA 1KERA 2DHQA 3BH0A 4GGMX 1R6UA 4Q5IA 1KQGA 1DKMA 1XO1A 4M8SA 3OSZA 4I8XA 3EC2A 4Z7QB 2VFAA 3AV0B 5IYZA 4LX0A 1HQCA 1TU3A 2F3SA 2CVFA 3WGZA 1B6TA 1KVQA 1H93A 2C9ZA 2X23A 4ZDKA 1R5NA 3UUEA 4B6EA 4E4TA 2XVAA 1BXGB 2F1RA 5K0ZA 1ZFNA 4L4UA 3F97A 4EZIA 4NJEA 4UEJA 4TT3A 3KZ1E 4ROTA 5AKEA 2P77A 3LQFA 4BLOA 3DFFA 4DBLE 1C80A 2TSYB 9LDTA 3N2LA 4C7OB 1Q44A 3I3OA 4HEA6 4HMOA 3C5HA 5AUOB 2YCBA 3H83A 3KTOA 1KNQA 2OV6A 1Z17A 1PGJA 1XROA 1YVEI 4B4KA 3C24A 3FRJA 2VPWA 1F0YA 3JZDA 1ZSVA 3AOGA 3LQYA 3NBQA 3QNMA 4KE7A 2D2IA 5AM4A 5JFOA 3KM0A 1LC0A 1R1DA 1U9ZA 3TTWA 4EEXA 4L02A 3LDHA 3F5MA 4XX0A 1U63A 4D9EA 3VVBA 3HJGA 4FDTA 4EHLA 4J1NA 4OHVA 4EKDA 3OFVA 4QPZA 2RK6A 4HNUA 1UR5A 2XCLA 2XUIA 3V8BA 1UMDB 1GPUA 4M9XA 2X1VA 3ZVRA 4DF3A 3ASZA 3G5LA 4GP9A 4AT1A 1NYQA 2JAWA 1JS1X 2DECA 4RFSA 4YS6A 3GK3A 2P9JA 2WVHA 4FILA 3U7QA 2OHVA 3MYYA 5C35A 1UAYA 4Q82A 2Y9PB 1PD0A 3MERA 2HUPA 1L9XA 2FPIB 3DZBA 3F74A 3HDHA 4ZAVA 5HG0A 2QRHA 3HJAA 1QFZA 1ZI6A 3UHOA 3GJTA 4LXGA 1ODIA 4NZNA 1T1RA 4LVCA 4RQAA 4AG5A 2ZKLA 2BKXA 3IIKA 3SICE 4P36A 3K0AB 4KPYA 2N46A 2A5LA 3WKBA 5IPFA 3EGDA 3CEJA 4M9QA 4ER0A 4Q4HB 2JCGA 3T3HA 3EA0A 1O57A 3ASUA 4MPJA 4F3YA 2DQKA 4ND8A 5BSGA 3CX6A 1OW3B 3O92A 1QHEA 4IIYA 4QEZA 4B3DA 4E5MA 1MA3A 5LQMA 4XYMA 3KB1A 5A4FS 1ORVA 3PITA 2IF2A 2YVKA 4W99A 4TWZA 3CYFA 3H6KA 4EHHA 1XVTA 2QBYB 4RVUA 3GNSA 3OTQA 4JT9A 4O4IA 4A5OA 1A1SA 1Y8QA 1MAAA 1GCGA 1JU9A 2YFKA 3Q10A 5C80A 1Z18A 1CULC 3HG7A 4X92A 3FYUB 2C2GA 1VSTA 1E0KA 1JR3E 4ISBA 2XA9A 3RSLA 2B78A 5BQ5A 3I8XA 3L6UA 3UAWA 4EB0A 2VK8A 4N3BA 1GPNA 3JD2A 3MFYA 1NNSA 1J39A 1EWKA 2PRKA 3W8EA 3TDMA 5C4IA 5GY7A 3AIKA 3PGA1 4IJKA 1TI7A 3COPA 3DNPA 3RVDA 1RLTA 1ZUHA 1RHRA 3AVTA 3ZDCA 3A3KA 3FF1A 4ZDIA 1E6UA 3I28A 4MVJH 1PW7A 1EM8B 5K45A 3NHAA 3L0OA 1IVSA 2ZUDA 2AD1A 3GMSA 5BOVA 5SICE 3I04M 3FTPA 5KU7A 4WSOA 3TVYA 3LE8A 3PUYA 3FCOA 3JQRA 5EZQA 4KRFA 2RC5A 2ZTHA 1P9OA 2IOFK 3FUXA 1QTRA 1C1HA 3MOSA 1BHO1 1TQ8A 3DZGA 3O1LA 1FRZA 3SJCA 1N0VC 4YAKA 3ZE1B 3MS2A 3JTMA 2CZCA 3OQVA 3NVMB 5FUQA 4IR7A 4XLLA 1TO6A 4MGKR 3T15A 2FUCA 3WLTA 5EHXA 1JJIA 3VDQA 2WAXA 3BL5A 3MWFA 3PXEA 2NUAB 4AL4A 1J97A 5LBTA 5KJEA 4MKRA 1RC0A 2X3UA 2PXHA 3HU2A 5K3SA 2OVFA 1IEXA 1ZUD1 3Q40A 2OFOA 2EYQA 4B6FA 1G0NA 1N7JA 2OC4A 1M2FA 3AUXA 1TKAA 1UBJS 4CKXA 4YR7A 5EIXA 3L8MA 5H81A 2G9VA 3FTEA 1QO9A 5K0LA 3OOJA 3UC9A 4L7QA 5LIRA 3LX5A 5EQDA 3FTDA 5L4LA 4N54A 1H4TA 1J0XO 3CM0A 1XCMA 4JC5A 3HJCA 4LYEA 4BPRA 3S44A 1E0DA 5FO1A 4FT2A 3ESDA 2OXCA 1OGIA 4UU1A 4GE3A 4A0GA 4ZMRA 2VDVE 2WINI 4N76A 4BU1A 3ZI0A 1JEYB 1UODA 4EI2A 3K9FC 2PHZA 4A2CA 4CW7A 2NX2A 1L7RA 3I76A 3UHFA 3KZKA 3QVVA 2O2IA 4UMFA 4AY6A 1M8KA 3R20A 3S28A 2VSXA 4JC4A 4R8SA 3LZ6A 1S8FA 1QP8A 2GLXA 1MOQA 1DQYA 2R68A 3I6QA 3KSAC 3IDSA 3D3WB 3S8MA 3I62A 2C99A 1N32B 3EVDA 3RS3A 2R84A 1YB1A 2VNJA 1M34B 1A5ZA 1W49A 4R4JA 2BMFA 4IDDA 3NHMA 3B5EA 4OUDA 4RV5A 3WS7A 3P0FA 3QEOA 4KQ2A 1WPRA 4DDHA 2AR7A 3FKSD 4EJ6A 4B3IA 2FHSA 2QUZA 4X1YA 4HRVA 3ZZUA 2PIDA 3OWHA 3INYA 5ECGC 4ZHQA 4LFAB 1U1EA 5K0EA 4S2UA 4DMHA 5F1OA 5JR3A 2XD9A 5KOJB 4UTOA 2BFNA 5TVGA 1RJ9B 4QXOA 3A1UA 3UHJA 2NPIA 2Q0XA 3AHFA 3A6PC 3R6GA 1LSOA 2Z5VA 4DV1B 2JIDA 4JL5A 1M6VB 3LY8A 2JC3A 4RMIA 3STXA 3WMWA 1S4MA 3NB0A 4WBNB 3DXFA 2DSNA 4J1SA 3FFXA 2X0NA 3B3GA 2FWIA 1B8UA 1SCAA 4RLSA 4DM3A 3W2GA 1MO4A 1OD6A 4PS0A 3R3ZA 1H22A 3C14C 3KZNA 5HCUA 1T2AA 3G7NA 3KTFA 3PGKA 4TS4A 3VYUB 4EUSA 1RXYA 2G28A 4PC1A 4F93B 3I9V6 1F0NA 3VHXA 5J4HA 3HP4A 3OIGA 3S1AA 3AQ4A 3V7YA 4KV7A 9GPBA 3U7JA 4GR5A 3KUKA 4XDYA 2IVZA 2OQIA 2RGXA 4H15A 4EJ2A 4MYTA 1BW9A 1WUTA 4MR7B 5CDUA 3KZMA 5J59A 1NUTA 1T6YA 5C8XA 5J5VA 1JDJA 3GPLA 1KEKA 2O59A 2J3HA 4A2QA 4A36A 4R2WA 3SDBA 5AKLA 3VZSA 4A8HA 4MJ3A 1N57A 3ENWA 2HF8A 5FPPA 1MH1A 3O4HA 2XA1A 4OXNA 1JFLA 4F5DA 1KDYA 2J6BA 4E5DA 2QLTA 2V7VA 4WUTA 5ECDA 2HLDD 1GCUA 1HNXB 2WMNB 1T8TA 4JQZA 1ZJWA 1G63A 1M54A 3CVUA 5B4UA 4WBNF 1U65A 4NAUA 4X41A 5JCZA 1NTRA 1ZICA 2FZ5A 5TE9A 4E51A 3TEJA 3EZLA 4CN9A 3Q7IA 1I6LA 3NETA 1T10A 2XDYA 3O2QB 5DF1A 3KU1A 3VPBA 4GG1A 2MT9A 3DBVO 4BFYA 5BV7A 3DCJA 2CNBA 4EFMA 2NP7A 1DDIA 3R77A 1ZLXA 4J3FA 5JAMA 2O1XA 1T9CA 2PD6A 3GIDA 4YNBA 5A06A 1O9GA 2IUYA 1VSQA 2A0KA 3EF3A 2XT6A 2I62A 4BNKA 1RRVA 2ZUUA 3JAKA 2WPNA 5LQSA 5JNWA 5IM4A 4RMJA 2IP4A 1BXZA 2YH2A 5CEFA 3FJYA 1CLUA 1KI3A 3FJOA 1C0IA 1FFGA 5GOTA 4PG7A 3AHCA 4KMSA 5ALDA 2QI9F 1XCJA 3Q3GE 3HCFA 5DEIA 5FOWA 3U7QB 2K5UA 1T2CA 1G21A 2X9GA 4X90A 1FB5A 2VJLA 3KD2A 4GPD1 2B61A 4MVJG 4R1PA 3HR7A 3T0FA 2PSFA 4C2AA 4UUMA 3JD3A 5FI3A 2GSWA 3HN2A 4MQFB 4XJXA 1QIGA 1SPXA 5HNKA 2R7KA 1M2VA 4NCHA 4QU0A 4BMYA 1JHPA 2D4HA 1J2JA 1QAOA 2R44A 2RFLA 3S29A 5DHTA 4D42A 1PCXA 1LPMA 5AOAA 1LVUA 2PQMA 3UJ7A 1W5SA 2QVGA 1AKWA 3VNBA 1U8UA 2VEOA 4G5XA 2H16A 4JU9A 3O4GA 5KTYA 1F7VA 2GN8A 1FBNA 4OMFG 1EK1A 3N86A 1FSFA 1YA4A 4RA9B 5CPFA 2FA9A 4ENPA 1C8BA 4CQMD 2EAUA 1XU9A 3K1AB 4Y2UA 3DZIA 4R0VA 5DHFA 1BD4A 3D7LA 3FFAA 2YXNA 4UBIA 3IBCA 3ZCTA 4EQ6A 1KDOA 5SZIA 2V3CC 4IDOA 2H2IA 3F6BX 4FDAA 1RQNA 3WIEA 3GJZA 2FLKA 4Z0TA 1H2XA 2XUOA 5I4BA 1IZZA 1YSCA 4MV5A 1R8XA 3O73A 3RC1A 3U7FB 1OH5A 4LYYA 4BJ1A 5CDTA 1JDBC 1RAIA 4FS3A 1P2VA 1YCHA 3LIPA 2XLCA 3F6PA 5JQWA 1BEZA 5CX1A 4D6YA 2PS9A 4LBWA 2IHTA 4OKNA 4LC0A 4N8SA 2I4OA 4O4LA 1PSDA 3IOBA 4PO9A 3R8XA 4I9HA 4UBNA 2AW3A 5D87A 4TROA 4C5BA 1X7WB 1U1FA 4B5LA 1DJOA 4HJXA 4JBNA 3P32A 5B53A 1AS3A 2ZRPA 1JX6A 1VHQA 3D6TB 3UMGA 3VYTB 4YYEA 1BJTA 1DO2A 3CR7A 3C6BA 2Z6AA 2YUIA 3A6KA 4XEUA 3GT0A 3LVQE 3Q11A 3G2LA 4O59O 3R23A 3TMAA 5C8YB 1AH2A 3EDYA 3ZWOA 1JMVA 2R2GA 1FFAA 1JEEA 4CZ2A 4EYSA 3LCVB 2CKMA 2AEJA 5H9VA 1TTQB 3PNPA 5E0KB 2QQ5A 4LC1A 4RKFA 2HIMA 1USWA 4K88A 1OAOA 4WEQA 3DD1A 4MV1A 3S0JA 1CYDA 2HEGA 4KFSA 3QKSB 1OQAA 2X9LA 3NAGA 3IO3A 2NV0A 3N5KA 1NT2A 1K8YB 1X1AA 4A2WA 3DV0B 3EIXA 2C4MA 2IYPA 3PQ7A 5IM4F 4X8HA 5EZ6B 1I4WA 2Z58A 3DBOB 3E53A 4AKTA 2JFBA 1OLOA 4KXNA 1ORIA 1TA4A 3C1UA 2J5QA 2BTEA 3R6LA 5CCXA 3ZYZA 2ZJ2A 4U2CA 2BKEA 5A2QA 1L7DA 4IO1A 1P9LA 4INZA 3LAWA 1U0EA 2J9FB 3AF0A 3ECSA 3LUAA 1E7SA 3LBNA 4NCIA 4P98A 5LYJF 4NC9A 3QF7A 1L7MA 4YCMA 2OUKA 3SYNA 1K3TA 2XH8A 4IIDA 3E15A 2GQ0A 1EWTA 3V4FA 3HS3A 2QJFA 3IPCA 4GRAA 4X6LA 5HCNA 5KNDD 2EVWX 1KDPA 2P3LA 4FFLA 1DG1G 4HI0E 2DPMA 2DUUA 4HPXB 4UHHA 1E1QA 1E2JA 4JKIA 2OWEA 1A95A 3M8KA 1Y5MA 5D3KA 4BB9A 1P7PA 3K6SA 3OEYA 1XF1A 2JLUA 2C5LA 4H60A 4X6YA 2CHUA 3TFWA 4JBGA 3TRFA 3AB7A 3QBDA 1XZBA 4KRYA 5GTDA 4OUDB 5JS6A 2ZE5A 3UANA 1KVRA 2X7HA 5D6OA 3T3GA 1VRVA 3D0OA 3SIRA 3PIIA 5KDDA 1JE0A 2C7OA 2QTZA 2OCKA 1ZN7A 2PRSA 1GZ3A 4MRRA 4I5IA 4H6WA 5K20A 1RAFA 8ADHA 4K6GA 1G2OA 2A9OA 3ND6A 4EYQA 4NNPA 2ZWOA 3U7EB 2AOWA 2P9ZA 3KUXA 1LLCA 5KOHB 3TI9A 1FIUA 3ZU2A 5MFPA 1E69A 4O3MA 3IDZA 3LO5A 5JTUA 2P79A 3D3QA 5TPWB 2IYFA 2XUDA 1FC0A 4FI3C 1QHNA 2WWTA 1VL2A 2BGMA 1OFUX 3BB3A 4F4IA 4G67A 1LCIA 2GXQA 1XHLA 2CXHA 4JCCA 4L6IA 2WA2A 1GPDG 3OCJA 2XUQA 3CZMA 3ZLJA 2BGWA 4EHNA 5FPYA 2O1WA 4GIBA 1DPFA 4OAPA 4CM7A 1H1DA 1XMQB 5EJ9A 3K32A 2EEPA 3EW9A 3QBTA 4RMGA 1FUUA 2ZCVA 3NOVA 3QUBA 3R7BA 1DMSA 2FF7A 2FX5A 2VHVA 4QLAA 2JGMA 4BGUA 3OIYA 3N3BC 4WZBB 4TRMA 2ZBPA 2ZM5A 1Q92A 3O0TA 3G82C 3KEFA 4B9AA 1N6KA 3ZDRA 1P4JA 2XBUA 3UKDA 1AM4D 1Z26A 1MLDA 5AJTA 1U2DA 1GTRA 3AI7A 2FMTA 2ZYUX 5I7WA 2W8ZA 3NATA 1ZBQA 4RHTA 3QU9A 2WB2A 1HDOA 1KVSA 1ZGAA 1H9AA 4QELA 2WC1A 2R66A 4GQBA 4AUKA 3LWDA 5KJFA 2Z83A 3PF8A 3MQ2A 5REQA 2RHLA 4KJZA 4G0QA 4ZT2A 3H2ZA 3AV3A 4NZZA 5EIAA 1K6JA 1ZZGA 2IODA 3VMMA 1E3WB 5AR1A 2I8LA 4OMUA 5JZMA 1IAVA 3AI3A 3LV8A 3WA6A 1OVMA 2GCNA 5EI5A 5LA6F 3E18A 3U31A 5JH7B 2J6IA 1MABA 1IUKA 1IN6A 3I61A 1RHKA 4REMA 4UJ3A 3K4PA 1FVOA 3ND7A 1RLJA 3HCDA 4R7GA 4CF3A 2B5VA 1CZLA 5CBKA 5LN1A 3QE4A 2JBHA 1WOMA 3EARA 4ID3A 3PUZA 5EQJB 5HK9A 2ODNA 4MYCA 1NV9A 2YYAA 3AY7A 2L2QA 1ZOIA 1WSAA 3FBWA 3DOHA 5F78A 3O2JA 4HDSB 3OIDA 1CF2O 2JFYA 1W19A 2AZXA 1DXHA 2FR8C 4HDMA 3C6KA 3EHEA 2FJPA 3AXTA 2YMLA 5CFLA 3MF4A 1Q84A 4ZVKA 4BRSA 3ZGYA 2O0LA 1IB0A 4M0FA 3PQ2A 3FNGA 4QDKA 2XGMA 3DL0A 4KH1A 2YMMA 4EG5A 1NG1A 3DLIA 4WOKA 1RDFA 1YKSA 3LKDA 2MINA 4UE3S 3BDVA 3VKFA 4QDXA 3BBPA 1GXSB 1WXQA 1NC1A 3C8UA 4G5YA 3HBAA 4OP2A 5JCOC 3KLBA 2UZ4A 3CS3A 2P35A 3B8EA 5CB4F 1DKLA 5JVDA 2XSZD 3N58A 5BWBA 2GAJA 3NCHA 3PENA 2OBMA 3Q87B 3QKSA 3KQWA 4TV8F 3RO7A 4W1SA 2C03A 1UFOA 4PO3X 2ADMA 2B6HA 1GVHA 4GD3Q 2I3AA 2VBGA 1GM5A 4AKHA 1BYUA 1J07A 3P52A 4JYZA 3UFXA 3KZOA 2WYHA 3FMPB 1JU3A 3HGTA 2WKQA 4RA6A 5JU6A 2Y66A 2YASA 3PUJA 5J2TF 1MNAA 1FEZA 4E2XA 2NW6A 4L8VA 3PDUA 3TCNA 5HF6A 1E79D 3DFZA 4O4JF 1KYQA 1M5TA 3FCAA 3WO1A 1VYTA 3WFZA 5CA1A 4PYNA 2GEVA 5ALFA 1DAIA 4ZCMA 1S2GA 2FKAA 5ER9A 1FXSA 1FNNA 4M1KA 5CFMA 1M75A 3SSMA 1CY0A 1QRAA 3SSNA 5JQGB 1XEWX 1U2QA 4UM9D 9ABPA 3I2JA 1MJNA 3PIDA 1S3SA 2KBEA 2FN7A 3FLMA 4JQOA 2AN9A 2V0CA 3AFMA 3AM4A 4NCKA 3A9SA 2Z2ZA 4MQEB 2X58A 3B6JA 4JX8A 3DE7X 1OIVA 1JB9A 2C2YA 5K99A 4CKBA 2OLEA 3SBXA 1Y3CE 4BX0A 3N74A 3DBHB 2O2YA 2J0UB 2ZSHA 3N0VA 1CUJA 4K9OA 4KQ6A 4H1VA 2JA2A 4GLLA 3R7FA 3CB2A 2IEBA 1CUHA 3AW9A 4IP0A 4JT2A 3QVOA 4B47A 2PPLA 2Q2WA 1I7PA 5EMMA 2A1TR 2X9VA 2OCIA 1UOPA 3B3AA 3NDRA 4UUQA 4CFZA 5HKKD 2VJPA 3D6AA 4TWRA 2GPWA 3OURA 4R8MA 5K3AA 3O3MB 4WZBA 1L5MA 3QPCA 5J4YA 4CQMA 4F2PA 3AL0C 1TJYA 2IP2A 2ZQZA 1DU4A 4PZLA 5FWAA 2BUBA 4WZBE 3LUGA 3PC4A 1G42A 1RHJA 1P19A 2C8LA 2B82A 2CHEA 4RIFA 5CG2A 1Y4DE 2QN6A 3AEQB 2JLYA 2X4LA 1U9IC 4D82A 1I4EB 5DGDA 4X60A 1U28C 5FR1A 2ZVQX 1VOTA 2BH2A 1X7XB 4Q4JA 1T9GR 2VH1A 4GOLD 3O8OA 4KXVA 2WWHA 3G0DA 2ZB8A 3IPAA 1TUIA 5CURA 1Y3FE 4NV3A 3USES 4LXIA 3EZ6A 5IJ0A 1FSGA 3UPDA 4D9BA 5LWHA 3Q3EA 3RROA 1YK0A 4XTCS 2VT2A 4Y6OA 5M5BA 2XIJA 1QH8A 4JEHA 3ANYB 3EULA 1TFUA 3L0ZA 1KETA 4YRJA 3EIHA 5FEMA 3W5BA 4U2GA 1K98A 1AK2A 1IK6A 2ECKA 4G09A 4YGXB 3DHVA 2XRZA 1TK3A 5TEWA 2MSCB 3T9EA 3TTXA 3CX7A 5MGNA 3SR4A 2VZLA 1H2YA 1TM3E 5GONB 2G72A 5L7TA 4U63A 1I3CA 2E49A 1CK4A 5J1TB 1KYZA 3LW7A 4R81A 1QPZA 1FX0B 4M88A 1YJ8A 2RHWA 3PD1A 2XAAA 3HDGA 3A28A 4LJ9A 4X1YB 4ZFNA 2DR0A 1RZ3A 2YNMA 3EVZA 3HKEA 5MGBA 5GWXA 1FP4B 2ATVA 2ZAYA 3W9SA 4M0CA 1V4NA 2ZSBA 3TQIA 1NPYA 4MW5A 4BBPA 3KZCA 5A5FA 3E35A 5ADUS 4RL4A 2YOGA 2ZXEA 2OO7A 1VI2A 2BTQA 3QEMB 4Q37A 2VDLB 2BGIA 5A02A 3L4JA 1M8FA 1N1GA 3F47A 1KPHA 1JNXX 2FW1A 2X5JO 1FP2A 4FFRA 1WDWB 3G0HA 2GEBA 4KLNA 1XJ5A 4C76A 3L9WA 3I9MA 1ZO8A 4TM8A 5EC8A 4DLNA 4YK7A 3M9LA 3G2HA 2B20A 1ESDA 4MYUA 4BZPA 1M5RA 2IHZA 2I54A 5IT5A 1L3CA 3A6LA 4IINA 4LC9A 1BCRB 3T4UA 2GJ8A 2XYQA 4X3CA 5IANA 4W5RA 2A57A 4DCVA 1VKZA 1P7VA 1XGKA 4CTJA 3FYUC 2BSQA 1V26A 2NUPA 5LP6F 3PA8A 2JLSA 1PQUA 4WTOA 1PT9A 5JAOA 1J0DA 4ARZB 3JYPA 1P1BA 1DXQA 3DMRA 4IHQA 3PUHA 1S8NA 4S05A 2YQ5A 3VC3A 1HPLA 1TK9A 2P62A 2XQVA 3R3XA 1SC1A 2FMFA 4X93A 4LYJA 1Z6TA 2PRIA 5AI5A 4JL8A 3DEIA 3FW1A 2FEKA 4TXNA 5IN5A 4BP3A 1QF6A 3UT6A 3P9QA 4U9IS 4L16A 1U0GA 4BKQA 3CLTC 5I9BA 1L5SA 2R85A 1LJUA 2PKRA 2EHJA 2IYLD 2O3JA 2E1PA 2BFMA 1Z4QA 2XOXA 3PKIA 4HK4A 2DP4E 5KWVA 2OD7A 5LQAA 1YAJA 1NSTA 1UPXA 4K9QA 4D9MA 4N3AA 1C7JA 3T1VA 1OH7A 3BM5A 1SC4A 4KFTA 3LT4A 3NONA 3GAAA 3MC1A 3UV6A 1E77A 3GEDA 4L9RA 4AZSA 4ERXA 3IUEA 4RTSA 4I55B 5CT4A 4FCWA 4AZ0B 1EUDB 2Y93A 2RHHA 4J7UA 1PKEA 2NU8A 4KQ9A 4LF9B 3EGWA 3OZTA 2D7JA 2BP7B 3CX3A 1YZTA 1QMPA 1MGOA 2UKDA 3EFBA 3TS1A 3Q9SA 2IYUA 1KFCB 1LI4A 2GBIA 5JJKA 2F3TA 4INOA 2OSBA 5HS6A 4OI0A 3WB0A 4HAYA 1ZKDA 2F8LA 3F3KA 1NX6A 2EWWA 2H06A 2OP0A 3Q6MA 4RD6A 1SCIA 3H0EA 3WDLA 3LT5A 3LZDA 2QLMA 1G59A 5IBRA 1ZJ5A 2WKWA 3Q7QA 3SY8A 4YJ3F 2QLJA 3ZGVA 4YMLA 2DJ5A 1FDOA 1U81A 2CYBA 1XZMA 4MLDA 2JKVA 5EPOA 3CGWA 5A4KA 5GIOE 4B3BA 3KTDA 2QT1A 1N6HA 2C96A 4F56A 2IS1A 2WUEA 3DLPX 3TGPA 3EXHA 4MVJF 4MUGA 3WMXA 1ZWKA 2H1FA 3H1EA 4MTLA 4AB1A 4KPFC 2ZYHA 3CQ9A 2XQIA 4KCGA 1FVXA 1TZJA 3T7IA 4REOA 3V1YA 1XP8A 4O4JA 5IDYA 4PHCA 2R6GA 4R51A 5C37A 5HPYB 5KX5A 4GPZA 5G0TA 2ORYA 2W6PA 2DVMA 2INGX 4GO1A 1OIWA 1RIFA 4ZVLA 4IX9A 2JFWA 3NQ41 4G0ZA 4QNNA 1YOBA 3N8HA 1KIFA 2FFBA 1J7JA 4HX5A 4JLKA 3DKKA 5FWXA 4J49A 3H1FA 3ZR4B 1AUXA 1P1RA 3WFJA 3L9XA 4O29A 3I5YA 2FUG6 2EWMA 2CNLA 3H5VA 3IP5A 1U2EA 2AN1A 3E7XA 3DMDA 5B55A 4KK3A 3GFVA 4MGEA 2BHRA 1KJIA 3QXXA 1Y5IA 2Q62A 2RKOA 3EWNA 3NP9A 5ENVA 2WIGA 3SI7A 5MN6A 5AVXA 1DFIA 5CDSA 1WW3A 2VNSA 3EBPA 1YBVA 1U3UA 4PN7A 1G8GA 2EJTA 4IO0A 4KO1S 2I8CA 4CCWA 4DLLA 3L0BA 1RRCA 1SVKA 1GZSA 2WWIA 1RTKA 3G9XA 4FONA 3MMNA 2Q3DA 1A7KA 1XAHA 3L1HA 2HCFA 4Q9JA 4R5HA 4AULA 5TT1A 4C21A 3L6EA 4QVGA 1NMSA 3QVUA 4XJTA 1VCIA 4U39A 1VMAA 3R0ZA 3ENNA 1G7CA 1D6NA 2FW0A 2QUBA 2X86A 3KU4A 3RS2A 5IC4A 3UWSA 4EX7A 3U1BA 1ZD1A 2VP4A 2AZDA 4MZXA 2C92A 4G5QA 5JDCC 2REBA 3UC5A 5IYZB 1QVVA 2IYWA 3PD7A 3PS9A 4XIGS 4IDAA 4WH0A 4ZQIA 2CMDA 1ILWA 4BVLA 4EG4A 3R5HA 1NVMB 4PXAA 1U90A 2PU5A 1DQZA 3TINA 1MFZA 1P9WA 1G41A 1ZGJA 3A6FA 1WWKA 3M33A 3T5PA 3ZJVA 1AKQA 2DSTA 1ZNZA 4WLEA 5A7GA 5BSEA 1XZEA 2QOEA 2P7HA 5FWXB 2A7XA 2RK3A 1UJMA 4QHTA 4C0SA 1V7CA 3FCYA 2P8JA 1WUIS 1VE5A 1R27A 1LDYA 2J67A 1KE2A 1I3LA 2YHIB 4DGSA 1VJGA 1X1TA 4D2IA 3RWMB 4O2BB 1ORWA 2LIPA 3EQ7A 2XZPA 1NRXA 3FIJA 3LCUA 3OHMA 3G8AA 3PE6A 4RWZA 3PXDA 4B6SA 3SP1A 1VBNA 1X7DA 3KSZO 5GV7A 4D97A 4DIMA 2P41A 2VAWA 5IF3A 3FHJA 4I6JA 5GVRA 1UPAA 2SECE 2AYYA 1SBTA 1MQSA 2E6KA 1QM5A 2YL2A 3AF2A 4PF1A 3O9VA 3T6KA 1YZKA 2XZOA 3IV7A 2WJZB 3M5DA 4J0IA 4OYHA 4RK5A 2OT3B 4NZ9A 4MQ4A 3GFTA 3D5EA 1JWBB 4POOA 4IHKA 4HQOA 1NW3A 4TN1A 2ABWA 2QIOA 3OF3A 3VC1A 1O6CA 1Y81A 2Q2NA 3AKYA 3O8QB 1IHXA 4ZAZA 3IQDB 1CJBA 5FFFA 1QPBA 2VDRB 3IRUA 4CR8A 4UTZA 1YBAA 2QQGA 1Y42X 2PT9A 3TM4A 1JXAA 4KUGA 1RXCA 1V48A 5EL0A 6NULA 3UO8B 1VPEA 1Z73A 3TLCA 2AOVA 1VG8A 3TPZA 1PN3A 5AW0A 1K7CA 5BR8B 4RH1A 4MDEA 1CRPA 1ICIA 5IC5A 4MYHA 3ZCQA 4HD8A 3COSA 2X42A 4JXKA 1G21E 2RBEA 4UZEA 2OV1A 1NATA 4XASA 1MT3A 4PC3A 4QUBA 4M46A 2O5EA 4BLQA 3ND9A 3T5AA 3RTEA 3EH1A 3AL3A 1XWIA 2OG1A 1QIIA 2WM3A 3DE4X 4GYWA 5IYZF 5UKDA 3TQHA 1OX5A 1Q6YA 1VJRA 1YZGA 3M34A 4RE6A 5FTLA 1P45A 2HMUA 2V7BA 3JWPA 4IPTA 3CPEA 4A5SA 3DJFA 3LXRA 3OI7A 5K6AA 5E6SB 4PANA 3D0QA 3DOEA 3PQ8A 4B8WA 3JQDA 4DCOA 5AVWA 1KEEA 5F3DA 1QX4A 3FGZA 2OB2A 1QAQA 1J56A 3UW3A 3AUUA 2Z04A 2X2FA 5AVYA 1G20B 1T1EA 3GYGA 3GOHA 4DAEA 2J5KA 2JK1A 4MUXA 3K4QA 4NBVA 3FOCA 4XGKA 3RUCA 4UARA 2YNMD 5DOZA 4D57A 1XRNA 2UYOA 3BWXA 3H5IA 3QFRA 2C4HA 3QFFA 4L3VA 4C0AC 1RIIA 4LGCA 3QX8A 2R6CA 4JUAA 3INNA 1Z4IA 2CL7X 2W37A 2M32A 4YFVA 1ZCFA 3MBKA 1BMTA 2C83A 4OF4A 3D1JA 4C0HA 5K0SA 2YWEA 4NAVA 3MTGA 2G5CA 4FFNA 5H4GA 2P4SA 3S2ZA 5LMZA 1E2LA 1JQKA 4QGHA 4WCFC 4C3VA 4Z4IA 4FNOA 2C4WA 1B0PA 1RT9A 4GMDA 2BONA 4L51A 4XQ9A 3QEBZ 4LS3A 2A5GA 1W7AA 1C7EA 1PK7A 1GN8A 2IOQA 4NZOA 3H2SA 1EIWA 1UT8A 2E48A 4CTMA 3KCQA 1CY2A 5EZ5A 1T4DA 2Q6KA 3OX2A 1JJ7A 4QTTB 3JWIA 2I2AA 3MLEA 1FPMA 3L8ZA 4XSVA 1J2RA 2EGHA 2Q8QA 3OJWA 2WPDA 1T29A 1UJ5A 2VT7A 3GN1A 1IZ9A 3NWOA 5AJZA 3BXOA 3C8DA 2R6R1 4U5XA 5C8YA 3SXUB 4D3FA 3C6MA 3SQWA 2ZBQA 5HOQA 2PE5A 3I9JA 1FYXA 4GHWA 5KHLB 3N6RA 2VUHB 4LAFA 3SSAA 4G36A 7GPBA 2CBXA 3BEOA 2XR1A 2D1QA 2H2FA 2EQAA 4KYVA 2AIRA 1L4BA 1P44A 3FLAA 4LF6B 1UBUS 1W1UA 3O9MA 1XCPA 1V0JA 4OQLA 2C5BA 2ZYIA 3JR7A 4D0GA 1N2SA 1T36A 3JV7A 4MVJI 2WIDA 3KFXA 4CLRA 2GD0A 1B74A 4R83A 1G98A 2J59A 1Y98A 3N3AC 1SZDA 3HM9A 1NW7A 1DBQA 3VR3D 3TGLA 1UBEA 1F8YA 3MILA 5G1NA 3RRBA 2QE7A 5A0FA 3CVOA 3QPBA 1GA4A 2NXEA 3C8MA 4R2MA 4YRPA 1RYMA 3D7RA 1JR3D 3OZAA 5DSZA 1E5VA 5T5QA 3SFVA 2YV2A 3OWXA 2FZEA 1GDDA 5HE8A 2CMGA 5K6TA 1VIAA 4CMJA 1PGNA 4DDKA 1V5FA 1TVEA 1H05A 1O95A 4M0LA 1LZKA 5BV8A 5CB6A 3CH5A 3GLIB 1LLUA 3ANSA 1BIFA 4HNGA 4Q3NA 5ESXA 5KYYA 3A70A 4KX3A 2EKPA 2ZDQA 3CXRA 2D0OB 4ASUD 1IXYA 2HNAA 3DUFB 2DM6A 1FNMA 3W90A 1J24A 2HJVA 5GONF 2DFKB 3AUSA 2CNKA 4G89A 5EWMA 2QGFA 2HRQA 1T1SA 3WSVA 1RP1A 3IPYA 1OJ7A 2BLLA 3GGPA 3GPDG 3G2NA 3HPQA 4BQNA 4WUVA 1DS6A 3HY6A 3LUFA 1RACA 2QU7A 3PCXA 3EFOA 3S6JA 1HFJA 2QXUA 1TM4E 2I87A 3TDNA 4OYLA 5IVKA 2VDKB 3BB1A 4HYTA 3UV3A 1O5OA 4B84A 3H9GA 1WABA 1U0OC 3JQ8A 3T3MB 221PA 3FGOA 4FOPA 1SBCA 1KYTA 3LPMA 4QU5A 1QYXA 3HBFA 4IIGA 5I7UA 5C51B 2HW8A 1QRUA 4EFLA 1K7XB 3BD8A 2C9CA 1IN7A 1KVUA 1NONA 1XDBA 2FU5C 1PSZA 1ZISA 2V8BA 4JBYA 1CR0A 4JQSA 3O8NA 5CDFA 3F6EX 3E8SA 1PR0A 3BJEA 3C7TA 5JCXA 4MS1A 5KMGA 1R18A 5DTIA 3KJQA 2C42A 2FRDC 3QJGA 1SOAA 4CNBA 2IDZA 3DZDA 3DHWC 1XPJA 1YO6A 2VWGA 1OXXK 1YRBA 4XIYA 4ESOA 4PCVA 2G9ZA 5MDHA 4IYJA 4Z4HA 3D3JA 4XH9B 1K89A 3IODA 1Z9BA 3W77A 3C5EA 3ZZTA 1O96B 1JXMA 1DFHA 4I0WB 2GM5A 3VYWA 5JH7F 4HTAA 5FBRB 1JHRA 4JC0A 4Y6SA 1XOIA 1RHMA 3AJ9A 4FWTA 4P32A 3HEAA 5A3QA 4F2HA 2N42A 3DDOA 1R9MA 3CZ4A 1EHYA 5EJ2A 2G6BA 3STUA 4G0YA 5A04A 4LVOA 3UMMA 4E5VA 1B23P 3OKPA 2O5VA 3R2JA 5E1DA 1PYGA 4WJLA 1YJQA 1XPOA 2QRMA 4TKMA 1ISIA 5IZCA 5JAHA 1SXHA 2Q3CA 2XDWA 4JJEA 4UEWA 1ADYA 1KJNA 2PVPA 1L7NA 1HG0A 2VH5R 2VYNA 3P7MA 4L8FA 4PNZA 3MCWA 2OHGA 2XNJA 1QKJA 2C7GA 2FZVA 2ISQA 3BA6A 3DLTA 3IUQA 4UUBA 1FZQA 4LOLA 4Q1DA 3ZCPA 4B85A 1E8MA 1KEWA 1OAKA 2GN1A 3H1AA 1PJAA 5JXGA 1LNQA 2PEZA 3FFTA 3K0CC 5LOVA 1EJ0A 3HJNA 5ARCA 1RPZA 2IJGX 3NKLA 2ZJ8A 3DBRB 3WRWA 3WRXA 4EITA 2WU0A 4HGNA 5FPQA 3BE4A 4EZBA 1IULA 1XZAA 2JHAA 1Z68A 1GUZA 4KWEA 3EEQA 4G4GA 5K3FA 4URVR 3F71A 1AQUA 1GYRA 1YZHA 4QDUA 2QW1A 1UMDA 4BV8A 5LU9A 2Y1KA 3G2JA 2G88A 5JG7A 3TCKA 3H99A 1US8B 1KI1A 1C81A 1UKYA 3HI4A 4LXXA 1I9GA 2I71A 5AVKA 3K94A 4ME6A 1VPLA 1JKXA 4RD0A 3CJQA 3AJRA 2CV1A 3B5IA 5TS3A 2ZRKA 4M1YA 3ABIA 1E2IA 2SKDA 4NBUA 3KE8A 3HDQA 3IAUA 1L4UA 4MTCA 2EX0A 2B0CA 3ET4A 4XKJA 3BXEA 5KVVA 2C2OA 2GWHA 2Q2QA 3GRFA 3GZNB 3OM0A 3HWX1 4QASA 2HA2A 2AQ8A 3GDFA 2ZAOA 3IJ5A 3M4JA 1CUXA 5KSPA 2D1FA 1OLUA 2CBGA 1ECLA 4QQRA 2FLVA 3TTUA 2B4AA 3MRXA 1G55A 2QMZA 3I58A 1HTTA 1M7GA 3HH8A 3F7NA 2Y99A 4G4SO 4Q4AA 5U1PA 4GUDA 2HU8A 2RI0A 1CE8B 3QXGA 1CFJA 1Z2CA 3BVPA 3IUJA 4PSKA 4QTUB 5LNK1 4MGIR 4ZHQF 1H4VB 3AVUA 2FW9A 1TQ6A 3FOFC 1D2NA 1JPUA 5COBA 5L45A 2OTCA 4IKOA 3DMNA 5JC8A 1ZSNA 3I01M 3CZ5A 3U4IA 5ENDA 2YVQA 3AFNA 3PGMA 1YRAA 2DR2A 1Q1BA 1YHZA 4OSPA 3C48A 4J8PA 5CBPA 1JFRA 1SXJB 2ZB4A 1P0MA 1BDMA 1UKAA 3DTTA 2XCTB 1Y3IA 1H3EA 3RI3A 4LDRA 3U3ZA 1O6BA