4WDRA

Crystal structure of haloalkane dehalogenase linb 140a+143l+177w+211l mutant (linb86) from sphingobium japonicum ut26
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
293
structure length
293
Chain Sequence
GAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAIAMPIEAADLPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGWILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQLPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGALTTGRMRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloalkane dehalogenase
publication title Crystal structure of haloalkane dehalogenase LinB mutant (L177W) from Sphingobium japonicum UT26
doi rcsb
source organism Sphingobium japonicum ut26s
molecule tags Hydrolase
total genus 107
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2014-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4wdrA00
3L1JA 1JKMA 3C5VA 3RLIA 3WZMA 1VXOA 3D7RA 2WUFA 4G8CA 5ALUA 4CG1A 3O9MA 1R1DA 4TVKA 5D6OA 3WLAA 4UHFA 2WHQA 1J2EA 4CG2A 3I2IA 4YPVA 5AK4A 2Y6VA 4V2IA 4TGLA 1W1IA 4J0GA 3HYSA 4KR0A 1XZLA 5IKXA 5DTIA 3WK4A 4MXDA 4CG3A 5AKZA 1XZHA 1BS9A 3PICA 1A8QA 4C89A 2VAXA 2P8SA 5H3HA 2ZJ6A 3EIOA 4BAUA 5JD4A 2VATA 3DL7A 1O6GA 1QONA 3QMWA 4X93A 4M0EA 1IUPA 4Y2SA 1CUAA 5AM4A 4PSUA 3HI4A 3KDAA 5FRDA 1E5TA 4CCYB 4IQ4A 4N8SA 3DKKA 5D3KA 1B41A 1QO9A 3FBWA 2XMDA 2OAGA 3EQ8A 2QUBA 1ETHA 4CCYA 3HABA 4FFVA 1HL7A 2XDWA 2AJDA 3H18A 3I6MA 2YXPX 5ALRA 1QOZA 3D0KA 4UFPA 2ZJFA 1CUIA 4UBOA 1XZBA 5AIBA 1HBJA 1LPOA 4Y2QA 5BOVA 1O6FA 2PKYX 3K6KA 4ITVA 1R9MA 3BIWA 4OD0A 5IVDA 2R11A 3LCRA 4UHHA 3FVTA 1Q0RA 1CUYA 1XQWA 1XZDA 5ISMA 4FLFA 5JAPA 1U8EA 5ALYA 1QFSA 4M0FA 5K3AA 4H7DA 2XLBA 1JU3A 1XRLA 3GUUA 3HXKA 1I6WA 4DMFA 4U2CA 4K6HA 4QA9A 4JH0A 1LLFA 2QT9A 3BXPA 1UK8A 1ODTC 3WMRA 3FYTA 5E4TA 3A6ZA 5D3ZA 1QIDA 1CUSA 2BUAA 2XQJA 2G4LA 3RKSA 1ZI8A 5SYNA 3CXUA 1TRHA 1MU0A 3IBTA 5AKGA 3WKBA 4UBNA 5AM0A 2XUPA 3KSRA 5ALGA 2X5XA 3W9UA 4J0HA 4RNCA 3O0DA 2WU3A 4Y2UA 3W06A 4KRXA 5A2GA 1H2ZA 1GKLA 1G5FA 5HFNA 4EBBA 5C8XA 1HPLA 2QR5A 1XLVA 5IVKA 4CIBA 5AM2A 4DNOA 1MX5A 3F97A 4P93A 4A23A 3G9XA 4UFOA 3S2ZA 1RP1A 1GPNA 2X8BA 2VJDA 2HA0A 5BV7A 2I3ZA 2XUJA 5YASA 3W05A 3M83A 3TEJA 5CRIA 4ZI5A 3VVLA 2HU7A 5SYMA 4BVJA 3U0VA 3B3QA 5JATA 4J03A 3H17A 4ZREA 4G9EA 4QEKA 2GYVA 3YASA 3IA2A 3W2TA 2GYUA 6YASA 5EI5A 1PJAA 2WKWA 3BF8A 1F0NA 2PVSA 3S8YA 3STXA 5D7BA 2DFPA 3SC2A 1MTZA 1JJBA 3FNBA 3BE8A 1FFEA 2H7XA 1FFCA 1N1MA 3I1YA 3BDIA 2ZYSA 1QIHA 1KU6A 2IITA 5ALEA 5CT9A 1EI9A 4WFIA 4EA6A 2ZYRA 2O7VA 3HJUA 2XMQA 2WG2A 3OURA 4H7IA 3M81A 4QLOA 3HLKA 4CI9A 2C0PA 1U2EA 4BVLA 1GT6A 3DKRA 1KU0A 1H2WA 3I2HA 3IVMA 3RM3A 1CUGA 5BWBA 2AJLI 2VSQA 3MUOA 4Y2JA 5ALNA 4NVRA 2JIDA 2PU5A 4W1SA 3FYUC 1BRTA 1A88A 4C4XA 4J0KA 2HA3A 1EHYA 3KWJA 1W76A 1VJ5A 3BIXA 2WFMA 1R9NA 1S8OA 5ALHA 1WB5A 2ONCA 4XX1A 3MUNA 1ZIYA 2PUJA 2JGJA 2JEZA 5FLKA 2RONA 5AKEA 5AI5A 5AKIA 4RGYA 3C87A 3F9CA 2Z5GA 1W6RA 5I8PA 3SK0A 1YR2A 5ALVA 4U2EA 4BDSA 4L0CA 4Y2YA 3EQ9A 1K4YA 1Y37A 3ESDA 1MAAA 5AHXA 3BJRA 4AXBA 3F96A 5CXUA 1XZKA 4OCZA 4Q3LA 3FCXA 1MNQA 5ALJA 2HM7A 3AZOA 4J3JA 1TKRA 5HF9A 3EF3A 2PBLA 1THGA 1RYYA 2XE4A 2B4KA 4FWBA 3HRHA 5LKRA 3X3HA 5AKKA 1NU6A 5EHQA 1XQYA 4NZZA 4QWWA 3T4UA 3ZLTA 2WILA 1L7AA 2PU7A 3PF9A 4MEAA 4RE5A 1XZJA 1CVLA 4H18A 5JYCA 3QBJA 2QJWA 2UZ0A 2GZRA 5A6VA 5CT4A 4J0DA 1WCYA 3R3UA 4PSCA 1ZD2P 2DSNA 1GPKA 3Q0TA 4X97A 3E4DA 2QZPA 3FOBA 4Y2RA 1VKHA 7YASA 3WWOA 2RAUA 1SOMA 3R3WA 4RPCA 5ALPA 2JBWA 4X92A 1GQSA 3F67A 1XRNA 1X2EA 5KBYA 5LLSA 5AK5A 3KXPA 4B6GA 3NGMA 5AKLA 2WTNA 3O4GA 2VJBA 5HK8A 1WB6A 4BCBA 4H7FA 4W9RA 3C6ZA 4E46A 3GFFA 4B7ZA 1FFAA 3LS2A 2IIVA 2HHAA 3D59A 2H9YA 4D9JA 5J3JA 5AI4A 1AQLA 4FBLA 3FWHA 1UKAA 2JGMA 2ZSHA 2RHTA 3LP5A 2VJCA 2OGSA 3DNMA 3DEAA 4EZIA 3ZLUA 3R3ZA 1HKHA 2QVBA 4EB0A 4GBGA 4N5HX 3VKFA 2CKMA 4B84A 2AJBA 2HA6A 3FLAA 5JASA 4KE7A 5K5EA 3ICVA 5CTAA 1BEZA 3O4HA 3HC7A 2V96A 3HZOA 2J3DA 5FPPA 2WIFA 4DTCA 5DYYA 3KWFA 2QRUA 1J07A 4DYHA 5AICA 1MN6A 3L1HA 3HEAA 4QDTA 2XQFA 1DWQA 1CPYA 3I2GA 1YAJA 3WIBA 1X70A 4JYMA 2Z3WA 4W1RA 3ESBA 3IUMA 5LIPA 4LIPD 5CT8A 4RE6A 1WB4A 3CCCA 1MJ5A 2HL6A 2YYSA 1T2NA 3O95A 4N8DA 3IUJA 4NS4A 5AIAA 5AP9A 2QKYA 5EHNA 2CZQA 1DWOA 1QJ4A 2AXEA 4E11A 1G66A 3OOSA 1TAHA 3N0TA 4WDQA 3STVA 2IX9A 1F6WA 5A7FA 1Y7HA 5EFZA 5FOQA 5JD6A 4BYMA 5AO9A 2CB9A 1JJFA 3G9TA 3H04A 4Y7DA 4K6KA 5JAUA 2EDCA 4WJLA 4UFNA 4FMPA 5LP1A 2BUCA 1CUDA 1DTEA 2ES4A 1UK6A 3C6BA 1QIJA 2ZYIA 3I6YA 2QS9A 5AI9A 1QIMA 2PX6A 5BWCA 5IVHA 1YAHA 2QJRA 3M82A 4MYDA 1EINA 1GKKA 2WQZA 2XQIA 1UXOA 2H7CA 4BATA 1EVQA 1TQHA 3A2NA 4FTWA 4JUIA 4QDXA 4KACA 4X91A 3OPMA 4BVKA 2EDAA 2YH2A 4DGQA 1XZMA 3TRDA 2WUEA 3A2LA 2XMGA 1VOTA 1EX9A 3FSGD 1BEEA 2VAVA 5DTJA 2HA4A 4H7EA 4DNFA 1N5MA 4AO6A 3I1IA 1TCAA 2G63A 2Q0XA 4MQLA 3K2IA 1YA8A 1Y7IA 4J7AA 1HDEA 4QNNA 3DD5A 5EIHA 3H2KA 1K6EA 3W04A 4BCCA 4X6YA 4OB8A 3WK5A 1EB8A 2WU4A 1BN6A 3V48A 1XZFA 3B5EA 3WKDA 1TIBA 4AX4A 1XQVA 2GBIA 3C45A 3F98A 3M3DA 5HF6A 5ALXA 5AM3A 4FFWA 4AZ3A 5DNUA 5DLPA 1A8SA 2GYWA 1AZWA 4H0CA 2ZSIA 5ALDA 3MGAA 5AI8A 4IH4A 1RWQA 3D2BA 4G8BA 3IIIA 4LKOA 4B0OA 3H19A 1N5RA 1K5PA 4ZRDA 4X71A 5AKJA 1EDBA 2CMFA 4HRYA 3V1NA 5JANA 5AKYA 1CLEA 4UHBA 4Q3OA 2JGEA 5K3EA 4W1QA 1XKTA 3R3XA 3QVMA 3G7NA 4MQMA 2FUKA 3NUZA 1JT2A 4X6XA 2HA2A 2R8BA 4C87A 1M33A 1AGYA 4UHCA 1L7QA 3PDCA 4B81A 2RIPA 2GZSA 1VA4A 4EY8A 5HK9A 3ANTA 4KE8A 3G0IA 1XZAA 3V1LA 2ZYHA 2OQVA 1AC5A 5FKJA 5A7GA 1UK9A 4AZ0A 3STYA 1U4NA 3DCNA 3EQ7A 3AFIA 1SCIA 3Q8WA 2HRRA 1XRQA 5A62A 2ROQA 2HFJA 2JGLA 3GROA 4ZV9A 3IURA 1UZAA 2H1IA 1EK1A 4HAIA 4LHEA 5CW2A 1UT6A 3PF8A 5JAHA 4G4IA 5IVIA 4PO3X 2XMRA 3DDUA 4WCVA 4GECA 4KYVA 1XZGA 3D2CA 2QXTA 4AQDA 5I7UA 5A71A 3STWA 2XUFA 5ALFA 2WLSA 1W75A 5AM1A 1AUOA 4ZWNA 4HZGA 3K9BA 5KWIA 3NWOA 1A7UA 1MO2A 5ESRA 4L3WA 4KE9A 4UBKA 3WIOA 2XMBA 1LBSA 2O2HA 2ZJ7A 2WFZA 3FLEA 4GW3A 2OLEA 1YSCA 3ZLVA 5HKAA 4I3FA 3C6YA 1EK2A 4FLMA 3W9BA 3CN7A 5LZ7A 1E8MA 3D2AA 2ORYA 5AJHA 5FPQA 1ORVA 2WTMA 3PFBA 2PSFA 3WYNA 2DHCA 3AZQA 1QIEA 2XMSA 2XQKA 3TJMA 5FDFA 2BFNA 1T4MA 2DHDA 4CFSA 1CFJA 4EY6A 4AMYA 5HFAA 5DYWA 3MVEA 5JALA 3OM8A 3WWPA 5KWJA 4UBJA 2ZVDA 2WSLA 2X76A 1G42A 4W63A 3DYVA 5HF8A 4OUKX 1R4ZA 5LZ4A 2RHWA 3WK9A 2NW6A 1DT3A 1XZCA 3QITA 2WHRA 2GBCA 4B9AA 1MT3A 1CUCA 2BGNA 5F4ZA 1CRLA 4LYEA 5ALSA 1SFRA 2ACEA 3ILSA 4Y9SA 3WL7A 3JWEA 2WHPB 4AN0A 1CUXA 3WJ1A 3SWWA 4HRXA 4AB1A 3D4LA 3H2HA 1AMNA 5JADA 2WHPA 5A7HA 3N2ZB 3QMMA 1YB7A 2OCIA 2GBGA 2WM2A 1BN7A 2C7BA 2XUAA 3WI7A 3PUIA 2O2GA 3AIMA 1QLWA 1A8UA 2RI6A 3H0CA 2CEKA 2BJHA 2HU8A 3WKEA 5CH8A 3F8SA 4X3CA 5EIEA 1BROA 2HIHA 5K3BA 1GZ7A 2J4FA 4H77A 4NMWA 1PFQA 1ACJA 3G0GA 3TGLA 3STTA 4O08A 5LZ5A 4X00A 1C7JA 4HTAA 2HDWA 4DSZA 3H2IA 5LKAA 5AI6A 4G9GA 3ZI7A 3H1AA 4BDTA 4PF1A 1ZGBA 5HQ3B 1EB9A 2JGKA 2JGIA 1YA4A 3WYDA 2VTVA 1SCQA 1TK3A 4G1FA 1E8NA 1W52X 2I03A 3RARA 4DIUA 1LPBB 5HQ3A 1LPNA 4MYSA 4FDMA 4Y2XA 4LYDA 4WDRA 3I28A 2OQIA 3GELA 5JIBA 3GBSA 1UKBA 4OB7A 3ED1A 4U2GA 3I6ZA 4B9EA 4C01A 1DINA 5E4YA 3C70A 1C4XA 2JEYA 3VDXA 4Z49A 2Z8XA 1GQRA 4YX9A 4N8EA 2XMZA 1E89A 3O4JA 5K3DA 3G0CA 5AKXA 1SC9A 5EGNA 2DCMA 5HZGA 4BC1A 4JYPA 2XUHA 1LPSA 4X7BA 3KD2A 3H2JA 3QPAA 1UWCA 2YASA 1L7RA 2XB6A 2RGUA 2QXUA 4BAGA 2WUGA 4G5XA 3DOHA 3L1IA 4Y2PA 5ALMA 4N5IX 5FV4A 5I9IA 5LZ2A 2XUDA 2B61A 2PL5A 4BBZA 1CV2A 1E66A 1QZ3A 4DSAA 1R3DA 2DQYA 5CXXA 1BE0A 1XZEA 1VA5A 3KOOA 2WJ3A 5EHXA 4GHWA 2FJPA 2OPHA 4GI1A 2OGZA 2Y6UA 4J0CA 4K5QA 1LPPA 1CR6A 4BAZA 4X94A 3WK7A 1LBTA 1LPMA 2LIPA 3VJKA 3HSSA 3OTQA 1WPRA 5CBKA 2Y2UA 4DNPA 4BRSA 1K8QA 1QIGA 4IH1A 4Q3KA 2O7RA 2WFLB 5T4HA 5CT5A 3WKCA 3B12A 4KE6A 4BE9A 4MEBA 3VJLA 1UOQA 2HRQA 1F8UA 3ICWA 3R41A 2I78A 4G4JA 2WFLA 5T4FA 3G8YA 5C8ZA 1CUHA 1OCEA 1W4LA 4AO7A 1CEXA 2VF2A 3C8DA 1BCSA 4JEIA 1VZ3A 5AM5A 3WZLA 1ZOIA 4FKBA 4OB6A 3JW8A 3DL4A 1CUJA 3DLTA 2D0DA 3I2FA 1GPLA 2HADA 5FP0A 2O2IA 4GEGA 1QIIA 1DX6A 2C4HA 4BTLA 1JFRA 2QOEA 4H7KA 5LZ8A 3D3NA 1Z68A 4Q82A 4AN1A 1MX1A 4F60A 4KEAA 1MAHA 4OYLA 4Q1VA 1P0IA 1PV1A 3VVMA 1N8SA 4UBLA 1ORWA 3FVRA 5EIAA 1UK7A 3UUFA 1QGED 4C4YA 2XI4A 1XRRA 4M0MA 3V1MA 1ISPA 3C8HA 2VA9A 4B0PA 3OC0A 1CUWA 1UKCA 3P2MA 1BU8A 3AZPA 3IUNA 2XUKA 3FAKA 1IZ8A 4A16A 3WL6A 4I19A 1YASA 3U1TA 4G4GA 2XUIA 3V1KA 4UUQA 4DMCA 3GA7A 5CT6A 1YS2X 4FBMA 1FJ2A 1WOMA 2WJ6A 3D5EA 2ACKA 5AOCA 4BE4A 2PSHA 2XUQA 4U2DA 4X90A 4QZVA 4P9NA 1NU8A 5AI0A 4GDMA 5IH7A 5AOBA 4Y2TA 5DJ5A 2PSDA 2I3DA 1QO7A 4LXHA 2J3QA 4HXGA 1CQWA 1GGVA 4P92A 1Q84A 4PQEA 4UHEA 3QM1A 5HCUA 3C6XA 1ZD3A 1UOOA 1NX9A 2B20A 1SCKA 4CCWA 2K2QB 5EHZA 1TCBA 5AH0A 4I4CA 1XLUA 4LXIA 2OCGA 3FSGA 2WIKA 2V9ZA 4FOLA 3GZJA 1JI3A 4QWMA 1MNAA 3R40A 5JAOA 4ZV7A 1DQZA 1HQDA 1J06A 3AILA 1B6GA 5C7YA 1IZ7A 1TCCA 4ROTA 3H1BA 4QDUA 5ALIA 2QUAA 1WM1A 1C7IA 2WG0A 1XLWA 2FJ0A 5K3CA 3VISA 1AX9A 5HF5A 2WIGA 5JZSA 4B83A 4K6GA 2PSEA 3RK4A 4IH9A 5ALKA 3DQZA 3T52A 1R50A 1EA5A 1MX9A 3ZPXA 1ODCA 4FHZA 4C4ZA 4PSDA 2QMQA 1H2YA 3WWEA 1K63A 3V9AA 3SX4A 1CIJA 4UBIA 1ODSA 5C8VA 3WK6A 4LXGA 4GXNA 4ZGBA 1OXMA 2OG1A 2XQGA 4YK7A 4KAJA 4KJXA 2OCKA 1QTIA 3WWDA 4HXFB 4GLBA 1JU4A 4AO8A 4HXEB 1Q0ZA 2VT6A 3AIKA 4MWTA 4P08A 4DLNA 2VEOA 4G8DA 5E2IA 3WWCA 4XVCA 4AMZA 4OSEA 3WJ2A 1ZIXA 5JD5A 1THTA 1R88A 3DS8A 1IUOA 4Q34A 2JF0A 3LIIA 3WA7A 3O9VA 4OYYA 3E3AA 4BCDA 4EY5A 1EVEA 5JZ9A 1EDEA 1FFDA 4U2BA 3ESCA 4PV7A 3FCYA 2G5TA 4MWSA 1G4HA 3QH4A 4HVTA 4BTVA 3QYJA 3AINA 4E14A 1MPXA 3VXKA 5HKBA 2Y2VA 5CMLA 2WUDA 2WIJA 2QTBA 4U2FA 4Y2VA 4UHDA 1CUVA 1YCDA 3QZUA 3PI6A 3G9UA 3I2JA 1VXRA 4IO0A 4KRYA 4H35A 1P0PA 2VQ6A 1CUUA 1YS1X 2BAGA 1YB6A 3LIPA 2BCEA 1QIFA 4FLEA 3A70A 2E3JA 1P0QA 5ALWA 1X2BA 3E0XA 4XJVA 1JMYA 4H7HA 1LZKA 2HA7A 3FLBA 1WHSA 4HS9A 5CH5A 4XWGA 1LGYA 1F0PA 1P0MA 4A5SA 1E8DA 1AKNA 5CH3A 1QIKA 2AJ8A 1UFOA 1VE7A 5K3FB 2J4CA 1DQYA 2OGTA 4DMHA 1KEZA 1IMJA 4QE3A 2VJAA 3IUQA 3STUA 4MJ3A 3C5WP 1CUFA 5K3FA 4UPDA 5ALZA 4JNCA 1OILA 5FXMA 4K2AA 2H7YA 4EY4A 4BP9A 3ESAA 1CUEA 5T4BA 4Q05A 5E4JA 1DWPA 1ZJ4A 4XIIA 5ALQA 3I2KA 3BF7A 2C5GA 3UMJA 3ZWQA 4KAAA 1USWA 3ANSA 1CUZA 2EEPA 3IULA 3R0VA 1H22A 2WJ4A 3CCBA 1LPAB 4DNQA 5LZ9A 4B82A 1VZ2A 4CIAA 5T4EA 3WL5A 1DU4A 3VJMA 5AK3A 3WK8A 5DNVA 2G5PA 2XLCA 2Z8ZA 4PNZA 4WFJA 3O4IA 1E3QA 4WY5A 4BZZA 2AJCA 5ALLA 4B80A 2GBFA 1LNSA 4ZXFA 3A2MA 3R3YA 4BZWA 3E1GA 4UBMA 1EDDA 3JYHA 4OU4A 1HLGA 4QDOA 1XQXA 4W1PA 4IHAA 2XT0A 4X95A 1DX4A 5CURA 4C6HA 5ALOA 5KREA 4F21A 4H7JA 4X85A 1ZICA 3G0DA 2ECFA 3AUKA 2BKLA 3PUHA 4C88A 1ZJ5A 1VE6A 1EH5A 2HU5A 2Y1KA 1XZIA 3QPCA 3NOXA 2XUOA 1ZD4A 4DMKA 2JGFA 3IB3A 4GWLA 1QE3A 2FX5A 5DNWA 4E15A 3C43A 2DHEA 4BRZA 4TPKA 4B85A 2Z3ZA 4QLAA 1IVYA 1QTRA 2OAEA 3QPDA 1U65A 3AIOA 5JZBA 4PW0A 4FNMA 1D07A 4OU5A 4S0XA 1J1IA 1XKLA 5DWDA 2HFKA 1UOPA 1EXWA 1ZI9A 1JJIA 2CJPA 3WL8A 4ARBA 1GXSA 4J0IA 2B9VA 1ZD5A 1FSSA 1WPXA 2PPLA 3DOIA 3BDVA 2OCLA 1XRPA 2W22A 5AK6A 2OXEA 3ZV7A 1CQZA 2W6CX 3G9ZA 5FUMA 4X6UA 3WA6A 2BGRA 3OG9A 2C58A 4FNGA 4QDZA 3CN9A 1ZI6A 3BJMA 2PUHA 3DJYA 3H2GA 4BB0A 1H2XA 1ZGCA 4F5ZA 3G02A 3QMVA 1Q83A 1VLQA 1XRMA 2DR0A 5JARA 1WHTA 1CUBA 4WY8A 2WG1A 1DT5A 3WQHA 2QM0A 3R3VA 1JMKC 2PSJA 2XUGA 2XMCA 4ARAA 1ACLA 4INZA 4YASA 1AURA 2V97A 1LZLA 5LYYA 4BC0A 3LLCA 5ALTA 3AJAA 3PE6A 3UUEA 3EBLA 2VT7A 3FYUB 4EY7A 3BWXA 2CBGA 5AOAA 4L72A 2DQZA 1H23A 4L9AA 5AKHA 1FFBA 2PM8A 3DYIA 2HA5A 2CUTA 3FYUA 4KAFA 3WKAA 2C5FA 4F0JA 4ETWA 1XFDA 4WFKA 4BP8A 3G0BA 5DYTA 1IUNA 1XROA 1QFMA 3IDAA 3HACA 4EUSA 2D5LA 5C81A 1BCRA 4EHBA 3PFCA 4DM7A 2WIDA 2BUBA 2C0QA 2V98A 3BL8A 4OPMA 4J0JA
chains in the Genus database with same CATH superfamily
1I4WA 3L1JA 2XB4A 3JQAA 3JZFA 4RO0A 4PTZA 3RLIA 3J80A 1FXWA 1I01A 3C3CA 2YBDA 3WZMA 2VDRB 2IP2A 3K0FB 2NQ2C 1QC5B 5ALUA 2APJA 3O9MA 3MYRA 4NMLA 3OKPA 4TL6A 4PLGA 2JCVA 2XB9A 3AEQB 3JQ8A 1Q50A 2R6JA 5GP1A 2Q5QA 2IQ5A 1AKUA 3CU5A 4ARVA 5IDXA 3OWXA 5D6OA 3LG2A 1UKVY 3WLAA 4UHFA 2V6MA 2L2QA 4CG2A 3THXA 2IPXA 2FKNA 1TL7C 2Y6VA 4JJZA 3I30X 3QUSA 4J6FA 2QRVB 4DPMA 4Q9HA 4KR9A 2QQ5A 3DAHA 3QY0A 4L6AA 1RPTA 1ZW1A 2GAIA 3CE6A 3HYSA 1DARA 1XZLA 3W7AA 2EU8A 3TL3A 5IKXA 3UWMA 2OEPA 3U61B 1MC5A 3UPTA 5FOVA 3WK4A 3D43A 3UPDA 1NW7A 3CF4G 4DS3A 3V80A 1N8KA 2VZ8A 4CG3A 2OUKA 4E1BA 3HDQA 3SAJA 2D1TA 3COZA 3QOXA 1BS9A 3N2LA 1A8QA 2CVFA 1ILEA 2C07A 3I5XA 2ZJYA 5B3LA 4F46A 1P1BA 2EXXA 2MOKA 4E2FA 1ZH4A 1GA4A 1XIVA 1G2QA 2XNJA 5FBQB 4A8JA 3W1WA 3VU1A 2QMHA 3DP9A 2DWCA 4AS3A 4F9TA 1FP1D 4K87A 1VMAA 3DKVA 1SCUB 4RLFA 5DOVA 4AYTA 4CM8A 5ICEA 4HKTA 2YWXA 1CQIB 1QFZA 1WZCA 1KZHA 5KNLA 3WLJA 3DBHB 2JG3A 4U7HA 3T7TA 2WM9B 5JDCC 2UZIR 1CUAA 2XR1A 5IDYA 4JCOA 4PSUA 3VX4A 2J9FA 3KDAA 4RK1A 1NLMA 3BM5A 5FWAA 4DJEC 1ECLA 3R0ZA 1WV1A 3D7LA 1Y5MA 4IQ4A 4N8SA 1T4GA 1LQ2A 2I2CA 1ZNZA 1SB8A 4BNDA 5BPHA 4LOJA 2GERA 1NBHA 1ZXLA 1P5JA 1YDFA 3IT1A 3PEUA 2XMDA 4YAJA 2C61A 2OAGA 4NPAA 3QELB 1UXIA 2VP0A 1X1AA 4MV7A 4ND5A 5AMXA 3V1UA 4P54A 5KNBA 4FWTA 1V3QE 1GNQA 1FJHA 2IYZA 4FFVA 3WDKA 5F73A 1WW2A 3EXAA 4NXNB 2F4NA 1JDJA 3AESB 3CJRA 3AFHA 3M6IA 4WERA 3RFCA 4EJ2A 4P4NA 1E3EA 2Q7DA 2AN3A 3FJYA 5DTEA 4AMUA 3AERB 2G0NA 4MGZR 2QGZA 1U0RA 2GZ3A 3H18A 4UMDA 1TVEA 1J9ZA 3TWOA 1NAIA 1V8FA 1Y9ZA 2XH8A 3AH8A 3GJ5A 2YXPX 3I9V1 5HIMA 3RSGA 1E20A 2I4NA 2Q46A 2QP4A 4YRQA 4O5OA 1E5VA 2XBUA 1B6RA 3WV5A 1QOZA 2IT1A 5D01A 3D0KA 4FR5A 4E21A 3BD9A 4UFPA 2E5LB 2NU8B 2COUA 1O97D 4UD2A 2ZJFA 1CUIA 3EFBA 5CUQA 3HMKA 4JC8A 3SMQA 2DM6A 3W34A 4KXUA 3UGJA 2M1ZA 4CR6A 2P69A 4Y2QA 2XD4A 2GD0A 4YP7A 5BOVA 1IQ0A 1FUEA 1O6FA 3FPBA 3ETGA 1UR5A 3HWSA 3M4ZA 4P33A 3K6KA 4H6PA 5BV1A 1IEWA 2QORA 2ZI3A 2RGYA 2IYRA 2Y1CA 2ZXFA 2HJ9A 4OD0A 4WADA 3WLEA 1F2TB 1OFUA 1WIWA 1XU7A 2AF3C 1SBNE 3LCRA 4J8PA 2ZSJA 1CBUA 3VO2A 1X94A 4C0SA 2CWDA 1VHTA 2P27A 3HXLA 3E2PA 1FNSA 1Q0RA 4RK4A 4WZ6A 3JSAA 1I2MA 4GMFA 2JJ1D 4GXRA 3TOXA 4DR5B 5GIOE 4AECA 4XUDA 1OZGA 2ZREA 2X23A 2Z9BA 1Z25A 4QIHA 5ALYA 1QFSA 1T15A 4J2HA 2GD2A 4RDXA 5L4NA 4TT3A 1GKIA 1HLFA 1E2MA 4Q03A 3Q15C 3SR0A 1JU3A 2LKDA 1NXVA 1FDVA 1XRLA 3GUUA 3NDRA 4DLYA 4GWGA 1UXHA 3A7DA 2WJAA 4I8IA 4K6HA 1OYVA 1PL0A 4LYAA 1ULHA 4B3DA 4BO7A 1NVKA 2R4UA 2XZTA 1N0VC 2ZUSA 5I9BA 3VR3D 4Z54A 1S4QA 3CT6A 2QBYA 4GE0A 2J3KA 4RHCA 2C20A 1GPJA 3BXPA 1VG1A 3ZK7A 5JZVA 4CT4B 1RLTA 1Q7EA 4TLDA 3UO8B 4ZKEA 3KAPA 1OI7A 3WMRA 4DC9A 4AKIA 5CM2Z 2GFHA 4N0EA 4KXVA 2FQ1A 3BGDA 5KSYA 3OC6A 1ZP6A 1K97A 4RTPA 4ZCPA 1QIDA 1YR6A 3GL9A 4PXYA 3EIXA 3L0PA 1QQ6A 3O3MB 3FOFC 5HW0A 4QECA 1Z07A 2B8JA 2OHGA 4QELA 1ZI8A 1UINA 1G3UA 1XT6A 3UK1A 2W2QA 5KDOA 3UM9A 3M4JA 1IM2A 3IBTA 4GICA 2UVPB 4TV8B 5AKGA 1ZS9A 3AGPA 1HORA 1Z4MA 5HWSA 4QUEA 4FGJA 5ALGA 3MC1A 1LI7A 1VLJA 4OLHA 3VU8A 2ZI5A 1A5BB 2C7OA 5HE8A 121PA 2VDPB 2H2GA 3MTIA 5AR1A 3IPXA 2O2YA 4HI0E 1PTJC 2FRDC 4Y2UA 3W06A 5JV5A 2CLEB 1QGUB 3UMYA 5KKAA 2QTZA 4EW6A 5A2GA 4CXMA 3B1KA 1XTBA 1H2ZA 5E6SA 4BU0A 4LISA 3GT7A 3RE1A 4UEKA 4PNPA 3TR0A 3CZMA 1FX0B 4AN4A 1P4GA 4Z4QA 5IM4F 4CTOA 1EZ1A 2IHNA 2ZAYA 3OM1A 3VC7A 4H4DA 1X19A 1VG9B 4M9RA 4BO1A 3ILHA 3P2OA 4JQCA 1ECCA 5EVJA 3RUPA 4B3XA 5KS2A 1RBMA 4NEHB 4U7JA 3QEBZ 1RQ2A 1HEUA 5IVKA 1T2VA 5FBRB 3E9CA 2BR3A 2IPMA 4P93A 1V4VA 1FU7A 1NXPA 2WDZA 3S2ZA 1RP1A 5H8WA 4QUKA 5IG2A 2JAUA 2ZS8A 3QUQA 4QU9A 4PAOA 5I5EA 3UJ6A 5AW2A 5ECGC 1QGYA 5AJUA 2BPOA 3HLTA 3W5AA 5F3WB 5CX1B 3RU7A 4FYYA 2H1LA 2G8NA 2NIPA 3MAAC 5L6MB 2HGSA 3QWAA 2F9LA 2VBIA 4HN2A 1DMSA 1L5VA 1FNDA 4ZOCA 1QJCA 3CEAA 2CHEA 3ODGA 3NS7A 1LY1A 4EPXA 4AQYB 2OZEA 1P29A 2R2GA 4B43A 1ZG3A 3U0VA 2PKXA 2R7KA 4DSNA 2WT8A 3L01A 3KPWA 5FR2A 5MN4A 3T0GA 1E59A 4MI6A 4JFRA 2HQBA 2HIGA 2J0UA 3LOPA 1YCGA 3C4JA 4D9KA 5LL6P 3W2TA 5EHIA 1DBRA 4WKGA 1NIPA 3GFOA 3KTAB 4IMPA 4P2GA 3IT0A 1V1MB 2OT3B 2W6MA 4IS2A 3D3QA 4PGGA 5EI5A 3GPLA 1UBFA 3B53X 4Q7JB 3P4XA 5DI3B 1YZKA 5ECWA 4BMXA 3FR7A 1RC1A 5CLFA 3RAEC 1YBVA 3DDCA 2PXAA 4BMCA 1HK7A 4CI0B 1NP6A 4FW8A 4N01A 2LW7A 3BB4A 3OIFA 3HXOA 5F2EA 1J49A 2CV2A 2QJFA 4X7PA 4ZOEA 1KZ7B 1U7DA 4B7UA 2J5BA 2GCEA 1G41A 3M9WA 3C3WA 3RJ9A 4CDGA 1MTZA 3BXEA 4WLVA 2QVGA 5A4MS 3SFTA 1A9QA 3CLHA 1MDBA 1M6VA 2UVQA 4PO1A 2YJ6A 1Z2PX 1G3IA 2H7XA 2BMEA 4WEOA 5I48A 3QKRA 2ZE8A 3I1YA 3V7WA 2EJVA 4LPKA 5FI0B 4L5AA 5AQ1A 3KKPA 3LBYA 3BDIA 4GX1A 2HN9A 1DELA 1IMOA 3BA6A 1O03A 3PKIA 4BFYA 5AVRA 1QIHA 4G01B 3PFHA 4CLEA 2O5RA 3FI9A 3QV2A 1GU7A 4XYLA 4RVFA 5ALEA 1TKAA 4HTFA 2FOXA 2BKXA 2EKQA 3HY4A 2IV3A 3UV3A 3IKMB 4WFIA 2ZYRA 3PNMA 1PD0A 3K73O 3V6LA 4DJJA 5IHXA 1H0KA 2WG2A 4A15A 3OURA 1AS0A 4F1WA 4LWQA 4QLOA 3HLKA 2GDZA 2VPTA 3SGLA 4P3XA 1F8YA 4ZVQA 4D74A 1PR1A 2R9VA 2C0PA 2EYQA 3KQMA 4WZBE 5F4BA 3IXQA 4RF2A 2PIAA 2ZBRA 3O4FA 2O19A 4DA6A 3FNEA 5C18A 3MMSA 4RIIA 1I3CA 1GEGA 5IW8A 2ZZMA 4G9BA 1Q22A 3DMDA 4YAFA 1ZESA 2NZWA 5BWBA 1E2BA 4ZT7A 2ID7A 3CW2A 1E5QA 4HZUA 3MUOA 5C3UA 1ZU4A 3MSCA 4GM0A 4P86A 3N28A 4WK4B 3SZMA 4J91A 2JGDA 3W3ZB 5BUSA 4C21A 3OBIA 4F4FA 2CXRA 4KZPA 1FMJA 4L4ZA 2EFGA 3SHOA 1D1TA 1MJNA 2PU5A 3ZD9A 5H70A 4W1SA 4W5NA 3KE8A 5IYZB 5I7OA 3CXRA 3DE3X 4IL5A 1BRTA 1OGJA 5FI5A 2CYBA 3CX8A 4BMPB 1JBQA 4Y2GA 3FOCA 4OXXA 1EHYA 2JLZA 4J90A 1IG3A 4MARA 3KWJA 4LZJA 1E4EB 4UOEA 1T8SA 1C1DA 3B9PA 3NDIA 1RXUA 4KV7A 4CM1A 2IEIA 4KKVA 4G0PA 3P0JA 1H3EA 4LI3X 3A6PC 1QGZA 2JKZA 3ZVLA 1I7NA 2OUIA 2P90A 3AEKA 4NFSA 4PAMA 5B3AA 3HCOA 2HMSA 4RK6A 1IWBB 3PHIA 3FVVA 4JODA 1A4IA 2BGIA 2R8XA 2UUPA 3BCSA 4A1FA 4LHVA 2ZS7A 4A1OA 5A6SA 3CLUC 1VIMA 2PS3A 2XYVA 5CNMA 2PUJA 5JUWA 2JEZA 4U3JA 2WYVA 2YJ4A 5JAZA 4ZTUB 1P1KA 4D26A 1RQNA 4N41A 1U1EA 1YJ8A 3C3BA 3LVRE 4N3NA 1CSEE 2HK6A 4QBIA 3KB1A 3Q9SA 4K81B 5JSFA 2P6NA 2VPZA 4IIFA 3AL3A 5AKIA 1S9DA 1L4LA 1M6NA 5CFNA 3B6IA 3B70A 2Z5GA 3UTCA 3BE5A 1GFZA 1R0CA 4U1RA 3WB0A 2Q0HA 1YTLA 1YR2A 3UB2A 2PBFA 3IKVA 1V9SA 1QFJA 2YVAA 5ALVA 4Z2AA 1P61B 3I72A 2JIRA 5H7XA 4L0CA 3MS7A 2TMDA 1QHNA 4FFBB 2XNKA 4YACA 1K4YA 3BHNA 3LQFA 4IX1A 5C2JB 2QY9A 5AHXA 2IYSA 1DBWA 4AXBA 4BHTA 3SZRA 3UHPA 1B23P 2WF9A 3F71A 3F96A 1SC4A 2SKDA 1G5IA 3SYTA 4DLRA 2BTQA 3FDIA 5CXUA 3VR6H 4Q3LA 2PUGA 3O2JA 1C2YA 1SA0A 3RV3A 4J3JA 5TDHA 5CGQB 1F3LA 1R5OA 3H9GA 4MUAA 3MNFA 1VTKA 1GNLA 3TXYA 3PDWA 4O2AA 1AH2A 1RYYA 5A3SA 1ZQ9A 2B4KA 2XE4A 3PUWA 4FWBA 4LFBB 1E94E 1QO0D 1RM5A 2XNCA 4OAOA 1UBLS 3X3HA 5K03A 5ER9A 1ISGA 1NU6A 1XQYA 3C6QA 4KNVA 2Q6KA 1QRUA 4RGVA 4RACA 2JCGA 3OO1A 3OZEA 3ZD7A 4MMZB 3SQLA 2OP0A 4MRMA 4ZCRA 1TYEB 1BG6A 3U26A 2HBZA 3RUHA 1B0ZA 2PU7A 3KKOA 2ZJBA 3ZS8A 3ABRB 2AOUA 2ZUCA 1RKVA 3RIMA 4IINA 4DBLC 3WGHA 5FTLA 3DMRA 1EGHA 1XZJA 2R1ZA 4KVAA 5H68A 2BP7B 1QGAA 3O75A 1HH4A 1E2QA 2G17A 3K0AA 4Q4JA 3UJBA 4PS1A 3IR5A 2GBLA 1RQLA 2ZPAA 1DG1G 1GM5A 4TYMA 3QBJA 5CDFE 2VNHA 1T9HA 4A2QA 5KOYA 2A3RA 3TLZA 1RR6A 4HDSA 5EJ9A 4US0R 4M4SA 3B7WA 4Z4CA 1IJBA 1C30A 5BYBA 2DSNA 5B7GA 4M53A 5FWXA 3U31A 2ZG6A 4PLHA 4QGFA 4WA7A 1DKLA 1VP3A 1FRNA 5T67A 5LU9A 1JDBC 4FZ5A 3EG9B 4NONA 1KVQA 3LRTA 1VYUA 1NW9B 2FQWA 4JQSA 4Z3DA 3RT1A 1JYSA 2C9OA 4M6WA 2CV1A 2OO7A 3FOBA 1DZ3A 1W36D 2WSIA 3FKJA 1VKHA 1DSSG 1SQFA 2EW1A 4DSOA 5E0KB 1EVIA 5IT9A 5BWNA 3QI2A 2PMDA 3WIVA 1SOMA 4XRRA 3P94A 3JQBC 3B60A 1VDMA 1TQ8A 1PWZA 4WK2B 4B34A 2PX4A 2JBWA 3D6VA 3AFGA 4G4SO 4BMZA 2VDJA 1MBZA 1R0YA 1X80A 3FHOA 3KB6A 3MUFA 3F67A 4NDZA 4I9FA 4YRGA 1JG7A 1UWLA 3RS7A 4WKCA 2X5JO 2XEDA 4UPEA 2J31A 2QD2A 1MVOA 4JB8A 1ZOLA 4K9NA 5LLSA 3JTEA 1KETA 1SUDA 3NHFA 3NGMA 3LI2A 4UTRA 5BN3A 5ES4B 2P6OA 2Q1UA 2VJLA 3VZBA 1JNYA 3ZX4A 4JJKA 2H2AA 3SSOA 1ENPA 2P9YA 1WZUA 1CY6A 2VJBA 1DC6A 2W6JA 3RGWS 3WRWA 3IP5A 4XQCA 1APBA 3ZUPA 3K1YA 3JARB 3TCKA 1P3Y1 1D7AA 3PHHA 1K06A 3R5FA 5E7MA 3LVFO 1A2OA 4IDFA 3EEIA 3W4IA 2V7GA 4RFVA 1VRCA 3T7SA 3WFZA 2CT8A 2QRPA 5F76A 2IIVA 5BO5A 1NFRA 2HXGA 2RK3A 4V02A 1DKUA 4X1OA 3F4BA 3D59A 4B7CA 4ZYTA 5J3JA 2HC9A 5FLYA 4QTTB 1AQLA 2NPIA 4BMOB 3E9EA 4FBLA 3UT0A 2J6BA 4MV0A 3O93A 3ELUA 4R8VA 5MGNA 3DV0A 1Y8RB 4ARCA 1MORA 5B1IA 4MQUA 3C6KA 4BRUA 2H1HA 3LMKA 1AN0A 2BY4A 4F3CA 4EZIA 3N2KA 5SZIA 1R4NB 1JR3D 3UATA 1U9YA 2C82A 3N2GB 3AVVA 1RAIA 2W90A 4ZRMA 3L6CA 4TSKA 2TMGA 1N5IA 4W7SA 4GG1A 4BPBA 1U1DA 1NVWQ 2QJTA 4K9MA 1XPOA 1T5SA 1O0BA 2F2TA 4MO2A 3DWEX 4R05A 3SHTA 1N6PA 4BLUA 5KCMA 2X2EA 3RU3A 4B84A 1XI2A 3BKXA 3V3KA 2WYIA 2HA6A 3PRKE 2F59A 2PUAA 2RH8A 1V4NA 2V65A 2WMOB 1ZHFA 1BE1A 4TVBA 2XZLA 3OF2A 5JEEA 3W5HA 3NIWA 4DTIA 1GRCA 4HQOA 3HB0A 4QHSA 2X8LA 3U7JA 3HZOA 3A1SA 2VP3A 4ZRNA 2J3DA 1SXJE 3IT2A 3KWFA 2QRUA 4KWTA 3QG5A 3U4MA 4LRYA 4WKNA 2X0FA 1HA3A 1MZVA 1JWBB 2C04A 4PYOA 3KDSE 3QVLA 3DYBA 4RVSA 4LYJA 2FK7A 2IYXA 2XIJA 1DWQA 3EAGA 1HT2E 3GNTA 1VQ1A 3DBLB 4Q1BA 3CG0A 4J7CA 3T7JA 3TAXA 4B79A 4KITB 4J3FA 4UMFA 2WOJA 3GARA 1X1SA 3W1VA 3I2GA 3N8GA 3Q7EA 4EFKA 2FSGA 2ADMA 2HXSA 4UDNA 1GPAA 4TX1A 3FYSA 1FYDA 1KC3A 5CEEA 5JXIA 2C99A 4W1RA 1MRZA 2CNBA 3NHBA 4F56A 3ESBA 3IUMA 2O6HA 5FPKA 3LGAA 4QJIA 3ZHXA 5L3QB 2WQ6A 1N36B 3ET4A 4N47A 2PA3A 3JQAD 5FO0A 1WZIA 2R8YA 1WB4A 4KVGA 3SXJA 1GZ5A 1MJ5A 2HL6A 2YYSA 1BS2A 1U8FO 4IOJA 5CPBA 1E7MA 1O96A 3K70B 1U1FA 2ZKIA 4MV1A 4GOXA 2JCYA 5HGJA 2XQVA 1AGRA 5GZ1A 1UBRS 1BOFA 2JZCA 3G5MA 1XX6A 4UXIA 1MO4A 1ZM3A 2PS1A 4NZ9A 4X3OA 4M7RA 4CBVA 1MRNA 4JA2A 1OU0A 5IABA 1QCDA 4YJHB 4OHUA 1TJ4A 5AP9A 4TS9A 4J76A 3E61A 3WYAA 1VJGA 4LVNA 2WNHA 3AB7A 3KQWA 2AXEA 5FOTA 1BXRB 1M3SA 1CR0A 5AXBA 3BH7A 3B8HA 4D0LB 4ISCA 3N0TA 3MJ4A 3FPFA 4RWEA 3RYIA 5E9QA 2IX9A 3OIWA 1Y42X 2FK8A 2F3SA 3NUQA 4IW3B 2AIRA 4LI0A 1N6HA 3GYBA 5AW9A 4M36A 1EG2A 1LLUA 1E0JA 5DEOA 5DLYA 2Q7OE 3NTOA 2PAFA 2ZYVX 4I6JA 4XUCA 4D97A 3FRIA 3H1TA 3KV3O 3ANMA 1U31A 3UKDA 3WSVA 1KKMA 1TYDE 4F96A 5EVCA 3H04A 4Q6BA 1ICIA 3NEAA 3QWFA 1M1NB 3JVDA 4JBGA 4KLCA 1L5OA 1P6XA 4QUGA 3B85A 4Y7DA 1NQ5A 3V4ZA 4EJFA 4BVEA 2EDCA 2V58A 2R79A 4JVSB 2XJ4A 2XTAA 5LP6A 2BUCA 2BHTA 3BQNB 1DTEA 1Y98A 4B8YA 2FWNA 1UK6A 5IK2A 1I1NA 2NU9B 2C5HA 1P31A 1FTWA 3HSYA 3QBVA 1ADJA 1FE8A 3I6YA 3ZWMA 1N6NA 1OE0A 2A1UA 3PX7A 1OTXA 1PNOA 2FF5A 3EZXA 1ZUD1 2B1IA 3KXKA 2PX6A 1FB5A 2VJNA 3IVRA 4RHEA 3RB8A 4KXMA 4X1KA 2O7QA 5BWCA 2WA2A 2OV1A 2JJYA 4S1WA 2D4HA 4CHTA 2VT2A 4PZZA 3SQWA 3GLRA 3O74A 1GKKA 1XGKA 4ND2A 4F9GA 1JZTA 1NYTA 1RCFA 1WXDA 1VJ0A 2OC4A 3JASA 5D87A 3OPYA 1UXOA 4ERXA 1LA2A 3EDRA 4ZEXA 2ACWA 3SYKA 4PC2A 2VKTA 2QB5A 4ACBA 3ZGZA 1JHVA 2ODNA 3K9FC 5FUXA 5IU6A 1TQHA 3A2NA 1DDOA 4TKLA 4IDCA 4C05A 1JEAA 2XNDA 1N9KA 1PWEA 2QTGA 1SZDA 2QL5A 2IV2X 4PE5B 1XZMA 4DGQA 5I7RA 2WUEA 2G5CA 2C00A 2QDKA 4Y1EA 3A2LA 1DBPA 1X7ZA 1EP1B 1T6YA 3L7AA 4TWIA 4DLPA 1SUIA 1A76A 3GIDA 5DX0A 4MDEA 2IPOA 4MWEA 2GZAA 3TNYA 3ZLBA 4LGCA 4PLTA 4UC0A 4B6QA 1E32A 2B92A 4PO8A 4ER5A 2UXBB 3WLRA 3GGJA 1U1GA 4A73A 4P3NA 1MFZA 1WX1A 1VB5A 1ATZA 2MU1A 1ZITA 2PN1A 3FZNA 3LQQA 3PDIB 3MJTA 4H7EA 4DNFA 3A6EA 4AO6A 3AKYA 4CHGA 4E2YA 1A77A 5LOVA 1TCAA 1Z6AA 5EESA 2F6RA 1Q1NA 2G63A 3WX0A 5BW5A 1Q3TA 2QD3A 4MQLA 1PEAA 3LHFA 1FU8A 3BZBA 3PD1A 4WNIA 2IHZA 4Q1EA 3KSBC 1TVMA 5IJ0A 2J30A 4TMFA 4HUTA 1QVZA 4MJXA 4QNNA 4DWOA 4DV7B 4FYVA 1VLZA 5EIHA 1MXFA 2X3FA 3PHJA 1TW2A 2VDLB 1YGPA 3WK5A 4IICA 4QOJA 1OZ0A 1II8A 2CHGA 4PGAA 2QYTA 4JLOA 1XLTA 2B7BA 3IALA 4JBHA 3ZE6A 4A8TA 1DKPA 5IYZA 1XZFA 5B6PA 4RTRA 2GR9A 1U0BB 4GYJA 4XGQA 3VV3A 2XB2A 1TIBA 1GVHA 3KHUA 4AX4A 3IAFA 2JAQA 2I6TA 1HNWB 2GBIA 4MJLA 1BKYA 1V8PA 2HSDA 4IHJF 3NIBA 2HSZA 3F98A 3UT5A 2REXB 3A9UA 4G4SP 3M3DA 1FFSA 5CB4B 1ZMRA 1JHYA 3T9BA 3ADBA 1XDWA 1QBGA 2I7CA 2QT0A 3W2EA 2VBFA 5ALXA 3RCBA 1MEJA 1N5OX 1O0SA 1VJDA 3K2EA 2GN0A 4JWKA 1A8SA 1NOIA 3D6JA 1DFGA 4KV9A 1AZWA 1RBYA 2ZFUA 1IN6A 1L4BA 3DAOA 3O7WA 4RABA 2OWEA 4E33A 1A9XA 4Z3OA 5ALDA 2AR9A 3ZHUA 4TMVA 4EWLA 3K0SA 1Y3AA 4IH4A 1R8XA 1GU0A 3E5MA 3HA2A 3LQRA 1N9GB 4Q6WA 4WK6A 2ZSBA 3FCEA 4UOZA 1RWQA 4ALMA 1V7PC 4LKOA 4B0OA 4FKMA 1N78A 3H19A 1N5RA 4RNDB 2ZR7A 3W3AA 4OP2A 3P9IA 2XWBF 4HB2A 1C3VA 1P7VA 2QENA 4ZRDA 3HPRA 5EYPA 5IC4A 4EW3A 1E9EA 4X20A 1G4UR 1ZVKA 2AN4A 2JBAB 3QIAA 4DJAA 1J56A 3H5WA 1Z8DA 4HRYA 1FBNA 2O5EA 2NXEA 3K53A 2FSHA 3WDMA 1UEIA 1EUDA 3ER6A 1KQPA 4LG1A 4QHYA 2A8YA 3A6LA 3WWYA 2FPPB 4MHSA 1TFRA 2GCNA 3PPYA 3FOAA 3ZWDA 1YC5A 4V0SA 1GG5A 1YJQA 1J5XA 3GJ4A 1NTOA 3DW1X 5IAKA 1NW5A 3R6GA 3NIGB 2Y1WA 5EE9A 1V8OA 4GRIA 4R1OA 4CGZA 1P8AA 1UBHS 4QFBA 3EXFA 2NV6A 2BFFB 1F5SA 2FUKA 3NUZA 3WC4A 1YI8A 4YCCA 1B0UA 2FI1A 1EE1A 1ONOA 3DB2A 3LU1A 4GP7A 1PK9A 1P4HA 3KTDA 4C87A 2WY2D 4RVNA 3SC4A 5BSHA 2WTUA 3ZKAA 4MUBA 1YRHA 4L7VA 4UHCA 1TZKA 1SHZA 1S5PA 3DLPX 3BH6A 1U11A 3I04A 1X6VA 1YDMA 1K5DA 3HCFA 4ENWA 3IE1A 3ZE7A 2GHRA 4FB4A 5HK9A 3R44A 2PWZA 2SNIE 4C6TB 1Z82A 3PB3A 4E31A 1B8NA 4KE8A 3G0IA 4CQMA 1EVKA 1XJWA 5GONB 1KMIY 2JJ2D 3A1UA 4HOYA 3ROFA 3VR6D 2C8JA 4E1VA 3I3SR 1LXCA 1DPFA 1R0BA 2ZYHA 3D31A 2CJYA 4G1BA 3S55A 1PT7A 3CLSD 1OBOA 1AC5A 3VPSA 4DCVA 1T6BY 2OV4A 4LDJA 1YIOA 2QM3A 2VHWA 3COSA 1UK9A 1MIOA 2J5QA 3S0JA 3IHLA 5DM4A 3STYA 4XWWA 1SVKA 1U90A 2XCTB 4S1PA 2RHCA 1NUHA 2W0SA 1M5RA 4C0WA 4UW9A 3KYCB 1RYEA 1ORTA 3UJNA 4JI6B 3H1EA 3SHFA 3UCEA 2AUTA 1E2NA 1PJTA 4BBAA 2ROQA 1FS6A 2HFJA 5TJHA 3WGIA 4WZZA 1BX3A 2R8OA 3AI3A 4B2LA 4NXMB 1HV8A 2NYRA 5AW6A 2J0SA 3CKKA 1EK1A 5B64A 4LHEA 2QP9X 4MQBA 4UASA 3MOGA 5CW2A 1DIHA 2JNWA 4C7JA 1NVFA 1OW3B 3BB1A 4GP9A 4MQEB 5IVIA 1ISJA 1CP2A 5FOXA 1H2EA 1W581 4UVEA 1AO0A 2QNBA 3BT7A 1CJTC 2LBPA 3HNOA 5K0TA 3AR9A 4RJTA 4PHHA 3VGJA 4ZOLA 4WCVA 3O6VA 4DG8A 1WDKA 1C9NA 3CO0S 3WR5A 3FWKA 3UJPA 1F8FA 1XZGA 2QAIA 4JFAA 5DOZA 2IYQA 5I7UA 1YBAA 1C7EA 1HLDA 2W48A 4FUTA 3OH8A 3IAS6 3STWA 4ML3A 3NGXA 2XUFA 5H81A 4QPCA 5ALFA 3IAXA 3RC8A 2XITA 4UD6A 3VYWA 2BV3A 3UC5A 5BQFA 2ZXUA 3UMFA 1LNZA 3N7TA 5AM1A 2V6JA 1S8AA 3ORQA 3K9BA 3W8EA 1ZISA 5LC1A 4P7FA 3ID6C 4RLQA 3AU9A 5GGXA 2X6TA 3E22B 5BSUA 3UCXA 2Q5IA 4L3WA 3K5HA 4QXRA 3THWA 2EIHA 1FP7A 5HQ3B 4UBKA 2CNNA 1R2QA 4GPTA 1THZA 3GDHA 1XL0A 3ENNA 1VG8A 2V7QD 5BW6B 2P9EA 3WIOA 1LBSA 4DR4B 3TKLA 2A6PA 2ZJ7A 4BIMA 1EFTA 3RC9A 3DJFA 1USIA 4HAZA 4GW3A 5DM2A 2I6XA 2R66A 3PD0A 1NZFA 5HKAA 3S2FA 1L5QA 4BMVA 1OAOA 1ECFA 4HNRA 2HCFA 4XWYA 2DPLA 3W9BA 1ZBDA 3VOTA 1JP7A 1RAAA 3A6FA 5DI9A 3ZHRA 3FFXA 1BE6A 2V59A 1B76A 1KJ8A 2DQ4A 3DP7A 1J21A 2H4JA 3D2AA 3KPYA 1I10A 4IYRA 4W7HA 4AKSA 1T2CA 3RREA 3OLYA 1J99A 3LUAA 4PY2A 3TECE 1M7BA 2BDTA 5CR9A 2CYCA 3MTEA 4B4KA 2BHLA 2YUTA 1GTVA 1VKRA 4JBXA 2UZ1B 1UBSB 1CJKC 1L7DA 2JFNA 3TQHA 3L02A 4ZPJA 2HJHA 1KMCA 1BAPA 1UMDB 1FPQA 1V43A 2A2ZA 2R44A 3GJXC 3MCAA 3AZQA 3FPCA 1D04A 3PX2A 2CKDA 1MOQA 2RIRA 3BXFA 1M1YA 1D2GA 3SQDA 4CR8A 3BJEA 3ZIAA 4MNTA 2P7HA 1HZZC 4HYQA 3K15A 2G71A 1C3LA 3P71T 3Q3GE 1CFJA 3U80A 4NG4A 4QC2A 3TSWA 2H31A 4EY6A 4E13A 2LWIA 2DXIA 3SS7X 1RCTE 3A4TA 4G5OA 4WOKA 5DYWA 1OAKA 2HO4A 5FLEX 3VSAA 4YJ3B 5CVDA 2C95A 3AEZA 4NV3A 3A3NA 3RRMA 3WGJA 2VSNA 2ZU6A 3R5KA 1JQAA 4C2TA 3UMSA 4URVR 3DAGA 4R2JA 3AG5A 3LK6A 4L8LA 3W77A 3N3AC 5KDDA 3VKVA 3EYAA 1BHQ1 3NUGA 4QUBA 3JXEA 2ZVDA 3RFFA 1BJKA 3HJGA 2WZDA 3IOMA 4EAQA 2QLBA 5HQJA 1KYTA 4D8XA 2O59A 1N2SA 2X76A 1G42A 3RUCA 4XDHA 4LF9B 5IARA 4U9UA 3TLBA 1SBYA 4MR9B 4DLTA 1M7HA 4O59O 4DZRA 1TQ4A 2RHWA 2G77B 5LZ4A 2PG3A 1PIWA 2NW6A 3MUEA 3DFKA 3UA4A 3ECSA 2BYTA 2O2EA 1NAHA 1F4PA 1PS9A 1ZO8A 5DE3A 5JYDA 3ILVA 1DV1A 1YRWA 3I9OA 4B40A 1L4UA 5IHPA 1EUYA 3RTDA 4B9AA 1MT3A 4TLAA 1MVLA 4NYJR 4PM4A 1X14A 1TZMA 2G1JA 3EUAA 4TMTA 3CIOA 1SFRA 3IHTA 4Y9SA 3WL7A 1RBQA 3VR4H 4OV6B 2OL4A 4RF3A 1UIMA 1TYBE 3W6NA 3JQ7A 5F9HA 1JFFA 2YIJA 3SWWA 1K1EA 2WWWA 3AV3A 821PA 4HWRA 1SUPA 3R1IA 3WHIA 1G98A 1NVBA 3R8XA 3KETA 4OQEA 1IC6A 1SBQA 3OFND 5JJCA 4D25A 1GWNA 2WHPA 4FMDB 3OTIA 5A7HA 5AVQA 3N2ZB 4E22A 3K70C 3KYJB 4LWPA 1KNXA 3QNMA 4Q9AA 2PMEA 1ZA2A 3VDRA 5IANA 4RXUA 1NKVA 4RY8A 4L7QA 1E2KA 2M6RA 1BX0A 2RGEA 1V45E 2ZWMA 3Q3JB 3TL6A 2GBGA 1N2CE 4HEA1 3U4QB 3U3MA 2WM2A 2E5FA 2VHYA 4DF3A 4BQSA 1BN7A 1A9OA 4Q3CA 2PQ2A 2XE6A 1N1DA 1G9XA 4JVLA 4IVPA 5F7XA 4ENSA 2X86A 3V7YA 5TLSA 5LB2A 3F6BX 1PT6A 1U2GA 1LJ8A 2OHFA 2XRMA 1Y4SA 1GZDA 3PD7A 4F5WA 4X63A 3MJFA 2A92A 3DE4X 3KVOA 1Q14A 4KJZA 2Z57A 1MB4A 2BTQB 2BJHA 2HU8A 3TLKA 4KBFA 3GUCA 4AF8A 4BP1A 4CU2A 2XCRB 5KYGA 3TRIA 4PICA 3U39A 3C4QA 4X3CA 3URKA 3VSEA 4B31A 3NRBA 1GUZA 2XJ9A 1GT91 4F4UA 4IXNA 3S7ZA 3S81A 3EW7A 3B2EA 3FTEA 2PD3A 4EI7A 2FZGA 3KALA 4JUFA 4M22A 4Y0NA 4M37A 3LD9A 3U7QB 4TKMA 2CMGA 1GZ7A 2CN1A 2J4FA 3PHCA 1Y3FE 4GSKA 1VKOA 5GMOA 3M34A 1X7YB 1T2FA 4WBSA 4ZU1X 5HIIA 2E0IA 4L95C 4O08A 1G63A 1D1PA 1ONNA 2AYZA 2C1EA 3OCCA 4XEHA 1PDVA 1VL6A 3U7FB 4MYHA 2VBCA 4F9FA 1JIJA 1C7JA 1E3TA 1UBUS 5KTMA 2B3TA 3H65A 2KHZA 2AMYA 4DHWA 1A5AB 3LC0A 3PRHA 3VR0A 4QREA 1WTCA 3Q7SA 4G9GA 1L5FA 1YC2A 1IYZA 2FRVA 1WY7A 1U0FA 3DFZA 4XUEA 2FFBA 1GNTA 3MCTA 4P36A 2D2XA 4UJ3A 3F73A 1OLUA 3EVEA 2YS6A 5FEUA 5THQA 4EB6B 2V45A 1TM2A 1OF1A 3FJOA 1EB9A 3NASA 2AE2A 4BNFA 3Q9LA 3IKTA 1ARZA 2QSZA 3TFWA 4F04A 1KRHA 3F8TA 3PPWA 2IV7A 1DTWA 4HAWA 2HWYA 3AKZA 2I03A 2NYUA 3QEMB 5A3QA 1LPBB 3IUBA 4QRHA 4FIDA 3ZVMA 2Z09A 3DOUA 5KAPA 4M0CA 1NW6A 2H4WA 3JD0A 4Q12A 5HDQA 1K6XA 4LYDA 4DCPA 4X5OA 4WOCA 3RAGA 1ADYA 1VGQA 3NHYA 3I64A 4M1MA 4M8SA 4O2BA 2NTNA 1KEEB 3QPUA 4UREA 3T94A 1QKIA 4E5UA 2XSZD 4U2GA 1PEKE 5IASA 1QP8A 1B3BA 2R86A 3U3OA 2Y27A 4R9SA 3RUFA 3C14C 3IP9A 1RDFA 2BFBA 3K1TA 4MA0A 4RENA 5A04A 5JXHA 4B4WA 1QPBA 3RADC 4RMIA 4R0NA 3HS3A 2W4QA 3ZZ0A 2WWIA 1K68A 1VPDA 3H2YA 3SQMA 4AYXA 5EPOA 1Z16A 1QORA 1T1IA 3CNNA 4P6VF 1MC4A 2JEYA 4QL3A 5FL3A 3TLXA 3VDXA 4Z49A 3PNVA 3IB6A 4Y1FA 3DT6A 1GQRA 5JZMA 4LF6B 4C4PA 4BN5A 4R2IA 4N8EA 5IC5A 2VK4A 2XMZA 1HDGO 1E1NA 1E89A 4MPPA 3E6AA 3EC1A 2VCEA 2FSVA 3K9HA 3AF6A 5AKXA 3ZCSA 1JVSA 1UJ4A 1XKQA 3B48A 1R18A 1WS6A 3FTQA 3ITDA 4E32A 4IQFA 1LX7A 5HZGA 1V8BA 3GRPA 4I9HA 3D6AA 4I1RA 3DOEA 3H0KA 4DIBA 4R16A 2XUHA 3WGVA 4HLDA 2IOFA 2QTNA 2AI1A 3GC6A 4LNUB 4RCZA 3RYHB 3PEVA 1G8SA 3GLGE 2R6GA 2XXBA 3IDOA 4WE3A 3AF2A 2WU0A 4P0TA 3A31A 5KHAA 4DG9A 3HJFA 4HAYA 3FR8A 2NO7A 2ZETA 4BY9E 1OOEA 1TDJA 4IZ6A 1Y8CA 4IGFA 1UWCA 1V6CA 1OT3A 3I6BA 3RS5A 2QXUA 1FW8A 1W2HA 1XEWY 3ENQA 4H1UA 1EZ4A 3G13A 5FTWA 1V11A 3H5NA 3PRJA 2GDJA 4FJ0A 3TE7A 3ZDXB 5ALMA 5SICE 5FV4A 4V3BA 3U3JA 4EX7A 5IXJA 2VTKA 4EKEA 1K3UB 2PBZA 1QK4A 3GCGA 4PZDA 3NNSA 1RJFA 1IK4A 2IE8A 3QA3E 5BPFA 5I9IA 1T4DA 2HRZA 3CH7A 4ASUA 2VHCA 4HEQA 1OJ7A 3RYCB 2ICAA 2XUDA 2HF7A 4BO9A 2B61A 2NV0A 3CVYA 4BNNA 5LQMA 1RE0A 5BW4A 1UZMA 1PSWA 3B3GA 1CV2A 1QZ3A 3BK7A 4EG6A 3WGQA 3KXLA 3GI1A 2QE7A 3PLNA 4YWHA 1TZCA 1R3DA 2DQYA 4QEZA 3GHYA 3D8HA 4R8MA 5JFGA 2H1VA 2LGJA 4XYBA 5FORA 1EX6A 1KJJA 1E1YA 2GK3A 5EXSA 3GLFB 1QV7A 1VA5A 1Z83A 5EWLA 1O87A 1JW9B 2H18A 2WJ3A 2PNFA 2JFVA 2XAUA 3OLCX 4RJJA 3EULA 1PFYA 2A5DA 3PNBA 5H3CA 1AQYA 4TTTS 2FJPA 5FI1B 1QYIA 4OJQA 1TVCA 5JH7B 3G49A 3JWHA 4XIJA 1YFJA 1Q74A 1V2HE 2X4GA 1UPCA 3BEOA 4GI1A 3COYA 3UJ3X 5K3SA 1PF7E 3NHJA 3OEED 4PFSA 3TOVA 4MUNA 1CR6A 1QCZA 1T8PA 4LE2A 4DARA 4X94A 2WD7B 1U0LA 3VQTA 3VU9A 1EK6A 3WK7A 4C06A 3KKZA 4G84A 3NFRA 4GU5A 4X24A 4XR9A 1IOVA 4NULA 2BE9A 1P2FA 1A9PA 2GKOA 4RORA 2HWWA 1T43A 3U1BA 3FDZB 5CFPA 2CLOB 3VJKA 1ECBA 3BWCA 3OTQA 4I1UA 4RH3A 2NXNA 1LF5A 1YU9A 1G59A 1JXAA 2PSSA 4RH1A 4CMIA 2B30A 1VSQA 1N7GA 1SVUA 1XF1A 4I55F 3FZQA 1XN1A 4BRSA 4NJEB 2IEYA 1ITZA 5M5BA 1LTQA 1XPJA 1QIGA 1YQUA 1HLPA 4HDKB 4WX2B 1JAZA 1V8ZA 2MDTA 3NTQA 4NAVA 2FZ4A 5HKLA 4WL0A 2O0KA 3NYIA 2WFLB 1MOPA 3OE4A 4S1OA 3RFVA 3GLIB 1N6RA 1S4MA 2LRHA 2ZE7A 2J32A 2QW1A 4TM7A 4KBGA 2X9LA 2V3WA 4I2VA 1DQRA 3EY4A 4ZKDA 4AJ4A 5IZCA 2RC6A 4IDGA 2PMBA 4AI6A 2BBWA 1E1RD 3CQ9A 4Z5XA 4OHKA 1EK0A 2PUTA 3EUFA 4LV8B 1G9SA 4R1PA 4L07A 3ADDA 4IXDA 1QCCA 5C8ZA 1RLUA 2CFSA 3DCJA 3ZWYA 3DA8A 1CUHA 3H9UA 3O8RA 2J07A 1W4LA 1U5CA 3S8MA 3KE9A 1COWD 5EXPA 3GLVA 4KW7A 4RU1A 2GTHA 3MJSA 3DL0A 3ZCQA 3A58B 1AXRA 1GPUA 1MQSA 2FDXA 1VZ3A 4QYXA 1GQFA 4UUPA 2AYXA 1CK4A 3FUCA 2PO7A 4N7MA 3IUSA 5JISA 1JR6A 4I2NA 1RKQA 2GI4A 1UPXA 1EQUA 1PNVA 1T0HB 1G5PA 1GUDA 3T7RA 3EZFA 3O8CA 2ZJ8A 4PYNA 4RUKA 1GGEA 3DL4A 4TV9A 2Y8EA 1VLVA 4FR0A 3DLBA 1NE2A 3R4VA 5IF3A 3CR3C 3W79A 5A3VA 1PQUA 1D6JA 2HWKA 4KN5A 3MT8A 3LUCA 4N5DA 4GEGA 5FP0A 3RC3A 4YAUA 2V6GA 3C15C 1DX6A 1XTTA 2IPLA 3QVKA 2O54A 2NAFA 4PWZA 3SICE 3CVUA 5LZ8A 1HMYA 4CV1A 5KHOC 2LV8A 4Q82A 2NZVG 3ADOA 1MX1A 3JASB 2XZPA 3OPYB 4F60A 1TJ3A 4GD3Q 1FP4B 1S8NA 4Q1VA 4B75A 2FVYA 3K4QA 3M6MD 4UEJA 3TE6A 2EWVA 4JSYA 2V54A 3N7AA 4BFVA 1FDRA 2GM4A 2CLMB 2WHYA 2ZT5A 5DV9A 1CJSA 1USKA 1YWGO 4IKPA 2CHQA 1Y1RA 3JX9A 2PFSA 3FB1A 1K75A 3S27A 2FU5C 1FC0A 3L3BA 4C4YA 3KXIA 1EBBA 4NZPA 4JV5B 4NBLA 2IYAA 4G37A 1JA1A 3A6HA 2UU9B 4J3NA 4U7DA 4YI5A 1CNFA 1JL3A 2B4RO 3CWQA 2GCPA 4IF4A 4ZQFA 4L8GA 3SZOA 4AXXA 3HP4A 4KN6A 4B0PA 4URYR 3B5JA 2VG8A 2J09A 1PFWA 1NNI1 3BK2A 3BRWD 3HJCA 3P2MA 3QPWA 5CP8A 3CSUA 3INRA 5CDFA 4H6XA 1J00A 3CZ4A 3R5SA 3HWWA 5AHKA 1M34A 3C0KA 2IUEA 3CS3A 4QQ8A 1M8KA 1FY2A 4AJ9A 1EDZA 3BERA 1YASA 2DH5A 4J7XA 3T1VA 2ZR0A 1Z12A 4DAEA 3OP1A 3V1KA 3OPXA 3ETJA 4UM7A 1QHIA 3GA7A 1SVLA 5CT6A 1FNBA 1N7IA 1E9DA 1Z6XA 3UIEA 2EQAA 4Q3BA 4B5KA 2P6PA 1G16A 4OUDB 1JA9A 3PCXA 4QOFA 4QPZA 2ZZKA 2GZDA 4BB6A 2ACKA 4WCDA 2BGWA 3L7CA 5AOCA 1DB3A 2R2AA 3FI0A 3R7SA 4U2DA 3VHXA 3A6GA 4QYIB 4BB9A 2I0FA 2DR3A 4QD3A 5LDGA 3ND9A 4QZVA 2CMDA 1NQTA 2BKAA 5ICMA 4I46A 5GWXA 5BSGA 3ROQA 3KQPA 3BWYA 4Y2TA 2Q4EA 2ZB7A 4HX2A 5F77A 4BNJA 5CDTA 5HRAA 1YS4A 3L6EA 5BNTA 4LXHA 2NPFA 4MKGA 2ZTVA 2RJNA 1W35A 2Z83A 1A9XB 4EO7A 2ERXA 1O58A 1N4DA 1W44A 1CQWA 2QNRA 1H0HA 3HO8A 3UV7A 5I7SA 4DB2A 1Q84A 3LYAA 3WS7A 2DP4E 2DPXA 3QM1A 4QJ5A 3OIDA 5B1EA 1U0NA 3DBRA 3HV2A 1MP0A 3HUDA 3IAHA 3TUJC 4ZANA 1DOAA 1ZJWA 1SCDA 5TQ2A 4RD1A 1NX9A 4D8TA 2B20A 2GZ2A 5A02A 2GLUA 4G63A 1WL8A 5I5GA 1QE0A 5JPIA 4G5YA 4RSMA 4IJUA 2JS7A 2FCAA 3QJYA 5EHZA 4C7OB 3HP7A 2RGCA 3GDGA 1XBTA 2P67A 3VR4D 3VAYA 3KFLA 2HLHA 4LS3A 3L4JA 3HJAA 4RQTA 2F48A 1G5RA 4INAA 1XLUA 1A27A 3CKMA 2QM8A 4NBNA 3WMWA 1M73E 4MEJA 3WIDA 4UNNA 2JIZD 1F06A 1DAOA 4MCJA 5CLHA 1K92A 2XE8A 1I33A 1C7FA 3I8XA 1BE8A 3CW8X 4FOLA 3PWTA 4KPEC 2ZDGA 1SCNE 3DE2X 4ZO6A 2NVUB 4B3IA 1T1RA 1K7EB 4G5QA 3Q8KA 4OFBA 2QAGB 3B7GA 3R40A 3HJTA 1RE1A 3DLCA 4GEKA 4HNVA 5BVHB 2SCUB 2YXDA 1SUSA 2HRBA 1ESNA 1J06A 3AILA 3LUJA 3OFVA 3ME5A 1CRWG 1PZXA 4JSTA 4Q9KA 5DP2A 4RTLA 5IKEA 4RULA 1SKYB 3AEUA 3EB9A 4PCVA 3V5NA 2R6FA 1C3OA 2WM8A 1QR2A 3H1BA 4ROTA 3GGPA 4DWVA 4E5SA 5JWHA 4IIDA 4EFMA 5EPUA 5IM4A 4FYPA 3BBLA 1WM1A 3BWVA 3KR1A 3OY2A 4IXMA 1XCBA 4JZYA 1XLWA 2C31A 2FEXA 3CTPA 3FIUA 5D6NA 2COKA 3L6UA 1XMJA 4KU4A 1P5ZB 4AMGA 1T8RA 1NF8A 3GF4A 4B83A 5EZ5A 5L7YA 4EPWA 5ALKA 2ZRMA 3WGLA 1I80A 1INLA 4MUMA 1OFIA 1PUIA 2Z2XA 1QVVA 4DLSA 1MX9A 3QVWA 3ZPXA 2AQIA 4I6GA 3KQUA 5BR8B 4AY2A 4X60A 3WMFA 1G6KA 1N6LA 2IE0A 2WWGA 4NU0A 4QYSA 1EEHA 2JIQA 3LE8A 3AHDA 3ZE1B 1J1ZA 3DTYA 5DHRA 1DKQA 3L06A 3RVMA 4CM6A 2QMQA 1FVHA 1LSUA 1KQOA 4HDOB 2Q3MA 5T7BA 1DRWA 1SU4A 1ULSA 2NVWA 3OCWA 2WTEA 3PL1A 3SX4A 3SBOA 1Z2NX 1CIJA 1P44A 2GBLC 1UKEA 3H3XA 5BY2A 4MVJI 1KA9H 5EWJB 2P91A 1FFYA 1WD5A 3KNZA 1P45A 2OFWA 3BMOB 4KAJA 2H9AA 2X22A 4AJ1A 1JDUA 2OCKA 3L40A 1CDDA 3LBAA 4W5WA 2R4TA 3FYDA 1CR2A 4EHNA 2QZZA 3UA3A 2AG8A 3WWDA 5J23A 2OFOA 4GLBA 4D9NA 1JU4A 1HX7A 1NBME 4ZOLB 2CW5A 4AO8A 3I04M 5UKDA 2FWRA 2EHDA 4HXEB 2DFTA 1V3TA 2Y1OA 1TO6A 4FHCA 2ZS9A 4NHOA 2IOHA 1F4LA 3DZHA 3MB8A 1GG9A 1BWSA 3ZCXA 4LHSA 2CFOA 2X19A 4ZYXA 1FTSA 2D2FA 4LRXA 4RV9A 1NI4B 1U0SY 5DSXA 5IBRA 4TUYB 4YUAA 1IY8A 2WJIA 3IMGA 1Q7GA 2F1OA 2XMPA 5CLGA 3T54A 2X3UA 1GSIA 4HNUA 3I52A 1THTA 2Y1LA 1WQ3A 5B5SA 2D5IA 3GFVA 5KTNA 3O26A 2VKQA 4HF7A 2HHHB 2IJGX 3DS8A 4FP9A 5D3MA 1IUOA 3SX2A 4ZMSA 1N3LA 3LOQA 5DX1A 5FUYA 4HVLA 1J8YF 1M0WA 2JFYA 1T8WA 1XCPA 3OA2A 5K8UA 3WA7A 5B2ZA 3SKYA 3K2BA 3M6LA 4EY5A 1AB6A 2IOFK 2DJIA 2PUDA 2H07A 1EVEA 4CUJA 5JZ9A 1U99A 2EP8A 4JQYA 1B43A 4H1HA 5JPDA 2P9TA 1RQXA 4KO8A 4EH1A 1EDEA 1O9GA 1E6LA 1NUAA 3CGGA 5JG7A 3Q98A 4GS5A 4U2BA 2HX1A 2B83A 3F3SA 4M9CA 5EQDA 4MS3A 3ZDQA 4YAWA 4F4DA 4N1AA 2G5TA 1T2EA 1IXKA 3TNJA 3A1EA 3KUDA 5B7QA 5ICSA 1M0SA 4ODIA 5DIZA 1Q7BA 3CINA 1L5RA 4HH1A 4OH7A 5CA1F 4E14A 1KMHB 2XNHA 5DW0A 1E6KA 2Y2VA 5CMLA 4P4GA 3REQA 3Q7TA 4C0XA 1QGOA 4JY7A 2ORVA 2OBYA 2O2DA 1LVHA 5FEMA 4UHDA 1BC5A 4E4TA 3B6KA 1DS6A 1M74A 3GFBA 3B8EA 3PI6A 3G9UA 3A06A 3HEBA 4IO0A 3RBVA 4L50A 1H9CA 2J6IA 3TW0A 2JIOA 3WG9A 4KL8S 2GPTA 4YDQA 2O8BB 2VF7A 4ZAGA 1ENOA 1P0PA 2VQ6A 1LX6A 1OH7A 1W29A 3UANA 4JWTA 1YK1A 3VMMA 1AKQA 2JRCA 1DJOA 1EIZA 1QZXA 2BAGA 3WBBA 1W49A 5MDHA 1RW4A 1IUKA 3D6UA 3I05A 1YB6A 1ZGZA 4W6ZA 1JLRA 5AXCA 3CEHA 1X1EA 4PXAA 4BVBA 1N8TA 1MOSA 1PJRA 1VGRA 4H1VA 4L51A 4MX8A 1O8BA 4FLEA 1NTRA 3KOMA 3LPDA 1WHSB 1WV0A 1WQ4A 3FOZA 2UXDB 1MO3A 1WTAA 1VCHA 1X2BA 3FPJA 3OP4A 3GPBA 3KQQA 2F1IA 3MJEA 2RGAA 4XJVA 3RS4A 1LZKA 2UZAA 1AU9A 4MULA 4OI2A 2QTHA 2FN4A 3E84A 1ORIA 4BO6A 4DR1B 4TS4A 1GSAA 2GPSA 2X8JA 1IOLA 2BZGA 3ABZA 3M1YA 2V1XA 1KH2A 4MLZA 2B4YA 2H2FA 3P9PA 4HS9A 4ZOAA 5IJXA 3T5MA 1QF9A 1C0IA 3ADPA 3I1JA 1MX3A 3EXEB 3SD7A 3VPCA 2QRGA 2BFWA 1QDUA 2C59A 1P0MA 2D00A 4OREX 3P27A 4XA8A 3DO8A 2FFHA 1AT1A 2PH1A 2XAAA 4OHBA 1M2HA 3JTMA 8ADHA 1UFOA 2CDRA 1QX4A 1S3FA 2LD4A 1DAIA 1DQYA 1US8A 2WF6A 3RSOA 3SQOA 4MR8A 1X13A 2IYVA 2XPCA 4HWOA 4DMHA 4Z2YA 4ZU6X 1E2GA 4C7OA 2YY6A 5HJ2A 2B4AA 2VJAA 4DKJA 3IUQA 1Z7GA 2J3JA 4Q37A 4YS6A 3STUA 1QOQB 1HFWA 4BNLA 1AJEA 5HX7A 3VKHA 2Q9BA 4KFUA 1JKXA 5E0OA 5K3FA 1U04A 3DE1X 1UL1X 1AUPA 1KI2A 1OILA 2HLDD 4TLMB 2B5WA 3LBHA 4Z7QB 1R16A 1S1CA 2L17A 4TLCA 3S1LA 1RQRA 3ESAA 5EL0A 4NX2A 4BP9A 4L8YA 1D6MA 1RTKA 1Z7WA 3RTAA 4DZZA 3THYB 4IILA 1I5RA 1WNTA 3AVOA 4JT4A 1VPWA 1CUEA 1E6UA 1L5ZA 3V2HA 1DADA 2GPBA 3I12A 1XWFA 2FEMA 3BQMB 3OZVA 4N0MA 3P20A 1ZZEA 1KZ1A 1JKFA 3II6X 3S40A 4GI5A 4JLKA 4EL0A 4IDBA 2ETXA 4F6LA 1FSFA 1DRVA 2AI3A 3IAM1 1PV2A 3H5TA 3HUFA 1NXOA 1TMKA 3CX4A 2EP7A 3J81k 3ABIA 1IZZA 2NWQA 1GA1A 1KZ6A 2EEPA 3AP2A 4K1LA 4K9PA 4MQ6A 5IULC 3LKDA 4CV0A 1NG9A 4BO4A 1P2UA 4LQDA 2VC2B 3CCBA 3DOCA 4HNSA 4GLOA 4MS1A 4Q9LA 4B3MB 1Z6PA 1CJMA 5LP6C 1REQB 2GN2A 3U7HB 4L8VA 2EFDB 3U17A 3DOOA 4CIAA 5KJFA 1LRJA 1CY4A 5T4EA 3O73A 1RKXA 5K6TA 1RXCA 3VAAA 5AK3A 4YUXA 3CNBA 2J6CA 3E18A 3NM6B 4RLHA 5CX4A 5G1OA 1WAMA 4BNYA 2FZLA 2OM6A 3K9LA 3GDFA 1S2NA 1HRDA 1RWOA 3B1FA 2H3EA 4RIEA 2QSUA 3H1FA 421PA 3AI1A 3ETCA 3FNGA 5EIBC 4DCGA 5HKOA 5E9WA 1EFPA 2FPIB 4JOCA 4BZZA 4E6EA 4WXHA 4FIZA 5I51A 3K05A 4HRAA 4I50A 3GNQA 4PRLA 4ZMBA 5DCYA 2F8TA 1T5TA 3ZU3A 2QXYA 1E1KA 2BRUA 2E6KA 3H86A 1JXMA 4R6WA 1XMQB 1TFUA 3A2MA 3IA7A 3N59A 5LYJB 2IBSA 2XZDA 3R74A 3Q3EA 4IKOA 3SZGA 1I4OA 2A9KA 2B1GA 3BWDD 3W1EA 5JR3A 2NMVA 2J8ZA 4CIWA 4DHEA 5JVDF 1E77A 3T9CA 1HLGA 4EKYA 3EGDA 3IQFA 1E1CA 4RFSA 1X42A 4DE5A 4WECA 4BQPA 2Q6IA 4KO3S 1R74A 4IHAA 4B45A 2BEWA 3OO0A 1P74A 2WWFA 4WWHA 1OC4A 3GOHA 4PBRA 5JS6A 1YR1A 1WKBA 2QMUA 4LZLA 3E8XA 5H9WA 2O4CA 4KCGA 2QZ4A 2V3CC 4F21A 3AVWA 4RZIA 4J16A 4X85A 3G0DA 1Q1AA 4IDPA 2I3AA 1UJNA 1P5HA 2Q5CA 4HAXA 1ZN7A 3AUKA 3K30A 1TB4A 4PLCA 2EL9A 3U3XA 2PQ6A 2DT5A 3W6ZA 2CBXA 4QG7A 1KHTA 5REQA 1ZJ5A 1VE6A 2F9MA 4MKIA 4OKIA 1BDHA 4M9SA 3VHLB 4EVIA 1R0RE 4LYHA 1U5BA 1Z18A 2XTJA 1SXQA 5ICFA 2XVXA 5EXDA 1G2OA 5D7NA 3X1JA 1M2WA 2Z2IA 1WVMA 3CEJA 2O57A 3NOXA 3P97A 4IMIB 3SMVA 3BZUA 4X8HA 4S1VA 4F9EA 2W6ID 1BQEA 1E1DA 1ZD4A 3KUUA 4LECA 3RJTA 3DBVO 5IJAA 4ASUD 5BSRA 1E98A 3OJWA 1A4RA 1YR9A 3Q6NA 4XWAA 3C43A 5TVGA 5FNVA 5PNTA 1AB5A 2IYPA 1VCIA 4DNXA 1KY2A 2DHEA 2ZWVA 3AF1A 1G8YA 4R1LA 4BRZA 4OHCA 3L0ZA 1SURA 3L07A 5J4HA 5JEDA 3RVRA 1DHTA 4LK3A 2RHMA 4QLAA 2EKBA 1W4ZA 1QTRA 4B73A 1JWAB 1KY4A 1F5NA 2EIXA 5I9SA 1CERA 2EJUA 3PJEA 2QLFA 1U65A 3AIOA 5BSWA 5JZBA 4Y1GA 3L84A 2BC9A 3ENWA 5C46F 1QANA 5IT0A 3LW7A 4OFZA 3LPLA 2PH7A 3TOZA 2O8EA 3SXUA 4M98A 3F1KA 5JDIA 3WLNA 3CLRC 4N54A 4RHYA 1LNQA 2GXUA 4AMVA 2BKEA 1J0BA 1EM8A 4I6EA 3RC2A 5BUZA 3ZG6A 5EUBA 1PNTA 1UJBA 1PVDA 4OU5A 4D42A 4E94A 5JO9A 3ZNOA 1SMKA 1UOPA 4CMJA 1NW4A 2FUNB 2JLAA 1ODJA 1GTL1 3RWMB 1XVUA 4ZVMA 2KJQA 5F2KA 2FHPA 1GZUA 2AOWA 1GGKA 1YVDA 2V5UA 3WLOA 1Q7CA 4ARBA 4YPOA 2A9VA 2XWSA 1I2BA 3WNVA 4DUZB 3OAAA 3QFRA 3WRYA 4J0IA 1QF7A 1EJ2A 3VNUA 3EUWA 1EU1A 2AZXA 1WO8A 4GH5A 5IC6A 2PVPA 3EIUA 4Z1MD 4EHLA 3EXHB 1NPTO 3RDPA 3RFXA 3HKBA 1QSGA 3GEDA 3GR6A 3RVKA 2VEDA 3SIPA 3FPSA 1UC4B 4JLPA 2QVZX 1E4OA 4MZXA 1FYXA 2JL1A 1O54A 4MYCA 1BMTA 1SVOA 3O2SB 4WZBB 2B3DA 3OZBA 4MWBA 5IAAA 1U0EA 2OCDA 5KYUB 1G17A 2QVYX 1L4FA 4UU0A 1LEHA 2GCOA 3MS4A 1J9EA 1H5QA 3FSJX 1Z0AA 5ERGB 2PS0A 2Z1MA 4X6UA 4HMQA 1NVUQ 1U0JA 1E79A 4UQOA 4LDNA 2B8NA 3V4OA 2GQ0A 2H1CA 2Z1DA 1TM3E 1JG1A 2ZRFA 1YRYE 3BFKA 3P1JA 2PRYA 3G17A 3GJQA 4FNGA 4QUAA 2HJGA 4PX3A 5AJWA 3K70D 1RRPA 1RPJA 2AFIB 1PTKA 2NO6A 2PUBA 4KQHA 2NVBA 1EVJA 4ZDJA 4EAAA 5K8IA 1HEYA 3W9YA 3Q2IA 1H6BA 3P9QA 5TT1A 2GAOA 3DUFB 4P53A 2QVLA 4DY4A 2QL6A 1XRMA 1VLQA 4DLZA 4OEHA 2MJLA 1SBTA 1PZHA 4INPA 3FMVA 1TLFA 5JARA 5JZOA 1CUBA 3K6RA 3PQ5A 5J4LA 1UPUA 1KK1A 1ECPA 4N3BA 1DT5A 1S2GA 5HOQA 1B2LA 3VUFA 2HMAA 2C54A 4EY3A 3WMXA 4EQZA 5J5VA 1MEOA 5K0ZA 4KOAA 1Z35A 3OX3A 3PSHA 2UZ4A 1CF9A 1UP4A 3FDXA 4DCJA 1XELA 3MRSA 4L74A 4ILKA 5FTMA 2W2TA 5KSPA 3CH6A 2P5UA 2QTMA 1Y1SA 4KX3A 2QF7A 2I33A 2PZGA 3AF0A 3LLCA 4DUGD 1FJXA 3C97A 5ALTA 3VA7A 3PE6A 5LDDC 4M0PA 4FEGA 1CETA 2J9XB 2MTBA 3GLSA 4OXNA 5EJ5A 4EY7A 3AUAA 3D4BA 3OQIA 4JI8B 2BF7A 2TMKA 5AVOA 5AOAA 1XNQB 1P62B 2ATCA 3IQHX 4C3OB 2CLKB 3O3OB 4S24A 3UJCA 2VJOA 2XYGA 4KMMA 3NBUA 4BKUA 2P9FA 3E3OA 1FFBA 3DFUA 2PM8A 1OV6A 2BFEB 1ZM4A 3E7DA 2CUTA 1M66A 2ZBQA 1JEJA 3F78A 3FYUA 3JVVA 4KAFA 1WSBA 1JG2A 3E9ZA 3WKAA 1Q20A 2C5FA 4D9EA 5KPDA 2HKIA 2VHJA 3BFPA 4HY3A 1NJ8A 2RH5A 5H02A 4LOHA 3U4IA 2RKBA 3OTWA 4BP8A 3G0BA 2KX7A 5DLEA 2O8DA 5DRTA 3PE3A 3NV9A 5K8JB 3VI4B 3QOFA