4WDRA

Crystal structure of haloalkane dehalogenase linb 140a+143l+177w+211l mutant (linb86) from sphingobium japonicum ut26
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
293
structure length
293
Chain Sequence
GAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAIAMPIEAADLPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGWILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQLPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGALTTGRMRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Haloalkane dehalogenase
publication title Crystal structure of haloalkane dehalogenase LinB mutant (L177W) from Sphingobium japonicum UT26
doi rcsb
source organism Sphingobium japonicum ut26s
total genus 107
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2014-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4wdrA00
4B84A 1JJIA 4AMYA 1P0IA 3D59A 4FOLA 1QTIA 5E2IA 3P2MA 3V1MA 1VLQA 3R3WA 2BJHA 3D2BA 1ZGCA 2WU4A 4GXNA 3DKKA 1DWQA 1CUCA 5CH8A 2RONA 2VSQA 5ALUA 3D3NA 1EVQA 3CN9A 1ORVA 5HF9A 4H7HA 3QMVA 1LNSA 2PSEA 3GELA 4BTLA 4DMHA 1GPKA 4KJXA 3R3UA 4N8EA 5HF6A 1XROA 4IH9A 5JD5A 5AH0A 1N1MA 5YASA 3GUUA 3BJMA 2XMRA 4OPMA 4W1RA 2C5GA 1DWPA 2PPLA 3V9AA 5FKJA 2JGEA 2XUHA 3VJKA 1CUVA 5CXXA 3QM1A 5H3HA 4C89A 3G9UA 2ZSHA 4C4YA 4ZGBA 5IH7A 4KACA 2QVBA 4KAAA 3WYDA 4UBNA 4FLMA 1BU8A 2I3ZA 2WUDA 5HKBA 2YASA 2HA6A 5CRIA 4FMPA 4I4CA 5AI8A 4S0XA 5DNWA 4FLFA 1FFCA 3ESBA 4LYEA 4QNNA 5JAOA 3OG9A 4P92A 2QJWA 1W76A 1UFOA 3O4GA 1MPXA 4Y2XA 4FHZA 3WJ1A 2GBIA 3BL8A 3I1YA 4H7FA 5ALRA 1L7QA 2OCLA 2XUIA 3FVRA 4BTVA 1BEEA 2H7YA 1N5MA 2XMBA 5LZ5A 3C8DA 3CN7A 5ALGA 1XLWA 1AX9A 2BUBA 3W9BA 2HIHA 4UHBA 2OGSA 1QIKA 6YASA 2GYVA 4PQEA 2GYUA 2WTNA 5AIAA 4W1PA 2IX9A 3UUFA 5I8PA 5AI0A 1ZICA 5AK5A 3S8YA 3IVMA 3AJAA 4Y2PA 3RARA 1GKLA 1XZCA 2GBGA 4EY6A 2QRUA 1A88A 1DQYA 1I6WA 3DS8A 3L1JA 4DTCA 5AM0A 2XUDA 3IUQA 5IVDA 2HRQA 5A7GA 1HPLA 1AGYA 2H9YA 5KWJA 1R88A 3C6XA 3V1KA 2C7BA 3IUMA 5CW2A 4B85A 3D0KA 4PW0A 5A7FA 2VF2A 1MNAA 2Y6UA 2EEPA 3DKRA 3F67A 5ALVA 3B12A 4FFWA 1H2WA 4W63A 5EGNA 1XQVA 2WM2A 1DWOA 5E4TA 3ILSA 4OU5A 5FRDA 4BE4A 3QPCA 3KWJA 5JZ9A 4RE6A 1CR6A 2I03A 1J07A 2HU8A 4F60A 1EB9A 5HQ3A 2XQIA 5BOVA 1ODTC 5ALDA 1XZGA 3C6ZA 2WHPA 4EA6A 4MWTA 2DFPA 4UBIA 3H04A 4DLNA 4OYLA 4UBMA 5T4BA 2V97A 2VJBA 2QMQA 1SFRA 1ETHA 1AURA 2GYWA 5J3JA 2XB6A 1XZFA 1U4NA 2JF0A 3MGAA 4Q05A 2VJCA 4QE3A 1JU3A 3ZI7A 1CQZA 4JUIA 4GW3A 4BE9A 2DSNA 3DEAA 3OOSA 4B9EA 3B5EA 5C8VA 4KE9A 5A6VA 5EHQA 3DL4A 2VTVA 1AZWA 2ORYA 5AM1A 1TRHA 5ALYA 2CEKA 5C7YA 5K3CA 2AXEA 1WOMA 3AZQA 3FCXA 3QYJA 3D7RA 4BP8A 3I2JA 3WWCA 3N0TA 2R11A 3FYUC 4DNPA 1YAJA 2PUHA 1A8QA 4BATA 2O7VA 4G8CA 3I1IA 3C6BA 4FNMA 2PU7A 4N5HX 1ODCA 3QZUA 2H7XA 3AUKA 2WG1A 3M3DA 3FLAA 3ZWQA 4XJVA 5AICA 1L7AA 3AZOA 2QOEA 3N2ZB 4PSCA 5CURA 4OCZA 3A70A 1IZ8A 4QDOA 1X2EA 3WWPA 2HA4A 4MQLA 5LZ8A 2PKYX 3FLBA 4OB7A 1QGED 2OPHA 1MU0A 3W9UA 4UPDA 2RHWA 2ECFA 2JEZA 2RAUA 2H1IA 3GBSA 4B0PA 1UOPA 5AK3A 1QE3A 4EY4A 1QLWA 2XUAA 3DJYA 1N5RA 2PSHA 3QMWA 5HCUA 1JJBA 3ZLUA 1WHSA 2XE4A 3W2TA 3WWOA 4X94A 4GWLA 3WK7A 4BRZA 5HKAA 5CBKA 3DYVA 1LZLA 1EDEA 5T4HA 1CUBA 1ZI8A 2WIGA 4H7JA 1FJ2A 3WKEA 1EB8A 3DNMA 3R3ZA 4AX4A 4ZV7A 1XZMA 3H2JA 5HF5A 3LIPA 1XZKA 5AM4A 1UT6A 3G0GA 1R1DA 4Q3KA 1FSSA 4ZWNA 4Y2YA 4E14A 4E15A 3H19A 1J06A 4BYMA 1CLEA 2VJAA 5ALHA 3SC2A 3W06A 4K6GA 1B41A 1W52X 4PSUA 2JGLA 1GKKA 3G7NA 1TCAA 1XRMA 4UFPA 5ALJA 1Q0RA 4FTWA 3HACA 2JEYA 3RM3A 1FFBA 2C0QA 4H18A 3VVLA 4NMWA 5DTJA 2QR5A 4B80A 1XFDA 3O4IA 1BN7A 2HFKA 2OAGA 2OQIA 2VAXA 3OC0A 2VT6A 2WFLB 1LBSA 3DDUA 2EDAA 1MTZA 1CUDA 2BKLA 3EF3A 3STWA 1GPLA 1VZ2A 4Y2SA 1CUSA 1H2YA 4DIUA 1VE7A 1ZOIA 2EDCA 3ZLTA 4AO6A 3R3XA 2FUKA 3FBWA 2PBLA 2B61A 1VZ3A 3BIWA 3C87A 5JD4A 1QFMA 5JZSA 3OURA 1YS2X 3ANSA 1QIMA 4GBGA 3W04A 4WFJA 1THTA 1MNQA 2QTBA 3TEJA 4NZZA 1CRLA 4HRYA 4KE6A 3HEAA 1VXOA 4P08A 1CUUA 3FLEA 2FJPA 3AIKA 4CCYA 3F9CA 1MJ5A 2XMDA 4X85A 1D07A 2ACKA 3H2GA 4IQ4A 2XMZA 1XKTA 4UHFA 3FOBA 4KR0A 5JAUA 1Y7HA 4ZRDA 1VE6A 1XRQA 4BCCA 4X95A 4EZIA 4GEGA 2WIJA 4ARAA 1QIJA 1Y7IA 5JASA 3G9ZA 3K9BA 1BRTA 1EHYA 5DYWA 2NW6A 3SK0A 4FNGA 1ACLA 4A16A 4QA9A 4G4IA 4HAIA 1BCRA 2Y1KA 4O08A 2BGRA 1AUOA 5HZGA 3AIOA 4M0MA 4Y2TA 2FJ0A 2HRRA 5C81A 4X91A 3D4LA 2AJDA 1L7RA 1XKLA 1P0MA 2VAVA 3OM8A 3DOIA 5E4YA 5K3FB 4XX1A 5AOBA 5AKLA 2OCKA 1YAHA 2XQJA 1CFJA 1W1IA 3WA7A 3RKSA 5LKRA 2J3DA 2CMFA 5A7HA 5KREA 1W4LA 4J0DA 5JZBA 2CBGA 5CT6A 3STUA 3R0VA 5AI6A 3WYNA 4Q3LA 3JW8A 5AKZA 1XLUA 3EBLA 1HKHA 1VA5A 4LKOA 2JBWA 5DYYA 4OB6A 4G4GA 2ES4A 4E46A 1UKAA 3G0BA 4EUSA 1YB7A 2WKWA 2C4HA 1CIJA 1IUPA 4MEAA 2K2QB 2HDWA 3AZPA 1YASA 2OCIA 1ISPA 3H17A 1G5FA 3H1BA 4MEBA 4MWSA 5JANA 4CCYB 4H7DA 1JI3A 4UHDA 4Y2VA 4AO7A 5EHNA 4X93A 1BROA 4J03A 1YCDA 1SC9A 1XZBA 1EVEA 2VATA 4A5SA 1LPOA 4N8SA 5T4EA 1TK3A 3M81A 5AKKA 3FYTA 5DYTA 4YX9A 2QM0A 1CUYA 2XMSA 1T2NA 1LGYA 3PI6A 5FLKA 4LYDA 2DR0A 3M83A 2OLEA 4KYVA 4BAZA 2QUBA 1JKMA 4Q3OA 2E3JA 2B9VA 4AQDA 3FNBA 4DMKA 3WL5A 4WJLA 3A2LA 3TJMA 4EY7A 3PFCA 3CCBA 3MUNA 4NS4A 2X76A 3WK4A 4B83A 4K2AA 1A8SA 3I6YA 4EBBA 3WLAA 1MX9A 3DQZA 2GZSA 4G8BA 2P8SA 4HVTA 4BBZA 4N8DA 3WKBA 5SYMA 1C7JA 2YH2A 4QDXA 5CT9A 1JFRA 1YA4A 2HA0A 4B0OA 2WLSA 4OYYA 5EI5A 3WL6A 1E66A 1JMYA 1AKNA 3WIOA 1QIFA 2XDWA 5AJHA 5ALPA 5AKIA 3FWHA 3WKCA 2HA7A 4RNCA 1LBTA 1Z68A 3QPDA 3E0XA 2QXUA 5HK9A 4J0CA 2ZJFA 5CT4A 1CUHA 5AO9A 3G8YA 2BGNA 4BVKA 4YPVA 3KXPA 5K3DA 3WL7A 3L1IA 3HABA 4TGLA 4K6HA 4OU4A 3BXPA 1GPNA 2HFJA 2J4CA 4AXBA 2G5PA 1UKCA 3HC7A 1SCIA 2VEOA 2AJBA 1XZHA 4X97A 2B20A 4IO0A 3STXA 4C87A 2PSJA 4Y7DA 3SWWA 1UOOA 1K5PA 2JGJA 4Y2QA 1EA5A 4PF1A 4DMCA 1E8MA 1IUNA 3VVMA 5JAHA 4BZZA 2IITA 1UWCA 5LZ9A 3ZLVA 3VISA 2ZYSA 5DNUA 4UBJA 5AI9A 1K6EA 3ED1A 5LIPA 3G9TA 5D3ZA 3B3QA 2VJDA 4WY5A 5JALA 1BS9A 1UXOA 2Y2VA 2JGMA 1R9MA 4H7IA 2BCEA 1VOTA 2DQZA 5AP9A 2OCGA 2RHTA 2X8BA 1MT3A 1GQRA 3C6YA 3IB3A 1TKRA 1U65A 4FKBA 1ORWA 2WHQA 3PDCA 1RYYA 1EI9A 1TAHA 5CT8A 5DTIA 3STVA 3I6ZA 4J0IA 4H0CA 4FWBA 2XLBA 4BRSA 2ZJ7A 3G02A 3WK8A 2O2HA 5IVHA 1VKHA 1HDEA 1EK1A 5AIBA 4UFNA 3T4UA 2PVSA 3GROA 2CZQA 1XZDA 1E8DA 1TQHA 2ZVDA 2GBFA 1QJ4A 3UUEA 4X6UA 4I19A 4UUQA 4KE7A 2XQKA 3LIIA 7YASA 3V48A 2WFZA 4ZXFA 3TGLA 4BAGA 4X00A 5LKAA 2I78A 1LPPA 3PICA 4ARBA 5IVKA 4AN0A 1EX9A 5HK8A 1QZ3A 2WFLA 1BE0A 4HXEB 4JH0A 5CH5A 5K3EA 1ZD4A 2ZYHA 4X71A 4EY8A 4PO3X 2AJLI 3VDXA 3HYSA 4BZWA 4U2BA 2VQ6A 4L0CA 2WIDA 3HI4A 1IVYA 3H2HA 2G5TA 4EHBA 3IA2A 3E4DA 2CUTA 1VXRA 3HRHA 1CUWA 5ALZA 1YSCA 4ETWA 2O2GA 1XRNA 3K2IA 3I2KA 2RGUA 3R3YA 3STTA 4AZ0A 5AOAA 1F0NA 2ZJ6A 3IDAA 3IURA 4QZVA 4WDQA 4BVLA 2XMCA 4IH4A 2OQVA 1XQWA 4BCBA 3Q8WA 4PNZA 3OPMA 1J1IA 1VA4A 2XI4A 4Y2UA 3V1NA 1BCSA 1MAHA 4D9JA 5ESRA 3HZOA 1YA8A 2WUEA 1USWA 5AKGA 2JGIA 1FFDA 1AMNA 1K63A 5LP1A 4BCDA 4TVKA 1A7UA 2VA9A 1LPAB 3WKDA 1LPMA 2ROQA 1OCEA 3KSRA 5ALEA 2C5FA 2PM8A 1VJ5A 1DT5A 4K6KA 1IMJA 1Q0ZA 4LIPD 3QBJA 5ALMA 2QXTA 4EB0A 1QIDA 4GHWA 3PFBA 4BVJA 1MAAA 1ZI9A 4J0JA 2RIPA 4X6XA 2XLCA 4C4XA 5ALQA 4B81A 2AJCA 5K3FA 3HLKA 3PF8A 3ZV7A 4CFSA 5AOCA 1DT3A 3ZPXA 1QFSA 1QO7A 1ZD5A 5A71A 2WJ6A 4FFVA 3AIMA 4X6YA 5DNVA 5F4ZA 4DSAA 3BDIA 3GA7A 2ONCA 4ROTA 3CCCA 1ZD2P 2FX5A 4MXDA 1X70A 5DWDA 4IHAA 5JAPA 4GECA 1JT2A 2ACEA 4U2FA 2Z8XA 4AMZA 5LYYA 1ZI6A 2DCMA 4Y2JA 3H2IA 3ANTA 2B4KA 2HM7A 4HZGA 1SCQA 3C45A 4L9AA 5ALTA 1W6RA 3I2HA 4CIBA 5I9IA 3I2GA 3VJMA 3O9VA 3LCRA 3DLTA 2WQZA 5AI4A 1HLGA 1Q84A 3C70A 5CMLA 3HSSA 1XZAA 4GDMA 2WIKA 3MUOA 3PF9A 1HQDA 1QIEA 1UK7A 3G0DA 2HHAA 1S8OA 4BC0A 3C5VA 1ZJ5A 3QPAA 2XMGA 4WY8A 1O6FA 3R3VA 1DU4A 1EDBA 2VT7A 3O4HA 5EHZA 2CB9A 4XVCA 1SCKA 1TIBA 5I7UA 4BDSA 1CUZA 1NU6A 4M0EA 1CEXA 2V98A 1CUEA 3BJRA 1DX4A 1H23A 2WTMA 5AK6A 1U8EA 2XT0A 4DNQA 4U2GA 4QWWA 1GZ7A 1H2ZA 1EDDA 4QDZA 1CPYA 3IBTA 1EH5A 1G42A 1P0PA 5HFAA 3HXKA 5HFNA 4AZ3A 5AI5A 1LPSA 1Y37A 4BAUA 3YASA 3JWEA 1CUAA 1KU6A 2V96A 2O7RA 4KE8A 4W1QA 3I28A 3H2KA 5AKYA 5HF8A 3VXKA 4XWGA 3E3AA 5JIBA 5K3AA 3BF8A 4AN1A 1U2EA 3F8SA 3NOXA 3WI7A 2HADA 2XUPA 2X5XA 4GLBA 3GFFA 4XIIA 2O2IA 1RP1A 4FBLA 1XZEA 3F96A 1XQYA 1ZJ4A 4MQMA 4UHHA 4G9GA 4BP9A 4P93A 4J7AA 1R4ZA 5AM2A 3QH4A 2WJ4A 3H18A 3I6MA 1B6GA 1UK6A 2RI6A 2R8BA 3WQHA 4Q34A 2ZYIA 1E8NA 1WB5A 2GBCA 5E4JA 2Z5GA 5AHXA 4OD0A 4DYHA 2UZ0A 3SX4A 3I2FA 1ZIXA 5CT5A 3KDAA 5AM3A 2J4FA 5KBYA 4CG2A 2HU7A 1E89A 5KWIA 3NUZA 1E3QA 2D0DA 5C8XA 4TPKA 2G4LA 4G1FA 3MVEA 1F8UA 3DCNA 4WCVA 1WPRA 1E5TA 1R9NA 3IUJA 4G4JA 5AM5A 5LLSA 5K3BA 3A2MA 3L1HA 1NU8A 3VJLA 4E11A 3JYHA 1XZJA 3PUHA 4CI9A 3FVTA 3RLIA 2WUGA 1LPBB 4JEIA 5FPPA 1XZIA 4C88A 1EK2A 1CVLA 4UBOA 3OTQA 5EIEA 1UOQA 4AO8A 3IUNA 5A2GA 2XQFA 3S2ZA 2AJ8A 4HRXA 1XLVA 3PUIA 4ITVA 1MX1A 1QIHA 3AFIA 1JU4A 2HA2A 1K4YA 2PSDA 3D2CA 4QDUA 1OILA 3WMRA 3NWOA 1WHTA 5JYCA 3A6ZA 1CUXA 1ZGBA 1EINA 4YK7A 1N8SA 3WIBA 3WWDA 5ALFA 3FCYA 1YS1X 1G4HA 4CG3A 2Q0XA 1CUGA 4OUKX 4Q1VA 1PV1A 5FXMA 2WUFA 1F0PA 2BUCA 3CXUA 4UBKA 5FUMA 5CTAA 4RGYA 1THGA 1XRLA 4X3CA 3M82A 1WM1A 2XUJA 4BC1A 4QLOA 5ALNA 3T52A 3IULA 2OXEA 2XMQA 1LZKA 4KAJA 2V9ZA 3R40A 3WK9A 1SOMA 4C6HA 1QIIA 2C0PA 3C8HA 4HS9A 4LXGA 4A23A 2C58A 3LLCA 5FPQA 2ZYRA 2PU5A 1JJFA 4X90A 1NX9A 4PV7A 3KOOA 2XUOA 3QVMA 3QMMA 1X2BA 4OB8A 3GZJA 3O95A 2Z3ZA 4UFOA 5ALXA 2XUFA 2Y2UA 4YASA 5AKJA 2WJ3A 4V2IA 3BIXA 1CUIA 4UHEA 2QUAA 1CV2A 1AQLA 2I3DA 5EFZA 3G9XA 4W9RA 1GT6A 4HTAA 2PSFA 4QEKA 1BEZA 3DD5A 2G63A 5C8ZA 4FBMA 3BWXA 1RWQA 2YYSA 1PJAA 2WU3A 1TCCA 3O9MA 3I2IA 4H35A 3WZMA 2JGKA 4MYDA 1WCYA 1QIGA 1YR2A 3PE6A 3G0CA 5CH3A 5DJ5A 4FLEA 5D6OA 5LZ4A 5FP0A 2BUAA 3BE8A 5FV4A 1A8UA 3G0IA 4KAFA 1IUOA 1XRPA 1JMKC 5EIHA 4F21A 1XRRA 3FYUA 2J3QA 1R3DA 1QONA 5FDFA 1UZAA 2HA5A 4J3JA 3D5EA 4I3FA 1F6WA 4M0FA 5D3KA 2OGZA 4JYPA 2QKYA 3WZLA 4J0KA 1K8QA 1UK8A 3HJUA 2WSLA 3FAKA 4QWMA 5ALOA 3ESDA 4FDMA 1QTRA 2WG0A 3AINA 5IKXA 4UBLA 3ICVA 1AC5A 2HA3A 5ALLA 4MJ3A 4DM7A 5IVIA 4L72A 1G66A 2PX6A 2WHRA 1EXWA 4CCWA 5AKHA 5HQ3B 1GXSA 1QO9A 4DMFA 5AKXA 5T4FA 3ESAA 4BB0A 3LS2A 5ALSA 2Y6VA 4WFKA 1XQXA 2WHPB 4L3WA 1MO2A 1IZ7A 5BWCA 2BFNA 1M33A 1KU0A 4AB1A 1LLFA 1O6GA 4INZA 1FFEA 4C01A 3FSGA 4BDTA 4ZI5A 5EHXA 1UKBA 4F0JA 3Q0TA 2XQGA 4HXGA 4X92A 2QT9A 1QOZA 1XZLA 5CXUA 3WL8A 3D2AA 3F97A 5JATA 3STYA 3ICWA 3H1AA 3WA6A 4K5QA 1YB6A 1C7IA 2HL6A 4Z49A 3RK4A 3DL7A 3WK5A 4Y9SA 3AILA 2DHEA 3LP5A 3NGMA 4B7ZA 1HBJA 2IIVA 4U2CA 4Y2RA 4P9NA 5ALWA 2WIFA 4N5IX 4DNOA 1DTEA 1WB6A 3U0VA 1W75A 3FYUB 2DQYA 3X3HA 2YXPX 2CJPA 1DQZA 1KEZA 4LXHA 1C4XA 4QLAA 2XUQA 2OAEA 3F98A 1P0QA 3KWFA 5JADA 2WFMA 4G8DA 4GI1A 3EIOA 4J0GA 1BN6A 4B82A 2BAGA 4ZREA 4KEAA 4WDRA 4H77A 4LXIA 3O4JA 3DOHA 4C4ZA 2XUGA 4KRXA 4HXFB 4U2DA 1CQWA 4RE5A 3EQ9A 4ZV9A 4UHCA 1ODSA 2QZPA 2Z3WA 1ZIYA 1H22A 3TRDA 2OG1A 5ALKA 3W05A 2Z8ZA 1WPXA 4U2EA 1R50A 2WILA 4QDTA 1TCBA 3WKAA 4B9AA 3C5WP 1UK9A 2LIPA 2HU5A 4IH1A 5ALIA 3FSGD 5LZ7A 4F5ZA 4CIAA 1J2EA 3WJ2A 2GZRA 5AKEA 4PSDA 4WFIA 2W6CX 1PFQA 1ACJA 4OSEA 4RPCA 4DSZA 5ISMA 1DINA 3A2NA 3UMJA 2WG2A 1OXMA 1HL7A 1T4MA 4H7EA 5JARA 5EIAA 4CG1A 2PL5A 5LZ2A 4J0HA 2W22A 4W1SA 1H2XA 3QITA 5D7BA 1CUFA 3DYIA 2JGFA 3O0DA 5SYNA 3WWEA 1GGVA 2QJRA 5FOQA 1MX5A 5JD6A 2QS9A 2JIDA 1CUJA 3EQ8A 2PUJA 2D5LA 4NVRA 3ESCA 4H7KA 3IIIA 1LPNA 3H0CA 2H7CA 3U1TA 3C43A 3KD2A 1Q83A 3BDVA 4JNCA 5AK4A 2ZSIA 5K5EA 2DHCA 3V1LA 1MN6A 2CKMA 2OGTA 4G5XA 4DGQA 4Q82A 1WB4A 5A62A 4B6GA 1FFAA 4G9EA 4DNFA 2DHDA 1GQSA 4LHEA 1ZD3A 4KRYA 3VKFA 3BF7A 2XUKA 4X7BA 3EQ7A 3WK6A 5DLPA 5BWBA 3E1GA 1DX6A 3R41A 4JYMA 3K6KA 4MYSA 4EY5A 5BV7A
chains in the Genus database with same CATH superfamily
1P60A 1AA9A 5KTMA 5CX4A 2I7TA 5H3LA 1JJIA 2ZI6A 2PG3A 4Z99A 5IU6A 1CZUA 1NW4A 2GH1A 1UZUA 2O8VA 2RGNC 5AYVA 3SYLA 5EP4A 3D59A 5E2IA 4DMRA 3VNVA 1D2HA 3GFTA 3P2MA 3BE6A 5FORA 5JPCA 1VLQA 3I6QA 1TF7A 1ABFA 2N9UA 4WJZA 5H7XA 1LI4A 1II8B 2DU8A 3ZE2B 4FW9A 1VDMA 1EFPB 3BB3A 1P61B 3IDFA 5GV7A 5MN4A 4MDYA 3M2TA 3ND9A 5FF9A 1R0LA 4RUKA 3NPMA 4AFNA 2H2GA 1N2JA 1YDGA 3IJ5A 4NHEA 4EI2A 4XEUA 1Y34E 3CN9A 1SRQA 2ZI3A 2MWMA 4D4HA 1O8CA 1G1AA 1Z4KA 3FJ1A 2HQBA 3D0OA 4H7HA 4MUEA 1BQ4A 5FBZA 4BGIA 4CL3A 4EBBA 3R5JA 1W0JA 3A9UA 2WYIA 4FZJA 1LNSA 2BKXA 2YVQA 3GELA 3DO6A 3C6KA 3OBBA 3TEFA 1T3GA 3AEXA 3SXJA 1CDZA 1JQKA 5DHQA 3R3UA 3VJKA 4YJ3A 1O0BA 5A0VA 2ILVA 4GGOA 3W8RA 3HV0A 4D3FA 3R7BA 2VCEA 4GF5A 3FMPB 2P9QA 1OD6A 2SECE 4CKCB 1V39A 3R4CA 4RADA 2J0UA 4MX8A 3ER9A 2X3YA 4DDVA 3IO5A 4UM9B 1RTKA 3L6RA 3INGA 4QTYA 2P2NA 4OPMA 5J1SB 5CDGA 4W1RA 4D74A 2X0NA 1C9KA 4CM4A 4YUWA 4GX2A 1NFFA 2C5GA 4HBZA 4X8OA 3VUEA 6PFKA 4WCDA 3A1WA 3EMDA 3LDAA 3U3XA 4MGIR 3O94A 3W7BA 3R6TA 3L5KA 4BGDA 4LYHA 3LD9A 1E5XA 3OCXA 5H3HA 4WPGA 4EYGA 3LXMA 1YQXA 1KETA 4ZOEA 3TQOA 3G9UA 5HUQA 1MP0A 5FTJA 4B2IA 2B99A 1HNWB 2D1TA 2MHCA 2Z43A 4U5XA 1RQPA 4ZO4A 2ZBEA 1B6RA 3LUBA 5IF9A 2WIBA 4BFZA 4MHSA 4AU1A 3B6EA 2V7QD 1IOZA 4YJKA 3UJ8A 2E1RA 3P9ZA 5FNZA 5BUZA 5HMLA 1M34B 1QS0B 4HMQA 4RY0A 2VR1A 3FFTA 1X7YA 4TMVA 5HFJA 3SSNA 1F5NA 4KSBA 1BCRB 5JXGA 1VB3A 3Q87B 4LDPA 4YAFA 2DCUA 4ER0A 5CCBA 1M8FA 4Y30A 2C7VA 3I92A 2DMRA 4JP5A 1YQTA 1Z75A 4KUEA 4WXEA 4Q9IA 4AROA 4CQMA 4XWKA 5K4GA 1GFWA 4IP0A 1VJTA 4KN5A 1ISGA 4JB3A 5FWDA 3RIGA 3OUUA 3O38A 3GLIE 2YASA 3PDHA 3PNVA 4IG4A 5IT4A 4L0QA 2XZDA 5IAGA 5DU2A 5KJFA 2EKQA 1FYVA 4TRJA 1YRAA 1H05A 5AI8A 1MDFA 4Q4LA 1Z7GA 5AJVB 5FJIA 3IQXA 3RIMA 5LMUB 3DCIA 2NUAB 5CX1A 1KJ9A 4FLFA 4I4NA 2AWNA 2X0JA 5F1OA 4Z1MA 2XDYA 1WXDA 3ESBA 4RHUA 4KH0A 3W4IA 4ECEA 3L7MA 5IUJC 4EPXA 1YH3A 4I3GA 4YPFA 2QJWA 3W5JA 3DPSA 1TGVA 1UOEA 1W76A 3QP9A 1N0IA 4B6JA 3ZVNA 2OT3B 4JAVC 3ZU2A 3GR6A 1MPXA 3ZE6A 4NPHA 5KJ1A 4Y2XA 1IM2A 4FHZA 2VDWB 2VK2A 2GHRA 3UPTA 2GBIA 2FE1A 1UJ5A 3I1YA 4GMKA 4UC0A 5CDYA 2VTBB 2XUIA 4PLZA 3NQ41 4UAVA 5SZKB 4TQUS 2QUHA 2F6RA 1AKWA 3M89A 3PDJA 4BIMA 3B5IA 2FN9A 1CF4A 3L7OA 2YQZA 3PD0A 1XEAA 3O31A 1VMAA 2XMBA 2Y9MB 2H54A 3PFKA 4HVAA 2IWRA 4CTMA 5C80A 2FLVA 2FPUA 4B3RB 2P40A 3CWCA 3MD9A 2CHGA 1FRVA 2BUBA 2JZOA 5BN5B 3TE7A 4C2UA 2BM1A 4U8GA 4UHBA 1WVIA 1Z5PA 4OATA 3QFSA 4XB1A 1PFUA 2VN8A 4J9UE 1RRCA 2GYVA 3NHUA 1LC0A 1LBHA 5KDLA 1JE0A 2O0MA 3QOWA 1K0UA 3A10A 3AY3A 4GBMA 4NXNB 1Z4OA 4PQEA 1Y89A 1MA3A 3E70C 2WTNA 5DYNA 3RBAA 1RWMA 3W9YA 4NPAA 4B4DA 1NY5A 3B7GA 1P77A 3QWHA 2AB0A 3SEZA 4E6PA 4B2LA 1N9GA 2LCIA 3KVRA 2QAIA 3AJAA 3UJ7A 4B3FX 1ONSA 2RJNA 4Y2PA 2YBEA 3R5HA 2O57A 5J5AA 3OM1A 3A32A 3FGPA 3HU3A 4EY6A 1P29A 3BSYA 1CK4A 2QRUA 4LC1A 4OXNA 1DQYA 4MW9A 4RS3A 3ZGYA 1JQBA 5D3MA 2MIIA 1ZMOA 3L1JA 3W77A 3PQFA 5AM0A 2F1KA 3FOEC 1U8CB 2IY8A 4DT1A 3DEYX 4QVKA 3MJRA 5IVDA 3SFVA 3WWYA 1PX0A 4FI3C 4IVQA 5KWJA 2Q9BA 1RWVA 1E92A 4QRHA 5GV8A 4UNIA 4WESB 4RVGA 3JQEA 2NMVA 4OH1A 1R2QA 1RS0A 4MMZB 3DEJA 4RH1A 1E2KA 1K5HA 3PQEA 4LRYA 1JYEA 2JFHA 3QWFA 4B85A 3EZXA 3PQ8A 2OV4A 2NU6B 3B53X 1XQ6A 3ZZUA 5LQMA 1XNRB 4BX2A 2EEZA 2H1LA 3K0KA 1YOVA 3A6JA 1TM4E 3PRYA 4FVTA 4TWIA 2A94A 5JEEA 5ALVA 4KO8A 1ZVVA 3EC7A 1V11A 4W63A 1E0JA 2TMGA 1MO4A 3UHPA 1NDUA 2FGKA 5F9HA 1Z88A 3S28A 3EF0A 1XQVA 1RHRA 3DOOA 3S7ZA 2PD3A 4KGXA 2GM4A 1U63A 3KAPA 1TYZA 2EJVA 3E1KA 3GDHA 3EVZA 3ILSA 4GPD1 3PSAA 4MVJM 4BE4A 4D9IA 2VP0A 3K9QO 1ZN2A 3NFYA 2LUOA 3IMFA 1CVRA 3UK2A 5FPKA 5M5BA 4IDHA 1CR6A 2GN0A 2HQRA 2XEXA 3NM6B 2JFOA 2I03A 2ZI4A 3F49S 4L4SA 3WRXC 2BMAA 2G6TA 4XI9A 4F60A 2J59A 3KR1A 5HQ3A 1FFYA 3M0EA 4BQEA 3GN1A 3DV0B 2P78A 4KCGA 2HPZA 2UVQA 4DC1A 1M66A 2HJRA 2FRDC 3EC1A 3V4OA 3ETCA 1LJLA 2DULA 1UT5A 3CLVA 3NVDA 1YDEA 1P1RA 3TCNA 4G5SA 2II6A 3PUZA 3GUZA 1W36B 2ZXUA 1NHGA 1OPXA 4BNUA 1KVRA 4MWTA 2QD2A 2VP9A 5E6SA 4A91A 1J97A 2I2AA 4CUKA 1LKZA 4C0KA 1E3SA 1PU2A 2HTFA 5LDHA 2AFVA 5KDOA 3DZBA 4D6XA 2FFAA 3OO1A 3ORHA 4EVIA 1A4RA 2VJBA 3G2HA 4IUDS 1ZRHA 3U0BA 3SSMA 4ZI7A 2GM5A 3ESZA 1Q14A 4I9HA 2CCJA 4RWZA 5FL7D 4F11A 1KHHA 2H2WA 4P58A 2VQDA 4JBNA 4HH0A 3HFRA 1XZFA 3VR2A 3AHCA 3AEUA 3H11B 4GLFA 4FQ7A 4AKTA 4M0PA 5CK4A 3MGAA 3W1EA 5EKXA 1NXPA 1GZUA 2Z4TA 2NU7B 1JU3A 5I6DA 1OFUA 4RENA 1CQZA 3JD1A 3KUKA 3ZI7A 5EIBC 1O95C 5LJIA 2WZDA 3GPDG 3K0CC 2FMIA 1GRVA 4GW3A 3LZDA 1P6XA 1CZLA 4BNXA 2XF8A 4B9EA 4E2FA 3WBBA 2ZZKA 3PZRA 3T5MA 3X2EA 2EFCB 4DWOA 2GPBA 1VPTA 3TFOA 4DZRA 4UTVA 4XSHA 1B3RA 2VTVA 4LHWA 4R01A 2AOVA 5TJHA 3C3KA 3ROFA 3A1NA 3RTBA 1TRHA 2FUNB 1NW6A 4KBYA 4U6NA 1SB9A 2YYYA 3WGOA 3CRRA 2O0LA 4BEBA 2SNIE 3JQPA 3KOZA 3P9IA 3UC9A 1U8UA 3TIGA 1SR8A 3OIGA 4G0UA 2AXEA 1WOMA 2A86A 2DWUA 2JRLA 2JIZA 2PAAA 4WN9B 5NULA 5T5QA 3WOHA 4MV9A 3X0DA 5AVWA 1YDWA 3DZIA 3FCXA 1AS0A 3D7RA 3QYJA 2JLCA 1E1RA 3I2JA 2FWRA 3QENA 4MGHA 4RGVA 3WWCA 4C0JA 5A4FS 1UM9B 4DNPA 1M2EA 2Q3EA 1K8RA 1T6BY 4RW0A 1KQOA 1G4UR 3EXEA 5E8JA 3RR2A 1QP7A 3C7DB 4KLRA 3ZE9A 3PGXA 1LNZA 1T29A 4BNWA 1P1JA 1JEOA 2A0YA 3ASZA 2B3DA 3N0VA 2IGTA 3BIFA 4FNMA 1AHPA 1CNEA 5LBIA 1ODCA 3FPGA 2VSOA 3SBXA 5LYJF 1U2DC 4EHKA 1ZD1A 3HDJA 2FVYA 3SZLA 1MQAA 1HZZA 1XUOA 1HDRA 3DNPA 3MWGA 3WO1A 2V7TA 3TF5A 4UASA 4UPEA 1JHZA 3FPSA 2I4MA 1OAOA 1RXYA 4ZAXA 3NBXX 1NUHA 4KLNA 3PWKA 3ZWQA 4C22A 2Q3HA 4ARZB 4MUMA 2JI9A 4XJVA 5IULC 3PXDA 1F2TB 4PS0A 1ZM2A 3TOSA 2C1ZA 5KSZA 2VS1A 2Q6LA 5FCDA 3N2ZB 2M32A 2ZBVA 1KFCB 2ZT6A 4OCZA 4IDEA 3A70A 4CU2A 3PA8A 4R9UC 1IZ8A 4MI3A 3ZV3A 3IR7A 5F7XA 3OZDA 4C0QC 2HA4A 3FIUA 2D2FA 2FW0A 4CEJB 2EWMA 3IYLW 4DR7B 1EEXB 4FXOA 4W8OA 1GTVA 5ESXA 2GPAA 1TVKB 3RS7A 1RYEA 4H3KB 1I3MA 1WIWA 2PKYX 2Y71A 3G88A 5HJEA 1O4WA 4OB7A 2FWPA 2CFTA 1ULBA 1MU0A 1TZJA 4N9QA 4REOA 4EZEA 2V7BA 5E9WA 1HE3A 1CNMA 2O3JA 3QA9A 4CJXA 1BDJA 5GPBA 4YROA 1E3EA 3NBZC 3ANMA 3WLTA 3VI4B 4QULA 1C9EA 1JN0A 3EFEA 3EVGA 2H1OA 1X3SA 3ELUA 1X0XA 2IIQA 3JZAA 1M2WA 3ZHCA 4BQSA 5IAOA 1UINA 2WWVD 2G80A 3TZQA 1RFLA 3UHAA 5HZHA 2ZYTX 1O0SA 3ZJUA 3DDZX 4GX0A 2XUAA 3DJYA 4JENA 4DLSA 4GSLA 3K1JA 2DBYA 4XDHA 1RPAA 4C29A 2A1UB 3GL9A 3DZHA 4A0SA 5JDIA 2GYYA 2GCOB 1EE2A 1IPFA 2QA5A 3GT3A 3TDNA 3A6PC 3W2TA 2M98A 3D5QA 1OX4A 4CM1A 3SYNA 3LLUA 2QNRA 2JLYA 2VK1A 4X94A 2BM0A 1ST3A 2FA9A 2YWFA 3KHUA 1T0JB 4BRZA 2GZMA 1Z5OA 3TLCA 5HKAA 2UAGA 5CIYA 2FEPA 3WQQA 4INAA 4O2LA 1M1NA 3E8MA 3HG7A 1P3DA 4UDOA 1QRTA 3IE2A 1E0KA 4HO1X 4N3BA 3DFZA 5T4HA 1ESDA 4FT2A 1M0SA 5EIBD 1PJ2A 2YZ7A 1ECJA 1YO6A 4AIRA 3WGJA 1WY5A 3VZDA 4RK1A 2DFTA 2WIGA 4H7JA 2ZSFA 4DDTA 2W2NA 3HB7A 1CZNA 1EB8A 4R3UC 3WAKA 7ADHA 3NRCA 5K09A 5A5FA 4WD3A 1XYGA 3VYVA 3R3ZA 1TIPA 1VJGA 3ZCXA 2G08A 4QGBA 1X13A 2CXPA 2LDBA 3AKZA 1P6QA 4ZA2A 1P17A 5HF5A 3LIPA 3Q2KA 2K7ZA 1UT6A 4ZWNA 5TQ0A 3RFTA 1C2TA 2H0RA 2IXGA 2EZ9A 4UNSA 4BL5A 4E15A 3QE3A 2EFYA 4UU1A 5ETJA 2AX3A 3K9CA 5EYPB 2D1QA 1EX1A 3LK7A 3PXCX 1V25A 3C3PA 2FMHA 4BYMA 4PY2A 1GL3A 2VJAA 4TQGA 3AKEA 4EITA 5I7WA 2X6TA 2P2DA 2VBCA 3KDSE 4INJA 4OJMX 4BBJA 4EFNA 3W06A 2R7NA 2WV9A 5J4YA 1AQJA 4BKPA 3ZDCA 5JLAA 2BD0A 4K6GA 1B41A 2C4WA 2ZWAA 4PSUA 4XQGA 1FQKA 3LU1A 1JDUA 2F4NA 3GUHA 5CVCA 3KXKA 1KFKB 5GM2A 3TVTA 2W8ZA 4CCAA 1R4MA 5FH9A 2JLAA 1HDCA 5GJCA 1NPTO 3KM0A 5KQLA 2OCAA 3UK7A 3QKRB 2XQVA 4LA4A 1EFVB 4AZVA 4PYOA 1IATA 3O03A 2ET6A 1C9YA 4H18A 1VYHA 3W79A 1P1CA 3NB0A 2PK3A 3AU8A 1Z5ZA 1OC2A 4XR9A 1U28C 2VSNA 3G2MA 4BRWA 3IP3A 3MN1A 3RIEA 5ER6A 3GLQA 4GSYA 1XN4A 1F3LA 2GNOA 1DBWA 3HNOA 2Y0EA 3F6SA 2ZB7A 1PT5A 3O4IA 3K0AB 4BRUA 5HSGA 4OLJA 1E5VA 4A92A 3SKVA 1OLUA 4O4IA 1PEDA 3I61A 1C8LA 3WOVA 2OQIA 3EGIA 3RSOA 1RADA 3T5GA 1SQ0A 1OIWA 3VR3A 4BEVA 2QIOA 3CF0A 1JLHA 4UNRA 1DBIA 2PXHA 4D41A 3WDKA 3LP8A 2VT6A 4K7JA 3DT6A 4YFYA 3HK2A 4XDZA 3VOTA 5I3ZA 1VKNA 3ROKA 3DDUA 4N5LA 4RYLA 2HD4A 2W0MA 2YMMA 1T0HB 2HC9A 1LRJA 3HM9A 1MO6A 4DWJA 4F7WA 2BKLA 3EF3A 3MHPA 2EFGA 3WIUA 1J8MF 1RM0A 1M1YE 1SU8A 3B7WA 3HA3A 3VTKA 4CTOA 4JJ8A 1CUSA 3IILA 1SUPA 5DN6D 3E7DA 4JXZA 4LJKA 5G1NA 1JX6A 4IV8A 3COJA 3RFXA 3ZLTA 4EW2A 3VTZA 1KQGA 3DOJA 1Z6XA 4PG7A 3AKDA 2I6FA 5I7AA 4KRFA 2FUKA 1HDXA 1VHDA 4JSRA 1B42A 3PRHA 5KNDH 1AIPA 1FQWA 1G5TA 3FBWA 2ZU0C 5K8LA 3QI7A 2ZRNA 2VT3A 2ZQ5A 3A1CA 4MR7B 3IBFA 5CLLA 2B61A 1BJTA 2HJVA 3EZGA 3GEMA 4Q9AA 4X1IB 4DG8A 5CDTA 3C7KA 3W2FA 1DBSA 5FWNA 5JD4A 4IJ5A 1MB0A 1Z0SA 1QFMA 3HBNA 3T4PA 1HRDA 5JZSA 3HUEA 5A5DA 2KBEA 2PX4A 1WHSB 1A5ZA 4GBGA 1AS3A 4ZI2A 3HM2A 4WFJA 1WF3A 4W7SA 4BNMA 3MT7A 3H1EA 1PR5A 2Q9CA 4B3BA 2PXAA 1MNQA 3U4QB 4LJAA 1H5UA 5K01A 4AZ0B 4L9WA 2FDXA 4QYIA 3SEQA 1QGAA 3TXAA 4F6LA 3KTAA 4D0SA 5IJZA 5IK2D 3A4VA 3O8NA 4UUOA 3I5XA 4FSDA 2C7OA 3M70A 4XRRA 1VXOA 1J42A 4P08A 4BLTA 4O6VA 3L46A 2JJQA 4ZC1A 2Q6IA 1SM4A 4OHYA 1TFUA 4JFRA 5BYJA 3SD7A 4LYJA 3VR6H 4D3DA 3G5AA 1PT8A 1KDOA 1JZQA 1YRBA 4CCYA 1WPQA 2ZYDA 2OBNA 3JVDA 2AWOA 4Y9UA 2OHVA 3UCEA 3L1UA 3ANNA 5I9SA 1HG0A 1OZHA 4P1ZA 3UV3A 2FP3A 5DMXA 1YRHA 5A6SA 4W9MC 4E13A 2X0KA 3JZFA 3UC5A 2VHZA 2AVDA 4DQDA 2QL7A 5CDFE 4A6XA 1I32A 4S24A 2FQQA 4ZT4A 4AJHA 1H69A 4LY0A 5ED4A 1I4OA 3K4QA 4UW9A 4NENA 4X95A 1SXJB 4GZ5A 5IJ9A 5J47A 2W6IA 4ZEOA 2QN7A 2VWPA 2WIJA 4ARAA 3KR2A 3TS1A 2DR3A 3HEMA 3IB6A 4BMNA 3QYAA 2L69A 4GWGA 2B9EA 2XVXA 3SGLA 5CFQA 2CMHA 3OOJA 3G9ZA 3A7EA 3D6MA 2GA8A 2BM8A 1WP4A 1DIRA 3AYXB 1OLXA 3PQDA 2R96A 4CE6A 4QA9A 3PVCA 5BRNA 1BE1A 1GUBA 1Q5PA 3N6XA 3EPJA 4HAIA 4RFSB 5CVVA 4HAVA 2JFYA 4Q7KA 8MHTA 2Y1KA 2UYCA 2QRVA 5REQA 1STOA 2BGRA 5ICCA 3AIOA 3I39X 4KFUA 4PICA 2WT9A 1JG7A 3M4JA 2IYSA 4CM7A 1ISIA 4V0LA 4B2YA 3K5HA 5MGBA 2Z6QA 2FJ0A 4BGVA 4E5UA 2HRRA 3ESQA 2W6QA 4X91A 2PBZA 1XTJA 1NBIA 2LDXA 4PXAA 3ETHA 2A58A 5FPSA 3SE0A 4GZMA 4ZEWA 3OPYB 3QE4A 3DOIA 2P9HA 2ZSEA 5SICE 4J0FA 4EMTA 2O52A 1M6VA 1MOZA 3AHHA 5E0KB 3NNNA 1LDGA 2XF2A 1HYBA 4J4TA 4B6OA 5FLEX 5K3FB 1X9IA 2HRZA 2NO1A 4XX1A 5AOBA 3NV7A 4YRSA 4RHXA 4HQFA 2XB8A 1Q0QA 3DE6X 4FEEA 1YAHA 2ZJ1A 1K3UB 4BLQA 1MX3A 3PIDA 4F93B 3O91A 1VE5A 1B3BA 4U63A 4KPFC 1PWZA 1IAQA 5CAEB 3WA7A 1XWFA 3NPAA 4DZZA 3ZW8A 4HXYA 5A7HA 4XDYA 5KREA 1VG1A 2CBXA 4J0DA 4ZEVA 3L4KA 1OFHA 2IPMA 1F2DA 3EZFA 3EYAA 1NNLA 4OFBA 4PSKA 3TOVA 1EA7A 2Z08A 5K0EA 1XZ8A 3PK0A 4IXNA 2INGX 3TGPA 5C7OO 1UAGA 2RAVA 4JJEA 4HZUA 3IQWA 2DSTA 1P74A 4KKXB 2AD1A 3V4ZA 3WYNA 2BMDA 2P7HA 1KOJA 1I14A 4E1AA 3UW1A 2G8NA 3DZCA 4ZTBA 1HORA 2QN1A 3C8MA 2DLNA 3EDYA 4RA6B 1XLUA 4C4PA 5I8PA 3B6IA 1U8AA 2NO6A 3OD5A 5DZSA 3GJ8A 1L4GA 4UM8B 4QHSA 4EY3A 4QYXA 3I1JA 1QP0A 4XDGA 1A9TA 1ISMA 2BRUC 3RS0A 2JGDA 2UKDA 1Q3TA 3QOYA 4LJRA 5E6RA 3LPCA 4OB6A 4ZVVA 3U7IA 5DF1A 5GTDA 2VZ0A 1KQ3A 3TCXB 1V47A 5DYIA 3CX8A 1PQWA 2AMFA 3HVRA 1YUMA 3WTBA 3QKSB 5A4AA 4CW7A 4EUSA 1QG6A 3K32A 3TK1A 4R41A 2QM7A 3HDHA 3FMIA 1BJRE 4CV2A 1W9HA 2K2QB 1FTNA 5DW0A 5G0UA 4FYKA 4Q01A 3SSOA 2JLSA 2O7NA 4E30A 1XELA 3RHZA 3GGOA 2F59A 1G5FA 3H17A 4B46A 4K46A 2ODAA 1TA9A 4MB0A 3AP1A 3I2YX 1V1RA 4GKAA 2ZR7A 4M9CA 1PK8A 5J2UB 3D4BA 4HEA1 1NXTA 3K9HA 3WHLA 1DVRA 1TE2A 5DSXA 1L2TA 2YBDA 1CR0A 4U7TB 1DFHA 3V4VB 5DP2A 5JAZA 3EVDA 3OQOA 2GK7A 3SC6A 5IDQA 5KTOA 1I4DD 3QEOA 4YT8A 4X93A 2XCRB 2V5UA 3NC4A 5H1YA 4F3TA 2FKNA 4J0EA 4NJEA 3R9IA 1BROA 3DBLB 3U3RA 3FGOA 5HE8A 4YUVA 1FXSA 1SC9A 2G06A 1ZITA 3UJ9A 3P9YA 2DP4E 2GXUA 4CODB 2BKVA 2IYFA 3FF1A 4NV0A 4TMWA 3MNFA 4EJSA 1AV7A 3B89A 1Q0HA 5EY5B 2IC5A 4KNYA 2B78A 5ES4B 2VATA 3UOGA 4A5SA 2VRCD 5E1DA 2I2DA 2VWGA 3FZGA 5LL6P 2BGGA 3SBOA 2QN6A 1C3VA 2OV1A 5KVCA 2NPIA 4FMCB 1GUAA 4IF6A 3WRYA 3GMTA 1DKMA 4KYIB 3LRPA 3WNZA 4C04A 2QM0A 3I73A 5HR5A 4ZCIA 2ESRA 3GIDA 1I2CA 3FZEA 3OC6A 6Q21A 4INOA 3OKCA 1NNEA 2OBBA 3OY2A 1Y7PA 4BNLA 5K3OA 4X3OA 5DNCA 1U2SA 1DCFA 1OWOA 2NUTB 3NWEA 3PI6A 1VRVA 5FLKA 1GTSA 4LYDA 4OF4A 1L9KA 5EIXA 1OBVA 2ID9A 2NACA 1P4JA 1T35A 3GLIB 1FFXA 2OLJA 2PRSA 4KYVA 1XTTA 2C5HA 3N0RA 3RYFA 1PQPA 3QYPA 1U0JA 1JKMA 1W36C 2JJ2A 4AQDA 5F21A 2WTEA 2XGMA 5DI9A 2YIDA 4PZEA 4WJLA 3FTFA 2AYYA 4MW0A 3GP3A 4TVBA 2PFKA 1KAQA 2DQKA 4OHCA 2X7JA 1FP4B 5KI6A 1A77A 5C5IA 3HDVA 4TVOA 4OIMA 4DSTA 1DTWA 2GFHA 2ZUVA 3IXLA 3DLAA 2HI0A 4ALMA 3QX3A 2GK4A 2KMLA 3DTVD 4CDRA 1NG1A 5JV5A 3NWBA 4JHLA 4K2AA 3VYSB 3WAJA 2BSQA 4IHJA 1UBSB 3F2VA 2EJBA 3HWRA 1ECLA 2IOHA 2QRJA 2RHJA 1AKMA 1KAOA 2XADA 2UVDA 3EG5A 2O8CB 4LHXA 4HVTA 4RABA 1FL9A 2EBUA 3HCFA 4BVGA 3WKBA 3QQ5A 2PZEA 1NJGA 3OLCX 3GGDA 4ZOLB 1Z4QA 1T26A 4IILA 1C7JA 2DUNA 5KYXB 1YJQA 3I0NA 1RQNA 5CT9A 2HO4A 4AZ3B 3DWFA 4Z0HO 5G3ZA 1REQB 3OSZA 4LRTB 3OWHA 1CF2O 3ZBUA 2VWHA 4EQ6B 1E60A 1CJTC 1DL5A 1YR8A 1J9EA 1M2OA 2JIOA 4KQGA 3RE1A 4YP7A 3MWEB 3LO8A 1RAAA 3FDFA 3ERCA 2GAAA 3BWEA 3WGNA 1T8WA 1QIFA 3NP7A 4MWZA 1LTQA 4DCOA 3BH6A 4P5PA 4MCIA 5BQ3A 1NMXA 2D5BA 3VV3A 2YUTA 1ISJA 5DHTA 3WKCA 3S8EA 3MZ0A 4RNCA 3AHJA 2V9PA 4JZYA 4Z9BA 2GPSA 3QPDA 5AW1A 1QWOA 4ZAVA 4D9MA 3PNKA 3DVLA 1UMBA 4MWOA 1CRWG 4RHFA 3WR5A 1JEJA 1XTKA 3N59A 3UKJA 5JNWA 5K0ZA 2PIDA 1JSCA 2HBZA 3K5PA 3QBVA 3VBCA 3ZW7A 5HK9A 1I9GA 4IQGA 3WLIA 3ZS9A 3NH9A 4NZOA 5CT4A 4YR7A 4YV1A 1E9CA 5AO9A 3G8YA 2BGNA 1ISFA 3ORYA 1IQPA 3FHJA 3TO5A 9ATCA 1P1FA 3L79A 4NJMA 4UARA 5K3DA 5A2QA 5K8IA 1YZUA 3WL7A 1NRXA 2CHFA 3DBOB 4JC8A 3KIPA 4N47A 5IUKC 2JGRA 3NTUA 5K8UA 3B85A 4CNQA 1YE5A 2E4XA 1GIAA 1KEVA 3NT5A 2FW8A 4NFLA 3RVOA 5KYNA 4BP8A 1XV5A 2AHRA 2ORIA 3HABA 4IGKA 1G9SA 5JFTA 2C29D 2XMPA 4J1SA 4N7MA 4L2IB 4QUKA 5K2OA 1VLLA 3KUCA 3U3MA 2AC7A 4CKEB 4F5WA 4JA0A 1T1IA 4NCBA 1GPNA 3H1PA 4LOHA 4PE5B 1WU8A 1QVZA 4JU9A 4CLEA 4FB4A 3EXIA 1O9BA 4K05A 1NP6A 2FMXA 3EVBA 2HSZA 2XRMA 1UKCA 1ORHA 1SCIA 5K0JA 2QGFA 2AJBA 3OPVA 4X97A 1IY1A 3NRJA 3I5UA 3ISJA 2PH3A 3F4BA 4QC2A 1PZHA 2PUFA 2UVPA 4ZZ0A 3V8QA 1CC1S 2BSXA 3VX4A 2V0GA 2M6RA 2XD4A 1XVUA 3K8OE 4JLBA 1P5RA 4JL6A 5B1DA 2O6LA 1GDTA 1I94B 4O33A 4Y7DA 2RKBA 3PGJA 2AW3A 4M98A 4E22A 2PZBA 2PBRA 3OEEA 3PXXA 4W9NA 5IXSA 3J81A 1OWLA 4EKDA 5FWXA 4DS3A 3I9OA 4PF1A 4P82A 1TLTA 1XTQA 1MENA 2PRZA 3BEDA 4PZAA 1W36D 3E5NA 2K87A 3ANYB 2XTJA 1GRRA 1IUNA 1G8JA 4IZHA 3GFQA 2R8ZA 2Z30A 3AGQA 3H5VA 4HZIA 3KC2A 3RROA 1TUBB 4K8RB 1PGPA 2AG6A 4S1TA 2H5JA 4JOBA 5C1IA 2FE4A 3ZD8A 1M67A 3A1VA 3IMCA 3OEHD 2ERCA 3OOWA 2Q27A 1WDKA 4M0UA 5KNDD 5C4GB 3HO6A 1GCOA 4KUGA 3ZW9A 1G5RA 1UJ2A 3VISA 1P8JA 2ZYSA 1F1BA 1A8HA 1TQ2A 4UBJA 1KK0A 2XJ9A 4GE3A 4LJYA 1SIUA 3SCZA 1J2TA 1H6DA 1V7PC 2WWTA 3N76A 3A36A 4G4SO 1BXKA 2RARA 3GRPA 3G9TA 1Q7TA 1VL2A 4P4TA 1KDYA 3B3QA 1N6NA 1MVOA 5C9ZA 4B73A 3A14A 5JALA 2ZBQA 4XSVA 3TL6A 4DN6A 1SCDA 3RS8A 1UXOA 4PFKA 2Y2VA 1U1DA 2EGHA 3QSYA 1R9MA 1FEZA 4H7IA 1ZIOA 3FDJA 2BCEA 4Y6RA 1JVSA 1N3LA 5AP9A 4ER6A 3R0XA 2FQXA 2VNSA 1NQWA 1UIRA 4CM9D 4C43A 3PQ6A 3U4GA 4AJKA 5IDXA 3IEVA 1W0KD 1KI6B 1TC1A 1DSSG 3LQ2A 1GQRA 3CNEA 1Z4PX 2NTNA 4PR0A 5KC9A 1TKRA 1UXGA 4FMCF 1U65A 2H51A 4WGFA 3IV6A 1ORWA 3PDCA 3Q10A 5TF4A 4M2LA 3NDBB 2FDCA 1RYYA 1S02A 2WVAA 3UJNA 4NEQA 3AM1A 2ADFA 2Q4TA 2WJZB 3ZDZB 1R0ZA 1U80A 4R1OA 3PWSA 2A5FA 3KLMX 4Y1FA 2YV2A 3D64A 3G02A 1L5KA 1FUYB 3GFVA 3M9XA 1OIVA 4RY9A 3WK8A 4PAQA 1HDEA 2J7KA 3J81k 1EK1A 4YMWA 4JMPA 1RRVA 4S35A 3QYFA 1JNXX 1I36A 3TVYA 4PYRA 1C9NA 5KNBH 4E5VA 1BKSB 4P5DA 3ZU4A 1OX6A 2M9MA 2ZVDA 1E1KA 1ZMBA 4MWDA 3LG2A 3AW8A 2Q5LA 1QJ4A 3M6VA 4OI4A 2C5AA 4I19A 4UUQA 2BMEA 1H2RS 1C1DA 4QM6A 1WSDA 3AVTA 3F4KA 2GLUA 1EUCB 3D8RA 3F5QA 3PC7A 4YRJA 3KO8A 2WFZA 5AK0A 4ZXFA 1YMVA 2OYSA 2ZRJA 5HUJA 5GADl 4C0HA 2A33A 3PUYA 2RGRA 4X00A 2CXUA 2FFQA 3H0EA 4Y2HA 2FF5A 3AMVA 4D5EA 1AZSC 3RVLA 2I78A 4YJHA 2IU6A 5C4MA 1ENPA 1G4AE 2NO0A 1DRKA 4LHYA 3FHOA 3WQRA 2A4KA 1A1VA 4X1OA 5FBWB 2FXVA 4ZOLF 4HAUA 5FB3A 4AN0A 4LZLA 3O8LA 4KTVE 4J4HA 5EQFA 3F7NA 5HK8A 4IFIA 3A4TA 4UPVA 1QU2A 1OF1A 2ZRHA 1QO0A 3EBOA 3IP1A 3PLRA 4BWVA 4KMMA 5BSKA 3FZQA 4JH0A 4NPCA 4AD8A 3ZK9A 4A27A 3PIIA 3KU1A 3QU7A 5LP6B 4AM8A 3GDOA 4DL9A 4LJ7A 1OXBB 2YDXA 1RHJA 4QFMA 3D02A 4FYJA 3A3YA 4WY2A 4S2EA 5IAKA 4DJEC 1CKEA 4EG6A 4QUIA 3R7SA 3ZX5A 1ZD4A 3W3AA 4UQOA 5K3EA 4X71A 2V7WA 3AQIA 5K8JB 3T9EA 1DRVA 3SYKA 1CR2A 3Q2IA 4JBIA 3NM5A 3NYRA 3KFLA 3QF4A 1K97A 1T91A 1ZU5A 3Q9SA 4H1VA 4MVJA 4N65A 1RJ9B 4PO3X 4YB8A 3OZBA 4BZWA 5ILOA 4CKZA 4L0CA 2AN5A 1F51E 2OY0A 2WIDA 2ZI5A 3G1TA 3IXQA 1X77A 3K0FA 4CL8A 2JFQA 1WRBA 2H8KA 1WW3A 3C3WA 3O3MB 1DUVG 4R7TA 3L0SA 3UTDA 4DCJA 4Z8XA 2XDQB 2ZKIA 2LKDA 3ABRB 1KZ6A 3HRHA 3Q1LA 2O3RA 5DXJA 1DQRA 2XAAA 5IJWA 2XB4A 4JP3A 2OQRA 4JOSA 3ZNPA 1OH8A 1XRNA 1J1ZA 1KC1A 2QTTA 3I2KA 3WYAA 1HT2E 3R3YA 2YJZA 4KREA 1DKNA 1G6OA 3JRNA 3STTA 5HJ5A 5KCMA 1UBMS 3P1JA 2JASA 2VCHA 2DPLA 2P6PA 2Q1YA 2WTAA 1E77A 3CKLA 4HLUA 1F0NA 4KZKA 1K92A 3FOAA 3IURA 1A4UA 2H1VA 2WKPA 4AKIA 4DV5B 1VGRA 2R2AA 3TLZA 1MTOA 2NZJA 1RXVA 2UZ1B 3KKKA 1LW7A 2Y0PA 3K31A 1W1UA 4NIMA 1P2UA 3MCUA 2FGJA 2V03A 3IAXA 1LFAA 1Y63A 1VLVA 4PNZA 4GXTA 4Y6PA 3RUHA 2WICA 3LC1O 3WFIA 5KYYB 1UBRS 5B37A 2NUPA 1VA4A 2XI4A 2DERA 1LEHA 3RANA 3GRYA 1KZ4A 1TU0A 4BFCA 3UJ6A 1MAHA 5E7MA 4WX2B 4AG5A 1LLQA 4PSVA 1U3GA 5ESRA 1CW2B 4JVMA 1AH2A 1G8KA 4OI1A 1OSNA 2H1RA 2QVXX 5TVKA 1AF7A 5IM5A 1T4CA 4MYCA 3RWOA 3TPZA 3VDQA 2JGIA 2XRFA 4MARA 4KYTA 2X1MA 3EVNA 4BO4A 5HWSA 5TPZA 1AMNA 4WACA 1K63A 3B1KA 5LP1A 821PA 3QK7A 1A7UA 1T8UA 2HR1A 2OCBA 1QM5A 4ED9A 1RU3A 1D4AA 2NXEA 2HLDA 4KLCA 2PMWB 2XTMA 3G2QA 1S3SA 3L92A 3WBKA 3IAAA 1E98A 3IVAA 6AT1A 1WCIA 2JFZA 3DQQA 1KQNA 2X5JO 1VJ5A 4DJAA 4WSOA 5BOSB 1GM5A 2HHHB 2CNWA 3B78A 2J7PD 4K6KA 1QK4A 1IMJA 3D8UA 5FWYB 1FUKA 2R4TA 6NULA 1IHXA 1ARZA 5C53B 3UNXA 1XAIA 3F7TA 3W7VA 2CCKA 2HMSA 1AXEA 3F3SA 4GKBA 1EZ1A 3VR5D 4E94A 1TLLA 3AF1A 4IV5A 4RMNA 3LDFA 3N8IA 4GO1A 3JAKB 3RTDA 4GM1A 4UNPA 1B15A 1FLAA 3LC2O 4L8FA 1NVGA 3ADDA 3AR5A 2JFNA 4JLOA 1U1EA 1J22A 1JPVA 1R6UA 5ALQA 5K1ZA 1JTVA 3RAEC 1NJ2A 3VGPA 1RT9A 4EGJA 1E1QA 1QGYA 1IQUA 1NYTA 1RXSA 1PYGA 2GAJA 3HLKA 4MK4A 3P94A 3PF8A 1I3LA 3GJ4A 4XUCA 3ZV7A 4D42A 2V7XA 1YR6A 3HPQA 3BWMA 1JKFA 4O59O 5AOCA 4BVFA 4ID3A 1LTKA 2A9QA 2IEDA 4L3VA 1BMQA 1JDJA 1LH0A 1MRSA 1S8NA 1U90A 3KPYA 3LKDA 1B74A 4TTAA 3RYTC 1ONNA 2A6PA 3F1LA 4DHEA 4ERNA 1C3LA 3EUEA 3C3CA 3D3JA 1A50B 1M1YB 2IPAB 4HNAA 2HUNA 2GM9A 3C3BA 3FGZA 4IYJA 4MKXA 3PNSA 2VSYA 5ED0A 2KI5A 7MHTA 3HXOA 4D0GA 3RUEA 5BMVB 5BPHA 2EBHX 5CVTA 2GNAA 4KXVA 4D92A 1RJEA 3DLBA 3AIMA 1ZJ6A 4OA5A 1RE1A 3BDIA 4XUEA 3HYTA 5ECGC 3PJEA 3HXQA 1YFJA 4ZXPA 4GPEA 4YLYA 1Z9BA 3OQJA 1Q1AA 3QVTA 4GL2A 2Q50A 2WOJA 1KA9H 4E4RA 3T1TA 3UAVA 1XTSA 3U9SA 4N5MA 2O06A 2D8MA 1MZVA 1WKBA 3PUWA 3NEAA 3SX0A 3V9PA 5B64A 2HTEA 5J2TB 3BE5A 3N58A 4MXDA 2PKXA 2P65A 2YHAA 3BK7A 1VL5A 1TYEB 1WS6A 2HHJA 3PRJA 3QTTA 4IHAA 5DWDA 3ZU5A 4JLAA 4DA6A 2ZR8A 4BKQA 1Z36A 4D56A 3UMYA 5JS8A 1JT2A 1QHNA 3BMNB 2OO5A 3KYDA 2WE8A 3OAAD 4O4LB 3ECCA 4X61A 5B4VA 3RRNA 1NA5A 4EFMA 1XMQB 3G2IA 5FULA 1D1PA 1JQEA 1JT9A 1SHZA 2CNLA 2XZLA 4PO8A 3R5FA 2FPGB 1PG0A 3NLLA 4KN8A 4UNQA 3KQLA 4MINA 2ZZNA 2DCMA 3B3FA 1E2NA 4QFDA 3M7IA 4GYKA 4Y2JA 1TZCA 1KWGA 1V8ZA 3H2IA 4QVIA 3M6IA 1SXJD 4YUYA 1H9BA 5MN6A 1FK8A 2XNJA 4OFXA 4IVRA 4HZGA 3H9CA 4PQFA 3T5TA 5ALTA 1W6RA 2W2LA 1R12A 3LBIA 1JA9A 3I2HA 4K1XA 1RNLA 2XAUA 3LYAA 3WBJA 4B7AA 3CE6A 1DELA 1MV8A 1ZNXA 3RS9A 4KXWA 2I65A 5FLXA 2QUKA 3SJZA 2F90A 5IC4A 3GRKA 3LCRA 4LF8B 4EUKA 1QANA 4QHTA 4RVNA 4N82A 3BN3A 3PXGA 4E1BA 1JBQA 1Q1NA 2J0VA 3FJYA 3RHTA 2NSHA 5FNVA 4XE5A 1R5BA 2B8EA 5KAPA 4MCHA 3USZA 4RK6A 5HW0A 1IN5A 3EQZA 3T3HA 1C7QA 5KTNA 3EWIA 3OPYI 2AVNA 5LN1A 3HSSA 4GDMA 4A8PA 2OC4A 2KSQA 3R0QA 4JL8A 5BR4A 1M2NA 2IEAA 4JJGA 1IZZA 1J9ZA 3ABSB 3MUOA 3VC7A 4AG3A 4BECA 2WAMA 5BORA 1GGFA 3EW9A 1LJ8A 2ARKA 2HHAA 1GPWB 3R9XA 3C5VA 1WMSA 1QAQA 2NYVA 3M1AA 5C35A 3VKGA 2PR2A 5DGHA 1CERA 4RHYA 2VTDA 1D2AA 4A6PA 4BMYA 1NBWB 4IINA 1AZTA 1URPA 3EJWA 3U3KA 4C3OB 3EPRA 1NYQA 1K98A 1RYMA 3I3SR 3O4HA 2BSAA 5HOEA 4PNPA 2WTXA 3LFUA 3FVQA 5KVQA 4DQ0A 4LQLA 4XVCA 1GPUA 4C7OB 1YR7A 3IPRA 1Z83A 3BPSA 4G5RA 1JBEA 3EWNA 1O77A 4BUCA 3IIMA 4Q9DA 1NU6A 1RYHA 2OP1A 4TMYA 5A1JA 4DIBA 4B3CA 3GJ5A 1EVYA 2QQEA 3AKCA 1V6CA 3NANA 3NHMA 3QXHA 1P5HA 3FROA 3VMMA 2J9GA 3DE1X 2WTMA 4R8LA 4KR9A 5B3LA 5IT9A 4II3A 4G85A 2HBRA 2PD6A 2YRXA 4YDQA 2KWIA 3C4QA 4J16A 2B6NA 2VLBA 4K6OA 4DEVA 2IF2A 4JP8A 1FZQA 4U2GA 4YNBA 3LAWA 2X7HA 5JYEA 1M6YA 1VYUA 3RIHA 4ARIA 2UYQA 4INPA 4IY1A 1H2ZA 2I4TA 1G8HA 4OUDB 4ZYYA 5KTTA 3QU5A 3LUHA 1EH5A 1P0PA 2JJ1D 3U17A 5HFNA 4PBTA 4YUXA 3FFWA 1P0CA 4EL0A 3C1AA 3AB8A 3KP1A 3OKFA 3OMWA 1L4LA 3LY8A 2FZVA 3H7AA 3Q85A 3V4PB 3WLJA 3CMCO 3R23A 4MGZR 4QYMA 1M5RA 4N12A 3IOCA 3ZHOA 4ESOA 2GAOA 2K2WA 5AHWA 2QSZA 3JQ9C 3JWEA 3TRHA 1BHJA 1CUAA 1KU6A 3DH0A 1QE5A 2R1ZA 4P3XA 2WR8A 2YICA 2OESA 2QTZA 3GA5A 4LJSA 4M36A 3KQHA 2O7RA 4KE8A 4UUAA 1SVMA 3QPWA 5F76A 2XT6A 3SHWA 1T2UA 1ZSVA 2F43A 2HSDA 2JANA 2A5GA 3RWMB 4BMOB 5CFMA 5IFKA 1W59A 3LSYA 3ZJTA 3NIBA 2IS6A 4XIJA 1E7SA 3F9IA 2O2ZA 5CBPB 2QMYA 2ZW9A 1S2NA 2ZRFA 1OV4A 1PZNA 2CY0A 5EJIA 3ZD9A 4EGSA 1YGPA 4O2BB 2D1FA 3GG9A 1N6RA 2B7LA 3L7CA 4N0DA 4Z6KA 1K7FB 5JNUA 2FW9A 1NMSA 3O2SB 1D0IA 4W7HA 2BI4A 4D8UA 1X7XA 5JWHA 5BSEA 2G5CA 5DE3A 3NTRA 1RLJA 4WBNB 1EWVA 4DCSA 4JJFA 2HADA 4G0XA 5KNBD 4FE4A 2MOKA 5BT8A 3TIIA 2MR5A 4IWYA 2F9FA 1ZAYA 3HRKA 4BMPB 4GLBA 4ZC8A 4XIIA 4JB2A 1YHNA 4MYHA 3AVYA 2WYHA 1Q21A 4ESVA 1XX6A 3ROTA 1ITZA 2R68A 3AWDA 3QTBA 2YJGA 3LL7A 1XZEA 3U5TA 1XQYA 1XPOA 1SOAA 1T15A 1ZJ4A 3ACDA 5MDHA 3EXFA 1SU4A 4Z4GA 3DMGA 4W8GA 4PZDA 2VK4A 2FZEA 4JEUA 3PE4A 4DG9A 5BMVF 4UHHA 4G9GA 2W7TA 2B8JA 3CZCA 5AXBA 1R4ZA 4BP9A 3CJQA 1MORA 1U81A 1BVRA 1HTWA 4S1NA 1MGPA 3PC6A 2Q8QA 4EZBA 2C5EA 3W5CA 4LXYA 1NQ5A 4C3UA 5CFZA 2WJ4A 4X84A 3DXFA 1GPH1 4J6EA 5EC8A 4F4UA 4U1RA 3B20A 3MS2A 5I4IA 4NEHB 4U8HA 4DADA 1BA2A 4QXQA 4PZLA 3HU1A 3WRVA 1Y4SA 3OIYA 4A0FA 1BMDA 2E4AA 3ICCA 5AXDA 1UZLA 3OEWA 3G2OA 5J2TF 1JMVA 2Z5VA 4UU8A 2ZXFA 1RSZA 3AG5A 2YJNA 3S5UA 3C1TA 3D8SA 1D2GA 4ZARA 5KQGA 1TMGE 5E4JA 1MKYA 4QJBA 4O4LF 4OD0A 4W5JA 3HFGA 5FTWA 2YOHA 3L49A 2GX6A 2GRJA 2I80A 4EMBA 2AXPA 2C77A 4BJ6A 3QV1A 2QUIA 3L7KA 3I2FA 1MJFA 1P44A 1J21A 2REOA 3FBTA 3IOYA 4NJOA 4JYZA 1CG6A 4JT4A 3ZQ6A 5JS1A 1OV6A 3DDNA 3KDAA 3AR6A 3PQ3A 2G82A 2IDKA 4MUNA 2PWPA 3DHNA 2NYAA 1U2RA 1WWKA 1H1LA 5AM3A 4C76A 1AQUA 5KBYA 4HQNA 2AK3A 3WGYA 5I7SA 3EZYA 3NEJA 4Z3DA 4KQEA 3AF5A 4CG2A 1QBKC 1SVOA 5D87A 4UTRA 2BF4A 1GFZA 3PLAE 3CNQS 3ZHVA 4WXHA 4NZPA 4TV9A 2D0DA 5CFNA 2XVYA 4JI3B 2GILA 2O8FA 4JC0A 1E1DA 3I9JA 3FGNA 3OJXA 4JCCA 4M53A 4FKZA 1W0CA 1I51A 4JC4A 2M1XA 4WXMA 4EFDA 3MWDB 3RFUA 1KPHA 2ODEA 1YCGA 1Q0SA 1F8UA 2PGXA 5LB4A 9ABPA 3HCEA 2R00C 1F20A 1OI3A 1PJQA 2JCBA 3G59A 4LI3X 1UT8A 4B4UA 4EGFA 1BS1A 1L1RA 3RASA 2AJTA 3NGLA 4M37A 4FINA 3HP7A 5AM5A 1G5PA 2PVPA 5TGTA 4Q48A 4NZYA 2A0XA 3F6BX 4IIFA 3VDMA 1YVDA 5H9VA 1DKLA 2VUSA 4UMDA 4YQZA 4AJ9A 4IR7A 4FFPA 5K3BA 3V4SA 1QQBA 1IE3A 1X9HA 5HG0A 1NU8A 3LT0A 5JISA 1PZFA 2HJWA 3Q8XB 2P67A 4NCKA 2PZ8A 3TN7A 3ZY6A 3K05A 3RNOA 5KSWB 4ADSG 3PUHA 1VP9A 4CI9A 1UP6A 2X5KO 3KEFA 4UVDA 2AR0A 3WYCA 1USGA 2G7MC 3FVTA 2VQSA 3HP1A 1MH1A 2ZRMA 1LPBB 3EOBI 4GG1A 3MMNA 4JEIA 3DHVA 4ZT7A 3T3NA 2PS9A 1X1EA 2VDRB 1GAXA 3TM5A 3ZIUA 3THWB 4Z0TA 3T3OA 4UBOA 4YA6A 2IH4A 1ZD9A 4B17A 4R98A 4DABA 4EKNB 4LK3A 4NFSA 1RRPA 3ENQA 1UOQA 4QD3A 4AO8A 4F1KA 3T06B 2XQFA 4BKOA 5A2GA 5HIKA 4MP6A 4LZPA 2NQTA 2P2ZA 5BY2A 1FSPA 3CISA 3KEMA 4EJ0A 1L8AA 3EC2A 4P84A 4C0WA 1HNNA 3PUIA 4WWHA 1QIHA 3IPYA 2HA2A 4EARA 4M46A 2B6HA 1J2RA 2C3YA 1OILA 3LQRA 4BFWA 1IRXA 1MPTA 2O59A 2QRHA 2YFKA 4HPXB 2WSSA 4NNJA 5GGXA 5JHHB 2C95A 2Z5FA 3ENWA 4YJ3B 1X8LA 4OLAA 5JFGA 3C85A 1O5OA 2AOWA 1SIOA 5DV9A 3V7NA 5M7EA 1BS2A 3WWDA 1JPUA 3VHRA 1AD2A 2J0UB 4UD2A 2QMOA 5LR6A 3G8CA 2O9JA 3S2SA 4CG3A 3MJ4A 1DAHA 2NNLD 1SOUA 1PV1A 1U04A 3H3XA 3SNHA 2WUFA 3P0IA 2VP2A 4LW8A 1E2EA 2AXNA 4NMLA 4E5DA 4Q4HB 1JILA 2PX8A 3C3EA 4CM4B 1HEUA 2GI4A 1XTBA 3C5HA 3E23A 1EXDA 5C4IA 2ISSD 5CYGA 4WERA 1EGMB 1E4EA 3MMZA 2XUJA 3MYRA 1TYCA 4RLFA 6ABPA 1N78A 3T52A 1E3LA 3G2KA 2OXEA 3RC7A 3KAQA 3CU5A 1BMFA 1TK2A 1I0LA 4KAJA 3FCUB 2V9ZA 3VZBA 2BFEA 3R40A 1QMPA 3ETGA 1X38A 1XNGA 2IHZA 4JQCA 4W6QA 3HN6A 2ZB4A 4FD2A 1EX6A 2RGCA 4O2BF 4Q24A 1NULA 2CJFA 3AONB 2I6GA 4MS1A 3UVEA 4D96A 4PCUA 1LB1B 3IHKA 4ISCA 3S1AB 5CEJA 1ZVKA 3F7OA 1A04A 1JHVA 4R5HA 2Z3VA 2YW9A 1P3JA 4DJTA 1X7YB 2IZ1A 4MMYB 4ACBA 5C46F 3PCRB 4F2GA 2FN4A 4WBNF 3K6SB 1ZMRA 4EYOA 3KT3A 1NJ5A 4BN0A 1G20A 5FLYA 1HYQA 3KU4A 4X1KA 1D9XA 2CK3A 1QGOA 3SLRA 3EDCA 4RK7A 3MYYA 1W4AA 4RVDA 4NF2A 1GG8A 3U5ZB 1U5BA 3KYIB 3JPWA 4MRRA 2JATA 1A4IA 2EP5A 3MGGA 3OP1A 3QVMA 4FT4A 3SDSA 4BX3A 4KOEC 5ITWA 1ZCJA 3NTOA 5C32A 1TQ4A 4U7DA 3WRXA 1RBZA 2WYUA 4YAUA 5KYKA 1M7HA 3VR4H 3DB1A 1S3IA 4JLUA 2Y2UA 3PE3A 3L6UA 4I08A 1FS5A 2IUUA 4V2IA 5KS2A 2FRDA 3E3MA 1S1MA 1OYOA 2QUAA 2FPMA 2P5UA 2VP3A 1J0AA 2VJKA 2ZJYA 3BQMB 4OEHA 1OVMA 4RJJA 4XJTA 3RVNA 1DARA 1H85A 5DK6A 1AQLA 1E69A 1T2DA 2E7ZA 2OOSA 3M3HA 3SS9X 5C8DA 1JR4A 1WMDA 4FJ0A 1W4CA 2ZSBA 2VFAA 5DGCA 3T9CA 4JKIA 2B5OA 3GUVA 1CS0A 2I67A 3B6KA 4C1BA 1GT6A 3VZRA 2PHZA 3G6WA 3HBFA 4HNRA 4HTAA 1UBKS 2VXBA 1PR6A 4I8IA 2R6HA 1PZGA 4TL9A 4HLDA 1DIHA 4J2HA 5DM60 3KCQA 1BEZA 1N32B 2GTHA 2Q21A 3RAPR 2FRVA 5ELMA 4GDFA 3SR3A 4H6VA 2FOLA 4RF3A 1B93A 4KJZA 5C8ZA 1W5BA 3C7AA 3JWPA 3K6RA 5CPFA 3RJ9A 4JWKA 1KJIA 2YYSA 1AB5A 1UF9A 2GN9A 1TCCA 2BGMA 2CVFA 2FW6A 3HBJA 4HNHA 4DQVA 4G56A 1DAKA 3CVOA 1O95A 1BVYF 3K0CA 1CP3A 4LJLA 2O8EA 4XW2A 1OZAA 3HCRA 4RPLA 3CEPB 1V9LA 2ZROA 2AOTA 3IH5A 5F1PA 1E7MA 3W8DA 5IN4A 3GYBA 4QASA 4XQCA 4DCGA 2GKGA 4FLEA 4AUNA 1HF3A 1GV1A 3QVUA 3T3PB 4AKHA 2PYDA 1GQQA 1AMUA 2EJUA 5K20A 2B4TO 1A8UA 2IEGA 2YHUA 3G0IA 2H48A 3SQMA 5EINA 4LDQA 1P7WA 1IULA 4F21A 3FB4A 3PYMA 1FRZA 2ZTHA 5L45A 3V3KA 3ZJYA 2FEOA 1KDTA 2JVIA 3I9MA 4HDSA 4K0RA 1HETA 1JPJA 4KI7A 3ZHZA 4DT1B 5CD9A 4RELA 4MROA 1BWPA 3MILA 5BR8B 1EFCA 1QONA 3MTBA 4CQNA 5DBHX 4QNMA 4BPBA 3NXSA 4PONA 1GPDG 5D5HA 1VSUA 4G0NA 4J3JA 4WFQA 4EUHA 3HUFA 2OK8A 3CEJA 1KNQA 3ZV4A 1OMOA 3BRWD 4Q3NA 3NHKA 5I3CA 2QX8A 1TGYA 2FRXA 2BFFA 1IMOA 5D3KA 3GFSA 2PUWA 2PNJA 2O1WA 5AUOB 4RSRA 4A1FA 3QWAA 1Z0FA 3WZLA 2G40A 3AVQA 4C6RA 1C14A 2JHFA 5G4LA 2YJ5A 4CMGA 1SOWA 4ZI3A 1NC1A 1YOVB 2ZANA 3DMDA 3QLUC 2FETA 5EMHA 3PEYA 5ITVA 3HJUA 4FNOA 3ZWDA 1K0FA 4QWMA 2A67A 1V11B 5ALOA 5HJ2A 4YP5A 2ZJ4A 3BH7A 4UEWA 3F46A 4N6GA 1JALA 2D06A 3ELYA 4M6WA 2IH5A 4DILA 4K1LA 2E4UA 5BWNA 4UBLA 5FO0A 1G5QA 3OZUA 1V4NA 1X1TA 2DLCX 1PGJA 3VYWA 4WZAA 4DM7A 1FP6A 1UC9A 4LV5B 4LGCA 3P2JA 3BBLA 4RANA 3E1SA 4TM8A 4ZVUA 4C3ZA 3ILXA 1B26A 4LXUA 3R44A 2EIXA 1WCWA 3E2IA 4CCWA 2AT1A 2BPOA 4E2WA 3H8WA 3VH4A 3MXTA 4DBVO 2DWCA 1QO9A 2CL5A 3DVSX 3I05A 4MTLA 4DMFA 5T4FA 5KHOC 1G2PA 1DBRA 1U0HC 3EZ9A 1PW5A 5JUWA 1TJYA 5G0VA 2PD4A 5LLTA 2NSJA 3U80A 3OLQA 4FC7A 3NUQA 1GA4A 2BGLA 4YJ3F 3X2SA 3QKUA 5CXQA 1D04A 1NKSA 2JDIA 4MKFA 5B1YA 1G3UA 1ESMA 2AG8A 4R81A 5TC4A 3BKWA 2WF6A 3BG5A 4NV1A 1E94E 1H4TA 2G1PA 4IMPA 3B6JA 4M0CA 2OFWA 1QZZA 5BWCA 4L6AA 1DTSA 2BFNA 5H81A 1M33A 3R6LA 1KU0A 3WYGA 5HPYB 2EGUA 1LLFA 2IOQA 3VSDA 2GPTA 1AGRA 3K2BA 4FIDA 4PLFA 1GRCA 1YZQA 4EDFA 4ZI7B 3F3KA 1TJ5A 3WYFA 2HLPA 3OF3A 1A9ZA 1JFFA 3FSGA 4LGYA 1CJMA 2WI8A 4RMGA 1OBFO 1FSFA 4F0JA 3Q0TA 4YRAA 4CTNA 2VYFA 3CUSA 1K7XB 4X92A 1U3UA 4WHMA 2ODPA 1QYRA 3F8WA 1MJHA 4RCVA 3GLGA 4BVBA 1CY8A 1Z8NA 4EAAA 1CDEA 2GT1A 3RV4A 4IDPA 5DNAA 3H05A 5FBRB 1DLIA 3OP4A 2AOUA 2W2KA 1MC8A 2R1UA 3WA6A 3B2NA 4IFBA 1DUSA 4K5QA 3VAAA 1Z15A 5KYUA 1C7IA 1L3IA 5AQEA 1D3AA 3TW4A 2HXYA 4CM8A 1O5IA 4IGEA 1DDIA 3BRCA 1T5IA 3Q9LA 3RK4A 3WQBA 4WKPA 3HCDA 2A57A 2G9VA 3IAEA 3O9ZA 1J24A 1N34B 3WK5A 3QHAA 2CUZA 4HH1A 2EVWX 1Y4ZA 4Y9SA 1Y6GA 2DHEA 3H84A 2RG1A 3QOXA 4RV5A 5IMBA 2H2FA 5EGSA 2XODA 4EFKA 3IKMB 3N07A 1XXHA 3ND8A 1Z6QA 1E3JA 2NOAA 4XGNA 3T34A 4B7ZA 2R6GA 3ISTA 5GJBA 3FPFA 3CRW1 2D8AA 2IYRA 3EXEB 4F3KA 4CIDA 4DR5B 2YIVX 2EIHA 1YTUA 2LCFA 3IQFA 4ATNA 1WLSA 1YQEA 1ZYUA 1QDEA 5D2CA 3JYQA 4XPZA 4HMOA 2H07A 5EPOA 2CKDA 3ENZA 3AHGA 3FB1A 1HDYA 1KZYC 2FUG1 2QB5A 2YXPX 3PC4A 5KSOA 2QLMA 5IJ0A 3LCMA 1DQZA 1I7DA 2R86A 1DJQA 4ENQA 1ZN9A 1HOXA 5F7JA 2PEZA 4JZKA 1Q0TA 3WNDA 2VF7A 4QLAA 4C9BA 3FRHA 4J3FA 3HJTA 1PW7A 2ZUCA 3F98A 4TQ9A 5I9MA 1P0QA 4UUPA 2R6ZA 1G9XA 3EEIA 4Q9NA 4A6EA 4TTTS 1GLVA 1SU6A 2OBYA 5DTRA 2E2WA 4OQLA 2G83A 3LPLA 4FZ5A 4OXIA 4RPHA 4G8DA 4YV7A 4GI1A 1U28A 1P2DA 1ZHFA 1Z12A 3HXTA 3PDUA 1OBOA 4KXLA 4DLKA 3RUFA 3A9SA 2ZR9A 1U9JA 2HPAA 4BQOA 1C9MA 2Q5HA 2DY1A 3F6CA 3JV7A 3OTHA 1ZVMA 3NHBA 4OX9B 4KPUA 4ZREA 2P0AA 1HWYA 1KVTA 3CH6A 3H9BA 3DKPA 2MR6A 3IP8A 4IIJB 4V0MA 4CTJA 2H06A 3I6BA 1Y5RA 4A0GA 4WDRA 4ZJYA 4GRIA 1VDZA 1H3FA 4PLPA 4I9UA 4C4ZA 4ZCTA 2XKAA 2XUGA 3N2GB 4KRXA 1VCNA 4HXFB 4U2DA 3FUUA 3VKWA 4C0LA 4RE5A 4CR8A 3KZVA 3OFSA 4ZV9A 1Q44A 1ZRNA 3UMFA 2QZPA 2RHOA 2QK4A 5KOIA 2LTAA 2RGYA 1V96A 3NRBA 5E6UA 3A6EA 1TM3E 5K03A 4PGMA 2C88A 2OG1A 3LXXA 1OHHD 1T5BA 5CW1A 1KRXA 2QG6A 1X7ZB 3Q72A 4NBNA 3G1UA 5D84A 5EESA 1H0KA 5KUTA 3PHLA 1GXSB 4MVJE 3VX3A 2HBYA 3UG7A 1R50A 1Q7GA 5IX8A 1YMUA 2MTBA 3TLXA 1II8A 2CNBA 2BY4A 1JA0A 4MGYR 3WKAA 1AXRA 3DW1X 4EA9A 3MQ2A 4YRLA 1EFPA 1R0WA 3MCTA 4ZIRA 5I8ZA 4DLBA 1O8BA 4IEIA 1S7CA 4L9RA 4B75A 4IH1A 3R77A 1SC6A 4IL5A 1NASA 2QRZA 4URXR 5DGTA 1AV6A 5IXYA 3O7WA 2IS2A 3CLSC 2EZ4A 4LUCA 1GN9A 2I8CA 2GWHA 2Q62A 4R3NA 1U94A 1VPVA 1GTG1 1GITA 3FWZA 4XWAA 3WJ2A 4D44A 5AJWA 3ZKWA 4HQLA 2W71A 1TT5A 1QB7A 1T8TA 2WIAA 3HKEB 4HB2A 4PSDA 3R7NA 4OLHA 4FHFA 1ACJA 1U7OA 4RPCA 1C8VB 2Y1DA 1N57A 1KZ1A 4RZSA 4DSZA 4DV3B 2OUIA 1M1NB 3A2NA 3TLJA 1KMMA 2FEXA 3UMJA 4D9KA 5LU8A 1HL7A 3JYPA 3SC4A 4W99A 1RQXA 5A4IS 1OB5A 4LFAB 4QKQA 1FW8A 3SOZA 2C3OA 3T3EA 5U9CA 2CMKA 5LZ2A 2PQ6A 1TEVA 5B3JC 3LW7A 4ML3A 1B00A 1TTHA 3G0OA 5JNTA 3CB4A 1L6RA 3HU5A 2G4CA 2VPPA 1A76A 4KNWA 2ADMA 4NCXA 3S3TA 4DV7B 1CUFA 2HSEA 1ZHOA 2QMUA 3DYIA 4D99A 5LM3A 2VWQA 5TQ0B 3OQHA 5BSRA 2J3KA 2G25A 4DM4A 4EHDA 1JXQA 1TPYA 5HQTA 3JD0A 4HUJA 3IS3A 2GFQA 1B1CA 2HREA 4NU5A 3W7AA 2IPXA 1MZPA 3IUYA 5FR1A 4OQPA 1TAUA 1NATA