4WDRA

Crystal structure of haloalkane dehalogenase linb 140a+143l+177w+211l mutant (linb86) from sphingobium japonicum ut26
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
293
structure length
293
Chain Sequence
b'GAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAIAMPIEAADLPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGWILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQLPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGALTTGRMRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloalkane dehalogenase
publication title Crystal structure of haloalkane dehalogenase LinB mutant (L177W) from Sphingobium japonicum UT26
doi rcsb
source organism Sphingobium japonicum ut26s
molecule tags Hydrolase
total genus 107
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2014-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4wdrA00
3KWJA 3E1GA 1WHTA 1ODCA 4C87A 4DMCA 4B0OA 2XQKA 4B9EA 4AO6A 4EUSA 4FWBA 5AM5A 4QDXA 3W04A 1QO7A 4E46A 1AQLA 1XRPA 3W06A 2QUBA 3WK6A 3G0CA 1AURA 3FLEA 1ISPA 3F9CA 3MUOA 5C8VA 4BATA 1WOMA 4W1RA 4OSEA 3G02A 4HXEB 4Q3LA 1XKTA 1ZGCA 3DEAA 1CVLA 3V1LA 4G9EA 3DL4A 1O6GA 3CCBA 2Y6VA 3QZUA 3FYUC 4AZ0A 4BRZA 1BRTA 3DNMA 1CUXA 5KREA 4RNCA 4U2CA 2XMCA 4FHZA 4A16A 3LLCA 4O08A 1IUPA 2Z8ZA 1THTA 4Y2JA 4AX4A 4QLOA 3GFFA 3ZLUA 4U2BA 1CUFA 1CQZA 2VT7A 1MPXA 2XI4A 1G4HA 4U2DA 1ZJ5A 5AKGA 3Q0TA 1RP1A 3QITA 3WK7A 1IZ8A 5T4BA 2AJBA 4GEGA 5ALUA 3D2AA 4UBKA 4X00A 4UBNA 1Y7HA 5FKJA 3EQ7A 4OCZA 4ARBA 3NOXA 3R3ZA 1PFQA 2P8SA 3IB3A 1C7IA 3FVTA 1MX1A 7YASA 2ROQA 4OYLA 2QXTA 1R88A 2DHEA 3MGAA 2GZRA 3IULA 1XZIA 1KEZA 4P9NA 3AFIA 2CMFA 3M83A 4F0JA 4DNFA 4H7HA 1BN6A 5HQ3B 5JD6A 5AM4A 3F96A 5JALA 3OM8A 2QMQA 1XFDA 4OU5A 1MT3A 1HKHA 2XUFA 5AK3A 4FLFA 5EIHA 3R3WA 2CEKA 2WUGA 1USWA 1LPBB 2XUAA 1GKKA 1GQRA 1Q84A 2OAGA 4J0GA 1DINA 2HHAA 4CIAA 3W2TA 1DX4A 3H2IA 1KU0A 1NX9A 3VJKA 1CUIA 5HQ3A 1VE6A 1AX9A 4FBLA 4PNZA 1MAHA 5FPPA 4M0EA 3YASA 3AUKA 4QDTA 4GWLA 4CCWA 5CT8A 1U8EA 2XE4A 5CURA 4FFVA 3GBSA 4KACA 2WUFA 5LZ7A 2HADA 3IUMA 2DR0A 1CPYA 3B5EA 1J07A 4WFKA 1W1IA 4LIPD 1ZD2P 3EIOA 3I6YA 5ALVA 3AZQA 3BWXA 3QVMA 2OGSA 5ALXA 4INZA 3O95A 5HF8A 4WY5A 3R40A 2PBLA 2QR5A 1A7UA 4WJLA 4B82A 1W4LA 5HKBA 2YASA 4Q05A 4G4JA 2AXEA 4AMZA 3G7NA 4XX1A 3PICA 5AM2A 4L9AA 4H77A 2PKYX 3V1MA 5JARA 2QUAA 4PSCA 2Z5GA 5AO9A 2WJ3A 3AINA 1J06A 2H7XA 4C88A 3D2CA 2HA6A 3F97A 1LPNA 5AOBA 4DIUA 3VJLA 4ARAA 2ZJFA 2XDWA 2JGFA 3R3YA 2RGUA 4HZGA 4YK7A 3IUQA 4CFSA 4EB0A 4NS4A 4H7DA 1EVQA 1HPLA 4FMPA 5YASA 3K6KA 3FOBA 4XVCA 4BP9A 3E3AA 2EEPA 1DWPA 3R0VA 5ALFA 4DLNA 2QTBA 3B12A 1DT5A 5JADA 1NU8A 1QIHA 4TGLA 2WIGA 3FBWA 1GKLA 6YASA 4D9JA 3PFCA 4J03A 4H7JA 1SCIA 4G4IA 5J3JA 3FYTA 3C6ZA 4Y9SA 1IZ7A 1CUEA 5HK8A 2HA5A 3STUA 4UUQA 3ZLVA 2ACEA 1MNAA 1ORVA 3WQHA 2VQ6A 5E4YA 1L7RA 4JEIA 4J0JA 4H18A 1HLGA 1L7QA 3LIIA 2OPHA 1E89A 5CT6A 1LGYA 2H9YA 1YCDA 3OURA 3S2ZA 2QOEA 1XQXA 3ESBA 3DQZA 3WL5A 3I2GA 1RWQA 4I19A 1XLVA 4UHDA 2QS9A 4FBMA 5ALZA 4Q3KA 1GPLA 1TIBA 2WU4A 3NUZA 5HKAA 1FJ2A 2WUEA 3IVMA 1WM1A 3HSSA 4AN1A 3D0KA 2HFKA 2WIFA 3Q8WA 2YXPX 4IH1A 1P0IA 5CH8A 2PU5A 3EF3A 5F4ZA 4JYMA 3IBTA 1EH5A 1YASA 5ALTA 3SWWA 1K8QA 3WZLA 5DYTA 1UOOA 2CKMA 5BV7A 3G9UA 5JANA 3B3QA 4X71A 1ETHA 3WJ1A 2WG1A 3ANSA 4N8SA 4G8BA 4ZV7A 4GXNA 4EY6A 4UBLA 1U65A 2B9VA 3O4HA 3G0IA 1K6EA 4EZIA 1AGYA 3C5VA 4TPKA 2RHWA 5HF6A 2CJPA 5AM3A 1TRHA 2DQYA 3DD5A 3DKKA 4GW3A 5ALWA 2C5FA 2OGTA 1XZMA 3ZLTA 5A2GA 3I28A 1JI3A 3N2ZB 1ZI8A 1H2XA 5A7HA 2PUJA 5AP9A 5AK5A 3FVRA 3DL7A 2RONA 3V1KA 4WFIA 4FFWA 3UUFA 3FLAA 4WFJA 4CG1A 1NU6A 1A8QA 1UKAA 3WWCA 4BAZA 2LIPA 1MNQA 5D7BA 2AJLI 2ZYIA 1GXSA 3R41A 1G42A 4BVKA 1QLWA 5BWBA 3QYJA 4Y7DA 5HFNA 2ZSHA 3A6ZA 1CEXA 1ACLA 1XZAA 3HXKA 4L72A 1BE0A 3C43A 3QH4A 1EDDA 1VXRA 2WHPA 4B9AA 5D3ZA 1UOPA 1WCYA 2DQZA 2OLEA 2PSDA 1RYYA 3M3DA 2WFZA 5JAHA 5EHXA 4W1SA 3O4GA 4LHEA 2Y6UA 1XZHA 4J0HA 4UFPA 5AKXA 1ODSA 5T4FA 3WKEA 3HABA 2V9ZA 2EDCA 3LIPA 1HDEA 5FP0A 4Y2RA 2HIHA 1H2WA 2JGKA 1GT6A 1MX9A 4HVTA 5CH3A 5EGNA 2HA4A 3DJYA 4KEAA 1YAJA 5ISMA 4QE3A 3CN9A 4AQDA 2PSJA 2D5LA 5LZ8A 3LCRA 1XQVA 4UHHA 1CUWA 5ALJA 1YA8A 1Q0RA 3ZI7A 3G9XA 2WILA 2RI6A 4WY8A 3WWEA 4N8EA 2QJRA 2XB6A 4ZREA 1XZKA 4UFOA 5I7UA 1VE7A 4FLEA 2J4CA 1VOTA 3O0DA 2ES4A 3AIKA 2XUJA 2XUOA 4WDRA 1HQDA 3WKBA 4L0CA 5JZBA 2VJAA 4F5ZA 2HRRA 4HXFB 3HACA 1IUNA 1W76A 3A2LA 4PF1A 5LZ5A 4HXGA 2ONCA 1LZKA 3G0DA 2BAGA 4OB6A 1JJIA 4OD0A 1JJFA 2WJ6A 4IH4A 4KRYA 4Y2TA 1QFMA 3S8YA 5AKLA 1H2ZA 4X95A 2BCEA 2BUCA 2JGMA 2J3DA 3WWOA 2VJDA 3HJUA 1F6WA 2BJHA 1ZD5A 2ZVDA 3ESDA 3V48A 3WKCA 1MN6A 1VA4A 4EHBA 4I3FA 1LBTA 4W1QA 4MQLA 2R8BA 2XQJA 5AKEA 5E2IA 4QEKA 5EHNA 5CTAA 1Z68A 4X6UA 4CG3A 2VJCA 4X97A 4IO0A 2XQGA 4PV7A 2JGIA 4X94A 1B41A 2GBFA 2PL5A 3L1HA 3FWHA 2ZJ7A 5ALIA 1LPOA 2XLBA 2Y1KA 4MXDA 2WTNA 1IMJA 1MU0A 2HA2A 1CUVA 1TK3A 4ZI5A 1I6WA 1N5MA 2Z3ZA 4N8DA 5AIBA 3KWFA 2BFNA 2UZ0A 3TEJA 1XKLA 3AZPA 4J3JA 3VKFA 4C4YA 2ZYRA 3I2JA 1AUOA 3I2HA 4RGYA 1YS1X 3D5EA 3HZOA 2ZYSA 3WA6A 1WPXA 1HBJA 1CUHA 2GYUA 2WQZA 3O9VA 5C81A 4A5SA 2XT0A 5ALNA 1LPPA 5AI0A 1BU8A 3O9MA 2IITA 4B85A 3X3HA 1N8SA 2WG0A 4UHBA 4BZZA 3O4JA 5AK4A 4Q34A 2WUDA 1QIMA 1H2YA 2CUTA 1Q83A 1J2EA 4DMKA 1MAAA 2HRQA 4FNMA 1ODTC 3QPDA 2D0DA 2VJBA 4NZZA 3PF8A 4HRXA 1E8MA 2YH2A 3PUIA 4H35A 4Q3OA 4UHEA 3QMVA 2X8BA 5FV4A 4X3CA 1XLWA 2Z8XA 2I03A 2QM0A 4HRYA 5DNWA 3QBJA 2BUAA 1ORWA 3VISA 3VVLA 4E14A 1K5PA 4BBZA 4K5QA 5FPQA 4Q1VA 4BDSA 4QDOA 1QFSA 3C8HA 2XUPA 1LBSA 2HDWA 1ZOIA 4L3WA 1IVYA 5CW2A 1K4YA 5LZ2A 1CUBA 2WJ4A 3I2IA 5EFZA 1ACJA 3U0VA 1XROA 4C89A 4QDUA 1VKHA 1TKRA 2RIPA 4IQ4A 4KAFA 2JF0A 4P93A 1JFRA 1EX9A 3E0XA 4AZ3A 2VEOA 5EIEA 2HA0A 5EHQA 4QZVA 3BJMA 1ZI6A 3GROA 3PI6A 5E4TA 5JASA 1THGA 3OG9A 4BC0A 4N5HX 2H1IA 2IX9A 4J7AA 1EDBA 2AJDA 1L7AA 5JAOA 3WIBA 1QIDA 3C6XA 4DTCA 2OCGA 2GBIA 4QA9A 3VDXA 1JKMA 5E4JA 2HA3A 5AH0A 5A7FA 3GA7A 3L1JA 2PUHA 1UZAA 4BCCA 3WZMA 5T4HA 4EY7A 2C7BA 3G9ZA 1XZFA 4BE4A 2NW6A 5FOQA 5JAPA 4DYHA 3RK4A 5C8ZA 3F98A 1UFOA 1AMNA 2X76A 4NMWA 2B20A 4KJXA 2VATA 5K3DA 2XQFA 5I8PA 4BAUA 3MUNA 5AKKA 2XLCA 4BC1A 4NVRA 4WCVA 1Q0ZA 3IURA 5EI5A 4DNPA 4XJVA 3I2FA 5FDFA 5DYWA 4K2AA 1BS9A 4OU4A 1EHYA 2XUIA 2I78A 3WL8A 5SYNA 4UFNA 2PPLA 3DOIA 4BCBA 5IVDA 3KSRA 3H2KA 1VLQA 4QLAA 1CUUA 5LP1A 3HC7A 5EHZA 2QKYA 2XUHA 2GBCA 3KXPA 1A8SA 2GYWA 2W6CX 3QPCA 4BAGA 2PSHA 3NGMA 1DWQA 5HCUA 1AZWA 2C4HA 1E5TA 3EBLA 3UMJA 3G9TA 1BEZA 1N5RA 1EI9A 3LS2A 4OB8A 4W9RA 2YYSA 5D6OA 4LXHA 5ALPA 5ALYA 2B61A 1UK8A 1A8UA 3LP5A 2ZYHA 4DSAA 3OC0A 2XMQA 2ZJ6A 2G5PA 1YS2X 1CUAA 5K3CA 5ALOA 3OOSA 5AKJA 5IVKA 2WFMA 1HL7A 1R1DA 2CB9A 4LYDA 3H18A 5K3FB 1CUGA 4HS9A 1EB9A 3STVA 3CXUA 1EK2A 4TVKA 3WYDA 1BROA 1QIEA 4GDMA 2IIVA 3WK8A 2C5GA 1C4XA 1EXWA 1TQHA 3KOOA 4OUKX 1ZD3A 2XUGA 3I2KA 3STWA 5DWDA 5HF9A 1FSSA 1TCAA 5DYYA 1O6FA 2WU3A 2WHRA 1JU3A 3DKRA 3I1YA 2BGNA 1WB6A 4K6GA 3D7RA 2C58A 3QMMA 5LIPA 2JEYA 5SYMA 5FRDA 5K3FA 5IVHA 4MJ3A 4Y2XA 2GBGA 2WIKA 3ED1A 1LNSA 4E15A 1JMKC 3BIXA 2AJCA 2PVSA 3WMRA 2DCMA 2VA9A 2WHPB 1IUOA 3A2NA 3WLAA 4KE8A 4V2IA 4M0MA 2QJWA 3DOHA 4RE5A 2HA7A 1D07A 4C6HA 1G66A 3BL8A 2HM7A 4J0KA 5DTJA 3R3UA 3STYA 3TRDA 1MTZA 5HFAA 2OCIA 3STXA 5EIAA 4Y2SA 1QONA 5KWIA 5AOAA 4BVJA 1J1IA 1XRLA 5LKRA 5AKYA 5ALMA 2JGJA 4IH9A 1F0NA 1XZLA 3M82A 2V98A 5BWCA 3A70A 2XUDA 5CBKA 4PW0A 3W05A 1EVEA 4U2EA 1E66A 4BTVA 1U2EA 3GZJA 5A71A 1ZICA 4OB7A 3PFBA 1W6RA 4Y2VA 2XMDA 3SX4A 1DQZA 5T4EA 5DJ5A 5JZSA 5LLSA 5FXMA 4Y2YA 5ALRA 2ECFA 1QGED 5AJHA 5A6VA 1R9NA 1E8DA 2I3DA 4PQEA 3ICWA 4K6HA 5IKXA 5KWJA 1H22A 5H3HA 4BRSA 4UBJA 3G0BA 4FNGA 3K2IA 4CCYB 2VAXA 3U1TA 4FOLA 3ZPXA 1FFCA 3V9AA 1VA5A 4LXIA 4KRXA 1VXOA 3JYHA 4GHWA 4FDMA 1E8NA 2VT6A 1WHSA 1QIJA 2BGRA 4Q82A 1XRNA 2CBGA 3QMWA 2JEZA 1C7JA 3T52A 1R9MA 4DMHA 4H7KA 1BCRA 1YAHA 1QIGA 4BZWA 5AM0A 3ESAA 3WJ2A 5FUMA 4CCYA 2QVBA 3C87A 5HZGA 5AI4A 1E3QA 1CUZA 1OXMA 4W1PA 2AJ8A 3WI7A 2FUKA 1EK1A 3ANTA 5JAUA 3DCNA 3W9BA 2G63A 2ZSIA 3R3XA 1G5FA 5AK6A 2XMGA 1JMYA 3AIMA 2OQIA 4JYPA 3SK0A 3KD2A 3C6BA 2OQVA 5AM1A 4A23A 5IH7A 1BCSA 1YB6A 5BOVA 3M81A 2PSEA 1QIIA 1YSCA 5ALSA 4ITVA 5KBYA 4KAAA 3AILA 3D2BA 1PV1A 4MYDA 2V97A 4Y2PA 2X5XA 3IDAA 1ZIYA 2H7YA 4X90A 1KU6A 5ALQA 2XMBA 4KE7A 1M33A 2O7VA 4BCDA 1EINA 5JIBA 2ACKA 1FFEA 4KAJA 2O2GA 3GUUA 2HU8A 1R3DA 1CIJA 4XWGA 2FJ0A 3ICVA 5JATA 2OG1A 1AC5A 3HI4A 5AIAA 3RARA 4J0CA 3MVEA 4GBGA 5CH5A 5DNUA 4MQMA 1LPAB 4DSZA 1QTRA 1Y37A 1UK6A 1VJ5A 3BE8A 4ROTA 2JIDA 1LPSA 1N1MA 3ZWQA 1CUYA 5CT5A 5JZ9A 2HU5A 2WIJA 3I6MA 3H1AA 1SFRA 2C0QA 1MX5A 4JNCA 4Y2UA 2RAUA 3C5WP 2HL6A 2WFLB 3FCYA 3NWOA 4BYMA 3HLKA 2B4KA 2ORYA 3FLBA 2WHQA 1DQYA 4QWWA 1QIKA 1DT3A 2QZPA 5CXUA 1DX6A 5DLPA 4YPVA 5AKZA 2WG2A 3EQ8A 4B81A 1WPRA 4AXBA 5I9IA 2V96A 4FTWA 4BVLA 4B6GA 4EY8A 2GYVA 3N0TA 3IA2A 1GGVA 1GPNA 4CG2A 2WFLA 2O2HA 3VJMA 3L1IA 3CCCA 4AN0A 3R3VA 4G1FA 1SOMA 1GQSA 5CXXA 4HTAA 2VAVA 2WTMA 1WB5A 5AI9A 5AOCA 1TCCA 1CUJA 1K63A 1ZIXA 2Z3WA 1FFBA 3WL7A 1QJ4A 2QT9A 2VSQA 3HEAA 1XZEA 4PSDA 2J4FA 4FKBA 3IIIA 1UKCA 5ESRA 4DM7A 3JW8A 1A88A 4H7EA 4B7ZA 2RHTA 2G4LA 1DU4A 1BEEA 3DYIA 4RE6A 1W52X 5AKHA 2QXUA 3QPAA 1XZDA 5ALLA 3WK9A 2VTVA 4UBOA 5AKIA 3DLTA 3EQ9A 5D3KA 1GPKA 4BE9A 4KR0A 4DMFA 1SCKA 4X92A 2Y2UA 2Q0XA 4DNOA 4GLBA 4AMYA 2HFJA 2WLSA 4FLMA 1ZJ4A 1Y7IA 1X70A 3BF7A 3O4IA 5DTIA 2WSLA 4G8CA 4F21A 3SC2A 3E4DA 4UHFA 4LYEA 4YX9A 1QZ3A 2BKLA 1CR6A 1CQWA 1MJ5A 2JBWA 1QO9A 2J3QA 2PX6A 4BDTA 3HYSA 3C8DA 3WA7A 4B0PA 3ESCA 2O2IA 5ALKA 2PU7A 3FSGD 5AI8A 1UT6A 3RLIA 2OGZA 3I1IA 4B84A 4G5XA 2G5TA 4MEAA 3HRHA 3BF8A 3DDUA 4QNNA 3C45A 3W9UA 3JWEA 3WWPA 1UK9A 5LKAA 4HAIA 3H17A 3WIOA 2I3ZA 1FFDA 5A7GA 3F67A 4JH0A 1OILA 4KE6A 1CV2A 3H19A 4ZXFA 5K5EA 1EB8A 1ZD4A 3AIOA 3FNBA 1F8UA 2OXEA 5K3AA 5JYCA 3F8SA 1CUDA 1B6GA 3H2JA 1ZI9A 3GELA 1DWOA 5K3BA 1SC9A 2BUBA 3DS8A 4LKOA 1XLUA 4IHAA 3P2MA 5HF5A 4AB1A 1X2EA 3H0CA 4B83A 4ETWA 3DYVA 1UKBA 4DNQA 4MWTA 4S0XA 2DHDA 3H04A 1XQWA 4MYSA 5C8XA 4QWMA 2XUQA 4H7IA 4P08A 2EDAA 2O7RA 2XMSA 3AJAA 4H7FA 4JUIA 1SCQA 3CN7A 3FSGA 1XZGA 3PDCA 4UHCA 4EY4A 1JJBA 3C6YA 3OPMA 4G9GA 4QDZA 5ALEA 1DTEA 4AO7A 4C01A 3A2MA 2JGLA 1XRRA 5LZ4A 1FFAA 4ZGBA 1JU4A 4UBIA 3H2GA 3AZOA 1VZ2A 1LPMA 5CMLA 2K2QB 3QM1A 4F60A 5IVIA 4GECA 4C4XA 3TJMA 2QRUA 1XZJA 4Z49A 4RPCA 2DFPA 1EA5A 2FJPA 5LZ9A 2W22A 4KE9A 1QIFA 3WK4A 1QE3A 1QOZA 1F0PA 4ZV9A 3WWDA 2FX5A 4M0FA 3IUJA 4YASA 2CZQA 4P92A 2HU7A 5LYYA 1WB4A 5AI5A 3VVMA 3H1BA 4GI1A 3RKSA 3FAKA 3C70A 4ZRDA 1ZGBA 1LLFA 2XUKA 4BB0A 4LXGA 4X85A 3VXKA 2DHCA 5AI6A 3BJRA 1BN7A 3TGLA 4PSUA 1YA4A 1H23A 1MO2A 3PUHA 2PM8A 2Y2VA 5CT9A 3BIWA 3D3NA 2DSNA 1UOQA 4H0CA 4U2FA 1P0QA 3PF9A 2WKWA 2E3JA 2PSFA 4WDQA 5CT4A 4U2GA 5JD4A 4C4ZA 4E11A 2GZSA 3RM3A 1XQYA 2R11A 3K9BA 3ILSA 1QTIA 4CIBA 4CI9A 1XRMA 3D4LA 3WKAA 2XQIA 4G4GA 4AO8A 1U4NA 3BDIA 1TCBA 4DGQA 3BXPA 1UWCA 4N5IX 1EDEA 1S8OA 4X91A 5ALGA 1CUSA 1OCEA 2OCLA 2OAEA 1VZ3A 1T4MA 4J0IA 5ALDA 5AHXA 4UPDA 1R4ZA 4J0DA 3IUNA 3H2HA 5HK9A 5C7YA 3STTA 4Y2QA 1UK7A 4X6YA 3D59A 1PJAA 1X2BA 4B80A 1CUCA 4XIIA 3ZV7A 1YB7A 5K3EA 3BDVA 5AICA 4EY5A 3OTQA 3PE6A 5FLKA 2C0PA 5CRIA 4K6KA 3I6ZA 4I4CA 3WKDA 4MWSA 4MEBA 3WL6A 4G8DA 3FYUB 1AKNA 1XZBA 5DNVA 4UBMA 1P0PA 4OPMA 1YR2A 1T2NA 1XZCA 4BTLA 4W63A 3WYNA 4KYVA 1W75A 1R50A 3FCXA 2WM2A 4ZWNA 4EA6A 4X6XA 1CFJA 3WK5A 1CLEA 3UUEA 1P0MA 2WIDA 1GZ7A 3FYUA 1CRLA 4X7BA 4EBBA 5JD5A 2XMZA 1UXOA 4PO3X 3G8YA 1LZLA 2VF2A 3G0GA 2XMRA 5ALHA 1TAHA 4OYYA 1JT2A 3KDAA 3T4UA 3V1NA 2OCKA 4BP8A 1XRQA 2JGEA 2H7CA 5A62A 4X93A
chains in the Genus database with same CATH superfamily
2XZLA 1UXIA 5DASA 4CF7A 1H65A 4GP6A 3VKGA 1KI9A 1JHZA 1WHTA 1ODCA 1SBTA 2JD1A 3PPYA 1DXHA 2JFVA 2D0PB 4QRHA 3M9WA 4X24A 3ZBTA 2XQKA 1O94D 3C0KA 5DH9A 4B9EA 3FPBA 4AO6A 1ODJA 3SZOA 2OILA 2J9GA 4DQDA 4AZ0B 721PA 4MDEA 3Q6IA 3TPCA 3G2OA 1AQLA 1PU2A 4ANFA 1L9XA 3GRCA 2XGJA 3W06A 4Y6QA 5CCDA 5IYZB 2ZPTX 3FCCA 4TTVA 1AURA 1F4LA 1Z5PA 1Y3IA 3FLEA 3JALA 4ND8A 1ISPA 5K05A 2J3IA 5CDFA 4AMGA 1ZOLA 3WC4A 2XODA 4US1R 2HW8A 1QP7A 1W94A 1KMHB 2VNSA 3CSDA 1WOMA 1T9CA 1XQ6A 1TTPB 2QSUA 4QULA 1JDSA 2ZIFA 4LZPA 2ZSAA 4LRQA 2HTFA 3D6FA 2D0IA 1XKTA 1ZGCA 1GU1A 1J97A 1TVMA 4BMZA 3B2QA 1VG8A 1S8FA 3IODA 1ZSYA 3V1LA 5KJFA 2G17A 1V3TA 1O6GA 5KJ1A 1PJ4A 1LXCA 2ATEA 4CNBA 1F8YA 1U81A 3NB0A 1L4MA 1I01A 1D4ZA 3IOEA 2WFAA 3NIGB 4PQRA 4R2IA 1LUAA 4BO5A 1UANA 3OZIA 4E0BA 1V95A 3HH8A 4MUYA 3NEPX 4Z5XA 4UAVA 1BRTA 3S29A 2BP7B 5BV0A 1TVKA 4KLAA 1C2TA 1PZXA 1JT9A 4EGCB 4U2CA 1QO0D 3M7IA 1E7WA 2XMCA 4ID9A 5F5XA 2P9HA 4FC6A 1X3SA 1J2JA 1NI4A 3CNOA 4CIXA 3KBOA 2JHAA 2A0KA 5TEWA 4DDTA 1A4XA 1L4FA 4LECA 3LLCA 4D8TA 2IHNA 3NHSA 4QJ5A 3OPYA 4MQ6A 2GAJA 5IDXA 4BMDA 1VSVA 4GLLA 2QN9A 4PYLA 4TRRA 1JXOA 2FTKE 5CYFA 1KA9H 3R7DA 2GN8A 1IC6A 3GFFA 1NFQA 3OQIA 4YONB 4LF8B 4DCPA 3TL3A 4PO1A 3TTVA 1CUFA 3IC5A 2CFSA 1O97C 4PC1A 4BBJA 1FNSA 1LDYA 3ADCA 2OHOA 3P4YA 1ZJZA 1QF9A 1KQFA 2NP7A 3GUCA 2QTMA 3UWSA 4PNEA 1MPXA 3FIUA 2X0FA 4INJA 4MQFA 2JDID 3ONVA 4ZEVA 2UYCA 4K87A 5FTMA 1ID8A 2VQDA 4YWJA 4CM1A 1UAYA 4KR7A 3EXEB 4KXWA 1ZJ5A 3P94A 4NDNE 4R81A 4RQTA 4Q9HA 5IH3A 4ALKA 2PUGA 5JJLA 1H2EA 3QITA 3TK1A 1M72A 1PV2A 1IZ8A 3O4VA 5T4BA 4IO1A 3Q85A 4KFTA 3TSOA 5CVVA 1EFTA 2FN4A 3PYMA 1JG7A 1NZDA 4FR5A 4D25A 2A5JA 3CNHA 2FKNA 3SIWA 1Z4JA 4L4YA 1FQJA 4EKNB 4CHGA 2Z9DA 4TQ9A 2FR1A 4WPGA 2XEDA 4UBNA 5KQLA 2OB2A 5AW1A 2R6DA 1K88A 1VIVA 1Y7HA 2UUPA 5FKJA 4OCZA 4I4TB 1RVDA 1ZHOA 4ZOEA 3ROZA 2DFLA 5BN4B 5K6RA 1GZHB 3TPFA 3OHPA 5MHTA 1AXEA 3WRXA 1PO7A 3FFBA 5IDQA 2WBLC 3OIVA 2YWDA 1J8MF 3HA3A 2NO1A 2WMYA 1C7IA 2CXUA 2KMLA 3FVTA 1Q3HA 5KTNA 4XJXA 4YBRA 1J7KA 3CR8A 3MGAA 3CUTA 5DM2A 1RBMA 4US0R 3TR5A 4IOLA 5AW8A 3FF1A 1XZIA 5TMPA 1F8GA 1Z39A 4HXYA 5U4QA 3NKLA 2ENWA 1JHRA 2E85A 4L6IA 2BVNA 1KEZA 4U7WA 4HOYA 1ZN2A 4F0JA 1DJQA 4Z8YA 2IA5A 4UMVA 1RCFA 3OLVA 3U61B 3OQBA 4ZO4A 3UB3A 1XVAA 1EUCA 5JD6A 1MC4A 5AM4A 4X7PA 2BH9A 2DP4E 3OM8A 4Z3KA 2PPVA 3I64A 2V9PA 3KQLA 3WMXA 3I32A 3THXA 4JOBA 2XUFA 2BFBA 3LX6A 5LB4A 3WSWA 5BW4A 2C00A 3RUPA 1N6LA 4ND2A 5K0BA 2JLAA 3K9WA 4RDCA 3WX0A 3WLKX 3P27A 3R3WA 3PL1A 1F4PA 2R65A 1SOWA 2QM8A 3O1IC 1D2MA 1NMQA 3CEAA 1CQJB 4RNDB 3TX6A 1IZYA 2P5TB 1GKKA 1KDPA 2I1WA 3PFWO 4C07A 1LH0A 4GWKA 1Q84A 3W5UA 1E1KA 1P45A 1QGAA 4J0GA 4DHEA 1E5VA 1BHO1 1I7SB 1DINA 1Z62A 3OPXA 4JVSB 2C03A 3KZCA 4CIAA 5J1SB 2B1QA 1EX1A 4DVGA 1N3IA 5FBZA 1Y3CE 3GMIA 4FFNA 5FWAA 4BO9A 4DCSA 1NVMB 3HKDB 4ZDIA 4LXUA 2WB2A 1YVPA 4HFNA 2WY2D 4MVXA 3LVBA 3JQQA 4URFA 4YS6A 3TMAA 2VUSA 2I99A 3C3AA 3LOUA 1YIDA 4QDTA 1NW5A 1YHZA 3DMYA 3UAZA 1PHPA 4HDMB 5CX1A 3L2OB 3QKWA 5EKSA 2GFIA 1PWZA 4FFVA 3GBSA 3DDNA 3FXAA 3RROA 2HADA 2C88A 3EOBI 1EX7A 3ZQJA 1OZHA 4BY9E 5I9SA 3ZKAA 1ODLA 2GNPA 5FO0A 1QF6A 2EXXA 2NIPA 1A27A 1QPZA 1RXUA 1RJGA 3I53A 1GZ4A 1YC2A 1OX6A 3MTIA 4V0QA 2A35A 3G7UA 3SICE 4CKBA 4KKXB 1KH1A 5BMVF 2XVXA 4IINA 1DNPA 5TQ0A 2OFFA 3T7IA 3M6IA 2OGSA 2REBA 3CO0S 3PPVA 1RHQA 4QFMA 4EJ0A 4NCNA 4MRSA 4TTTS 2W11A 4UEKA 2XXBA 4WY5A 3CX8A 4ZAZA 1BA3A 2HPHA 3QEMA 2ZAGA 1MPTA 4GT1A 4II2A 3RSHA 2PBLA 4BFCA 2ZSFA 3RSSA 2V4UA 1MZPA 2LKDA 5IBRA 2NTYC 3UANA 4WJLA 1RQ7A 1D2NA 3EYAA 4CM6A 2QZ4A 5IJAA 2AOUB 2WVGA 2H0QA 3NDPA 5A9TA 1ZR2A 2QPOA 3U40A 4HDKA 4Z6KA 4FYJA 4F56A 1A9TA 1U94A 4TV9A 4Q05A 3FR7A 4HGRA 4L22A 4G4JA 2DVMA 4HGNA 1JIIA 1Z6GA 3G7NA 1NM5C 5E2BA 1FXUA 2E4ZA 3H11A 3AHHA 3LVQE 4OATA 4B17A 4KYIB 2PJZA 2BFPA 3CVXA 3EVCA 3KVNA 1MVNA 1C2YA 2RBKA 3LV8A 4P3NA 3PSHA 1A7AA 1PJQA 4XZ3A 1YD7A 3DQPA 2Z83A 3ITKA 3LBFA 1TVEA 3EGXB 3NC0C 1M8FA 1DIOB 2BGIA 4JFAA 3CGWA 1P2GA 5FBWB 4NFSA 3ACBA 3G68A 3IT2A 4GZ3A 4M87A 4CEHA 3J80A 4BX9A 3LBAA 5D51S 3DKIA 1VJGA 4HK4A 4PSCA 4DZZA 3EWSA 1HDRA 2Y1CA 2W2XA 1SEPA 4FYHA 1PEYA 3D81A 5AO9A 1W73A 1VIDA 1Y9ZA 2FZ4A 2RAVA 4CMCA 3CO5A 3N9IA 3TQOA 3C6KA 1UBEA 1RADA 3D2CA 1E6MA 4UNNA 1M7GA 1CDZA 1TEXA 2HA6A 2VXBA 3AY7A 3BB1A 4OG2A 4ERNA 3OOWA 2R79A 5EPEA 4Y6OA 1NW6A 1I0LA 1B00A 4GMFA 4QBGB 4ARAA 4ZZ2A 2CVPA 2ZJFA 2PS9A 4PHCA 1J8DA 3F46A 1C1DA 4HAVA 4YJ3F 3E9EA 5B1DA 3ZEIA 4UAJA 3W5CA 3OQVA 3R24A 4YK7A 1JSZA 1Z4IA 4PTLA 3ZLBA 2FFQA 1TW2A 1O96B 2ZWIA 2A67A 4CFSA 1WUIS 1SBHA 4JK3A 3RJMA 2QQGA 4H7DA 4HSEA 3H8WA 4XX0B 2AMLA 4MI9A 2ZR8A 3K6KA 4YT8A 4XVCA 3CR3C 1XB2A 2ZPUA 2G9UA 1C0EA 1U3VA 3BXZA 3ZXXA 1R5OA 2MR6A 1YE8A 3P9KA 3ZDRA 2WM8A 3M33A 1J22A 3VU0A 1H8ED 2CVZA 3PB3A 1U4SA 5C35A 1WQ4A 1NTRA 1NMSA 4PZUA 3JAWB 2VFAA 4DLNA 4QKQA 2QTBA 4R0NA 1A8IA 4BNGA 1QANA 2FPRA 1KYWA 3B12A 4NV0A 2IZ5A 2HHJA 3SYKA 5JADA 2J08A 4YQEA 4FDAA 2I4TA 3UJ8A 1FIUA 4MYTA 3UB2A 4F3KA 1BWQA 1E7MA 5CM2Z 3TLJA 3I62A 3W5DA 4BWFB 4DV1B 3V7NA 2WIGA 1XJ0A 3HJRA 2J6CA 5FLEX 1NRJB 5KVQA 5CYPA 2O20A 2RGAA 3DE1X 3EXAA 3ESYA 3OT4A 5G1NA 3C97A 4D9JA 2UXDB 3MBKA 2H1OA 2J3MA 3CRZA 4ZYZA 4QPDA 2E18A 1C8KA 2IUYA 3P9NA 3AERB 3KZMA 4H7JA 3LUBA 1JQLB 1RM0A 2R8ZA 3MWKA 3SHQA 2PKXA 5CVTA 2FHPA 5J3JA 2JK0A 1YZLA 2ZUVA 2AMFA 2IH5A 2YXDA 3FYTA 1BMDA 1Z0IA 4LZJA 4LYAA 4RHTA 4Y9SA 3OCCA 1N2SA 3DT6A 3ZTTA 3JASB 1MB3A 4C0AC 1YHYA 1MIHA 3H0KA 1AS3A 5HK8A 2A9OA 1USVA 4GPEA 4O59O 3HBFA 4UEWA 1MV8A 4UUQA 4WVLA 3VR0A 2YJTD 5HHTA 1D0IA 1T2AA 1NXOA 1U8YA 1SD2A 2A9VA 3EPRA 3M9LA 1PVOA 4TZTA 3X1KA 1L7RA 1WCIB 1R16A 3C8MA 4O4LB 3ER8A 3KSMA 1EMDA 3FDXA 2CCGA 5GIPE 4FD3A 5JSYA 1FJXA 1DDOA 5AVTA 3FN4A 2BDTA 4IYJA 3LF1A 3T0GA 1HLGA 1Z88A 1GILA 1GSHA 1TQDA 3M4ZA 4X6LA 2V58A 4LC9A 5FEMA 3TQIA 3LIIA 3OOJA 1U7OA 4LXYA 4WAUA 3TNYA 1BHJA 4WZ6A 4BLRA 4HQLA 3BQ9A 3LX8A 4L7VA 1LGYA 1OZGA 4ODIA 4WSOA 1ZVVA 1K0UA 5JS8A 1GYPA 1XQXA 2GVZC 3JQAB 1G20B 3V8MA 4V38A 3L79A 4TVOA 4JJKA 4E2FA 2HCJB 3R5JA 2XDQB 4RACA 3FSEA 2QS9A 3I61A 3NT5A 1DOAA 1NJGA 2P78A 3PPWA 1GVHA 5JRJA 4M22A 1W4CA 4GM4A 5ALZA 3U4GA 4FJ0A 1NQ5A 4Q1CA 3V7UA 1GPLA 3V4LA 1LTHR 4YN3A 1FFWA 5TT1A 4J4TA 1GL9B 1PFKA 4OX9B 4FR0A 1WD5A 1YKGA 2FU5C 3AEUB 5FTWA 3U0BA 1OKKA 4B3FX 4HT3B 4ZYUA 1D6SA 1WZ2A 2RHCA 4KITB 2HWWA 3VHXA 5C9ZA 5HKAA 2Q99A 1OH8A 3IVMA 2GILA 4ZA2A 2WAOA 4NYIR 1L5SA 4CQLA 2EWWA 2FWIA 3DE0X 2HIGA 3AOEA 1MRZA 2Q3JA 2VPWA 3ONEA 1U3GA 4ZYTA 1GKIA 1OOEA 2B6NA 1NRIA 3OT1B 5FQOA 5DE3A 5BNIA 3ZBQA 2PH3A 3D0KA 4JI5B 4AN4A 1X7XA 2WIFA 3Q8WA 4GKBA 2IZ6A 2YXPX 4P35A 3I2YX 1L3IA 4U02A 1Z5ZA 4XUDA 2Q45A 2I6XA 4B35A 4E4RA 3R23A 3B70A 3JATB 3PNVA 4JYMA 4CMBA 3NCHA 4BZXA 3T41A 3UOAB 1PGPA 1MC1A 2BFOA 3ZCQA 1J0XO 5FR2A 3SWWA 5ALTA 4TYNA 2F8SA 1C0IA 4E07A 3P52A 3SZ3A 5DLQC 2VJOA 3AW9A 5DYTA 4CBVA 1UOOA 4L4UA 4U8GA 4ZPXA 1HURA 3VR2A 1QM5A 2HJVA 4CN8A 1JVSA 3G9UA 2KQUA 4H3SA 5K0TA 3JXEA 2J0UB 5AT1A 4RQAA 3B3QA 4DYDA 2PANA 4X71A 1JDJA 1EVYA 3L77A 4ICIA 1FP6A 3FGNA 4R9NA 3ZKWA 2WG1A 3ANLA 2FWJA 2X0DA 5JZOA 3ETNA 2R8OA 4KQWA 4EJMA 4C03A 2DJ5A 3GJQA 2O3RA 5CTJA 1BQ3A 1Z7EA 1JG2A 4ALIA 2QRHA 1ZGHA 1Z73A 2B9VA 1UBMS 2OVBA 1OXUA 2D2FA 4ABYA 1QC5B 1ZVKA 3G0IA 4JLWA 4O4IA 1KOJA 1FL9A 4PAGA 3ST7A 5C5DA 1U8XX 3QHPA 5HKKA 3K8QA 4PYKA 3RWBA 1N36B 2UZ3A 4RFSA 4XFDA 5SY4A 3KYCB 5AM3A 1L5YA 1TRHA 3GRZA 4GW3A 4HSGA 3O8QB 1KEPA 4FHDA 4BRUA 3KE8A 1ZW1A 2OGTA 3H3JA 4JODA 5ECGC 1UFVA 2EW2A 1V5FA 1IOWA 5HUQA 4NZPA 1KO4A 1F14A 1JI3A 2I54A 3QWIA 4P83A 2CDRA 5CYOA 1YBHA 1D5CA 3SHVA 4I9UA 1RD4A 2JAWA 4JIGA 5A7HA 3ZWNA 4BLWA 4YMHA 1OT3A 1SC4A 1GAXA 2MSKA 3HYCA 2RKOA 1L5GB 2X77A 3T35A 4R8VA 1FUUA 1WMFA 2I7DA 1KOGA 3K8ZA 4KQJA 1D5WA 4JT4A 1BGXT 4M1KA 2VJLA 3FVRA 2VSNA 4ZGWA 4G84A 3W5SA 4JJZA 2NYVA 3DMFA 3NJRA 4HAOA 1W88A 3EJWA 3PDIB 1JSCA 3FWYA 5G3ZA 1P9LA 3COVA 1QBKC 3C3YA 4P4LA 2EP7A 5HBGA 2ID4A 1E6KA 5EIBC 1JDTA 4WFJA 3ZW9A 2W71A 1XK6A 2QYTA 1T6XA 3AMVA 4NZNA 3P0JA 2RHRA 3FJOA 1WBDA 2UZ4A 1Z5NA 3JYPA 2XTAA 2ECKA 3NBZC 5D7BA 3ICQB 4C29A 3K1AA 2ZYIA 1KR5A 2A58A 4RTPA 1GXSA 1LLCA 1QZXA 3R41A 4RF4A 5J47A 2YBDA 2XCIA 2Q6LA 3IUPA 3LZDA 4MRMB 4G1UC 4KGZA 4Q16A 1R5JA 4YP5A 3PC8C 3TPZA 4M1SA 2NMVA 4BVKA 3P8ZA 3TOXA 2I9KA 3G2LA 2FWMX 1TT5A 4NJMA 5EQTA 1G6OA 1ML3A 3VV2A 4DA8A 5JBIA 5MGNA 1YBMA 3ZS9A 3IE2A 2YJGA 4Y7DA 3VOAA 1N78A 2XAUA 3CPJB 4PZYA 1P2DA 4WKPA 2VO1A 4F1JA 1PI3A 5H59A 3WNVA 3IOCA 5CA1A 3B9RA 2NZ8A 1Y80A 1REQB 2JJMA 2PYDA 1AS0A 2JIZD 4IKEA 2NSJA 1M0EA 1ULTA 2ZBUA 3CWCA 1VSUA 4FEGA 4L72A 2HREA 4X0EA 5KNDA 2I66A 1MQ8B 2B25A 1EDDA 3IEVA 1XDDA 4Y1RA 4EMBA 1YIAA 4Q1BA 1W85B 2Q4RA 4RUKA 3FGZA 5BWMA 3L4BC 4XE5A 4OH7A 3GEPA 1PR4A 2H17A 2R6AA 2VWGA 3C3CA 2FG6C 1FX1A 3DZHA 3OWHA 5D3ZA 3CUKA 1RQXA 3ZW7A 4RTJA 1WCYA 3AG6A 3SZRA 4RF2A 5CGZA 3WDSA 5BVHB 1KJQA 2FX2A 3PJFA 3H84A 3LFUA 3JARA 3IHKA 4F1KA 2OXRA 4MVJM 3GLSA 1E2MA 1QHHA 3BL6A 3MUEA 3LCVB 2WFZA 1K2WA 5TNXA 3M3DA 1QX4A 1XBTA 3KE9A 2NUAA 4NU0A 4P36A 4AYTA 3IUBA 5EHXA 4W1SA 2V0GA 3O4GA 4O1IA 3RQIA 6AT1A 1WY5A 4ENUA 1IAVA 2W2TA 3ZWCA 2TS1A 2P27A 2YN2A 1TCUA 3HABA 1OWOA 2EDCA 3B5IA 1L7MA 1A77A 1HDEA 1QRSA 3D3JA 1L7EA 2HIHA 3F4LA 3F7OA 4MW0A 3VC2A 2G70A 4UM5A 2GD0A 2MYPA 4KH0A 3RUEA 2JGKA 3GCZA 2DWUA 1DBQA 3UCXA 1MX9A 1G2IA 1T43A 1THMA 2ZJ8A 2Q5EA 2L0XA 3E2PA 3KTAB 5CH3A 3JYLA 5IN4A 4F91B 3JQ7A 5LQSA 3DJYA 3QX8A 2R5WA 1OWPA 1H85A 3T3IA 4TMWA 4QSMA 1F6BA 2ZE8A 2N3ZA 1Y5RA 2DPXA 3HJNA 3LW8A 4JJ7A 5HCNA 1E2BA 3BWBA 1YAJA 4LYFA 4YRSA 2VK2A 5LD2C 3IR5A 1SUDA 3BJIC 1ZK4A 3ESRA 5FV7A 4JZYA 5ICFA 4C76A 4R0MA 3MZ0A 3ZHVA 3AEQB 4GO1A 1HDOA 1MOQA 3B38A 4RL4A 3TO5A 1VLLA 4FGUA 1KRHA 2RKBA 2XNKA 3QWAA 5F35A 4JBYA 1ZVMA 3HLYA 4WBSA 3X1JA 1HQCA 5CUQA 3C2QA 1U9ZA 2D5LA 4I08A 4QM7A 4NK5A 4PG5A 3DP9A 1N9ZA 1XQVA 2FK7A 3LCRA 4A8TA 4UHHA 3PQ2A 3DL0A 2DH6A 4KBGA 3VH2A 1U0SY 1TU0A 2IDJA 4OGKA 2FP4A 3G9XA 3GMDA 4JL5A 5E6UB 3L6RA 3ZI7A 4MPJA 4WY8A 4N8EA 4TV9F 4BOYA 3ZVLA 4PLWA 5HJ7A 1T1SA 4U0JA 1O03A 1XZKA 1NVGA 3MN1A 1DXYA 3MMZA 3QNMA 4RY2A 2H5LA 2BFAA 4UNPA 5KTKA 1HYHA 5FPTA 1QV9A 4RFLA 4TMZA 1I2AA 2GASA 3OLCX 4D5GA 2ES4A 1DZIA 1JBKA 1YBFA 2PGNA 1KZYC 1GA1A 1R6UA 4DBLE 2W00A 2XUJA 4NEGA 1JG3A 2IXDA 3MGGA 3G49A 5LYJB 4D6XA 3OU6A 2W6JA 2YOHA 4HYEA 5ICMA 3ZD8A 2NZUG 3M2TA 3O21A 2JJQA 1OX4B 4NG4A 5JVDB 1GFIA 5JRZA 1E5XA 1R74A 3PP8A 2QRVB 2XYGA 4BXOB 4RKQA 4GR9A 4KODA 1PBTA 3MC1A 4HXFB 5L3SB 1OFGA 3B1ZA 4QU5A 4ZC8A 1FRZA 1M2HA 4ECAA 3LT0A 1FLNA 4Y8VA 1TMKA 4CKEA 3EG5A 4LF9B 4Z9AA 1R8QA 4ON9A 4CQJA 4OI1A 1I2ZA 3A2LA 2BI7A 2J46A 1RZVA 5BQFA 1X38A 4F9FA 2C54A 1FP4A 3IAM1 2I2BA 1LF0A 4QFBA 5LZ5A 3TW8A 2N1BA 5FNVF 1K6XA 3G0DA 4FGZA 3UKOA 4F45A 1E5QA 1GITA 1KETA 5EEHA 2J0VA 4OB6A 1OIVA 2FLVA 5CM9C 1A71A 2E2WA 4OD0A 3ZUPA 3O2SB 2C2ZA 1JNXX 1MJNA 5BO5A 1QFMA 3HI6A 4YDRA 3IMGA 1A8HA 3S8YA 3MINA 1GU0A 1IHDA 1T5SA 4IV8A 4EG7A 2ANCA 4UOQA 4AY2A 2BGUA 2YV3A 3MTEA 4N7RA 1SB9A 2WDZA 3BK2A 3N28A 3HJAA 4A1FA 4BIMA 4Z7NB 3I5XA 4YP9A 4L0DA 1B8NA 3F6YA 2WLTA 5GV7A 3AEZA 4IJWA 1E1QA 3O1LA 2RFLA 5CEFA 2O54A 4NXMB 1JZSA 2MOKA 2OM6A 1W29A 4RCZA 1XDUA 3VPAA 1Y6FA 2GPNA 4RH3A 1KFEB 2A57A 4OAPA 3EDOA 3ZCPA 2PTHA 2WJAA 5JI2E 3GFVA 5IABA 4BNMA 4ZK2A 4R1TA 5CDUA 2Q5OA 2R6GA 4FM9A 4JBXA 2JATA 4PCLA 1ZD5A 2Q0HA 1GCUA 4W7SA 3WG9A 3RHSA 2G0NA 1M34B 3ON5A 3TF5A 1TYCA 2C57A 5L7YA 3LGSA 4RCVA 3VUEA 4XQEA 1ZHHA 1RKVA 4JOSA 1LBTA 1RRVA 3AXTA 4HG2A 4U7HA 3ZLJA 2G09A 2GJKA 1MAUA 3AFHA 3B1FA 2QWXA 2XQJA 5K51A 3SJ7A 4A92A 5HIAA 2GHTA 4JITA 5AKEA 4ZN6A 1HG1A 1T36B 4QEKA 4AK9A 3QE3A 3GIWA 1KIAA 1MIOA 1Y1PA 2J9RA 3L4EA 5CBPA 3TW4A 1NNI1 4A6EA 2Z2KA 1I7QB 1E1CA 2F1OA 3TE7A 1B8OA 1OIXA 1XEXB 4KXXA 1DC4A 4N12A 2Q21A 2JGIA 2E6KA 1H8HD 1SA0B 3OF5A 2FOLA 4V3BA 2IBTA 4X94A 1B41A 2GBFA 3H75A 3L1HA 3KR0A 3HV2A 1Y98A 1PTJC 3L0ZA 3N6XA 2OV4A 3GGOA 4JT8A 4QVKA 2XLBA 1RKBA 3OO1A 4MXDA 3SJBA 2JLZA 1KQPA 4R8RA 1P7WA 3R5KA 5E0KB 1N6RA 5HZHA 1M6EX 4DV6B 1A2OA 2O8DA 2JJYA 3AJRA 1N33B 2DGDA 4FN5A 1RZ3A 3E4CA 3OEED 4I0WB 4RY9A 3LTEA 1S2GA 5J2TA 1XPUA 1X7DA 5HZKA 2FSVA 2IWRA 2DTDA 2HA2A 1KE2A 2YV2A 4QLBA 4KR2A 3CE9A 1NN1A 1XTJA 2WHEA 5EKUA 1N5MA 1Y8QA 5IWCA 1JAHA 1MJGA 3E9DA 2FMHA 4E30A 2JI8A 2UZ0A 1T1RA 1ILEA 3TEJA 1G5QA 2VJMB 1E9EA 3ASVA 1NW8A 3TOVA 2WD8A 3HUEA 1XKLA 4OQMA 3D7NA 1IRXA 1F1JA 2YHUA 3Q87B 3SP1A 2GN6A 2HQSA 1MEOA 1DEHA 1M1ZA 1QP8A 2HHLA 2YXNA 1G5HA 3OI7A 3K31A 1AUOA 1MHPA 3EEQA 4JGIA 1OXBB 4UEJA 4XLZA 3D5EA 4UW9A 1SU8A 4XM2A 4ZCSA 3AJEA 1LK7A 3AU8A 4EHLA 4UXIA 4Q9LA 2EZ9A 3SIPA 2P6RA 4ZYXA 1JG4A 1I3MA 4PLHA 1VCHA 3DEJA 4G4SO 1GA4A 3S6JA 3NTVA 4KTVE 2ZSBA 5J59A 1CE8A 1NVDA 2CYBA 2WQZA 4FFLA 3W7BA 2X5OA 4CQNA 2XYPA 2ZBEA 4LRYA 4IJ6A 3RS9A 3TLAA 4BNDA 5BORA 1E0AA 4UE2A 5ALNA 1JPNA 5KKCA 2E37A 1KORA 3LKDA 3QLUC 1W0CA 3T15A 3DZDA 2BFEB 2FA9A 3U80A 4QOEA 4B85A 1V16A 2PZGA 3QENA 4YAUA 3SKXA 4UHJA 1DKPA 3AEXA 2WG0A 4UHBA 3PTZA 3TXXA 1CJMA 5TQ2A 1U5AA 5AK4A 4XRGA 5GADl 1U8TA 4M0DA 4KIJA 1RR6A 1QIMA 1YVUA 3DYBA 4FP9A 1H2YA 5C31A 3PYLA 1GVNB 1XWIA 4EJ2A 1Q83A 3N5CA 1J2EA 3CRMA 4DW8A 2HRQA 3VVCA 3C7TA 3KOZA 5HP4A 2JFQA 4EABA 1YQQA 1ODTC 2ZSKA 2VJBA 3ETCA 3KVYA 4P4SA 1NVKA 2YZ7A 4CLDA 3EZ7A 1SUSA 1YB2A 4GI2A 1E8MA 1R6BX 4UM7A 5DRYA 3O0TA 5J9FA 5KTRA 1KWKA 4OHZA 2FGKA 5FD8A 3BFJA 5JHHB 3TBFA 3G2MA 4O4IF 3UFBA 2AMJA 1W0KA 3PXAA 3H2ZA 1KEWA 1Q0QA 2IU0A 4JYZA 2Z8XA 2QNIA 4HP8A 4LRSB 4YQZA 5TPWB 3QYPA 4IJKA 3RVBA 4DKXA 3O8RA 1Z2PX 3V34A 4HRYA 5FBKA 3F90A 4RZXA 3BGDA 5H80A 2P9TA 1IWOA 2I4MA 3QBJA 4IQ8A 2RSLA 1JB9A 4K6OA 3CA8A 3OCVA 1SZJG 3KU4A 5JZMA 3VJRA 8OHMA 3QU7A 1VPLA 3K70D 2YVUA 3A1VA 5FPQA 5D7NA 3R9XB 3EULA 2M1XA 2BI8A 4JI4B 4JJIA 5EXSA 3N05A 1DJNA 3FCAA 3UTCA 2MINA 3WGUA 5JS1A 2O19A 1QVWA 3KFVA 1Y33E 3WRXC 2XTZA 2PX0A 2XF8A 1ZN9A 3DWFA 1GKYA 3B52X 2ZS8A 2LPMA 3IT0A 1FRVA 4HN9A 1RIFA 2QZ9A 1MFZA 4K9MA 2QY6A 2YL2A 3HNRA 3Q9NA 4DC9A 3FOFC 2EL9A 4N65A 4YAWA 3R7SA 2Q50A 3B85A 4JLAA 1RRCA 1H1TA 5BT9A 3IT3A 4EF5A 4BNZA 5HE9A 4IQ0A 3L4JA 3THYB 1KDOA 1R18A 3ANMA 1CUBA 4GUDA 1WZCA 1SIWA 2BELA 5EWLA 2WJ4A 3VYUB 1HUQA 1Y4ZA 1A5AB 3FOZA 1KEVA 2FPWA 2JASA 1L8XA 4OHOA 1E58A 2L69A 3LWBA 2KBFA 2RIPA 4J6FA 4YCNA 3PRYA 2WOJA 3VSEA 4NH4A 2RGNA 1YQUA 2CLIB 1VYTA 4MLCA 1K3TA 1OFHA 4RM3A 5CM8B 4P93A 2FEAA 5A03A 1JFRA 1EX9A 5HJ5A 1L8AA 3ZZTA 1UM9B 4AZ3A 4M83A 5EHQA 3BJMA 5B30A 1MABB 3GROA 2HLDD 3DW3X 3OX3A 3PIRA 3OG9A 2H1IA 3EXG2 3CT6A 4HDOB 3QEKA 4RIGA 4B3RB 4KXQA 2JJ8A 3G5UA 1O7JA 4J7AA 2X6QA 4MHSA 5CA1F 5JAOA 2JBAB 3RCBA 4JI3B 2HRDA 2P65A 2C2XA 2PUTA 3DAYA 3N8IA 3WIBA 3SG0A 4HF7A 1T5LA 4LGCA 3RUAA 1A5BB 3QMPA 3C6XA 4S12A 4DTCA 1CY4A 3TVDA 1A9XB 2REQA 5FA6A 4BNWA 1HZJA 1ZWLA 4RTKA 2OMKA 3ZWKA 9GPBA 1XU4A 1Z38A 2GM9A 4D1YA 2QT0A 1YZNA 1B14A 1KY2A 5AH0A 5A7FA 2WTXA 1EUZA 5SZHB 2PUHA 1QX3A 3DZCA 2AL7A 5KQMA 2Z2YA 3WZMA 5T4HA 3VR6D 5HEKA 1TUEA 1T3ZA 1EJ6A 1OHHA 3AVQA 5FCDA 1ZC4A 3VI4B 1BYIA 5LNK1 3I39X 1SBNE 4OJKA 5ADUS 6LDHA 2ZT8A 4GMDA 4EKGA 3THOA 1WMAA 5G3YA 1VJ1A 2C8JA 2HZ7A 1CD5A 2KHZA 1P2TA 1GDTA 1YS6A 4QG7A 1KKMA 2QLMA 4RKWA 2JLXA 2YZ2A 2Y1DA 1RWVA 2G9VA 2EFYA 2CNKA 2YCLA 2BFCB 2R2AA 3AJ8A 3FROA 4NBLA 4UD6A 5EXEA 4YWHA 3WDLA 1HRKA 2ZSUA 3F74A 4BAUA 4DCGA 1TI7A 3HV0A 3R9WA 2ORIA 1UEIA 5H9VA 1GTJ1 1KYVA 1JR3E 1X9HA 5IASA 1Q0ZA 1XD9A 3RBVA 3RF6A 3OMWA 4DAEA 5SZKB 4E5UA 1SXJD 2ZJ5A 2DHQA 2CY0A 3DG9A 4X1OA 1QGUB 5EI5A 2P3LA 2RH4A 3MTAA 1IWPB 1SUWA 3IR6A 3TXAA 5JG7A 2VLIA 5JJBA 4YBZA 1YE5A 3PGMA 4DNPA 3LRPA 2HRZA 1HX7A 5FOUA 1X1SA 3E18A 4MUNA 1KI6A 3JQ8B 4XJVA 3FUTA 4YRZA 1F3OA 3I2FA 1U8CB 3FKJA 5IVPA 1TO6A 3LHFA 1MA3A 4G09A 3U1BA 2X6RA 4GE3A 3JQCA 4K2AA 2IYVA 1B6TA 4JROA 1P2UA 4QXAA 5AJXA 2AOXA 3RIXA 3LPCA 1T6NA 5JYDA 1NQAO 1PK7A 1V43A 4S1VA 5LN1A 4LSGA 1UMBA 1XJCA 5EQFA 4UFNA 2C9YA 3A8TA 4Q1FA 4RK5A 4YR7A 1DAGA 2OYSA 1PVDA 5EJ5A 2Q5FA 1YMVA 1SM4A 2W8BB 2VAMA 2B35A 3GJTA 3LUJA 2WWGA 3M3HA 5KSZA 5K2MA 2PMEA 3H2KA 1NVTA 1LK5A 4HN4B 4QLAA 4B43A 1FP1D 1V2GA 3QEOA 4GNKA 4JC4A 4IZ6A 5ESDA 3VFDA 4A2WA 4LG1A 5LP1A 3HC7A 4H4CA 2F00A 2I0FA 4BS9A 1W0JA 1Y3AA 2PX5A 1MD9A 3KFXA 1DXOA 2XGOA 5EJIA 1ZNZA 1XNQB 3HLTA 3UJPA 3ZNNA 3NJ8A 5JQGB 2BKVA 1PR9A 3I73A 2RHDA 4M1TA 3TDKA 3WGLA 4NU6A 4AKTA 3SVLA 2J32A 4Q6BA 3HXLA 4YAFA 4Z4IA 2Z95A 3QP9A 1EFVA 3NEJA 4GI3A 4BAGA 1PS9A 2Y0CA 1FFYA 4IWNA 1DWQA 4C30A 4C1NA 2CSUA 4B8WA 4WNCA 3IHTA 1CY6A 3HPRA 1U5BB 4Q48A 2XSZD 3GFTA 2JFFA 1N5RA 2D2EA 2P1ZA 1YOVA 2RG7A 5F52A 2QTRA 5D5PA 4EF4A 3O03A 3WWZA 4KX5A 4OB8A 2PZJA 4PZ9A 1C3OA 3OFVA 4N7BA 2WJZB 1T9GR 3EQ6A 3WVNA 2AXQA 2O4UX 3RQSA 5LR6A 1M6VB 5D6OA 5C46F 1XF9A 1JAZA 3M1IA 3BKXA 4H17A 1K8XB 5ALPA 3STHA 2JAQA 2W6QA 1QAOA 5EUMA 1KY4A 1Z37A 3CF4G 4WNYA 4XOUA 4EW2A 1UJMA 3OLYA 3PDJA 1RRKA 1DRUA 2AJTA 5EWJB 2NU8A 3WFIA 3ZX5A 1QU2A 1IULA 1UK8A 2IC5A 3A1WA 3LP5A 4V2UA 1I1OA 5G0VA 4D8YA 2ZIXB 1ZMOA 1R66A 4KBFA 1Y7LA 4J91A 4TV8F 5TMBA 3TB6A 4FNAA 3LLMA 2AC4A 4L5JA 5K3CA 4FU0A 1XCGB 1EFPB 5AD1A 3QEJA 3CZRA 1TFRA 2FMFA 4WERA 4CM8B 2EBWA 1WX1A 4QHYA 3GH3A 4JUCA 1M2VB 4G37A 1U90A 1HL7A 2G4CA 4G0PA 3M5DA 5K4GA 2LE0A 5HFJA 4H4DA 1ITZA 2CB9A 2AG8A 4PG7A 4MW1A 4G63A 4LYDA 4OA8A 3JQEA 4X1KA 3H18A 5K3FB 5LP6A 2LKCA 3DE4X 1CUGA 4UQOA 3UT5B 1R4MB 1ZGAA 1T0IA 2J5BA 2R8XA 5LPNA 2F48A 1BROA 1BX0A 1ZGGA 3OZGA 1GADO 4IP0A 2D06A 4QYWA 1L5OA 2IIVA 3MLAA 3OHSX 4Q39A 4BPRA 4ARZA 4IJQA 1ADYA 4WRRA 2BEVB 3IMKA 3UPUA 3R6TA 4A82A 3AVTA 1C0LA 1TQHA 3BGVA 5DM0A 4KWHA 1XTQA 4J2HA 4PQYA 3VR3A 3I2KA 3STWA 2G06A 1M1UA 2Q6IA 3LKVA 4E4TA 4MJXA 1U5CA 3UMSA 1BMFA 1JR3A 1X7WB 2I4IA 2J48A 4JASB 1FSSA 4R1OA 3ZDZB 4DR2B 5DYYA 1O6FA 1RS0A 4D3DA 4S05A 1XFAA 3I01M 3QELB 1QR6A 4FFOA 2W6ID 4FYMA 3I04A 3CVOA 1Q17A 2IXTA 3Q3VA 3DKVA 1PWHA 1QHFA 3AFGA 3D7RA 3FJ1A 3KQYA 2OBNA 3OUTA 4JJAA 1M5TA 2VT3A 4IZHA 3ZIAD 4EITA 5CDYA 3RGGA 5IT5A 3OICA 5J2TF 4AG5A 1VCMA 1HL3A 3LWZA 2I91A 1U2DC 2GBGA 1X1TA 2WIKA 1AK1A 1WG8A 2P91A 3BIXA 5EJ4A 4LXQA 1U9YA 4G0QA 1GTSA 4XWKA 4RVOA 3T5PA 4WZBB 4RWZA 1ZIDA 1N2CE 4E09A 5JH7A 3KB2A 5G1PA 4E33A 2NU9B 3ZI4A 3RWMB 3BREA 3ZDAA 1KJIA 4F6RA 3PUKA 4DJFC 2WHPB 2WD7A 4H1HA 4MUEA 2XYVA 1JAXA 3NVMB 3T0FA 3FYSA 3PNQA 4E2ZA 5A3RA 1TF5A 5DK6A 4KE8A 1LQUA 5IKMA 2VTBB 2PMKA 4MDYA 1ZN8A 1DC5A 4LHYA 3B6KA 3AM3A 4M0MA 4GX1A 5E8JA 2QJWA 2HHHB 1M2OA 2XRZA 1FLVA 3QLVA 4R0VA 3KBBA 4CQMA 4ZEWA 3OZDA 3ISTA 3VPXA 2IYPA 3FFWA 4BX8A 1KI2A 3EN0A 3BL8A 1VSTA 2HM7A 1OH6A 4JI1B 4X41A 1JEAA 1MTZA 3E03A 1ORHA 1AQNA 3LBNA 3RS4A 2OOSA 1BX3A 1C9EA 2JGNA 5FOTA 4EMTA 5CNKA 2DKNA 2UZIR 3IV7A 3GRRA 4R2XA 5AOAA 4I2NA 4R9SA 2EW8A 3B5JA 1B3RA 3KUCA 1GPDG 2AIRA 2VP2A 4FFPA 4G1VA 4QBKA 4Y98A 2WINI 4DCJA 2HDHA 4D9KA 4E32A 4FYVA 3UMGA 3L3BA 4TTRA 1VG1A 2IV3A 4E31A 4Q7QA 2Q8QA 2W83A 4MROA 4TQAA 3EIUA 3FI9A 3M82A 4EGFA 3DV9A 2X7HA 5TVGA 2EKZA 5GV8A 5GVRA 3W77A 3TFWA 2FZ5A 2XUDA 4PW0A 5CBKA 2ZJOA 4OF4A 2ZRNA 2H2DA 1BAPA 2QENA 1JYSA 3U7QA 2Z04A 1U2EA 4F93B 4XLTA 3DO6A 4MICA 2W2KA 1QHEA 3GEHA 1IEVA 2NUPA 2VWQA 1F2VA 1U7XA 4R7TA 2C9OA 4ZXPA 1DQZA 1A72A 2BLNA 1KFJB 1NA5A 1XSEA 4LSMA 2OD2A 5CHYA 3U60B 2AFHB 1ESEA 3EMVA 2EGUA 4N0MA 5L7WA 3O84A 1EXNA 5DJ5A 3FPSA 1BTOA 5IJXA 1N3LA 4C78A 4DA7A 3FDIA 4BB5A 1XDWA 4Y2YA 1BDJA 1ECPA 2ZM6B 2H2GA 5ALRA 5IX8A 3V2GA 4RD1A 1UWKA 1PR3A 2ECFA 5JHGB 3WGJA 2VQ3A 5AJHA 4D0NA 1E8DA 4TTIA 3PUZA 4DSOA 4IDEA 4K6HA 3OX1A 3MJTA 1GA6A 1H22A 3SC4A 4F06A 2LCIA 1QP0A 2E4AA 2W2LA 2BBWA 3RTBA 4MPPA 4YCAA 3SQNA 3HO8A 4LE0A 2UXBB 5E3IA 3ZDBA 5FTKA 4JLPA 1VPEA 1XTTA 1YNOA 3LQKA 1A95A 4HTFA 5THQA 1D3AA 2IYQA 1U2QA 2CLMB 4QGGA 3BGIA 1KJZA 4EHIA 4OHYA 2QRLA 3VMMA 1L4GA 1Y6ZA 3PRJA 5EUCA 1F7UA 2IODA 3VPDA 1A2QA 3L93A 4L57A 1FUIA 3O1JC 1VA5A 3CX6A 1E2IA 1VXOA 2QM7A 2WJPA 4KRXA 3SXPA 5JCZA 1N7JA 3DVAB 1SCUA 2PIAA 3HKCA 4CF5A 1E8NA 4MI6A 3VZDA 1NBME 2VT6A 2SECE 4GICA 1C3EA 1ONNA 2ZTHA 5J4KA 1BDHA 4W8GA 1Q44A 2EWVA 2DBRA 5F3RA 3ABIA 2J5KA 2BGRA 1NQOA 2JHCA 2HH9A 8GPBA 3NJ4A 3P19A 4MIOA 4Q82A 2O2ZA 5C32A 2OB1A 2B69A 2P30A 3EZXA 3WIUA 3HWRA 5TXGA 2JEZA 2V3CC 3R09A 1YRAA 4YMSA 1FDWA 1O95A 1OSNA 1X8XA 1EZ4A 4TS1A 5AXCA 4P4TA 4YEDA 1P1KA 4MKXA 3DWEX 2ECPA 4BZWA 2BEWB 3IP5A 5AM0A 3ESAA 3BMCA 3C24A 4ZO8A 1YZ3A 4L50A 4M6WA 4PAOA 5EESA 3U2QA 2FMTA 2GBPA 4IF4A 1L5FA 1T5BA 1OLSA 1X77A 2EWMA 4GRIA 4L3OA 4CCYA 2EFJA 4V0RA 5HZGA 3LXMA 5AI4A 1R27A 5E6RA 2BFMA 2DM6A 1DRVA 1E3QA 1GGMA 1N2CA 3H7IA 4BKOA 1YULA 4BYGA 5FFNA 2VXCA 1K8YB 1M10A 2F3SA 3LCMA 2PV7A 5TC4A 1QSGA 1HM5A 3WI7A 3AX6A 1EK1A 2F3PA 2N46A 1YJ8A 3CUUA 1R0SA 4MPTA 1DIBA 1Q7GA 2O7SA 5DULA 2DR3A 2VPTA 3KTDA 2QV7A 2A78A 4PAMA 3NYIA 1XD2A 2QG9A 1N7HA 1P61B 4DUYB 1IL0A 3L1VA 1Q7RA 1E59A 4K8RB 3S2IA 2WQ6A 2CJFA 3N39C 2AE2A 3C6BA 2OESA 3HCNA 2V7PA 3KIPA 4JUBA 1DO0A 5CX4A 3JV7A 3TTXA 5LQAA 1DFIA 3R74A 4P0QB 3DP7A 2R0QC 4NE2A 5AM1A 5TGTA 2X1MA 3T95A 4E21A 1RC1A 4M9QA 5HKLA 5IH7A 4RZ3A 1ZJYA 1H0KA 1YB6A 2EJVA 2QTNA 2XF2A 4CU2A 1DADA 2YZGA 1DAKA 2JLUA 1Z4PX 1IXRC 3QIVA 4QUEA 2G04A 3VSCA 2FG7C 1STOA 4N9QA 2EIXA 1FFXB 1DC6A 3FVQA 4ZVOA 5C34B 4AM8A 3NRJA 3ORSA 4KAAA 3ENZA 5CNMA 3V4SA 3D2BA 1V45E 1E9FA 4BBPA 5LA6A 4KMSA 1MA0A 1KMNA 3AI1A 3L7JA 2H29A 3A9SA 3IQIX 4QYMA 521PA 3Q0EA 1IH8A 1D1TA 1PX2A 2GB4A 1QB8A 3BZWA 3AT1A 4Y2PA 3T38A 2X5XA 2Q7OE 1U02A 5D5QA 1CRZA 1ZIYA 2ZROA 1BFUA 1KF0A 2H4XA 3TZCA 4DDMA 2PGOA 2IOHA 3ADKA 1KU6A 5PGMA 2H1FA 3EUWA 4DLRA 2GM5A 3Q11A 3HA5A 3A4YA 3L1UA 2Q4EA 5K4HA 4OHVA 2DJIA 4QQKA 3O75A 5AQ1A 1PNRA 2F6RA 1M33A 3IESA 1CZHA 1GNPA 1UF9A 2H2AA 3H2SA 4P7FA 2ILTA 4YRTA 3FDZA 4CEJA 3SYRA 3H1PA 3OJOA 4M2LA 4MO9A 4KAJA 4P33A 2AR9A 3GUUA 1V1JA 4G8JA 3TOZA 1CIJA 2OZVA 2C95A 3BTSA 2TMGA 1ZLXA 2Q1WA 2YV4A 2EJBA 3A9RA 3JTEA 5JATA 2OG1A 1Z5UA 3D8RA 3VKWA 5TPZA 3HU5A 3N2KA 4K2HA 4XD7D 1M6HA 1IN6A 1YQEA 1QK5A 5JJIA 3RARA 3IJRA 1GTVA 1H66A 1XEFA 1ZY2A 4PBTA 4GBGA 4WI1A 5CH5A 3TLMA 2A0UA 1ZM3A 1RAGA 3WICA 4DSZA 2O8CB 1YZUA 1QTRA 2SKEA 1X7HA 1ZQ1A 4ESOA 3PNBA 4ROTA 5I01A 1YZFA 1VHWA 2VCYA 5C18A 4YRFA 3B1WA 5B6IA 1PQYA 4O3FA 5H83A 3ZWQA 4AL4A 1CUYA 5IN5A 4D4HA 2NXNA 2BZGA 2YV1A 1KVTA 5CT5A 1NBMA 3TAUA 3K5WA 2CVHA 4PZEA 3QI7A 5I5GA 2M6LA 2IELA 1JILA 3KHKA 5DWVA 4UJ3A 3KJFA 3Q7IA 3TSYA 3U62A 3X2SA 4BEWA 1OXTA 4U9IS 1GSIA 1L4KA 5HZMA 1BJRE 1MX5A 1Z74A 4YRBA 1PJLA 4FZVA 1RCUA 2ZRQA 1TYAE 2P77A 4RPKA 4PYMA 4QTTB 5BQ5A 5JD3A 1G6KA 1FSPA 5K8IA 1NPTO 1VL8A 1YUMA 4YVFA 2WFLB 3MWJA 5LQJA 4M4SA 1PJSA 3HLKA 1C9JA 3FLBA 1DHRA 1EK5A 1DQYA 1XTRA 2NV0A 4CM4B 3CZCA 4ZO9A 2J0QA 2BMAA 1Z9BA 5E7IA 3TLGA 1OQAA 2YJNA 1Y8RB 4ZAYA 3RUHA 5FJJA 3U5TA 3SLKA 2YUIA 1DT3A 1XHEA 4X54A 1IBRA 4PU0A 3HBJA 4YPVA 1J2UA 3H4VA 4CT0A 4E5PA 5AKZA 3EQ8A 3WB9A 2PLFA 3V33A 3ER6A 1N2HA 4K3UA 2NPFA 2VC2B 4TZ0A 5ETJA 5FUQA 1MMFB 3MUFA 4CM5A 1FTGA 2PN1A 3DV0B 1JL3A 1N1EA 1MO6A 4BVLA 4MVJD 1RYNA 1NATA 4EARA 1JIKA 2DPMA 2XMPA 2OP0A 1KHTA 2GYVA 5AVSA 5BY2A 1Y82A 4WEQA 3ZCVA 5A9SB 1FYVA 2CXSA 2J0EA 3BL5A 4KGDA 4GXQA 5LP6F 2F4NA 2PXAA 3KQVA 4CG2A 1I2DA 2O2HA 4C6RA 4DZTA 3FKSD 2QPTA 3CCCA 3L1IA 4GIBA 4AN0A 4EFMA 5KDDA 2RB4A 1G6HA 5DCLA 3SF8B 4G1FA 3AHCA 4DJTA 3L8GA 1W49A 4Q9JA 3Q8XB 1Z0SA 3E2IA 2VAVA 3N58A 1H2FA 4ZCIA 2BC9A 2ZUWA 3W78A 4RSMA 3NWJA 5AI9A 1O94C 1W36D 4HAYA 2BZSA 2WTAA 3GJ7A 3BMNB 4KC0A 3W79A 4C4YA 4JOCA 2JLQA 3LGXA 1K63A 3HN6A 3LWDA 4JXJA 4PLYA 4MR9B 1J5EB 4U7TB 1Y5LA 2H5IA 1YHNA 2DUWA 5JJ5A 1NJSA 1WE2A 1TMOA 4O2LA 3HEAA 2PUFA 5LFAA 1JTEA 1VMIA 4PSDA 3LO8A 2J4FA 3SZLA 3LY8A 3PQCA 3RSCA 5JOQA 1UKCA 1OREA 3JW8A 3AGPA 1X92A 6PFKA 4H7EA 5HM6A 3P4XA 3ITDA 4JJ4A 5D1NA 3V8RA 4B7ZA 1SUBA 1Z36A 4DPLA 3C85A 1RQNA 1CT9A 2RHTA 1Z29A 2COUA 4Q12A 4ZJPA 1EWRA 3UG7A 2CNLA 1DU4A 4ZHQB 4J0QA 1W2WB 3DEKA 3DYIA 5FWXA 3S1LA 3ZQKA 4RE6A 5DKFA 1AM4D 2YHIA 1OASA 2GSDA 3L6BA 4HB4A 5AKHA 3TZKA 5B3LA 5B1YA 2O6LA 3ENKA 4QECA 3O82A 2DWCA 3PXXA 3QPAA 3J81A 4GM1A 2YVKA 3KU1A 4OTZA 1HFJA 3EGIA 4IDCA 3WK9A 1U1CA 4QU8A 4B32A 3K71B 3EQ9A 2V59A 1Y4SA 2A59A 2PMWB 3CZMA 4MV5A 4UDOA 1T8WA 4KR0A 2JVJA 3N8GA 2Z2ZA 4R8LA 4UD2A 4AS2A 7ADHA 4CLHA 3UM9A 3WMFA 4MLPA 1Z47A 2OLJA 1E2FA 4Z4CA 4X92A 4CM7A 2DWQA 3NALA 5K8TA 4R1LA 2Q0XA 4HMOA 3HZZA 2YS7A 4EGSA 5JNLA 5B1SA 1DBRA 3VZPA 4JS0A 1FPQA 2BDUA 5HMMA 4WLOA 4YV7A 3RVDA 2FUCA 4NI5A 3CC8A 3HFSA 2PUDA 2P9EA 1Y7IA 1US8A 3UXHA 3O4IA 5DSXA 1HGXA 1I6KA 4LTNA 2CMGA 4MTLA 2PA0A 4O6VA 2H3HA 2WSLA 3VU8A 2Z5FA 1J8VA 4IW3B 4JP2A 1L2TA 1VKNA 1YZYA 2GI4A 1KQOA 3FHJA 1JLMA 3S1AA 5CB0A 3ILYA 3WHLA 1UC9A 3L9WA 3JQ9A 4YX9A 2FSIA 3PITA 2LDBA 4AMVA 4D0SA 2BKAA 2QVLA 3ABZA 3K09A 2VXOA 3NANA 1DVRA 4KYTA 5L4SA 2VYFA 3ONWA 1CQWA 1NW4A 1MJ5A 1UDAA 1W46A 2A92A 1G63A 3U4IA 3DGEC 5DYGA 3HS3A 2F1IA 5ITVA 4KIWA 2MYNA 2ZVJA 5BN1A 5J5CA 3DTVD 3VZSA 2Q4TA 1ZESA 4AP9A 3C8DA 4B3XA 1PFWA 1VKJA 3WA7A 3QXHA 4ZGGA 3U09A 2NV2B 1YDGA 2RHGB 1T4BA 1AQUA 4G0OA 5L9AA 3MQ4A 4C7XA 1J49A 1U0RA 1AHIA 1EFDN 2HBRA 1T8PA 2H59A 2MWMA 2VT2A 2ZANA 3CG0A 5AI8A 4D46A 4DN6A 2V7QD 3I1IA 1S3GA 3L8YA 3OBIA 2G5TA 2RJNA 3FY4A 4G5XA 1QYVA 4RK6A 4RX1A 1KEUA 4WOBA 1O77A 3BF8A 3H5VA 4QNNA 4HNHA 2IV7A 5I7WA 3W9UA 3SZUA 2GHQA 3JWEA 1UK9A 2ZWVA 4WX2B 1IY0A 5GQSA 3WLSA 3C7CB 4ZTZB 1T9KA 5A7GA 1K6IA 3VPFA 3F67A 4IZOA 1GNRA 4JH0A 3OE7D 2QJTA 1UC4B 5KQRA 2D8MA 2Y1OA 1G8AA 2CCKA 1JIQA 1TJ5A 2JKVA 2R4QA 1USUA 1PGJA 3H19A 3IIEA 5K5EA 3V32A 1SHJA 2L17A 2H4ZA 3FNBA 2QTWB 4H9GA 4WZAA 3RB8A 2B98A 4GOKA 2BBOA 3RR2A 4DCVA 3MT9A 1CUDA 4ND5A 3SSNA 1PX0A 1DWOA 1AS2A 3CURA 2A5YB 1I51A 1JN0A 2BCGY 2KLBA 3GWZA 3QVGB 4AUKA 5LDDC 3U81A 1SC9A 4LKOA 1FPMA 1YMQA 2AX3A 4IHAA 4NV3A 5EIOA 3SJAA 1UJBA 5HF5A 4AB1A 1O96A 2NZYA 2QLJA 2IUTA 3F5DA 3KZVA 3W34A 1D2RA 4G0ZA 4UDXX 3LLUA 3H0CA 8AT1A 5CFMA 4OHXA 1U11A 4X44A 2ZCVA 1EQUA 2B2CA 5EYPB 4S0XA 2DHDA 3H04A 3NAGA 2BE7A 1KXZA 4MYSA 3ZXSA 4ZAXA 4AAYA 3AL3A 4CI0B 3QU9A 1QCYA 1WXDA 1T4CB 3BXHA 2XUQA 1C4OA 3R44A 3UJDA 5C8XA 2XECA 2O2SA 4HUQA 5J23A 2RJOA 1QHSA 3IUYA 4R05A 3V4OA 3BS4A 1GNQA 4B6JA 5EP1A 5AVWA 2ARKA 1MUUA 2OR3A 2O7RA 2XMSA 4PG4A 3UBMA 3DUFA 3ZW8A 5GTDA 3KQKA 1SCQA 1A76A 1Y34E 3V9PA 3F9RA 1V1MA 2EF1A 3EZFA 3GLVA 4ZALA 3FSGA 4M46A 4CT5A 5JRDS 4HLCA 4KFSA 3GAFA 2PEZA 2VJQA 4RXMA 2DLCX 3ZJTA 3T06B 3C6YA 4KXNA 1HA3A 3ZJ5A 3IHLA 2W48A 1F2UB 4G23A 4DJ5X 3JS5A 3BFVA 3QQPA 4FZ5A 4HH0A 1C8BA 3H2YA 4AO7A 3IP6A 1HXHA 4KFCA 1JF8A 4YXFA 3QUBA 4KMOA 4QUHA 2ATXA 4I6EA 4P34A 4WH0A 3U13A 2YC4C 4PICA 4C5CA 3PXEA 1XRRA 1P4HA 2CXRA 2WAXA 3AB8A 3IPCA 1OBHA 2I4OA 1H5NA 1MOPA 3OIUA 4MULA 1ULSA 2HF2A 2OO7A 3DBHB 1X1DA 3LY9A 1DXQA 1PS0A 2EVWX 2I6GA 3GJ3A 2WT4A 2QV0A 1QG6A 4KOAA 4YIKA 1FP2A 3IO5A 4IMPA 1D2GA 1E62A 4G01B 2Y9MB 1I14A 4OQ4A 1PJZA 1Z2OX 1JU4A 1H1DA 1Z13A 2BEUB 2VUHB 5A4DA 4ISBA 3H86A 4BRSA 1XP8A 3A1NA 3DC2A 4O4JA 1WCIA 1EGVB 1L8QA 1LPMA 2WUWE 1Q0LA 5LBIA 4IGEA 1VRCA 2G80A 3DPIA 2W8ZA 1CF9A 4GECA 4PPNA 4M55A 1RLJA 4P2GA 4CKWB 2WF8A 1ESMA 1N2GA 3LQ1A 3DR3A 3LUDA 1RYEA 4ES6A 3ENQA 3WLMA 4RPCA 4KHPB 3DM9B 2YOGA 4F85A 2XOKA 1UPUA 2QMZA 5LA6F 3BXGA 1ZHFA 4L2IB 3SF0A 3R0QA 2IJGX 2JCYA 1H0RA 4GOND 4ZVUA 5LZ9A 3OQOA 1HMPA 3RODA 1MB9A 3Q10A 4NPAA 3IKTA 1QIFA 3WK4A 1W8IA 2IV2X 4KN9S 1F0PA 1AU9A 3ANXA 4PZDA 3WWDA 2BTQA 4ENTA 3C1UA 4M0FA 2GN0A 3HL4A 4Z2AA 5INTA 1CDEA 3B1VA 3TNDA 4CF3A 2OAP1 3RRMA 4CCSA 4YASA 3QFCA 4CGYA 4HEJA 3KTFA 2W9XA 3L7YA 2IGTA 1EVIA 2W37A 5AI5A 2L2QA 2ZK7A 4BNYA 2YYAA 5NLLA 5A4IS 1JA9A 1ECLA 2NUBA 4GGOA 4CETA 1EKXA 1LVHA 3JZIA 4PZPA 2Q29A 4WZZA 2OXIA 4ZIRA 5KNLA 1KRWA 3NTUA 3QF4B 1D4FA 4EUNA 2J3JA 3MJSA 2E1RA 3C70A 3UC9A 2GCOA 2IHYA 1GZ3A 3WQBA 1ZGBA 3GJYA 2IVFA 1HE8B 1RAEA 4W5WA 2AOVA 3Q7QA 3ZHYA 4LXGA 3IOBA 5JPDA 5AI6A 2IX3A 1V9SA 3OEYA 1C9DB 2FVYA 3E82A 1GV0A 3TQFA 2VK4A 4PSUA 3RSZA 2B1JA 4ZI3A 1EK0A 2E4WA 4QOFA 3W7AA 1Z22A 2IBSA 2Y2VA 1JNYA 5FL3A 1UOQA 1SO8A 5FULA 4B74A 4U2FA 2G1JA 4GMKA 3MTJA 5I7HA 4LMRA 3L8CA 1Z6XA 3NTLA 5CFLA 3MPUA 2RE8A 3PF9A 1RLUA 4BNHA 3U7RA 1Q1AA 3KQOA 3UW3A 2JFOA 3W9SA 1ZH0A 2E3JA 5TLSA 2JLYA 3FBTA 1DARA 4LRUA 1HMYA 4XFKA 1Z12A 4QD3A 4R2KA 5CT4A 2AYYA 4CL8A 4EH1A 5JD4A 3K2EA 2H1VA 1SKAA 3RSQA 4C4ZA 4PE5B 5LC1A 4NONA 3D02A 5UKDA 3OECA 1LRJA 3OCZA 1IJEA 5DO9A 4CNQA 5JU6A 3A28A 4OFWA 1E4EB 3V8PA 4MUGA 1Z6PA 1GZ5A 1VRWA 3GY0A 1M8KA 3O7WA 1UBRS 4Q19A 1KJJA 1RZUA 2H4YA 4BPBA 3ENVA 3RFTA 3SYNA 2GFQA 2XQIA 2GD2A 3B1JA 4NHOA 4YUYA 4AO8A 1O6ZA 2HK9A 5KPJA 4UVHA 2JI9A 1L4NA 4XI9A 4DGQA 4C4PA 1C1XA 4OHMA 2NYAA 3F8WA 4IVRA 1E3DA 2P6OA 3LYHA 4ENQA 2GAIA 1UWCA 1Y6QA 3JZAA 2C9CA 1EDEA 1TF2A 5H4HA 8MHTA 3BILA 2WP8J 1ECCA 4ML3A 3FMPB 2HQBA 1E2HA 5KNBH 2CDAA 5A05A 1KQNA 2W58A 2VZ8A 3LP8A 4N48A 2VIIA 2OAEA 4RKFA 2MMCA 2F62A 1LK0A 2PR7A 1UP4A 3VUFA 3F73A 4CN9A 1JGTA 3MQFA 3RVJA 3Q2KA 2R1TB 2FZWA 1L8OA 4UPDA 4YJ3B 3VYTB 4CMEA 5BR7A 3EPJA 2P6UA 2BT4A 2ETVA 3LQQA 4CLRA 1XN1A 1JFVA 3NHPA 5KC9A 3GDOA 1JFSA 1RXYA 3HA2A 5GOTA 1FUEA 1GZ6A 4NOKA 5TIIA 1N32B 5HK9A 3C7DB 5J43A 2FFRA 4J16A 3AHGA 4CDMA 5CFZA 1G55A 2HEIA 3ODGA 4KR3A 1FZTA 1HYGA 4Z1MD 1XA0A 2OM2A 3LM8A 3QHQA 2PDAA 3MWFA 4FK8A 1LBIA 4QO8A 1FYEA 1OAAA 4PC6A 4MKFA 1PJAA 4JLBA 2I5PO 1UDCA 2FWNA 2R48A 4GZ6A 4PGGA 2D1SA 3Q6NA 5GZ6A 3T5GA 3OJLA 2VAWA 1G21B 2OORA 2I4RA 3PDIA 2IW1A 2C1XA 1Y4AE 3BVPA 1CHDA 5I4BA 2XOXA 3HUDA 3VZQA 1FDTA 4ALMA 4MA4A 5IMBA 5TMDA 1XVVA 4ID3A 4P98A 2I6FA 3WLNA 2VCHA 3ZV7A 5BOSB 2PXXA 1C3XA 3B20A 1VIYA 4IVPA 2X9LA 5K1ZA 5A3SA 5AICA 4UTXA 5IDYA 1EFRD 3K1TA 3UQZA 1I80A 4MRMA 5CRIA 2Y1LA 3W6NA 5LWQA 1WHSB 5LQDA 3OZTA 3I6ZA 4K6KA 5DOVA 3O3CA 2A9JA 4B87A 3QV1A 3WL6A 3KOXA 4G8DA 4HEQA 3HGTA 3CIFA 3OD5A 4JLVA 3KVRA 4MW5A 4B7XA 2BGGA 4K9DA 3U4CA 4Y18A 3KHUA 2X14A 4BFVA 2YHSA 1F8XA 5A4JA 4RU1A 1BZYA 2GZ1A 1XZBA 3KG2A 4O2RA 3M2PA 3SJUA 1IEXA 4MYHA 3BZUA 4JUDX 5EE0A 5JSZB 3MYYA 3HUFA 1PYOA 1JA1A 1SKYE 2ZQZA 3OZSA 3JWPA 4FZRA 1H2RS 4F4FA 3R20A 4L5YA 1YR2A 2D1QA 3UMMA 2R6FA 3EW9A 8ABPA 1XMQB 4I4LA 2OBXA 5L95A 1EUDA 2WKQA 4CYMA 5MFPA 2CHGA 1QOPB 2QTAA 3FOWA 3ROGA 4BTLA 2EJCA 5ECYA 3GEGA 4KYVA 5F1OA 3HUUA 3L6DA 4H3VA 3U5Z