1MAWA

Crystal structure of tryptophanyl-trna synthetase complexed with atp in an open conformation
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
326
structure length
326
Chain Sequence
MKTIFSGIQPSGVITIGNYIGALRQFVELQHEYNCYFCIVDQHAITVWQDPHELRQNIRRLAALYLAVGIDPTQATLFIQSEVPAHAQAAWMLQCIVYIGELERMTQFKEKSAGKEAVSAGLLTYPPLMAADILLYNTDIVPVGEDQKQHIELTRDLAERFNKRYGELFTIPEARIPKVGARIMSLVDPTKKMSKSDPNPKAYITLLDDAKTIEKKIKSAVTDSEGTIRYDKEAKPGISNLLNIYSTLSGQSIEELERQYEGKGYGVFKADLAQVVIETLRPIQERYHHWMESEELDRVLDEGAEKANRVASEMVRKMEQAMGLGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interconversion of ATP binding and conformational free energies by tryptophanyl-tRNA synthetase: structures of ATP bound to open and closed, pre-transition-state conformations.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Ligase
molecule keywords TRYPTOPHAN-TRNA LIGASE
total genus 114
structure length 326
sequence length 326
chains with identical sequence B, C, D, E, F
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2002-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 1mawA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1mawA01
1MC1A 5FO1A 3RK1A 1N2IA 1KQNA 3AG5A 1T6YA 4MUHA 3FOCA 5KHAA 4YP6A 3IVCA 4KPUA 5K0SA 4JYZA 2AG6A 2O8VA 3IH5A 1T9GS 3TZLA 1HYBA 1N2EA 4DDKA 4G5FA 2J07A 2QTMA 3P52A 3DPIA 4MW7A 2D13A 1WQ3A 2A1UB 5HUJA 4U8HA 4MAFA 1TYAE 4ZCQA 1N2OA 1IH8A 2IELA 3CLRD 4EG7A 2XRYA 4WSOA 5BNZA 1WXFA 1TYCA 2G36A 3DLAA 4GRIA 4PBRA 2CV2A 3ND7A 3ILVA 1U7XA 3TS1A 4I6JA 3UK2A 1WJGA 5DB4A 2CYCA 3ZXIA 5DASA 4AS1A 3G5AA 2A88A 1OBCA 4QRDA 4MW0A 2CYAA 3CLSC 3FNRA 2D54A 4MWDA 3N9IA 1MJHA 3TNJA 1O0CA 1H1TA 4JFAA 1D2RA 2QTRA 4NDAA 1WXHA 3CLRC 5LFAA 4MQ6A 5EKDA 2H29A 1KORA 1OD6A 3G6KA 5IJXA 2PZBA 2GM3A 2CYBA 1KQOA 3G59A 3VRHA 1CT9A 3CVWA 1VBKA 1S4MA 2OQ2A 4ND6A 4ZT6A 1QJCA 2PXHA 3KT6A 1M1ZA 4H3SA 1R6XA 4ZT7A 5J5AA 3ELBA 1F9AA 2Z3VA 3PXUA 5HUHA 1EJ2A 1J70A 2JA2A 3INNA 1GLNA 1OWLA 3ZIUA 1M8FA 5J58A 2A4MA 2VTBA 2QJOA 4ND7A 1YUMA 5IHXA 4KR7A 4PY2A 2YXNA 3PNVA 4OUDA 1T9GR 4L2IA 4UZFA 4GU5A 1EFPB 1GTRA 2JAXA 4A91A 3FHJA 3A04A 1QQTA 2WSIA 1YIAA 4HJRA 3SYTA 3P0HA 3BL5A 4HJXA 1NZJA 5FO0A 4TS1A 4CT0A 1LW7A 3PNYA 4XSVA 4NAUA 1O95C 1KH3A 4Q16A 1O97C 1KP3A 3OP1A 2TS1A 1JHDA 3LOQA 4QREA 4MVWA 1QU3A 1GZUA 3AIIA 3QTTA 4MUNA 3FWKA 4ZCTA 5TEVA 1QTQA 2V0GA 4EG6A 1NURA 3ZJTA 3X1JA 4EG1A 4J75A 4MVCA 1NUQA 4R2MA 3F3MA 5H16A 2QUJA 1XNHA 3COZA 2DETA 4MUFA 2XRZA 1IFXA 2ZP1A 3H9CA 3CLUC 1NUUA 1I6KA 3COYA 4ZT2A 2V0CA 1U3CA 2EJCA 1WOYA 1N2GA 4UZEA 1TYBE 1OWMA 3CVXA 4JZYA 1QRSA 3ZUGA 1H3FA 5KWVA 1XNJA 4NX2A 2A86A 1P7PA 4MUEA 4YP5A 4DNXA 3TQIA 1I6LA 1T6XA 3RBAA 3A4IA 4MUKA 1M8GA 2VTBB 1H3NA 1KP2A 1PFUA 3HFJA 1F7UA 4Q93A 2GKSA 3N05A 4CDNA 2O5RA 3GLVA 1F7VA 2I1LA 1F4LA 2DUMA 1MRZA 4KKVA 1N2BA 3IMCA 4R0NA 2CFOA 3NV7A 3H05A 2PG3A 4P2BA 3GMIA 1V47A 3DV2A 1EUYA 1X6VA 1QRUA 1J21A 1EFVA 4L2IB 4R2LA 2J4DA 1IRXA 1EUQA 4MVXA 4EFKA 2ZUEA 5AHWA 2CV1A 2BYTA 1OBHA 3ZJUA 1KH1A 2A1UA 4YBRA 2CV0A 1FFYA 4MW2A 1PG0A 3S3TA 1O94D 2OV4A 4XFJA 4BWVA 1K4MA 1O6BA 4ZT4A 2YY5A 3U1VA 1ZJWA 1Q19A 3CVVA 5H7XA 1OWPA 1NI5A 1GN8A 3SP1A 4U7JA 1QU2A 4MW5A 4PBSA 2X1MA 1GTSA 1UFVA 4NATA 5TS2A 3RJZA 1A8HA 1ZH0A 1IQRA 3N2YA 4HK4A 3DO8A 1O0BA 3RK0A 3MLBA 4DJAA 1G8FA 4ZT3A 3UY4A 4HPWA 4DDMA 3CR8A 1H3EA 1X8XA 4RUKA 1N3LA 1T6ZA 2Z09A 4DE5A 1R6UA 3K9WA 1M83A 3H9BA 4I6EA 1R6TA 3FDXA 1GAXA 2E0IA 1J1ZA 3TQOA 1I6MA 3IDFA 1JIJA 3ZXSA 1ILEA 1FYDA 1JIKA 1TQ8A 3A2KA 1TFUA 4EF6A 3SZ3A 1VBMA 1SURA 2GOYA 1O96A 4MUIA 2X3FA 5JBNA 1LI5A 4ZCPA 1TYDE 3FIUA 3P0JA 2D5BA 2R5WA 2A1TR 5DEOA 4NZPA 1TEZA 4NAHA 1YI8A 1N78A 1EE1A 1EFVB 3D6VA 3C8ZA 3TZEA 4MLPA 2CUZA 1J20A 2A84A 3HZRA 5LLTA 1BS2A 3MMXA 1COZA 2WB2A 1XNGA 2X0KA 3FG9A 2PFSA 3ZGZA 1M8JA 3MUEA 3CA8A 2QUHA 3COVA 1EFPA 1RQGA 4FZJA 3OTWA 3X1KA 1JEEA 3AG6A 3PRHA 4K03A 1JZQA 1K97A 3CVUA 1WKBA 4G6ZA 4DLPA 2H2AA 2C5SA 1V8FA 3Q10A 1WY5A 2PIDA 4WNYA 1QNFA 5F23A 3SEQA 2J5BA 4MW4A 4X0EA 1MAUA 2A1TS 3COWA 4ARIA 2E21A 2QUKA 1WQ4A 5DK4A 3IVGA 1ZUNA 2CSXA 1IQ0A 4MVYA 3CLUD 4MWCA 3L93A 4EGAA 5HG0A 3FETA 1KQPA 1KAMA 4ZCRA 1MBZA 1WXGA 3UOWA 1O96B 1O95D 2E89A 2YWCA 3CLTC 3IOCA 4U63A 3H97A 2EL7A 4YP7A 1WXIA 4QBTA 3IVXA 2B7LA 1KH2A 2IP1A 3AKZA 2YWBA 2RE8A 3KT0A 2DXIA 3IUEA 3FH0A 4MULA 1DNPA 3SZGA 3N8HA 3H99A 3UMVA 1N2HA 1K4KA 3FI0A 2HGZA 4MUGA 2X1LA 4F4HA 1KR2A 1J1UA 1KKUA 1I2DA 3LCJA 4I6GA 1NSYA 2ZUFA 1M8PA 1YIDA 2AKEA 1YULA 1MB2A 2BTEA 3CVYA 1JEDA 3NBAA 2WQ6A 3MXTA 5LM3A 2DEUA 1NUTA 3CLTD 4MW9A 1Q77A 1WXEA 1K92A 3AFHA 1O5TA 1JIIA 2DPLA 3Q4GA 3GUZA 5TGTA 4EG3A 2CT8A 4EG5A 1PFYA 1U0BB 3KFLA 1PFVA 4K0RA 3HV0A 1GPMA 4CQNA 4JXXA 2WQ7A 1WZ2A 2DLCX 3IODA 3Q12A 1G59A 4AQ7A 1MAWA 3QE4A 3RHSA 1XJQA 1O97D 1ZH6A 1U7DA 3HL4A 4MWEA 3L92A 3D6UA 5K0TA 1VBNA 2QJFA 1NUSA 2DERA 3RFFA 1JMVA 3A05A 3FY4A 1EXDA 5KCMA 4ARCA 1VLHA 1N2JA 1O94C 1Y42X 4OJMX 2Z08A 2A7XA 4F3RA 3X1MA 2AZXA 3IOBA 1MB9A 3M5WA 4CDMA 2DR2A 2RD2A 3MLAA 1JGTA 3ZJVA 3P0IA 4J76A 3IUBA 4KPUB 3JXEA 4MW6A 2QJTA 3I05A 4EG4A 5FNZA 3PNBA 1QRTA 4OUDB 4S1OA 2NZ2A 5TEWA 1JILA 4EG8A 2QTNA 1NYLA 2HZ7A 4DDHA 3LE8A 1JZSA 3HGMA 3AL0C 3IOEA 4MW1A 1NUPA 1U3DA 3ND6A 3CLSD 3K32A 5J59A 1OWOA 1Q15A 1PFWA 1N77A 4KR6A 4RPIA 2HMAA 2PZAA 2PZ8A 2E18A 1OWNA 1Q11A 1M8KA 3HMQA 2QUIA 1B6TA 1MOPA 3ISJA 1LI7A 4G5YA 1G8HA 3UC5A 3SEZA 1JECA 1KAQA 3VU8A 4E1AA 1IVSA 4JXZA 3VGJA 1N1DA 4ZT5A 3SDBA 1YUNA 1VL2A 2J09A 1PG2A 2J08A 1N75A 3ND5A 4XFDA 3KT8A 2JANA 3NBKA 4KR9A 4YMIA 4MUJA 3IMGA 3QTBA 3E27A 1J09A 3IMEA 1IHOA 1NP7A 4ZCSA 2NSYA 1ULHA 3KT3A 4PBTA 1IQUA 2VXOA 1G8GA 2IJGX 4MWBA
chains in the Genus database with same CATH superfamily
2Z4TA 1MR3F 1W52X 3DZCA 3AEUA 5G53C 3L6DA 3OQHA 4E94A 4RTLA 2AYXA 3PKZA 3U3MA 1XK6A 4G25A 1WHSB 3LI2A 4QATA 1U5CA 1OIVA 5BQ5A 2JHCA 2E37A 1ZNQO 2R7KA 1UZUA 3GEGA 4OREX 3TTXA 4I1OA 1URPA 2CXPA 3PQEA 4ZOBA 4B7XA 4DCCA 1DEKA 4DTCA 2AOVA 4G5FA 3P9XA 3SQXA 1YWGO 4HCJA 1XALA 5KVQA 3EH1A 5KYXB 4P32A 1OF1A 2ZIFA 3QELB 1DC7A 2Z6QA 2FGKA 1D2AA 1Z2CA 4XGQA 2RI0A 4HBGA 3ZTYA 4HKTA 2IZ6A 4ARBA 3M6IA 1ZD4A 4H1HA 3T3NA 3MRTA 2G40A 4JX8A 1YA6A 4ALKA 4M1YA 2I76A 4HN9A 3GVPA 3T9AA 4G0XA 1GUAA 3AFIA 1G19A 3LBNA 3OG9A 4C6RA 4EBBA 2HQSA 4AJ1A 1INLA 1JHRA 2CLKB 3ILVA 3GGGA 5BT9A 3M3PA 2DPYA 4OH1A 4FEGA 3T7IA 2BGGA 1Z6XA 1WCWA 4YS6A 5I7EA 4WVFA 3RVKA 3TM5A 4AUEA 3QU4A 1YRHA 4AJNA 4DQKA 3HCEA 4OA8A 4DJFC 5A0FA 1ADGA 1LDGA 1ONOA 2QY6A 2Z5VA 3ESCA 2REQB 5JZMA 2CYAA 3FNRA 1QG6A 2C7GA 1RXIA 3BWCA 3EZNA 4NMLA 4F96A 2X8LA 4HWGA 4PIVA 1D2RA 1SBHA 3P9QA 5IM4A 2FPIB 1K3TA 5HKKD 4BFTA 1T36A 2BR5A 1VCIA 3ZY6A 4AO8A 2ZUDA 4QUKA 1CZKA 4I2VA 2CCJA 2FLKA 3TD9A 2AN3A 2D8AA 2Z8XA 4NKRA 1IM8A 3PLNA 5K0NA 5LJLA 4B34A 1LPNA 3ODGA 2H1RA 2IYOA 4M0LA 4BUJA 1E9FA 2XKJE 4G81A 4IWYA 3O1JC 4V1CI 2OKGA 4GBGA 1M1ZA 3H17A 3W3AA 1DADA 4DDWA 1EKXA 1N9KA 1NNUA 3A4LA 3LU1A 5D3QA 4ZEXA 3PIDA 1KDRA 4OK3A 1BNCA 1KTVA 3EWAA 3MIIA 1IVSA 1BKSB 1HT0A 1WZIA 1ZJJA 1K7XB 4XGRA 4ZHQA 4EZEA 1V3UA 4RX1A 3ZOKA 1G6OA 1OTYA 4WUTA 1JPJA 2ODBA 3DMYA 2I8AA 3B51X 3LGAA 4QYWA 4WZBE 5A5VA 3A1TA 1J9EA 1PLLA 4MJ3A 4XR4A 1M2KA 4FOSA 1TCAA 4URHA 4BFVA 2CBXA 2YNMC 4JJAA 4C05A 5B7NA 5KOJA 3S2UA 3CUSA 1E3QA 4BX8A 1EXNA 3I5XA 1Y1SA 2DOKA 5M29A 1WSAA 1F3LA 4EX7A 2BZ1A 1Q0LA 2CJXA 2VUSA 4QLBA 2NU6B 2W93A 5A9TA 3VZSA 1VKHA 1VZ3A 1X9HA 2WUDA 4B8ZA 4BQFA 5I3ZA 5KDOA 1Y1KE 1YNSA 3E84A 3BHMA 1QX4A 4HJXA 1JBEA 1YL6A 3KKLA 2JCBA 3GVIA 4LCEA 4DJTA 4REOA 2ERXA 4NAUA 3UIEA 4CFYA 1OJ7A 4MQLA 4D9BA 1O97C 2VZLA 3G7NA 2OZVA 4FKZA 3GN1A 4UTZA 1YGYA 3MZ0A 4EHJA 2NU7B 1WMDA 1KEUA 4BQSA 3KZ1E 1PTJC 3QEAZ 2AMFA 4B1FA 1OH5A 1XZ8A 2NPIA 3CX4A 5KJ1A 1EX9A 4PZAA 2YQZA 2QUAA 2I6QA 1W4RA 3FWKA 4B3FX 1E20A 2R48A 1WZUA 2K2WA 4WUVA 2Q0XA 3CIOA 4OL9A 4Z3DA 2ZAOA 3ZU2A 3L1IA 4RD2A 1HGXA 1XTKA 2RHHA 4WEQA 3G9TA 3GXOA 3X1XA 4C04A 1VE3A 3AONB 4JH0A 4E07A 1YTLA 2FW8A 1V16B 2LVBA 3RKRA 2HXGA 3S27A 2H52A 3H9CA 2YNMA 1BDJA 2FYTA 3GLTA 3GXBA 2HNBA 4KWHA 4RHFA 1MGOA 3PENA 5B2ZA 3ZWNA 3O4RA 2A2ZA 4UZEA 2AZTA 4EY3A 2QLMA 4DLTA 1BS1A 2KLBA 4PCUA 1H1LA 3CKKA 3GPLA 5AW1A 3ZNQA 4IHAA 2WPNA 1RWQA 3GJRA 1YJQA 4RH0A 1JDBB 2WC1A 3S7ZA 5F2EA 5KTYA 4MZDA 3D4LA 4FE7A 2PL3A 4R8KA 5CFPA 1SO8A 3MQFA 4TWBA 3VSBA 1L4EA 1CJSA 1I1NA 2AH5A 1SB8A 2UZ4A 1BQ4A 3R1IA 3UMSA 1PL7A 2DBVO 4LYEA 4BJHB 1OA0A 2BMEA 2ZCVA 3GD5A 4AY5A 3ND9A 2WW8A 3UT6A 3NV7A 1E1QD 4RZSA 3N0RA 2ADFA 2F67A 3K8YA 3QEMB 4LZJA 2JKVA 4P2BA 4ZTUB 3OZDA 1NNLA 3HN7A 1A4IA 2EKPA 1WPGA 1J21A 4C7OA 3H4MA 2AK2A 4KH0A 2GSDA 1GPNA 1DC3A 3I2KA 3RUAA 5DVZA 3JWHA 4MJ7A 4ND8A 3EGWA 1XL1A 2P8SA 2YZ7A 4A2QA 2QTZA 3K2QA 4RSMA 3PNSA 4BUCA 1NNSA 1Q50A 4C4ZA 1Y63A 2A3NA 5KTSA 5FTJA 3K16A 1T5SA 4JVMA 2RHTA 3N70A 1LBSA 3DE3X 4OQFA 3O8OB 2R00C 5J4HA 1RRMA 3DMDA 4CKCA 4BWVA 4FKMA 2RCYA 2TMGA 3ACDA 2ZRGA 1L5HB 3WNCA 3HXMA 4D26A 2BFPA 1W1WA 1BEUB 1UXHA 2PGDA 4MP6A 1KE1A 1YRLA 2CVQA 4NOLA 3ETLA 3X1WA 2BFEA 1QHHB 4LDZA 4WACA 3V1NA 2JHGA 5TGZA 3SOZA 1SOAA 2JAWA 4W1SA 4LQLA 3D2BA 1LZKA 1P0FA 3FVRA 4QOFA 1N8TA 3KJGA 1PKEA 2G08A 4K1XA 4C4XA 4CMEA 2RGAA 3MILA 2R79A 1UKEA 2VAPA 3IKLA 5DHAA 3A6PC 2XRMA 3SF0A 5AT1A 1W29A 4RUKA 4ND1A 2PHZA 3QJGA 5DBHX 2AMJA 4QXPA 2MYTA 3K0FA 3RK4A 4MH0R 1JJ7A 1QF7A 5T4EA 1RAFA 2ARKA 3GLFB 4IJKA 2RHDA 4WD3A 1MFZA 1DZ3A 3PS9A 1VKRA 3B8HA 1FVXA 4HAOA 4UULA 5KYKA 1I94B 3L1HA 1VPVA 4GPD1 4RENA 4RY2A 2UXDB 1EAMA 2OO5C 1U2EA 2JZOA 2CK3A 3BHJA 4IIUA 1FIUA 2NW6A 1A98A 2XGJA 1SC1A 3L8MA 2MT9A 3A2KA 1N9GB 1X86B 2C1ZA 3LZDA 2COEA 2PZMA 1QGZA 2PPLA 1L5QA 4IFIA 2CLDX 1XZNA 3S2GA 4XZ3A 3C3WA 4P4UA 5A5DA 1G2PA 1LI5A 4MYRA 3AR4A 3R5XA 3OJCA 2BFCA 3DZHA 1FDTA 1B2RA 3CEMA 1JR3A 3OE1A 4NG5A 1IBLB 3DBRB 4KO4S 1K88A 4NXMB 2W11A 4KMMA 4QUEA 3BRCA 1S89A 1RIIA 4FUQA 1IQPA 1YQDA 2OPBA 4XASA 4D8UA 1BVRA 2GYYA 2Z57A 3AF6A 4ODIA 4R3NA 4R0VA 3K2IA 5LQKA 5EC8A 4LXTA 4O3MA 2JI7A 4WA7A 4ICIA 4OYLA 4TSRA 3VR3A 1DEOA 2CFIA 2WLSA 3NFYA 5J40A 4CM9A 2D2EA 1YFKA 3GEEA 4WL0A 3TSWA 2PGXA 3DNMA 3K7EA 4S24A 3LK7A 5YASA 2JLZA 4RIEA 1Q5PA 2FFHA 3LXMA 1XXHB 2H8KA 3AG6A 2RMKA 3S68A 3JYOA 3F6YA 3NMUF 4OP3A 4PN7A 3RUIA 1CS0A 2N1BA 1G98A 5E4JA 4LJKA 5JXWA 4BMDA 4YMVA 4GXQA 5K4GA 3DFZA 4ME6A 1RLUA 1QHEA 4XIYA 1CRLA 4KR0A 3SKYA 3UB4A 2PUAA 1VKNA 2HK8A 4D9NA 4GQIA 3IQIX 3ZE1B 2GD2A 4BYMA 5A04A 1QXSA 3AVVA 4EKDA 2C94A 1QZTA 4FFMA 1VG8A 1UT5A 2GWRA 2XSZD 1E1DA 1MORA 3GZNB 1Z26A 2BBOA 2VKQA 2BGIA 1ZCZA 4JB0A 3EVDA 1YV9A 2IZ5A 1H42A 1IZ7A 2YUTA 3NHSA 2EF0A 3AW9A 3B82A 2E85A 3H11A 4EKYA 3VU9A 3AM1A 1TYEB 1XPRA 4KXFB 5ALPA 1BFUA 3DEKA 3NRBA 4MV1A 4OI1A 3MUFA 3OEHD 1N6PA 1K27A 3R3YA 1VM6A 2YC4C 3S2FA 4QE3A 3FETA 1ZN8A 1L4HA 1XYGA 3LDFA 2FZEA 5DWVA 1NKSA 1XXHE 5KOHA 1VLJA 3HRHA 4EHBA 5HZHA 3O2SB 3ZY3A 1KAOA 2MSDB 2I8CA 2EL7A 2V74B 3M6UA 4KVAA 5I7SA 4UDOA 4NBWA 4D9EA 3C97A 3N86A 2PIAA 1N5MA 3OPVA 3P4UA 3PUWA 3ZD9A 1ZNWA 3KJHA 4TMTA 4XVQA 4FDAA 2CHGA 1KZGB 3D9QX 4FHCA 5ER9A 2GJKA 5K0BA 4JL5A 4OATA 3JPWA 4GX2A 3SYLA 5IJ0B 2DPMA 2HJGA 3F6EX 2B7CA 4N4AA 3EWNA 2R6AA 2HBRA 3ORHA 3KALA 2P1DA 1ML4A 2QR3A 4TXLA 5LB2A 3BB3A 4UEJA 3S29A 3VTKA 3K70C 3PDCA 2XCTB 3B70A 3HSKA 2ZR8A 2WJHA 4UMVA 4WE3A 4OBBA 1U99A 3WL4A 1FJ2A 2WPDD 3DD1A 3FWYA 4UJ3A 2B9VA 1XZAA 2RK3A 2ICAA 3NU1A 2OYCA 4D6YA 4GXNA 5IYZB 3AINA 2BGMA 3PIRA 4J3FA 3P2YA 3LX6A 2YJTD 2I1QA 1YB2A 3MWYW 2BTEA 3G88A 2P0AA 5IAGA 1OLUB 5BSEA 1NBMD 4JLSA 1KY4A 4LRWA 3BMCB 1RTKA 2QRQA 4LDQA 2AFVA 5DW0A 1WXEA 3IR7A 3GFPA 3SS7X 2UXBB 2BIFA 2OKCA 1TMGE 4AY4A 3FNBA 2DR3A 3GUZA 4N41A 3ANLA 3F4KA 1AMNA 1GDTA 1EXWA 2ZJZA 4M1TA 2A58A 2W2TA 3HPRA 4FHGA 4J1TA 4WOCA 4Y6LA 1C4WA 1Q0QA 4XAQA 1I9CA 4BNJA 3HV0A 4P4LA 2ZK7A 2VDWB 3GA7A 2D0DA 4JJEA 4YMWA 3A1EA 4N8EA 3FMPB 3SK0A 2ZJAA 4NZYA 2BGTA 1XTIA 4AP5A 3L0YA 4CUJA 1WCXA 2VDUE 4TXJA 3EPJA 2FUNB 1IN4A 2FTKE 3ASVA 2ZXEA 4Z9YA 3UGJA 3TF5A 8MHTA 4L50A 4F6CA 4LF4B 3UJ3X 3L92A 3ZV3A 2LIVA 2QI9C 3VC1A 3N0VA 4NU6A 5FYDA 1E7QA 4OJKA 5AUPB 4JI8B 3EVGA 4OB6A 3H84A 3I4CA 2QJFA 3BTOA 1HFJA 3KKPA 3P2EA 5FLKA 3RUEA 3RYIB 3WKCA 1P9WA 2QMOA 3A05A 3BGDA 3G5MA 4U5XA 3WK9A 1FL9A 3F2VA 2YJ3A 1EFAA 3ETJA 3QWAA 5EKUA 2OHOA 4PZUA 3LT1A 2IVFA 3THRA 1OU4A 2HL6A 4TKMA 4YQFA 5KOIA 4C21A 4HYEA 4KE6A 1NG9A 4QSHA 3P32A 3ZJVA 1Q16A 2HSZA 1H65A 1GNVA 1XVTA 4US2R 2XZLA 2OM6A 1RLMA 4WXEA 1T9AA 3PPXA 4AC9A 4HX2A 5D51S 4FLEA 1CD5A 3K8ZA 3PC4A 3U1BA 2ADOA 2QTNA 3CG0A 1D6SA 2HDOA 1IG0A 2O6HA 3OEYA 5K8TA 3W5DA 5KNLA 4HEA1 5DMXA 5LN1A 4GE3A 1JKXA 3DCJA 1KBZA 3JQ7A 3G02A 1ODSA 4ZVOA 4MVJE 2NTJA 3UOGA 4IXWA 2HMVA 3FCXA 4C03A 3N6VA 2V6IA 4RPKA 2NUPB 2J0SA 2GEBA 4BFCA 3O21A 1JEQB 5BR8B 1WUIS 3O74A 1SA0A 4FGWA 1YIOA 2PZ8A 5K3FB 4HWSA 4A27A 3G89A 1X1DA 2O7NA 4P80A 3IEKA 4G09A 4TVOA 4DA6A 1G8HA 3UC5A 2P91A 5FBHA 2FW6A 4R9SA 5IVHA 2A59A 4KGDA 4D3SA 3I1JA 3VI3B 3DHNA 4DBVO 4Z3OA 2XOKA 4G89A 4ZOLA 2XWJI 3W4IA 1C9JA 1QHHA 3RJTA 4HF7A 4UE6A 3KCNA 4MHTA 1RKUA 2IDZA 4XGIA 4WFQA 4CR7A 3OE7A 1GILA 4JSTA 4DYDA 1Y7HA 3C6XA 4JKIA 2HQRA 4OU4A 4LCBA 3N7TA 4RA9B 1TAUA 1IAQA 1ZA1A 4FMBB 1L5LA 1GD1O 2P5UA 3WFIA 1OZAA 1OFTA 5HQTA 2CNLA 5E6RB 4CDRA 3OWXA 4NABA 2FPPB 4CQJA 3AIOA 3IMEA 4OOEA 1HPLA 2B69A 3FNGA 2HT6A 3SVZA 1NN5A 1KKMA 1DG3A 1ZHHA 4RWZA 2WOOA 4WFJA 3T3DA 1BU5A 1W36B 1KP9A 3RK1A 1JG6A 3FPHA 3VU0A 3STUA 5BOSB 4H7EA 1XRMA 3MYRA 3DMHA 4FGJA 5IWAB 1IXYA 2CJWB 3A14A 1N4DA 2CL6X 3WDKA 3KVNA 3H2JA 2YZKA 4IDGA 3WB0A 3L1VA 1LV7A 2G5CA 2ZIWB 3HGTA 3KTOA 2ODAA 4P7BA 4U2BA 5D3MB 5DJ5A 1W9HA 1UAYA 3NTVA 3RRJA 4AW9A 4L9RA 2QN1A 1SU6A 3JQGA 3S2IA 3VR5H 5BPFA 1GU0A 4ZA2A 4X6YA 3RC1A 2J07A 1E5TA 1OBOA 1ZOOA 2FWNA 5IPFA 4FZ3A 5G0VA 3G8BA 2IU3A 4UUNA 5HRUA 4MA4A 1TO6A 4YA6A 2JGAA 1PSDA 3U7JA 4N5IX 2IELA 2MSNA 3OOHA 3CO0S 4TSKA 3THWB 2NAFA 4QDXA 4FW8A 3AYZB 4NRDA 1AXEA 1LNQA 4TTRA 1ZJYA 1GGFA 5CJ2A 2C7QA 4XCXA 1Z38A 4KO1S 3CNEA 3JQ9A 3URMA 3O92A 5JAIA 1Z63A 1RD4A 1QS0B 2G77B 4JWTA 1X9GA 4YO7A 5TPWB 3GB9A 4HAUA 2YFYA 1K1EA 1TZJA 1SMKA 1YS4A 4M21A 5JRJA 1F1BA 2XQJA 4B7CA 1MAHA 1D1QA 1BJKA 1NHWA 2RHWA 2I33A 2WYWA 4P0TA 2NN3C 5KWSA 1N3IA 3DOCA 5IK2D 3W5AA 4BNMA 2XEDA 2XQIA 3KXIA 5KTOA 3OQMA 3QNUA 1Z5UA 1Q2XA 1U2QA 5KS2A 2AKYA 3E3AA 5E6SA 1TD9A 1KMIY 5SV2A 3LYHA 5EZ6B 4JFAA 3OOSA 1KSGA 2POQX 3G49A 3K6KA 2Q9UA 5JD6A 1JG4A 2RGCA 1EFTA 1FUEA 3GBPA 5CA1B 1YJ8A 3LP6A 1L4NA 3RO7A 2QROA 4OMCA 2ZIEA 1VIDA 2JH3A 3BB1A 4DIDA 1FRVA 2M6SA 3BH0A 4UHCA 1OFGA 1NLZA 3HRKA 1LH0A 1YZVA 3O75A 5DNUA 621PA 5IKOA 2B61A 1AH2A 2BH2A 4FCCA 1QCCA 2FDRA 3LCRA 2PL9A 3IJPA 4CKBA 1RE1A 3HB1A 2ZZMA 4ND6A 2NXCA 3AKEA 2C00A 4JQOA 4TTIA 1LY1A 2B30A 2X0JA 3D3JA 4OVKA 3UWMA 5EYPA 4WBNB 3F6RA 3ZE2B 2ORIA 4Q7EA 1AXRA 1NXPA 2JJ8A 3ZLBA 3FKSD 1RVDA 4ZAGA 1W49A 3ICPA 3HH8A 5HUHA 2FPLA 2JA2A 3WWYA 1ECFA 3Q7PA 4BNDB 2FZCA 3H19A 1K5PA 1Q1NA 3NHAA 4NYIR 3R3JA 1ZK0A 2QYSA 2GAFA 4TKLA 2EV9A 2H2GA 5LYYA 4QU8A 2H0QA 2QJRA 5GONF 1EDOA 1ZD9A 1EHYA 1PP4A 1IY0A 2ZRPA 4W9NC 1NQXA 2QHXA 4E46A 4QTZA 4RD1A 2FW1A 3SKVA 3H6KA 1X2BA 4M4SA 1JDSA 4TOIA 4UZFA 4WZBA 1J0AA 2C77A 3MJEA 3SD7A 3HI6A 5I7FA 4QQKA 1ECPA 3A04A 1PFQA 1SUIA 3DCNA 4S2EA 3UC9A 3GEPA 3RRBA 2F8MA 4NTZA 1KDVA 4YJFB 1GG5A 1W59A 2UXCB 3TO5A 3PLAE 5FWXB 3R7LA 1R8QA 4DXHA 1G1MA 1DBIA 3RYFA 1ZW1A 2FJPA 4O33A 4ARVA 1VGQA 3LL7A 6Q21A 1Y6GA 4OPMA 2KI5A 1WG8A 3AEXA 3NB0A 3RSSA 5KOHB 4Q3AA 1R3DA 1SVOA 3RVNA 7MDHA 3V1TC 4A0SA 1AMOA 2PXAA 2C8VA 2C20A 1OXMA 4EL5A 4BO4A 2FPMA 1ZMOA 1AQJA 3U7HB 1YVRA 1Q12A 2BFOA 1XG5A 2YRXA 2W4IA 4L4XA 5IF3A 3VSAA 3SQOA 1L7RA 3D0QA 3ONDA 4J75A 5HTKA 5DCYA 3X0DA 3H1TA 2Q29A 2IUTA 8AT1A 3M70A 1G5TA 1KFJB 2WJAA 3QVJA 1AKEA 1W30A 1XNHA 4FFBB 2NQTA 4M0PA 5GV8A 2EKBA 3FLEA 3FUTA 4QFDA 5FFMA 5B3JA 2XRZA 1XTBA 3R75A 2IHNA 1QRRA 5BYBA 4ZT2A 1PNOA 2WWGA 4MCHA 5IN4A 3EDRA 1U3CA 4E1BA 3S5JA 1TYBE 3MQ4A 2P7HA 1QRSA 1HC7A 1TU3A 1LPAB 2VHXA 4BZWA 3CJRA 3OQOA 4NX2A 2A86A 3NGMA 1JFVA 3GZTB 4JSRA 4F4CA 2J9ZB 3EIXA 4WLEA 1QBGA 3K73O 4FNAA 3QVGA 4RIHA 5DH9A 5FRDA 1Q83A 3DC7A 1KP2A 3ZZTA 2AOUA 2VK2A 1HORA 3N05A 2H17A 4WPGA 1YZUA 3R3WA 1M7HA 2FLWA 2QAIA 3RRZA 3ZDZB 2WMNB 2ATXA 3DDHA 3RYIA 4AMUA 4EYEA 3HVKA 4LW8A 4UHEA 2OYSA 2D5IA 2PMBA 2PJUA 4D0SA 2VBCA 2CL7X 4JLMA 521PA 2F9FA 2EWMA 3IC5A 4P5PA 4UBMA 5GZ1A 5HJ2A 1G8YA 1V4VA 1DHTA 3NIDB 2ZXFA 4CMCA 4KOEC 1X6VA 3NBMA 1AE1A 1DU4A 3HG7A 5FL3A 3E7FA 2XDYA 3OQJA 3HP1A 1UBSB 1IY2A 4M6WA 5EWJA 4FDTA 5M5BA 3W9UA 3ZLVA 2XE6A 1VMDA 4KYVA 2WKRA 3ZQ4A 2Q5LA 3IIMA 1P4RA 3ER6A 2CV0A 2BE7A 1IJEA 2EF1A 1U4SA 1TO1E 2ZVQX 2Y71A 4J90A 1T5IA 1JWLA 1NRWA 5I9MA 1T13A 3VX4A 4OQEA 3ERCA 4P98A 2R751 3KU4A 4P6VF 2B37A 3Q3HA 4ZI2A 2VSXA 1YHYA 1OWPA 3QGMA 3JVDA 3PUYA 1N92A 1NI5A 4KXUA 1QYDA 4OXYA 5CM8B 2PX5A 5GJWC 1YS7A 2JASA 1IHYA 1JMKC 3BDAA 3F67A 3I73A 4FCTA 5THKA 4BKRA 1E1LA 4XWTA 1QLHA 2Z5FA 3NR2A 4LXYA 2UU9B 1BRMA 1KO4A 2EDAA 4QBGB 3MS4A 3DKPA 3PHBE 2QVGA 2X2EA 1LBQA 3GRUA 4XIIA 4ZCMA 1D2NA 1HTBA 1TDJA 3WLLA 2A33A 3GGJA 1ZO8A 1Y8AA 2IE0A 4PSVA 4RTQA 5DM4A 1AGXA 3CH6A 1OHHA 2NUPA 1TAHA 3TZKA 3W04A 2WYVA 2GBIA 3KB6A 3MA0A 3ZWBA 3I72A 1J2RA 2G80A 3K09A 1G20B 2X4DA 2JGFA 4RV9A 3RS3A 2AN4A 3LOUA 4H1WA 5LCXA 1WUYA 2H07A 4UREA 1XTSA 5DK6A 5DSTA 4BRSA 1L4LA 1RAAA 1ZUNB 1LK5A 1HA3A 4JEUA 5DXFA 1U9IA 2A67A 5MN6A 2NVBA 2ZTMA 4KNVA 5EXTA 2JJ2A 3ZHRA 4EA8A 3PGLA 4BX0A 2L18A 3CWZA 4PLFA 4Q1EA 1JAZA 1Q1BA 1VMAA 1XWWA 5J9FA 2AMLA 4LFAB 2NT4A 3DTNA 3E4CA 3FGPA 3H1EA 4IS2A 4FBLA 4B9EA 1OLXB 3CWCA 3I6BA 1GT6A 3GEDA 1ZONA 4AICA 3T9CA 4M88A 1Q3TA 3C39A 1T9DA 2HJWA 5JVDB 3ZV4A 3TJZA 2OAQ1 5HKBA 1PJ4A 4MB6A 5B53A 5ISMA 2BSQA 4QYMA 5C18A 5IM5A 1HR0B 4OM7A 2HCTA 2O3SA 3CUYA 4LOAA 5K2OA 1ICIA 4XDHA 1CRWG 3AY7A 2V9CA 1FP4A 2GN6A 4XRGA 4DCNA 2QORA 1YDHA 4OXIA 5M34A 1LWOA 4MV9A 3SHWA 4NOKA 1B3RA 2GPAA 2BISA 1SVIA 2PR7A 2ZJ3A 4TSFA 4NEHB 3DGEC 4HQLA 4J1SA 4WT7A 1NNI1 1P19A 3CONA 2FPXA 3RT9A 5IMSA 1MO5A 3VPBA 2O05A 4D3DA 2P78A 3ZTTA 1XRPA 2OCPA 1A8IA 2L17A 4RMIA 2Z5GA 4Q03A 5DM70 2V7PA 5B58C 1CUFA 4M60A 4ARAA 1DIAA 3NBZC 1AUQA 3GT0A 3NC1C 2NNWB 4MP8A 2QM0A 2QW8A 4WNCA 5F51A 5SYNA 1EZ1A 1A0OA 5ERXA 2D7CA 2JGMA 1WY5A 7GPBA 4HRAA 5BWMA 1AY0A 3DDSA 1T2EA 1Q1GA 1LA2A 5LLDA 4JT2A 1GNSA 2J5BA 1ZXXA 3CURA 4CTMA 5IAAA 1UJNA 3EISA 1YZQA 3PR3A 3GDOA 4NQRA 5AIAA 3WYGA 4O59O 2OBFA 1EVQA 1CLUA 1YDWA 1HX7A 4ARIA 3WP1B 1MO3A 2MSKA 1UMCB 2LCQA 4NZ9A 4C4PA 1A3CA 4F60A 1U2GA 2R9VA 2J85A 3CE6A 1MQ8B 3HL0A 2IWHA 2GVZC 1WNTA 1XLWA 2W43A 3HS3A 1K5DA 3L0IB 3LCVB 4UAUA 4ZZ2A 5KNCD 1PD1A 4NIMA 5FLYA 5AI9A 1LVHA 3GAZA 1EFLA 1YRBA 5A4MS 1O57A 5A71A 4PR0A 1O3YA 2CLIB 1FLAA 5DP1A 2EWWA 3E5MA 3BQMB 3TD2A 1R5JA 2HADA 2J6CA 4UEQA 4EJSB 5CD1A 3MWEB 4MEAA 3R9KA 5AIBA 1QZZA 1PDVA 3VVBA 4EMSA 2Q46A 4HR7A 1EVEA 3H7AA 1MEEA 4Y2UA 4CCYB 2RE8A 1KVTA 5AK6A 3LW8A 2RJOA 3DM9B 1S3GA 3N6XA 1O95A 1RAIA 2COUA 4AULA 4HY3A 1C2TA 1N2HA 4FW9A 5DFAA 1GZHB 4JC4A 2AD1A 4MUGA 1ATZA 3AVOA 1RLOA 4UJ5A 1E79A 4EFNA 2P2ZA 3DE2X 5HE8A 1M6VA 1TTHA 1WUTA 4GMKA 4M37A 4Z8XA 1DAMA 2GVNA 1GGHA 1YFZA 4MVJD 1R8XA 1NLMA 4JBLA 4Y18A 3LHFA 1DFGA 2VEOA 3MWDA 3U7RA 3RTEA 3WS7A 3ZZUA 3R6WA 3AETA 1JHAA 1XTVA 1N5OX 1QB8A 3A8TA 2F4NA 2B98A 2Q4DA 1XRLA 3Q72A 4E03A 3FI9A 3MJFA 2QPLA 3CFYA 3CEHA 2V8BA 2WF7A 3ANSA 3FTPA 3IP5A 3NNNA 4AYTA 1NMEA 2VUHB 1Q77A 1M2GA 2WE7A 1ZITA 3QTLA 1T36B 2AW3A 1DPGA 2VNKA 2GMWA 3GWZA 3F3KA 3N7AA 1JIUA 2HF9A 3ZV6A 3DT6A 1E9CA 1U0EA 2V54A 5JVDF 5K3BA 1G42A 3E5RA 1VI6A 2VHUA 2ZKIA 3KFLA 4CW7A 2GCNA 4KQ6A 1AKYA 4EEXA 3LUDA 1ZIDA 2FWRA 5HWSA 3LP5A 1HOTA 1ZISA 1TEHA 4R5HA 3T7DA 4X54A 3MINB 5A0VA 3NQ41 3QKSB 4P7KA 1QF9A 4MIKA 2O0KA 3D0OA 2VDWA 4E32A 5KYWB 3JAMA 5AKHA 4YCNA 4CG2A 3OJOA 2ORYA 4MR7B 1MH1A 4NEQA 3ZJ4A 1NVFA 2NLOA 4J0KA 1P9RA 1DRJA 1OASA 2JRCA 3I2IA 4I1YA 4REMA 3ABQB 4MYHA 2Q5OA 3JQAB 2WHQA 3W4JA 4BNXA 4K2AA 1UXOA 3DW1X 2CHVA 4C3VA 3MB5A 3QLVA 4A3SA 1X1CA 1QU2A 3TNLA 3OOJA 1Q21A 2ACVA 4OAOA 1MVOA 4CLOA 3I4FA 3DZFA 1IK6A 3TGWA 1RM5A 4FFRA 1DRWA 3EXEA 2BGNA 4RHUA 3VMMA 4F3RA 3CR7A 4FD2A 1CPYA 4PZEA 3WLHA 5IDYA 2C03A 2VRCA 3NT5A 3D8BA 3U7QA 4F84A 3VPXA 3IUBA 5HKOA 4JMPA 3QMMA 3TM4A 2VJCA 2ID9A 4KVZA 4JLVA 3WQRA 1VTKA 4BFWA 3F46A 3L0CA 5IUKC 4EHAA 4OBXA 3UWPA 4GH5A 4O2BF 4P7FA 3JWIA 3ZWCA 5T67A 1MA3A 4NBVA 1JJIA 2C8JA 4IZ6A 2JL1A 121PA 3K0CC 1RWMA 3I64A 3HGMA 1G3IA 1OX6A 2HLHA 4DYHA 1DB3A 5G4LA 3G6WA 1U3DA 3PCRB 4X6UA 4EH1A 2JKYA 4YXWD 3K70D 4CMAA 4Z53A 3T3GA 1GR0A 3PWSA 3OFND 5ALUA 1JL3A 2PZAA 4PXAA 3RS4A 5JROA 3CNOA 4G5YA 1RRPA 3HMQA 4HLDA 4HNGA 2AJCA 3ZE7A 5GADl 1FW8A 2Y1GA 3BXGA 4NULA 4ZMRA 1NASA 1H0RA 3MJTA 2GBLC 1N0HA 1XDZA 3D6NB 4KDEA 1GGVA 2RONA 3A1SA 3VU8A 2AQKA 1EK5A 2OZLA 3EBPA 4FBGA 1FBNA 5DM60 4OQMA 2FQYA 3KDPA 3RT1A 2ZIAA 5BSUA 1H4SA 1YRQA 1VE5A 3TKAA 2EZUA 1GUZA 4P4TA 3W5JA 3AI7A 4B32A 4ZALA 1T2NA 2O8CA 3ZU3A 2WNHA 1CUBA 1SCQA 1SRRA 3ICWA 2JVKA 3A9RA 4ZV7A 5KDLA 3UZUA 2R8YA 4FVTA 3MTIA 4D9IA 3UCXA 1SXQA 2IDJA 5FQOA 3VH3A 1D09A 1QQBA 3ORSA 1JX6A 3E27A 3K94A 3KC2A 4PINA 4A92A 1QHGA 3AF3A 4XFKA 2CFRA 3DFKA 5D01A 4Y2RA 1OVGA 4Q3OA 2YS7A 1ULHA 1RW4A 2FSVA 2KYRA 2QSUA 1STOA 2VXOA 2XT6A 3CJQA 3DZ8A 3KOXA 4GPZA 4L1KA 5E9AA 1CUVA 4BECA 1I51A 4IKPA 5G3YA 2VNSA 4QXMA 1KVUA 4OKNA 2NVUA 2FR8A 4J03A 2OXRA 4OP2A 4V0RA 4B4WA 5KEIA 1BHO1 4KPUA 3V7WA 4G97A 4Q9AA 2PJRA 3WGYA 1NN3A 4PF1A 1XJ0A 1YUBA 4U7PB 3V80A 1CQWA 3I62A 2PUGA 1HYBA 4YRSA 2HSEA 3H2IA 4RS4A 4V39A 2JEOA 4L6CA 4F04A 3VR5D 4FX2A 4B3JA 5ELXA 1EUDB 1LNSA 5GGXA 2F3RA 4R4JA 4MVJP 1FUIA 1P7VA 3OZWA 4U8HA 1Z4LA 4O4IB 2FVXA 2D1QA 4I50F 4UCQA 4WXYB 3V97A 4RZ2A 4K9SA 3Q8XB 5JBQA 1IN1A 5C34B 5T4FA 3JW8A 1TLTA 1PT9A 1UFKA 1Y3HA 4K9PA 3OI7A 3MJRA 3QKIA 1GADO 4M8LA 5E1BA 1RQLA 1EBUA 3F8WA 3STHA 4W6ZA 1V8BA 5LZ4A 4C7KA 3KKQA 3E6AA 2PLAA 4K9LA 3ZXYA 3IV7A 4PBRA 2FP3A 2GYUA 3I5AA 3MHPA 2P2LA 4Z54A 2D6FA 2VT6A 2OHGA 1DT5A 3NIFB 3O90A 4HDSB 4BPRA 2GEFA 4HNUA 2C98A 4MV5A 4GBED 1CY8A 1F51E 2R1VB 3KKMA 5HBRA 2REQA 5HFJA 1VZ2A 3HNRA 2V7EA 3I9KA 5HX7A 1A82A 1Y3CE 2G1KA 3UA3A 3G5AA 3UXEA 5H3HA 1E1YA 2FX5A 1MAVA 1MB4A 1OA1A 2PWZA 1Q17A 4YR7A 5ICGA 2WT8A 4PFKA 4D3FA 2IFTA 3D4OA 2IOFA 5JVDA 5HIKA 3WP0A 1ENYA 4GKAA 4BEWA 4QTTB 3WIOA 4CEJB 1QQ7A 3HA7A 3KSRA 3N2LA 1UKAA 3DEHA 4K3VA 1B15A 5EXPA 5BSTA 5GONB 1ZJ4A 4NDAA 1TVMA 4N8SA 3VNBA 4N7BA 1GTZA 1XMVA 1DUVG 1IHXA 2O4CA 2QM3A 1R27A 2OXTA 1I7DA 3D8HA 4PQGA 1FSPA 1L6IA 2II6A 3EJ6A 1I1QB 3QHPA 2Y1EA 3TX6A 3PUZA 3QXCA 4O2AF 3GJXC 3BWBA 3DSRA 4PRLA 1YO6A 3QRWA 4ETWA 5KMGA 4HZIA 5ESXA 4PHGA 1AK9A 1S4MA 4F6LA 1CQPA 1CQIB 4BQOA 3QSYA 1ESCA 5CJPA 4KMRA 4QUAA 1WCYA 4GXTA 1QFYA 3TZ6A 5FXMA 3INYA 3AOEC 1W4ZA 3PYXA 1Z0ZA 3F0TA 3VU1A 4BIIA 1IY8A 3IA7A 4U0KA 1VE9A 3DBVO 2ZE6A 3GPIA 4D3YA 1U28A 4K6CA 3NNDA 4M9ZA 5TQVA 3UHAA 3LWDA 3V8BA 4BKMA 2ZJYA 4CM5A 1E3SA 1B0ZA 2SBTA 1C7RA 1GCOA 3UXYA 3O8RA 3DL4A 2IX3A 1BMDA 3BIOA 1E9VA 5IHXA 3EIUA 3MRSA 2ORED 3L0PA 3ZBUA 4HV4A 1GKLA 4F2GA 5C7IO 13PKA 3DZDA 4YV7A 5C1BA 4UCXA 4JVOA 3MJHA 4N5DA 1ZH8A 3B3JA 5KJCA 3EIHA 4OU5A 1YFJA 4IZOA 1GFIA 1BEZA 4RHCA 3KKOA 3UXMA 5IULC 1QRDA 2OSBA 4H3KB 4HFNA 4A91A 4B43A 1QQTA 3R3VA 3QBEA 4I08A 2WAOA 4JLDA 3F1LA 3H5IA 4PHFA 2A92A 3P0HA 3ZGOA 1NXSA 4ZDIA 3NUGA 1GG2A 3CU5A 1NZJA 3AEZA 3NAMA 2RH8A 3E7PA 1YR1A 1EBBA 2CUTA 4F8EA 1ANKA 4X95A 4K9MA 4P4GA 1L4GA 1ZN2A 3L7IA 2ZCJA 2Q5JA 4PNPA 1SM4A 1W2HA 5IJAA 1Y8RB 2JLCA 4GLJA 4KWEA 4RADA 4KGXA 4EF4A 4GPTA 4O4JF 3AQIA 2HMYB 1VYHA 3L0BA 4Y2HA 2RGUA 1KVQA 3AIIA 3FA2A 5CFMA 2BCEA 4O4LF 1C14A 4WZBB 1CZHA 3LXRA 2G76A 2XODA 4ZCTA 5KYXA 3DXZA 5CNIA 5JBIA 4TMZA 4RBNA 2V0GA 2PANA 5GIOE 1A71A 2QGFA 3IAM6 4GP6A 5H83A 4AO7A 2WWYA 3ZJTA 4P93A 1AN9A 1HE4A 2DBYA 2PNFA 2Q3JA 2YW9A 5I5EA 3MTBA 1KZYC 4HEHA 2W2KA 3RSCA 3V9PA 1CJMA 1WDWB 2FSPA 3ZDYB 2R62A 2HWXA 3EGIA 5E4YA 2HSJA 1OGJA 5EKTA 2QA5A 2YS6A 3M6VA 2K2QB 5CXUA 1DJOA 2J30A 1UQUA 2OO5A 4QPJC 3QJ5A 4CQMA 1OWMA 5AVVA 1H0SA 4BVHA 4WBNA 2XVAA 1EA7A 2VH2A 3GLHE 3L0DA 5AUNB 4I81A 3U13A 3SWWA 3VHXA 4P5EA 4B81A 3C98A 4ALJA 2BSXA 1D1SA 3G0BA 5BV1A 2FRDA 2A9PA 2H2DA 1P2DA 4OK5A 2FWIA 4MCJA 1M8GA 4KQEA 4OM8A 4YDHB 4ZANA 2VYVA 4RF4A 4FEEA 3LKVA 4YRBA 1JN0A 4M0KA 4YJDA 4D92A 3QVGB 2PBFA 4IILA 4GRAA 2RAVA 3SM3A 2V7XA 4JJ4A 4QQFA 1QPGA 2PRIA 3MLEA 3VDRA 3ILHA 3VZCA 4QX6A 1YACA 2JEZA 1GAJA 3KAPA 3TIIA 4BEVA 4UOEA 2VHQA 3QNWA 3VM6A 5JSHA 2IU0A 2EJWA 3JY6A 5KTKA 3DBOB 4C2TA 3LPAA 3GPCA 2GZRA 4E12A 1P2TA 3MT7A 1TMKA 4YRTA 3MAJA 1Z6AA 2B92A 3RVRA 1KDYA 2PUHA 3WFJA 3C45A 1WSWA 3FPSA 4M7OA 1OAAA 3V48A 3SOPA 2AFIA 1HDGO 3U37A 5AVJA 4POOA 3H5RA 3O9MA 1Z6TA 3MGKA 4FZRA 2BFDA 2FZ4A 3AJAA 2J31A 1NXWA 4NNJA 4UAVA 4YREA 1U7WA 4L57A 2CZGA 4I5GA 4BFYA 4XLZA 2QS9A 2J3QA 4Y9TA 2PR2A 1KRWA 2AYYA 1SWVA 3KSUA 3C3YA 1J07A 3JS5A 2QYTA 1WXWA 4DLXA 3GJYA 1FDIA 4UMFA 3EZ2A 1SCIA 5E0OA 2JGIA 1CK4A 1QHIA 1XTJA 4E33A 2ZWVA 3QG1A 3TDNA 4BAGA 1OFIA 3JZFA 3QKRB 2MYUA 4YRAA 2BEWB 1A8HA 2HM7A 4YAWA 2VDOB 1ZCAA 3O8CA 4QEKA 5E6UB 5A02A 3KCQA 3JTMA 1KWKA 2P41A 2FQQA 1E0JA 4COOA 3I1FA 5LMUB 2Q8QA 3UAYA 5IDWA 2VH1A 2YMPA 3NHPA 3DG9A 1TCUA 1XMPA 1ZD5A 4HMOA 1LRKA 1P5HA 1JXOA 4AP9A 3FAKA 1DAIA 2GERA 4BMVA 4EPVA 3IP7A 4JBWA 2X40A 1W0JD 1ZS9A 3L06A 4GUAA 4TT3A 4PVDA 5DBOA 5LZ8A 3C41J 5LZ7A 3QEJA 4QXAA 4TM8A 2VF7A 3UW1A 2VK1A 1VJ5A 3Q6IA 1T4GA 2CMFA 3Q9UA 4I4TB 3T3MB 5G0TA 5F5LA 3WA6A 1MZPA 1TZMA 2VAXA 4MI1A 4EHIA 4YQZA 4EPTA 3OJLA 1RI3A 2JI9A 4JT4A 1A2QA 1RM0A 4ENUA 6PFKA 4V1CA 3RCBA 3HA5A 2F90A 1JTVA 3LYLA 3MTDA 1JHVA 1W34A 3L7YA 2FN4A 2PD4A 1QIJA 2GCPA 2XX3A 2ZAYA 3DFFA 3NAGA 1ZYUA 2IV3A 3RFVA 4E11A 3HC7A 4C20A 1RMTA 4YXFA 4EF6A 3RI3A 5JBNA 2GZDA 2VJNA 4A16A 2R0QC 1YR9A 2BMWA 4G24A 2YZNA 3L6CA 4DBLC 4IXDA 4LHVA 3BMQA 1FFHA 3ZE8A 5LYJB 5EHZA 2WTBA 5FIUA 4FT4A 1JLLB 1JQBA 1TB4A 3JAKB 3HACA 3QG5A 1GPH1 4ZVVA 4B7UA 1WS6A 3IBTA 1F0YA 3DFUA 4R9UC 4AI6A 4JGBA 5A4FS 2AX3A 3GFGA 5BR7A 3GCXA 1AF7A 1SEPA 3NFRA 3WBKA 3TCNA 1Y82A 1QV7A 2CLCX 1OX5A 5FBKA 3O7MA 5IW8A 2B4KA 2V9ZA 4OFZA 3WYBA 3VJRA 4KDRA 1FNDA 1MNQA 1RPAA 3ED5A 4R9RA 3X1KA 4J1TC 4GR4A 4JCCA 1XO1A 3I04A 5B2EA 2HHLA 1ZD1A 2A5YB 3VISA 4AO6A 3WQQA 4F5ZA 2Y27A 1LB1B 5DNEA 2BOVA 3GFQA 5EUCA 5CB4B 1M1XB 1HE8B 3C6YA 4MGHA 3G0GA 3KQKA 3SXPA 1TQDA 2C5SA 4XB1A 3ID6C 2QX4A 3MFQA 4CLEA 4TYWA 4U1RA 4Z0HO 1D7AA 1T4BA 1PRYA 3Q10A 3P97A 4B3GA 3Q8WA 3I1YA 1MXFA 1F6WA 2HWUA 2WKSA 3QVOA 2NO4A 1L1EA 1PUJA 3WZMA 5F23A 1O5OA 2OAEA 4PG4A 1VKZA 1E7RA 3DTYA 4PLYA 1I4WA 3P7MA 4JJ7A 3WMWA 4EO4A 1SBCA 1K2WA 3HVHA 3PFBA 3WB2A 3ZWYA 2WF5A 1GQOA 2A35A 1AX9A 1UK8A 2A9JA 4LWQA 1K63A 3P9IA 5K8UA 4D4JA 4Y8VA 4MWCA 1R9NA 3AKDA 3NBFA 1VJ1A 1NP6A 4WHMA 1JP7A 4Z9XA 4ZOCA 1UODA 1JQDA 2PSJA 5EP4A 1JDBC 2VTEA 2CZCA 3KB8A 4W1QA 4IDAA 4EB6A 3CLTC 3PFWO 1RYEA 1X7HA 2AF3C 4U63A 3UUWA 5F7OA 4JDPA 2Z6UA 4TL9A 3ZCPA 5EIBD 5GONA 2D2IA 2XBLA 3RRFA 3V4RA 3KLOA 2EBWA 1DC6A 1GY8A 2Y93A 2ERCA 5C52B 1NFFA 1YZFA 4MULA 3VHRA 2HU7A 4D0NA 1DNPA 2R6R1 4B45A 4JL8A 5E3HA 1AMUA 1EVJA 4HOYA 2UUAB 2AXPA 1LRLA 3AF5A 3IAS6 1BIFA 2QE6A 4OXQA 5DGIA 1CYEA 3H0CA 1KR2A 6REQA 3KJFA 3RUDA 5EWLB 2AFIE 4B44A 2YYYA 4QXQA 3E9NA 4ZICA 1ZWKA 4Q0MA 2O8CB 3LX5A 2W58A 2LKCA 3OURA 4IQ8A 1Z0IA 5FLEX 4D4HA 3JX9A 1ZM7A 2YIJA 3DD5A 3GK3A 3W5HA 1OB2A 2P4EA 2ZG6A 4WKNA 3CVYA 1WV1A 1R4MB 4MYDA 3Q6MA 1E0KA 4UAJA 5CB0A 1JA0A 1NLUA 2YIMA 3PUXA 4N0DA 4J0GA 5BR4A 3MXTA 2ATVA 1KU6A 1NE7A 3PUVA 5AJZA 5G02A 4IIYA 3CLTD 3R44A 4P7GA 3BMNB 4PC3A 3WFZA 3KQWA 2H1CA 4DDTA 1P18A 4OQXA 3ZOZA 1HOXA 2F1JA 4HI0E 2ZBUA 1A1VA 1MT0A 5DU2A 3FTCA 2HW8A 4OHRA 1YMQA 2VT7A 3TRDA 4BMSA 5BUZA 3MK31 3LHKA 5BWCA 3CVOA 2QBYA 4EG5A 2VDQB 3OPQA 2BKEA 4AUNA 3PF8A 2PD6A 3IPLA 5ARBA 5JSQA 2OHFA 1C5KA 3KR9A 2PY6A 2VBGA 4OY3A 4IXTA 3UWDA 2FN7A 2WQ7A 2OLEA 4RC9A 4DZZA 4ECAA 2I6FA 4XJXA 2QW0X 1T8WA 3MJVA 4Q1FA 3E61A 1AU9A 1E61A 5P21A 4AKTA 3IVAA 3VOBA 3U4QA 2VNJA 3B1KA 1S01A 1PGJA 2DVMA 2I2XB 2Y4NA 1IJFA 2HH9A 2IXBA 4CG0A 3SYKA 1FX0A 1UQTA 2Z3WA 3GOHA 4LXHA 3L8DA 1D2HA 4TLAA 5D84A 2UZ0A 3MMZA 1D9XA 2V55B 2GJ9A 5JAHA 1R15A 3DZJA 4D0GA 3R9WA 2WZBA 3GT3A 3OX2A 3RFFA 3R3SA 1CULC 4HXFB 3A1CA 1A4UA 1W36C 1MD9A 1Y6FA 1GNRA 2O1WA 3BD6A 4Q7JB 1L4KA 3O82A 4BKPA 5C37A 1E59A 4BDSA 4HN2A 1W5TA 2XMBA 1T4DA 1P3Y1 1QGAA 3FYTA 3QFRA 1U5AA 4XQ9A 1VCOA 2RD2A 2C2YA 4UFOA 2QLBA 4ML3A 3FKQA 4G56A 4GP7A 3D1VA 4DR2B 1DIGA 2XXAA 3FD8A 3LBYA 4CM6A 5CCBA 1C1DB 1WEHA 3GRZA 3IAM1 4KK4A 4MR8A 4R1MA 4ARUA 4UQOA 5LIPA 5FI5A 2LW7A 3SBOA 3K1AB 1J22A 3TN7A 3OQNA 1KY3A 3WLAA 1RDFA 3CEPB 4JI6B 4LPKA 3PQ7A 1WXQA 2BFCB 2R65A 4QNRA 3DMTA 3PNLA 4X7RA 1L7VC 4O08A 2B6HA 3WYAA 1YOVA 4RORA 1X1TA 3WRYA 1TRHA 3B3QA 3EUAA 1ULUA 2H31A 2XAAA 1OT3A 3B3AA 2ZRFA 1KOFA 1VL0A 3EAFA 3JWJA 5BSRA 2X7XA 3VPSA 4FB5A 3U48A 4BVEA 4INJA 2VVTA 4DLVA 3K0EA 4RDCA 4JLJA 1J2TA 3AV0B 1W9MA 3IIEA 4ZVMA 1QDLB 2HF2A 3RRXA 2BCGY 4FGUA 3NWEA 2I3BA 3AP1A 4IIBA 4MQFA 4W8GA 3U4IA 3VYWA 5JZ9A 2EJBA 1XZJA 2KBFA 2W6JA 1JHYA 3PX3A 5BMOA 2O2EA 3GEHA 3MWGA 3MCVA 1A9PA 1Z5ZA 4H0CA 3EXFA 3GQVA 1A9OA 4ZO9A 4C29A 1WIWA 2GPWA 2WOJA 2D3WA 1WO8A 2W6CX 5D5QA 2RI1A 1GYQA 4LYJA 3WRXC 1V7QA 3IV6A 5BV7A 1D1PA 2HHAA 4PLGA 5F76A 3ZV5A 3EN0A 2JS7A 1HEIA 3V4SA 4EB0A 2O7SA 4RPJA 3KV3O 1OFHA 1UBUS 2FKNA 2ZI6A 3G8CA 5TMBA 2IEGA 1HFEL 2XKKA 1ESNA 1NW3A 5DTEA 1SKYB 3TOCA 1PNRA 2V5AA 1IM5A 4XYBA 1C4OA 2FJUA 2FSUA 2F48A 2INGX 3USCS 3OZGA 5COAA 1NXQA 3RTGA 4O4HF 5C1IA 1SZDA 1J42A 1LKZA 2V6JA 2VYVD 5DGXA 4YUAA 2PSFA 4DV7B 3LFTA 3N39C 2O20A 1FFDA 4B2IA 3ZVRA 1MP0A 2AI3A 2YASA 2ZYAA 3VSEA 3WLFA 3GCDA 4F56A 2E5FA 5JS6A 3TZLA 2CL0X 2QVYX 3GRFA 3I5UA 3IDQA 1VRWA 3Q9SA 5KYVA 2PMEA 4L8YA 4CIXA 1UZAA 1HE5A 3P52A 4AG3A 5DNCA 2HWWA 1H8HA 1N2CE 1LBIA 2FFJA 1F2TB 3CZ9A 2B4TO 3HBLA 2DH6A 4N0EA 4BRUA 2YH2A 1JB9A 3ESZA 4KAFA 3E22B 3EZ9A 3Q7IA 1IH8A 4LQ4A 3R76A 1M75A 5JNSA 2OO3A 2D1SA 2ACEA 2JK0A 2MOKA 4L3OA 3IERA 1XXHA 5DE3A 1JHMA 2BRUC 4TTVA 4MQUA 5LOVB 2VFAA 4GI3A 4O0LA 1Q6ZA 2ZYHA 4I14A 4HRYA 1CS4C 5D6OA 1ZVQA 5HM6A 1UPTA 4GE0A 2IEBA 1GPYA 4C4OA 4HUTA 1JJFA 3NTUA 5A3QA 4J0CA 4MQEA 1VHWA 3TW0A 3TS1A 4DQ0A 4LSMA 4ZDJA 5IUJC 5LZ9A 1MDBA 1C50A 2QUBA 2Y1KA 4NPHA 2JGJA 1JJBA 4F3KA 3EWIA 3D3EA 3Q5EA 4X61A 1OBCA 3FRIA 4QOHA 5LOVF 4G5SA 4L0CA 1U8AA 3FN4A 4HYQA 3L7AA 4P33A 1XYYA 2QZ9A 2HHCA 1HK7A 3I09A 1TT7A 3EMKA 5FTNA 4J43A 4DC0A 1VL5A 2P4HX 4H60A 1E5VA 2MHCA 1V2GA 1UBTS 3WB1A 3I83A 2Y0PA 3W8DA 3IOMA 1RP7A 4E5VA 5I8WA 3QIAA 5LQNA 3RIYA 1FZTA 4HGPA 3TGPA 1FMJA 2DCMA 1E9SA 4DLWA 1RYFA 2BDUA 2WE8A 2X4IA 4JKOA 1YOBA 3G59A 1I2CA 4QJ4A 4QOEA 3JVIA 5T3YA 3VRHA 4QO8A 5G4KA 1KJJA 4N76A 4L08A 1NYQA 1JS1X 1G5RA 2P2CA 4RCVA 3BRWD 2YVQA 5EHQA 1RJ9A 3VZQA 4O4HB 3VDNB 3MTQA 1GEGA 1K0UA 1T1EA 1ZMXA 4ER3A 5CFZA 3FGOA 4US1R 2ZWMA 1U8EA 4JHLA 3TLGA 5AOCA 3CR3C 5LKRA 3KSBC 5T6MA 4PO1A 5LQRA 4B6JA 1JDUA 4ZJYA 5KX5B 5F98A 2CJYA 3DT9A 4OBEA 5AW0A 3PXCX 1UBJS 1YMVA 1IVNA 2ONKA 3EF1A 3AOGA 4M9SA 4KSYA 2XGMA 1S6YA 2XY4A 4PTZA 2BTQA 4GZ6A 1Y4SA 5JUWA 2DWPA 3QEBZ 2JHAA 4BLOA 1B8PA 1T1JA 2RIPA 1YE5A 3KJQA 2YX1A 2ZIVB 1LTQA 2ZJ1A 1GCGA 3VR2D 1ZVVA 4TLLB 4B4VA 1Q84A 1W4CA 3NGXA 3PXXA 3ESBA 2AG5A 3FBTA 4KIUA 1GRNA 4HNVA 1LJUA 3DKKA 1QLWA 1TKCA 1W87A 3N3AC 4KREA 2O23A 1PL6A 4JASB 4YACA 1LFAA 1VYUA 5AUQA 5CDUA 2GLUA 3FDFA 5IVKA 3QI7A 3CCFA 3QHAA 1N0WA 4LZPA 4GOOD 5HIAA 1QAQA 1I32A 3SF8A 1LLFA 3NPMA 1V6CA 3TDMA 2CNKA 4CF6A 1KH3A 3FM9A 5GJVC 4ND8B 2WM2A 4CCSA 3BTSA 4YMHA 3FDZA 2C5FA 5EIWA 1UZLA 1BXZA 4FIDA 3SR3A 4UBKA 1EIWA 4ALMA 2B0JA 4FN5A 3D6AA 4X65B 2ZWOA 3OLYA 3TMYA 1WDMA 3O9VA 3O8OA 5CH5A 2NXEA 3TZBA 4ZHQF 1QHSA 4K05A 1K6EA 4IOKA 2HTFA 3BRQA 4K9RA 2FWPA 4Z1OA 3CY6A 2FH5B 4C6HA 3HN6A 4J0EA 4OCZA 4RL6A 5CMLA 3WWOA 1ADFA 1BE1A 3ILSA 2FSGA 4JB3A 3S5UA 1TW3A 2RFLA 4G01B 2XJ9A 4Y2QA 3JAKA 2ZRJA 1NZDA 3D31A 3LUHA 1RAEA 2OTCA 3MD9A 5LLSA 3VYRB 4N48A 3CLUC 2XMRA 3COYA 2GBGA 3GT4A 4WY8A 5ALWA 2DPXA 4B85A 2AG8A 1M2FA 3CVXA 1SC3A 4Q3CA 4JZYA 3V2UA 5K0ZA 1TUBB 4CDGA 1IUPA 4P53A 3U40A 2AEEA 1Z5GA 1ZLYA 2G9ZA 3TPZA 3OAAD 3AUUA 4MPTA 2O8FA 1WCV1 1G3MA 1P7PA 2WU3A 4GR5A 1E4OA 2HGSA 4AKSA 5GP1A 1T6XA 3HJUA 1FYEA 1H9CA 1PWEA 4AVYA 2M6KA 4MUAA 5EFOA 1EP2B 4BGEA 1ODFA 3PNQA 4F5EA 1HV8A 4ZVLA 1FF9A 1HQKA 4H7FA 3A0RB 4YGXB 3ESAA 3TCKA 1NVDA 5IF9A 1SHZA 2G71A 1F4LA 4ZO7A 3DVRX 1W75A 4LF9B 1GT91 1A9QA 2GO1A 2OD2A 2GD0A 2CBGA 2RHOA 3PUIA 2D0PB 2BAGA 3D8UA 1G60A 3KQMA 2ZSBA 3WQHA 3U16A 4LNHA 3E8SA 1CUXA 4J16C 2GAAA 3AR5A 3VOTA 5KTTA 1P60A 4Z7QB 1C3XA 1EFHA 1ORTA 2ZFUA 1RHJA 2GZSA 1KETA 4OTZA 1NY5A 3ET5A 3M83A 1YHZA 1T15A 1UF9A 4AMGA 1XVUA 2L69A 4CF7A 1NBWB 4KE9A 4UMDA 3ZJUA 2RGBA 1E2JA 1FBTA 1HFKA 2G1AA 5EGNA 3VPGA 2F55A 2XHZA 3QMWA 1T91A 3FDJA 1OE0A 2DHRA 3BWEA 5DNYB 4DGSA 2OMKA 4F2HA 2OV4A 5BSHA 4KE8A 3NVKI 1Q74A 3WTCA 3F96A 1EHIA 1DOHA 3G9QA 1EH5A 2HRZA 3PTZA 1OC2A 1QPBA 1U8ZA 5EXSA 1JUDA 9ATCA 1SXIA 3ONVA 4PBSA 4LOHA 3LT5A 3MBIA 4F4DA 2JBWA 2P2DA 2G70A 1EFRD 1QG4A 1W25A 2Q4BA 2WIBA 4Z2AA 1K06A 1OHHD 2J3IA 3BRWA 4YRLA 1AGNA 4BLRA 3FPGA 1PNTA 3FYDA 1X7WB 3TMAA 3RVOA 2C1EA 4RLSA 3VVMA 3DO8A 1BXGB 1UAGA 4TWAA 3TZQA 3GRPA 3H18A 1J33A 3OKCA 4J29A 3V2IA 3BFVA 3IVRA 1CDDA 1JIVA 3REOA 2PX6A 4IICA 4B2YA 1C4XA 1I0LA 2YQ4A 4PGMA 5FV4A 1WCIA 2XNKA 3CR8A 4IV0A 3UCFA 3AFGA 4GPBA 5EWLA 2CDCA 2RKOA 4OKIA 1GA1A 1XRNA 3GRYA 4HGNA 4P5DA 3R6LA 4JVNA 4L51A 3N8NA 4HNQA 5LDDC 2E87A 1ESEA 3KIPA 3GL9A 4KHZA 3TQFA 2MDTA 5SZIA 1Q91A 2PMCA 3OIFA 1CERA 3SLKA 1ZQ1A 4ENSA 3CBGA 3AZPA 1UC9A 5E2IA 3TQOA 1V71A 4EO9A 2Y1WA 2IQ5A 5DP2A 1PJ2A 1DC8A 4FDUA 4TROA 4MIEA 1M2WA 2CLEB 3NO4A 3EASA 2UZ1B 3FUWA 3DLBA 4LMAA 1DRVA 4MDEA 4OHUA 4HB0A 4Z0TA 3T9FA 3E35A 5MGBA 4Y1GA 3ICVA 5TX7A 4JC5A 4PC6A 5FT9A 5L3ZA 1HE2A 3ELYA 3O2QB 4UTOA 1TAGA 2GM5A 2O57A 3NVMB 1N4AA 3QQPA 4DNPA 4QEZA 5JXIA 4MCIA 2VKTA 1S3FA 2BM9A 1XU9A 2BUCA 2WRZA 5CLLA 5GOZA 4DUPA 2GGSA 2Q5QA 3RC9A 3SSNA 3W8EA 3ITNA 4DF3A 1GQRA 4MLPA 5KPDA 4YPOA 4ZOEA 6ABPA 4YJFA 1I2ZA 1L4UA 2IOQA 3W77A 4X84A 1P7ZA 1IZ8A 1N2CA 3MERA 2FF7A 3SFVA 4G23A 1M76A 5EMJA 2ZRQA 4A7PA 3T9DA 1QPZA 3HDTA 4PU0A 2VK4A 4Q4LA 4E3WA 3UQZA 1ZM9A 4KAXA 3JD0A 1DBRA 4FU0A 4QGSA 4KX5A 3PRHA 2QVXX 3SXJA 3HXLA 3VQTA 5BN4B 4H59A 2V96A 3INTA 4XWKA 1B8OA 1HT1E 3OLZA 1SG6A 1IBRA 3F47A 4KQWA 4WJKB 1QUFA 5E38A 2Q3DA 3B9BA 1JHQA 3D2CA 2H2AA 1TPZA 2E4WA 2QR2A 1ZP6A 2YIVX 1TVCA 1G9TA 2R00A 1YZTA 4DLAA 2HCBA 4FYWA 3Q2KA 2VHTA 4MP3A 3OPYB 4ENRA 5ULLA 3B48A 2OV2A 4KAAA 4DB4A 4MW4A 3WLTA 3PP8A 3VNSA 4DXAA 1Y80A 3ZKAA 2B83A 5LBUA 3HY4A 1U6KA 3OJXA 3IKTA 3ZHCA 4TXNA 5J2TA 4J0IA 4EL0A 4ERNA 1A88A 3MJSA 1W0KD 2RBKA 2AI1A 5FOWA 3ZTWA 1QLJA 1SVMA 4TLEA 4HYTA 1CJTC 1O95D 4KN6A 1ZINA 4KAJA 1NVGA 5JSUA 1GRCA 4EJSC 5HRCA 4R2IA 3N74A 5UKDA 1JLKA 2CL5A 1W5FA 1S2MA 2O52A 3WL7A 1Z4QA 4D4GA 5TXGA 2DZDA 1X7XA 4R1TA 1ZDMA 1FEZA 1OIXA 2J87A 5EJ4A 5JYDA 1D2CA 2QAGA 1V6SA 2IXDA 2QMQA 4QA9A 2FJ0A 2NZWA 3GLUA 3D64A 1N5KA 3JYNA 4H7DA 4RNCA 4UASA 3AUTA 4YJ2B 2KX7A 4JLAA 3KFXA 3SZGA 1MF7A 1NDHA 1NJSA 1UXIA 2JFHA 3N8HA 3Q3VA 4FHZA 3UMVA 1Y0BA 3V7FA 2GTPA 4EYKA 4LF7B 4R7ZA 1G8JA 2XYQA 3IAXA 3GGSA 4PV7A 4DRZA 4F92B 4F3NA 1TX4B 3LYAA 2QVLA 5J43A 1WNFA 1O03A 1DO8A 4IUYA 2AOXA 1Y4AE 1JU3A 1Z6ZA 2Y0CA 3K0HA 3KYJB 3V4PB 5JS1A 1CZLA 2QD4A 5IEBA 4HGRA 2OCKA 1O58A 1XD2A 3O8QA 1V8ZA 4YRMA 3L6OO 1KOGA 1NOJA 3MUNA 3HN2A 1J06A 3KUDA 4O4JA 4QG3A 1UP6A 4FFSA 5KU1A 4B6RA 1AGPA 3CXUA 3LO8A 5CR9A 2H08A 2HYDA 4BWYA 3EOBI 4MKHA 2PSSA 4BGIA 1O5TA 4M1ZA 3K0SA 1P1KA 2W37A 1CEQA 2E3JA 3Q8KA 3ORYA 1IBMB 3DTVB 3J81A 3QIVA 2QDXA 1P1HA 3G2MA 4G8DA 2X4LA 3UMMA 4YBZA 4UTXA 4TSFD 1NI4A 1P81A 3DMPA 1ZR2A 1QIKA 4A1FA 3T7KA 1QVZA 3ECSA 3TBKA 3H5TA 1X9IA 2CWWA 1P4SA 3I9MA 3LUJA 2ATEA 3Q11A 3VAAA 5ED4A 1TVKA 2DLCX 2FCRA 4Q5IA 1JW9B 3H8VA 4JP2A 5AI4A 2O5EA 5JD3A 1TD1A 5B64A 1CIVA 1EJ0A 3ANYB 1UDXA 4ID9A 1W1IA 5BPHA 3A1NA 2YHAA 3OZSA 4TQ9A 2J0QA 3EW9A 2W6PA 4WKBA 2NADA 4MUBA 5CLJA 1TF2A 4N7JA 1TJ5A 4DSTA 4YAEA 5JALA 4O5AA 5G1OA 4DLUA 1BFKA 2RGYA 3EK2A 5CX4A 5BWOA 5DHRA 5JSYA 5IT0A 3EEYA 4EF5A 1NUSA 2N47A 1TL7C 2O2XA 3ZH2A 2ISSD 2ZR0A 2AQHA 3B5IA 4RVDA 5EJ7A 2NV2B 4L5BA 5AI6A 4PG7A 3W8NA 5HJEA 1XA3A 1O94C 5JSKA 1K8RA 3MPUA 6ADHA 4OJMX 2GBPA 5DSXA 3QY9A 4H17A 3HNOA 3NKVA 2OGUA 1PUXA 2ZT6A 4KQ9A 4YQYA 3FB1A 4RIFA 2G0AA 5JECA 4AXBA 5IJZA 4QYIA 3PE3A 3N2NA 4F4UA 4EKEA 2DBQA 1XMJA 5HMLA 3HR8A 4HVLA 3LKZA 3INRA 3T1NA 3NP7A 9MHTA 1VLZA 1F12A 3QYPA 3C8HA 1Q20A 3WMGA 4FQ5A 3TSAA 3EFOB 4YCBA 4D57A 2EFCB 4LOLA 1LLDA 3HZOA 3W6OA 3SX2A 2J9YB 3ITDA 3W2TA 1S02A 1U4OA 2X5NA 3BFJA 4ZYLA 5C81A 2ST1A 4HWTA 4OQ4A 2AT1A 2FW7A 2REXB 3AB3A 4KSBA 2EX4A 3NBYC 4JKYA 2W2LA 3K32A 2UVQA 4JGGA 4JQYA 2DG2A 3LX8A 1WEKA 5DISB 5KWIA 2IT1A 2B8WA 1CUSA 4QGGA 2ROQA 3MWFA 4DKXA 3P2OA 1BA3A 5K8VA 4Y2JA 1NI3A 2YZGA 1KZHA 2XTNA 1KMMA 1UT6A 2Q49A 4DPLA 4ZGGA 3VAZA 3I2HA 3GLIB 1PJSA 3ITKA 4ZPXA 4YFVA 3MT9A 1OI4A 4FR2A 4C6TA 3VGJA 5JPIA 3SICE 4R0MA 1PYDA 1UK7A 2X42A 3C3XA 3DL2A 3I01A 5LMCA 5EXEA 1EZZA 2PCJA 5LNK1 3L8GA 3C7CB 4RHXA 1XC7A 3IAAA 3J7TA 4RKQA 1BO6A 3PC6A 5J2TF 3VHXB 3FTEA 3KEQA 1RKVA 4WESB 5IC6A 3DPUA 3WXMA 3V00A 2GTIA 4B74A 4YHBA 5LQCA 4KPEC 4KRGA 1THZA 1XMOB 4M0FA 2PCLA 3IAFA 5FWYA 1U28C 3GJTA 3DL0A 1JI0A 2KW5A 2IS1A 2WMDA 1Z62A 4BN5A 2XCQA 4QPDA 3C3AA 3ETEA 2HJRA 2JARA 3E53A 5I45A 4IFEA 4MJXA 4RVNA 3G5TA 1NJ6A 4V3CA 1YK0A 1IE3A 4G5XA 4HH4A 4MWGA 3OJ0A 5EJFA 4A4DA 1GLGA 3O3CA 4QGBA 1N6NA 5DTMA 4YP6A 5KAMA 3T9EA 4CM3A 3VR3D 2CK3D 4G41A 3LA6A 2V4ZA 1SIOA 1WL8A 4LMBA 4ENWA 1KPHA 3NV9A 4PLCA 1XEXB 4Z4EA 2FX2A 5FBZA 3BULA 5EJ5A 5E2BA 4NBKA 1GOTA 3RYTC 1GL9B 3T41A 4DCGA 5FX2A 1ZBQA 2ZYVX 4GLFA 4RU1A 2XOXA 4ZZIA 2A0WA 1B3BA 3NALA 1JT2A 4X71A 1ONSA 3H86A 3K72B 3KPJA 3LUFA 4MGYR 4N82A 3CINA 1HF3A 1MMFB 1NHGA 2PQ2A 2QZZA 3AI3A 4HD8A 4U2GA 4HDSA 5BNZA 1WXFA 2BVNA 2G36A 2C84A 4JXKA 2Q27A 4LZWA 3PEYA 2X13A 1OVMA 4NU0A 4GBMA 1YKGA 3W79A 1DWQA 3PJDA 2CV2A 1Z6GA 2OAGA 1IG3A 4IINA 1CR1A 1Y33E 1U7XA 1LNZA 2HHJA 3OIGA 1CIJA 4FGLA 3FSRA 2BMAA 4RKYA 5AOVA 3UK2A 3DAPA 3E9EA 3FBGA 4OQPA 2QD2A 4JJZA 1M33A 4MV8A 5B36A 5I7OA 1ZG3A 3BSFA 3JYPA 3T3EA 5IKPA 9ABPA 3ZIAA 2C2BA 1L5YA 3G2KA 1IN6A 1F2TA 1IDN1 1LSOA 3WLEA 3ZWKA 4AN0A 1U8CB 4FZ5A 4JI1B 5CHYA 1MJHA 2HWYA 5CDFA 4CODB 3CO5A 5B3AA 2QE7A 2SECE 1ODLA 2BMDA 3UJBA 3M34A 2GH1A 3ZHXA 2G72A 4O4LB 1YZNA 3KZXA 4NHEA 1S7GA 1N0VC 2H5EA 2HIHA 4O4IF 4R54A 4BMCA 1XQYA 1NYTA 2GJ8A 1KGSA 1II8B 3JQBC 4HL6A 2F9MA 1KRXA 2HV9A 1WMBA 5HOQA 2W2VA 3B2QA 3CKMA 3IO5A 1ZJ5A 1KYWA 3CVWA 1D4AA 1X94A 3OKPA 3JPYA 3LUKA 3WGKA 2IHZA 1KFBB 2FEAA 2XYPA 5B1EA 3VA7A 1MFPA 3NDBB 4EQZA 4EYQA 3I3SR 2CHFA 3HKEB 4POAA 1B0UA 4ND5A 5IEJA 2J3KA 2J0VA 1PZNA 1X3SA 1HYEA 2BC9A 2JFFA 2IPXA 4RGVA 4ZRNA 1OI7A 1OWLA 1V26A 3FCSB 1NJGA 3ZIUA 1M2EA 1BCRB 2H0RA 2O3RA 3UK7A 4D9HA 2QJOA 4JOCA 1QP0A 4C2AA 2QN8A 4OKSA 2R87A 1U0JA 3PBKA 4LK3A 1ZWLA 3MD0A 5DZSA 4ZU3A 1ZMBA 2GB4A 2XMZA 2AHOA 1P77A 3AC0A 4RE6A 4EITA 3LP8A 4B2LA 1DG1G 3C3EA 5EJMA 3Q87B 2YDXA 3G2OA 4BHTA 3BJZA 1WW2A 2NXWA 4K6FA 4XOIA 3QVKA 5KSWB 1YCDA 4HJRA 1JPVA 1RI2A 2JD0A 5FNVA 3ASZA 3G5LA 3TLEA 4BQPA 2OGWA 3PFCA 1JNXX 4NV1A 3FNIA 2PUVA 1ZD8A 3BGSA 1FP6A 2J6IA 1B1AA 3ME5A 3AUSA 4KYIB 3IIJA 2N75A 3I9V1 1O95C 1ZUWA 2X8AA 3JQEA 2C1XA 4J4TA 2DTEA 2I7TA 2ZZKA 1KP3A 1YJBA 3BTUA 5CX1B 3U39A 3LJKA 2CF5A 2SKEA 4YAOA 4YRNA 1PDWA 3DV0B 3PQCA 1V8DA 4C9BA 2NSDA 4ZTZB 3M2PA 1XZBA 3PQ2A 1JLHA 3HE3A 4J2TA 3RNLA 2K6GA 1M6YA 1DKOA 1XVIA 1E2PA 2ZBRA 1UM9A 4FYMA 1XI2A 5C8VA 3MT8A 1BYIA 2OHXA 3E9CA 3ROPA 5D5HA 2QRUA 5THXA 2SKDA 2R4QA 2P90A 3GH3A 2VP9A 4ZV4A 5K7SA 2FW9A 3L0SA 1DAHA 4XYEA 2P11A 1H8EA 4PCAA 1EAYA 1QO0A 2VG8A 4RCZA 3LVQE 1IFXA 5IABA 1X19A 2P62A 3D6JA 4K26A 1N2GA 4RGQA 4ZZ3A 4A1OA 1YD7A 3KXLA 3C4VA 2HQBA 2JJYA 2DTDA 2HI0A 3QX8A 3R5SA 3LLMA 1SCUA 3F49S 3KZKA 5DI9A 5DBGA 1E2MA 4L78A 1VPEA 3CB4A 4XWWA 3R41A 5FV7A 1XD9A 2NZJA 3CW2A 1XRQA 2R1UA 1FB5A 3R7SA 1BGXT 2VOJA 3AY0A 3FWZA 2I54A 4LRYA 4WFKA 4N49A 1HQYE 4B8YA 5CXQA 1I36A 2GZ1A 1J00A 1Z4OA 2FVYA 2XF2A 4G5RA 4JIGA 4QUBA 1OR8A 4NNPA 1ADBA 1H23A 3BFPA 4KPGA 4ZVKA 4CE6A 5KSYA 3BJIC 4N5LA 3CTPA 2I6GA 1G20A 2YV3A 2BSAA 3NCHA 3CVVA 1NQOA 1I4LD 1Q3HA 4LTNA 1NIJA 1MRZA 4BLQA 4IQ4A 2P3LA 4IUDS 2G0NA 3CQ9A 4O8ZA 1OYYA 3ADDA 2ETVA 1CUJA 4P4NA 5KWJA 3LDHA 4QYSA 1HQDA 3IP3A 3WKDA 1E5DA 2Y1OA 1MKYA 3WG9A 2DBZA 5HW0A 2VHYA 2FQWA 3N0TA 4D41A 5AHWA 2MWMA 4ENTA 2CV1A 4GL2A 3ES9A 3IEXA 3C6MA 2V7TA 2C92A 3FVTA 1GARA 1O87A 2WHRA 1KH1A 2XZTA 3H8JA 4HGOA 1EIZA 3QOXA 1QH9A 3HDJA 4E2YA 2JD2A 5BT8A 221PA 2FRVA 3DWFA 4AF6A 5J5VA 3B2NA 3DO5A 3WSVA 2QBYB 1LTKA 2C2WA 5CGQB 3FWNA 1GQ2A 3U1VA 1JVBA 2QN3A 3RSGA 3ROEA 1E2HA 2ZB7A 1NONA 2ZS7A 5AJYA 3QEMA 3HLKA 2MU1A 4QYIB 1ZM2A 2QXUA 1TF5A 1XA4A 3MCTA 4CLRB 4AZWA 4ZMSA 4OSEA 5IVDA 2X1MA 2GQ0A 4R8MA 2WPDA 2AMVA 2XE4A 5CT5A 2W5UA 4QUHA 3RIMA 1TC1A 1ZH0A 2ZB8A 3PHHA 4UVGA 2PRYA 4INPA 4P34A 4ROTA 1U11A 3NHFA 3WZ2A 2QRVB 1CQJB 4GC5A 4J49A 4B73A 3R74A 2GZHA 4HXGA 2BY4A 1YASA 4M6WB 4BU1A 4ZAYA 1Y4DE 5F2KA 2R6HA 2X9VA 2Y6VA 4O5OA 2IYLD 1S0UA 4EHKA 2I4MA 3N8GA 3E1KA 4GG1A 3MELA 3OHSX 4F06A 4BN0A 3BSWA 4U3JB 3GNSA 3O38A 2JVIA 4XARA 2EZ9A 3EGXA 4PG5A 2P2YA 4DEYA 2ACWA 1C7ZA 3V4LA 2O2JA 5LDHA 3BHIA 3C7KA 2GDJA 2X58A 3NIGB 1G16A 2ANBA 1U9ZA 4PRZA 5TARA 3LPNA 2RHJA 3ZWMA 1G66A 1P2UA 1L5RA 4PZCA 4RD6A 4N6OA 2WJWA 3DVAB 2V8OA 3KL4A 4OJYA 1MDFA 2VH5R 1I6MA 1UMCA 3IDFA 4FWIB 4TKZA 1F5NA 4S1WA 4ECEA 4JUDX 3D59A 4U9UA 1ILEA 1PZXA 3GJ8A 1CJCA 3DEAA 4UBJA 3RAEC 3TUIC 2R4UA 1XL0A 1TFUA 3ZBPA 1LI4A 1VJCA 4V0QA 4IUCS 1Y7LA 3H2KA 3GFVA 3EXIA 4LQCA 4K8OA 5AJTA 4R1SA 1YE3A 2BHNA 4X97A 4IJUA 2W6ID 1CF4A 3BIXA 4AJHA 4UE2A 5CT4A 1N9ZA 1YKFA 4INOA 3FIUA 3Q41A 4KBYA 3P0JA 2VHVA 3N1UA 5P8WA 3QFHA 4YMTA 1ZOPA 2OK8A 3LRTA 1H2FA 3C5CA 4IWNA 1FK8A 1FPMA 1KK2A 3CBQA 1UADA 2J8ZA 4JNKA 5FNVF 2RAFA 5FUWA 4AKHA 4UPVA 3NHYA 8LDHA 2A84A 3SR4A 2C3MA 3QV2A 1L9KA