1MAWA

Crystal structure of tryptophanyl-trna synthetase complexed with atp in an open conformation
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
326
structure length
326
Chain Sequence
MKTIFSGIQPSGVITIGNYIGALRQFVELQHEYNCYFCIVDQHAITVWQDPHELRQNIRRLAALYLAVGIDPTQATLFIQSEVPAHAQAAWMLQCIVYIGELERMTQFKEKSAGKEAVSAGLLTYPPLMAADILLYNTDIVPVGEDQKQHIELTRDLAERFNKRYGELFTIPEARIPKVGARIMSLVDPTKKMSKSDPNPKAYITLLDDAKTIEKKIKSAVTDSEGTIRYDKEAKPGISNLLNIYSTLSGQSIEELERQYEGKGYGVFKADLAQVVIETLRPIQERYHHWMESEELDRVLDEGAEKANRVASEMVRKMEQAMGLGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTOPHAN-TRNA LIGASE
publication title Interconversion of ATP binding and conformational free energies by tryptophanyl-tRNA synthetase: structures of ATP bound to open and closed, pre-transition-state conformations.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Ligase
total genus 114
structure length 326
sequence length 326
chains with identical sequence B, C, D, E, F
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2002-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 1mawA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1mawA01
1NSYA 1QJCA 3RK1A 3CLRD 4Q93A 1M83A 1T9GR 1TYCA 1MC1A 4ZCTA 3ZJTA 3LCJA 4L2IB 4ZT5A 1O96B 1QTQA 1K4MA 4EGAA 1QRUA 2DUMA 5DASA 5KWVA 1NP7A 1J20A 1N2EA 3FG9A 5LLTA 5TGTA 4DJAA 1JMVA 1NUSA 1KH2A 1GPMA 4JXXA 3JXEA 1YI8A 1M8JA 3N2YA 3CVWA 3ISJA 1N2IA 4MUFA 1EJ2A 1KH1A 1JIKA 3IVXA 2Z08A 3N9IA 1GN8A 2GM3A 3LOQA 1PFUA 5K0SA 1J1UA 3IOCA 2H2AA 3A2KA 1OBCA 3FY4A 1NUUA 4KR7A 3CVUA 1U7DA 5DEOA 3IVGA 1B6TA 3U1VA 1COZA 3H97A 1TEZA 3E27A 3NBAA 3GLVA 4ARIA 2JAXA 5J5AA 1MAUA 1XNHA 3SZGA 4ZCSA 1PFVA 2AKEA 4MWCA 4PBTA 1YUMA 3CLSC 1J21A 3Q12A 1IQUA 4ND7A 4EG7A 4G6ZA 2VTBA 2OQ2A 2CV1A 4XSVA 1NUTA 2O5RA 5BNZA 5JBNA 3FWKA 4PBSA 4XFDA 1HYBA 2GKSA 4MW0A 4MUEA 1KQNA 3IMCA 3COWA 1I6LA 4NZPA 4PY2A 3BL5A 1P7PA 1MOPA 1EUYA 2J5BA 3A4IA 3H05A 5H7XA 4EG3A 3CLUC 2YY5A 4MUIA 4MW1A 4AQ7A 3N8HA 3S3TA 2G36A 3NBKA 4HJXA 2A88A 4MWBA 1H3EA 3Q10A 1EFVB 1YUNA 1K92A 1O0BA 3PNBA 3QE4A 2HGZA 5AHWA 3AG5A 1J1ZA 1JEEA 1F4LA 3FIUA 1T6ZA 3RBAA 3I05A 3IDFA 1EFPB 4G5FA 3HMQA 4CDMA 5K0TA 1O97C 1TFUA 1IVSA 3TZLA 1KQOA 1T6XA 1O6BA 5LM3A 3M5WA 1KP2A 4F4HA 1T9GS 4OJMX 1O5TA 1XJQA 3DV2A 4H3SA 1NI5A 4QREA 1O95C 1TYAE 4MUHA 4WSOA 1PFWA 1QNFA 3P0JA 4GU5A 4R2MA 4MAFA 3ND5A 3IOBA 2Z09A 3PRHA 1JIIA 2QJOA 3VU8A 2A84A 4U63A 3KT8A 1O0CA 2C5SA 3ZJVA 1DNPA 2A1UA 1N2JA 3MXTA 3K9WA 3KT0A 1X8XA 4ND6A 3Q4GA 1V47A 2DLCX 2IELA 2J07A 3G5AA 2RE8A 4DDHA 1J70A 3VRHA 4JZYA 1N75A 2V0CA 2E89A 3AG6A 4HK4A 4KR9A 3D6UA 3KT6A 4I6JA 3QTBA 1OWNA 3A04A 1TYBE 2CYAA 3COYA 3RK0A 1FFYA 3RHSA 1U3CA 3CVVA 1VLHA 4MW7A 4NAUA 1IQRA 3A05A 3P0HA 4MW5A 1ULHA 2X1LA 4OUDB 5TEWA 4K03A 2PFSA 2YWCA 3K32A 1YULA 1XNJA 1IRXA 5LFAA 3CVYA 1ZUNA 1MJHA 1WQ4A 4UZFA 1XNGA 5J59A 4DDKA 2ZP1A 1QU2A 4YP7A 4ZCQA 3UY4A 2WQ7A 1X6VA 4P2BA 3IUBA 1QQTA 4MVCA 3F3MA 2PZAA 2IJGX 1MB9A 3DLAA 2EJCA 3UK2A 4MUJA 2AZXA 3HV0A 1H1TA 4G5YA 1PG2A 3ZJUA 4ZCPA 1T6YA 2QUHA 1R6UA 3P52A 4JYZA 1QRSA 3OTWA 3CLRC 5HUJA 1N78A 2CSXA 3SZ3A 1I6KA 2E18A 3L93A 2PIDA 3KT3A 1Q19A 1KP3A 3TQOA 2WB2A 4J75A 2E21A 4EFKA 4DLPA 4CDNA 1LI5A 3DPIA 3G59A 3TS1A 4X0EA 1RQGA 1WJGA 1NUQA 4PBRA 2CFOA 3RFFA 3SEQA 1JZSA 1N2BA 5KCMA 1GTSA 3CLTD 1BS2A 2PZBA 4MVYA 4ZT3A 1U0BB 1O94D 2DETA 2PXHA 2V0GA 2QUKA 1N2GA 3IMEA 1N2OA 4FZJA 3AIIA 3PNVA 4NX2A 1ZH0A 3NV7A 1GTRA 4CT0A 1G8FA 1IH8A 4EG4A 3UMVA 2CYBA 5HUHA 1OWMA 4NAHA 3X1MA 4MW9A 2WQ6A 5FO0A 3UC5A 3PXUA 3ND7A 4NATA 1M8KA 4UZEA 2XRZA 1PFYA 4YP6A 5KHAA 1KKUA 4I6GA 1G8GA 3X1JA 4MW2A 1H3FA 2O8VA 3ND6A 4WNYA 4F3RA 1WXHA 4R0NA 4MWEA 1A8HA 4ZCRA 4L2IA 1N77A 1O96A 1KQPA 2X1MA 4MVWA 1QRTA 4ARCA 3AL0C 1VBNA 3H9BA 3TZEA 3QTTA 1KAMA 3COZA 5FO1A 1K4KA 1KR2A 1OWOA 2HZ7A 1NZJA 3ZUGA 4HPWA 1JECA 1WXIA 2QTRA 1VBKA 4MUKA 1WY5A 4K0RA 2DR2A 4MQ6A 3L92A 4I6EA 1YIDA 1N3LA 1I2DA 3HZRA 1WQ3A 2J08A 2TS1A 1IQ0A 1IHOA 1KORA 1N2HA 3ELBA 1JEDA 2CV2A 1JILA 1U7XA 3CR8A 1JZQA 4MUGA 2RD2A 4MVXA 2ZUFA 1NYLA 5J58A 1G59A 2YWBA 2EL7A 2BYTA 2B7LA 1JIJA 4KPUB 1WZ2A 4TS1A 1OBHA 1M1ZA 2CYCA 1ILEA 2PG3A 1R6TA 1ZH6A 1MBZA 3CLSD 1S4MA 2JANA 3SEZA 3X1KA 3FDXA 1GAXA 4MW4A 4ZT2A 2IP1A 1SURA 3TNJA 2A86A 2J4DA 3FNRA 1EXDA 5DK4A 3LE8A 4DDMA 2R5WA 3IH5A 3P0IA 1QU3A 2A4MA 2DEUA 4R2LA 3FH0A 2Z3VA 1MRZA 1WXEA 4E1AA 1F9AA 5EKDA 2A7XA 3HGMA 3H99A 3IUEA 4DE5A 3CA8A 2D54A 3KFLA 1ZJWA 3MLBA 3FI0A 4J76A 2QJFA 5H16A 5IJXA 4BWVA 3MUEA 1OWLA 2I1LA 1PG0A 2E0IA 3H9CA 2A1UB 1MAWA 2CV0A 2OV4A 2QTMA 1Q11A 4A91A 3CLUD 1EFVA 1LI7A 4NDAA 1M8PA 3N05A 4MWDA 3TQIA 4HJRA 4MW6A 3ZGZA 5TEVA 3SYTA 1LW7A 3G6KA 3MLAA 1EFPA 1H3NA 3DO8A 3IODA 2XRYA 1TYDE 4MULA 1I6MA 1R6XA 4Q16A 3ZIUA 2ZUEA 1IFXA 2J09A 1OWPA 3FOCA 1NUPA 2PZ8A 1WXGA 3PNYA 5FNZA 2HMAA 4DNXA 4U7JA 4MLPA 2VXOA 2GOYA 3ZXIA 3OP1A 2QUJA 1O97D 1UFVA 1EE1A 5F23A 2CT8A 1OD6A 3ZXSA 2YXNA 3MMXA 1JHDA 1MB2A 1KAQA 2H29A 4EG5A 1Y42X 1WOYA 4AS1A 3GUZA 3UOWA 1KH3A 1O95D 1TQ8A 4EG6A 3FHJA 1GZUA 4GRIA 4YBRA 3SDBA 1M8GA 1WXFA 3IVCA 5HG0A 1F7VA 2D13A 2DPLA 1JGTA 4RPIA 4CQNA 4RUKA 4YMIA 3HL4A 1D2RA 1V8FA 1Q15A 2AG6A 5IHXA 3D6VA 1GLNA 4EG1A 4ZT7A 4XFJA 4U8HA 4QRDA 3FETA 4KKVA 2DXIA 4JXZA 2VTBB 2A1TS 1G8HA 3ILVA 3INNA 1EUQA 3AKZA 4KPUA 4YP5A 3SP1A 2QJTA 2QTNA 3CLTC 3RJZA 4OUDA 4JFAA 1O94C 3COVA 1VL2A 2NZ2A 1F7UA 2NSYA 1Q77A 1U3DA 5TS2A 3HFJA 4ZT6A 1YIAA 3C8ZA 2JA2A 2QUIA 1CT9A 4S1OA 4EG8A 5DB4A 4ZT4A 4QBTA 2D5BA 2BTEA 2A1TR 2DERA 1K97A 3VGJA 1VBMA 1M8FA 2WSIA 3AFHA 1FYDA 2X3FA 4EF6A 1NURA 1WKBA 3IOEA 4MUNA 1N1DA 2X0KA 4KR6A 3CVXA 2CUZA 1J09A 3IMGA 3GMIA
chains in the Genus database with same CATH superfamily
5CB0A 3EZ6A 1JN0A 4LPSA 1ENPA 2QRVA 1FYWA 4ONEA 3L0IB 2CMDA 1CFZA 1Y4ZA 5CNKA 4A82A 1U8TA 3GFPA 1AXEA 2HF9A 4U4AA 1UP4A 3ZWQA 2XITA 1NF9A 1Y1KE 1IIBA 1KL7A 4MDEA 3UMSA 2C3OA 3KWLA 4CTNA 2OORA 3G8BA 2AJCA 2HLDD 2J3QA 4H18A 3F4KA 3AEUA 4WI1A 2ONJA 4BKQA 3ZEIA 4DXAA 4PX2A 3VMFA 3NETA 4D79A 3EGIA 3C6KA 1GPMA 1U6IA 5IVIA 3M3PA 3LVFO 1HFKA 3OTHA 4TXLA 4DJ5X 2ECOA 4QYMA 3ISJA 1OYVA 4CKZA 4BKPA 3FB1A 4EO9A 1NSTA 3IVXA 1U7UA 3QVLA 3GAMA 5H4GA 1VOTA 2AYXA 4QDUA 2OAGA 2OQVA 1C7JA 4M9SA 2YYSA 1AF7A 3L04A 4KB5A 3RKUA 3WL5A 2PKWA 3GLUA 5JSQA 1QFJA 5EKTA 1T0PA 3P5BA 1NXVA 4DXHA 2XA1A 4P4NA 1IY0A 2D2XA 1W4CA 2MOKA 2VHTA 1KEPA 3F6SA 3M6FA 5IP5A 2XUJA 3H97A 5TMEA 4HBZA 1HDRA 1NYQA 2VP0A 4A8JB 4EZIA 3A4YA 1OT3A 5JDIA 4ZCSA 4PC2A 5E7QA 3SS7X 4C20A 1QF7A 3N2NA 4MUMA 4BFZA 1KMQA 1V8PA 2OVFA 4Q9DA 5KMGB 2IE0A 2Q3BA 1IVYA 1RKVA 2IYZA 1UXKA 3UC9A 3R24A 4BRUA 3U4DA 1OASA 2HBYA 4I19A 1CEQA 2Q6TA 4PQGA 2HJWA 3SHTA 2DQ4A 4LHWA 4NJOA 3PLAE 1CPYA 3JU3A 2H65A 2Q1TA 4N5HX 4HLNA 4Y9RA 1E4EA 1SIWA 1YRAA 1LPPA 3MSCA 3OBIA 4AMBA 4AXBA 3C3XA 4H27A 3SKXA 1L1FA 1O0SA 5AJXA 2WE8A 2WYOA 1QLJA 1ORVA 5KC8A 3PIRA 1ESDA 4RSMA 1HBJA 3BXZA 5KOHB 1KR5A 1QIJA 2A5YB 3MC1A 2O5EA 3KEOA 3Q3JB 1YE5A 1A9PA 1DKQA 1UT6A 2EFJA 1SG6A 4ZREA 3WE7A 4D9JA 1QVWA 2G8LA 4MRVA 2IS2A 1DQPA 2AN4A 2Q2NA 5IBQA 3WX0A 2Z30A 3CUSA 5ELLA 5BV8A 4JT9A 3BWXA 2LW7A 5F78A 3IYLW 2M98A 3K5WA 5IT0A 1J97A 2ISCA 4QXQA 1Z4MA 4L4XA 1I5OA 1O5IA 1XCJA 3K1JA 1XZAA 1P4AA 1QK3A 1T6BY 1JTEA 2Q9AA 3E7PA 4MVJM 5T3UA 4HGRA 4BLVA 1J1ZA 3B9RA 2C0CA 3JQQA 4KIFA 3ZK7A 4TZ6A 2R8YA 5DLPA 3ZGYA 2H16A 1NUAA 2HUNA 1W88A 1BVHA 1VMKA 3BDIA 2LDBA 2NU8B 4DYDA 5BN3B 4W9RA 3VU1A 4DR3B 1AZTA 3WHKA 1NYTA 1GSIA 2V7BA 2BKVA 4NR0A 1VCHA 3MWEA 1PL6A 4GP9A 4Q3KA 2WTUA 1EYZA 4NMWA 4BV9A 3O4HA 3V00A 5F7JA 4EPVA 1MJNA 2G7MC 3HA5A 5LN1A 4L0QA 1SUBA 4AJPA 1A9SA 3ELDA 3OCCA 5LDDC 1AY0A 2O8BB 3DEKA 4LZLA 1DTEA 3KKNA 5B1IA 2C8LA 5K8UA 3VDQA 1I4LD 4HZIA 2GCOB 3COSA 3WK9A 1Z5PA 3KSMA 3CIOA 4Q9HA 1MH1A 3LXRA 3DULA 4CGYA 5F98A 2F3TA 3MJFA 4LRWA 1ZIDA 4PZ9A 1JIIA 3A6KA 3R5TA 4JT4A 1QQ5A 5DGCA 1EB9A 3OEED 4YRCA 1L4KA 3VYRB 4IQ0A 4Q3BA 1O0CA 3D2CA 1T4CB 3PNKA 2A1UA 3A32A 4LY6A 2QSZA 5LNK1 3WKCA 2FR1A 3F9RA 1NXOA 4E31A 4RL4A 3VNAA 3LFHA 4DGQA 3G5AA 3L0CA 2GBCA 5KAMA 1TPZA 2RCYA 2X14A 4JITA 1JWAB 2G04A 4L0CA 3BIOA 9ATCA 2EW8A 1OZ0A 4D6PA 4LMPA 2JKZA 3MYRA 2IYEA 3U4AA 3CSUA 3X1ZA 2QP3A 4Z9BA 1QR2A 4GAEA 1O9GA 3E7WA 3ONNA 4CNBA 2LCQA 3SBDA 5I45A 3LM8A 2FUEA 2O2YA 1ISHA 3I9MA 2EHJA 3O0DA 3UWKA 4DMKA 1WM1A 3M49A 3R0JA 3O7MA 4G0OA 2I22A 4RKFA 3GEEA 1XRNA 2RH9B 3UGTA 3KVNA 3WAKA 4PR0A 2O2GA 2C9DA 2IBTA 4ZYZA 5GVSA 1Q7EA 4RGBA 5TPWA 1UDCA 1JQDA 1OQAA 4EKEA 4RTSA 1MNQA 4XM0A 3LQ1A 1GADO 1R66A 1FS4A 4TMFA 1WQ4A 3ZY2A 4DM4A 5J2UB 1EDZA 1M2GA 3GGJA 4U0JA 1XNGA 4MKXA 4UZFA 1EHIA 3U0BA 1D0VA 3HYCA 5HWSA 5FR1A 3UY4A 1PGJA 1R0LA 1R0BA 2QQFA 5KX5F 1UAAA 3GA0A 4P33A 1Z2CA 2E9SA 1PGOA 2R6GA 2YY7A 1KAHA 1PW5A 3AHFA 2QR5A 2VAWA 4LF6B 4P3OA 1CR4A 1ISMA 3V1YA 1NXXA 4E70A 4ENSA 4I2VA 4JQOA 1P5HA 1T5IA 1K8ZB 1LWOA 4ZK6A 4G5YA 3OCWA 1NXTA 1QRDA 1II9A 2PFKA 3SMQA 1KRWA 4MEBA 2WSBA 3ZZTA 4YNBA 1Q7RA 4XQGA 5CNIA 2V8BA 1KVQA 4FFWA 1J0XO 5LA6A 3C7TA 4QDJA 4UEWA 2QE7D 3S2UA 2XE7A 4ZJZA 1U0RA 3FHTA 3QFTA 2ENUA 1K27A 2ZBQA 4WD3A 4X1OA 5G4LA 3M4NA 1XLUA 1BEEA 4GYKA 1OCEA 5FI0B 2QRUA 1LPBB 1O08A 1IVNA 1VYVA 1M2FA 3N3BC 3KZNA 3KPVA 1NVAA 4IOKA 4N6NA 4ZYYA 4GKJB 4RNCA 1CLEA 2H4HA 4IQ8A 3VHLB 2FQXA 3HWWA 5KCMA 5EZ6B 2YHIB 1CLUA 2QTHA 2QYSA 3AV0B 4GI5A 1Y5IA 1SVIA 4MO9A 5IJZA 1C7IA 4IPTA 4DNPA 4CXMA 2AT1A 2OLEA 2VSYA 1W75A 3QYJA 1WZIA 2HWXA 4UQPA 2P79A 4BC0A 4BXOA 1UEXC 3GLRA 2EJBA 2XIJA 5FFFA 3UMMA 1OB5A 2YFKA 5FLKA 2J46A 1AN0A 3O4IA 3ZYZA 1HZZA 1YZNA 3S2IA 1L8XA 1ONNA 3G8CA 2AB0A 5EMJA 4EG4A 1YFLA 5KBYA 5HGJA 3ETNA 1K5GA 4Z9FA 4BMSA 5ICEA 1KFEB 1RS0A 3SKYA 2X23A 1YNSA 1P17A 3PGKA 4HQRA 4TYMA 3T4XA 3ND7A 4GL4A 5LUBA 1EJBA 1CJVC 4G4IA 3FSGD 2XRZA 1FDIA 1ADYA 4FM9A 1E6CA 1ST3A 4F6RA 1PFYA 2WKPA 2Y4NA 4JH0A 1LVUA 1VXOA 2HGSA 2VSNA 3PVSA 2W70A 1P0IA 1XN4A 5EJ6A 3PC2A 5F5XA 5AT1A 1BGWA 3DDZX 1T3TA 1M2OB 2NQ2C 4EJ0A 4OHMA 1E9SA 2B36A 2XDWA 1YA8A 4PSUA 4WDRA 1EVKA 4YP1A 4BVHA 1UMCB 4DNFA 3TPCA 4IH9A 4ZCRA 5L8VA 5HF6A 5FTWA 4CTJA 4ROSA 5IWAB 5EP1A 1GTJ1 4IUCS 3BJIC 3AL0C 5E6SA 1R8XA 3H9BA 3B1WA 4KE6A 4EM6A 4X65B 3QU7A 2WV7A 4ZQHA 5HOQA 3Q87B 1NONA 4FGJA 3R6WA 3QVOA 3RYHB 4BO0A 3LPNA 3W3AA 4BUZA 3RRJA 3FJOA 5F1KA 4HNRA 4MX8A 2QTRA 5EPUA 5HEKA 3ZK9A 5HOEA 5EWMB 3EQZA 3EK2A 2DR2A 4KSBA 2GYWA 4I6EA 1USVA 1ZMRA 2NSDA 4NU5A 3BRSA 4ZPJA 3ZGVA 4L8YA 2XMSA 3OIVA 3IPYA 1IQ0A 3MUFA 5HA5A 5KJEA 4JI3B 1T6NA 2CFSA 3AY7A 1G41A 1NBHA 1W4AA 2CEKA 2NYVA 3JQAA 3MMZA 1EINA 2C3YA 5K3BA 3S7ZA 3ZIAA 5MN5A 2ZFUA 3PITA 2O2EA 2Q4DA 4RTLA 1CY6A 3BE5A 2FP3A 3KV3O 3KG2A 3CH6A 1ZOLA 4B7CA 3AWDA 1CZLA 1KEEB 5T4EA 1DTWB 1Z6TA 4K3UA 2JBHA 2XT6A 2BI7A 2ATXA 3B38A 3I6MA 3WY9A 3OVMA 4G8CA 3VUFA 5DLYA 4HT3B 3C45A 1IOWA 1J8FA 2CNLA 1PD0A 1RW4A 5K6TA 3TB4A 1V5EA 2B61A 1P1KA 3X1KA 5LJLA 1IHDA 1YMQA 3RIYA 3W06A 3PFHA 1P4JA 1JBQA 1JXOA 2J9YB 4MMZB 5DK6A 2BGIA 5LYYA 3QI7A 5D5HA 5F7ZA 3PC4A 3FNRA 4NOKA 3VXKA 3THXB 4YJ2F 3T3EA 4DDMA 4KO2S 1BCSA 3WQBA 2IP2A 3LC1O 1LDEA 4MQEB 3CE9A 3W34A 3WGVA 3IIIA 1WUYA 4X6LA 3UF0A 5FAKA 3G13A 2BUBA 1T3LA 4RX1A 3RWBA 3BA1A 4WCFB 1FMJA 4ESVA 2B1JA 1QBKC 1L6RA 4CKBA 1FVXA 2Q29A 3GJXC 2F67A 3ELUA 2EFEB 1NJ2A 5FLYA 5MGBA 4RJTA 1VSQA 2Y0CA 3OQ1A 3IQZA 4MRMA 1W581 3LUPA 1M5RA 2BGTA 4IYRA 4KQFA 4QNMA 5DX0A 4MGKR 2I1LA 4DV4B 3BSSA 4X1KB 3AVTA 2XYVA 3K92A 2J8ZA 1E3LA 1Y1QA 3MUOA 1HL3A 3N76A 3TGLA 1Q6ZA 1PUJA 1X19A 5HZGA 5BUQA 2C78A 6AT1A 4NNPA 2DT8A 2PGJA 4Z2YA 4MS4B 5AI5A 3GPCA 4RDCA 3HUEA 3E0XA 1KK1A 3KPUA 4A2PA 3B78A 4V3CA 3IEKA 2B1GA 1ENZA 2J0UA 3K72B 5T4FA 2ZYAA 3NTOA 3ORHA 1PQUA 2PXCA 3OY7A 4TV9A 2P0EA 4A10A 4EA7A 2HBZA 1ZI9A 3ZIUA 3M5CA 3NHWA 5DYGA 2VQDA 3KYDB 5LVAA 4S1WA 1SVLA 5FPKA 3H0EA 5FA5A 3HCCA 3ZKWB 1VDZA 2YZ7A 1AO3A 2HMAA 4C7KA 2W4QA 4DRZA 5HGXA 5KTYA 3B6ZA 2HY7A 4U7JA 2VOJA 4ALIA 2PHZA 1MGOA 4QYXA 3U13A 1MENA 3QVTA 5BUCA 2I6GA 4MWZA 3DONA 2X0DA 4E30A 5LYJA 1FP4A 3UAVA 4CE6A 1JE1A 1TT5A 4KK4A 2H29A 3AW9A 5IFKA 1F4VA 2QPTA 3RD5A 4MINA 4XVRA 4AP5A 4QSHA 3UW1A 1XWFA 4PAQA 2G07A 3SYMA 3ESDA 1SHLA 4TLMB 2AR0A 1T9AA 3MSXA 4RKQA 1M8GA 4U3JA 4W5NA 1P2TA 1ZO8A 4M1EA 5K3DA 2V9CA 1AUVA 2HHJA 1L5WA 2QVXX 3LXMA 3IVCA 4PC6A 5K8VA 3U9LA 4TZKA 1VB5A 1ZGJA 2MYTA 3E8SA 3FE2A 4NE2A 1W1UA 3CYFA 1I8TA 3HXKA 4CQNA 5EGNA 1Z0DA 5LDHA 1V8FA 3JS5A 1XRQA 2CCGA 3REFA 3UXHA 2DTEA 5EN4A 1NF8A 1RBYA 1V8OA 3HB0A 1XWIA 3QPCA 4DL9A 3HUTA 3W8DA 4AUNA 4FBMA 4C0LA 4XOUA 4EG1A 2RK4A 5BMVF 1FNNA 5DHAA 2C2BA 3WSWA 1P29A 2PGLA 4Q4AA 3UHOA 1AMUA 3VO2A 4GF5A 4FYMA 2HDNB 1QP8A 5L3QA 3IO3A 3NH6A 1PHPA 1F20A 1K68A 2I6QA 3UCEA 4NMHA 1D4AA 2V4ZA 1Z35A 3IA2A 1ZZEA 1RLJA 2JIZA 2R60A 4NTZA 4YP5A 2MMGA 3FNQA 4J3JA 5JVDB 2H2WA 2QTNA 2W48A 5HKKD 2W2XA 1GM5A 3BERA 2DZDA 2ONKA 4V02A 1QS0A 4F0JA 3TOXA 5KVQA 4DCOA 1NV8A 1P60A 5CFPA 1SUIA 2H31A 3IQXA 3S6JA 4Q4CA 4IXDA 2IV3A 2C99A 4RSGA 1OBFO 2FYTA 4ZT6A 1GAJA 4XWKA 3E81A 2B2XA 4PFQA 3C8ZA 5CK4A 5DM4A 2PD3A 5K4AA 5SYNA 4ESHA 2G25A 3NG1A 2X77A 3LT0A 2PSJA 5AVXA 1GFWA 3LYHA 3UN1A 3JWEA 8OHMA 2IZOA 4OM7A 5GGYA 1ZHFA 1YVEI 2VNJA 1SD2A 3G2OA 4FGUA 4NEQA 1ICEA 4YRDA 1K97A 1MT0A 3F6RA 4X20A 4RHFA 3AR3A 2CXHA 5T8KA 2AZDA 3BL6A 3VVBA 1HR0B 2WSIA 5JNVA 4JI7B 4AAYA 4ZI5A 2W0MA 4DB4A 3HDJA 4JLVA 3MERA 1GGKA 1KJNA 4JL6A 5K5EA 4TL8A 4PYKA 6YASA 3WQQA 3IMGA 4Y6QA 2A9KA 3D6HA 1V5WA 1RTTA 3E9MA 4IVQA 1NBOA 3BMOB 4JNKA 4RC9A 1M83A 2A5DA 2BJWA 3AWIA 4R9UC 1T9GR 3VAZA 1Q0ZA 3KKZA 3R7WA 3WB1A 2Y2VA 3N7UA 2P3LA 1R0XA 1THZA 4EYOA 4TTVA 5C2JB 2IZ0A 1TXGA 2XX3A 3ZLTA 3T9EA 2GS9A 1NT4A 2H1WA 1DKUA 1C3OA 2H7CA 4JOCA 5HIJA 3WQRA 3MJVA 3WGMA 1PLKA 3UGKA 3MGCA 4LNUB 3U7EB 1OVGA 5KYGA 2VHVA 5F5LA 2ZAIA 3I28A 4OFBA 1E9VA 1N2CA 2WICA 1Z8HA 3CUWA 4EHHA 1QH9A 4AY6A 2XV1A 4I5FA 3VR6A 5EIFA 1G6OA 5MFPA 1YJ8A 4CMIA 3UYKA 3ZDXB 2IYUA 1FTGA 3CR7A 1EJ2A 3F2IA 3EVZA 4Z7JA 2UZIR 3TINA 3KDAA 2J0EA 2OCYC 1XELA 3R5FA 4PYOA 1K8QA 3WJ2A 1Q16A 1YRWA 5ERXA 3S68A 3TK1A 4PE5B 1QGDA 5H83A 3ORSA 1SCNE 3NUGA 1X1CA 2ZE5A 4ZRMA 3UH1A 4F93B 3U4QB 2JD0A 2OLKA 1XX6A 3IVGA 1XVAA 3OLXA 1XEXB 3P2YA 4G5RA 4EBBA 2WA2A 2W6NA 3CFYA 1G8JA 2P9EA 4FDAA 4IY1A 2B82A 5DZSA 1KDYA 1RM5A 3G0IA 4FMCF 4PO8A 2I34A 4EAQA 1IN4A 4DR2B 2MINB 2ZRQA 3EFOA 2NSJA 1WW8A 3DOCA 5EL0A 3O5AA 4KYUA 3E58A 3HCDA 1SC9A 2ZQZA 4IDDA 4NAVA 4G6ZA 1Z16A 4AROA 1L5RA 5EJIA 4ZV9A 4MV4A 1Z17A 2QENA 3TMYA 3FMIA 3E8XA 1UPFA 3MBIA 4I9HA 3H1AA 4CYMA 5IDXA 1FJGB 1YC5A 3PXGA 2CDAA 4PHCA 4D7AA 1HDXA 4ER3A 4F5ZA 2FW7A 5KNCH 2BLLA 2BZ0A 1WU8A 4BTEA 1Z2PX 3V1NA 2FEKA 5C4MA 2GWHA 2PZFA 3I2JA 5E9QA 1ISRA 5DM0A 5DOVA 4COKA 2H2GA 2GLUA 1TGYA 2GYYA 5JYEA 1DRVA 1I13A 3QHAA 4FOSA 2HRZA 4WLFA 3L41A 1GOTA 4OQPA 3RHFA 5E3HA 4KHPB 1L8OA 3JAKA 4YJFB 2XMRA 3OZEA 4I1UA 4TV8F 4I55A 1ZIYA 3ITKA 3U44B 1FDSA 1ODCA 4INZA 1J56A 5FIUA 5BOSB 2PYDA 1H3EA 1XFDA 1YH3A 4RXTA 1JPNA 3Q10A 1EA5A 3A3NA 1KVRA 3MAGA 2HSWA 2YCLA 3G1UA 3H6GA 1OVMA 3PNBA 4FHDA 4YT4A 5JNWA 5JWOA 1ZVVA 2OHFA 2DWPA 2EYQA 4MLCA 1MT3A 2W37A 3I58A 3HR7A 3EAQA 4NEGA 1OXMA 4GOND 4RHCA 5BV2P 1OYWA 4FS3A 3VZDA 4YUVA 2DC1A 2PPLA 3FMPB 3REGA 2GJAA 1N5MA 1CRLA 1MOSA 1EU1A 1SUCA 4R69A 1BHQ1 1U5BA 16PKA 2JFOA 3KE9A 3OZIA 3WYCA 1QKJA 4X00A 1CB7A 4QHSA 3T7CA 1ECJA 4L27A 2NPFA 3EPHA 5ITZA 3KAKA 1AS0A 5TQVA 2Z8YM 4YWHA 4ECEA 4ROTA 2O0KA 2QJRA 1BVYF 2NZJA 2Z8ZA 4WKNA 4XX0A 1CZUA 3WIDA 1ZRNA 1CUEA 3CNHA 2QTBA 3E22B 1SY7A 3FMVA 4KIGA 4G4SO 4BQSA 4C05A 4UBKA 4JSYA 2H1HA 2IYOA 1LI4A 1NVBA 3GMDA 1OXSC 1EG2A 2FPUA 5E0KB 4K9RA 2ZYWX 1X1AA 4O2LA 3ZWWA 1WBJB 2FR0A 1KPIA 2RAPA 3C7AA 3WXMA 2DLCX 5JXIA 1VPWA 4UM9D 2HMSA 2PH5A 2I4IA 4H59A 3OQMA 3I12A 3ETLA 3OE1A 3W7VA 5CPBA 1DZIA 4E5YA 3K9CA 1SOWA 4G1VA 1N3IA 3HRHA 4B48A 1NDUA 4CF4A 1JP7A 1QWOA 2ZWIA 1OH6A 3GBPA 2ZKIA 3VR2D 5C8DA 4UVDA 1YRLA 3G2KA 1FFEA 3BFJA 1CVLA 2G72A 4FLEA 4MTLA 3MVEA 3TLJA 4A6XA 4GL2A 1KS9A 2ZT7A 4G3XA 2JZNA 4JYMA 4XUGB 3HO8A 3WNDA 3ZNOA 3G7SA 2WM2A 1KZ7B 3I9KA 5JBIA 2QLFA 2PJRA 1U3GA 4MV5A 3DE6X 2HJVA 4M9QA 3CKLA 3L6RA 4E32A 1QHGA 3EN0A 3CVVA 1UC8A 2QIOA 1VLHA 2HA7A 1EQAA 4P4SB 3JQRA 2FOIA 1WHTA 2Z2KA 4KE9A 2YASA 3B13B 2RHMA 4C4SA 3F7MA 2YWCA 3OIGA 2J30A 1XNJA 3B1KA 4YRFA 5TNXA 5HZMA 1NXPA 4C0AC 5ICSA 1PZEA 3HDGA 1WUJS 2YWJA 3G79A 2PR7A 1G21B 5FA8A 4JLWA 3SNHA 3VTKA 1VG1A 1FS6A 1DBSA 9MHTA 1L8LA 4WEOA 2PKCA 4XWOA 3FPCA 3RVRA 4WADA 2PZAA 3LW8A 1EM8B 1J4AA 4IFIA 4BLOA 4BV8A 3WA7A 4WGFA 1C4WA 3LDAA 2ZWAA 2VDNB 1OU0A 4W5OA 3NUZA 1VMEA 3QBEA 1QV6A 1UOOA 4OV6B 3FJYA 1FLVA 2GEUA 4RK1A 4JC0A 2JLVA 5DNDA 1SIUA 1ABFA 2GKOA 3TSWA 1U9IC 1QRSA 2QJWA 3OTWA 3WOHA 4GEKA 1LS1A 1DWUA 1Y1LA 3PXEA 2E18A 5JNUA 3VR5H 2IS6A 1OH5A 2BZGA 3KT3A 1E3WB 3WVNA 5IVPA 1I24A 2FEMA 3E23A 1WRBA 4CDNA 4DLPA 5L45A 3ICQB 1N6KA 3Q6NA 4K2AA 1FXWA 4D9HA 4JJKA 1RQGA 1CCWA 2O7VA 4K6KA 4QGBA 1JJIA 2RKOA 4OG2A 4I1VA 4PYRA 3AR4A 3ZEAA 2PDAA 4HADA 2VXYA 4LHXA 1TADA 5ALTA 1X7YA 2Y66A 1DFIA 3EXAA 4G86A 3HJAA 2XF2A 2FZKA 1YAHA 2ZUUA 4K88A 5KYWB 2FPIA 5BY2A 1ZNQO 3HP7A 3O8OB 3NIFB 2IEZA 2IW1A 4KXUA 5DYYA 5LZ8A 1OXUA 3UCXA 2NLOA 5T57A 2JAUA 3WMGA 3A3YA 2ROQA 2ZZMA 1G8FA 1NR1A 2WIBA 4LRTB 4CNQA 2CYBA 1RYNA 2OZVA 2ZVJA 4J0CA 1T0JB 5FPQA 3WLQA 5JAIA 4KQKA 1JDNA 4NAHA 3A36A 2WD9A 4JQZA 4RVCA 1J42A 4GP6A 3U48A 5ECGC 4UUPA 5KNCD 4IJ5A 3EA5A 1PZGA 5J3JA 2C03A 1G7CA 4O1MA 2HK9A 3ZY6A 5KTTA 3EDRA 2IYSA 4XLLA 1TUEA 3ODPA 1EUCB 3ZIDA 3F6BX 1RCTE 3C5CA 1GUFA 4MR9A 5E3IA 3ZR4B 3DBRB 4DDWA 2O8VA 2JJQA 1MQ8B 3L8MA 1XXHB 1IPEA 1YBVA 3CINA 4U2GA 4HDSB 3H11A 4Q47A 4WNYA 1YQTA 4G37A 2ZYUX 3ECSA 4XVHA 1FF9A 3VZBA 3V4RA 2ZK7A 3DVQX 4MRSA 2X1MA 1JUDA 3O93A 3P9YA 4KU4A 2NPOA 4RQAA 4WLOA 3RBXA 1GTL1 1AKVA 4ZOBA 4BJ3A 5IKMA 1V9LA 5J2TB 2BR5A 2REBA 3ADKA 3NVAA 5HE9A 3CS3A 3HKDA 4C4PA 4ITRC 4AMYA 4XQEA 2ABWA 1Y9DA 3MT9A 1CUBA 1DEHA 1G1AA 1NLMA 2A8YA 3A4TA 3TAUA 1JECA 3RBVA 1VBKA 1KO8A 1V1JA 3NANA 2CLFB 3OZUA 5ECYA 3K0KA 1NC1A 1N9ZA 3ES9A 5E1MA 1H0KA 2G9QA 4U9UA 1SNYA 2JC3A 3OPYI 2Z98A 5H9VA 1Z9BA 3QH4A 4MKGA 2JJ8A 4BO1A 1E2LA 1MP0A 3GFOA 4FR2A 3SHFA 1ZFNA 2QDKA 3OFJA 4XJTA 2R1ZA 1UJ5A 3DV0B 1YJXA 2IXFA 4NF2A 3HDTA 5CUQA 3T7DA 3TX6A 5LQCA 4S1TA 1LNQA 3H1BA 2FCAA 5CFZA 3ZZ0A 1Z5WA 4NFYA 2BC9A 1JILA 2DBYA 4WWHA 3JQ9A 3K0CC 2BJHA 5HKBA 3FGPA 3UMYA 5EP2A 1LTQA 4CLRA 1RM4A 4U0KA 2BHRA 3FR7A 4MVXA 2VPIA 1SKQA 3ZWCA 3PXCX 4UDOA 2XCTB 2GZMA 2BYTA 5HSGA 1FVFA 2X58A 4HDNA 3EVEA 4RJIA 1MBZA 1EM6A 5EUCA 3T3PB 1G5PA 1S4MA 2GKGA 2YRFA 4CU5A 5IJWA 2PTGA 3A9WA 3NHUA 3NONA 4G0UA 3Q88A 1I94B 2YJTD 3PUZA 1T8PA 3W4IA 2AL7A 2J4DA 2HJRA 4G9GA 4R8SA 4DUGA 2R5WA 5GVRA 5GY7A 5FR2A 4BDSA 3IE2A 1KYXA 3JWGA 3O3OB 2GTHA 4MOWA 1EX7A 2Z3VA 4D8WA 2WD8A 3EZLA 4J0KA 2JDIA 3Q0TA 1SRQA 5EKDA 4RVNA 2NIPA 4D8XA 4P0PB 5K6AA 2B99A 4WJLA 3H99A 4JR2A 1BMFA 1JSCA 1U8XX 2ZB3A 1MVOA 3CA8A 4RYLA 5DGTA 4BVAA 3KEFA 3FTCA 3JQ8A 1XN1A 3DEJA 1L7VC 1RYBA 2QJFA 5IJXA 2BAGA 3OOSA 5BVGB 1DWOA 1E1NA 2F1IA 4OUKX 5KWIA 1J5EB 4LZAA 2FQ1A 4XA8A 5KYVA 1H0HA 2ZSUA 4CQLA 1GGHA 4WZBA 5I9SA 1PEAA 4UUMA 1QHSA 2INGX 4G8JA 4OQLA 2ASEA 2A0KA 3EULA 1VLQA 1C4XA 2WHQA 3LT4A 3MT7A 4Z0NA 1M8PA 2AMFA 3IUJA 4RESA 1W0JD 4CMGA 3PC8C 3LYLA 4PEVA 5FH9A 1Y6ZA 1QAMA 2XUHA 3N07A 1FJHA 3Q7RA 1KY5A 3QPWA 4KVZA 3SYTA 4I9NA 1O4VA 2X86A 3G82C 3RQSA 4YHHB 4E2ZA 5CBPB 1I6MA 1NNUA 4R2IA 4ZU6X 2QP4A 4YCJA 3B9BA 1OWPA 1XMSA 1LD3A 2HCRA 3CH5A 3QA3E 1IL0A 1G3MA 2SKCA 3BE4A 2CNWA 3AR8A 3L40A 5FNZA 5CH3A 2VZ0A 3DOEA 1GPDG 1YBFA 1T15A 1U8EA 3NC1C 4UUNA 3T7AA 2ANBA 1R50A 2KMLA 2Q9BA 3PKIA 4CG1A 3VR5D 1THMA 2YXNA 2DX7A 3B2QA 1VRVA 1ZG3A 3F67A 4XD7D 2J41A 2WF5A 2GM9A 3ZCXA 2ZTVA 2Z56A 3UOWA 3K4HA 4Z0PA 3WIOA 2RHLA 2LXNA 1KAEA 1V6CA 3NT4A 1SB9A 2B4KA 4HVTA 4MQ4A 3TSCA 3WGZA 4U6NA 4NMXB 4CDRA 1L8AA 1Z34A 4L9WA 3EOBI 3I6IA 1HG0A 1V3TA 2UZAA 3VKVA 2C2GA 2H7VA 1ZVKA 1BXGB 1JR2A 1X1DA 4RUKA 2PUBA 3RABA 3QFHA 2EYUA 1IOLA 1OFGA 1UC4B 3JQPA 2QT0A 2X41A 3M5PA 4W6ZA 3TO5A 4ZGGA 4ZPXA 4C7OA 1P2DA 3ABIA 3FNGA 5HKLA 5COBA 1M6EX 2IUTA 2BGMA 4FDMA 2HA6A 1QK5A 4GYJA 2F4NA 4KKVA 2M6RA 3RSLA 2D1QA 1GTG1 3A2NA 5ARDA 1BYIA 2BMDA 1B1AA 3KKEA 3S2YA 2ZT8A 4G89A 4I9UA 4W82A 2ZCJA 2GBLA 1VGVA 4ZYTA 3LZ6A 3SP1A 3MAJA 2P2NA 4AMZA 4BO2A 1TU0A 3COVA 1DO8A 5K3CA 1PW7A 2ZDHA 4ZARA 2P68A 2BFDB 2BSXA 1T91A 3CPEA 4KRYA 1UBRS 1IBSA 3ABSB 4PFSA 1CDZA 3FRJA 3NZEA 2Z2YA 1Y37A 4MV9A 1NWHA 2H54A 2EP8A 1KTIA 3PWTA 1TZJA 2X2PA 4HNVA 5GZ1A 1EP9A 3H1FA 2EAUA 4JC5A 4O4LB 1VM6A 4QBTA 2D5BA 4LZJA 5ECWA 1XZDA 3EC1A 5D2CA 4Q4JB 3T1VA 2ODWA 2XJ4A 2XOEA 3L82B 1ZW6A 4Y2JA 3AH8A 3EHDA 2G67A 3OM8A 1RE1A 2OBXA 3HCPA 4RGQA 5TIIA 2IHNA 1N32B 1DAFA 2ONCA 4HXYA 4AZ0A 5JSZB 3K9LA 4MH0R 1T2CA 1S3IA 3KB1A 2YBEA 4TT3A 5ALVA 4AO8A 4CLOA 2X0KA 3BREA 3CWCA 2WYVA 4PLGA 5GOZA 5HHTA 3AEQA 4JI2B 1U94A 4KO3S 4O4HA 3AFNA 3VISA 1YQUA 3ZLBA 2PZLA 1O8BA 1R9JA 3S28A 1TYCA 2VEOA 4G0PA 5BRAA 3O4RA 3H5IA 4XYMA 1MC1A 2PS3A 3LCJA 4GP7A 2HLDA 4YTEA 3WIUA 3RFUA 1NKSA 4XXHA 4MGZR 4QECA 1KMHB 2BTQB 4RMHA 1B76A 5TMBA 2Z2ZA 1W47A 3LK7A 3PLNA 5JC1A 1EI9A 3OOHA 1AKNA 3D8HA 4JZKA 3NXKA 3I5XA 3H1GA 4PPYA 5CX4A 1PYDA 4EUFA 1AQLA 3DJYA 3DVAB 3NHYA 1Q1AA 1T5BA 4KXLA 4PZZA 4QUDA 4CI0B 4F4IA 1GU0A 2QXUA 1TZMA 4V0KA 2VLIA 2ZJZA 3KRTA 4FSHA 5FV7A 2EFYA 1M6VB 4D4MA 5JNTA 3W5BA 1E1CA 2V3VA 4QJ3A 2G17A 2FX2A 1PG5A 2CXNA 1W8IA 3ITDA 1UJCA 1YZ3A 3OPYA 2Y1LA 4M54A 2C5GA 2ZI3A 4N0QA 5FUWA 2IEGA 5G0TA 4HGNA 3WMEA 4BY9E 3MQ4A 3AVQA 4F9EA 4NZ9A 4JYPA 4DV6B 1E3DA 1KDZA 3PDWA 4U00A 3EZ9A 2IU4A 3WNBA 3CCFA 4YJKA 4D56A 3EJWA 3C4VA 3QX8A 4HEA1 1EBFA 4M9XA 3HQ4O 2ETVA 2JFWA 2R8OA 2IY7A 1NNLA 2OHXA 3P9XA 2XQFA 421PA 3CRMA 5M29A 2H6EA 3CRW1 1U04A 1OA0A 1V26A 3UKOA 2KB0A 4XDHA 3RBZA 3QE9Y 2O8FB 3C98A 5D3MA 1CULC 1JJ7A 1TAQA 3WBJA 1S96A 1YK0A 2J3KA 5AJHA 1NRXA 3PE3A 3A7EA 1OREA 1T5LA 4W5HA 5CITA 4F5DA 1Q14A 1MB3A 1SVOA 2BBSA 3N2GB 2QI9F 3I8OA 3B8EA 4HNAB 4C03A 4HS4A 2CXRA 4F2HA 2Y6VA 3AP3A 2FSIA 1IBRA 3HKCB 4ACAA 3JVIA 4DTIA 2AK3A 4Z6KA 2J9RA 5CIWA 1UEIA 1UJBA 1HMYA 5A0VA 1D1TA 2XH8A 3KTFA 3QFSA 4PG8A 1PJTA 3PXXA 1J2TA 3GJ3A 4J0IA 2XE6A 4PLWA 4TUYA 2FUCA 2NUTB 5I01A 1DV1A 2E1RA 1FSSA 2I6TA 1YQEA 2UVQA 3KVYA 2I2FA 4HLQB 4MS1B 5D84A 5CAEB 5EIXA 4Z3OA 2WW8A 5CDTA 4BFWA 3AV3A 1G6Q1 3S2SA 1Z15A 3ED1A 4YWJA 2QUBA 5JDCC 1H8EA 3IALA 3AR6A 2J3LA 1TF5A 2JLYA 1E8DA 3NS7A 1Z4KA 4OHOA 4HJXA 4OCZA 3TAXA 1ZCJA 4ML3A 5TJ9A 3MPUA 5CD9A 2YRWA 1VL1A 1Y4AE 3RFTA 1VSUA 5DHQA 3C3PA 4YA6A 2KM1A 2O1XA 3OZDA 3P32A 3PL5A 3OQPA 1DAMA 1W9HA 4Q66C 5CPFA 1E62A 3OCUA 5G2OA 3BC1A 1YJCA 1Z4IA 1DQYA 3IDFA 3U17A 3VOAA 1YDFA 3EPPA 3KJZA 1M9NA 3QEOA 2E6UX 3AINA 5JY6A 1L5QA 4PQEA 3AUFA 3K1AA 1GPYA 5F64A 2FUG1 2F8TA 1J07A 2M6SA 4KQ1A 5J2UF 1B7GO 1K88A 1PNQA 2CF5A 3JW8A 3LQRA 3I1JA 3TEMA 1AQ6A 1F6DA 1KYTA 1WMSA 3UHJA 1ZGGA 3M6AA 4PAGA 1E6EA 1NI5A 1X77A 5CNMA 4M98A 1UBHS 3Q7EA 3WJAA 3TUIC 5B6PA 1CKEA 1Z18A 5J4VA 2D7CA 5AHRA 1CRQA 3D3WB 4A73A 3CT4A 3OEEA 3WDSA 1UBKS 4JK3A 4QQNA 3W04A 1EVYA 1PN3A 1ZCZA 3ZU2A 2QAGA 1GNRA 2D8AA 2A84A 4UMFA 1RQPA 3CM0A 1UKCA 1TJPB 3DBLA 3NTVA 4LJ9A 4D9KA 3HLYA 1N2JA 1UJNA 2EV9A 3KT0A 4W8OA 3ZJVA 4PVDA 4WFJA 4DWJA 3HE3A 1XTVA 4HLUC 2H2IA 5IW8A 2R6ZA 1FCJA 1TCBA 3TCKA 4X64B 1WXXA 4PZYA 4F12A 4G0WA 5AW6A 1I7NA 4N41A 3FLBA 3VPFA 4NABA 4S12A 3F98A 5DX1A 3D6UA 2O1WA 4AUKA 3GLHE 5L53A 3UK0A 3IGFA 3UEOA 3AI3A 4LJSA 1TYBE 5I7HA 5ITVA 1V16A 1X9HA 1YQDA 1ONSA 2C8KA 5FHQA 5L3ZA 1RADA 1GTZA 3COYA 4R83A 4V0OA 4BEWA 4KOEC 3VC1A 3E9RA 4MCIA 3A05A 3TRHA 4DA7A 1VGQA 4I08A 1AV6A 1D9ZA 4A26A 1BC5A 2PFSA 3W5IA 4Z4CA 1CZKA 3K71B 4Y3UA 5KYUA 3O92A 2VDQB 3AJEA 4B6JA 5FPYA 1ZUNA 3JASB 4CQMD 3UNXA 3OIFA 4I1OA 3THWA 2I8AA 2YIDA 3WRYA 3AJRA 3F8TA 4V2UA 3E9CA 5JXHA 2GHQA 3GOQA 4RZQA 5C3UA 3GLKA 1RI2A 4RDXA 2AJDA 2QU8A 1UMDB 3BKWA 3L1JA 2AWNA 5CFNA 3BAZA 5I6DA 1XL0A 2FV8A 4U6QA 4I4TB 2W42A 2BHTA 1NBMD 3LGAA 4L5JA 3KQNA 3KOWA 5AK3A 4R9RA 4LSWA 2VCEA 3FHOA 3ZJUA 2I2CA 5FPHA 2O19A 1PK8A 2GAIA 4YUZA 4NOJA 4N7BA 4DSAA 4IGAA 2HK6A 3DEHA 3ZKAA 1MRNA 4HWGA 2IXTA 1PE0A 4LJ6A 4BB9A 4CMBA 4CI9A 4D3XA 5MHTA 4N18A 4ZRNA 3BMQB 4CFZA 5JD3A 4EECA 5FUXA 3ZE1B 2XUAA 1J6UA 1E7RA 1G4UR 2IEDA 4UD2A 5K3SA 1NMSA 1WJGA 2B94A 1IPHA 2FEXA 2WHEA 3IQDB 4A5SA 2X4GA 5BP7A 3LX6A 5FBVB 3G0BA 5AW8A 4H3HB 3B3FA 5A7GA 1DOZA 4J2TA 1GUAA 1N3BA 3TCXB 1TO1E 2RJ3A 2V7GA 3GIDA 1OAOA 2PZBA 4MVYA 3VU9B 2NWQA 3Q40A 3FKJA 5AVJA 2ILVA 3OFND 1KZ4A 1V39A 5T64A 1NHWA 4IZHA 1KZ6A 2V7TA 5GINE 1GNVA 4QUEA 3PL1A 3FPBA 4QXAA 5DRYA 4XR4A 3UAWA 2HK7A 1RYFA 1E5LA 4GX2A 2DECA 4PCLA 3EFEA 2JK0A 2FNAA 2NX2A 3L9XA 4RK6A 1ZGHA 4ZOLB 3RUAA 5C7LO 2PX8A 5C52B 3RTBA 4KW7A 4YO8A 4DCMA 5HUHA 1F17A 2W00A 2I1QA 5H02A 2BN4A 1NFRA 2YW9A 3FSGA 4XGIA 3OEHD 5AO9A 3C6MA 4BGEA 2FLWA 3PXUA 1P7ZA 5CYOA 1KEUA 5F7OA 3P19A 4CCYA 3F6EX 3SI7A 4FFMA 2QWXA 1Z5VA 2WUVA 4AWBA 4C08A 4HZUB 2V6IA 1A9QA 1KDRA 2A9JA 2FXVA 3T9FA 1ZU4A 4RV4A 4EGQA 4ZO6A 3TLXA 3TZKA 1Y7HA 2GR9A 2RC6A 2HWKA 2YNMC 2NU9B 3DWEX 3L7BA 2M1ZA 4G0XA 4YJGB 1AXGA 2XB4A 3GJ7A 3WMRA 1A8HA 2V7UA 4QJ5A 3NIWA 1KPHA 3VHXB 5BYJA 1A5AB 1NKVA 1VGRA 3GBVA 1E2EA 1P2FA 1Z08A 4KQWA 2XYPA 3PQ6A 4OFXA 3WLJA 5IDWA 1ID1A 4DQVA 2GPBA 4ZHQB 2ZPTX 5B4TA 3DDCA 1UQTA 3J80A 3U4MA 1U0JA 4KMSA 3BWBA 5DP1A 1JKJA 2PS1A 2ZPUA 3EWAA 2HZ7A 3C4JA 4NULA 1XEWY 3NTQA 4YCCA 3DO5A 3K6SB 4H0FA 5PNTA 1VPTA 4ND1A 4RSRA 4UAVA 3ZW9A 4V1CI 2XUOA 2J3JA 2P7HA 3KL4A 2ODTX 1AO0A 1X87A 4D0RA 4G8DA 4B3IA 3MMSA 1YIDA 1C1HA 4WESA 1KDPA 1R8QA 4ZXFA 3ZI4A 1H1LA 5B6JA 1N9GA 1KORA 4GR5A 4LCBA 3PICA 4P8RA 2LD4A 5G40A 4B8ZA 2WAAA 2CW5A 3QV2A 4B3FX 5I7EA 1H22A 1KK2A 5BSHA 3PCRB 5JJ5A 4ENQA 3L7AA 2NU7A 2WHYA 2Q1XA 2BUCA 1D1QA 1JZQA 3PGA1 5HR5A 5IVHA 1TC2A 1NYLA 1JQ5A 1L5SA 2RIRA 3OD5A 3QU9A 5K0ZA 3S5JA 5LQKA 2OENG 1EVLA 3ESCA 3OI7A 1N57A 3PHLA 1XHLA 1ZOSA 1LSSA 1XQ9A 1RKBA 3RYFA 5I51A 1RAIA 1WLSA 1F14A 1YONA 3QU5A 2ZROA 5KOIA 1AK9A 3GLTA 1U0HC 5I9NA 3MIIA 4WA8A 5JEEA 5D87A 4EPWA 1X7ZB 4NE7A 1U2DC 1KYQA 3KUKA 3EYAA 4BYMA 5I5EA 3OLQA 4N5DA 4B6EA 1C9DB 3EXFB 4OM8A 4LN1A 2WFAA 5FPSA 5A5VA 3I61A 1H2WA 4Q37A 4KHZA 2X9VA 1F9AA 1XAIA 3QOYA 3N58A 4GC9A 3TB6A 5GJBA 2ZR9A 2DFPA 4DSTA 3L4BC 2VTDA 1S8OA 3AK4A 3BORA 3PFIA 1UFRA 2JI7A 5AQ1A 1JAZA 1E69A 2B5WA 3GAAA 4IJVA 1B2RA 4KNWA 1X1TA 2ZWMA 3D1LA 4PO9A 1LPNA 3FBWA 1NVXQ 1SRRA 3CUTA 3HEAA 2WJVA 5HTKA 5HBRA 4QYIA 1B0AA 4ZQFA 4EJSC 2QGZA 3T1QA 3EUFA 1XZEA 4D4IA 2ZJYA 1K8XB 1RWWA 2HFJA 1E2FA 1K6JA 3FWPA 2MT9A 4LDJA 3P26A 4MI6A 2H4WA 1YB7A 4AZ3B 5D1NA 4PZPA 1TAHA 1GDTA 4LY3A 3HPRA 4JUCA 4KLAA 4A1FA 2POCA 4F8JA 1BRMA 4MWDA 1U90A 2OFFA 5HJEA 2IW3A 5CA1A 4MW6A 5CCBA 2Z2JA 1PV2A 5JVDF 3H5WA 3I6QA 4QPZA 3JZAA 3UG7A 3OE7D 4MQFB 4D9MA 1G5RA 3SC2A 2Z5VA 4NNJA 1X74A 1SCJA 1Z25A 2G5TA 4K8OA 4J2HA 1XFAA 1U28A 5I9BA 1K7XB 4FILA 4FYHA 4JIGA 2RGXA 4IFTA 4LEIA 5HQ3A 4JCCA 1UFVA 4ZYVA 4LTMA 5HYVA 2PBFA 4CMKA 2H17A 4B5LA 1RWMA 1HRKA 2A0XA 2CEAA 3AU9A 4X92A 2DYKA 4CIVA 2XBMA 3C3DA 4KIWA 2GDJA 3DCNA 3KTAB 4GMKA 4PS0A 1Q7CA 4TLEA 4YMTA 1L1RA 3U7QA 1H65A 2PD6A 3LHFA 1P1FA 4NYIR 3E9YA 3DLTA 4WW0A 2CNKA 2JVJA 3A1FA 4TMWA 4XPIB 2N0SA 3IUYA 3QF4B 4YQZA 2RSLA 3OCYA 1YAJA 2B34A 1MC4A 2GZ1A 3D4OA 3HWX1 2C1XA 3SXPA 2JBWA 2P9TA 4LX8A 3IHLA 1DE0A 1DIHA 1R0CA 3DFMA 1ZCAA 4E5UA 1GGVA 2ICAA 3Q7IA 2ZDGA 1Q15A 2VDLB 3K5HA 1UUFA 1I10A 2BKAA 4D3FA 4XWTA 4LWZA 2XEDA 5A3JA 1ZS9A 3M0EA 4WFKA 1XJWA 3RVMA 2IEBA 3MGGA 3D43A 4ZT7A 2QPOA 3A0RB 3DWIA 4AUMA 1OLOA 2WP8J 2LKDA 3GARA 3ZGXA 5TVGA 1XYVA 3A6ZA 3ESAA 5AKLA 5GAJA 1BMDA 5TS3A 3VO8A 2NUPB 1J0DA 1NVMB 3VNVA 2O7QA 2DY1A 3C16C 5AM0A 4WXMA 3HP1A 2XVAA 3C5VA 2CNNA 3KYCB 4JT2A 1VHTA 3NASA 1IZZA 4GE0A 4L75A 5DCYA 3RASA 3VQTA 4EHLA 2O8EB 4QT0A 2FR8C 3GCGA 3SDSA 3MOIA 5BN1A 3T1HB 3A27A 3QNWA 5JY1A 1EFHA 1CP3A 1U3DA 2OKGA 1E2UA 3E35A 3HLKA 3KEQA 1RR6A 1KSFX 5FUMA 4MHTA 3ZTYA 4JJ7A 4P5PA 5AK4A 1E1DA 5J4YA 2WM8A 3BWEA 1F0YA 4YCLA 2JATA 1QORA 2A33A 5BYAA 5FLXA 1QQAA 4NBUA 1TU3A 3B3GA 2Z2XA 4HN2A 5CGZA 1CJMA 1QFXA 5I5GA 4DVJA 4BNJA 4E21A 1N6HA 3DE0X 4B4KA 1W4LA 1BRTA 2ORWA 3DE4X 2RHCA 4CF6A 1MVNA 4I50F 1J1IA 2VT3A 3LUBA 3ZOKA 2I6XA 2P2ZA 3JYOA 3W1VA 1MHPA 3ZY3A 4NK5A 1LBTA 5T4HA 1GCUA 1NJ8A 5F1OA 4KR6A 3DT9A 4ENWA 1G64A 1O9HA 1RXIA 2QT1A 4J7CA 5ESDA 1Z83A 2HHAA 4B5KA 1JFRA 5IDVA 1XJ0A 2W4IA 3WLFA 2WSSD 2VAPA 2HCFA 1S3FA 1HKHA 2QQGA 6GPBA 3A3PA 1PV1A 1J8QA 2NSHA 4AM8A 3T3OA 4ESOA 4FXOA 2JGNA 3PUVA 5JUWA 1QRUA 1G66A 5DBEX 2CFTA 2A57A 3QLVC 4PS1A 1F8GA 4PZEA 4EVQA 4GPTA 3C0KA 4OBWA 4WBSA 1UFQA 4UUOA 5H8WA 3KXLA 2FPGB 3BD8A 1UXOA 1XU4A 4DV0B 2YZNA 4HAVA 4OHVA 3BMNA 3IUSA 4UXJA 3WQSB 4EB6A 4BU1A 3H9QA 3MK31 3DD5A 4N8DA 4DM3A 2XZPA 3Q2KA 4ZKEA 4KXYA 2LCIA 2CDRA 5KCZA 1Y8CA 5CW1A 1FFXB 3U6BA 2NVOA 5PGMA 3CTPA 4NY1A 4CMEA 4GZ6A 2JIMA 4PNEA 1E2KA 4UUBA 4V1CA 4E2WA 2I2WA 4B17A 1K08A 4IDPA 3VJKA 3JTMA 2JGMA 3NIGB 1NF2A 3Q72A 5KX5A 3VVLA 1IQPA 1QNLA 1OLSB 4JP2A 3ZZMA 4QG3A 3A2KA 3R9WA 2IWHA 3Q85A 2ZU6A 1QG4A 3CMCO 3IUQA 4S04A 4JV5B 4QATA 1YCHA 2QTLA 3AESA 1II0A 1OXBB 3B82A 5J5AA 1BU8A 1CETA 4FINA 5L7WA 1RWKA 2AKEA 4NPAA 3EGWA 1QHYA 1JI0A 1MB0A 2FW8A 1B8NA 3B53X 4I1SA 5SICE 3LC0A 2RGNC 4ZTUB 2QV0A 3SQXA 1UBEA 3W6PA 1IU9A 2O9JA 4QGSA 4ND7A 1KJZA 2O07A 1PJQA 3LSTA 5GADl 2QMUA 1TLFA 2WHPA 1KKLA 4CHGA 4XWGA 1JHAA 1RJ9B 2VTVA 4DLAA 1U1GA 4LDAA 5C4IA 3VC7A 3FIJA 3ND9A 1H4TA 2C61A 1NUTA 2W0SA 3FUVA 2WJZB 4GPZA 1JYEA 4PG5A 5B4VA 5H81A 5LWHA 5D1HA 3EMVA 4BCCA 2VP5A 3K05A 5F9HA 2IF0A 1M6NA 4P86A 1XVTA 4PSVA 3ZHQA 5AVQA 5CA0F 3KWFA 5AOVA 2FPKA 4KWCA 5JS1A 4FX2A 1KQNA 2X0EA 2VF4X 2J3IA 3QOFA 4OLHA 5EIBD 5KTPA 1BAPA 3K0SA 2BFFA 4IBOA 1GL9B 4TQAA 1V1RB 3TBHA 2RI0A 1X2EA 3IURA 4U2EA 1XDDA 5E7JA 4DMMA 2ZE8A 3ETGA 2N3ZA 1LX7A 2A9OA 4HEA6 3G85A 4TL7A 4DILA 1FZTA 3NW9A 3QQPA 2G36A 3OUUA 2LE0A 4O2BB 4X60A 2OQIA 4EY3A 1YA4A 2BI4A 1ZGCA 5TRTA 3AR9A 1X9IA 3D7KA 2GVDC 4UVGA 2ZJ8A 3W5UA 4D46A 5ECDA 5CB4B 3M9WA 3HCOA 5M34A 1W5SA 3ANSA 3SS8A 3ZI7A 2O59A 4Q1BA 1QYWA 1QE3A 3W6ZA 1D3AA 1N1EA 4LQDA 4AN1A 1I4DD 4DR4B 1E2JA 3JVUA 2VXCA 1V2GA 4J9VA 3QBTA 3GZNA 4M0LA 3A9SA 4QXPA 4D3YA 2PH3A 1XTBA 4CTOA 5G1NA 1JQLB 3DC2A 3LIPA 4IMPA 4NH0A 4A92A 2ZIUB 1R0YA 1NSFA 2OHOA 2R4UA 3FNFA 4Z86A 1O97C 1Y7LA 2BM1A 2W6JD 2O2SA 4FYYA 4MHSA 2C4HA 4IH4A 3I72A 3U3OA 1TM4E 5T3YA 3LY7A 3M5WA 2OT3B 1L5HB 3B5JA 4G81A 1GZ4A 4CV0A 3TRDA 1P7WA 4Q12A 2GN6A 3SS9X 2ZRJA 4XRRA 1WUKS 4D0GA 4YUXA 1TTTA 2N1BA 1BS1A 3IQGX 2Z57A 3P9NA 1QTIA 4OI0A 2WSMA 3DLPX 1T2DA 4OFWA 5FJJA 5AW2A 5K0CA 1AHHA 2CJXA 5DHUA 4RTNA 1YL7A 2FB9A 3MXTA 1XROA 3GEMA 3EAGA 3PJRA 2AOTA 2GO7A 4JQCA 1PJLA 4Q1AA 4TRNA 4ARUA 2A35A 3IRUA 1E2GA 2LGJA 1T26A 2JPDA 4LGCA 1U7ZA 3VRHA 2P2LA 4L8WB 5HILA 4JZYA 5E9AA 2AG8A 2VPQA 3A6LA 4J7AA 4V0NA 4PN7A 4PF1A 1RPTA 3LIIA 3V8BA 3CKKA 1WPQA 3FZQA 2X76A 3IXQA 3JD2A 1U0EA 2F6RA 2WKWA 2YWGA 3ABRB 2JLSA 3CRZA 3HEMA 4B8WA 4FCTA 1GV0A 3VBCA 2P4HX 1X7HA 2OP0A 4WH0A 2DE0X 2FZ5A 2VF7A 4PYMA 4F3CA 2WABA 1JFFA 3MBOA 2RBGA 4QICA 4TLDA 4BRZA 4CKEA 3ILSA 2RHTA 4J0QA 1DKRA 1JJFA 3IULA 3OQHA 4TXJA 3OHMA 2QVBA 1TA4A 4FBLA 2P11A 3O95A 4G0QA 4J29A 4YHBA 5AKHA 4YBZA 5TEWA 4AD8A 2JI6A 5TF0A 1XTQA 2BCJQ 3HNPA 5CT6A 3KQLA 2PSSA 3JARB 2W8BA 1VHDA 5M5BA 1QIDA 4CV1A 4DDKA 4FOTA 3P2OA 1L4EA 2PGIA 5IMBA 1PLLA 2PKQO 3WGHA 5IKXA 1NBIA 1ECCA 4OK3A 2YC4C 4GYYA 5KOJA 3TTXA 1TVCA 1RWQA 1XAGA 1J2EA 2RJNA 4DG9A 3MRSA 1CEYA 3FDZB 1Y8RA 4OJYA 1ETHA 3PDUA 3RU7A 2AZXA 3R3ZA 2GXAA 2UYHA 3F8SA 3EBLA 1F0PA 1FY2A 5LC1A 1QH0A 1ZYUA 3HUUA 1U99A 3KBBA 3X44A 3TDKA 2XTJA 2Y1CA 3U40A 1E2QA 3TUJC 3TOCA 1HL7A 1QVVA 3FOAA 1D9XA 1N2SA 3GN2A 4D4LA 1ISIA 4C07A 1OI4A 3LWNA 4FT4A 2BUAA 4LDPA 5K0BA 4G1UC 1VLVA 1K66A 2HBRA 1YZLA 3I0NA 4FYJA 4RD3A 4UUAA 5EP3A 3VOSA 3DPIA 2JNWA 10MHA 3TS1A 4KIUA 4C3ZA 1GQFA 4L8FA 3QVWA 3SEQA 4IVRA 3GI1A 1L7OA 1O89A 3C1AA 2D7DA 3FM9A 1DL5A 4NEHB 1JV2B 2JLXA 4KO8A 2YS6A 4EWLA 3K8OE 3TIVA 2IX9A 4X8LA 1TKBA 4TQ9A 4A0HA 2GK3A 2I0FA 1XOIA 1M34E 4A15A 1CUXA 3LC2O 4QT4A 4GX1A 2Y0DA 1G8AA 2A5LA 4ECAA 1WZEA 2XD9A 1QCDA 2B0JA 2YXPX 2XXBA 1Y3HA 4GVLA 3O9MA 3WI7A 1IN5A 1F12A 3RF7A 2IS1A 2AXPA 4X3OA 3RC7A 4HQNA 2HQSA 5KNCA 3OE5A 2VC2B 2GX6A 3M83A 4W1SA 2ZB7A 2VRCD 3QF7A 5BN5A 1JAYA 1XLTC 3K9FC 3PE6A 4C2AA 3MOGA 4YDSA 3F1LA 4JKOA 5G4KB 1R27A 3CNQS 3QEAZ 3B70A 1PK7A 2AFIE 3WYEA 3P9IA 2AV6A 4NDZA 2OCAA 2ARKA 2H5JA 1AUQA 3HFSA 1G8GA 4I6GA 3VYWA 5BXQC 1Q44A 5C8YB 2R2GA 4E3ZA 2VK4A 5C5DA 5L7TA 5FHRA 2FSPA 3FLEA 3NJRA 1YDEA 5GIPE 1KFCB 3SVLA 2NGRA 1XQYA 3HCBA 1KYIA 2KYRA 4MVWA 4Z51A 4GFDA 2Q8QA 2II6A 2DBRA 1EX1A 3F3YA 3CBGA 2PRIA 2I4MA 2QG9A 3NOOA 5BSEA 1NG9A 2JKVA 3GRUA 2ZB8A 4NBLA 2FSGA 1JEYB 3DCIA 3LYAA 1T0UA 2YV5A 3Q5DA 2H1VA 3IDZA 4Z53A 5EZYB 1IBMB 3BXXA 1W59A 1WXIA 2VJQA 3ZD8A 1NW7A 1VECA 2DTDA 1QH1B 3EG5A 3KSRA 4D5GA 4RGVA 1QHIA 2H7YA 3HJGA 1ADJA 1CZOA 1NE2A 2PRZA 2PJZA 3WAGA 3THYB 3FCUB 4WDQA 4WNAB 1KJIA 4V24A 3U19A 1DC5A 1YJAA 3IAS6 3I9OA 3J81k 1HYQA 3QEMB 4L4ZA 2JLZA 2J9FA 3TZ6A 1U8YA 2N42A 2NZUG 4LE1A 3OX3A 1Q0SA 5CJPA 4MPTA 2O6LA 1SIBE 5L4NA 2IA5A 2B8TA 5DM60 3OJFA 2C2YA 1NAIA 4O1HA 4JU8A 1GG9A 1Q2XA 2C5BA 4QU0A 4YJHB 1EWKA 2MHCA 5EJGA 3V2UA 4BTVA 4BZPA 2XNJA 5E4FA 4PPFA 2CZQA 2B7LA 1W94A 4YYZA 1AOXA 3OWOA 3L7KA 1R4MA 4FUQA 4LYFA 1TAGA 4E1VA 3EXHA 4UARA 4WY5A 4E07A 1ZH6A 2RH4A 4IIYA 2R44A 1A7UA 3DO6A 4MW4A 1GYRA 1I7QB 3DL2A 4HB3A 4YRQA 1MZVA 1PEDA 1WHSA 1BMQA 5BNTA 1ZISA 5GZ6A 4UMDA 5JZMA 1WETA 1HX7A 4JCOA 2Q2OA 1FMFA 1SQFA 1QHFA 4EY4A 5EJ5A 1TQHA 3TEJA 3L6CA 5JFOA 3G2QA 4KKXB 3LLCA 2RH5A 3GRRA 2HPZA 4CKCA 1BQ3A 5JTTA 1XRRA 2UXCB 1TL7C 1DZ3A 2NO1A 4H60A 1RACA 2EFGA 2J1LA 3H0CA 4GMGA 1Q0UA 2DMRA 3BCHA 1CUZA 3GBSA 4E2FA 1F5SA 3H84A 3K0FB 3PVCA 4JLBA 4PIMA 2OVBA 3WZMA 4DDVA 1QUEA 5F33A 1WKCA 4TX1A 3ROFA 4BWVA 3MUEA 1ZVQA 4F1WA 1JPJA 1MAWA 1RZ3A 2X8LA 1JSXA 1Z0SA 4HDCA 1KFBB 4MUXA 4IGEA 4BO5A 1W0JA 3DV9A 3HEBA 1Q11A 4EJSB 1GKYA 1EFVA 2A6PA 3ORYA 3AF6A 2HQOA 4I0WB 2I4LA 1BE8A 3OBBA 2C9CA 2WDPA 1PKXA 8ADHA 3QBVA 5JSFA 5BV0A 5F2OA 2J5KA 4WXYB 1ICIA 3QMVA 3LGXA 1RKQA 3L2OB 5TPZD 2CJFA 5A4IS 4HWSA 1F8FA 4JYBA 5B1HA 4JUAA 1SKYE 2Q0QA 4JB8A 2Q1YA 3LOPA 2OORC 4KUGA 3VOBA 5DTRA 1PSWA 4C0HA 3M34A 1K9VF 5FLEX 3DEAA 3C6BA 1D8AA 5TQ2B 1DQRA 4MI3A 4M1OA 4CEIA 1C80A 3QKSB 2QX6A 3ZXIA 1KP9A 2AN9A 1UKVY 3M5DA 4YDRA 3BS4A 1A8PA 3ZHBA 4IDBA 5FBHA 2ACVA 5F12A 5IANA 5LIRA 1GPH1 2YJ3A 2QUZA 8AT1A 2IBSA 4XQ9A 3FYUA 3W2IA 2GK7A 3T54A 5C32A 3GUZA 2CFRA 3O8QA 2BMEA 5HX7A 3PSHA 3I1YA 5K99A 5I8ZA 3BGIA 5EFZA 3F2VA 1TIKA 3K0EA 1V1MB 4BBAA 4F6CA 2IIQA 3AGPA 3S70A 1BDJA 2D13A 4H16A 1ISPA 1CIPA 1REQA 1N2XA 3WQHA 1TECE 1IMOA 4XQ0A 1NZDA 3N70A 4OSEA 2HA2A 4K1XA 3R74A 2QU7A 1I4TD 2PSFA 3W05A 2JKYA 3IQWA 3NKVA 2ASVA 4TSKA 5E1BA 3W7AA 4DIFA 1IAQA 1FW6A 2AG6A 5JSYA 3D6VA 5J40A 2RHOA 3FMOB 1M2KA 1RHKA 1WLYA 5E1DA 3OOWA 4ZXPA 3AP2A 4HQKA 5THKA 1LDYA 4M8NE 3ZQUA 4DRXB 3LQQA 4ITVA 4WK6A 2J0SA 2C96A 1UK6A 4X8HA 2F8MA 4QXOA 3E7DA 1M73E 5ELXA 4MYCA 4X66B 4XX1A 3L1IA 2RIPA 4TYWA 3Q98A 3ANMA 3Q0IA 4LNAA 2VH5R 4QU5A 1S2DA 3QY0A 2Z3WA 5DHSA 3T4EA 4HEHA 3TTVA 3AETB 3MRTA 4LGVA 4PINA 3LDFA 3PT9A 2GHRA 5IVDA 5EY5B 1BW9B 1T2VA 3VJMA 4DZZA 1FU4A 2IHKA 3ANLA 3HZOA 3DYBA 2WPNA 3ONDA 1U9ZA 2W2VA 4P4UA 3OZAA 5FPTA 5C34B 4FKBA 3BWCA 4YXFA 1HURA 4KUEA 5HKAA 1CQXA 4PLYA 2JFFA 3X1YA 4BMZA 5A62A 3BXEA 1AE1A 1O57A 2BEWA 1ECBA 3IDAA 3ONFA 3V8RA 1SOMA 5BNWA 2CVZA 3HBFA 2FA9A 2XODA 1MJ5A 1IIRA 4AW9A 1CR1A 4DLXA 5DWDA 5JCZA 2XNDD 4L95C 5EHQA 3RARA 2HUPA 3ROXA 4H4DA 1D1PA 3EJ6A 2Q0XA 3DAOA 3KQVA 2GZAA 2I76A 3QVUA 1M76A 2PN1A 4RYDA 5JAOA 4UU0A 4F3NA 1ELOA 3EVNA 5CX1A 4YVFA 1XV5A 1S2OA 4EPTA 4DR7B 2PE5A 3CVXA 4EW3A 3F73A 3OO1A 2E5LB 2IUEA 2CVHA 4C0XA 4JVNA 4CCSA 2WFLA 2XNKA 1N6NA 3A2MA 1UH5A 2N1MA 4IW3B 4J03A 3C74A 5LP6C 1N5OX 2GXSA 2B37A 2JI8A 3I76A 5LB2A 5UKDA 3SSMA 3CY6A 5JWHA 2X0JA 3IP1A 2CL7X 4PLZA 1IXZA 1P8JA 1W48A 1CUHA 3PFWO 4RD6A 3ZNQA 3K31A 3AF0A 5KWVA 1L3IA 5JS2A 1WXWA 5AM5A 2YMMA 4NKRA 1DAGA 4BS9A 1W49A 2XQVA 3R0XA 5LLTA 6ADHA 1SBCA 2GPWA 2FMUA 4NECA 3RSZA 4BN5A 3CGWA 2DGDA 3ZDQA 4ND2A 4WOKA 3PK0A 5ALGA 5FULA 3EXIA 3FDFA 4B3HA 3L5KA 2FN4A 4ZYUA 1R7RA 2XDQB 4OHUA 2R6AA 4G01B 4MUFA 2QBYB 2B9EA 3RT7A 3O1LA 1MO2A 1PSDA 1UDWA 1DS6A 4PGAA 3ZWYA 3WLNA 4C7VA 4UNPA 2VYVD 2XQGA 1E7WA 2O50A 3A3KA 3L1KA 5HFJA 3UO8B 1N7GA 3QBDA 4CKXA 1S7CA 1OHHD 1P7VA 1KEWA 3K0BA 1T8YA 1Z3IX 4NC9A 3DL7A 3VDXA 2NN3C 1E94E 1U0GA 2EG5A 1L0BA 2PZGA 3TQRA 3EMDA 3IP7A 2VLBA 4FP9A 1VJDA 5ALNA 3RI3A 2BP7B 5H70A 4CQJA 3AFMA 4YCMA 2Z2IA 4CF7A 3NCHA 1XJ5A 2P67A 1QLHA 2WHRA 4KXWA 3ZJ4A 4BATA 1TQ4A 3IT2A 3UWDA 3WNVA 3KK0A 3WKAA 3H19A 3I52A 3IP3A 4X3CA 3CRRA 4QU8A 4FLMA 2ZVDA 4DG8A 1Z26A 3IE1A 4D41A 1BE0A 4PN3A 4AMGA 2YW2A 3O4VA 4DANA 3ON5A 5FQNA 3TKYA 1FMTA 3GLGE 3SZMA 1FUIA 1UAYA 3L07A 1C5KA 2WVGA 1T3HA 2EW1A 2GHTA 4GLFA 1JFSA 1MJGA 2UV8A 2ORIA 5G1OA 5CXQA 1JJAA 2LKCA 2O7NA 5D5PA 1FPMA 1B0UA 1H6CA 3H13A 1V5FA 1K0UA 4OQYA 1BZYA 2G7ZA 3IMCA 1RKUA 5FYDA 4MITA 1EUYA 5IABA 3H05A 1R00A 1LV8A 3QNMA 4A36A 1I9GA 1Q5PA 3C8MA 2CE2X 4RMIA 1LSJA 5LZ9A 3F97A 5GOTA 2BR4A 2VJPA 4UBMA 3JALA 3EWNA 4IDFA 4F5WA 2I65A 3FI9A 5C8ZA 4OU4A 2A88A 4MWBA 5KC9A 2BJVA 2VBCA 3BB3A 3IIEA 4MVJE 1X42A 3ZV5A 4WCVA 5CW2A 1I7DA 1G2QA 4LRSB 1NA5A 4HDRB 4K9KA 2IV2X 2C2KA 4IP0A 4ERNA 4FKZA 2EG9A 3ONVA 3MYYA 5G0WA 1QO0D 4Q1EA 5EMMA 3ZVMA 4LVNA 4I8XA 4YJDA 4OGWA 4FD3A 2NM0A 4JUBA 5E9JA 2FFJA 3E3MA 4JELA 1N2CE 1B3RA 2D5CA 5K0TA 1XRMA 3DT6A 4MZDA 2IFTA 2QSJA 2XCUA 2QV7A 1K7SN 1KDVA 2B2CA 3VSAA 4IVPA 4L51A 1RKXA 1O6BA 1MLDA 4NJMB 1PQYA 2C9ZA 4Y9TA 4BVGA 6REQA 5ER6A 4AJJA 1KEVA 3DV2A 4ZAGA 1UXIA 5F2KA 4B31A 1KHHA 1NU6A 1QIMA 2AFHA 3S1AA 1RYMA 1NM5A 1HZZC 3AXTA 5TF4A 1SQSA 4OXQA 2Y99A 3MB8A 1ZL2A 1BIFA 2VUIB 5K4HA 2NZVG 5EA2A 1YDHA 3LPLA 1S01A 2QRMA 1EAYA 3BHNA 5HJ2A 3S2ZA 3DL0A 3TLKA 1K0FA 1Y9ZA 2FFAA 2QJOA 2F7SA 5JJKA 3VI3B 2R1TB 1FTQA 1XCMA 3U81A 3AO0B 2WBLC 2EGUA 2F62A 4OA8A 1NNI1 3NVDA 2YJZA 2QL6A 5HK8A 4HH4A 2WVAA 3ZWKA 3EYWA 4TGLA 1DDIA 4YONB 1IUPA 4KL8S 2FMKA 1OILA 2HRRA 4GG1A 4LECA 1ZD5A 2WJPA 1TKCA 3AFIA 5J63A 2BM8A 1XA3A 2FOLA 5FTNA 2ESRA 3N2LA 2FKAA 3OM1A 3WK6A 2VDWB 1Y89A 2IUUA 3SICE 2ZANA 2O57A 4Y8VA 2BBWA 5K3AA 4XCQA 1X1EA 3T9BA 2HA3A 4PO3X 3A04A 4TKLA 4R0MA 4UOQA 4U02A 4RV9A 1ZAKA 4Z0HO 4GBGA 1Z63A 4EAAA 2KLBA 3T7IA 621PA 4K9LA 1OX5A 6ABPA 1U3CA 4PC3A 4W1PA 1F51E 2GLTA 4M83A 1ZJ6A 3BWYA 3L6OO 2ZYSA 1QAOA 4U6SA 4CQMA 4WN9B 3RF6A 4CUJA 1L4GA 3BF7A 3VNSA 1UZLA 2HKIA 4JUIA 2BHNA 3KZMA 1SMKA 1I36A 4CL2A 2NP6A 4PZLA 3P9KA 1C1XA 2W2LD 3ROEA 4G2TA 1MX1A 4EKNB 2V5VA 1O6CA 2A9PA 2GZ3A 2VZ8A 4B8YA 4C0QC 4E51A 2FDCA 3HBMA 3GLFE 2R3SA 2VNSA 4MVCA 2A3RA 1NBMA 4EGSA 3MJTA 3EFBA 1FQWA 4KAJA 4XYEA 5DXFA 2BEKA 5C3MA 2BF4A 3QLTA 4YT5A 3NDJA 1RYYA 2JFYA 4E3WA 4X5OA 3D7NA 121PA 1JHMA 3GLIE 1EFTA 1R6UA 1T9HA 2CE7A 2LVBA 5LA6F 1TUGA 2OC9A 1PJAA 2ST1A 3B6MA 5TE9A 3RUDA 3T5CA 4Z7OB 2OZPA 3FPEA 4TYNA 4ZEVA 2BGWA 5LQAA 1T3SA 1M1YB 2ORVA 2P3SA 3WHLA 1I6KA 3RE1A 1LNSA 5BQFA 2Y9MB 2VHYA 3LCVB 4O5AA 2PIDA 1Q19A 2GERA 1MIOB 1RXUA 2E21A 4M36A 4EFKA 2A67A 4K1LA 2YICA 4FCCA 5F21A 4LS3A 3JQBC 4L5AA 5FFNA 3E5NA 3ZVNA 3NP9A 2C98A 4N9QA 1D2AA 3GVCA 4WQMA 1WEKA 1RJWA 1PZXA 3A1DA 2PLFA 4ACBA 4U2DA 1NRJB 4IL5A 4IHJA 721PA 1KBQA 2QQ0A 3DHWC 3BH0A 3PI6A 2AVNA 1U0NA 3OFNA 1VRCA 4WXRA 4JHLA 2EJUA 3HJFA 3B6EA 1VPEA 2ZKLA 3SF8A 3PYMA 4O02B 3GB9A 5DXJA 5HCNA 5C18A 4GYWA 2V0GA 4IIXA 4J4HA 3VR4H 2Z1MA 4EGFA 7YASA 3BIWA 2P69A 3IMEA 2GMWA 5AM1A 1KSGA 1JE0A 3RVSA 3VH1A 5FWYB 5K1ZA 1ZEJA 1IZ0A 2XDAA 3QENA 4DAEA 2RK6A 1NXQA 1CB0A 1WS6A 5HRAA 4O2AB 1GG8A 4DBZA 2QN6A 2F9FA 5K9ZA 3N3AC 5MDHA 1GQOA 3K35A 3D5QA 1GO2A 4G97A 4X9XA 3QGMA 1T9KA 4MW9A 2WM9B 4KMMA 5K20A 1VI5A 4M1QA 2X9GA 2HWYA 4K81B 4ZOCA 3HJTA 2AQKA 1YOBA 3A06A 1GT6A 1RPAA 2PRSA 2QN7A 5DN9A 3TE7A 3ZZUA 2R6JA 2GPYA 1BCRA 1KSJA 3Q9SA 5ALUA 2C04A 2LP4Y 3QVJA 3GA5A 1BU5A 1KAOA 1F06A 3MS7A 2CLHB 1E0AA 3JZIA 4JWKA 1C30B 1WXHA 1UZUA 2OK8A 4YFYA 4Z99A 1Z0IA 3PKZA 2PL9A 5KPJA 2X5KO 3HTXA 2FN9A 3GIWA 1QYVA 4FQ7A 1KQPA 1Z6ZA 3R3JA 4H17A 2QRJA 3DB1A 4L8GA 4XB6B 3ZW8A 4RTKA 4DA4A 4JD5A 4O08A 3G88A 3OUZA 2AJBA 5E7MA 1P7CA 3DBIA 4AJKA 4KUHA 3UUFA 5IH7A 1VCOA 1LX6A 2W6OA 4AY3A 4L02A 3GNTA 3WFZA 4BKMA 1QV7A 1RQ7A 2PWBA 3BHIA 4WKBA 1XTTA 1X92A 4CL3A 3PI7A 4MQ5A 3WLKX 3A4NA 5IJ0A 3GD7A 3LLMA 2G5CA 3T34A 1KOJA 1NQOA 1YZFA 4DY6A 2Q8NA 2V0NA 4MQ6A 3K30A 1E6KA 1T1GA 2HMYB 5JLJA 1MX9A 1U7OA 3LNTA 2BFAA 4PLHA 4U5XA 4Y0VA 1MEEA 3VR3D 2J08A 3CLHA 2B69A 2TS1A 5EVJA 1GA6A 1R16A 3CX7A 1HT0A 4JJZA 3FCCA 5DU2A 2UZ4A 3AXSA 3IR5A 2JLWA 1W34A 5LLDA 4F06A 3AB3A 3IP5A 1OPRA 3FOBA 2BFPA 1D2HA 1JEDA 3E61A 4JROA 1JEJA 1KC1A 1X3LA 1J99A 4M89A 4WOCA 4CM9D 1RRCA 2XF8A 2F8SA 1A5TA 1VG8A 2XWPA 4PRYA 5AH0A 2B3TA 3VSEA 2RD2A 821PA 5KYTA 2PKRA 7ABPA 2DULA 3K0AA 1S8NA 2VVTA 4J3FA 4P58A 3UGQA 1LTKA 1WZ2A 5B5SA 3W9BA 4TRMA 1M1ZA 3OLCX 3CVOA 4M0CA 1NMZA 3HO1A 2IQIA 4WKCA 1LV7A 5LWQA 5CLFA 5DOZA 2HQRA 2Q07A 1DIOB 3ASVA 2ZJ6A 4RA6B 3DKKA 5I4IA 4NCAA 4IZOA 2YVLA 2QPLA 1OFUA 2ZYDA 1YFZA 2AOUB 4CHTA 1RFGE 4P7GA 3VAAA 5GJCA 4RTJA 1ZXBA 3T6KA 4KPEC 2HNBA 1RZRD 4QJIA 2VBGA 3I2YX 2I55A 5LQSA 1TQ6A 2C31A 3MWDB 1DOHA 3IUEA 3QPVA 1R0ZA 4GSKA 1QGED 1TTQB 4NE9A 2ZM6B 5DWVA 4XUDA 3C2QA 4J76A 1FNDA 3OJOA 4D9FA 2EIHA 3KAJA 5F3WB 4MROA 2XGJA 1MORA 5BYBA 3VA7A 3F9IA 3SBOA 4FKMA 3B6JA 3TD9A 2UKDA 4OH1A 4OXKA 4GSLA 5LJIA 1EFDN 4QRHA 4R1TA 4BO7A 3C6YA 4N0DA 2OXTA 1DMRA 5EXXA 1APBA 1K86A 4QFDA 1IAVA 3U4CA 2I8LA 4D1YA 1T0HB 2PUHA 1R74A 3G2PA 2PO7A 2VHXA 4GC5A 2VRBA 3IPLA 4FIZA 3OE7A 2H85A 2X2OA 5CURA 4RH1A 5DMXA 2F3UA 5DF1A 4ARBA 4DMHA 3EVBA 3ZCPA 3FUTA 3B2EA 2KBFA 3HV2A 5BN3A 4D9GA 3IODA 2BE7A 1L5ZA 2PEYA 4Q4HB 3CG0A 4ZVVA 1GL3A 4V0RA 4RD1A 4ZRDA 4BMYA 5AW4A 1E7MA 5DE3A 3FOCA 2G9ZA 1GFSA 2JH3A 4NZMA 4UHKA 2EGHA 2RAFA 4AX4A 5JC8A 2VEDA 2I2BA 2ZRHA 4Q1FA 3B12A 3YASA 5CYGA 3JVVA 1EK1A 1R3DA