1MAWA

Crystal structure of tryptophanyl-trna synthetase complexed with atp in an open conformation
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
326
structure length
326
Chain Sequence
MKTIFSGIQPSGVITIGNYIGALRQFVELQHEYNCYFCIVDQHAITVWQDPHELRQNIRRLAALYLAVGIDPTQATLFIQSEVPAHAQAAWMLQCIVYIGELERMTQFKEKSAGKEAVSAGLLTYPPLMAADILLYNTDIVPVGEDQKQHIELTRDLAERFNKRYGELFTIPEARIPKVGARIMSLVDPTKKMSKSDPNPKAYITLLDDAKTIEKKIKSAVTDSEGTIRYDKEAKPGISNLLNIYSTLSGQSIEELERQYEGKGYGVFKADLAQVVIETLRPIQERYHHWMESEELDRVLDEGAEKANRVASEMVRKMEQAMGLGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interconversion of ATP binding and conformational free energies by tryptophanyl-tRNA synthetase: structures of ATP bound to open and closed, pre-transition-state conformations.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Ligase
molecule keywords TRYPTOPHAN-TRNA LIGASE
total genus 114
structure length 326
sequence length 326
chains with identical sequence B, C, D, E, F
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2002-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 1mawA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1mawA01
1U7XA 3A05A 1N2EA 4ZT4A 1YIAA 1IQUA 1OWLA 1WOYA 2WSIA 4U63A 4YBRA 2VTBA 4G5YA 1FFYA 1U7DA 1JIIA 3HMQA 2QUJA 4RUKA 2BYTA 1JIKA 5J59A 3LOQA 2EL7A 3N05A 3UOWA 1KORA 3NBAA 1XNJA 5TGTA 3COWA 2A88A 1NURA 1O94D 2D5BA 3H9CA 4MUHA 1F7VA 1MOPA 2ZP1A 4MVXA 3TZLA 2QTNA 4MWCA 1IQRA 1T6ZA 4KPUB 4ARCA 1ZUNA 1YUNA 1EFVA 5KWVA 1LI7A 1OWNA 1T6YA 1T9GS 3INNA 2E89A 4R0NA 4L2IB 1TYDE 3FG9A 5HG0A 5BNZA 1K97A 1VL2A 1O94C 4MVCA 1WXEA 3PNBA 2CV1A 4PBRA 2R5WA 3ND7A 2I1LA 2J08A 4JXXA 2J5BA 4YMIA 3CVYA 1DNPA 1NSYA 1NYLA 4I6EA 2H2AA 4ZT3A 1O97D 1XJQA 3X1KA 3C8ZA 3IODA 1B6TA 1P7PA 3IOEA 2XRZA 3DPIA 3U1VA 1VBMA 3G5AA 4MUJA 1GN8A 4YP5A 3ZJVA 4EGAA 1KH1A 4R2MA 1U0BB 3CLSD 2XRYA 4ZT2A 3IMCA 5HUHA 1ZH6A 4DLPA 4AQ7A 4MUEA 2A84A 4ZCRA 1KQOA 3KT3A 1OWOA 1VLHA 2GOYA 4XSVA 2J09A 5FO0A 1IQ0A 2HZ7A 3IMEA 3UY4A 3A4IA 4PY2A 4Q93A 3CLTC 3Q4GA 4MUIA 4ZCSA 2PG3A 1GZUA 3AFHA 2YWCA 1Q15A 5IJXA 2IJGX 1M8KA 3RBAA 5IHXA 2PXHA 2A1TR 1O95C 1IRXA 1A8HA 5DK4A 2YY5A 1QJCA 1J1UA 1N2BA 4H3SA 1JEDA 4JFAA 2GM3A 1PFUA 5H16A 2G36A 3N2YA 1O5TA 3QTTA 3H05A 3JXEA 3CLTD 2WQ7A 1WQ3A 1N2GA 2JANA 1T6XA 4AS1A 3A2KA 1TYAE 2CYAA 4HK4A 3E27A 2PZBA 3OTWA 4RPIA 5HUJA 2ZUEA 1MAWA 1N2OA 1TEZA 1WZ2A 4DDKA 3N9IA 1MB2A 4I6GA 4EG3A 4CDNA 1M8JA 3CLUC 5DEOA 3D6UA 1M8PA 1GLNA 1NP7A 1N2IA 1EXDA 5K0TA 3GUZA 3F3MA 4KR7A 2AZXA 1KKUA 1U3DA 3QTBA 3FHJA 1G8FA 1NUUA 3L92A 3M5WA 4I6JA 1WQ4A 4OUDB 1EFPB 4EG4A 4CDMA 5F23A 3ND5A 2YWBA 4CQNA 4A91A 1PG2A 2D13A 3SEQA 2CT8A 4MW0A 2CUZA 3P0JA 5FO1A 3SZGA 2HGZA 4JYZA 1QNFA 3CLRC 1GTSA 3X1MA 3ELBA 3PNYA 3A04A 2O5RA 1TYCA 3FOCA 1I2DA 3COZA 1YULA 1KQPA 1KR2A 3RJZA 1S4MA 1JZSA 4KKVA 3AG6A 5AHWA 4ZT6A 1J21A 2DPLA 3LE8A 3MUEA 3KT8A 1TYBE 3NV7A 1F7UA 3PRHA 4ZCTA 1N2HA 1COZA 1YIDA 1JMVA 3G6KA 2D54A 1JGTA 3HFJA 5J5AA 3AKZA 1VBKA 1X8XA 2E18A 2DXIA 1QQTA 2PZ8A 2QJOA 1QRTA 2CYBA 4ZT5A 1OWPA 4TS1A 1KH2A 3X1JA 4JXZA 5EKDA 1MJHA 1OWMA 1KQNA 2QJFA 1XNHA 4L2IA 1N3LA 3TQOA 3Q12A 4MWBA 2CV2A 1M1ZA 2H29A 4KPUA 4MWEA 1H3EA 2JA2A 5TEWA 3Q10A 4XFDA 4U7JA 3OP1A 2J07A 3VU8A 3MLAA 1N78A 3IUEA 3H99A 4MLPA 1V47A 2DR2A 4X0EA 5DB4A 3TZEA 2A7XA 1OD6A 1QRSA 1R6TA 1O97C 3ZUGA 4P2BA 1K4MA 4MUGA 4DE5A 1CT9A 2DLCX 4GRIA 4PBSA 2GKSA 4WNYA 1OBHA 1ZH0A 4NX2A 1J20A 3HZRA 4EG8A 3IVXA 1R6UA 4HPWA 1J1ZA 3COYA 2DEUA 1NUSA 1O0CA 2A4MA 3MMXA 4EG6A 3P0IA 1Y42X 2WQ6A 1EUQA 2RD2A 4GU5A 2X1LA 3CLRD 2E0IA 1F9AA 4MUFA 2ZUFA 3P52A 1K92A 3PXUA 2CYCA 3HV0A 3H9BA 4JZYA 4UZEA 1PFWA 1VBNA 1NUPA 1O96A 4NZPA 1U3CA 2NZ2A 4FZJA 4U8HA 3TQIA 3ILVA 3MLBA 1SURA 1O0BA 1QTQA 4NAHA 1R6XA 4G5FA 2AKEA 3ND6A 1J70A 1KH3A 2QUHA 2EJCA 1RQGA 1WXFA 4UZFA 1O95D 5JBNA 1N2JA 4J75A 2O8VA 1I6MA 1UFVA 4EFKA 1BS2A 3K32A 1WXGA 3FI0A 4MULA 2X0KA 3DV2A 2V0GA 3ZXSA 3FH0A 2DERA 2PZAA 1EJ2A 2E21A 2A1UA 1LW7A 3IH5A 4MUNA 4KR6A 1M83A 4OUDA 1EFPA 1N1DA 2A1TS 3UMVA 1QU3A 1NUTA 3I05A 2QUIA 1FYDA 3N8HA 3ZIUA 1M8FA 4ZCPA 2BTEA 1NUQA 1J09A 2J4DA 4F3RA 1PG0A 1PFYA 3SZ3A 2B7LA 2QUKA 1V8FA 3FDXA 4MW7A 4ND6A 1MAUA 1N75A 4ZCQA 3NBKA 4YP6A 4MVYA 3FWKA 4ZT7A 3UC5A 1HYBA 3VRHA 4DDMA 1GTRA 1WY5A 1NZJA 1JIJA 4MW2A 2JAXA 1KAQA 1WXIA 3H97A 5J58A 2NSYA 4WSOA 3SYTA 2A1UB 1KP3A 3ZGZA 3FNRA 3AIIA 2CFOA 4DNXA 3TS1A 3IUBA 4NDAA 1Q19A 4MW4A 4EF6A 3FY4A 3SEZA 3KT0A 1G8HA 4R2LA 1NI5A 4EG1A 1XNGA 5KHAA 3COVA 2OQ2A 1G59A 5LM3A 3DO8A 4MAFA 1ZJWA 1IH8A 4MUKA 5KCMA 4E1AA 3UK2A 2QJTA 3CLSC 1WXHA 5DASA 2Z3VA 1O6BA 3CR8A 3IVGA 1JHDA 4G6ZA 4KR9A 4MW6A 3ZJTA 3SDBA 1QU2A 2PIDA 4S1OA 1N77A 1MBZA 3IDFA 3CVVA 1GAXA 1ILEA 2PFSA 2X1MA 2IP1A 1YUMA 3ZJUA 5FNZA 3VGJA 3ISJA 4BWVA 5LFAA 1T9GR 3GMIA 1EE1A 4Q16A 1MRZA 3ZXIA 3D6VA 2A86A 1JILA 5H7XA 4MQ6A 2RE8A 4NAUA 2C5SA 3FETA 1M8GA 4MVWA 5TEVA 1H1TA 4J76A 4ARIA 2HMAA 1IFXA 3DLAA 4MWDA 1MB9A 3CVUA 1QRUA 2DETA 2QTMA 4QBTA 3RFFA 3RK1A 1ULHA 1Q77A 4OJMX 4K03A 3S3TA 5LLTA 1KAMA 4YP7A 1KP2A 3IVCA 3K9WA 3IOBA 4QRDA 3RK0A 4HJXA 3AG5A 1OBCA 3P0HA 1X6VA 2QTRA 4MW1A 1H3NA 2DUMA 3HL4A 4DJAA 1JZQA 3CLUD 2OV4A 1TFUA 2CSXA 3KFLA 1JECA 3MXTA 1WJGA 4XFJA 1EFVB 1MC1A 3IOCA 4QREA 2IELA 4PBTA 3KT6A 4HJRA 3FIUA 1GPMA 2YXNA 1F4LA 4MW5A 3CA8A 5TS2A 4NATA 4MW9A 3L93A 3CVWA 3G59A 1PFVA 1G8GA 1IVSA 3IMGA 3LCJA 4K0RA 5K0SA 3CVXA 3HGMA 2VXOA 3BL5A 1I6LA 2AG6A 1IHOA 3SP1A 1I6KA 2CV0A 2X3FA 1LI5A 3QE4A 1O96B 1D2RA 4ND7A 3TNJA 2VTBB 4EG7A 3AL0C 2TS1A 1JEEA 4F4HA 2WB2A 1EUYA 4EG5A 2Z09A 1TQ8A 1Q11A 1K4KA 3PNVA 1H3FA 1WKBA 4DDHA 3RHSA 1YI8A 2V0CA 3GLVA 2Z08A 4CT0A
chains in the Genus database with same CATH superfamily
1YRYE 4XZ3A 4IHJB 4OMDA 3ICVA 3S1AA 4OFXA 5A06A 4O4IA 5G4KB 3UV6A 2G72A 1N0HA 1DJPA 3PE6A 4WCDA 2V65A 2DPXA 2XUPA 5GIPE 5JR3A 3T7EA 2F1IA 4YRNA 3TE6A 4MWZA 4PLFA 4FYXA 4LF7B 2DOKA 3LVRE 2JHFA 1FXWF 2C4MA 3G1WA 4JJKA 4DILA 3LC7O 4RUKA 5BO5A 3KL4A 1JIKA 3CBQA 2DTDA 2BKUA 4G0OA 3O83A 4GPAA 2CDBA 4NENA 7GPBA 3KJHA 2AXQA 5EERA 4JU9A 4L8GA 3SC4A 3V7YA 1XTSA 2WC1A 2CFTA 3CZ5A 3OIGA 3PTZA 5CD9A 3RBVA 4MUHA 1L7MA 1LX6A 3KQSA 1MOPA 2B6NA 4HR7A 2VQ6A 2ZUBA 4DMCA 4A6PA 4ZZ1A 3MT9A 4JQSA 2H00A 3RYCA 3A4TA 2JBAA 1CRQA 4HNQA 3FCYA 4KPUB 5E95A 2PX5A 4MYSA 5BMOA 1GLVA 1I4EB 2M6SA 5HQTA 2CXXA 3INNA 5DI3B 4NG5A 4YVFA 1YE5A 4C5AA 2Y0BA 3WIOA 3G2LA 4E4TA 1ABEA 2FEWB 4BPBA 2NPFA 5HPYB 3U7QA 1TMKA 4YRAA 1JNYA 1FLNA 3CY6A 3L01A 4XD2A 2D3WA 4C1BA 5ADHA 4UAVA 3D2LA 1ISSA 2TECE 5KTOA 1A9XB 4GYWA 1NVBA 4MWGA 4DAEA 5BR7A 4IUCS 3CVYA 2WTUA 5E8JA 3PYMA 4ROTA 3THYA 3JQ9C 1AURA 1HNWB 2EZUA 4F6RB 3FN4A 1II9A 1OUMA 1XTPA 3JYQA 3CWZA 3SYMA 1VI6A 2OXRA 1HQDA 4JOQA 3V3KA 2FCRA 3E7DA 2YJNA 4PLZA 4EX6A 2VCHA 2GF9A 1I3OA 1T4CA 3BL8A 4OQQA 1O4VA 3CZ9A 4LE2A 1QX4A 2WHQA 2EZ9A 2D2EA 3Q7EA 4YR7A 3IC5A 5JG7A 4GX1A 5LDGA 3FHTA 1R3DA 1EWKA 1Q17A 1UBHS 3IOYA 3I23A 3UH1A 3QMPA 3EIEA 4OLFA 1U5BB 3EGDB 3VYTB 3ZX4A 1M2FA 2K2WA 3KRTA 3R6TA 1F9EA 2NGRA 3BMOB 1RTTA 2IV7A 3ZU2A 1OFTA 4CMCA 2QY9A 2ATXA 1RWNA 1XCJA 2OPBA 2C0PA 3TK1A 3FFTA 2QR3A 3IJ5A 4EWLA 3VNVA 3TRHA 1Y9EA 2F62A 3GGGA 3VJMA 2NO4A 2XVZA 3C7AA 3U09A 4CEJA 3OQJA 5E3HA 8MHTA 5E4JA 1H2WA 1OWOA 5H0IA 2V9ZA 2Q4OA 4G1CA 1E5VA 4Z8XA 4C08A 5HKAA 4DM3A 4UEWA 1T4CB 5JHHB 3MB5A 3X0DA 3EPRA 3TRFA 1L4NA 1MABA 1B43A 5HVNA 3F74A 1IN4A 3Q2IA 3VO8A 4MUIA 2VPIA 3MCWA 1P2DA 2UYQA 2V45A 3NVAA 4INPA 3THYB 1E9FA 2OXTA 3IEIA 1Q0PA 1P5RA 2L0XA 5L7YA 3KNZA 2VK4A 2EW8A 3TRJA 4O33A 1AHIA 1N25A 2H4ZA 4Z54A 2IJGX 4X1IA 5SYAA 2PXHA 1KEPA 1NVXQ 4I8DA 5IDYA 2H08A 1B6RA 1IRXA 1ULZA 5E4YA 4BQOA 1Q0SA 5J4VA 1SD2A 2Z57A 1DQYA 3LT5A 4NZMA 4FS3A 1R9NA 1GZSA 2IEDA 2W70A 1DC7A 2JCSA 2QTTA 2W0SA 4II7A 2C7OA 2MU1A 2R79A 1GILA 1N6LA 4I1RA 2ST1A 5JC1A 3DV9A 4YJ3B 1QDLB 5DX0A 5JXGA 2ZAIA 3GARA 1LW6E 3KAKA 1P19A 5FLEX 4JOBA 3RUEA 4Q01A 5HILA 5HS4A 5EJ5A 4HFMA 3SKYA 3BWXA 1NW9B 2WJIA 2FEAA 2XOKA 3EPKA 4NXNB 3HVJA 5FFFA 3WIEA 3OHSX 3OTWA 1A5ZA 3UXEA 3OZGA 3PHBE 4G0XA 4MCIA 1TEZA 2YWRA 3NAGA 4UUQA 4BE4A 3A6HA 4YA6A 1ZM3A 4AKGA 1P0FA 2UXCB 4AYTA 4N0QA 3CLKA 3GZ4A 1M8JA 2FB9A 2XMGA 1SXGA 3S1LA 3KQKA 2AR7A 2C5LA 4Z3DA 4IINA 1N2IA 3GAAA 1UH5A 3AFOA 3AF2A 1TKAA 3BEOA 3P5SA 1QFSA 3ZW7A 2R6CA 1QCDA 1OXSC 5K1ZA 1U3DA 3QTBA 1F8XA 2BCGY 2E37A 1MO4A 2MWMA 4WNAA 3D7RA 2X7JA 1S2DA 2DCUA 2OPHA 2YWBA 5EP1A 1G17A 2G1JA 3ETCA 3HADA 1XNRB 5BR1A 4A91A 5TX7A 1NLYA 1Y63A 3NJRA 2PS3A 3HDTA 4R05A 1MEJA 1W94A 3R7DA 4QPDA 1KZHA 5KNDH 1PVOA 1TAUA 3CLRC 1UK8A 3N2NA 5CDFA 3D0KA 4ZN6A 1E8MA 1VB3A 3M8KA 3PNYA 2RG7A 4B2YA 2CJXA 3IAHA 3RSOA 2FEPA 5ULLA 2RI1A 3G89A 3IPLA 3L7YA 3TKYA 1WZUA 4HGYA 1X7YB 4JT9A 2D62A 1AZTA 2QE6A 2WJJA 1OTYA 1PLKA 3ZDBA 1QHEA 4WXMA 1K2WA 4Y2UA 3IUMA 2PO7A 3ROPA 1DOAA 2Y1GA 4MO2A 2J9RA 4O4HF 2Z1NA 1AK2A 3D4OA 2OHGA 2XE8A 3HSKA 4MQBA 5CA1F 1U4SA 4MLCA 2JHCA 1OX5A 3H5VA 1XRLA 2WA2A 5AK5A 3OICA 1WB9A 1DC5A 2BM9A 2PN1A 2FPWA 1ZCZA 2CGEA 4WCFB 1A2KC 4FYVA 1XD2A 4M8NE 1X3SA 3EUWA 1DC8A 4J90A 3DZCA 1U9YA 1AMOA 3OD5A 5AI8A 4AL4A 1RT9A 2C9DA 3X1JA 1OV4A 2IHVA 4OKIA 2FMXA 3BGIA 1H0KA 2O8EA 4BVGA 4WTOA 5JQGB 5KIAA 3BXGA 4LV8B 3EZ2A 3SVTA 3PE3A 4INZA 4C5CA 4XM2A 1LLUA 5FRDA 2B30A 4YREA 5FUMA 5A1JA 3RFVA 1V96A 3BG5A 1ZUNB 1GQSA 4MWBA 2P68A 4EELA 4ZI7F 3KJZA 5B64A 2NUPA 2ZI9A 3LCMA 4V03A 4B31A 1KO1A 3IYLW 3LCVB 3NNDA 2YZNA 2HIMA 5JVDF 1NMEA 1EP1B 2IYTA 6Q21A 4CM9D 2WNHA 3RKRA 4O4JA 3UJ8A 4BTLA 4S04A 2AEEA 1UOPA 3ED5A 4UBNA 5MF6A 1VLLA 3CNNA 2HFJA 1EK1A 3CC8A 3QLTA 4MUGA 4Y0VA 3WNCA 3TGPA 4XCQA 4OK3A 1NY5A 2BFBA 4WJLA 4W8HA 4NX2A 3QFRA 4MWSA 5AIBA 2ZSHA 4KXLA 4UEJA 5GMOA 1R6UA 4ZK2A 4LZJA 2H5IA 3UOGA 3ENKA 5EWJB 2FQYA 1Z88A 2FSIA 3LX6A 1ZH4A 2OBNA 3PKZA 1XQ1A 3Q0EA 1U3FA 3DJYA 3MMXA 1PR4A 3PUXA 4QYMA 4V3CA 2GN9A 3P0IA 1I2ZA 4HT3B 3FCAA 4L4XA 3DVAA 3ZWVA 4GU5A 3UWSA 2Y1DA 1ISMA 3RU3A 5LUAA 1INLA 1QAQA 2QLFA 4QYWA 3KZMA 4L3WA 3QX8A 3VR4D 4ID3A 3VDNB 3WWEA 1BU8A 4BJHB 1D7OA 1ISFA 2JAPA 4HDNB 1EZZA 1CZRA 3LZDA 4FQ5A 2HTFA 3TUJC 4QFBA 2QLLA 3GGOA 2ZU0C 5ERGB 1ORRA 5TB5A 3W8DA 5ECGC 4MRAA 4WKNA 2DFTA 4ZI2A 2J9FB 2NUTB 1N6HA 5JCXA 5CT8A 3DEAA 4OO3A 2JIQA 4AY3A 2HO4A 1L7QA 2B5WA 3L8FA 4YC7A 4G5FA 4KSBA 3D4PA 3I2JA 3IERA 1NBWB 3T9AA 4ZYWA 4N82A 4XUEA 3MOIA 2HL6A 3TM4A 1FVHA 1H5QA 3N5KA 4TLBA 1U81A 4WXYB 2GD6A 1VYTA 1J99A 1M5TA 4J75A 2MT9A 3FPBA 4KAJA 5SZJA 3T3PB 3C14C 4HLQB 4M53A 3IFSA 3U81A 3TSOA 2FHSA 4GFDA 4CQLB 5HKOA 1PWXA 5BNFA 3VYSB 1ADYA 2D0IA 4Q3OA 1P0IA 3NUQA 1ZP6A 2I99A 2X9QA 3VR2A 2DERA 2UXBB 4RKQA 2RHHA 1A0OA 3LXUX 1HDOA 4TWRA 2VK8A 2A1UA 1F5SA 1FMTA 1MUUA 3AWIA 2FCAA 4LBVA 4NU0A 2E85A 4RNCA 1N0IA 2ZE6A 1MD9A 2LGJA 3O8NA 4JGIA 2C94A 4PNPA 3TL6A 1E20A 1ODCA 1EBFA 4DEVA 3KTOA 4HRAA 1I7PA 1ZD3A 4PLPA 1BCRB 4LVOA 4TOIA 2QW0X 4ZCPA 3VNAA 1AUPA 4BP1A 1AO0A 2PH7A 1NYTA 3LQ2A 3AGQA 3TZKA 1EXMA 4QQNA 1DXQA 2IKQA 2QL9A 1V8FA 2WDZA 3FDXA 4ND6A 4UTVA 1SM4A 3KU4A 3FMIA 1NPDA 2RK6A 2WU3A 2W2LA 4KIUA 4YP6A 2VOEA 1KO7A 1KSJA 1IXKA 2R3SA 4YQFA 1JYFA 4FMPA 3ADCA 4XQCA 4W5QA 2YS6A 4LJSA 4MP6A 4X6LA 3ECAA 2IP2A 2ZQYA 4PX3A 1PVVA 4DIEA 3FNHA 4CIAA 3G5TA 2R8YA 3TKAA 4DPKA 1G20E 1KP3A 3DE0X 2C2KA 5A0FA 3MRTA 2IX9A 4FGWA 4DCTA 1E2MA 2E55A 2ZJBA 5GINE 4KMSA 1Z6ZA 1ZS9A 2OMKA 2OORC 3GFVA 5AUQA 1J6UA 1G20A 2ZT5A 1FUKA 4G37A 2AE1A 4IHAA 4Q4HB 3QWHA 5AT1A 1O1YA 3OF3A 5DF1A 4YRQA 4CKBB 4QX6A 4MIYA 1ZC3A 2DY1A 1W5AA 2I8AA 3FYUC 3SEZA 4Z51A 4CU2A 4C0KA 3TLGA 4OGWA 4WERA 1N7JA 1Q20A 3BZWA 5EJ9A 1CUSA 2QK4A 2PLAA 1NMZA 2O52A 4P3PA 1VC2A 1DPGA 4J7UA 1JKJB 4D9EA 5F5NA 1EK2A 4ER6A 4J0FA 5BVHA 2F4VB 1MVLA 2W37A 3EFBA 2I6TA 5K3DA 4F84A 4G6ZA 1SKQA 1R8XA 3IURA 5K0JA 2FDXA 2Q5LA 3VX4A 5KBYA 2DF8A 3ZEIA 2Z9CA 4HVTA 1LPBB 3A9SA 2CXHA 4TLCA 1PKEA 2AJTA 3ABRB 3QOWA 1E1KA 4OHUA 5FPPA 3WHIA 4US2R 5LPNA 2YUIA 4B40A 1AO3A 3CVVA 2BFCA 2IU3A 3N7UA 1NVVR 3ILSA 1KBOA 5DCUA 2C3YA 4IS3A 2EKZA 3QKWA 2GPYA 4N5LA 3LDAA 1MPXA 1S7GA 1YGYA 5D3QA 4ZAGA 3N0RA 1OASA 4W82A 2FU5C 2CNBA 3NIBA 4HNSA 3AESB 4X3PA 3V4OA 5J3JA 4NMWA 4G2NA 3GQVA 4G25A 3RROA 4HDAA 3DE1X 2BKAA 3GJ4A 5KYKA 5GM1A 4EBBA 4EJ0A 5LC1A 3DFUA 4ZPXA 2BMDA 2WJWA 3T5CA 1X87A 4BFYA 4C9BA 4NE7A 4P7FA 2YIMA 3A2MA 2UVQA 1BHJA 3HR7A 2FFHA 2JKZA 3H6GA 4ZFNA 4Z2YA 2VCEA 1VSUA 1IFXA 3L49A 4MWDA 1QZXA 2QL7A 4EI2A 1S02A 4BRZA 2ZDGA 1S2OA 3H9UA 4PC2A 5T4EA 2DETA 3AJRA 1EWQA 3RK1A 1JVSA 1OHHD 1I14A 3S3TA 3UT6A 4EG0A 3PHGA 1G19A 2OK8A 1NQ5A 3OUZA 2Z1DA 3SJ7A 5LQRA 4P0QB 3ETDA 4ZYZA 3G9ZA 1P2FA 3K9WA 3CXUA 1WXWA 4ES6A 5TY0A 3M6MD 4UDOA 1IUOA 2FJPA 3QV1A 4FYKA 2CZCA 5L45A 3ZWBA 5FORA 4OU5A 3ZGVA 2FSPA 4PC7A 1F4PA 4LY9A 5P21A 3ZU6A 4EZEA 1VJ0A 1WJGA 1TUIA 1D1PA 5LUBA 1ARZA 2HJSA 4M0UA 2KW5A 5J4HA 4B5KA 4EHKA 2AB0A 4XWOA 1KYTA 2I29A 1BH2A 1NX6A 3O5AA 1BDBA 3FHLA 4L0QA 4LRYA 1CD5A 3P94A 5KJCA 1L7NA 1Z0FA 2E1PA 2GZAA 3TIFA 3TOCA 1MC5A 3PX7A 5B3JA 5HJEA 1VMAA 5DX8A 5KX5A 3G8YA 1H8HA 4FFNA 2WB4A 1E79A 4E7OA 1P33A 2GH1A 4QTXA 3EX7C 5E38A 2YY6A 3P27A 1ZVKA 2H1RA 3RFTA 3NLLA 4OQPA 3EWAA 1TJYA 1IN8A 1QLJA 2V4UA 4RFVA 5CA1B 5KZMB 1V25A 1SZPA 2AW5A 3R5TA 4ZVPA 5E1OA 3ROFA 2RHCA 2ZR9A 1V4NA 2P8JA 1NBAA 4O4IB 5G4KA 1EX7A 3RBZA 1UKEA 4BKOA 1KU0A 1Y3CE 1W0JA 1PJQA 5FOTA 3VTAA 2XCUA 1IAVA 2CLSA 1P4GA 2CLFB 4CL0A 1USIA 2HLPA 2O8DA 2P9TA 5EYPA 3WBFA 2ZYGA 5K8VA 1EQUA 4TRRA 4B3RB 2IXAA 1Q12A 1F2TA 3UGQA 3OFKA 2WE8A 1M0WA 3U4QB 3JZIA 4YBRA 2PZKA 1BHSA 4H6VA 4O4HA 2OBLA 4YUXA 1CNMA 1C4OA 2CLMB 3MRSA 4YACA 3DTVB 4D42A 4H77A 4YCLA 3O8RA 1YL6A 1VG1A 1XEXB 1DKNA 1L1EA 3ZKWB 4M0LA 5DGDA 1L4UA 3N05A 3LUGA 2NLOA 3H3JA 3CUKA 5ARCA 1DDIA 3VTZA 4HDMA 3PUJA 1VHWA 3DOIA 5IULC 1BTOA 2ADMA 4WQMA 4XCVA 2G5PA 3NHZA 1B41A 1C3LA 3QRWA 5GP1A 4ASUD 1JIUA 1Z73A 3AUYA 3PWSA 3Q3CA 3QHQA 4G24A 4TRJA 3BMXA 5C5CA 1ZUHA 2J0QA 3IDQA 2QD3A 3R4CA 4PIPA 5CVTA 3HYCA 1LI7A 2GTPA 4AROA 5BNZA 2VTVA 1FRNA 1RHRA 2J3MA 5AVJA 2A9VA 5IC5A 4IGKA 1VL0A 2MSLA 2G70A 4MVCA 2GTIA 2VA9A 2Z0MA 3I5UA 2YH2A 3AEQB 5JO9A 3O38A 1E98A 1PGPA 3DM9B 2C8VA 1Q7CA 5KEIA 4C0WA 2C92A 3SQMA 3JS5A 2YIVX 3UT5A 2C42A 3P9IA 3LRXA 4EYKA 3HU5A 1NVEA 2BGIA 5A4DA 5M2QA 1GQOA 1QH1A 5JD4A 5CDFE 4GLBA 4E11A 2XVMA 4MQEA 1UOQA 4EKIA 1P9NA 1CY0A 5F52A 1GGHA 4CDGA 4BRSA 3AL0C 2HK8A 1YR6A 3E8SA 4GM0A 4CCWA 1AJEA 5J1TB 2I6SA 3D4BA 2AC4A 2WP8J 2FEMA 2BDEA 2YJ4A 4O4JF 4QDZA 2SCUB 1SOAA 4AUNA 4CLRA 3U3XA 1A3CA 1NI4A 1X74A 4WY2A 5JQWA 2QOEA 1W76A 3VR6A 2G06A 1ID1A 4YAFA 5I5GA 3O8CA 1AS0A 2GM9A 2K7ZA 2XRYA 2ISCA 3VU1A 3UM9A 5KYYB 3HVUA 2NP6A 1E5LA 2IYWA 2YVLA 2DLDA 4QATA 1AHNA 2ZIUB 2VF7A 2OBFA 4M9RA 4HATA 4O5AA 2PX4A 3NHLA 2ZSUA 1I30A 4QWMA 4ZCRA 1MX1A 1VDMA 4RH0A 4GI5A 1A97A 2QVLA 4B33A 4RQBA 2IUSA 4CIXA 3DG9A 2VUIB 1HDZA 3ZG6A 4IJMA 2Y1KA 1CJMA 4MKIA 3KKNA 4U2DA 1WABA 3R7SA 3ZDFA 4BO8A 2BKXA 3DL0A 1A2QA 1PD0A 1XF9A 3T99A 1QGYA 1ODKA 1VE7A 3RUFA 3UY4A 2B5VA 1CVLA 1E6CA 3UMJA 4BNLA 3WGZA 4I9NA 3PT9A 5KNDA 4F0JA 3FWPA 1E2LA 1IJKA 1Q15A 1SXJB 3A11A 3JQ6A 3T6KA 4CETA 1US8A 4M55A 4NZNA 3Q2OA 1M1NA 2QGZA 2R6HA 2VHEA 3JYPA 5NULA 3TIVA 4QU9A 4MNTA 3NUZA 4I1SA 4R2HA 4EAAA 1J1IA 3F1LA 3RF7A 4IX1A 2VO1A 2F8MA 3JQAB 4MQLA 1KI2A 1T9BA 3LQYA 5IC6A 1NW4A 4D44A 4C7OA 5T7BA 1S4QA 3B78A 4H1UA 1F06A 5U4QA 4M54A 5F3RA 2DBQA 1Y1KE 2W6JA 5H16A 3N2YA 1Z4IA 1YDEA 1ZL2A 2P30A 1WL8A 3DBRA 2Z9DA 4Q7MB 2G0TA 3RAJA 3TLZA 4D4MA 1JIVA 1TM4E 1HL3A 3PFCA 1DRKA 1ZGZA 2YIDA 3BK2A 3G8CA 3ITKA 4EO7A 1EZ1A 1RRCA 5BYBA 3VR4H 1TZBA 1IYZA 4DV7B 3PQCA 2V7VA 4OPMA 2YC4C 3VMFA 4XIFA 1BH6A 1F8UA 3AEKA 1ZGBA 3J81A 4KLNA 4KXYA 4MYDA 1VG0B 1JDJA 3DAPA 1ZLYA 2JIOA 4P8RA 3L77A 2E9SA 2QENA 2ZIWB 3G3EA 3NTLA 3GAFA 3ZQ6A 3V2HA 2PHZA 4B6FA 3FVVA 4QPJC 2W22A 2P9YA 4A6EA 3AU9A 3GUZA 1SXIA 4KQ9A 1ST3A 3JAWB 3RANA 1C9JA 4PG8A 1Q83A 4OUDB 1EFPB 2FSHA 2GCOA 4M9QA 4XR4A 4BUZA 2W8BB 3C3EA 4KDCA 2XUGA 4PYKA 4U2BA 3NCTA 5EINA 5H70A 4BNJA 2D13A 1PO7A 2ZB3A 4NCXA 5EG5A 2CUZA 2OY0A 2PGLA 4HDRB 3NFRA 5FO1A 2VPPA 4HXEB 4H6XA 3V8BA 1S2NA 4WBSA 2AN3A 3ZW8A 1PP4A 2ZTSA 1USGA 2WU8A 2AVNA 1NE7A 1RKXA 1XA3A 3W6PA 2CUKA 2IWHA 1ZN8A 1B0PA 1LZLA 1L3IA 2EVWX 2H65A 3FD8A 4FN5A 1VJ1A 4I1YA 4OBBA 4DDWA 4QUAA 4GO1A 3RJZA 1EBBA 5KINB 4UAUA 4J0IA 1JSRA 4UJ5A 2G04A 2FWNA 2DPLA 3CNOA 1PL7A 2BJWA 1VZ3A 3LD9A 1ZW6A 5IDQA 2P6NA 3ZDRA 1U3VA 3NDIA 5T4FA 1RMYA 2BFEB 3ZZ1A 3O8DA 3HDVA 4Q66C 1FRVA 5G40A 4C2AA 4FLEA 1FFDA 3DOFA 3QV2A 3RVBA 1WV0A 2XBLA 4O1IA 3NTXA 4X00A 4JY7A 4MXDA 2FW7A 4HAUA 4MIKA 4RYLA 4N76A 1JHVA 2DUJA 1JQJC 4RJ2A 4BLQA 2AEFA 3J81k 1S9DA 4JLNA 4X8HA 3T1NA 1WSBA 2MSKA 3A14A 3PICA 5HRCA 5FL7D 1KE1A 5CVDA 5ALHA 3NGMA 3LY9A 4NFHA 3U31A 5B36A 4GXNA 3D3JA 5TF0A 1KETA 4HEA6 3H9GA 1UFRA 2CK3A 2HA0A 3LBHA 3TMAA 1NBIA 2H52A 2PRYA 5IKOA 1Y4ZA 4FNOA 5CXXA 1GEGA 2COUA 3MLAA 2IT1A 2ZJ4A 3HI6A 5HBGA 1G3MA 4R71A 1R6TA 2O3RA 1DBIA 2VT3A 1SPXA 2DX7A 3NTOA 3WGNA 1FNDA 4ACAA 4Q6WA 2YJ3A 3B6JA 2ENWA 3L7AA 1LJ8A 4R9NA 5AYVA 3GJ8A 3ENQA 4W1PA 3S2ZA 5CU7A 1XEXA 3ZKWA 2OCPA 3T06B 1CF9A 4NWIA 2Q3FA 4QGSA 1IY0A 1TRKA 1K0UA 4KWCA 3M3HA 4QQ8A 1ZEJA 2Y1FA 4N5IX 2VA8A 2EFCB 3A28A 1HH4A 3QPCA 4HTFA 1KI3A 2NU7B 1JBEA 4TLAA 5IUJC 3BWBA 1Q6ZA 4KE9A 4B9EA 3S8YA 4HDQB 5FBLB 2TMKA 2Y1EA 1BDJA 3FB1A 1QRRA 4X62B 1I1HA 1OXUA 1Z3IX 2EYQA 4OHFA 4RY2A 1AKMA 3KWJA 1PK7A 2WG1A 4PVCA 4WEOA 1WUTA 1UC9A 3A7DA 2GEDA 2JFUA 3H42B 4X5OA 4DA4A 1XYYA 3PEEA 4XVRA 3WGYA 4O02B 5FL3A 3ZVKA 5TVGA 2GM4A 5ILQA 3USZA 4QGAA 3PENA 4LJKA 1C14A 1JBQA 2X2PA 5K6TA 3F5SA 1IM2A 3PFHA 3VR6H 3IHTA 4HOYA 1SULA 4OIFA 1EP2B 1KPHA 1G3RA 3HXQA 2BP7B 4BFCA 5H9WA 2XXAB 1R7RA 4YRSA 4P6VF 1H1LB 3JQFC 3NC0C 4DR6B 4D5GA 2IXGA 3EXFA 4X9XA 5ENZA 3VC1A 5JNRA 1R50A 3N86A 5DNEA 4Z6KA 3E61A 1U63A 3QVUA 4GEGA 3UQYS 1A50B 5FNVB 2FZ4A 3UMMA 4PYJA 2PUDA 1IN1A 1ODTC 2QQ0A 3JVVA 1L5QA 1C9MA 3KOZA 4B2IA 1VYHA 3NW9A 4C0BA 2EWMA 1WXGA 4KB5A 4L6AA 1VL1A 5KS2A 2VPWA 1NU8A 3NOVA 4J0GA 2WF5A 4PINA 1GSHA 1Y48E 3NUGA 4MB6A 5JEEA 4X24A 1LWOA 3ABQB 1OI3A 1PZFA 3BE6A 3N59A 2VZ9A 2WVAA 1LW7A 4UCFA 5F5XA 5FEUA 4FGJA 1SQFA 3EEYA 4Z4QA 2FZVA 3H9JA 3P32A 4OFWA 1DRUA 4EVSA 1A5SB 1QU3A 3VAZA 4X8MA 4OU4A 3MJ4A 3LTNC 2X8JA 2IOFA 1NR1A 3H1TA 1Z4JA 4TLMB 3AZQA 5E6RB 2C4HA 3JR7A 4KITB 2O2EA 2JFFA 2QKYA 4LZLA 4F5ZA 5LIRA 1U2DC 3WWZA 4XD7D 3DKRA 2YX1A 1BRTA 4AZ0A 4DWWA 3GDHA 4L8VA 1QZUA 4WOBA 4CMAA 1G0NA 4ZCQA 4AXBA 4UMDA 4UD2A 4MVYA 4HDCA 3EOBI 4CF6A 2Y4NA 4KGXA 1U2QA 4I4TF 2O8CA 1DKOA 2I3GA 3O3CA 1JIJA 3UUFA 3U16A 4NBNA 4WSOA 4BEBA 3L5OA 2Q7OE 1RLTA 2ONJA 1W9HA 3FNRA 4JJIA 3RAEC 1I7NA 2CFOA 4MQMA 3RFCA 3EGWA 3TQHA 1CR6A 1GEEA 4FCWA 1LS6A 2FLKA 3WGJA 2FPPB 5LU9A 1Q22A 4MZDA 2C2ZA 1P74A 4NDAA 2C2WA 2IYAA 4OA5A 4B6PA 4Q1EA 4EENA 4EM6A 7ABPA 2PUCA 3KT0A 3TRIA 3GROA 3PGJA 1XNGA 2Q2WA 3FVWA 2B94A 2R751 3V4LA 4BNTA 3ZGXA 5M3BA 5CLFA 5DRYA 5TJHA 1PWEA 5CVEA 2JFXA 2X4DA 3ND9A 1UZNA 1ZGAA 4KGDA 4ZVUA 3V9PA 3W6OA 4DJFC 4PLYA 3WOHA 3WKAA 3ZQUA 1OXMA 3UJCA 4HNHA 3G2KA 9MHTA 2H07A 1JDVA 1ZO8A 2PKEA 5GONF 3RNLA 4AVYA 3DAHA 1E6KA 5FPSA 3EXAA 5F2KA 1JG4A 1TTPB 3X2FA 1GADO 3S68A 5J2UF 5AOCA 2YN2A 3DMDA 5HJ7A 1WLSA 1LY1A 2YOHA 5E4FA 1DG1G 3BF7A 5ELMA 1JWAB 3OURA 3JWIA 5KOYA 2O06A 1E0KA 2BFFA 1YQ9A 4J6FA 3KUXA 1CEYA 4GIBA 4GKKB 1TVKA 1RM0A 2IFTA 2R1VA 2WFLA 3PEUA 3PNQA 4QASA 1W49A 2NXNA 3MNFA 1JFRA 1EXVA 3FNGA 2VI5A 1T9GR 1WA5A 4PXYA 1U9IA 3C7TA 5DN6D 4ZEVA 4M22A 3G13A 1RWXA 2CCKA 5C1IA 4QOEA 3KPVA 1JG6A 1UPCA 3OZEA 3QPAA 1GKUB 3ZCPA 2RH4A 1JILA 3F5DA 5H5JA 3C2QA 1M54A 5FTWA 4A15A 3VNUA 4AG5A 2PSDA 3KJNA 2K87A 4ALNA 1V7ZA 5TEVA 3M5PA 1F1JA 4QT4A 5IAAA 1UDBA 4CLDA 5KTMA 1XZKA 2FZ5A 3DFIA 2VNHA 5I7FA 3MXOA 4EUFA 4YT2A 2H6EA 2VDLB 2QTMA 4WMLA 3AVYA 3K6SA 1YB7A 2EDCA 2NO1A 4K03A 1R6VA 3HJUA 5EGNA 2FLVA 1EUCA 5K3AA 4F5EA 3WGMA 3CPHA 4K3UA 1F48A 1TEVA 2VPTA 4DJEC 1H2BA 4O2BB 1BCRA 1KY4A 4DM4A 1CZHA 1KYIA 2XD4A 4KQ2A 4V0RA 1ZSNA 1KFJB 1I3LA 4JLDA 3VPXA 4ND3A 1ZM4A 4OKNA 1LV7A 3SR4A 2XCRB 2Q1XA 2DUMA 3M83A 3I5YA 2UAGA 3FNBA 2JGDA 2ZXFA 1KU6A 4TMTA 3OLYA 1TIBA 1XQXA 2A0UA 2E4AA 2IKSA 1WCXA 2HIHA 3ICWA 5T6MA 1BMTA 2YZ2A 3NHWA 4TYYA 3WQRA 1UMCB 4NQRA 2X2FA 4XLTA 2OM2A 5FDFA 2B1RA 3AVPA 2IELA 2CL0X 4B8YA 1JDTA 4KFUA 1Z5PA 2PBLA 1YZKA 3MOSA 3X44A 3QSGA 4P3YA 4BO5A 2ONYA 5IG2A 1SKBA 2D0DA 4NCBA 1MW8X 1JHXA 2FHPA 2BMAA 1FNBA 3KB1A 1PS9A 4YTEA 1YO6A 1ZM9A 2UDPA 2ZSBA 2JIZD 1RZRA 3OE1A 4KXWA 1Q7RA 5TQ0A 4GDFA 3D81A 2EBUA 3QK7A 1C0EA 1YR9A 2WWTA 4BNMA 7REQA 2WF9A 3OE5A 1ZUIA 2Y8EA 1V43A 2V6IA 5J4YA 3E8XA 2F55A 1ORIA 3WGTA 1YOVB 3WLOA 3AESA 3K30A 4OXQA 2O6HA 4Z8YA 1C1DB 3GRKA 5ELXA 4QGHA 4BJ6A 1C4XA 2HADA 2OT3B 3GA7A 4C78A 4O6VA 3J7AC 1CJVC 3ZZTA 3GUUA 3HP4A 3OMLA 4FGZA 2H1OA 3PR2B 5IPFA 1R66A 4C0XA 4FYPA 1FTQA 2C20A 3B2NA 5KQGA 1NVKA 1H65A 1QOZA 1R4ZA 3WAGA 5REQB 1MQ8B 2CDRA 1QSGA 1IZ7A 3M6WA 1FTWA 3NBXX 1XKLA 1EI9A 1UMBA 2R66A 4L9AA 4Y2QA 4Q37A 2Q49A 1FVFA 3WGGA 5DP1A 2EL7A 4A5OA 4C0LA 3UOWA 2PCLA 2CC2A 1KORA 2ZRKA 3BBPA 4F86A 3KIPA 4XIYA 2BHNA 1AUXA 1DE0A 1I9GA 1J7KA 3CZRA 3HZOA 4WXRA 3NHAA 3HPQA 4UHJA 3UICA 6LDHA 2DUNA 1ESNA 1UBEA 4O4JB 2C1ZA 4B32A 2VSQA 3AJ8A 1JKIA 4M49A 4RTNA 5KC9A 2DMRA 4CKBA 2QXYA 3C85A 5DT2A 5FFMA 2AFRA 4H60A 1IQRA 3GCWA 4MLDA 1K27A 4FYJA 3ZQKA 2H3HA 5EI5A 3ZLVA 3IDZA 2AXNA 3LDFA 3ZTTA 1L7PA 3OP4A 4RE5A 1DBWA 1HTTA 2Y4OA 4UDYX 2ZBEA 1QF9A 3PGKA 3PNBA 3REQB 4MKRA 4B81A 4XYGA 4ARUA 4EKDA 2DKFA 3BJEA 3IUYA 2ZBFA 4YGXB 4AULA 2J1LA 1P2VA 1B73A 4M1TA 3U39A 3VZPA 2VATA 4L16A 1Z17A 4G5XA 5AKZA 3TL3A 3V1TC 1FRFS 4BNIA 5C2JB 2UUBB 1D8TA 3FDIA 4YRPA 1NSYA 1WZNA 3SXUA 4V2UA 2HDNB 5JCJA 1XJQA 1UANA 1CRLA 3QEOA 4LVUA 3T0GA 3CE6A 4IO0A 5IHPA 1P31A 1DB3A 4KXMA 2QZ9A 2XRZA 1NN5A 3TCNA 5KNDD 4HAWA 3PC2A 3NV9A 1XKQA 3GIWA 5D85A 5HIIA 1XZDA 1FFXB 2YFKA 3VTFA 1SZDA 4BOYA 4FE3A 3IP9A 4EBFA 4ERNA 2G76A 4FFMA 2RGUA 5TQ2A 3R4VA 5IK2D 3P26A 4F72A 3K53A 4EGAA 1CQJB 1TLLA 1GPLA 1QDUA 2HHAA 2IHUA 3CLSD 3GEMA 4G8JA 3TDKA 3RV4A 4JI1B 5DM0A 2WHEA 2K5UA 3DUFA 4P83A 3PZRA 2GN2A 3NWPA 2ZI7A 4AQ7A 2XE7A 3BSWA 1U2ZA 3I4LA 4RSMA 2AI3A 1EINA 2IYZA 4EDFA 4IFEA 2HRDA 4GL2A 1S9HA 1IXZA 3RI3A 3EC7A 2EG9A 1VIVA 4ZQHA 1E2BA 3MBIA 2D2XA 1NDHA 3DBOB 5FADA 5COAA 1TZJA 3L0PA 5K2OA 4AS3A 4BLTA 4ZMRA 2ZRFA 4RQTA 1WBBA 3A4IA 3GHHA 4QUHA 2OUIA 3GMDA 5FPQA 1KEEA 4G8DA 4NS4A 1D8AA 3WFJA 1CIJA 4ZYTA 1CY6A 4ZZ2A 2JH8A 3OJOA 3E81A 4IDPA 3OKPA 1Z22A 5ICCA 3F7NA 3I6BA 2XMZA 3QG5A 1M8KA 2ZIEA 4JJ7A 1LJUA 4IJUA 4WFKA 1VE5A 1IBSA 1O95C 4R7GA 2ZBQA 4PG5A 3UJ3X 1TAQA 1E59A 3R3SA 4UDXX 1YQQA 1AB6A 4IZOA 4UHKA 1JLHA 3UA4A 1N2BA 4GNRA 3ZYCA 3NKLA 4IGAA 3STTA 3L6CA 5SY9A 3T3HA 3WGLA 1N3BA 1E64A 3AF0A 2BEVB 2PQ0A 2PU5A 2RHWA 2DFPA 2V59A 4ESOA 4H7DA 2GF2A 2NV0A 4H3HB 4JQCA 3OLQA 1TYAE 1KMHA 5FUWA 4RWEA 3KCQA 1JDNA 1PDWA 2IODA 2ZWVA 3NBZC 2WIJA 1U0NA 4RVOA 1X0VA 2OENG 1OYWA 4M7WA 3WC4A 4V02A 2HJ9A 4R01A 2B78A 3GF4A 4RA9A 1XTUA 3I1FA 4CU5A 2GQ0A 3ETGA 4MB2A 3TLKA 2OKCA 3BX1A 3OCYA 5GWXA 5D5HA 4ZVMA 4NP6A 3R8CA 3ER9A 2W2MA 4L4UA 2R8BA 2FH5B 2OV3A 2GYYA 3G8BA 3PD1A 4KYTA 4XQ0A 3W4JA 3WV5A 5IXSA 3FTEA 2CLKB 1G8FA 1JAXA 1FFGA 2DHQA 2VJNA 1WZCA 4PTYA 4X7RA 1NNLA 5IVHA 4EY5A 1B1AA 2V6GA 1I6WA 1KFEB 1L8LA 3RJMA 2BZGA 2IRWA 3GFQA 5BWNA 3SZGA 4DV3B 2G1PA 3ZWAA 1SUBA 4FHGA 1NFRA 5F4BA 5EHZA 1JJFA 1YNSA 1PU2A 1E96A 2HCBA 2NU8A 1WPXA 4PAMA 4URHA 3RW9A 3ZDDA 1SUSA 2YW2A 3ZOZA 2A35A 1C3EA 1D2EA 2EP8A 2BKVA 3HJBA 5H59A 3DOOA 3MJSA 4OFBA 4NJMA 4EOGA 4J4BA 4Q12A 1YBFA 1YULA 3IALA 4UU7A 1NNSA 1QORA 3WKCA 2WWGA 3F46A 4TZTA 1ZR4A 2OFXA 3NHFA 4DQKA 1N6IA 1NTRA 1RC8A 2Y27A 2IH2A 3GRRA 1TMGE 3MILA 4J94A 1JHQA 4WZAE 1ESZA 4H3VA 4MI9A 4O1HA 3UTCA 5LCXA 1XMPA 3FF1A 1A7KA 4OHXA 3OPVA 5J5AA 1TCAA 4DQUA 1Z13A 3HKCA 1JVBA 2F3QA 1F2UB 1FTNA 2RKBA 4FQ7A 4MPRA 1IHYA 4I19A 5AVXA 2F8TA 4LVCA 1L3BA 4UMEA 3L6UA 1P1KA 3EISA 4ZT5A 1UMCA 1Q0UA 1Z0JA 2XMCA 3R5XA 4I5EA 3PEYA 4ZVLA 3Q6NA 4I81A 4N3CA 2I7TA 1OWMA 3O84A 2XUFA 4QDUA 1XNHA 2ONKA 2VTKA 3ONWA 3AM5A 1QS0A 2XTAA 3AHIA 3O94A 1OFVA 3KTAA 4CGYA 2JGDB 2PYDA 3D7MA 4FHZA 4GOKA 2RHGB 4IIYA 3S8EA 2ATEA 1KMNA 2AK3A 4KPUA 2JBAB 3EIXA 4RMJA 3K6KA 3D0QA 3E3NA 3PNLA 2BE9A 2Z83A 2QMHA 3FYCA 3MCTA 4PPNA 3PFBA 5DTEA 2R1ZA 2H16A 4D8XA 2I6QA 5JUWA 4GUAA 4ZKDA 1LQUA 1PJ4A 3L0ZA 4DV2B 2P27A 4XYEA 1Y6QA 2AMVA 5G0SA 1P77A 1PQWA 5K3CA 1W5FA 1U8AA 3RIXA 3SHTA 1FQKA 1OBHA 5C0OE 2VDRB 3HL0A 4YCSA 5EN4A 3EDRA 3JQAD 1PF7E 3OMXA 3FB4A 4AY2A 4MHSA 3B1YA 2C04A 3K0FB 1P9RA 4TZKA 4MJ3A 4BMPB 4C4RA 4HPWA 2QZJA 1MEEA 1GYQA 1NF8A 1W6UA 4RZSA 3B7WA 3PHHA 1KDRA 1V39A 3QUCA 4HBGA 3N8NA 4ZCLA 1D2MA 3K09C 3TWOA 3TQFA 3TZBA 3GEGA 2GBFA 4I5IA 5LJLA 1PJCA 4DCNA 3E5RA 1H6CA 2EXXA 5EQTA 3HXOA 1GU1A 4IOJA 4R6WA 4IIJA 1E3QA 5TGDA 2LIPA 3T95A 1F9AA 5KNBH 4UBLA 3SFVA 2AZTA 3C3AA 3V46A 1Q2UA 3CU5A 4C4XA 2QI9F 2R6JA 3DNPA 3FAZA 4CI9A 5CFQA 1AUVA 3B5IA 4X93A 2QIOA 2H8KA 1Z5NA 1GNVA 1VI2A 2WA1A 1RQPA 3QLJA 4HB4A 4LNUB 2ZTUA 2Q3EA 4ND5A 3RDPA 1H6DA 1P80A 5J2UB 5CFMA 3ND6A 3NEAA 4DHEA 3IO3A 4M36A 2QUHA 4B76A 1GUFA 5FBWB 5HM8A 2NP7A 5GONB 4MS4B 4BO4A 1XDBA 4MEBA 4QOFA 2RG1A 4FJ2A 5AHKA 3BD8A 4F96A 2Q3BA 4LY3A 1QG6A 2QMYA 3I34X 2C9CA 2HV9A 1XEWY 3S29A 2YW9A 4NYMR 3ETHA 2F3RA 3FNEA 3EEOA 2WV7A 4GWGA 2QYOA 1YS2X 1CZNA 1PWZA 5AW6A 1TLTA 4GOLD 3EZGA 3O31A 4E2WA 4JLPA 2RJ3A 1UJ2A 2ZM5A 4GP9A 4XPIA 2YFYA 3A1FA 2WJZB 1Y4AE 3DCNA 4IMJB 2FSVA 1ISHA 2BGUA 5T4HA 2HRQA 1FVXA 3RJ9A 1GSIA 2PMBA 1A9ZA 3CKLA 2P9QA 1LTQA 2M32A 1O6FA 3EWSA 2JHAA 1E61A 4JA2A 4P3KA 4YXWD 3FTNA 4P7BA 2R8OA 5JH7B 5BW5A 3RYHB 1M66A 3I01M 2VJYA 3MWGA 4KV9A 4D3YA 2JFYA 3ASUA 4IR7A 2JIPA 2A9RA 3EDMA 3FWKA 3ANSA 3PA8A 2PKQO 4BBAA 2E6UX 4COKA 2WU4A 4AJ1A 4H9GA 2FOIA 3IJPA 2ET6A 1IWPB 3BWVA 1ITZA 4BVEA 2PUJA 1G42A 2X2EA 2N47A 3E9ZA 1EWRA 2PX6A 4DKXA 1S3IA 3WGOA 3X43A 5EPUA 5ALLA 3UMCA 3T1YB 2YJ5A 4AYWA 4I36A 4IQGA 1BQ3A 1WB5A 3NB0A 1YJAA 1Z4LA 5HZMA 4UHHA 1FDVA 5KI6A 3TS1A 1MV8A 1P9LA 1VL8A 2Y9MB 5IDVA 5JNTA 1W0KA 4BLUA 1IUNA 4PHHA 2X9NA 4D0RA 1BEUB 5DHAA 3PFWO 1U7TA 2J9GA 5ARBA 5JVDB 2PSFA 1P17A 1G59A 1OPXA 1YI1A 1DFIA 1ORDA 3CF4A 4GH5A 2PMKA 4RPKA 4ZI7B 4HWOA 3EFEA 4A8JA 3HG7A 4OH7A 5CLGA 3PDIA 1Z5VA 3WYDA 1R9JA 2ZXEA 4HGRA 3GG2A 1OZ0A 4K8OA 4FBMA 1Y9DA 3KJXA 4B7ZA 2DG2A 2JK0A 3ZJTA 1UWCA 3CQ9A 4ZOCA 1BMFA 3CH4B 3W6NA 4B6EA 3EUEA 3B38A 4N12A 4RDXA 1QU2A 5CT5A 2D1QA 3BH7A 1N77A 4LE1A 4D92A 3BREA 1XF1A 4H1WA 3M6IA 3EZ6A 5BN5B 4C2BA 2X1MA 3H84A 3ZJUA 1QFMA 1Z0DA 2ZUSA 3AWDA 4IDFA 3STVA 5I47A 5LP6F 1V11A 4JXKA 3BIJA 4F9GA 1TPYA 3QLVC 4P0TA 2KWIA 1V5WA 2ZRAA 3AQ4A 4Z0TA 3WKDA 4OSOA 3ZJ5A 2BD0A 3BCUA 4DJDC 2O7SA 1V45E 2FPMA 3K0EA 3HQ4O 1B74A 1UBLS 2QRVA 1U0RA 2CKDA 1QCZA 2IZOA 2AW3A 4TKZA 4E07A 3PYXA 4F04A 2CZGA 3KEMA 1NIJA 4RM2A 2IQ5A 4C0AC 3NVMB 3HXKA 2ZIAA 4ZEWA 5FL7A 2WYVA 1RWVA 4JUFA 1XO1A 5ITZB 1XHFA 1WR8A 2J32A 621PA 3SIRA 1JAZA 3V2GA 1NMXA 1H0SA 1UT5A 2WSBA 1QZZA 3M9XA 4K9NA 3SU8A 1B8OA 1BWQA 1QQ6A 3LQQA 4X7PA 2C7VA 4BAZA 4OAPA 4E08A 3AEZA 4HD8A 1PJBA 4EHNA 1J4AA 4I55B 4RVCA 3CPEA 5EESA 5LNK1 4QUJA 1Z7GA 2PH5A 3EBOA 3QKRB 5EIBC 4R3WA 2HFKA 2O2GA 5ALVA 3J7TA 1FL9A 3DOEA 4QDKA 2IHKA 3P0HA 3PBKA 4S1VA 2FJ0A 1M0EA 4MW1A 2ZVPX 3OQIA 5TJ9A 3REQA 5LQSA 1R0WA 3GG9A 3ONEA 1JJ7A 4JUIA 4UCWA 2BFWA 2LR0A 2PO5A 1CP3A 3L7CA 1NG1A 1H2YA 3E84A 4QOGA 3W2HA 2DWPA 4HY3A 2D2IA 4WJZA 1ZL0A 1TM3E 4G5QA 1Q0TA 1AKVA 4MQUA 4H16A 5EL0A 5FQOA 2HRZA 2VBIA 2YMPA 2VQEB 4RHCA 1MRSA 3JYOA 4LJ8A 3CA8A 4FCCA 1T9CA 2OCAA 4X1YB 5CT4A 2HN9A 3T94A 2BBWA 1THZA 4LFCB 3U80A 4YXFA 1G66A 3GEIA 1DV2A 4RXUA 5EE3A 1IHXA 7MDHA 1T43A 2GXAA 4KGZA 4PPGA 3UHOA 1F0PA 3HGQA 1CY1A 3UG7A 1RI3A 1GL3A 4GLOA 3USCS 1GAQA 3H4VA 1MB0A 4B73A 5B12A 1CB0A 2IYSA 2Y92A 2HA3A 3DGFC 1R5BA 1CU1A 2DB3A 1W48A 4TVBA 1BCSB 1EHIA 3TW4A 2DKOA 2WR8A 3D0OA 4QDOA 3O8OA 1U3GA 2CHVA 2QG4A 2VJQA 4JUAA 2I6FA 4DT1B 3GVPA 4TTJA 5AHRA 1QGZA 2PBRA 2P6UA 1CE8A 2Z09A 1O9BA 3A1VA 4MEJA 3PF8A 3RLIA 3ZR4B 1BW9A 1D4ZA 2P4EA 4HDRA 5IASA 2XPCA 5H3HA 3OU2A 4FWBA 2IDMA 3KPYA 2UUOA 3ANLA 4ZDWA 2GHTA 3FZEA 2G8NA 3C7DB 2B8NA 2BSQA 2QMOA 3V4FA 1LDBA 4MKGA 3TJRA 5C52B 1N2EA 4K6MA 3OJEA 3BERA 4QSHA 4ZT4A 4EMTA 5K8CA 1Z63A 2F48A 1BOOA 3GUVA 4DLRA 1JLLB 1DRVA 2HSDA 4UM9B 1PR0A 1Z26A 2BH2A 3QLEA 4JI3B 5FCDA 1JIIA 3QHAA 4MJ7A 3T5AA 2PZMA 4HGPA 1U98A 3OZDA 5EMKA 1E6LA 1WDKA 2NO6A 4ZMBA 4D43A 1U2EA 4Y2RA 1XNJA 1XPRA 1C1XA 2P2GA 4NCHA 4MGKR 1XTJA 4O08A 4BB9A 4V2IA 3AEKB 2J48A 1R2QA 2HWKA 4R6XA 5KWJA 1RYEA 1AS2A 1AVTA 4PF1A 3JWPA 3A58B 4TXMA 4TWAA 3MELA 2Q2VA 4LYYA 2CHGA 4DLWA 4N5MA 3DLHA 4E5YA 1FLVA 2A9PA 4YCAA 3GZNB 1H4QA 3EMDA 2NUBA 2VJAA 4DXDA 4TWBA 3INGA 5KYTA 3UJDA 5B6JA 1ODFA 1EFVA 2WM9B 3NBQA 4HUQB 1SRRA 1T6YA 1UBTS 2PL3A 3T7CA 2CXPA 4KC0A 1DHRA 2R7AA 2PJZA 3GRZA 1Y7LA 4RL4A 4AYXA 5DM60 4JQOA 4BRUA 3BB1A 1GRCA 4QLBA 2QD1A 3FOZA 2DWCA 4S0XA 1B16A 2HSJA 1EK0A 4JQZA 4PFKA 4B7CA 3PHIA 1DCFA 1N5JA 1KOJA 2G5CA 2W2KA 3OM1A 4O2BA 2V7EA 3QFHA 1FNCA 3GGCA 1WAMA 5ARDA 1GZ6A 5A02A 5JADA 3H8VA 3JQ9A 1Z4KA 2VDVE 3RB8A 4BNHA 4COOA 3WAJA 1RZUA 3BGVA 3I9V6 5C8YA 4A73A 3U1BA 3DUWA 5TSDA 2XEDA 2YINC 4XJSA 5IN4A 3KVNA 2AUNA 1KYYA 2R65A 4OAOA 2XX3A 3ABIA 3CB4A 3ZWMA 2ANCA 2WBLC 4PGGA 1EX1A 3OPYB 2MR6A 1HEYA 4HSEA 4YP5A 5DLDA 3T52A 4DLTA 1OKKD 1ZKDA 1MOZA 1UMDA 1YRHA 3HA7A 2VZ8A 1GRNA 1XK7A 3KG2A 4Q9NA 3NAQA 5A7GA 5AK0A 3AUXA 3GBVA 4O2RA 1N0UA 3Q40A 4O2AA 1ZOSA 3BUSA 1VKNA 3CO0S 3OO1A 3F6EX 1PV1A 1ZRSA 3RSLA 3UWPA 3V1UA 4AF6A 2X6RA 1DEXA 4HWGA 1E79D 4NDZA 4I9HA 2CNDA 3AHGA 4PYQA 4GDMA 3BB4A 1YMQA 1NIPA 2BF7A 1WHSB 2XB6A 4FMBB 1KQOA 2AK2A 3H6HA 1I01A 1TUEA 1ZGGA 1YL7A 2JLBA 2HMSA 4MV0A 1FMFA 5DYIA 2WAMA 3PQ2A 4DG5A 5EXDA 3IX7A 1HE2A 1ZH2A 3PC8C 4IHJF 5KCZA 4RGBA 1P45A 3CMCO 3S7ZA 4CT5A 4W6QA 2I3AA 4M88A 1N5DA 2IPLA 4LMRA 3JQEA 4U0JA 1L8OA 3AM3A 4XVCA 5HGJA 1NJFA 3RS8A 1XDWA 3FE2A 3QH4A 3RGGA 4ZGBA 2BBOA 2IE8A 5IHXA 1UFOA 1NFFA 2A1TR 2IUFA 2O8NA 2RARA 2ZGVA 4NNJA 2H11A 1HPLA 3GEEA 1JLRA 4DNOA 4TSFD 1CC1S 4Q19A 3GRPA 1GRQA 2DWQA 2OVBA 4L5CA 3UPDA 3EA4A 1VIYA 2CZQA 2GM3A 3C8MA 1TF5A 3CT4A 4AP6A 2PK3A 1XGKA 2YZGA 3PRYA 5AP9A 4CBVA 4DDUA 2W6OA 3R9XA 3HR4A 5AUPB 3CLTD 1NXTA 3GFSA 5DLPA 2I1WA 3IPYA 4JBGA 3WAKA 2EBWA 2JIDA 1BDMA 3PDUA 2JLXA 1TVEA 3GLSA 3DEHA 5BVGB 1XP5A 4FW8A 5LQAA 1E63A 1XZGA 3RM3A 3IB3A 2NSHA 2CL7X 2HSGA 5AOVA 1N9GA 1ZX1A 3GVHA 2FF5A 2ZJOA 3QFSA 4K86A 2VP5A 3FF4A 5DIFA 2C2OA 5EXPA 2LBPA 2XGOA 5FOSA 2JIMA 2Z3WA 3GLGA 5CDYA 1LNSA 4HDKB 4G09A 3E4CA 2OSBA 2Q1UA 5I4BA 1C30A 2FAXA 4AT1A 4CKCB 2YJZA 4A2CA 4L4SA 2DT5A 3DR5A 1U11A 2AZXA 1RYYA 4IIXA 4D3ZA 1HRKA 4RHTA 4S35A 1JDBB 5CCBA 5AW9A 2E48A 3WB1A 1WQ4A 3GJTA 1UAGA 4Z1MA 5FH9A 2FZKA 1PTJC 4YJ2A 4KN8A 5E6SA 1L3CA 3RVPA 1CY4A 2OC9A 3EZFA 2CLLB 2EERA 4CJXA 2GPSA 4Q5IA 2VDMB 2XKBA 4TUYA 4D8TA 4MW0A 4F9EA 2CT8A 4NBUA 2CL6X 2DQYA 3V1LA 2HGZA 1UL1X 2DP4E 1BVYF 2JFHA 6GPBA 1ODLA 1D0IA 2IY7A 3A32A 3HCCA 3I0MA 3I1IA 3MT0A 2XZTA 4JJAA 3SHQA 5KJ1A 1HM5A 2PQMA 4HLNA 3V2UA 4ZYVA 5IRCD 5EZQA 4G81A 5JSUA 1VIAA 3OHMA 3NX4A 1Z8NA 2UUPA 4NOJA 5CA1A 3JV7A 4B3SB 2HWUA 2W2PA 1UM8A 1JZSA 2PX2A 5A05A 3BGOS 4DXAA 5BMVB 4OLAA 5K6RA 1R37A 5FB3A 4QEKA 1IOVA 1RXWA 5EJMA 3ZDEA 4EA9A 1WCWA 3K9GA 4RF2A 1H1LA 1T3GA 5BV7A 2X14A 1JMVA 1U0TA 3A25A 1GT6A 3G6KA 2VYNA 1KPIA 4JGBA 1T3LA 3QVKA 5HZGA 4KO8A 5ICMA 2QU8A 1OLUB 1YDGA 3OCJA 4KQXA 1DQPA 3EIHA 3LRPA 3O92A 5K0GA 2V7XA 4OJYA 3E1SA 2I4LA 3ET4A 5DBIA 4RKYA 4CR7A 4JXZA 4D0NA 3A3PA 1D2HA 2YXDA 1VE6A 5K8TA 3QELB 4YHHB 1R15A 4GC5A 1NVFA 4OYYA 5C53B 1O95A 1QO0D 2VDNB 3CX4A 2GZDA 4LHYA 4EVQA 2QZPA 2I66A 4YJ2B 4QKQA 2JCVA 2C7PA 2DULA 5B2ZA 1Q7BA 4TMVA 4WUVA 2NT3A 5CM8B 1I3KA 3W78A 2WT4A 1GNSA 4IX9A 4Q7KA 3TVYA 4C7MA 1N78A 4EB6B 1A95A 1ZK1A 2QU7A 4J3NA 5I45A 2GN8A 3OCUA 4WEQA 3O73A 1BA3A 3GLGB 3N7AA 2IK8A 1Y7IA 1NZFA 2QN7A 2GDZA 2I33A 4P2BA 4PANA 3DLCA 4V0SA 5AI4A 3OOYA 4YYEA 4PR0A 4MGYR 1M1YE 4F1JA 5FPYA 4BO2A 1T35A 3PPXA 1J5XA 4RMHA 4S24A 4OQNA 1DKMA 3HZRA 2IY9A 4IEFB 4K05A 2FMFA 2AXEA 2IHYA 1EVYA 2ZDQA 5BVGA 1T4BA 3WLLA 1J1ZA 4GQIA 3I72A 4FLFA 4UMVA 5DXAA 4OA8A 4XGRA 1PNRA 2OZVA 2P5UA 3TSZA 5BWMA 3BXPA 5SYMA 2CVPA 2EJWA 2Y1CA 3HJTA 3DFZA 2NAPA 4J7AA 1Y8AA 4MUBA 2DWOA 2WQ6A 5BSRA 4NKRA 5D7NA 1UKCA 3DTVD 1P9OA 2P35A 3PNKA 4KDRA 3TIXB 1FFWA 3CLRD 3DKPA 4UKDA 4NU6A 4POAA 1FP1D 2Z6VA 4WASA 1GZ4A 4MS1B 1A1VA 1K92A 2OEPA 2W00A 3HABA 4GZLA 1M0SA 1L5HB 3DBIA 1NXQA 3LFUA 2XQKA 1NT2A 3DMNA 3QKSB 4OL0A 4PSKA 1BCSA 1JPUA 4G9BA 3C24A 1RI1A 3K4PA 3DPUA 4FZJA 1XB2A 4JJZA 3MCAA 3KE9A 2LE0A 4F4DA 2MIIA 3ICCA 3TSAA 1JR3E 3AUJB 5D87A 2BCEA 3HN2A 2BEUB 2I2AA 3OT1A 4P58A 1R6XA 3CPSA 1KSFX 2AKEA 1ZQ9A 2ZWMA 3NHJA 5EKTA 3KOOA 3RS5A 4KBFA 3SBXA 5G0VA 4UVDA 2VXYA 1W5EA 3DHNA 2OL4A 4QULA 2FSFA 1GL9B 1P6UA 4H18A 5JBNA 2ON6A 3I62A 2ZRDA 3T0FA 1W4ZA 1V3TA 1V1RA 3PITA 3U4IA 3ZCSA 2I3DA 4PAQA 4OHRA 1MEOA 1R0XA 4NU5A 4PFJA 5JSQA 3D5TA 2QQ5A 2R1UA 3Q2KA 1W25A 4XYBA 3WA7A 3MIIA 1Z2OX 3VKVA 2PZAA 2V4MA 3LU1A 3UUGA 3H9QA 1JPNA 1M76A 4Y9SA 4BKMA 4JJ6A 4HNVA 5LYJF 3T1OA 3LZCA 4LW8A 4OK6A 1F4VA 4L72A 3OIWA 1YDHA 2O5EA 3S40A 3B36A 4EYOA 4LC0A 4BO3A 3KJIA 3HXLA 1DIHA 5FTMA 4C2TA 4JLUA 5MHTA 3CZMA 1WB4A 3QF4B 1BHQ1 1C41A 2GPBA 1E2QA 1P9WA 4IVNA 4F5DA 3KKKA 1XTKA 1KC3A 4MVJI 4FC7A 2B2XA 2HXYA 5C5EA 2GZ2A 1X2BA 2ZBVA 4WOCA 4URYR 2QTLA 1Z2AA 3WMWA 1JFLA 3IEMA 3EHDA 3AL2A 3KQHA 2EX4A 1EQAA 4EK9A 3NBMA 3IAM1 4YJFB 3OQBA 2JI8A 3E7WA 3AJAA 1IK4A 1E9AA 3OAAA 3QLVA 4P22A 2C2MA 2W2KB 1M0TA 3H16A 3OOHA 4GQAA 4QU8A 2WTNA 4RDIA 4RK4A 3I58A 2WSMA 4LRTB 5E6UA 5LA6B 4JVNA 1NP6A 4PSAA 3NT5A 3Q1KA 2P62A 2VN8A 2A1IA 2YHAA 3ADPA 1PX2A 2PV7A 1HGXA 4GYJA 1CYDA 3NVDA 2QR5A 4MQ4A 5EMHA 5C80A 3TD2A 4F9FA 3C7CB 3EVAA 3SYTA 4KIJA 1ONBA 1R0ZA 3B2EA 1O87A 3CFYA 3NM5A 2XUOA 4G84A 2F43B 4WCVA 5J63A 3TSYA 4BN5A 2C2BA 5K8UA 2W93A 2FRDC 2ZYRA 4FMCF 5IH3A 2QLTA 1PGJA 2AJLI 3E35A 1OC2A 1V71A 1XK6A 3KUKA 5KOHA 1SB9A 2DFVA 1XLTA 2KBFA 3PNMA 5U1PA 3L1VA 4IUYA 3SJBA 1ZJZA 5AKIA 1G3IA 1E5DA 3ZJYA 3QA9A 1J97A 4YUYA 1K7CA 1CR0A 1GKKA 3GPBA 3P4UA 3CUVA 3OZIA 4JLKA 3U6BA 1UJBA 2B34A 2WFMA 4Y6RA 1IBCA 5BOSB 4XE5A 3TBKA 3MWEB 1VLQA 5B6PA 3F6SA 3ITNA 3X1DA 4KO4S 2RHLA 3NBFA 5BRNA 4CFZA 2NTEA 3I92A 1Q92A 3MD0A 2WIBA 2VHWA 4E94A 3W05A 2C31A 4B79A 2QYTA 1ACLA 3K5HA 1VPTA 3WLEA 4ZI3A 2BGTA 1XN1A 1ILEA 1YUMA 3DE7X 1KSHA 2FOXA 1DCMA 3I4CA 2C9OA 4OM8A 4QG7A 4NYJQ 4WN3A 2QNRA 3VGJA 5BPFA 7MHTA 3ELUA 2QJWA 1JDSA 4ZYYA 1NW8A 4QE3A 3U49A 2CVOA 3VO2A 1WZIA 2W2OA 3G68A 4ZXPA 4GLFA 4YMTA 4LF8B 3BSYA 3BFKA 4PS1A 3A1DA 1KE2A 1NI4B 3FSRA 4DA6A 1RLIA 1A8PA 3IXLA 4GMKA 4OF4A 5HRAA 1CETA 1DT5A 2GPJA 2WNIA 3C48A 4L15A 1WMFA 4MQ6A 3V80A 1OZGA 2Z95A 2YQZA 2YZ7A 1UIMA 3CF0A 3F3KA 3I6MA 4OAQA 4R41A 4DN6A 4EGJA 5HBRA 5GGYA 3PJGA 3WYAA 3A6PC 2HMAA 2M1ZA 4C88A 2GPWA 2QRLA 2BFNA 3PC6A 4PQFA 1ZWLA 2YTZA 2ATIA 2B1QA 3EN0A 1IJFA 2AUTA 1YJXA 2EZTA 2JLQA 3FPCA 3R0IA 4L3VA 4RF3A 4XI9A 2QZZA 3EVGA 1U0JA 4MINA 1YZVA 2P2DA 3Q3HA 2Z5FA 4WXEA 1CS0B 3T4UA 3ZZMA 4JH0A 3TFOA 1BKSB 2A5YB 3EUAA 4X7MA 1OBCA 3K94A 4PVDA 1T8SA 2C9MA 1II0A 1H3NA 5EHXA 3WLIA 5DH9A 2WJYA 4ZHSA 2CSXA 3U44A 4WVLA 4RIIA 4TYWA 1JECA 1FDUA 5K3SA 2XB2A 3N2GB 1NF9A 1PR2A 2DHEA 2WOJA 4Z1OA 1MC1A 3B89A 3EZNA 5DYYA 3ZCUA 1JEYA 4ZVTA 4M8SA 2PSSA 4TQ9A 1RDFA 1GPMA 4QNRA 5TS2A 4WCFA 3CN9A 3LO8A 3T35A 3AETB 5K03A 1P2BA 5FOXA 3LBIA 4OH1A 1YH3A 1XL1A 4I55A 1ORVA 1EE9A 1P4RA 1TZKA 2ZPUA 3B82A 4ENWA 4G26A 4ROSA 2PRKA 3LYHA 4Y2XA 1J2JA 1WPQA 3BL5A 2C83A 2X0DA 4IDCA 4QVGA 4WACA 4Q4CA 2GF0A 1XAJA 2OZEA 1RADA 4OQDA 1WW8A 1E3LA 2ZBUA 4QFCA 5HX7A 1HYQA 2FGKA 4RHXA 4O4HB 3AP2A 1E7MA 3GLIB 1G9XA 1JXOA 4OX9B 4Q9HA 4M9ZA 5F51A 1E9SA 4HG2A 3KAPA 4DLUA 4WK6A 5DNWA 4BMSA 1C4WA 1KZ7B 1ND6A 2FFRA 1ILWA 1H3FA 2C4WA 2BEJA 2HJWA 3IQZA 3P0RA 5A5DA 4KPYA 2J3HA 1MG5A 3H0KA 5DWVA 1YVRA 1SGWA 2GMWA 4L0CA 1Q5PA 2PWAA 3E5HA 5DNYB 5C4GB 3LFHA 3E1KA 1NVMB 2B1IA 1ZFNA 1HRDA 1KSGA 1XCLA 1A5AB 1Z75A 3ZDZB 4TTAA 4WNAB 2R6FA 1CPYA 3LXMA 1FX0B 2V7GA 3MSXA 1E1LA 1YIAA 2WSIA 4M6WA 2IYPA 3BH6A 3GP3A 3KQNA 4MR8A 4CUZA 5KNBA 2AHOA 4DPLA 3EQZA 1N5OX 1JXQA 2WKRA 4JYMA 1F6DA 5JJCA 2BYTA 1E1CB 4TKVB 1NT4A 2Q9AA 3DTTA 4AJ9A 2V97A 5GAJA 3VZSA 1JKFA 3ELYA 4U7PB 1GPDG 3M0EA 5F64A 1GU0A 3U3ZA 3GDOA 1GUAA 3VKFA 2R97A 1U5AA 1LBTA 2ISQA 4JP5A 1CHDA 3HWRA 4UNSA 1U7ZA 3V3TA 2COKA 2BTQA 2PXAA 2C2YA 4YH1A 4B1FA 3E5NA 2ZP1A 1RP1A 2X15A 3JD3A 1B26A 4MVXA 1JWBB 2PLRA 4P4TA 2IZ5A 1DS6A 4HAXA 3KQPA 3ME5A 3EBPA 1RJ9A 1FJHA 2KMLA 3ODPA 3ZK7A 4GPZA 1DBSA 1Z45A 2VT6A 1PJAA 4Z9XA 2P91A 1NVTA 2EFHB 4G01B 3RQIA 4LCBA 4AJJA 5C18A 3CN7A 1XQWA 4GVXA 4Q3BA 3LUKA 1LQ2A 5JANA 1VBFA 3G5LA 2HXGA 1UP4A 2AN1A 1PS8A 2OD2A 4L08A 1Z35A 2H1CA 3JQFA 3KVVA 4B09A 1XYVA 2ZLBA 3HKCB 3REOA 4WLUA 2PGDA 4FFSA 1I4LD 1HSOA 3RAPR 3OCZA 4XGQA 5BUSA 4E3ZA 3H2IA 3EAQA 2F64A 4C4AA 1B6TA 1SG6A 2I4RA 3MC1A 4PG7A 4PWZA 3QBDA 2ZYHA 4TMWA 1W0JD 1ZWKA 2J9ZB 1ZHFA 4JBWA 4A8TA 3E22A 4G5HA 1ZVJA 4RSHA 1BDIA 1D1QA 3WGIA 5H3LA 4RF4A 3ONFA 2GPAA 2IUYA 3QFTA 4EA6A 3TBFA 2BHRA 5KHOC 2ZRGA 3O9ZA 2OHOA 5LU8A 2NU8B 3PXGA 1M2OA 1RKBA 3LT1A 4YRFA 4X54A 1D6NA 2AC2A 3A27A 1HSZA 2IPAB 4MITA 5KQRA 3PS9A 3SSOA 1UAAA 4FUQA 2HHLA 3OA2A 4C0QC 1ZH6A 4OI4A 1E3WA 3KC2A 3IMKA 3QLUC 4J1TA 4RYDA 3W5HA 2ZS7A 1U5BA 3EGDA 1UINA 3AUFA 1H69A 3RRZA 2HJRA 3GZJA 4AM8A 1Y7HA 3CG0A 2MSDB 2YZKA 3LVFO 2DR0A 3R9KA 1YBHA 3VSDA 3IE0A 4NMHA 2CNWA 2WJ4A 1JRLA 4NBLA 2OZPA 4MQFA 4BCCA 1A9YA 1FEZA 3SE7A 1D07A 1O4WA 4TTTS 5LP6A 1WV1A 4ZU1X 4Y9UA 5CUQA 4RTPA 3RTEA 3AFMA 5LR6A 4LZNA 1TT5B 4G56A 2VQ3A 2JI6A 1GCIA 4I5GA 2FG6C 1G8KA 4CFYA 5A5EA 5B3KA 4E5DA 1YB1A 4XGIA 4E14A 4X66B 5I8ZA 1V8ZA 1FRZA 2GEVA 4BKUA 3FWHA 4BMXA 2A3RA 4IXMA 4A0HA 4D9CA 1KAEA 4AWBA 1CW2B 5DK4A 2PWYA 3EASA 1IHUA 3FSEA 4LWOA 4V0ME 1T25A 3JQDA 1N7GA 3L8HA 3VA7A 4CCYB 4DMFA 5C32A 5KB3A 3LCRA 3RADC 1XVVA 3ROEA 1DTSA 1G20B 2YHSA 3KEOA 4EHAA 1BS1A 2PA3A 5CBPB 3HJGA 4RVNA 4F4JA 4YV1A 3P9SA 3SZRA 1NVDA 5ESRA 2IEGA 4FEGA 3FZYA 4BNZA 2QMEA 5D6OA 4GI1A 3WLSA 5CFOA 4LNAA 5E3JA 1ENYA 4M0KA 4B6GA 1G8YA 1R8YA 1X1DA 2V9CA 3H5OA 4RY9A 5AR1A 4ILEA 5CNJA 5MN4A 5LD2C 3LPLA 1L5GB 2HU7A 3PQ6A 4B6SA 2VNIA 1NKTA 4MUMA 3FWZA 1MB2A 1QZ3A 1X42A 4I6GA 4NENB 2IHTA 1IZ9A 1C1HA 5DEOA 1XVAA 3D6UA 1LBHA 1KEEB 3U7IA 3UWMA 5HW0A 1E0SA 1ZXBA 2J3KA 3HUDA 1EXDA 4JI6B 4IJKA 1U1CA 1DX6A 5B1SA 3I2IA 1XZLA 5EY5B 1SXJE 2W9XA 4N7BA 1KKUA 1XKTA 3PEWA 3F7TA 1P6QA 2FSGA 2JG3A 1NR5A 3P2OA 3QUTA 1NUUA 2BMEA 4KI0A 4EKYA 2FTKE 4HRVA 2C99A 3PUYA 5LD2B 3U17A 2IHNA 5KHLB 5B58C 1XI2A 1DFHA 3KTAB 1E4OA 5FTKA 3CSDA 2R4UA 5HUQA 4CQNA 3MIZA 1BX1A 1NXOA 4LJ6A 221PA 1HDEA 5JOQA 1BROA 1R1DA 4R1OA 1G0OA 2O9JA 4HGOA 3SQWA 2HMWA 2MYTA 3N2ZB 3R3WA 5LP1A 2J7KA 1HDCA 4WV3A 4Y9TA 2DFDA 3A04A 2R9VA 2ZTMA 4KMRA 4WHMA 2J3JA 4C6HA 1CKEA 1GYPA 2IUTA 1K8ZB 3VNRA 1X7XB 4BX8A 1KEVA 1RR6A 2IC5A 3DT8A 3FRIA 1ZIXA 4E5KA 3W9SA 2VT2A 1ES9A 2ZULA 3AGPA 3OF5A 4JJFA 3MMPA 2VNAA 5A9RA 3JAMA 3WSVA 4QTZA 4BS9A 5CK4A 3NT2A 5I9LA 1BA2A 1I0IA 1D2NA 2LRHA 3UO8B 2FR1A 3SC2A 3LDUA 4M1MA 1FU7A 2JI9A 3D6TB 5CB4B 4AAYA 5SZKB 1EIZA 3C39A 1MA3A 2QAJA 1ZCJA 2OFWA 3H3FA 2LDXA 3OVMA 2O54A 1X8XA 4NJMB 1L4EA 4L4YA 4HYTA 5JZMA 2OFFA 3KHUA 5DSZA 3MAGA 4FZ5A 3ZV4A 2HK7A 2I87A 1KYZA 4XTCS 3FLMA 3TAXA 3K9HA 2BR5A 4K40A 2ILVA 4QQRA 3DBLA 2J31A 4BMNA 1ZIDA 3DVAB 1TVCA 4XJVA 4NARA 5MGBA 5HS6A 4MK4A 1WS6A 1XRQA 3LGXA 4YRBA 3KSUA 1SOVA 5TEWA 3I9V1 3DFMA 3PGMA 3PWZA 3WWOA 1NXXA 4JKOA 2BFDA 2PSHA 3ETLA 3Q87B 4I46A 4P32A 1UWKA 3RBXA 3U7RA 4DQXA 2ZTHA 3DL7A 3UGKA 1VZ2A 2YJTD 1VHQA 3K2QA 1O97C 4G07A 3EWIA 1FMCA 1R0YA 2OZKA 3MEQA 3V55A 1KK3A 5EIWA 3V4SA 5IBCA 1SBQA 5AI6A 3H86A 4ZI5A 4RA6A 1BU5A 2GZRA 3OM0A 4KV7A 5F3DA 3L6DA 3IBGA 1ZRHA 1UPBA 2VAWA 2PWBA 3IVXA 3Q7RA 4WLEA 2CHUA 2Q3MA 3VPHA 4B84A 4D3XA 2VYQA 1U6JA 2JZCA 3H5RA 2PPLA 2BIFA 3RWMB 1A27A 1PUJA 1W4RA 1YZ3A 3CV3A 4FSXA 4EQZA 3CMMA 3IMFA 4L8YA 2XD9A 4A3SA 4LF6B 5AJZA 1JDBC 5EIXA 1ECBA 1GTVA 1ML4A 3AY3A 4EJSA 2G08A 1SK8A 1JN0A 3FPLA 3P2JA 4HPJB 1PJTA 1PVDA 2H4JA 4ZV7A 5KWSA 3A3OA 3RQSA 2IZ7A 3ZWCA 2YMLA 5B3AA 2R25B 5AKEA 3HYRA 1YOVA 3K8ZA 3HYNA 4R4JA 2C1EA 2V1UA 3GEHA 2CMDA 4OB6A 2M98A 3MS2A 3HBLA 4ISCA 1GLGA 3QE0A 2RHBA 4IMPA 1VBNA 3IIMA 5IKPA 4WK4B 4JJGA 3QNUA 2I1QA 2IHJA 2YOGA 1SHTX 3BXZA 4FC6A 4WH0A 5I5EA 4L1KA 1KQFA 1GVHA 4PFQA 3H4TA 2EKDA 4Q4LA 4D9KA 2X0RA 2QSUA 1GQYA 2J41A 2YIJA 4YMGA 2XYRA 2ZK7A 1P60A 2CHEA 3ZNQA 3U13A 1KHHA 1KH3A 1XTTA 1MG0A 1YU9A 2FPGB 2J87A 3WGVA 3KR9A 3KWLA 4OGKA 2V3WA 1F60A 3N7TA 3DDCA 2PE5A 2ZPAA 5FFNA 1MDFA 3ER8A 1RJFA 4EFKA 1JSLA 5JASA 3KLNA 2QM0A 1WMBA 3R7FA 3LK6A 4FT2A 4GAEA 4F3TA 2DQ4A 4LHXA 1M34A 4DWJA 1GAEO 4REQB 5CIWA 1G4UR 1Z6AA 4EHJA 1TB4A 3QWFA 2CL5A 3B12A 4YRTA 4QUBA 5EVCA 3BE4A 2G1UA 3KHTA 1LTHR 1P5JA 4H7JA 4WLOA 5I9NA 3EC1A 2R68A 3BIXA 1F5NA 4UVEA 1M83A 5EE9A 5TIIA 3FPSA 1N1DA 5AFSA 2WIGA 1VMDA 3ZWWA 3GFFA 4TMYA 1FF9A 2P9GA 1YDMA 1NUTA 3EPPA 3FUWA 4OMCA 1K3TA 3VR2D 3E0QA 1W4BA 2Y0CA 4IXNA 4UTOA 1WVGA 4PLWA 5DBHX 1IY8A 4WLNA 1IZZA 2LKCA 5ICGA 4EMUA 4RTKA 3D1LA 1N4DA 3G0DA 3ICPA 1CJBA 4IVRA 3LQRA 2NSDA 1MRNA 2OHIA 3GLHB 3L02A 5JSZB 5I8PA 1P3Y1 3WIDA 3MT8A 2CK3D 3AKCA 3NM6B 1GD1O 4E30A 2C7QA 1P2SA 4IZIA 4FU0A 4IM7A 1MU0A 2O1EA 3BHMA 4BXOB 4JDPA 1O9GA 4G36A 3W5VA 1QHFA 4LSWA 5JISA 1KAQA 2X41A 3KQVA 4UARA 1MV5A 2NXJA 4OQLA 1BWPA 2G9UA 4R2XA 3LNCA 1P39A 1GPWB 3LIIA 4OJNA 3O0TA 4I1VA 1TUBA 2OXFA 1XEAA 4MMXB 1J0CA 3I2FA 4IDGA 1RLMA 4XYLA 1G4AE 4YUAA 3R76A 1MO5A 1X80A 3RJ5A 3JWEA 1YQDA 1OT5A 4HB3A 2WFLB 5K3FB 1P7YA 2YICA 3UYLA 1FU4A 1VRVA 5K99A 1NI5A 4L9WA 1D2GA 1E5XA 2R11A 3OY2A 3WJ7A 1NW5A 1VMKA 2ZAYA 3R3HA 3VPCA 4QPPA 1XRSB 3D6NB 2QLBA 1DAFA 1UJ4A 1GJRA 2ZB2A 4LBYA 5DHFA 4H4CA 4W5OA 1X39A 3HB7A 1U0FA 4PG6A 1OX4B 4X8LA 1DPFA 2OG1A 5BR8B 1THTA 2QNBA 5MFPA 1UC5B 2H4FA 2Z3VA 1UPFA 5BPHA 1SCQA 1UMBB 3N6XA 3Q3VA 3T34A 1QGOA 3P9YA 2NO5A 2Q5FA 5JS2A