1MAWA

Crystal structure of tryptophanyl-trna synthetase complexed with atp in an open conformation
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
326
structure length
326
Chain Sequence
MKTIFSGIQPSGVITIGNYIGALRQFVELQHEYNCYFCIVDQHAITVWQDPHELRQNIRRLAALYLAVGIDPTQATLFIQSEVPAHAQAAWMLQCIVYIGELERMTQFKEKSAGKEAVSAGLLTYPPLMAADILLYNTDIVPVGEDQKQHIELTRDLAERFNKRYGELFTIPEARIPKVGARIMSLVDPTKKMSKSDPNPKAYITLLDDAKTIEKKIKSAVTDSEGTIRYDKEAKPGISNLLNIYSTLSGQSIEELERQYEGKGYGVFKADLAQVVIETLRPIQERYHHWMESEELDRVLDEGAEKANRVASEMVRKMEQAMGLGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords TRYPTOPHAN-TRNA LIGASE
publication title Interconversion of ATP binding and conformational free energies by tryptophanyl-tRNA synthetase: structures of ATP bound to open and closed, pre-transition-state conformations.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 114
structure length 326
sequence length 326
chains with identical sequence B, C, D, E, F
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2002-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 1mawA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1mawA01
2DLCX 2BTEA 3L92A 1RQGA 1TQ8A 4Q16A 2NZ2A 2QJOA 3ZJVA 3AL0C 5IHXA 1IQ0A 4JYZA 1NUQA 3H99A 4YP7A 2QUHA 1M8JA 1O95C 1U7XA 1R6XA 1WOYA 4EG4A 2DUMA 4L2IB 1WXFA 4MVXA 4PY2A 4U63A 5FO1A 3NV7A 1IH8A 3IODA 3KT8A 2QJTA 1V8FA 1VBKA 4ARIA 3INNA 3IH5A 4EFKA 1M8GA 1I6MA 1KH2A 4I6JA 4ZT2A 1KAMA 1J21A 3RJZA 2PIDA 2WSIA 3FDXA 3UOWA 3GLVA 4ZCQA 4P2BA 3ZJTA 3G59A 1NSYA 1O6BA 4MW7A 2V0GA 1JEDA 4HJXA 4K0RA 3A04A 3X1JA 3CVXA 1YI8A 1EFPA 1WXGA 1NI5A 2D54A 1N1DA 3H05A 5H7XA 2CV0A 3JXEA 1WXHA 4KR7A 2GM3A 2VTBA 5KCMA 4MWEA 1NYLA 4MVYA 4ZCSA 1MRZA 1JIKA 5J58A 4PBTA 3FH0A 3SP1A 3COWA 2TS1A 1QTQA 1GTSA 3P0IA 1OWLA 3HMQA 4NZPA 1O0CA 3IVGA 1MB9A 3TS1A 2QUJA 1CT9A 3IDFA 1I2DA 1KH3A 2CUZA 2WB2A 2R5WA 2A4MA 1VLHA 4MUJA 4AS1A 1PFVA 1WKBA 2DERA 3IMCA 3SEQA 3COZA 1OWPA 3KFLA 2YY5A 1K4KA 1J20A 2AZXA 1U7DA 3AFHA 3FG9A 3FOCA 1OBHA 2CYBA 1TFUA 1IRXA 3LOQA 3UK2A 1H1TA 2Z3VA 1J1UA 4ZCPA 1N3LA 5F23A 4UZFA 1N2OA 4L2IA 1JECA 2O8VA 2CSXA 2BYTA 1U0BB 1ZH6A 1KH1A 1I6KA 3RK0A 4DDMA 1Q19A 1O97D 3Q12A 3N8HA 1G8HA 3FIUA 4MVWA 3I05A 1YUMA 3PXUA 4H3SA 4ZCRA 5LM3A 3CLSD 4MQ6A 3BL5A 1Q11A 3MUEA 2DEUA 1LI5A 2G36A 4HJRA 4EG3A 3IVCA 3ZIUA 5K0TA 1KR2A 3ND7A 3ZXIA 3CLUC 3GUZA 4MW6A 4EGAA 2VTBB 2I1LA 1KAQA 4YBRA 5K0SA 4I6GA 2CV1A 1MC1A 1UFVA 1JILA 4MWBA 1Y42X 4ZT5A 1LW7A 3RBAA 3ILVA 1BS2A 4YMIA 1N77A 1NUPA 4G6ZA 4MWDA 1TYCA 4JFAA 3TQOA 1J70A 4R2MA 4YP5A 3DPIA 3IOBA 4DDHA 3PRHA 3LCJA 4MW9A 3KT6A 1TYBE 2X3FA 3U1VA 4MLPA 2A88A 2GOYA 4MW5A 3AKZA 1Q15A 4NATA 4HK4A 2RD2A 2XRZA 3D6VA 3LE8A 4ZT7A 5DEOA 1R6TA 1G8GA 1QRUA 1FFYA 3KT0A 2IP1A 1ZJWA 2J07A 4I6EA 3IOCA 1NUTA 3Q4GA 2QTRA 3SDBA 2DXIA 1MB2A 2QTMA 4TS1A 1J09A 2ZUEA 2QTNA 1FYDA 1QQTA 1T6YA 1YULA 2E18A 1V47A 4ZT4A 4DJAA 4R2LA 1IQRA 3A4IA 1KQOA 1O96B 4ZT3A 4EG7A 4FZJA 4U8HA 1XNJA 3H97A 4MWCA 4KR9A 1O97C 3UY4A 1O5TA 1MAUA 3CLUD 4MUGA 4CT0A 1VBMA 1T9GR 4MUIA 1G8FA 3D6UA 5H16A 2Z08A 1F9AA 3DO8A 5KHAA 3UC5A 1GAXA 2ZUFA 5IJXA 3VU8A 2DETA 4AQ7A 1MAWA 1OWOA 1WXIA 3CVUA 4XSVA 2AKEA 3CLSC 2CYCA 3X1KA 1XNGA 4DE5A 4G5YA 3HV0A 2OV4A 3G5AA 1PFYA 4EG1A 1KKUA 2YXNA 3K9WA 1QJCA 4BWVA 1X6VA 2JA2A 1OWMA 1K4MA 2A1UB 1TYAE 4CDMA 4XFJA 4MVCA 3CVWA 5FNZA 3SEZA 4PBSA 1QNFA 3IOEA 3RK1A 2YWBA 2JAXA 3DLAA 3N9IA 3KT3A 4MUFA 1NUSA 1GN8A 1EUYA 3MLAA 3AIIA 4XFDA 1NUUA 2O5RA 1N2IA 1YIAA 3NBAA 3IUEA 1EUQA 1J1ZA 1O94D 1OD6A 3H9BA 4MUEA 1H3EA 4QREA 5DB4A 3UMVA 2X0KA 2E21A 3P0JA 1O0BA 2CFOA 3IMEA 2OQ2A 3ISJA 1O96A 2PG3A 2H29A 3IVXA 3VRHA 4ZCTA 4UZEA 1I6LA 1TYDE 2ZP1A 2PZBA 1GLNA 2Z09A 4EG6A 1JIIA 2D13A 3ZGZA 2A1TR 2XRYA 1QRSA 2DR2A 2HGZA 1U3DA 5LLTA 3MLBA 3FHJA 1M83A 4ND7A 4ZT6A 1M1ZA 3P0HA 1NP7A 1R6UA 4RUKA 1M8KA 4MW2A 5DASA 5TEVA 3TQIA 1OWNA 3IMGA 1EFVB 3F3MA 3AG6A 1F4LA 3N2YA 2A1UA 3OTWA 1IFXA 4PBRA 3ND5A 4X0EA 3DV2A 1D2RA 1N2BA 3GMIA 4MUKA 3QE4A 5KWVA 1S4MA 1KP2A 4RPIA 4U7JA 1X8XA 1PFWA 3CLTD 3P52A 1WZ2A 4YP6A 3RHSA 4WNYA 1M8PA 4F3RA 3RFFA 4J75A 4OJMX 1NURA 3S3TA 2HMAA 3HFJA 4GRIA 3M5WA 2J08A 4WSOA 2NSYA 3CVVA 3PNYA 3QTTA 3SYTA 1JEEA 4MUNA 1YIDA 1N2EA 2IJGX 4KPUB 1N75A 2PFSA 2PZ8A 1O94C 1DNPA 1MOPA 2V0CA 5TEWA 2X1MA 1PG2A 2GKSA 5JBNA 1WQ3A 4NDAA 3K32A 4KR6A 1MJHA 1TEZA 5FO0A 2HZ7A 4A91A 3FETA 1JIJA 3PNBA 4DDKA 3Q10A 1KORA 3CA8A 1KP3A 1P7PA 1K97A 3COVA 2WQ6A 1A8HA 3N05A 1T9GS 3CVYA 3A05A 2VXOA 3C8ZA 1H3NA 2WQ7A 1IHOA 2E89A 2DPLA 4OUDB 1EJ2A 4EG5A 1WJGA 3PNVA 4JXZA 1EFVA 4GU5A 4MULA 4F4HA 2H2AA 1WQ4A 3IUBA 4S1OA 1T6ZA 1KQNA 2EJCA 1HYBA 1F7UA 2B7LA 5LFAA 5BNZA 4E1AA 1JZQA 1ZUNA 3E27A 3HL4A 3SZGA 5J5AA 1JZSA 5TS2A 1QRTA 2J4DA 3CLRD 1IQUA 1YUNA 1PFUA 4EF6A 4ND6A 1PG0A 3TNJA 5J59A 1GZUA 3VGJA 2CV2A 1WXEA 1N2HA 3CLTC 3CR8A 4QRDA 3ZJUA 4MAFA 4NAUA 4J76A 3G6KA 1ILEA 1N2GA 1T6XA 4NX2A 1XJQA 4NAHA 1Q77A 5HUJA 4ARCA 4KPUA 3FI0A 1MBZA 1U3CA 2CYAA 1O95D 4MW0A 4R0NA 3L93A 5HG0A 2QUIA 1KQPA 3FY4A 3MMXA 3SZ3A 4EG8A 3FWKA 1COZA 4CDNA 4DLPA 2PZAA 2D5BA 2J09A 2J5BA 1EXDA 3NBKA 1JMVA 1WY5A 3ZUGA 1M8FA 2A1TS 3AG5A 4QBTA 2YWCA 1JHDA 3ZXSA 2E0IA 3HZRA 1QU2A 4OUDA 1LI7A 3HGMA 3ELBA 1N2JA 2AG6A 4Q93A 5HUHA 2A84A 1K92A 2X1LA 4MUHA 3FNRA 1JGTA 1QU3A 2JANA 1N78A 1B6TA 1EFPB 1XNHA 4KKVA 3OP1A 2RE8A 3X1MA 3TZLA 1NZJA 1IVSA 2QUKA 1F7VA 5DK4A 2EL7A 4MW4A 1GTRA 1VBNA 3ND6A 1OBCA 3H9CA 4DNXA 4MW1A 5TGTA 4G5FA 4K03A 3MXTA 1ZH0A 2QJFA 1SURA 4JXXA 3CLRC 3QTBA 4JZYA 3COYA 5EKDA 2IELA 5AHWA 1G59A 2A86A 1EE1A 1ULHA 1H3FA 2PXHA 2C5SA 2A7XA 1VL2A 3TZEA 4HPWA 2CT8A 4CQNA 1GPMA 3A2KA
chains in the Genus database with same CATH superfamily
4PE5B 2ZRHA 1SZJG 1M7HA 4MPRA 4MV6A 1IMOA 1ZMBA 5BR8B 2YW2A 4TSRA 5D6NA 5JT1A 3HWX1 4WZ6A 1PN3A 5JAUA 5KSZA 4MUAA 2XZPA 1N8KA 4F06A 3RVRA 4EVSA 4YP7A 2KI5A 2WUDA 3EFOA 4H1TA 4EY8A 4B3CA 4G5RA 3EG5A 1TKRA 1T1EA 4GE3A 4IWXA 3O38A 2JS7A 2CNNA 1NMEA 1OHHD 2P1ZA 2XTAA 4MS4A 1GZ4A 2O2IA 3ONVA 2Q6KA 4KR2A 4PY2A 1Z37A 4BGIA 3L1VA 1WXWA 2C5FA 3GEMA 3L8EA 1Y34E 1K6JA 2BGRA 3REGA 4ARIA 4FK8A 3VKFA 4F6LA 2GBIA 1UXJA 3INNA 5DXAA 3V8NA 4EMBA 5BN1A 3HWWA 5HF9A 1KMNA 1UC4B 2XIJA 3TRFA 3PEUA 3ZDDA 3IKTA 3SMVA 1JMKC 1VIYA 4MV3A 2ZM5A 3K30A 3I5UA 3FDXA 4OMUA 3MTAA 4ARSA 1MKYA 4P2BA 3G2NA 3M34A 1YMUA 4H7JA 1XRLA 1BFDA 1GL9B 1KHHA 2VEDA 4AYXA 4FWBA 3A04A 2MSWA 2PQ2A 3Q5EA 4GT1A 4ESVA 1KPGA 2B8WA 2HIAA 2PRYA 3A7DA 1GT91 4LHZA 1DKPA 4O5AA 3VU9A 2FPKA 3WWDA 3PQDA 4LHWA 4LY9A 3HR8A 3NUGA 4PG7A 3K9QO 3D1LA 4A0HA 2WYWA 1ISFA 3FHTA 4PXAA 3AGPA 1X94A 3OM8A 3QH4A 2FWIA 1XRSB 2AOWA 3D4OA 3UUFA 5JARA 2CNBA 1L8XA 1FX0A 4C7JA 3BT7A 3LLUA 4G5SA 1G9XA 2FSHA 2P4UA 1Z12A 3WLEA 4DXHA 5LYJB 1TUIA 2R25B 1AN9A 3LC7O 3AZOA 5BMVF 3SFVA 5IXSA 1ZMTA 2SKDA 4TN1A 2WB2A 2RFLA 2ZGVA 4WA8A 5M7EA 4KFUA 4IEFB 1UPCA 3HJNA 5T67A 5ELLA 1CF9A 1ZG3A 2QY6A 5BURA 4CIDA 1P1BA 4QVKA 2CW5A 1JJAA 1PW5A 1YOVB 2IDJA 1GA6A 3D8TA 2BHTA 3IUJA 3PC8C 1K7XB 3LS2A 3PLRA 4G1MB 2G1PA 1U7DA 1ZK3A 4YXFA 1L4GA 5J1TB 4B4VA 5KX5B 3O47A 5IN5A 2IHVA 4G23A 2XUGA 2PV0A 3DDOA 3OJCA 1TQ2A 2UXDB 5LIPA 5B7GA 2P9TA 3VU0A 4ENTA 3UPDA 5IZ4A 1B74A 1UWVA 1VLJA 2QROA 1TT5B 4KSBA 4Y98A 1YBFA 5ES3A 5EZ5A 4AJOA 2UUCB 4H6XA 5C1BA 2JKVA 2ERCA 2WTXA 3DL7A 2Q1YA 4X5OA 1EVQA 1QHNA 1DV2A 2F3PA 1TM4E 1W35A 3AUFA 4HQRA 4L5JA 5BT9A 1Z6GA 2R44A 2C97A 4AG5A 2YMPA 4ALLA 1CQXA 1DX6A 3QFTA 3WLAA 4JQSA 1I9CA 4LDPA 4MVWA 1RAEA 3MTGA 2ZFUA 5DOZA 5FYDA 2AL7A 4B84A 2OBNA 1NP3A 1POWA 1UKZA 3NHMA 4IH4A 2OPHA 1CBUA 2FCAA 2W6NA 4LRYA 2VKQA 4GOND 2D2VA 3K0BA 3IT3A 2DH5A 3GMSA 2DEUA 2OCXA 1R0ZA 1XEWX 1GGFA 2ZXFA 4RMJA 1OZAA 2YWJA 2X0NA 4EPVA 4B3IA 3IVCA 3OUTA 3AJDA 4OFWA 1ZD1A 2WZDA 2FSPA 4P31A 5CA0A 3E53A 1Y3BE 3VO9A 3TGPA 3QG5A 5FTLA 1YVUA 2HRRA 1JILA 2H07A 3N87A 1JTEA 2XYPA 1T1GA 4XEUA 4ZT5A 5FL7A 1BS2A 1HLGA 4R1OA 3GUYA 4G9EA 5JSUA 5E6RB 4G0YA 1G5TA 2XAUA 1PQ4A 4IVQA 2PU5A 3I62A 2FPMA 3CCCA 4LJSA 1G66A 2JI8A 5CRIA 5E3JA 3W9SA 3KVNA 3SHVA 2Q3JA 1GKUB 1NDQA 4FDMA 4CKEB 3H5OA 5LQDA 1O8CA 4YUWA 3U17A 2IYOA 4BUJA 2B92A 2OENG 1JLRA 1W73A 5HGJA 1JEYB 1F0NA 4J91A 4M0FA 1IMJA 3LBYA 1SUCA 2QUBA 3T7IA 3LECA 4QFDA 3U0VA 4DUZB 5I8ZA 4DB2A 2BDEA 3JRXA 1J2EA 4RPHA 1PO7A 3NC4A 5ESRA 1RTTA 3EIWA 1IC6A 2HJ9A 4XD2A 2D06A 4Q02A 2AN4A 4DFDA 3QM1A 4EUKA 2DXIA 3ADKA 1HTWA 4A2QA 4DHEA 2OLKA 3OOEA 2FJUA 3R74A 1X7XA 1R2QA 1T6YA 1YQUA 2G9ZA 2GMWA 2J59A 3ZS8A 1MO3A 1J5EB 4IMIB 1G19A 4D9JA 2AX4A 2AQHA 4N7JA 3ZD6A 3E9ZA 2WU3A 4Y2HA 3Q85A 3V2HA 4OXIA 2YBDA 3LM8A 1G20B 3SHQA 1DO8A 1EUDA 5ISMA 1U8XX 5FB3A 1DDGA 3AERB 2PKEA 3ZGNA 1C3XA 2C8LA 1BMFA 2Y1CA 1ZGHA 3KKKA 1WNTA 4W1SA 3DEZA 4BCBA 5D86A 3LPDA 4LOJA 3VYUB 4LEIA 2QVCA 3IOMA 2IYAA 5IM5A 1DCKA 1UBNA 5IJXA 1PZGA 5KNCD 4B3XA 3ZVNA 5LQKA 1GRCA 2I33A 1G3IA 3RS4A 3T3GA 3W06A 2IEAA 3UW1A 1E9SA 2XQGA 3R0XA 5AM2A 5LXTA 2WYHA 5KYWB 3LF2A 3CUWA 2C0QA 4ENRA 1PWXA 3X1KA 5J4YA 1A3CA 2VYQA 4HT3B 1YB6A 4K86A 2V6GA 3I1JA 3MWKA 2Q4EA 1WIWA 1FDSA 4GO1A 1EIWA 1KFCB 2UVQA 1R6VA 1TUEA 4LF9B 4I9HA 1KEVA 1XQ1A 1K4MA 2Z8YA 2D8MA 3SLKA 4ZHQF 1E1YA 1JSXA 1X7GA 4L8VA 3VR5H 4I46A 5CAEA 1JWAB 4IAOA 6ABPA 1AKMA 5C7OO 1SAYA 2FXIA 3UIEA 5AK3A 1AGRA 1L5OA 1WV0A 5COAA 1C4OA 2WAXA 1G7CA 1X7ZB 3TOSA 4M6WB 2WKWA 4NCNA 3IOEA 1R0YA 4DG5A 4ZFNA 4K9LA 4DABA 1WB9A 2Q46A 1U5AA 4PHTA 3K70D 3H4VA 4IKOA 1GTVA 2BI7A 3JAKB 4I99A 1N2ZA 1X1EA 3FN4A 3WNVA 2UVDA 1GNVA 1NUUA 1D4ZA 3BN3A 3H4MA 1UFQA 2VR1A 3OF2A 3DYVA 1ORWA 2AZDA 3DXXA 721PA 1YQDA 4MVJP 4GKJB 1T8TA 3OEHA 1DPFA 1QK4A 3QYFA 2IOFA 2HMWA 5K0LA 4CKBB 1GDHA 1H4SA 4RQUA 3GPLA 5EZYA 3CH4B 5DPMA 1O0BA 4ARAA 3ORFA 4UARA 4ZOLF 5JIBA 3H86A 1WLSA 2P6PA 1GQYA 1E2QA 1FB5A 1HYGA 5F5LA 3UK1A 4M76B 1QBKC 2HV9A 5JATA 4C2AA 3TB6A 4QSHA 3T1OA 3SYLA 1OT3A 2PU7A 2GT1A 2FN8A 2ACWA 2WWHA 3NU1A 3QLJA 5IAJA 3T6KA 3TYXA 2DE0X 1CLUA 1JYSA 4EJ6A 3QRWA 4DCOA 4YLEA 5EJ7A 1JX6A 4P3NA 4ZQHA 2D2IA 2RHOA 4UMEA 2YY7A 1P0MA 5HIIA 4J1TA 4YLGA 3ZR4B 2YVLA 1HDXA 2X4IA 3G9TA 2VOJA 2YZKA 1I3CA 1J9GA 1NP7A 1D03A 1XDWA 4BLQA 1C1DB 1R0SA 2G08A 2R6CA 4OBEA 3NHLA 2W2NA 3THWB 4EYEA 1UJ6A 2C2XA 3OQJA 2P8JA 4RC9A 4WNAA 5TEVA 3E3MA 3SY8A 1J90A 4GI1A 3WFIA 3C5EA 1QZZA 2GRJA 3GEBA 2ZI3A 1ISPA 3LQRA 4JI6B 1MO4A 4ZXPA 3UAXA 3KHTA 1N6NA 5JSHA 3AVOA 3O4IA 2VJYA 4Q7JB 4D4MA 1NBOA 1SUEA 1JU3A 3KR2A 1UP4A 4YJHB 4HLUA 1AN0A 4L07A 1XJCA 2ZUBA 2B1JA 1Z35A 1GA4A 3BXGA 5DI9A 3KQLA 3R41A 1H2HA 2V6MA 4JVLA 1FQOA 1NVVR 1U99A 3CINA 1YS9A 4LJ8A 4TN5A 2P2DA 3KTDA 3OKAA 3PIRA 5F98A 3I1YA 1NOIA 2Y1XA 3D8SA 4OGWA 1MJNA 3DG9A 3HJGA 2IDKA 3KUUA 1JHQA 2QXUA 2IC5A 1GAJA 3MF4A 3BF7A 3C3WA 4L16A 4EMSA 1YR2A 3SF8B 1VIAA 1NXSA 1P1RA 4ARZA 1MGOA 2Q8PA 4E6PA 4I1YA 2J41A 2NYAA 3VZCA 1W5AA 1JT9A 1PX0A 4U7TB 3M5WA 2J08A 4YO8A 1I9GA 2W2XA 3DL2A 5B2EA 3KJIA 1CJUC 2CB0A 2PWYA 4G85A 3PC2A 3T06B 1XJWA 2R87A 4ML3A 1XQVA 2XQFA 4MRMB 1Z45A 4OY3A 4RKYA 3PNKA 1L4MA 4P58A 5A3SA 3WLQA 2IXDA 4MJ3A 1CHDA 1G20E 3B1JA 3G2MA 2PX4A 4PWYA 4XTRA 4PAGA 3M4JA 1A7UA 2VEOA 5ALTA 5HKOA 1N5LA 3CB2A 1G3RA 3R0VA 3S1LA 5BUSA 3Q8LA 1I3KA 1GCOA 4GGPA 4J8PA 4ASUD 4WXYB 1RQNA 4N76A 2ISSD 2BHRA 2IL1A 2VQ6A 3MWEB 2XB4A 3FCAA 2WWXA 4FTWA 1U9JA 5LMZA 2QMQA 3G49A 1WZCA 3X3HA 1E3MA 2VA9A 2NZJA 4M89A 1QF9A 3BL6A 3Q2KA 1JDUA 3MCAA 3ZV6A 5B55A 5FUMA 2DTEA 2NP6A 3LYLA 1Z8DA 2WTAA 1X14A 1Y3IA 3EUEA 3OZTA 4R2IA 1HLFA 1RP1A 1SM4A 3N05A 3ED1A 4H1HA 2D59A 2BFBB 4BO5A 4LGMA 2C3PA 4JBXA 3AT1A 3B13B 1A8QA 1CJSA 3C14C 4WCFB 3QVSA 3IEMA 3Q7TA 3VDXA 2GEVA 1PYGA 4N47A 2HUPA 3K0SA 3UXHA 3ZNNA 1XEFA 2PSSA 1P1JA 2QTTA 3WLKX 2JFOA 4O25A 5CVVA 4X9XA 1NSFA 5AKYA 4PQRA 2H2AA 4QX6A 1U6KA 1PX2A 4AJ9A 5KSYA 5BQ3A 1UMDA 1XA4A 4OQZA 2P75A 3GJ5A 2P9JA 3INRA 3A4VA 2GK3A 2YHAA 3WGKA 2YCBA 4NH4A 2VKTA 3I2JA 3OIWA 4XGKA 2OQVA 5A9SB 3PX7A 1ESZA 3O9VA 3PQEA 1WB4A 5KDDA 1NN3A 1QR2A 3QX8A 3S2GA 1Q21A 3W2TA 1OBOA 4DCJA 2WYVA 4ZTUB 5KEIA 2V7EA 4GH5A 1XV5A 1ORTA 2JCGA 3QOFA 1C3LA 3N5KA 5EFZA 7REQA 1LV7A 3MOSA 5J59A 2IWRA 3R9XA 3WRVA 1V6AA 1GGJA 3FF1A 5F1PA 3OQHA 4ZQBA 1DDIA 2PUJA 3UJ8A 3CLTC 3QLTA 3UATA 3UANA 1AUQA 1S5PA 4MVJM 2W6JA 2FJ0A 1AQIA 1TMGE 5TPZD 5JBQA 4GVLA 3GCXA 3KYCA 1PL7A 3LNTA 2G70A 1CZUA 1K2VN 3E22B 3LC2O 2HMUA 2ZANA 3H2GA 3O90A 3SZUA 4KQ6A 2OHFA 3OCWA 1BS9A 1UDAA 2RHBA 1Z5ZA 3GB9A 1JEQB 3RKSA 3OEED 5K20A 4C6TA 4KFRA 2FEAA 4QTZA 4I9UA 3W05A 4DAOA 4JJ4A 5KTKA 3WE7A 4JT2A 5DTRA 1BHQ1 3L0OA 1QYCA 1LK0A 3MMXA 3N86A 5FOQA 4GQAA 4U9UA 1O4VA 1F14A 1UCFA 2NOAA 5B6PA 4HDRB 3KZ1E 1NJ6A 2VSYA 3RU2A 1LBQA 2QG4A 4TUYA 4I4TB 1CRPA 2H2GA 1MEJA 4QHSA 4EARA 3OTHA 4CQJA 2ZPUA 4IGAA 5FWXB 1TCAA 2H1RA 1Y1PA 5J2UA 3PPYA 3AG5A 1C1XB 1UBMS 1E1NA 4ATNA 5C8YF 2D0PB 2NPFA 5IBPA 1YC5A 3GT0A 5CU7A 3RTGA 2FQYA 3S2EA 3WBBA 2NAPA 2I3GA 4DCSA 3JYQA 1H23A 1VGQA 4WFJA 3U4HA 3LUGA 2C5EA 3E5RA 3CNEA 3GPBA 4F1JA 3C98A 4CQMD 3EQ2A 4KG7A 1KERA 2TMGA 3FSGD 4HFMA 6ADHA 4R3UC 3U7IA 2BLLA 2YXEA 2I1WA 5LQRA 4S2UA 4EPYA 2HM7A 2QLJA 4XDZA 1CV2A 5DT9A 1TAGA 1T3TA 3AP2A 3RJ5A 4NBRA 2IHJA 2ZVQX 4CDRA 5LDDC 5E6SA 1NZJA 3DMPA 3R7LA 4K6FA 3ZDRA 1RHQA 2DY1A 4C1NA 5DK4A 3F6EX 3VTZA 4O0LA 1GTRA 2B82A 4PEVA 2O8NA 2JZOA 3NIGB 2IXGA 3WYFA 3CGGA 5H59A 1LF0A 3NTLA 5EWMA 1WY7A 1ZESA 2P6OA 3AR6A 2C7RA 4MO9A 4BX9A 2ZE5A 2ZT7A 2IV3A 3PL5A 5EXSA 2GYYA 3EXEB 5EKDA 2IW1A 2QNRA 1SCBA 3QU5A 5TLSA 2HA0A 2R2GA 4CV0A 4TMVA 4BU0A 4KE9A 3ZDBA 2FG7C 4NFYA 2ZLBA 3W3AD 1WDLA 3M6LA 4H35A 4L4XA 3KKPA 4EGCB 2NYUA 3ETGA 3RTBA 3G8YA 1GCAA 2BTEA 3K4QA 4OQNA 1RQGA 1E2KA 5SZJA 3A14A 3F8TA 1FMTA 1OGYA 3SHFA 5CG1A 1JG4A 5ALKA 3RC3A 4YAEA 4L5YA 5FPKA 4M98A 4FEYA 3RARA 5FJJA 4UM5A 3D3JA 3W78A 1B42A 1XAJA 4G24A 3BMNA 5BXYA 2QUHA 1M8JA 4J16C 1R6XA 1Y4DE 2XE8A 3OHMA 1A4UA 1IY2A 3MFQA 1PZEA 1TJ4A 5L40A 1W2HA 1SXJE 1R7RA 3ANMA 3MXOA 4U63A 4Y2SA 1DCTA 5LPNA 3HUFA 2FLKA 1ZM4A 1VBKA 5EHNA 1GGKA 4OLJA 1S3FA 3EIQA 4DXAA 1EVJA 3CX7A 1N7JA 4PINA 4JP8A 4ZVNA 1YE5A 2FQWA 3JW8A 3LG2A 1BQ4A 4JVSB 5TGDA 3RWOA 3TXAA 1W85A 5EUBA 2B99A 3H9GA 2IHKA 3QVTA 3EQ8A 4EJSC 3CUTA 4AUEA 1NVTA 1I13A 3OZDA 4OHOA 3IEXA 3BWMA 2G76A 3CKYA 1M34A 1SRRA 1OB2A 4HN4B 4PPGA 1DKLA 1PT7A 2HRBA 1Y1LA 2KPOA 3P5BA 1QZTA 5ALZA 3V6MA 4EHNA 1X80B 2IHBA 2OC4A 3MEQA 121PA 2NGRA 2VRCD 1KXJA 1ONNA 3O4VA 2P6MA 3B3AA 1R9NA 2IPMA 4L8YA 4OB7A 3TCKA 4YJGA 1K7FB 1YZNA 4CF7A 5J58A 4E08A 2IRWA 2E4ZA 3FWYA 5CNJA 3LHDA 3T7SA 5KREA 4YPVA 3L6CA 4HNAA 1U2RA 1JR6A 4HH1A 1L8OA 5GOZA 3BPSA 3IOYA 1JKFA 1ETHA 3QXJA 3DCIA 1W1WA 4JJ7A 3UXYA 4QGFA 3OU7A 2JVKA 5TV2A 3WKDA 1U28A 4BO0A 1KGSA 1LPNA 4UTZA 4LDZA 3M3DA 2RG1A 1JMYA 5FKJA 2JI9A 3WGGA 4OYLA 2XZTA 5L4LA 1GGMA 3ROTA 1LNQA 4OQEA 3IMCA 3LVQE 4HYEA 1HFKA 3LDUA 1DG3A 3KJHA 2Q0SA 1W9HA 2I6QA 2ZITA 4F60A 4QDKA 4BP3A 3ABQB 4J2TA 4REMA 4TOIA 1DXOA 2YRFA 5LJIA 5L7TA 4KBYA 1SUFA 4PO1A 5AIBA 2GZDA 1ZMRA 1C14A 2Z3VA 4YGXB 3TSAA 4QQ8A 4TS4A 4CDGA 3RI3A 2PSFA 4H17A 2PANA 2R5FA 4DEVA 1K5DA 1NXXA 4JB8A 4Z8XA 2B8JA 2BYTA 4TV9A 1X3SA 2CVOA 3OUUA 1KH1A 4KPGA 4AZWA 1XK6A 3PI6A 3K96A 3P8ZA 4RA9A 3LA6A 1TKAA 4AN0A 2JJ2D 2OHJA 5CW2A 1PT6A 4JAVC 1U9IA 1FRFS 1Q0UA 4PYRA 1EK5A 2V7PA 3HBNA 4MX8A 5FPPA 4FLMA 4BO9A 5JU6A 1N25A 2GKGA 2H4FA 1KY5A 3T5BA 4QXAA 3TEMA 4QLAA 1L5WA 2VVTA 1XCBA 4H3SA 4WKPA 2J0VA 2IWHA 4KIFA 3TZHA 5GVSA 3K6SA 5DM0A 3VX4A 1QC5B 4NQRA 1MO5A 3DOEA 4AKIA 3I6QA 4IIGA 3A1FA 3NTOA 2SKCA 3EA0A 4JUIA 2MMGA 4US1R 3GAAA 1KJYA 2E48A 3I32A 1CD5A 2BGLA 3TQSA 3HA3A 1ESMA 3D0RA 3GUZA 3BBPA 1VG0B 3OFKA 3P9IA 4BMXA 1XZGA 1H1LA 1YZKA 2YFKA 1W0KD 1Y0BA 3U49A 1Z7WA 3B9BA 2B5VA 1T2EA 1SC3A 3BDAA 2JAPA 3K35A 4GNRA 1STOA 4CVNA 3D7KA 3GJ0A 3EVTA 3IV6A 2FDXA 3OSZA 1EB8A 3AEYA 3FNQA 5JC1A 4V24A 1LF5A 3DW3X 4QPJC 3W79A 4QKQA 1ZHOA 2GHIA 2J8ZA 4JFAA 3G3EA 4QBGB 1TYEB 4MDYA 3V4VB 1E2DA 3VHQA 1P1KA 3IOBA 4OA5A 5FADA 1N9GA 3WGQA 2C2BA 4K2AA 2XNDA 5CK4A 2D1FA 2WHYA 3DLHA 1KGDA 4MLPA 2FRXA 1Z8HA 2D0IA 4OSPA 5KZMB 3IQEA 5FORA 1SWWA 4D3XA 5DNEA 4QM7A 3COPA 1C4KA 3LE8A 1VL8A 2XVYA 3AOEA 5FX2A 4FILA 4DR3B 2R4TA 2VUSA 1GKLA 2ZE6A 3DAYA 3OX1A 4KLNA 4REQA 4D9GA 3HU5A 1ZXBA 4B7ZA 1DHRA 4JJKA 4UOZA 4DM4A 3EZ6A 3SDBA 5FLKA 4BNLA 2E4VA 1XTKA 2XGMA 421PA 1UFOA 4FT4A 3URKA 5FA8A 2EBWA 4GSYA 1SO8A 1K2WA 3KOUA 3VMMA 3SXJA 3KPJA 5K3FA 2XYRA 2GD6A 4WK2B 2E18A 1C7JA 1EINA 2MYUA 2OO5A 3MT0A 3M33A 3PVSA 1YZGA 4OXQA 3M0EA 1O96B 3ZQKA 5MN5A 4RWZA 3WDSA 1NY6A 5IJ0A 3IO5A 2VYVD 1TK9A 5L7WA 1NVAA 4IIJF 2P6UA 4LJYA 4MVJE 1TTTA 3GNQA 4C87A 5LNK6 4S1VA 1RYMA 2KX7A 3CH6A 4JGIA 5AJZA 3LLSA 1Z6YA 2FSIA 2R1VA 3UHOA 4A9AA 3OC0A 5H16A 1MAHA 4V2IA 2ISQA 1U8EA 1E2IA 1T13A 4QFMA 5D85A 4B4WA 1IXRC 1QCCA 1UK8A 3FLAA 3H04A 3IAXA 3OCCA 3PFBA 3FA2A 4NYIQ 1WL8A 3AF2A 4PZEA 4RK7A 5FD8A 1MAWA 2AVNA 3G2QA 4EO7A 2A5LA 3L4BA 4I5EA 5B1DA 4E4RA 3JYHA 2CYCA 2D8AA 1H6DA 2N9UA 3OWOA 4S1PA 3MWDB 4D25A 4KRGA 4Q4CA 6Q21A 1AHNA 1WSWA 4RKEA 2EP5A 2V4MA 1CR1A 1AXEA 4IIHA 2YXNA 3F5FA 5IC4A 3RREA 1T0PA 5AOVA 4QU5A 1DUSA 1BDMA 3AYXB 4YDQA 1ZC4A 1OWMA 2JA2A 1HNNA 4P84A 4U9IS 2EFJA 1U1EA 4DLTA 1V11B 3U81A 1IHDA 4O8ZA 3A37A 3KDSE 1NWHA 1FP7A 2YFYA 2FR0A 5DTIA 1EEHA 2H1OA 4I4LA 1SD2A 3W8FA 4ED9A 3R5SA 3ZHSA 4D9EA 1T3ZA 3OM1A 5D6OA 2G4VA 1JP7A 3GFQA 4Y30A 2WK1A 2ZAGA 1RE0A 3LD9A 5HK8A 2AQKA 5AKEA 1I2MA 1INLA 5JOQA 3VH2A 2ZWIA 2OKGA 4JLSA 1R3DA 3OJWA 4MWZA 3PUJA 3KJNA 1KRXA 2Y9PB 1GUZA 2A9KA 4KN8A 2DT8A 1JE1A 1H05A 1A5TA 1E4EB 4TTPA 3UN1A 5EP4A 4BJ5A 4BNNA 1VSVA 2FKNA 3AF5A 1XLTC 4RTLA 5A3QA 1I7QB 1DJOA 4P3PA 2O2ZA 2O2XA 3CLVA 3OX3A 2WD8A 5BN5B 4D8WA 1HETA 4YASA 3ZHCA 1TMKA 1ICIA 4JOSA 2ZQYA 3ZZ1A 3EIFA 4BFWA 2JGMA 2R3SA 1WCV1 3CHYA 3DWFA 5EIBC 4NMMA 4CM5A 4LDQA 3DZCA 2BRUC 4BMZA 3R6LA 4MKGA 2VYFA 4P1ZA 4PRKA 4YV0A 3WL4A 1RWKA 3NAZA 3SEFA 2HK8A 2HPAA 2ZI7A 4P7FA 4RVFA 4RXUA 3KPUA 3SS9X 4FQ5A 1K7CA 2F2TA 3KKLA 4X7BA 1MA0A 5E6UA 4RIFA 1SUWA 1A96A 4R2HA 3S40A 4OGGA 1D4FA 2O8CA 2ZT6A 3L7LA 1RLTA 1YQEA 3HJRA 4AQYB 1EIZA 4A23A 2D74A 1BCRB 1ZK0A 1J5PA 2F1OA 4YRFA 1K6EA 5CFLA 1M8KA 5K5EA 4ROTA 2C82A 1NUAA 2YHIA 3IE1A 4YMUA 4OREX 4DV6B 3ZD8A 4FX5A 1Z56C 5LUAA 5D84A 4RD0A 1NBMA 3ELDA 3GY0A 5DN6D 1MN6A 2Y6UA 2GF0A 1XTBA 2FW9A 2Y1EA 3HKEA 3T1YB 4LSGA 1K6MA 2V7GA 3NNNA 1PIWA 4HCJA 4DJEC 1WD5A 1TGYA 4DMGA 5DSZA 1X1CA 3VZRA 3GMIA 1J2TA 3P0EA 3QE4A 4MUKA 4NE2A 4BZZA 3P9QA 4XD7A 1M1UA 1S4MA 3CZ5A 3KVRA 4RTPA 3G5TA 1QANA 4Z4IA 4G86A 4CLXA 1PZHA 5LC1A 4E2FA 1S8AA 3IHKA 1ZM9A 3CFYA 2NAFA 3SIPA 1MQSA 3C16C 4KB5A 5HDBB 5EIEA 1NNI1 5LP6F 4FEAA 1EBUA 2X14A 1ZN8A 1Q1AA 1T5SA 1UXGA 2FUNB 1JXMA 3CN7A 3HYSA 4INPA 3TKAA 3ZXYA 2H63A 4XWOA 4FR0A 1EFCA 1PSZA 1Y9DA 3L7DA 2O5VA 3SYTA 3VV3A 4TKUB 3DBIA 4LXUA 3HWSA 3P2JA 5JVDB 1N36B 3T4PA 1O87A 3V1UA 2D2EA 3NH6A 2CFCA 3JASA 2PR2A 2VTDA 3U9SA 1KBZA 1P1FA 2BKLA 2YUIA 3VXKA 5CA1F 1I7DA 5IVKA 5DMHA 4Z9FA 2Z4TA 5KVVA 3LUDA 1R6BX 3BFPA 4TYQA 1Z33A 5FO0A 4UEKA 5CW1A 2EFGA 1JIJA 3W6UA 3TJZA 4D9NA 2QYSA 3GQVA 1YASA 1GQFA 3K73O 2GM9A 2MWMA 5GQSA 3X1YA 1NY5A 3ZVMA 1YA4A 2MSDB 2HN9A 2A3RA 1FEZA 3TSWA 1V1RA 4CMIB 1E6EA 2EERA 1SBQA 4RFSA 3F4BA 2RJNA 4Z2AA 2XWPA 1XO1A 5FAXA 4E0BA 5BW8A 3A3YA 3II6X 3WV5A 4BL5A 3DOUA 2PD4A 4WNAB 1GUBA 4F3CA 1D4AA 4NH0A 2BEWA 3LU1A 2IYWA 1SBTA 3K0AB 5DRTA 2VNHA 4IV5A 3BVPA 3JQAD 3EH2A 4GU5A 2I5PO 3RYIA 1W88A 1OUMA 1CHNA 4O4HF 4YAGA 3D81A 4D8YA 1XZCA 5K6TA 2IZOA 2QVBA 4UU1A 1JAYA 2FSVC 5E0KB 2ATIA 1XDBA 2OZKA 4EX6A 2VHTA 3TLGA 4Q4JA 3CX3A 1BGXT 2YASA 1OLXA 3IJ5A 4ZK2A 1RT9A 3ANYB 4MLDA 1XZQA 2RHRA 4WTOA 4XR4A 1NVGA 3PWTA 4B4OA 2C9MA 4MEAA 2VATA 1MC8A 5IK2D 4KGVA 3I2GA 4FFVA 4JIMA 4F3TA 4JDUA 1PFUA 4OXRA 1KVUA 1TPZA 2PKRA 2YWGA 4XGRA 4EY7A 1W19A 1GPLA 2GILA 3F78A 4IQ4A 4LX8A 3REFA 3ZV4A 4D98A 1E32A 1F5SA 4C4RA 2OCDA 1QP7A 2I03A 1OZHA 2YL2A 2WMNB 2JFUA 4V0ME 3RVNA 2QENA 5A9RA 1Y6GA 4NE9A 1X9GA 1XMSA 2JL1A 1UZUA 3ER6A 4XR9A 2GQ0A 4B5KA 5JXGA 4UEWA 3KQNA 3HN7A 4OQLA 5FNVF 3WB2A 2VJKA 3WXMA 4FSDA 3H8JA 3GQBB 4E1VA 1X8KA 2ORED 3SYKA 4Q4JB 3HDGA 3GRCA 5AI9A 1U3CA 1CR4A 2WIGA 1U3GA 3SN6A 4KP7A 3QENA 4KQ1A 3UV3A 4IFEA 1YS4A 2G7MC 1KJ9A 1V5WA 2PDAA 3B1WA 4DLPA 1YV9A 2EF0A 1R74A 2ZJYA 4UHKA 1NF9A 1I94B 3A3KA 2VHJA 4WL0A 2FSUA 2J9YB 2WPDD 4OQFA 1AUVA 5DWVA 4Q1CA 1D6NA 3VM6A 4EHIA 4KIUA 3QBTA 5A4DA 2ZDQA 4ZD6A 2VP5A 1QGUA 3A8TA 1VHQA 5MN4A 1BWQA 5A6VA 2RH9B 4E33A 2R66A 4CJXA 1OE0A 1CB0A 3AFMA 4K88A 5JI2E 2QVYX 5BV7A 3SR3A 4CM3A 3OTIA 2AG6A 3GEEA 1DBIA 4IICA 3AZPA 2RI0A 2OOKA 1K92A 2X1LA 4GMHA 4TTRA 2H57A 5H4GA 4AG3A 4MUHA 3DC7A 4GDMA 4E88A 2C07A 1K6IA 3D6MA 1YZYA 1J8QA 2XOXA 1VM6A 1XNHA 2GBLC 4KKVA 4DJDC 4EKDA 3B85A 2VA8A 1FW8A 2FZVA 1SXIA 3FLMA 3OPYB 3GJSA 2HWYA 1QS0A 3BJMA 4DRXA 4LYDA 1FP2A 3FTPA 5D7BA 2QUKA 3R77A 1C3JA 3BFJA 3MINA 4RH1A 1L5QA 1IPHA 1SVLA 1M2KA 1WMBA 4MW4A 4C6HA 3Q8MA 4KVFA 1MGPA 2IU3A 3T9CA 2MSNA 2XA9A 3ZBTA 1U2DA 3BHNA 1U9CA 1JHAA 4TVSA 3MXTA 1CUYA 1P31A 5CYPA 1R8JA 2I6TA 4LJAA 3ZEAA 3DCNA 3QTBA 5G1OA 3R8FA 5B12A 4CG2A 5JSZB 1OYWA 1BX3A 3PS9A 2X23A 4NU8X 4XJXA 9ABPA 2PMDA 3TNLA 2WFZA 2I7CA 2ZAMA 3K92A 1ULUA 3D0OA 2X1HA 5F4BA 3IIJA 2IDZA 4FUQA 3MUFA 1IK4A 1ABBA 1ECPA 3C3XA 5IM4A 2DTDA 2CJFA 4JODA 2XQIA 2IP2A 2PKQO 3HNRA 3CIFA 4OQXA 3QUSA 4PONA 1H2RS 4QJBA 1LRKA 1AZTA 1CUZA 3CEJA 3Q8WA 3C3EA 3QPAA 521PA 2CLKB 1KO1A 4G4IA 2K2QB 4XCXA 4B2LA 5TMPA 1QRAA 1A2QA 4FYWA 3ZE0B 3RAGA 1Z34A 3HYCA 2BDTA 4A0SA 5LD2B 2HYDA 4O4LA 2AW3A 5FO1A 3FNGA 2CY0A 1QYIA 5AK0A 2XJ4A 3A28A 1SCDA 3DE5X 3NHYA 4YUVA 3A6LA 3QKTA 5J4VA 4XFKA 2I87A 3WWZA 4C4OA 5D3MA 1ZJ4A 4HQFA 4ZT2A 4CHGA 7ABPA 1J21A 1GOTA 3B1VA 4O2AB 3HXTA 1PI3A 2J4FA 3GOHA 4PVDA 4ZCQA 4D6XA 1PJAA 4CM7A 1CF4A 3BJIC 1QOPB 3QF7A 1E5VA 1HE5A 2YXPX 1SBCA 3FUWA 3ILYA 4JVMA 3RWMB 4B40A 3ACCA 3KOZA 3UCEA 3X1JA 4C01A 2A9RA 5BSTA 1FE8A 2D54A 3U7RA 5DN9A 4JZKA 4L5AA 2J0UB 2IZ5A 2B35A 3JU3A 3O21A 3G2KA 3R23A 3TLAA 4CG1A 5CFRA 3BWEA 4HATA 1KI4A 1KYWA 5F78A 4M1SA 3W6ZA 2HCTA 1P8AA 3Q72A 5JZSA 4GLFA 2WJIA 1SXQA 1EFRA 1JHRA 1JR3D 2WSBA 4N03A 2OFWA 2V5AA 2QSUA 2V7XA 3C15C 3LBFA 4M36A 4QT0A 4NJEB 4RCYA 1SVSA 1O0CA 4WACA 4RDCA 2PX6A 4JHXA 2D3TA 3SQXA 4BNGA 4B3GA 3EJ6A 3H6KA 1JF8A 1Z0DA 2FMFA 3AF4A 1W5SA 4KFTA 3ZV7A 2DC1A 2WKSA 1ENOA 3A9WA 5DGIA 1QIJA 5C3MA 3EZFA 4MUJA 3TB4A 4YEDA 1J0AA 1PFVA 1FPMA 1SR8A 2WQZA 1XXHB 2PNJA 1W36C 2AJCA 2DERA 1BAPA 1NTOA 3FB4A 3COZA 3GFFA 2XKKA 1WUIS 1GD1O 3CKKA 2AZXA 3DBVO 3JQ9C 5KOJA 3AFHA 4HKTA 3WIUA 4KUHA 4LOHA 3B8HA 4I19A 2XMQA 3BKWA 4DN6A 1DARA 2BL4A 3HACA 3P19A 1RQXA 5BN4A 3UA4A 1GAQA 2GESA 1ZI6A 3I8OA 5I01A 3I9OA 3TIGA 4URVR 5BW4A 1M1NA 1RWOA 2QMOA 3UT5B 2WYOA 2C9ZA 3BC1A 1SXJA 3T9EA 2ZIUB 3PQ8A 4BFTA 2QN3A 3EWSA 2XOEA 3QVUA 4X1IA 3EIHA 2VHEA 2O05A 3S8MA 3T0FA 2QORA 4KYVA 4ENWA 3M6FA 5IKEA 1KWGA 2DUWA 3DMYA 3FIUA 3UAWA 3DZJA 3I05A 3DHWC 4QELA 2CVZA 1YS6A 3DO6A 3L06A 4DQLA 3RVPA 4ZCRA 1DBPA 3P9YA 4OH7A 1QVWA 3VDMA 2R65A 1JU4A 3ITDA 4UTRA 4E5DA 1A9ZA 1FP4B 5KYVA 3TFQA 4YUYA 3I9NA 4RZSA 3T5DA 3FYHA 3SF0A 3Q0IA 5F1KA 3D4LA 5BWNA 1EX1A 1OI7A 1LI5A 3H9EO 2BGGA 3FUTA 1A0OA 2LNDA 3A1WA 1GNSA 3HN2A 4A03A 4EG3A 3RTDA 1DMRA 1A2KC 5ABPA 1SN7A 2Z9DA 5C1DA 4F93B 4H3HB 5KDOA 1KEZA 3HSKA 1H69A 1P4RA 5CD9A 1OX6A 1Z2CA 5BYAA 3BH0A 3EVFA 1N5DA 1ZOLA 3A3NA 1LBHA 2G9UA 5A7GA 3PDHA 3IFSA 3RRNA 4RMHA 4KDCA 1LSJA 3ZS9A 4AJJA 1BU5A 2C0PA 5DYIA 4UVDA 1ARZA 5BVHA 4OK5A 2GJKA 2HT1A 1DO2A 3AUTA 5DV9A 2AR7A 4KK3A 2GZRA 2XVMA 1RHJA 1YK0A 2UV8A 3HTXA 4ZDKA 2A9FA 2V3VA 3GUVA 1YE8A 2DU8A 3P2EA 4RYDA 3KT6A 1TYBE 2BUAA 2KE5A 2ZM6B 2A94A 1RMTA 1ML4A 2W42A 4GZLA 4L4YA 4L3WA 1VSQA 1ZA2A 4EZEA 1Y5RA 2BFEB 1K0UA 3S1AB 5ITZA 3SU8A 5EWLA 4D57A 4E30A 2XSZA 3TR6A 3LSTA 2DAPA 3KKOA 5F1OA 1IL0A 2QTBA 3K9HA 1FTGA 4RAQA 1ABEA 1ZNYA 3FPEA 3Q4GA 4Y2UA 3LQ1A 1VKZA 4EABA 3CO5A 2CJWA 4IOMA 2RMKA 3RS5A 1MO6A 3PTLA 3L1IA 4O5OA 3FOWA 2GXQA 2HY7A 3RVKA 4N4AA 1BQEA 1HQDA 2ODQA 4B47A 1GZ5A 2NSLA 1QH9A 4ZT4A 5KQGA 1NBEA 3BULA 3OZGA 1UMCA 1OXKB 1T24A 4LYJA 4E2XA 1XKQA 3DZGA 1R1DA 1UMBB 3LSYA 4UHBA 1CK4A 3L7OA 2X13A 3OAAA 4XPIB 5DX8A 1E1RD 4HNHA 1ZJ5A 3TKLA 4IOJA 4JLMA 4KBFA 4W9MC 1RAGA 4HTAA 2KW5A 4MYRA 5SZHB 1G63A 1EI9A 1DB3A 1IY8A 1KYYA 1N7HA 2ZUFA 4TLMB 2AFHB 1UM9A 2VJPA 1XEAA 4JCOA 3JQEA 3ZLVA 4MS3A 4K05A 2V9ZA 3T7JA 2PGOA 5ANRB 5T4EA 3TL6A 4WADA 3NV9A 4UMFA 4AICA 1HE2A 2PX3A 1GFSA 4DE5A 1H1LB 2GD2A 1JJVA 3QYJA 4H1VA 3M70A 1X77A 3WHPA 2ZKLA 3OZXA 1CS4C 4FHDA 1P2SA 1ISRA 1Z4LA 3DVQX 2EFEB 2ZR7A 3PX3A 1QJCA 1SNYA 2JGDA 3DFIA 5I4CA 2AA3A 1OI3A 3PIIA 4X65B 1A2OA 1EESA 8ATCA 3I04M 2IOYA 3L82B 1L5ZA 3VZSA 2VUHB 1R66A 3LPMA 4M46A 4BMVA 4CDMA 2Z8ZA 3CJQA 4YCLA 2ZBPA 4LVOA 5KUTA 3PQ4A 4OA8A 5AXCA 1OVGA 2Y2VA 3VGPA 5ALEA 4BO2A 4HFRA 3CVWA 1UZAA 1XXHE 1MW9X 4UMDA 4CT4B 3UBTA 1IJEA 1VL5A 3RK1A 1PYDA 3ZCUA 3NC0C 4ZVVA 4JJEA 1LBEA 2GEFA 2XAAA 3V9AA 4O59O 3FX2A 1VJTA 5T8KC 1GQOA 4M9UA 1BEZA 1NLYA 1JG7A 5ADWA 4F12A 4QO8A 1PUXA 1O95A 3OE7A 1TU3A 3BCRA 3NM5A 4L1KA 4J03A 1ZGBA 2FN7A 3FBTA 4MRAA 4R1TA 5I7UA 2HH9A 4WZBA 4V02A 1JLLB 4J4HA 3T9FA 1E6MA 2BFCB 2ZE7A 3QXCA 3MB5A 3DDHA 1E8DA 2JFVA 2ODAA 3UH1A 1XQWA 4DYVA 4Q00A 4MYHA 1R8QA 1P2BA 3Q87B 5CFZA 4XRRA 3JX9A 1MZPA 2ZR0A 2H92A 3GFPA 1V96A 2I2BA 1L0BA 2X22A 3OF5A 1MB4A 4MP3A 4YNBA 4EBFA 3JALB 2PG3A 1KK2A 1IM8A 1P0IA 1KVSA 2WM9B 3C3DA 5IYZB 1JDZA 3WLOA 1DEXA 3A0UA 1I6LA 3R3WA 3HJHA 1WCYA 2CXNA 2IHYA 1ZBQA 2DHRA 2Z09A 2WJVA 3AY7A 3BMOA 4KUEA 1ENYA 2AI1A 5JTTA 1M6NA 4MVJA 3UFXB 3BBLA 4C06A 1P44A 1QJ4A 3OIDA 3ZDFA 1IQPA 4G25A 5GAJA 1MORA 4MJ7A 3T3MB 2QZ4A 4FZ3A 2OCIA 2RJOA 2RK4A 4M7RA 4P7GA 4NZNA 1GT6A 2YYYA 2VTEA 1XAGA 2C2GA 4ZZ2A 1BRMA 1MC4A 4FT2A 1VPVA 1YJ8A 2IVFA 4JFRA 4B6EA 3GFRA 3NOOA 4F0JA 1M0EA 2F3UA 3AEKA 4O4IB 3SXUB 4DIOA 1E89A 4RHYA 2YV1A 4BTEA 3LUHA 3OCYA 2B36A 3NFYA 3H17A 2D5AA 3G8AA 2P30A 5B3JC 2BGMA 1CC1S 4MIYA 4CEHA 1R12A 1XHEA 1ZICA 1QFSA 4FJ1A 4MEJA 2I3DA 4XCVA 4ZI7A 5BSVA 5K8LA 3RC2A 3K71B 1UPXA 1ZGGA 5AR1A 2V9PA 1XVAA 5ICSA 4JHLA 2R1ZA 1QQ5A 2PS0A 3A31A 3VOSA 5TQJA 4D0GA 4MS1A 3PLNA 1OILA 2HYIC 4WJZA 2GNPA 2XXBA 2X5KO 4ZC8A 4IRXA 1DQSA 2EX4A 1ZUNB 2IYXA 3IDSA 3FW1A 2IQ5A 1E0DA 1AJEA 4URFA 5A5GA 2R47A 2YV3A 3BJZA 1HI9A 4J3JA 4NCIA 4KQHA 4Q3EA 1L1QA 1Y3HA 3RLIA 4ZJZA 4WQMA 3OWXA 1C3EA 3OX4A 5JWRA 2G0TA 1RJFA 2XNHA 4J75A 3ROGA 4X3PA 3CF6R 1TLTA 1NURA 4GMKA 1WKVA 4KW7A 1FTNA 2ZTSA 4E4YA 4RTNA 5E3HA 1EFHA 1UJCA 5L95A 3QYAA 3GEDA 5J1SB 1GM5A 5KSOA 1IBCA 1V5IA 2EKPA 2WFLB 1ZUD1 4TTSA 5GV8A 3E7PA 4KEAA 4WXRA 5BPFA 1OHHA 1T1IA 3V4OA 4FMDF 2NU8B 2DY0A 3FFBA 4KPUB 5T41A 1FVHA 3TOCA 1UFKA 3CTPA 3MG9A 1V16B 2Q50A 5TEWA 4CFSA 4JLKA 4RHCA 3ECSA 2B2NA 3DF9A 1W4ZA 4IS2A 4KO3S 2J3EA 3R5XA 4OLFA 5LQAA 1PS0A 3OZCA 3QBVA 2CHVA 1GHTA 2ZBRA 4ZAGA 3IVAA 3VSEA 1DJMA 4JC4A 1Y9AA 2VJOA 1ZD8A 5E6UB 3L0DA 2OCYC 3G2PA 3OLZA 2HSEA 5EIAA 3VNAA 1X42A 2PRZA 1GPUA 3LBHA 3PUYA 4I3HA 2LKDA 3GJ6A 4DY4A 1C7IA 1TD9A 1X0XA 1T9GS 2CDBA 4I4IA 3A11A 1L6RA 2YZ2A 1TIKA 3RJMA 1DWUA 3ZKWB 1GZDA 3A9TA 3EYAA 1WVGA 3O82A 4N9QA 4TS3A 1VPDA 3RHFA 3ADCA 4OMDA 4QBIA 3JARB 3KETA 1U2TA 1L5SA 2PYZA 2F1KA 2WINI 4US2R 1BYUA 1GR0A 2NQ2C 3JD0A 4BEJA 2FG5A 3LDAA 3HKEB 3CNLA 3PL1A 1P9OA 5AT1A 4CMBA 2XRMA 3CNBA 3GLHE 4OBBA 1HY3A 1YL6A 1TVKA 2AR0A 3ICQB 5E4YA 3BWYA 4GOLD 3D7MA 2VK4A 3GI1A 2FMIA 2I4TA 2ZYTX 3HL4A 3BTVA 3RASA 3SHTA 3KC2A 3PHHA 5LBIA 4CV3A 2HRCA 3FTQA 5BP7A 1CZLA 4KN6A 3WDMA 3S0JA 5H80A 5EUQB 1PF7E 4Y6GB 5F21A 2GJAA 3IP5A 4YB8A 2QW0X 3PUZA 1FVFA 2ZVJA 2IYFA 3KHUA 2WWTA 3R5FA 4FR5A 4UEQA 2GM5A 2WHQA 1QQ7A 3KWFA 2RC5A 4DBVO 3WLIA 3FNIA 3LT2A 4RACA 1CX9B 5IWCA 4GXRA 2V58A 4KVGA 1FMFA 3QXXA 4UAJA 4CLHA 4H7FA 2XHEA 2H7CA 3A32A 5EE9A 3RD5A 4OK6A 4F21A 4Z4GA 4FLFA 3PJEA 1E94E 1E7QA 1EKXA 1I51A 3LOUA 4JUBA 4NAHA 4ARCA 3NBZC 3OPNA 1AK9A 1X7DA 1YZVA 2KQUA 1B14A 4EUSA 4J7UA 3SS7X 3GLKA 5L4NA 2E5LB 3GUUA 3S5JA 4R0NA 3M82A 4GICA 3RFUA 1JQEA 1VMAA 3PUVA 3UGQA 2JHPA 5HG0A 3AW9A 5BOSA 1Q1EA 3UOGA 4Z9XA 4CDNA 4BATA 4R68A 2VDQB 1E62A 3UZUA 1FDRA 5J2TF 5K0FA 4YRKA 4X8HA 4YIKA 2Q28A 2W48A 1ZOOA 3B12A 4Q05A 4RQAA 3ZIAD 4DNFA 1KQFA 4IYRA 3TX2A 4JV5B 2JGJA 2HO4A 3K05A 1I5OA 2YX1A 4XX1A 4EA9A 4OHMA 5JAOA 5CYFA 5IG2A 4FPXA 1PTKA 3T38A 4YCCA 4KNYA 2Y76A 3MIIA 1C7EA 1BZYA 1EM8A 2DZDA 2LRHA 4ZO9A 2R7AA 2H8KA 1EQAA 1W25A 2VUUA 3PEVA 2J48A 3IULA 3BD6A 3DYBA 4HQ6A 4L3VA 4WEOA 5CNMA 1S02A 4OUDA 1LI7A 1QP8A 2FUG6 1LDEA 1MXFA 3KQOA 3UKJA 1UF9A 3OZ7A 3RYFA 1LI4A 1AIPA 4TM8A 3RYIB 3FMOB 3G7SA 1F20A 3Q7EA 5FRDA 3D2AA 3W6NA 4A0RA 5E4TA 4BB9A 5CEFA 3B6EA 3VR6H 3O6VA 4EUNA 4OPMA 4ETIA 4Y1RA 1ZXXA 5ADVA 4L4SA 2BFFA 2BMWA 1A8PA 2FWPA 2O5EA 4QULA 5LNK1 2AYYA 1CTQA 1WS6A 3E2IA 1TYZA 2BE9A 2HRQA 3KZNA 4GR4A 1HUQA 2M6LA 1WW2A 3K1JA 5KYYA 4FE3A 1RLJA 3TLBA 4X6YA 5B30A 1AKTA 1Q17A 4UNPA 4U3JA 1YHNA 1PR5A 2C8JA 2EZUA 3GBVA 4ZVSA 4LFCB 4F6RB 1T9ZA 4HWPA 5CHYA 5HTKA 2FSGA 1NJGA 5DTEA 3FPHA 2SCUA 1QGDA 3H9CA 5KNBH 3C8MA 1ACJA 3FCOA 2JD1A 1MRNA 2OYCA 4OSEA 5DX1A 2VF7A 4TMXA 1ZX1A 4V0MA 3PPXA 1QB8A 3DXZA 4FYJA 4S0ZA 1DBWA 5GONB 3NH9A 1JVBA 1XTPA 3LK7A 4OKIA 3RIGA 4JENA 4XWYA 1NMZA 2QZZA 4RH3A 3F2VA 1CDZA 2A7XA 4TM7A 2GNOA 4K9SA 3R0IA 4MKZA 1WMFA 2JHAA 2P77A 3A4TA 3FYUB 4JWTA 1XKLA 5HR5A 4W5RA 4PTYA 1PS9A 1QHIA 2NZ2A 3QF4B 2QJOA 1FZQA 3LKDA 1YKSA 2IIVA 1BRTA 4KQMA 5LZ7A 4DIMA 5CBPB 3ZJVA 2PMBA 4C5BA 4FYKA 3PD0A 1NUQA 3LZCA 4Y2XA 2BUCA 3UK7A 5G3YA 1TZMA 2XBUA 3GLFA 3EPLA 3MPOA 2BR4A 4MGKR 4WFQA 3WKAA 3JQBC 3GFSA 4MVXA 4DEXA 5K6AA 3UMMA 1T0IA 3KZOA 5AW6A 1XD8A 4QTUB 5KNCA 3I5AA 2WSSD 2C7GA 2QX4A 2WG0A 3BGDA 3OOJA 4N0MA 3BB1A 1DFHA 5CFMA 4B7AA 2ODTX 3LK6A 2RGUA 3P9XA 4UPVA 5JH7A 1JJ7A 5LL6P 2HBZA 3WNDA 2QW1A 3ZJTA 1T0UA 4DIKA 5JZBA 4M8KA 3NHPA 1IHYA 1JEDA 3G8BA 3BRQA 1SVIA 3GP3A 4JX8A 4UJ3A 1DCMA 1U1IA 2IKSA 3ECCA 1AURA 4JBIA 1PHPA 4TQAA 2IV2X 2LWIA 1HRKA 2JI7A 2ZRGA 3PDJA 1X3LA 4TQGA 3PXGA 5LQJA 4KR7A 4NCBA 3QUAA 1XRMA 2CNDA 2VK1A 3JD4A 3RTCA 4X84A 1MD9A 4RF5A 3V2GA 2F8MA 3A9CA 1SVOA 2JB9A 3CXUA 5G0VA 1E9CA 4U2BA 1AX9A 3L02A 1N33B 4NPAA 5FTMA 3RYHA 4XUCA 2QTGA 2R7KA 3P0IA 4JNCA 5L3SB 1N4AA 2CHEA 4X90A 1F2TB 3CVOA 4R1NA 5BQ5A 4AECA 4JI2B 3RJ9A 1PSDA 2AYZA 3ICOA 2VT3A 4QJIA 2GI4A 4C0SA 2BTQA 4CKWA 1R4AA 4PX5A 5EXTA 4YMLA 3ZJYA 3TW4A 2GJ4A 1PQYA 1FXWA 1V8BA 5DXJA 5F7JA 4BAGA 2GA8A 4AURA 4N1AA 2GN9A 2NWQA 3PGLA 3HY4A 1RYNA 3EQ9A 2ADMA 1L5KA 2WT4A 1FJ2A 4Y2TA 2JFNA 4JC8A 4CKXA 5BV0A 4PNPA 3DL4A 4N0DA 4OQYA 3R09A 4M8SA 4S3MA 3K2QA 1A9QA 4YECA 5F2NA 3RHTA 5CVUA 1V6CA 1ESDA 1H1TA 3HPRA 1T9BA 4G0OA 3RS8A 1TT7A 1SUAA 4DPLA 4DLKA 2RIRA 1GGVA 3ZKAA 4L2IA 1U0BB 5GJVC 4WLOA 3PT5A 4MXDA 4F7DA 4BMDA 2QZSA 2ZT8A 5EEHA 5CEEA 4GPTA 1SGWA 1KI1A 2V55B 1LRLA 2Y71A 1T1JA 3PZRA 1KI2A 2ZRFA 3ZU6A 5AM4A 4C4XA 5BPHA 5KWJA 3T34A 1G8HA 3VVLA 1R16A 1TF2A 2H06A 1II8A 2ZTUA 1KZ9A 2IUYA 3LCVB 2WF8A 2VHWA 2DMRA 4RY9A 3ZY3A 4F86A 1GDDA 4EL5A 3PHGA 2UXCB 4W5NA 3SD7A 4RL6A 2FZLA 3O83A 5A04A 4RM3A 2ECFA 1AF4A 1G2PA 3WOHA 1X9IA 4CLRA 3ZI4A 3MUEA 4C0XA 1OU4A 4OX9Y 5ESWA 4A26A 4J0DA 5KYUA 3AB7A 1RBZA 2IH2A 1QCDA 2CLMB 2HI0A 2GYVA 1SXHA 3SJUA 1CKEA 4H77A 2XVZA 4R98A 2FPGA 2RGCA 4REOA 1S0UA 4OCZA 5FOUA 1U3FA 1W2WB 1XBTA 3CZ9A 4F5DA 4AI6A 3PE4A 2Q6OA 1RFLA 1WTAA 3DEKA 1Z7EA 4MWBA 5B64A 3Q3VA 3SX2A 1U80A 4LJLA 4HWKA 1KOFA 4UUMA 4C7OB 3WL6A 3G13A 2QQ0A 2R8OA 4C4TA 1PLKA 1CUEA 2B5OA 3TRIA 4U2KA 2G0NA 1SVWA 3RABA 4W5OA 4L5IA 2OE2A 4JH0A 4BO6A 1XG5A 2G4CA 1K5HA 3HI4A 4S1WA 5F5XA 3ZXUB 4INOA 1R50A 5CH8A 4Z3KA 2J9GA 1L5HB 5IP5A 4LDNA 3N75A 4HK4A 1UH5A 3U1TA 2RD2A 4UNRA 3EIUA 4NBNA 2R8YA 3LGXA 5BO5A 3AFNA 1YU6A 4A73A 4ASUA 2ES4A 2RGBA 1FS4A 3DBRA 1GQ2A 4HN2A 3QBJA 3S70A 4UU7A 4YP1A 1T9AA 5I9MA 4DV7B 1J09A 1ZVKA 2DOKA 3CEHA 4H3VA 1ULAA 2XA1A 1ZCAA 3B5JA 3STYA 3TZCA 5KX5F 4JEUA 1TU0A 3IERA 4LOLA 3HSSA 4XE5A 1KMHB 1SKBA 1Z22A 5JW6A 3TGLA 3SQWA 1YR3A 3QELB 4BZXA 2G80A 4R69A 1TZCA 1MJGA 4MV0A 2CXUA 1VPTA 2VWHA 3PHLA 3C39A 2JIMA 3K20A 4OAOA 4ZIRA 2GPBA 4MWCA 4N3AA 5E2IA 1Q3TA 2AFVA 3O84A 2G17A 3P96A 4HAZA 2H51A 4LW8A 4KYUA 3IXMA 4Z7NB 1NI4A 4UTXA 3SNKA 3EXHA 4CT0A 1DO0A 1NT4A 1NL3A 4RDIA 5JNTA 5KBYA 2Z08A 3K1YA 2WP0A 3UC5A 4AO8A 3GF4A 4BJHB 3ZVKA 3HKBA 3IUSA 3JAMA 5BQFA 1CEQA 5LLDA 2FLWA 1I6WA 1PQUA 4AZ3A 3F5QA 5LBUA 3LHFA 3L4SO 4NCKA 1L1RA 4DA6A 4E4TA 2FH5B 2C7PA 4J6FA 4WASA 4XSVA 3H6HA 2Q45A 4R9NA 2EHDA 3O1HB 1U7UA 4WGGA 3B1FA 3F6YA 1DLJA 2XMPA 2WA1A 3PFGA 4LFAB 4KIGA 1RQPA 1VJ1A 4WZAE 3HFGA 1QTRA 2GD0A 5EMJA 4ITRC 4DA8A 5HZHA 1TOAA 4MKHA 3NKLA 2B6HA 4AG6A 4LXIA 4X44A 4F2DA 1RLOA 4INZA 3U4IA 3EAQA 4Q1AA 3R44A 4HPXB 4PFKA 3BE6A 4YAOA 5EYPA 5K3SA 4CYMA 4YMHA 2M98A 2QRHA 2VNJA 3THXA 1VSUA 2N42A 5IZCC 1ECCA 2WU8A 1JPNA 1T26A 2I54A 2NQTA 4MB0A 1QGYA 3MGBA 4TYWA 1E63A 3HEBA 3H1PA 5BVGA 3IURA 4MTLA 3IB6A 4IIVA 4M9QA 2F55A 4CEJB 2FMUA 3NWBA 4PBSA 5TPZA 1NW4A 2ZJ4A 3SEZA 4B34A 2PM8A 4S12A 5HDQA 4NK5A 2HC9A 3T54A 1HEUA 1Z07A 3G2IA 1Z2DA 2QZJA 2AJTA 5ITZB 2WJJA 4CW7A 5ALFA 1IHXA 2JLRA 3DHVA 3E9QA 5FUVA 5HKKD 5HVNA 3OEEA 1UAGA 1X1BA 1FU7A 3HJCA 4FFRA 4IBOA 3BB3A 4HDQB 1PJSA 5SY6A 3N0TA 3O8QB 4FOOA 4LE1A 3RNOA 5LU9A 3KUKA 3JATA 5DB4A 4RLHA 5F3DA 3PFHA 1WZUA 4KIJA 4L8LA 5TC4A 3ICVA 4MGIR 4Y1FA 5BSEA 1IBRA 2J45A 2HSJA 3I2HA 3QEAZ 4RSRA 3R20A 3RG8A 3T1NA 1C3VA 1RRMA 4OAQA 5H3CA 1OYOA 4C78A 4PLVA 3NM6B 2COUA 2AC7A 4WOKA 4HNVA 5IULC 3CF0A 3MS7A 4FZ5A 4BMYA 3MMPA 1LW6E 1ONBA 4IDCA 1JIIA 3KZMA 4K1XA 3SSNA 4B82A 3C5HA 4Z49A 2EXXA 4FNAA 4FCVA 4CQMA 2NPIA 2WU1A 4W82A 4PYLA 4WBNA 2BN4A 3FSGA 2HGZA 2B1GA 3LVBA 4HTFA 4RPLA 2RBKA 3WI7A 4BRWA 4R2JA 1RKBA 1VMDA 3FHJA 2FDRA 2P79A 2V6FA 2ZK7A 3KU1A 3LY7A 3SDZA 2QP3A 1UEJA 1M1ZA 3OZIA 4KO2S 4O4JF 1MHPA 3DDCA 4FKZA 4LGYA 3TJRA 3TMAA 3AEXA 5ER9A 1NRWA 1P9LA 2V7WA 4OYYA 3X43A 2W22A 5LA6F 4DW8A 3TNFA 4RMNA 4F85A 2VK2A 1C30B 5HFNA 4UOEA 3OTOB 3IMGA 5JCJD 2BMVA 1ZY2A 3DAPA 3DCJA 1EPUA 1XU4A 5DBFA 2JGDB 5ALHA 1P1HA 4KXQA 1F4LA 3K5PA 1KDVA 1OYVA 5TQ2B 2RH8A 1MVLA 2AK3A 2GN8A 3BAZA 3DNMA 4RJ2A 2IQIA 4MPPA 2GF9A 1FVXA 2HQOA 1DBRA 3F9IA 3CX8A 1DWOA 1X7YB 4GIBA 4F2HA 2WYIA 5B1IA 1QH8A 2EW8A 2VBFA 3E9DA 3RO7A 2XDAA 3ZNOA 4AVYA 4PLZA 4DUGD 4RXTA 5JJLA 1XTTA 3P52A 4I1RA 5I7HA 4LWZA 3W3AA 1LTKA 2OO3A 2P5SA 4DPKA 4JJFA 1IOZA 3EWNA 2Q1UA 5IAOA 3GJRA 1KP9A 2JFFA 2VNAA 3ADPA 3H0EA 4PR3A 1J49A 2I4LA 1S96A 4JYMA 4O2BA 2Q6IA 4QOIA 1KR5A 3P9PA 4HB2A 3VC1A 5IEJA 1R9GA 2GUWA 4WZBB 4W5TA 3E3LA 4F84A 3PKJA 1U8ZA 4XM2A 2VRNA 4AZ0A 5JAIA 1QAQA 1H4QA 3L77A 4CT5A 5LOVF 2A9OA 2Q1TA 3O74A 4AKHA 2IJGX 2PL3A 3KX2A 1O0SA 3P71T 3NWPA 4Z4CA 1AKQA 2OQRA 4GE0A 1HT1E 3EBLA 3ETEA 4BNHA 5G41A 4EP1A 2JFQA 2BH9A 5SV2A 4PANA 1T9DA 2XRFA 5JSQA 4LC0A 4W7SA 3LZ6A 1DOHA 3L0SA 1KBOA 4QSMA 1WQ3A 5FA6A 3TZBA 1TEZA 2VXCA 4LGCA 4BQPA 5JXJA 3FOEC 4QTYA 5COBA 2QQFA 4HDNA 4WESB 2XVXA 5REQA 3V8BA 3W5IA 4Q3LA 2WHEA 1Y8QB 3KTFA 2YHBA 3CMMA 4QUHA 5BQPA 3DDZX 1QE5A 2A5GA 2ZCUA 1DAGA 1K7SN 3GXOA 3M6AA 3PQ6A 5DM4A 3LTNC 3NVMB 4MI9A 2EYQA 3GZNB 1GN9A 1W34A 2C98A 2VRCA 3L7IA 1HTBA 1IAVA 1T9CA 2GPAA 2PEYA 3H2HA 4YWJA 2WQ7A 4LV5B 4M55A 1SUDA 2COEA 5TPWA 2B94A 5KCZA 3E0XA 5T3UA 4LZJA 1QPBA 4ONEA 3ORSA 4DILA 4DY6A 2G3YA 4ZAZA 1M6VA 2NLOA 4YFYA 3EVNA 3A10A 4PFJA 3WLJA 1BGWA 2IW3A 4YT2A 1H42A 5AKGA 3Q88A 5I8PA 1PJLA 5D87A 5FBZA 2BCJQ 2DRIA 4DSNA 2IU6A 4DV0B 3A6DA 3GT7A 5CBKA 5I3CA 2B34A 5I9SA 1CR0A 1F2UB 1NQVA 1RD4A 3SIWA 5JAPA 2C1XA 4UASA 3CZAA 4YRDA 2ZB2A 2H65A 4K81B 1CNEA 2J7KA 4XM1A 4XH9B 2A35A 3VZBA 1KO8A 2X4DA 3ME5A 1ILEA 1JI0A 1KMQA 2J9XB 2XWQA 2QLNA 4FX2A 1N2GA 1P29A 4HQ0A 4MWGA 1XJQA 3B78A 1FSZA 3AR3A 2BBWA 3O8RA 1U8YA 1E59A 2CLOB 1P0PA 1U0JA 3HKDA 3NTXA 2YC2C 1U02A 1UZNA 4M53A 5DSXA 4CV1A 1MBZA 2ZBDA 3R5HA 4GSKA 3LKZA 5FH9A 2IBTA 3W1VA 4BWGA 1O2DA 1IJKA 2JJ2A 3H13A 1X86B 9ATCA 5K0CA 1N0WA 5JZOA 1CY4A 3OM9A 4DCPA 3DZBA 2YUTA 4G81A 4L7VA 4E09A 2QEQA 2ZJ2A 5F64A 1RXSA 5EZQA 1C1HA 1V26A 4ZOEA 2HIGA 1RXEA 5GMOA 1YA6A 1YZTA 3HJFA 5KHLB 1ZVMA 2B9VA 2Q3HA 5KSPA 3R4VA 4WCVA 3VR6D 1NNLA 1VLMA 1Y8RA 1QAMA 1WD7A 3MCVA 1ORVA 3PCRB 4MAMA 3B36A 2ZRIA 4Q66C 5CVEA 2AQ8A 3HJUA 4L9SA 3NBKA 4NEQA 1WY5A 4NABA 5IVIA 5DHTA 2QIPA 1LVHA 2OBLA 1A1SA 3TEFA 5JQGF 3JZDA 2XMDA 1OX4A 3EXFA 1HDEA 1UC8A 5KKCA 1CP2A 3E35A 1UXKA 1W0KA 3GJ7A 3L7YA 3Q11A 4BO7A 4BJ6A 3GP8A 4GL4A 4NU6A 1BWSA 3AETB 3LXXA 5GV7A 1E1MA 1KSHA 2IUEA 2VLBA 2JANA 1YNOA 3BIJA 2FEMA 4FDLA 2OGWA 5DYNA 1EFPB 1QP4A 2ZUDA 1R6AA 3DL0A 3GLHA 3B6IA 2V5VA 2A58A 2V6IA 4RPGA 4Y8VA 5FBKA 4BLWA 4LMAA 1RYYA 3N53A 4TSKA 3TZLA 2PXXA 1WZIA 4C0AC 3FXAA 4XWAA 3MCZA 3CE9A 4KTVE 4ZHQB 5IU6A 1SOAA 3DAFA 1Z75A 4B33A 4FBMA 3PHIA 4XQCA 1X15A 2PGLA 3ND6A 4EW6A 4X6LA 4EA6A 1RWPA 3N2IA 4GP6A 4M1QA 1CZHA 5CT8A 3JQQA 4BLOA 3FTEA 5HGXA 4URXR 5AW1A 4C2TA 1SCUA 4KE7A 4L8WB 3PE3A 4UD6A 2R85A 3H7AA 1D6JA 2BJHA 2P0AA 3GOQA 4W7IA 3WKCA 5LJLA 1FNBA 1DG9A 3U60B 2J85A 1XLUA 2X0FA 2QZPA 2PXHA 4UUOA 1HDIA 4R2WA 4GYKA 2D5CA 2IPAB 2ZU6A 3CKMA 3MMNA 5EE3A 1YS1X 5EG5A 3HYLA 3CW8X 1BXGA 2NV2B 2VK8A 1PR6A 3W4KA 1ZR2A 2E9SA 4ZI5A 1XLVA 4OKSA 1NVKA 2VYVA 5A4MS 1IG0A 2JBAA 4ZOLB 3WBFA 1QHHB 3LT4A 5K3AA 4YH1A 4C21A 5A7FA 3KRTA 4BFZA 4QICA 5ECGC 3WJAA 3KSZO 3BXZA 4PZLA 3AIOA 3PQ5A 1J0DA 2G5TA 2PLRA 2YINC 2J3DA 1IDOA 1XRQA 2UZIR 2DHQA 4A10A 4DS3A 2QJTA 3GHHA 3IP1A 3UAOA 4B31A 1G5RA 1T2CA 2ZQZA 4YQZA 2JHGA 4Q4AA 3H18A 1ZW6A 5HM8A 1ZK1A 2N0SA 3OFVA 4IMPA 1KAMA 5EWJB 4FCCA 1EDEA 4AJKA 2OB2A 4EHJA 3AY0A 1M66A 2A1IA 2WSIA 5B53A 3UOWA 4EI2A 4HDKB 2I3ZA 1RM5A 1ZGZA 5AXAA 3JQ7B 2D1RA 4M9RA 3FGNA 3OJOA 1QLHA 3ACDA 4HGYA 4ENVA 4D45A 4RCZA 3DVSX 4ZREA 1VCIA 1BE1A 1EB9A 3EASA 1YI8A 1HURA 1MLDA 3EF0A 3JD2A 4FXPA 4QGHA 4B46A 1L7VC 4RK5A 5I48A 4UBIA 2CV0A 3EDRA 3CB4A 5IUKC 2AJDA 1AVTA 2GR9A 3MJ4A 1P7VA 3PE6A 4C1BA 4TZ0A 1T5LA 3T3IA 3X1ZA 1JIKA 5KNDD 4J1TC 1H9AA 2E4WA 1PEDA 3A9SA 3EYWA 2OOSA 2R1TA 3EEOA 3DE1X 3CKLA 4HDSA 2YN0A 4BNTA 3TJMA 2L19A 2DFTA 2AC4A 4GZ5A 4F38A 1JDBC 2IXBA 1RBMA 3OOSA 2B1QA 4JMPA 2INGX 2ZI4A 3QE2A 3WGNA 1NF8A 2KSQA 4ARVA 4EWLA 3IDFA 3HA7A 2ZSJA 2HWXA 5E9JA 3OQNA 3HYTA 1P5ZB 3CWQA 4UOQA 4RSMA 4EHLA 2IYVA 3AGQA 4ZRNA 3D2LA 4KIWA 4O29A 3OE5A 2B4TO 1XAHA 4WH0A 2FP4B 2BP7A 3R3UA 2O3UA 2QTZA 4HSGA 3BGWA 1P62B 2C3UA 1B73A 3OT4A 3A4YA 3I04A 3CO0S 4C0KA 4Z4EA 2XXAB 3FOCA 2B4AA 2FV8A 2ZIXB 1XUOA 4FB4A 5BWBA 1JIQA 1GYRA 2CFIA 1U2GC 2W2KB 3AUUA 3ENZA 4EBBA 4YJ3A 4DPMA 2Y66A 3HJAA 3CPHA 4YGYA 2MR6A 3THOA 4RV4A 3R1IA 4Y3UA 3Q41A 3UH0A 4BKRA 3A70A 3U3XA 4F4CA 2O8VA 1YMVA 2C9DA 2TECE 3A6PC 1HYHA 3GJ4A 4GM4A 2HF2A 1EZZA 4ZDJA 4QZVA 1QG4A 4EY6A 1KYIA 5AOBA 4FLEA 5CMLA 2PGIA 4A8JA 1KYQA 5IJ9A 2PVPA 3C85A 2J0QA 3Q98A 4WLUA 5T64A 2D62A 5DLPA 1DBSA 2G9RA 3KL2A 3VKWA 2IYQA 4CWAA 1CRWG 3B38A 2FZ4A 1RI3A 5DIFA 5LM3A 3F4LA 4E3WA 4BFCA 4NOLA 2Q5QA 1QBGA 3GNLA 4EY5A 1K9SA 4XRGA 5DN6A 4M8LA 1SBIA 1I8TA 3M5CA 4Q7KA 2H1HA 4K9PA 3UJ3X 5KYXA 4KITB 3AEQA 3B7WA 4X24A 1T91A 1DC8A 2F9MA 4OU5A 4YS6A 2MIIA 4UCFA 1JHMA 5K0SA 4DR1B 1NF2A 4E94A 2C59A 2JARA 2DX7A 2QU8A 5CLJA 1I01A 1AMUA 4NK4A 2P5UA 3T15A 4OP2A 3ESQA 3AKYA 2WJYA 3ROKA 3ZD7A 4YI5A 1YH3A 4I55B 3K0KA 1FLAA 2AD1A 4HC4A 2YQZA 5KVAA 2Q3CA 2XLBA 4HMQA 1BROA 1EGMB 2VNKA 1JPVA 2GZ3A 1ISSA 1F51E 3DOCA 4S1NA 5AW2A 4WFIA 1VYTA 3LRPA 1Q0HA 4JASB 1NBWB 3BORA 2KB0A 3KYDA 5KTPA 2O2DA 1BW9B 2ZREA 4NIMA 1NRXA 2Z1MA 2QPTA 2R60A 4HAWA 3U7JA 4D8XA 3IP6A 3C41J 3DBLA 4P5EA 4AJNA 5DEOA 3MC1A 1Q1GA 3BSSA 3UGTA 4M54A 3NONA 2H1VA 1VPEA 2HWUA 3NTVA 1Q7RA 1OVMA 3TTTA 5H02A 1TVMA 3SEAA 3DEAA 1RWMA 4GMXA 1RCTE 2G88A 3RROA 3FI9A 1BN6A 3QEOA 4WOJA 5CDGA 1LQUA 4EKNB 1QQTA 1DJNA 2I6XA 5E7MA 4BPBA 4CTOA 3BJEA 5KPJA 3MERA 2WVGA 3UAZA 3MBKA 3OKPA 2IXEA 3U5ZB 3DTYA 2O57A 2AT1A 2NUTB 4R8LA 1E5LA 4DV5B 3AR4A 1DWQA 1K89A 1TRKA 2JA1A 4X1OA 1T3SA 1I2ZA 1NN5A 4S2EA 4FI3C 2C3MA 3NRCA 1ZSYA 2VH1A 1VBMA 3NKFA 5C8YB 3D6UA 3JQAA 1P4AA 3FCXA 4IQGA 3PNLA 1VKHA 5LB4A 4UNQA 2ZRAA 4ZDWA 4F72A 1V3UA 3VHXA 1ORIA 4KV7A 2ZBGA 1M73E 5ALWA 2VS1A 2Q5CA 3L8MA 4B3DA 3GGGA 2C7OA 1OA0A 4S24A 1OZFA 3G82C 1NVEA 5G1PA 5IK2A 1L7NA 1KVRA 4ZGWA 1I10A 3WWCA 4TYYA 1ESCA 1A4XA 1COWD 3LUKA 3OIYA 1PD1A 4L0DA 2A1UB 4QYIA 3EA5A 3VH3A 1P60A 5CLFA 5KNLA 3O1IC 5HMLA 3KKZA 1PLJA 2L42A 3CV3A 4KQEA 3DWEX 4U0JA 2Q5HA 3SVLA 1ZQ1A 3Q7QA 3QZUA 3R3HA 4JR0A 1OXMA 1RBYA 4PHFA 1TM3E 1SQFA 1P5JA 1VKRA 3WKBA 4CQLA 4FJ0A 2VJMA 3CZQA 4MUFA 3RUHA 3SSOA 1TKBA 3D6JA 1OT5A 3THYB 2DWOA 1ESNA 2P4EA 4Q6BA 1XKTA 3UK0A 4NULA 3EEYA 2P5YA 1DAHA 4HZUB 1VLVA 1QVRA 1O7JA 1KI8A 5A4JA 3K0FA 5ITSA 1GQRA 3OT1B 3EWAA 3WK5A 4XDHA 1MIOA 5KQRA 1PSWA 4BNDA 5D1HA 2RDMA 2CXTA 2WPDA 2N1BA 3DUWA 3ZHVA 2VAVA 2WV7A 2HADA 3ISJA 2X8AA 3OLCX 1G291 3ZY6A 1PJBA 2DECA 2CNWD 5DNAA 2PMFA 1UC9A 2NV6A 4UZEA 1EDZA 1RXUA 2DFDA 4X61A 3LC1O 3TBFA 4LDRA 2DFKB 1KK1A 4KV9A 4YCBA 1NAHA 3VTAA 3VJMA 1P2VA 4RLQA 1QRSA 4FVTA 2G1AA 4ZZIA 2ZIZA 5GOTA 3WO0A 4WN9B 2E5WA 1RJGA 3AINA 3CEMA 2JJQA 3O75A 3MLBA 2EBUA 1UKEA 5CIWA 2QQ5A 4D4JA 3C3PA 1R8SA 4FKBA 4MRVA 1R6UA 2BIFA 2C92A 2XY4A 3WK9A 1YJBA 2PUFA 1V1JA 2JJYA 1B0UA 5DASA 3H5TA 2XCSB 4WZAA 2DULA 2OEPA 3HBLA 2GEDA 2AG1A 1Y4UA 5CFOA 1UOPA 1XMPA 4LSZA 1J2JA 3JYPA 5L3QA 3VDNB 4JBYA 1N0VC 2NMVA 5CA0F 1R5BA 2VT2A 4B9AA 1TQHA 4D5GA 3G02A 4R41A 3S7ZA 2NO9A 4LS3A 3QFFA 2J7PD 3D0QA 1P2TA 1HEYA 3AFGA 3LX8A 4QOGA 4ETNA 4RF3A 5BWCA 1E2JA 1WB5A 3FOAA 2OV6A 4FMCF 2D5LA 2PJZA 3OOHA 5DTQA 5FL3A 4QOJA 1C9JA 3BK1A 4CCWA 3AJAA 5A3RA 3PR3A 4Q4LA 4PXYA 4RYLA 5HIJA 1GKIA 5DCLA 4DQ0A 3B2NA 4JJAA 3VZPA 4DKJA 3MSXA 2FEPA 3BTSA 4ZAWA 4EPWA 4HGPA 2E4YA 3GT4A 5EP3A 4IUDS 1DVRA 4GPAA 2PUTA 1EX6A 2HMAA 3VKVA 1ABFA 3TLJA 3U3KA 4LISA 3W8EA 5DGXA 3IV9A 5EIBD 5DTMA 2NSYA 4RTOA 4G0NA 5EL0A 1U90A 1UT8A 3G89A 4AY3A 3U31A 3W2IA 3E1SA 4ZOBA 4JGGA 4ZVKA 3AM1A 3Q5GA 1FK8A 1YDMA 4IQ8A 4ENUA 4IFTA 5HQ3A 5GTDA 1H2BA 2MHCA 5HK9A 4A82A 3FMPB 1KI6B 3E1GA 3WQHA 1U0EA 3GT3A 2C88A 3PUWA 1ADBA 1G18A 1G60A 2IDMA 2IYTA 2TMDA 4J0QA 3SGLA 4CNBA 4Z7JA 2PH7A 1APBA 1FFEA 4CEIA 3EGDB