1MAWA

Crystal structure of tryptophanyl-trna synthetase complexed with atp in an open conformation
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
326
structure length
326
Chain Sequence
b'MKTIFSGIQPSGVITIGNYIGALRQFVELQHEYNCYFCIVDQHAITVWQDPHELRQNIRRLAALYLAVGIDPTQATLFIQSEVPAHAQAAWMLQCIVYIGELERMTQFKEKSAGKEAVSAGLLTYPPLMAADILLYNTDIVPVGEDQKQHIELTRDLAERFNKRYGELFTIPEARIPKVGARIMSLVDPTKKMSKSDPNPKAYITLLDDAKTIEKKIKSAVTDSEGTIRYDKEAKPGISNLLNIYSTLSGQSIEELERQYEGKGYGVFKADLAQVVIETLRPIQERYHHWMESEELDRVLDEGAEKANRVASEMVRKMEQAMGLGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTOPHAN-TRNA LIGASE
publication title Interconversion of ATP binding and conformational free energies by tryptophanyl-tRNA synthetase: structures of ATP bound to open and closed, pre-transition-state conformations.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Ligase
total genus 114
structure length 326
sequence length 326
chains with identical sequence B, C, D, E, F
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2002-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 1mawA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1mawA01
3N8HA 3ZIUA 2A84A 3SP1A 5DK4A 5J5AA 3HFJA 1VBKA 4J75A 1I6LA 3K9WA 3TZEA 3IODA 1G8HA 1IH8A 4ZCPA 3MXTA 2A1TS 3JXEA 1J1ZA 4YMIA 3LOQA 5HUHA 4BWVA 2A7XA 4J76A 1EFPA 1EXDA 1N2IA 3UY4A 1N77A 3UOWA 5AHWA 1EUQA 4ZCSA 4XFDA 1LI5A 1QU2A 2A1TR 3AIIA 1QRUA 3NBAA 4EG3A 3HGMA 1KQNA 3X1MA 1ZJWA 5J59A 3D6UA 1F9AA 1UFVA 2QTMA 3H97A 1Q15A 3FY4A 1MAUA 4XSVA 4H3SA 1XJQA 3M5WA 3DO8A 2CV1A 3P0IA 1MB9A 2X0KA 4ZT6A 4ARCA 2PZ8A 2CSXA 5BNZA 1XNJA 2GOYA 1JMVA 1QRSA 1GPMA 1X8XA 4PBSA 2VXOA 3RBAA 1PG2A 1M83A 4ZT7A 1KR2A 2J4DA 1N2OA 2NSYA 3AL0C 4NDAA 3CLRD 1WKBA 4MW7A 4U63A 5H16A 4CDMA 3DLAA 3A2KA 3FI0A 4K0RA 2PG3A 1WXGA 1JEEA 1K4MA 4PBTA 5LFAA 3ZGZA 1XNHA 3FDXA 3QTTA 4ZT4A 2CYAA 1GZUA 1OWLA 1MOPA 1OBCA 3CVWA 3SZGA 1U7XA 1OWNA 1LI7A 3OP1A 3CLUD 4MW4A 4OJMX 3Q4GA 1ZUNA 1WXEA 4MW0A 1KORA 5K0SA 3FH0A 2R5WA 4L2IB 3UK2A 2Z09A 1KKUA 3ELBA 4QREA 4CDNA 4ND6A 2HGZA 1TEZA 1TYBE 2QUJA 2PZBA 1JIIA 2CYBA 3CVVA 2V0CA 3AFHA 4DDMA 2HMAA 1QJCA 1Q77A 3G5AA 1M8JA 4DLPA 1M8PA 1IVSA 1T6XA 4NAUA 1V47A 3FOCA 3CLSD 3IMEA 2VTBA 3IOBA 3ND6A 2JAXA 1VBNA 1T6YA 2YY5A 3OTWA 2CFOA 3TNJA 4CT0A 1FFYA 5J58A 1OWOA 2B7LA 1PFVA 2IJGX 2A4MA 1BS2A 1J09A 3H05A 4NATA 4EG1A 1O0BA 2BTEA 1NUSA 3IVGA 4KR9A 3KT6A 2QJFA 3HMQA 3IMGA 2D54A 1F4LA 4EFKA 3NBKA 5IHXA 1U0BB 4DDHA 1ZH0A 2IELA 3IUEA 4MWCA 4ZT2A 1N78A 3DV2A 2WQ7A 1J70A 2D5BA 1O94D 1V8FA 5DEOA 4DDKA 1H3NA 3ND5A 4NZPA 3RJZA 1KH1A 4MUEA 1OD6A 3P52A 1O5TA 1GTSA 1O96B 3IVCA 4PBRA 3ZJUA 3K32A 4GRIA 2Z08A 4OUDB 1M1ZA 1F7VA 1YUNA 4KKVA 1TFUA 1P7PA 3CLRC 3Q12A 1QQTA 2H29A 1KP3A 2DPLA 4MVWA 4U7JA 1XNGA 4K03A 2AZXA 3FG9A 4PY2A 3VRHA 1HYBA 3GUZA 1F7UA 1PG0A 4S1OA 3I05A 1COZA 4ZCRA 1MB2A 3KT0A 1N75A 3GMIA 1OWMA 3UMVA 3CLUC 3MMXA 1IQ0A 1R6XA 2D13A 1JZQA 3ZUGA 4MUKA 1N3LA 1EFVA 1WOYA 1NUQA 1O6BA 4WNYA 2DR2A 3MUEA 4ZT5A 2A1UB 2ZUEA 1JEDA 1WQ4A 3IMCA 4WSOA 4R2MA 1WZ2A 3C8ZA 2IP1A 4JXXA 3PNBA 5DB4A 4EG4A 3FETA 1K4KA 2A88A 4MW6A 3A04A 1N1DA 3CLSC 2RD2A 4MUGA 4MWDA 1T6ZA 4MWEA 1G8GA 2V0GA 2PZAA 4KR7A 5EKDA 4MW9A 4YP7A 1JECA 1O95D 1NUPA 4ND7A 1T9GS 4MLPA 5FO1A 2X1LA 2DLCX 4HK4A 1PFWA 1EE1A 3SDBA 2PFSA 3SEZA 5FO0A 1GLNA 1WXHA 2PXHA 1NURA 1Y42X 4MW1A 3L92A 3G6KA 3TQIA 4A91A 1CT9A 3COYA 3ISJA 1T9GR 4MULA 4YP6A 1GTRA 3N9IA 1EFPB 5HUJA 1H1TA 4KPUA 3F3MA 3KT3A 2DXIA 1IFXA 1O94C 2CT8A 4JXZA 4U8HA 3MLAA 3AKZA 4QBTA 2WB2A 3RK0A 4G5YA 3TQOA 3H9CA 4P2BA 5TS2A 1VLHA 3IOEA 3COWA 1YI8A 1EUYA 3UC5A 4AQ7A 1JZSA 1N2JA 3HV0A 1IQUA 1S4MA 3FIUA 3TS1A 2C5SA 1G59A 2XRYA 2RE8A 4EF6A 4UZEA 4ZCTA 3RFFA 2EJCA 2WSIA 4AS1A 3Q10A 1D2RA 2E18A 1NUUA 1JGTA 1JHDA 5FNZA 1OWPA 3GLVA 3SYTA 3VGJA 1VBMA 4HJXA 2E89A 1YIAA 5LLTA 4JFAA 3COZA 4MUJA 2QUHA 1KH3A 1DNPA 1MJHA 1WXIA 1NI5A 1EJ2A 1O97D 2YWCA 2J08A 1O0CA 4ZT3A 4EGAA 2A86A 1B6TA 1JILA 4Q16A 3L93A 4MUIA 5TGTA 4JZYA 1N2BA 4MVXA 1ILEA 3IDFA 2DERA 4G5FA 3P0HA 2DUMA 3AG5A 3KFLA 5HG0A 2OV4A 1I6MA 1IRXA 1GN8A 3E27A 2BYTA 3BL5A 1H3FA 3VU8A 3ILVA 4NAHA 4MWBA 1I6KA 2Z3VA 4RPIA 3X1JA 2GM3A 3PNVA 4CQNA 4JYZA 1U3DA 3ZJVA 1O95C 4I6JA 2TS1A 2JANA 2X3FA 2QJOA 4MUNA 1MRZA 3IH5A 1KAQA 4KR6A 4I6GA 3IUBA 2VTBB 3U1VA 4Q93A 5KHAA 4NX2A 3PXUA 4MVCA 2E0IA 3FWKA 3CVUA 4F4HA 3CR8A 3LCJA 1NP7A 1WXFA 1M8KA 1WQ3A 1MBZA 2CV2A 1K97A 3H9BA 4MAFA 4L2IA 1H3EA 2O8VA 2J09A 3PRHA 1LW7A 1ZH6A 3SZ3A 1WY5A 1N2HA 1GAXA 1KAMA 1J20A 3SEQA 5F23A 1A8HA 3A05A 5TEVA 4QRDA 1JIKA 3CLTD 3QE4A 1G8FA 1N2EA 2E21A 1TQ8A 5IJXA 2G36A 4YBRA 3AG6A 1YIDA 4EG7A 3IVXA 1R6TA 4ZCQA 5H7XA 1YULA 2O5RA 1TYDE 1U3CA 3LE8A 1OBHA 1Q19A 3D6VA 1WJGA 4HPWA 1J21A 4TS1A 3KT8A 4MW2A 2QTNA 3N05A 4R0NA 2WQ6A 2DEUA 4MVYA 1NYLA 1QTQA 2AG6A 1O97C 4YP5A 5KCMA 3ZXSA 3N2YA 1X6VA 4EG8A 2CYCA 3G59A 1IQRA 2YXNA 3TZLA 3IOCA 2HZ7A 2AKEA 1QRTA 2GKSA 1R6UA 3FNRA 4MW5A 5JBNA 2EL7A 3RHSA 1J1UA 4FZJA 1O96A 1EFVB 1RQGA 3P0JA 3QTBA 4R2LA 4OUDA 4UZFA 1NSYA 4G6ZA 1TYAE 3RK1A 4E1AA 5DASA 1IHOA 4XFJA 4HJRA 3ZXIA 1KQOA 2QUIA 4EG5A 3INNA 1N2GA 4GU5A 1NZJA 1JIJA 4DJAA 4MUHA 5K0TA 5TEWA 2ZUFA 2YWBA 2XRZA 3FHJA 4I6EA 3A4IA 4RUKA 1FYDA 1NUTA 2QTRA 1M8FA 1Q11A 1VL2A 1U7DA 5LM3A 3CVXA 1KQPA 2CUZA 2PIDA 2DETA 3HZRA 2JA2A 3PNYA 4MQ6A 1MAWA 1MC1A 1KH2A 2I1LA 2A1UA 3CA8A 1PFUA 1I2DA 3MLBA 4X0EA 1QNFA 2OQ2A 3S3TA 3ZJTA 1ULHA 1PFYA 5KWVA 2CV0A 2H2AA 4KPUB 2J07A 1TYCA 1KP2A 2J5BA 4F3RA 4DE5A 3H99A 3COVA 3CVYA 1SURA 3CLTC 2QUKA 1YUMA 1K92A 3HL4A 3NV7A 3X1KA 1QU3A 2NZ2A 4EG6A 4DNXA 3DPIA 4ARIA 2QJTA 2X1MA 2ZP1A 4MUFA 1M8GA 3ND7A
chains in the Genus database with same CATH superfamily
2J5QA 4KAAA 4CG0A 1DV2A 3JQDA 5EHXA 2UUPA 1E5QA 3IE2A 4UHCA 1UQTA 2F3TA 2J85A 4EMSA 3T1TA 2YVUA 2RHRA 1S3SA 2Q21A 3HFJA 1H8HD 1V37A 1WAMA 3Q1LA 1AQLA 1IH8A 1O4WA 4F86A 3EN0A 4NYMR 1RLMA 4PTLA 6Q21A 3LPAA 1UK6A 3VYRB 4EF4A 1SQ6A 2X4IA 2WZDA 3PXDA 4IDHA 4MCAA 4RD6A 4WVFA 5DT2A 1EFPA 4YT4A 3Q15C 2NVWA 3ZY6A 1N77A 4K46A 1WW2A 5K3BA 1YGYA 2HU5A 5J2TB 3FYSA 2LXNA 2QENA 3FSGA 5B4TA 3RJ9A 3RAPR 2YXLA 4KV9A 1A5BB 3RG2A 3A1EA 3TRJA 3UT5A 1H2FA 5BSFA 3E82A 1SCIA 4IICA 1KK3A 1P5HA 3TLAA 4A0SA 5PNTA 5C5CA 2PPLA 4BZQA 2CL7X 3T5BA 3AL2A 2H06A 5ESXA 2J0UB 3OWXA 2P2YA 5ALWA 4ARCA 4EATA 1MC5A 4BO5A 3OQ6A 4BN5A 3OFNA 3JSAA 3GEHA 4EAQA 4KQ1A 1ZJYA 4DR6B 1KSFX 3AIMA 3Q3IA 2X7XA 4K9KA 3K2QA 3RSOA 3EMVA 2ORED 1SHTX 3ID6C 2A5DA 2Z1DA 5SV2A 4H08A 5D2CA 2EXXA 2Y0BA 2E82A 4C89A 1P73A 3LHFA 4DPMA 3IBSA 1IRIA 3VVLA 1F0YA 1KAGA 2BUCA 2VC2B 2RH5A 3AL0C 2DHEA 2NU9B 2WHXA 2BW0A 1XLWA 3O6VA 2C3PA 2FWRA 4PZUA 2IX9A 1I2AA 2X6RA 4TXMA 1CS0B 2DQSA 5TMEA 3RABA 1NVTA 5DGXA 2GZ1A 3NRJA 1XTQA 2CHGA 4R84A 5GY7A 5ULLA 1AN0A 2OFPA 5DH9A 5HJ5A 1XO1A 3KU4A 3VO2A 1DWOA 1R1DA 2DKOA 2WTAA 5E2IA 3DV0A 4C6TA 3B70A 7ABPA 3PUKA 4CLRB 2C82A 4R54A 3SJUA 1AO0A 1Z83A 3BBLA 4LZNA 2UUBB 1JDBC 1OLUB 3DE6X 1NF3A 4ICIA 1UPUA 5JTUA 2QWXA 2OESA 1EG7A 3LT2A 1NV8A 1ATIA 3ZDZB 1US8B 3E8XA 4XEHA 1JIXA 1O87A 1ZGAA 2FQXA 5ER6A 3X0DA 1QHFA 4ABYA 10MHA 1CQXA 4FHZA 5JCJA 3UUEA 2Q5IA 3NUQA 1HZJA 1LUAA 4RHYA 3PIDA 1VA4A 4IIFA 2YX1A 4RA9A 1M6HA 3SI7A 4AXXA 2HGZA 4ESEA 4QZVA 5CLJA 5ALUA 1NQWA 1LDYA 3OPVA 2HTEA 2QSYA 1WUHS 3IULA 2PU5A 3ROMA 3ENWA 3A2MA 3TG8A 1RAFA 1VG0B 4NBRA 3COJA 3LQ4A 3FOCA 2I2DA 2GJ9A 2O2IA 2VJYA 3D6JA 4O33A 4BNDA 2VTBA 3OX2A 5F77A 1C9JA 1G9TA 1HFJA 1U98A 2JFVA 3QXGA 2XCRB 3I9MA 2W37A 2WSYB 1MXHA 1NXTA 2QDKA 4Q01A 4OTZA 1LS1A 5H68A 1ZUIA 1UXKA 3MMPA 2SKEA 2L69A 3BWXA 1FDIA 1Q7GA 1BS9A 2VJNA 3F8WA 4P7FA 2FMHA 4RY9A 2JFZA 2ZUCA 4KR9A 3V8PA 3AK4A 4JUIA 1QF7A 3S8EA 1GPDG 3FE2A 2NSDA 2GCNA 5JZOA 2ZXUA 3C3YA 3M9WA 5C18A 3ZTTA 4BQOA 1DEXA 3DDZX 5H82A 4NOKA 1ZXBA 3WNCA 3EE6A 1VJ0A 1M2GA 1WPXA 2GS9A 2GAIA 5DNEA 5EIFA 3AVVA 4TM8A 1JXQA 1ISIA 1N78A 1L5YA 1RZVA 4LHWA 4WHMA 5JEDA 4JXJA 2DCMA 2WABA 3OICA 1KH1A 5EJMA 4TN1A 1RC0A 1P1JA 1M6EX 2R8PA 4QE3A 4CTKA 4Q66C 1A88A 2JGFA 3HJUA 1EXVA 1MEOA 3VHQA 4C3VA 3EBLA 4X1YB 4X71A 5KDLA 3QWIA 3DKRA 5CNKA 4PRYA 5LMUB 4GSKA 4F85A 1RU3A 5M04A 1A7UA 1J06A 1HO3A 1V5EA 1LFDB 4GMHA 4L8GA 3WRYC 4BBZA 3N2KA 4ALIA 3AEUB 3OMLA 2FX5A 4HLUA 1D1PA 3D7SA 2CF6A 2XSZD 3IQHX 1I30A 1H93A 4X64B 3VAAA 3IGFA 4KUEA 4E7OA 2OLKA 3L06A 5F35A 2P2LA 2AZ4A 5D1HA 2BOVA 1COZA 1SCDA 4I5EA 4M9SA 2XXBA 4PZPA 1QZTA 4TXJA 1B6RA 1F8UA 2DBQA 3BM5A 3QOXA 3A3OA 5DBIA 3KZNA 1M72A 2HEGA 3B6JA 3MWDB 4TTJA 1GN9A 1M2WA 1PFGA 3V4VB 2F43A 1IQ0A 1DJLA 2YUTA 2FQ1A 1Z3CA 1ML3A 1NUQA 2VWHA 1XQWA 1NMZA 1W1WA 2NV6A 3CTMA 3GUVA 1A7AA 3DHEA 5F1YA 4QAQA 2IXEA 4Q39A 4D6PA 3A6GA 1NLMA 1S5PA 2CNWA 3JARA 3WXMA 1IUKA 4C4YA 1GADO 2H57A 2NXJA 4JHXA 1SKAA 3T06B 3WLJA 4UC0A 3A2NA 2C7BA 3GYGA 1I4DD 1DUIA 1C3LA 4V0QA 5FHQA 2FWIA 1H2EA 3BE8A 4HNSA 2H7VA 2IP1A 1K9VF 4UNQA 1PKEA 3UQYS 4BY9E 1MZPA 3FTQA 1RWQA 3LP6A 2QTAA 4FOTA 4RKEA 3PLAE 4AY6A 4OGWA 2WD8A 3GVHA 1Z75A 2AXPA 2D62A 3D8SA 4MNTA 4GT1A 3TMKA 4RGYA 2H9YA 4DM3A 3VR2D 3RTBA 1UC4B 3LZCA 2V0GA 3E0XA 1D2GA 1J8VA 1P33A 2I1WA 1JEYA 5IAEA 3IBGA 3H1EA 4QVKA 2AOUA 4CDGA 3KQLA 2R2GA 1TRKA 1XI2A 4Q7LA 1MDFA 3MVEA 5C2JB 5C46F 2G5TA 5KJFA 1T2EA 1GPKA 2WJZB 3O8OA 3L77A 2ERYA 1QV9A 4LV5B 1SB8A 2QX8A 1F2TA 4B3TB 1IEVA 3CISA 2X8BA 5AM2A 3RH0A 3FD8A 3REQA 1S89A 1QSGA 2QLFA 3G3EA 3QU7A 1KSHA 4JB0A 3CPJB 4ESVA 4P3OA 3HB9A 1PR9A 2ZXFA 3ISJA 3LUAA 1T9GR 1W9MA 5T8KC 2I6SA 3N9IA 4D0GA 2YWDA 1DC4A 3VSEA 2IUEA 3S2ZA 4H1WA 4EQZA 4HNUA 5CFZA 4HXYA 3IP5A 3OJEA 1XMIA 4YAEA 2HT1A 2RI1A 4FSHA 1IZ7A 2N9UA 2PA3A 3RIXA 1EFLA 4KW7A 4GP9A 2RI0A 4ZOLB 1A9RA 4QOIA 2WM3A 5IVDA 2ZR9A 4B3SB 3C3WA 2OP1A 2I76A 1F38A 1P31A 2WPNA 4B6FA 1MGPA 1RJDA 2R68A 4YYZA 1EP2B 4ZANA 2IDZA 1EUDA 1EUYA 2ONKA 2G8LA 2AI2A 2EJBA 2I2AA 3LT5A 1J9EA 1EZZA 1G60A 1JZSA 1JBKA 1Y3HA 3SE0A 6LDHA 1AK9A 1QWSA 3KOWA 4GBGA 1NDQA 2C1XA 4FPXA 4BN0A 3HJFA 3I3OA 1E4YA 1QCYA 5FPQA 2O0LA 3OCUA 1Z68A 4EYKA 4QXAA 3LKVA 3DE3X 4D3YA 3E5MA 1MX1A 1L7QA 2E18A 2ZW9A 4RACA 1CYDA 3B13B 1H2ZA 3N2ZB 3GZNB 2CFIA 5E4FA 1XT6A 1VGVA 3FFTA 3NUZA 3QY0A 5HMLA 4EQ6B 3SYTA 5LWHA 2VHJA 4LRWA 3RROA 1ZITA 1XXHB 4XXHA 5IUJC 1BROA 3H13A 4EO4A 2PL3A 3U6BA 4Q05A 4P0TA 2VQ3A 5HF6A 3IO5A 4WBXC 2BMEA 4M60A 3W04A 1U80A 1Z5PA 3VH3A 2FUG6 4D74A 2V6MA 5M2QA 1OT3A 3RC1A 3FOEC 4UUOA 3WK7A 1X7XB 3GT4A 2DFVA 1HTBA 4JI3B 3VH2A 1X77A 4ZC1A 1N4DA 3EGEA 2RH9B 1SC4A 1SO8A 1QM5A 4G09A 3DYVA 3UUWA 2A86A 1NXOA 2JHCA 1PTJA 2ZB7A 4I14A 5IDYA 3RRMA 3ZK7A 4IMPA 1PYDA 2DUMA 4HAWA 2HYDA 2ZT8A 3DTVB 1P5ZB 1GN8A 4PX2A 4UNIA 4X41A 4CIYA 3M34A 1E59A 6AT1A 1I7SB 2HNKA 1AE1A 8MHTA 2EX0A 5KSOA 1XEFA 5AOBA 4EP1A 3ODPA 3QWAA 4PN3A 2OZEA 3B5JA 3BMNA 1W76A 1O0SA 1FA9A 3GNSA 1IG3A 3PNVA 5BRAA 5JS7A 4QFBA 3IAUA 1E8NA 4V1CA 2PH7A 5HCNA 2JIDA 3AGPA 1NIPA 3CURA 3TECE 3W4KA 1FSGA 1E99A 5MGNA 2C8KA 2XVZA 2ZRPA 1NR1A 3NT2A 5LQDA 2GBIA 1D4ZA 4LOKA 1SHKA 2RAPA 4OLFA 4RZXA 5DX0A 2LTAA 4D3DA 5JVDA 5EEHA 1A77A 2JI8A 2R6FA 5A5EA 4Z1MA 3H2JA 4LTMA 1H69A 4FGSA 4I5GA 1QO0D 1R4MB 2JS7A 3U4AA 4ARZB 4ETIA 1Z4IA 1IBKB 1JG1A 5HJ7A 1YFLA 4ZREA 4RV9A 1TAUA 3AZOA 4LZZA 4F6LA 3PQCA 3PWZA 5EI5A 4JCOA 3FCYA 1QJ4A 4KPYA 1E4OA 4IXNA 1ESCA 3JYHA 4BAGA 2V3CC 3RWBA 1XVLA 1CKEA 4DR4B 1JBQA 2WKPA 2W7TA 3RVDA 5I5GA 4CG3A 3AQ4A 3IPCA 1BOFA 2QMUA 4NG4A 1L1QA 2G4LA 2D06A 4N9WA 3RM3A 2GFIA 3UVEA 2PZJA 2E5FA 2GBLC 1KYWA 7MDHA 1N0HA 1IUPA 1UZUA 3I5XA 4WLOA 4YY3B 2L18A 4U3JB 4WJZA 3SJ7A 4ZOEA 3WQSB 3C6ZA 1S2LA 4D3XA 3IAXA 4DZZA 5B7PA 1HE2A 1RZRA 4RIHA 4ENPA 1NN0A 3CLTD 5KQLA 5AKHA 3F5QA 1ZJ6A 4RZHA 4TTIA 1N2EA 5DHTA 1HOTA 1JHXA 3RC9A 3IEVA 2FPGB 2JJ2A 3BHJA 2AFVA 2DBZA 3QPAA 3USES 3OUZA 1N36B 2V7QD 3AG6A 1RI4A 2W9XA 3DC2A 2DTDA 2H1FA 2JLAA 1POWA 1R0ZA 3C1UA 4G0PA 4M7OA 4X45A 2OYRA 1EFCA 2NAPA 3AHFA 4N5NA 2FZEA 3MW8A 4QHTA 4DFDA 2R6CA 1JLHA 1G3IA 2WF5A 4P4SB 3EZ6A 3ZCVA 5ICSA 2BFAA 2QNBA 4V0LA 3CC8A 3P19A 2X15A 2PX4A 4RD4A 4G5RA 2PQ0A 4M6WA 1E8DA 3E9QA 5CTJA 5DGHA 2QAGC 1V6AA 2DJ5A 4DKXA 5DGIA 3MHPA 1JVBA 5JLJA 2BEKA 3CLKA 2HLDD 1X6VA 4P5EA 5K4GA 5IYZA 1QTIA 1MIOB 4RFSA 3WGNA 1F1JA 4F06A 2VZ8A 3ZI0A 4A5SA 5A7HA 1N8TA 1QIFA 1QRTA 1VKZA 4ZO7A 4ACAA 1K0UA 2XY4A 3LLUA 4B84A 4D8YA 2G67A 2QI9F 3TOSA 2EL7A 3EGXB 1BVRA 4CCSA 4EWLA 5HQ3B 4LRXA 4JL6A 4KG7A 4YT5A 1ISPA 5IC5A 4F12A 4FMCF 4D5GA 1OZGA 2H1WA 1NBWB 3EDQA 2JHAA 4ZOBA 2WYHA 1Z6XA 4RNCA 2RK3A 3FYTA 5DASA 1JDZA 2KBFA 4IXMA 5ED0A 5B3JC 1NN5A 2NZJA 4CMHA 2GASA 2JASA 3GDFA 3V8QA 1NKSA 2XUHA 3PYMA 1EWQA 4DKJA 1FP2A 3RIMA 4DYHA 3MFYA 4DAOA 4DSUA 1U2ZA 5K0TA 1WXXA 1I2CA 3WZLA 2CE2X 4L1KA 3FHJA 1BYUA 2I9PA 1XF1A 3RHFA 3WNDA 3FLMA 3A27A 3QG5A 3ER8A 3HXTA 3DGFC 2PX0A 3AKCA 4JEUA 1Q11A 4X00A 2GCEA 2AIRA 3CT6A 4CEIB 1WULS 1PJAA 2WEKA 3JQRA 1MCZA 1L9KA 3BD7A 2ZI6A 2WV7A 3F6CA 1GGNA 4PPYA 5I5EA 1X1QA 2GK6A 2QMOA 1MO2A 1A8QA 3L6DA 3PXCX 1MC1A 1MJFA 2P79A 1KEPA 2CUTA 1K7XB 1QNFA 1R9NA 2VPZA 3VU1A 3K0CC 2XA2A 1KKMA 5C80A 4NKRA 5EA2A 2NUTB 1FMFA 3R74A 2W0MA 2W43A 2CLDX 3PGKA 4UNRA 1AZSC 1KP2A 3NASA 2QQ5A 1HSOA 5C32A 1U9ZA 3CVYA 3N2NA 2K5UA 1K9SA 3DBRB 3JR3A 1DFIA 2VYND 4W5JA 4EAAA 3K0HA 2FG6C 3KKMA 2GEBA 4KO1S 1XZ8A 1QNLA 1XTVA 4PC6A 2QEQA 4P0QB 2P2ZA 4B73A 4DNXA 1JR2A 4F5WA 2CWDA 7ADHA 5L40A 3AVTA 5EKTA 1Y1KE 1JPVA 1M7BA 3TSZA 1WCIB 4N3NA 4JT9A 1CQPA 2OBNA 1YHYA 2I6FA 1W4CA 3ROZA 2RJOA 4KIUA 3OX3A 3A58B 4EYEA 3HK2A 4KRXA 4DUYB 4E5MA 3B3FA 4EHAA 2PYDA 1RLOA 1ATZA 4BMPB 3JVIA 1RXYA 2P6PA 4NU6A 1TNDA 5LYYA 5HRUA 3H1PA 4G5GA 4F93B 4L76A 1JHPA 2A1TS 1J1ZA 4ILEA 1UBRS 4UXHA 1U0LA 4EI7A 1T2AA 1XVIA 4C7BA 5FUYA 1VE7A 3I9KA 1EXDA 5AW8A 3O84A 4AC9A 3O8RA 5IT4A 5EMNA 3U44A 1TTPB 5FA8A 3K6SA 3BXFA 1DOAA 2FEMA 3OIWA 3RVPA 3ZQUA 3GXBA 4F56A 5AW1A 2YTZA 2Z5VA 3OPMA 1R37A 4QA9A 4XFDA 1JA9A 3KSZO 3VDQA 2QPLA 4BMXA 3UT6A 1CIJA 4BQPA 1I80A 2ANBA 2PAFA 5TDHA 1KQNA 4EUFA 1GSHA 4HQNA 4BWFB 4M83A 3U9SA 4H6WA 3AM5A 1CZRA 4LWPA 1HI9A 1KYYA 4C01A 4Y6OA 3A3PA 3FUXA 5HHTA 2IV3A 3AF3A 1ZUWA 2AX3A 5BT9A 3K9QO 1NW6A 3GLKA 2EP5A 3DO8A 2CV1A 3P0IA 3F74A 3NOQA 3LPMA 2CLEB 4NMXB 1CS4C 1FDUA 3ZS9A 2GRUA 5BNZA 3LV8A 2R7AA 1TLTA 4YGXB 3EZGA 3ETHA 5JZVA 3T6KA 4FE4A 1E5XA 2J1LA 2YUIA 3TLXA 2VXOA 1YBVA 4PHGA 5DRTA 4A2QA 3GVCA 4IQ0A 1M83A 3HN2A 5C4MA 1YB1A 1RAAA 1JNXX 1G5TA 2C4VA 1C7RA 3UCXA 3UJHA 3K0FA 1P1FA 2VBIA 3G1UA 5A05A 5CAEA 1OXTA 1UL1X 1N5RA 5FFNA 4Y30A 4YJFA 1Z63A 1VHDA 2JCBA 3ESZA 3DLAA 1W4LA 1EFUA 1K6XA 1UKVY 2WT8A 2J6IA 3DCIA 3MXOA 3LCRA 3Q9UA 4TLDA 4PHTA 3ZKAA 4D9MA 5C8XA 2G6TA 3V80A 3FDXA 3RYHB 3W3AH 2I8AA 2J4CA 1OBCA 1QVRA 1X70A 1Y63A 2JIBA 2O2XA 4WKGA 3ZDYB 1HMYA 1UCFA 2UZ4A 2CL0X 4L75A 3D4NA 3TIGA 2UKDA 1DCTA 4P0PB 3P27A 4MV6A 1QORA 3EOBI 4X92A 1VE6A 5D85A 4J0DA 4I4CA 3VZSA 4ZYZA 5FPTA 1MX9A 5H4HA 1W1IA 4K6GA 1T9BA 2X6QA 1N7JA 3C6YA 3FB1A 1P9WA 2ZYIA 1KI4A 4TSKA 5B7NA 1QR6A 1IN4A 4XDHA 3OF3A 1L5HA 3WRVA 3ZKWA 3AXSA 1SXJD 1HLPA 3WTCA 4BJHB 2ZRAA 4DBLE 2GJ8A 1XCJA 3IBTA 2V0CA 2QN1A 4JB2A 2IZ1A 3TSOA 2I1VB 3G5AA 1FY2A 4ZU6X 1DBWA 4MS4A 2PUJA 2QS9A 3PEFA 4BX2A 2VUUA 1J97A 2IYUA 1MO5A 2AWOA 2X7JA 3GRVA 4HDRA 4AJLA 3GFVA 1U7HA 4NBUA 4XYLA 3U49A 2ZKIA 3CO5A 1THGA 2YICA 3CT4A 3MINA 3MTIA 3KEGA 4X85A 4XM2A 3T9DA 4DLYA 3OCWA 5BSVA 5ADWA 2C7GA 3S2IA 3RT1A 3KUXA 5KUTA 5KYWB 3X1DA 5C34B 2VJAA 2A4MA 4NATA 4QPNA 4BKUA 3E9CA 4FZRA 1C50A 2J31A 1IMJA 5KJ6A 2NW6A 4XUCA 1C80A 1U5CA 4KBGA 4V3CA 3N2IA 3EASA 3NJ8A 1F06A 2HU8A 2RGEA 3O4JA 2OC4A 4DXDA 2E4YA 3ER9A 1CUAA 4Q18A 1V2GA 3DZJA 4PYOA 2BM1A 2VRCD 3D8RA 3SX4A 2WWTA 4AG5A 1ZZEA 1I4TD 2ZRFA 4CT4B 5DCWA 4MCJA 3WQBA 5KTKA 2HT6A 2LD4A 1ADCA 5DEOA 3TTYA 2OYCA 2EX1A 2R65A 4K6HA 4IYJA 4CUJA 4GZMA 2RAVA 2IHBA 5IBPA 3A7DA 1NBME 3IC5A 1F2VA 1T9KA 3QP9A 3K9BA 4XASA 3T5TA 2KS6A 1QK3A 3JASA 2Q1WA 1ZEMA 4KQ2A 1J7KA 2IKSA 1YJAA 2H63A 2F1OA 2XQJA 3IVCA 1KYXA 4K9LA 5K6AC 5KWJA 1TGVA 2O6LA 3L6EA 2X2PA 2Y1KA 1Q7RA 6CHYA 1WMDA 3SFTA 3NVDA 1I4LD 3JVVA 3A11A 5DNVA 4PR0A 3KUUA 5C1BA 3IUPA 1IN1A 3EPPA 2CBGA 2OO7A 3I28A 4F8JA 4HDMB 8ADHA 2HPZA 3ZVLA 3GU3A 3WOHA 1HYBA 1LW6E 2YHIA 1Y1PA 2J3LA 1LTHR 1T8TA 3ADOA 1JRLA 4REOA 4BE7B 1XU7A 4NNOA 5A5FA 4W5HA 1Y4DE 1Z4QA 2PSEA 2FMXA 4C2BA 1MJGM 1U7ZA 3LP8A 4O2BF 4BLUA 1RRFA 3ZIAA 4ETMA 1V3UA 3KT0A 3HLTA 1KJ8A 2BFCB 4ILKA 4MLCA 5HVNA 1B8PA 3QX7A 4G4JA 1RRMA 1NOJA 1M34A 3NHFA 4GM4A 1PJ4A 1Y1RA 3H5AA 4K9RA 3N8GA 3UKDA 3W2GA 1GTL1 1A8UA 2P9EA 2XNHA 2Z6VA 4C76A 2FTKE 4UBKA 1DL5A 3QPDA 4DQLA 3DAHA 3GEPA 1ESZA 3OZVA 4RF3A 4ZFNA 4WNYA 2GLXA 4GEKA 5KNBA 1E6MA 3OLYA 4XUEA 1KJQA 2IDMA 2ZSJA 5PGMA 2A1UB 1H0RA 3PD7A 5EXPA 3SX2A 3FUCA 4K8RB 3BTVA 3FCEA 3KXLA 5JIBA 4OI2A 4R2MA 1OKKA 2NXEA 4K2AA 4YJGA 4JI1B 1HT0A 5AW6A 3E3AA 4ML3A 1R15A 5DM0A 4NFHA 4EJMA 1AMNA 1KFJB 4PIMA 3CEAA 3IDAA 1JH8A 3IV6A 1N7IA 3DQZA 4FFBB 1E3MA 2Q3JA 5KX5F 2IIPA 3TYXA 4IJWA 1XTUA 4RKQA 1TPZA 4L4SA 3TQSA 2CC2A 2Q0HA 4J90A 4H0NA 2XW6A 3G5UA 3OFKA 3AERA 1G8GA 4MWEA 5DHPA 5I7AA 1GYRA 1IONA 1BOOA 3VXKA 3OPYA 5IWCA 2FJPA 2PGAA 2XAUA 1EU1A 4RZUA 4ZEWA 4MI3A 2WZQA 2NSJA 3QGMA 1GZDA 3R6LA 3TLGB 1LBHA 1HSZA 4DCNA 4B7XA 3E3MA 4HMQA 2ZUWA 1C7FA 4A8PA 2J9FA 5JRJA 1CB0A 3OI7A 4JP5A 4S1NA 5DSXA 3RIEA 5K3OA 2PFSA 4Y2JA 4OYYA 2R1UA 4C87A 2O52A 1GLNA 4QDUA 3CG0A 4RETA 3C8MA 5F64A 3UK2A 1W46A 4MRMA 1GD1O 3QBVA 3G6KA 2BE9A 4MPRA 4EEKA 3QH4A 3ZBUA 2POCA 4FGKA 1MGOA 1OGYA 1U28C 1Z4NA 4Y1RB 4PZCA 1WL8A 1Q3KA 4P82A 4K6KA 2UZ0A 4IUCS 3TQFA 2VK4A 2IOFA 1KZYC 4C78A 4EIWA 4F6RA 4RTJA 1WSWA 4IH1A 3L7NA 4EB6B 2WB2A 5BNWA 1J90A 1PYOA 3G1TA 4DT1B 3K70B 5IJZA 5JH7A 1PEAA 3B1ZA 1G21E 1TIKA 3PFWO 1RNLA 1ICIA 2B7BA 2EKZA 1VJ1A 2M6RA 3CCBA 3O21A 4FMCB 4GLOA 4M9CA 2WIFA 4OGFA 4XQEA 3ZDDA 1Q84A 3QJ5A 3T52A 3QFFA 1JR4A 1N2JA 5KNDA 4L8YA 4Y18A 4ZTUB 3IP6A 4KBYA 1CR2A 3KV1A 3U62A 5EJ2A 1VKRA 3S27A 2RE8A 2DFPA 2HHLA 2O2DA 2C88A 2FLWA 1MIHA 1UBHS 1VIAA 2FPPB 3QNUA 2O8FA 1Q0ZA 2YZMA 3OCZA 4HBZA 4WNAA 2OK8A 3OLVA 4R81A 2Q2OA 1CUGA 5BW5A 1NUUA 1W5TA 2KLHA 2AMYA 2OB2A 3EFOA 3TM4A 1BH6A 3V4PB 4ZYTA 1MAAA 1UOEA 2IEBA 2Y77A 4Z9AA 1D7AA 4L0MA 4L6IA 1KK2A 2EDAA 2IITA 3IAM6 4LYYA 3TW8A 3JRNA 4U00A 5IKMA 1CEEA 3UNXA 4DV2B 3PK0A 4RMGA 5JD6A 3F49S 4FJ2A 2C98A 1J0BA 3R24A 4JQZA 4P3KA 5FUBA 5HE8A 4CM1A 3F2VA 4ZO6A 1D5WA 1UMKA 1Y6JA 2P30A 1J25A 1VHTA 2X5JO 3LKDA 3MTGA 3E3LA 4U3JA 5U4XA 4IDQA 4WINA 1O97D 4ZQFA 1CUSA 3HVKA 5K09A 3FOWA 3H6KA 5TARA 3AV0B 1TA0A 3VPGA 1KMHA 2OBMA 4TS9A 3LQ1A 4K7JA 1RKUA 2Q2NA 3PE6A 4YCBA 3TLCA 2KSQA 2AC4A 1EWKA 2WOJA 1DCMA 1E9FA 3KZMA 3NFRA 2AG8A 4NE9A 4F96A 3KUCA 5IARA 1VRCA 2Q3FA 4GR4A 1A8PA 3PVCA 1DG9A 2ZWMA 1U1DA 2UVQA 3E27A 2ZUTA 3CLVA 2DYKA 1NRWA 1UEIA 1H8HA 3EG9B 2O5VA 2SBTA 1CDEA 4LX8A 4XJVA 2JCGA 2VT3A 3ZXYA 2XUAA 1ECPA 2A14A 1XEAA 2Z3VA 2GM3A 1XNQB 2O2GA 2H07A 1QDUA 4L22A 4JYZA 4BUZA 1O95C 4LI3X 4C04A 5BVHA 3V4OA 5A6VA 1R4ZA 2X3FA 1BKYA 1GQSA 3L0YA 2H2HA 3INTA 5BN4A 4GYKA 3BHMA 2NUPA 3NEPX 3QE3A 1XFAA 5ARDA 5B36A 3P45A 2ZUSA 3ZE1B 1D7OA 2GYWA 4UVEA 2EBFX 3Q40A 3JRWA 3S2UA 3WLHA 2NYUA 3AU9A 2E7ZA 2XCQA 2NSLA 2YHUA 2R84A 2AJTA 4IBOA 2OHGA 3RCBA 4PIVA 3ZOZA 1CY4A 4DIKA 3KLBA 2ZRDA 3R20A 3TEMA 4LY6A 3MG9A 1LRLA 1CV2A 3GRCA 3TKLA 2BLLA 1BU8A 2CXUA 1RM5A 4UVHA 2XGSA 4MQEA 1ZVJA 3DXZA 4G85A 4I1PA 1IXRC 1W1UA 1N5KA 4DC0A 2CV2A 5JQGF 2CSUA 2HV8A 4NONA 4FOSA 1GGMA 4MQ5A 4P3YA 3J80A 5EZYF 3MN1A 1NAHA 4DA9A 3C3KA 1GPBA 2F3SA 3TRHA 4O2LA 3OECA 5BY2A 5JI2E 1IOZA 3G0IA 2VNKA 3WWOA 4GGOA 4Q1VA 1JIKA 2B25A 3MRTA 3PNSA 3VZBA 3I3SR 2WJVA 1JSRA 4WCDA 1KYQA 2O5CA 3GRPA 3K4PA 3KEQA 4J16A 2Q8NA 1A82A 4EG7A 1EE2A 2AOWA 2G8NA 3RV4A 3EC1A 3D81A 5TMBA 5KNCH 4G67A 4B4WA 4GI3A 2QTNA 4R0NA 2NUTA 4TKUB 1UJNA 2D1YA 3BEDA 3N8NA 1JYEA 4J91A 3PT9A 2AG6A 3D7NA 3BIFA 1TK3A 1ZD1A 3PIIA 1B0AA 2OCYC 4L74A 3HO1A 2I4NA 2OHIA 2YXNA 3DBRA 1E0AA 4L07A 3EVEA 1D07A 1N9GB 3QU4A 2WAOA 2AI3A 1F4PA 2V5AA 4G5OA 1ZM9A 3F7MA 1OTXA 1R6VA 3X2SA 3UAOA 3U16A 4BNXA 2GNPA 4MW5A 3OZ7A 3AF4A 4PC2A 3NANA 4NBLA 4BVGA 3R2JA 4L4ZA 1VLZA 2Q2VA 3D1VA 4NZOA 1D2CA 1VCOA 4Z4CA 4UZFA 1NSYA 3UJ7A 4F9FA 4LZLA 4CPDA 2B82A 2B1IA 4E1AA 3OSZA 4PWYA 3SK0A 2JGKA 3U1BA 1RAHA 1TM1E 1ZO8A 2I2WA 3KTFA 3PEVA 1HEYA 2YMQA 1MFZA 1G20E 4L28A 4B3HA 4X95A 3T38A 1JIJA 1QVVA 2I55A 5CLIA 2DPYA 1G2IA 2HA6A 1TXGA 2O1WA 2QRPA 1G9XA 3IXQA 4JR0A 3AFMA 2NM0A 4I6EA 4NQZA 1WB9A 1YMUA 1A9OA 4KWHA 2NO5A 4TVOA 5IKXA 2GKOA 2ZDQA 3LAWA 4YV7A 5CJJA 3AY0A 2AJBA 2MHCA 1NLYA 1R0BA 1TE2A 1SOUA 5BOSA 2FR1A 2WDPA 5B4VA 1GSAA 1FFGA 4PZ9A 3VX3A 4E2YA 1QE3A 1GNRA 5BOVA 1XUOA 5A3VA 2ADMA 4N8EA 4FP9A 4OAOA 2VHQA 3GLFB 3FTPA 2EARA 3CMCO 5J1SB 1PR2A 4E5VA 3CZMA 2FN7A 2HMTA 1XRQA 3QOFA 4G2NA 5FUXA 5F76A 2IV2X 3RW9A 4Q1AA 3UAXA 2Z0MA 3WGLA 3HBNA 3FHTA 5J63A 2WYVA 3TZKA 4JOBA 1FMLA 1ZOOA 1KEVA 1IY2A 1T35A 3DBLB 4Q19A 3SSMA 4U7GA 1QGED 1Z2NX 4GKKB 1SOAA 1UT8A 4ND8A 4KXWA 1K92A 3OIYA 3P0RA 4RF5A 1EXMA 1OXVA 2XDWA 1LDNA 2XSZA 2ZDHA 3UIEA 3VNRA 4F7WA 1UBMS 1CUEA 2G1JA 1I94B 4J4HA 4DRYA 3DPIA 2IXFA 1BGWA 1XE3A 2B8NA 4DBLC 5KSYA 1N2CE 4KTVE 1E3LA 1SD5A 2DQKA 3VR3A 1QGZA 2HRZA 2QNRA 4RORA 5HBRA 3UWKA 2DC1A 5HZHA 1WHSA 2ERCA 3GPIA 3NDRA 3PNOA 4G1MB 2Q5EA 4IZHA 3WTBA 4J75A 3E70C 5F33A 1PDVA 1E79D 1G8HA 3GX1A 1TMYA 1M76A 4UBIA 1HPLA 3AB3A 4JLSA 2OCBA 4HS4A 4J0EA 1GR0A 5E9AA 1ADJA 1RPZA 3IB6A 4U7WA 4JMPA 1JDVA 3R8FA 2GPBA 4A0FA 1V45E 1ZD4A 1SK9A 2CW5A 1S8FA 3DWEX 3FWYA 4O2BB 2BGUA 2HA7A 2YXBA 3P2EA 2FF7A 4U7PB 3TEFA 1CLUA 1E1MA 1VGQA 2QR2A 3PXGA 1YE5A 4BMYA 1GR1A 4LYJA 1OC4A 1ZJWA 2M1XA 3PFHA 1C5KA 2GZHA 4X61A 2QN8A 2A92A 3E0QA 4TKLA 3VR2A 3X1XA 3GPDG 4GXRA 2H5LA 2VI5A 2QU8A 2EDCA 2EKBA 2JFHA 3OM1A 3ROXA 4TWAA 2OORC 3IMKA 3NHJA 1KRWA 4I4IA 5BURA 3C3JA 2OCAA 1T4BA 2GOYA 3L7KA 2BGNA 4IOMA 3CKLA 1RI2A 4G0UA 2CKDA 2H1VA 4ZVUA 1X8XA 2HU2A 5KYWA 3D4LA 5H8WA 1PW5A 3ZHYA 2EKLA 5KX5B 4BZWA 2QM0A 4L95C 3DJFA 3D0KA 3OZWA 2KWIA 1W36D 2FPIB 2GCOB 1N2OA 1P0FA 4LHYA 4OXXA 1X1SA 3TLJA 5GP1A 2QVLA 3H9JA 3D0OA 3L43A 5IM5A 3MT9A 3ZZTA 3OH8A 3MJEA 4HD8A 4AU1A 1RLUA 2RK6A 2WWRA 3FUUA 1YQWA 5FTNA 1TLLA 1ZH8A 2VUIB 5FPYA 3WWCA 2BR3A 5EVJA 2CWWA 2G25A 3BE6A 4DDVA 1QLHA 3A2KA 4IX1A 4P9NA 1WXGA 2IDJA 2J5KA 5FLYA 4N01A 1SIOA 2L17A 3ZGZA 1IJFA 2H7YA 3LY5A 1ZL0A 5EIAA 4BB5A 4BMZA 5AR1A 4ZT4A 1KPIA 2N42A 4FXOA 5KOJB 1IJBA 3C43A 1KY4A 1L3IA 2AMVA 1U2EA 3H83A 3BB3A 3H9QA 5COBA 3WQQA 3CVWA 5JYBA 4LZJA 1T2NA 4Y0VA 1J2RA 2WI8A 4J6FA 4XSHA 3MJTA 5CM9C 4GMXA 5LN1A 3PX3A 2JGMA 4Y2RA 4OYRA 2JIQA 3OOHA 3AR4A 3BH6A 2ZJ2A 1Q6ZA 1T5LA 4R0VA 1TZ2A 2D2IA 1D04A 3N74A 4V0RA 1SG0A 1I3MA 1XD8A 4N41A 2AXNA 4XQCA 2PS3A 4NFLA 2KHZA 1T5IA 1Z5ZA 4BGDA 3PX2A 2FZ5A 3PFBA 3DZDA 1AGRA 4L08A 3DLCA 1WUKS 4QU5A 4RLSA 4D5EA 5C35A 3I4CA 4KK4A 4RVCA 1MABA 4AZSA 3AH8A 4IIBA 2G04A 1DKPA 3KJEA 3VKFA 5DCYA 3IL2A 4EKDA 1IVSA 2Q4RA 2XTMA 5KSZA 3HM2A 1P3Y1 1YQGA 3HACA 2VL7A 3MT7A 4FYXA 3OZSA 5FDFA 2JL1A 3BH7A 4OQNA 1UOPA 4WE3A 3SD7A 4RPJA 3VSBA 3GIWA 1FNNA 4IY1A 3RVLA 1XIVA 4AG6A 2QD3A 1TM4E 2IPNA 2P2CA 4MV0A 3GP8A 4DCMA 3GPLA 5E7QA 1M1YE 4X7MA 5EIWA 1IOLA 3MJDA 2RG7A 4YQYA 4FBLA 3NHYA 4B2PA 3A9UA 2O3QA 5KAPA 4E7PA 4ANFA 1A76A 3OOJA 2I9KA 3DOJA 2PX8A 4RF2A 1UZAA 1XDDA 1GHTA 2EKDA 3GLGB 1R0RE 2R62A 3UB2A 2VXCA 2VBFA 1QG6A 4KVFA 2CBZA 1VRWA 2EGUA 3DV2A 1V41E 1W5EA 3ZW7A 3PUXA 4POOA 5K0GA 1T8WA 2WQ7A 3S40A 1JE1A 1TECE 2AKYA 2VEOA 4LSMA 4IHJA 5KBYA 1LDBA 2D5CA 1P91A 1U0TA 3G2LA 3L7OA 3MJSA 1LPOA 1YK1A 1QOPB 3QLTA 3M7IA 2DWPA 2J9YB 2Y27A 3OT1B 5THQA 4FS8A 2ZIWB 4ZPJA 2A9PA 4HFMA 1U7OA 3ILYA 3NM5A 3DBIA 3R0XA 4UU8A 3X2EA 1A72A 1B43A 4F1WA 1J6UA 3VM6A 5LYJA 1L5WA 1COWD 4R8SA 1KR5A 1G5HA 1UMBB 4YJKA 3UHOA 1TQ4A 2FRVA 5G4KA 2A9JA 1TL7C 1QH8A 3JWGA 4QYIA 3WYEA 4CIDA 4OIFA 3W6NA 1UUFA 1U94A 2QLBA 4L4XA 4UFNA 4C5CA 3ONVA 5U4QA 3MA0A 4L78A 4ZCLA 1Y4ZA 2GKGA 4J0KA 3KXDA 3HYSA 3CINA 4ZO4A 2NP6A 4LXUA 1PG0A 4M0KA 3ABIA 4AMZA 2WVAA 4UCQA 4NVRA 5EGSA 2D3TA 5H70A 3T5MA 4LDQA 2IWRA 3WKCA 1YI1A 3TM5A 1BGXT 3I32A 1K0FA 3SG0A 3OFSA 1KZ4A 1VLVA 4B6SA 2IH2A 3F6YA 3IPAA 1UBLS 2GUWA 1E2DA 2NZYA 3QLUA 4JDPA 4LZOA 4NC9A 4M9XA 3ANNA 1PI3A 4YAGA 4E31A 1DKQA 4NCAA 2EJVA 3MUEA 4A8TA 4K6CA 5DLDA 3ZDAA 2JI4A 1AKYA 1GY8A 1WA5A 4X3OA 5JQGB 5D01A 4CIVA 3JQ8B 1U5AA 1BCRB 1T4CA 3FR8A 4YO7A 4H15A 2P65A 4B6EA 4G9GA 1ZJJA 3EXEA 1KBZA 1QUFA 3C8ZA 3CW8X 4PRZA 1JLMA 5EZYB 2W98A 2CXSA 3EXFA 3OF5A 2XMPA 5A0TA 5IMBA 1XKQA 2G1KA 3I6BA 3OIGA 4W9NC 4DMCA 5H3HA 1ZGCA 2LUOA 2RD2A 3BQNB 5KU1A 2WHRA 4MKXA 3FSJX 2JZNA 3COSA 4OQPA 1BQEA 1T24A 3IO3A 3ZGXA 2YKGA 4UDOA 1OBVA 4I1UA 4UW9A 5FR1A 2PZAA 3GAMA 3CYFA 4LN1A 1L7VC 1EFKA 3RRFA 2NU7B 2HLDA 3HJGA 5C52B 3II6X 1ZN9A 2PBZA 5DHRA 3DL2A 2IUUA 3KJFA 4OHZA 1TVMA 1X7YB 5IX8A 2YYAA 5JSFA 3KAQA 3VI3B 4HZUB 1YFKA 1CVLA 2OD9A 3SDBA 3ZGNA 1FMTA 3SU8A 1BHJA 4GI5A 3T3HA 3WR5A 2ID8A 3IAHA 2B98A 3H5OA 4PLGA 1CJVC 1PKXA 2UDPA 3TL6A 3WLFA 2WF9A 4TV8A 3MBKA 2WTEA 1J9ZA 3QPUA 5DM2A 5GQSA 4QPCA 3FPLA 1EHYA 4GGPA 1PJCA 1I24A 3K73O 1EQAA 4IIGA 3HA2A 4KPUA 4PZLA 2J8ZA 4UFOA 4ZQEA 4C1BA 1SUIA 2YOGA 2REQA 3EG9A 4DXHA 1P17A 5EHNA 4NECA 1KAHA 2GF2A 2WHQA 3AEYA 1QE5A 2VTKA 1AXEA 3AHDA 5C4IA 3EGCA 2FDRA 2OKGA 1E7YA 3CBGA 2F9MA 1U3UA 1LJ8A 1K98A 2Q2QA 2RGCA 3A1SA 1OROA 3W8NA 5EP2A 1Y3IA 5CYPA 2HWYA 1O57A 2Q49A 4BP8A 2EZUA 5DXFA 3NTXA 4IFEA 1UXHA 1OI2A 3KLOA 3BMQB 5ELXA 1YI0A 1Z35A 1ZYUA 4HDOB 5JUWA 3W90A 5CYOA 4HS9A 4G0NA 2IEIA 1D2RA 1YQEA 3HUFA 1NA5A 1THMA 3Q3JB 4R16A 5GVSA 2H00A 2O2SA 3GVPA 2D5LA 4G89A 5LXTA 3QXSA 4U2CA 3QVUA 3SHVA 3AJ8A 4I55F 5BSTA 5JQWA 1AX9A 3KQQA 3NFYA 2HU7A 2HF2A 2QN7A 2H18A 4AJIA 5KYTA 5A9SA 1ZU5A 3EIWA 3EJWA 3IEXA 3HHPA 4OQLA 4RPGA 4XE5A 5E8RA 5I7OA 5LMCA 1PK9A 1RMTA 4MHSA 2XYHA 4NDNE 2FEOA 3NHSA 3R3WA 1ZN2A 5K3DA 2VYNA 2YWEA 1FW6A 2IPAB 3FCUB 3KSRA 1UJ5A 4E94A 3Q2IA 1CIVA 3HADA 4F5YA 2GN8A 1F9EA 1Q83A 5CNMA 5CTAA 1HLGA 2YBDA 4AMBA 3TWOA 3GN2A 1RADA 1GAJA 2FKAA 2UZIR 1SWWA 3GFGA 3T1VA 1J2TA 4BO6A 2CMDA 4HSEA 2C42A 1YONA 2OUIA 2V59A 3OQPA 3PNMA 4HAXA 5EMKA 2X23A 1UEJA 2LR0A 3H2IA 2AX4A 1ZUNB 5KOIA 2JGDA 2V7EA 4GOJA 1WO8A 3DEYX 4ENSA 2IXBA 3GJTA 4U9HS 5CVEA 3PVZA 3WGQA 2W5UA 4KYUA 5HIJA 4CQNA 1KJJA 3HI4A 4N39A 5HGXA 2J46A 3CUVA 1SUPA 1N2ZA 2VTEA 3CR3C 4MWTA 3IUSA 4OQDA 3SGLA 5REQA 1RBQA 4DHEA 4X7BA 5EZQA 1SCNE 2C9ZA 2H2GA 1YC5A 1DRKA 3GRZA 3PTLA 2VG8A 4OD0A 4E3WA 2O8EB 3A6JA 5CCEA 1SVIA 3QXHA 1OYYA 1OGIA 4AI6A 3PQ6A 4BZXA 3H04A 1BX1A 3STYA 3ZD7A 4FEYA 4G5QA 1VJRA 1VKOA 3DTNA 3H7IA 3ABRB 4JU9A 5A3SA 4EARA 5FPSA 4ZN6A 2XOXA 2IH4A 1Z5WA 2O7VA 2DULA 3FWKA 1TJ4A 4JWTA 4RBNA 4V0ME 4N5IX 2HQ1A 5FXMA 3V7NA 4HXFB 2GMWA 1WQ3A 4XYGA 1LI4A 1RHQA 3O0TA 4UE6A 5EY5B 3KWLA 1KJIA 1C29B 1MRSA 1DIGA 4UAJA 3RV3A 4WIAA 3SXUA 1T1JA 2Q50A 4WDQA 4CV0A 2ID4A 2PL5A 3EVDA 4JASB 4L2IA 1Q6YA 4PYMA 5TV2A 1GQOA 3VO8A 4ZGBA 4Q1EA 5B57C 1Z34A 2EEZA 3HCDA 3PRHA 4PZYA 3IT2A 1ZH6A 3P9CA 3N53A 5CJ2A 3TCXB 1E1CB 4LXYA 3PDHA 4MZDA 1V95A 5AM1A 2K7FA 4L6CA 2XTZA 1W5FA 3EEBA 3WL5A 1SXGA 2RARA 1VP9A 2G83A 3U1TA 4PGFA 5K5EA 5H02A 4XWTA 2PGJA 3EIOA 4CMAA 5AJTA 3C5HA 1BRTA 4PZ0A 4H1VA 2R3SA 4KQ6A 1W4AA 1QXSA 5IVKA 2BP7A 5P21A 2R87A 1U8XX 2Q46A 1A9QA 2NG1A 2X8LA 1WQ1R 1X7ZB 4QULA 2FH5B 4WUVA 1G98A 4MVJP 2F4NA 3UJ6A 1NQVA 3WC4A 4AMVA 5EQTA 2ZRQA 1ZSNA 1J21A 1VTKA 4TS1A 1QYVA 2OXEA 1X0XA 3A9RA 4MROA 2IXGA 3MBIA 1NBOA 4O5OA 1N8NA 3HEBA 3B1YA 3NHBA 5F9FA 1PR5A 5D00A 4FLEA 3ZXSA 1KY3A 3MAGA 1KBOA 4R7ZA 1QGDA 3N0WA 1ECJA 4ZQCB 3OPXA 3WLOA 3SQMA 3Q9LA 4BTVA 3IOCA 2P6RA 2AKEA 1SXJA 1LKZA 1AGXA 2IUTA 2Z2ZA 3DL7A 2I78A 5BUZA 1UXGA 4RM3A 1WU7A 5AHXA 3BF7A 4BEVA 3TFOA 1T6NA 1SBYA 2BFBA 2CNNA 1MB0A 2X9QA 3WNQA 1RQGA 1HEUA 1X13A 3I04M 2DHCA 3QMWA 2GUGA 1TYAE 1IM5A 4ZI2A 4CCWA 1TKCA 2QZZA 1ZRMA 2YWHA 3GV0A 4IRXA 1Z0ZA 2O2EA 4OUKX 1F48A 1VP3A 2XB8A 4A8HA 1BE8A 1L7DA 1RR6A 1IY8A 3V7UA 3WRWA 3LC7O 4LQ4A 3FXAA 5CA1F 5K0FA 4FOOA 5AM5A 5J5CA 2ZUFA 1PWZA 4LOAA 5GIOE 2MOKA 5AKYA 1I1HA 5BSWA 1OLOA 3NYRA 4AMUA 2IYXA 2PR2A 3CX8A 4FINA 4O08A 3PX7A 5BYJA 3IP3A 1OIVA 3C4VA 1R0SA 2OBXA 8LDHA 5CXQA 5IPFA 4G23A 1NXXA 1T1SA 2ZZKA 1M8FA 3R6GA 4HV4A 1L5ZA 4LKOA 3T7RA 4ZEVA 1U7DA 2VRCA 3E3OA 1DIOB 4GE0A 5JNUA 5AVSA 3CJQA 4KAJA 2X8JA 4Q1FA 1YTUA 1V8BA 2ZPUA 1V6CA 4NV3A 2PNJA 3QVWA 4YV1A 4O4HA 2Z30A 4TRJA 3MSCA 2Q6IA 4RANA 1KH2A 4IVPA 4UREA 4PXYA 1CUXA 1P2DA 2PTGA 3DO6A 1RWXA 2PHZA 4DCPA 1PFYA 2MINA 4EEXA 4OA8A 4Z3OA 3RRYA 2XADA 1SC9A 1S2MA 3JQCA 1CZKA 2IYTA 4LIPD 5FTJA 1AS2A 3IELA 1VPLA 2I6QA 2J07A 5A1TA 1WMFA 1Y8AA 3ENKA 3AVXA 2XPCA 3L7DA 3VPFA 5JAPA 2FPIA 3A4YA 4JLNA 3DMDA 3C97A 3JQ6A 5HPYB 5JANA 5FQOA 3KEFA 2I3ZA 4H31A 2NZ2A 4Y9DA 3L82B 2AFHB 2HADA 4C0QC 4DCCA 1BCSB 4LXXA 5LD2C 2C5GA 4Y2PA 3WO0A 2PKCA 4M8NE 4AKIA 5ICGA 3BBPA 3K6JA 3NHLA 1W88B 3FBGA 4KIFA 4XD7D 3S55A 1WZIA 1K86A 3KYDA 1F2DA 1EXNA 1IZ8A 1PJ2A 2B4AA 2KJQA 2ZJ3A 4YXWA 4DY6A 5IAKA 1PNRA 3H2SA 2CK3D 2LNDA 3BK1A 5J9FA 3NVKI 4YMIA 2WVHA 3LVQE 4JLAA 5EXDA 5UKDA 1XMPA 13PKA 5DYYA 1WPRA 4KE7A 3LPLA 2O2YA 2PSJA 2GEFA 3HFGA 3NIBA 2Z2XA 4LW8A 4E4TA 4XJXA 2SNIE 4YP1A 1QRDA 4B0OA 2OZVA 3VPHA 5GV7A 4DL9A 4KXYA 3V3KA 1E2PA 2JEZA 3JPYA 3LXMA 4H6XA 4YAWA 3NGLA 3AHIA 1FXWF 1Z8FA 1USVA 2FUG1 1XD2A 2ZBGA 5BQ3A 1F9AA 4CQLB 3DNFA 1ONNA 3QI2A 4MVJE 2QZJA 4MPPA 3VR6D 3QLJA 3DOFA 4I9NA 3K8YA 4PSCA 3HKBB 3O73A 4FQ5A 1AHNA 2X5NA 4G5HA 4Q3NA 4RY2A 3NEYA 2QIPA 4P38A 2FSIA 4F84A 2YDXA 1T0PA 3GNLA 4DNOA 5JYDA 5H9VA 2LCQA 1B1AA 2IZZA 2C4UA 3NYWA 3PQ2A 4YRIA 1B3BA 3K1YA 4MIKA 2ZR8A 4A3SA 4ZYXA 4I1SA 2NP7A 5GV8A 2FFBA 4RIFA 4K9OA 4JITA 5IANA 3I52A 3EGWA 1MPTA 1Z7EA 3M2PA 3HWSA 2ZZMA 1Q50A 1T29A 3G17A 4NDAA 3KHKA 1G4AE 2NXNA 4KI0A 3VYWA 1VIVA 2QTLA 5CGZA 2YZ7A 1R8YA 4MW7A 1CRLA 4BNFA 3HDYA 4CDMA 5L7YA 3DBHA 5SY9A 1BN6A 1UT5A 3W7BA 4P5PA 5LSAA 4ZAZA 1E77A 3GDHA 2OXTA 1GZUA 1Y1LA 1OWLA 4E08A 2PXXA 2DP4E 3VUEA 5L7WA 5DDIP 3BSWA 4AJ9A 1ZCBA 3OT1A 4NOLA 1FJ2A 3GWGA 5ALZA 3MWLA 3QKUA 4MWZA 5DFAA 3TZCA 4M7WA 3AKYA 3R4CA 2FCAA 5IFKA 3RS9A 1C7QA 2X1VA 5ECYA 4B81A 3Q7RA 1AOXA 1UMBA 2DPMA 2J3KA 4D0NA 4R3WA 5KB3A 2QMHA 1QHNA 1E2HA 4CMKA 3Q3HA 2P2NA 3EQ9A 1JJBA 2ABWA 4FR2A 4U39A 5FJIA 5K1ZA 2C2YA 3ZDEA 2VTDA 3RVJA 3FI9A 2GJSA 2VA9A 1UOOA 3E4CA 1DO8A 1UWVA 1PNOA 4MCHA 2FN4A 2RSLA 1D8AA 1QFZA 3CUKA 1PHPA 3KIPA 5DMXA 5DV9A 1G0OA 2CYBA 4R2KA 4YRFA 1JG7A 4C4PA 3KD2A 1AURA 1M8JA 4EKIA 4QBHA 3JWIA 4IDGA 5FBZA 1OUMA 1U9IA 4UTZA 3JYOA 3SN6A 4BFSA 4H7KA 5CK5A 3LSYA 4KQ9A 1R64A 3D7MA 2W2PA 3KB2A 1UR5A 1RM3A 3HGQA 3HNOA 3SC6A 3ASVA 1SMKA 1LQ2A 1QTNA 3G13A 2QL5A 3MMNA 4AUEA 2ZM6B 3HLYA 3UV6A 1S8AA 4WFIA 1D2NA 3AUAA 1NONA 3JTMA 2YV5A 4I55B 2NO7A 3SF8B 1P6UA 1FFAA 4DG8A 1PL8A 1Y9ZA 2XVAA 5ITWA 1JLKA 1VYTA 1KEZA 4Q7QA 1R9GA 1SUBA 2VHEA 5SICE 2DB3A 4PINA 3EVZA 3QITA 3AUYA 2PK3A 1DKOA 2BJWA 3NHZA 4ITUA 3A1WA 1FRZA 4JMLA 4OL0A 4RQBA 3HKDB 1ZH0A 3SBDA 1SGWA 1C9YA 3GW8A 4HRVA 5SYNA 3UB4A 3BXPA 5LDGA 1H2WA 4RTSA 1E64A 5JAOA 1OMOA 2HHCA 2XV1A 1J70A 1GL6A 3U4DA 3B9RA 3F73A 4XAQA 1RMYA 4JIMA 4HADA 3IX7A 3PJFA 5HFAA 1WSDA 4TLCA 2D0DA 4DCJA 2H16A 1OD6A 2V97A 3C5WP 3VNAA 2BEWA 1Z2OX 3HC7A 1C9EA 5EQFA 5LKAA 2ZSIA 1X8LA 3IOMA 3QUBA 4JL5A 5BN5B 2Y4OA 3WKDA 1HETA 1G7RA 3HRKA 1IXYA 5D87A 5FYDA 5KNBH 4WZAB 2D0IA 2YN0A 4RZQA 2PKYX 1AS0A 4XDYA 2EOAA 3HE3A 3TX2A 1EGHA 1KZ7B 2GM4A 1PP4A 1VG1A 3BXOA 4MWSA 2XYRA 5BUSA 1S3IA 3NV9A 4OFXA 3Q12A 2D3WA 4FYHA 4LOJA 1RXVA 2Y9MB 3ICWA 3QXJA 1CR6A 2I71A 5L8VA 2XMCA 4HEQA 1KEUA 4DLBA 1W73A 1T2UA 1JIUA 5EJAA 3GRYA 2VT6A 4OMDA 5A03A 2O05A 4POAA 2EKQA 1SELA 2HJGA 4KWIA 2WKQA 3NDBB 3FPGA 5IMSA 4TMTA 3DVAB 3ABQB 2H2DA 1S96A 4ZVTA 4M0UA 2C0QA 5C7LO 2NQTA 1I13A 3GMIA 3RFUA 5DNCA 5KOHA 4QDJA 2O9JA 4RGBA 2IW1A 3NDIA 3ZC3A 4F92B 3I0MA 1FDOA 4JDUA 3U7QA 3G82C 1O6BA 2XE7A 3UXEA 4JBLA 1PS9A 2GZMA 3BL8A 4BV9A 1PSDA 2I6UA 5HF5A 2DR2A 1KYVA 4FGWA 4FWIB 3AUSA 4ZT5A 3T61A 3LBHA 3FZQA 5JNWA 1JFLA 1JEAA 3L8FA 2BI4A 3LDGA 2ST1A 2AD5A 2FWMX 4CKWB 3D6MA 3T0FA 5JSHA 2OCPA 1YVEI 4JLVA 1ZM3A 1AKNA 4TXNA 4YA6A 4ZI5A 3T3DA 3BKXA 4EABA 4RSRA 4U02A 1T0BA 2JHPA 2OLEA 2PWZA 3ITNA 1CRZA 1THZA 1E6CA 1NW3A 1ISHA 1RJWA 2MYNA 4MGYR 1EUZA 1L6RA 5EXEA 1I0ZA 1QQ7A 1OXXK 1RI3A 2PVSA 3P26A 5CPBA 3R7BA 4BE9A 5BSGA 5JAUA 3MMSA 3S7ZA 1Z0IA 3QVVA 3W6PA 1XU9A 2C2XA 1C1HA 1DCFA 4NI5A 2Q27A 4QWMA 1Q1ZA 3GPCA 1LX7A 3JWHA 4DCUA 4ID9A 3RC3A 2JLYA 2LGJA 4I1RA 1RE0A 3GHYA 5AHRA 5H59A 1ZM7A 4YRPA 3TAXA 1T9GS 1X7WA 1RXUA 2X7HA 3MYRA 4UXJA 3IYLW 3R23A 2GN0A 3CN9A 4WLUA 2HPHA 5FO1A 3EPJA 1QQBA 3PXXA 2P9QA 2IT1A 3OTGA 3KQSA 2J48A 4W7HA 3WYCA 4EH1A 5D5PA 5I8WA 1ICEA 1P60A 5K4HA 1MHTA 1K27A 3PPXA 2MIIA 2Q4EA 2OFXA 1RYEA 2GM5A 2Z8YM 3AUUA 3KWFA 1SZPA 2LDXA 5LP1A 3PP8A 2CHVA 3KKLA 1JHMA 5E4JA 4ZXFA 1ODSA 1YBMA 2V6JA 3FKQA 4BNKA 4DJTA 3RSHA 2B1RA 2JD0A 3PT5A 3GC6A 1U0JA 4ZVSA 2QRJA 5LA6F 1DIAA 4DIFA 6REQA 4TLEA 1GPNA 1KOJA 1PX2A 1NVVR 3ZV5A 4FFWA 2GPTA 4WKPA 3UPDA 3WYBA 1O77A 4JP8A 1I4WA 2GJKA 1Z16A 3CRRA 3LA8A 1ESEA 1SUCA 4BXOA 3RKSA 2NXWA 1X42A 1R4NB 5FLXA 3EOZA 3LHDA 4NCXA 2YASA 2P9JA 4KRGA 4MMYB 1QC5A 4QBGB 3SQXA 4FZ5A 4D25A 5LP6B 4OLAA 5CDTA 4NCKA 3ODGA 2PUBA 4GI1A 4MEBA 1ZD9A 3MM4A 1FTYA 1OXUA 3E84A 4QGFA 5A0FA 3LPCA 3NVMB 5HK8A 3ZCXA 1U3WA 2C29D 4AROA 1S02A 3BCHA 1DOZA 3SR3A 4C5BA 4L5CA 5CA1B 2B5OA 4EKEA 1SHZA 4EHJA 3GAAA 4FS3A 1K4YA 4TL7A 1XQXA 1RRCA 3OE7D 3PDJA 4RD3A 3WWYA 1T3GA 1NN1A 1Q0HA 2HUPA 3NTVA 3OJ0A 2AC7A 4KH1A 5BV2P 1C2TA 1B15A 1CE8A 4BGIA 4HDKB 2Z6UA 1NW5A 3PTAA 1II8B 1NU6A 3FDFA 4I81A 3KR1A 1Z0KA 5DP1A 4JFAA 1PSZA 1Z12A 1UXOA 2C4NA 2QUHA 4EPWA 5L3SB 5I9IA 4B6PA 4BCCA 3GLGE 4QDZA 3ANTA 4ETWA 1DKLA 1MH1A 1E89A 3NO4A 4BQRA 1CUZA 1H2HA 1EJ2A 2PGNA 1N6OA 3QG1A 2CFTA 2IHYA 1YL5A 1AQUA 1GCGA 4IDEA 4L8VA 3VPBA 4GLJA 3R0QA 1YMVA 1ZMTA 3QVGA 5J4KA 5SYMA 1JN0A 4X8HA 3DE2X 4J4TA 3U56A 3DCYA 1PJ8A 1R12A 3C3DA 5L3ZA 4E2XA 4C21A 1YQXA 4I46A 2QI9C 2XBLA 4MR9B 4EL5A 1UQUA 2EW1A 3TB4A 3PKZA 3K70C 2VATA 1KOLA 1Z6GA 3ELWA 3I01M 1I6MA 3A6FA 4IM7A 1Z4OA 3BGWA 3V6LA 5JCXA 2ZBUA 4N47A 4W1QA 1ZHOA 5JBQA 5JSZA 3U3DA 1BEEA 4AUMA 2KBEA 1E79A 2P9BA 2XRMA 3ZN2A 2C54A 4XIJA 4DIBA 1NXQA 3RJMA 3EQ7A 2FQQA 1QO7A 3OF2A 2F6RA 2PUGA 5E6SB 4GQAA 3JQ9A 3EDOA 1V4NA 4X62B 1ESDA 3KDPA 2Q0SA 1UQRA 3LPNA 5IUKC 1KAQA 4KWEA 4UNNA 3KNZA 2DLDA 4BFVA 5B5SA 4I3HA 1QHXA 1B6GA 1DJPA 1M0WA 1M2VA 2G0AA 4ON9A 1VKNA 1QH1A 3W9BA 5A4MS 2IP4A 2QG9A 1VB3A 3TW0A 4RTKA 1NMSA 4TLBA 5EYPB 4JT2A 1HT3A 2XB4A 2FSFA 4Z9BA 4B76A 1FJXA 4IW3B 2FUNB 5KKAA 1S2IA 4DMRA 4DQXA 2ZYSA 5ARCA 4BZPA 5KC8A 4I9HA 3GFFA 3KQYA 2VJDA 2PD6A 2JBAB 3AJEA 4MDYA 5F1OA 4YRMA 4XB6B 3NB0A 1DJMA 1WHTA 4A15A 3PUIA 2NACA 4DMUB 2IBTA 2F3QA 2H5JA 4MUMA 1W6RA 1YJ8A 2V7PA 4RPKA 5EIOA 1YQ9A 5FV4A 2BSXA 3C6BA 5AM3A 1Z45A 2WWGA 4ZIRB 1M0EA 2MSLA 2JCVA 1AMOA 1MW8X 2Y1WA 4IG4A 4AZ3B 2RHLA 2IY8A 4ITRC 1RIIA 3RYTC 3SZUA 4BECA 5F23A 4X60A 3KUKA 2X6TA 4EZIA 3Q5DA 1IQPA 3LO8A 1Z18A 1YOVB 1JH9A 5D5HA 3WLSA 2YS7A 3DMNA 3DWFA 2HF8A 2Z58A 3KTAA 1RZUA 2VR1A 3ZGOA 4WZBE 2ZBRA 3CHYA 5CT5A 5BQXA 2BUBA 4LEIA 2AZDA 1F6WA 3ZW8A 4ENRA 3GJXC 3FPJA 2WHPB 1NULA 3QFCA 1VC2A 4PSDA 4WOBA 3ZHXA 4DWJA 2P3OA 5DYNA 4HP8A 5F73A 4KFSA 1RM0A 3NUGA 4D4MA 2AOTA 1B1CA 1CY1A 1YCHA 4PXSA 3TZQA 2K7ZA 4UTVA 3ZWBA 1IY9A 1R5BA 1WJGA 4BLWA 4YJ2A 3N8KA 4FYJA 2WG2A 3GGDA 1XHFA 4DEVA 5CM2Z 1YQDA 1HG0A 5TXGA 1NQ5A 1HQKA 2EWMA 3L7IA 1V16B 1X9GA 3FFXA 4J7XA 3JD3A 3AX6A 4NQRA 2NPFA 3TR5A 3G59A 4PO8A 1DFGA 4JL8A 1GFWA 3I8XA 4HVTA 4GWLA 4NBTA 5DBEX 1P2UA 1POXA 5JDIA 2FPRA 5E9QA 4B34A 5A6SA 9ATCA 5LL6P 4TMXA 4AO7A 1J0AA 1XTJA 2PLRA 2OV6A 3D0QA 1J1UA 1QO9A 3DL4A 1PBTA 2D7JA 2IEYA 4EJ0A 2Q45A 4WFKA 1KDVA 4JKYA 3QEKA 4AD8A 2AG5A 3RIHA 1XYGA 1G63A 2ODEA 2WWHA 1AA6A 4I3FA 4N76A 2BBWA 4FNOA 4FONA 4HGYA 2AJLI 2OD2A 3DMRA 1VLQA 1GPLA 1Z25A 3U31A 4TUYA 1K3FA 2WJJA 2X3UA 3INNA 3QUSA 4KO2S 1E9EA 1XVVA 4OOFA 4R8MA 5G1NA 5TQVA 4YI5A 3U40A 2H2WA 4CIWA 1AC5A 3A06A 5CW1A 3HA7A 2VNIA 3U4HA 5KWIA 1XDWA 2LDBA 4FCWA 2AXEA 2J3HA 1TZKA 3W79A 4I66A 5IDQA 5ELMA 3WSVA 2XUDA 2ZVDA 2JRLA 1I10A 1BXKA 5JC1A 4NMHA 1KY2A 2HIMA 3C5CA 1OI7A 1Y5RA 3IHLA 4XVCA 3ZGYA 5IDWA 1IPHA 3V33A 4EK9A 4Y2GA 4XGKA 3KTDA 1XEXB 4JELA 1SBNE 2QY6A 3HKBA 3HXPA 1W7AA 1NP3A 1KZ9A 3BD9A 4CI9A 2C1EA 3R0JA 4BO2A 5TPZD 1Z8DA 3OZBA 5E6RA 2P9TA 5A3QA 2ZIZA 5LU9A 1NLZA 4IWNA 2ECQA 2ZAGA 1XTSA 4XIFA 2BCGY 3FZGA 3W5IA 4FOLA 2IPMA 4C4XA 2ZRKA 1Y8RA 3IUQA 3HR7A 4X44A 3UWOA 3FKJA 4FUTA 4N12A 4HUQB 3WMEA 2QUKA 1RYFA 1YXMA 4UUPA 2EZ8A 1QHIA 4X24A 4OHXA 4DM7A 5HUQA 4LMBA 2V03A 2GVDC 3WAJA 3OOWA 5BMVF 3QPCA 2X40A 4GGMX 1RWNA 4PAQA 1KZHA 1LJLA 2PUWA 4KJXA 3IJRA 4XWYA 1M2EA 3FTDA 3B82A 3KB1A 4RLHA 1DRWA 1RI1A 3BMCB 2VP3A 4PCLA 3OCCA 2WK1A 2FI1A 3KP1A 4MR7A 4P22A 2N3ZA 2Y1GA 4FD3A 4ESOA 2VP5A 1KU6A 1NPTO 3L0PA 3GJ7A 5SY4A 5IXYA 1JHVA 4GEGA 2G70A 2W6IA 2VYVD 5FP0A 2G88A 3OU2A 3S8MA 3S2GA 3T9FA 3ND8A 4UMVA 3NGMA 2XXAA 3OT5A 1V7PC 2QDXA 3GUHA 3KTOA 4MYDA 3RDPA 5JO0A 5GM1A 1SZJG 4MR8B 5LUAA 2P4EA 1YB2A 5IEJA 1SZDA 2VPYA 3ENZA 4MS3A 2B7CA 3I53A 1MVOA 4BNUA 3IAM1 2G0NA 1NVWQ 4QNMA 4MGHA 3WWPA 4F46A 3LUKA 1JU3A 1KYIA 2AFIB 3L8ZA 2H08A 4LDZA 4RKYA 3KZVA 4ZDWA 5TGDA 4MDFA 2OLJA 3AJ9A 3F71A 4FCTA 1NPDA 2B5VA 2EYQA 1E96A 2REOA 4LBZA 1FUEA 1U3FA 4PGAA 1J2UA 3RUPA 4AKSA 3GDOA 1ZRHA 4YJ3F 3NT4A 5IXSA 5T57A 3S5UA 5LB2A 4F38A 4RFLA 3QLVC 1L5NA 3HEMA 3C6QA 2AVNA 4FB4A 2PZ8A 4UMEA 4DS3A 4KQKA 1J5XA 1QCZA 1RAIA 1Z8HA 1PUIA 3W2FA 4LWOA 1C9NA 1RQRA 3UQZA 2EQ5A 4G97A 3T7JA 3ZV6A 1KRHA 1PNQA 2IZ7A 5FBHA 1JYSA 4A8JB 1RBMA 2ONZA 3CQ9A 1Y8CA 3ONDA 1WRBA 1UBEA 1UF9A 4O0MA 1DKUA 1P7ZA 2ZEJA 3VTKA 4LHSA 3SAJA 2FSSA 3TLZA 3I76A 1VL1A 2ADOA 2C2WA 3D7RA 3B12A 4A03A 3X1WA 4D9GA 5HDQA 4GWGA 3F6PA 4GP6A 4F5ZA 1C0LA 3GJ8A 4X91A 5EJ6A 1DMRA 3EUWA 1XRMA 3T5GA 3WGIA 3N75A 1BA2A 1LCIA 1YAJA 4S12A 5LOVB 3RU7A 2CYAA 1ACMA 2CMHA 1YSCA 4H1UA 2I3GA 4N1AA 4K26A 4MYHA 4TQUS 1NMXA 1BE6A 3TH5A 1YZ3A 3ZJYA 4BHTA 3OJOA 1E1LA 1CB7A 3JRXA 4MV8A 4RXMA 3D3WB 3NS7A 1QFYA 3N59A 3V1YA 2CHFA 3CEMA 4R68A 1Q2XA 2RGNA 1KC1A 3THOA 1XKXA 3FMFA 4ESHA 2BEVA 2EF0A 5LA6B 3EF0A 4LTDA 1NNEA 1M6YA 4LPKA 3RS2A 2UYGA 2QTVB 3P8ZA 4HQ0A 4YB8A 2X8WA 3MWEA 4LJ4A 5K8TA 5LDDC 1UDWA 4A82A 1FDWA 2Z09A 2PUAA 2J9RA 4BFYA 1N6NA 5HNKA 1G2QA 3WGZA 2FPUA 1OYWA 3K9NA 1KQ3A 3ZZ1A 1Z5GA 4BO8A 4RMIA 2XJ4A 1QJCA 1RPAA 4K1LA 1I32A 3PRKE 3T54A 3ET4A 4CRWB 3AHCA 1CJCA 4QRHA 1KI6A 3ABOB 3IIIA 3IMEA 2AK2A 2QQGA 4Q3KA 1OXKB 1Q1NA 4RPHA 4UOQA 1GFSA 5IWAB 2JAHA 3GLIB 1W96A 1YRYE 1RTKA 2GJ4A 4UEWA 4DTCA 2I8LA 3EPKA 4NOMA 3P9YA 4BGEA 2FR8C 3OQIA 4YDQA 1BD4A 4CT0A 2R4QA 3CWQA 4N0QA 4XJSA 2B7LA 1V9CA 2H0RA 1J09A 2OGUA 1P0MA 2ZBQA 3FPHA 4HPJB 4Y0AA 4Y98A 2OAQ1 4AL4A 1LNZA 3IVGA 3AJDA 3QELB 4KO3S 3PFKA 1M5RA 4J7CA 4HNVA 3AETB 3M5PA 3O4IA 2D54A 3M6XA 3PITA 4L27A 1USWA 1CD5A 1GYQA 4OJKA 2X2FA 1SHJA 4K6FA 3I8SA 1Q7TA 1HE3A 1QIMA 4OI0A 4DDHA 1Z6AA 4IIJA 1VE1A 5B1EA 1T3SA 2FETA 4MPTA 4BFWA 2O20A 2DU8A 5TR9A 4WXRA 4UE3S 3RS4A 3IHKA 2DY0A 3V4FA 3FMPB 4DQUA 4H0FA 4YO8A 2WWIA 1X1EA 4HDNA 5LMZA 4MUEA 3D4OA 4KCGA 1PQPA 2WSBA 5BVGB 3WBKA 4KIWA 1JKXA 1GTSA 1Q20A 4MRAA 4M0EA 2A9RA 2X0FA 1E0SA 3R4VA 3AT1A 1U6KA 5FX2A 4WEQA 5F98A 1SCKA 3MNFA 5F5NA 1PK8A 4MA4A 2CEKA 3AIOA 4EYGA 2BSQA 1M2OB 3OX1A 4AFNA 1F2UB 2Y0CA 3CLRC 4HQOA 4LJ7A 4D9FA 4Z7QB 3K16A 1JAYA 3OZGA 4AKHA 4LGVA 5LQRA 2JIRA 1PT6A 4U7JA 4JHLA 2C3YA 4K03A 4PY2A 1ZRNA 2EW8A 4TOIA 3O8QA 5CITA 4NBVA 3B7WA 4WCFC 2JEYA 3OZAA 4Z5XA 5M3BA 4IS2A 2GPYA 3BZUA 4C3OB 2BE7A 4H16A 4LRUA 4LJSA 3AJRA 1UKZA 1U7WA 5JSQA 3OE4A 2Y93A 3AJAA 3R77A 4Q1BA 1IZ0A 4PYRA 4KLZA 2ZB8A 5DW0A 5AXBA 1YCFA 4XARA 4CKEB 2P91A 3LCVB 2ZRGA 4L0QA 3E61A 2EZ4A 2Q6OA 1XTPA 2O6HA 3M2TA 2I34A 5BSRA 1BQ3A 4CODB 4UTPA 3UUFA 2ZRCA 1PL0A 1W2GA 1YZYA 3PCTA 4IKOA 3EB9A 5ELLA 3VC3A 4K88A 4D3ZA 2SKDA 5IH7A 1BO6A 2W2XA 4KNVA 1VKJA 1JEDA 3C3MA 2IRWA 3DZ8A 1MC8A 3VC2A 1P8JA 5ALNA 3LMKA 3TZBA 2QAJA 2JGEA 4D9IA 1U9CA 1VZ3A 4EVQA 2C4HA 3KOMA 5FOUA 4JXXA 3PNBA 4H4DA 1DEOA 2CF5A 2IU4A 4FX2A 4CVNA 1UEXC 4FI3C 1J4AA 4MW6A 4EPRA 3JSXA 3OLCX 1D09A 3H2GA 3PUZA 5KJCA 1IBSA 1ZMOA 4HDKA 1SBHA 3WYDA 3THXB 2LCFA 1FJGB 4BRUA 4ZI7F 2BBSA 3OJFA 2YCLA 4E09A 5HZKA 3IUYA 2AE2A 3IURA 4HWKA 3S99A 1L8LA 1WSBA 4AJPA 2RMKA 4KITB 4WNCA 3H1FA 1ZBDA 3K05A 2W48A 4FKZA 4G2TA 3R7AA 3D5QA 3T5AA 5H3CA 3WL8A 4JLKA 5CXUA 1JXMA 1Y34E 1M34E 2IWHA 1BDIA 5TQ2A 5F51A 2GEUA 1W5AA 1PJ3A 4K9DA 1OA1A 4X6XA 4QOEA 2GH1A 3AXTA 3HU3A 3L92A 3H1BA 1R3DA 2AYXA 1UZMA 5FPPA 3IR6A 4PHCA 4LWZA 3KVNA 1IBCA 1MEEA 2C9MA 4DV0B 1E1QD 4OCZA 1UC8A 2BUAA 4B17A 4H3HB 3BIOA 2BMAA 1RACA 1U4SA 3DAGA 3OTIA 4AT1A 1IEXA 4L85A 5D5QA 2IEGA 1Z0AA 2Y6VA 4F04A 1TW3A 1HL7A 1YU9A 4GG1A 5I9TA 4LGCA 5LZ8A 5JFOA 2SCUA 1LD3A 2PGXA 4LMPA 1CUFA 4UAUA 4IDOA 2XVMA 4FC6A 3TVTA 4HX2A 1UAGA 3COWA 4ZOCA 3G2KA 1M2JA 1T5TA 1OFUX 3DDUA 3VNQA 4DREA 2Q62A 3OEWA 3TK1A 4I7EA 1EK0A 1RD4A 1GEGA 1NPYA 3IALA 5JYCA 1SK8A 4PWZA 4QEKA 2V9CA 3TS1A 4XLZA 4K6OA 3V4SA 4JV5B 1S01A 1CY0A 1Z3IX 3L0BA 1EK2A 4QU8A 4C4AA 2JLSA 3DM5A 2OGZA 3V34A 4CCYA 2IYAA 4G25A 4W1PA 1IEWA 5E3JA 5F1KA 3UMRA 1VI5A 4UTRA 5C7YA 2I0FA 4MHTA 1EB9A 5IULC 1K7FB 1NX9A 1Z4LA 2JBAA 2Y2UA 1DC5A 3DZBA 4N6OA 4YRZA 1GRRA 1XPJA 1V26A 1H85A 3CR7A 1XYVA 4EEZA 1QFSA 4F8YA 3OLQA 2L19A 3M1IA 1K3TA 3TAUA 5A5VA 1NC3A 2X13A 1U0OC 1JDUA 1KH3A 1Q91A 2ZRBA 1QIJA 2DY1A 2GILA 4HRXA 1Y7LA 1L4BA 1YMQA 2FPKA 1TUGA 2I33A 4RVNA 4URXR 4NYIR 1NI5A 5DGDA 1WSAA 1SQ5A 4INAA 4TGLA 4Y3UA 2WVJA 4M9RA 3OZCA 2RIRA 3Q87B 3UMFA 3MCZA 4MB6A 3HB4X 1YOVA 4XPIB 3ACBA 4UHHA 3PKJA 5LQSA 2V9PA 2WFAA 4XD7A 2R60A 2PMKA 1RYYA 1AN9A 3I5MA 3M4XA 4I8DA 3WHKA 4DYDA 5AVUA 3EULA 2G7ZA 3CB4A 2PX6A 5CCBA 3TGLA 4GOXA 4FDLA 5AH0A 3AI7A 3ZZMA 5EZ5A 1JR6A 3G49A 1LF0A 1T3HA 2CK3A 1KJ9A 3MB8A 1Q1EA 1IBRA 3OZTA 1E20A 4ND1A 4TZTA 5H5JA 2JJYA 1JA1A 4ADSG 3QRWA 5BMVB 2FDXA 3IAEA 3R3HA 1I51A 3BXXA 5T4BA 4BVHA 2HW8A 4QXQA 1K8YB 4FFSA 1SKQA 5KYUB 2IOQA 5JR3A 3KDSE 2A8YA