1JEQB

Crystal structure of the ku heterodimer
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
537
structure length
520
Chain Sequence
NKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAENKDEIALVLFGTDGTDNPLSGGDQYQNITVHRHLMLPDFDLLEDIESKIQPGSQQADFLDALIVSMDVIQHETIGKKFEKRHIEIFTDLSSRFSKSQLDIIIHSLKKCDISLQFFLPFSLPFRLGGHGFPLKGITEQQKEGLEIVKMVMISLEGEDGLDEIYSFSESLRKLCVFKKIERHSIHWPCRLTIGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDDDETEVLKEDIIQGFRYGSDIVPFDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords KU70
publication title Structure of the Ku heterodimer bound to DNA and its implications for double-strand break repair.
pubmed doi rcsb
source organism Homo sapiens
total genus 142
structure length 520
sequence length 537
ec nomenclature
pdb deposition date 2001-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02735 Ku Ku70/Ku80 beta-barrel domain
B PF03731 Ku_N Ku70/Ku80 N-terminal alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1600.10 Mainly Alpha Orthogonal Bundle Ku70; Chain: A; domain 4 Ku70; Chain: A; domain 4 1jeqB03
2.40.290.10 Mainly Beta Beta Barrel Ku70; Chain: A; Domain 2 Ku70; Chain: A; Domain 2 1jeqB02
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1jeqB01
1AUQA 1M2VA 2WW8A 4UM9B 1AOXA 4UM9D 5E6SB 3V4PB 4JDUA 3ZDYB 1FNSA 2I6SA 5HDBB 1PT6A 1T0PA 3IBSA 4O02B 2B2XA 2ODQA 1L5GB 1ATZA 1TYEB 5KYWA 3EG9B 4HQLA 5KYUB 1MF7A 1CK4A 3K72B 5E6SA 5KYYB 3Q3GE 3QA3E 1XDDA 4IHKA 4A0QA 4C2AA 4MMYB 3EOAI 1IJKA 3PPXA 2VDMB 4WK2B 3K6SA 3EH2A 2XGGA 1M2OA 1LFAA 1MJNA 3RAGA 4Z7NB 3EG9A 5HJ2A 5KYUA 5HGJA 1AO3A 5KYYA 2NUPB 1DGQA 3E2MA 2NVOA 5KYXB 4NEHB 1JV2B 3N2NA 2ADFA 4HQOA 4NENB 1RS0A 4WJKB 1JLMA 1JEYB 2O7NA 4M76B 3ZDXB 4CN8A 2IUEA 4MMXB 3M6FA 2WINI 3EGXB 5E6UB 4CN9A 4PN7A 4IGIA 3V4VB 2NUPA 1N3YA 3HXQA 3ZDZB 3GXBA 3TXAA 4WFQA 4NENA 1Q0PA 3PPYA 4Z7OB 2I91A 1JEYA 1M1UA 1OAKA 2ODPA 5LN1A 1T6BY 1ZOOA 3VI4B 1M10A 2ICAA 3EGXA 5E6UA 1U0OC 1ZONA 1V7PC 2VDNB 3NIGB 4CNBA 1IDOA 1IDN1 3IJEB 2VDQB 4UM8B 1UEXC 2NUTB 2VDLB 3PPVA 4XW2A 1U0NA 5ES4B 1SHTX 1MHPA 2QTVA 1RRKA 3FCUB 1JEQB 2RT5A 1MQ8B 3ZE1B 3FCSB 3TCXB 5KYXA 4C29A 3EGDB 1RTKA 1MQ9A 2NUTA 3TVYA 1MQAA 1N9ZA 3EFOB 5BV8A 3BN3A 1DZIA 1CQPA 1PD1A 2VC2B 3BQMB 1FE8A 1BHO1 4MMZB 3NIFB 4FX5A 3BQNB 1JEQA 4HQNA 3EH1A 3TW0A 4F1JA 3T3PB 1SQ0A 1U8CB 2I6QA 1RD4A 1YVRA 3EGDA 3HI6A 1QCYA 4BJ3A 3EFOA 4G1EB 2VDKB 5KYNA 1PCXA 4HQKA 3ZQKA 4HQFA 1BHQ1 3VI3B 3K71B 1NA5A 2VDPB 3ZE2B 1QC5B 5E6RB 4WK0B 4G1MB 1PD0A 2VDRB 1OW1A 2XWJI 3T3MB 3K6SB 4F1KA 4IXDA 1M2VB 1XDGA 1XUOA 3HXOA 2M32A 1YVPA 1IJBA 2VDOB 3EOBI 4DMUB 3F74A 3F78A 3NIDB 4WK4B 4Z7QB 1M1XB 2XWBF 4C2BA 1ZOPA 1QC5A 5E6RA 2X5NA 5KYWB 1SHUX 3PPWA 3ZE0B
chains in the Genus database with same CATH superfamily
1AUQA 3RV4A 2P75A 2P2NA 1WUJS 1Y9JA 3H1FA 3CH5A 2OM2A 3GJ4A 4EJ6A 4JI2B 3UC9A 4RQBA 1OFIA 2G17A 4GLOA 4KUHA 2OORC 1VFNA 4Q1EA 3OOJA 5CX1A 1Z4JA 1PN3A 2QRNA 2WKQA 4M9UA 1XFAA 2V03A 3TSOA 1BGVA 4I5IA 2V55B 2CL5A 2NU6B 3KPUA 1CLEA 1CK4A 2BDTA 4ZV7A 1KFKB 3BAZA 2VQDA 2VK8A 4QGAA 4JR1A 4B84A 5BXQC 5IU6A 1KY5A 2B21A 2QTCA 3QM1A 2O5RA 4AWAA 1LJLA 1XRMA 2GNOA 1FFAA 1Y6JA 1OVMA 3CLSC 4JSRA 2BTOA 2SCUA 4HH4A 4PEVA 1UBEA 4JXKA 5JQWA 1L7RA 3KOMA 3CJRA 3HKBB 4BNYA 1U1EA 5HGXA 4DMKA 4TRNA 2C7OA 3QVMA 3D7KA 4ILKA 2CKDA 4P35A 4HJXA 4QASA 4BCDA 4G0ZA 1GTZA 1N6HA 1COWA 3VNRA 1D6SA 1RAEA 1W5FA 4KLAA 2FDXA 4NZPA 4ZQHA 4F91B 5J5CA 1VJTA 3TB6A 4X20B 4B82A 1XMPA 1KK1A 2A7QA 2MWMA 3BBPA 3QHQA 5FOQA 1JXQA 1QIMA 3HJBA 4II2A 3GLGA 3PQ6A 2H07A 1QK5A 4PZAA 4NE7A 2O4UX 1DWPA 5EXDA 5KNDH 4NULA 2X77A 2JCSA 3QBEA 4CODB 3OX1A 1V48A 4FGSA 5DT2A 3S1LA 4BQPA 4CKCB 2I91A 2TECE 3BIFA 2AFHE 3CBQA 1C30B 2DH5A 5BSWA 5B5SA 2OAQ1 2XGMA 1BKDR 3OMLA 1G1AA 4QOSA 3CZ5A 3K0AB 1EWKA 5FCDA 1HRKA 2DG2A 2ZREA 3HFSA 3Q88A 1LI7A 2JEZA 2PTGA 2R97A 3OOEA 4LRTB 1ISMA 2FR0A 4I1IA 3UMCA 2W93A 1JU4A 2EZ4A 4N82A 3BRSA 1UDCA 2NUBA 4QAJA 4FGWA 1JSLA 1WV1A 1XZCA 2YMLA 4KLNA 5FUWA 3EDYA 3IKJA 4U3JA 2QVLA 4WNAB 3O91A 3TH5A 4RK4A 1FW8A 1C9MA 4DIOA 1YB6A 2IP2A 4RF3A 1PT9A 4PBRA 1JYSA 3VISA 3QK7A 1T2EA 4I5EA 5CA0F 2FB9A 2QP4A 1DELA 2QY9A 2OBBA 3D6AA 4HO1X 4PLGA 2AXEA 4ETWA 2XNDD 3RC3A 1UXGA 2O8NA 3CJQA 3FOAA 5AVJA 2CXUA 2DT5A 4FKMA 1NSFA 1B16A 2B6HA 2Q41A 1YACA 2OHFA 4Q3EA 4BWVA 4Q93A 1OW1A 1VLLA 1EG2A 5FOSA 3UTCA 4PX5A 1KWKA 4IXDA 4CTOA 3UCFA 3HADA 3OZAA 3DF9A 3DMFA 3ETLA 1DIRA 2MMCA 3RYHA 4COKA 4D82A 4OSOA 1TZMA 1EJ6A 1NU8A 2QVGA 2ZYTX 4V2IA 1NTRA 3V32A 4EG3A 4EGAA 3MOIA 3DTTA 3L46A 4JLNA 2PTHA 4U7HA 1GA6A 1XMOB 4A2WA 4L7QA 2ET6A 3EXHB 2CBXA 2G9QA 3S6JA 2R6DA 5DJ5A 1ZVKA 3CCFA 3KQYA 4MKZA 1GQOA 4MYDA 4C4AA 4DNPA 1A4XA 2JRCA 3D4OA 1TKBA 4KPGA 1IHXA 2JHGA 1ORHA 3H83A 3W8DA 5B64A 2G88A 2VSXA 4LRXA 5CM2Z 1WDTA 1CZHA 3ZU6A 4EOGA 5IX8A 3SKVA 4UE2A 2NU7B 4WT7A 2IU4A 1E92A 2QAGB 4YX9A 4G23A 3VR0A 3Q9LA 1R64A 1IN1A 4Z86A 4EQ6B 3NLLA 3A6ZA 3QYJA 2HC9A 3TBHA 1K6IA 5D00A 2G1UA 1ZLYA 2RSLA 3O9ZA 4KAFA 1XEFA 4RPLA 3DMTC 2IYPA 4UHBA 3IFSA 5F5XA 3RASA 2WQ6A 1PGQA 1XDBA 2V6GA 2WUDA 1JG3A 1TJNA 2ADFA 4KB5A 3PX3A 1OU4A 4XWWA 2R3SA 4G0PA 3VR1A 1OFHA 1XDUA 3I2GA 5K0NA 2HNKA 4HFNA 2PSSA 4JL5A 1T8YA 4YRGA 1S4QA 4OOFA 1YZGA 2AI2A 2O8DA 2W58A 4PLFA 4ZVVA 4X00A 2NZYA 6GPBA 4F7WA 3E0XA 1LTKA 1G1MA 3A8TA 2XEDA 4BECA 3PQ4A 3D8UA 3RYCB 2J31A 3GRZA 3HXTA 2H9AA 1U0OC 1QYXA 1ISHA 3ZV3A 3ZHUA 5BP7A 3LQ4A 1BG6A 1YE5A 4MV5A 4HH0A 2I7XA 1E5QA 2HLPA 2QJWA 2ATEA 4NOMA 4X7PA 3AP3A 3PHHA 5EMNA 3RG8A 3FFXA 3HMQA 4GYWA 1Y3AA 2YHIB 1HLFA 2H00A 4ZV9A 4PPGA 5EIBC 4Z4IA 2AG8A 1PU2A 2PT6A 1QGUA 2GPYA 4Y2SA 3D2CA 1TOAA 1ZX1A 2GTHA 2CD9A 5K0FA 1NC1A 5L3RA 1Y8RA 2FPPA 3C14C 4KRGA 4X1YB 1A7AA 1YVEI 1AKYA 2P11A 4J0GA 2MCFA 3TVTA 3QJYA 5ANRB 1QP4A 3MLAA 4CL2A 3H2GA 2P7HA 5HE8A 3ZW7A 1D5WA 4L9RA 2ZWPA 2XQJA 5LYYA 1SRQA 2WWTA 4ENUA 2BUCA 3TZLA 4DLBA 4QXRA 1ZIDA 4CF3A 1STOA 1V16A 4IICA 1U8CB 5CCBA 2JLXA 2R6JA 3L1JA 1Z8NA 2JA1A 5DGXA 5BVGB 3WADA 1IHUA 2VPZA 4NYMQ 3RSQA 3VOTA 3SHQA 1N9KA 2FLWA 1IK6A 2JCVA 2PL1A 3M2PA 1OLOA 3I5YA 1E1QD 3QVSA 3IV6A 3ZJTA 8LDHA 2R5FA 3F6PA 3RDPA 4QELA 4YGXB 1UJNA 1WJGA 4OCZA 2CKMA 1EESA 3LO5A 2OQIA 2VNJA 2EJUA 4D44A 4EGSA 1IJBA 4OX9Y 4DMUB 2CHVA 1BJRE 1EFHA 5BXYA 1RYDA 1OREA 2PH1A 3BDAA 4R9UC 3RVNA 4TLCA 1G21B 3NR2A 1B14A 2ZK7A 3BJEA 3W5JA 2BM1A 4F6RA 4WE3A 3N9IA 2F3TA 2G9ZA 2VRCD 2VNIA 4WKGA 3SX0A 4PC2A 4ZI7F 5HKKA 2DQ4A 1XRSB 1E2LA 1E2FA 1XTBA 1RXIA 1L5HA 4OF4A 1PJLA 3AF1A 2PPLA 2G5GX 2FFAA 1EFRD 4KIFA 3NONA 4Q3DA 4V03A 5ER9A 2OB1A 2XDQA 1E2BA 2P9EA 3A1FA 5H4HA 4U39A 5KOHA 2EP8A 2JBAA 3KOOA 4UBKA 2GAJA 2OAGA 4QUAA 1RADA 3KG2A 2V58A 2NAFA 1PT8A 2ZR0A 1JP7A 3ZWVA 1TU4A 3KSRA 5EJGA 1NV8A 3PZRA 3FDXA 1EZ1A 3QVJA 5CT4A 3NIBA 1K98A 3B3AA 1PNVA 1NPYA 4WOBA 1EFVA 1WAMA 3A1EA 2K5UA 5A5FA 2GZ3A 1G3MA 3LHDA 3WISA 2AL7A 1A9ZA 1NY5A 2ZJ6A 2HY7A 3ZCVA 1E99A 3IJPA 1E4EA 4JMPA 2BEUB 2C3UA 3F5FA 1XF1A 3IXMA 3IDZA 2ZRKA 1GGEA 3UG7A 3VR6H 2IXDA 3BHNA 4ZK6A 2CLFB 3AW8A 4PXAA 1R5NA 2RGCA 2WKSA 4G5GA 5L3ZA 3WAJA 1CG6A 4WXYB 1QBGA 3UUWA 1QHHB 3MTQA 3Q72A 2YJZA 3P20A 2ZJFA 1K8ZB 3PPYA 2NNWB 1CFJA 2ODPA 3L1UA 4UUMA 4DIBA 3WLFA 2C1ZA 2XVAA 5EE3A 3RHFA 3P9ZA 1K3UB 2BFDB 4NLLA 3G0OA 2CNDA 3H13A 4WBNB 2PGNA 4NBVA 3D59A 3FSGA 2P2CA 4URHA 4RKQA 3PA8A 2PMFA 5PGMA 4FHZA 2QUJA 3CG4A 1EPUA 4A16A 4MUMA 4MRMB 1QAMA 2X1VA 3KT8A 4I9GA 1QH1B 3I4CA 2IRWA 3KT6A 4FHEA 4N1AA 5THQA 3VDQA 1CQXA 1U31A 3IHTA 3I3SR 4G6ZA 1JHUA 2JASA 4MUXA 3W1WA 4YRPA 1M0EA 4Y1EA 2CCJA 2E2WA 5A4DA 3P52A 4IKEA 3A4VA 4L0QA 5ULLA 1ZD9A 2P3SA 4P58A 2SKDA 4YJ3F 4AY5A 1QZTA 3FYDA 3BXEA 3FPEA 3G49A 2QLMA 3M6XA 2UDPA 5H83A 4C29A 1FP4B 1X80B 3BXFA 4MWSA 1NBMD 3S2SA 1YRYE 4HK4A 4EB0A 2PKWA 3C85A 4B32A 2AWOA 5K09A 1NSYA 3N3BC 4MIOA 1WXDA 4CKEA 1D5CA 2X23A 2XIQA 3M5DA 4MHOA 3I28A 2XWQA 3FFAA 4UW9A 3EG5A 3VPSA 1V47A 2FPOA 2H9YA 2IYSA 3G0CA 4Q7KA 3TG8A 1RI5A 1YHNA 2KW5A 4C06A 1SNYA 1SCIA 3BMCA 3DLPX 4OUKX 1C3VA 1Q22A 2QYSA 1YA8A 3OO1A 1KRHA 1W8DA 2VVTA 1MC5A 2Q3CA 2X8JB 1Z6TA 3IYLW 3ZE2B 4CLOB 5CCEA 4YJ2B 1P9RA 5EWMA 1Y5IA 3GUHA 5DSZA 5B4TA 3C4QA 2HMTA 4PPNA 3AEKB 2FQWA 4QPPA 2X86A 3QW4B 1USKA 3IBFA 2CMKA 2W4IA 5L40A 3ZGYA 1KQFA 1NVTA 3RNOA 2BP7A 1LTQA 2ZTVA 2W2MA 3ZY2A 5FBZA 1ARZA 2R1TB 4TMTA 3FX2A 2O0MA 3UCEA 1TAHA 2H59A 4G5QA 1H8EA 5EJMA 4GKKB 1HETA 3NALA 3ZEIA 4M9QA 1AGNA 2D2XA 3CVXA 1H23A 5BPFA 5HRAA 4KK4A 5JIBA 1TFUA 3IS3A 3PQ8A 2G36A 1NURA 2GARA 4MARA 4E1BA 1IZZA 3DNPA 4G0VA 1U8YA 1O57A 3WGLA 1X92A 3GEPA 2RAFA 3AY7A 4LZWA 4UEKA 3OJCA 3OE1A 2JCBA 1IPHA 4AO6A 4X94A 4B9AA 4YMSA 3MUOA 5IYZA 4LRYA 5F1YA 5LIPA 3F1LA 3ZYCA 1KJYA 3J80A 3HA7A 1KOGA 5GOZA 1ZIOA 1NOKA 1TYCA 4FYMA 2F3PA 4QVGA 1G4UR 5FQNA 3WV5A 3EEFA 4IUYA 3SSMA 1YZNA 2IP4A 2Q4DA 4P31A 1EFCA 1C4OA 2I55A 4G0YA 1H9BA 3CXRA 1CD5A 2POCA 4BCCA 2P68A 4POAA 3X44A 4IIYA 3PNSA 3X0DA 4F38A 4HAXA 4AFNA 2E4ZA 4IJQA 3A31A 3IVXA 2CFRA 1UANA 1HMYA 3GLGE 3OE7A 5F2NA 1WCXA 4MWGA 1X7XA 4HXEB 1UKZA 3IC5A 4J94A 1UAGA 5A6SB 5JAMA 1NI4A 4L5AA 1BW9B 1DEKA 3WAGA 4G9BA 3LXUX 4U2CA 4L02A 1KYXA 1GZ6A 4WXHA 3L92A 3C5WP 4QUEA 2H65A 5SY9A 1KRXA 3OIUA 3V1LA 5MN6A 3HWRA 1C7FA 4O0MA 3SSNA 4KAXA 3DFUA 2ZG6A 1VHDA 3PFBA 3A6PC 3CVVA 2NTVA 5IN5A 3AJEA 1PF7E 3OQBA 1AY0A 4RV4A 1P2BA 1P4GA 2KSQA 1CY6A 3N0WA 2M6LA 4NMXB 1K92A 4BLWA 2VJLA 4H1TA 4J0KA 2GM9A 1JEQB 1LBHA 4EYSA 1ZK2A 4B48A 1FYFA 1NG1A 1NVAA 3DE1X 4KNWA 5E3IA 1SBNE 4BFXA 2O48X 2JLVA 2Q8PA 3PLRA 3G0BA 2IUSA 3IULA 4M1TA 3WWPA 3WLKX 3IKVA 1TEHA 3C6KA 5I01A 3JAKA 4BJ5A 2BGUA 2I6XA 3OKFA 3L8CA 2CDBA 4RKRA 1Q0HA 1ZY2A 2NNLD 1BEEA 1NZFA 1ZKDA 2O50A 3SC2B 1N5JA 3W05A 1Z4NA 2W2LA 3KVYA 5KKAA 5TS3A 5KHLB 3PEVA 4NCHA 4QYTA 3EGDA 4MVJH 5A62A 1ZUNA 1IATA 5EAIA 4IUDS 1QFMA 2FPGB 4UU0A 4MKRA 5HK8A 5K5EA 3CVYA 4QU0A 2IHYA 4C6RA 5MFZA 1EP1B 4BE7B 1FRQA 3L1HA 1B15A 2YIMA 1N8TA 2YV4A 3T7IA 1QV6A 2AYYA 1PD0A 3DVAB 3P2EA 4LCJA 2NPOA 4GICA 5FPTA 4GL2A 1BDMA 4QOGA 4BO8A 2WEKA 3TF5A 5K0EA 2Q8NA 3GCWA 3OQJA 5BUQA 1NNI1 2XADA 4EB6B 3OZGA 4ZZ1A 1RWKA 2ZRGA 2C9DA 1XZFA 2C5GA 3FIUA 4LVUA 5BMVF 2IV7A 1OH8A 5EPUA 1C8VB 4KNVA 1M5TA 3KFXA 4R81A 3QI2A 5LP6B 1DAGA 3KOWA 3PF9A 4TTPA 3WLEA 5KKCA 1II8B 3EF3A 4NU6A 5KVAA 3HK2A 2VHXA 3R44A 3IMGA 3U3DA 2AF3C 2CYCA 3NRJA 5EWJB 1G98A 4JB0A 1WDLA 4Q7JB 4TUYA 5ICEA 3D6FA 4BDTA 3FTNA 4A10A 4Z1MA 3F6RA 1QK3A 4GL4A 4WASA 4ES6A 5F5LA 2F62A 4QDTA 1YMQA 2CLKB 1R5JA 3A6DA 3E7FA 3EDMA 2YWDA 3L01A 4LYAA 4PONA 5DMXA 5B1SA 5LJLA 1AKEA 5HMMA 4RY8A 2MSLA 4B6OA 2QRZA 4Z9YA 3OESA 1NASA 2EFJA 4FKZA 4QPCA 5CD1A 4QECA 4C3UA 1J5PA 4GOOD 1XXHB 5AVZA 2UVQA 3PIRA 5HKBA 5EJAA 3BSWA 1FYEA 2PSEA 1ZJWA 1KEZA 2V96A 4JBGA 2R8XA 4OHUA 2PRYA 2L17A 4Y6OA 3IOCA 4XWTA 5IAEA 2CZQA 4PCAA 1NVUQ 1JKXA 3B5JA 1EB9A 2V6JA 1F6BA 3DZKA 1PHRA 1Z45A 2GPBA 3GEIA 3H0KA 4G1UC 1HDIA 3ET5A 4MR8B 2DUJA 2B69A 4MROA 4EEXA 4DPKA 2BONA 1OT5A 7YASA 1N2EA 3O0DA 4KR3A 4G1VA 3IUJA 4R8RA 1C2TA 1IEWA 3KSDO 4R1UA 3VR4H 4DCVA 4H1UA 4TT3D 1JF8A 5K0JA 2ZIZA 3KKKA 4I8DA 4LPSA 4P83A 4IJ6A 4PFSA 1GV0A 1G6HA 4IH9A 3RTGA 2RGRA 1V9SA 3R5KA 1EUZA 1ACLA 3GEGA 3OIGA 3PLAE 2JC3A 5D1NA 1WXIA 3THWA 1OC2A 1GA4A 5F1KA 1XPRA 3UJBA 1T8SA 3FCYA 2BH9A 3DUFA 4ALMA 4GSLA 1TADA 2VDNB 5JNUA 2WV7A 3MF4A 5EQTA 1M2WA 2O2YA 1G3IA 4C22A 3T3NA 4RQAA 1W1IA 1IHPA 2HRQA 2JIDA 3C8ZA 4RETA 3U80A 3U48A 3VC7A 1A97A 5D6OA 4ENPA 4YRJA 2QW8A 2COKA 3HSKA 4WLEA 3PFNA 4REMA 2AC7A 2FSFA 3H2JA 1T9CA 1ONPA 3IP6A 1XZLA 5E1OA 3HZOA 5HF5A 5KCZA 4HAUA 3ZYZA 3LF2A 3LG2A 1EHCA 5C34B 4LDPA 3MTIA 3DONA 4ZODA 3OAAD 1I1HA 5LXTA 4G0OA 2NUTA 1ZH2A 3KJIA 1QYIA 4A8PA 2QD5A 1PR0A 3FPKA 1NVVQ 5DNYB 3GZNB 3FE2A 2XH8A 1A72A 4RS4A 4KOEC 3QITA 4CMAA 5JEEA 3LTNC 4TKVB 4M3NA 1X1RA 1J8MF 1JDBC 2QE7D 1NP7A 4K1XA 1G16A 5ALPA 1NKVA 3M6UA 1ZS9A 4ZEOA 3B6KA 1OAOC 4O25A 2PMEA 3D6HA 4KR9A 3ZHRA 1M1NB 1PL7A 3JALA 1AKQA 4CM4A 1E32A 1HDRA 1OE0A 5BMOA 3MWDB 2EFDB 1XHLA 5TPWA 5SZKB 3B1VA 5AK0A 2HTFA 3AHGA 5FO0A 2GYUA 4YQFA 5KNCH 1EFPA 1XQWA 3RJTA 2RIPA 1JHYA 3L0SA 4M1YA 4YRIA 2NXJA 5J47A 1B8OA 3O4IA 3VKHA 3ESAA 1FQJA 4DKJA 2B1GA 2JAXA 5H3LA 3DMDA 2JI7A 2WUEA 3DD1A 4M8IA 3IAAA 5HFNA 3WYDA 4PBSA 2PUTA 4BMNA 5JH7B 1I7QB 1GAWA 3I9LA 1JX6A 2E4XA 2IIPA 3B78A 3TRIA 1CJSA 1GNPA 1SQ6A 1ZU5A 5KQMA 3OFJA 1YFJA 5I7EA 1T0IA 4QATA 1J1ZA 4ZO9A 1ZN9A 5KTYA 4RHTA 2RGUA 4OAOA 5BSUA 4AG5A 3G2IA 3NTOA 4DUGA 3KIPA 2N42A 3PUXA 1GLGA 3HBMA 5GJWC 3YASA 3V4SA 1W0KD 4YJHB 2BW0A 3G9ZA 1M6EX 1MB4A 1ZMRA 2W90A 3Q1KA 4R3NA 4X91A 4EW6A 5ITZA 1Q57A 3ROZA 3O84A 4N5DA 3HACA 3QA3E 1SUPA 1X1AA 1Y98A 2XAUA 4R8KA 1FQKA 1QDUA 5IW8A 5IUKC 2NADA 1W5SA 5D86A 5CFLA 2NYUA 3KQSA 4HLCA 3OFVA 1U6KA 2VI5A 4IFIA 4KODA 1NYTA 1TF5A 3FPCA 4BFCA 2IIVA 4L73A 1RZRA 1RM0A 3EZ2A 4FKBA 2RAUA 4IW3B 4L8GA 5HMLA 4R2JA 3WB2A 1I6LA 5DULA 4IHAA 3T6KA 1SU4A 2OZPA 1A1SA 1P0PA 4FWBA 3JRNA 2OVFA 4NHOA 1U7OA 1TCBA 4K1LA 1NNUA 2JFWA 3TX2A 4ND3A 3WLSA 3O5AA 3AXSA 3KUXA 2ISSD 3Q10A 1VKRA 4R16A 3II6X 3ORSA 4TMVA 5AJUA 4GPAA 5IARA 1ODIA 4LC9A 4FGJA 4A2CA 3R9XB 1T5LA 4B6SA 1TLLA 1EWYA 1NY6A 3GDFA 3RK0A 4NENA 5F76A 2JZNA 2QE6A 2RHMA 2PH5A 4HRAA 1VI6A 1EVJA 5K3AA 5H80A 4OKSA 3AUXA 1F06A 4S24A 3LNCA 4M83A 5JALA 4KXUA 2C1XA 5FIUA 3INNA 2WSSA 4CNBA 5DM0A 2RDMA 2XPCA 1J20A 4JI4B 4P3PA 1DQPA 1QQAA 3EIHA 1S89A 4BNTA 1Q50A 3MBOA 3CVJA 1KFBB 4MULA 3ENNA 3M9LA 3G89A 3W9SA 4F5DA 2QGFA 2X14A 3LPCA 4QU9A 1E3IA 2PL5A 4TKUB 3LHFA 4B33A 4CQJA 5KTPA 4O6VA 1R8YA 1XD2A 1ZUWA 1Y7PA 1U9ZA 4I8XA 3CKLA 2IELA 4NJMA 1H9CA 4AZWA 2V7EA 5AKHA 5BYBA 1XEWX 2I7CA 3HABA 4F2WA 3AIMA 4CVNA 4OL0A 4ALNA 2IS4A 2E85A 4KE8A 2QTBA 5EEGA 1CQIA 3UMVA 5LLDA 1UZMA 4AW9A 2MSNA 5G0WA 1VE7A 4EKEA 2QSZA 2GLUA 2XNFA 4IX1A 4LZJA 1PKEA 2BFMA 1QHIA 2GKOA 3TMKA 1M7HA 2GRAA 1FJHA 4IOLA 3V8BA 1RE0A 2XF2A 2AH5A 4HVTA 4UVIA 4B4VA 3E3OA 4OHKA 3TD2A 3WQHA 1QIHA 3AF0A 1AKWA 3DTYA 3MWJA 4GPBA 4PSKA 2NZJA 1EK1A 5EE9A 3B2EA 2WM2A 3OJEA 3VXKA 2DQKA 3T54A 3PITA 4ZMBA 5JXWA 1QS0B 4ZVKA 5CIYA 1KK3A 5MGNA 2XXAB 1KI7A 4ZOBA 1CERA 1VQ1A 1XMVA 1XTJA 3NEJA 1KMNA 4TRRA 1XZBA 3O73A 1ZQ9A 2FSHA 3CN9A 3WYBA 1L4HA 1UK8A 5A4JA 5B53A 4C4PA 2W6JD 1J56A 1ZK4A 3PCTA 1TC2A 1O6CA 2FEXA 3ANMA 1YQTA 1IQUA 2F3RA 4V24A 5FTKA 4OQYA 1PRYA 4HDNB 3T7RA 2AZXA 5EYPB 1ZVJA 3PB3A 1GKYA 5CMLA 1DJPA 2I3BA 2WF9A 4J0JA 2IGBA 1OX5A 4TLDA 2ZI5A 5BOVA 2PD3A 3IX7A 2V4ZA 4KUEA 1TA0A 3DJFA 3HY3A 4ZOEA 5ECWA 3UMYA 4DYDA 4BPBA 1E4YA 3NXSA 2WVAA 4GSYA 4QQ8A 1QNFA 3B36A 1QKJA 1M0WA 1BDBA 1J97A 5ALOA 1KTIA 4JX8A 2GA8A 5JCOC 1N34B 2OLEA 2GTPA 4GMHA 2H2HA 3PKIA 3W6PA 3GPLA 3ZEAA 2XGGA 1GNLA 2IGTA 4FU0A 3LQ1A 3IE1A 2Z04A 4YFYA 2AJCA 2D3WA 5CB0A 1ZU4A 1BSVA 4XXHA 3WYAA 4D8WA 1BFDA 4RIEA 4NDAA 4AKEA 2D1FA 4JWTA 4AQYB 4OUDB 4BUJA 2QIOA 1GQFA 2WG1A 3NC4A 4OTZA 3U49A 3V33A 2QVXX 2B8TA 3EXFA 1TZKA 5FBRB 3MUEA 3OKCA 4UZFA 8GPBA 1L4UA 2RGEA 1EXDA 4NH4A 1XPOA 3BORA 1SXHA 5I45A 3ZCPA 3DJYA 3HV2A 1IM8A 1N4DA 3V55A 3V5NA 2AHOA 1ECJA 4MS1A 4ZAZA 4URXR 2XQFA 2FPWA 3DZGA 3K6RA 4C3OB 4KN9S 4DV5B 1O77A 1W29A 3N0RA 3OI7A 5DRTA 4UDOA 4HVCA 3SVLA 5A7FA 1IDOA 4F9GA 3E9RA 3NOOA 5SZJA 2XVXA 2H5IA 2WE7A 1OI7A 1E7MA 3AGPA 3AM5A 3NZEA 4L4YA 4MP8A 5F3DA 4R71A 5I9LA 4F6CA 5IKPA 2BEVB 5JWRA 1E9DA 4NC9A 2XDAA 4KFCA 3GLHE 4P7KA 2IBMA 1QPZA 3KYIB 5BWMA 3OEEA 1ULBA 3PT5A 2XT0A 4P5DA 3WXMA 4QFDA 2CJYA 2QP9X 1R6XA 1Z6YA 3O8DA 1V8FA 1KO1A 2I22A 3BD7A 1G41A 5JAUA 1WLYA 1UJ6A 5JARA 1WW8A 1ZEMA 3N2ZB 1NJ1A 3IV7A 3D3JA 5I9MA 4A1OA 2YL2A 4L3VA 1U1CA 2Z4TA 3V3TA 3VRHA 3WRXA 3V2IA 3SEQA 4C78A 3C3YA 4WCVA 2DUWA 4FUQA 2VJMA 1VKNA 4WNCA 4GP6A 3V80A 2LPMA 5GAJA 2BFCA 2QLJA 2JFPA 4XIIA 2EJTA 1YVRA 4EDFA 4EPWA 2BZSA 2GCOA 4PZ0A 5C80A 1Q3KA 3DLHA 3AVUA 1DXYA 2QTHA 1JMKC 4MI9A 3RFVA 5ALZA 3RYFA 2WT8A 1GUYA 2ZT5A 3M6VA 3CZPA 4JKYA 1YA4A 3S2FA 1RFGE 4L5CA 4EATA 1JHVA 4O1HA 1JXOA 2CN1A 1K6EA 2NSDA 4OB6A 5AXAA 2JJ2A 2KMLA 2ONKA 1Z6XA 3EGEA 3HUFA 4X6LA 4F1KA 5FBQB 2A9JA 4YAKA 2BJHA 1AK2A 4GMFA 4P3KA 4E4RA 2A1UB 4KIGA 1FU8A 2WIDA 1JHAA 1KR5A 3G8CA 2JI4A 3GUVA 1KZGB 3OIDA 2PSDA 1KSGA 1JNXX 2X2EA 1G4HA 3WA6A 2B99A 2IEGA 2ZUTA 4BBZA 2AUTA 1H6AA 4ASUD 3GBSA 4YAGA 1N2CA 5BR8B 1ULSA 2X5NA 3IXQA 4PIMA 5BSTA 3R4VA 1P7YA 2H51A 1CIPA 2IHTA 2WABA 3FKJA 2A9PA 3HL4A 4OFBA 5FJIA 3RO7A 5KOJA 4RZHA 2RHBA 2Z30A 3DYVA 1CCWA 3FI0A 5EUMA 1WE2A 5KAPA 3UH0A 2ZVPX 4JUAA 2XGSA 1GCAA 3I2HA 3MXTA 2BKUA 4F4JA 3TLGA 2FW9A 3DWEX 1OXBB 3IILA 3C3KA 1RYBA 2RGNC 1T8WA 1HOTA 4NCBA 2VQ3A 4N5NA 1ZINA 4KLZA 2H1VA 4E2FA 1Z08A 1OSNA 3VM6A 5C1IA 5BT9A 1NE2A 5LZ9A 1E0JA 1G5HA 2PBFA 3JVEA 4I50F 4ZMSA 1BX1A 3SDSA 3WNBA 4IIJF 1NMXA 2IL1A 2IWHA 4ARVA 4DC0A 1P0IA 1D2CA 2D2VA 4AL4A 1VZ3A 3FVQA 4BGVA 4MJ3A 4RMGA 1T5OA 4Y2GA 1XR3A 3E05A 1XKXA 3HS3A 3OQ6A 4WACA 1WMBA 2FF5A 3COPA 2ZRNA 2QMQA 1YK1A 4HUQB 3R0XA 2G0NA 1XEXB 4GZ3A 3BTSA 2NUPA 3BC1A 5A4IS 4KSCA 3KYDA 2BISA 3BE5A 4IIGA 1DP4A 4ARBA 4IVNA 4IY1A 1C4KA 3R24A 2JIRA 5BW8A 1W36D 3ACDA 4JEIA 2VYNA 4U9IS 1NM5A 3CKYA 3IPLA 4CCWA 5DRYA 4L08A 4Z2AA 2E4VA 1L5WA 4ETMA 5K9ZA 1ZJ4A 2GBIA 3LA8A 3VU3A 1KR2A 2M6KA 1ISIA 4A6EA 5D8DA 5CFPA 4FZ3A 1PYDA 4WESA 4L74A 2EW1A 4YGYA 1UQTA 2R8OA 2VP5A 2VOEA 4AG6A 4ADSG 4ZCSA 3FPJA 3QY0A 1ILEA 1U2SA 4KQMA 4IWYA 3DH0A 2GD2A 3HKEB 4QUHA 3SD7A 3HNPA 4CF7A 4AQ7A 4M1MA 3VU9B 3F5DA 2J8ZA 2B78A 1WLSA 4IF4A 3BFXA 4UC0A 4ZFNA 4MV4A 3E5NA 3QKSA 3T8YA 3W4JA 3N70A 3WSTA 5CDTA 2B4AA 2Q3DA 3OLZA 4JI7B 2Y0DA 1CQPA 1DE0A 1GADO 1PWZA 3K1AB 3FRHA 3P0RA 3WHLA 4EF6A 5B30A 4K6OA 1N6OA 4U6NA 5CB4B 1O97D 2JDID 1UBCA 3UJ3X 2HNBA 3ZDRA 2VTBA 1SQ0A 1XB2A 3R3SA 4RMIA 1MX3A 5FPPA 2A4KA 5IHXA 2PSHA 4E6EA 5B36A 3G2QA 3EXG2 2CDCA 1M7BA 4GI2A 3ZBQA 3ZXXA 3O2NA 4JOQA 4R84A 3ZW8A 3KSAC 2HYIC 3QXJA 4MEJA 4TQUS 4WY2A 3ZDBA 2JLQA 1U5CA 1QOZA 4TV9B 2DFTA 2D0OB 3OHMA 4FEEA 3UGQA 2O3TA 4M9RA 1JZQA 3QUSA 3VNBA 3AEQA 3DZBA 3VPCA 3MRVA 3HCFA 5CTAA 4C89A 2RGWA 4MJLA 2BRUC 2PS9A 5CVCA 1SKUA 1TDJA 3IBTA 4E14A 1CDEA 5BN5A 5K99A 3DFIA 3E9MA 1PVVA 2HHJA 4GWLA 1R0KA 2J7KA 4W1SA 4R51A 1T1IA 2QBYA 5KYWB 3K6SA 2D2FA 4Z3DA 4IDEA 2F2TA 4EPYA 5FEUA 3PR3A 5FB3A 1GNQA 3EIWA 3R7WB 3ABOB 4EJ0A 2JGNA 4W5JA 1XLTA 1D7AA 5LB2A 1DEAA 4E2XA 4AF8A 4Z9BA 4CT4B 2FEWB 3AVTA 5DLQC 3PXGA 4M8SA 4JXZA 1L5YA 7AT1A 1MDBA 1JFRA 1ETUA 2D5IA 4HQLA 4G41A 2JHPA 2NVWA 4MUAA 2C9OA 3IUQA 5IVDA 3VKVA 4EG7A 1HRDA 1THMA 4YRKA 3GUYA 4PX9A 4TLMB 4DIMA 4DWOA 3VZBA 2BHTA 3U13A 4ISCA 3CT6A 4I8IA 3H75A 4JJ7A 2VPYA 1B6SA 2VPQA 1E9RA 3IKTA 3LE8A 4W7IA 2BGLA 2CNNA 4TYMA 1W76A 2VO1A 3LBYA 2VXOA 1W6UA 1D2MA 3PE6A 3ZHBA 4YECA 2EBFX 1ULTA 3CLVA 1JJVA 4LPKA 4ABYA 5K8LA 5CNIA 3QXSA 1JN0A 4HGOA 1VE1A 3CUEF 4WGGA 5DF1A 3WMFA 3S2YA 3IDAA 4OJKA 1VE9A 4EO4A 2AMJA 2PIAA 1T13A 3IAM6 4PN7A 2P6PA 1EIZA 4P7FA 1PJ8A 2FPRA 4JAVC 3BCHA 2MINB 4P3NA 1YDHA 3MBIA 3PRKE 4RPGA 3UAWA 1Y8QA 4F11A 3VOSA 6REQA 3GEHA 4MPDA 4MRNA 3CX3A 5EHZA 3OZ7A 4W5RA 4DV0B 1HDEA 3QEKA 2JH3A 1OB2A 2XB2A 3SFTA 2HIMA 2JGRA 3GRFA 2D4AA 2Z56A 4C7OB 3A11A 3EMVA 3AU8A 3R4CA 1JR3D 3OCWA 2ECPA 2M6SA 4BASA 4E94A 4JU9A 5C4IA 1DPGA 3VTZA 4EKGA 5JFOA 1WF3A 2X0NA 1QM5A 1FDWA 1GUAA 5AI6A 3JQBC 3DVRX 4NOLA 5C8YB 3A06A 1HF3A 4D3FA 1U0NA 2D3TA 1X19A 2FWNA 2LVBA 4O2AF 1PJ2A 3L4BA 3OZWA 3GDGA 2FR1A 1DMRA 1OH6A 2QQ0A 1KI2A 2A9RA 4HEQA 4HEJA 4W8HA 3RLIA 1B1AA 4RSHA 5HQJA 3AL0C 2C03A 1AXRA 1ZSVA 2XYGA 1EWTA 3EFOB 3WMRA 1SZDA 5JVDF 1T2FA 3REOA 1Z74A 3ETEA 4YFVA 1WTAA 4P7BA 3KYBA 3NIFB 2BPOA 2FETA 2NSLA 5GADl 2VAWA 3QU5A 4WEOA 5CFOA 4I1OA 1EAYA 2I6QA 2WF8A 3PWSA 4ZKDA 1S2NA 3QX3A 3DTNA 5ICCA 5M29A 1CY1A 2OD9A 2WIKA 4G1FA 1IJFA 1F60A 1GG9A 5B3AA 2FEKA 3GLRA 1KJ9A 3RE1A 2ZWMA 1HG1A 1ZH4A 3I5XA 3HDVA 1L7OA 1YRQA 2VXYA 5TMDA 5LA6F 1MOPA 1D2EA 1QSGA 3OTIA 4QBIA 2YJ4A 3EYWA 4BXOA 4TS4A 1S5PA 1MR3F 1PW5A 3AHEA 2M6RA 4WLNA 2HQBA 3GN1A 4BB0A 2BOVA 3QWFA 2VDOB 3VDMA 5C5DA 5L3VA 2XLCA 2APJA 1OT3A 4BNDA 3TQOA 5TVGA 4LFBB 1G9TA 1TM3E 3HKDA 1UPBA 3OURA 1OR8A 1UK6A 4I6EA 3ROKA 1HDCA 4NG5A 221PA 1NI5A 2AMYA 3FDZB 1S3IA 3R5XA 3L0DA 3I62A 4FFDA 1RLTA 4RIGA 1GXSB 2DC1A 4JDUA 1UH5A 3F7NA 3FYUB 3K0SA 4YRDA 1CP3A 1W49A 1X87A 3DOOA 4YCJA 1U5BA 3DKIA 3NEAA 1TGVA 4H1HA 1R0YA 2OV8A 2VTKA 1XWFA 4FYHA 4LJ6A 4MW0A 4O4LB 3RVLA 4AKIA 1ULHA 2B35A 4YS6A 3CY6A 1AD2A 3B1KA 1DKPA 1KZYC 3L02A 3QOWA 4FFSA 4BNJA 1J2TA 3U09A 3A3NA 4YBRA 3A9UA 3MRSA 2AC4A 4BZZA 2FFRA 1M66A 4ZD6A 4JC0A 3EXHC 2JARA 4HQ6A 3IPCA 4ZAGA 4EENA 1W2GA 2BTQA 2TMKA 2GCNA 2P30A 3GQBA 4MVJM 2B1RA 1NBOA 1WO8A 2PCLA 3NHKA 3Q5DA 2ORYA 3TIVA 1YC5A 3JQ7B 1M2KA 3V4RA 4LJSA 3K0FA 4B4DA 1ENPA 1TT5A 2CLOB 2ZETA 3MB5A 2QAGC 4M7RA 1RM5A 1Z36A 4E12A 1CF4A 3C3JA 1E1NA 1QNLA 2ODAA 4KTVE 1A8PA 2GJKA 3G6WA 4BZPA 1VPEA 3P2KA 3TTYA 3WL3A 4B85A 4PX3A 4R2HA 3NUZA 2VJOA 3LMKA 4TVKA 3C3DA 3NHYA 1BD3A 4C5AA 3CRQA 4RD1A 1N7JA 3W5VA 1YZQA 3FSEA 1SKQA 2IV3A 4GRAA 1SD5A 4HLUA 1NW3A 4CKYA 1P2VA 3EGXA 3K3PA 4BMVA 3W7VA 3C87A 1K27A 4AJ9A 3WLHA 2Q7OE 3FN4A 4N3GA 5J2UB 1OF1A 1CS0A 3F4BA 2VDQB 1Y89A 5C3MA 1HM5A 3WLOA 1N2SA 2Q1TA 5DWDA 1G8PA 2OILA 4UJ5A 3KM0A 1AMNA 3U4QB 1U7DA 4BUZA 3ZY5A 3LLUA 1M1YA 2PMKA 3IBYA 3NEPX 3JZIA 2ZQYA 1NZDA 2OC9A 5CPFA 3M9XA 4NMLA 3DKPA 4NZMA 5B1HA 3VZCA 4CM9A 3FAKA 1M8KA 4P7JA 1E9FA 4W5OA 2VJDA 4JZYA 1MTOA 4QC2A 2XTJA 4HWSA 2WT9A 3Q6NA 1R0SA 3BQNB 1B6GA 1LSOA 3T3PB 2ZJ5A 1RJFA 1BFUA 1G20B 1VG9B 2QJRA 3RK4A 3X1XA 3HB9A 3Q3CA 5DM2A 1J21A 4A92A 4OYHA 1ILWA 2XEXA 2HM7A 2FWRA 1ZD2P 2R87A 3BE6A 3N2KB 3NEYA 3QKWA 4HB4A 3ZWQA 3ZU3A 1C3XA 3RRXA 3ZWPA 3AI3A 1ADBA 1X7ZA 4KSYA 5TV2A 5CA1A 1E6LA 2FDRA 2EKZA 3VUEA 4CKBA 1XKQA 5ELXA 2X4IA 2W83A 4U5XA 1R0WA 1ZD1A 1NP3A 3EZYA 3EAFA 4HC4A 3Q7SA 1TZJA 5IPFA 2R84A 2QL6A 2J48A 2HU7A 1CJTC 3QF4A 3EWSA 4C08A 5T57A 5KMGB 2E48A 2EKDA 3PI6A 4RTQA 5MFPA 4N47A 4FJ1A 1N2CE 4FFMA 5CLJA 5LIRA 2R0QC 1JAZA 1QPGA 3OM0A 3EBOA 1OAAA 1PZGA 5LNK6 1N75A 2YHSA 1JFSA 1UP6A 3LT5A 4QQKA 1T6XA 3OD1A 1K8XB 2QAJA 2XCIA 1LY1A 3KEMA 3N5CA 4FGKA 1OIVA 5JEDA 1O3YA 1X15A 3K2EA 4FYIA 1GPBA 2V54A 1ZNXA 4Q1VA 4RACA 1WDMA 4XIYA 1JEAA 3HYNA 3GL9A 1OZGA 3AG6A 2RE8A 3H99A 1MF7A 2BHNA 5GP1A 3AOGA 3RJ5A 4JR2A 2YXPX 1BXGB 2FKNA 5FORA 1G0OA 1NHGA 5REQB 4XUCA 3VGJA 4D8UA 1FTQA 4CWAA 4C2AA 3KT0A 4CFSA 1HV8A 4JOBA 4QTUB 5L53A 3Q0IA 2Z43A 4FXOA 3QVOA 3UKDA 1JPJA 1SQ5A 5FUMA 2WVJA 3ESZA 1D2NA 2WIGA 2X7XA 5ALSA 3TKLA 3U7RA 1EX1A 3W9BA 3GEMA 4Q4LA 5GGYA 4XWOA 5DGCA 5BOSA 2R96A 1VL8A 3W04A 4U1RA 3DCIA 2R5NA 5CDSA 1C50A 5EP2A 2QW1A 2XZTA 3PNYA 3T61A 2DWOA 1YZLA 2H18A 3L8DA 5IVKA 2WJZB 3WDSA 4RZ2A 5IC4A 2HXYA 3PJGA 2IXAA 2G8NA 3A4YA 3AUUA 1Y6ZA 3PR2B 4PVCA 1IVYA 3L4SO 1OI4A 5FNVF 2V7GA 4JBYA 3GNSA 1DU4A 4Z0NA 5M3BA 1RQGA 3WLJA 4Y1RB 2JK0A 4MOWA 3TW8A 5F52A 2PGIA 3DT8A 2VLIA 1SU6A 3ILSA 1QR2A 2Q1UA 4Y0NA 3TR6A 4CZ2A 1PWEA 1SCQA 1LPOA 3EF0A 1CUBA 2B4KA 2HLDD 1WXHA 2IDZA 4PQYA 5JJIA 1ZOLA 1NJ8A 4UTPA 1VIAA 1NPTO 3CEAA 1JS1X 2GMWA 1DVRA 4HEA1 3CZAA 2PS0A 3C6XA 3RGGA 2RGXA 3RUPA 1GOTA 2WWXA 3AUJB 4UM8B 2Q99A 4Y0AA 3OM1A 5A4AA 3ACCA 2GN9A 4DG9A 4W1PA 4MZXA 5U1PA 4G01B 4TMFA 2QTVA 5E2BA 4D3DA 2HZBA 2PUFA 4JLVA 9ABPA 4A0SA 3CUTA 2A9OA 5K8VA 4KXQA 3SJCA 3CONA 3ES9A 1II9A 4JC5A 3C1TA 3KQUA 1JKJA 1LW6E 2J0VA 3WB0A 5BVHB 1PR3A 3AVOA 5JI2E 5U9CA 1SIOA 1FFDA 2XY4A 4UAGA 3SE7A 2IWRA 5DTRA 2YMQA 4B7ZA 4YN3A 3PHIA 4HDSA 1G4AE 1PSDA 2H5JA 3KL2A 1DIOB 1GFSA 1ZD3A 2H2FA 4KXYA 2HJRA 2GBGA 4ZVSA 4BMPB 1YS1X 2G71A 2AOTA 2HA5A 2VUSA 3HDGA 1G0NA 5EHQA 2H11A 3VZSA 4X64B 3U16A 3Q8WA 4CEHA 4EHFA 3OCJA 1AQYA 5A02A 2I9KA 1DHRA 1I5EA 1E3QA 4G4SP 3K71B 1TYZA 3H9JA 1A7KA 2HMVA 1FL9A 2QV0A 1NG9A 1GDDA 1DQSA 1US8A 1XELA 1XNGA 3H84A 1QIFA 4HBZA 4PSDA 4XQGA 5ILQA 3SBOA 1NBWB 4GWGA 3K32A 3V1YA 5DXAA 4DWVA 4UASA 2R48A 2BMAA 2J3JA 4QBKA 5DNWA 5A3VA 4EMUA 2BFEB 5LU8A 4Z7QB 4KLRA 1WZIA 1MX1A 2XNDA 3CNHA 3U1VA 5IMSA 3ME5A 2HSDA 3NBQA 3ZIDA 3OT4A 1Y8ZA 2OCBA 3ZVRA 1W581 3O3CA 4INJA 3GH1A 4FR2A 1UDAA 3CC8A 4Q16A 3DGFC 4Q9DA 4YCLA 1IRIA 2NU9A 3D7MA 4N7JA 2ODEA 4WZ6A 1SC6A 2GZRA 3F67A 2WJWA 3GEBA 4WXRA 2ATCA 2IYLD 2RK6A 1DDOA 2OP0A 2WOOA 1CUSA 2HSWA 3BB4A 2FP4B 4KXNA 2BUAA 2KPOA 1EK2A 3U3XA 4B43A 3Q12A 2H8GA 1R6VA 2IF0A 3T99A 2DTDA 5K4HA 2HBQA 3ITNA 1Y1QA 1XDDA 3EIEA 3FTEA 1XJ5A 4MCHA 1PQPA 4LOAA 1MQSA 5FWXA 4CETA 1PJAA 1IJKA 1OX4B 1ODTC 3IVMA 1ZK0A 4LI0A 5TPZD 2ZXFA 3THYA 2RI1A 4MQFB 3TSYA 3WL4A 2VHQA 5BNFA 3EVFA 2LCIA 3DWFA 1E64A 3UBMA 4BEJA 1L4MA 1FFXB 1R9MA 5EZYA 3W2TA 4XAQA 5GIOE 4LA4A 4TSFA 3FNEA 1TUBA 4MNTA 5IM5A 4Q03A 5D85A 4ND8B 1NR5A 3DKRA 4C4ZA 3FHTA 4F04A 3ABQB 1GSAA 1PI3A 2AUNA 4CMGA 1DCTA 3MWFA 2IUEA 5LJIA 4XYGA 1PX2A 1WUYA 5JRJA 1E1MA 3L82B 4TTQA 2HDWA 2RJ3A 4B4WA 4D81A 4EPTA 3BREA 4UUNA 1GRRA 1CUFA 2NZWA 2IU6A 2Z8ZA 4L0MA 2OFOA 1M33A 4BEVA 1YUNA 3ZCSA 4RTOA 4OQXA 3OJOA 3BMOA 2R4UA 4DQXA 2RHDA 2FV8A 4FQ5A 3H05A 4HUJA 4N0PA 4P08A 1AKMA 2GT1A 3GVHA 2D54A 5EJ9A 1PVDA 2GBCA 4JA2A 1SA0A 2P9TA 4ID9A 3NWBA 10MHA 2I78A 4P86A 1KQGA 4AP6A 2XCTB 3EWNA 4OJQA 4KSBA 2HA4A 1MNQA 4G0UA 3EUEA 3UMBA 2IXBA 6AT1A 1CJVC 4EW2A 5D5QA 3O90A 3FUCA 4N9WA 3V2GA 2PY6A 3RVRA 3AKCA 2DPXA 2YW2A 3AQIA 3GLIA 2G82A 4WOJA 3ETJA 4GOND 2PGJA 3U81A 1SBQA 2DWCA 2Q3BA 1DFHA 3K8QA 4DR6B 1XRNA 2DUNA 2XQVA 3LIIA 1XU9A 3NHJA 2H5LA 2C83A 5AK3A 2W42A 4WTOA 1C8BA 4FB4A 2O19A 4PYIA 4RGBA 4BLPA 1NQAO 3O03A 1P0MA 4AQDA 3CB2A 2PNFA 2MTBA 3K9NA 3QVUA 2GXUA 3Q7RA 4FJ2A 3BSFA 4L5BA 5JNWA 2EATA 2A9QA 4P54A 5EJIA 5H70A 3UAYA 2CLIB 4LYDA 4DC9A 5KJFA 1VLJA 5HPYB 1UP4A 1E9EA 1L1RA 4TRMA 2PV0A 4HFMA 4EUEA 5LQNA 2H1RA 3HYCA 3PPIA 4TQGA 1B6RA 5I5EA 1SBHA 2VNHA 1GPLA 4KHZA 4EUSA 1FYXA 3UAZA 2JB9A 4D92A 3M3PA 1U0FA 1YONA 2G72A 3ANTA 1Z5NA 3IODA 3QSGA 2FPIA 2DHCA 3RAJA 5A0VA 5BWCA 1JPNA 1J2EA 1LRJA 1OKKD 2V4UA 5E6RA 2P2GA 1LX7A 2NT4A 3HJRA 1DOZA 3HYSA 3BGSA 1XAGA 1U1GA 4AX8A 3GG2A 4ZJPA 1GUZA 2IHNA 4UM9D 2JKVA 2P2SA 3HFRA 3SBXA 4U7GA 4D6PA 4EZEA 4G4IA 3OE4A 1DWQA 1JA1A 3U3KA 4LFAB 3K9HA 2AJLI 3BK7A 3JD2A 5AVSA 3RS8A 4U8GA 5T8KC 1JR2A 2D2EA 3GJ5A 4WECA 3SIRA 4OLAA 4OHMA 2R8BA 3QYFA 1Y4AE 2ZJAA 2DX7A 3VR2D 4ESVA 2E18A 3ZOKA 4Y2JA 5LP6C 3ITEA 3CLTD 1LBSA 3EOAI 4IFTA 4MVJP 4B44A 2WB4A 1Q21A 3DR3A 4NZYA 4O2BF 2DP4E 2P65A 3ZD8A 2L23A 1S3GA 2IHVA 3OOSA 4LBZA 3UMFA 3AJRA 5FI1B 4BV2A 5AUNB 2KS6A 4B6QA 2SNIE 1JQBA 3HDYA 3DMGA 3PYLA 4GP9A 1HGXA 1WPRA 1J2YA 2ZTSA 1C2YA 3JRXA 3UPDA 3MFYA 4EA9A 3I37X 4V2UA 3OFSA 1HQKA 1ML4A 3VPBA 2VHJA 4CDNA 4GF5A 4G81A 3LJKA 3BF7A 3JARA 1IONA 2QVYX 1OPXA 4OQQA 1OLXB 3EA5A 3F4KA 5DNAA 4GZLA 2WINI 3DB1A 1L8AA 1P8JA 4BKUA 3VVCA 1E1RD 1OYOA 1OLUA 3I39X 2R00A 3EXEB 3GCGA 2ZUUA 2EVWX 1Z7YA 3GXBA 3H3FA 1SELA 1Y63A 4ARUA 2DPGA 3DAYA 1CEXA 5IKXA 1OAKA 3WLNA 1E0KA 2PWYA 3I72A 4F21A 4P3YA 3FROA 1XAHA 1BHSA 4HTAA 4IZHA 4LW8A 2G9RA 3ZNPA 1IHDA 1FS6A 2XW6A 5ICFA 4CEJA 1LVGA 1XT6A 2ZDQA 3GVXA 3SBEA 4EUKA 1OYWA 3WHKA 4EQZA 1Q2UA 3QX9A 4DCPA 1P44A 1QJCA 2Z5LA 2WJGA 1OXVA 4JEUA 4V0LA 4AECA 3NS7A 1GN9A 2B1JA 3H5AA 2F43B 1RI3A 1XDWA 2IVZA 4NNOA 4DVJA 2O6LA 4YLYA 3SDBA 1M1YE 3F1KA 4R1TA 4M46A 1SHZA 2Q3LA 1SVIA 2YWCA 4K6MA 5ELLA 4FIDA 3V1NA 3QUTA 4D56A 1KMCA 1CQJA 1X7YA 1KY4A 1I2BA 3LUJA 3QX7A 1YR1A 3OPVA 4GC5A 3LBFA 4LZAA 5E9QA 5HYVA 2AUMA 3ZBUA 3GJ3A 4P2GA 2FGJA 4NVRA 1DSSG 2FSVC 4X24A 2PKQO 4FNAA 3WP1B 4H59A 2FWBA 2MU1A 3H9GA 2Z9CA 4B31A 1UJ5A 3KOUA 4UCFA 3DZJA 4NAUA 5MGBA 3LHKA 1H3NA 1WRBA 1M2HA 1DQNA 2CXQA 2BM8A 2VH2A 4GLLA 4WN9A 4YJKA 3PQDA 1VSVA 2WFLB 4BFZA 1KO4A 3EVCA 4YV0A 1C9EA 1FTWA 3F71A 3N86A 3NBXX 1WX1A 3PUWA 3U26A 4DXHA 3D8HA 3HXKA 4R2MA 2XWJI 3CO0S 4Z3KA 1R4NB 3MD9A 1N32B 2BHSA 4P4SA 2ZE6A 1C1DB 1PQYA 3QU9A 3ROTA 3HG7A 3W34A 3BVPA 4FD2A 1SU7A 2WHQA 1XQYA 5I51A 1XX6A 3SFVA 1SUAA 2X6QA 1B1CA 3R0JA 3RM3A 3VVMA 4JQCA 1KIMA 4EFNA 3WO1A 4LTMA 3HZRA 4ZEXA 1TEXA 3WRVA 3VC2A 4MICA 1GQRA 2A8YA 2AG6A 2HQ1A 2PLRA 3DULA 3L7BA 4YMLA 4DJJA 3CR8A 3H8JA 4PFKA 3OZVA 3LX5A 3VO2A 1GN8A 4HPJB 1T5TA 2A86A 4IZ6A 4MYSA 3H87A 5HZMA 3ELUA 5DI3A 1E69A 3C43A 3KU1A 1N6PA 4DLVA 4UAJA 2W6PA 3BKXA 5HKAA 3CSSA 1NZJA 2KLHA 1UIRA 4MVCA 3O47A 3DOCA 3E18A 1P8AA 3I9NA 4PX2A 3TGPA 1P4HA 1R1DA 3AQ4A 3I76A 1M1ZA 4MR9B 2BY4A 5CK4A 4H3VA 1NT2A 2VF8A 1VGQA 2JLZA 1XHEA 3V7YA 1JG1A 3ZJVA 2YVLA 3DYBA 1OBHA 3M4JA 3MLEA 4M9SA 1XTIA 3WOVA 1JHQA 3L5OA 3FYTA 1U4OA 4ZHQA 5J2TB 1P1CA 4ETNA 1J22A 3K7EA 5JNVA 2P27A 3VYWA 3ENKA 4KGXA 4LJYA 4YWHA 4F4CA 3GP3A 4K9KA 2JAPA 1Z4QA 1XLTC 2QSUA 3GJ0A 4G8DA 2YFYA 2QN6A 4HB0A 1EVLA 1MA0A 3IA2A 1WVIA 1ZUIA 4FMPA 4YMHA 4G0MA 2ECFA 1O96B 3K2IA 5IYZF 5EKUA 1N2OA 4KQCA 4A6XA 4D9JA 2QI9F 4JT9A 4DREA 4I1PA 4V38A 1PJRA 1MB0A 4EHBA 4D8XA 4XQ9A 1SC3A 2FOLA 2JKYA 4HVAA 4BKRA 3FRIA 1ZONA 4WLUA 1VB5A 3LLSA 1BEUB 4YRTA 3QUQA 1R7RA 1JG4A 1U0LA 2GRJA 1XTSA 4K40A 1P3DA 5E1BA 1C1XB 5LKAA 1B76A 3K1ZA 4JUIA 2JAUA 1NYQA 2IOQA 3AKYA 5EVCA 3QOYA 1OYYA 3R7SA 1SHTX 1HUQA 4JODA 5I7OA 4ZP1A 4BFWA 1KH3A 4BX0A 5KO2A 3EOZA 1Y3CE 2C5AA 1JT2A 5CFQA 3OY2A 1MQ8B 1U81A 1TMKA 2F1JA 5EIFA 3TJMA 3U17A 3GIWA 1WUKS 1LS6A 1MABA 4L1KA 5EWLA 5GONB 3PLNA 3RYIA 4TL7A 1E79D 5HM6A 2B3DA 2IXEA 3A3PA 1XQ6A 3BN3A 3FMOB 3SEZA 3TLJA 3Q9SA 2E37A 2Q6KA 2YHBA 1VBFA 1BU5A 3KZNA 5FWYB 1AJEA 1G6Q1 2RGBA 2VF2A 2WHPA 1DNPA 4BRZA 1KYYA 4LHXA 3ASZA 4EKNB 2CE2X 2WIBA 3HYLA 2R1ZA 4HZUA 5FBWB 3RBVA 5KB3A 2JRLA 4KFRA 3GUZA 5A4KA 3CR7A 3LOUA 2G83A 1RHUA 3QWAA 4ANFA 3K1JA 2GNAA 1Z8DA 1RYFA 2WKWA 3R9KA 2V5AA 1P3JA 2PQMA 2EG5A 2UYYA 3G85A 1VXRA 3P1JA 3VTKA 3ZY6A 5BO5A 3IDFA 1YNSA 3WBBA 4EVIA 3NWJA 3LX8A 5C3UA 3CW9A 4EZBA 3UMSA 3WGYA 2BV3A 1YR7A 2W6MA 3EZ6A 4F4UA 3EOBI 3L1VA 3Q5GA 2ZI6A 3S2ZA 5KVCA 1KJWA 1VIYA 3L0OA 3LRTA 4IR7A 4OMFG 4EHIA 4N6OA 3NUQA 3O4VA 2GCIA 1YBAA 3U4CA 4JQYA 4RNDB 3IMCA 4DCJA 4J0HA 3FZEA 4PGHA 1N33B 2NZ8A 2BFBA 4G24A 3GRYA 1AGRA 2XYRA 4S1WA 1XVIA 4WMLA 2P9YA 1UXHA 4DLZA 4XD7D 4JS0A 3GY0A 2YINC 3I9JA 2WSBA 3HY4A 4C43A 4C0LA 1FMCA 4JP8A 1UL1X 3QV2A 3V00A 2VP3A 4O2LA 1D1QA 2AC2A 4BTEA 4X8MA 4D96A 5BURA 1L4LA 1JW9B 1OROA 2OXIA 3UKJA 2ZBDA 3HJGA 3BZWA 3MINB 3PUIA 3WDKA 2VRBA 2WHYA 1D8AA 1Q6YA 1TQHA 4B7CA 5FAXA 4QGBA 4NYIQ 2G40A 2HK7A 1HT1E 4DRXA 3WGGA 3F3SA 4EVSA 2QORA 3AL3A 4FILA 1EFTA 1IY0A 2FF7A 2K6GA 4FFBA 4PYMA 3ZLBA 2ZW9A 5LD2B 1W87A 5IJZA 2W2KA 2VK1A 4DQKA 2I4OA 2PX8A 3C6QA 3OO0A 4GZMA 3EODA 4TUYF 4FDLA 1U9YA 1GDTA 1MEEA 3IPYA 3SQNA 3RADC 2E49A 4ID3A 3N53A 5F7OA 1FTNA 4HGNA 4P80A 3D7RA 1E0DA 4LYJA 1LKZA 3PTLA 3ANNA 3NGLA 3VX4A 4BO9A 2I66A 3W9YA 3OA0A 2O8CA 4EB8A 3C24A 2AZTA 3JS5A 3Q3IA 3GU3A 4JQOA 1C9NA 1UK7A 1ZOOA 5IG2A 4MCIA 2OBXA 2VH1A 4TT8A 5E6UA 5F2EA 3EC2A 2IZ5A 5DCWA 4ZCLA 3QMPA 3HGMA 2PXHA 3OWHA 4PSVA 3RJMA 5CCDA 5ALUA 4R69A 1K8YB 2XV1A 4YHHB 1P73A 1UMKA 1ISJA 2IYQA 4S3MA 1OFUX 5JANA 2P2YA 1CUUA 3CF2A 2J0UB 3U6KA 2IYNA 4KXVA 1QZ3A 1L4BA 4ZTZB 3RB8A 4BFLA 1ODLA 2R7NA 2A58A 1O9HA 2GEFA 2AMLA 1ECCA 5K2MA 4EJSA 1DLJA 1JTFA 4IDHA 2Z95A 2C58A 2B36A 2Z6UA 1ORDA 3H9QA 4L27A 2QRHA 1IUNA 3O8QB 3LYHA 3I12A 1ZH8A 3AI7A 4RHYA 1W36B 2BF7A 2HTEA 1ZSYA 4UHKA 4MIEA 2PO5A 4C03A 2CFTA 4X9XA 5KPDA 2C7BA 3OF2A 3M70A 1G17A 4XQ0A 2QAIA 1Z6ZA 4L3OA 2FTKE 1SXJB 4UBOA 5E2IA 4MS3A 3RC7A 2VP2A 1FRNA 1Z5PA 1AHNA 4P3XA 3TIIA 3EVAA 1GTRA 4EY6A 2AKYA 3AYZB 3R09A 5KWJA 4UFOA 1SXIA 1EA7A 3DBOB 3KYCB 4I4LA 4GMGA 1C1HA 2JJQA 1I4LD 4IDAA 2GK3A 3MS2A 4JLDA 1RRVA 1KMMA 3A4TA 1VMAA 1M2VB 5LXTF 2QUKA 1J2JA 3LBHA 4LIPD 4QUBA 3DEJA 2HGSA 1I10A 2JGDA 2UKDA 2V7XA 2ZDHA 2OCGA 3CLRC 3GJ8A 4XPZA 3UH1A 2YHIA 4UPVA 3Q7IA 2YVKA 4Q02A 1M1XB 1U11A 3UAOA 5DM70 3VJKA 4B3HA 4W99A 4CI9A 4ZVLA 1OW3B 4ER3A 1YMUA 1F9EA 2K2QB 3WTCA 1ZG3A 3K5PA 4ZZ0A 3PBKA 3ZKWA 3UAGA 4MPTA 1U28A 5C37A 3UOWA 4EMSA 4B7XA 5H82A 1LNZA 5KQPA 4Y0VA 1XVVA 1YOVA 3MPOA 5D2CA 1KEEB 4IDFA 4KE6A 3JQFA 3NDIA 2VA8A 5IT4A 1C3OB 2ODWA 3HP7A 3LYLA 2F3SA 4PG4A 4NF2A 1ZR4A 4LXUA 4BFYA 2EERA 1ISRA 2CNWD 2NM0A 5EI5A 2BR4A 5BVGA 4LSZA 3DAPA 2PJZA 5F51A 3SXUB 1KZ7B 1X9IA 5JCPA 2FZWA 3DBHB 2YZNA 4GT1A 3GB9A 1XOIA 3UVEA 1W96A 1QV9A 1JI3A 3GLFA 1V5WA 3B1WA 5JAIA 4LGVA 4PTYA 3SZUA 5IM4A 4BO5A 2XGJA 5AW6A 1PTKA 1W4BA 2P69A 2P4EA 4NQZA 2EKBA 4G86A 4D4HA 1RMTA 2HRZA 1JLLA 5BORA 1BRTA 1UOEA 1GNRA 2IDJA 1ZQ1A 1GCOA 2ISQA 1ZHHA 2GOYA 3KWLA 3L6OO 1V26A 4LHYA 3WLTA 1F0PA 4MQMA 4O5AA 4FXPA 1XZAA 2PH7A 4I4TB 4KQ9A 1MT3A 1W88A 4DZTA 1G21A 1E20A 4FZVA 1U80A 1F48A 4INOA 3G9TA 5LQCA 1Z8FA 2YWEA 5FX2A 3BX1A 1C0IA 1J06A 1E0AA 3CW8X 1PZXA 1PK9A 2ZRBA 3FNIA 1U4SA 4L4UA 4Q3NA 1L7QA 2EGHA 3KKZA 2Q4TA 4LXQA 1P9LA 5IDVA 4YR7A 2J6BA 4BV9A 4TXLA 4LF9B 4NICA 1A77A 4JGIA 3K20A 2PE5A 4A36A 1QQTA 4AKHA 3WDMA 2I3ZA 4J49A 1QWSA 4WBNF 1OWLA 3UHJA 4K03A 1Y8CA 5FHQA 4DL9A 1WPGA 1H2XA 2B1IA 5GZ3A 4RDCA 1W59A 5DNCA 4YRRA 2CBZA 2OP1A 1G7CA 2VNKA 2XKJE 2ZVDA 4AWBA 2Y1KA 4IDDA 4V02A 3V7UA 5LWQA 2R60A 2VRWA 4MUKA 2Z2KA 4Z7JA 2NV6A 4ZI7B 1OXSC 2J09A 1OB5A 4PC7A 2VQFB 2Y1DA 3U3ZA 4PBTA 1AC5A 1PSWA 1DDIA 1YUBA 2XKAA 3OU7A 4G1BA 1XJQA 3CH4B 1E58A 2HRBA 3IIKA 3NBKA 1F17A 2EX4A 3LUPA 2DT8A 2F1KA 1X1SA 3JWPA 3TW6A 4A91A 2J30A 1BVHA 3JZMA 4EG8A 3H18A 1XLWA 1ACJA 3MAAC 5HJEA 1O5IA 3IO5A 4MKFA 4YQZA 4MW6A 4BQOA 2I1QA 1NF8A 1Z26A 1LDGA 1W5BA 2GK6A 3MTGA 3IGFA 5HF6A 4RJJA 3I5UA 2ZJ8A 1YAHA 4M89A 3QEMA 2DF8A 2ORWA 3O4JA 1MNAA 4GSKA 1SKBA 1WDKA 2GN1A 3B5IA 1VJ1A 1YZFA 5IKMA 5JXGA 5DASA 5G2OA 1GR1A 2F8LA 3SZ3A 1FDRA 3RROA 3X2FA 5K1ZA 2A5YB 3E61A 1GSHA 3PNPA 3HH8A 1SCDA 4P36A 2WW8A 2ZFUA 2A5JA 4IO1A 5G0TA 2WWHA 4S2EA 2WDPA 2YS7A 3LYUA 3UG6A 1CRPA 2ODBA 2JH9A 4OXQA 4V3CA 4RJIA 3N6VA 4N3AA 3NTLA 4Y67A 2W11A 1A2OA 4LWOA 3SEFA 3FNRA 3K2BA 2GTIA 4MPPA 5AK6A 4I36A 3T0FA 4EF4A 1MW8X 1DXHA 1G7TA 2P3OA 2CXXA 3FCAA 5AKGA 4BL5A 4C07A 2F64A 4FFVA 3CX7A 3ZHXA 1Z7BA 4B2LA 3ICOA 2NP6A 2X0FA 4IDBA 1L3CA 4Q3BA 2ID4A 4KFTA 4A6DA 5BUZA 2BWJA 3GZ4A 2FVXA 5HQ3B 3KDAA 2YZMA 3AF2A 1P2SA 1U8ZA 5KYUA 3WAKA 2C7PA 1XCBA 3CFYA 1R10A 2RH8A 2Q5CA 2I03A 4NP6A 4JLOA 3GLSA 3C15C 5E9JA 3AC0A 3G2MA 3N2IA 3OQMA 4O4JB 3SF8A 3P9QA 3OTGA 2QUBA 3WFZA 1ZN8A 4LKOA 4L57A 1ORRA 1RAHA 1QG0A 3OQIB 1TPZA 1A9TA 4HAIA 4W82A 1E66A 2VYFA 1FRFS 4JI1B 4H0CA 2V74B 5F1PA 3VH1A 2BGRA 1FSSA 2NVBA 3DZDA 2PU7A 4K8OA 4KC0A 3T34A 5F7JA 5KTNA 3L8YA 1NFFA 5DGIA 1TVMA 3JASA 5IF3A 3V1UA 3ZUGA 1P7VA 2ICAA 2QTAA 3QGMA 1N7HA 3OP4A 4ME6A 2OFPA 3V4FA 6LDHA 2FE1A 2V9ZA 1RR6A 2ZJ3A 3BF8A 2VSNA 3OX3A 1WSAA 2CDNA 4KQHA 4NBWA 2G9UA 1IL0A 1P31A 2R7AA 3BRWD 1Z68A 3IAUA 2P78A 2RKWA 4DNXA 1KRWA 2K87A 3TTWA 4DDVA 5I3CA 4BNUA 5H3CA 3I5MA 1VLZA 2W8BA 4I5FA 3WXBA 2V0NA 4DVGA 2OAP1 2WZBA 4HDMA 4PC6A 4UM7A 4AJEA 3CLUC 4YAOA 4C30A 2RT5A 1U5AA 4JUBA 3GP5A 1YR6A 2ECOA 4HQRA 4L15A 4TLLB 3U9SA 5A5VA 4BO4A 5BN3A 4ND4A 3IQIX 1NVDA 4QXAA 1ZGHA 1OTHA 3RYTC 3GNTA 3QLJA 3TTUA 2CWWA 1K3FA 5EQDA 1I4EB 1MB2A 3RFCA 4IQ0A 2XNJA 1I6KA 1KQOA 2RFLA 2HF7A 5AKKA 3FFTA 5C31A 1PK8A 1LVHA 2X13A 3LWDA 4S1OA 4XWKA 2H17A 4Y9UA 3TQCA 2QMEA 1R6BX 1QHGA 1IBCA 2E4UA 2X8WA 2LKDA 4A1FA 1R6AA 3H04A 4H6WA 4BVFA 1W5AA 1VYHA 1VP9A 2YBDA 5DN6A 2Y3IA 4PR3A 5LMUB 1N6LA 4GVXA 1ZGAA 3CRZA 3DYIA 5EERA 3DL7A 3COZA 1YE3A 1MORA 1NYRA 3B3GA 1BA3A 2IF2A 3EMDA 4IDGA 2O2DA 3G82C 4R1LA 4C0QC 3D4IA 1SOUA 1SUFA 3WGVA 5JD6A 3CEMA 1COWD 3NIDB 4NDNE 2P77A 4ZOQI 3WHPA 2AVDA 2F4NA 1SM4A 1I2CA 5E0OA 1R18A 1XTVA 2BAGA 2GEJA 2ZJ0A 3KZVA 3LT4A 1H3EA 3AVVA 2Q7DA 1JA9A 2ERXA 2DY1A 1J6UA 2F67A 1TK2A 1YIDA 5FYDA 3CNNA 4QGSA 4QT4A 5DW3A 2PA0A 4PZPA 5FTLA 4E2YA 3DXFA 3FPHA 2GZSA 4DT1A 4ASUA 2OD2A 4TXMA 2ODQA 2D74A 3DE4X 2CXSA 4C4XA 4DLRA 5LP6F 5HCUA 3TOZA 1F14A 3DDWA 1BMTA 3MTBA 4HLQB 4L8VA 4AJNA 2PGAA 3X1JA 2IH4A 4QXOA 1S7CA 3GC6A 3H2KA 2QT9A 4BJ6A 5FF9A 5HIKA 4UU1A 3F8TA 4QDUA 3E9NA 4KBFA 5TB5A 2PT7A 4K9RA 4XVCA 3MJ4A 3HVKA 1CE8B 3MJRA 4U2DA 4C1NA 1FYWA 1VPLA 2VJKA 2ATXA 1W1WA 3EC1A 3TAXA 3AHCA 4EFDA 1ZIPA 3I53A 4HGPA 4CKZA 3X1KA 3DVAA 1W93A 4HDRA 2ZU6A 5EGNA 4AXBA 4ZCRA 5I48A 4F2HA 1FLVA 4OYYA 1FMJA 2FI1A 4QFCA 4U7DA 3W2GA 3TUIC 4O4HA 3KE8A 4IYRA 2GFHA 4JUCA 1C9YA 4H17A 4PLYA 5TRTA 1DG1G 5DYIA 2JS7A 2ZAOA 2ID8A 3WI7A 4QYXA 1RZ3A 4UUPA 1U02A 3D1JA 4PZUA 3VSDA 1UMDA 3F2IA 2BMFA 2XTMA 3M4XA 3P2OA 4N8DA 1T4CA 1L5SA 1VBMA 3OX4A 1II8A 4PLZA 5TIIA 2ZI7A 2ZIXA 3O2QB 3H5RA 1IZ9A 5JD3A 5KVQA 1J7KA 4X0EA 1L9XA 1VCOA 2XR1A 5IANA 4FBGA 1CVIA 4PQGA 2VHEA 4TOIA 4HD8A 4O8CA 3IP5A 1CLUA 4HB2A 4X8HA 5CDFA 5TT1A 4BV8A 1P39A 5JYBA 1PJCA 2W48A 4GVLA 4K05A 5HKLA 3RK1A 3SKXA 2R6HA 6NULA 1SK9A 3NO4A 1TXGA 3LL4A 1NULA 5JDIA 1AHPA 3VHXA 4X63A 3P9XA 4DXDA 5BMVB 3LWZA 3WMGA 1A0OA 2WD7B 3RTCA 4UHHA 3A04A 3ZJ4A 1PZMA 5KPJA 4PNHA 1QLHA 3FNQA 3IAEA 2CJWA 5A2GA 3LU1A 1IXZA 1SZJG 4YDHB 2BJVA 3DUWA 2VYVD 5AJZA 3TTXA 1JLHA 2UXCB 3B1FA 4PANA 1P7PA 1E98A 1AQUA 3OE5A 3MC1A 3R3HA 3TJRA 3VU8A 3EH1A 5CB6A 2C59A 2FEPA 3M82A 4Y6PA 5AJVB 4YREA 2B4YA 3C5VA 2XZLA 2GXAA 1E7RA 2WMDA 5IAOA 2QZPA 4X6XA 5T4HA 4M22A 1RRGA 1KMIY 5G53C 5B1EA 1O0CA 1GPH1 2ZI9A 4FFOA 3DE5X 1YT5A 3QKRB 1P5FA 4N0DA 4QFBA 5FBLB 4ER6A 2W4QA 2HSJA 2X9QA 4G9GA 5JZVA 2JEOA 1POWA 2OCYC 3UHAA 4I9UA 1HNWB 4RIFA 1GG2A 1NSTA 2RC5A 4FZ5A 4W1QA 1TIKA 1UM9A 2JFXA 4TZ6A 3S2UA 1Q1ZA 1PG5A 1AB5A 4HKTA 3TL6A 4D43A 5BV0A 2XUIA 4GD3Q 1E2DA 1ZN2A 4WUVA 4BBAA 1AQNA 2QN7A 2C07A 3G1UA 2OWDA 4MCAA 3LSYA 4AT1A 1JWAB 1KJ8A 4RF5A 5AKZA 5JAPA 4BAZA 3HR4A 3L06A 3T12A 3HCPA 3TZ6A 2IJGX 2BGMA 3D4BA 1ZESA 3FUUA 3TKAA 4LJ4A 3R8CA 1L5VA 5K8IA 1IG0A 3I23A 1T0PA 3IEXA 4RV9A 4OI1A 3TLXA 1EDOA 4U7PB 1TCAA 1XAIA 4IV5A 5D3ZA 2A57A 1WR8A 3EEYA 3G3EA 3PCXA 3H2YA 3A3YA 2C84A 1IOZA 4WXEA 4FQ7A 4AY3A 4G89A 1LSJA 5KYYB 4M9CA 3T3EA 2VK4A 5AUPB 5K3OA 1JMYA 3LVFO 4GZ5A 3WNQA 3ZE6A 4NESA 1MB9A 1V7ZA 2D7JA 2GHRA 2O57A 3V1TC 1V7CA 2IZ6A 3OQVA 2LE0A 5B7NA 3EULA 4YNBA 5HJ2A 1HWYA 3M6LA 1AO3A 4OA8A 5C1PA 1U3FA 3QPCA 4JLSA 2CV2A 3AFIA 1RWWA 3UF0A 2Y6VA 1K7EB 5COBA 5ALLA 2AFIB 1PG2A 1S3SA 2JI8A 1JU9A 3BWYA 3GFTA 3NWEA 4PS0A 1YHYA 3EDQA 1N77A 1TYDE 2HFKA 4XYEA 2F55A 4C1BA 1GITA 1I4TD 1C0LA 1TK9A 3D3NA 4M0KA 3N8NA 4AO8A 4HB3A 4IMJB 3PEWA 1SXGA 1RYMA 1R9GA 4OX9B 1G21E 1GKLA 2HHLA 2J5RA 2OPHA 1Z2EA 4IPTA 1FK8A 3KZKA 2ZATA 2ZR9A 1F3LA 1O6BA 3MMNA 3V6MA 4BC1A 2YASA 4IXNA 5JS6A 3SZGA 1L8XA 1DS6A 1Q3HA 3EGWA 4BNXA 5KTMA 1JDSA 2BF4A 2GB4A 3OJWA 1YQDA 1PNQA 1JFFB 2V7VA 4AXXA 2UZ0A 1I32A 4QDZA 2QEQA 1H94A 1NLYA 2EX1A 4UOQA 5D5PA 5EHXA 1N6NA 3LXXA 3Q7TA 4KKXB 1L4GA 1JAXA 4KDEA 3ENVA 1Q0QA 1VB3A 2YXLA 1ECLA 3FCUB 1FFEA 1MDFA 1XTPA 2IEIA 3TCKA 5A6VA 5EN4A 5I47A 2PR7A 2EFEB 3E4CA 3H4VA 4XRGA 4Z2YA 4GWKA 1SUCA 2O2ZA 4W9NA 1EJ2A 2JFHA 3WLLA 3FR8A 4D80A 2XQIA 1MA3A 2AN1A 5GGXA 1KAMA 2A6PA 5HKKD 1DZIA 2JLAA 1SVMA 1CRLA 2E4WA 3HCNA 4DEVA 2DKOA 3NT5A 1QH9A 2ETVA 4F8JA 3E5RA 2O2SA 3BWBA 3E9DA 1UPCA 2Y99A 3BIXA 2WA1A 3PX7A 2C94A 1SWVA 1TJ3A 1EUCA 2O06A 3KKMA 2QX6A 4QGGA 3KK0A 3HCBA 4PQRA 5GOTA 2DLNA 2YOHA 4FYWA 5HRUA 1YJCA 1G5RA 1D6MA 1JFLA 2FRDA 3ZNOA 1I3MA 5I7SA 3CZ9A 1UUFA 2QLFA 4GE3A 3R5TA 2F1OA 2RG1A 3FPAA 2JFUA 5TMEA 1HT0A 3AF5A 2DFDA 1NONA 4NYIR 5BN1A 1SUSA 3H5IA 1A9PA 4LRUA 4FC7A 1RKVA 2HN9A 1DBRA 3PF8A 3TI7A 1YBFA 4D9IA 4WINA 3RRNA 5K01A 4KG7A 1WMAA 4WZBA 1XNHA 4G85A 5K8CA 4MVJF 4DJEC 3E5HA 3FJYA 1P6QA 2H48A 1FFSA 3ZD9A 4WCDA 4CIBA 1TCVA 4C0WA 3U5ZB 1XMJA 3BMQB 3N8IA 3DDNA 1ADGA 2DLCX 2FPUA 5G4KB 1SVNA 2Y4OA 3IPAA 4DIFA 5EC8A 1GM5A 4JT4A 3D5TA 2UZ4A 2DHDA 4RTKA 3THXA 3BT7A 4OGWA 3BHJA 1TE2A 4LXIA 2BEWA 2EARA 1YMVA 3IBCA 2PZ8A 4DBLE 1ZKMA 3FSGD 5KQGA 1HG0A 3LOPA 1EM8A 3DMPA 1GGKA 3M8KA 4ZKEA 2PT5A 4UCXA 3TSZA 2QLTA 3IQXA 1AKUA 3HHEA 4DCUA 1O89A 2YZKA 3MCUA 2D1SA 3EASA 3W3AH 4LX8A 3IA7A 2GEUA 2XXAA 4QX6A 1P61B 3ITDA 1OBOA 2O59A 3LK6A 1Y0BA 5ESDA 1MO4A 4J91A 3T7EA 3WK8A 1CP2A 2ZS9A 2QL5A 1NUTA 3QLVA 1ZYUA 3AJ9A 2RGAA 3O8OB 3KWJA 3QBTA 4IKOA 4AP9A 3CINA 2Z1DA 5CGZA 4CMKA 5DHSA 3GRRA 4CHTA 2GDZA 2G1AA 4ER0A 3CRMA 3DOUA 5K3SA 3ON5A 1ZD8A 4CM5A 3DBVO 4MV7A 4IS3A 3K30A 3LM8A 4B4OA 4DQVA 1RQXA 2Y2VA 3E58A 4DUZB 2A5GA 2IYWA 1UWLA 2WJJA 4TGLA 4YIKA 4Q48A 3I83A 1YL5A 2CUKA 4YUXA 3ET4A 1YS4A 1HEUA 1KMHB 2RD2A 1AIPA 1GZHB 1RWBA 1T3SA 2ZRDA 4ZANA 2W2QA 4HNAB 4Q05A 2PS1A 2GFIA 2C0CA 4GECA 2VL7A 1TVCA 2UZ1A 3WO0A 4E5SA 3FB4A 1QFXA 2LV8A 1RPZA 2A1IA 3H8WA 3K15A 1IY9A 1KXZA 4J16C 4UBNA 1GEGA 1F1JA 1ORTA 3D2BA 4XB2A 1PVOA 4IXMA 4MO2A 1CVLA 3AJAA 2H1CA 3KAPA 3LQKA 4UKDA 2FP3A 2X41A 3NWPA 4U6SA 5AMXA 4K8RB 2JFVA 4BKOA 1QGOA 3DAOA 1WU8A 3DTVD 4JXJA 4ATNA 3UWKA 1QV7A 4D41A 1H8ED 5TEVA 1WETA 1RJGA 5EUCA 4HS9A 2J0QA 3CURA 1T4DA 2HWKA 3IKMB 3MEQA 5I4CA 3E9CA 5IK2A 1RPTA 2GM3A 1L5FA 3G23A 2XUQA 3O1HB 3F49S 4MMZB 2AOUA 4ODIA 1DJMA 4Y9DA 4US0R 5HOQA 4HNHA 4WSOA 3TNYA 2BFPA 2JJMA 3OLYA 1RM3A 3WLMA 5JCZA 3NH6A 4R9VA 1ZWKA 1NLUA 5ALYA 2G3YA 4ZDIA 1Y42X 1KI1A 2OV6A 3R77A 3VR4A 2RGYA 5AW2A 4RWZA 5DBGA 1U4NA 3BXZA 3KSUA 1P5ZB 4B80A 5EKSA 1IB0A 5IZCA 2WC1A 4JYBA 4K9PA 1W9MA 2O5CA 1V1RA 1O8BA 5AIAA 1Q7TA 2XMSA 3C8HA 4UTXA 2NO5A 1X1QA 4YAEA 3O9VA 4BMOB 1N78A 4QPDA 1ZL2A 3PD7A 4ZV4A 7MHTA 3OLQA 2MR5A 1M34B 3AOEA 2I9PA 3Q11A 4PG6A 2BBSA 1PJQA 2PA3A 1JQDA 2RAVA 2Y76A 1FY2A 3OE7D 4HSGA 3R8XA 3FMIA 4CL3A 1YULA 1CUCA 3ZDYB 1J8YF 4PPQA 3VNSA 1EUQA 1ZGCA 4QRHA 1DEHA 4EM6A 4HV4A 1UEIA 5AWFC 1MV5A 1EEXB 4H7FA 5IP5A 2DKNA 4Q66C 4RVUA 3EK2A 1JB1A 3DBLB 5CA1F 1ST2A 2N46A 2VZLA 1L5GB 4FMBB 4P22A 4ZJUA 4PTZA 5IJ9A 3AILA 1E6UA 3GGDA 2PUCA 5KWIA 5D6NA 4C0BA 1H1TA 4DLYA 4XZ3A 3OF3A 2ZT6A 4KYTA 5ILOA 2PVSA 4G37A 1T8UA 3MJCA 4HUTA 3QNMA 4EHHA 3MPUA 3OM9A 3PDHA 3UB3A 5ADVA 2WPNA 3L7YA 4L5YA 3COVA 4DDKA 3ZHZA 2XB9A 3KQLA 2E5FA 3MT8A 4J0DA 4RD0A 3DL4A 3FUVA 1QHYA 2NP7A 1GZ3A 1HA3A 1VGVA 2FWAA 2UYQA 4B17A 3TX6A 4F5YA 1NXWA 4MV1A 3ROEA 1YI0A 3RR2A 1L7EA 4OK5A 2GASA 4IVQA 4DSNA 3GD7A 1C3LA 3T5AA 4WZAB 4CMBA 1USUA 4HADA 1F2UA 1KK2A 4Q9NA 2HCTA 5LBIA 2NVUB 4R3UC 3CPSA 3VGPA 1RJWA 3D3WB 1XA4A 4E5VA 4ZQBA 5JT1A 4L28A 4IFBA 4PYKA 4JQZA 4R3WA 5C5CA 2W2LD 5TC4A 3FD8A 2RH9B 2HIAA 3EVZA 3UWOA 2JCGA 3QSYA 2ACVA 1C9KA 1GRVA 2B7LA 3R23A 4BNGA 1GQQA 3ZE8A 3A1NA 5B3LA 4ER7A 3VSBA 3AESA 1MT0A 3S0JA 5FLXA 1Z5OA 3TGLA 4NMMA 3OPMA 3DO5A 3Q1LA 3WBKA 2B1QA 4X85A 2GBLA