1JEQB

Crystal structure of the ku heterodimer
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
537
structure length
520
Chain Sequence
NKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAENKDEIALVLFGTDGTDNPLSGGDQYQNITVHRHLMLPDFDLLEDIESKIQPGSQQADFLDALIVSMDVIQHETIGKKFEKRHIEIFTDLSSRFSKSQLDIIIHSLKKCDISLQFFLPFSLPFRLGGHGFPLKGITEQQKEGLEIVKMVMISLEGEDGLDEIYSFSESLRKLCVFKKIERHSIHWPCRLTIGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDDDETEVLKEDIIQGFRYGSDIVPFDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KU70
publication title Structure of the Ku heterodimer bound to DNA and its implications for double-strand break repair.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 142
structure length 520
sequence length 537
ec nomenclature
pdb deposition date 2001-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02735 Ku Ku70/Ku80 beta-barrel domain
B PF03731 Ku_N Ku70/Ku80 N-terminal alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1600.10 Mainly Alpha Orthogonal Bundle Ku70; Chain: A; domain 4 Ku70; Chain: A; domain 4 1jeqB03
2.40.290.10 Mainly Beta Beta Barrel Ku70; Chain: A; Domain 2 Ku70; Chain: A; Domain 2 1jeqB02
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1jeqB01
1CQPA 1TYEB 3EGXB 1RTKA 1QCYA 1XUOA 4MMXB 3EOBI 1IDOA 4MMYB 5KYXA 5ES4B 2ODQA 3BQNB 4HQFA 3EH2A 1CK4A 3NIDB 1U0OC 1PCXA 1UEXC 4F1KA 1MJNA 5KYWB 3EGXA 3T3MB 3HI6A 2VDRB 1RD4A 5E6UB 1FNSA 3NIGB 3QA3E 4IXDA 1IJBA 2NUPB 1JLMA 4HQKA 1ZOPA 2XGGA 2NVOA 4HQNA 2O7NA 4DMUB 1AUQA 1M1XB 1L5GB 5E6SB 3ZE0B 4F1JA 5E6UA 3PPWA 3F78A 4WK0B 2VDOB 5KYXB 3ZQKA 1SHUX 3ZDYB 4IHKA 3IBSA 3NIFB 1LFAA 5E6SA 3TW0A 1BHQ1 4Z7NB 4CN8A 1MQ9A 1M2VB 2ODPA 1JEQA 1PT6A 2VC2B 1MQAA 1V7PC 1IJKA 1MF7A 4PN7A 2ICAA 3ZDXB 3V4PB 1MHPA 3HXQA 1JEYA 1M2VA 4UM9D 3PPXA 4NENB 1PD1A 3BN3A 2VDPB 1M10A 2B2XA 2M32A 1XDGA 3BQMB 4UM9B 1Q0PA 2VDKB 3V4VB 2XWJI 1JV2B 5LN1A 3FCSB 3K6SA 4WK2B 4BJ3A 1N3YA 4NENA 1NA5A 1XDDA 4G1MB 4FX5A 1QC5B 1JEQB 2XWBF 4UM8B 1AO3A 4O02B 4WFQA 4M76B 2I91A 3Q3GE 4HQLA 5HJ2A 2NUTA 4HQOA 5E6RB 2WW8A 1SHTX 2RT5A 4MMZB 3ZE1B 1JEYB 3TVYA 4CN9A 2I6SA 1QC5A 3K72B 1N9ZA 2IUEA 3M6FA 1SQ0A 1RRKA 1DZIA 3K6SB 5E6RA 3PPYA 3EG9B 3VI4B 5KYUB 4Z7OB 3TCXB 5BV8A 1YVRA 1DGQA 2VDNB 4C2BA 3EH1A 1M1UA 1MQ8B 1OAKA 1ZOOA 4A0QA 5KYYA 2NUTB 1RS0A 1ATZA 3E2MA 3EG9A 2VDQB 5KYUA 5HDBB 1ZONA 2I6QA 4WJKB 4G1EB 4WK4B 3EGDB 3EOAI 1U8CB 4IGIA 2ADFA 1FE8A 4CNBA 1IDN1 4NEHB 3VI3B 5KYNA 2X5NA 3T3PB 3RAGA 1YVPA 1M2OA 3EGDA 1T6BY 3TXAA 3PPVA 1PD0A 5KYYB 1U0NA 3IJEB 4JDUA 3EFOB 1OW1A 3HXOA 5KYWA 4C29A 4C2AA 2VDLB 1T0PA 3F74A 2NUPA 2QTVA 5HGJA 3ZE2B 3FCUB 3N2NA 2WINI 2VDMB 3ZDZB 4XW2A 1AOXA 1BHO1 3EFOA 4Z7QB 3K71B 3GXBA
chains in the Genus database with same CATH superfamily
2ZUUA 2NZ8A 4QBGB 3RS3A 1DDIA 2G8NA 1FFCA 3PQCA 4WNAB 5G0VA 3QHAA 2PJZA 4UE6A 1SPBS 4WFKA 1XAJA 2Z2YA 521PA 1V35A 1Z38A 5K5EA 4A82A 3B9PA 3DWEX 4TS4A 4K9RA 1NHWA 2VJMB 3WNVA 3SC6A 4K26A 3RROA 5EZYA 2IDZA 2XBLA 1CZUA 4U2EA 3UTDA 1DAIA 2V7QA 4JLDA 1R74A 4MULA 3AL0C 3B8HA 2CLDX 5IXYA 1NLUA 2YVAA 3HVKA 5FHQA 1FCJA 4ZT2A 5LQNA 3VR6H 1QFZA 3RRXA 4HDAA 1L3CA 1JALA 4KL8S 4YCSA 3HXTA 4XYEA 1XEWY 2F00A 5CTAA 4YRQA 1GPH1 3UYLA 5D3MB 3TKLA 4W6ZA 5EZ6B 4DCJA 3MFYA 1XTIA 4O59O 4EGCB 1NJ5A 1OROA 2FSVA 2QMOA 1I32A 4KKXB 1YS4A 1T8RA 2DJIA 2GFHA 3VXKA 3I73A 2WAXA 4JU9A 3A6LA 1XNGA 3R5HA 3IEXA 5LJIA 5K0TA 1DBQA 1I2CA 1PZMA 1NY6A 3H9GA 2QM7A 4U5QA 1PR9A 4FNOA 4R1QA 1ISPA 1M2NA 2A59A 2VPTA 1DRKA 4UAJA 4Z9YA 4OQMA 3W8FA 1ZI8A 3UATA 4Y1EA 5JR3A 1IPHA 2O2ZA 3R7WA 4MVWA 3HA7A 2OE2A 4G24A 4M9RA 1HE8B 1YK1A 2XMCA 3NOVA 4OSOA 3QXHA 1XB2A 3BK7A 4IJWA 5ALDA 1XDUA 3TVTA 1AJEA 2HXYA 4HNQA 4JK3A 2AW5A 3AFOA 4J1SA 1DVRA 1NUAA 2YZGA 4WFQA 2Y0DA 2W2TA 3P2EA 3P4XA 3GCGA 2Q6KA 1NUTA 3M5PA 5CK4A 5A5VA 1UXOA 2CLMB 3W4JA 5FTMA 3ZLJA 4NABA 5JFOA 4AO8A 2D1FA 4F4FA 2B8TA 3Q8XB 2X0KA 4LZPA 2P6UA 2JIRA 2PS9A 1E4EA 4YCAA 4F3KA 1MLDA 3NVDA 5F7JA 1ZPDA 2G28A 3B13B 1JU3A 3WQSB 4DV1B 1N2EA 2CHGA 1SZCA 4MI1A 3ZOKA 5BVGA 1U4NA 1GA4A 5FCDA 5IKOA 3BMCA 3OPYI 1O6FA 1BSVA 1C9EA 2IXAA 2SECE 3GL9A 2B78A 1CKEA 3AEUB 1H2RS 3A1DA 4HZIA 3IHTA 1EFUA 3LC2O 4OREX 4C7XA 1K0FA 3AESA 4BUZA 3F8SA 4NCKA 3ZQJA 121PA 2NO1A 1I30A 2OZLB 2GDJA 3RSZA 3OWHA 4U3JA 5LC1A 1CEQA 4Q6BA 2EARA 2ES4A 2GZ2A 2I2CA 2PX5A 4MVXA 4D45A 1D5WA 5ULLA 2L69A 3OT1B 2H0RA 3VSAA 1X74A 1W8IA 4D4KA 1ZH8A 1XR3A 4MYCA 2OENG 1IUNA 4UCQA 1E5XA 3LHDA 3MQFA 1QXSA 4ZTUB 1BKDR 1SQFA 3FJYA 2XKAA 4UJ3A 3FNGA 3UFXB 5DTQA 4N1AA 4GU5A 1QMGA 4ENPA 5DM70 4QEKA 4D0LB 5BMOA 1GZUA 1U7ZA 2GEFA 3H04A 4UAUA 1M1YE 3MLBA 3UUEA 1CB0A 4CIBA 9ABPA 3NUQA 2PWAA 1E89A 4O4LB 1ZSVA 2JGFA 5B3AA 5MFPA 4QQRA 5KNDD 2QN7A 4INJA 5TQ2A 2IYAA 5F1OA 1E64A 1HH4A 4FD3A 4K6GA 4P93A 2NUPB 4KDRA 1R15A 2OO5A 2RB5A 1YUBA 1KY4A 1TK3A 3TFOA 4OV6B 3L4EA 1L5GB 3KM0A 3LT1A 3ADDA 2QTNA 4QOIA 4ZYLA 3K9LA 5BN5A 3U56A 4ZAZA 3RYIB 3LRTA 2B7CA 3REQB 3U81A 5MDHA 3ZU5A 5B7GA 3GLHE 2IUFA 2WE7A 2XNDA 4YNBA 4E5MA 4ZCRA 4Z5XA 1XGKA 4TWJA 2J3JA 4JA0A 1A8IA 1Z28A 5JVDF 4JBHA 2A1TR 1WXFA 3OF5A 1FDTA 4BLRA 1J8VA 1N7IA 4RIEA 3W3AD 4RQAA 1X2BA 2YV5A 3FVWA 3EUWA 3NBUA 4GNRA 2NV2B 3LUKA 2JCXA 2IHTA 1CX9B 3DUFB 4FS8A 5ANRB 2QX8A 1V37A 5I7SA 3PPXA 1DC4A 1C1DB 3RTDA 5FV4A 2GJSA 3ILHA 3JTMA 3UJPA 5F5LA 3PHLA 1J8YF 3RARA 1UWKA 2V4MA 3GEEA 4PPGA 1C7QA 2QYHA 3CF4A 4ABTA 2QMEA 3CO5A 5JG7A 4U02A 2O48X 3R3UA 4LZOA 5AI6A 2VXYA 1XIVA 3ZYCA 1ZNYA 2Z5GA 4GX0A 4LJSA 4QJBA 2CXOA 2BSXA 1DAFA 2NGRA 2REQA 4NYMR 5IDQA 1R00A 4MMZB 4H7KA 3R9XB 4AQYB 1AN0A 2VSNA 2JH9A 4CF6A 2RE8A 1A8UA 1S5PA 3QXGA 1QWOA 4NZZA 2A9JA 4RMHA 2A9VA 4B6EA 1O3YA 3BREA 2VJQA 2C94A 4IEEA 2WSSA 4EGFA 5JCXA 2RAUA 1YI0A 1E1QD 1GGVA 1O89A 1K9SA 1OILA 3N39C 3ZQ4A 5L8VA 1LPBB 3MTIA 1WD7A 2J31A 1UKBA 2R5NA 3KCNA 3KHKA 2JEOA 1K3TA 2C4HA 2XWQA 4UDYX 2DE0X 2OD9A 3SICE 1OZGA 4CR7A 1POWA 3ZHXA 2A86A 3QVOA 4MRSA 8ADHA 4EB3A 2GS9A 1YBMA 1BE0A 3HCEA 5E9QA 3DPSA 1J9EA 1DRJA 4IZOA 1LK0A 3L5OA 1EZ1A 1VFPA 3WFJA 2OPBA 1GGEA 4W8OA 1YDGA 3FBWA 1N5MA 3KNZA 4J0DA 1Y1SA 1GZDA 1NFFA 1RI4A 2W2VA 3AGQA 2PZBA 5FOSA 3A6JA 4X7PA 1DU4A 3H05A 5G1OA 2H1IA 1M7BA 1NPTO 3WLHA 1J8FA 4HCJA 4MR9B 1BX0A 4R54A 1M1NB 4WEOA 4UHFA 2EAUA 2C5SA 5E7QA 5I9IA 3GJ3A 3RVKA 1RJGA 3OJCA 1XEWX 2Q7XA 2HCFA 4PTLA 2ONZA 5L4LA 4EKNB 2HK6A 3QVVA 1C81A 3KYCA 4XH9B 1OAAA 4OQDA 2P27A 3CR8A 3VISA 2QHXA 4YRJA 5ALTA 3M9WA 1U0OC 3QUBA 1YS6A 1CIJA 2O52A 2R87A 3O4FA 3VPFA 3WG9A 2I6TA 1EVEA 1N5RA 2NU9A 2ZYUX 1DTEA 1P77A 1P74A 4XM0A 3NT2A 3MMPA 1XMSA 4YBZA 5FRDA 4OQNA 4L2IA 1HV8A 6CHYA 2ADOA 1T4CB 3AKEA 2Q0QA 3M3HA 3QKWA 3QEBZ 4RTMA 1LX7A 3IUYA 4BATA 1W8DA 3EYWA 1Y1PA 5K0BA 1LLQA 2F9MA 1OW3B 1W5FA 3DEAA 1KZ4A 2D8MA 2Y1XA 1C3OA 2EFYA 2VJOA 3L18A 4L0CA 4MV3A 2HMYB 4RY9A 1RJWA 5CX4A 3CCBA 3EZXA 5EQTA 4YCMA 5JC1A 3GG9A 2WHPB 1VI6A 1GA1A 4BPRA 1VPWA 4FZJA 2BHRA 4KVAA 1KR5A 1QO0A 4G5OA 1FFBA 5E6SA 2OVBA 4B3JA 1DUVG 2MT9A 4ERNA 1UAYA 2PL3A 3VOBA 4R51A 4UNQA 4EG1A 4C08A 1ABEA 3CN9A 1PHPA 1X1TA 3DBRA 4LISA 4JHXA 4X97A 2ZJ5A 3TG8A 4KXWA 4ZO7A 2IFTA 4BQRA 2EKZA 3L46A 4PGMA 4IFEA 4B35A 1R5JA 4PAMA 2OUIA 4B45A 2JLVA 4G0NA 4DNPA 4O4IA 3DF7A 1WUHS 4QUHA 2ASVA 3NC4A 3GFPA 1T9DA 3ROMA 3PTZA 3W8DA 3SS9X 4ALMA 4UBIA 5ALHA 2ZBVA 2J07A 4RZIA 5K3FA 721PA 2KY6A 1LPNA 4D9MA 1M6VB 3AHCA 4NPAA 3WYNA 2XCSB 3IA7A 3OX3A 5B2ZA 3C3CA 3AI7A 3RJ9A 1GPLA 3QVJA 2O07A 1RYDA 2KI5A 5JNLA 2F90A 4AFNA 1WUTA 4N18A 1B2RA 4URFA 3TW8A 3E3AA 1RCFA 2LBPA 4M36A 5JAQA 4RWZA 2FW6A 2R96A 2YZNA 1P19A 5EHNA 3SE7A 2I87A 3TTTA 3C8UA 4M1QA 2QJTA 5CTJA 5EMMA 4KWEA 1H9CA 2O2JA 1YVRA 2FTKE 1E32A 3FR8A 4A15A 4II2A 1KORA 3PS9A 1XTUA 2X2OA 2BH9A 2TRSB 2C00A 3B3GA 3FE2A 4GM0A 1AS0A 2X0EA 1VLVA 3A9RA 5HE8A 4F3RA 5C81A 2HRDA 3P7MA 1KK2A 1WW3A 1P0PA 4LJ4A 4HGPA 4RTNA 1SOWA 3QI7A 1GDHA 5LA6F 1TEZA 4LX8A 2L23A 2GK3A 5L7WA 3JARA 4TMYA 4JYAB 3MAJA 4W1PA 2QBYA 3RG8A 5BT8A 2ZWOA 1Z75A 1LK5A 4UVHA 1GGFA 1FLVA 4F6CA 5LBIA 3MOIA 1BN7A 4ZXPA 3T35A 1W0KA 1CJMA 1AKVA 2AWOA 2WPDA 3JVDA 3PZRA 3D54D 4F84A 1MC5A 3M4NA 1JF8A 5ITZA 5KDOA 4PCVA 2O0HA 2V6IA 2A2ZA 4EFLA 4V0ME 1CT9A 1DIBA 5C8YF 5CYPA 4RF4A 3LUAA 1I7SB 1Z5WA 3LAWA 1EYZA 5EKUA 3EN0A 2Z5VA 3VR2D 3DOIA 3IUPA 2GF0A 2Y1CA 1CJVC 3N74A 1GKIA 2OV6A 4HDSA 1OC4A 5HUJA 3MJHA 1QCYA 4FQ7A 3NATA 1VZ2A 3OM1A 4L8GA 2VL7A 2JVJA 4U2BA 3CURA 3P9CA 1VL2A 4H4EA 5BN3A 2YINC 2FGKA 5IDWA 4DIEA 1RM4A 1ML4A 1XMIA 1Z2AA 2G3YA 3WMGA 5CHEA 2BKVA 1V1JA 1G16A 1SULA 4OQ4A 1GL7A 3EGVA 3JU3A 5GV7A 2WWFA 3H2HA 2Y76A 3CLUD 2H1HA 3RS8A 2JGNA 4LPSA 1DXHA 1NRXA 2W2MA 3MGBA 2R7NA 4MB2A 1MH9A 1VBKA 2BKXA 1TA9A 4BVGA 1OLOA 1ZRHA 3AZOA 1W35A 1QGDA 4JJGA 4RVDA 5ALGA 5K4HA 3Q87B 4KK4A 4IHKA 3BDVA 3IBSA 2PSFA 4NEGA 1D6MA 8MHTA 4Q47A 3VFDA 4F8YA 1ZAYA 2D2FA 2C58A 3K0HA 3NPAA 5U1PA 2OCLA 4EHFA 4IFTA 2QTLA 1SU7A 1IXZA 1TC2A 3ZGYA 4CBVA 2R6HA 3KR1A 3EAGA 3T5PA 2VP4A 1ZUIA 5JYDA 4WKOA 4QFBA 1P5HA 2EV9A 3WLJA 3COWA 4EY7A 4D9BA 3T1NA 1GGNA 4C6RA 4F11A 1JRLA 1JZSA 2F59A 3AR7A 3DAHA 5ESDA 1DEKA 1M7HA 1ZL0A 2I54A 2OC9A 1JYFA 3L84A 4M8LA 3WL4A 4EF6A 1I7QB 1DMRA 4MPDA 4Y30A 4KRXA 4KHPB 1LS6A 2VDWB 4KDFA 4TROA 4MVCA 2AE1A 1Z0DA 4XDGA 2FFJA 3DDSA 3O8LA 2WD7A 1D09A 1TM3E 1XI2A 4HLDA 4MAMA 4PSKA 5B7QA 1U7OA 4MSUA 4YLGA 2ANBA 2QSYA 3B6IA 3FYHA 4C9BA 4Y3UA 3CB4A 4LJAA 4CLOB 4F5YA 4PPYA 2IZ5A 5L3QA 3ER8A 2OG2A 4JI6B 2A4MA 3PJFA 4TLEA 2CW5A 1OOEA 4WOPA 5BW4A 1QYDA 3Q9SA 1Z56C 3OPYB 4R6XA 4U9HS 4UEKA 4TQUS 3DLIA 3NFRA 5IUJC 1T0IA 1ZMOA 3M89A 2CB0A 3CXRA 4HK4A 3W6PA 3KV1A 3ZHVA 1TJ3A 4R16A 2HK9A 5GJVC 4UHDA 4UTVA 3AF1A 4H08A 3BSYA 3NW9A 3GLKA 1O0BA 2RGCA 1M8KA 4OHUA 3ZIAD 1ZX1A 5MGNA 1YDFA 2B5OA 1ADJA 4ODIA 1L7PA 2WWIA 3ORSA 2ZRFA 4BX3A 4MWDA 1T5SA 4LKOA 3Q9LA 1RKBA 3OOHA 4D9HA 4WNYA 1Z0AA 2HEGA 1I1HA 4FR0A 4RPGA 4BP8A 4MKZA 5AKKA 4GZ6A 4TQ9A 1G9XA 3TGWA 1IPFA 4BFTA 4R8MA 1J0BA 3P45A 1UEIA 4NBTA 4PO3X 5D86A 3VR6D 4BZPA 3LX6A 5IG2A 4M7WA 1VPEA 2O5VA 4LJKA 4Q7JB 3VI3B 5J1SB 4INAA 3NS7A 4ND3A 2QMYA 4B83A 3QXXA 3SR4A 5L53A 4IO0A 4O4HB 4L85A 3I0MA 1Y8CA 1Z6PA 3A1UA 4KQKA 2AK3A 2PGOA 4GEGA 2X9QA 1K8XB 4JT8A 5THQA 4C29A 2G70A 2P2ZA 1RQRA 1SURA 2OQIA 2D1QA 3M9LA 3QGMA 4KAFA 4TKVB 4AIIA 1AMNA 3F71A 2PKWA 1EFHA 5KX5A 2DPMA 4YS6A 2VDMB 2VRCD 4DR4B 3PFBA 1UC8A 3ETLA 4LJRA 5KVCA 4J3FA 3BXPA 2PX6A 4X45A 5T4FA 2BJHA 3SFTA 3DYBA 1HXHA 4A0SA 5L3VA 2F55A 1GL3A 1VHWA 1RJ9A 2LCFA 4ZT6A 5EVJA 3PUKA 1F2TB 2P40A 2IWRA 3DL4A 1ZINA 4LW8A 3SEQA 4WRRA 1MG0A 3O8RA 4DUZB 4TMFA 4PLYA 1A9OA 3OTOB 2PL9A 2Q4BA 2YMPA 4CIYA 3TNDA 5HTKA 3AVOA 3R24A 1XMOB 5D5QA 4NBWA 3MBOA 1WKCA 3LSYA 3MT0A 3ZHUA 1VSVA 1ATIA 1JIXA 1OC2A 1M1XB 2BV3A 2CD7A 2J5KA 3AILA 1O94A 4LYGA 4M46A 5J4VA 4LF5B 5A4FS 1I4TD 5FWYB 4UPVA 4ZEWA 2NOAA 1SHUX 1PK9A 1W9MA 3CV3A 4Z3OA 3FOCA 4I50B 1LX6A 1CY0A 3RCBA 3O4GA 3T94A 3ISVA 2D2VA 3UMSA 1UJMA 4P35A 5J2TF 2FZ5A 1KO7A 3DEYX 5B4TA 1GARA 1KFJB 2XNFA 1SBHA 3E3LA 3PQ4A 3DLAA 4WL0A 4GZLA 5TMEA 4N3AA 3TD9A 1V7PC 2F4NA 3GLRA 2I22A 4HWOA 5GM1A 4RULA 2ZBQA 3TR6A 3VHXB 3VNSA 2HSGA 2E55A 4HI0E 3INYA 3OQVA 1UMBA 4PC6A 5ETJA 3SYRA 2IYQA 4DSNA 1KVUA 1RVV1 3V1LA 1RI3A 2CJYA 1GUYA 2BVNA 3CUTA 4HBZA 4NR0A 4QTXA 1E79D 3FDZB 1H66A 3JQ7B 1QBKC 3K6SA 1F0PA 1DEAA 5I5EA 5KQMA 2Q49A 1PJRA 5DBIA 2JGDA 3DE0X 1YZKA 5EE1A 1FFEA 2ORWA 1V9SA 3E7XA 1EHYA 1S96A 5FL3A 2B4YA 3OX1A 4KWTA 3UV7A 2ZSHA 1AUVA 3RDPA 3A3PA 3G5UA 1G60A 2CL7X 3F5FA 3NPMA 1Q1QA 3BD7A 3Q1LA 4BP3A 1BGWA 4WLUA 1J6UA 1UADA 5TMBA 3R7WB 1V5IA 3EQ8A 3RVDA 4KXMA 2ZTUA 3PXDA 3TLMA 3HKDA 3WV4A 1ZGBA 1N3BA 1SZDA 2IZ1A 3FWNA 3UOWA 3W3ZB 4NS1A 3V4SA 5C8VA 1N8NA 3ND6A 5MF6A 1L5ZA 2AG5A 1DRVA 1ZHFA 2Q6IA 3CNHA 5DKFA 4EKYA 5FWXA 4BAUA 3PUWA 5ILOA 1Y8RA 1XL0A 2D74A 4JLAA 4WERA 3FLMA 2HRZA 3WJ7A 4HTFB 2RC6A 3FPCA 3H9EO 2H1RA 4XFDA 4NI5A 3H3XA 5EJ2A 1V9CA 5DULA 3IP3A 4Q7MB 2ZGVA 2QUIA 3KWFA 3NH6A 3RVJA 2QJOA 2N1BA 3K09C 2VT2A 5LP1A 2IH2A 2GPJA 1I2MA 2XE7A 5A1JA 4CL2A 1V4BA 2G80A 4RTPA 1T6XA 4X91A 3QNWA 3NKLA 1I7PA 3RV4A 3AEQA 3HHEA 1X0XA 3SJAA 5BVGB 1L5MA 1LDBA 1BROA 1S6YA 2GDZA 2ZU0C 3EAFA 3IV9A 3MCUA 2DWOA 2R8BA 1NV9A 3NTUA 3GGDA 3DM9B 3H7IA 1HOTA 3CRRA 5DW3A 4CTMA 2EERA 4B80A 4EOGA 1ADGA 3SKYA 3A05A 5LDDC 1I3OA 3PEEA 2AEEA 3QFFA 4PSDA 3RW9A 4NZMA 2Q6TA 4YAFA 4Q3LA 4GF5A 4E21A 1XHEA 4YAEA 1WBJB 2RGGA 4KRYA 3RD5A 1UODA 5EJ9A 3U26A 1SCQA 3LGXA 3RQSA 1KEPA 3DAPA 4BHTA 1CETA 2MSLA 2R4QA 3C3EA 3MXOA 4QVKA 4KBGA 3FETA 4PC1A 4XKJA 3VO8A 1KRXA 1HOXA 5CFOA 1IOLA 3GAMA 3HJHA 3JSXA 2H1SA 1C3EA 1ZVJA 1GCIA 3QEJA 1ILWA 4Q0MA 1Q1AA 2R6CA 3DHEA 3UB4A 1HDZA 2AGVA 2WWHA 2JLQA 4QDKA 2YYSA 2AXEA 3NUGA 1MD9A 5LSAA 4EAQA 1RWBA 5LYJA 1Z7EA 3OX2A 4W8HA 3QG5A 1K66A 5H9VA 1S2GA 2FN8A 3LXRA 4ZCIA 2JL1A 4R1MA 4RACA 2YWRA 3C7CB 3VJLA 4X1OA 2QT1A 5AH0A 2X4IA 3CKKA 2R44A 3WNCA 1F6DA 5BW6B 2V6BA 3F5MA 5KTSA 5BN5B 2XB2A 3PA8A 4TTJA 4X71A 4UU8A 3OE1A 4DQUA 3E8XA 2R8OA 1N7JA 4RJ2A 2NTNA 2PUVA 4HNUA 2A1TS 5BMVF 1OBFO 1QVAA 1QM5A 2O05A 3R1IA 1HL7A 1Z2DA 4MDYA 1F2DA 3MOSA 3Q72A 1K7CA 1M3SA 4NOLA 4ZN6A 2DHCA 4BB6A 2AKAB 1ZOLA 1ZJ6A 3GVHA 4RNCA 2A5DA 3A4NA 1Z0JA 5D85A 4U2DA 3TBKA 4A16A 5CLFA 1Q92A 4E1AA 2KW5A 3K7EA 3ZE1B 2IY7A 2XLBA 1U0RA 3ZDCA 1O7JA 4CPDA 3DL0A 4GH5A 1GU1A 1DTWA 1NN5A 1Y6JA 2FYTA 2JAUA 4G0XA 4PR0A 1J5PA 1CUYA 3GGGA 3QSYA 4L4YA 1OB2A 3UMBA 4OOEA 1X94A 3EZYA 3LCJA 4IH1A 5C1PA 4Q9HA 4Z7OB 3U13A 1R8XA 1SCAA 5E1DA 1N2CA 4EL5A 1U80A 2OLKA 1U1CA 3ZWYA 3UY4A 4RF2A 4QSHA 1S8FA 2R6JA 5M29A 1TZCA 1DHRA 3IMFA 5DW0A 4R4JA 2GHRA 2RHTA 1E4VA 1EZZA 3W8EA 2Q7OE 3PD7A 3RIMA 3L3BA 5LD2C 1SHZA 4D56A 4BC0A 4GQBA 5BV8A 3NETA 5EQFA 1GR0A 2A33A 1CZRA 4OMCA 3WHKA 1ZD4A 2WZDA 1I36A 5LJLA 4Y2JA 1E7YA 3NR2A 4OHVA 5FKJA 3U61B 2X6TA 3QHPA 4IDGA 4B3CA 4GG1A 4NNJA 2GCPA 3RK4A 3ZY3A 5AVVA 4RWEA 4IVQA 1XZEA 4LGYA 5DIFA 1G6HA 1C3XA 1WUJS 3KTAB 1AC5A 4NU6A 3IBCA 3K0CA 5FNVB 2KM1A 3VVCA 3BIOA 5K51A 3UMYA 3KOUA 5B58T 1U2EA 3ZH2A 4NRDA 2UYQA 1ENOA 1UC5B 1AGPA 2MR5A 4G25A 4MR8B 5JMWA 1DIGA 5IUKC 3ET5A 1PS8A 6AT1A 4M22A 1RJEA 4L9WA 1NW4A 1PX2A 4DIKA 2ZJZA 3PC3A 4N47A 2QLMA 3Q3JB 4KQ2A 1LKZA 1ONOA 1UBFA 1Z7GA 1BGVA 1B2LA 1RDFA 2IC5A 2YS7A 13PKA 2BC9A 2PJDA 2EP7A 2P11A 2R7LA 2ILTA 2GZSA 3BFJA 2DT5A 3P1JA 3KYCB 3G85A 3QVTA 4LY3A 4EFMA 1U3WA 1YB5A 2QQEA 4U7PB 3ST7A 1PUJA 3T4EA 2O06A 3ODGA 1YJQA 1JDJA 1XRPA 5AJUA 4G0UA 3DBOB 2DFDA 3TW0A 4ZK2A 4L6CA 1N1DA 1KDYA 3PHGA 5I7VA 4EPWA 2EU8A 4B76A 5LVAA 4YMVA 4FGKA 3B1ZA 3GGCA 3LTNC 3W9UA 2GWRA 3NDIA 1II9A 1NMZA 3EXEB 4KVGA 4XQCA 1IB6A 5G1NA 3WLRA 4ZYZA 5DI9A 1CR4A 1N25A 1P6QA 1VMAA 3KUXA 3L8EA 4B3HA 4CM1A 1Z45A 5CDUA 5ALQA 5K3CA 2QLFA 5SYMA 3B48A 1E66A 3OMWA 2Z4SA 1VJ1A 3O1HB 5EFZA 4HS4A 5JDIA 2IXEA 1KIAA 4L5IA 4UHKA 1P2DA 3EEFA 4NX2A 2DFVA 3OEYA 4NYIR 4ZKEA 4ND7A 4W1QA 1G66A 4OJMX 4RUKA 5ALWA 3N0XA 4NPCA 1ZYUA 3DBRB 4BASA 5LIRA 5AKHA 3G0GA 3GFTA 3D0KA 2E4YA 3L5KA 1PT9A 4FNAA 4PG5A 4EB6B 1JT9A 1L5RA 3AHIA 1PG2A 2X0DA 1E9DA 3U37A 4E3ZA 1KJWA 4TL6A 2C2YA 3BFVA 4X8HA 1Y5RA 1ORHA 3F1KA 1ZK2A 3SS8A 2I3BA 2QB5A 4JJZA 1CZHA 5K6TA 4ZYUA 4OLAA 1NOKA 4CMBA 1Y3AA 4KN9S 3JQCA 3S55A 1X7GA 4C4OA 4ZZ3A 3DOJA 4C0LA 1N75A 2AOUA 2BRUA 3GJ8A 2I66A 1B16A 1XZAA 3NNDA 3C97A 2QVZX 4DCSA 2JBAA 4PNHA 4R83A 3UZUA 3D3NA 2Q4OA 4DZZA 1E3WA 4RXMA 3BCRA 4R2MA 1C8VB 2QTRA 1MGPA 4RXTA 3KE8A 4AJKA 2J0UB 4K9SA 4GWKA 3UEOA 1UJ2A 2HCTA 3P20A 5HDBB 4QO8A 1Y6ZA 3JXEA 3C2QA 2FW7A 3H1GA 2ON6A 2O5RA 1I6KA 2R1UA 3WK5A 4CYMA 3Q0EA 1QIDA 3GFSA 5IVPA 3TLYA 5L51A 5FBQB 4MKIA 4ZDWA 1FFWA 1X19A 3FFWA 1DAKA 1EFVB 3LW8A 4HXYA 1RLUA 3A1CA 4BO1A 4F0JA 3WZMA 4NMXB 1QZXA 3BA1A 1JHUA 3JPYA 4I4IA 3E15A 5IASA 1YVEI 1G98A 5C4MA 4EL0A 1ZEJA 1VKOA 4N48A 4EX6A 5A05A 1K7SN 2FSFA 2JIOA 1P1FA 3IE1A 3GOHA 3UVEA 1X6VA 2HF7A 3G0DA 4B48A 1NKVA 5ALZA 3ZVKA 1FTNA 3LRXA 5EC8A 2XVMA 4CTOA 1GUDA 3JARB 4R8SA 1E2DA 3BMNA 1G6KA 3KDAA 4I08A 5GP1A 5DNUA 4MV7A 4G67A 1K63A 2PXXA 4MMYB 4RSMA 5EFOA 3GZJA 2PZGA 3PGKA 3PKZA 3H5VA 1GSIA 3CSDA 2YXNA 1NZJA 4LMPA 4UNRA 1RQ2A 2I2XB 2AFRA 2BFCB 5A2GA 5CA1A 1GQOA 4ROTA 3LY5A 3V55A 3RIXA 4YR7A 5C5IA 5DCYA 5ITZB 1KPIA 4XJVA 4MH0R 2PL5A 5K3DA 3I83A 1JLLA 3TM5A 3HGQA 4RYLA 3JRWA 2G4VA 4HDSB 4A6XA 4YP6A 1Y7HA 3IHLA 4FUTA 4UUAA 4RTSA 1ECGA 5TPWA 3S0JA 1SD2A 2Y4NA 2C83A 1XL1A 2H29A 1NM5C 2NWQA 1MUUA 2VXBA 3ANYB 3OJEA 1O94C 1ZUNB 1E6CA 1W85A 2VPIA 4GFDA 4NOMA 5B1SA 5C37A 1P0IA 2MINA 2VHZA 1V5FA 4N4AA 1C1YA 1CDDA 1GNRA 4HSEA 4BLWA 3GAAA 4OXRA 4LDPA 2ACEA 4MIEA 4TT3D 1BQEA 4Z0PA 4CQMA 2P8JA 3IUMA 1FFGA 5HR5A 1BXKA 3ABOB 1EUDB 3GFOA 3VNUA 1C30B 2Y3IA 4NOJA 2IYSA 4X1KB 4U7FA 1U9CA 2F3SA 3D4OA 2N1MA 4KMOA 4GKJB 3M70A 5AW1A 1DXYA 4JJAA 1BS1A 4D99A 3ODPA 5A3SA 4YVFA 3TL6A 2VP6A 3CNNA 1D5CA 2WYUA 1Q0LA 2A92A 5KTRA 2BM8A 2BGJA 3DE2X 3HCNA 2ZR8A 5AHWA 1A4UA 2QTWB 2QUZA 1QC5B 3D2BA 4DM3A 2XT6A 1H2YA 4JB2A 3G1WA 5K0NA 1VZ3A 4AMGA 1A9XA 3LNCA 4XX0B 5DHPA 3IIJA 3KEFA 5JO9A 2FW0A 3V2HA 4NMWA 3R6WA 1VIAA 1KDRA 2EJUA 4ZMSA 1BRMA 1CS4C 5E95A 1FVOA 4E6EA 2GAFA 1SWVA 1U99A 2AHRA 3FYCA 4E88A 3IP7A 4CEJB 2WD7B 1PLLA 1QDLB 1BE6A 1WZCA 2FLWA 2PUHA 2QVXX 4KO4S 1QZ3A 2B8WA 3AP2A 3LLVA 4QELA 4U8GA 3U3KA 4AZ0A 1ZG3A 4E1VA 4HDNA 1QGOA 4PZPA 2OSVA 4BYMA 1YR1A 2BE9A 3C8MA 3P4YA 4IIEA 4PU0A 5JFTA 1R50A 5HZMA 2FWBA 4FYWA 1S3FA 3CZ5A 4J7CA 2F8TA 3BL8A 1NUPA 2Y8EA 1NOJA 3BGDA 3DMPA 1CUHA 3TZBA 3G0OA 2IF0A 2IV2X 1T3ZA 2FB9A 3G49A 3LCUA 3B9BA 4JS0A 3NWPA 2P5UA 2FR8A 2IYPA 4KIUA 5EIAA 4WESA 3FPLA 1KI4A 5AM5A 2Y99A 4NC9A 1L5NA 4KEAA 1L5LA 4YJGB 1NRWA 1IM2A 2EZTA 2FOXA 2WP0A 3HWRA 4RPJA 3FJOA 1BJTA 4OH7A 4DCPA 2ZRIA 1O2DA 4YJ2A 3SWWA 4KV9A 5KYTA 2H2FA 1OB5A 3SDSA 4Z7QB 4RDCA 3DQPA 1J33A 2LTAA 2NAFA 4BO9A 1N1GA 4ITUA 1LUAA 4RTRA 2VUIB 1II0A 3AI2A 3R6DA 4FFBB 4N8SA 5A6SA 4RXUA 2V03A 1D3AA 3IS3A 2CXSA 5IJ9A 5AW5A 2Y2UA 5FO1A 1PEYA 1Q7EA 1VHQA 1K7XB 3RC7A 3VR3D 3H5WA 1GRVA 2GNAA 4JWKA 1UZAA 3SBOA 1T9AA 1TJ5A 1G21B 1Q12A 5JW6A 2DY0A 4ZAYA 1LDEA 5I47A 1EESA 4GKKB 3ICEA 5L95A 3SDZA 4YV7A 1DX4A 1ZC4A 4ON9A 1Q44A 3L7AA 4HWKA 5CLHA 2I4IA 2CWDA 3NWOA 1BFUA 4BP9A 4CHGA 1O6ZA 1NVFA 3FUCA 1BVUA 2BFNA 5B3JC 2FFAA 1C4OA 1N8KA 3ZE6A 3ICVA 3HNOA 4M60A 4YRPA 5C52B 1Z35A 3UCXA 1JECA 2ZSFA 3KEMA 3RS9A 4LECA 3ZBUA 5A3RA 4FIDA 1TKRA 3HWX1 4FKZA 3P52A 2WHEA 1DC5A 2AYXA 5A3VA 1LY1A 1NQ5A 4UU7A 3B20A 3WBFA 2GCEA 3ZV4A 3V4RA 1R10A 4HSGA 5EJ6A 1R3DA 3RK0A 1I2ZA 1DQYA 1O54A 1V71A 4DTIA 5GPBA 1P44A 4X9XA 1GPAA 1I0IA 4XWKA 3HRKA 4Z2YA 3I1FA 2NZ2A 1IN5A 4G1FA 2JFQA 4L4UA 4EJ2A 2JLYA 1SPXA 2VDKB 2QV7A 1RXWA 4M86A 1VPLA 2HLDD 3M6AA 5IT9A 4XAQA 3ZLBA 1M6YA 1DIRA 3DZDA 4OBWA 4I5FA 3WRYA 3FNFA 1KZ7B 4AN0A 1AG9A 2CE7A 4HUQA 2C8LA 1JKXA 5JQGA 2QG9A 3ASUA 5I9LA 1SCUB 1D7OA 1Z6QA 2BHTA 2GZ1A 4O63O 1VA4A 4BNHA 3ZHZA 3SHWA 4DMMA 3TVYA 3QMVA 5BSUA 3W6OA 4B43A 5LP6C 5I7UA 5K6AC 4DR2B 3K72B 2HA7A 5KVAA 4MR7A 2W6JD 3C43A 1NBMA 3UHAA 2KSQA 4FIZA 5CXUA 4WZZA 3K6SB 3D7MA 1JEJA 3HNRA 5LB2A 1REQB 3LQ4A 1TPYA 4LG1A 3DGEC 4N40A 4WK6A 3KAJA 5JUWA 3FLEA 2JATA 4IG9A 2INGX 3O90A 2VJYA 3TTVA 1Y1LA 3NAQA 2Z2JA 3DFIA 2P7HA 4F72A 4FSXA 1ESZA 1S4QA 4UUPA 5K1ZA 4H4DA 3WMEA 5AKXA 1EKXA 2GJ9A 3A10A 3IXQA 4JR0A 4QARA 1SIUA 4MGHA 1EGMB 4DLUA 3IT3A 5FI1B 3K70C 3KFLA 2X5XA 1P4GA 1W0JD 2HYDA 3B1VA 4LSWA 4RDIA 4CNBA 2A1UA 1J2RA 1BDMA 1P7VA 5KYNA 1SQ6A 1GRCA 4XVHA 3RT9A 3W5HA 5AVXA 2V3WA 2FSPA 3OZIA 1XA3A 3H42B 2WUGA 1EVKA 3B1KA 2IHBA 3N2YA 3ORRA 1IIBA 2HWWA 4EQ6B 4Q4CA 5I51A 1WOYA 2XV1A 3EXG1 2VKQA 3GMDA 3IUJA 4KIJA 5KAMA 2EF1A 4BZZA 2R5FA 2VA9A 1Z29A 2A58A 2KB0A 3UAZA 1I5OA 1T0PA 4JLWA 3FYSA 4TTQA 5EY5B 1JHMA 2C2MA 4YRIA 3I62A 1FY2A 5ICEA 5EMHA 2ZI3A 1HLPA 2ZROA 3HN6A 3JAKA 3JD4A 4ER7A 2PIDA 1DOHA 5J2UA 2ARKA 3BERA 4W5OA 1GZ4A 3OE7A 5G1PA 2G0NA 5GQSA 1VECA 3GFBA 3K3PA 3K0CC 1P4AA 3MEQA 3BQNB 4MS4A 4X44A 3U7EB 1WZUA 3DPIA 1IG0A 2HA4A 5BN4B 4G9BA 4GBMA 3RKRA 3ZCUA 4ZHSA 4JQCA 2PWPA 1DXOA 1D1PA 5IK2D 2A7QA 4GMFA 3PNSA 4D9KA 4IQGA 1RD4A 2QRJA 2VOEA 3KTDA 4MCIA 2NUAA 3RYHA 2UZ4A 3TR0A 3T5GA 2QPLA 4QREA 2CLSA 1LA2A 3RSGA 1DC7A 2SCUA 3LXMA 4M0CA 5DSZA 4M6WB 4UFOA 1DLJA 1HRDA 2IZ6A 1CUWA 1JIIA 3GOQA 4B7XA 2B30A 1H2WA 3OF3A 2JHFA 2K7FA 4NBLA 2OCGA 1Y6GA 1WD5A 10MHA 2XYVA 3NAMA 4EEXA 5BQ5A 1GPKA 1FS6A 4X61A 1UBUS 2ZJ1A 3TCKA 2F64A 3IAM1 2W6PA 5GZ1A 4BO2A 4WECA 4UNPA 2F43A 3ZJ4A 3M6XA 4R5MA 3HLKA 3FNBA 1NMYA 3CY6A 1Z5OA 1D4OA 1Y4AE 2OGWA 2PV0A 4BO0A 1HBJA 1GGJA 1P1BA 1XP8A 3LUCA 3ZWWA 5ICMA 3FVQA 4AJLA 4GOND 2BP7B 4OUKX 2G40A 1YJCA 1T29A 2FFBA 3DL7A 4ENWA 3CNBA 4MUIA 3WSWA 1H6CA 1U3FA 4EFNA 3GEGA 1Z16A 1QQ7A 3FVTA 1VBMA 4WIAA 2CHEA 4IDQA 1MP0A 1V4NA 3TX6A 2VNJA 5ALRA 2HADA 4D4JA 2ZQYA 5BUSA 2PPLA 2ZYRA 3GFRA 3PA6A 5HSGA 2PX4A 3A4TA 3HZHA 5CHYA 4QRIA 5JDIC 1KY2A 2AFHA 5C1BA 1E8DA 2B21A 3D6TB 3GQBB 4HOYA 2JZCA 3GX1A 3IIEA 3FGOA 2OFWA 1XTVA 2KPOA 3PGMA 5EWLB 2VBFA 5I7EA 3EX7C 4J0IA 2P9JA 3VYVA 3SLRA 3DDOA 5KB3A 3R09A 1SA0B 4Q34A 5FWAA 3S1AA 4JCOA 1JAHA 2Q41A 1LPAB 1N7HA 1ZCFA 2BF4A 2NO6A 2XMQA 2XZTA 2DF8A 4NCNA 3U09A 1ABFA 5JPDA 2A78A 4J0EA 4U00A 5TRTA 4HFMA 2ZZNA 4JT9A 3PJDA 4MUFA 3BGWA 2HA2A 4NBUA 4E31A 2AMJA 1QP4A 5CVDA 2HFJA 2YV2A 4MV1A 3ZD6A 4AKIA 3DMDA 4LY6A 1WXHA 5DNVA 5CEFA 3JRXA 1JFTA 1KY5A 4S0ZA 3GYBA 2B83A 3F6PA 4PCAA 1F20A 2FPMA 4DARA 4LFAB 1DTWB 2WA2A 1Y7PA 3DL2A 3OBIA 4WAUA 2R8PA 3VSEA 3FJ1A 4IUCS 5F21A 4HB3A 5H5JA 1J8QA 3EEBA 4XD7D 4N5DA 5ALYA 2XAAA 3B6ZA 4N03A 1O4VA 3NCTA 5JCOC 5CH8A 3UT5B 2XEDA 5AFSA 3LJKA 1N2CB 3WYFA 3O2JA 1QPGA 2JGEA 3ZKAA 5AJXA 1OLXA 2YXDA 2OCBA 2PKEA 3I5UA 4WDQA 1IHDA 4GDMA 3JYHA 5LZ7A 4R3WA 1UKYA 3EARA 5T41A 1C7FA 4RKYA 3N0RA 4BGEA 3K6RA 1TRHA 5AJTA 2AQHA 3RH0A 2HRRA 3L4KA 2AJLI 1ZOIA 5FI5A 2Z2ZA 1U7TA 1E1YA 1X1AA 4I4TA 1UDWA 2WG2A 3L7DA 4CT0A 3GJ0A 1FYDA 2WIKA 2Z30A 2I7TA 3EH2A 3QFCA 2G9NA 3WDLA 3C8ZA 3WLPA 5TPZD 1TA4A 2ZIZA 2X5OA 4L9AA 4UZSA 5CT9A 2AUNA 5DLPA 3ZHBA 3B60A 1GCGA 2YWDA 3JD0A 3S7ZA 4ZOQI 2BZ1A 3MVEA 4KAJA 1SWWA 3RSSA 1KQ3A 2DYKA 2QRPA 2W2LA 5CVUA 1FB5A 2H4WA 2ZBUA 3G0IA 1EB8A 4JB3A 4QL3A 1KK1A 3TLAA 1R6BX 5GWXA 1HMYA 2G7MC 1N9KA 4YJKA 5FBKA 4QDJA 3VKHA 5CDHA 5U9CA 3O7MA 4JX8A 4R01A 1YHNA 3W2IA 3PNMA 3BZUA 4QU0A 1WQ1R 1XNJA 3QLTA 2JZNA 4HF7A 4AZWA 1Z8NA 3NHJA 4J6EA 2WHRA 1IHOA 1A98A 3AF4A 3W9BA 1U5CA 3JVVA 2BKLA 4ARSA 3R7AA 4TYMA 2ZYDA 4E94A 2C4VA 4BNTA 3T9DA 1N5IA 1WUIS 1MAAA 3U7QB 1CJSA 2R6GA 3HJBA 2O2EA 3NBXX 2JFXA 1VJCA 1TM4E 3OM0A 5JSUA 1JSRA 2BM1A 1VPDA 2PRKA 1G8SA 3ETJA 1GYPA 2CVFA 5AM4A 2G63A 4EPTA 1V7QA 4XDZA 5BWCA 3IAFA 2VHXA 4NENB 2R60A 4FB5A 1WCIB 2DQYA 2R6AA 3I9LA 2Q2QA 5KMGB 4RVOA 2YNMA 1NV8A 1YR3A 1RCTE 5B55A 1SBCA 1H0HA 1XNQB 2FN4A 4YY3B 4ESOA 4GUAA 3MTJA 1HK7A 3IOYA 2RHWA 4B2PA 4HUTA 1SUFA 3BX1A 4MPRA 1IOWA 1NMQA 8ATCA 3WGTA 4ARCA 3VMFA 3WRVA 2W2XA 5ICSA 4LXHA 1JNYA 3MTAA 4QXRA 2Q45A 3TIXB 3SJ7A 4AF7A 4BMXA 4PYNA 5HVNA 1ZM4A 4AY5A 1YQDA 2WMOB 3AR4A 3M83A 2DR2A 1Y4ZA 3IOCA 4K9NA 1GT6A 5A02A 2XKKA 3E9NA 5FORA 1H6AA 1KO1A 4IUBS 3OBBA 3OECA 3OAAD 3R6LA 4AY6A 1HQCA 1HE3A 3FMOB 2G06A 1TIBA 5DNAA 2DFTA 2E4WA 3SJZA 4RD2A 2YH2A 3ENNA 4F9GA 3K0BA 4YMIA 1ZU4A 5KSWB 3CPJB 4QUKA 1X8XA 1W5SA 2EG9A 1BW9A 1E5TA 2CGEA 4BQNA 1BFDA 1K7EB 3CW8X 4AZ3A 1FTYA 4JEMA 5LXTF 4P86A 5LBUA 1UK9A 2NXJA 4JGGA 1XVUA 3NP9A 4L5AA 2IYZA 4NEHB 4URUR 4WBXC 2COUA 2O7QA 1E6KA 3FPAA 5E0KB 2H2DA 5DSXA 1NMXA 2C3PA 2Q46A 3WYBA 4PC7A 1YMVA 3KUCA 3IPLA 3M6UA 4F5ZA 5KQLA 2F3RA 2JHPA 4GGMX 1E5LA 1B43A 4G26A 1SXHA 2I9PA 3KXPA 1RT9A 3X1MA 2G77B 3ASVA 4Z8XA 1VGVA 1SC1A 1M8PA 1XCPA 4AYTA 2FR8C 3C5VA 3CVXA 2VQEB 4IEFB 4EHNA 3C14C 4D41A 3I2GA 3B3JA 1QGUB 3GEHA 2ZK7A 4KZKA 4O33A 5KSPA 3WGUA 1BHO1 4ED9A 4XRGA 3KLPX 3RKUA 3I04A 1OBOA 2JJ2D 3JV7A 2DLDA 3ZU4A 4BX9A 3DBVO 3G2JA 4A92A 3VR5H 1OJLA 1XF1A 1GN9A 3FCCA 4GMDA 4UUOA 4XLTA 3B82A 3WWDA 3GLGE 1CUXA 1K7FB 1QS0A 3VZQA 4E5PA 5AVTA 3AYZB 3CEJA 1OBCA 2QU8A 1TA0A 3HPRA 2C0PA 3K20A 4ILEA 4RBNA 3IAHA 5JD6A 4GP7A 1DBPA 3GUZA 2WWXA 3F6EX 4BOYA 1GUAA 4QGBA 3ZW9A 1Q7GA 1A9QA 1ND6A 3U0BA 2ZW9A 2NACA 3HADA 1GG2A 1XLTA 2JFNA 2ZJ6A 2ZSIA 4J94A 1GTJ1 3K5HA 3LUDA 4IXNA 4TN5A 2WOJA 3WIVA 4B4WA 4G89A 1SHJA 5IMBA 2FWPA 2RH5A 3GJSA 2XRFA 4Z99A 1PUIA 1V25A 4NONA 3X2EA 1C1XA 1TCUA 1Q7TA 3N86A 2Q6OA 4J91A 3AM5A 2FPGA 3MYYA 4OGGA 1Q14A 5EJ4A 4G4IA 3B5IA 4B0OA 5HMLA 3SZ3A 3VYRB 5UKDA 2WIFA 1LF5A 1TJPB 1KQNA 3LPDA 4DQ0A 4E08A 4OX9B 4WLNA 4DJFC 2QT0A 3X44A 3UMRA 621PA 4HAWA 2J3EA 2ZQ5A 2IODA 3C70A 4R2LA 1P17A 2CJXA 3ZDXB 1M83A 3QWIA 2CL0X 3NHMA 2QLLA 1XDGA 3I6MA 3G2IA 2NLOA 5TQ0A 1W85B 1LU9A 1CQZA 1J2EA 2QZJA 2ZYVX 2OD2A 2MINB 3L49A 1VSQA 4HO1X 4BJ3A 1F8GA 4Q93A 1RKUA 1Y9ZA 1ZNXA 2CXNA 1QH1A 3PEFA 2ZZMA 2FMKA 1MB3A 3CUSA 4OQZA 2HEIA 2VAPA 4D43A 5GM2A 2VA8A 1U8YA 5CCBA 4B4OA 2J7KA 3WRYC 5A4JA 3IQDB 1NVEA 3NHLA 2FN3A 1ZGJA 3B7GA 1ZGAA 5CD1A 4TRMA 4RA9B 4DDVA 5FYQA 3H8JA 4FWIB 5JS2A 2ORIA 4BQIA 4X20A 1FFHA 1XVAA 4DUGA 1XLUA 4NZYA 3X1XA 1UFQA 3H2JA 3TRDA 4XGRA 2OXFA 1RVDA 1SVUA 1YJBA 2NNLD 5E6RA 5FV7A 2NPFA 1YRWA 4QTTB 2PH5A 3OF2A 4HS9A 4JLUA 5GJBA 4KRGA 4K9OA 1G5RA 1EVLA 1TM7E 2OLJA 3S6JA 4BIIA 4RABA 1KK3A 4S1OA 4YXFA 1A9XB 1XVLA 5CPBA 2H4JA 1KI6A 2B6NA 2YDXA 3OTQA 5D6NA 1QANA 3KR9A 1LI4A 4ZV7A 3VYSB 1NI3A 3JQ6A 2UVPA 3SX2A 1DKQA 1BXRB 5H16A 1TO6A 4Z4QA 3ZBTA 2PT9A 1HETA 2M6RA 4ZODA 4YQEA 4EB0A 1QONA 1CRQA 4UBOA 1S9HA 1SXJC 5H4HA 4YRAA 5GOTA 3SMVA 4NQRA 2K2QB 2FEMA 1KO8A 2OY0A 2P4SA 3GEBA 3OHPA 1ZIYA 4OUDA 5T6MA 2OILA 3TZEA 3VUEA 3B2NA 1FFXA 3TB4A 3ZIUA 3DHVA 2O7VA 1UWVA 1XZNA 3Q15C 3C5HA 3C6MA 4ZV4A 3D7KA 5ED0A 1LSUA 5MN4A 4D4LA 1AA6A 2DT8A 2VWQA 2VZEA 3AONB 1R0XA 4RPLA 1BH2A 3H9BA 1QQAA 3G68A 2E87A 3M4YA 1XSEA 4ENTA 1NBWB 2ODQA 2G5CA 1WW2A 3PUVA 1RW4A 2CLKB 1BS9A 3AJDA 4JSTA 3USZA 1I6WA 4ZCMA 2VLBA 4R41A 4XVCA 3UQYS 1JEDA 3K0AA 3FFTA 3PL5A 4Q3DA 1GA6A 5HILA 1JLMA 3QE4A 2CHFA 4ME6A 2VSFA 3LF1A 4Z49A 2FW1A 3KZNA 3N3BC 3L43A 3S2EA 5CB4F 4FQ5A 1AUQA 4YRLA 3AG5A 4Y2TA 1SU4A 5EA2A 4NK4A 5EMJA 1NG9A 2CXQA 3QSGA 3ZE0B 4BE9A 2GAOA 5H80A 5FADA 4OQLA 5B58C 4WQMA 3FH0A 3K4HA 1LNZA 2C8VA 1WMAA 5TC4A 1EFLA 5IJ9B 5LFAA 2VHCA 3DBLB 2QUKA 2Y67A 5F3WB 2A9RA 2GRAA 3UPTA 4EMUA 2ORED 1C0IA 2CBZA 4AS2A 4O1IA 4C87A 4ZZ0A 2QU7A 3PEUA 4LYJA 4RPIA 2CFOA 3MTEA 4R9SA 1IY9A 3MILA 3QA9A 1VL1A 2XY4A 4KJXA 3BXOA 1H4TA 4WMLA 1GP2A 1YASA 4ZT5A 3REGA 3SIPA 1NQAO 2IP1A 3KB8A 1IN1A 5F7OA 2XYHA 4A7PA 3PE6A 3ACDA 3BB3A 3P2IA 3PEVA 2C4UA 2JI6A 4GOMD 4M55A 4TV8A 4XUCA 2PZFA 4AJNA 5B5SA 3IT1A 5IDXA 1L1QA 4WK2B 5KC9A 1NBOA 1EP9A 4K8OA 3A4YA 4Q3BA 1OZHA 4NESA 1J5EB 1D6NA 2XUHA 1VL8A 3U7FB 3VU1A 3L05A 1Q91A 2PD4A 1BTOA 1GAXA 2AOXA 4JNCA 3IDFA 4GICA 4JBXA 2B61A 4R7GA 4HWPA 5HBRA 1CR6A 1OFGA 5ALKA 5JI2E 3DBIA 1M1YA 3EJWA 1E8MA 1GAQA 1NW7A 5T3YA 1PR2A 1ICIA 1VI2A 1ZCZA 3HUUA 3K9HA 3OIUA 4JJ7A 4L5YA 5AOCA 1FYXA 1Y9AA 2IEYA 3V32A 2VYFA 3WX0A 1KI1A 1CR0A 4OK3A 4GPAA 1G6Q1 4D3DA 3U5TA 4OFZA 5IEJA 1MC8A 3PCXA 2B34A 1XXHE 2WBLC 3K53A 2XYQA 2Q7DA 1DCMA 5JQGB 1Q2XA 2QAGB 4M0FA 1NF8A 1Q3TA 1V1MA 4GX5A 5SV2A 1VOTA 2NSDA 2W70A 2WJIA 4WI1A 1DINA 1U28A 5G53C 3OEHD 2NU7A 1OV6A 3A6ZA 4I7EA 4CUKA 4B9EA 3CJQA 4DRZA 4PZCA 2QI9C 3GLHA 5EXXA 4YWJA 3BYZA 2IU6A 3IUQA 1Z06A 4JYPA 2IYTA 3N7UA 5HX7A 2O0MA 2B82A 2X13A 3PXUA 1HT1E 5FTLA 2CEKA 2X15A 1WDLA 3PQFA 1IZ8A 3RSOA 3ZI7A 4BFZA 3EJ6A 1X9IA 3KQMA 4DRXA 3KQWA 4NDAA 1YB7A 3TOCA 1U0HC 4IS2A 5DM4A 3THSA 2MMGA 1O58A 3MWDA 1A8SA 2YHBA 3PE4A 5H8WA 5I7HA 1D03A 2WE8A 1RLJA 4PTYA 1FNBA 4KYUA 5KUTA 3KSAC 1E6WA 3TEJA 4ECAA 3KWJA 1TF5A 4ND8B 3H83A 2B0CA 1MRSA 2QTBA 1DOZA 3FPEA 5JSYA 4BZWA 3BSWA 2WM8A 1IK4A 3VM6A 5KVSA 1JR4A 2ZRAA 3LUGA 5AXDA 5JAPA 2OKGA 1TYDE 4N0DA 4LYHA 2A1UB 2X4LA 3FMIA 3ZKWB 4ZOCA 1RACA 1AMUA 1R9MA 4FYMA 1EA7A 3TAHA 4PWZA 2DQKA 3ICWA 1F4LA 1YWGO 4FBLA 1U9ZA 2NO0A 3SDBA 4R2JA 5A7HA 1HDXA 3KFVA 3SHTA 1ODLA 2WA1A 1X87A 3M33A 5FA6A 3WBJA 4QXPA 4KTVE 4WH0A 2QLTA 5DGTA 2J4DA 4B6FA 1XWIA 4J75A 4TWBA 1SO8A 4JFAA 4JVSB 2DP4E 3VU0A 3W1VA 2H2WA 3CEAA 2YFYA 2K4MA 3BHIA 4XWYA 1EGVB 4GS5A 1KMIY 1KZ9A 2AR9A 1TI7A 1YAHA 3CLRC 4ALLA 5C4IA 3GUUA 4XOIA 5AVJA 2X9NA 1USWA 2YWGA 2UUBB 5EIBD 2D3TA 1PZNA 4V0OA 1J7KA 3LLUA 5HFAA 5C7OO 4W5QA 1NP7A 1V16A 4LXUA 4EEZA 3AJRA 1VJ5A 1L9XA 2X76A 4IQFA 2PBZA 4DJJA 3R0QA 4QFMA 3ZWOA 1G5TA 3B6JA 5DTIA 4Z51A 3U7HB 1Z34A 3HU1A 2GPAA 4R9NA 5M34A 4L1KA 3BIWA 3BIJA 3RVMA 1Y3FE 1Q17A 1YZVA 1TZKA 5JARA 3ZJTA 4HYTA 3JQAA 3WSVA 2EYUA 5LOVB 4LSZA 1L8QA 4XX1A 4C6HA 2PX2A 3G89A 5KWVA 4B8YA 2FWJA 4WZAE 2G72A 3FKSA 3B8EA 1F2UA 4HDKA 3ZIDA 1QAQA 4W63A 2QWXA 3L6OO 5CNJA 2FG7C 1VHJA 3D3WB 3DZ8A 3F1LA 2CVZA 3T3EA 4DJ5X 1Q1ZA 3MYRA 2F43B 2H7XA 3E22A 1ZOSA 5E7JA 2EKBA 1L7BA 2YNMC 4BFLA 2QN1A 1AO3A 1U1IA 5TEWA 3SC2A 3M49A 4TYPA 1DX9A 1JNXX 4Q00A 2G9VA 2ODNA 3VNBA 2ZJOA 1NXPA 1VBNA 3EW9A 3GJ7A 2Q2OA 3A9WA 5AVZA 3NMUF 3MELA 1CXZA 1TRKA 4F4CA 2J5BA 1O0CA 1HFKA 3OM8A 4NHEA 3EA0A 4KSCA 2IS2A 1R4MA 4GP6A 5E38A 1PJ3A 2NTYC 4AUMA 1DARA 3O7WA 4UPDA 1JAYA 5AW8A 3N9IA 3TCXB 1NVTA 1TJNA 1U3GA 2Y0BA 5TY0A 2VDNB 2D00A 2GN4A 2DC1A 2NPIA 2Z5FA 3RGWS 4KYIB 2AFHB 3IE2A 5AKEA 1YDHA 1GM5A 4YACA 4JUFA 4DF3A 1FNDA 1YB2A 2TMKA 1GQYA 1PSZA 3C41J 3G9QA 5IDVA 3WOHA 5KINB 4BP1A 2V0GA 4DCUA 3B2QA 4EEKA 3P9SA 3QBTA 1G55A 1FP2A 1KMNA 5DHAA 3UPUA 4MVJF 3V4OA 1WEKA 2HR1A 2IDMA 3I28A 5EN4A 3QBVA 2VQ6A 4FOLA 1KJJA 1YCHA 1QZTA 3ELYA 3OZFA 4ZCQA 1ZBDA 1RRVA 4A6PA 4CM9D 1ZBQA 1JIQA 1SU6A 2QTVB 2Y0CA 1LD3A 3E48A 5IYZF 5JZ9A 1PD0A 4F4JA 3NOOA 4HWTA 1E69A 2J67A 1IAVA 3LT5A 3OUZA 3QYPA 1R88A 3H97A 1GCUA 4MS1B 2OM2A 2AVNA 5F98A 2H8KA 1MKYA 4HX5A 1I2BA 3N1UA 2TMYA 2FFQA 4TUYF 4Y6QA 3T34A 3VRHA 1AH2A 4HJXA 2BHSA 4Q1FA 4N41A 3V2GA 4RQUA 1AHHA 2RK3A 2WJAA 1FZQA 4EITA 4P80A 4COOA 2CXTA 3QXJA 5F23A 1M5TA 1Z39A 3QE3A 3VJKA 1H2XA 4N7MA 4DIOA 2G09A 1IJEA 4I4LA 4Y1FA 3KXKA 1I13A 3HSYA 1YRLA 2HNKA 2JIQA 1HTWA 3ASYA 3BWDD 1JYSA 4HRAA 2W2KB 2I34A 5G4LA 4F7DA 2OZPA 1GYQA 3CZAA 5BR8B 3ZD7A 2F1KA 4IXDA 3W4KA 6REQA 1I33A 2C84A 5CRIA 3IH5A 1HYBA 1NI5A 1YDMA 3ZX5A 4ZO6A 3THWA 4WDRA 2IT1A 3AYXB 2XWPA 3E84A 3HDYA 5ERXA 4RK6A 1JS1X 1R0SA 4EPXA 2I2DA 3VZDA 3EPPA 4N5MA 4MQ5A 2EZUA 5ES3A 5DMHA 3UJ7A 2WHQA 3V2IA 4P1ZA 1ZGCA 4PGGA 1IQUA 1XLTC 2GF2A 2ZSDA 3KHSA 3NC1C 4GR5A 4D9JA 4BBAA 1M0WA 1QE3A 2HK7A 2J8ZA 4FN5A 4MA4A 4PGFA 3ABSB 3IO5A 1OI2A 4E11A 4IGEA 4JY7A 5JHGB 4CMEA 1N77A 1MQAA 4TVSA 4PAOA 2AYZA 1VKZA 2VO1A 1C50A 3IULA 3O83A 3WZLA 2XKBA 3A9TA 3MWLA 3AEKB 3R8CA 4JBGA 4CDRA 1PD1A 4Z3KA 4MP8A 4XYMA 3MJDA 4BNDA 4D8WA 2ZRHA 1XAHA 2J3QA 1SUBA 3K1AB 4C7JA 821PA 3J7TA 4I9GA 1XVVA 2Y0PA 2O2XA 1VPTA 3PIDA 4H18A 5KWEA 1E61A 3ER6A 4H0NA 4V0MA 3SHQA 3STTA 5CX1B 4LKRA 5C34B 1RZRA 1YR8A 3LO5A 2XBMA 4LHYA 3A4MA 1JUDA 4LZJA 1U0GA 3C4JA 2MCFA 1NLFA 1YZFA 4D8VA 5A5DA 2YN0A 4P4SA 3TOSA 1G8MA 4LF7B 3MWGA 5LNK1 5A4KA 1B3RA 2V59A 2QTMA 3HFRA 3QEMB 1CZNA 2PZJA 1ZK1A 1SKMA 2PTHA 3RRBA 3P0HA 3AI3A 1R5OA 3FSEA 4HZUA 3NIBA 4IHQA 2C5EA 3R6GA 4FMCB 4HEA6 4MV0A 3VR5D 5I6DA 4RGVA 3DVSX 2XITA 2IK8A 4TWZA 1JKMA 1ZIOA 2DX7A 1GPMA 1M2KA 1UM9A 2V45A 3UG6A 3R3VA 4QDXA 2CFCA 2WZBA 3NM5A 1TC1A 4DG5A 3ILSA 2CF6A 1N36B 2EF0A 4L3VA 5JAHA 1F2VA 3WLAA 3A4IA 4QGFA 2HBRA 1OLUA 1DKLA 1EXMA 4RH0A 3B7WA 3DMYA 1N3IA 5F77A 2ADMA 1PT8A 5HF6A 1A7UA 2JJ1A 1ORIA 1YF3A 3II6X 4CKZA 2BSAA 4W9NA 2PXAA 2VHJA 3E7FA 4TLDA 1QH9A 3NWBA 4LRQA 3RU7A 1ILEA 3RVPA 1XTBA 1WF6A 4U6NA 1Z82A 2V7EA 1USKA 2WMYA 1EGAA 2HWXA 4AJIA 2FPIA 3BD8A 2P9GA 4I2NA 3EEIA 1V3VA 1H8EA 1VLQA 2P9FA 3H5TA 2IOFK 3TBFA 1E2MA 2Y05A 4S1TA 3I9MA 4MUJA 4AZ3B 2Y1EA 1EE9A 5SZKB 4CTNA 1AKTA 1ZRSA 1DWUA 3PENA 1H5QA 1I4WA 4DXHA 2J08A 3STHA 4BBJA 1K7YA 2E7ZA 1BXGA 4BRZA 3ID6C 3VU9B 5K3EA 4BNJA 3I0NA 3HACA 1ZXBA 3LP8A 4IY1A 3T5MA 2VQFB 1ZVVA 1E1RA 3PFHA 4BDSA 2J9ZB 2YQZA 3DDZX 3JVIA 4K03A 5K4AA 1DQPA 2IP4A 3G8CA 4KI0A 4D3SA 5JRDS 1C7IA 3N2LA 3UJHA 1TYCA 2VYCA 4LFBB 4MI6A 2OYCA 5KTYA 3V1UA 3HY4A 1V8DA 3R77A 3PXXA 5DTRA 5BRAA 5JXJA 2J45A 1TMYA 2R84A 4RJIA 4EA7A 1F9AA 3M82A 4QQ8A 1TD1A 3TOXA 1O95C 2PU7A 2OYSA 3E6AA 3UT0A 4E09A 1H2HA 3OTIA 3Q9UA 4X3PA 2AE2A 3V33A 4MZXA 3WGVA 1JAXA 2D5IA 2YL2A 4Q7EA 4AJHA 1E2EA 5K8CA 1Z4OA 3AR5A 1H85A 4P92A 4S1WA 1C0PA 1X70A 5HKOA 5KOJA 4MRNA 2AS0A 2DZDA 2ONCA 2VF8A 4IJ5A 4FJ0A 2XTAA 4M9SA 1F1BA 1VIMA 4G0MA 3D6AA 4F3TA 1JQDA 1A2QA 3SQXA 1PRYA 2VDPB 3UENA 4PCLA 1FJGB 2FW8A 1FDWA 2JD0A 2P3LA 2R6FA 2WU0A 1K6EA 3PWSA 3R5KA 1ZJ5A 3VKGA 4X8LA 3HLTA 3F6RA 1E4OA 4R8VA 3PVZA 1ZNWA 3A2MA 4DS3A 3MUEA 1IPEA 3IP9A 3K0KA 5PNTA 5FPTA 4O4JF 4ZAXA 2Q9AA 3IKVA 3DO5A 3K9NA 4OA5A 3RANA 3TAUA 3UWOA 4DCVA 4IIVA 2DBZA 3COPA 3SBEA 2ZT7A 2UVQA 2XHEA 3DCYA 3KZXA 2ZRCA 1W2WB 3NM4A 5KSZA 1Z4NA 1M34E 2O1WA 2ECOA 3SEFA 5JSFA 2HA6A 1PR6A 1WRBA 3W6ZA 2D4AA 2OORA 3IPRA 5C5CA 4OK5A 4HH3C 4N54A 1PDVA 1PLKA 1U8XX 1QH1B 1VMEA 2VYQA 4IDPA 1JI3A 3U4CA 3DVLA 2GBIA 3AG6A 3H6GA 2VXCA 1OX5A 5M04A 4K0KB 4A0QA 4BVBA 3CF2A 4O2BA 4DSTA 1FEZA 3WP1B 4DM4A 1EGHA 4IJKA 3TB6A 4V0QA 2L6UA 3CNQS 2K87A 3DM5A 1PZXA 4PFQA 4AAYA 2D7CA 4KN6A 4X20B 1U28C 4BU0A 3RVOA 3AB8A 4JMPA 3GLIA 1XO1A 2Q50A 2X1MA 4J0KA 1F0YA 1NLMA 1XHLA 1GILA 4EO7A 1G3RA 2UXDB 1DJPA 2PV7A 4CG1A 3PP8A 5AVSA 5IJAA 2HJWA 3ZLTA 4PLWA 3W8NA 5JSZA 4LOHA 5IAAA 1NVAA 1TGVA 3R3HA 3LCRA 2NU8B 2A0FA 3ES9A 3I6BA 3STXA 5A4AA 5BV1A 5IJZA 4MJ7A 4E4RA 2ZETA 2OHXA 2EGUA 4IWXA 2G0AA 1Y89A 1FU8A 2VG8A 1CQPA 3FIUA 3LHFA 3HO8A 1KKMA 3R0XA 2L2QA 4AX8A 3GVXA 2AOTB 2V7TA 2G17A 3ZJ5A 4H59A 2DLNA 2QM3A 4MB0A 4JBNA 1MFPA 3BMQB 4UHCA 2ZUFA 1OH8A 1NHGA 3PCTA 1FFXB 1Y3CE 3MT8A 4I8IA 4YP7A 3A2KA 4Y6OA 2NW6A 4J16A 4QOHA 4IRUB 3SYKA 2F8LA 3CUKA 4I1RA 5KNBH 4P8RA 1PNRA 1OTXA 2E5FA 1D1SA 2ERYA 3B85A 1UH5A 4D4HA 3AHEA 2W6CX 3IDOA 1Z73A 1XXLA 2VHTA 4AYWA 3RYFA 1NJ8A 2GZDA 5CFNA 4LC9A 3HCBA 2WPNA 4AXXA 5ELLA 2AN5A 2B2NA 4IV5A 3K0AB 1NYQA 2J9XB 2YV1A 4IL5A 5GZ3A 4BLSA 4D8TA 2X7HA 3KJNA 6LDHA 3GPCA 1V3QE 2BFDB 4NJMA 1IY8A 1FMLA 3N7AA 4HTAA 4LDNA 3UMGA 4AP9A 3VDXA 5A5GA 4RK5A 2BTQA 2Q1YA 3H1EA 1L5SA 3PQ2A 4MP6A 3WLTA 4BWVA 5TGTA 3G9UA 4NEQA 4CF5A 4BMDA 5HQ3A 3KSBC 2NSYA 1YC5A 3P9IA 5AK5A 2Q5EA 5FBWB 3GAZA 4TLAA 3SQOA 2ID4A 1P39A 3COZA 3OSUA 1P29A 3DHNA 3CRNA 5COQA 5DE3A 3RODA 1E0DA 4M9ZA 1Y3BE 4PWYA 5C53B 4IVRA 1OXVA 3BRWD 1AKUA 3W5BA 2RGWA 3QRWA 3ZK7A 1P72A 1N3YA 2YYYA 4PHCA 4O4LF 1H3FA 5F3RA 2X0RA 1XBTA 5FPYA 1WB4A 1N9GB 3PQEA 1ISFA 3BZWA 1CBUA 1XZFA 4FHFA 5IC5A 2EWMA 4EHAA 5FI0B 4PLFA 1GD1O 4A8JA 4IDCA 2L17A 5KNCA 4HVCA 5LL6P 3ZZMA 3ETCA 3QVGA 4L22A 2J59A 1CLUA 1VB3A 2DQ4A 3ASZA 3PUIA 3JWPA 5JJBA 4GYKA 2IGBA 2WKQA 3RABA 3HR4A 3X1JA 1I4LD 1XHFA 3EC1A 2CNWA 3AVQA 1W52X 3L6DA 2VZ9A 3R7FA 5D3KA 3ZV5A 1NBIA 1WZNA 4KO2S 2EKPA 4J7UA 4XE5A 2D0OB 4AJEA 2DGDA 1WU8A 2P67A 2GD1O 5KHLB 3I23A 1ZNZA 1M1UA 1GZVA 3ZW8A 4Q4DA 4Z9BA 4DQXA 4UUMA 4EI7A 5C32A 4I36A 3AB3A 2XCUA 1WPXA 5KYUA 5BMVB 1Z8HA 1CQIB 5EJ8A 3L0IB 1RC8A 1BU8A 1J25A 2J48A 2SNIE 1Q50A 3T7SA 3H2GA 3MWYW 3I45A 4WPGA 4MYUA 3ZWBA 1SJ9A 4LYDA 2CK3A 3J81A 3U40A 2IE0A 4G0VA 5IJ0B 1Y4SA 3HQ4O 2PH3A 3NH9A 2O2CA 5BURA 4HLCA 1T6BY 1C9KA 4B44A 3I2YX 2FMXA 1PNTA 5DBEX 2J30A 1U0NA 4J3JA 3GJXC 2O23A 4UE2A 4Z2AA 1KI9A 1KH1A 1UWCA 3LXXA 3UO8B 3PFGA 5DISB 1KEZA 3FHJA 1Q1EA 4J4BA 4YT8A 2FX3A 4CFSA 1UOQA 4NAVA 4JLJA 2ETVA 4TV9A 5AT1A 2NVBA 4KQGA 1B1AA 3CUEF 3GMIA 5IT5A 5LQJA 1XCJA 2C5HA 1NC3A 3S2SA 2I1LA 4C7OB 4R0NA 4EP1A 3IDZA 4H2DA 2EWWA 3P26A 4X92A 1NW5A 3RM3A 5IC4A 3NVKI 4QO7A 3GMTA 1CF9A 3MWDB 4V24A 2BGWA 4US0R 3G8BA 4CLEA 3LOQA 3BGOS 2WYIA 4OF4A 4XDYA 4CF7A 3OLZA 4LZNA 1Q83A 2VEDA 4M98A 3TUIC 1LPMA 1WPRA 2ID8A 1KS2A 2HNBA 2XGSA 1QORA 5IN5A 4WSOA 5L3RA 1N5OX 4I5IA 2OXIA 4Z1MD 3IB6A 4GOJA 4FWTA 4RNDB 2XGJA 4D44A 5EWJA 4DCGA 1I10A 4GBJA 4B4KA 5KOYA 1E2LA 1E92A 3FI9A 4BFSA 2HO4A 3M6MD 5FLYA 1K5PA 3AF6A 1Y7TA 3JX9A 2GJ4A 2JASA 3FNQA 4PRZA 4X0EA 4FOTA 1XEXB 1HQDA 1XZBA 1CY2A 4JI7B 4JOCA 4B79A 4DR3B 4G23A 3B3AA 4YLYA 1NBHA 1U8ZA 3RSHA 1V8FA 1ZD2P 3I2HA 3AH8A 1QPZA 2BR3A 2ZAMA 4AG3A 1XJCA 2D54A 2ICAA 5A9SA 1C8KA 3OOWA 5CDGA 4QVIA 1J0DA 3QX7A 3W0LB 1UAGA 2ZYHA 3GPDG 4KIGA 4Q4JA 4C89A 2NTEA 3C45A 3AM4A 5AOAA 4FYYA 2FWMX 1CP2A 1S3IA 2JAQA 2NU6B 3BULA 5FFNA 1T35A 2C5FA 2PCJA 5KOHB 2PXHA 1ESMA 1SUDA 1ZZEA 3QWBA 4HMQA 2YY5A 4YRTA 5ECDA 4E2WA 4MQFB 3BICA 3PF9A 4M76B 2IZ0A 2NZYA 2YWFA 2F4VB 1IK6A 3HP7A 3GN1A 3MJVA 4YI5A 5CM9C 4WW0A 2NUTA 4QT4A 1Z37A 4M8SA 1FW8A 4JBWA 4ZIRA 2P65A 3A1WA 3TTYA 1NVXQ 2I2BA 1F2UB 1W49A 1ZD3A 1PJ2A 3PDIB 4PC2A 1PKXA 2IPAB 4FX2A 3RFVA 4DJDC 2IU3A 1KO4A 2GERA 3GRUA 4L73A 5A3QA 4JB0A 3MIIA 4TM7A 3TIFA 2N9UA 3E22B 3F3SA 4RSRA 1FVFA 3QLUC 1LEHA 4POAA 1SZJG 2PWYA 5D5PA 4C2BA 2VNIA 1EVJA 3CZPA 4UVIA 1KQGA 1ES9A 3CKLA 4MW5A 1LSJA 3O92A 3UXHA 4IDDA 3ZXXA 4L50A 3TDNA 2C42A 1DXQA 5CDSA 1U2ZA 4CTKA 3L0PA 1P7CA 4FXOA 3UJCA 2A0XA 1LDMA 1QHSA 1YGPA 2HIAA 4IGFA 3IQWA 4RGBA 3KKNA 4RF5A 3TXYA 1XXHB 3H19A 4AX4A 1NBEA 3UHFA 1FSPA 4GZ3A 2CV1A 4KX5A 1KE2A 3FSJX 4FOPA 1YZTA 3T4XA 5A62A 4XWTA 1NJ1A 3U1BA 1BOOA 3MIZA 4WLOA 2AI2A 2ATVA 3DE7X 4W9NC 4RMGA 4RZXA 3HZZA 1D6JA 4TM8A 2E9SA 4H9GA 4EELA 2ODAA 2ZB4A 2H1FA 4G5RA 3QV1A 4PQFA 3W04A 5B3KA 5JANA 3T1TA 2ZUEA 1E1CA 1QIEA 2R68A 3DMFA 3OY2A 3ZU6A 4A9AA 1YD7A 1YL6A 3B9QA 4E13A 4HQFA 1VKNA 1U8AA 1JIVA 2JCBA 1B1CA 1M2HA 1OYVA 2JK0A 4XCQA 6YASA 2XUPA 3V8EA 1MW9X 4MICA 1U2SA 5EINA 1BG6A 3PITA 4JOBA 2FMIA 3GLTA 5JCJD 4Y6PA 3JAMA 5FLEX 2OP0A 3MJ4A 1YNSA 4IW3B 3MN1A 5KYGA 2IHVA 1E1KA 1VXOA 2XHZA 3PDUA 4GLOA 4ML3A 2OEPA 3ELBA 4TMZA 3E3NA 4F1JA 2UKDA 2NNWB 4TLMB 2ONJA 3ZCQA 1WF3A 4NYJQ 1RWQA 5CIQA 5DNCA 2L42A 2Q5OA 1M2EA 3GEIA 3DLCA 3TGPA 3AM1A 1XCBA 2JFOA 4XSVA 3F67A 4YXWD 3SVTA 3SKVA 3KEOA 1R5BA 3SI7A 1R64A 2EX0A 2GBPA 5C9ZA 3QFSA 2YWBA 2JI8A 4LRYA 4DIDA 5DNYB 2Q07A 1YR6A 2A35A 3P0JA 2ECPA 3THWB 3EEYA 3IR5A 1I1QB 4U7DA 3FTPA 5EPOA 5KTKA 1OAOA 1TUEA 3A1VA 1N6LA 1MHPA 5DF1A 3O8BA 3BS4A 5CYOA 2PKCA 1QX3A 1KHHA 1EB9A 3AC0A 3IVCA 2OHIA 3OUUA 5A4IS 2Y9PB 2J6BA 3C3DA 4F4HA 3W5DA 3IP5A 4II7A 2W48A 4BPBA 5H02A 2I78A 4I1YA 1W0CA 1X7WB 2WG1A 4E5NA 3AR2A 1WA5A 3KT0A 4AVYA 3ABQB 5JXIA 3VNVA 1IU9A 2YS6A 1XFAA 1B73A 3E1SA 4G65A 4CLXA 2R1VA 1Z07A 4PBSA 3SXUA 4GGPA 1OT5A 5LBTA 3W5VA 4BX2A 4YTEA 1ACMA 1WOMA 2GPSA 4IOJA 2ZT8A 3MUNA 4RS3A 1EFPA 1L8LA 4ZCLA 1N0HA 2F1HA 2ACVA 3L8GA 2M6LA 1UKEA 4WKGA 4DWVA 3FTNA 3NKVA 3QPDA 4XPIB 2BMEA 4TPKA 4J2TA 1KKLA 4M8IA 5CH3A 2WQ7A 1DZIA 3E53A 1KSHA 1WZ2A 3C3YA 2HWYA 4OHOA 5I4KA 5EWMB 3F3MA 1Q0SA 2OORC 3WWZA 1QG0A 5E3JA 1ZGGA 3G2PA 5B2EA 2JJ8A 5JBQA 1H9AA 2I80A 2UVDA 2C2WA 2PRYA 1ZCAA 3KQHA 3OCJA 1ZONA 3R0ZA 4PHTA 1NYTA 1YZGA 2QI9F 3HDQA 3HUEA 3I2FA 1B42A 2ZJ4A 2I4MA 2DUUA 1KC1A 4HZUB 1E1DA 2Q3CA 4JQYA 1HEUA 1Y81A 4PO9A 3RFTA 3VAZA 3FLBA 5M3BA 4HNVA 3DFZA 3DT8A 3DBHB 2QN6A 1XZHA 3HUFA 3WYGA 5A1TA 5K8LA 1YQTA 4GQIA 5EYPA 1PV1A 1T13A 1T4MA 2H16A 4HUJA 4LZAA 2ZP1A 4PLCA 1R4NA 1Z4LA 3GH1A 4OI4A 3UAVA 5JT1A 4ZT4A 1K88A 2H2AA 3ICCA 4Q1EA 3V7NA 4Y2QA 3CWZA 1CS0A 2HRCA 2Q8QA 1PX0A 3FZGA 3QE0A 3QU2A 3JSAA 2WFAA 2GKSA 4DLXA 1QRSA 4JLMA 5F1YA 1MFZA 2H1VA 2J9FA 1CWUA 3HUTA 4QYWA 1RRMA 5IEBA 4GWGA 1S8NA 2DTXA 1OLUB 2HMWA 4A26A 4F7WA 1LFDB 2H06A 1D2GA 1NE7A 2P2GA 4DBLE 2AG6A 1JLHA 2O57A 2JAPA 5P8WA 4NH0A 3KQKA 3F5SA 1H6BA 3NBKA 1X77A 3ENVA 4P5DA 4R9UC 2IYNA 4PFJA 1VKJA 2R85A 5G40A 4X60A 2VH1A 1Z8DA 4PPFA 3GBVA 4CKYA 5GONA 5CLJA 2VQDA 3DTVD 3NNSA 1Z88A 2C2ZA 3H8SA 4QUGA 1RLMA 5JEEA 3I3SR 5B37A 1J4AA 2Q3MA 1QB7A 1WDWB 3R40A 2RHMA 3T9EA 3T61A 4DUYB 3WIUA 1MV8A 2V6MA 4OEHA 1WDKA 2P6RA 2BBTA 1CY6A 3UWDA 3ZXYA 4C07A 2Q5IA 3KZ1E 3KV3O 1Q84A 4UXHA 3J81k 4UM5A 1ODCA 3IESA 1GRQA 4K9KA 1F0NA 3X1YA 2OM6A 3KKMA 1Q57A 1IBLB 3I0ZA 1IJFA 4MRVA 2C2OA 4TVKA 4O4HF 4IHJB 5E2AA 1OCEA 3X1DA 2VHWA 4LC1A 1EP1B 3EVGA 2O0JA 4EPRA 1G4UR 2FK7A 4WJLA 3EXHA 2XMZA 3IKMB 4ZEVA 2NQTA 5HJEA 2HT1A 1D0IA 1OFUX 3ZWXA 5AXBA 4CMKA 3T7JA 1L4FA 1Q1GA 1BE1A 3U4IA 1BHJA 2BW0A 4DCTA 5GZ6A 2C98A 4MUYA 1G4HA 3H7AA 5EE0A 3DEZA 3S99A 3NTQA 3H2YA 5JNTA 3P71T 1SNYA 2IQ5A 2QD4A 5E0OA 5DTEA 1Y8QB 2IV3A 2UZAA 3BWEA 3VH2A 5BQ3A 2FWNA 3MT9A 3TSAA 4TSFD 5KQPA 5AIAA 1T0HB 2GPNA 3I30X 4RK0A 1W36D 16PKA 5FJIA 1TT5A 1CB7A 4TVOA 1M5RA 3KT6A 3VNQA 5TVGA 3TH5A 3UAYA 2GSWA 3OLCX 3PRHA 1E1LA 1JHAA 4RENA 4BV8A 1UIMA 3KEGA 5AKYA 5I9TA 3GRCA 1M6EX 2X2FA 4MW1A 4M8KA 4EYKA 3H1BA 4F56A 4NAHA 2DULA 1UJNA 2LWIA 1FQOA 2H07A 2OWDA 3EG9B 3PPYA 3FGPA 3JZMA 5EI5A 4WNIA 4F2PA 2UYHA 4I50F 1UBTS 1OX4A 1JT2A 3HBNA 4MWGA 5L3SA 4Q82A 3BHJA 2O2HA 1E0JA 1NIPA 1A1SA 2AR7A 2PL1A 1BMQA 1XN4A 2OZVA 4BRUA 3WIDA 3T1HB 3DLHA 3T4UA 3DC2A 3ETGA 4BVEA 5KNBD 4CG2A 3FOBA 3GZ4A 4MJXA 4EYSA 1JR6A 1ZD5A 4P3OA 1W6RA 3K8ZA 3CZMA 1N0UA 2O3SA 3KQYA 5MGBA 2Z57A 3QOFA 1KL7A 1X7ZA 3LA8A 1QR2A 4X00A 3HGMA 1IYZA 1YZYA 2XDWA 4NMLA 4BZXA 4CEIB 3O31A 3CU5A 5KHOC 4LWPA 4OYLA 2OV8A 3LQ2A 4LJLA 1BEZA 1ZSYA 4YUVA 2WDPA 2B0JA 3GRVA 1NT2A 3NVAA 1ISRA 4I1IA 3VPXA 4TYNA 3DLBA 1STOA 2ZIVB 4IDHA 2C03A 2EW1A 4MVJE 2GGSA 3P0IA 3HMQA 4JL6A 1L5KA 1WLYA 3R44A 4YAIA 2FFHA 2BJVA 3OU7A 4QDOA 5TARA 4B71A 4JI0B 3IQFA 1TQDA 5EJMA 1V5WA 2O8CB 3EFOA 3GEPA 2RAFA 3ITKA 2VTKA 4L0MA 3GGPA 1W34A 4BKUA 1FTSA 1K89A 1WSDA 1ZA2A 2IYVA 3U3MA 3OWXA 2EX1A 4GBED 2GLUA 3G2NA 1UANA 2CXRA 3H75A 2YYAA 3AHFA 1WUKS 1Z5ZA 2JLCA 1Q3KA 5JJKA 5C8ZA 5JEDA 1UDCA 3ONVA 4WD3A 3OQIA 1VMKA 3AM3A 2RK6A 5AJHA 2PYDA 2DPYA 3Q5EA 5HZHA 3TQHA 2P77A 4ECEA 3K2EA 1LPPA 4IIYA 4KXFB 3D7NA 1CNEA 3GJRA 2HW8A 1UDAA 4PNZA 2VYVA 4YO8A 5CW1A 2GBLC 4K0RA 2HJRA 3WHLA 3L7MA 4BV3A 4F5DA 5DLYA 1T2FA 2HJSA 4R84A 2XAUA 3MF4A 4TKVA 1QZZA 2RONA 2ZDQA 2IL1A 2ZBEA 4EH1A 2WTXA 1XELA 2D0DA 2ZUCA 4O2RA 5AQ1A 2BD0A 3N8IA 4OVKA 4N49A 2OFXA 3KQUA 2QMQA 3E9ZA 2XQJA 2BGUA 3PYMA 3DZHA 4NIMA 4O29A 4RFSB 3IEIA 3GJ5A 4X3CA 5JMPA 2AFIE 2PUDA 1FJHA 3OPVA 4D2IA 5AXCA 4MLCA 4OAOA 2FZ4A 1QYCA 3E9MA 4WOKA 3STVA 2VT6A 2C5BA 3USCS 4CE6A 4RJTA 4Z4IA 3R5SA 1KVSA 3RJ5A 1M2VA 3BRSA 4KK3A 3PNLA 4HB4A 1D6SA 2UDPA 3KJQA 1FP4B 5LUBA 1SOMA 5FR2A 3UOAB 1Y3HA 1ZWLA 4QSMA 1GKUB