3EFEA

The crystal structure of the thij/pfpi family protein from bacillus anthracis
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
208
structure length
208
Chain Sequence
b'TKKAFLYVFNTMSDWEYGYLIAELNSGRYFKKDLAPLKVITVGANKEMITTMGGLRIKPDISLDECTLESKDLLILPGGTTWSEEIHQPILERIGQALKIGTIVAAICGATDALANMGYLDTRKHTSNNLEYTKMVCPNYKGEKFYELGPAVSDANLVTASGIAPLEFAMEVLKKIDVFTLDALHSWYNLNKTHKPEYFFQLMNSINK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ThiJ/pfpI family protein
molecule tags Chaperone
source organism Bacillus anthracis
publication title The crystal structure of the thiJ/pfpI family protein from Bacillus anthracis
rcsb
total genus 70
structure length 208
sequence length 208
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3efeA00
1VCOA 3FIJA 1T3TA 2R1TB 3EN0A 1FYEA 4K2HA 4B31A 3NOQA 4ENUA 3TTXA 4Y1EA 4ENRA 1QVWA 1N57A 1L9XA 1R9GA 4OGGA 2A9VA 3TTVA 3ZJ4A 3NORA 3TTSA 1T0BA 1OI4A 3L18A 2WJZB 3D54D 1OX5A 1PDVA 1VCNA 1P7YA 4P34A 1J42A 1GGFA 1IPHA 1KXJA 2VRNA 3N7TA 3BWEA 2R1TA 4L7QA 4ADSG 3GRAA 2YWCA 3PQ7A 3MIIA 1QVVA 2GK3A 4OQ4A 2ISSD 3KKLA 2VXOA 2ZUSA 4PXYA 3P9QA 2R1VB 2ZUUA 5DFAA 4UNIA 1Q2UA 1T36B 3TTWA 4E08A 4HCJA 3UOWA 3EWNA 4I2NA 4L78A 2RK3A 4BIMA 1KA9H 1Q7RA 4ENQA 2ZUVA 4MNTA 4MTCA 4P36A 2R1UA 4Y1RB 4ENWA 3CY6A 1VCMA 4L8WB 3WFZA 3ZR4B 1P5FA 4QYTA 5LIRA 3R76A 3TTUA 1M6VB 4D1YA 3NOOA 1OX4A 3B3AA 5K4AA 4MGHA 4I4NA 4AULA 1U9CA 3PQ3A 3L7NA 1IZZA 3TTTA 3TTYA 3TQIA 2NV0A 3FSEA 4RKYA 3VU3A 3EFEA 1CE8B 1P81A 2YWJA 4L95C 2YWDA 4S0ZA 3PQ2A 4LGYA 4JQSA 4AUNA 1SY7A 4AUEA 4ENSA 4OFWA 1I7QB 1GPMA 4LRUA 4B40A 1FY2A 1I7SB 4OJYA 1KEEB 3UMMA 1BXRB 1I1QB 4N0MA 4GE3A 1GPWB 1GGEA 2XF2A 3PQ5A 5SYAA 1IZYA 4B2YA 5IP5A 1QWSA 4OIFA 3CZAA 1S1MA 4UZSA 2RK4A 5E9AA 4ZGGA 1C30B 2VPIA 2ZUWA 3P9SA 4GUDA 4WINA 3UGJA 1GGHA 2FEXA 5JZOA 2D7JA 1UCFA 5SY9A 4AUMA 3NVAA 4RKWA 3M3PA 4GE0A 3R74A 1OX4B 1QDLB 1QVZA 2AB0A 2AD5A 2H2WA 3EZGA 2ZUTA 4ZDIA 4ZDJA 1KWGA 1KWKA 3L3BA 3OT1A 1GG9A 1SOAA 1PV2A 4XLLA 4B7AA 1VHQA 4UOQA 2W7TA 3PQ6A 4BFLA 1A9XB 2V4UA 4I46A 3BHNA 2RK6A 4UCFA 3ZJ5A 4P5PA 4P2GA 3RHTA 3R75A 1P7ZA 3F5DA 1PE0A 1JDBC 2YWBA 1O1YA 4ENTA 4OGFA 3EJ6A 5SY6A 3SF8B 5SY4A 1PDWA 4ENPA 3UJNA 4QYXA 3NOVA 3F71A 3PQ8A 3L4EA 4P35A 2IUFA 3B38A 4L8YA 1CS0B 2NV2B 4ZDKA 1QF7A 4B5KA 1ONSA 3OT1B 4Y1FA 1OX6A 1JVNA 1OY1A 4AJ9A 5BV2P 4Y0NA 3PQ4A 2VKTA 2ABWA 3ER6A 3P9PA 2GHRA 4Y1RA 4R7GA 1G2IA 4L8FA 3SF8A 1GGJA 1WL8A 1CF9A 2VDJA 3CZ9A 2OR3A 1K9VF 2LXNA 3NONA 3P9RA 1C3OB 1P80A 3SOZA 4E5VA 4N12A 3CYFA 3CNEA 3MGKA 4ENVA 4Y1GA 4BTEA 1GGKA 3B36A 2R1VA 3UK7A 4WXYB 4UOZA 5JZMA
chains in the Genus database with same CATH superfamily
1TI7A 2WF5A 3ZE1B 4UBLA 5DLYA 3UV7A 3AR4A 1WF6A 2I9PA 2Q9AA 4M9RA 5EG5A 5KQPA 1W47A 2NTNA 5EUQB 3NCTA 4LWPA 2ZSBA 4AU1A 2R0QC 2X0JA 1JVSA 5BRNA 4YUZA 2J41A 4MK4A 1WEKA 5J2UF 2BKUA 1NXSA 4N7BA 3EVCA 3TZQA 5E1MA 1D5CA 4HQ0A 1M34B 5FWAA 1VMAA 3LZ6A 4UM5A 3ZIAA 4CNQA 2W48A 4D4HA 5CEJA 2A84A 2VXOA 4TTPA 2F8MA 1WMDA 4OL0A 4P31A 1PFQA 3PX3A 1ABFA 1RZ3A 2IUUA 4RJIA 4UD2A 2XODA 1FFXB 1JR2A 1UP6A 1CHDA 2QYTA 5HBRA 3QYAA 2XOEA 3G49A 1VHJA 2B3TA 3WHKA 1Z0IA 3II6X 1RRPA 5FA6A 1ITZA 4Q4JA 4CUZA 5HTKA 3TQTA 2I2AA 2YKGA 1EZ1A 2XHZA 3VVMA 1MC1A 1C81A 5IHXA 4HLNA 2BEJA 4QUHA 2IQIA 3FSRA 2R6GA 5C0OE 4AWXA 1C0EA 2OXCA 1JEEA 2G80A 2D2VA 4Z0TA 1Z0KA 3QKSA 3KEQA 3P9YA 5TARA 1W36B 2ZIXB 3IA7A 1B6TA 1RHJA 1ZRNA 4K87A 3V4OA 2VF2A 1PR2A 3BD9A 4C78A 3AF5A 2HAEA 3N7UA 4ALIA 4TSKA 3ZI7A 3WISA 5CB4B 1HX7A 3K8OE 1L8OA 3HJCA 1A7JA 1ZK4A 4X6XA 4XX0B 4LZPA 1VPDA 3KYCB 3OSZA 4BMOB 1NSFA 5HEKA 3CLRC 2Q49A 3KVYA 2Q41A 3IBCA 4ZYVA 2O3UA 1CUEA 4R68A 2ONKA 2AMFA 1Z5OA 4MVJP 3HBLA 5IULC 5DWQA 1JHOA 2MCFA 1JI3A 2WMDA 3QE3A 2J87A 2QMYA 4I5GA 1KMQA 4X71A 2Q5HA 4N6NA 2RHLA 1F4VA 2O7NA 4MWOA 5HG0A 1SOAA 3GDHA 1XJCA 3FLEA 2ZDHA 3UA4A 2YL2A 5LDGA 2W7TA 3T7RA 1RXEA 2JFVA 3GLQA 3AILA 1HM5A 3PEVA 5CVDA 5A9SB 3NT4A 1M1NA 1KK1A 4PGHA 1I2CA 1I9CA 1I24A 4WOKA 1HFWA 1E0DA 4YWJA 1Y4ZA 3RFTA 2JGMA 4TWIA 3FOWA 1TO6A 1ULZA 2Q6TA 3H5WA 4HDRB 5D3KA 4CU5A 4ETNA 4BZZA 1ZH0A 2M9MA 1IXKA 1IJFA 1P5RA 4ISBA 3JVUA 2CXPA 5IM5A 3RI3A 1JQ5A 2LDBA 4RGQA 3IUEA 3NOVA 1PFWA 1W44A 4FEGA 3WK8A 5ELXA 4C2TA 3C16C 4GLFA 2YASA 4ZCSA 4KW7A 5BT8A 3WL6A 3IEUA 2JZCA 2KHZA 1ZO8A 2J9FA 1GPLA 1Z0FA 1UKAA 3MT8A 1WUJS 3LG2A 4ACAA 4N5HX 2BJWA 4MYTA 1N34B 3QMWA 4WFIA 5A6SB 2VUUA 2X76A 2G6TA 2V6IA 2XB6A 2YNMD 3HGQA 4JEMA 3I73A 4IEIA 4WVFA 3DE6X 1YVDA 2VNHA 1O0CA 4BAUA 5HZKA 2X4IA 1BCSA 3VX3A 2C2KA 1O03A 1AK2A 1YQQA 4PFSA 3IC5A 2A0FA 3BGOS 2R8RA 1MHTA 1CJKC 1Z68A 2ECQA 3I32A 1GRCA 1Y1LA 2RKBA 1JBKA 2XVXA 2HA2A 3CRMA 4JENA 4F2HA 3HUTA 1AKVA 2R25B 1NUHA 1RWVA 3NAQA 1T4DA 4TVSA 1NOIA 1VM6A 4G1CA 2WHQA 1NW4A 1R9JA 4R6WA 5HMLA 2WIKA 4LYDA 1T29A 5A1TA 1N9KA 1G3MA 2BSXA 1DOHA 2FVXA 2WJZB 3K9WA 1X3LA 3L5OA 1N5IA 4KNWA 3DW1X 3SF0A 3IV6A 4BNHA 2EIHA 1LVGA 2V6JA 3N2ZB 3KPJA 3WLAA 3RYHA 1O8BA 3H2JA 3PNOA 4Q7EA 5TQ0A 2R8EA 3NP9A 2CBZA 4HAYA 4IY1A 1QJ4A 2A9PA 1T2VA 1UXKA 1SKYE 3QFRA 1G59A 5A4IS 1IG3A 1Q7GA 4AIRA 3UIEA 1UMBA 3RSGA 4I1PA 1QP4A 3P9CA 4QBKA 2W93A 3BGSA 4F38A 2Y0DA 1S02A 2QL6A 4GYYA 4B3JA 4EKNB 2QORA 3EFBA 2FEKA 2RHDA 2YZKA 3ANNA 3F67A 1WKBA 1HDYA 1OAOA 2R4QA 3FM9A 4R54A 1FUYB 2FHPA 4RADA 4YX9A 3FI9A 3PE6A 1W76A 2VCHA 1YB1A 3AF2A 3Q7IA 4KQEA 2JA2A 1TDJA 1GRRA 3L0DA 1SXJA 3ZCUA 3BREA 4DSUA 1NJ8A 3JATB 2VSYA 4KUEA 3CEPB 5TMBA 1SA0A 2ZS8A 4KQCA 2A5JA 2JLSA 2PEZA 2BJVA 1OU0A 4JWTA 1OW3B 4CCYB 5EHGA 5IKPA 1KS9A 1PS9A 4LKOA 4MO9A 5KJEA 3ESDA 4IVRA 4KQXA 5AVOA 1EGMB 4RQAA 1HG1A 2VP4A 4DCMA 4RA9A 3BXZA 1RRMA 4E0BA 3FLMA 5E6RB 4ER0A 3OF2A 2BCGY 2IHJA 5DF1A 1O95D 4XGIA 3CZAA 3R3YA 1FRNA 3C6YA 1YTLA 4E2ZA 1PSZA 4CMIB 5D3QA 2IOYA 3KC2A 4TS1A 3WTBA 2BMEA 1AIPA 4YFYA 4NMMA 3O73A 3ZDEA 2FRDC 1GV1A 1C9JA 3M9LA 3NH6A 4PEVA 1F60A 1E1RD 5LNK1 2G4CA 3DHWC 3ENNA 1S9DA 2AW5A 3NTRA 2PUTA 3PE4A 2VEOA 2VWQA 4GS5A 4DMFA 4AN1A 2H8KA 4DSAA 1C4KA 2X15A 2PGLA 5C46F 3NUGA 4IOLA 1WZEA 2XTMA 5G1PA 1EJ6A 3P0EA 4U7PB 4DRZA 4JI7B 1JHZA 3BZWA 1FW8A 3SC3A 4I8IA 2OUKA 4BFWA 4ZYLA 1BDIA 3I12A 2Q2WA 1KJIA 1AKNA 3L79A 1HNWB 4F0JA 1TF5A 2ZYSA 3BEOA 2EJBA 3LAWA 3RC3A 3V8NA 2EFGA 4TV9A 1PJZA 1M72A 1T91A 2I80A 2HIAA 4ENTA 1I9GA 2Q1TA 4XAQA 4GXNA 3OFNA 4CETA 1JX6A 3E27A 3I45A 4JJ8A 4EHIA 2EZTA 1XEAA 4CMAA 4YCMA 1EXVA 4WXEA 2WI8A 4A1OA 5K51A 1OE0A 2H0AA 3IBFA 3H11A 1I2ZA 2FEOA 5EJ8A 4K6MA 4D4JA 3H2GA 3QU9A 3DFZA 4BJ1A 4Q9IA 4Y2JA 1SK9A 4ZOEA 2FFRA 3RIXA 5HCUA 4NFYA 4U4AA 1B23P 3I5XA 3M4ZA 4FQ8A 2ARKA 4UNPA 4UFNA 1NOJA 3CNEA 3CR8A 4HWRA 3OJLA 1W85A 1Y8AA 1ZW6A 2PIAA 3I9JA 1Z2EA 1UMDB 3WKBA 3U16A 1E5LA 2LRHA 1D03A 5FAXA 2C00A 4WUTA 4AZ3B 1KY2A 1U6IA 2WV7A 1QO0D 1YB7A 3L6RA 2FI1A 4XUEA 1XA0A 4MHTA 3AIOA 1QE3A 2EV9A 4X61A 3U7IA 1XD2B 1DG9A 3CSSA 4UTRA 4HNUA 2O8BA 1DZIA 4ESEA 4Q82A 2ZSDA 2PMWB 1IPHA 1W93A 1Y48E 2LD4A 2RI6A 4C7BA 3UJBA 2C7QA 3EPHA 1NQVA 4BHTA 3RJMA 4M8IA 4RPLA 3UJ3X 3IEIA 4YAKA 3FNIA 2W2LD 1JQDA 1MO4A 1HOXA 1T36B 3H2KA 2JIBA 4HNHA 3IT0A 3BRSA 4BFXA 1RAAA 3V1MA 2FWRA 1P2BA 3KQVA 4Q3OA 1JYSA 1N2CB 1QKKA 2VQ3A 1G20B 1JQEA 2Z4SA 5F23A 2I4TA 2ATIA 2HB6A 1VPWA 2OECA 3ROZA 3KALA 3AM3A 3CB2A 4FGLA 1F9AA 3FCYA 3PF9A 3K2QA 3JQ7A 2VHTA 3W5SA 4LQCA 2CNWD 2WMNB 3FN4A 5AXAA 3KQUA 4M60A 2HRCA 1Z17A 1NULA 2D8MA 2HDOA 5HDBB 3COJA 3KLPX 4YFVA 1H5QA 3W8FA 4LF6B 1CZNA 4AQYB 2VP9A 2F1JA 1FNSA 3WNZA 1G2OA 2QI9F 4LRUA 3GFRA 1Y37A 2QVXX 1JHUA 3HY6A 3I8XA 5KQMA 1FA9A 1I7SB 4RPKA 4WKGA 4WWHA 3RRXA 4C0BA 3RG8A 1QZ3A 4UUNA 1SCUA 1N2CE 1MOZA 4FFMA 4M0MA 4AP6A 3PNYA 4JSRA 2GZRA 1I4LD 5HUJA 1JL3A 2JB9A 1MO2A 1HE1C 1R6BX 2ZRAA 4LC9A 4U2BA 5C1IA 5JNVA 4RELA 5B1SA 5I4KA 5H68A 1E6UA 2HM7A 4KQIA 2XEDA 1QONA 4KV9A 4XUCA 4FM9A 1IK4A 1GXSB 3QXXA 3Q7QA 1A2BA 4Q02A 3SN6A 4C5BA 2IYNA 2QSUA 1SUWA 2WT9A 4OH7A 1UWVA 2JJ2D 3BHNA 1GCUA 1UMKA 3I1YA 1E0KA 1LI7A 5MGBA 1BVHA 4WESA 5L4LA 1HKHA 4IJQA 1N3LA 3W34A 2RBGA 3CN7A 1WSWA 4TVKA 4RY9A 4AZ0B 1Z7YA 3BOSA 5JASA 3F4LA 4NEHB 3H9BA 5SY4A 3AP2A 1V0JA 1V9CA 2A1IA 4KVFA 3ZXUB 1YJCA 3KJXA 2PUAA 4REOA 1IHYA 5CX1A 1NW5A 1P17A 2GLUA 2ADFA 2BMWA 3GJTA 1A9TA 1NXQA 2YHAA 3IURA 4IGKA 3V9AA 3VR2D 4ZCQA 4RFSB 2ZB8A 4MV7A 2JHCA 4DA7A 5TX7A 1ZRSA 3MQ4A 1Q20A 3DFKA 2FPOA 3MN1A 3HXTA 3JYPA 4LQLA 3T3GA 3W78A 1CUWA 1VG9B 1UR5A 2IYOA 1AQJA 2WHPB 3GLFB 3LNCA 4KLRA 2GN8A 1QPBA 1M5TA 2FGKA 3KQMA 3HYRA 5SZJA 3FMPB 1QQ6A 4MPJA 3EDCA 4H7PA 1CF9A 3S8MA 3RRZA 4AJNA 1UP4A 1LTKA 3G7UA 4NK5A 1LJUA 3GJ4A 4MDHA 3H65A 2EARA 4UDYX 4OXRA 2BISA 4HDRA 1XZDA 2IHYA 2Y1WA 4MULA 1PT9A 1Y82A 2R8XA 2YY6A 1H2ZA 1ORDA 1L4NA 1T8UA 1ODKA 3Q5EA 1H9AA 3NHRA 4DV5B 1YMVA 2ZE7A 1PFVA 4OHYA 3OQNA 1BFDA 1OT5A 3DOOA 4JSYA 2PQ6A 3P71T 1UOOA 4A5OA 5E3HA 2ODEA 3VOSA 4PY2A 3NO4A 4LMBA 1UDWA 1EDBA 1OA1A 3RANA 3ZU5A 4EBBA 3ECCA 4HI0E 1KJZA 4I99A 4PBRA 3PEWA 4MS4B 1XI2A 5JAPA 3BQNB 1R88A 3C6XA 4QPCA 3PUYA 3SHFA 2YNMC 4R0VA 2J9RA 4D9BA 4GOOD 5KUTA 3K9QO 1W5AA 4QOIA 4XIIA 3KCQA 4HQ6A 1Y6RA 2UYGA 2HV8A 4FOOA 1CBUA 4B5LA 4MW6A 1NV9A 4FDUA 2BFEA 1A9RA 4HGNA 3UH1A 3VSDA 2NO9A 3W5DA 3A9UA 4HNGA 2OBYA 4FJ1A 2EX4A 4ZRMA 3TZLA 4C6HA 1E3WA 1XDUA 2BMDA 2WJ3A 4PGAA 4ZAFA 5LZ7A 3FFTA 4D0NA 5E1BA 1DC3A 1T2UA 1YK1A 3O0DA 3OZEA 1QGAA 1EHCA 4CKZA 1E3MA 1C7QA 1D2CA 4I4NA 3W05A 2X0NA 3IQHX 1XO1A 2B2CA 2VJKA 4H1HA 4DQ0A 1APBA 2OYSA 5BMVF 4PU0A 4JGGA 1V11A 1NRXA 3F4BA 4O2RA 1YDHA 2I1VB 2OXIA 3O4FA 4PRYA 4FHCA 2WD8A 4EB6A 3W2GA 4IJ5A 1K8XB 1R64A 3HJHA 2PYZA 3PI7A 4UCXA 4MDEA 3H6KA 1ZWLA 4EPXA 2VYQA 5TRTA 1T1IA 5A1JA 1Q3TA 5E2AA 5FUYA 1L4MA 1Y3HA 3AI3A 1LB1B 3S27A 1T2EA 1IK6A 3GCZA 2G5PA 1NW6A 2QHXA 4H7EA 1YL6A 5AJZA 2QM0A 4HLUC 4IF4A 3WJ2A 1PGPA 4D5EA 4L4XA 3TOSA 4DLZA 3ELUA 5CA1F 3M3PA 4Q16A 1DIGA 2Y1GA 4TS9A 4U0KA 1G8HA 4R8KA 2C2WA 4QJ3A 2Y1CA 4CT5A 1AKMA 2HWXA 1UBEA 3BL5A 4ZAWA 3MWYW 5AJVB 4BLUA 4A8PA 4B3SB 3NZEA 4JLOA 1QIGA 3ORYA 1JAXA 1U5AA 1TZ2A 3GRYA 3TLJA 3V7FA 1YC2A 4ZAGA 1SG6A 4GF5A 4H35A 3K16A 1ZGJA 4MEJA 1XTZA 3K8YA 2OBNA 1KY3A 4B3TB 1KP3A 5DN6A 4F92B 4UHHA 3ICVA 2OOSA 3FZNA 4EGJA 1DIRA 1QIIA 3C97A 4C4OA 2F1HA 4G1EB 1OXUA 1R6XA 4ND7A 5CGQB 3RRYA 4DDUA 4FE3A 1DWOA 1EVQA 2IRWA 3U7RA 1TJNA 1ZESA 2EZ8A 2FYTA 3FE2A 3I39X 5AK6A 2H1SA 3SC2B 4PLYA 2E82A 2IYAA 4KVZA 4P4TA 2IUYA 3T0IA 1U0GA 5CCEA 1Z2AA 2CJPA 3WQRA 3UGQA 1KMNA 2DG2A 3G0DA 4R9UC 3WB1A 4M88A 4EA8A 1JG7A 1GL6A 5LBUA 4TLDA 3L1JA 3TL2A 3LLMA 2OR3A 4OGLA 4UEJA 1E1KA 2C03A 3UJ6A 3O31A 4JCCA 4RNDB 2NSYA 1NMSA 4HVTA 1E89A 1DMRA 1O6BA 1U2PA 3UK0A 4PO9A 1E32A 1ZRMA 3OX4A 3UGTA 2Y6UA 3GJ5A 4YECA 3QI7A 2Q1UA 4HDAA 1JEOA 1U3FA 4FLFA 5CFMA 3SNKA 3O2SB 2QJOA 3UMBA 1FFEA 3UCFA 5TPWA 4DEYA 1TUBB 3IUPA 3DXXA 4G4GA 3K1AB 1YRHA 2ZRJA 5KTNA 3CLUC 5AXBA 4DSOA 5FOXA 1SH7A 3PE3A 5HKKD 1PW7A 5IU6A 2ZPAA 2WU8A 2E0IA 1GAEO 2G8LA 2GBPA 2I5PO 4HMQA 4KQHA 2BGKA 2I55A 4F96A 5AD1A 3EWAA 3TZBA 5BW6B 2H7YA 1TYBE 3T3IA 1IPFA 1RQGA 2FP4A 3RUPA 2VDPB 3TSAA 4ZEXA 3UHJA 4F56A 1JHAA 1FU7A 1XGKA 3LVFO 4MAMA 4URYR 2M1ZA 3QE0A 4BNXA 5K0ZA 1CF2O 1J00A 3TL3A 4WBNB 2GCEA 3R0ZA 5KYNA 5ENDA 4H60A 4KO4S 1CY1A 1USWA 4KLCA 2Y0CA 4BS9A 1XIVA 3IPXA 2CV1A 1U1GA 3JTMA 1XK6A 3VR6H 4MRAA 2CW5A 3VNBA 1I1NA 5E6SA 1RM3A 2G5TA 5KYUB 4MWTA 1R6VA 2X3FA 4RJKA 2PUBA 1I2DA 2REOA 1P1HA 3LYUA 4G41A 5JAOA 2PFGA 2ZIEA 3QEJA 4MVYA 1JDTA 4R8RA 2C29D 5JWOA 4HH1A 2I29A 2O2HA 2R1ZA 4NAHA 1M75A 5ER6A 3K9HA 1JLSA 4PHHA 4LDRA 1UJ2A 2DBRA 1W6UA 2P7IA 3HM2A 3FDJA 4IZHA 4WL0A 5K8IA 5K3BA 1JR3D 1G4UR 3GD5A 3TCNA 1N2BA 1N5KA 4EKIA 2XKAA 4XWKA 2IYEA 2V6FA 3W9BA 3KCNA 4O5AA 1OWLA 3PR3A 3QLVA 2YOFA 4Q9DA 2BTOA 1RM0A 1T1GA 3DEZA 1N0IA 3LJKA 1GZDA 1NXVA 3NHPA 3PEUA 4ITVA 5ALWA 2RGEA 1M54A 2JAQA 4OP2A 5JSZB 2JPDA 1NXOA 3WLPA 4YRQA 3LUGA 4MV3A 4UHKA 2ZJ8A 4YLGA 4JB2A 4CF7A 3OZWA 3TVYA 1SU4A 4AKGA 2XJ4A 2CJWB 4X3PA 4OATA 1G63A 4HK4A 1KFJB 2E21A 3AUJB 1CS0B 4EGAA 1QTQA 4JJ7A 1XRLA 3W4KA 1Q7BA 4GP7A 2MINB 5FBQB 3N70A 6ADHA 1V6SA 4GXTA 4GXQA 1TCUA 5H59A 3R7NA 2YVUA 1WXGA 1CF4A 4IDCA 5TQJA 2GA8A 3CGGA 5CHYA 3AM1A 3EVFA 1B8PA 3KUDA 1R5BA 2DHEA 3B89A 1E59A 1N9GA 4JIMA 2YFYA 4MIEA 4PYMA 3DDCA 4IH1A 2Q5CA 1W5SA 1GQ2A 2ZBRA 4HB2A 4L16A 5TQ2A 5A02A 4E5VA 4FILA 4RX1A 1E66A 3A1EA 5HE8A 1J1ZA 5KTMA 5CFNA 4A2PA 4MS3B 1JDVA 3A37A 1IJBA 1TKAA 4C21A 1QGYA 1JSLA 1WB4A 2BM9A 1NRWA 4B44A 1B1CA 1OV6A 4H4DA 4LXTA 1MABB 2OCBA 4IDOA 1SBYA 4Z0PA 3JQQA 4B73A 2WTUA 2Z9BA 5JYBA 3HNRA 2D3TA 2PS1A 5FWDA 1GN9A 4INOA 4JL5A 1GZ7A 3MWDA 4X1IA 1UPUA 1P77A 2H57A 3DZIA 1KP2A 3GD7A 1XXHB 1D4OA 2J5XA 5G3ZA 3DR3A 5GWXA 4OF4A 2HV9A 3GLIA 1QK4A 2IXDA 2IDJA 5GVRA 4ZRNA 3PD0A 1YGPA 1EUZA 2EG5A 2JVIA 1JWBB 2P2DA 3ZHYA 4I1RA 1EA5A 2Z1NA 3UK1A 3ZIAD 1RYEA 1CRPA 2G07A 2W6PA 4U00A 4HBZA 3PJGA 3F7NA 4PG4A 1I2AA 1XXLA 4WLEA 4OHRA 4X3OA 4B82A 3F6CA 3GLIB 3U3DA 4DDKA 1BDBA 3JALA 4NDNE 4MVJG 4QYTA 4V0OA 1NJGA 4M0CA 3S4YA 5AJUA 2JJ8A 4YJDA 1L1QA 1TA0A 3BSYA 4JYAB 3TRJA 5IMSA 4N6GA 4JVNA 2VPXA 2FUG1 2YWGA 1SMKA 4ER5A 4RANA 4K26A 3LCUA 3S3TA 1UBTS 4PAOA 3TI7A 5I9MA 4M7OA 2C95A 3E2IA 5AVWA 6REQB 4YJ2A 2DHQA 4AUEA 4HXYA 1YZUA 5MN4A 3BJEA 4FZ5A 1JIUA 4HHEA 5EJ2A 1DEXA 5SYAA 4BMVA 2PE5A 3QTLA 1QJCA 4CQMA 1BXGA 3ZHRA 1ZUD1 3DZFA 4RZIA 3UH0A 1JA9A 1Z5ZA 4L0CA 4DCUA 2W22A 2IELA 4F3RA 3ZV7A 5IAGA 3P4XA 4E5SA 1OXXK 5KDOA 4X1KA 2YV1A 1E2GA 3L0IB 4AJ2A 4Y2SA 2AI1A 3DL2A 2FZ4A 3KT0A 3EODA 3WKAA 4B80A 4CFSA 1DC8A 2WTNA 1EFKA 3PKJA 4WI1A 4CEIB 2ZBGA 4DMRA 1FUIA 3N2GB 3LVRE 5G41A 1DEHA 5I5EA 1YXMA 3CUUA 4JK3A 3HA3A 5EMMA 2ANBA 4HDKA 1YR8A 3DDWA 4JZYA 1MTOA 1T4CA 2FQQA 2BDEA 1NJSA 4DCGA 3ZWDA 4J91A 2QX9A 4OIMA 4DT1B 2YOGA 5BYAA 1PSDA 1FFAA 2DYKA 2JEZA 4JROA 3C5HA 1M0TA 1HT2E 3OIGA 3UUFA 1FFDA 2QTZA 3AHCA 4YAUA 5B58C 1H0SA 5LP6C 2ERCA 2XPCA 1SR8A 1TT7A 3EMKA 5DNDA 3SKVA 4L6IA 4RH0A 1X39A 2CXXA 1J33A 2PMBA 3HH8A 3AUKA 3MK31 2BFPA 3NHBA 3QLEA 3LBYA 4EZIA 1DP4A 2L17A 2WT8A 1EXWA 2Q4OA 1DC4A 4NY1A 5DHUA 4II2A 4XDHA 4AP5A 4DW8A 5IDQA 4Z54A 2GF0A 5JJCA 5K2OA 1LS1A 3DXYA 4IH9A 3C3WA 2CXTA 4ZPXA 2FJUA 3SR0A 4F5ZA 5BWLA 3EFHA 4RMIA 4UU7A 1ABBA 3K0AB 3K0EA 4JQYA 4G5OA 2LIPA 4QUIA 3TTSA 2JGLA 5F7XA 5K6AA 1WMFA 2M1XA 4DILA 4M9ZA 1CJMA 1K27A 1QB8A 2N0SA 3N2EA 1IULA 2F3RA 5DVZA 5DV9A 5A5GA 1KDRA 2QLLA 3F6EX 4FFBB 4I5EA 5DTRA 1K88A 3MELA 3AI1A 2Q3DA 1ADFA 5CU7A 1T9CA 5FBLB 1W1IA 2CKDA 4YV7A 4CT4B 3ZCTA 1HNZB 3P9IA 1UDAA 2H06A 3I76A 1ENZA 2W71A 4HEJA 5CBPA 2G25A 2BMFA 1QLHA 2O8DB 3QVMA 2JDID 1ECGA 2G09A 4O4LB 3RABA 1DFIA 4L75A 5GIPE 4YRKA 2IW1A 3FCSB 3WRYC 4FYWA 3MB8A 221PA 5HFAA 2JVKA 3PC8A 1Z22A 5D01A 4CMJA 4D6YA 4P54A 1ZIOA 1SKMA 5HKBA 1W2GA 2WUDA 1WABA 2DE0X 2KM1A 5HQ3B 2FDXA 1FJXA 1LV7A 1IOWA 3P0RA 2ZB7A 4JR1A 3ZE6A 4EHFA 2YOHA 2HY7A 3O1JC 1K4YA 1T4CB 3AUFA 4BU1A 1TQ2A 4R1UA 4DBLC 1SVKA 2XTNA 2AKEA 3DDZX 4WZBA 4KX5A 3GG9A 1N5RA 2L19A 2MSLA 1II9A 1U7XA 3MJVA 3SK0A 1O95C 4MRMB 1UFRA 2PX3A 4C7OA 5EVCA 4ER6A 5G4LA 5T7BA 3NBYC 4P93A 2AMVA 2Q6VA 3HYCA 5BSWA 2QBYA 3F6PA 1VECA 5LQMA 5EUBA 1PR6A 1XN4A 5B3AA 2MJLA 3PXBA 1R3DA 4A1FA 1PNTA 1P8JA 4HDQB 1A04A 2GTHA 2WAXA 1GRQA 3JD0A 2GJ8A 3ZNOA 1A5BB 1UOPA 4K9RA 3HJUA 5K6AC 2AS0A 2RJNA 3H2YA 3VH4A 2X4GA 2CK3D 3NCHA 2HYIC 4M76B 3LV8A 4FJ2A 4M38A 4CQMB 1CFZA 1JTEA 1LFAA 3V1LA 2HZBA 4TWBA 2HFKA 4H6WA 2FMIA 1A3CA 2QPOA 1UKYA 1VLHA 4HFMA 1Y1QA 3FFAA 3B1JA 3MAAC 4DA9A 3W8EA 1N2OA 2EX0A 4BBAA 3C3YA 3B6ZA 4GLOA 4NNOA 3ZJUA 4BC0A 1VL6A 3KOYA 4O25A 5I9NA 3O92A 2CK3A 3SDSA 3EGIA 3K20A 1GAWA 2PUWA 5KC8A 3EPJA 1VXRA 5E3IA 3BMCB 3CO0S 4TV8F 2H52A 5EXXA 3G9QA 5KOJB 5DM0A 4E46A 3R9IA 5HHTA 4JP1A 4LBYA 3SLKA 1M1XB 1EVZA 5GPBA 4TLBA 1W2WB 2EFDB 3LBHA 1VQ1A 1RRKA 2XNDD 2XQGA 3DH0A 1XPRA 1U9IC 3SF8A 4Z6KA 1RQRA 2ZZMA 3F5FA 3QWAA 1UAAA 1C9MA 1N5LA 3TRFA 2FW9A 4ENRA 3DQPA 4Q9AA 5EJFA 3ZWNA 3FIUA 1P0CA 3R3HA 4KWHA 1N5OX 3AEZA 1CNEA 3I28A 4DSNA 4KMRA 4M86A 4HAIA 4O29A 3IBTA 3W5VA 4CLDA 1JKMA 2PBLA 3C7TA 4P81A 4Q19A 4F60A 5K0TA 3D6VA 5DBIA 5KVQA 3LE8A 4JVSB 3K4QA 1TMOA 2PT9A 5TR9A 3ABZA 3NBKA 4MHSA 4YK7A 2IXAA 4CKBB 3D4NA 2QZPA 1WOMA 2PEYA 3C3MA 3EW7A 5CFPA 2J3LA 3VR4D 2QN2A 3D54D 5KYGA 3H6HA 2OB1A 3NBZC 3VPCA 1E3WB 3SEFA 2UUCB 2V3CC 3U1TA 1PHRA 5DNVA 2ZJ7A 1XRJA 2BFEB 4AW9A 1YAJA 3UMSA 1ISHA 1T5BA 3SJCA 5EQTA 3QFHA 3WQBA 1S8NA 3A9WA 5BV1A 2O7SA 5AQEA 3OG9A 3N2GA 3UOAB 5IT9A 1P5JA 1R5NA 1RXVA 1BS1A 4JC0A 3ZXIA 1XRQA 2VDVE 3K0CC 4Y1RB 4E2WA 5JVDF 1P1CA 3JQDA 4Q7LA 2QRJA 3VR3A 4G6ZA 3DEIA 2UDPA 5ULLA 5UKDA 3RAJA 2RGYA 3P96A 3KHUA 2VDNB 3ZZUA 4D4KA 4AMBA 4H7FA 3W1VA 1AB5A 4KACA 3TTTA 1LTQA 3U7HB 4G0MA 2MOKA 1M2EA 2QRZA 3E2PA 4IFIA 1Q0RA 4OMUA 4RIEA 1YS1X 2ZBUA 2FK7A 1ML4A 3EZ7A 1Y8QA 3S55A 4CF3A 1V26A 3NFYA 5FWNA 2O48X 4QO8A 5ICGA 1ZC4A 2CUTA 5LYJF 4ZJUA 2JFZA 1NN3A 4KKVA 1F7UA 4ZQHA 4CT0A 3NTLA 3M6IA 3GUUA 3QH4A 5CDFE 1IFXA 4BUJA 1KK0A 3NASA 5AHRA 4OFZA 4FWIB 2P65A 4DNFA 3NATA 4OM7A 5TIIA 5LIPA 1EUQA 2PR2A 1IZ9A 4MW2A 3F4KA 4KQJA 1FDOA 5A7HA 5FNVF 1XTJA 2EIXA 2HQ1A 3HU5A 4RV9A 3GLFA 1G38A 4QRIA 1HPLA 3QFCA 4U1RA 2E5LB 2OKCA 1AZLA 2X14A 3L4BA 4ILKA 2VBCA 4BJ6A 4BWFB 2DQKA 2FWIA 2JAPA 3I2KA 3GT7A 3FRIA 5IEJA 2MSWA 1A1VA 1R6UA 5EFOA 2B0CA 3UY4A 2WT4A 3UANA 3GLGE 1VCHA 1ZJZA 1PEKE 1CQJB 1W4CA 2PN1A 2QTHA 2RAPA 4TGLA 1WPGA 3R7WA 5FBWB 3CSDA 1GPAA 3RC8A 4IFEA 3WDMA 4UFPA 1OASA 1TOAA 1X1SA 1I6KA 3L4KA 1VB5A 3TDMA 3VYTB 3ZGYA 1XU4A 4GECA 4QPPA 3EG9B 4TXJA 4O4JB 1GNLA 3A2LA 4P0TA 5BYBA 2QD1A 3IQIX 5ALIA 1DKPA 3FA2A 3RS4A 2XCLA 4ZMRA 2DJ5A 2CFRA 3AWDA 1Q21A 1TZMA 3IS3A 4TL7A 4MR9A 2Z9CA 4EY5A 1U63A 2UZ4A 1HBJA 1R15A 1CNFA 1U90A 1RACA 4EKYA 1WHSA 3QX8A 4EO7A 3E3MA 3LLCA 4I9FA 1EE2A 2XX3A 4LVOA 3S2YA 4Q03A 4Y2GA 4RIFA 4QLAA 4QLOA 3HB7A 1F20A 2EKPA 4O4JA 1FS4A 1WW2A 1GFWA 2P4SA 4YXFA 4KNYA 4B2IA 1YQUA 2NN3C 2GRAA 2VDOB 5JBNA 2PT6A 2BUCA 3LYHA 3MFQA 2H29A 2C2OA 3EWSA 1XMPA 1YOBA 4DDWA 1E6LA 4CTKA 3B9RA 5FPKA 3BT7A 1FU4A 1PDOA 1J90A 4CCAA 2W2PA 2YHUA 4IO1A 4IFBA 1KAOA 2FW8A 1TCBA 5YASA 4G0ZA 4LK3A 5FBVB 2ORWA 3A3OA 3QLVC 1RXSA 2K6GA 3SJZA 3LC0A 1AX9A 1B00A 2ZP1A 4HNTA 1H8HD 3I04A 4YP6A 3ULKA 1KO8A 2WD7A 1KL7A 1PVDA 3B2EA 3WGNA 4N6OA 5K0FA 4G23A 3QG1A 4BO4A 3PIDA 4DQXA 1V3QE 1Y3BE 5EUMA 3IMEA 2YN2A 1QHXA 4BFUA 5FYDA 1IXRC 4D9EA 3BORA 4PPFA 1NMQA 2B4AA 4YROA 3MPOA 1DDIA 4BJHB 2G0NA 3X0DA 3C24A 1Y8QB 1GLNA 5KQRA 4L28A 4MUYA 3V48A 1UANA 3RWBA 1K97A 1SXJE 1CJCA 2P9GA 2CUKA 1P2UA 3RYTC 1RI2A 3K73O 4ESVA 3PXXA 1N4DA 1SVIA 1E2EA 3B48A 4OHMA 2FZKA 2PVCA 2W43A 4I2VA 4RWEA 4B7CA 2QRVA 2VAXA 4INJA 3HMKA 4M1MA 4ZO6A 3RU3A 4C7KA 2IA5A 4GPBA 4DCTA 1IATA 3BJIC 5DGDA 3QVTA 5I4BA 3IVXA 5JQGA 1OB2A 2C3UA 1JSXA 3CBGA 4AAYA 1E2DA 5FOUA 2PWAA 3ORFA 3INNA 5KYXA 1I7NA 3VDQA 2JCYA 2VF5X 5KU1A 5FTJA 1GL9B 1YZHA 1RPJA 2QSZA 4CEHA 4EKGA 4OIFA 5J43A 4ZHSA 1QRUA 2RDMA 3AEQB 4MMYB 3I5AA 4PTYA 1WSDA 2NTEA 2OBLA 3OHSX 1LPMA 1T1RA 4NG4A 4D8WA 1S8AA 3ZOKA 2ZM6B 4EB8A 2V3WA 3S0JA 3P20A 1CY8A 4KE9A 4DBZA 1H4QA 3HLTA 3THYA 2J3EA 2NTJA 3P4UA 4ZAXA 1I4DD 1V8OA 3AVVA 2OHVA 4CNBA 5KNCD 1B6RA 3VH3A 3T5PA 1U7WA 1NJ5A 1PJ3A 1GWNA 2BGMA 2BKAA 2CHQA 3CTPA 3RYCB 1M2HA 1A82A 1UF9A 1C1YA 4L8LA 4N9WA 3P2MA 5KNLA 4P5EA 4MUXA 1E8DA 4HLUA 2D4HA 2ZRMA 3WGLA 3E3OA 4XLZA 4LF8B 1Q6ZA 1QFYA 3BXPA 2O7RA 5TF0A 1YL5A 5COAA 3OESA 1L5RA 4ACBA 2O8EA 1Z6GA 3PHLA 4K6OA 5FOTA 4MMXB 4AO8A 3ZH9B 1BN7A 2VYND 3WB0A 1A27A 2IY9A 3GGGA 4FFVA 2R66A 3E9EA 1LZKA 1D6NA 4GC5A 4GX5A 3SYRA 1Y3CE 3VOAA 2YW2A 4QXOA 3Q9LA 3R3SA 1NUSA 1Y9ZA 1S01A 2V6GA 3BH7A 3EYAA 3GPCA 1UPAA 1VPEA 2DWOA 3LQRA 2WABA 2BF4A 3ILSA 3MMZA 2VKTA 1BKYA 2JGIA 2YVQA 3HJRA 3RKRA 1DTEA 1XQWA 2I1QA 5FUXA 5A6VA 3VJRA 1FX0A 1Z06A 1W96A 1YIAA 3NRJA 3PNLA 4MXDA 4OP3A 1JYEA 4L8FA 3IIKA 5C7LO 2XADA 4EQ6B 5DNUA 3L41A 1KVUA 1ZBDA 2FPKA 2YWFA 1O08A 3EEQA 4IGIA 5TPZA 2HEIA 3FTQA 4JBXA 3MGKA 3V1UA 5LZ2A 3IUSA 4GVXA 3B6EA 4MMZB 3MNFA 2GERA 1TA9A 3ZK8A 4RTQA 5LM3A 3FPJA 2CNWA 4GOMD 4M0PA 2I4NA 1NF3A 1C3VA 1GTVA 1J9ZA 1X9HA 3TZKA 2AFVA 4EA7A 4LF7B 3QUBA 3MAGA 4ZPJA 4MEBA 2C9MA 1FP1D 4AURA 4XARA 1Z37A 1X13A 1TM7E 1NRIA 2JKYA 2R5NA 5H82A 4RTSA 3EC2A 4ZC8A 1GZ3A 2ZAYA 1T5OA 1AT1A 1BKDR 2KWIA 2AJ8A 3LQ4A 1XVAA 1HYEA 3NDIA 3LD9A 5G1NA 1DKLA 4KN5A 3DLBA 1IUNA 3LFHA 5M5BA 5BXYA 4KFUA 5BUQA 3UXEA 1QP8A 3ONVA 4BQFA 2P90A 5CVVA 3TIGA 4UBOA 4J1QA 4QHYA 5H7XA 1JLMA 2PS3A 4QUDA 3TUJC 1OFGA 2P9CA 1WDKA 4JDUA 5DASA 1E2JA 4C29A 5A9RA 4NULA 3QEAZ 2DTDA 4NPHA 5IVIA 5F21A 1G8YA 1YQTA 1M73E 2XUHA 4EG5A 2YMQA 5LKRA 3IV9A 3GC6A 3L49A 5F35A 3GJXC 1TAQA 2VRBA 1EQAA 3NVMB 3GGCA 4P6VF 2ICAA 4YUWA 2H6EA 4CCWA 4D9JA 5EP2A 4G9BA 3ENVA 2Q27A 4GICA 4UBJA 5CDUA 1JEQB 4QXPA 2FP3A 4ZZ1A 2ZRIA 4OJYA 3OZCA 4LYGA 1DBWA 1U0RA 2PKYX 1HYGA 1XVTA 5KYYB 4CMKA 4U2FA 3ZJTA 2VDQB 3ZDAA 3BF7A 1Q11A 1C30B 2EP8A 4IQ4A 2F17A 5FRDA 4HGQA 1K2VN 1BJKA 2P4QA 3DQQA 5DTIA 1O87A 2PZJA 3EXFA 5C7IO 5KJ6A 2D7JA 1DIAA 1FBTA 1W75A 2Z8YM 1Q83A 1T8RA 1QVZA 3NTQA 3R1IA 1ISMA 1D2HA 3HZZA 3ORRA 3PNQA 4JH0A 4NCBA 4GH5A 3OT1A 2N1BA 1ESNA 1G0NA 4ARZA 2EBHX 5EYPB 2VZLA 3HWWA 3VYWA 1FPQA 1AQUA 2OVFA 2YCBA 5JS2A 1Z8FA 3ZU2A 4QBTA 3OVMA 4D9HA 1LS6A 5JYEA 3L7IA 3X1DA 4A2QA 3ZZ1A 4FMBB 4YP5A 2FQYA 3OU6A 5AKIA 5ALLA 3MRVA 4E2YA 3VV3A 1TL7C 5EHIA 1E9SA 1GZ4A 3ZY5A 5AW5A 3L77A 4D4IA 1WBBA 1VG1A 2ZCUA 1KARA 3HUDA 3DD1A 4BFTA 2YVKA 4KWIA 3WLIA 4F4JA 3NT5A 4DIFA 4RDXA 1GN8A 2P9JA 4MRRA 2A94A 2I7XA 2WKSA 3LQKA 3KKPA 3TZHA 2XB2A 3JU3A 3UF0A 2XDQA 3BM5A 3SM3A 2W8ZA 2DEUA 2H1IA 2AA3A 1XAJA 1JECA 1AGPA 1UM9B 3C1OA 4MVJI 4O8CA 4E3WA 1QGUA 4HGZA 4E6PA 1PU2A 4HDOB 4HC4A 4X00A 3UWKA 4ZTZB 2NP7A 1C2TA 5C5IA 3U62A 2YRWA 3B9BA 2GN9A 2O2EA 3BMOA 3R23A 2ZULA 3DDHA 2A59A 1BC5A 1SU7A 2VYVA 4PR0A 4ZVLA 4KITB 4U5QA 1HXHA 5A71A 3UM9A 1V9LA 2N46A 4PHFA 3ZZMA 4A3SA 1JXQA 1W581 5BQOA 4Z8XA 5KJ1A 4Q3EA 3RSSA 1C80A 1X14A 4OJMX 1H94A 2RGNA 4QELA 5A06A 1TLLA 3WZLA 1PG0A 4HXGA 3PRYA 5TB5A 3V80A 2C1XA 3UA3A 3IGFA 3OPQA 1RMYA 3EQZA 2FN4A 4ND8B 4A2WA 4MHOA 5PGMA 1EP1B 1NN0A 1NW3A 3SX2A 4CIYA 5IN4A 1UFOA 2UVPA 1H6CA 4PFJA 2RJ3A 3BFXA 4IS3A 5D00A 3ED5A 1DCKA 1DS6A 3H1GA 2J0QA 4MIYA 2CXUA 4W63A 3B5IA 1UT6A 1JR4A 3PKZA 1T9GS 3UOWA 5JG7A 2AN4A 3PKIA 4F45A 5E95A 3U3RA 4G81A 4LEIA 5JZBA 4QFCA 2QUAA 3MB5A 4HNAA 3LZCA 3OX3A 5IAJA 3V9PA 1RQXA 3EQ7A 3U7GA 2XB4A 5JT1A 3WTCA 4J3FA 4JIGA 1PN3A 1CCWA 2G9VA 5EKDA 4JI3B 4WXHA 4MKHA 1W4ZA 1MZVA 4YJHA 3RYIA 3V8QA 4C0SA 4EF4A 3OOJA 5JALA 1WS6A 4L9RA 3K0AA 4A91A 2IYZA 1U8CB 1TCVA 3C4VA 3HEAA 5LQDA 5EY5B 1B74A 1H65A 2OXRA 3BWVA 3KUUA 4ZOAA 5CD1A 1Q16A 1PNOA 4M9QA 5CB6A 2N1MA 1ZOSA 3F0TA 3EY4A 1Q50A 2R44A 4PXSA 5IDVA 3IR7A 4OU5A 1JKJB 3OECA 2FZLA 3UMMA 1ORRA 5AVYA 2XF2A 3LP6A 4NBSA 2JD0A 2QR5A 3CZRA 3DV2A 3VISA 4EHNA 1FXUA 2ONZA 5BW4A 2IH4A 3JQFA 1EB9A 1KEZA 1T1JA 3GZ4A 4HSEA 1AQ6A 3OWXA 3QENA 4CQMD 2BWJA 3RFUA 4D3FA 3L1KA 1TT5B 4DV0B 3N2YA 1FXWA 2WKWA 2WG1A 3CUWA 1TRKA 1KZ7B 1D2NA 2AD5A 2XNCA 3B82A 4PZEA 3CVOA 1SIOA 4ZVQA 1WQ4A 4BLOA 2XD9A 3ZY3A 3ETCA 1E18A 3WADA 1QRSA 2ID7A 2VOJA 3SKYA 1FRVA 3ZC3A 1F0YA 2D5IA 3SS8A 1EFDN 4I46A 4OSPA 3NC0C 3KOUA 4OQLA 2WA1A 3GLHE 1U4NA 4L7VA 1CRZA 1R8JA 1CUZA 4WBSA 5TC4A 3M89A 1EFPA 1KEVA 2MR5A 4LOHA 2K7ZA 4GXRA 3V4FA 1BXRA 3PXEA 3AK4A 1US8B 1E92A 4NMLA 2XYQA 4CMHA 4DL9A 1XG5A 2QG9A 4AJOA 1G9TA 1Q6YA 3DMYA 3LA8A 1GQSA 5THQA 1W35A 4UAJA 4CMEC 2LWIA 2GDJA 2IPMA 2RFLA 2V9CA 4ZVOA 3DUFA 4TKLA 1DJPA 3G23A 4XKJA 4B7UA 1B1AA 2D5AA 2OOKA 1J2TA 3HKCB 4G5SA 3S29A 4W9MC 2X8JB 3TGWA 1OH5A 2VBIA 2NT4A 3M1YA 3ZGZA 1J5PA 1UPFA 3X1WA 5CAEA 4IINA 4RDIA 1HEIA 3CNOA 2QL7A 1H5NA 2N9UA 3UFBA 5FI3A 1DQYA 5U4XA 2C9CA 2W5UA 4RV5A 4BASA 1DEKA 1KDOA 1R0SA 4YUVA 1OAKA 3NMUF 1JHDA 4IRXA 1XZHA 4U2GA 4NSNA 3U61B 4UOZA 3LWNA 2J9YB 3A6DA 3DVAA 2XQJA 3DNPA 3OZDA 3IHLA 4MUIA 4NFSA 2RB4A 1KC3A 2BHTA 2HDHA 3U4AA 4JV5B 3QWHA 3LRPA 3QTTA 2IODA 3WRXA 2G82A 1AXRA 4N39A 5AKYA 2VPQA 1RKBA 4OTZA 3AFIA 2EL7A 4PR3A 3UYKA 3M70A 4Q1VA 3T4UA 4PQYA 1QGOA 3JQAB 4AXXA 3A1FA 4I3HA 3ZY6A 3TQFA 1IXYA 1UBNA 4RJLA 3VR5H 5F52A 4H7IA 3RK0A 5L4NA 3KKOA 1PYOA 3B52X 4K28A 1UMDA 3L8FA 4QJ5A 3V8MA 3WWEA 1KPIA 1JS1X 1QH8B 2X6RA 3A0UA 1YZQA 3W3ZB 4LGCA 3FBWA 2NO1A 1NQUA 3AY0A 3I9LA 4PRLA 5EKUA 1W87A 4OY3A 4JL6A 3HVIA 2B34A 2GAJA 4EYQA 4JXJA 4KPGA 1URPA 1YACA 1A72A 3MIZA 4X7PA 1Y7HA 3AUSA 5F7JA 5DMHA 1XXHA 3B7PA 1I0IA 3CKKA 4FYXA 1HK7A 1U0LA 3I30X 4D79A 1FDRA 2WSYB 2GCNA 5T4BA 1FTWA 1IEWA 1S9HA 5I7HA 4UE2A 1QE0A 2A88A 2CJFA 3ENWA 5TGDA 1M7HA 3OKFA 4NONA 4XSVA 1JJIA 2L0XA 3AZQA 3DLAA 4BU0A 1EM8B 1WMSA 2A5YB 3K6KA 1AB6A 4LXYA 5E6UB 3VPGA 3NDBB 4QARA 3BB4A 1OBHA 4TKVA 1KHTA 4N5LA 3KXKA 3AETB 4KLNA 4F2DA 1I7LA 1IQPA 2V0NA 2XJ9A 4S04A 2ZYUX 5AKXA 3WLRA 5AI8A 2XW6A 5ALXA 5FBRB 1SA0B 3BD6A 2GYVA 1WB6A 5ADVA 2ZU0C 3FDZB 3C45A 3EBLA 1Z7WA 1J0CA 3P27A 5CA0F 1EJ2A 3TW0A 3EA4A 3IQXA 3AJ9A 3EGOA 1WXDA 1SRQA 1INLA 3KVRA 4X63A 3VAYA 4CDRA 3Q8LA 4KRFA 1MVOA 4E07A 4OM8A 3NEPX 5BSMA 4RLHA 1U0HC 3B60A 3PYXA 4B7AA 4B8WA 2RJOA 3DF9A 4HMPA 1Y5MA 4F6CA 1NVFA 1HDRA 3L8ZA 1XMVA 2H3HA 4MS1B 1NA5A 1QBGA 1M1YB 1D0SA 3MFYA 4JUDX 4US0R 4IIJB 5TS3A 3SQMA 4TMFA 1US8A 2E89A 2GKGA 3A1UA 3CH5A 3GBPA 3RUHA 1YMUA 2J9XB 2QV7A 1X8KA 3DC2A 4Q6WA 5L7TA 3I9NA 1PE0A 4NCNA 4KR6A 2CBXA 5LN1A 5CB4A 3LMKA 2CV2A 2XUOA 5IFKA 1NNSA 2XUQA 2D1QA 1QXSA 4QNRA 1SVMA 2W2KA 1VL2A 2FRXA 3BTOA 3FUXA 2NAPA 3USCS 2EHJA 2NTYC 4LIPD 4LMAA 4CIXA 2Q0HA 2HSWA 2TSYB 2ZUEA 2KPOA 2FW6A 1UKCA 1JQBA 1NM5A 4F2WA 1GARA 2G71A 1ODTC 4WECA 1ZD4A 3PF8A 5TS2A 1NR1A 3M5PA 3PDCA 4GX1A 4RF4A 1QUFA 5CX4A 4ZO8A 4EJFA 2CT8A 1DEAA 2OAP1 3GPIA 1SHLA 4UU8A 5B3JA 3JAWB 2BGLA 2VJPA 3CBQA 1EZ4A 5M34A 2JLBA 4XM2A 1FFXA 3RRMA 2PSJA 1BCSB 2D2IA 4C7VA 3CG4A 2JFWA 1NJ6A 3M9WA 5E9JA 4BY9E 5DGCA 1ELOA 4TZ6A 3RR2A 4NICA 5ICFA 3IIIA 4KZPA 1JDSA 4R1SA 1K5PA 2QYOA 4GG1A 5EKTA 2OESA 3L6EA 3I1IA 2JKVA 4ZVVA 4C2AA 2I87A 1KFBB 5KYUA 4RIIA 1PJTA 4JLMA 3VOBA 4CUKA 2PH1A 1F12A 3OZTA 5JTTA 3S2FA 2QK4A 2BCJQ 2ZYAA 3NORA 1ZW1A 4PGFA 4Y0AA 1CEEA 1OI4A 1X2BA 2PGJA 2QMQA 2XMCA 3KS9A 3PNBA 5EGSA 3VNQA 3LRTA 3MMPA 2I3ZA 2QUHA 3UENA 2W6OA 1JPVA 2IS6A 4AF6A 5IN5A 5I47A 1L5MA 3HSYA 3DSRA 5ISMA 3KL2A 1E3QA 3PT9A 4D9MA 1QRDA 3Q88A 2DLNA 1NHGA 1Q2UA 3KL4A 3TRIA 2VS1A 1CPYA 3BGDA 4Y2UA 3O47A 1Q7EA 1U2DA 3V1KA 4RTKA 1EJ0A 3TN7A 3PX2A 5D3MA 4R2JA 4BAGA 4EB6B 2XWBF 2ZUVA 2JGNA 4PE5B 2AEMA 2XOKA 4OUDB 5ENVA 3DWEX 3KFXA 4K9PA 3WFZA 1W5FA 3PI6A 3KR9A 4FGUA 1TUBA 3ZWQA 4ABTA 3OEWA 4QPNA 2YQ5A 4CTJA 3PD1A 2J46A 2AZTA 2Q4BA 3S6JA 3C1TA 1AHIA 1YVEI 3FMGA 4MIKA 4B46A 1DO2A 4OG2A 2HF9A 1GQRA 3G17A 5J47A 2HQRA 4CTMA 5H8WA 2ADOA 1DQSA 1YVUA 3L0CA 3PSHA 1XMQB 4JQSA 2J3IA 4B7ZA 4CM8A 6ABPA 4UXIA 2JD1A 1TKBA 1VL0A 2A1UB 2PXHA 3AG5A 1NQWA 3EH1A 4FX2A 4ID9A 5DSXA 1LWOA 3C8UA 4TX1A 4DUPA 4WSOA 1Y5LA 4P4SA 1OJ7A 4R1OA 1RC0A 2VHUA 3C6ZA 3NC1C 4WA8A 3GLRA 3WOVA 5FJIA 1BNCA 3DWFA 4FYJA 3DJFA 1XEWX 3LYLA 3WYNA 1RWKA 2IVZA 1POWA 2P2SA 1ZQ9A 3NVAA 4FMCB 1G1AA 5FNVB 2EJVA 1P4JA 5BMVA 1UJ5A 1N36B 4L3OA 2XMPA 2JDIA 3TNLA 1OGJA 4J9VA 1H2HA 1R5JA 1G42A 1U81A 4ODIA 1U3VA 2ZAIA 4BV9A 5HCIA 1A5SB 2X5JO 4TTSA 2KBFA 4AS3A 4UCFA 1GDHA 4ON9A 3E82A 4JR0A 4KHZA 3WL3A 3ZKWB 4C30A 3WXMA 4EY6A 1WTCA 3WK6A 1BH2A 3FNFA 2I2CA 4XX0A 3UAVA 3EXIB 1YB6A 1K06A 3LBAA 3AM4A 1Z4QA 3NV7A 2DBVO 2I7CA 3QEBZ 2FPUA 5ITZA 2BR4A 5A3QA 4CZ2A 5DHQA 1CQIA 2CEKA 3F7MA 2CHEA 3AP1A 4OB8A 4MAAA 2XMSA 4M9CA 1JQJC 2P2NA 3LHFA 3RASA 3EZYA 5JNSA 1I3MA 4AJ9A 1Y6FA 3OE1A 1PX0A 2OHIA 4HQLA 2AQIA 2WTXA 2C2ZA 3OTQA 3WMXA 3ZWXA 2ODQA 4ER7A 1V45E 1RNLA 2PKQO 4Q4JB 5AM3A 3AQ4A 3E9RA 3TQSA 1VE1A 3WWYA 3G82C 4CI9A 2Z2YA 3CG0A 5KYYA 1JSRA 3HCBA 2C78A 4WNCA 5EP4A 3QXGA 5LLDA 2AQKA 5A4MS 3WAGA 1E8MA 1KZ9A 1NVKA 1OZHA 3IE0A 4HF7A 2IYUA 4M55A 1SC1A 4RIGA 2HC9A 3WL8A 3WYEA 4UPEA 5BSFA 2QZZA 4EFMA 1QMPA 1OV4A 2D1FA 2VI5A 1DKNA 4ZVUA 2NU6B 5A9TA 5IFLA 3C3KA 3IMKA 3T8YA 1WLSA 4ITUA 4U9IS 1JF8A 4FZVA 5KAPA 1VI2A 3N76A 5LQJA 3IAUA 1ZN8A 2FSVA 1NW9B 3DVLA 2HU5A 4DNXA 3G8DA 3SYMA 4I0WB 2R751 4QDXA 3C5VA 3LO8A 4FWBA 3E5RA 1QG4A 4XZ3A 4WKBA 4X54A 4BLSA 1MC4A 1FBNA 4M37A 2B8TA 4MW9A 1QUEA 1WDLA 4ND1A 4QWMA 2E37A 4XYBA 3Q3JB 2YWCA 4ZO4A 5EE0A 5AW8A 2IKSA 2XUKA 1QVVA 3QKRA 4BVEA 3KQYA 4M1WA 1FTSA 3H99A 1PHPA 3BTVA 5IC5A 4C6TB 4HUQB 1GPKA 3SAJA 1R18A 2A5DA 3K72B 4K9SA 4UTPA 1N92A 3LL4A 2YJ3A 2GR9A 2GJ9A 3M82A 2RHBA 3P2IA 2B1JA 4JLNA 1H3FA 3GFQA 3N8DA 3WLHA 1S4QA 3S70A 4KG7A 2D00A 1KH3A 4HSGA 1UOEA 3WGOA 5KKCA 1Z6YA 4RTNA 2F3TA 1SBCA 3BGIA 3OEYA 4X8MA 1FDTA 1U4SA 3ZUGA 1F2VA 2EW1A 3RHFA 4DREA 4OYRA 5K7SA 1J4AA 3QPVA 4I4TF 2CHUA 4N65A 2QE7D 2X58A 2OT3B 4GQIA 2EEZA 5DBOA 2VA8A 4F4DA 4F6RA 3FDZA 1N6LA 3RHZA 4ZAVA 5K03A 2FR1A 4BLRA 4BX0A 3CIFA 4RZUA 4ERNA 2N47A 5AXDA 1GCIA 4JELA 2VJMB 1ZXLA 5DOVA 1C7ZA 2W2LA 2Y1KA 2HA7A 3GUZA 4HAZA 3V7NA 4PX3A 1U8FO 2B69A 3KOXA 4FD2A 4EG0A 1MEJA 1Z2PX 3UTCA 4RV4A 4BNZA 1YQ9A 3KQLA 2Y0EA 3JZAA 3UWPA 1XJQA 3DZDA 3OO0A 4LZWA 3U37A 4GPD1 3LOQA 1U8TA 1XCMA 3RIMA 4BVHA 3FLAA 5DRYA 4GBGA 2B8JA 1BEEA 1MOSA 1KSGA 5CLIA 4M3NA 3ROXA 3EIHA 4HEQA 1QDLB 1TO2E 1L3BA 2QMEA 1ZM2A 4H3KB 5D85A 2VP3A 1KEKA 4QPZA 1WZCA 1T9AA 3UXHA 4UTNA 1RWXA 2HNKA 1Q0ZA 2QTRA 2C8KA 2C9DA 4FOTA 4NBTA 4QODA 2VK1A 1KYVA 1OD6A 5A0TA 3DEKA 5K3AA 2JH8A 1Z2DA 4PZ0A 5L9AA 4IDQA 1ZL2A 2GEJA 2QLJA 4FDTA 2HWKA 5IC4A 2H1VA 1JMKC 4GM0A 3GJ7A 3ZWAA 4J0KA 3H5NA 1NNLA 3D7SA 3JAKA 3PPIA 1K63A 4K1LA 4D8XA 1PGOA 1O1YA 2WM8A 3GZNA 1TJYA 2XWQA 3RSZA 1A8SA 1FLAA 3K9NA 3F6SA 4IWYA 1JLLB 3AERB 4KR3A 1LI5A 3DE2X 4D8TA 1L5HB 3SYNA 1Z39A 2C5FA 5DNWA 2ZI3A 1VFPA 2QX7A 2RHOA 2ZZKA 1JVNA 1MP0A 1OTYA 2WICA 3ITEA 4ROTA 1ISPA 4FXOA 4OQNA 2YJGA 4NQRA 4RPCA 2ZFUA 3AINA 2Z2IA 8GPBA 1AKWA 5EESA 1YKSA 3QYJA 2R6DA 1MVNA 1WPXA 4DC9A 4PX2A 5K0NA 1ZGHA 2VSXA 1PGNA 1SCDA 1RI4A 4BAZA 3U9LA 1Z4LA 1U99A 1OTXA 1ZEMA 2QVYX 4YT8A 4KPYA 3H8SA 1CUJA 1I2BA 4TV8B 2POQX 1J7JA 4FP9A 3RS7A 3TTXA 2HJGA 3WJ7A 4EHKA 1Q0TA 3IP5A 1IOZA 1FYXA 2MT9A 4U7HA 1FSSA 2IEIA 4YRLA 4HMOA 1J42A 1XMSA 3FR8A 1E60A 3LL7A 3RVQA 4ZIRB 1BEZA 1V3UA 3R3WA 4UDNA 3G02A 4H7KA 3CRNA 3IAS1 2HA6A 1QHNA 3M2PA 5BR8B 2H9YA 4DLLA 1IRXA 4CQLB 2ZI7A 1R0WA 3AW9A 2ODNA 4IUBS 4EAAA 3IIJA 1TU3A 1VG0B 2FEAA 3K0KA 1VLJA 3MTQA 4DA0A 3REFA 2EAUA 2QN6A 1GITA 3IBGA 4FC6A 4LOIA 5KAMA 1J8QA 3WY9A 1AQNA 1PZXA 2B98A 3KOWA 4PZZA 3ZIDA 5CR9A 2W2TA 1XZMA 3JATA 2XOKD 1ODIA 4BVBA 3SR3A 4RMHA 4YB8A 2HGZA 4BNTA 3K3PA 3VR1A 2DCUA 3KZXA 2C2BA 1IIBA 3UMFA 1U0EA 3X1ZA 1RC1A 1XNJA 1RPTA 2W11A 5J4VA 4X1YB 5BV7A 4GWGA 4S2UA 5JH7B 4BKPA 3ML1A 4YJGB 4HEHA 4ZVRA 4Z7NB 4L4RA 3ZEIA 3LT4A 3VO1A 5KX5B 3HM9A 4Y18A 3BZBA 3CWCA 2H9IA 4OI1A 1VSUA 1AGRA 2BZ0A 3AUYA 4QHTA 4ZT3A 1Z5PA 4NU5A 1M8KA 3V2HA 4H7HA 2BAGA 3H1TA 4UUOA 1IY8A 1RSZA 2QX6A 3EPPA 2CNLA 3Q12A 1L4GA 1RFGE 2GEBA 4KRYA 4M87A 3RS9A 3UTDA 5IAOA 2VNSA 4YJHB 5KHOC 5K99A 2I8LA 1XJ5A 2G9QA 1EVKA 3U0VA 4DJFC 3EH2A 2EW8A 1N0UA 1CRQA 1DC6A 1GG9A 3R0XA 4UU0A 5JE8A 1CQZA 3TVTA 5JXJA 4U5XA 1CDZA 3AERA 4UTXA 5AWFC 4D4LA 2J0UA 3EIEA 4KN8A 2N42A 1JMYA 3EG9A 2D62A 4P3XA 1ORIA 1CB7A 5CCBA 1AQYA 1R6TA 2WLTA 4MLCA 1BJRE 4RL6A 1W9HA 3O8OA 4J2TA 4BQEA 4OCZA 1WF3A 3G68A 5JNUA 2OD7A 2C4KA 2O8CB 1OLSB 4KTTE 1EWKA 5E4FA 2GN6A 4M8NE 4B3FX 1L8AA 2HPZA 2O0KA 3EMVA 3EVEA 3NKLA 3OTGA 4DR7B 3IE1A 2G1JA 2XT6A 4Y2VA 5CYGA 1V1JA 5EINA 3AV3A 2QW8A 5KKNB 1B26A 1HMYA 1XDGA 3QVLA 3SZGA 3T41A 4BQSA 3G3EA 4WN9B 3AEUB 1LTHR 3DDSA 3HACA 3NNSA 3OWOA 1L5FA 3P97A 7REQA 4LNUA 2IF2A 2IZ5A 4PC3A 4B9EA 1XFDA 4IFTA 1YB5A 3LGAA 1LK5A 1I10A 3A6KA 2R6AA 3EBPA 2FQXA 2QVZX 2OZEA 4NYMQ 5B7NA 1C4WA 3AGPA 4KGVA 1K7YA 2Z6QA 2C3PA 4HQKA 3BMOB 5IVDA 1HDXA 1GQYA 1CY2A 5D6OA 1MOPA 1KRWA 4P7GA 4HWGA 5K3DA 3VU9A 1H4TA 4D41A 4DJJA 3SLRA 3Q5DA 4LV5B 4UCWA 2P40A 4DZRA 4JWKA 1TA4A 1X7YB 3D3KA 4EG3A 2OXFA 4KIGA 4F6RB 5HJ5A 3T1YB 1FC0A 2RMKA 2QTCA 3SICE 4PO1A 3WIOA 3D0KA 1X7WB 1FJ2A 2H8GA 4D98A 1FMLA 1C2YA 1VCNA 5TMDA 2PD6A 1B14A 1C0LA 2VRNA 3MLBA 4MB0A 2BL4A 4HQOA 5GOTA 3ZHZA 5BVGA 5BQXA 2F64A 2VJLA 2PQMA 4OHUA 1G6Q1 4HNSA 1NP3A 4MQ4A 4C7MA 1F9EA 4H16A 4WFJA 3VPXA 5AJXA 3EF3A 3Q0IA 5EWMB 3RT7A 4JD5A 1QIKA 2WU1A 5F1OA 4KOEC 3AL2A 2ZE8A 1GUAA 3OPMA 3NI2A 2JBAB 1YSCA 1L7PA 2IYRA 4JMPA 1CP2A 4UHCA 3A9VA 5EIFA 5FHRA 3UUEA 5AI4A 1O96A 1PVOA 2FMTA 1XDBA 4ZYXA 3TBKA 1OFHA 3CFYA 4Q3AA 5CIQA 5LZ9A 4UZFA 1ONPA 5MGNA 5C8YF 4BP1A 1Z4JA 1HTBA 3G5AA 3WNCA 3QQPA 2BI8A 1XE3A 3A04A 4A8TA 4E32A 4J7XA 5KQSA 1POXA 2O5VA 3I37X 4OSOA 3PC4A 2CBGA 1K1EA 1KKMA 4PAQA 4B40A 4O63O 4UBKA 4HT3B 3LUBA 1DRUA 4ZGBA 2IW3A 4UVDA 3RDPA 1EGVB 1JFVA 3EGDB 1SOMA 1XZNA 2GN4A 3H8VA 4Z8YA 4XX1A 2ZBFA 1RKVA 4OI4A 3DXZA 1QFZA 3PNSA 4IZ6A 4LHSA 3ANSA 4GSYA 4UXHA 5J5AA 3FSGA 4D9NA 3I61A 4NECA 4HRVA 4DTCA 1WPQA 3IELA 3ZWWA 1NKSA 1GSIA 1VE6A 2O8FB 1YUMA 3UV6A 1SHJA 3FNRA 3KOZA 3OU7A 4FEYA 4MV5A 4Z9FA 4W5QA 1Z38A 4LW8A 5DZSA 1XV5A 1AXEA 16PKA 3UUGA 1KORA 3R2JA 1E5DA 4BFLA 5H3CA 2Q3LA 1F6DA 4R7TA 3V3KA 5T41A 3VJLA 3OAAD 1CD5A 3GJYA 2PMFA 4LY9A 4OQDA 3GGDA 2WFMA 4YWHA 3RGGA 4LE2A 3KQNA 4RF3A 4TT3A 2QUZA 4W7SA 4P3KA 4TRJA 5G4KB 4QXRA 3WMFA 4CM1A 3UT0A 1SXJC 1O95A 4C87A 1KGDA 4RD3A 1QGUB 1SD1A 1IL0A 1T0PA 2WFAA 1NXWA 2GFHA 3JAWA 4JBIA 4DVJA 5BR4A 5LMUB 1UQUA 4H1UA 3UMVA 3RC2A 4QBIA 4G67A 2GO7A 2H48A 1IY1A 3IT3A 1G9SA 2GTIA 5TF4A 3TKYA 5GV8A 1EH5A 5CEFA 4C4TA 2QTVA 1OBOA 2C4VA 4U7JA 4A2CA 4ZI3A 1TECE 1IAVA 3KZKA 1GUYA 3IPLA 1AZTA 3HB0A 3LHDA 3MF4A 3K1ZA 3H84A 4BNNA 2W0MA 3WLTA 3IB6A 2R4TA 1L7QA 1BE8A 2B83A 2I1LA 2XNHA 2YYSA 2ZRDA 4ETWA 1V1MB 3QF4A 5HRCA 2NTVA 3LQQA 1W0JA 4L76A 4AZTA 4DQUA 1EUYA 1J97A 2YINC 4G1VA 2R1VA 5TXGA 5K3SA 3NWOA 4ZRDA 3U4GA 1QH1A 2AYZA 3WK7A 3AVUA 5DU2A 5CIWA 1KVQA 4IDGA 2BKEA 2YV4A 1ZD8A 4IHQA 1E6CA 3MG9A 3QW4B 3HVKA 1Y1SA 4QQFA 4TT8A 4EJ6A 4JJKA 4TQ9A 2V7QD 4CL0A 4TS4A 1JFFA 5AKJA 3RO7A 3WGTA 3R41A 1R8QA 4I3FA 1SUFA 1SPXA 4RZSA 3KRTA 2ZVQX 4XRRA 2HTFA 3IRUA 4QWWA 1N75A 5AM2A 4BP3A 4ZHQA 4A8JC 4BGEA 1TLTA 4IIVA 1XPUA 3ZE2B 4Q3KA 3BWYA 1V39A 3FVRA 1YB2A 2Z08A 3EUFA 3OO1A 3SG0A 2BGRA 3ND6A 4BBJA 4DKXA 1PV4A 3NOXA 1R4ZA 3O82A 4JT2A 5E9WA 4BX8A 1XTKA 1RRFA 3AGQA 2GAFA 2FOIA 2EQAA 3THSA 1MKYA 3ESRA 1FNBA 3PUWA 3QXJA 4GI1A 2AQ8A 5DGHA 1A4IA 3WMRA 1CUGA 5F2NA 4P36A 2KB0A 4URFA 4Q4LA 4UREA 1M34A 2V5UA 2ID4A 3W3AH 4EUFA 1D8AA 3E22B 5EMNA 2F3PA 3GMTA 4WV3A 3DCIA 3DGEC 2RG7A 4BGUA 1BSVA 1C7FA 4GZLA 3K53A 4MDYA 4DLRA 2JIOA 1P2TA 2B3DA 3O2JA 4FZRA 2XCRB 3NJRA 4C14A 2NNWB 4UEQA 3I2HA 3RIEA 3L8HA 1PQYA 3CONA 1EGQA 3D8RA 3KWMA 4QTXA 2I2FA 1IB6A 3DTYA 4R0MA 4CKCB 1EP2B 2JFYA 1VMEA 5DIFA 5GP1A 1ZVMA 3OH8A 4ANFA 4LJ7A 1RXUA 1VSBA 5JSYA 3Q8XB 1V6CA 2VYCA 1DX4A 1CUBA 2GYYA 3FNBA 4DQLA 2XSZD 1NT2A 3PUKA 2V5AA 2DUJA 2BD0A 1G5IA 4GE0A 3VH2A 4R2MA 4RMJA 5BVHA 1GU1A 2GAAA 2ZTVA 2BMAA 3R09A 4RVHA 4PINA 4OHKA 5JUWA 2ZBEA 3RNLA 3MBKA 2OM6A 3LKDA 3LIIA 1O97C 4FWTA 4JL8A 5CPFA 2HXGA 1D6SA 4Z3KA 4G63A 3WHLA 2D4AA 2BFBB 1KS2A 4J07A 2Q9BA 4K03A 4P2GA 1FMJA 2PGDA 4FMDB 2PHZA 4KWCA 4KSCA 4WJLA 3KTFA 3O8LA 4IIDA 3PFCA 1K0FA 1GUZA 1KYYA 2JAUA 3R7DA 1LK7A 1QC5B 1N1MA 2PPLA 1L5OA 1N6RA 2YMPA 3HJAA 5AHOA 2BI7A 2LZ0A 5JLAA 2PDAA 2IX3A 1BG6A 3C3DA 2HRBA 3RUIA 1COWD 2IK8A 3LTNC 2PGXA 1OAOC 1UZUA 1XZFA 5EP1A 3FOEC 3GWZA 4KPEC 2Q7OE 1P29A 2GJ4A 1UEJA 3E53A 5JRJA 4PO8A 2E7ZA 1ZUNA 3JQBC 3NKVA 1U0JA 2WP8J 4XUDA 4B83A 4BZXA 3ZV6A 5CB0A 1SIUA 1ARZA 1HFJA 3T3NA 3TMKA 4HPXB 5CVEA 2WNIA 4N7RA 3PHHA 4DLAA 5F77A 1DBIA 4PONA 2JIZD 4NV0A 2X2PA 1KYXA 2EC5A 3IQWA 4JYCA 1QHYA 4I8XA 1SQGA 1L5YA 3RV4A 4KN9S 1KYQA 2QTBA 3ZE7A 5JWHA 2NU9A 1GTZA 2LCQA 3WSVA 4D9CA 1HNXB 3OQJA 1XKXA 4UVHA 4JBLA 3GGJA 4M8SA 1K8ZB 3PQEA 1JT9A 3OCYA 2C04A 4ENUA 1EXDA 3AB7A 5HK9A 2QYSA 3DJYA 3IB3A 2I4LA 3IJEB 4OGGA 3DW3X 4QJBA 4A9AA 4LXIA 4BFSA 4CIVA 3U6KA 4MGYR 1DG3A 1L5WA 2JI4A 1B76A 5FXMA 3UWMA 1B4DA 1RWOA 3D02A 3D5QA 3THYB 1DFGA 4LPSA 4P7KA 1NKTA 1TD9A 4R4JA 4S1WA 3ZDYB 1K68A 3U4MA 4ZMSA 3VOTA 5BUSA 1XTUA 1K4KA 2Z8XA 4IYJA 4AY4A 1XLTC 2PZMA 4TVOA 2WTAA 1XCLA 3DHEA 2OHJA 2EFCB 4L6AA 3T5DA 2WF8A 3KEGA 5IJ9A 2A0WA 4BVGA 1MRNA 2XVAA 3DO5A 5F2KA 5KVSA 2O1XA 4NOLA 3H9QA 3PJFA 5KSPA 2J0VA 2OC4A 3AG6A 5DGXA 1SAYA 4EOGA 5LIRA 1J8VA 3A58B 2OEPA 3ZWOA 4AMVA 4B8ZA 3FX2A 3EZFA 5KWSA 4D9GA 2WU4A 1ZR4A 2FN3A 4EMBA 3BSFA 1QX4A 1MU0A 3BBPA 5AW2A 2H2FA 1ZVQA 2WVGA 4ZEWA 2GO1A 5CLLA 1JFRA 2LIVA 3MJTA 1RTTA 3V42A 4OQPA 2PH5A 1MABA 1XF9A 3VSAA 3DVAB 1N3YA 2BCEA 3ZGXA 3K5IA 2AOUA 3V1TC 4DG9A 2IOHA 4DJEC 1ISIA 1V5EA 3M3HA 4WH0A 1FQKA 1IY2A 1R8YA 3IQEA 1SXJD 3ZY2A 4D8UA 5I7OA 3U4CA 4RQUA 1GGNA 1OYYA 4V0MA 5LU9A 5LMNB 1AE1A 2XMRA 1SC4A 3NTVA 5HDQA 2FOXA 4JU8A 1P2DA 1HFEL 4R7ZA 1Q15A 2J9ZB 3R5FA 4ISCA 4KAJA 2FHSA 4DBLE 5H5JA 1IBRA 4B45A 5B64A 4DB4A 4GFDA 5IABA 4TZTA 2CJWA 2YS6A 4W5OA 3QOFA 4YQZA 3A4YA 1ZD1A 3NR2A 4Y6PA 3SIRA 4M1SA 1T3ZA 4OYHA 2V7VA 2C99A 1YKGA 4J2HA 4XVQA 3SZ3A 4H17A 5LDDC 4MUMA 4MWSA 2WQ6A 1Z0DA 4EHBA 1NP7A 3N07A 1VOTA 3GARA 2SKDA 4Q47A 4GRDA 1R0RE 1R4AA 5B6IA 1DJQA 2OGUA 4IIEA 1WZIA 1X7HA 2BFDA 3PJDA 1N0HA 3RCBA 4NG5A 5DYTA 1M2GA 3IKLA 4WJKB 3WC4A 2IYLD 3LDGA 4MWEA 5REQA 4BQIA 1NBMA 2RGGA 2XLCA 3T34A 3W9SA 1ZSYA 3LHSA 4GGPA 4M8LA 2CFCA 3C5EA 3M1AA 4RHEA 3FPSA 1X7XB 2BKVA 1P2VA 3PU6A 2R2AA 3HG7A 4YGYA 1BHSA 1PUIA 1X0XA 1YRBA 3P1JA 3S1AB 5B3LA 1GGJA 1XVLA 4JQZA 4MUFA 4B71A 2FUCA 4RXMA 1RJ9A 4R2LA 1RQLA 1EFLA 3E5MA 2CD7A 1SD5A 1YULA 1WU7A 1UFVA 2WF6A 1Q7TA 1N8SA 1RHKA 2HN9A 2R6HA 4LVNA 4MI1A 4W6ZA 3PX7A 1ODCA 2DPLA 2B8EA 4G4IA 1K8YB 2WJWA 3E9YA 2XIJA 3ILVA 3L8YA 3MTBA 3ZDBA 2MTBA 1X3SA 4AYWA 1FDVA 4QFDA 4ASUA 1LW6E 2ACKA 1FZTA 2Q2QA 3C14C 2XCIA 5F7ZA 1F8UA 4BO1A 2O06A 1UZNA 2X4DA 3H75A 3VVCA 5AW7A 2J67A 2ZAMA 2QMOA 2NYVA 4D57A 2C58A 3AYXB 4YNBA 4AXBA 2Q1YA 2IZ6A 3MUEA 4YMSA 5DP1A 1F1JA 5I7VA 5HTOA 1QOZA 1KAEA 1WP4A 1YIOA 1BS2A 3F8TA 3IDZA 4NTZA 2ZUUA 1PJCA 1XOIA 1C14A 2FX3A 1DIOB 3GN2A 2QGFA 1IAQA 3JWGA 1G98A 2O2IA 4LJLA 4Z1MA 4FGWA 5HF5A 4Z49A 3LSTA 4HTAA 2VPTA 2CLSA 4OXKA 4DJAA 5H9WA 2PZKA 2RG1A 5KSYA 1NG1A 5HBGA 4Q00A 3AR3A 4QEKA 3VQTA 3RUAA 4KYUA 4QUEA 3IQGX 3P0IA 4YIKA 3U1BA 4OB7A 3H16A 1NNI1 1XNRB 1G8FA 3TF5A 1Z8HA 1CV2A 3TOXA 2DBZA 1HF3A 3ZV5A 4YBZA 1XPJA 2ISCA 2OCYC 5SZKB 5LXTA 1JAYA 5C37A 1JWAB 4ARCA 1JR3E 1SN7A 1JW9B 1MQ9A 5ALNA 1ODFA 2G1PA 3DT6A 1T3HA 2EQBA 3HU3A 1OYVA 1FVHA 1ZJ4A 4BO5A 1U31A 2DFDA 3CF6R 2DULA 2RIRA 2BGTA 4PZ9A 3VU1A 1PG2A 3PA6A 1ACLA 2JARA 1W94A 5JSQA 3VDMA 3M6LA 4EGCB 3D4LA 1JMVA 2GVDC 1DJOA 3C8ZA 2I34A 3MTIA 1EINA 5CW2A 4EX6A 2B5WA 3PNMA 3ZKAA 4MITA 2H1CA 2VT7A 5FOWA 4BB0A 4R0NA 2RHRA 1R0BA 3EE6A 2L82A 3FW1A 2YWEA 2YYZA 3I9OA 3KWLA 4JLKA 4TUYB 3DZBA 4B7XA 4YRTA 3UN1A 4IBOA 3CLSD 4RK5A 1BVUA 2AG8A 4Y9RA 5IXYA 1I3CA 4ARIA 2L69A 3EHDA 3MMXA 3E58A 4QBHA 4CL8A 2NO6A 2PRYA 3KR1A 1VHTA 5BNIA 5JIBA 4P0PB 3TGPA 4EA6A 3KTAA 4FW8A 3FVWA 4BMNA 3FCEA 3T5BA 5JXWA 2RHWA 2AE1A 3DAHA 3ESZA 3HHPA 5EMLA 4IDEA 1KU6A 2I7VA 1AHHA 3A2MA 3IO3A 1X2EA 4ZI7A 1E2FA 5HKLA 3T7TA 3ORHA 4XD7A 2PG3A 4YP1A 1PAUA 3NBUA 1T1SA 2G5GX 5DM60 1Z7GA 2OFPA 1QYXA 2I67A 3SF8B 2EP5A 3OSUA 4AJIA 1OFVA 4OLAA 1BX0A 2C77A 1A98A 2C4UA 3PFHA 3L4EA 4CJXA 4HDMB 1VC2A 4INAA 4OXIA 3UT6A 4ZDKA 4U7WA 3IKMB 2WBLC 4B5KA 4OLHA 1S96A 2KLHA 1S3FA 1JGTA 5GOZA 4XWWA 3H5IA 3SM9A 3ASZA 4K9DA 4L3VA 1P72A 4DV4B 4K40A 4CF6A 2CJYA 1QRTA 1EP9A 2GBGA 2PGOA 1NL3A 1QF6A 3WDSA 3C5CA 2P4HX 3EDOA 3EULA 4GI5A 5ADUS 1CEYA 4E5NA 2B1GA 1TW2A 4ZOLB 1Z5NA 4ARUA 2GBFA 2YXDA 4WK2B 3H42B 4Q01A 3M49A 2UUOA 4L8VA 3W77A 2RGDA 1KRXA 5HJ7A 2VIIA 1X77A 1OC2A 1U94A 3UT5A 4FC7A 4KVAA 3WGYA 3UWDA 4C4RA 4DRXB 1UP7A 1QB7A 2CHVA 2VWHA 4I4IA 5MFPA 4P08A 3DC7A 3DYVA 4GBMA 2A9VA 3H8JA 1Y7TA 2VWGA 3T4EA 5AICA 3EIOA 1YS7A 1B0PA 2G9ZA 1Z82A 2B82A 1HSOA 1QS0A 4KGXA 1G21B 4F9FA 5BN1A 5DBGA 4P80A 3ZHCA 3TIVA 5ILOA 3QEMA 1KSHA 5JMTA 3WRXC 4MRMA 1N2EA 1U04A 1E58A 1P1BA 1V8FA 3D8UA 3OEEA 1P7WA 4FCWA 2UVQA 4OHXA 3GDWA 5C8XA 1XKLA 4NE9A 1VLLA 3WV5A 3LOPA 3ZIUA 2VUHB 4OBBA 4C7XA 4ZKDA 3A6JA 1TGYA 3LYAA 3LX4A 1L3CA 1WR8A 4WLUA 2ZITA 1DXHA 1TW3A 1X1AA 4H15A 4NAVA 1MAVA 3L6CA 1YDWA 1W19A 1NAHA 1ZRHA 4RLFA 2Q21A 3IESA 2I4OA 3GMDA 2AN9A 1S2OA 2A57A 2SNIE 5IXJA 2DOKA 3TO5A 1T6BY 3G0GA 3LCRA 3GRZA 3FOZA 1KMMA 5JSUA 1WWKA 1FX1A 2O3QA 1N7HA 1IN1A 1FMCA 5DW3A 3K94A 1VIDA 2NUBA 4W8GA 4JUAA 3NU1A 5AUOB 2OLKA 2QVCA 4K9KA 3AI7A 1RLOA 1JALA 1T0JB 2Z2JA 4MLPA 4NFLA 3JX9A 3PQ5A 1VJRA 2G4LA 2A9OA 3NTXA 2F62A 4H6PA 2RHCA 3TRKA 3VNSA 2WMOB 5DLPA 2PUDA 3GV0A 4LRXA 3D6MA 1JBQA 2Z9DA 2G17A 2GZSA 1GGHA 4ML3A 3Q72A 4WASA 2WHPA 4QG3A 4PZAA 1FX0B 2IITA 2B4QA 2D0DA 2OO3A 3IUNA 3LC7O 4QULA 1D1TA 1FCJA 2FZCA 3DWIA 4U2CA 4V38A 5C5EA 2VUSA 4ZREA 1GZVA 2H0RA 1SKUA 1XMIA 1N6NA 1YZFA 4CW7A 3A1CA 3WMEA 4LI3X 3PUXA 4URXR 1OGYA 2YZNA 3VZPA 1ID1A 4HRAA 3L7AA 5A3JA 5A4FS 2QRPA 1F7VA 1MIHA 4TWJA 2AEJA 2GK7A 1K7EB 2KLBA 2O8VA 3U7JA 1AS3A 2ZU6A 4DG5A 3DO6A 4YRJA 2GM3A 5FTLA 3S1AA 2IE8A 3QZUA 2VP5A 4Z86A 1RZUA 2WP0A 4FD3A 2CLLB 4YC7A 1NN5A 1YRWA 3B78A 1LRJA 3IMCA 4GBJA 4QHSA 1ULUA 2H00A 2PU7A 1NI4B 3N28A 4HDNA 1UK7A 2P6MA 4PSUA 4QASA 5KMGB 5KTPA 1OWOA 3GBVA 3DHVA 4C06A 1G2PA 2ZM5A 2Y0BA 3ZDFA 1R2QA 1N2IA 1GVHA 3RREA 2JGEA 4PHCA 2JCSA 4V39A 1UMCA 4QGAA 5DSTA 1NU8A 1ADJA 1ZMOA 4MGKR 1GTSA 5K05A 5JDCC 1DJLA 1JBEA 3AVOA 2EZ9A 2AXEA 3LK7A 2SCUA 4LHYA 4MINA 4Q34A 3ZW8A 1YCGA 2QN1A 3SFZA 3HCEA 5GZ3A 1Z3IX 3PFFA 4IUCS 5G0TA 2JFBA 4H7JA 3U48A 4JHLA 4ZT2A 5KDLA 4JGBA 2VK2A 4ME6A 4NZPA 1Q0LA 3K9BA 2HI0A 1WDMA 3BFJA 3X1XA 3MRSA 2OZPA 1YI8A 2D06A 1R9GA 1H2BA 3GIDA 3TTVA 1SKQA 1FMFA 4RAOA 3EIWA 2NAFA 4GL4A 5JAQA 2PV0A 3KSUA 2J5RA