3EFEA

The crystal structure of the thij/pfpi family protein from bacillus anthracis
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
208
structure length
208
Chain Sequence
TKKAFLYVFNTMSDWEYGYLIAELNSGRYFKKDLAPLKVITVGANKEMITTMGGLRIKPDISLDECTLESKDLLILPGGTTWSEEIHQPILERIGQALKIGTIVAAICGATDALANMGYLDTRKHTSNNLEYTKMVCPNYKGEKFYELGPAVSDANLVTASGIAPLEFAMEVLKKIDVFTLDALHSWYNLNKTHKPEYFFQLMNSINK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ThiJ/pfpI family protein
publication title The crystal structure of the thiJ/pfpI family protein from Bacillus anthracis
rcsb
source organism Bacillus anthracis
molecule tags Chaperone
total genus 70
structure length 208
sequence length 208
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3efeA00
4AUEA 3GRAA 3PQ7A 4AUMA 4ENVA 1CE8B 1GGEA 3B36A 2AB0A 3TTSA 2XF2A 3ZJ5A 1KWGA 3RHTA 3B3AA 4XLLA 4I46A 4L8FA 1Q7RA 3P9QA 1GG9A 3EFEA 1QVZA 2YWDA 4N0MA 1GGKA 5SY9A 4P2GA 4N12A 3FSEA 4P36A 3TQIA 3L4EA 3PQ6A 2A9VA 1P81A 4BIMA 1PE0A 3PQ5A 1FY2A 4B2YA 1GPMA 1O1YA 1KWKA 4Y1EA 2VKTA 2H2WA 1QDLB 3NOVA 1JDBC 4L8YA 4OJYA 4Y0NA 3SOZA 4UNIA 3TTVA 4WXYB 3TTXA 3F5DA 4ENPA 4ENRA 3KKLA 4ZDKA 3FIJA 2AD5A 1R9GA 1VCNA 4ENTA 1PDWA 1N57A 5SY6A 4JQSA 1QVVA 4AULA 2GHRA 4GE3A 4AJ9A 3P9PA 2ABWA 1OY1A 1C3OB 3L3BA 1G2IA 4P5PA 3BWEA 3UMMA 1IZYA 4HCJA 3UK7A 1P80A 2IUFA 3TTUA 1VCOA 3R75A 1VHQA 2R1UA 3M3PA 3MIIA 1KEEB 4LRUA 3CZ9A 3R76A 5LIRA 4ENSA 4Y1RB 3R74A 4UOZA 1FYEA 4L8WB 4UCFA 2R1VB 3EJ6A 3MGKA 3ZR4B 4B7AA 3P9RA 1J42A 3NOQA 1OI4A 1CS0B 3ZJ4A 2LXNA 2VXOA 4ADSG 5JZOA 5SYAA 3UGJA 3NONA 1K9VF 1IPHA 5IP5A 1SY7A 3OT1B 1JVNA 3TTYA 4ENQA 4RKYA 2ZUTA 1CF9A 2FEXA 3EWNA 2R1VA 1P7YA 3L7NA 3N7TA 5K4AA 1U9CA 2NV2B 2YWJA 1PV2A 3L18A 4QYXA 1SOAA 4BTEA 1KA9H 1WL8A 1VCMA 4WINA 5E9AA 3OT1A 4RKWA 4B40A 1QF7A 1GGHA 2R1TB 1OX4B 2ZUVA 3EN0A 5SY4A 1S1MA 3CYFA 3NOOA 2VPIA 2ZUSA 4L95C 4MNTA 3CZAA 4R7GA 4P34A 1P5FA 2VRNA 2ZUUA 2V4UA 4UOQA 1T0BA 1QVWA 2GK3A 2OR3A 3TTTA 1OX6A 3BHNA 4BFLA 1GGFA 4OGFA 3NORA 3P9SA 1I7QB 2VDJA 4OGGA 3UOWA 3CNEA 1PDVA 4Y1GA 2ZUWA 4B5KA 3F71A 1KXJA 4Y1RA 1ONSA 1L9XA 2D7JA 3PQ4A 3UJNA 1A9XB 2W7TA 3SF8B 1GPWB 4MGHA 3D54D 3PQ8A 1BXRB 3NVAA 4MTCA 1P7ZA 1QWSA 4I2NA 4ZDJA 4OFWA 1Q2UA 4GUDA 2RK4A 3SF8A 4ZDIA 1T36B 4AUNA 1GGJA 4K2HA 4I4NA 2YWCA 1C30B 4UZSA 4ENUA 3PQ3A 4ENWA 2NV0A 4E08A 2R1TA 1OX4A 2RK3A 2WJZB 2ISSD 4OQ4A 1OX5A 3EZGA 1IZZA 4OIFA 4QYTA 3VU3A 4Y1FA 3TTWA 4GE0A 1T3TA 2YWBA 3B38A 3CY6A 1UCFA 3PQ2A 4L7QA 4PXYA 4S0ZA 4B31A 4D1YA 5JZMA 1I7SB 4LGYA 1M6VB 2RK6A 3ER6A 4P35A 1I1QB 4L78A 5DFAA 4ZGGA 3WFZA 4E5VA 5BV2P
chains in the Genus database with same CATH superfamily
3V4PB 1GTRA 1IHYA 1BQ4A 2ALJA 4CLEA 1SHUX 1GDTA 3MINA 2ZSEA 2Z9CA 4ZQFA 4ZVLA 4A4DA 5IASA 4MVJE 2ZJ8A 4R40A 3NCTA 2JIOA 2YTZA 2JGIA 2X40A 3L40A 5EUCA 3E2PA 3OWXA 3VPBA 1X7DA 4FYPA 2C0CA 4M7OA 4ZYWA 1FVHA 2Q29A 1B0UA 4EWLA 4OLAA 2BM0A 3VPDA 1KZ4A 3ZGNA 4PLZA 3P5BA 3DFMA 1X8LA 4PSUA 3CIOA 2QUHA 4UDXX 4KRYA 1PEYA 1DU4A 4NCXA 1JMVA 1NVWQ 2ZJBA 1E2HA 2I2FA 5L3RA 3UB2A 5KMGA 5JJBA 1JBEA 3RSFA 5I5EA 1PI3A 1ECBA 1GNTA 2O4CA 4L02A 5HF5A 5CDTA 4JQYA 5AJYA 5AHOA 5FPKA 2COKA 4AL4A 4W7IA 5IF9A 2YWHA 3VTZA 1G66A 4FDLA 1V7ZA 2GUWA 2Z56A 1HMPA 3BORA 2HRBA 1XZQA 2OV4A 4BUZA 3BIWA 1U8XX 1Y5NA 1OXSC 2QTHA 4CLRB 2R1UA 4F3YA 3C1OA 1FLNA 4PEVA 4D8UA 2RHRA 3VKWA 3ZLJA 4L8WB 4HFNA 4Q1CA 4PCLA 1QGZA 1EA7A 3E81A 4HMQA 1P9NA 3H0CA 3T4UA 3SHTA 2E85A 3A27A 3A9RA 2MR6A 2OOKA 4GQAA 3DONA 2CLLB 4AKSA 5EP1A 1CUWA 3I37X 4E22A 4YRLA 5JNTA 2G07A 1ZOLA 2XECA 3WRYC 1KMQA 2H2HA 4OU5A 4UBOA 4V0QA 2H8KA 2AK2A 5TV2A 2OQRA 3R6TA 1RYMA 3HCNA 1E2MA 3ILYA 2WIGA 2XDWA 4AJJA 5JRZA 2ZRLA 1UUFA 3C74A 2R8YA 2HIGA 3HABA 3LT5A 4W1RA 4CETA 3ER9A 1VI6A 4LZAA 3EC1A 3NMUF 3IT1A 4LQLA 1FFHA 1NJFA 3DXYA 3LK6A 3K05A 2ZYTX 2CVOA 4W7SA 2QZ9A 1RRKA 3AJ9A 3L01A 5I5GA 5LKAA 1KE2A 1ZMOA 1WDWB 4OYRA 1QS0B 2P9BA 4CLRA 1HFJA 2P7IA 1FJ2A 1NHGA 2AN1A 2QMOA 2C4MA 3A4LA 3ISVA 1EWYA 2IXDA 3PI7A 3OESA 4OH7A 4FD2A 4KDRA 5E38A 4GOLD 3GB9A 2TSYB 2ZYRA 3EQ7A 4XFJA 3R5JA 3OX1A 2PLFA 3VX3A 3SE7A 4BMPB 2PPVA 3H2YA 4HRYA 4RX1A 3S2FA 1KP2A 1O96B 2HLNA 3CT4A 3P71T 2C07A 4ILEA 4XXHA 3FF4A 4A8HA 2H48A 4UHJA 3RARA 4J90A 1LI4A 3T12A 3MS2A 4M8KA 1ISSA 4PGHA 3LA6A 3WLKX 3ZGLA 1Z0JA 2GJ9A 4QGFA 3VYVA 3ZBUA 1EWQA 1GDHA 3KR2A 4TM8A 3UPTA 1Y1TA 1D2HA 1YK0A 3ZI4A 2B25A 1KC1A 1AK9A 4B32A 1QVAA 1V39A 2FMXA 1ENOA 4K6GA 4F8JA 4XR9A 2N9UA 1E5LA 1W35A 1D4FA 5EXDA 2NZ8A 3JYOA 3PUWA 4MI1A 2OYRA 1QS0A 4DLXA 4KOEC 2AB0A 3LFUA 2WT8A 4B47A 2G1PA 1P18A 4NXNB 3K9GA 3VDQA 2MSLA 4ZZ2A 1C3VA 1T9BA 2YDYA 3MT8A 1KPGA 5A7HA 1NXQA 3D6TB 1ZHFA 1P17A 5FQOA 2H4WA 1EXMA 1OU4A 1GM5A 1U7PA 2JFWA 5DCWA 3TZEA 2X7XA 3O9MA 3GJ7A 3PWZA 2O0MA 4RCVA 3UWDA 4XB6B 3MNFA 5DI3A 3WDLA 2BHTA 4JHXA 1KOFA 3LZDA 1MA0A 4LKOA 1YKGA 1SVOA 4DR3B 3T7SA 1O96A 2HU2A 2FRXA 2YXDA 4C76A 1P19A 4PWYA 5IUNC 2X6TA 4Z2YA 2WTNA 3FMGA 2AMVA 4Y6SA 1QONA 4JQSA 4KQ9A 4KUEA 1Y8QB 4G9GA 3T52A 5IABA 5J1TB 3A2KA 2H63A 3UQZA 4D41A 2NO5A 1JTEA 1TAQA 1QFJA 5AW1A 2XMRA 1E1RD 2BFEB 4NENB 3V97A 4QHSA 4Y6PA 2X1HA 1N6IA 1ZI8A 2PANA 2V0NA 4JJFA 2DFLA 4P86A 5A3SA 2R7AA 2P2ZA 2PKXA 2OB2A 3DNPA 5TE9A 3U37A 3ELDA 4MV9A 4K9RA 2HRDA 3V2GA 2P9QA 4BXOA 3QMVA 4P4UA 1P8AA 2XADA 4I08A 4K03A 4Q66C 3D31A 4KQMA 2ZRAA 1K9SA 4QBKA 3R4CA 4U6QA 4RM2A 4QPCA 3RS4A 3ZK7A 2VNJA 4YI3A 4PC1A 2PZBA 3TE7A 1EHCA 4JLBA 1QIHA 3IQDB 5CYFA 4WZZA 2VOJA 3V33A 1UEIA 2MHCA 2R1VA 3W5UA 5BPHA 1SKQA 4NMXB 1O95D 5JMOA 1HQKA 1YUBA 2IZZA 4PSAA 5LZ8A 4K9PA 2I2AA 4LPSA 1N5JA 1RI4A 1WB4A 3HDGA 2JFHA 4IIFA 1MH9A 4K6OA 2OFOA 3HP7A 1ICIA 1AKQA 2JW5A 1BFDA 1NE2A 1EHYA 2IP1A 2VOEA 1Y8QA 4IXMA 2PE5A 1DMSA 2WZDA 1ZGBA 3EF0A 5AQ1A 1M67A 5F7XA 3IIJA 2BFEA 4NENA 4D9CA 4OBWA 5J5VA 3Q8XB 3RJZA 5P8WA 3N8DA 4FC6A 1CLEA 3F2VA 2D59A 3HZHA 1OLXA 2NU8B 2IYRA 3NX4A 2VAPA 1RZVA 4Y2GA 2Q5QA 2PRYA 1C2YA 1M5UA 2G17A 4EA6A 1QP0A 3OTGA 3HVJA 3QHAA 5LU9A 3AEYA 4TKUB 2X0FA 3SVZA 1XWWA 1CJSA 1LI5A 2RHDA 2V7VA 2QW8A 3WGKA 1V1MA 2GWRA 3TGWA 5AJXA 3TNLA 2XKAA 2XT6A 5L40A 1E1QD 1TVKB 2VJYA 4G4IA 2I4LA 1Z68A 3CJQA 3DMTA 3LXUX 2EFDB 2HTFA 4HAIA 4PSVA 3SHWA 3UJHA 4N7MA 2J9RA 2KJQA 2X22A 3ZY6A 3W9YA 2OZVA 1KFKB 3S2YA 1H2BA 1Z36A 2C4NA 4I5GA 2BSAA 1MAUA 4JX8A 5K01A 5D86A 3THRA 1VMKA 2PN1A 4I8XA 4YCNA 3ZNPA 1GNRA 2C7VA 2OD9A 3S7ZA 4TWIA 5EMJA 5AK5A 2G6BA 4BBJA 3CW2A 1W4CA 3ER6A 4KQIA 1GPNA 4EMUA 1Z4JA 1IEQA 2WSMA 5ADVA 4BEBA 5K3SA 3BE4A 4BE7B 4DIDA 3NASA 4HAYA 4MKIA 5F5LA 2OHIA 2NU8A 4B8ZA 1SPXA 1MMFB 4MS1A 1U7TA 4P22A 2CV1A 3LDGA 3E61A 1LK7A 3PFCA 1G42A 1VLHA 2ZGVA 3D8SA 5DNAA 4EELA 3VNUA 1ZUNA 2CWDA 3IAAA 4FKBA 4P2GA 1P31A 1JB9A 4TKUA 5DYTA 3UHOA 1KIAA 1PG0A 1PJRA 1QG4A 2LIPA 2VNKA 2QSYA 3CE9A 1SZCA 4DLKA 3RS9A 4D0RA 4YJHA 3RT7A 4L4UA 4Y2PA 3AXSA 3HR8A 4BWGA 2CE7A 1U2DC 2Z2ZA 4L8YA 3ZKWA 1G20B 4D44A 3NYWA 3DE6X 3K6JA 1DBPA 4YJFB 1CB7A 1D3AA 1U1DA 2VUIB 3BXHA 2NTJA 1LV8A 5M29A 1ECPA 1DDIA 1Z6TA 3X1XA 2OVFA 2I4NA 1UBEA 4G0YA 4ESOA 4TKZA 4NEGA 4TMVA 3H11B 1C2TA 3H84A 4BBAA 2NVWA 1J70A 3DEZA 3ROEA 4PG7A 2HY7A 3UKJA 1FZQA 1Y89A 1XCMA 4K9MA 4WL0A 4ZOLB 4B6GA 1AQIA 3RHZA 1FTGA 4XUDA 3HI4A 1KEEB 4ANFA 1FDOA 3JQGB 2Y9MB 5H9VA 1WKBA 1H2RS 2FW7A 4KTTE 3UJ9A 1YJCA 3GRRA 3SXUB 1AS3A 1JG3A 1RPJA 1W6RA 2J9ZB 3JWEA 4DCUA 5GM2A 3N39C 3KSDO 4JUCA 5EJ9A 3SYNA 2EYUA 5FUYA 2IT1A 3P96A 4OHPA 4IUBS 2CB9A 3EXEB 5DXAA 2FSSA 1XU4A 1F8UA 2EZTA 2YDXA 3R3HA 4E13A 1G20A 5MFPA 5JXGA 3L8ZA 4XGQA 4P32A 3OI7A 2B94A 2HA7A 4CVNA 4P93A 1M6WA 3RVNA 3OY2A 4HSEA 1RVDA 2Q3BA 2R8EA 2VYFA 4LWZA 4EGCB 1W49A 3EF1A 3FHCB 4Q5IA 2H4FA 2VDQB 3H11A 2YXNA 2HEIA 2I2DA 2HMWA 3PRYA 1E0KA 2YVUA 2V4UA 4K1XA 1J5PA 5LXTF 3CLVA 4ZJZA 2XNCA 5FYDA 2R96A 3RKUA 3R23A 2Y0CA 3LDHA 5CM2Z 3WLLA 2EC5A 3R7AA 1U9YA 3K5HA 2IU3A 1T6ZA 1EEHA 1NV8A 4PAWA 5AVWA 1KEEA 1U8EA 3AM4A 3QH4A 3P32A 4KXXA 4B81A 4LRYA 2XIQA 3IGFA 2BHSA 4J7UA 5A4JA 2HXYA 3SXUA 4CIDA 3IL2A 4E15A 4PGMA 4TTIA 1NVKA 3N8NA 4GZ5A 3P97A 4H3SA 5FCDA 4IXWA 4ZYLA 3G2HA 5LP6C 4QDTA 3RV4A 2W6CX 4HS4A 1P44A 4MEJA 4IM7A 1K89A 4LC1A 1R66A 1YAJA 4PR3A 1ZA1A 3QI7A 3I3SR 2V55B 3RYIA 4HEA6 4C5CA 3G2NA 2HLDD 4DIFA 1V47A 1JJBA 4NOLA 1QBGA 1SB8A 1YS1X 2B1IA 2BE9A 2R5NA 3OQ6A 1DAFA 1ZOPA 2WLSA 3KL2A 2OHFA 5DTIA 2AQKA 4GR9A 5F2OA 5JZMA 2IX3A 3CINA 3OLQA 4PV7A 5CA1F 4MRAA 1U0SY 1SD5A 3E3OA 1UXIA 3KPYA 4QOIA 1BN7A 2CW5A 1MB9A 1GT91 3TO5A 2EXXA 2WHYA 4L4ZA 3GVCA 4J0IA 1SAYA 4II2A 4TMZA 2R48A 1QLHA 1EXNA 2QTNA 3PHCA 4LRTB 3AY6A 2IQIA 1O9GA 3JZIA 1XG5A 3USES 2UXCB 3Q10A 1Z0UA 4DV0B 2O52A 1GYRA 1OTXA 1QIIA 2JJ1A 3W3AA 2ZSDA 4JB3A 1RACA 2A1TR 1NX9A 2JAOA 1W93A 2DQ4A 1A9SA 4XSVA 3U4DA 5K05A 4NSNA 4XD2A 1HRDA 1KYZA 4EX6A 2HK6A 5JLJA 1R9GA 5AKHA 2CE2X 2D00A 3PNQA 1WXEA 1ZW6A 5HE9A 3CG4A 3H5TA 3TCKA 3L0DA 4NK5A 3NWBA 4OYHA 1S0UA 1GADO 4P4NA 2DR3A 1QZ3A 1FOEB 3BGDA 4W9NC 3B6IA 4PS1A 4WZBE 1AVTA 4IJQA 4JI3B 1ZJWA 3L1VA 4BKOA 4H27A 3TCXB 2IGBA 2QE7D 2RJNA 4M1KA 1HDRA 2PT7A 2Z4RA 3KPVA 3O4RA 1AHPA 4H17A 5G1OA 2WD7B 3M3PA 1M73E 2QVGA 3BTVA 3R9XB 2BFCA 3CVJA 2J9YB 3KZMA 1WY5A 1JPUA 4LJSA 4P92A 5LB2A 4BWVA 4EABA 4EVRA 4LYJA 4FHCA 5FTLA 3JVIA 4PM4A 2ZYSA 1OV4A 3ABOB 2I87A 3UGJA 2LP4Y 1R0WA 3I2IA 4NFYA 3H1TA 4OLJA 3V1MA 3KDPA 4Q05A 1F3OA 2Y1CA 1P7YA 3BSWA 3GF4A 5BR1A 3ESXA 1YB1A 1HH4A 1E5XA 3P9YA 3QXSA 2R4TA 2ZRBA 1RYYA 3BD8A 5TGTA 2ZWOA 4BN5A 4KSCA 4ZZIA 2EQ5A 4YIHA 3P0FA 4N6GA 3THWB 2RCNA 3RK1A 3AF4A 2G09A 2C9DA 2R8BA 5EMHA 2ZTSA 3ZYZA 1J97A 4U2DA 2JCVA 1TZKA 1Q7CA 3M6XA 1WDLA 1QFXA 4CEIA 4LWPA 4BRWA 2O7VA 2B0JA 4HWSA 4UULA 2E4XA 1MW8X 3F5FA 3E27A 4C30A 5H4HA 1G5HA 2GK3A 1MX5A 4CRWB 1DELA 4EARA 1SG0A 2WD7A 4FK8A 1I6LA 1RC0A 3HKCB 4LOLA 5JAPA 2EERA 1YR8A 1I24A 4URZR 3PEWA 2XJ9A 4NABA 4EA7A 2BL4A 2R62A 3MQ4A 3W5VA 1YI1A 1P2VA 1ZQ9A 2XE7A 4O8ZA 5DX8A 3RU9A 2HA4A 3QE2A 3QV1A 2X76A 2UVQA 3ZDDA 1TKAA 2I54A 1PSWA 3D6JA 1MNAA 3MBKA 5D00A 2BT4A 1RLTA 5DYYA 1PUIA 3RROA 4KXUA 1CYDA 3VU1A 1YC5A 3K6SA 1WZ2A 1SKMA 1YZVA 1M7HA 3DM9B 2ZAYA 3FCYA 5TGDA 4Z1OA 3MS7A 3THWA 2G0NA 4X8MA 2Q1YA 1YTUA 1QX3A 2V98A 5F9HA 4ZRDA 1KEZA 1HETA 2GPTA 2J9FB 3AU9A 3E4CA 1WMSA 3I58A 4ITRC 4UBJA 2QP3A 3C24A 4ZCIA 4HV4A 1JKJB 3OETA 1AC5A 1R4ZA 4IH9A 3CUUA 1YU9A 3U3XA 2OO7A 2PMDA 2FW9A 1Z8HA 1GZSA 1ZUIA 3OLVA 2B5VA 3AKDA 3OTOB 2YMPA 1G8FA 4L4RA 2JZCA 2GS9A 4NARA 3I9LA 2O2IA 2GERA 3HKCA 4HY3A 3UFXB 4BIIA 2WF6A 1OA1A 3DGFC 4GI7A 4MXDA 1RQPA 4WZAB 1KO4A 3L41A 4NMMA 5EJGA 4PZAA 2RG7A 3BXZA 4IIJF 4TN5A 3IAUA 3JVUA 4R8RA 3V55A 2AFIB 4N7BA 3W5DA 3DXFA 2AEJA 3RAFC 3LLUA 4DMUB 1SVSA 2W5UA 5LXTA 2FE1A 4QVGA 5J23A 3V42A 1K6EA 3N2GB 4YNBA 1EK1A 4LDNA 1ECFA 3HXQA 1WD5A 1YV9A 4TV9A 4DJFC 2Z0MA 2ERXA 5LBTA 3SFZA 2Z5GA 1S3GA 4A26A 4KMMA 4F5WA 1UK7A 2YZNA 3H5OA 2CHEA 3VC2A 1WO8A 3BB3A 5LOVB 3OE7D 5CIYA 2D74A 3RW9A 3DOUA 4MITA 5ARBA 4Z4IA 2EFGA 3GLVA 5G1PA 1C81A 2HFKA 3H1PA 1T8SA 3AR7A 3I8XA 1LKZA 4DSOA 4YRMA 3FYUB 2RD2A 2EQBA 1I32A 5EZYB 1QHGA 4G37A 4TYNA 3VR5A 2B21A 3W5BA 4LY6A 3W5SA 2PUEA 3G1UA 2ZI9A 1GZ4A 1MT0A 4JLOA 4TRRA 3UFXA 5LLTA 4K0RA 4B7AA 3AWIA 5AW7A 4CL8A 3AJ8A 3U1TA 1OF1A 2WWRA 3NCHA 4M8IA 2CDCA 4LJRA 1J4AA 1EEXB 1QCDA 1CZNA 3HVIA 3OJFA 2UZ3A 2AFIA 3DH0A 4V3CA 3WHKA 3WGVA 1AZLA 2PGDA 2QWXA 3L7NA 1FFAA 2GBLC 2ZANA 4FOTA 4EI8A 3K9WA 1JDVA 2AC2A 2O2CA 3AIKA 3O3MB 4ID3A 4RY0A 3GDGA 4YRDA 4DV4B 3D1VA 1G8KA 3KRTA 5DCYA 3IEKA 4KPUA 1K66A 5KOIA 4LRSB 3QUSA 3DBLB 1T3HA 4KU4A 4MQ5A 4C3ZA 1SQGA 3HUFA 1RCFA 1V35A 2A3RA 1AK2A 1T3LA 1YDMA 2PZLA 4QATA 4XIGS 5H0IA 3AHCA 1R9MA 5CVUA 1XWIA 3ACCA 4Z86A 4URYR 4LHYA 4QC2A 1T4MA 2VF7A 1XZFA 3I62A 4MKGA 1SIOA 1RAIA 1NA5A 1C0KA 1QV6A 5B1EA 3FYUA 1UWCA 5EZYA 3A31A 3MPOA 3UEOA 4GPD1 4LSMA 3PGLA 4A16A 1DHRA 1LVGA 3GGJA 1QV9A 2HWXA 4UJ5A 4WN9B 4B4WA 4RD2A 2JHCA 3R9WA 3N5CA 3B85A 2BKEA 3GK3A 3ZWMA 1PT8A 4MHTA 1TIKA 5DF1A 1P7ZA 3K20A 4Q3NA 1JG7A 4WFKA 2QU7A 1XYYA 3EARA 5HG0A 4LZLA 3FLEA 5TX7A 1TUIA 1JUDA 1VIYA 3HM2A 3KS9A 1E6LA 3E58A 4QREA 2BJWA 2CDBA 3DLPX 4G5RA 2FPSA 2AA3A 1Z34A 1YZUA 2IUTA 1EVQA 2ILTA 4PSCA 4R9UC 1FQWA 5K8TA 1BX3A 2O3UA 3A9UA 2D5CA 1V37A 3H97A 2VAXA 4GPBA 1WV1A 3DBLA 3IAXA 3LBNA 3LUHA 3NDRA 4HZUA 3KXLA 2WE8A 3KJNA 2FPXA 2XOEA 1W5SA 4EG6A 2P6UA 1DEXA 4G97A 4UDNA 2IX9A 3WFZA 2YV2A 3CV3A 5KQSA 5C5EA 4DIBA 1VIAA 4NAUA 1MW9X 1KP9A 1KO5A 4YRQA 5MN6A 1U8UA 4E6PA 5BN3B 5K2OA 1O0CA 1NNEA 3EOZA 3PLNA 1UPAA 3QPUA 5HE8A 4KPFC 3QRWA 1IEVA 2Q6KA 5SICE 1XZGA 2JJ8A 3EAFA 3UICA 2QV7A 2X77A 3NHKA 4UHDA 3TUIC 4ZC1A 1GTVA 3P2IA 5K0SA 4EJFA 1SCDA 2HBQA 1Q11A 2OLJA 5JJ5A 4OGWA 1RBYA 4HH1A 4UPVA 4RW0A 2Y0BA 1GFZA 4Y2HA 2XSZD 1JQBA 3C14C 3NBKA 1YR2A 4RH0A 4URXR 1IRXA 1PGQA 3TZCA 4MLZA 1FP4B 1JDNA 3UA4A 1UOPA 2E1RA 2VQDA 3RC2A 5FOQA 5JPDA 1JHRA 4RK1A 4JIMA 4CDNA 4O1HA 4C0JA 4EI7A 3QMPA 4RK4A 6Q21A 5AVRA 1TK3A 2I6FA 3CSDA 4PICA 1RCUA 1KEUA 3B6EA 1RQ7A 1DJQA 2X2PA 3FCOA 2A9OA 3QA9A 4R6WA 4HNUA 1U1GA 5DHQA 4AKIA 4FHDA 1X14A 2A33A 5EKDA 1ZS9A 1N9KA 1ZZEA 3GYBA 4OQNA 4P31A 5A7FA 3WYAA 3JX9A 2CUNA 1GWNA 3LOUA 3FTFA 2P9ZA 1OFVA 2BLLA 4KIFA 1IY0A 1RBMA 5BN3A 5LMUB 5AM1A 1QOPB 4B4DA 2WWYA 1WPQA 1MOPA 3EOBI 1ZM2A 1KAMA 1F4PA 1P29A 3WK7A 4DRXA 2OHOA 3HBJA 4FOPA 1JI3A 1Z2DA 2PLWA 1SK9A 1S9DA 2QN9A 1E4EB 3K73O 3L92A 3NHRA 4NE2A 1KO7A 3WIVA 2VNIA 4WCVA 3W7AA 2XXBA 1BOOA 3UAYA 1CRZA 4DDWA 2XYQA 1LBSA 4CIVA 4PY2A 4N5NA 1H4VB 1VYHA 2C92A 2FEWB 4UZFA 4HNTA 2F64A 1T1GA 3EW9A 3OM9A 1JDTA 3L5OA 4KXWA 5HS6A 4LHVA 1MH1A 2PSDA 2VHVA 5ALJA 4ZXFA 3N2ZB 5CDFA 3NW9A 4MB6A 3LECA 5DYNA 4E46A 5AVYA 5C7YA 2GSDA 2HT6A 1O7JA 2YJGA 3EFHA 4XB1A 5DM1A 2EHJA 3WSWA 1QPZA 3OHSX 4ZCSA 3AHHA 3AINA 2A92A 2JJYA 1WUIS 2P2YA 5HZHA 4TZKA 3F71A 5KKCA 3A6FA 4M0KA 3HB5X 3GLKA 3MRVA 2Z4SA 4RGQA 3A04A 1G6OA 1OAOA 1UKEA 5BSMA 3IIMA 4HZIA 5HKLA 3L1JA 1G4UR 4OUKX 3LXXA 2XNSA 3DL0A 2BMDA 1E4EA 2P3LA 3STTA 3TNYA 2QVLA 1G0OA 3R7NA 4E07A 5JY1A 2IUEA 4K2HA 4C0WA 3FTCA 3FMFA 3ANYB 3H99A 2WYIA 3NTRA 4GR5A 3VZBA 4DUPA 3AF1A 3WRWA 4X93A 4Q3AA 4FZ5A 2A0YA 4OQLA 4L73A 2O0HA 4X92A 5TVGA 1QH0A 4Y1FA 3ZW8A 3T7IA 1XTTA 4B31A 1B93A 2CUZA 1MO3A 3CX3A 1I2CA 4MH0R 2EFCB 3K9FC 4DN6A 4PFSA 1WZNA 4UMFA 2BGLA 1H66A 2YRXA 3RTGA 5AKKA 1ZRNA 2JAHA 4GT1A 3TQFA 4J0DA 3ZK9A 2QORA 3UUWA 2ZAMA 4NCIA 4HJXA 3QMWA 3DPUA 3CJRA 4DMFA 4WXMA 1YQTA 2AUMA 1ZM3A 3S8YA 5I9BA 1DDGA 2AI2A 1DIHA 4FX2A 2YMQA 4EJSC 1Q44A 3N87A 3AW9A 2V5VA 3HJTA 3B3QA 1YOVB 3BIXA 5D6NA 5JAIA 4OM7A 2JBHA 3P9XA 5GV7A 5I7OA 2QN6A 1NPDA 4JUIA 3T9CA 4E2FA 1PNRA 3JQFA 4HAXA 3IPRA 3HP1A 1ARZA 4NU5A 2OUKA 2A1UA 4E32A 5D84A 5EMLA 1N5LA 1Y5MA 4QYIB 3PP8A 2OILA 1B14A 4TVKA 5FNVB 1KY4A 5JFOA 3IHTA 5FI1B 2J31A 2IBSA 3T3EA 1QG2A 2X8JB 2REQB 3ORRA 4I1RA 1IPFA 1GT6A 3OA2A 4IDCA 3S5JA 10MHA 3HDVA 5LIPA 4PPFA 1T0JB 3K09C 3CCBA 2IYLD 4XPZA 1Z0SA 3UTCA 2WILA 5A5EA 1NRWA 5KTRA 1A1SA 4CM6A 2J3LA 3CLSC 1U7XA 2DH5A 2KSQA 2PX8A 4K40A 4CCSA 3CUVA 3TDKA 4EL5A 2IS4A 2IGTA 2JFPA 2MYTA 1XZJA 2YWFA 5IT0A 3I3OA 1VQ1A 2ZZKA 1A9RA 1UM8A 1WX1A 2CLSA 2WWHA 2Y0EA 3DLTA 4UBMA 5BOVA 1XMQB 4BFWA 1IZ8A 1YSCA 4B6QA 3BFVA 5D3MB 4CMIB 2CKMA 4G2TA 3V3KA 3AL2A 4BZQA 2EEPA 4DV2B 4D9KA 1SUBA 2XA9A 3CMMA 4D96A 4JX9A 2GN6A 3D3QA 3Q5EA 4GOJA 1T4BA 1M66A 1NR5A 4PIPA 4M54A 1RXWA 4TWJA 4YJ3B 1XVUA 1H1LB 3TAXA 1J0BA 2C3MA 1IEXA 2JAXA 4DM4A 5FNVA 3AUXA 4LNHA 3RNLA 2XGOA 1LNZA 2DHRA 3K31A 5BSTA 3TPFA 2X8JA 4TRNA 2V54A 3Q1LA 1SD1A 2FGKA 2XUHA 4R8MA 4EUHA 5BNZA 4A1OA 3A4IA 4N01A 3H1FA 2VYQA 3D8TA 5ALKA 2EATA 3CVOA 3VPCA 3ANSA 4US1R 2IWHA 4MI9A 4AC9A 2BGJA 1N3IA 2CLDX 3WGIA 4DCJA 1N0IA 1R18A 1SM4A 1YUNA 1P0IA 2OCKA 1XDSA 2Q62A 2Q6VA 4GNKA 4QUHA 5KVQA 3VYUB 2D1FA 2H29A 3KKPA 3MUEA 4EFLA 5DEOA 2HRRA 5FAXA 3CRRA 2ISCA 4QODA 4XQ9A 4LYGA 5H9WA 4CMIA 4KRGA 4WUVA 3U3DA 3TAHA 2H85A 2VJMA 5D7BA 5JFTA 5H83A 3EGWA 1C8LA 1I9GA 2H7XA 2GAAA 4XX0B 1NQXA 1THZA 5EXTA 2GK7A 2GQ0A 3PD7A 4K9KA 4A1FA 5K09A 3KOMA 2JLXA 1H1LA 2ZYIA 4M0LA 2JLVA 2C8KA 2UU9B 2MSEB 3KZNA 1XN1A 3AKZA 3C8DA 5BXYA 3BXFA 4OP1A 3GUZA 4ENVA 3U3KA 3J7TA 2CF6A 5IK2D 1BHO1 1V5FA 3RUHA 1J7JA 1U3FA 5GM1A 1GNVA 3IQZA 3QUBA 1M6VA 4I46A 1YULA 1Q7RA 3W9BA 1J24A 4PZUA 3ON5A 2QUIA 3ZJYA 1XAGA 4MCHA 1OH7A 2Q1UA 5JD5A 2CLMB 3I45A 5FBWB 4G4SO 2Q6IA 4BQQA 1WHSA 2X58A 3DDOA 1ADYA 1BDMA 3QTTA 4FHEA 4OJQA 2Q6LA 2ZEJA 1SHKA 1IZ7A 3D4IA 4ZO7A 4S05A 1XZLA 3LKVA 4UKDA 4ENPA 5AWFC 2RG1A 1N4AA 3FX2A 4OP3A 4QRDA 2CLIB 4IINA 1SVUA 4IICA 1XFAA 2VJDA 4F9TA 4XVCA 3FNRA 3Q0IA 1TRHA 2F9LA 4A2QA 1GLNA 2YV4A 1ULHA 1CXZA 1AKUA 2Y9PB 3ZHQA 4XX0A 1XMJA 4UASA 1U2PA 4NKRA 4EY3A 5BSWA 3ONVA 4HLUC 3CCFA 4MYHA 1MZPA 1KYQA 4R3NA 1RZRA 2NAPA 2BN4A 1KRWA 4R2WA 3B9RA 3K9BA 3JQQA 5FL7D 5CFMA 4R2JA 4UCQA 2QXTA 2V7BA 1QHYA 4UHEA 1AB6A 1EK5A 3P9RA 2VJBA 1ODLA 4M1EA 5A0VA 3LDUA 3U62A 4YVFA 4K9QA 3KT8A 1ZN7A 2I7DA 5TPWB 2ZKIA 1NZJA 5AVXA 2JVIA 2EOAA 4ENQA 1X1SA 2HFJA 2X0EA 3LX4A 5B36A 1RMYA 3EXHB 4LA4A 5K8VA 5HW0A 1LFDB 3F5QA 3EMKA 4HHEA 3LDFA 4HDNA 3SYRA 1OXVA 2O0JA 2GZMA 2EZUA 2PGLA 3BRWA 3JSAA 1VCMA 4IH4A 3S2IA 2EF0A 2AIRA 3LQQA 3OCWA 2AHOA 1OREA 3HU5A 4QUAA 4PFQA 1SBTA 5DTEA 3MMSA 3UKOA 2PMFA 4KAXA 1M0TA 4F9GA 1GTG1 2XRMA 1L7BA 4C4PA 1DBSA 1DX6A 2VHWA 3LW7A 3U0VA 1XCJA 3LCCA 1K5HA 2QQ5A 1IE3A 4IFTA 1VKJA 1T8RA 3O1JC 3BKXA 4NDAA 1CJUC 4P33A 5T4HA 3IODA 2H4JA 1N5IA 1E7SA 3EW7A 1B42A 3BGSA 4TQUS 1VG0B 4Y1GA 4LISA 4YJGA 5FJJA 4URWR 5CIQA 1JA9A 1EMDA 1XOIA 2E37A 3UUEA 1PG5A 2PT6A 4QDOA 3RS2A 5LQJA 3ESQA 1HWYA 3Q88A 3VYSB 2XNDA 5H80A 1NZDA 1XK7A 4NU8X 4X1OA 1HNWB 1CRPA 1B16A 1BD4A 1G5FA 5TPWA 2HPHA 1A1VA 2OG2A 3AQ4A 4OFWA 1YZQA 4UM8B 3EXHA 2QTFA 3AY0A 1C1XB 3RBAA 1KI1A 2GZRA 5M3BA 3K3PA 4DLVA 5BO5A 3UC9A 7YASA 3R3WA 1KSHA 2LCFA 3ZDQA 1E1LA 2OECA 1NLUA 3NXSA 3IQWA 3L9XA 2GEFA 4P4TA 1N8TA 2OCAA 4RA9B 4AT1A 4ZT4A 3AUFA 3BS4A 3VU0A 3R7SA 3D8NA 2QLNA 2QMUA 2XCUA 4ZAFA 1ND6A 1Z29A 5BUSA 5ABPA 3VJRA 4QT0A 1JZSA 3OIUA 4R2HA 3RTAA 1OLSB 2DR0A 3KKOA 2AQ8A 1ESMA 1Z16A 2AFVA 2MSKA 3DQPA 1VKHA 2HF9A 3KV1A 3L79A 3TR0A 1EVZA 1XVIA 3RYHB 3VHRA 4RDXA 2P27A 5ANRB 2GAIA 3OC6A 4KZPA 1IXSB 4BC1A 4QLBA 4FFRA 5HM6A 1U8AA 4CM4A 5SY9A 3Q7RA 4MYDA 3MWLA 2MR5A 1G9TA 4IRMA 4N3GA 4B9EA 1RU3A 3MJTA 2QY9A 1F20A 2H2WA 2XQVA 2ZIFA 4WKBA 1C1XA 1OBHA 3K5IA 2VT6A 3CH7A 2ONJA 4WACA 3TXXA 5JPCA 2ZS8A 3FIJA 4GBMA 4HVTA 2OPBA 3AP3A 4U2CA 2XB8A 2R68A 1QU2A 3IDZA 2VF5X 4AK9A 2JCXA 2NT3A 1ZP6A 4BFCA 1BKSB 2LKDA 1UP7A 2YICA 4DDHA 4MW6A 1GQSA 4DG9A 2GI4A 5KNCA 1OXMA 1TQ2A 1F1BA 1XZBA 3DDZX 3NHWA 4LMBA 4N47A 3CR7A 3AK4A 4IV5A 5K4HA 3B5IA 3K9QO 3DG9A 3H86A 3GBPA 3MTDA 3EUFA 3AM5A 3HQ4O 3REOA 3RYHA 3SBXA 2JFFA 5A4IS 3EPPA 4MUHA 1AH2A 1KJNA 1OGIA 1N9ZA 2RAFA 4GU5A 2PS9A 2L42A 1TF5A 1J2UA 2AUTA 2D06A 3GJZA 4LJ4A 1CS0B 4RQBA 3SZLA 1STOA 1TLTA 2XY4A 3X2SA 1TLLA 3L8CA 5DBHX 1SY7A 4ZOLF 2VAVA 4AP9A 1USIA 1NTRA 5KQGA 4E5MA 3VI3B 4DEXA 3A1NA 3MERA 3K94A 4KGZA 2JANA 3IV7A 3CH6A 2QJFA 2XCRB 3GJQA 5ECGC 2Z3ZA 2DCUA 3UM9A 3VYRB 4G07A 4BMYA 1XF1A 3ICVA 1R4MA 3ZIAA 1SMKA 1YR7A 5A3VA 2QLBA 4QGBA 1MGOA 1W87A 2ZS9A 3I9MA 2EBHX 1GITA 2M6LA 1CQZA 1VL2A 1JAIA 3UMCA 1XTJA 2FFAA 3DO5A 3LKDA 4IUYA 5FUBA 5FAKA 1YMQA 5E6SA 3WHIA 1V9LA 1GGFA 1TCCA 5GAJA 4OIMA 1X9IA 2FPUA 2XD4A 4I1PA 5LD2B 2NXWA 2OESA 1MN6A 1WQ3A 2W8ZA 4EQZA 2RI1A 2DC1A 2ASEA 5D3ZA 1BWRA 2B1GA 1VRVA 2HA6A 1KVTA 2AXNA 3ITNA 5KWJA 5F9FA 5BRAA 2IL1A 1IK4A 3N2NA 4MW0A 2OKCA 4A5OA 2BBSA 3O1HB 3HSYA 1LBIA 3EJWA 2A0KA 3H9GA 2D1RA 3HC7A 4E7OA 4N76A 1BQEA 1FUIA 4G4SP 3B60A 2X8BA 4IHJB 1T3SA 1Y3CE 4C4OA 3U09A 1HL3A 1PR1A 2ZB4A 3HG7A 4K2AA 4DQLA 3KOOA 4LZZA 1NNLA 4OXYA 3DXXA 3WRXC 3OZGA 3FHTA 1JQKA 1ZMRA 4L1KA 4WXEA 4Q4CA 3QU5A 2Y67A 4HFRA 2VPWA 5CX1A 1MB3A 4L8GA 3V2HA 3KD2A 2EAUA 2B92A 3Q11A 5B3LA 2KM1A 1UBJS 2FR0A 1NBME 1J0DA 4EW2A 5I3CA 1PIWA 3U7JA 1SUDA 1RZRD 4Q21A 3LPLA 1N25A 3OLYA 4W8HA 4Z4GA 1V6CA 3HM9A 4WCFC 4TLMB 4AS1A 4ARBA 2J0EA 1YIDA 2GK6A 2YWRA 2QRKA 4ZCLA 3BHIA 3FNGA 4NLLA 4Y2TA 4B4VA 2BMVA 4Y8VA 5CFNA 1CUCA 3KCNA 1E7QA 2UUPA 2VVTA 1VCHA 2OBFA 3DMRA 2V03A 1N2ZA 3KC2A 2P9TA 3OZAA 4FE4A 4G0ZA 4IHQA 3O91A 1W5FA 3L4BC 4LEIA 2J1LA 4BLPA 4YV7A 1EK6A 1Y3DE 4OH1A 3QJYA 3PGVA 1SC9A 3WQSB 3E5RA 2HIAA 1ORRA 3IV6A 4IHJA 2GJSA 2I3AA 5BSRA 3ANNA 3I76A 1IJKA 1U2SA 1QVVA 1VG9B 4C78A 2HNBA 4OUDB 5L7TA 2XI4A 3O7WA 3L6OO 5B37A 2BGIA 3RTBA 5A03A 5EHNA 4L9SA 1FYFA 5MN5A 4TXMA 3CKYA 2GXQA 2CNWA 3AI3A 2QLLA 4M1OA 4D8YA 5AUPB 3CVXA 5BVHB 1QGUB 4S1OA 5COAA 1WAMA 1ITZA 2WHRA 3EVDA 3RSHA 4KC0A 1GYQA 3WNVA 1JVSA 3ZGYA 4BLRA 2PJDA 4P2BA 1ZU5A 2FR8A 2EFHB 2AOTB 1HFEL 2FZKA 1NASA 2PL3A 1L5WA 3F1KA 1XKQA 3P45A 4IS2A 1UJ4A 3NAGA 4O2RA 3G13A 2J87A 4BGIA 5JHGB 4OX9B 4IZ6A 3U39A 2X7HA 3DD1A 1SBZA 3EGXA 4ERXA 2Q3MA 1RE1A 4FGLA 2J5RA 2V4ZA 1FP7A 3BIJA 3HKBB 2WB2A 4YCJA 3Q3EA 4C05A 1JFVA 9MHTA 3HN2A 3NOOA 1GL7A 2EBUA 5CT6A 3U2QA 3D2CA 4ZYVA 3OMWA 5EAIA 1E18A 1KYVA 2FMIA 4P34A 4E51A 4OVKA 3UGQA 3DZKA 4WTOA 4NBTA 2BKAA 4XQEA 5ALVA 4JQCA 5DCUA 5I7HA 3MPUA 4QAQA 3CVYA 2JIQA 1QGUA 1XZKA 1CV2A 5EE1A 3F9CA 1A27A 4LV5B 2XOXA 4BP9A 1ATIA 1Z25A 4BV9A 2C29D 1SQ6A 2ECFA 2GN2A 3H5LA 4MHOA 3RFCA 1XFDA 1KH3A 3U60B 5I4KA 1EK2A 4ZOEA 4UEQA 4WOKA 3MCUA 1JECA 2A58A 2GDZA 2R6JA 4PLVA 2HMVA 3WYDA 1P8JA 2YJ5A 4R7TA 3LTEA 4KUGA 3DQQA 4LTMA 1E2GA 4QD3A 1RYFA 4PQRA 2MWMA 1N2OA 1DS6A 2GPNA 5F3DA 1GGJA 2ZI4A 1S5PA 3ITEA 1CQWA 3QSYA 3HKBA 4QARA 2B0CA 2HZBA 1B76A 2CL7X 4QYMA 4F21A 1QUEA 3W6OA 2CVQA 3P26A 4QYTA 2W70A 1EI9A 2BCJQ 2WHXA 3E3NA 4LCBA 5FPYA 4B48A 5AYVA 4DBVO 1CZKA 3V9AA 1S4QA 5HQTA 1M76A 3KJHA 4ML3A 4OSPA 3KQQA 1IB0A 4CODB 2QD3A 3FNFA 4HRAA 2EBFX 4EUKA 5ARCA 3CF4A 2R00C 3F4LA 1ML3A 3FCCA 2AG0A 2VTEA 3F90A 1CKEA 4MUNA 4JJ6A 2NYVA 1O97C 4R98A 5ENVA 5KAPA 5TT0A 1RLIA 1GZ5A 3UWKA 1KQGA 3ZJVA 3HEAA 3KEMA 1KYWA 3HHEA 1E3QA 2JFGA 3JD1A 4M0MA 4N12A 3I32A 5T6MA 1MHPA 2WAMA 5DRYA 3HADA 2ZTHA 2ZSJA 2HWWA 1JYFA 4F96A 2I9KA 2LUOA 2RHLA 3RJ5A 3EC2A 2I3BA 2WMNB 5FULA 2G7MC 2O1WA 4RTMA 3UBMA 5I3ZA 1GJRA 3AIOA 4IX9A 4AMZA 3GJXC 3U4AA 3OJ0A 2WWFA 3D1LA 3PUZA 3VC7A 1ZM7A 5KVAA 3L0PA 3OAAA 3R5XA 3PD1A 3EGEA 1M2FA 1Y0BA 2CCGA 3HFRA 2YW9A 3DTVA 3I4FA 4JWKA 5JS7A 1S89A 5DISB 2TMYA 4C0SA 1PNTA 4ERNA 1U3DA 2G67A 2VHCA 4IDOA 3KSAC 4QGHA 5J40A 2ZVJA 3OIDA 3WADA 4F5ZA 4UVHA 4QA9A 2YHBA 3C98A 3IT2A 5ERYA 1M2GA 1VBNA 1M2WA 1IAVA 2I5PO 2J45A 1RFLA 5EZ5A 3L7OA 5AVKA 5ENZA 4P3PA 3UV7A 5BQ3A 2XIJA 2HO5A 2REXB 1INLA 4KSBA 4X71A 4MUYA 4NYJQ 3DM5A 3I0NA 4QBHA 3EBPA 3W6UA 1CRLA 1Y6FA 3DLIA 2IYFA 3RNOA 3LIIA 4WT7A 2HBYA 4DLBA 4ZARA 4EITA 4G0WA 2LXNA 3AF3A 1FVOA 2HIMA 2OCDA 2W42A 2YXPX 1CUSA 4FILA 2WG2A 3ZU4A 3I12A 3GV0A 3EVNA 1Q0RA 3EWNA 4R81A 5EZYF 4MVJF 5DTMA 3FDIA 1ZMBA 3VPFA 5C80A 4U7WA 5JUWA 2WFMA 1TQ8A 3IUPA 1N2CB 1RYHA 1F48A 4XPIB 3TOCA 1JG6A 1E3SA 1OWNA 1ZESA 3NM4A 2EDAA 3DHWC 3ZBTA 4B3HA 3D7RA 4JEIA 5KYWA 2AN9A 1VI2A 3ETNA 2HBZA 3VHQA 4CV0A 3QXHA 1U0JA 1HO3A 4HWRA 3G1TA 3KWJA 5BNIA 3LW8A 1QXSA 3PG5A 5A7GA 4C6HA 2I6SA 1JIJA 2PT9A 4FCVA 5FEMA 4O2BB 1CCWA 1G55A 4R9NA 1HDZA 2C4HA 4UVEA 2BV3A 2WIKA 3CLSD 3H8VA 3MTGA 3P9SA 4MR8B 3ZHCA 4DMHA 7MDHA 4QKQA 4FFMA 4DA6A 3SY8A 5FADA 3HBLA 1IJEA 4GXRA 2C61A 1HV8A 4HBGA 4XGIA 4BQIA 1N33B 4J0EA 2Z6VA 2N1BA 1X80B 2JK1A 3EF3A 1N2JA 3UT0A 2MIIA 5KTSA 1OR8A 5HOEA 3CNOA 4GBGA 4LXGA 1IZ9A 4OA8A 2VPQA 1W0KA 1TUGA 1MEOA 3X2EA 1XO1A 1DKLA 2HYDA 4D80A 4ZMRA 1QTQA 1PJTA 3D4BA 3LCRA 4R2MA 3U4CA 4RTKA 4AJKA 1N2CA 1M6YA 3PHLA 4RF2A 3ZCVA 4XIJA 3EAGA 4OKIA 4KBYA 3GP5A 3N0TA 4DJDC 1Z5GA 3DZHA 3EHEA 4B6JA 2YWEA 2G4CA 2YJTD 1RI5A 4DC0A 1Y5RA 1PRYA 1AN9A 3VPAA 2Y8EA 3ZIUA 4C1BA 3TRFA 2HK9A 3DAPA 4KODA 2C9BA 3QTLA 5CMLA 4PAOA 1RTKA 2H2GA 2BDUA 4YAGA 4OCZA 2MT9A 1QLJA 2YJNA 4O2BA 5TQVA 1AE1A 4AUMA 1C0PA 3AWDA 1Z4KA 4MV5A 4PTYA 4Y6LA 1HXHA 3TN7A 1E0JA 5DBIA 5A5FA 5HSGA 5EYPB 2QMZA 2V65A 5AUOB 3A58B 3UMFA 4PO3X 2MSNA 3B51X 3PQ5A 2FZ4A 3OQPA 4HWTA 4J49A 1E7RA 1Z5WA 3CX8A 1EXVA 5CVVA 2QS9A 1L7XA 3TTXA 4GSYA 4JA0A 1GR1A 4YT4A 1TTQB 2Q28A 4OQEA 3IT0A 5AD1A 2HNAA 1X38A 2KMLA 2OV1A 4R3WA 4TYWA 5BWCA 2DRIA 2SNIE 1RI1A 2J0UA 2JGEA 1UBNA 4LX0A 3FFAA 4G1MB 3BWYA 3CHYA 2C42A 3IP1A 5JD4A 2Z1DA 3IB3A 5WRFA 5CT9A 5SV2A 4B6EA 5T8KA 3RABA 4KVFA 1GRCA 2H0RA 5J2TB 3L46A 1OYVA 2IUFA 4HGYA 3TTUA 3EVCA 1QE0A 4R3UC 5KTTA 1TK2A 4GG1A 2G9NA 4FP9A 1E6MA 2QX4A 4D0SA 2YXEA 4ASUA 3OFKA 3IPCA 5EYPA 4J2HA 4DC1A 1AF4A 2R8ZA 1I2ZA 3OCZA 4QHTA 3DMHA 5CXSA 5TY0A 2OXIA 3TR5A 4K05A 1VJRA 3TX2A 4V0ME 5K8JB 3BHMA 3MJFA 3D0OA 4D0NA 1P2UA 2O1SA 3VR6D 3VTFA 1N78A 1GVHA 3JQ7A 4G9BA 1DADA 4YRKA 2DU8A 3DNMA 4C87A 1W75A 3NEJA 1HE8B 2DWCA 3OEHD 2VTVA 2YASA 2YYZA 5I47A 3CYFA 5CPBA 2N46A 3TSOA 3RC7A 2BJVA 3PWSA 3DS8A 3LM8A 1X2EA 3JWIA 1JHOA 1R5BA 5JH7B 3AM3A 1SQSA 3MQ2A 1UL1X 4U39A 2E82A 4X6LA 3CRW1 4QUEA 3FAZA 1LX6A 5BYKA 1QFSA 1PN3A 1R4NB 1Y4ZA 3BHNA 5J2TA 4JY7A 2C59A 2RGWA 4CCAA 5JBIA 3D0QA 3GEPA 1P6XA 3IEIA 3R20A 3ASZA 4P7JA 1BEUB 1LPMA 4JR1A 3WV5A 3AETA 1OT5A 4ZVMA 2FW8A 4Z0NA 1JHDA 2GZAA 3X0DA 4NE9A 5ITZB 1CBUA 2FUG1 1YS6A 4IDAA 4BLSA 1R0LA 3IQFA 4NYIQ 3ADKA 1RXEA 4JGGA 5KYKA 3HN7A 3SHQA 1B6TA 2H8GA 5CM8B 4I6GA 4B71A 4CQMB 1TZJA 4FQ8A 4ZODA 1F06A 1N7IA 2OAQ1 3OEED 4M9ZA 2JKVA 4PCVA 3KE8A 4C7OB 2FB9A 2AGVA 2PMKA 1TQ6A 1J1UA 2C78A 3K9NA 5H02A 3AVTA 3DE3X 1LPAB 1NYQA 2ZM5A 4ZRMA 1I3MA 2JASA 4DFDA 3K1JA 3H18A 1ZUWA 1XNGA 3IJ5A 1FXWA 1ZJZA 3STUA 3WHLA 1N92A 1BFUA 1E8MA 1N6RA 3HA2A 4L85A 5CNKA 5JH7A 1MF7A 2W2KB 2WVAA 4GLFA 4FFBA 4RJLA 4XWTA 3JYHA 2ZT5A 1JRLA 4EIWA 1G291 1A4RA 3UMYA 4S1TA 4WX2B 4GMFA 4H3VA 2ZCJA 1KWGA 3VH3A 1Q1EA 1DQPA 2PZKA 3MGGA 1A8PA 3B20A 3NBYC 3PYLA 4R2KA 4DG8A 2AJ8A 5ITZA 1SUWA 4EJ0A 2H2DA 5K0CA 4F3TA 5KO2A 4IDHA 5L7YA 3ROGA 4DSNA 3NBAA 1MQSA 1ZGHA 2I99A 3D0RA 3H2JA 2GO7A 4O0LA 1NMSA 1YA6A 2PUFA 5DGCA 2FZ5A 1IN7A 1RPTA 1JWBB 2CNLA 3DMFA 2BP7A 1KP3A 1M1NB 2X5KO 2WYHA 3QI2A 4CQMA 3C7DB 3ICWA 2B4AA 1EZZA 2W2LA 3L0OA 5ELXA 3E2MA 3HCOA 5KJ1A 4Q4JB 1M0EA 3ODGA 5LLDA 3NTQA 1M3SA 3A9WA 3WB0A 4FI3C 2NTYC 3VZCA 3MB5A 4C7OA 4JFRA 1L5KA 1SWVA 1LVUA 3H4VA 3GVXA 1QK3A 3WA6A 3G2MA 2VWGA 1Z0FA 1PL6A 1UT6A 4OHRA 4NJOA 4RC9A 4LAFA 3FKJA 5ARDA 4YDQA 5K20A 2W2KA 2HCFA 4JVOA 2XTNA 3VR3D 2O05A 4Q3LA 1HLFA 1VC2A 3QFHA 2O2YA 4JZKA 3SJUA 1FJGB 2F8TA 2IYOA 3MIIA 5CT5A 2PS3A 2RH5A 2CSUA 4MB2A 4PPNA 1FP1D 2IHKA 2AOUB 2JJQA 4DB2A 1U28C 1TPYA 2WR8A 5FNVF 1G8YA 2F59A 3O8QA 1B8UA 1AHHA 3PIRA 4X1YB 1CX9B 2VUSA 1P5ZB 2I4IA 3KJFA 4WKOA 1J1ZA 2QPLA 1KI8A 5FIUA 3SPXA 3ESAA 3U13A 3E7XA 5A4MS 3KZKA 2P5SA 2NTNA 3SHOA 4OHZA 4NCNA 3OT1A 1A50B 1GSAA 4Q4JA 3AFHA 4S1VA 1J56A 2HA5A 2DSNA 2J46A 3B6KA 5DHPA 5TQ2B 4JKYA 2X86A 4HP8A 1TEVA 4YRCA 4RIHA 1QYCA 1SFRA 2AKYA 1BC5A 3DDUA 2HSJA 2VRNA 3EVGA 3PZBA 1YB5A 5AOAA 1GHTA 3EIEA 2ASVA 1H22A 3K1YA 4GRIA 3H9BA 4LXTA 2QI9C 4O5OA 1GEEA 1H0SA 4FYVA 4US0R 4ZQIA 4H08A 2HEGA 4C3OB 3JQ8B 4NMWA 3MB8A 3D4PA 5H82A 3KL4A 1DAHA 1VFPA 2GYYA 1J07A 2OCIA 3D3WB 1PT6A 4HLNA 3DV0A 4AG3A 3BWXA 4YJ3F 3S70A 5BNTA 1JSXA 2RC6A 2AOUA 4UE6A 4V39A 3K0EA 3GT0A 4WADA 5REQA 3V1UA 1ESZA 1ORDA 2D62A 2G0AA 5ENDA 3RFTA 3RUDA 3H7AA 2JAQA 3BDVA 3DC7A 1UZMA 4PW0A 4X1YA 3RPEA 5AM2A 1HOXA 3AW8A 1HC7A 3DHYA 3FSRA 4FE3A 4KFUA 1C7JA 1L7NA 4WJKB 5KPDA 3HJNA 3SZRA 2GNAA 4MV8A 2IWRA 4DJ5X 3QZUA 3BRSA 3N6XA 3WYEA 2I3GA 4F86A 2VO1A 1P2SA 4E08A 4NV3A 4F56A 1Z5ZA 4YONB 5ALSA 1E2QA 1YQ9A 4MUEA 5TQ2A 4LXQA 4U1RA 2E48A 1O6GA 4NATA 3WLOA 2R8RA 1UZNA 5D8DA 2RI0A 1RRFA 4XR4A 3AR9A 2L17A 3V1NA 3HCRA 3JASB 4MVXA 1MA3A 1KZHA 1YE5A 3OCVA 2XMSA 1F8XA 3ENNA 1CUEA 4UREA 4XOIA 1JH9A 3QM1A 3D4LA 1FNCA 2BEUB 4L3VA 4E21A 4EGFA 1XT6A 4INAA 1ZIXA 4CMEA 3Q12A 1OCEA 2BCEA 3PX3A 4LZOA 4G67A 4XLZA 5DVZA 2FVYA 1NFQA 1YL7A 2BFWA 2ZPTX 5FHQA 4IKPA 3KVVA 1ST3A 2I76A 1T8PA 1KRHA 4C6SA 3QVSA 5KTPA 2G5TA 3CPHA 1FS5A 3ILXA 4LE2A 4WECA 1AHNA 1GUDA 1RFGE 2FRVA 1XDUA 4OXNA 1K5GA 3O8DA 1ZMTA 4P7BA 2CK3A 1AB5A 4FW9A 1QJ4A 2ZCVA 4MGYR 5CLHA 5HUJA 3D6AA 1ACMA 2VBGA 4HGNA 4XDHA 4EYSA 3SD7A 3BL6A 5CB0A 4QUDA 4KSYA 4YAFA 5L51A 4A9AA 1MC5A 4F6CA 2DFTA 4G1FA 3FYDA 1PZXA 3E23A 4MVJG 4ZCTA 1K4KA 3A0RB 1VHWA 3UK7A 1HG0A 4HWOA 5IUKC 4HMPA 2WWTA 3D6FA 3VVMA 1Z6PA 1S2LA 5EWJB 1V71A 2F1JA 1RYBA 1I5RA 3LVFO 1RM3A 3OLCX 2ZSUA 5E2BA 4CT4B 3LBYA 4JP8A 1T1EA 5CJPA 3R9IA 3NC1C 1R8JA 1V16B 3EZXA 4XVRA 2I65A 4C4TA 1XB2A 4I1SA 5A04A 1FCJA 1DAKA 1P3Y1 4ZYUA 2WU3A 3CUEF 1DTEA 3IYLW 2GF9A 1BTOA 1D4OA 3OF3A 2GCPA 4HB3A 4H9GA 4MZDA 1WULS 1C4OA 3P0IA 3QFCA 4QUBA 1MB4A 1PHRA 4AY4A 2QTLA 3A7DA 5GWXA 3NGLA 1II9A 2WUDA 2HREA 4N3NA 4MR7A 5FUVA 2XV1A 1L5FA 4RMJA 3MTAA 4DDMA 4YYZA 1E2KA 1W85B 2JIZD 3K4PA 4MNTA 4M38A 1L5GB 1BJKA 2V7XA 3ZYCA 2XDQA 5JWRA 1XNRB 3K0SA 2RCYA 2RC5A 2ADFA 3SYLA 3T3IA 1KORA 3SQXA 1N2XA 1PS9A 4IJ6A 3WFIA 1YVPA 1I5EA 1OE0A 1U5BA 5THXA 4HUTA 6LDHA 1LJLA 5EWJA 3ZG6A 5FF9A 3MOIA 1AKEA 1JDZA 4H1VA 4PBRA 3WGYA 3R6GA 2XQJA 3TGLA 3WQQA 3ETJA 3PC2A 1FTWA 3I9JA 4KN5A 4P4LA 1V16A 2VRWA 2XOKD 4E12A 4FDVA 3QV2A 4RTOA 4CF3A 2BWJA 5B7GA 4WXPA 4Z3KA 4HNHA 5E6RA 3RE1A 3PL5A 3O83A 4M8NE 5DGDA 2VDVE 4EHAA 3HTXA 2P9GA 1ZDMA 4O63O 4XLTA 5GZ3A 5KYXB 4GUDA 4NL4H 5AKXA 2OO5A 4M4SA 3RK4A 3FBWA 3Q8MA 2CXUA 2IZ6A 4X3OA 2ZB8A 5CCXA 2IIQA 1BGVA 2CVPA 2FSVC 2OCYC 2ZBVA 3HY3A 3P0HA 4ZV7A 4AN1A 5AI0A 5IJ9B 2ST1A 3LVQE 2NZ2A 1VZ3A 1X2BA 3A1DA 3HWRA 5HMLA 4GBED 2VP3A 4I3GA 1HYGA 4IJKA 1KI3A 4WNCA 5U4QA 3ZXIA 5A9TA 1CTQA 2IW1A 3E0QA 4UBIA 4GQBA 4QUKA 5DM70 4D26A 4ZAGA 4P54A 4PAMA 4EF6A 3INGA 2X0IA 1XKXA 4PO8A 3GY0A 3L5KA 5DNVA 3NIDB 2DHDA 1HFKA 2KLBA 5C53B 2PRIA 1EVJA 2R60A 4LOKA 3DR3A 5DYWA 4LFAB 3U44B 2ZIUB 1XDZA 3RVMA 4EG3A 1EP3B 1VLQA 1VP3A 4GYJA 2JIMA 3O9VA 5HCUA 2FSGA 3MHTA 1J8VA 1KOGA 2QAIA 2LR0A 4FINA 3DVLA 3R5KA 5BRNA 3AVWA 1CWUA 2PBRA 1NT2A 4G1EB 2I6UA 2V9ZA 1XMVA 2FPGA 1H5QA 3FPLA 4W9RA 4OI1A 4ND6A 1D4AA 4BJHB 1V96A 3EGIA 1EZ1A 1MO4A 2Q7XA 2X0KA 5T6BA 4E5DA 5EJ4A 3LUCA 5K45A 5PNTA 5LMNB 2XGJA 1WE2A 5BSGA 5IJ9A 4OK3A 3Q9SA 5GONB 2ZITA 3IS3A 2A94A 1QYDA 1H2EA 1DUSA 1O97D 2V97A 1E63A 1IL0A 1YRQA 1TA4A 3JRXA 1LRKA 4QWWA 5H70A 5A3JA 2J5KA 1VRCA 3GJ5A 2P91A 5ICCA 1P74A 4I6JA 4A73A 1LZLA 4O4LB 2DULA 4Z7JA 4X62B 1VE1A 1KPIA 2UUCB 2Z98A 3U44A 1HQCA 4QPPA 5ALDA 4QDKA 4MWCA 1HZZC 2CJYA 2C84A 2YNMA 5BNFA 3WKAA 4FU0A 4IGEA 3HRIA 1RHJA 3M1IA 3R3ZA 3T9BA 3RIEA 4MRSA 5JRJA 1RM0A 2GN1A 2VPZA 2C1ZA 1RHMA 3I8SA 2F4NA 1QORA 4N8EA 3F46A 4EG8A 2CT8A 1CP3A 4IKOA 4R51A 4M8SA 1B23P 3CRMA 5JHHB 2W22A 2BFNA 1XALA 1ILWA 3K92A 4AURA 2GVZC 3VJLA 2JS7A 4TTTS 3KU4A 4B84A 4FBLA 1JP7A 1ZX1A 4MAFA 5GONA 3B82A 1DC4A 1WUTA 2OFFA 2VUHB 2BMWA 3E5NA 4KQ1A 1BRMA 1CEXA 4YACA 4RULA 1QKIA 3JQBA 1QVWA 3VJKA 4NPAA 2RONA 1ELOA 1SXJC 4MUAA 3LT1A 3ZI0A 4Z9AA 1WB5A 1LNSA 3B3FA 1LPNA 1M34A 2NADA 3L0IB 4O4LA 3RWOA 3ZVLA 1KXJA 2F48A 3GJTA 3LXMA 1OXKB 3UJNA 1A9XB 4F2HA 2O19A 3QKTA 5A9SB 3PQFA 1PR4A 1N6PA 1KZYC 3HCWA 2WJWA 3E84A 1FMLA 3TLYA 4MW5A 1QLWA 2XRZA 4CTNA 4OQFA 2BEVB 1PGPA 1G16A 5DKFA 3PSAA 5BR8B 3A1WA 4KW7A 2JIDA 4PC3A 1H4TA 3GFBA 4MDEA 2ID4A 4QQKA 1SCQA 3IJPA 3KSRA 4RZ3A 2A78A 5SYMA 3BKWA 2B5OA 3SS7X 3AYZB 2QX6A 4MKXA 1IVNA 1Y1LA 4C0AC 3QY0A 3LS2A 3I72A 4PXYA 3TZBA 4D1YA 1T4DA 2LE0A 3CBQA 3EA5A 1VSBA 2P9EA 4DSZA 1SO8A 4X5OA 2AV6A 2GCEA 4AY6A 1Q20A 3HRHA 3A7EA 2HU7A 1CR2A 3CIFA 3H2KA 4DR4B 2CC2A 2ZULA 1A5AB 1M8KA 3BGVA 5FD8A 3SKYA 1XAIA 1P1IA 4V2IA 2FYTA 1DKMA 4MWTA 4JI4B 1RXSA 3R8CA 3RR2A 1T2UA 1QC5B 3AY7A 1MBZA 2CLFB 1FPMA 5L3QA 4BNDB 3N3AC 4PX5A 3SAJA 3CF0A 1RYNA 1AY0A 2P8JA 3G0BA 4L15A 3V2UA 3CLTD 3C3EA 5L95A 4EHFA 4EQ6B 3R7BA 3K4QA 3TBHA 1JBKA 2PQMA 4RF4A 3PDWA 4NP6A 2BEVA 4JEMA 3AJEA 3HVUA 2UXBB 5CH5A 2BEKA 4TXJA 3CNBA 2QIPA 1CUHA 1DGQA 2FZEA 1QAMA 2QN1A 3IEPA 2WZCA 3CGWA 3P2EA 4Z9BA 5DTQA 4K0KB 1ZD1A 2MYPA 1C50A 1RWPA 2RGXA 3MLAA 4MWSA 4HG2A 4NZ9A 1BJTA 1FFEA 5AM0A 1QIGA 4DCSA 2BFFA 3TUJC 1P80A 2NVBA 1BMDA 4RO0A 4FQ5A 4NOKA 3RT1A 2Q5JA 3FDFA 2F6RA 3UH0A 4QL3A 3R76A 4YDSA 4AJNA 2VP5A 2ZYGA 4YXWD 1C4WA 3H1BA 4LOIA 4F8YA 3HEMA 2GXAA 1NBIA 5ER6A 3QKWA 1QC5A 3DFKA 4IOMA 3TEFA 2ZBEA 1HUQA 1PSDA 2ZM6B 4XE5A 2OCLA 4IOLA 1TO1E 3DMNA 4H16A 1E2LA 3SOPA 2GYWA 3WLFA 4F4IA 5FUMA 2VT7A 4PLPA 1QHHB 1DAEA 5AKZA 5TMBA 3TKYA 5BUCA 2HO4A 3AUJB 4J9VA 4EQ6A 1I7PA 3RFXA 4B6FA 3I5UA 2HMSA 3AI7A 1YKSA 3H0EA 1XEWY 4RADA 2CN1A 2GLXA 1Z3IX 3MMNA 4RSHA 3KR0A 1EIZA 2KLHA 1CULC 4MUMA 1JNXX 4Q9AA 3RO7A 1DSSG 1VPDA 4G85A 1EQ2A 1XZHA 4CN8A 5FPHA 5JCOA 1JR6A 2ECKA 4OQMA 2HW8A 1Y6RA 1YR6A 2W11A 1DV2A 2GPAA 3ZQUA 2FCRA 2J4FA 2V6GA 1G41A 4D4MA 2YMLA 1AO3A 1ZC4A 3JWJA 4IEEA 2GD2A 4C0BA 4KIUA 1QYIA 3K8QA 1DG1G 4WN3A 5JSFA 2VH5R 1FMCA 3CWQA 1W8DA 1ORTA 4KVZA 1TVCA 3NO4A 5CVCA 2ID8A 3RSQA 3PHBE 1GN9A 1GU0A 2C4UA 4BNWA 1UPXA 1NWCA 2ODNA 4FWIB 1KU6A 4GP6A 4ER5A 2XUQA 5TT1A 1GA4A 1KK0A 2C9CA 1P33A 3I9KA 1BXRB 3ODPA 3OPNA 3PTZA 4J75A 4MPPA 1L5MA 4PF1A 2CGEA 1J33A 3ZLVA 5JYCA 1QHHA 4B7UA 1PL7A 1Q3TA 1YBMA 2CFSA 2NZUG 3QEOA 4LDRA 3W4IA 2DBVO 3HL0A 1X7WB 3ENQA 2A4MA 2PGOA 2O8FB 3PC6A 4YT2A 1V3UA 3UBTA 3ELWA 1BA2A 4PC6A 1SUPA 2F3SA 2JDIA 5AVTA 5KNBH 3TIXB 5FYQA 1BMQA 4P6VF 4J4BA 1CRWG 1TF7A 2QP9X 3IUNA 1SOUA 3SLRA 3UMGA 4F2DA 3I5MA 3GUVA 4GLBA 2I33A 2WSSD 4J8PA 4YP1A 4ZP1A 3MAGA 5FI0B 2Y1KA 4WY8A 2R9VA 1E1CB 1EJ2A 2HHLA 3IDFA 4LQDA 4D0LB 1LTHR 4G3XA 3B3AA 1VB5A 3UG6A 3C41J 8GPBA 3LG2A 3PNOA 4UD6A 1V8BA 2PX0A 1X9HA 4TSRA 4P53A 3SZMA 4Y98A 3ZXSA 1AD2A 2DAPA 2XGMA 2Y1LA 1Z2NX 4B2YA 4EGQA 3Q4GA 2V4MA 2AVDA 1G4AE 5DBEX 1E9CA 1YA8A 1F12A 2P7HA 5BMVB 2V0CA 5AI9A 3QFTA 4KYIB 1ODIA 3DYBA 3R7WA 3URKA 2XUZA 1BMFD 4PLWA 2WJPA 1V8PA 2ROQA 3G2PA 2P2GA 4FT4A 1DWQA 4QXOA 2P2DA 3QQ5A 5F7JA 3IALA 1N57A 1UQTA 3BXXA 2IPLA 1BHSA 3FYHA 1XROA 5A4KA 4TLCA 3PXUA 4QU0A 1U2RA 3ZH2A 1BYUA 2OAGA 2PUWA 3O4HA 5IH3A 3ROQA 1OIXA 4F7WA 1FYVA 3QNMA 3OIGA 1E2UA 2YZ2A 1L8XA 3D1JA 4YP0A 2D7DA 4Q3EA 1C29B 1FP2A 1ZHHA 3I28A 4FZRA 3BCSA 3IILA 3RREA 1ZI6A 1Y5LA 2YOFA 3VU9B 1E59A 4BLOA 5G40A 1QB8A 3K9HA 3NIFB 3R8FA 2ZETA 4YMIA 3BAFA 3A4YA 1USVA 1DKPA 2X0JA 3QVKA 3Q72A 4JP5A 4M9QA 4QUIA 3R9KA 1L3CA 1SKYB 4XWWA 5DSXA 5IKXA 4NYMR 3KAQA 1UWVA 4IBOA 5BMVA 4Z4EA 3E7DA 1T9AA 2XUOA 4LHZA 2ZJ1A 4JA2A 4RV5A 4DA7A 5K8LA 4I1IA 1VG1A 1UDXA 2WZQA 5ILGA 3IAM6 1JDPA 3AFGA 4C7XA 4QXAA 4DLSA 4I50B 3OF5A 1W47A 2GCGA 1HLPA 4PVCA 1GAWA 1EGVB 5GMOA 1IY9A 4DA8A 4L95C 4HDSB 2GPWA 4N6OA 2HXGA 5AH0A 5CB4B 5F9MA 3F6CA 2ORWA 5EZ6B 3C3WA 3PJFA 4KGXA 3L6UA 5TC4A 3ZS8A 4Z1MA 1E9DA 2HOQA 3N0RA 4N40A 3WDSA 3ESZA 3LIPA 1OASA 4Q7JB 5TNXA 1OXXK 4G0VA 1SBQA 4M87A 2JHFA 5AUQA 1XPOA 3VU9A 3HJBA 5J58A 3UIEA 4ER3A 4M6WB 4C7JA 4PBSA 1ZNQO 3AKCA 5AFSA 1JU9A 3I0ZA 5E1MA 2OM6A 4FTWA 4G5GA 2V59A 1YRHA 2VPYA 1V7CA 4JYCA 3RYFA 2VEOA 2O8EA 4ZV4A 4O2BF 2CUKA 2FR1A 3DZDA 1AT1A 2DKOA 4JUBA 4OMFG 4BFZA 1MJHA 5EIAA 3KSBC 2P0EA 1HQDA 2PYIA 1MIHA 1NJGA 1JKFA 3FZNA 4QOEA 2VRCD 4IMIB 5HP4A 3GP8A 2AEEA 1TO6A 5EKTA 3G7UA 2UXDB 1H2FA 2CWWA 4X1KA 2APJA 2AS0A 3LKZA 1RYZA 4ZTBA 5THKA 1QCZA 1NXXA 3F8SA 1T3TA 2VPPA 1I4DD 2XTZA 1OYWA 4ZC8A 2IIBA 3PQEA 5IJAA 5CB4A 2P11A 2HJ9A 4RDIA 5AM3A 2DUWA 2X1MA 4HB4A 4P35A 3I64A 1R0CA 4MP8A 2UZIR 3VYWA 3NALA 1AMNA 3K32A 3GP3A 4RVUA 3X1MA 5IN5A 4KYTA 3STYA 4CNQA 4YRAA 1A4IA 4R41A 3L02A 4C88A 1T3ZA 2YWGA 1IU9A 6CHYA 5GY7A 3DOOA 3H1EA 1CHDA 4EGSA 4DLLA 1E3DA 3DOEA 5C3UA 4EHBA 2ONZA 1CIVA 3HLYA 4ID9A 1S2GA 2CMHA 3DB1A 3GMSA 4OLHA 4YMGA 3F78A 5A5GA 1NU6A 4N9QA 4RIFA 2JD0A 2RHCA 4OHVA 3MRTA 4RIEA 4KE6A 1U0OC 2VT3A 1M10A 3NOVA 1ZLYA 3EIUA 5HKBA 1G18A 6ABPA 4Z49A 4HDRB 3U5ZB 1CVIA 2I78A 2RB5A 3DWGA 3IDQA 3KVNA 1YE8A 3LI2A 3Q7PA 3ETCA 4J0KA 4NPCA 4PYNA 4YS6A 2DVMA 2E0IA 3DT6A 1TJYA 4LVUA 4TYYA 2A8YA 3REGA 1JR3A 5LZ4A 2BBWA 4DA0A 1DT3A 2FMHA 4CKWA 1KAOA 1M2HA 3TMKA 4C7MA 1M2EA 3UJCA 4WAUA 2RGNC 1CF4A 4L0QA 5KQPA 2OFPA 3BH0A 2HJWA 4RXUA 1RADA 2G8NA 3T4XA 3URMA 3TBFA 4DLNA 2SICE 2FCAA 4F3NA 4MJ7A 4TTSA 4CV3A 1OFHA 4D0GA 2Q0XA 3CO0S 1R8XA 1J2EA 3WAJA 4IDNA 2C2ZA 5KWSA 3SS8A 5A6SB 5LQKA 2OT3B 3ZD7A 3HJUA 4UCFA 3FZGA 1TMYA 3CR8A 1BXGA 4JDPA 3DDCA 3KZCA 1EVEA 3T9DA 4TN1A 1R2QA 3CF6R 3BMOB 3RTDA 3H5WA 2FFBA 1JB1A 3EVEA 1GPDG 3KVOA 3L2OB 4H7PA 4JU9A 5J2TF 2UZ4A 1LDEA 1DX4A 1VBKA 3JVDA 2C1XA 2FEXA 3AY3A 5EIBC 1KEVA 2C54A 1NNSA 3MG9A 2K7ZA 2FX2A 2RKOA 3K0HA 5JAZA 5CCEA 1ZVKA 1PF7E 2IYAA 2Y4OA 1M7GA 1GFIA 5DW3A 2PU5A 3SR3A 3H5VA 2G1JA 2H06A 3H3JA 3IPLA 4UAUA 5DXJA 5HF8A 5EJEA 2Q2WA 1Q50A 3EVZA 4P80A 3TH5A 2D54A 2GCIA 5I7SA 5AICA 5BPFA 5EY5B 1XNJA 3KLPX 4NCJA 5JZ9A 4H0CA 3W5AA 2F1KA 3B12A 2VK1A 3UA3A 2FRDA 1KTIA 3PZRA 9ATCA 4CU5A 2E89A 4GEKA 1UBHS 3PTAA 1RHKA 1VJDA 1QOZA 3AR8A 4G4JA 3WMEA 5E4TA 4BECA 2WIBA 3K0KA 1ZNZA 4R71A 4NBNA 2D5AA 1H42A 2XZTA 1SBHA 3LRTA 1UPFA 3BMOA 4FEAA 1TGYA 4TYQA 4BNDA 3ZCXA 4E31A 3U7QB 5BV7A 4B85A 5C8YB 2CXRA 4RNDB 2CV2A 4BO4A 1DC7A 1ZD4A 2X3FA 3U1VA 4LI3X 4YJ2B 5I8WA 1Q0ZA 2XVAA 4FFOA 1JAYA 4ND4A 1P1CA 1TZ2A 2WDZA 3KCQA 4FSDA 2PMBA 1Z7BA 5EE5B 2Q5CA 3WMGA 1AS0A 3UWPA 2H16A 3QEMA 2BGRA 1RDFA 3I1IA 4NWIA 4TSKA 1ODSA 3MJDA 3L1UA 4OIFA 1ESEA 4C29A 1POWA 5EMNA 3WK4A 1SVIA 1WZUA 1WEKA 1R0XA 2BD0A 2EW1A 4JJGA 4F93B 8MHTA 3IHLA 4MCJA 4HRVA 1MJNA 4QM7A 2FSIA 4LTNA 1X1CA 4FPXA 2VJCA 1DRUA 1PZHA 4X97A 2Z9BA 5LZ9A 3BMNB 1MC1A 3EVBA 1N0WA 3KYDA 4C03A 4RLHA 2PT5A 1NRIA 3A05A 1D1PA 3H13A 4JU8A 3QMMA 4LXIA 4RABA 5FI3A 1KJYA 3ZV4A 1COWD 1WMDA 4YYEA 1M72A 2AKAB 4XLLA 3CX6A 3RSGA 3UMJA 5KX5B 1XELA 1UJBA 4NFLA 3OJCA 3UPDA 3VSBA 3OKPA 3WK6A 1L3BA 1XYGA 2ZYDA 3U7QA 3ELUA 3QVTA 3GFSA 5ECYA 3WP1B 1R27A 3LDAA 2PGXA 1A4XA 3LX8A 3PPXA 1KHHA 4MRNA 3VR1A 1A9ZA 2YFYA 4N9WA 2XQFA 4YJ2A 5L3ZA 3SE0A 4ALLA 2CMKA 5LOVF 4WPGA 3WL3A 4JSYA 4QJ4A 4U7DA 3QFSA 2LDBA 3PNVA 1ZKMA 2ISQA 2GXSA 2FMTA 2G9ZA 5DNDA 3GFTA 3VO1A 3K4HA 4UVGA 2XYVA 1N6OA 2GDJA 1QRAA 2HLDA 3DKVA 3GO4A 3IVAA 3L3BA 4QGGA 1ADBA 1P2BA 1BGWA 4YBRA 4YK7A 4ISCA 1CQJB 2QAGB 4A03A 1WBJB 3U49A 4UU8A 1P2DA 1L4KA 3NH9A 2Y2UA 4A82A 4GZ6A 1NXSA 1O94D 3BMNA 4MQMA 4RGBA 2EJTA 3ABQB 1MQ8B 1QDEA 3LL4A 1FRFS 1EX6A 3OC0A 4B5LA 4JLVA 1FMFA 3EXIB 4DAOA 2XNHA 2FP3A 3GWZA 1AZWA 1Q0LA 1QIDA 2J3KA 2PK3A 3MLBA 3Q2OA 5CLQA 5JZOA 5F4ZA 5KX5A 3TL2A 2F3RA 2J3EA 1QYRA 4QPJC 1KHTA 1KMMA 4EHIA 1UC4B 2HJRA 3V4SA 3RS8A 2BW0A 3EVTA 3UHJA 1GZ3A 2SCUA 2VDUE 4MVJH 5CFRA 2IXFA 1N9GB 1GGMA 2CMGA 3KK0A 2ZPAA 4RY8A 1DMRA 1OJ7A 1N7GA 5T41A 4MRPA 3WWOA 2QAJA 3KKMA 3B1XA 1MIOA 4KQHA 1V8ZA 2RHMA 1WXHA 4B8YA 2YVQA 4XM0A 2VEDA 4PANA 1DO8A 3O8OA 3BD6A 2YS6A 3EXAA 3HVKA 2JLZA 3CC8A 2QE7A 1CQJA 1DKUA 3G1WA 2O2DA 1FLVA 1MPXA 4ND8B 1KZ6A 4Z0HO 4C4RA 4U7GA 2HHJA 2OKGA 1IYZA 2P2NA 4IFIA 4TMFA 1TM3E 1N1EA 4M21A 4NEHB 3FHLA 1WUJS 2PU7A 2QZ4A 2MMGA 3EXIA 2GETA 4XRRA 4BB5A 3I61A 3ZV6A 2OZLA 4X41A 4Q19A 1T0PA 1HE5A 2VF4X 4IDBA 1JJVA 4FJ0A 4NHOA 5IBQA 1G6KA 4BL5A 1PT7A 3L7JA 3NFYA 4U7JA 3EQZA 1KL7A 2R25B 1VIVA 1IDOA 4FQ7A 4XYGA 1XXHB 5AI6A 2BUAA 5FP0A 3W8RA 3HCAA 2BGGA 1UAAA 1ZD3A 2C5HA 3NP9A 4L74A 1E2BA 1NUUA 4FFLA 1BHJA 3B9PA 1U02A 2XVYA 1SXJD 3OJWA 3IVXA 3KJGA 2I3DA 3MTJA 4HKTA 2XD9A 4IX1A 3QUAA 4XFDA 2HUPA 5KAMA 4DOMA 1W94A 4B3BA 2PUCA 2EVWX 2QK4A 2OAP1 2XAAA 3JYQA 3LHKA 4R31A 3NKFA 3LX6A 1L1RA 4YRTA 2C5GA 1EA5A 3AG6A 1C0IA 2X15A 4JHLA 4EVSA 2HH9A 3SJZA 5L8VA 4TL7A 2PKCA 3HKDA 1BE8A 1E7YA 1XE3A 1NWHA 3WA7A 1CRQA 4E5PA 2ZR7A 4BVKA 4BX0A 2IYSA 3TINA 2P3SA 3ULKA 4JV5B 2O6LA 2VBCA 1O6ZA 1XQ9A 2F43B 2VKQA 4JDUA 4N7RA 3TR6A 3EGDB 3V48A 1G38A 1YZGA 4DNXA 3LVRE 2IK8A 5GJBA 4ZVVA 3T0FA 2Y2VA 1V6SA 3LY8A 4AX8A 2RH9B 5AK3A 3UCXA 2EJBA 2C3OA 2YY5A 1UOQA 4TT3D 2WAAA 2PSJA 3I2FA 1XXHA 4BS9A 3TLAA 1U31A 4JSRA 3I9FA 3HXTA 4CQJA 4DVJA 1U6JA 4IF6A 4QG3A 2YIMA 3UAZA 3VMFA 4GM0A 1DG9A 3AUSA 4GZLA 2JGFA 5ALRA 1V8DA 3ENVA 3RUFA 1L1QA 1Y8AA 1CJBA 4NQZA 4BVJA 1OJLA 1H23A 4FZ3A 1R4AA 3SEQA 2PXXA 3I4CA 2NVUB 1XP8A 2J07A 3GEDA 1I4OA 4FGSA 2GN4A 5HGXA 2V7QA 5KI6A 1NYTA 1JR4A 3U4GA 4EKYA 2F4VB 3PKZA 4V0RA 3X1JA 2A14A 3ZOZA 5TR9A 1JTFA 1R8YA 2EWMA 3SIRA 1D2GA 1IHPA 3CLHA 1VE5A 2ZSKA 3R74A 3WQHA 4JIGA 2JF0A 1KVSA 3L1HA 5ESXA 2WOJA 4X65B 5FWNA 2J0QA 2HQ1A 3BQ9A 1UAYA 4RZHA 1HF3A 3AF6A 1DBRA 2ZJ6A 1VDZA 1XRNA 2F43A 3DMTC 5IM4A 3EGDA 1YRAA 1VPVA 3ST7A 3NHSA 1U1IA 4P5EA 4K88A 3QW2A 3D2LA 2QROA 4YROA 4DADA 2FP4A 3VOTA 3DFFA 5JSQA 1M8FA 5TDHA 4IG4A 5ED4A 2ENWA 1D2AA 3M49A 2C98A 5DLEA 3CRZA 5TF0A 4C5BA 5BWOA 5IVPA 2B3DA 5HGJA 2XUKA 1BWQA 1UMKA 2C9YA 1PS8A 3KTAB 2AW5A 4ALMA 1T4GA 3QF7A 1L8OA 1SC3A 4HUQB 1GXSB 2PHZA 3AIMA 2JBWA 2CDAA 2NVUA 1NXTA 4UMVA 4HDOB 5IS2A 4J3JA 2H4ZA 1KERA 5KNDD 3DW1X 5D85A 3P2YA 4MICA 2LBPA 3E9DA 4YCBA 4DLZA 4MO9A 1ODTC 1E92A 3UATA 3GH1A 2I62A 2R7MA 3FHOA 1JHVA 3FNIA 1TYZA 1PFUA 2FSFA 2P40A 3F8WA 4HAOA 5K8UA 2Q9CA 3IP5A 2FUEA 3A4VA 4P8RA 5J5AA 5IKMA 1YRBA 3A1EA 4GPIB 4RA6A 5DHUA 5JDIC 1ZSYA 4RESA 4AP5A 1KIFA 5C8XA 3MCAA 3TSZA 2OUIA 4QEKA 1JZQA 1O6FA 5KJCA 2FEMA 1UEJA 5GIOE 1IUPA 1Y42X 1WU8A 5FOWA 3AFNA 2A5LA 4L9WA 2C5EA 5A0TA 2O14A 1V41E 4LJ5A 4Z4FA 4KACA 1EHIA 1YH3A 1H8HA 2VDMB 1AKTA 3KTAA 4HXGA 4N03A 4Q1BA 4ECAA 4KNWA 2WJJA 2P9YA 1VL5A 2G40A 3RC8A 4BQPA 4M88A 4C1NA 1Z37A 1FNNA 2ONYA 5NULA 3RF6A 3OUZA 1XA4A 3TL3A 4B3SB 1VJ5A 3L8EA 4KXNA 5CEFA 2XMBA 3EFOB 1PTJC 3Q0TA 2AF3C 1RWVA 1XZNA 2FWPA 2PSEA 3O0TA 3PFGA 4KQXA 3STWA 2V6FA 5JCJA 4JUDX 3FR7A 3WRYA 3TIGA 1IN4A 1P81A 1T9ZA 1JA0A 1Z4OA 3ORSA 4MIOA 5JLAA 3RI3A 4V0OA 3SMQA 8ABPA 1U7WA 2I67A 2FEPA 4GWKA 4YP9A 1OZ0A 3CEHA 4KXLA 4MQFB 5A3QA 3J81k 2X9VA 4WLNA 4DT1B 2YVAA 3CT6A 1SQ5A 3B7GA 2QRUA 3C3XA 1TYDE 1DLIA 2IE0A 5C0OE 4F4DA 1I3OA 4Q1DA 4P7GA 4TTAA 1NVEA 2JD1A 3GJ8A 3HDYA 4KDCA 5JD3A 5K7SA 5KYTA 5LUAA