3EFEA

The crystal structure of the thij/pfpi family protein from bacillus anthracis
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
208
structure length
208
Chain Sequence
TKKAFLYVFNTMSDWEYGYLIAELNSGRYFKKDLAPLKVITVGANKEMITTMGGLRIKPDISLDECTLESKDLLILPGGTTWSEEIHQPILERIGQALKIGTIVAAICGATDALANMGYLDTRKHTSNNLEYTKMVCPNYKGEKFYELGPAVSDANLVTASGIAPLEFAMEVLKKIDVFTLDALHSWYNLNKTHKPEYFFQLMNSINK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords ThiJ/pfpI family protein
publication title The crystal structure of the thiJ/pfpI family protein from Bacillus anthracis
rcsb
source organism Bacillus anthracis
total genus 70
structure length 208
sequence length 208
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3efeA00
4BTEA 1C3OB 3MIIA 3P9RA 1OX4B 4GUDA 3NOQA 3CY6A 1GPWB 1IZZA 3ZJ5A 3CZ9A 3FSEA 3N7TA 4S0ZA 4ENWA 1OX6A 4ADSG 3TQIA 1GGKA 1P5FA 4UOQA 4N0MA 3ER6A 2VRNA 3L7NA 1KEEB 2VPIA 3EFEA 4L8WB 4AUEA 3SF8B 1P80A 2OR3A 4ENUA 3OT1A 3PQ8A 3UJNA 2GK3A 1QVZA 3UMMA 3EZGA 3NORA 4OFWA 3OT1B 3P9PA 4OIFA 4P5PA 4ENVA 1T0BA 4ZDKA 4RKYA 2D7JA 1GGFA 3CZAA 3F71A 2RK3A 2IUFA 2WJZB 1VCMA 4Y1RA 1UCFA 3PQ4A 4JQSA 3NVAA 3GRAA 4PXYA 4GE3A 4B31A 4ZDJA 3BHNA 4ENTA 1GGJA 3D54D 2AD5A 2A9VA 3R76A 2VXOA 2YWBA 3WFZA 4ENRA 1I7QB 4L8FA 1IPHA 2NV2B 2R1UA 4LRUA 1FY2A 1R9GA 4P35A 4BFLA 2H2WA 5JZOA 1FYEA 1Q2UA 5IP5A 4UOZA 3CNEA 5SYAA 4MTCA 3TTWA 2R1TA 1T3TA 4QYTA 4UZSA 4AUMA 4B2YA 1P81A 3TTYA 1VCOA 4WXYB 4ENQA 1GPMA 1GGEA 1P7ZA 1CF9A 2R1TB 2V4UA 4GE0A 4OQ4A 3R75A 1PDWA 1KWGA 3TTVA 1M6VB 3PQ5A 2ABWA 4Y1FA 1JVNA 1KWKA 3TTTA 1G2IA 3FIJA 3NONA 4I2NA 1C30B 2ZUWA 4HCJA 1N57A 2NV0A 3SOZA 1WL8A 4L78A 1SOAA 2YWJA 4L95C 5SY6A 1IZYA 1KA9H 1ONSA 1PV2A 4MNTA 4P36A 1QF7A 2YWCA 4P34A 4UCFA 4Y0NA 5SY9A 3PQ3A 1A9XB 2VKTA 4N12A 4Y1RB 3RHTA 2W7TA 1OI4A 2ISSD 1J42A 4LGYA 3L18A 1L9XA 4ENPA 3EWNA 5SY4A 1K9VF 2R1VA 2XF2A 3L4EA 5LIRA 4B7AA 1QDLB 4OGGA 2FEXA 3P9QA 2YWDA 3B36A 1I1QB 4B40A 1QWSA 2RK4A 3F5DA 3EJ6A 2ZUSA 3ZR4B 3UOWA 1PE0A 2GHRA 1BXRB 4P2GA 3TTSA 3R74A 3NOOA 1O1YA 5E9AA 4XLLA 4BIMA 1OX4A 4AJ9A 1SY7A 1KXJA 1VHQA 3M3PA 1U9CA 4RKWA 1QVWA 3CYFA 1VCNA 1GG9A 3KKLA 1CS0B 4OJYA 4ZDIA 2VDJA 3TTUA 4WINA 4R7GA 4D1YA 3UK7A 2AB0A 4L7QA 4ZGGA 1CE8B 3PQ2A 3B3AA 1OY1A 5DFAA 2ZUVA 4K2HA 3SF8A 1JDBC 4Y1EA 4ENSA 3UGJA 1P7YA 1QVVA 1Q7RA 4AULA 3PQ6A 5JZMA 4B5KA 1S1MA 1GGHA 2LXNA 3ZJ4A 4UNIA 2RK6A 2R1VB 1PDVA 3PQ7A 4OGFA 4QYXA 3B38A 3P9SA 4AUNA 2ZUUA 3L3BA 1T36B 5BV2P 4L8YA 3MGKA 4I4NA 1OX5A 5K4AA 3EN0A 3NOVA 3TTXA 2ZUTA 4E08A 4MGHA 3BWEA 1I7SB 4E5VA 4Y1GA 3VU3A 4I46A
chains in the Genus database with same CATH superfamily
3ZLJA 1EVLA 5DASA 3K32A 1UF9A 4LF9B 4LMPA 4KI7A 2EJWA 5CVJA 1JMKC 1YIAA 3N0TA 1YUBA 1FEZA 4UOQA 2B8EA 3N0RA 5IKEA 2IEBA 1MF7A 3H5IA 1VZ3A 2X7JA 4URXR 5FX2A 1UOEA 2ECKA 2PVSA 4L8WB 3B6KA 3QXCA 4EZIA 1AKVA 4C22A 1KQGA 3GJ6A 4YJ2B 3IVXA 4GMFA 4QBHA 4ZO7A 4L50A 3I04M 4PBRA 2BGKA 3OZRA 4MUIA 3VVLA 5JROA 3IEMA 2DTEA 4FJ1A 4C2AA 1KKLA 3BULA 3R41A 5CXXA 1UODA 2Q3LA 4RHXA 5D85A 1NW5A 5D3MB 2GAAA 2O3QA 5KJEA 2HPVA 2JJ1A 4O2LA 3FGOA 5LR6A 2O2YA 1BVYF 3KQVA 3P0RA 3MMZA 4AK9A 2NU9B 4XX0A 1K27A 1TU4A 1OLUA 1R8XA 1DC4A 1W35A 3RAGA 1W5FA 4MUGA 3ULKA 3MWEB 4YT5A 1IPHA 3Q98A 3TDMA 2CFOA 1D1TA 2IHTA 1RE0A 4JA0A 2HL6A 4NJEA 4ZEMA 3ROTA 3GVPA 1TF5A 3UMRA 6REQA 1J22A 3WLLA 3QUAA 1Z4IA 2ZSJA 1U28A 4DUZB 5ESWA 1D4ZA 1DKPA 2IHVA 1VJCA 4J7UA 4CKEA 5I7SA 4B74A 4D3SA 1COWD 3OP4A 1CJSA 4XWTA 5FUYA 2ZRAA 3THXB 3Q4GA 5G4LA 1SCKA 4KQFA 4EYKA 5C1OA 3NIWA 5F2OA 9LDTA 4QNRA 4RUKA 4EPYA 3AFNA 4OQNA 4Y9SA 1NW4A 2C00A 2HF9A 4Q16A 3MWKA 5CG2A 3IP8A 1XZQA 3LDUA 2C5LA 5F5XA 5KSYA 3PUIA 4ZAFA 1I8TA 2FTKE 4DF3A 5IWCA 5BWCA 1GSOA 5F73A 3UMJA 4E2FA 3M6LA 4WI1A 3NASA 3BS4A 4H9GA 3SS9X 1CNEA 3PCRB 4KGDA 2C9MA 3QNUA 1B8PA 1F60A 1YIDA 3MN1A 4GFDA 5EQDA 2VSNA 3ANMA 1E1CB 3OJEA 1SKUA 1UMCB 1ZVMA 2OZLA 3UJ9A 4BATA 5EUQB 4IILA 4TT3A 1AK9A 2I1VB 2J0QA 1HOTA 3SVTA 1G4UR 4HNSA 4JDUA 1W9HA 2FEKA 4OUDB 4QC2A 2ZPAA 4QPPA 3U40A 5CYGA 4BLOA 5TQVA 1GG5A 3JWGA 4V1CA 4LMRA 3HFSA 2D3TA 1PX2A 5DVZA 1OA1A 1CT9A 1ZM7A 2OV4A 1SR8A 5GJWC 3MLAA 4WINA 1QGYA 1WDWB 4R7GA 5BP7A 5JYDA 2IHNA 1QCCA 3PRJA 2W2KB 1DAFA 3ICQB 3E2PA 3QHPA 1J0DA 5I7HA 4R54A 1JJIA 2W4MA 4FZ3A 2BMJA 2IELA 4IDBA 5JZMA 4LF6B 1WRBA 4OQYA 3U9SA 5ENZA 4ID9A 1PFVA 2PZAA 2WVJA 3G9QA 3M7IA 3MF4A 4RQAA 3V1KA 4F2DA 1IN5A 1G17A 3CSDA 2YVUA 1YC2A 2QTLA 3IEKA 3CH4B 4L5BA 3V7FA 4NU0A 3A4VA 3GNLA 3HCBA 1BHQ1 5KDDA 2QTAA 1ZMBA 1FNCA 2YHIB 4PAQA 1CUFA 2H1RA 4XOIA 4L72A 4DNXA 3DYVA 1KP2A 4FS3A 2CUZA 1NTRA 3T3DA 1XMXA 2E4ZA 2EFEB 5E8RA 3ABIA 3ZLUA 4C0XA 3IP5A 4KTVE 1B15A 2GUGA 3I23A 4W1SA 3I0ZA 3D2LA 2PD6A 2CB0A 3W3AA 1V8ZA 1CRWG 3A37A 4GLOA 4BL5A 1BXZA 1BQ4A 1Q0HA 1SCBA 4QPNA 4G5SA 5EJ6A 4K9NA 4R6XA 2FFRA 1MQ9A 3R7BA 3O4HA 5DCUA 3TFOA 1E4OA 3FN4A 2I66A 4M22A 2X1MA 5FTNA 4F93B 1IXKA 4PZLA 3JVDA 1U81A 4ZOAA 4AICA 3PJRA 2C9OA 3RS0A 3TW0A 4B2IA 3OJOA 4JZKA 1KZ4A 2ZRDA 2WUDA 3CEHA 5KOYA 1UAYA 3DF9A 2OCYC 4FQ7A 1XYGA 4B3FX 1RKQA 1NRJB 2OLEA 3K5PA 3ADDA 3CB4A 4BVKA 5F2NA 3PUZA 4BFUA 1QKJA 3AHGA 2ZRQA 4LXYA 2VTBA 1IHUA 2BEWA 4LTNA 2X1LA 2PD4A 2XUAA 3HYRA 4MVJD 2AV6A 2HV9A 1UJBA 2VP0A 4S1OA 2YJTD 3WO0A 4ND8A 1K5DA 5L4SA 1YVDA 1RWBA 4R1QA 2AZXA 1DCKA 1PP4A 4IJVA 4RK4A 4TPKA 3JVEA 3WK8A 1CF2O 5ESDA 2JC3A 2TMYA 2XADA 2XOKD 3UAGA 4LGCA 4BO7A 2IBTA 5ARDA 1A7UA 1V8OA 4NQRA 5JQGA 5DHFA 4KWHA 2JEZA 5JE8A 5AFSA 2WQZA 4EPTA 2I3GA 3EYWA 3HGMA 3OQ1A 3MJ4A 4IDEA 3AT1A 5LOVF 2XA2A 3RTBA 3FETA 3LPLA 3NS7A 4I99A 2OO5C 1KZ9A 5SY9A 2EFCB 5IBPA 4QULA 2WZBA 1D8AA 1E7WA 4M0PA 4KV7A 1PHRA 3ROPA 3ZU3A 4ZAYA 1ZBQA 1BE1A 3P4YA 5CYPA 3T9BA 1L9XA 2FPGA 2Z6UA 5JLAA 2B8TA 2Q29A 3BB4A 4RABA 4TLEA 4G84A 4CIYA 4WLFA 4LHEA 2QT1A 4AZ3B 4GS5A 2C77A 4RU1A 3JWIA 1CRQA 4DDWA 1VRCA 5IJZA 2BJWA 2WM3A 2XVZA 3ICPA 3KKNA 3PD7A 3RPEA 2FWIA 3A1TA 1TOAA 1T0JB 4JUFA 4JDPA 1Z45A 1VCNA 1PTJA 4DBVO 2RBGA 2D1TA 2A7XA 1E7MA 1QGUA 1Z0DA 3CLRC 5H0IA 3DFKA 1PLKA 3WWOA 1R4MA 4B4OA 2WU0A 4Q34A 2W2PA 5DHSA 2JS7A 3LUFA 1J2JA 1T3GA 4RJJA 3QRWA 3K73O 2PRZA 2QI9C 1TFRA 2VF4X 4ZARA 1X19A 3R77A 4R69A 3DLIA 3KV3O 3B9PA 4I9GA 1E63A 1ORRA 1RT9A 4F9FA 5B55A 3G23A 3KE8A 3PNBA 4WY2A 1K86A 5J63A 1HZZC 4CWAA 1YD7A 3IPCA 2CEAA 2HUPA 3GX1A 4OK5A 1FU8A 3DZJA 5AJUA 5HA5A 4D4HA 1QHGA 3BCHA 4RPGA 3T9EA 3TFWA 1Z08A 1MAVA 1UDXA 5AW1A 3IL2A 2V3WA 1Z2DA 1M2VA 4IOKA 5FYQA 2QVYX 3QVXA 2X1HA 4LFBB 1PJQA 3ZGXA 4KFCA 2UYOA 1BNCA 4K9RA 2FKAA 3EPPA 3EFEA 4RQBA 1DU4A 4IQFA 4C78A 2PTHA 1H2EA 4AKHA 4GKBA 1GNQA 1E9SA 2P3LA 4DDVA 1T2NA 5M34A 2IP4A 3INTA 5CEFA 1YS2X 3LCJA 4CG3A 4CUZA 1RQ2A 2R47A 2ZR9A 4KSCA 1B1CA 1N6RA 5HF9A 3SLKA 3OU6A 4FGLA 4KEAA 4D6XA 4DIBA 4OHMA 4ZAGA 5T67A 2ZSBA 3QA3E 5IM4A 3V7WA 1P1JA 3N0WA 4JJ4A 1YO6A 1LPMA 3F6EX 1S8NA 3OLWA 5DN6D 4TTPA 3SX4A 4BQSA 2BZ1A 1EK2A 4EGQA 1Z88A 4DJ5X 5BPHA 1U2DC 2HEGA 4IVPA 4CLXA 1WDTA 4W99A 2NX2A 4ER3A 1RBQA 2VYNA 3F7TA 3WGKA 1LY1A 5DWVA 5C1BA 5AW6A 3BG5A 5BWMA 4FEEA 1V5GA 3FI9A 2V4UA 3LA8A 4B6OA 3I3OA 1L4EA 4NOKA 2EKDA 1CHDA 4M53A 1I14A 1NZDA 3O8NA 3TQFA 3D1LA 3GIDA 3HA2A 5KJCA 1DLIA 3PVCA 4AROA 1UKVY 2ALJA 3D02A 1JKIA 2XGJA 3AR9A 4KOEC 2D7DA 1WXIA 2Y1EA 3DE0X 1JJVA 2ZRBA 3D4NA 3KPYA 2GEJA 5IJ0B 2XMQA 2DFNA 1G16A 1SOMA 2FUCA 2ZAOA 3O3CA 3C8DA 5D1NA 5T3UA 2I2CA 3G2PA 4DMHA 4L07A 4Y2RA 2BR3A 4O4IF 1G1MA 1VXOA 1OXXK 2HHLA 3OFKA 5B53A 1M6WA 4P38A 5TMBA 1NN0A 6CHYA 5AVTA 1UBLS 1QCDA 2GD6A 3PZBA 1GILA 1ZOOA 1WO8A 4NZMA 2OXTA 4BMPB 5DNYB 4DCMA 4QFBA 3ECCA 8LDHA 4OAPA 1K7CA 1VFNA 2AC4A 1N7JA 1RDFA 3D3NA 3DMFA 3GH1A 3Q7PA 3RS5A 2VAPA 1I4DD 1VG0B 1WV0A 4BWYA 3I2HA 1K8YB 2LCQA 5LZ4A 4GDMA 1YFKA 3JQQA 2PXAA 3DL0A 2CE7A 4XAQA 2H7YA 4OHOA 4UKDA 4EKEA 2XMGA 3OESA 5CLHA 1UP6A 2RCNA 3MINB 1NXXA 3AKYA 4Y3UA 4EUNA 4ER0A 4LPSA 1A7AA 1SHKA 4RESA 3C45A 1Z7EA 3ENNA 5BYAA 2PS9A 4X3PA 3UGKA 1BGXT 3AWIA 4XJSA 2E87A 4QYIA 1KS9A 4YO8A 4D9CA 2XUOA 1VE6A 1FRZA 1E62A 3E18A 3QPAA 4EFNA 1L9KA 2GAOA 4Y98A 2O0HA 4D0RA 2D06A 3VU1A 4HATA 1IJKA 3M1IA 4QWWA 1XDDA 2Q1UA 3MM4A 4MUKA 3A7DA 2J7KA 3PEEA 5KWIA 3OKFA 4PSKA 1QP0A 1TYCA 2WG1A 3BDIA 2B2XA 3GJ5A 3GNQA 1KZ6A 4HYTA 2GSDA 3OOJA 3UPTA 1F6DA 4L73A 3EZXA 3RF6A 4PS1A 4TKLA 2DTXA 3BZWA 1WF3A 2YJ4A 5HFJA 2NTNA 3M9XA 2H4HA 3CLKA 2FPOA 3O8RA 5ALPA 3TB4A 4YJ2F 3JQDA 2ZRNA 2WTBA 3TQHA 1A4UA 1F8FA 2REXB 1W4ZA 1BKDR 2B1JA 2XNHA 3G0IA 3L6BA 5JCZA 3ROQA 1YVEI 1J49A 3QFCA 1M6VA 3TNYA 1WMBA 3PL1A 2HWXA 3HR8A 3KBOA 2UZAA 3CO0S 4TV8B 1ZN2A 4KQ2A 3SVZA 5K3FA 3HYNA 4ZRMA 3K9FC 1FF9A 1NN5A 2W6IA 2VRBA 4C07A 5K5EA 1T4GA 3W6PA 1IN7A 5HNKA 3FHTA 3EEBA 5KOHA 3NBMA 1XEFA 1ZW1A 1C7EA 2FZVA 5HZKA 2QRQA 3TDKA 3VTZA 3QIAA 2Q6VA 5C8YA 2R6CA 2R8XA 1UMDB 1T9DA 3QNMA 3VGPA 4ACAA 1YZVA 3VHRA 3EOBI 1Q6ZA 3MGBA 4FMPA 3CF4G 3M4ZA 3NVKI 1A27A 1JNYA 2O1XA 4HUQB 4Q4CA 3IC5A 1QOPB 3VC3A 4TM8A 2FP4A 3D4PA 2QSUA 1ADCA 1JAHA 2HCFA 3ISVA 2CBZA 4N6OA 5L7WA 3TR6A 3T9CA 3ET5A 4A03A 2Q3FA 1Z28A 4CODB 2UXCB 1D0VA 2ADOA 2Q2QA 1RHQA 1TF7A 2W8BA 3PGXA 4HCJA 4LI3X 4UZEA 4LF8B 1XELA 5HDBB 1PJ2A 1QSGA 1W4BA 3D3WA 4DUGA 4B48A 4PX5A 1WQ3A 2B7LA 2BCEA 4HDRB 1KBZA 1OXBB 2K4MA 4HDKB 4RHCA 2P0YA 4QGSA 4O2BB 1CXZA 4TTJA 4A8PA 1US8B 2K7FA 1Y8RA 2SICE 3EWNA 3MB8A 2UAGA 4KXWA 4AMGA 3QGMA 2NUPA 3EZ7A 3WKDA 5JH7B 3RASA 4B0OA 2PANA 3QY0A 1HH4A 1EFRD 3KB1A 1QWSA 1VJRA 1ZWLA 2EZTA 4B8ZA 1B6RA 2GK6A 1BWSA 5KNDA 5AUOB 4KZKA 4UAUA 2WOOA 2BGIA 4WNCA 1M5RA 3C87A 4QJIA 5EFOA 1OX4A 1W5TA 4U0KA 4EG0A 1A96A 3HC7A 2GRUA 3C8MA 3FKSA 3PXXA 1LX7A 2ZE5A 3BJZA 3IB3A 3Q8XB 5TX7A 2GA9A 5CITA 5KNBA 2NVOA 1T24A 3FW1A 5AM5A 3IE2A 5AOAA 3CIFA 3WDMA 2PO7A 2ZSAA 3OEHA 2ZUVA 3AVTA 2Y4OA 1HNNA 3I9NA 3NHZA 1QO9A 3G1TA 4HF7A 1TYBE 3M5CA 1P72A 1JG7A 1YA4A 3HSSA 4RGVA 4BMOB 1QP7A 1EFLA 1MH9A 1ZRSA 3CQ9A 3CVJA 4D0SA 1OYWA 3T4PA 1IVYA 2XDQB 3T61A 4D4IA 4MW2A 3TOSA 1PNRA 5D51S 2YUTA 3Q1KA 4CL8A 4Q12A 3MJCA 1L7PA 4I4LA 2REQB 3OY2A 4UASA 3VJRA 1KZGB 2EEPA 3H5WA 2I03A 3FY4A 3STWA 1PNVA 1XTJA 4W1RA 3RVSA 4XFDA 4A1OA 1Q2XA 3TIGA 5G02A 4DHEA 3C3PA 1UEXC 2V5AA 3L7YA 3JZAA 1IVSA 4WSOA 2ZVJA 1EFPB 4HNAA 1LUAA 3AU9A 4ENWA 1H42A 2JD0A 2QLJA 4FHGA 4IYJA 5IAGA 1I3MA 1RM3A 1XZMA 2G5TA 4HNVA 5EIOA 2YZKA 3OU7A 2HZ7A 4O3FA 4MAAA 1CY0A 1TZ2A 2L18A 2GJKA 4UNQA 2FWNA 1VRVA 3GPBA 5CMLA 1EP3B 1M1XB 3FCUB 4HUJA 4KQMA 4HB4A 1QVZA 2JHCA 3L8ZA 2ZANA 1QRUA 1LPBB 3KJXA 3MLEA 1IJBA 1ISPA 3HUTA 1F9EA 3K0CC 4MX8A 1UUFA 2XAAA 1O5OA 4BMZA 1KKMA 2P2DA 4BLQA 3M1YA 3G3EA 2VCHA 1V2HE 1XO1A 5K99A 4Q3NA 5CNKA 1Z6XA 3NHBA 2QZSA 1TQDA 1GTL1 1WBJB 4GE3A 3NNNA 5ES4B 5I4IA 3AUYA 1GKUB 1NHWA 4QYMA 2Y66A 4ZZ0A 1M2FA 3AFHA 2EARA 2HK8A 4QDZA 3VVMA 1LU9A 1XTUA 3TL6A 1TYEB 2RB5A 1LNQA 2ATCA 5BV7A 4HUTA 4X85A 3OZCA 4DNQA 1QGDA 2CDCA 5C3UA 3V8QA 2Z6QA 5JG7A 4WY8A 4ZT3A 5HQ3A 5I9TA 4JLOA 2JGLA 3ROZA 3ZWMA 4YACA 2WHYA 3OCXA 1CJUC 1M75A 4FHZA 4OI2A 1MB4A 1FW6A 1KDOA 4FX5A 1OC4A 3STUA 3RKSA 4CETA 5FPYA 3X1MA 4B3TB 3G5TA 1DFIA 4K9KA 5LZ8A 1WL8A 3RROA 3EWSA 1MTZA 2H3EA 3HRKA 4JS0A 1T4CA 2KPOA 4NE9A 1BS1A 5JPDA 1PGJA 4KMMA 3E9DA 4Z9XA 2AQIA 3Q3HA 3ZX5A 1RZRD 3H2KA 4CMIA 2VHWA 4Z1OA 3KYJB 3FGNA 1NBAA 1R9NA 1R3DA 3GLSA 2BIFA 4IJKA 4KPEC 1F12A 2NZUG 2W2OA 3WMEA 1L4HA 5KEIA 1VMEA 1X1EA 1J5XA 2I4MA 2IUYA 2DBRA 2JFVA 2W48A 4WXMA 1E2IA 1N5IA 3VSAA 1A8IA 3GP8A 2ZVQX 3JD4A 4P4SB 2DHRA 3KQOA 1K6JA 3L9WA 4GD3Q 5HDQA 4M88A 3I73A 3Q41A 5E4JA 4NJOA 1DO8A 4UAGA 3JRNA 2C42A 3IBGA 1CRPA 4CKBB 2ZYTX 1K06A 3ZZ1A 1U8YA 4KAFA 1TEXA 3KZ1E 4IO0A 3HM9A 2CLCX 4H3SA 4B6QA 4PAMA 1VIDA 4M99A 2O23A 5B58C 2CJYA 3EE6A 1PJTA 3K0SA 1Z4QA 1PZFA 3R3SA 4RO0A 4J4BA 3O9MA 3NAMA 3OPQA 3C3KA 1RCTE 3C3MA 5ALHA 1RWWA 3E1GA 2EFDB 4UVDA 4ONEA 5KX5A 3TZLA 5CLJA 4X92A 1L4LA 2HWWA 3QUCA 5YASA 4QQKA 4JP1A 5FIUA 3SE7A 3VZSA 5JAHA 1GJRA 4UHFA 2FH5B 4D9JA 4HQKA 2IYOA 5F51A 2ZSUA 2GMWA 2Q4DA 2UZ1A 2XNCA 3PFBA 4V24A 2R7AA 1W581 3HDJA 3MUNA 4LBVA 4UMEA 2FFJA 3CSSA 2ZATA 1SPBS 3DXZA 1JIJA 2FE4A 3R6DA 5T3YA 5K8IA 5E7IA 5EKTA 3ZY4A 4JXXA 2WPDD 3AR8A 1AQUA 1UK8A 1Z13A 3BMNB 3I01M 2A5YB 2GLUA 4GC5A 4K40A 1U02A 3GFOA 1V11A 3MBOA 1SA0B 2PJDA 3L6EA 4CM1A 4U7FA 3FCEA 2WU1A 3ME5A 1EH5A 3ZE9A 1PV4A 4A0FA 4CV0A 4D46A 2ZSEA 3B9BA 2VP6A 2REOA 4RFSA 1IPFA 2IIVA 2JFHA 3WO1A 4D4JA 1F06A 2HYIC 3ZJUA 3GH3A 2JFWA 4P84A 1QZTA 5IT4A 2R65A 3ZNQA 4ZOBA 2PD3A 2QV0A 3FHOA 1DC3A 3UK0A 2QMQA 1QQAA 1NVXQ 3RVMA 1VHWA 2GO1A 1Z56C 1GGNA 1FTNA 1DARA 2PSSA 3VV2A 4WCDA 3GRAA 5EVJA 1FBNA 5FPSA 2QR5A 4RIGA 1GQQA 3EK2A 5EFZA 4GKAA 2PPLA 4INPA 4KNVA 3KS9A 3N1UA 4MWCA 1GZHB 1P0FA 2C7PA 3IODA 4O33A 4GPEA 2ZDGA 4TL7A 2PDAA 4OB8A 2WJGA 5DKFA 3CF2A 3L0BA 2BMWA 4S1VA 3AFIA 5B6IA 5AKKA 4J29A 1GFWA 5HE8A 4M9QA 2CVPA 4B45A 4L57A 2W2LA 1MG5A 1G7CA 4UNPA 2PH3A 1JGTA 4FFLA 1L4KA 2BGUA 5TB5A 3QPWA 1KKUA 2NADA 3KHTA 1TT5A 2I4TA 2H29A 2PXHA 2QN6A 3N8DA 1L7NA 3GEEA 1QK3A 1N57A 3RU3A 1JVSA 4EHIA 4M0KA 1JHXA 2B7CA 4JLSA 2OOKA 4OP1A 3QBTA 4YAIA 4MNTA 2YWCA 3LRXA 1XJCA 1J0AA 2P9ZA 3ZI4A 4N4AA 4O4IA 1X77A 2ODPA 2QUBA 4KH1A 2A1TR 2HBYA 1JIQA 3E7FA 4U9HS 2Y1DA 1GNPA 5D84A 1NP3A 2VWQA 1AHPA 3ZW7A 1PEDA 4HGOA 1OIVA 1V3QE 2H65A 5ELLA 3IQZA 4X84A 2R25B 4U7WA 3UC5A 1M34E 2V6GA 5MF6A 1C80A 4RTKA 5LM3A 2QPTA 1U0RA 3ZR4B 3I62A 3WLJA 1BJRE 1ATZA 3QUQA 1EDBA 4EB6A 4UTPA 2B36A 3R9IA 2FFAA 4NDAA 2P69A 3IV7A 2ODNA 5EJ9A 2QGZA 3CYFA 3L2OB 3HKEB 4TRJA 3F3YA 4A27A 2VK2A 5BOSB 16PKA 2HNBA 3T7IA 5EAIA 5K6RA 3JARB 1ABFA 1SB8A 2J6CA 4FKMA 1GTJ1 4XW2A 4GX2A 4IOLA 3FFAA 4NCIA 5TQ0A 3EQ9A 3ICEA 3SF8A 3IUMA 1OZ0A 3LHFA 1HYEA 2RGNA 1N2CA 3WFJA 3WIDA 1MJFA 3GLFB 1R50A 2IYTA 1R64A 4N3AA 3OURA 1WXDA 2WM2A 3G88A 4IXWA 4M1MA 1K1EA 1Q7RA 1PFKA 1U7UA 1V6AA 4M83A 4R2HA 3ZWQA 4B5KA 1V5EA 2QAGA 3S27A 1NG9A 1FFEA 4P33A 2E55A 3ZWKA 3GGSA 3W1VA 2B98A 2CHQA 1JHVA 1NOKA 4GI5A 2JJQA 4OATA 3AL0C 2FEPA 3HYTA 4YAGA 4R8SA 3RIGA 4RTLA 4IEIA 1J21A 1FDVA 4L4UA 1NF8A 4HDNA 2QMEA 4RV9A 1PK9A 3LX6A 3V2IA 4I6EA 1OFUA 1QNFA 2XZPA 5JVDB 3W6ZA 1KEKA 1P7WA 5IDVA 1DFHA 2GRAA 1O0SA 1FUIA 2WNHA 3FSEA 2YL2A 3K1TA 4KMSA 2V0GA 5A5FA 4RKRA 2JIZA 3ZGLA 2VTVA 1R15A 3IBSA 1YJBA 1BJKA 3E9RA 4CIAA 4ZWNA 2AR7A 2Y68A 1E1DA 3DF7A 1P2SA 5DPMA 4TV8F 4QHTA 3VM6A 5DHUA 1WG8A 2J3KA 3UJNA 3G2QA 1WR8A 5D3MA 2F62A 5DYGA 4BMYA 3WXBA 4DKJA 2XDWA 3LCUA 1LJUA 1OMOA 1U0EA 1EM6A 1UPAA 3VKFA 4OI4A 3BERA 3O5AA 3RM3A 3S2YA 2PUCA 4ZPXA 3HCFA 2C5GA 1V8PA 2YXBA 3CKMA 5DH9A 4BV8A 3KJZA 5IMSA 1L5FA 1S2DA 1ZMOA 2DMRA 5HCUA 2OBMA 2C9DA 1ZU5A 1MOPA 1ZD2P 3TNDA 3W9SA 4KIWA 5A0TA 2X5XA 1LS1A 2Z5FA 4DJFC 1YE8A 1K0FA 4I8XA 1E4EA 2V03A 1Z2PX 2OUKA 3LPDA 1N8SA 2GFHA 2WU8A 1N2BA 3HADA 4JL8A 1M2OA 2IPLA 3DTVD 5TR9A 2W6JD 1YS1X 1FMFA 1U3WA 3W7BA 1AQYA 3W8DA 5JECA 3BMOA 1YGPA 2H4ZA 2V65A 4QGGA 3UMYA 1YZTA 4Y2JA 5DNDA 2QN3A 4OU4A 3UA4A 5DNEA 2IPXA 1NA5A 3P97A 4YBRA 5H5JA 3H2JA 5CVTA 2QQGA 3ZDEA 2RBKA 3HHPA 2BGWA 1G2IA 4YR9A 1W4CA 4YRBA 4BZZA 2RI0A 2XMSA 4O2BF 4FEAA 1M2NA 1UOOA 4QUJA 4WMLA 3DEJA 3SYKA 3L4BC 5CFNA 1FS6A 2JFQA 1L2TA 3K7EA 2R60A 4EFKA 4HDCA 4OQFA 1QRAA 2JFUA 1ZYUA 4UE6A 1OI4A 5CFZA 1FYVA 1IATA 2WHPB 2B7BA 1E1CA 2ONZA 4RY9A 3HTXA 1WCXA 3C3BA 2GZ1A 3DLCA 4YP5A 2YY6A 3MHPA 5EZ6B 2CDRA 4HKTA 5FOSA 1TPYA 1EVJA 3AEZA 3PEUA 1B8NA 2O3JA 1C9YA 2CZQA 3IMGA 1CR1A 3BHIA 3OETA 2XSZD 2H7VA 2H11A 2QX8A 4TUYA 4WZAA 5A4KA 3Q9LA 2XWPA 4DRZA 1Z75A 3GCZA 2KMLA 2RHGB 3DR3A 3P96A 7REQB 3HU5A 3OUUA 1JI0A 3SZGA 1JEOA 2RHDA 2XQKA 4PLTA 3K0FA 3VPSA 3U49A 2YIVX 4HS4A 4IGKA 3D5TA 2R5FA 2C7GA 3HB9A 3QMMA 4Q47A 4D1YA 5KCZA 2PJRA 1RAHA 2FUNB 4JBWA 1GPDG 1OY1A 3HJRA 4JBLA 4A10A 3LC0A 3EH2A 2VRCD 4OO3A 5G2OA 3CNNA 3ZDBA 2O6HA 3AF0A 1E79A 2IE0A 2IYZA 3F0TA 3WDKA 1SU4A 2R9VA 3E9NA 5ALFA 2WWWA 4YWHA 3EULA 5CFRA 1HORA 1XTVA 3KO8A 5JXIA 2GEKA 2LXNA 2QT0A 3OQPA 1JR4A 5LU8A 4KR2A 1TA4A 3HJBA 1NFRA 2P7IA 5FUMA 1ODSA 2AR0A 1FCJA 1N33B 2N46A 3NKVA 4Z1MD 4L0MA 2YHIA 2FSSA 3TN7A 3OAAA 4Q9HA 4WZBE 3UKDA 4MRSA 3FNFA 4HX5A 4Y8VA 3FMGA 2HKIA 2QD1A 5K2OA 5CA0B 2H5IA 2WT4A 1Z68A 3M82A 3I5XA 1MHTA 1UIRA 2SHKA 3HLYA 3OX3A 2H2AA 3H2BA 3N7TA 4TTAA 2VP9A 1JWAB 3H3FA 5KSZA 1Z5UA 3DMTC 3H5TA 3LUJA 4S1WA 1NZFA 4A2PA 1HYGA 4NLLA 3USCS 1CR2A 1XDZA 2DR0A 5NULA 3COYA 1XMSA 3EZFA 2C99A 1DDGA 4OXIA 4YK7A 1ZXXA 1LBTA 2QVCA 2WFMA 4Z7NB 4BBJA 2BEJA 3DBOB 4MVJP 5FR1A 1S9HA 1NMSA 1T5HX 4HXYA 2VSFA 1EPUA 1OLOA 3MUOA 3RKUA 4OIFA 4PZUA 3E15A 4DR1B 4EKNB 2UVQA 1ECLA 1F6BA 2GN4A 1AZLA 2PX0A 1IBCA 4MR9A 4EMSA 2PQ2A 3LG2A 4WBXC 5DX8A 5CDTA 4GM1A 3ACCA 4IL5A 3JQBC 1FK8A 2JGJA 4IHAA 1JAIA 2F67A 3FBTA 1XCGB 1L7OA 1LV8A 3E6AA 1JZTA 4FC7A 3E9QA 4M0UA 3U1TA 5GJVC 2IE8A 3DEHA 2KSQA 3AJRA 2AX3A 4LJYA 5T4BA 1LFDB 2PLFA 4A6DA 1OFVA 3GUVA 4NPCA 4Q9LA 2KLHA 3H75A 4H3KB 3AVOA 1SBCA 2A4KA 4IGEA 4KIJA 4PYRA 1HUQA 2G06A 2OCBA 3PPWA 4JKOA 4R2KA 1IPEA 2J9GA 2H51A 4TXHA 4AJNA 5PNTA 2UU9B 3QOXA 2JZCA 5CFLA 1BU8A 1IHPA 5F2EA 3ZD9A 3E84A 3Q9NA 1KK1A 3FDFA 2NSLA 2PWBA 1EWKA 2IZ1A 3NHKA 1GRNA 3P1JA 3QXHA 4RWZA 3TX6A 2MTBA 3HXLA 3CR3C 1DQPA 3W2IA 1P9WA 1P18A 1TJ5A 2V59A 1JG4A 2Y8EA 3R3JA 4TZTA 4YRQA 4PG4A 2AA3A 1VQ1A 1YQTA 2I6QA 1KOFA 2G9UA 2MYUA 2PJUA 1NQWA 1QGOA 3EXEA 5I7FA 3PSAA 2G8LA 1TUGA 3WA7A 3AXSA 4MYDA 5JJBA 2VOJA 1U2GC 1IAQA 1ESDA 1OSNA 1DX6A 1WP9A 2FYTA 1Q7GA 1EGQA 1ZGZA 2OGTA 3OJLA 5CW2A 2ZJ0A 3RNOA 2XXBA 4U0JA 4ARIA 2FCRA 3BYZA 4MWBA 3OVMA 5D86A 4F56A 3OZBA 1HE1C 4EB0A 2ORYA 1O3YA 1ZVQA 1G291 3VR3D 2ACKA 2NUTB 2ENUA 3BILA 4EGAA 4EJFA 2CJWB 3OJFA 5D8DA 2VP4A 4BRWA 2C2MA 4CMEA 5CXQA 3S8EA 3ANTA 1VL5A 3CXUA 3OCWA 1UWKA 2FLKA 1IOLA 3VSCA 2GHIA 3KBBA 3KAQA 3C98A 1EX9A 2D13A 2PN1A 1LK5A 5A02A 1BDIA 1UK9A 4PLZA 2GPTA 3BTOA 4EJMA 1ULTA 5BWNA 4ALKA 1INLA 1MR3F 1NW9B 4O4JA 3WMGA 1MB3A 1GCAA 1PJ4A 3QX8A 4V0QA 4WNYA 4V39A 2GCEA 4MAFA 5CIWA 3E82A 5B3AA 2R00C 2H0RA 2X9VA 3GFSA 3IBFA 4URWR 1Z7YA 4WERA 3TMYA 3NTVA 1ZRMA 4WRRA 3PEVA 4FGSA 4Y2XA 4KXFB 2EL9A 1RKBA 1D7AA 2HXYA 3NOVA 3TTXA 4L1KA 5K03A 3BL5A 3V2HA 3ENWA 1CZRA 1TM2A 3AY3A 1VJDA 1L7XA 2VDVE 3GRVA 4ALNA 1E3EA 1DOZA 1TZCA 3HJTA 3H5OA 1O95A 3KL4A 4IH9A 4NSNA 1W0JA 1QFSA 2ZS7A 4FTWA 5KOJB 1JWLA 3FVQA 4KXMA 4WFQA 4XIIA 2CKMA 2ZK7A 4DR7B 3CT6A 4JB0A 3HJUA 1AGPA 5AOVA 2I7CA 2UYYA 4CF3A 3NPMA 3VR4H 4OHRA 3N05A 3ZY6A 5L3ZA 1P4HA 5JEEA 1O54A 1OWLA 4QSHA 3SIWA 2QE7D 2FW9A 4PCAA 1FB5A 2VT7A 3SSMA 3U4AA 2I7VA 4JI8B 3I5YA 1R8QA 3G8YA 1JSRA 1XG5A 4PGFA 4RA9A 2Q9CA 3CR7A 1YBMA 1Z8HA 4UATA 3CZAA 3QX3A 3WIUA 4R2LA 2NO4A 5AHWA 2ZXUA 4S05A 2XD4A 3JQ7A 4AY2A 3DGFC 4X20B 2NUAB 5K8JB 3O2QB 3H65A 2UZ3A 3A1VA 5AJWA 5HKAA 1YGYA 1CV2A 1NIPA 1VKZA 1V0JA 1MX9A 2ZYHA 3R3UA 1UPTA 3DNPA 1KC1A 3T7TA 1IZ9A 1TMKA 2QRVB 4DLPA 2BZSA 3EVAA 2GZSA 5CYFA 4TOIA 1XZLA 3UXHA 4EITA 1ZIXA 2V7EA 1OWMA 1Z0SA 4MA5A 4NMWA 4U2CA 3QSGA 5DGHA 3RHZA 1B2LA 4KO1S 4J1TC 4ZU1X 1LB1B 1M8GA 1PQWA 4KUEA 4CLRB 5IW8A 1VCOA 4I50A 4RGBA 3E05A 2XWSA 1DJNA 2QRJA 5GM2A 3GNSA 4UARA 5CDFE 5IK2D 3SP1A 1WXWA 1L5ZA 4EG3A 3TQRA 2FWRA 3PI6A 1L4FA 4E51A 3O4IA 4KGVA 5HFAA 5IJ0A 1Q1QA 1E0SA 1O7JA 1Z7BA 2C29D 1W0KA 3QBEA 4B47A 2O4CA 2KLBA 2C95A 3ESBA 3RWMB 2AN5A 3UC9A 4KU4A 1K68A 1UJNA 2JEYA 1D9ZA 2WIGA 4Y0NA 5HILA 1SEVA 3LC1O 2PX2A 4G0YA 2VQSA 4QRHA 1CY4A 1SIBE 4BKQA 2BTQB 1Z12A 3G2HA 2Z04A 4QOSA 3S1AA 3KJHA 4BLWA 4CTMA 4HBZA 3AUSA 4JBIA 3QHAA 3AF5A 3PFWO 5G41A 1XLTA 3L7BA 3SMQA 3GMSA 5FUBA 4ZK6A 2AN9A 2JLSA 4GM4A 1BDMA 1WUHS 3EJ6A 1PWEA 1CUJA 1XPJA 2HBQA 2HWYA 5DB4A 4I3FA 1HDEA 1YCFA 3R0ZA 3L0DA 4RXUA 2GCPA 3CRQA 3OD1A 3OQIA 4PC2A 2FN7A 1Y89A 4PPYA 1N25A 2BC9A 1WCV1 2Q5OA 5B1DA 3W5DA 2MIIA 1E9AA 4AJHA 1PUJA 3REQB 4RD4A 1IZ8A 1CR0A 1LBSA 2QL9A 1TDJA 4PO1A 1RKXA 3T0IA 5JYCA 5DW0A 3KEOA 4LSWA 2XCSB 2CT8A 2QMOA 5G0VA 3IAXA 1O08A 4NJMB 1DRUA 2F9FA 4HEQA 1N5DA 1PR5A 3HHEA 3SX0A 1G7RA 2C4UA 4ITRC 5EZYF 4NBVA 2P40A 2GCIA 1LPSA 1MLDA 3WV4A 3WJAA 4PO8A 1G4AE 1U5BB 4FKZA 2CMFA 3EGDB 4FR2A 1R6TA 1MT3A 2AJCA 3LKVA 3Q0EA 4RFLA 3WWYA 1Z18A 3WYGA 1C1HA 1TFUA 2LV8A 1S7CA 1Y3HA 2Q5FA 2IHYA 3EMKA 5AHOA 3ZZMA 1QAQA 4DILA 3JTEA 3GA0A 5IFLA 2QRPA 1M3SA 3MG9A 5JVDF 5JADA 1CWUA 3ZBPA 1NMQA 4XDYA 4DADA 1MUUA 5JZSA 1Z4JA 4BMDA 1RLTA 4HPXB 3RO7A 4Q9DA 4BGVA 5BSMA 3WRWA 3WGUA 4K9LA 3QEOA 4NCAA 2F59A 1OYOA 4QUIA 4UBLA 3VJLA 2RJ3A 4X63A 1MC5A 1VTKA 4D96A 3NC4A 4DZTA 1D2AA 1I33A 4TVBA 1HLDA 4EH1A 5IH3A 4TV8A 2JJ8A 5DSZA 4KTTE 1Z25A 3UQYS 4Q02A 2X0JA 1P61B 1ODLA 1SRRA 2YXNA 3NORA 4BX2A 1POXA 2I65A 2JGAA 2BBWA 3GFTA 2VT6A 1XQVA 5FHQA 5FI5A 2RI1A 2H6EA 2P4SA 1QPGA 3HDVA 4U5XA 5HBRA 3V8EA 4C4AA 1Q50A 4CDNA 5A7FA 1CZUA 2WJAA 3IVAA 3CUYA 1VL0A 2RGEA 1KEZA 3IX7A 1XZAA 3BQ9A 2ZXEA 4MW0A 2A6PA 1UBJS 1UM9A 3OPMA 3SM9A 2VWGA 2IGBA 1FP7A 1Y9ZA 2IYRA 2MDTA 4JENA 4JQZA 3TNJA 4HUQA 5KVSA 2XXAB 3B1YA 3EFOA 1MVLA 2OG1A 2WWXA 5FTMA 5EWJB 1BX0A 1E8DA 5AXCA 1G2PA 4ED9A 1L0BA 1ZAKA 3QLEA 5EPEA 2JGRA 4HXFB 1C4OA 1ZM2A 3BWVA 1Y9AA 3GROA 4JWTA 1S1CA 2RHJA 2CXHA 1H8ED 2NVBA 1TVCA 3PEWA 1C30B 2EWMA 1J0BA 2GAFA 4RH1A 4PTYA 3BWDD 3EEOA 1X13A 2WBLC 3GAMA 4NF2A 4HDKA 4XGKA 1BHSA 1P62B 1XDGA 2Q3HA 4LQ4A 4O2BA 3WYNA 5KC8A 3PTZA 4I08A 2GN8A 1K7EB 3RADC 2JCVA 4LVUA 1US8A 2I4OA 1NNI1 1PG5A 1V71A 1XVTA 4WOCA 4EMUA 3BREA 2DKOA 4P9NA 1MPTA 2QLBA 3ROFA 1AY0A 5BQ5A 3WHIA 1QCYA 4TKVA 1SELA 3IPAA 2WDZA 1D8TA 3GJYA 4YT8A 3EZ2A 5IXSA 5I5GA 4L5JA 3F9RA 1WXHA 1WUTA 4YUVA 5TVGA 5BSHA 5I8PA 3EA0A 3HDQA 1QDLB 1CVLA 4LDPA 4QU5A 4KRYA 3AUUA 2J0UB 2YXEA 1OV6A 3FBWA 5AKHA 4CKXA 4YDQA 2WTNA 3P0EA 1N9KA 2PR2A 3KUCA 3WP1B 1MABB 2ZVPX 2G25A 2B9EA 4X1YB 1XWWA 5FBWB 5B30A 3TJMA 3WR5A 3GZNA 4B9AA 1T2VA 2AFRA 2Z2XA 3CLVA 2XCQA 4CMJA 5I7VA 1LZLA 3VO1A 3F3MA 5IU6A 4CMCA 1X7ZA 3NDPA 1U99A 4DSUA 4QFMA 2PZKA 2BM8A 4Y2TA 5FPPA 1Q7BA 2V6IA 4LWQA 2FRXA 5EGSA 4NCBA 1WZCA 2WJPA 1U0FA 2WUGA 2XDQA 3FCCA 4AP5A 5HRCA 3QVGB 4HS9A 5ALRA 2VWPA 3ROXA 4ZJUA 1CUYA 3PT9A 1KI8A 1SNYA 3DTNA 3EGXB 4Q3AA 5JCJD 5JNWA 2HNAA 3V3TA 1OWNA 3L8MA 2REQA 2ORED 3AB7A 1BCSA 1XX6A 3O47A 5EWMB 4UNIA 4ALLA 4C7BA 3NW9A 4OGFA 4FOOA 3OPYI 2AEFA 2ZIEA 2OORA 1Y63A 4UNSA 3WGTA 4KVFA 3J81A 1XCJA 4L85A 1EJBA 1A9TA 3HB4X 2I3BA 3LXUX 4L5CA 1T8RA 4RVNA 2C98A 3WRVA 4BIIA 3AVXA 2OP0A 1R0ZA 3M89A 5BT9A 1NLYA 1TM7E 2VSYA 3I12A 4CR6A 3N0XA 4LX0A 2HMTA 3RB8A 2OAQ1 3AOEC 4TYYA 5IJAA 2D54A 4IWNA 2H63A 1XL1A 1TKRA 4NCXA 4UFOA 3AEXA 2A1TS 2BEUA 3OBIA 4J2HA 3AEKB 4P7FA 1DIBA 1EVEA 3AF1A 3LLVA 3UXMA 4CDGA 1CJCA 5HPYB 4GBJA 1TC2A 3CRRA 2H2HA 3LMKA 4EHDA 4D3XA 2WICA 1W85B 1PR6A 3EZGA 3NEPX 4PPFA 5K0TA 1U0GA 1MB9A 1SZJG 3QE3A 4CLEA 1KYTA 3H83A 4Y2YA 3SS8A 1U8ZA 3THRA 3V1LA 4HNHA 2AF3C 3ZWXA 2ZREA 2WNSA 3W5SA 5JDIA 1FDRA 4NBKA 1E2PA 1KYQA 3G68A 2MWMA 2ZG6A 4C08A 4E14A 1KO4A 4NEHB 3KV1A 4IY1A 2DWQA 4PVDA 3R6WA 3MBIA 4RD0A 3UJDA 3UMBA 2JIMA 2QQFA 2ZT6A 1V26A 4GYYA 2D0PB 4QUGA 2W2XA 4KIUA 3BRWD 2WIBA 1CJKC 2D0OB 3I4FA 1IXRC 4JLBA 4ALJA 2RHCA 1PT9A 4AS3A 1VLVA 4KXVA 3DMGA 2JVKA 1P4GA 1TUEA 2A9QA 2F1IA 3RYTC 5F78A 4C4YA 1KO8A 2WFLB 3R75A 2FDXA 2PKCA 2O3RA 4CG0A 2QTFA 3LWBA 2FOIA 5DI3A 1ZD8A 1ETHA 1T5DX 2BONA 1RRVA 2F90A 2YFKA 3GWGA 1LI4A 4X8OA 1P6QA 1NJ5A 4YP6A 3RQSA 4J8PA 5E2IA 3WSWA 4PLHA 4HR7A 1EP9A 1QQTA 1OI2A 1P31A 1QHHB 1RWPA 4UMVA 4EFMA 3I28A 4JYPA 5GONA 2QBYA 4XTRA 2AIRA 1KVQA 4Z99A 1KMQA 3OFSA 1YWGO 1ZL2A 1KIAA 2YMPA 4IDQA 4ZEXA 3SQNA 4NPHA 2QRHA 3E0XA 3UCXA 3VDRA 4B4KA 4X64B 1SCUB 5DXJA 4LGYA 1UBKS 1ODFA 2WLTA 2Z95A 1Z5WA 4N3BA 4LOJA 4Q4DA 4RPJA 3RWOA 3SJCA 3W2GA 2HSDA 2DUJA 2JLYA 1TEHA 1WHTB 2QYTA 3D3JA 1Y6JA 4KZPA 4PZ9A 4E0BA 1JIXA 4R84A 1WKVA 4D4LA 4Z4HA 4RS4A 4HHEA 3HK2A 5FOQA 1NOIA 2VYCA 3LIPA 1FXUA 1V37A 2YNMD 4NH4A 1SQFA 2PS1A 1F5SA 2E37A 3A58B 4DR4B 3OZTA 1M5TA 5EJAA 3K2EA 3NHLA 3AWDA 2GD2A 2AB0A 3ENKA 2M32A 2VK8A 4F60A 2R8YA 1I2DA 1FL9A 2XJ4A 3W5IA 4IV8A 1U9IC 2C97A 4BJ6A 4LHVA 4HC4A 2AVNA 5DZSA 3O2SB 1J0XO 3QFSA 4YP0A 1L5QA 4H4CA 3VR5H 4DV1B 1IUKA 1QAOA 4EPRA 1OA0A 4ON9A 4R98A 5JCPA 1KNQA 2V98A 3GBSA 5H4GA 4DE5A 2EQ5A 3F3KA 4DMMA 3I2GA 1O94A 3SU8A 4FYKA 10MHA 5L40A 3N28A 2W98A 3G8BA 1VHDA 5J4LA 2PY6A 3A05A 3WVNA 4GUDA 1KSFX 1N1EA 2RKOA 1SA0A 3L8EA 3OE7A 1R1DA 4YR7A 2PH1A 3DCYA 5AW8A 3BICA 2BYTA 4UMFA 4P7JA 1E3JA 3FWKA 4KR0A 2QW1A 2VRNA 3I2FA 4TVOA 3CCBA 3N87A 3D43A 3OZ7A 5GPBA 4G8JA 2VDPB 1ZCFA 1USKA 3H6GA 4NZ9A 4FFNA 1G5PA 3A14A 4ZQBA 3E1KA 3EVNA 4YIHA 2JCGA 1WXEA 2VYVA 5GWXA 1J1IA 1JQBA 3OKAA 4HLUC 5ESXA 3TKAA 1ZJ4A 4QTUB 3Q3GE 3AHEA 4M37A 1VE1A 1J25A 1BQ3A 3KDPA 3KXPA 2UYHA 2XXJA 3RYFB 1L8XA 1I7QB 2AD5A 4OK6A 4MVCA 2NZXA 3DVRX 4QOIA 3FHLA 4MKHA 3PIIA 1VC2A 4CMAA 4D9NA 2D0DA 4Q66C 4YCMA 3EXG2 4QFCA 5EYPB 1HMPA 3AO0B 1XDWA 4JI3B 2QB5A 4INAA 4CT5A 2DP4E 4PBSA 1P9NA 3A31A 1B41A 1YB6A 2AI3A 3HXQA 4DIEA 1HMYA 4LRWA 1CB7A 3T3HA 1RHKA 1P73A 3OOYA 2FG5A 3U48A 2ZBUA 4XIYA 3FTEA 4XGRA 2AK2A 1OAAA 5ALDA 5KJ6A 1F8UA 1T6XA 1Y4AE 2H4YA 2QGFA 2P3QA 3A8TA 3H8VA 3P26A 4N8EA 4F6RB 5JY1A 2Z2JA 4Y9RA 3K6JA 2X5NA 2QSZA 2BI4A 4UQLA 4DLZA 1V39A 3VH2A 3NBQA 2I6UA 2PG3A 2WB2A 2PL9A 2RGCA 2HNKA 4IJUA 3TRFA 3U3MA 1G64A 2VK1A 4HB2A 4KPUA 5KVVA 3W6OA 1KR2A 1YFJA 3H1GA 3IURA 3JYQA 4KMRA 1B76A 2P78A 2VPYA 2EERA 3AM3A 2CMGA 3NT4A 2NG1A 4G5HA 1R6BX 4NECA 5JDCA 3EXHB 4UDOA 4WCFB 3T4EA 1G98A 2NPIA 2UUBB 4L5YA 3S4YA 1G5HA 2WR8A 2EFJA 2ZGVA 4E12A 1VIVA 3W8EA 1KQPA 1AXGA 5BOSA 1R2QA 1HDGO 4BEVA 4AO7A 3BE8A 2VZ0A 3HDGA 4ZFNA 1KARA 4WN9B 2VSOA 4TV9F 3IVMA 4QPDA 3T1TA 2JCSA 2WUFA 3FROA 4ZGGA 3GLFA 4C4SA 3SEAA 3WOVA 1DEXA 4I6JA 4YAFA 5I4CA 3E35A 1IH8A 3I8SA 4I1UA 4NE7A 5CX1B 5EZYA 4MPTA 5T8KA 3MJSA 1RRKA 1Z6GA 3IAEA 3HJFA 1U1FA 5HFNA 3JQ9A 3L41A 5FADA 2BGTA 4BJ5A 3UHJA 3EOZA 5C9ZA 2C84A 4I19A 1YDGA 2QJOA 3EDRA 2DH6A 3PKIA 3B38A 2GN9A 3ESRA 1EVQA 5H8WA 1GGMA 2NSYA 3VVCA 4BAZA 2F55A 4M0FA 2AE2A 5JVDA 1UOQA 3VU9B 2XUGA 3CRMA 3QUSA 4RMIA 2BF7A 4IVNA 3M9LA 1QJ4A 3PX2A 2HF7A 2VP5A 5DNCA 3IAHA 2ID4A 5DISB 1KY4A 3OMLA 3ZIUA 5JI2E 5IWAB 3HRHA 1XOIA 3CN7A 4G5QA 4PZZA 3KEGA 1SVIA 5BUQA 2WF6A 3LCVB 5HXAA 3R5KA 4I1IA 5EHIA 2E1RA 5BN4B 2RGWA 1JRLA 3PUKA 3X1KA 3IMFA 1AH2A 2WF8A 3GF4A 1AO3A 2PRKA 3LNCA 1J2RA 4KQXA 4HDMB 2RH4A 5AM3A 3RW9A 2G9QA 3F1KA 2CYAA 4BX0A 1NKSA 3Q5DA 4XUGB 4Y6RA 2C1EA 1EK0A 2CNWD 2XE4A 4M3NA 4MS1B 2LIPA 2IEAA 3EARA 1YZ3A 2EW8A 1MA3A 3IUPA 1QYIA 3LDGA 3NFYA 1NJ6A 3O3MB 3WXMA 2IY7A 1RRGA 3KP1A 5SYMA 3WK6A 1BDHA 3B1WA 1OWPA 3F2IA 4MJXA 1SVNA 2DQKA 2WJ4A 3AX6A 4N82A 3U9TA 2AOUB 3I9MA 1RCFA 4LK2A 3SN6A 4TMZA 2X6TA 4JUAA 1T3TA 3UUGA 1G7TA 2Q27A 4HAXA 4R0NA 3RTDA 4PANA 4YJFB 4N8DA 1P5HA 5D7NA 5KKNB 1SOUA 4P3XA 1DT3A 1ODIA 3BORA 5EXTA 2XNSA 4ZGBA 3L46A 2EWVA 5AXAA 1GZ3A 3C41J 1TNDA 3PFGA 4UHDA 3PGJA 2VJMB 4GH5A 2JIBA 2Q8PA 4L15A 1QPZA 3TZBA 3E7XA 1AMUA 1AUQA 2PBLA 1SVOA 5ALXA 4AIRA 4F2WA 1SGWA 5JJIA 4RF4A 4KKXB 4F8YA 2ZT7A 5K7SA 2WHPA 4ND2A 4V02A 3MHTA 3T1NA 4Y1RB 2M1XA 1KERA 2OV6A 3VBEA 3LD9A 4FGKA 3FFBA 1O6GA 3AJEA 1RPJA 4RTRA 3JAWB 4EB8A 1V2GA 3FGZA 4L22A 4RDXA 1QTRA 4X54A 5LIRA 2AMYA 1J56A 4IMRA 3OIWA 3TQSA 1W4AA 5T4EA 1NMZA 1ZIPA 2YWDA 4CV1A 3VISA 4P82A 2QM7A 1IVNA 4AZTA 4EZEA 1OV4A 1WOMA 2NO6A 5KU7A 2IZ6A 3VR6A 3B7WA 3CRW1 1GXSA 1WP4A 3R09A 1BG6A 1NF9A 1ZNZA 4NNOA 3IOYA 4RIHA 1CETA 1OXTA 1PZXA 1ESZA 2GYVA 2YZ2A 1M73E 2ZP1A 3T6KA 4GKKB 2AUMA 4OYRA 1EGVB 3BIXA 5ER9A 3TYXA 1FZQA 3VYRB 1HKHA 3NYRA 4Y30A 2WWGA 3HWRA 2A1UA 1FDUA 2CNNA 1EZ4A 4KQ1A 2N3ZA 4MP6A 3R7AA 2FPPB 1KIMA 1XP8A 2GZRA 2XT6A 1OFUX 4TLAA 3RIXA 3JQCA 4YJKA 1ULHA 4CLDA 4PZAA 3A0UA 1RIFA 4K6HA 3EG5A 1KMHB 4DV6B 3M9WA 1YE5A 1CTQA 4DNFA 4BZPA 3DOFA 3H11A 3BUSA 3ED5A 3AB3A 1ULZA 1LQTA 1H2YA 1JT2A 2HO5A 3ERCA 1XXLA 4GBMA 4QASA 4YXWD 2EL7A 4TMFA 2Y6VA 1RNLA 1N6LA 4ZGWA 4A0GA 4BGIA 1QCZA 1E2EA 1WCYA 2F8LA 3ZDDA 3RJ9A 3KSMA 5BMOA 1U04A 2O06A 1KI9A 1SXJD 2HA6A 1RHJA 3AEUB 1CR6A 2RCYA 3H1PA 3N8KA 1L5HA 5LD2C 1JDZA 3BXFA 2WYVA 2WAXA 4QODA 4O0MA 2FQ1A 2V7QD 3FPGA 2WT9A 2CSXA 5CH3A 2ARKA 3U7QA 4BVHA 3O94A 4M76B 3TG2A 3HSYA 3UBMA 1KK0A 2A30A 3UB4A 3NIFB 2O2XA 3AKCA 4GRIA 1A50B 1H5QA 4RZ3A 3S2ZA 3M6MD 4LYGA 1JDJA 1BFKA 3E9YA 8ABPA 1XPUA 3WYEA 4NBUA 3O3NB 4FGJA 4WVLA 4HFMA 4FFWA 1PBNA 2I6GA 3PDIA 5FI1B 4NMMA 2IYSA 1GTVA 3PD1A 1FA9A 2IOFK 3DFIA 1PWHA 2ZSIA 3GW8A 4AURA 1M2HA 4ZDJA 2O8FB 2VHUA 2AG8A 2X8BA 4MVJH 3QW4B 5FHRA 5IH7A 4YRDA 2Y0CA 3AJ8A 3ND8A 3ZDFA 2HK7A 2XUJA 4P54A 3SVLA 4RAOA 1U0BB 4ITUA 5KWJA 4YB8A 3L01A 5GV8A 3OFJA 5ELXA 5AJVB 1L5SA 3M34A 1YI0A 2X86A 1T3LA 3CLUC 5KYUB 4H18A 4LBYA 1NWHA 3V4LA 9GPBA 2BY4A 2X5OA 3W2EA 1J8YF 5B6PA 5EIXA 4R41A 3EEYA 3EZYA 3CNHA 4WXPA 4M7PA 1GPNA 1PO7A 1Y6ZA 4OKSA 2OCPA 2XB2A 2XR1A 4UTVA 3FFXA 4AO6A 1KVUA 3EW7A 4YMTA 2ZIVB 1FRNA 1P5ZB 2QLMA 1YR9A 2XOXA 2N0SA 3CH7A 4KDEA 4LZOA 2YZ7A 2XMPA 1G3QA 3ESCA 4BX9A 4TL8A 3I5UA 4IWXA 3VR0A 5M04A 3DOIA 5J5CA 2F8SA 4TKUB 2XMCA 1XAHA 2BMFA 2XVMA 2QZ4A 3NHMA 1XA3A 4MULA 1LTHR 5AO9A 3TJZA 1VI5A 4UUOA 1PFWA 4EVSA 3HG7A 2DH5A 3BGVA 1DX9A 3RS3A 5I7OA 2XRZA 3EC1A 3U4HA 2V8OA 5BYJA 1THMA 3Q2KA 5CM9C 1IY8A 5FA5A 3SHVA 4RIEA 3K2BA 5A3SA 3MMNA 1L1QA 1T13A 5AH0A 1OT5A 4M8LA 2DSNA 4FBMA 3IMKA 4YY3B 3EQ8A 2XBMA 1ACJA 4DZRA 5AI9A 3UK7A 1RWVA 3I52A 2H2GA 5FO1A 3WY9A 4EY3A 4NH0A 4LWZA 4E5NA 2HREA 2JZOA 3K30A 3UFXB 3OY7A 3OM0A 3U44A 4HJRA 2QROA 2Q5HA 1W5EA 4O02B 3QTBA 3R7SA 4D57A 3I2KA 1UKZA 4OHCA 3EZ9A 2H2FA 1AS2A 1C81A 3BSFA 4UE3S 1VI6A 3BXGA 3REGA 1D2RA 4EG7A 4C7OB 1REQB 1FRFS 2A9JA 1QB8A 3DEIA 4O2AF 5AHKA 2CV2A 4N0QA 2GKSA 2ZSFA 3UG7A 4C1BA 5CP8A 2JANA 5IVHA 4HMPA 3O84A 4M8IA 4FPXA 3UWDA 3V4RA 1SCJA 1UBTS 2HWUA 4DG9A 1BC5A 2G7ZA 3LKZA 3G1WA 1CD5A 2UDPA 1K3TA 2C03A 5B3JA 3G59A 3TZEA 1UFKA 3K5WA 3NANA 2XGGA 3RHFA 2ASVA 4LZWA 3Q5GA 4MJLA 4G0NA 4XIGS 3WWDA 3FZNA 3WAGA 4CV3A 4O3MA 2PMBA 2P5YA 3IT0A 3T35A 1MQ8B 3U81A 1E2BA 2CZCA 2Y3IA 3D6NB 3M4YA 1XSEA 2X7XA 2W22A 1RACA 3PA8A 5CCXA 5IVKA 1Z7GA 3K9HA 1LLUA 1HM5A 4JCOA 3V6MA 4FLEA 4OFWA 3TE7A 4WY5A 3ZWAA 1GU0A 2WZDA 1RFGE 1DOAA 4TMVA 1N6HA 2SECE 4R5HA 4ZEVA 3ENQA 1L3IA 5AD1A 5CK4A 2L0XA 5HIKA 1ZLYA 2CSUA 1ITZA 4BFCA 2W90A 1M5UA 4L9WA 3CUWA 4DLWA 2AQHA 1SUAA 3RK1A 4WWHA 2QRVA 1Z5GA 3SQLA 1SD5A 3K92A 4YDSA 1TYZA 3A6DA 4G4JA 4IXTA 1F2VA 4KBGA 4K9MA 5EXPA 1PW7A 2O2ZA 4R4JA 2OQRA 2MHCA 4J7CA 4N0DA 1Z06A 4ZOLA 3VC1A 4ND3A 1C4XA 2OBNA 1J7KA 1JMVA 2R7NA 2BFDB 5L45A 4AKSA 1UBRS 2G63A 3DULA 4I9NA 4KDFA 1ZIYA 1QXSA 2NQ2C 2OV3A 4MWZA 4Y9TA 2YASA 1RXVA 2AQ8A 3NHSA 5HKKA 2ES4A 1VSUA 4R1UA 3FNGA 4IGAA 1LV7A 4J0FA 2XLBA 4E4YA 2IODA 2RFLA 1NUSA 2I99A 2Z6VA 4NBNA 5HUJA 3T15A 1FBTA 2M1ZA 3LYHA 3F73A 5E38A 3LLSA 1XD9A 5GGYA 3UK6A 1A8HA 1R0RE 3WI7A 4HAUA 4RWEA 4IIXA 1P6UA 2E5FA 2VTEA 3VSDA 2QTRA 3RGWS 1ZRHA 1A04A 1FS5A 1RI2A 1TAUA 5SICE 1P0MA 1G5QA 3G6WA 1LGYA 1WTCA 4HV4A 3K05A 3MTDA 1N8NA 1AD2A 1SQ6A 3HDYA 1G21A 1Q11A 3H9BA 4NAVA 5DGTA 2G07A 1CEXA 2BUCA 3HUDA 2UYCA 4QQNA 4XR9A 1R8YA 3L0IB 5DP2A 4A2CA 4EF6A 5JSZB 3LV8A 2BFEB 2QP4A 1RAFA 1ZC3A 3UM9A 1W7AA 4B3DA 3AUTA 1GT91 4LN1A 1JEJA 1KIFA 1HT0A 1F4VA 3V1UA 4E31A 2I87A 1N36B 2B1IA 4GI1A 1SVSA 1Z5VA 4NJMA 5JALA 3KAKA 4WOKA 4EA7A 4TV9A 4MGIR 2C7OA 2CVOA 2BPOA 2WT8A 3O91A 5BVHB 5KYYA 4HQLA 1U5BA 3AI3A 3N2GB 1R0SA 3AFGA 1A8PA 4GWGA 3T95A 1FSPA 5C8DA 3OPVA 3A1CA 4KVZA 4XARA 2C2WA 2A33A 1TKBA 4XOUA 1NW6A 3P9SA 5THXA 1RJ9A 1LSJA 1T5LA 4D42A 2G0AA 4YS6A 4BO2A 3SPXA 3M6IA 1CS4C 1I32A 3HWSA 3K8YA 4E08A 3ZCRA 3B53X 3T0FA 2P67A 2LE0A 4Z7JA 3ELBA 5JQWA 1QFZA 2ZJ6A 2DWCA 2QIPA 2WJIA 3EB9A 3F98A 4EZBA 2QGNA 1QLJA 3GLHB 1G3MA 2GFQA 1DQNA 3ZHSA 2XTJA 4EDFA 5E3JA 2NU6A 1SXJE 3L7CA 4V3CA 3GJZA 4I8IA 3ICOA 3CLTC 2CEKA 1CZHA 2ZRCA 5AK6A 4H31A 4BVFA 1OJ7A 4ARZB 4ND6A 4PIMA 3GRFA 4BECA 3UAYA 3WYDA 1HOXA 5AW7A 4NI5A 2VR1A 5DM70 4E4RA 4FDVA 1JYFA 1OFIA 2JJMA 2JI7A 4QAQA 1J09A 3J7TA 4OP3A 3WWPA 2QTHA 4TVSA 1AGNA 2HA2A 1K7XB 2WHEA 1RWOA 4Y6PA 1WMAA 4B1FA 2YJZA 3UH1A 4YRTA 2Q6OA 4CN9A 2VAVA 2I2XB 3BRCA 3LUKA 2B78A 3Q3EA 1NRXA 4D80A 3OIYA 4BBZA 1NQOA 1XLVA 2JGDB 4J6FA 4MUBA 3TPZA 3TAUA 2V6JA 1TW3A 2EKLA 1ORHA 9MHTA 4DR5B 2XVXA 3D8RA 2J33A 2XXAA 2CFRA 1PHPA 3A1NA 3ZY5A 3EH1A 4TWZA 1J4AA 1XKTA 4EG5A 5JR3A 1BMTA 2GAIA 4YAJA 1Q0UA 3LRPA 2KM1A 4JXJA 4QXAA 5D01A 3WGVA 4UVGA 3CX3A 1JR2A 4GF5A 1C7FA 4EY6A 3JQ8B 2P2GA 4F04A 3BZBA 2BFFA 4KOAA 4P80A 5CB4B 2Z8XA 5JNLA 4DLTA 3KG2A 4PCUA 4PR0A 3STXA 2AMLA 4P31A 1C30A 1PQ4A 3VNBA 1XMQB 1BVUA 4PX3A 4TSRA 4EB6B 4G1VA 5JMWA 4LYYA 2HJ9A 1N0IA 3NBFA 2AF4C 3H97A 2V7BA 1DAEA 4XFKA 4K5QA 2XE7A 3LHSA 1BKSB 3OX4A 4KXUA 4DCPA 1I5EA 2OHGA 3ZKWB 4AX4A 1XU7A 2SKDA 2J9FB 3CVOA 2Z0MA 3C3DA 5A4DA 1OYYA 3RHTA 1RE1A 1UANA 5JJLA 3RBZA 2IJGX 2R79A 5EWLA 4QPZA 4FLFA 4IQ4A 1U28C 4PC3A 1AB5A 3MGGA 3L6DA 1XDSA 3TOVA 5KNCD 1U5AA 3UAOA 2J0UA 1DXOA 4RK6A 2FSPA 1SC3A 3DNFA 5LZ5A 4IJWA 3BK1A 1YBVA 5THQA 4XYLA 2DWPA 4US0R 5L4LA 6ADHA 5DXAA 1MABA 4X1YA 1IG0A 2P77A 1PS8A 3IOCA 1FXSA 4PFJA 2CLIB 3U7EB 4ZK2A 2WQ6A 3IALA 2O5EA 1PVDA 4MMXB 3SKYA 1KXJA 4D6PA 3BXZA 2M98A 1P1RA 3D6FA 1QOQB 1KETA 4XE5A 4UTXA 2EATA 2A94A 3EVDA 3PDCA 1WQ1R 4CT0A 2V3CC 1F1BA 2IOYA 1M2KA 3GO4A 4C14A 2GPJA 1ZN9A 3JD0A 2PH7A 1V8DA 5FBQB 3TLXA 2NT3A 4KSBA 4JYMA 1GQSA 1K7SN 2G82A 4B3MB 3IQWA 4CEJB 2F8TA 3GELA 4H6WA 5CBKA 1BEUB 5GGXA 5BQPA 3G8CA 2ZRMA 3HS3A 4AWBA 3MT0A 4MPRA 3QKRA 7AT1A 4P2BA 4UHBA 1CDOA 1TZJA 1IZ7A 2NAFA 1Q77A 1IUOA 3ASZA 2Z4SA 4KYTA 3W2HA 3GDGA 3VYUB 2GEBA 4RC9A 2PL1A 1RP7A 3DUFA 5A2QA 1VYHA 1JEYB 3R5TA 1CU1A 1XTIA 3VKGA 3PNOA 4P8RA 2E2WA 4D2IA 5I4BA 2HDNB 3KM0A 1EK1A 1YZHA 3AEKA 4ZOCA 4KI0A 5BVGB 3MFYA 4Q18A 2PL5A 4DVJA 2VQDA 1MIOB 1KHHA 2MOKA 3NR2A 4BLUA 4F96A 4RNCA 2WSSD 4X9XA 3RVDA 4BNWA 2OKCA 2XUZA 2E4WA 4BP3A 4B7UA 4DOMA 1AJEA 1I6WA 4YRNA 3NH6A 5JPIA 1VRWA 3MJDA 2P9HA 3QKSB 5ICCA 3VR4A 5AI8A 3SFTA 2WJJA 3FMFA 3HZRA 1ILEA 2ZTVA 4Y2HA 2IYNA 4DWWA 5TPWB 1ZCAA 1N0HA 1V43A 4QNNA 1XP5A 1K7YA 1A8SA 2G72A 2OD7A 5SV2A 1BD4A 3KQPA 1QNLA 4U00A 1ICIA 3CZCA 1X7XB 3FB4A 2E4YA 1YFLA 1Y5LA 2XWQA 4GOND 2QXUA 2FK8A 1U9YA 2VXOA 3AB8A 3MEQA 4HAVA 4IFIA 4BKPA 3UMGA 4N1AA 3UH0A 4EB3A 1P7CA 3C97A 3GLTA 5C2JB 3WBJA 2H1IA 3EMBA 2CYCA 2H1HA 4PG6A 3AINA 5AQ1A 4MR8A 1MD9A 1ORTA 3S8MA 5IEJA 1IWPB 3L7OA 4D79A 3A32A 2C59A 1MCZA 1H0KA 1N6KA 1V16A 1EK6A 3F46A 3P7MA 4QOFA 4JVOA 4R5MA 4WDQA 1WVGA 2WJHA 4JEMA 3TZ6A 2GK4A 4ROSA 2XGMA 4ZMBA 1KWGA 3IIIA 5EIWA 5EXEA 3T5BA 5EMNA 1PR9A 3RSQA 4LUCA 3WIBA 4BDTA 1FFYA 2Q07A 4ZANA 3EFHA 3JQRA 1YR2A 4MWEA 5ILGA 4H7PA 1DC6A 2QS9A 2GZHA 4HWPA 2W2MA 1U6KA 3WBFA 4F6CA 5JATA 3E8XA 4GLBA 1YZGA 2FLVA 2XNKA 4PPNA 4JV5B 3RVRA 5IDXA 1Y5RA 4XR4A 4Y2QA 1RSZA 2N1BA 5TJHA 2P2YA 1N2OA 3QVUA 3ESXA 1T3SA 3GEGA 1SEPA 4XVRA 3RYHB 3T7CA 3TIFA 2I0FA 1JHDA 1E32A 3V8RA 3B1VA 4IH1A 3W77A 3RC7A 2EYQA 5JS8A 1TQ6A 2TMDA 1V1RA 3K9NA 3KU4A 2CGEA 5EQFA 2J3JA 5DK4A 3MBKA 3TD2A 4BUCA 1EG2A 2XUIA 1CW2B 4L7VA 4P3YA 3OZIA 3CC8A 3L02A 1GSAA 1M76A 3OICA 5L95A 2IBMA 2WG2A 4GX0A 1V5FA 1RAEA 2WINI 4OQDA 4BOYA 4K6GA 1LZKA 4K0RA 5TPZA 3DDNA 4QJ5A 3P71T 3UUFA 1Z4KA 6ABPA 1YVPA 3KR1A 5HM8A 5IXYA 1UXOA 4US1R 3IDAA 1B74A 4XJTA 2FCAA 1FXWF 2BSQA 3ER9A 4AXXA 2VNAA 5AHXA 3FPCA 5IF9A 1FFGA 2I71A 4NZZA 2FWJA 4Q00A 1PYDA 3G8DA 1UQRA 5HGJA 4QKQA 1NVEA 5L3RA 4D9FA 5F7XA 1M8FA 2WSMA 3BGOS 2Z4TA 4D8WA 4LZLA 5D5HA 1DZIA 4H6PA 4O2AA 3NRCA 3TE6A 4A15A 3DHVA 3S40A 4JCCA 4NG4A 3EJWA 1PTJC 1H1DA 2HQBA 4X41A 5JSUA 4ZYYA 1BJTA 1NPYA 2FEMA 3BXEA 4MQ6A 4KXLA 3ABSB 3WLEA 5LLTA 3AUFA 1LWOA 1GQ2A 2PYDA 5A5EA 3D6VA 1W6RA 1E2FA 4LRTB 1SBYA 4N5HX 4FGZA 1IFXA 2NM0A 5FI3A 3GLRA 1VHLA 4LXTA 5AKLA 4MV6A 3S99A 2ZJ1A 4AUKA 4OM7A 3LKBA 1MP0A 3T34A 2BZGA 1QO0D 4XLTA 4D9BA 3OIUA 4WZZA 1ECCA 1PJBA 3DNMA 5TGDA 4EW1A 3BRSA 2O2DA 3MT7A 1R18A 4OGKA 3PPYA 1NURA 1JV2B 2GPNA 3TINA 3UATA 1O6CA 4YRMA 3TG8A 2IIBA 3NRBA 4RHTA 1SHUX 3CLTD 3K9LA 4IX1A 2G9NA 4FT4A 3QOWA 1A4IA 4I6GA 2J85A 3G2JA 1KYIA 3C6KA 7ABPA 4KDCA 1GD1O 4RKYA 4RVFA 1V9SA 2Z4RA 2YIDA 1YE3A 3EGWA 3RYFA 3UT5B 3EF1A 4E11A 1GYRA 4JOQA 4RKFA 4Z7OB 1XJWA 1E94E 4QM7A 1LDMA 1OLSA 2X0NA 1GEEA 1V3UA 5DM1A 4CEIA 1BMDA 2BHTA 1HQDA 1N2JA 2ZRLA 4GXTA 1G6HA 1SBQA 4FDLA 2I34A 3LZ6A 4JKYA 4L6CA 4M0LA 1WIWA 3AIOA 3ZEIA 2OCGA 3KXLA 1CHNA 1VPLA 3U0VA 1NKVA 2CXRA 2HBRA 1TJ3A 1CDDA 3O7MA 3CNLA 1O4VA 4ZZ2A 4BQNA 4GYWA 1KRXA 1QFJA 4TLCA 2ZYVX 2BKAA 4XM2A 1BVHA 3I83A 3WE7A 3QVKA 4G4SP 1QZUA 2E5WA 4BO5A 1N9GB 2D8MA 1YQDA 4OA8A 4RZQA 4E3WA 2CFSA 1VPVA 4H15A 5SZKB 3SYMA 4NAHA 3EPLA 5JWHA 3TTVA 1JEAA 1RAIA 1Q1BA 3KZVA 3P2KA 3PNMA 3EA5A 4R1OA 5CVCA 3DYBA 1V7CA 3JQAA 3LBHA 4BO3A 3N6RA 4EEKA 3EDMA 4W5NA 1VCHA 2FFBA 4M49A 2QXTA 3QMPA 2TMGA 4BJ1A 4B33A 4QO7A 2H5JA 2K5UA 4YV1A 3PQ3A 1OUMA 1W5SA 4TWAA 4NICA 2NP6A 2HEIA 5E7JA 3AP2A 5EQTA 4EUHA 5J4HA 4LDJA 3OQ6A 2CV0A 2D7CA 3EA4A 5ADUS 5K0CA 4FR0A 4HFNA 1NV8A 1G3IA 1G8HA 4WCFA 1VLMA 2VPXA 2Z6AA 2BE7A 2O8DA 3FYDA 3KYDB 1IWOA 1OU4A 3ECSA 3MAJA 4I1RA 4BN5A 3COSA 3U1BA 1MJNA 1YB2A 2RH5A 3MW8A 3NEJA 2L42A 1ZM9A 4JLKA 4WKNA 3EIHA 2OPBA 4CFSA 3U7IA 1G66A 1O1YA 1XLUA 2EZ9A 3JVUA 3FZYA 4Y6GB 1TCAA 1YQWA 3L5OA 5KO2A 2D59A 3AR6A 3DKKA 4XZ3A 5DM4A 4R9SA 2ZJYA 4H77A 4L75A 4DWVA 1C8VB 1Z37A 1AV7A 3K9GA 1MXFA 2FEAA 2E0IA 3LY5A 4EHBA 4LHYA 2F7SA 4W5TA 3S28A 1G18A 3GZTB 4WTOA 1R74A 2B3TA 1MXHA 1JW9B 2X4IA 4DLBA 2DR3A 3IEPA 5J5VA 3V42A 4EMTA 2PYZA 3N2KB 4LSZA 4B87A 3ZZUA 3N5KA 4OXKA 1GNLA 2YDXA 1JKJA 1XVIA 3FSGA 2AYXA 1TTTA 3BL8A 2HJSA 1VFPA 4PG8A 2HJGA 4GBED 3EUAA 1Y80A 3KUKA 4RTMA 1QH9A 1XMIA 2X0DA 4Q1BA 1ZJ5A 2PMFA 2Z57A 3B1ZA 4F38A 1MT0A 3CEPB 3IIEA 5K3CA 3QELB 4CPDA 3N8GA 4ITVA 5LBTA 3ZJTA 4KYUA 3ODPA 5DYNA 2RHTA 4AS1A 3G9UA 4EW6A 1PKXA 1U3GA 2ZS9A 2PNJA 2BDUA 1Q20A 3QPVA 3QTLA 3N07A 1AGXA 2YHAA 3EEIA 2P9BA 3AEQB 4FIDA 3RFVA 3U7HB 5BQ3A 4HZUA 4N0MA 4MQFB 2IXEA 2A5FA 1CPYA 2IA5A 4OB7A 5I9SA 1KDPA 3ZIAA 4YYZA 5I5EA 3QK7A 4DCTA 1OH8A 3JD2A 2GK3A 3H9CA 1Y48E 1I30A 2V7VA 4FN5A 3RTGA 3L49A 4N18A 4QATA 4TRMA 3R8CA 1A3CA 1ISJA 1KORA 1SXIA 2YMQA 3FUCA 3DQPA 3IP7A 3QKTA 4P4UA 5BW6B 4MUJA 2ZIXB 1SKQA 2AKEA 4BFTA 5BSVA 1YRBA 2EHDA 2Y0EA 1JX6A 4NQZA 4QUAA 5G4KA 4BQEA 1YOVB 2NVWA 4DNOA 1QR2A 3AW8A 3ETLA 3CZ5A 4YH1A 4BRZA 2B9VA 5ELMA 1DJMA 4NP6A 3IA7A 4J0GA 1UXKA 3NIDB 4I3GA 2DETA 5D2CA 3TX2A 3T0GA 2XUKA 4KACA 2SNIE 2XNDA 3C3XA 5CB4F 4PQRA 3N70A 2AQKA 3OG9A 1X80B 1YDEA 3LL7A 2FN9A 1PK7A 2JFNA 2OZVA 2XHZA 3W3AD 4F3RA 1PR1A 4EI7A 1I1OA 5A2GA 2PUDA 4KPGA 2VJMA 1ML3A 1U2SA 4L4XA 3F90A 4I1PA 3EC7A 4IINA 5A9TA 5DGCA 3EG9A 3ODGA 1JT9A 3F9CA 1AZWA 3HVHA 3L7JA 3AF6A 2O2GA 2IX3A 3Q1LA 2GBIA 5F7JA 1WZ2A 3HR4A 4C03A 2I6XA 4FILA 4NEGA 4NZPA 1EEXB 4LFCB 1GV1A 3WZMA 3WLNA 3OEEA 2PLAA 3F96A 5E7MA 4NWIA 3JAWA 1U3VA 2CWDA 3BN3A 4GP7A 4ASUA 4MZDA 2YY5A 1D03A 3A27A 1GYQA 1ZPDA 9LDBA 1D2MA 4UBKA 4MAMA 1MFZA 3WLFA 4RAQA 1EK5A 4JNCA 721PA 2C04A 3ZE0B 1GCGA 5JAOA 2EOAA 1JALA 1RHRA 4AJPA 2WD8A 2C3UA 3FUWA 4C87A 4FWTA 2PGDA 1PE0A 3HQ4O 4J43A 4L3WA 3CIOA 5LLSA 1B7GO 1DUSA 3NNDA 5D3ZA 1ZVJA 3NATA 2B1QA 2WWHA 1LK0A 1OHHD 1PFQA 3FTCA 3HB1A 5E2BA 5U4XA 3JRWA 1VE5A 2NTVA 2JH9A 3COZA 4J0EA 5A3QA 3VKWA 1YASA 4RM2A 1CIVA 2KWIA 2D2EA 3G02A 1SWWA 1L5LA 2MSDB 4NKRA 1XTBA 2ECOA 4YRPA 4Z6KA 5A9SB 1E3MA 1E7RA 2P35A 3BB1A 4RCZA 1RAGA 2VAXA 2Q4OA 4KK3A 1O96A 1WB5A 3G5LA 3INNA 3VHXB 4IXMA 4V0NA 4X7MA 2P1DA 3QMWA 5FTKA 3VR5A 3WK7A 1W2GA 5FF9A 1WPRA 3FNBA 1LDEA 1HBJA 1SOVA 4WZBB 1O5TA 2F43A 1PZHA 1SU7A 1WUYA 2VEDA 1X7YA 4G0PA 1WBBA 1J9EA 2FZLA 4RXMA 4BJ3A 1ZEMA 1MW8X 4QU0A 5BSGA 3F8WA 3UANA 3O4VA 4IDAA 4OSPA 1C3OB 4BTEA 1QH8A 2QN9A 1C7ZA 5HQTA 2I6SA 1LC3A 1KI7A 3HVRA 2PRIA 2EIXA 2R68A 3LXMA 4QL3A 4LKOA 3X2FA 4NZYA 3DHYA 4AJIA 1IQRA 1T35A 4BYGA 3I05A 4LDRA 1DIGA 2NO0A 4X7BA 3VR1A 3GA5A 2ZBEA 4ATNA 4CU5A 4XQ0A 3FDJA 4OMCA 3JASB 3MWYW 2DYKA 5J58A 4BP1A 4JBGA 2EJTA 2OAP1 4ZD6A 3GQBB 4A7PA 4JEHA 3HO1A 2GN6A 2C1XA 2X3FA 5JRJA 3DBIA 4LXXA 4TS1A 1Y4DE 1A5ZA 3WC4A 2QUIA 3F74A 3R0VA 4NCKA 3ZWWA 2IH2A 4JB8A 1C7QA 3M3HA 3O8CA 1GGJA 3IVCA 3IOEA 2PSFA 2QD3A 3V1MA 3NPAA 1X1CA 2PT6A 3Q5EA 1E8NA 3TAXA 2I9PA 3MIZA 3R1IA 4WOJA 3SHQA 2ZBQA 2HOQA 2DLNA 1C1DA 3L79A 4K9QA 1UPCA 2N9UA 3S44A 1X9HA 3UV6A 4BTLA 1GUDA 2HDOA 2BH2A 3FX2A 1GUFA 2JF0A 2VHTA 2JRLA 1AN9A 1P7ZA 3OIGA 5EHGA 1TMYA 4NATA 1TK9A 3OLZA 2OHHA 5B36A 1OLXB 2ATIA 1ZMRA 1TM5E 1XRQA 5IJ9B 4P92A 3A3YA 3IT1A 4M9CA 1DMSA 1MC4A 4JUBA 3RNLA 4QUHA 2A5JA 1EFVA 4Q4JB 4TRRA 1NUPA 4E5YA 2GYYA 4BE4A 4DIDA 1T8YA 2XYPA 4DMRA 3PF9A 4KYIB 4DRXB 4IICA 1ZEJA 3KZNA 4MHOA 3K8OE 2G08A 2V1UA 1IBKB 5IBRA 3WHLA 4GPZA 4KR6A 1ZLXA 5LBUA 1P1HA 1KZ1A 2PCLA 2XRFA 2QQEA 1D0IA 3Q7RA 4PHTA 5EA2A 5CFOA 1OC2A 4AMYA 2P62A 3KYCA 3MCWA 4RF3A 5CH5A 3WHKA 4ZHQB 2JAPA 1NYLA 2H2DA 2V9ZA 1NC1A 4U1RA 5HOEA 5ICEA 2QVXX 4IFTA 1I51A 4BO9A 1AVTA 2E48A 2DM6A 2Z9BA 3QF4B 1SC1A 2KJQA 4OI0A 4HK4A 4IFEA 4OHPA 4J0QA 3ZOKA 4NOLA 1DX4A 3VOBA 4QZVA 4UUBA 2WKQA 1RQXA 3T54A 2I55A 1EGAA 1BA3A 1XMJA 3E0QA 3BIOA 3EEQA 3RRJA 4D82A 2VXBA 2HHHB 3UFXA 3HBAA 2QLTA 2X6QA 4FD3A 4BE7B 1U7TA 4B79A 3IPXA 1AKWA 1CKEA 4PCVA 1YC5A 2F17A 3ZDAA 4JI2B 1PJ3A 4MYUA 1AXRA 4IZOA 3FNEA 1D1SA 1O89A 3E58A 4X1IA 3SZLA 5HKBA 2EZ8A 3AR2A 1VYVA 3QF7A 4WE3A 3HPQA 2R96A 3ONFA 5EJ7A 3L6RA 1GZ4A 1HDXA 1KYXA 3VPHA 1CLEA 1CUGA 3CSUA 3RAFC 2NWQA 2H31A 2PR7A 4PX2A 4DDTA 2PZBA 4UU8A 1WTAA 4P58A 5IG2A 6LDHA 1KSHA 2EBHX 1APBA 5K0ZA 5CVUA 4EA9A 3O93A 2TS1A 3KTAA 1T5BA 2K7ZA 2AG1A 2WA1A 5C5IA 1GPWB 1WW8A 4I5GA 3D0RA 4MGEA 2XF8A 4W8HA 4JIGA 2FETA 2IC5A 3UT0A 3F3SA 4AT1A 4CFZA 4A0RA 2RGXA 4C2UA 4PAOA 3GPIA 1C4KA 5FEUA 4HDQB 1Z5OA 1F0PA 1PSZA 4H60A 1W8IA 4RS3A 3RC3A 4D5GA 1T2UA 2PLRA 2YVLA 4EJ2A 5KNLA 4OOFA 4TTTS 5DHQA 1S3GA 2BFOA 3KZOA 5HW0A 4L16A 1E0AA