1P5RA

Formyl-coa transferase in complex with coenzyme a
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
427
structure length
427
Chain Sequence
TKPLDGINVLDFTHVQAGPACTQMMGFLGANVIKIERRGSGDMTRGWLQDKPNVDSLYFTMFNCNKRSIELDMKTPEGKELLEQMIKKADVMVENFGPGALDRMGFTWEYIQELNPRVILASVKGYAEGHANEHLKVYENVAQCSGGAAATTGFWDGPPTVSGAALGDSNSGMHLMIGILAALEMRHKTGRGQKVAVAMQDAVLNLVRIKLRDQQRLERTGILAEYPQAQPNFAFDRDGNPLSFDNITSVPRGGNAGGGGQPGWMLKCKGWETDADSYVYFTIAANMWPQICDMIDKPEWKDDPAYNTFEGRVDKLMDIFSFIETKFADKDKFEVTEWAAQYGIPCGPVMSMKELAHDPSLQKVGTVVEVVDEIRGNHLTVGAPFKFSGFQPEITRAPLLGEHTDEVLKELGLDDAKIKELHAKQVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Formyl-coenzyme A transferase
publication title Formyl-CoA Transferase encloses the CoA binding site at the interface of an interlocked dimer
pubmed doi rcsb
source organism Oxalobacter formigenes
total genus 131
structure length 427
sequence length 427
chains with identical sequence B
ec nomenclature ec 2.8.3.16: Formyl-CoA transferase.
pdb deposition date 2003-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02515 CoA_transf_3 CoA-transferase family III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1540.10 Alpha Beta 2-Layer Sandwich formyl-coa transferase, domain 3 formyl-coa transferase, domain 3 1p5rA02
3.40.50.10540 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Crotonobetainyl-coa:carnitine coa-transferase; domain 1 1p5rA01
1XVTA 2G04A 1XA3A 1P5RA 2GD2A 1PQYA 1T3ZA 1XVUA 1XK6A 2VJOA 1PT7A 2VJKA 2VJPA 1X74A 2VJNA 2VJLA 1XVVA 2VJMA 1PT5A 2VJMB 1Q7EA 1VGRA 2GCIA 2GD6A 2GCEA 1T4CB 2VJQA 1T4CA 1VGQA 4ED9A 2YIMA 3UBMA 1XK7A 1PT8A 1XA4A 4HL6A 2GD0A 1P5HA 1Q6YA
chains in the Genus database with same CATH superfamily
3KYJB 1XIVA 4KODA 2J5KA 2O8VA 1VZ2A 3TRIA 1O0SA 2DHRA 3QBEA 4F91B 1BJTA 3EH1A 3LKDA 4FGJA 1VCIA 2CFOA 1ZGGA 3FMGA 3CF6R 3PWSA 3COSA 1V2HE 1PKXA 1J7KA 1H2RS 2Q46A 3CSDA 2J3HA 3UIEA 3ZHYA 4OLHA 4HGZA 5D3MA 1WZEA 4RD6A 5P21A 1CQIB 1NAHA 3W3AA 3DTVA 3VKHA 2QQ5A 1PJQA 3KCQA 4MZDA 3FWHA 1YAJA 3NHMA 5T6BA 2WWIA 2HR1A 1UOEA 4I1PA 4ENRA 3JASA 3AUJB 4KBYA 4N3GA 4S2EA 3ZIUA 4EFNA 4RTQA 4JI1B 6GPBA 1Q20A 1Y5IA 3U3MA 2K7ZA 1A71A 3FJOA 4U63A 1Z0KA 3I0MA 4GLBA 1O96B 1CQXA 3DQQA 1CT9A 5BRNA 1ZNXA 1N8TA 3RUAA 5IANA 1JEQA 3EZNA 3MXOA 4LDRA 2VJBA 3PUHA 4MR8A 4IIHA 2P1RA 1KZ6A 1PBTA 3TQQA 2OR3A 3A4LA 4I5IA 2FSIA 2FW0A 3DOFA 3AR7A 3QIVA 1NLYA 4O4JB 3FSGA 3WGHA 1T3HA 3A9RA 3G7NA 2C54A 1C80A 3EA5A 3TOSA 3VSBA 4Q4CA 3QNWA 2NIPA 1QONA 2YRXA 1GGNA 1SZCA 2NV6A 2RC6A 2YJ4A 4GKVA 4L6CA 3CZ9A 4FEAA 4BO8A 5AVUA 1P6QA 2WW8A 3QXHA 4EG4A 4FNMA 4PW0A 4N47A 3HFJA 4GX5A 4L75A 5L7WA 1NVFA 1ZVKA 3WYFA 4M36A 4G5YA 1YB6A 2NSLA 4RDXA 5EA2A 3VDNB 1KPIA 1EDZA 2CLLB 1WXDA 4LPSA 3AVYA 3ERCA 2OOKA 5HHTA 4JC0A 3NDBB 4OQXA 1QRTA 3DTTA 4Q4AB 4KWTA 1KSHA 5EMKA 1ELOA 2WBLC 3K05A 4KZKA 1L5GB 4ZPJA 2PBZA 3W5VA 1CHNA 1AJEA 2GGSA 5AM1A 5DM70 1JAZA 3AOEC 1VC2A 4I9GA 4IIUA 3LCCA 4D26A 2CW5A 3CKLA 3KK0A 4K6OA 3DBVO 3TM4A 1L9KA 3Q12A 4WXHA 3TZCA 2XNJA 3V6LA 1ZY2A 1Y0BA 4MUYA 2DPMA 4NVRA 1ST3A 3T0GA 3VR4H 4XJXA 1UQUA 2FN8A 3D6VA 3TZHA 3UJ9A 1FNSA 1H65A 2BHRA 3RS0A 4DLZA 4ZI7B 4ZJZA 5LYJF 3HSKA 5HIJA 2CUNA 2Q7DA 1DTEA 1MP0A 4I6GA 4ZOEA 4IF6A 2AF3C 3L06A 4GMDA 5A5DA 1DHRA 4GHWA 2QRNA 5BY2A 5C1DA 4X61A 1KERA 2V7BA 5IG2A 1GADO 1GG5A 2ZVQX 4QDKA 4R8VA 5E2AA 5EEGA 3ETCA 4DIKA 4GI1A 1SUFA 4INZA 4O2BF 3C3JA 2PVSA 2QV7A 4Y1EA 3WV5A 3E9RA 5LNK6 3C8MA 1DNPA 3D3KA 4QXAA 1AGYA 4UD2A 4TZKA 4C5CA 3MTIA 5CT8A 3WXBA 3R5SA 4PZPA 4B3TB 3PIRA 3R7WB 4D8WA 1PZNA 3KPWA 4YRQA 1YCHA 1N2CA 4DCCA 1SA0A 1Z8DA 2XYGA 4LRYA 2B9VA 2J9RA 3ICQB 2DR0A 3VI4B 3AM5A 1N9GA 3MCVA 4I1VA 4BX9A 3W5UA 3R2JA 2J0QA 2W2LA 3A6JA 4NCHA 1AUOA 3WB0A 3F9CA 1ZPDA 5LQJA 1UC9A 1YU9A 3D4NA 3TDNA 4DLBA 5I01A 5JE8A 1HC7A 1XRJA 4IILA 4JJEA 3DVRX 4J3JA 3UK7A 4BC0A 2IE0A 3SE0A 3DEZA 2QE7D 1HWYA 2QF7A 2V5AA 1WTCA 5EUMA 3T9DA 5A0VA 4BVJA 1G8YA 3QYAA 5EKUA 3ZOKA 2A94A 4DRYA 3PC8C 3QJ5A 2X13A 1UMBB 2ZIVB 3OURA 4GPTA 3PC3A 1JA0A 4NZNA 2EP8A 4QARA 5JJBA 3D2BA 2JIZD 1KYWA 4MVJA 4BZXA 3CLVA 4PPQA 1E4EB 1Q22A 2AEEA 2GPWA 2VTKA 4OXQA 2WSIA 4HAYA 4MEBA 2ZRBA 2C3UA 3U9TA 5L4LA 4QUHA 2ZJOA 2HCFA 1EX7A 1W6RA 2ATIA 3DAYA 3O4HA 3P4YA 3WRYC 4JY7A 5IJXA 2BFBB 2IZ7A 3O1JC 3VTKA 9ATCA 1QWOA 2O54A 5CAEA 3TNJA 4Y7CA 4M6WB 3KV3O 3G9ZA 2DRIA 4MLDA 4PR3A 3QVUA 4MQFA 2A9VA 4RGQA 5BV8A 1Z08A 3MBOA 4JX8A 5FO0A 4B8WA 1ISFA 1E2LA 4CG3A 3B5JA 1Y6GA 2FKAA 2JFXA 3B82A 3H1BA 1W49A 1WS6A 3WP1B 1MO3A 3PNYA 4LDZA 5I5GA 2J3IA 5K3CA 1RM5A 2D4HA 3I1YA 3ICVA 1LLQA 4KR0A 5GPBA 2X4LA 1D1SA 2CHUA 5EHQA 2XDQB 1YQDA 1HNWB 1HG0A 1II8A 3JPYA 4AUKA 2DQYA 1YRBA 1K98A 5EE1A 5JFGA 2ZYSA 3MA0A 3T94A 2PANA 2Q1WA 1X14A 1XO1A 3QJYA 3A58B 4TMXA 3TR5A 4TTTS 3GNTA 1WETA 1Y8QB 3KB6A 3ZJVA 5TPZA 2ZU0C 3QEOA 3S68A 3J7AC 3Q5EA 4RD1A 1P1CA 1PKEA 4FHFA 4RWZA 2JAQA 3SK0A 4EI9A 2ZR7A 5FF9A 3A06A 3EVCA 3OJCA 3RS7A 2PGAA 1LBIA 1O6GA 1QTNA 2IELA 5EJEA 4DDKA 1OIVA 1XA3A 3ABIA 1F4VA 3AUAA 3LUAA 1LBQA 3H4MA 1DXYA 3R5TA 4N7BA 1QRSA 2RGNA 3R7SA 4AXXA 3M3DA 4H1WA 1N5RA 1DVRA 3AXSA 3P2IA 5E3HA 1B8UA 2WD7A 2NU9A 4TTVA 1ZVMA 3E6AA 4FS8A 3PPYA 4ZHQB 3RUEA 3SZGA 3UGQA 3P26A 5I7OA 1MOZA 2FPIB 2CLMB 1EX1A 4KQEA 5CDTA 1MG5A 2C0PA 3K31A 5DHTA 5K01A 3BGIA 1YUMA 2AFHB 1JIIA 2YNMD 4GGMX 4OK6A 1BDJA 1FUKA 1IY9A 2O14A 4RKEA 5AJVB 5B7PA 5EJ4A 1O08A 1QYIA 1RLTA 1T8WA 5EP4A 7ABPA 4FI3F 2VTEA 3ZTTA 1WZUA 4BX0A 1H4QA 10MHA 4RMHA 3AR2A 2WLTA 4YVFA 4AJOA 5K45A 1R88A 3KSDO 4HYQA 1AA9A 1PI3A 3ASZA 1AUPA 1QHIA 1SC1A 2GARA 2ZKIA 3RK1A 1CQJA 4ZC1A 1Q0QA 2POQX 2P7HA 4OQLA 1AQYA 3PL1A 2VHXA 2EU8A 4WK2B 3RH0A 4UFPA 1KA9H 1HNNA 2L82A 5TMEA 4KQWA 4E1VA 1K86A 5HBRA 1MKYA 2AVDA 4YRFA 2BJVA 2PSDA 2VHZA 2P40A 3WK8A 5JXWA 2KQUA 1PT9A 1YQUA 2HWUA 5BUCA 2WJZB 1S3FA 3O21A 3L7LA 4QPZA 2GPNA 4J7AA 4LJ4A 3O95A 4HX2A 2V6BA 2RIRA 2ZI7A 5EUBA 4AMUA 1MB4A 5BWNA 3OQ6A 3E22B 1HTTA 1R37A 1T5TA 3JD3A 3NRCA 1RTKA 1WR8A 2YN0A 3PQDA 1V4BA 5F33A 2M6KA 3P2YA 4HDSA 4G9EA 1JHVA 5F3DA 3OEWA 3MJHA 3VC7A 4NONA 1QFJA 4EHNA 4UZSA 2YW9A 5HCIA 1UJ5A 3HXOA 1DKNA 1US8B 3A8TA 3I8XA 3RCBA 1RLIA 3CTPA 5A5GA 1M5RA 4DGQA 1FQJA 3T5BA 4RACA 1CDEA 4FUTA 3OIVA 4FDAA 5DKFA 3TL6A 1LPPA 4WDRA 4RVSA 2YY5A 4MINA 4N8SA 5JCOC 1C9YA 2DKNA 5A2GA 2H5IA 3UWPA 2ORWA 4NZ9A 4C4PA 1HOXA 3DD1A 3UN1A 3DW1X 3TAUA 2BKVA 1EZZA 1VMDA 2AK3A 2ERXA 4LV6A 4MWZA 3D3EA 1WSAA 4PGFA 4NC9A 3IBCA 1XTTA 2RBGA 3DDNA 1SUCA 4D0RA 1JQKA 2PRKA 2WAYA 2IYLD 3O91A 2X2PA 5CT5A 5E1BA 1PG5A 3LYHA 3GWGA 4I50B 4I55B 4QPJC 4LBZA 3OQNA 5DMHA 5ALEA 2QVCA 3BXZA 3N86A 2XIQA 4K1LA 1LPAB 2C4NA 3SDSA 2IIQA 2JJ8A 3W5HA 3L4JA 4DMKA 4I8IA 4DCSA 3IEMA 1AMUA 5E6RB 4J1QA 1Q3KA 3AK4A 1JHUA 1C81A 4UAGA 4HNVA 1Z35A 1XZAA 3PDIB 4NPAA 4LQLA 3FTEA 1AM4D 4ZOCA 2EL7A 5IWAB 3A6FA 4BDTA 3PXDA 5D6NA 1OW3B 3L3BA 1MIOB 4R40A 1EFPA 5ICFA 3BIXA 3WMRA 4X62B 4ZYTA 1DEOA 3QLJA 2FKNA 1GGMA 3CVJA 5IHXA 5KX5F 1I7QB 2PD3A 4PTLA 4GM0A 2DETA 1VIDA 3EN0A 2XF2A 1JXQA 1FDTA 3CBGA 3COVA 3CZMA 3GYBA 3VV3A 1O97D 2AGVA 4ALKA 4ZYZA 4CEJB 1H1TA 2GN4A 5AFSA 1CY8A 4PGHA 4TWAA 1D07A 2WIFA 2JLYA 1L6RA 5TPWA 2QK4A 1HYBA 2VK4A 3OTWA 3JQAA 1II0A 4WESB 1SXJA 2WNHA 3CVOA 4C4AA 3R3XA 1GCOA 5MF6A 1Y3IA 4F5EA 5JYEA 1Z73A 4QTTB 4Z53A 1QJCA 4DZTA 2QROA 3EGEA 2EP7A 4JH0A 3AR9A 4QQ8A 4TLBA 4YMLA 4JFRA 2YWDA 2BTQA 3QVJA 4DXDA 1T9KA 3T7JA 4LOJA 5EUQB 3KTFA 4IFIA 3SIPA 3PJGA 2D5BA 1I7PA 2J0UA 3WWCA 3FXAA 4FE7A 4X1IB 3EXIA 3HRIA 3NEAA 1WDLA 4YP7A 3VOSA 4DLRA 3WLAA 3RHSA 4FMCB 1L5RA 3N2YA 1X80A 4OQZA 5HW0A 5LQDA 2XBMA 2IEYA 1CY4A 1J9EA 1P1KA 2O3QA 1FYEA 2ORIA 5IDXA 2P8JA 1OGYA 1EGAA 3DDZX 4CIAA 3A2MA 5AW0A 4LZPA 4C06A 1O4WA 2AG0A 2I9KA 1AX9A 1BVYF 3QLVC 2NZ2A 1G63A 2X41A 4ZKEA 2FW8A 2VK2A 4IO1A 1SCDA 3TZEA 1IDOA 5F98A 2W2KB 1F8UA 1QG2A 5FQOA 1WE2A 4TZ6A 2W6JD 2PLAA 2GA8A 5ESWA 4IIEA 5HGJA 2Y76A 3W6PA 1PE0A 1TU0A 2EZTA 1K97A 1R1DA 3F7TA 2BC9A 2VC2B 1R0XA 2ISSD 2NYVA 2DUNA 4KNVA 3EZ6A 2B35A 3K70C 1GPJA 3NBUA 4EB3A 2OFXA 4PVCA 4UXIA 5C2JB 3JD2A 2RGAA 3BMQA 5EHNA 4OSOA 4PSDA 4EB6B 1SUSA 3B52X 1Q77A 4BNVA 1A82A 3C3DA 4XB1A 2EIHA 1I51A 1XROA 1J20A 3GFVA 2PR2A 3UJHA 5JG7A 1LV7A 4A2CA 3A4YA 3SLKA 1QYDA 5LP1A 2OB1A 1MH1A 1AZTA 2C9MA 2QLNA 1BE8A 3UHFA 4DLXA 2FWMX 5TT1A 2H92A 3CISA 4S1NA 3UG6A 2PUEA 3RARA 3VQTA 4ZI3A 4P4UA 4BLTA 2ZSUA 3K9CA 2GZAA 2F1IA 2M1XA 2H0AA 1ZC4A 2VP0A 3HGQA 3L07A 4QOIA 3VR4A 5CB4A 3WMXA 5CFLA 4U8GA 4WBSA 3WNVA 1XTJA 3Q6MA 1Y6ZA 2C4TA 3CRNA 1MIHA 3WLIA 4A6EA 1P19A 4ESHA 5A4AA 1ZVVA 2CL5A 2HEGA 3RRXA 5JLAA 1QAQA 1X13A 2GF0A 2IQIA 4JVLA 1B41A 3USES 2I6FA 1IXSB 4CNQA 1AMNA 3G5AA 3I6YA 5HZKA 4MRMB 2B7CA 3VU1A 1M2EA 5C7IO 2ZT6A 4K46A 3ONEA 2HLPA 4KFTA 3EY4A 4AY6A 4CPDA 1YQEA 3AU9A 2GJKA 2M6SA 2VNHA 1KI6B 3AVUA 4ZREA 2H29A 3GMTA 1OFTA 1D4AA 5ECGC 3A9TA 1IJBA 5A1JA 1QXSA 2H8KA 3WZMA 3EVTA 3GUCA 1HLPA 3PCXA 1BD3A 5TQJA 3QUBA 2JIRA 5B36A 1DO0A 821PA 3DUFB 3MYYA 2X5KO 3LX5A 1QYWA 1W2GA 4W6QA 4EJSC 4C7OB 1OD6A 3GY0A 2NZWA 1A7AA 3HN7A 3U7HB 1LVHA 2QTCA 5GZ3A 4G5RA 2P3LA 4OB8A 1YONA 3KWLA 4H4EA 4Q00A 3OT5A 1Y9ZA 2Q5OA 1MO5A 3O3CA 4YHHB 1CZRA 2F1OA 1H3FA 3ECAA 1JBKA 3QW4B 4CG0A 1CRQA 1CY2A 4RV9A 5EY5B 3SSMA 5A05A 5IZCA 1GO2A 2RG7A 3P9NA 1G3QA 1CJBA 5FBHA 3STVA 2DHEA 4AROA 3VKGA 4N7MA 1E2MA 1BWPA 1YDMA 2J5BA 4DMLA 1Z34A 1R4ZA 3F4BA 1G7RA 4KE7A 3HLTA 3LPNA 4CE6A 3DZ8A 5B1SA 1TAGA 1R9MA 2GX6A 1Q0SA 3V00A 5KEIA 1E3WB 1ZI9A 1NVMB 3JRWA 1Z68A 4E33A 1C8BA 1M6YA 2ENWA 2ZSDA 2I2BA 4O4LA 1PCXA 1XVAA 4UHEA 4X1KA 1E1RA 4HUJA 5KHLB 4CLDA 4QG3A 4YJHB 2DH5A 5IT9A 1RI2A 2RB5A 2JAUA 4WUTA 1YR1A 2X5XA 5K4HA 3KOUA 3RYIB 1V5IA 3LUPA 2DT8A 4JBIA 4M98A 4D0LB 3DSRA 4UOQA 2ZVDA 5JU6A 2VYVD 5AM5A 2W58A 5CM9C 3WO0A 2BGKA 1C4KA 3B9QA 3R5XA 4CDGA 3PS9A 3IO3A 1W5TA 3NATA 3R8CA 2VRCD 1NNSA 3Q1LA 1W47A 4GX2A 1ZNYA 3DXFA 5ALKA 1JMYA 3KYCB 3VNAA 4KO8A 2IS1A 1WV0A 2JNWA 3QLUA 1FJXA 4EJMA 5K8LA 1R8JA 2TS1A 4JQOA 4PXSA 3WZLA 3K5IA 3GJ6A 2D62A 1Z88A 4FB4A 3W2IA 4E5KA 4P7FA 1N5JA 2A59A 5IVIA 3WAKA 1O9GA 5IN4A 1JB1A 1D0SA 1EUDA 1PW7A 4R6WA 4Y2RA 3R24A 3UT6A 3KEFA 1IC6A 1VGQA 4BVLA 1MORA 3OCUA 5BWOA 1J7JA 5TF4A 4AICA 1U11A 3AF1A 3FI9A 2R68A 1UXOA 4MRNA 3CBQA 4EDHA 1NQOA 2AN1A 2GJAA 3GBSA 3T5MA 3TB4A 1NW4A 4EPWA 5A9SB 1LH0A 2VAWA 4W8HA 3I0NA 5JROA 1T5SA 3A3PA 5IUKC 3LKBA 1U8CB 3LA8A 2MHCA 3Q7TA 4LSGA 2FY8A 3EOBI 2QE6A 2Z9CA 4A8JC 1VYHA 4C2UA 1QP0A 2NPIA 4NKRA 4L6AA 3GX1A 4RJLA 4ZTBA 2FWIA 3FCUB 5HK9A 5L3VA 3MD0A 3NIDB 1Q7GA 3S0JA 1IPFA 2XOKD 4HXYA 1NUUA 3NIGB 2ZYTX 3SZLA 2PE5A 3PF8A 3GT7A 4BY9E 4CGZA 1TU4A 3QLTA 1N34B 1HYEA 3KUKA 1CEQA 1IBMB 4O25A 4L7VA 1EBBA 5M29A 3HJAA 3MJEA 3HWWA 4DLYA 2GPSA 2FOXA 1NPTO 2JL1A 3IRVA 1VSQA 1YJCA 2PQ6A 3LCRA 4NESA 1Z4NA 2UZIR 4PONA 4LCEA 3MQ2A 5I9LA 1S4MA 1TMKA 5K03A 4DY4A 1WZCA 4HFJA 3ET5A 1XRLA 3T3PB 3V4FA 2IXAA 1NVDA 3L46A 4WZBE 4PICA 1QKIA 3AFIA 1HDCA 2PDAA 1VL1A 1A2QA 2FXVA 5KQGA 5FB3A 4L78A 1R0CA 1ZSNA 3A3NA 1QP4A 2X22A 4RH3A 2NSHA 3PTLA 4DMUB 2X7JA 3F9IA 2Y1FA 3PE6A 5FTNA 2Q3HA 3O8BA 1J1ZA 5DWDA 4NBTA 1N6LA 3OZWA 1V5EA 4ZN6A 1IZYA 1LSUA 3VZPA 1KK3A 2RK6A 2QB5A 4MMYB 5JH7F 4ZU3A 2HPZA 2OORA 2FF7A 3TE6A 4IOJA 2HXYA 1EJ0A 3EVZA 1IYZA 3PFHA 2FUCA 2D8MA 1T91A 3A3KA 4TMVA 4ADSG 3GP5A 4GMFA 2BKLA 2XB2A 3FTDA 4HDMA 3GLIE 1L7AA 4MVXA 5F1YA 1SU4A 1JILA 2C42A 2UZ1A 2ZBFA 3HCOA 4QYMA 5EMMA 1KYIA 4BP3A 4B3HA 4DBZA 3OO0A 4W7SA 4PEVA 4DIDA 3P8ZA 1FMCA 4Q21A 2AR0A 4MYDA 1O7JA 4II7A 4EGAA 5BW8A 2E87A 3PB3A 1OKKD 3H6KA 3WLHA 3FKQA 2R5FA 1WUHS 2JBAA 4IJKA 3PITA 2IEBA 3H9UA 5DYTA 3UT5B 2F1HA 2BPOA 5DNDA 1ZH2A 1D4ZA 3GELA 1UKYA 1SOUA 2P2DA 3PKJA 1PFYA 2JIDA 1XLVA 1ZI6A 1JI0A 2VVTA 4OGFA 3WL7A 2YWFA 2ISCA 3CMMA 3KXLA 3ZN2A 1P6UA 2P4HX 3L0OA 1X7YA 1JHDA 2EZ4A 5FV7A 4ENTA 2G7ZA 5DRTA 5KOHA 1QU3A 2QGNA 1PT8A 1SIUA 2B2XA 3V2GA 1TLFA 4HL6A 2G0TA 4MWTA 4L5AA 3TNLA 2DHCA 3E5RA 3H97A 3T1HB 1NXXA 1W85A 2FUG6 4XR9A 3KQVA 3OF2A 4NOMA 3DEYX 3H5VA 4Y2PA 3GJYA 4G0QA 3ZW9A 4PC6A 1O6ZA 2P5UA 2GAAA 1BVRA 2JHPA 4TLAA 4XFJA 2IL1A 2X6TA 4K2HA 5FPKA 2VJMA 2PH3A 4EQ6A 4FFNA 5CG1A 1FTNA 4LEIA 3C48A 1JHAA 1N6HA 5LA6A 1UC5B 1N6IA 3O8QA 5B1DA 3WADA 5AW9A 3OBIA 2IXFA 4FD2A 1E2GA 3GP3A 1BFKA 1VCNA 2K2WA 4FZ5A 3U3DA 3ZGVA 3A9CA 1YS9A 4HQKA 2BUBA 4X24A 5M04A 1JG1A 4OMCA 1E69A 2BFDA 2O7RA 2X5NA 3GUUA 5H82A 1U2QA 1CZNA 4ND8B 4YUVA 5B12A 4ZTZB 3DFUA 4JOSA 1YBFA 1G5FA 4UOEA 4EKIA 2Y77A 3HXPA 2XUFA 1Z75A 2ZYUX 1TD1A 3AY0A 4BNDB 5GONB 4RABA 4D5EA 2J7KA 2WM3A 3MVEA 3AF3A 3VO1A 3V9PA 4GR9A 1YC5A 4FGSA 3DOCA 1L5FA 5F7ZA 5ALWA 4LK3A 5K6RA 5KYGA 2CNLA 1IEQA 2Q41A 3LP5A 3OIGA 2UXDB 1EVQA 2G36A 1OU0A 4OU4A 1WW8A 4AURA 2FZLA 5BMVB 1E9VA 4KXNA 4QNRA 1UPCA 3LHKA 4IGFA 4DV0B 5B58C 1Y6QA 1W4BA 2PKYX 2VA9A 1UWCA 3DZFA 2Q21A 1SCAA 3HG7A 5EINA 1MX9A 2QU8A 3VHXA 4Y2UA 2AS0A 4DUPA 2EZUA 1H1LB 1CUYA 2JIZA 1WCV1 3MYRA 3O3NB 5J9FA 3RLFA 3RTDA 4C1BA 2BEJA 4JYPA 1BDBA 1K4YA 2HOQA 1R6AA 2C2GA 4R1UA 3UZUA 2QP9X 4RK6A 2BRUC 1C30A 3X3HA 4M1WA 4A5SA 3UMSA 3HCBA 3MWLA 4INAA 2E5FA 5C3UA 5G0VA 1ODKA 3SQMA 2ZZMA 1G17A 1G7TA 1MABB 2DLDA 4KIUA 5FWNA 5JQGF 2Q2NA 1RRPA 2Q49A 2V4ZA 2PIAA 5FA5A 2BCJQ 3EH2A 2Y2UA 3PR1A 2V65A 4FSDA 4B2PA 5IVPA 4AKTA 2WHYA 5HEKA 3I62A 2BFFA 3I42A 1XRQA 1EU1A 3ZY3A 1LLDA 4YXWA 4ZOQI 2AA3A 1H42A 3PC4A 4NBKA 4B3XA 4DJAA 1ZAYA 1B1CA 3E7WA 5HF6A 3S2EA 4MV0A 5A62A 2H63A 5IAJA 4O02B 1KVSA 5L3SA 2GVDC 2XCQA 1ZDMA 3TGLA 1FMJA 4I1IA 4XPIA 3T1VA 3Q15C 2OEPA 3V48A 2XUHA 4E3WA 2WABA 3HXMA 3SC6A 4OBXA 5AT1A 1ZMBA 5H68A 1SKQA 1ZKDA 4KJXA 2V4UA 2GD6A 1F4PA 1P29A 1BA2A 4KNWA 2HD4A 1OJLA 4BVGA 3F67A 4DIOA 3ESRA 3H8VA 3TRFA 2GPBA 3F47A 4F4JA 4LXUA 4H1HA 5ARBA 3C8UA 1CEXA 1OX4B 3ODGA 2JGEA 3R7NA 1P7YA 3V8BA 3CN9A 2ALJA 1UBCA 1JSCA 4HXGA 2O2SA 5EQDA 4DAEA 4XCQA 1LRLA 1P2GA 3CNBA 2Z4TA 3OZDA 721PA 1NF3A 4Q7LA 2QY9A 3ER8A 2H07A 2R11A 3N6VA 2IVZA 2IRWA 1PHRA 2ORYA 2XDAA 3LLUA 3ORRA 2ODAA 1PZGA 4MVWA 1E60A 2C2BA 3CC8A 1FJHA 2CYBA 5AQEA 1PDVA 4F8YA 2C8KA 1UDWA 1DJQA 2GO1A 3KUXA 4OHKA 1BCSB 5ALSA 3W04A 4E12A 3L6DA 4I4CA 1PG0A 2P2ZA 4KVFA 3CO0S 2M9MA 3GG2A 4RYDA 3TH5A 2PA3A 3L02A 2ACVA 2QLLA 2F8MA 1P6XA 2BT4A 3JYHA 4IMPA 4XYMA 4E2ZA 3ZD9A 3ZUPA 2QL5A 4KNYA 2Q3CA 4S12A 2XTMA 2PEYA 2Z9DA 2AV6A 3F97A 3ONVA 4RMJA 1WEKA 2HBYA 5AMXA 3Q87B 4R9RA 2R2AA 1GEEA 4CL3A 2QMYA 1G5IA 3HJUA 1GQRA 3LLCA 2L42A 2XWSA 4U2FA 3DJYA 4IPTA 2DWCA 2IXDA 5IT4A 3K92A 1LK0A 1LS1A 1BS2A 1NDQA 2XNSA 1UKAA 2YQZA 1JB9A 1HLFA 1LY1A 3NRBA 4YPFA 2FJPA 3IR7A 4C0KA 4KIJA 2P3QA 4NE7A 1U6KA 2O20A 3F7NA 2OESA 4GPIB 1BROA 3M6VA 1LNZA 4K9MA 4MPTA 1GRVA 5LKAA 2VTDA 2D06A 3INYA 5G53C 4TRNA 3S8MA 2ZULA 3SOZA 2YV5A 5D00A 4UARA 4H18A 3WFJA 4AB1A 1CB0A 1BXGA 5KSOA 3IVCA 3C8ZA 4IIFA 1H2ZA 3HQ4O 2E49A 3EFOA 1BE1A 3QV1A 5CNMA 5LXTF 3O5AA 1SWVA 4MGYR 1X7XA 1MC1A 3PIIA 4KUEA 2LW7A 3E3LA 1X8KA 1XNJA 3ZE1B 4G0MA 2ZPUA 1DBPA 3EQ7A 1WDMA 3G0GA 4IJUA 4RHEA 1C3XA 4TTRA 1ZGJA 3CIFA 5CH3A 5IM4A 1FMLA 1YDFA 3Q3IA 4KXXA 3KSZO 4RTRA 3K6SB 2Q3JA 4EEKA 5BXYA 5KJ1A 2XUJA 3EAFA 5HG0A 2XMSA 2YASA 4PAWA 2UYGA 1FC0A 1JDTA 4JI8B 1T4DA 3K96A 1V4VA 3BIOA 2C96A 1ZYUA 4MUBA 5FTJA 1IRXA 4B0PA 3QVTA 4CQMD 3KPJA 3ZHBA 4LUCA 4LHYA 3OEHD 3K1AA 5T41A 3NTOA 4CEIB 5IBQA 2J0EA 3TW8B 1KSFX 5AP9A 4BNJA 2E5LB 3DG9A 5DHAA 3MG9A 1TFUA 4DBVO 5CCDA 2NNWB 2QPLA 3RU9A 4HVCA 4H7KA 3DYBA 1CUZA 4O2BA 2VJOA 3S55A 3HHEA 1CVLA 3ZBTA 5JMTA 5FO1A 4I4NA 4YA6A 3ZLVA 1DZIA 1YE8A 1EFCA 1CF9A 2OPBA 2J6CA 4EG7A 2GOYA 3ZNQA 2ID7A 4WZ6A 5FUXA 4I46A 3E70C 2RH5A 1AF4A 3CURA 1R8YA 1IQUA 2XZDA 3GPCA 4JYBA 5CW2A 2EZ8A 1R4NA 3VTZA 3TOVA 5JRJA 3LBAA 4INJA 4V1CI 1BW9A 1PDOA 2VBCA 4ER7A 4X93A 3ROGA 1BDMA 5FBWB 1TEVA 3BWCA 8MHTA 1KIAA 1KXZA 3LTEA 3WK7A 4L57A 4YUWA 1ATZA 3QXCA 1PNOA 2Z56A 3CCCA 3EA4A 4YN3A 4MMXB 4DYHA 3C3BA 2XIJA 3M6FA 1UZLA 3ZE0B 1DO2A 4U7TB 3COJA 4YXFA 3BGSA 1C50A 1GARA 3HVRA 4A1OA 3WGMA 4DV1B 4FN5A 1ZM3A 2QTNA 2C9BA 3H83A 1L1RA 1QJ4A 3HJRA 4ZD6A 3VH4A 3LUBA 1UBKS 3TTUA 3KQPA 3JWJA 1T8PA 3TM5A 4YUYA 2ZWOA 5BV0A 2IPAB 3VV2A 5JTUA 3NP7A 3FUVA 5TMDA 4Z9FA 3FMIA 3U7RA 3V55A 2WKPA 1QOQB 2AFVA 2WNIA 5K3DA 3TECE 4KQXA 3OCVA 4H1TA 3IIIA 2BH9A 1IMJA 4JEUA 2AJTA 3ZLTA 7ADHA 5ADWA 4L0MA 2ZW9A 1UC8A 3N05A 4NJOA 1M8FA 3GO4A 4NV3A 1DFHA 4YRBA 1ZKMA 2APJA 3WLFA 2QTMA 1EXWA 1P9WA 4WOKA 1Y3CE 3NJRA 4EY7A 1T6BY 3AF0A 2O8BA 5M5BA 4NFHA 2WZBA 1D6NA 1JU3A 4HFMA 4HYEA 2BOVA 1IOWA 1SRRA 3K53A 1XZEA 4WUVA 5COQA 4BFCA 2H6EA 2AMFA 2DKOA 4NJMA 1G5QA 3FAZA 1SURA 4TRJA 1IJFA 2PMFA 3GBPA 1CP3A 2ZM5A 2YHIB 3DP9A 4M54A 3BFJA 4OM8A 4CM8A 1NDUA 4ZJUA 3WYNA 1W88A 1YJBA 4CTOA 4AT1A 4YMWA 2BP7A 4A03A 4AW9A 3EZGA 4N5LA 1QNLA 1DFIA 5I3CA 5D6OA 1XQ1A 1U5CA 3TIVA 4YAJA 4RPLA 1I4TD 3T3GA 2ORVA 1V9SA 2AFRA 3AY7A 3N2GA 3TPCA 5TS3A 3F6YA 1LJ8A 3NYRA 4LRWA 3MWFA 3NNNA 1E61A 4NH0A 5BV2P 4RVHA 4LI0A 3E7PA 2I67A 1K9VF 4P7KA 2QXYA 2KMLA 4UFOA 5BW4A 2HWWA 4NG5A 4B79A 1QHHA 1UK9A 1L8QA 1T13A 2JGJA 3HZOA 2ZE8A 3L6EA 4I9NA 3RSOA 2BGTA 2O8EB 3U3ZA 1ZJ5A 4EYSA 3BK2A 3A9VA 1DRWA 1N1MA 2G9NA 3UBMA 3D1LA 4EMUA 2CCKA 5KYNA 3QEJA 5K20A 2DE0X 2FU5C 1DTSA 5IUJC 1A9OA 1J0CA 5DSZA 1BVHA 1XTKA 4X6XA 4BJ3A 4BJ1A 4ZCMA 4LGYA 1Z2AA 1UBHS 4EP1A 2C8VA 3FZEA 2F3RA 2Y3IA 2Z09A 3QBTA 4G01B 4TWZA 1D03A 4XA8A 5FBVB 4PQFA 4GWLA 4BFTA 1A9PA 1Q57A 2FEMA 5JWOA 5AKZA 4RZSA 1KEZA 1HX7A 2H06A 3OC0A 4ZT4A 4ARCA 5BQPA 1YE3A 1N2JA 2R79A 3QPBA 1SNYA 1YVPA 1PGNA 5KX5A 3HYTA 3JR7A 3JQQA 1RYBA 4XD7A 4OJTA 5FUVA 1CEEA 2V7PA 5EEHA 1EWTA 3P0EA 1FFXA 5IFLA 1TLLA 2I6UA 4I5DA 5BN5B 4BMDA 3F96A 5K0EA 3DEIA 1GPDG 4G1MB 1WEHA 3NDRA 3QKIA 5FHRA 4ZXFA 4Z5XA 5LPNA 4EFKA 2HQBA 3T7CA 5JDIC 2XGJA 4V0SA 3LC7O 1E8NA 2HRQA 2ZWVA 3CH4B 3LWBA 3IP9A 3BN3A 2HUNA 3STTA 4S05A 1NFQA 2ZPTX 2CFIA 3HADA 4W63A 2ES4A 3UYLA 4IZOA 1XVUA 2FQXA 2ZWAA 6PFKA 3KRTA 3Q3VA 1FA9A 4JDPA 5DM0A 1NVEA 4Z0PA 3RGWS 3ZLUA 4KWIA 2A2ZA 3RC3A 2LR0A 4JCCA 3FKJA 2JIQA 1WUIS 4CKYA 3NBAA 1T2DA 3SXPA 1P0QA 2IP1A 3QU9A 4LBVA 8LDHA 3N2KB 3ABSB 4QBGB 2WM8A 5LSAA 1O87A 1CP2A 2M1ZA 2JK0A 5KNDH 1JEAA 1NQAO 4YDQA 4O2RA 3ZEAA 2O7VA 3Q41A 3RBZA 3TINA 1KHTA 4PHTA 5HF8A 1MW8X 2BFEB 2B5WA 4L73A 3L4EA 4ABTA 4X45A 2WF9A 2G72A 4M9CA 4DQXA 3MK31 2W6OA 3EEBA 1UWKA 4BLPA 1N3LA 3LXRA 2JCYA 3L04A 1VIAA 4J1TC 2I1WA 5HOEA 2J5XA 2WVGA 1EA5A 4GIBA 4L9AA 4JA0A 3S6JA 3ZWQA 3QTLA 2CL7X 4LYAA 1Y3AA 2ZBUA 1NBOA 3D2CA 2WDZA 3ELUA 4X8MA 2EWWA 5BO5A 3RWOA 3UMYA 1M8PA 2UXBB 1EESA 1Y1TA 2FZVA 1QOPB 3ZCRA 3E03A 3ZU2A 2P9CA 3CTMA 1Z17A 2VRCA 2EF0A 5T8KA 4CMHA 4D56A 3D7MA 3FOFC 1J24A 3N0VA 4U5QA 3WNDA 3QHPA 4G56A 1YDGA 1YB1A 1ORRA 3K7EA 2C83A 3TZLA 3K70D 4Y2VA 4LXIA 3SYNA 2AJDA 1VJ1A 1U5BB 4TXMA 1SAYA 4JB3A 3BULA 1FNBA 2G7MC 9LDBA 2X9QA 4U5XA 1NW3A 4NBSA 3ZCSA 2C5FA 3GJ8A 1TRKA 4KAJA 3H2GA 4PYQA 4S2UA 5AHKA 4NX2A 1WXXA 2Z83A 4LF5B 1A8HA 2Q4DA 3K5PA 5IT0A 3N58A 3IHKA 4XKJA 5GGXA 3B20A 3QENA 1LJLA 1E7SA 1H05A 2ZI6A 1Y5RA 3BMCA 4PG6A 3HJBA 5IULC 5B3LA 2JZOA 2FFBA 3RYHA 2Y99A 5DX8A 4X7RA 3MD9A 4N3NA 5JSUA 2REQA 1EWVA 4R9UC 5ALYA 3LL7A 1T9AA 2DM6A 5DH9A 4BC1A 3HJTA 1U63A 5F1OA 2D1SA 1H66A 2WG0A 1CJUC 1Z7EA 2GZSA 3QRWA 4AF6A 5KC9A 1N2IA 2MTBA 3WLLA 5ELLA 4JQYA 4IMIB 5BQ5A 3V1LA 2M6LA 3FCOA 4H4CA 4HDKA 3EIHA 1PYGA 5ULLA 3UFXB 4NG4A 1DBIA 3VUEA 4J7CA 3MELA 3MFYA 4N65A 1RJFA 4OI4A 4W82A 3ROZA 5KO2A 4ND1A 2JJ1D 3Q3GE 2WVJA 4PFSA 4X3OA 4XVUA 4HUQB 5DTJA 1HORA 3S1LA 2EEPA 3IELA 4F4CA 1NW8A 4AL4A 1T1SA 2PYDA 2P68A 4N0PA 4RHXA 1C8KA 4IVNA 4YIHA 3ZU5A 2PUAA 4AF7A 1XN1A 1MJNA 3DZGA 1Z4JA 5EIBC 3JQBC 3BRWA 1M3SA 5HXAA 2QAGA 2PSJA 3BA1A 3E8XA 3RADC 3EEIA 1VSBA 3FN4A 4OUKX 1QLJA 2PUHA 3VR5H 4C2TA 2CXOA 3ZHXA 2JGKA 2L0XA 2YUIA 3BIJA 3E2IA 3V4SA 4F9TA 5G0SA 4I36A 5HRUA 4ZPXA 3PHCA 1LPSA 1KFKB 4MHOA 5CJJA 1VLLA 3V9AA 1H2FA 2D59A 2EJCA 5EWLB 1GNVA 2POCA 3AL2A 5G4KA 3T5DA 4P2GA 5JYBA 1XNRB 5BQOA 1Z4KA 2ZKLA 4PLPA 4CKEB 2Q5QA 3PSAA 3KT8A 1P0IA 1Z5NA 3A27A 3QVOA 3N2LA 4R98A 1LBHA 1Y7PA 2CVHA 4L3WA 5EKSA 1HNZB 1FUIA 1F3LA 2QQFA 4ZIRA 3PEYA 1DTWB 2P65A 3BREA 3EHEA 2QXTA 3ETJA 3SXJA 3H1PA 4EG5A 1R3DA 5HFJA 2DP4E 3NFRA 1XAJA 2WP0A 4H7EA 3RQIA 4Q18A 5B2ZA 5L6MB 2EXXA 2I4RA 2IUYA 4H0CA 4N0MA 5DN9A 1ORVA 3QVMA 2L18A 4B4DA 1T2CA 4XIIA 3LAWA 3FSEA 1V5FA 1Q16A 3EZXA 3W5BA 2O5CA 3E9CA 3OX4A 4K7JA 1D8AA 3KQOA 1EUYA 1DAIA 1P44A 1I30A 4LYFA 1AZSC 3SWWA 1KO7A 3N07A 4H7JA 5TRTA 4E4RA 2DEUA 1TYDE 3TTWA 2EF1A 3I3SR 1TCUA 2ODQA 3Q8XB 4MKGA 2KM1A 3JQCA 2JI7A 2XA9A 4Q16A 1M7HA 1RAGA 3H84A 4KDFA 2Q6IA 2XLCA 3BICA 5C46F 1ESMA 4QYIB 4EATA 2NLOA 4QRDA 2G9QA 4LF4B 2EJVA 1F2TB 3CWCA 2HIHA 4D9HA 2Z8XA 2XMCA 3C8HA 4RY0A 4TV9B 5DULA 2Z58A 4R51A 1NP3A 1O6FA 3U0BA 2BGWA 1XA0A 3EFEA 5KMGA 2JAWA 4LDQA 4RAQA 4YRLA 2GPJA 2Q3MA 1EEHA 3DE2X 4U7HA 2IHVA 5HZHA 1P4GA 2Z6AA 2YHUA 2VCEA 3O8DA 3NHUA 4FILA 4L9WA 1E8DA 3AERB 2WQ6A 2MIIA 3WHIA 1M75A 2QUBA 3NG1A 4B2YA 4HYYA 1CJMA 4E46A 4YP6A 5AVYA 2X9VA 3ISVA 3DAFA 3OMLA 4LHSA 3WNCA 1KMMA 1Y89A 2W6PA 4N49A 5CH5A 5BQFA 4IJ6A 1J2UA 1OWOA 2BCEA 3R7DA 2GD2A 5JVDA 4NBRA 3WQRA 4F7DA 1EJBA 2HTFA 1K5GA 3MWEB 5EAIA 5KYTA 3KQMA 1RWKA 3MMNA 4P08A 9ABPA 1QH8A 5DNUA 1G5RA 1Z5UA 5CFQA 5B7GA 2JI8A 2QR3A 2QM8A 2VHCA 4Z3DA 4POAA 4MVJI 2Q4OA 1BTOA 1V96A 2WF5A 1AN0A 3ID6C 5ENDA 5LLSA 2R6CA 5ADVA 1EIWA 1CCWA 2H57A 2OP0A 3OF5A 1DINA 2F4VB 4E94A 4DM3A 2DZDA 3JSXA 2ISQA 3FPCA 3M3HA 4NL4H 1T5IA 3G5TA 4EY4A 4KSCA 2JFVA 4AM8A 1R0WA 4FFBA 3G68A 4GPBA 3QM1A 4PQEA 4TT8A 1M8JA 5FLEX 5BNFA 5KNCH 2Z8YA 3OA2A 2X1VA 3AZQA 4GYYA 2D3TA 2PH7A 3D8TA 5AVSA 3NORA 1JA1A 4GSLA 4BU1A 2BZ0A 1FBNA 4RV4A 2AFIA 4A4DA 2ZUFA 1TCBA 2XB8A 3DZDA 5DBFA 2Z1MA 3TOXA 4WZAA 2VNIA 4YNBA 5BSWA 3GMDA 3HKEA 5T57A 2CBZA 2OZVA 2P4UA 1VPLA 4HWKA 4JP5A 5I7EA 2Z9BA 2BEWA 5D3MB 3CA8A 3HUTA 5A06A 4LX8A 4RVCA 1U2PA 1NN5A 1MEEA 1KS2A 3A11A 3DTVB 2VDJA 1U3WA 3HJHA 4CUZA 5J1TB 3AOGA 4BUCA 2WYWA 5IF3A 5GGYA 3H0CA 3JASB 4J0KA 3UPDA 1I3OA 1QIKA 1KYTA 3B53X 4EMBA 4BGDA 4OKSA 1Z0SA 4WFKA 3TUIC 3W7BA 2ZUEA 4CLRA 1SVWA 4DUGD 5LB4A 4Q47A 4TQGA 3NKVA 1NNI1 2BMJA 2AUTA 2W5UA 2Y0EA 3E7XA 1OAKA 1JHQA 3EIEA 1CDDA 1VG8A 2BBSA 3KAPA 4PX9A 3SYMA 3TTYA 3UCEA 4Z1MD 5K0TA 2OYRA 1JEQB 3AOEA 1STOA 3FDJA 1G38A 5HS6A 4R81A 1P72A 2R1ZA 3CXRA 1RWXA 2CVFA 2DSTA 1I0IA 2QRVA 4MR8B 3TMAA 2A0WA 2PRSA 1J0BA 4MUXA 3WDMA 4OSPA 1OAAA 1L5MA 1T6NA 3IKJA 1NMSA 2AC4A 2E4UA 2JEYA 2VDKB 2VF2A 5GJCA 1PJSA 5FD8A 4Q1DA 3VO8A 5HQTA 2G0AA 3O9MA 4RY9A 4PAQA 1H6AA 2ZTHA 5AKXA 3VU9A 2G0NA 1G4AE 3G2LA 1HDZA 1N1DA 1KYYA 2FW9A 1AK2A 2RCYA 5J63A 3S4YA 5F3WB 3VNUA 2PUDA 4RVUA 4X7MA 4G0XA 4FYXA 2TECE 3CM0A 2IPNA 4O4JF 1OFIA 4YJ3B 5EP2A 3S27A 3QUQA 2WVHA 4QYSA 2P35A 1DEXA 3TX2A 4D57A 3U60B 1RPZA 1NJ6A 2G82A 3TTSA 2W2TA 3WGLA 2ZJ0A 4D4LA 3V8NA 1O94C 1PW5A 4E70A 6ABPA 1IB0A 4OK3A 2KX7A 4Z7JA 1LD3A 2OILA 5AHRA 4MSUA 2KI5A 4RH1A 4C03A 1GQOA 5EKDA 5JZBA 2PV0A 2NO9A 3PV0A 4BWYA 2VYND 1D2AA 1X7DA 1C0IA 2IU6A 3HVKA 2GEFA 1T2UA 5JH7A 4JIGA 1KYXA 1VHTA 2OO5A 5AHXA 1UWLA 4KIFA 2PGDA 3QF7A 4HMPA 5BYJA 1XZKA 3SBDA 4BX3A 1A4XA 4MGZR 2BYTA 1G59A 3M5PA 2WDPA 2WFLA 1L5NA 4CKXA 3OUTA 3DUWA 3NWPA 4JP2A 1A96A 1CV2A 5HDQA 1CVIA 2PGIA 4YDSA 2CJWA 4MA5A 1JL3A 5LCXA 4MRSA 5KNDA 4GP9A 4GKJB 4WBNB 1E2JA 3C24A 4OBBA 1HQDA 4QXMA 4Y6OA 2ZYAA 2ZIXA 1JQLB 4DLWA 2AZDA 1NUTA 4OU5A 3WLEA 4ZI7F 3HHPA 3PGJA 3LC1O 3TIGA 1BDHA 2GBLC 4KWHA 2JFBA 2R6HA 3IP1A 2YMMA 2F4NA 2HGSA 3OPNA 1Q0TA 4R1QA 2WOOA 1G64A 4JA2A 1DBSA 3TLGB 1E5XA 2XUOA 4RKFA 4DR7B 2B6NA 1N2CB 1SA0B 2GILA 2Q6OA 1NVVQ 1F1JA 4I5GA 3VZDA 5CVVA 3FTCA 4OQDA 5KTNA 3RYCA 2C92A 1U1CA 5F9HA 3V2HA 2YJGA 1M2FA 1R15A 1TMYA 3K9LA 1NUQA 4CM4B 1N9GB 3KBBA 4UCXA 4C43A 4Q1EA 2ZM6B 4GI5A 3K0CC 1AQIA 1NATA 3EJWA 3F3SA 1DDOA 3TR0A 3RU2A 3DZIA 2JFNA 4ZYVA 4X3CA 3D8BA 4UVEA 2YOHA 4G5GA 4QFBA 3QOFA 5JOQA 4DWWA 1KKMA 1T6ZA 2P6OA 4G1VA 5AVZA 5THKA 4L1KA 4LRTB 5CHEA 2AYZA 1S2IA 5AW1A 1DIGA 5BNWA 4FZVA 1FYXA 5L9AA 1RAAA 1SEVA 3AV0B 2ZIGA 4B35A 3LVRE 3USZA 3RRNA 1JFTA 5IXJA 3ENVA 1M10A 5KOJA 3REFA 4G86A 3TSZA 3WGYA 1NJ8A 2L19A 2NQ8A 1CIVA 3I05A 3P2OA 2WTUA 1EVJA 3EWSA 5L53A 1VBMA 1ZGZA 2NQTA 4TQ9A 1XFDA 3L7BA 1DAOA 4W9MC 4BHTA 5LFAA 1ZCJA 1QK5A 2BGIA 4CMBA 1KH2A 5MFZA 1YFZA 1L7MA 3AL3A 2IYSA 4M1EA 3PICA 4WECA 2LIVA 1LTHR 1P8JA 3UWMA 4HTFB 3RT9A 1NRXA 2AD5A 4MQFB 1QV9A 3CRRA 1YGPA 2P9BA 3C6QA 5GVSA 1E9AA 3IP8A 1RU3A 5MHTA 4JDUA 3U3KA 4LQCA 2JEZA 2R8BA 4OXYA 4JZKA 3QXXA 2V5VA 4P3KA 2IS6A 3G6WA 4G5QA 4PR0A 2KWIA 4CCYA 4DM7A 4EX6A 4GEKA 1Z0DA 3ODPA 2QVZX 3WSTA 1TUGA 3DNPA 3F74A 4QAJA 3GD5A 1JTVA 2W22A 4GF5A 5JPIA 2WYHA 3KM0A 4GOMD 3EPHA 4G89A 3CZPA 4IGAA 1XTUA 4L5CA 1CB7A 1ONPA 1UQRA 1XZHA 1AS3A 3JQRA 1RZUA 3NVMB 3DFKA 4Z9AA 1KE2A 2ZE6A 1MXHA 3IQIX 4CT5A 3REQA 1J8FA 5EE5B 1EFAA 2DPHA 1Q0ZA 2WV7A 3BWEA 2VQ6A 1XA4A 2QS9A 3FDXA 4RGBA 5JMOA 3KETA 1M66A 2ZYWX 4IIDA 4G1CA 4YUZA 3IPCA 1AGNA 4MUFA 4PZUA 4E09A 1JEDA 3E23A 2AFHE 2QDKA 2XF8A 2HIAA 5LUBA 4LECA 3P5BA 5JSFA 5HX7A 2AUNA 2YY7A 5FOXA 1FFYA 3IUMA 4I0WB 3O7WA 2NXWA 2WD7B 4GYJA 3KX2A 3GVIA 2KE5A 5FLYA 2QTTA 2WM2A 2NU9B 3VKUA 1AURA 2LGJA 1MB9A 1CS4C 5EZYB 4HS4A 3UJCA 3L1VA 5DI3A 2NXEA 2AZ4A 3T4PA 3DONA 1K4MA 1TA9A 2LCFA 2V0NA 2WYOA 3NHZA 1LJUA 1Y9JA 1YL7A 4B48A 4QM6A 3DT9A 1BMFD 3UJ3X 4XVRA 3RASA 3N8DA 4TT3D 3WL4A 1KNQA 4EY6A 1G20A 4JIMA 2VL7A 2LNDA 4N54A 1PLKA 3SR3A 3VO2A 3I5UA 4ZHQF 1EFDN 3N2IA 2ILTA 3AY6A 5EKTA 3GYGA 4AUEA 3TG8A 5B58T 2XE8A 4IG4A 2B92A 3PVCA 2GF2A 5ADHA 4EKNB 2Z6VA 3CUKA 2CC2A 2G4CA 5JMPA 4YAGA 1GPKA 5JCOA 4ID3A 3TD6A 5CH8A 3HA2A 3M2PA 4PYJA 4FOLA 2AL7A 1IY8A 5J47A 4QHTA 2H1FA 3COWA 2WWTA 2WAAA 2HBQA 5DYWA 5AUPB 4OSEA 2FN9A 4FHDA 5BV1A 3A1CA 4AJHA 4EEZA 3SQWA 2CE7A 1ZINA 3NWBA 5CD9A 1XMVA 4V0LA 2HWKA 3FTQA 4BO3A 2PJUA 1TFRA 5KNLA 3VVCA 4OB7A 4N9WA 4OMFG 3PQ5A 1DXOA 5JXJA 2J5QA 4NBLA 1U4NA 1YBHA 5K0JA 1T0BA 2BGUA 3JQEA 1DKOA 4NYMQ 1WAMA 5AW8A 4NXMB 4KREA 1AH2A 1ADCA 2W4QA 1NF2A 3SSOA 5CPFA 2TMDA 4FVTA 3U7FB 4BNNA 2Z6UA 1EFVA 1HDYA 3NIWA 3T06B 3GLFA 2VYFA 1UFOA 4GECA 1YRQA 3K8ZA 2NZ8A 4X63A 1Z8FA 3TUJC 4D46A 3HM2A 1TAUA 3KCNA 3UA4A 2OFOA 1W0KA 4MJ7A 5HQ3A 2K6GA 3GZNB 4RQAA 1KMHA 2BUAA 1TUBB 4FXOA 5KVSA 2E6KA 3L7OA 3GGOA 3PC6A 4ZICA 1XWFA 3CCFA 3P9SA 5HIIA 3WLTA 1PR0A 5DNAA 4B76A 1EKXA 3L0PA 2VUIB 3TQTA 1JIQA 1JLRA 4MA0A 4B3CA 1KIMA 1NKTA 2WHPA 4XTCS 3QE2A 2X6RA 3E1SA 1A88A 2TMGA 3LCJA 1QQ5A 5I9SA 3IDQA 2W71A 1XHLA 4OLFA 1E79D 4CEHB 4CGYA 3Q7PA 3SXUA 4ZTUB 3I9OA 4NU8X 1T0IA 2YJ3A 5JXIA 3IA2A 4TQAA 1KQNA 5DE3A 1T3TA 4Q7MB 2JI6A 5E2BA 1GPYA 2NO6A 3BSSA 3SQLA 5LXTA 1GL9B 1PNTA 2GN9A 2Q1TA 4KH0A 1SBIA 4NFLA 4ESOA 4UE2A 4J6EA 4XQ0A 4B6JA 4FZRA 4MS3B 3D7LA 3RAGA 5CG2A 4CN9A 2W93A 1XL0A 3E9YA 2DYKA 4RJJA 4D41A 4L15A 2G9RA 5REQA 4C7BA 2GEBA 5CFPA 1XRRA 1W29A 4I55F 1OU4A 3MTBA 3IBSA 4I50F 3OE7D 2OCBA 2H1RA 3PVZA 4W5HA 5LN1A 2B6HA 1W0JD 1BHSA 2A7XA 3QMMA 2BI4A 2EHJA 2B7BA 3ZBQA 1XVTA 2HZ7A 5CXQA 5KKNB 1Z9BA 1Z74A 1AB6A 1QFZA 1Z4PX 2D1QA 1EFPB 2Y0DA 3ECCA 1QTQA 3E3NA 2MSWA 2OVFA 5HTKA 2JLQA 1SD5A 1DAPA 1OC4A 5E3JA 2PVPA 5EWJA 3KQQA 5EC8A 4YR9A 3G23A 5HJEA 2FDRA 2C8LA 5HKKA 2JKVA 1SD2A 2C58A 3Q0TA 3N87A 3QU2A 2QVBA 3TO5A 5FH9A 2IEZA 4WKOA 2ZJBA 4LHXA 1YI0A 1WXQA 2HUPA 4C0AC 3AKDA 1QO9A 2IBSA 1SEPA 1MX3A 3JQAB 5BOSA 2CB9A 1IBRA 1SXJB 1SUWA 3KFVA 2HNBA 1JYFA 2HO4A 3DO6A 4GP6A 3BHMA 2O8DA 3ILVA 1AKRA 2ZSHA 3C0KA 1N3YA 4R2JA 5GMOA 2QM7A 4HH1A 2GLXA 1VE6A 4P4NA 2XDWA 2BTQB 4AJPA 1QTRA 3CRQA 4QGFA 2PMBA 4JLDA 1QF6A 1KETA 3E27A 3F78A 5FWYB 4ROTA 1XPUA 2GK7A 3ML1A 4CTNA 4IS3A 3D0RA 1ABFA 3ANLA 3OECA 5DNVA 3IPYA 4Q3EA 3RRBA 1G1AA 5DN6A 5G3ZA 2BEKA 3R20A 1C3LA 4IXNA 1UFKA 2Q1SA 4K5QA 4X1YA 5JNWA 2WJPA 3M2TA 1VJRA 5DP2A 3ZCVA 1SBYA 4WCVA 2IYEA 1JSLA 4KQMA 2E1RA 3PUJA 1TT5B 4P54A 4CKZA 1EUQA 3K9BA 1V45E 1ZD3A 1D6MA 1QQ6A 2I4IA 4JEIA 2X4GA 3QWAA 3GJ0A 5B1HA 2BE7A 4FMCF 1NVBA 4YRCA 2YWRA 1L3CA 2BM0A 4OGWA 1POXA 4C5BA 4MROA 1WKCA 3AHIA 3LRXA 3NGXA 4XAQA 1VKZA 5TGDA 3LY8A 3OOWA 3WX0A 5JNSA 3KQKA 4FK8A 4FOPA 2JJ1A 3SSNA 4UDYX 1IN1A 2JATA 2YWCA 3FH0A 4LJ7A 3R0VA 3QVSA 4QXQA 1FLDA 5TJHA 4B17A 3PGVA 2VR1A 2W83A 4C3VA 4Z86A 2YJ6A 1OSNA 1WULS 5E7MA 1VFNA 3H9EO 2OTCA 2RHTA 5CVEA 4L8FA 4E5SA 2FDCA 2H4FA 4FS3A 5FAXA 2BD0A 4PRZA 3ZQUA 1OOEA 1VLVA 2CXHA 3N53A 4M1KA 3BB3A 4KDRA 4Q1AA 5LZ7A 3ZR4B 3KJGA 4LCBA 4XDGA 4LKRA 4E2XA 2NUPA 4GDMA 4E6EA 1IUKA 1L5QA 3HZZA 4YLYA 3KSRA 3FF1A 4FX5A 2YWJA 3Q7EA 3FY4A 3SC3A 2QVYX 4HDQB 1N9KA 4JBGA 2WJIA 3A3YA 3QYJA 2OFPA 2VAVA 2VP9A 3AKZA 3OT4A 1P2DA 5CB4B 4JUBA 4CHTA 4EBBA 4TMZA 4AJEA 1NQXA 1YXMA 1KKUA 1KY2A 3FZQA 4JP8A 4YP1A 5C8YB 3HABA 3BDAA 3HO8A 1FIUA 5GJBA 3PQ7A 2I76A 1U99A 4IIBA 5DOVA 5TEWA 3P94A 3K9GA 1J42A 1RXYA 2H2FA 3S7TA 2AOUA 1HZZC 1U7TA 2NSJA 4XIYA 1SOAA 2D5LA 4YACA 1UEXC 4DW8A 2PZMA 3LZDA 2Q99A 5KDLA 2EW1A 1EHYA 1QPGA 1UDCA 2QMOA 4O2AA 4U6NA 1HE4A 4JXZA 1IWPB 1HFEL 1UPFA 1QGZA 4KMRA 4OLAA 1ESDA 2J87A 1NLMA 4IH9A 1KI8A 2CXXA 1ODJA 3PUIA 4O08A 2A30A 4MQEB 2CFSA 5SY4A 1BA3A 3LYAA 3R0QA 4MDEA 3MTQA 1JFFA 4IMRA 1G66A 3U3OA 3HO1A 3X2SA 1M8GA 1FW8A 4YTEA 4RIEA 1M2VA 4XQGA 3TI9A 1QHSA 1ZS9A 1R12A 1SMKA 2GN8A 4IKOA 4A10A 3CB2A 5KREA 4LMPA 1NDHA 3R9IA 3B3JA 1ZZGA 5JNUA 2OBLA 3LNCA 4JUIA 3ELYA 4H3KB 4JK3A 1OY1A 5BQ3A 3MAJA 3VOBA 4YWJA 5JD6A 1PV1A 2CHEA 3O4IA 3R5KA 5F1KA 1OX6A 5LBIA 2D2IA 4Y6SA 4IR7A 4MAMA 4MP3A 4QFDA 2HNKA 3FVWA 4URXR 2GTHA 3V2UA 1P39A 1Q6ZA 2O8FA 1A9ZA 4YP5A 3CJRA 1GOTA 1BEUB 4B6EA 3KQWA 4HDOB 2IY7A 4YRJA 4LHEA 5DRYA 4CMJA 1IQRA 1P17A 1OBHA 2XCTB 4CTMA 3LSTA 3RD5A 3QHAA 1HG1A 3KZKA 1V16A 2Y1EA 1SCBA 3D6JA 3WDKA 2FRXA 2KBEA 1OI3A 1RJ9B 1RR6A 3KC2A 3D3NA 3PHHA 3PFWO 3IILA 1WABA 4JQZA 4GS5A 3REOA 3KWFA 5CYGA 4Q0MA 2PX5A 3S2YA 1GKUB 1N57A 3HMKA 1SVMA 2HCBA 5MDHA 1VCMA 3RC8A 5AOVA 3ZYCA 1UZUA 1Z82A 4BB5A 1K3UB 4FQ5A 2C82A 5K05A 1B23P 2P8SA 4K9LA 4BVFA 2YXBA 3I04A 1KJQA 4ZMSA 5EZ6B 1KEWA 1ML4A 2XQJA 1V9CA 4J4BA 4NIMA 2WMOB 1KVTA 2AX4A 5H4HA 3UKOA 3ZIDA 3DM9B 3OF3A 1PJZA 1Y8RA 1BE0A 2G8LA 3AR4A 3BMOA 4BNZA 5EFZA 1V7ZA 3OZIA 5A4KA 1EUDB 3ZK7A 4U0KA 1IUOA 5DJ5A 1KEEA 4O59O 2CNOA 3C6YA 3UNXA 2A78A 2OENG 1T4BA 4M8KA 3DP7A 4J90A 3GDHA 4EEXA 3ANXA 2TMKA 1ILEA 4YQYA 1KZ1A 5CVJA 1OVGA 1FSFA 2XH8A 3IBYA 4RKRA 2ENUA 5BUSA 2WEKA 5KYXB 5B7QA 1GLVA 3R3WA 1RYHA 4W5WA 1GGHA 5AOCA 3VKVA 3QXJA 5EJMA 1GHTA 4TKVB 2J09A 2WTAA 1VL5A 2ZJ5A 2ROQA 3H65A 3NLLA 1DS6A 3CNHA 3KT0A 3OLQA 4TWBA 1QB7A 2R62A 2RSLA 4F5DA 3E7DA 2PUWA 3N39C 4XLZA 2OV3A 1OYVA 3CV3A 3RSGA 3NWJA 3CLRC 1GNSA 1QWSA 2QUIA 2VUHB 4Q66C 3CUUA 3DNFA 2HLDD 1BKYA 2DT5A 2DFDA 2Y92A 3FWNA 2DBVO 4QXPA 5LMNB 1RQXA 3LQ4A 3G85A 3VBCA 4JFAA 4QJ4A 4C01A 3S1AA 4EUHA 3AM4A 1K68A 2YZ2A 3ZV4A 3D7KA 4GE0A 1RPTA 2HSZA 1OYYA 1OVMA 1PGQA 3FNRA 2QTZA 2ZRHA 4FWIB 1RYDA 4LHVA 3B1WA 3S2GA 5DM1A 5AVVA 3J7TA 2ZWMA 1N5OX 3F1LA 3G0DA 4FWBA 3EODA 4RD4A 4Y9TA 5JHGB 1KSJA 3NASA 3PE3A 1RJDA 1OYOA 3G5UA 2PX0A 2RHGB 3Q9SA 5DOZA 1YS2X 2N0SA 5FI5A 3HJGA 2V45A 4HZIA 5BPFA 1NIPA 1PZEA 5JO9A 4YR7A 1AGXA 1WCXA 1F38A 4O5AA 4FYJA 4RLHA 4BQNA 4CMIA 2YHSA 3KVOA 4E5DA 2UZ1B 2VYQA 4HY3A 1N6OA 1ND6A 4FC6A 3GFRA 4KFCA 2JD2A 2HU8A 3QX7A 1D04A 2Y0BA 4L7QA 3O84A 3SNHA 4EKGA 2Q4EA 3H3FA 3NHAA 3EUFA 4X95A 1RRKA 3AW8A 5H70A 4C88A 4HZGA 3EDQA 5DHUA 4F2HA 3W1WA 1GQSA 4DV2B 1P1HA 1D2CA 2J3JA 5LIPA 4AQ7A 4R0NA 4PLWA 2VDPB 2XEDA 1NYTA 4MGIR 3RSZA 1U3TA 2GJ9A 2AOXA 4DC1A 1KFJB 4LA4A 2IWHA 5LDDC 4FDTA 3U9LA 1NQUA 3HVIA 1NJSA 3ZS8A 3GB9A 1TYCA 4LHZA 2O4UX 2O2CA 2QI9C 3MTDA 3CR8A 3WMFA 5JADA 3R0XA 2DFLA 2GN6A 2F3TA 3HEAA 3NW9A 1KJIA 4ODIA 4BASA 4U9UA 1CLEA 1E92A 1PIWA 1Q7TA 3K4PA 4RZQA 5B64A 1ISJA 2DFTA 4PO9A 1TX4B 3HFGA 1KYVA 2YXPX 1KZ4A 1L4LA 1O6CA 3I39X 4JENA 2HDNB 3PZRA 4RY2A 3IVXA 3KU4A 5I48A 4J0EA 4EQ6B 3KELA 5IVDA 4O2LA 3SMQA 4CQLA 5HMMA 4IIYA 5LA6B 3O8QB 3DMYA 4I4LA 2RD2A 1R6UA 4RTPA 1D9XA 1UDBA 1X6VA 2H1VA 1KOFA 1V1JA 1MOQA 2H2DA 2R66A 4IP0A 4KBGA 3WKBA 3KKKA 1U2ZA 2BFDB 2BRUA 3PT9A 4GZMA 3ASYA 3CWZA 3EXG1 4G2NA 1WVGA 1E59A 4HGQA 4RD0A 1KORA 4XM1A 3T3MB 1TZKA 1P2FA 2OAEA 1XMIA 1EXMA 4OQNA 2IDKA 2B5OA 1IZ8A 3LF2A 4GBMA 4CMCA 4GG1A 4AJ4A 3A7EA 3OKPA 3QQ5A 4K87A 1PK7A 3AR5A 4PE5B 4W5QA 2EAUA 3YASA 1KY3A 3CJQA 2QN1A 3QWIA 2FFRA 5HTOA 2A9JA 2ZB8A 5ALPA 2C2YA 4QHYA 5BNTA 3AI2A 2WWWA 2WMYA 4FDMA 2I0FA 1DCKA 1GQFA 3H18A 4ICIA 3RK0A 4BLWA 2V6GA 3OKAA 2P2NA 4JOQA 3O4VA 3T6KA 4JUAA 2YMPA 1E2IA 1EP9A 2DTDA 2ZRDA 4D4GA 3IV6A 5GONF 4FKMA 3JRNA 2D6FA 1ID8A 1ONBA 2OXCA 3FF4A 3ICOA 1IIRA 1J06A 4FW8A 1KMIY 1E3QA 2ASEA 1NUSA 4M22A 4Z7QB 4DPMA 3EDYA 4KYTA 2BLNA 1YACA 5CM8B 4ALMA 1GPAA 5BMVF 5CX1B 1HH4A 3L82B 3NBZC 3MWYW 5FFMA 4LYHA 1C30B 1UWVA 4G67A 2GJ4A 5JMWA 3URKA 3L4BC 2IYPA 4JYCA 4XWYA 1X7WB 1VBKA 3F5SA 4O0LA 3S2SA 4G63A 2Y4OA 3BQMB 3DE6X 2B98A 3EW7A 4HKTA 1OBCA 2CZQA 2QL7A 2Q28A 4EA8A 4IZ6A 3U5TA 5AWFC 2ASVA 4YV0A 2REOA 2WUEA 3IOBA 3PR3A 4GWGA 1WB4A 4XEUA 4QOJA 5TXGA 5C37A 3MSCA 3BE4A 3ROXA 4EVRA 3B6KA 4NTZA 2BFNA 2P67A 4L5IA 1YV9A 3ETLA 4RFVA 1Z5OA 5L3SB 5CLQA 3ZH9B 4UDOA 1GVNB 4D97A 2H18A 2EX4A 2BDEA 1O94D 2WB2A 3WRVA 4ZVTA 1UBUS 3CJTA 4OI1A 2UUBB 4HF7A 2GDJA 4EY8A 2VPTA 3BTSA 3AVTA 2WA2A 1DB3A 1XJQA 2C7QA 3ENWA 4PGGA 2AXQA 5IARA 4ZFNA 4U7PB 1CUXA 2HSDA 4Y67A 4ZO8A 1R64A 1Z0AA 1KWKA 2Q9BA 1XD9A 2BEUA 5BSUA 1IHUA 1C4WA 3ZD8A 4BCCA 2VAMA 5B6IA 5JI2E 2PA0A 2Y0PA 2REXB 4GFDA 4HMOA 5D5QA 5EI5A 4WGFA 3SF8A 5C32A 4EPTA 5JJCA 1CBUA 1XZLA 4R84A 2QLTA 3RPEA 3SIWA 3KL4A 1EBUA 1AK9A 4F1WA 4R0MA 2ZTUA 3VHLB 1EK6A 1CNEA 4NS1A 3U4CA 4GRAA 4BGUA 2XY4A 4TYNA 4UTPA 4N03A 1LDYA 3NM5A 2BKUA 2XKKA 1AQUA 3NV7A 2G83A 5TE9A 5FEMA 5ALTA 1C1YA 1KJJA 3NETA 4CF7A 3KOXA 2H8GA 2VT7A 5A5FA 2HCRA 1KVQA 5BP7A 2AJLI 3BERA 1CQIA 3FTFA 5GIOE 2IE8A 1VJTA 1L4YA 2CLDX 2HZBA 4YY3B 2I71A 3DE3X 3E61A 5EP1A 4LVUA 4JAVC 1BMDA 1A77A 1YS7A 3PPVA 4KR2A 5DT2A 2BMWA 2X3UA 1C41A 2HA7A 1W73A 1ZCZA 3ETHA 4PF1A 1T0JB 4DMGA 4YEDA 1DRJA 3OOHA 1T3ZA 3R8XA 2OV8A 3QVLA 1MZPA 2K5UA 1IN4A 3UGTA 3UHPA 3DHVA 3KL2A 4RO0A 4P81A 3WP0A 1QF9A 2J9GA 3LCUA 4D9BA 1L4GA 3ND5A 2YYSA 2JLUA 2GCEA 3F3KA 5B2EA 3IDAA 1L1FA 5IDQA 4GL2A 1H2EA 1RYNA 1ZC3A 2ZBEA 4IHQA 2F3QA 3N0WA 4FFPA 1QDUA 3TLEA 1ECPA 3W2TA 3EFOB 1VL0A 4DQLA 3VPGA 2CV0A 1CQWA 1EX9A 1XMSA 2XHEA 1SCUA 2ZWPA 4Z3KA 3OJ0A 4K03A 3ZY4A 1T5DX 1GDHA 1X9HA 1M8KA 4G25A 3EQ8A 4W1PA 1U3VA 3GWZA 1ZOSA 5DEIA 1WZIA 1I6KA 4IIXA 3G17A 1ZM4A 1E1CA 1FU8A 5JSYA 1E8MA 3JQGB 2OV6A 3ZD6A 4ZU1X 1PFKA 2HA6A 3DLCA 3VDQA 4M0MA 1XQ6A 4MV3A 4O6VA 4X71A 3UWOA 1KO4A 1ULAA 1XRSB 2BM9A 2QUAA 3ME5A 4LG1A 1CFZA 2F17A 3A6ZA 1T3SA 1J6UA 4AP5A 4UBIA 3RFCA 3VDXA 6CHYA 3TK1A 4FZ3A 4KQFA 1JT9A 1VZ3A 4MWGA 3KU1A 4FJ0A 3W5CA 5I4BA 4JBWA 1KGSA 1MU0A 4M4SA 2BZSA 2NO0A 1HI9A 3H9CA 1Z39A 4HGPA 3RROA 2VXBA 3LNTA 4LKOA 4JB8A 2MMGA 1GNQA 4QDXA 5DYYA 2X7HA 2JLSA 3ADBA 2IHTA 4CQNA 4LVOA 4R83A 2B8WA 2ECOA 2Q3EA 2YIVX 4TKUA 2QTVB 3RFUA 2QSUA 4ZI7A 5BOSB 5K8UA 4RQTA 1LI4A 2G70A 3RRMA 4IKEA 2IWRA 1Y1PA 2R6AA 1CK4A 3WS7A 3ZE8A 1QQAA 1K66A 4XRRA 1QIJA 3I73A 4BKPA 4CU2A 3BTUA 1C7FA 1XZJA 2PL9A 2J3KA 2WWRA 1YZFA 4WK6A 1BW9B 1W0JA 1EA7A 3ETGA 4JL8A 3WV4A 4L07A 4ZAXA 5C80A 1RHQA 1HLDA 3VGJA 1CY1A 3N7UA 1IM5A 1EDEA 4NEQA 3W0LB 1WP4A 3RTCA 4BQIA 2JJ2A 3O94A 3R7WA 2PZEA 4FJ2A 3EPKA 4XSGA 4OVKA 3BEDA 4L27A 5JSZA 1LKZA 3EARA 4JJFA 1J70A 2CK3D 1VRVA 4B4VA 3DMTA 3RM3A 1H69A 5FI3A 3CO5A 4JGGA 2OQVA 4LZLA 4KQHA 4QVKA 2H4XA 3HACA 1UMKA 4LC9A 4UTZA 3GHHA 4Z9XA 3H05A 2G1JA 1LLUA 2G28A 1Z5ZA 4ITRC 5L7YA 3RVPA 4P0TA 1XXLA 3HDTA 1QZZA 3NBKA 3QJGA 1Y4DE 3Q3EA 4WL0A 4HWOA 4XSHA 4DC0A 3TLMA 2PMCA 5AIBA 4RMNA 2BGRA 3CUEF 3M6AA 2OYCA 1AXEA 1Y8AA 2CXQA 1J8MF 1Y33E 2JW5A 2WFAA 3II6X 2NADA 4HNSA 4PNPA 3G0IA 1ISGA 2ZQZA 1Z2PX 3EFHA 4IY1A 1I6MA 1WW2A 4OHXA 3WBKA 2O8BB 1KP2A 3HCPA 3T34A 5JSHA 1LSJA 2MSKA 3O82A 2W8BA 1EG2A 4IIJB 4YFYA 1J8YF 3EDOA 2KW5A 3EGDA 2I4MA 4HDAA 4BIIA 3NGLA 3QMWA 1E4EA 2N46A 1X1BA 3KZNA 1YZ3A 4MTLA 1UPUA 1O95A 4YYZA 2HDWA 1PQWA 3SYTA 2O1XA 2GBCA 3DBLB 3M4NA 3FTPA 4P9NA 4BP8A 2XMZA 4FTWA 4CM8B 1GR1A 1MLDA 1W88B 2QTRA 1SKAA 2Q0HA 3PF9A 5L51A 1XNQB 1XEWX 1P8AA 2VSQA 1U2RA 1OJ7A 4M6WA 3EY9A 2FUNB 3R9XB 5FXMA 2B1JA 4BWVA 4X20A 5CNIA 4E4YA 3K0FB 2FUKA 5HF9A 3RVLA 2BDTA 5ALNA 2PWAA 3MXTA 3U7IA 3ZWPA 5A5EA 4TMTA 4HB3A 1ZNWA 5I9TA 1ZK3A 1MVNA 2EL9A 4U8HA 2IPXA 3TX6A 3AILA 3KUUA 4Q82A 1JQJC 4P3PA 2XDQA 3GEBA 1BYUA 3E4CA 4KLCA 2DC1A 1QHHB 2ZRMA 4R7ZA 5LQRA 1DIAA 2ZQYA 1NRJB 4MCAA 5DV9A 4CCWA 3DMGA 2A9RA 5AOBA 5GAJA 1DELA 4JI7B 3SAJA 5LP6C 1QS0A 5FBLB 3ZY2A 3IAEA 2CWDA 3ORHA 1EZ4A 2DJ5A 1Y8QA 3DT6A 3KKOA 5A2QA 3UQZA 5A3RA 1THZA 5K6AC 4EWLA 1I5RA 3CZ4A 2I62A 3BK7A 1ZBDA 3KPUA 4YALA 2RGDA 5MGNA 1JWLA 2PKWA 1AKEA 2IH2A 2IHNA 3IGFA 5H80A 5IJWA 1NJGA 2JLWA 3OI7A 1VE3A 5I4CA 3PT5A 1D3AA 1OPRA 1PL7A 4LYGA 2OCXA 1PWZA 1XHEA 2HA2A 3LGSA 3EG5A 1AD2A 2W00A 4OYRA 1ZN8A 4U6SA 5FP0A 4G0VA 4M8IA 4EELA 4I5EA 1OZHA 2BZGA 1IN5A 4DVJA 4L4XA 4ZHQA 1F8FA 4TLDA 2J30A 3WGTA 4AS3A 4XYGA 2WT8A 3I83A 3UK2A 3GJ7A 4KP7A 3TOCA 4BO4A 3LDHA 4FFOA 1HQKA 4PAMA 4OPMA 1RM3A 1FFXB 2J3DA 3BDVA 4J1TA 1NMZA 4TVOA 1UJBA 1IL0A 3Q88A 2X9LA 4MW1A 2EKPA 2DMRA 4YT5A 3LC0A 1JBEA 2JPDA 1SKMA 3SFVA 3LWNA 3TVTA 4EJ0A 3W4IA 4DNQA 4P3NA 4E1BA 2UZ3A 3JS5A 1TUEA 1WXEA 3AEXA 4NHOA 4F2GA 3AO0B 1A5BB 4BNIA 2C98A 4M38A 4ECAA 1DQZA 3WGZA 4FEYA 1XK6A 3S5JA 4KRGA 3L6OO 3H3XA 4O4IB 3MQ4A 4Q15A 3EFBA 3EQ9A 1ZI8A 4G5XA 621PA 3RRFA 4D2IA 1BJKA 1TQ4A 2PNJA 2VPIA 3LBNA 3MMXA 1Q1QA 1UK8A 3MJ4A 1SHJA 1WNTA 3FYCA 4ARUA 4YONB 2ZIUB 3H2BA 1XTQA 3JW8A 2CSUA 3W5IA 3EVEA 1GAXA 3W90A 5AKLA 2QYHA 1H5NA 3OCZA 1XMQB 2ZEJA 1EDOA 1N6NA 3C2QA 3E22A 3CN7A 2Y1KA 4C7JA 4ND7A 2WWGA 3E3OA 3VPDA 4WOJA 4Q3LA 4WEOA 1E20A 4DCGA 2IODA 1DLIA 5JDCA 1K5DA 2JA2A 3EPRA 3TZKA 3SKXA 3CRVA 2QSYA 3CUVA 4P53A 1C5KA 1ZH8A 1NE7A 3JSAA 4RADA 2H1HA 2VBIA 5HS4A 1XWIA 1YB7A 4D99A 2RAUA 3BA6A 1KKLA 3FYDA 4JBHA 3T7DA 5IKMA 4PYMA 4YCLA 1GCUA 1YVEI 4LTMA 3E84A 5F51A 3JYPA 1U0SY 1DWOA 4KXQA 3COPA 3GFTA 2XNDD 2ZT5A 1WCYA 2RI1A 4R68A 1K5HA 1OIWA 1VL8A 1QIGA 2HMSA 2WPNA 3JQDA 4UXHA 3ZVLA 2HF2A 3DLHA 3WNZA 4C0SA 2H08A 4MQUA 3IVMA 4RORA 3SFTA 4UJ3A 2ZYIA 4YMHA 4P83A 2UYCA 4FYHA 1AE1A 5CLIA 1N8SA 4R1LA 4F1JA 2LVBA 1P0CA 2VF5X 2YS7A 1B3RA 3O9ZA 4L6IA 4XCXA 5ER9A 4ZZ3A 3SZUA 1IVYA 2OCGA 2P2LA 3MJFA 4M9ZA 1L8LA 1JEYA 5JALA 1FTWA 5ES4B 4R1NA 3LLVA 4CMAA 5JCJD 2ZJAA 4FCCA 3IAM6 4RCZA 2IU4A 4G0WA 5I8PA 3OPMA 5SZJA 4KQGA 3C7CB 4B6SA 1TQ2A 5HUJA 4XE5A 4F2DA 3ZGLA 4V0RA 1TIBA 4LJKA 3BMCB 1N92A 1Z6XA 3I4FA 2W42A 3CVVA 3H86A 4UUBA 5CK4A 1EQAA 3JQBA 5E6RA 2SNIE 2HFKA 2XB6A 3EQ6A 4UNNA 4X94A 3FFWA 5C34B 3I2JA 3FOZA 4RENA 2REQB 3GFBA 4IYJA 2HT6A 4UTXA 1XLUA 2QI9F 1NXQA 4OQPA 1T9GR 4NCIA 4C29A 5GM1A 1TTPB 2YJZA 3P4XA 3WTCA 5KAPA 2X9NA 3RYTC 1U1IA 2YCBA 2CYAA 5HM6A 2P0AA 4AQYB 2H59A 4UVGA 3WR5A 5B4VA 1ZRHA 1QU2A 3AJAA 3VNVA 1PEDA 4CFSA 4QYXA 4CWAA 4HDKB 1LDGA 4ZEMA 4CI0B 4UBMA 4O3MA 5JYCA 4P31A 6NULA 4J3NA 3DLBA 1CUFA 2BJWA 3VI3B 4R8MA 2J6BA 3C4VA 3KOWA 1XFAA 4OQQA 4CEJA 4YRNA 1J5PA 3PDJA 2Z2ZA 4C6SA 4Z4GA 1MAHA 4QFMA 4KR3A 1JLSA 4MRVA 1XU4A 4TTQA 4M8LA 3QX3A 3PFBA 4HVTA 4Z3OA 1CUUA 1GUAA 1ZP6A 2ZIWB 5DT9A 2FQQA 4PX2A 5H02A 3NOVA 1M5TA 1UBRS 1H8HA 4GMHA 4HSEA 4U7WA 4XGRA 4ZQBA 3RJZA 2Q7XA 2WHXA 3UMFA 1U80A 3IMKA 4BP1A 5HIKA 4L16A 4ESVA 2MR6A 1LK7A 1E4VA 1ITZA 1SK8A 4MWBA 4TL7A 2QEQA 4JI6B 3ST7A 4Q39A 2X0KA 3ONNA 2P9EA 2D5IA 3UCFA 2BHTA 1FL9A 4X1IA 2EVWX 5L3QB 3LY7A 1BZYA 4J2TA 4F96A 3W8NA 3PRKE 2DQSA 5IKPA 4MDYA 4B1FA 2OG2A 3LPAA 1Z15A 5G4KB 3GEGA 2VK1A 4CIYA 1BHJA 2W0MA 4LFBB 1AO3A 3B6EA 4JXKA 5SYNA 3VHQA 2AW5A 4AJ1A 1ISPA 2B8NA 1KQGA 5TC4A 1F9EA 1T8TA 2O3JA 3RC1A 2GA9A 2B1GA 3IIJA 1R4AA 4D6PA 4XLLA 4EUNA 2QMHA 4F7WA 4BXOB 4YT8A 1GILA 3VKFA 4ZIRB 2OM2A 3KE8A 1PX2A 2B4RO 1HETA 3I52A 3I9NA 1QDEA 2PLRA 1T9ZA 4B7CA 5EJ5A 4MI9A 3V4PB 1JU4A 1OWMA 5J4LA 2ZI9A 3UWDA 1I4LD 1SXJC 2R7AA 1GCIA 5TV2A 4B81A 4EG0A 5CFMA 2L69A 3DVQX 2JGDA 3KQLA 1PWHA 3VMFA 1P4AA 2BY4A 3VPAA 3W7VA 1YQXA 2P9HA 3X2EA 1I0LA 5L3ZA 5E7JA 5AI5A 3T99A 1THGA 2F1RA 1GZ7A 4FN4A 3LT5A 2WR8A 4JODA 4B33A 5ALFA 1DJLA 1J90A 4RPIA 4XGQA 4QD3A 5HE9A 1D2RA 3JYOA 4PCVA 4BN0A 3PNSA 5BN3A 2P5SA 4CKCB 4MWEA 2ZFUA 1S2DA 2JDIA 3PEVA 2LWIA 3MSXA 4IO0A 2QKYA 1GPNA 3TW6A 1HDEA 2DY0A 4KN9S 2I3ZA 2IDMA 4Y3UA 1S4QA 1ZAKA 2P9TA 1JAYA 1LX7A 4KAAA 3AUXA 5KMGB 4KDEA 1NNUA 2IXTA 3ANYB 4IFTA 4FHGA 1J4AA 1V39A 2ZYRA 3DPSA 4MVCA 3TFOA 3H2ZA 3OH8A 4GNRA 2EARA 3NM6B 3GRAA 4MRMA 3Q6NA 5T6MA 3T52A 4DSNA 2P9QA 3EC7A 3A26A 3GRVA 5G40A 3AVXA 3ADKA 5JLJA 2C4MA 5DSXA 1E2NA 3QMPA 2FVYA 4HAVA 4TV9F 2X0DA 3WK6A 4B74A 1Z6AA 4KYIB 4MUJA 3G49A 1KI6A 4DDTA 1QTIA 4N7JA 5JVDB 4H1UA 3BM5A 2UUCB 1JEJA 4EO9A 1XF9A 1X1DA 3A6EA 4WX2B 1QRAA 3N3BC 3DC7A 1NE2A 3PZBA 4Y6GB 3HBLA 1QH8B 3OOEA 4WA8A 2Q5IA 4C2AA 2PU7A 3T3IA 3LHFA 3CLRD 5L7TA 2GYUA 3V34A 2C88A 4JITA 1XTZA 4RLSA 3C5HA 3HVJA 2OHOA 2X3FA 3TEMA 3FDZA 5D7NA 2H52A 2VHJA 2V7QD 1MB2A 3AEUB 2UVPB 3VR6D 1EB8A 2G9VA 2CHVA 3F8SA 4MIOA 3T4EA 3JTEA 3O38A 4WH0A 4RJKA 1KARA 1WOMA 3OAAA 4FFBB 2JASA 3GH3A 4AYTA 5GWXA 3G7UA 5LZ2A 2FWNA 1Q19A 5KSWB 4WOBA 1SFRA 1NKVA 2YR0A 2UZAA 3ZV5A 5FIUA 1DI0A 4R41A 2I8LA 2XA1A 4ALIA 4J43A 5JW6A 4M21A 1GXSB 2AFIB 2F90A 3KZXA 1TEZA 1L7BA 2WICA 4RD2A 3ZNPA 1DQYA 1UXHA 3A0RB 1P9LA 1R50A 3AP1A 4WZAB 2P9GA 3MCZA 1E3WA 2NOAA 4QOGA 4EENA 5A1TA 4PQRA 1CQZA 4OO3A 5CDFA 1BFDA 3KKMA 1IPEA 2V7GA 4PRYA 4F8JA 1YNOA 1FNCA 3C1OA 1CUWA 1FP4B 1MAUA 2GB4A 5ECYA 2VWGA 1VI6A 3BXEA 3VJLA 3RYIA 2BE9A 2OM6A 3R6DA 4D80A 421PA 5L8VA 4BMXA 1J9GA 1CW2B 4OIMA 5JV5A 5KVAA 2DHQA 4UATA 1JRLA 2FOLA 3GV0A 2YV3A 2G40A 1TF7A 4IBOA 4NQZA 4DANA 4F85A 4Z7NB 3I5YA 3LGXA 3V4ZA 1V8PA 2H2HA 2D54A 4ND6A 4B34A 5EE0A 2GAFA 1NQWA 4UPVA 5EHGA 2PRIA 4B46A 4A5OA 4JBNA 1H8ED 3N8IA 2PWZA 4QGSA 1RBMA 3MT9A 4AMZA 4IXDA 5THQA 3RS8A 4HLDA 2QRVB 2Q8NA 4WZZA 3VR0A 1AGPA 1X70A 1O9BA 1EQUA 2H4JA 2X3YA 4MRRA 1Y9DA 5BSTA 3RIHA 3GP8A 3HS3A 4M37A 1PQUA 2I66A 2JVKA 3WK9A 3NNSA 4JT4A 3PKIA 4IGIA 1PVDA 2C5LA 3AEKA 3I8OA 2FX3A 2NO7A 4XFDA 5A9SA 1J5EB 5JRZA 3PGLA 1XZIA 3IS3A 4KB5A 2PZLA 1GFIA 3LE8A 4UU7A 5EXEA 4F4IA 3RU3A 5F12A 3P0IA 4BFZA 4R31A 2ANBA 3NQ41 2HK7A 4RXTA 5A3QA 1DX4A 1EP2B 1NW6A