1Z88A

Crystal structure of lys154arg mutant of mature apha of s. typhimurium
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
208
structure length
208
Chain Sequence
b'TLNPGTNVAKLAEQAPVHWVSVAQIENSLTGRPPMAVGFDIDDTVLFSSPGFWRGKKTYSPDSDDYLKNPAFWEKMNNGWDEFSIPKEAARQLIDMHVRRGDSIYFVTGRSQTKTETVSKTLADNFHIPAANMNPVIFAGDKPEQNTRVQWLQEKNMRIFYGDSDNDITAARDCGIRGIRILRAANSTYKPLPQAGAFGEEVIVNSEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AphA protein
publication title Structural and mutational analyses reveal the functional role of active-site Lys-154 and Asp-173 of Salmonella typhimurium AphA protein.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Hydrolase
total genus 72
structure length 208
sequence length 208
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2005-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1z88A00
4L6AA 1QQ7A 2AGVA 1QQ5A 4MUMA 2G08A 5AKYA 5AKZA 1Z4LA 2AUTA 5AVYA 3P96A 2EAUA 4EELA 1IWOA 4O8CA 2X4DA 5AKEA 3WKBA 1SU4A 3RFUA 5E0OA 4XOUA 4JDPA 3RF6A 4L6CA 3AR4A 4CF3A 5ALZA 3OCWA 4XQ0A 2HO4A 2YJ5A 2G06A 4QQFA 5AM0A 2O9JA 2FPXA 3R9KA 1XVIA 3NRJA 3AR8A 1PW5A 4BEVA 3S6JA 2WF8A 2WF7A 3K1ZA 4EZEA 3U13A 1RKUA 3F9RA 3R4CA 2YBDA 4NAVA 2CN1A 1Z88A 1Z5GA 2ZXEA 3SKXA 1TE2A 2B82A 5T41A 2FEAA 3ZUPA 1Q92A 3ESQA 3DNPA 3L8EA 4HGOA 3QGMA 1CQZA 4MWOA 3AR5A 2G07A 2JAUA 2HX1A 5ALJA 3UM9A 4Y2JA 3NUQA 2C9MA 4HGRA 5AKHA 4L57A 1RC8A 1U7PA 4Y2UA 5ALPA 1Z4QA 4KNWA 2IOHA 4J2TA 4BBJA 1FEZA 2CFTA 2HF7A 4Y2VA 3AR9A 4AS3A 2FPSA 2GMWA 2WF9A 1Z4PX 2PQ0A 2B1QA 2ODAA 1U02A 4UAVA 2HEGA 2B30A 3GYGA 5ALUA 5ALTA 3E58A 1RPZA 2ZBEA 2B0CA 1L8LA 2GFHA 3A1CA 3KBBA 5AW6A 3E8MA 4UMEA 2RB5A 5AIAA 3SMVA 2YJ4A 3N28A 3L8FA 4UASA 3DAOA 4DFDA 2C88A 2I55A 1YV9A 2R8YA 3U26A 1WPGA 4BNDB 5ALVA 3EWIA 1QYIA 2WFAA 2P69A 4HYTA 4RESA 1ZRNA 1ZJJA 1YNSA 3AR3A 2G80A 3QLEA 3OPXA 1J97A 3B9BA 2YMMA 4EENA 3SLRA 5IT4A 1L7MA 1WR8A 3FPSA 4YCLA 4UAUA 1ZRMA 2I7DA 3WGVA 4DW8A 3AR7A 5AM1A 1RRCA 4UARA 5ALHA 3A3YA 4UMFA 1Z5UA 2IYEA 5AI5A 1QQ6A 4CE6A 1N9KA 5AVRA 1SWVA 2I33A 4DWOA 1EK2A 2FUCA 4C4RA 4I9FA 4F71A 5ALFA 3KDPA 2YMPA 1KYTA 3M1YA 4HGPA 2Q4TA 1ZOLA 3L0CA 4B6JA 4OHFA 1L6RA 5ALSA 3R09A 5AKLA 3D6JA 3SD7A 1RKQA 4CNQA 3QUCA 4BX2A 5AVTA 3FGOA 5AICA 1RLMA 5AI9A 3BWVA 1YMQA 1ZD3A 1L7NA 1WVIA 2RAVA 5ALXA 2G09A 5AHXA 2C4NA 2OYCA 1NRWA 3QXGA 5AVZA 5A3SA 5AM4A 3WKCA 1O03A 1L8OA 4Y2TA 1Z4NA 2AMYA 4G9BA 4QJBA 2NO5A 5ALWA 3KC2A 4HGQA 1RLTA 5AW2A 1RQLA 1WZCA 5AW4A 2BDUA 4ZEXA 1NF2A 4EEKA 1AQ6A 3OTQA 1VJRA 4ZEVA 1TJ4A 1Z4JA 3OCUA 2R8ZA 1S2OA 3FVVA 1T5TA 3AR2A 5AVXA 3FPBA 4FYPA 3EF0A 5AM2A 4C4SA 3W5AA 4YH1A 4KX3A 3L5KA 1O08A 2IA5A 4UMDA 3ZVNA 4KX5A 3NAMA 3VAYA 3L8GA 3WKEA 2ZBFA 1VFPA 3W5CA 2MU1A 3L1UA 5AVWA 2AH5A 3QU9A 3WKDA 5ALYA 1LVHA 1ZS9A 5AVQA 2JGAA 3SF0A 2P27A 3M9LA 3OCYA 5ALKA 5ALOA 3L0YA 3L1VA 2YJ6A 3ZX4A 4UU0A 4Y2XA 5IS2A 4CF5A 1TJ3A 3QYPA 3EF1A 2HDOA 2P11A 2JAWA 2NO4A 3ZU6A 2W4MA 2HI0A 1L7PA 3OCXA 5FP0A 4GXTA 4G63A 4H1WA 3WK9A 4Y2QA 1NNLA 1ZD4A 1ZD2P 1ZD5A 3MN1A 3ONNA 2OM6A 1YJ5A 1RDFA 3I76A 4AP9A 4Y2SA 5AI8A 2EARA 3WK8A 4OFZA 2WM8A 2YFYA 3IB6A 2FPWA 3PCTA 5ALEA 3ZX5A 1Z4IA 2PR7A 3CZ4A 3U7FB 5AI0A 3NIWA 3ZTYA 3L8HA 3IRUA 4HGNA 4KN8A 3ZWKA 2OA0A 2VKQA 2OBBA 5ALRA 5AVUA 2GHTA 4Y2YA 4UM7A 2QLTA 5AW8A 4Y2RA 5ALQA 3MC1A 4NV0A 3U7HB 4YCNA 3NANA 4AS2A 2WHEA 3UMCA 2ZBGA 4BKMA 1XPJA 3SKYA 2RBKA 2YN4A 2DQSA 2ZOSA 1YS9A 2EATA 3ZVMA 2I54A 4YIHA 1F5SA 2GO7A 4CF4A 2Q5EA 1U2TA 5AIBA 5AKXA 2D2VA 3CNHA 5AVSA 3ET4A 3NASA 5ALIA 2FPRA 4E88A 1T5SA 4DCCA 3W5DA 2I34A 3QUQA 2QYHA 2IOFA 4HAIA 3A1DA 3ED5A 5ALLA 3OCVA 3SHQA 4PNHA 4UM5A 3WGUA 4NWIA 4UU1A 4IG4A 1LTQA 5AKJA 3WK4A 1CR6A 1Z4MA 3UMGA 5AESA 3ZI4A 1Z4OA 4XPZA 3N8GA 5A3QA 4YGYA 4NFLA 3IJ5A 2YMQA 3OCZA 2JAOA 1RKVA 2B1RA 3ZW7A 2P9JA 5AW9A 2FDRA 5AKKA 1TA0A 4YCMA 3PDWA 3HLTA 5ALMA 1X42A 4KNVA 2FPUA 3ZVLA 4UW9A 3MMZA 3QU2A 3QU4A 5AKIA 3I1YA 2WF6A 1MH9A 4BX0A 4C4TA 1TJ5A 2C8KA 2B8JA 1JUDA 3EPRA 5AK4A 3B8EA 5AK6A 4Y2PA 3QUTA 3QX7A 1EK1A 3QU5A 2YY6A 2HOQA 3E84A 5ALDA 5ALGA 2CFRA 3N1UA 2O2XA 5A3RA 1SWWA 5AW5A 1RMYA 1Q91A 5ALNA 3WK6A 3L7YA 4Y3UA 3WK5A 3N5KA 3MPOA 3QNMA 5AW1A 2ZBDA 2FI1A 4UATA 5AI6A 4EX6A 2G1AA 5AKGA 3PGVA 4KYTA 1QH9A 5AW7A 3ET5A 4JB3A 3A1EA 2I6XA 2C8LA 4NABA 4YIKA 3TLMA 5AK3A 4OCZA 1L7OA 3B9RA 2R8XA 2NYVA 1VJ5A 3FM9A 4UMVA 3WKAA 5AW0A 4XE5A 4FFDA 2PKEA 2YMLA 4EX7A 2BDEA 4F72A 5AK5A 3I6BA 1K1EA 5AM5A 1Y8AA 1YDFA 3DDHA 3DV9A 3W5BA 3QUBA 1RLOA 4ZEWA 4FE3A 4OD0A 3KOOA 3U7GA 3J7TA 2HCFA 1J8DA 4J03A 2JARA 3HYCA 1XP5A 1T9ZA 2YJ3A 5AW3A 2Q4RA 2HSZA 3ESRA 3KD3A 2B8EA 2HHLA 3PGLA 1U2SA 2GHQA 3U19A 3NALA 4I9GA 2W11A 2G0AA 2WF5A 3L0BA 1Z4KA 5AM3A 3ZTWA 3U7EB 3WK7A 3BA6A 3E81A 1RQNA 2IOFK 3KZXA 1N8NA 2CFSA 2R8EA 3UMBA 1RMQA 2RARA 1RMTA 2ZG6A 3QU7A 4BNDA 1U7OA 3AR6A 5IT0A 4BX3A 2FUEA 4BYGA 4BEWA 1S8OA 2MSNA 2HF2A 2BY4A 5AVVA 3N07A 4IFTA 3FZQA 3ZWDA 4RETA 4GIBA 5JJBA 3I28A 5AI4A 2W43A
chains in the Genus database with same CATH superfamily
2GI4A 3C6BA 1JDPA 3C70A 1JE0A 3D8NA 4R9RA 1WV1A 1B1AA 1Y6GA 4BIIA 4R84A 3RSGA 2AUTA 2JS7A 4ZAYA 1YL6A 2PFKA 1GUDA 2ZIXB 3P96A 4BLVA 1KAOA 5D8DA 2IW1A 4X41A 2R5FA 4P36A 4AMZA 1PG2A 3O8QA 2P5TB 1MAAA 1P7PA 1R6XA 3F5MA 3JVEA 3M6WA 3ZY2A 3SHFA 4BVEA 3B1XA 1GA1A 2QNIA 4UQOA 1TIBA 3ECAA 3G2QA 2DULA 3HJCA 1JZSA 3A06A 1ODFA 1WSWA 2X6TA 1TZ2A 1WIWA 3HVKA 4N47A 4YRGA 5K0SA 1JHXA 4X66B 4JI4B 1QHSA 1RW4A 1CYDA 3FZGA 4EA6A 4HF7A 5I48A 4DMRA 4EJSB 1QZTA 1ZOOA 3QEOA 3PXDA 4LJ5A 4QDUA 4CHTA 1GRNA 3NNDA 3R7LA 4Z5XA 3PNSA 3AR8A 3DCJA 3DGFC 1MX9A 3ICCA 1U28A 4I4CA 1BVUA 3OX4A 1CW2B 5IKOA 5DKFA 5I9BA 2C4KA 2XQVA 1AKEA 1COZA 4DRZA 1AK9A 4JJFA 5KC8A 3A2KA 5H3CA 4X97A 3FGNA 5JATA 4HNGA 3F5DA 4QUAA 1TE2A 5IM4F 2FEAA 2X3YA 3BE5A 4I5GA 1N36B 3HCWA 4BLPA 2HF8A 4ZXFA 2YICA 3Q87B 4UBIA 3EARA 3JQ9A 4FQ5A 2AC4A 2QVBA 5BO5A 3B1VA 3HM2A 1CIJA 2HJHA 2D5LA 3KXDA 2EJVA 4PVCA 2J9YB 4CODB 4TPKA 3DEIA 2CVPA 3I1IA 4AJJA 4S2EA 5ALJA 4FFNA 1F17A 2P4QA 2WWTA 1KXZA 3DG9A 4XIIA 3BMQA 5D6NA 5LYJF 1QS0B 4H4EA 4O0LA 3ENKA 3AZPA 1NZDA 1IWPB 3DNMA 3ZHVA 1M2HA 1ES9A 3JSAA 4XIYA 1DUSA 4BP1A 4EHDA 3B48A 1JHAA 5KBYA 2J48A 4LV5B 1VP3A 1UEIA 1KS9A 3GLQA 5GY7A 3BFXA 1VL8A 2RCYA 2H1LA 2YWJA 5HKKA 1F4LA 1LRLA 1WPRA 1KHTA 3GLFE 4N5HX 2IOYA 3F96A 1PJQA 4MWSA 1X7YB 1QRDA 2Y71A 4F46A 1W6UA 4HRYA 5ES3A 1FFHA 1AGXA 3L6OO 1G2PA 4KPGA 1GKIA 4QSMA 5DM0A 2WAAA 2AOTA 5CURA 4L75A 2P78A 2VSFA 1KAMA 4HP8A 5GVSA 1N2HA 2ZZMA 2G9UA 1LC0A 1NP7A 4LJ7A 4WTOA 4UM8B 4UZFA 9ATCA 4Z4QA 2GFHA 5EE1A 2O2SA 2G36A 2C99A 5GONF 3A1CA 3W2GA 3W90A 5KJEA 3UXHA 1CU1A 1YQXA 5BSVA 1EB9A 5SY9A 3O47A 3TZBA 1TO1E 2ZJYA 1QOPB 5EJGA 2PFGA 1MVNA 3AF5A 3U0BA 4AP6A 4BYMA 3I83A 3WI7A 3RS2A 1E2HA 4RTKA 1XQ1A 1ZINA 3R24A 3UB4A 1NT2A 2J9ZB 4KE8A 2QU7A 4DDKA 1XTPA 3CY6A 4OSOA 4OYLA 4GBMA 1CUSA 3WMXA 5A3JA 4FS3A 1E9FA 1F14A 4HQ6A 4IIUA 3SDZA 4CLXA 3REGA 2Z09A 4GM4A 1G55A 1QYIA 4DT1A 1MQAA 1YS1X 5A6SB 3ZDFA 4GS5A 4JZYA 4QVGA 3U7IA 4CIAA 3FTFA 2HDNB 4HWTA 3E9ZA 1L6IA 4I1SA 4OJMX 3V4SA 4BVBA 1MGOA 4DG5A 4N7RA 1EFPB 2YJTD 3GLTA 4MUEA 2I91A 1JQBA 1M54A 5DTJA 1T2FA 3SM9A 1XPUA 1LI7A 3E9CA 1EXMA 4YCLA 4HDAA 3C98A 1BQEA 4P7GA 2AKEA 2O59A 4OAQA 4JT8A 3P2YA 4WLEA 3V8BA 2LBPA 4FLEA 4G97A 4D3ZA 4YJHB 4AJPA 4HCJA 2V4ZA 2RGGA 4IDCA 4EQZA 1WP9A 5ALHA 3A9VA 4LOLA 3LDGA 1E69A 2WD7B 3C3JA 3EJ6A 2XRMA 3CSSA 2GJKA 1NRIA 1XSEA 3F6RA 4JUBA 3G0HA 4ZT2A 4C4RA 1B14A 1TC2A 1XEXB 2N46A 1VE9A 2ZYHA 2E4XA 1PDWA 5CVUA 3ZBUA 3ZGLA 3F4BA 1M33A 3RYIB 3GAZA 4NBTA 4NDZA 4IL5A 1WG8A 1GR1A 3F2IA 3I23A 4N0QA 3N2KB 4CGZA 4RX1A 3R09A 5CEJA 5A4JA 1TZKA 2GF2A 1EA7A 4XFJA 1BXRA 3TIVA 1MQ8B 4WIAA 3PXBA 4GEGA 3LY5A 4BX2A 1SRRA 4PC6A 3NV9A 3VUFA 2QAJA 3JD3A 1N6OA 3OY7A 4B7UA 1XQYA 1V7PC 5HSGA 4B09A 5T4BA 2IQ5A 4NCXA 3BWBA 1N8SA 3VFDA 3ZXXA 1QH1A 5TS3A 1LBIA 4BMYA 4YLGA 2CLEB 2G09A 3OESA 1OLXA 1BC5A 5CK4A 1Z3IX 3RU2A 1RYDA 2GZHA 1HZJA 1YR2A 3CH4B 3PG5A 2X0NA 1BYUA 2GDZA 2VZEA 3HR7A 4BO8A 5A5FA 4P7KA 3ONFA 1L8OA 1M0EA 2W2NA 5FBRB 2P9ZA 1I7PA 2HBQA 3A9CA 3D43A 1QHNA 2AG6A 4NBUA 2IEIA 1DQYA 4ARZB 2OC4A 4NDAA 1MMFB 2H2DA 3BIXA 1O1YA 4II3A 5D3MB 2HYIC 3R7AA 1SD1A 1M66A 1FUEA 1QVWA 3T54A 3WGYA 3MWEB 1VMEA 2IXTA 3NO4A 1SIOA 4FYMA 5AD1A 3HL4A 1OXXK 1W5SA 2EX4A 4MKZA 4NTZA 1X77A 3OZUA 1DJNA 4QECA 4B87A 3V8PA 3C3KA 1E0DA 1H66A 1OZ0A 1DV1A 1MABA 3UK7A 1KMCA 2YQ5A 1EVQA 3CZCA 4EF6A 3FDZB 4FYPA 2NADA 3BXXA 1VBFA 3CBGA 3QE2A 1PEYA 2NXCA 3BICA 1GZSA 4OUKX 4KX3A 3RHFA 2D3WA 621PA 2XCUA 3WMWA 1LJUA 5F4BA 1C41A 2FZEA 1F0YA 2BEWB 4G4SP 3ELBA 3VDNB 2VJYA 1E0JA 2OBYA 3PT5A 1N6HA 2BTQB 3FJOA 1O95C 4QATA 3R8XA 5J3JA 3L4JA 1RWBA 2XUAA 1FP4B 1K4KA 4YXWD 1VPTA 3IAM6 2HFKA 3PRYA 4NZPA 5M5BA 2HIGA 4GF5A 5LUAA 4MVJM 2BFAA 3NWEA 3TZLA 4RVGA 2QLBA 3VC2A 4BO1A 1ORTA 3AM1A 3I9FA 3L0YA 3M33A 1E9EA 1HY3A 5JNWA 1O0CA 1ZNZA 2PSFA 4I99A 4ER0A 3VGJA 4RVSA 4E5PA 3R3JA 3DFIA 4BMOB 1UP6A 1BFUA 3GUHA 4DS3A 4GL2A 1SZDA 5AXBA 4LF8B 2NV0A 4DJDC 2WM9B 4DLVA 5IUNC 3MJEA 4WLVA 4XCVA 3LXUX 5DSXA 3ZBQA 4JXZA 3DR5A 1WEKA 2IODA 5TLSA 1MN6A 1K7XB 2HMUA 3DW1X 5JWHA 3SJ7A 1NJ2A 2ZJ5A 4RE5A 2AOVA 2VQ3A 1YS2X 4B4KA 3PB3A 1SZPA 2PTHA 4RSHA 3DD1A 4OHOA 1NQOA 3SSMA 2Y77A 1G1MA 3NYWA 1VLLA 4WX2B 3T35A 3SQXA 1T0UA 3TUZC 2DFPA 1GUYA 3WZLA 5D5PA 2YNMD 3NHMA 1YC5A 4M9XA 5JCJA 5KNBA 3ULKA 4RW0A 2JGFA 4A2PA 2KE5A 2JC3A 1A9TA 2FFAA 2GCOA 4GR4A 4RDHA 3DCNA 4WXYB 5D00A 1KETA 1K5HA 2BI4A 4DCVA 4E15A 1KZ7B 1USGA 2BFEB 1L1FA 5AVUA 4D9KA 3ADKA 4ZOQI 2LDBA 2PX2A 2VRCA 4ENSA 2XZPA 1H1TA 1PFYA 4IH9A 4ZDJA 3G9QA 2E85A 1P2VA 3WLRA 2D5BA 3GNQA 4B3GA 3KTFA 1EB8A 3M2TA 3V1UA 3EVAA 2ATEA 1IK4A 4EY4A 3AYXB 5LOVF 4YCNA 3K5IA 4AS2A 2Q9BA 1RI3A 3PITA 1A5AB 4QGAA 3DTNA 1O6BA 2YWRA 3F1KA 1OI3A 1M1ZA 5DIZA 3V1KA 3HNRA 1XMSA 1AHNA 1I0ZA 2VF4X 4G1CA 4YXFA 3NDBB 3RUEA 1E8DA 3CZAA 4ID9A 2A92A 3LWDA 2F90A 2P5SA 5IVPA 1NI4B 3IEXA 5KX5F 3FUTA 1DARA 3DMTA 1AZSC 5P21A 4EHIA 1EVKA 5K9ZA 4IGFA 2ZITA 2F2TA 4ZU6X 1Q16A 4F3RA 2NAFA 3PVZA 1DZ3A 1BHO1 3NASA 4OP1A 4GMDA 3S7TA 3O1LA 3TNYA 1OJLA 1D5CA 2PXXA 2YC4C 4QTUB 4ZICA 2Z83A 1DFIA 3OZBA 1U31A 2GYUA 4BN0A 7REQA 1U9CA 2ZE5A 1WPQA 2XVXA 4AUEA 2ZYVX 4P4GA 3AJEA 1WMFA 1IB6A 3SC3A 3PQ6A 5DTQA 1SH7A 3H1FA 4YONB 5FTJA 2Z5GA 1TTTA 1WXDA 2B4YA 4KI7A 3DDOA 1DAOA 3BHJA 3LX8A 3NDJA 4L9SA 3B1WA 2O5EA 1ND5A 4PSAA 3AU9A 1A98A 1PWXA 3PUXA 2E5LB 2IS1A 2BSXA 2DLCX 2ZSHA 3H5NA 4XSGA 2VP0A 1HE5A 3ISVA 3DEHA 3KHSA 5EIXA 4YEDA 2B1RA 2XZOA 1LK0A 4E32A 1PFQA 1V1MB 5AW9A 2G40A 4P4UA 4ZVTA 4IM7A 3RREA 1TA0A 1FW6A 1O57A 2P1DA 4XASA 4OI2A 5DM2A 3L0PA 1UKBA 2H08A 3H9JA 4RTPA 3KHKA 5HVNA 2B7CA 1HMPA 2ZREA 4G1FA 5HQ3B 2F4VB 1NONA 1T10A 3A2MA 1X9HA 2Y8EA 4ZALA 2Q28A 3JQPA 3LCMA 1BS2A 4AX4A 5G3ZA 2QI9C 4DANA 4ZHSA 3LSYA 4FGLA 3DYBA 1N2GA 2I8AA 2HREA 2LWIA 3Q6NA 4FONA 4ZYVA 2DUUA 5CB4B 3QE0A 3AINA 4K8OA 2EQ5A 3L4KA 2WDPA 2Z6UA 2COUA 4Q37A 3A1WA 3ANXA 2A2ZA 1ODSA 3G2KA 4MS1B 3RR2A 4Z4HA 4BHTA 2BRUC 4XQGA 4O4LF 4EO4A 3SBDA 1J0CA 1OF1A 3SS9X 3BD6A 4Z7QB 1DO8A 4UNQA 2VDOB 4IHJF 2R2GA 3H6GA 4BBZA 1Q91A 1IOWA 2FE4A 3O3MB 1M8KA 2Y99A 4Z4EA 4Z7OB 3H1GA 1Y6RA 4ALLA 1C14A 3VU9A 1P0IA 5JDCA 1CUFA 1BAPA 2ZVJA 5AW1A 1G98A 3FSGD 1LK5A 3HCCA 3WLNA 2OPBA 4MUYA 4W9MC 1BHSA 5B57C 1DC8A 5DNYB 1A8HA 4EYQA 3TMYA 5DYGA 5A3VA 4F8JA 2C7OA 3ET5A 4HG2A 4O4JB 3CCCA 5EJEA 2RGRA 2ODNA 4BMZA 1Q1ZA 1SIUA 4TT8A 4DEVA 4CL2A 4PS1A 2C8LA 5FUVA 3HKEA 3OM9A 1M2KA 3FCXA 2EJCA 3QLJA 1RYZA 4INOA 3RUIA 2QW0X 2ZUWA 4EUKA 4OL0A 1G5PA 4OQXA 5EWLB 4DG8A 4HGYA 4D9BA 4K9MA 2Z3WA 4PIMA 1T9GR 3UG6A 2YRWA 2NX2A 1H4TA 4IKOA 4NEHB 1J06A 4Q4DA 5CAEA 5IPFA 5LNK1 3AI3A 2JFXA 4I4TF 4F72A 1JKXA 2H57A 4ASUD 1QTNA 2AR0A 2HLNA 2ODPA 3K15A 4WA8A 2WHPB 5H4HA 3BSFA 5TSDA 3EVGA 1IBCA 1ZI6A 1H0HA 3BB1A 1W88B 1VYTA 1IRIA 4WD3A 2QL7A 2EF0A 2QTGA 3S8YA 2UKDA 2MINA 2P0EA 2ATVA 2JCSA 2JGJA 1FU4A 3BB3A 1NJ8A 3W1EA 1DG3A 1NE7A 5MGBA 1SHKA 4MS3A 2GEKA 3BTSA 2VNAA 4AT1A 4DLTA 1AV7A 1PR3A 1LSJA 3MWDB 5EIWA 4PLFA 4AWBA 1P60A 1CUUA 1U2SA 1YQ9A 1Y7LA 1H8HD 1RTTA 2XX3A 4P08A 4RLQA 5IAKA 3ZWVA 4CM5A 1YA4A 1BXGA 4H4DA 1YZTA 1UDBA 2Z5LA 2O5RA 3MUNA 4PX2A 1I3OA 3ZN2A 2WF5A 3IIJA 4GKJB 3DEZA 3RWOA 4BWYA 1NRJB 2WTAA 3AO0B 3DBRB 4V38A 1RI1A 1SEVA 2Z95A 4GWLA 5AJHA 5DWQA 3USES 3WL4A 4CMHA 1TMGE 5K2MA 2C5LA 4NZMA 4ALIA 4K3VA 1U2DA 4CMGA 4H7EA 2ZYGA 1K06A 2XKJE 5HQTA 2YXEA 1UPUA 1M0SA 1H9CA 2VDWB 3PXEA 3HLKA 4MQBA 4WI1A 5AHKA 1BWSA 4A6DA 3K9GA 4H9GA 2R9VA 1FSPA 2Q7DA 4E08A 2OCYC 4CF7A 1CUJA 1RRGA 1ECCA 2WMNB 5H80A 3V4VB 1NZJA 3AQIA 4EZBA 3F46A 3HA7A 4P32A 3KLOA 5GWXA 1WLSA 1ZNQO 2PWZA 4R3WA 5L3ZA 2OK8A 1RXUA 4C4OA 5F98A 3NP7A 1HXHA 3BCHA 3K92A 5CFRA 2DQKA 3V4PB 1QO0D 5HFNA 2Z30A 5CGQB 3HYSA 4YO7A 3MCTA 1JR2A 1QHGA 2E4UA 2PUGA 4N03A 3NHSA 1TYCA 4G0NA 1R8XA 2Q0SA 5AI4A 4RKRA 5KOJB 3HDJA 1W4BA 3AXTA 3IIKA 2OBFA 4X00A 3DMHA 3KB8A 1E2JA 1GDTA 2WC1A 3KL2A 4LOJA 1HWYA 3KAKA 3MJVA 1FK8A 4L72A 2PX4A 5L3SA 4GP6A 1TVKB 4LRQA 2Q9CA 1ZHOA 1PYDA 4MVCA 2HWUA 1GGHA 2GEJA 1LJLA 3LBIA 5DOZA 3MGKA 2GFIA 4JEUA 2VRBA 3UMFA 3EXEA 3QXJA 1UP7A 3H8SA 1KK1A 4M0MA 5E0OA 2W58A 3GI1A 3V8VA 1STOA 3KUDA 4O5AA 1AQJA 3I04A 3TLKA 2ZEJA 3U61B 1H2XA 5JY6A 4DMHA 2HO4A 4KO1S 2J9XB 4PNZA 1LU9A 4NS4A 2FKAA 3D64A 4JOCA 4PS0A 3F6BX 1VECA 2JHGA 5C31A 2ZTSA 1N3LA 4ND4A 1X7WB 3V6LA 1APBA 5JNTA 2XQKA 3G1UA 3EIHA 1PT9A 3UGTA 3BIJA 3R3SA 3WJ1A 1SCUA 4B0PA 1P0CA 1SKAA 1EP2B 2HPAA 3LUBA 4P33A 5KYXA 1XRMA 2WSYB 3NEJA 1MV8A 4HLUA 5D1HA 2WW8A 3LHFA 4ZFNA 4IV0A 2VPXA 4IIEA 5AK0A 5LQDA 1T5BA 4MR8B 3M89A 1W25A 2DLDA 3WC4A 4C2AA 2PUBA 2IXDA 2XY4A 3UB2A 4YB8A 3BFPA 1VQ1A 2Z98A 1GDHA 2O48X 2P65A 4HB4A 4Q9DA 4RVDA 1LDEA 1AOXA 2I1VB 4WERA 1I3KA 2KBEA 3SIWA 3BXEA 2PCLA 3W6NA 1FNBA 2NQ8A 4CUJA 4Y2JA 3O82A 5JWRA 2ZIGA 1GILA 3DDWA 1H4QA 2OCPA 1UPBA 3KQMA 4EDHA 4WMLA 4QNMA 4TYYA 4I5EA 1HTBA 4REQB 4B74A 1Z4QA 1QZUA 3IPCA 3NBQA 1J6UA 3OFSA 2JCBA 2DFLA 5JNSA 1N5JA 3JW8A 2QZ4A 4P22A 1O95D 2Y4OA 1E2BA 3BREA 1OLUA 3W6OA 1GV0A 1KI8A 1P2BA 2FPSA 2WEKA 1LDBA 4IEFB 1LA2A 2GASA 4J6FA 1SHLA 2O7VA 2XTAA 3B5EA 3EQ9A 5AJUA 2XRZA 5D2CA 2FMFA 1CR0A 3BS4A 4R81A 4EHAA 4GE0A 1PCXA 3MWFA 2MMCA 3GYGA 1P9NA 1H6BA 4Q03A 3EMKA 2VUSA 5FR1A 1L1RA 1PLKA 5CBPB 3ZHTA 7AT1A 1M2OB 5AW6A 5JSFA 1SJ9A 5CDFE 2RKBA 1PO7A 5BQFA 4IIFA 2IHVA 3H6HA 4F9TA 2FUG6 1NNEA 3T3MB 4BGIA 1UAGA 4XJXA 4UVIA 5ITZB 1H5UA 3EXIA 2JRLA 4GM1A 2GAJA 4HQRA 1ATIA 4JOBA 2P7IA 3IAS1 5BNIA 3WGGA 4F3NA 3INGA 1IUKA 4KKXB 4XB6B 3EUFA 4MUHA 1SOMA 2XH8A 4BTLA 1MDBA 1Y7HA 4X1KA 4X61A 3KBOA 1L7EA 2PZJA 4ER7A 4EY6A 5L9AA 3ZDCA 2ZBVA 1T43A 1ZCFA 1QR6A 3KCQA 4Z0TA 3QK7A 3AM4A 2H0QA 3BAFA 2GFQA 3V2GA 1G8KA 3O9VA 3WJ7A 4LQLA 1ZAKA 5INTA 2GJ8A 3HHEA 1N2ZA 1RAIA 1SKYE 1Z26A 4KZKA 4BY9E 3AJDA 5TQJA 4X1YB 4Q34A 2DKOA 5IG2A 521PA 4B6OA 2ZUBA 5FPHA 1LBSA 3I30X 1Y0BA 3I9KA 5AUNB 1L7MA 1GAQA 3OE1A 4QJ3A 5FBZA 5KMGA 1UK6A 2ATIA 2IE8A 5BV2P 3QPUA 3PQCA 1LLDA 4EW1A 2FDCA 2G88A 1GGEA 3B5JA 1HDGO 2AX4A 1K9SA 3A3YA 3OE7D 1Z5UA 2Z2IA 3UH0A 1NW7A 1W52X 3AV3A 2D00A 3L6CA 1MENA 3Q41A 1ECLA 1H69A 5EPEA 5FBHA 3RNOA 3WMEA 4D97A 3ZYCA 3IHKA 4M60A 4R51A 4XPIA 1I4EB 4NBNA 3SR4A 2GBPA 2YL2A 4KFUA 1JPUA 1QG6A 4TXNA 1WY5A 3ANNA 2PVPA 5DPMA 3ZLUA 1FNDA 4NI5A 1U8XX 3GF4A 3F78A 4FC7A 4EI7A 3ENVA 3P27A 1QGOA 4LQDA 4M1ZA 1B1CA 3GGOA 1S8FA 4YRQA 3GZJA 2DEUA 1BMTA 2HTFA 7MDHA 2JIQA 3UF0A 4RSGA 1XWWA 4I36A 3F6EX 4UEWA 2FZKA 1GEGA 2V55B 1Z38A 3MMPA 3P8ZA 1MLDA 3LWNA 4JP8A 2A0FA 5JQGF 5CXUA 1UZLA 3OFND 3GAAA 4P8RA 4RPKA 5I9LA 2R6GA 4RHEA 4MRNA 3AEZA 5FUBA 3RYFB 2E0IA 3KKPA 4DY4A 1GZUA 3M6IA 2AJCA 2RE8A 5IEJA 2I67A 5A4MS 4QHTA 2V96A 1DUVG 1XNHA 1SXJB 2VG8A 3GJQA 1EDZA 4MV5A 2NO5A 4MYUA 3A9RA 4MEBA 3W8RA 4KPYA 5I7RA 3C16C 1KHHA 3DEYX 1ULUA 2GD2A 4FDUA 2R4TA 3DL2A 1RQLA 4CMCA 3BG5A 1SC6A 1UFKA 2WIDA 1XG5A 5F9HA 1QB7A 2BM1A 5JALA 1NQXA 1C0LA 2H00A 2BIFA 2RHCA 2DFNA 2ILTA 2IXGA 3ACDA 5FA8A 1EX6A 1FYWA 4PCVA 5TR9A 4MCJA 4UEKA 2ICAA 2QX7A 3KLNA 4ICIA 4NULA 4ZO8A 4YPOA 4C4SA 4GICA 4OIMA 2WWRA 4US2R 2RGXA 2JFVA 5LKAA 3A31A 3MWLA 4KX5A 3T9EA 1BTOA 1F0KA 1ZMRA 1SPXA 3ZNOA 1DEAA 3FMFA 1QR2A 1IG3A 2WUFA 2J4DA 5EHIA 3VZCA 1TYDE 3NC1C 1M2EA 1D2EA 2MR5A 5AWFC 4HDMB 2Q8QA 5BOVA 4BVJA 2RCNA 4DUPA 4DSAA 2QXTA 4HNTA 3W0LB 2JK0A 2L0XA 2K2QB 3CO5A 1F8XA 3DYVA 2Q3CA 3EDRA 1AZWA 5ALKA 1M7HA 5F64A 1VB5A 2WJ4A 5HDQA 3TR0A 1QZXA 3IDQA 2WYOA 2JHPA 2HLDD 2PYZA 1Q3TA 1C8BA 4UU0A 5A0VA 4FEYA 4UUQA 2DBZA 4JJZA 2IIVA 4CTJA 2CDCA 4F5YA 4MCHA 3K4PA 5KTRA 2OD9A 4AZ3A 1PJ2A 2DH5A 2PLAA 2WWXA 3SHWA 3L6DA 1UZNA 4CKYA 3EWSA 1TEVA 1L7PA 3WNDA 4BVGA 3OQ6A 2NPFA 1ELOA 3G82C 1KH1A 3GJSA 5EUMA 4P4SB 5CA0B 2P2LA 3MINB 2HK9A 4MUJA 3RIYA 2A9FA 2ZBQA 4GI5A 4PLPA 4FE7A 1YJ5A 2WABA 4X0EA 4CCWA 1Y1QA 3D9QX 1CDEA 2GAAA 2NTVA 2AG0A 2YTZA 3HN7A 3JXEA 1NRXA 1LZLA 3IHTA 2WM8A 4M76B 2Z56A 3A6LA 4LRSB 5B3JC 2IUTA 2GK3A 1YQGA 3R75A 4LC0A 2PR7A 3CZ4A 1CDOA 4IUCS 1CEQA 2FB9A 4KXWA 4GOLD 1LX7A 1ADYA 2GNOA 3O2NA 2Q2NA 4C0HA 4D02A 5DYIA 1B2LA 3DBOB 4ND1A 4D3DA 1RC0A 3X2FA 2OBBA 4ZDKA 4DIUA 1RP1A 4DMUB 3C7CB 2ZRMA 3A8TA 3GJXC 4Y2YA 1Y9JA 3OM0A 4IQ8A 2FAXA 4EG6A 3E2MA 3GNSA 4M1KA 1T0JB 4RK1A 1UJ6A 1S2LA 3WGQA 1ZW6A 3U7HB 1XE3A 2HB6A 1SVIA 4W63A 4V24A 4X92A 2PFSA 4CKEB 4Q01A 2BFCB 3FETA 3LVRE 4QOSA 2Y0DA 3UT0A 4X65B 3NM4A 3LOPA 2JLAA 1DV2A 2EATA 2OXRA 2XUPA 3C4JA 1XQWA 2QLLA 3JQQA 4OJNA 1C0IA 4R7TA 4YN3A 4C4AA 2E1RA 4X6LA 5E6SA 1TKCA 4PFKA 4A8JC 2O2CA 1CY7A 3AL2A 3PK0A 1CJTC 4ZOEA 1J8QA 3Q5DA 1U2TA 2FPGA 2XWJI 2YUTA 3FOAA 1N2CE 2D2VA 3K5WA 2QW8A 3FWYA 4XOIA 5TXGA 3UXEA 3CLTC 5IKPA 2EWWA 3CRQA 1CKEA 3Q6MA 4PC3A 1NGSA 1NVEA 2YRXA 3K0CA 2C9YA 1QX4A 2HT6A 4N6GA 1T8YA 4Z9AA 1P1CA 1IM8A 4MGEA 2KM1A 4U2KA 1WDWB 5JAMA 1IHOA 4DARA 1HYQA 1EE2A 2I34A 4D43A 4PU0A 1YAJA 4OI1A 3FNQA 4LGMA 2W6IA 5AO9A 2D13A 2X1VA 1HURA 1DO0A 1QC5A 1ZI8A 3LQRA 1JEYA 2W8BA 4U39A 1ETUA 3CO0S 2VUTA 1V11B 3RRBA 1GLNA 5CB4F 2PNFA 2IX3A 4YUZA 1TA4A 2HHCA 5CYGA 3FTPA 1NBEA 1NW4A 1EMDA 3TLCA 4V0MA 4LWPA 1ZBQA 5CUQA 5DHRA 2JGIA 1KF0A 1N25A 2WOOA 4L5JA 1RE1A 2C95A 4YGYA 1QGZA 3P9ZA 1A5ZA 4H15A 1W5FA 1YC2A 1M72A 5BMVA 1SG6A 4GP9A 5JS8A 1UPAA 4LBZA 2FFJA 3EY9A 3PWTA 4IDDA 1J8MF 4IJKA 1POXA 4NV1A 3RVQA 1AS3A 1BGXT 3VO1A 3X1WA 1X42A 4KBYA 2IYRA 2QX6A 4BMXA 5CK5A 1QBKC 1YZKA 1US8B 1BD4A 3OBIA 3KR1A 3PIRA 2REXB 3BCSA 2QT1A 1Y4SA 3OIWA 3P5BA 1J2UA 4DA6A 4F4HA 1CE8A 4UVHA 4ZYXA 1V41E 3DTYA 3E7PA 3VSAA 3N0TA 4R2XA 4JQYA 2J6CA 3QX7A 2BR5A 2ZAOA 3DE2X 1EK1A 1NUPA 3PNLA 4W6ZA 3V7YA 4F85A 5BWBA 3PUJA 1NDQA 3AG6A 1Z2DA 3W7AA 4O5OA 3OPMA 3NJ4A 1AUOA 4Q4HA 3ROTA 3TLXA 4DM4A 4JBWA 1Z73A 1TDJA 2JD0A 1TRHA 4IRMA 5A9RA 3EIWA 2QLMA 4B73A 2G1UA 2YC2C 2OBLA 1OWOA 3KVNA 4IEIA 2V8OA 3T12A 3TW6A 4C7XA 2G3YA 5IWAB 3U4HA 2IBMA 1X9IA 1YMVA 2Q6IA 1NP6A 4X95A 2X5KO 4EM6A 1Y3IA 3KQKA 2O3QA 5I7AA 1V3TA 2RAPA 4Q3BA 3EHDA 2C2YA 3WP0A 5KNBH 3OPVA 1AKNA 2ECQA 1ZXLA 3DZFA 3HP7A 2D7JA 3WADA 3ZJUA 1BW9B 4X9XA 2ALJA 3EULA 1MO5A 3GLVA 3QMPA 4RIEA 3KT0A 3BM5A 1ZCBA 1ZXXA 4KQGA 4D41A 1OCEA 1AB5A 3A1EA 4TMFA 1P1RA 1VPDA 3DLCA 4U0JA 3INNA 1NF3A 4LVOA 4BZXA 1M1UA 1XPRA 1ONSA 3VTAA 1OXVA 4OYYA 3PA8A 5KPJA 1DPGA 1P61B 2OVBA 1FUIA 3GJ6A 4W8OA 4NCJA 1HEYA 4H77A 3RABA 3IL2A 4JSYA 2AJLI 1P2UA 5FV4A 1ZH8A 2VHWA 3A4LA 1H8EA 3E82A 3PKJA 1Y9EA 2H1WA 3Q3GE 4MW9A 5AM5A 1A97A 1XR3A 2IUEA 3QOYA 3STHA 4GYKA 1XLTC 4RTJA 3UMYA 1Z33A 1FMFA 3FOZA 3HUDA 4UDNA 1P19A 3K09C 4DIKA 2LGJA 2A14A 1C30B 1TI7A 4XGIA 2OVFA 3ZZNA 2NUPB 4I3GA 3BGDA 3O0DA 2W22A 1XO1A 3BXFA 2C5EA 5KYYB 2VWQA 5AW3A 1CEEA 2AJ8A 4PM4A 3ZHUA 1OBCA 2B8EA 1S9HA 4HADA 2NQTA 3TZQA 3HFSA 3RFVA 4RFVA 5KNDD 1KZGB 3VR4D 4BKUA 4WVLA 2CF5A 2N42A 4GX2A 1UJBA 3AUKA 4XX0A 3T7TA 1JH9A 4XM2A 3ASZA 4AY5A 3OHPA 2WUVA 4F1WA 1O8CA 3QVTA 4HTAA 1UMBA 1XZQA 3FXAA 3RK4A 1AJEA 2O8BA 1JDBB 1V3UA 3HCEA 5G3YA 5IZCC 4ZKEA 4IOMA 3EVZA 2O2HA 3R6TA 4BO2A 4YRPA 4BNFA 1RQNA 4JEIA 1V7CA 1OGJA 4P38A 4CEJB 5EQFA 5I8PA 3DMFA 3CZMA 2GZ2A 3LL4A 1FJGB 3H4IA 2PRZA 2PRKA 1NSYA 3JD1A 1RNLA 2VL7A 1T5IA 3ROKA 5KHLB 5K3AA 1DINA 3KSUA 1OGIA 2PZLA 3EGIA 4HN9A 4WE3A 4F84A 4DSOA 4O4HA 1YVDA 4UFNA 4DEXA 5E0KB 16PKA 1THZA 1FFYA 4S04A 2DHCA 1WM1A 3N07A 4LDAA 4LJLA 5A9SB 5B58C 1HE4A 3GRZA 3B53X 1Y6ZA 2GNAA 3PP8A 2FPMA 2K5UA 4HLNA 4RV9A 4ENRA 2WAMA 2QG9A 3B6EA 1QMGA 3MGAA 2O0LA 1MHPA 2F48A 1LRKA 4JUAA 1DIHA 2OYSA 4MO2A 5IZCA 1ZLXA 2Z2YA 3BZWA 1WVGA 4QPDA 1W1WA 5CRIA 1Z35A 2Y0PA 3C8DA 2DY1A 1BE8A 1NC3A 4LXYA 1MAHA 1MXFA 3ETLA 3ANYB 4GGPA 3V4OA 2ZYWX 3N2IA 3OZDA 5G1NA 2DR2A 1DAMA 2IS4A 3I8XA 1XJCA 4DM3A 3R5KA 2XDQB 2HH9A 1DJPA 2PUWA 4UTXA 3B1KA 3C6MA 3TI9A 2Y1XA 1L3BA 4MQEB 1LBEA 1TJPB 2AIRA 2E49A 4QQFA 1UJCA 5AM0A 1PBNA 2PX8A 1V9LA 4TTJA 4EHHA 3R9KA 3PDUA 2O5CA 3L49A 4G2TA 3UZUA 4UOEA 3WDKA 1MB3A 1SFRA 5CLFA 2OLKA 4BXOA 3K1ZA 3WB1A 4F9EA 3UJ8A 3F9RA 4K26A 2ZB7A 4O2BA 4FCCA 3Q8KA 2CN1A 5T3UA 3GMSA 1G41A 2CJWA 2R5NA 5E6UA 1V1RB 4PRYA 2HGZA 3OF2A 2WWVD 4UNIA 3L8EA 4X62B 3AIMA 1NA5A 1WUTA 5KINB 4EY5A 2FQXA 2EHDA 2ID4A 2PWBA 1CLUA 1CQZA 3LT5A 1TVCA 3M6AA 1KO4A 5HKLA 3W9YA 2R00C 5IASA 3E2IA 4XWOA 3NR2A 3UM9A 4CL0A 5CITA 2R87A 1JB1A 3HA5A 3ND9A 1V5EA 2ESRA 2EG5A 1SCQA 4HHEA 3F49S 4QSHA 1N5KA 4R16A 4RDCA 4BJ3A 4I46A 2NU8A 4AMVA 3F5QA 3OCCA 4AF8A 4JY7A 1CZRA 1D0VA 3HBLA 1Z29A 2A9RA 4UCWA 4CMBA 4JEMA 1OSNA 4RY8A 1G2OA 1RAEA 4DCNA 3GDWA 3BORA 3TAHA 1U0FA 4ISBA 1YVEI 3N6RA 3PRKE 4J2TA 4JCOA 4A36A 1UMKA 4URHA 2GBGA 2ZPTX 4NCAA 1GPMA 5IULC 3AF1A 3A37A 3QWIA 4M9SA 3H8VA 1RS0A 1BROA 5CJJA 4RWEA 2HEGA 2P67A 4ME6A 1OX5A 3T0FA 1MOQA 4R8VA 1C8KA 3L93A 1G8JA 1Z2NX 2A0KA 3HWWA 1S96A 2WD9A 3VU0A 3K0AB 2R00A 3MTIA 3W4JA 1FC0A 4YUYA 1ADJA 4B1FA 1CZKA 1O97C 1QFZA 2GD1O 3OOHA 4AZ0B 5J2TA 1ZVMA 5A0TA 2WAXA 2Q0XA 4Q21A 4CLHA 5KQLA 2CCKA 4M0DA 4G81A 1MT3A 1O9HA 1KMNA 2H8GA 1GRRA 3NBFA 2IYLD 4WFKA 3VR1A 1BEZA 4FOLA 5E3JA 4RD2A 4RMJA 3TS1A 3TR5A 2OT3B 3D81A 3EDMA 1WZ2A 1IBLB 3CF4A 5EP3A 3PQ7A 1ABFA 1M9NA 1TM4E 4HYTA 3CWZA 3H19A 5FTWA 3GVPA 3K70C 2WA2A 4RKQA 3OKPA 1U8ZA 4IDGA 3T4UA 4KVFA 4CQMA 1H2RS 5E1OA 5I7OA 3GRKA 4DKJA 1JGTA 1ODTC 3JWEA 1SRQA 3B7GA 4NENB 5LBIA 1BMFA 1HRDA 1TF2A 1CZUA 3HMQA 4XM1A 4AM8A 4P6VF 3T5MA 4EENA 4TKUA 1YB1A 3UQYS 1PL7A 1F60A 3FVWA 1SUDA 1K97A 2G71A 1L5HB 3LDAA 4H7PA 1DQZA 2G8NA 3RSQA 1SUFA 4EG8A 1OXUA 5SZHB 1UXKA 3MJFA 1WCIB 4NZOA 4TWRA 1PK8A 1XCBA 1DG9A 4FFMA 5A71A 3DW3X 2P2YA 3JQ7A 2EC5A 3RARA 3RAPR 3VJKA 4EPRA 1E20A 2CBGA 3MGCA 3VHRA 1ISSA 3D3EA 5EZSA 3VVMA 4AMBA 1FNSA 1E32A 2CVHA 3KQPA 3OQNA 2WYWA 1FTQA 3WNQA 1T9BA 4YWHA 3U5TA 4ZI2A 2BUBA 4RMNA 4FFWA 3EY4A 3X1KA 3IOBA 4MLCA 1ONPA 3SSOA 4RXTA 3VKGA 3OZWA 4OQNA 2LIVA 3VI4B 4WXRA 2W2MA 1R2QA 3NM6B 3TQOA 1E3IA 2R48A 5U4QA 2QRJA 4OHKA 5IBRA 4CNQA 3PXGA 3ZQ6A 1H6CA 1M34B 4A10A 1QQTA 1H85A 2XUFA 3ZQUA 1GRCA 5TE9A 5EJ4A 2CUZA 3HXLA 4IIGA 3K6SB 1PQWA 1EWTA 4KDRA 4A8JB 5DHFA 2EOAA 4P2BA 5TJHA 1SCAA 3EXHB 3TE6A 5AR1A 4D7AA 4F97A 5ALXA 4XYLA 4WESA 4R9VA 1AE1A 2XNCA 1X70A 3FRIA 2R11A 5FPSA 3NYIA 1DEXA 3PGXA 1HNNA 4OQLA 2QMOA 1KTVA 1KDTA 1E18A 3WHPA 4GM0A 2IDKA 4KLAA 3OICA 4Q1AA 3K9LA 1O03A 1R3DA 4Y2TA 4HLCA 1P2SA 4AQYB 2BGIA 1GTZA 1TD9A 3OEHD 4MSUA 4QJBA 2XUGA 4DM7A 1YZQA 2XWBF 2F43B 5DMHA 1YL7A 1GHTA 4KH1A 4P0QB 1J22A 4CMAA 4DV7B 2ZI9A 2REOA 1NVWQ 1NI5A 1R64A 3CJTA 4M0EA 2AR7A 5DI3A 1TCVA 3NWBA 1BE6A 3DMGA 1GQ2A 1QRAA 2Q2VA 2RI6A 3OCUA 3TLGB 3ZNNA 2O8CB 1BVRA 2DVMA 3I6IA 4L5AA 3WLJA 1ECBA 3PDIA 1KYXA 4UXIA 3H7IA 5G1OA 5CEEA 4BDTA 3EGVA 4KKVA 1UBTS 3SCZA 1H2FA 1P81A 2VTBB 3W5AA 3LT2A 3PFCA 2PMFA 3I1FA 4BNZA 4TYWA 2PXAA 4NMMA 4R1MA 5EQTA 5CA0F 5IFLA 3N2LA 4PAWA 5E9JA 3VAYA 3VPCA 4YUWA 4NH4A 4JU8A 2FP4A 1LI5A 2UYOA 1UODA 3IA2A 4TV9A 5IVHA 2CE7A 4FI3C 7GPBA 3EGEA 3OEEA 4MR7B 5DN6D 5LU8A 1JBEA 1YOVB 2ZI3A 3DVQX 4Q16A 4AQDA 3MPUA 4V0ME 1QHIA 1KEEB 1JV2B 2H1FA 1IY8A 3MJDA 1OB2A 2QTZA 2ZTUA 3Q98A 3L7CA 3EVFA 1YAHA 3O26A 4N8DA 2FSGA 3H2YA 2ON6A 5LNK6 3EC1A 3CKMA 3PTAA 4TYPA 1UPTA 2YHBA 4IOLA 1M2FA 1U9YA 2C5AA 5L3RA 4ZOLB 4FN4A 1ADFA 3U39A 3AI1A 5U1PA 1OV4A 4ZT5A 3ZGNA 3EYAA 2GJ4A 3BXHA 1P4JA 2CVOA 4WEOA 4Q4JA 2CLSA 4MPRA 3DL0A 3ELWA 4RPLA 1K89A 2MCFA 3WVNA 2I2DA 5IJ0A 2E9SA 4Y2QA 1MT0A 3QWHA 2F9FA 1VM6A 3A3NA 1AM4D 2OM6A 3ITKA 4NK5A 5ELMA 5JCOC 4JI7B 1CTQA 2XNKA 3PL5A 4CKBB 2X7HA 3WK8A 3VUEA 1E9BA 3D59A 4KE6A 4Q24A 3PQ3A 2FPWA 1UCFA 2GN0A 3CF0A 3BMCB 5FLKA 2QZSA 4XD2A 1SCJA 1WSDA 4FT2A 4B6SA 1BDBA 1PT7A 3MA0A 4UBJA 1YONA 3UKDA 1EX7A 1UDCA 2IGTA 4PIPA 4RNDB 3DZHA 4H1VA 4UNNA 4DDTA 1USWA 3ND5A 3TSCA 3IBGA 4NJMA 4FYHA 4BVAA 2X15A 3B9QA 2E18A 1BX1A 1LTKA 1P74A 2V97A 3HN2A 4OK5A 4P4LA 5IAJA 3SQMA 3ZVRA 2IBTA 1M6WA 5DSZA 1QOZA 4V1CA 4CL8A 1O94C 5ARCA 4RVHA 2WT4A 4G86A 1DBQA 1UMDB 3QXHA 2J08A 2X3FA 4FK8A 1JHRA 1KAGA 5KDLA 1KGDA 2LXNA 2JEZA 1JZQA 3PR2B 2VVTA 4S1PA 2OHXA 1P5FA 4TLLB 5HZKA 4ZI7B 4KCGA 1FOEB 4LC1A 4PSKA 1LWNA 2GBIA 2V7PA 4PZCA 1ZG3A 1T8WA 3HSYA 3IP7A 2JJ2A 4TMXA 3UBMA 2ZAGA 1GQRA 3HZOA 1WTAA 1KQFA 2G4LA 4X63A 1VPWA 1DCMA 1T91A 4HSEA 3BJRA 4DJEC 1NLUA 2AX3A 3ZJ5A 1UC8A 4D8VA 3ELDA 1XD2A 5B30A 1V6CA 3N59A 5IEBA 3QH4A 1KOFA 3U3OA 3VDXA 1ZWLA 1I3MA 5KQPA 1E5TA 2CV0A 2Q4BA 4OLBA 2PQ6A 2FWBA 2VPTA 3Q3EA 5TJ9A 1KPGA 2WZCA 2ODBA 1NQWA 3QMMA 3WMGA 5JPDA 2NTYC 1HFEL 3EGWA 3SR3A 2C5BA 2Q07A 3G17A 4XA8A 5BYJA 2C9ZA 4GBGA 4QGSA 5HKAA 4QOJA 4HDCA 4ZO7A 1E3WB 1KERA 1M6YA 1IM2A 1UR5A 1XDSA 4MW2A 1KDVA 5IJWA 4GD3Q 4IHQA 3THXB 2VJMA 9LDBA 1THMA 1XZNA 1EVIA 4IMIB 4BP9A 1BMDA 4EJMA 2HA2A 4HBGA 4AJHA 4BKRA 3DZ8A 2QM7A 3KZKA 1DGQA 2VP6A 3ZW7A 3TDMA 3TL6A 5JY1A 5KJFA 2FDRA 3AHGA 1WHSB 2D0IA 4C6TB 2YYYA 4PO9A 5ALMA 4CF6A 5KYWA 4NMXB 1Q7RA 1AVTA 3NIFB 5DOVA 1C3XA 3TSWA 4JXJA 2OBMA 3UV6A 3ZBPA 4YRDA 1IQPA 2AB0A 3KDAA 4UBLA 5DMXA 5A1JA 2EL9A 1DWUA 2VPQA 1CEXA 1ZH4A 2J45A 2OILA 3VPBA 4LFAB 1CUAA 3QI7A 4WY2A 1JLLB 2WIAA 5G1PA 1QNLA 5HRAA 2OL4A 3JWIA 1UXGA 3UAGA 4WZBA 3D54D 4BB9A 4HXGA 5IP5A 4Y0NA 4AO7A 4I3FA 3TCKA 9MHTA 1MB2A 4B75A 1GTL1 3LXRA 3GRUA 4II7A 4O33A 4QC2A 2X58A 2QRVA 2HJ9A 4D0SA 1V6SA 3LU1A 2VHUA 4JROA 1EUDA 3JY6A 1OUMA 2SKEA 1ILWA 3NTLA 1F9EA 5DNAA 3GOHA 4BJHB 2QRPA 4YP5A 2PMWB 4G65A 2WYUA 3FMPB 1RMYA 3GYBA 1GCUA 4E2WA 3I92A 4JEHA 1KJQA 5F2EA 2NSDA 4J7XA 3CEAA 3DBLA 3MS2A 1C1XB 1I5OA 3JD2A 3C1OA 2GAOA 3W2FA 1T8SA 2VJNA 1XTJA 4DZZA 2PRSA 1AN0A 1E7WA 4UATA 1W48A 2XVZA 2GPAA 3HCBA 1YHZA 1UM9B 3MS7A 3OD1A 3VMFA 3WG9A 1RVV1 4DRXB 4KLNA 5JNVA 1RYFA 3MJRA 4PR3A 4QU0A 3RRXA 2PVCA 1E2LA 1GNVA 3RODA 2NTEA 3JWHA 4ML3A 2JFHA 3I53A 3R9XB 2VR1A 5AMXA 1T6YA 4UBKA 1M5RA 3VR2A 1D2RA 2NYVA 3OG9A 4LMPA 2GLXA 2F3SA 4UMVA 4WHMA 1EUYA 4J0HA 1RYMA 2OCAA 2GN8A 2BONA 3R76A 1HR0B 1NBMD 3FCSB 2D74A 3IAS6 3MRXA 1BA3A 3H4VA 2FW1A 4XTRA 4BEJA 4EGAA 2BR4A 2G77B 3VAZA 4X84A 1ARZA 4JYMA 4YR9A 1NN1A 3DDCA 4IY1A 4B4VA 4YQFA 3RO7A 3EZ6A 4TMWA 2OORC 2OMKA 2HCBA 3NHUA 4KFRA 2V7VA 2C8VA 3PQ5A 2CXNA 1P77A 4UC0A 3VBCA 1IQUA 4HPXB 4MP3A 2GLUA 5JTUA 1O97D 3F3SA 2EJBA 3EGXA 1E77A 3QEMB 1DC3A 2HRDA 1JXAA 1E5QA 1P6XA 2HSZA 4WFJA 3KTAA 1CNMA 1GZDA 4JWTA 4B32A 4LPSA 4B31A 5LQSA 3T7AA 4C6RA 5K45A 4ZTZB 1CV2A 1E60A 1ULHA 2CNWA 2YXNA 4RLSA 1NW9B 1PVOA 3BHIA 3D2LA 3G8AA 2Z8YM 2VUUA 3N9IA 4JOSA 3ZE9A 4UBMA 2ZIVB 3LW8A 4EUNA 3Q8WA 4LXGA 5AOCA 5G0TA 1X74A 4AVYA 4LRYA 1E9CA 5AM3A 2Y0CA 1BEEA 2MR6A 3ZTWA 5I7WA 2AWNA 1QFJA 2RBEA 2YHIB 4FKMA 3U7EB 5BN4B 4WCVA 4BNKA 1RRFA 1Y37A 4Z86A 1EUCB 1Z0SA 1IY1A 5HIKA 4FHEA 2ZJ8A 3KZXA 3TLYA 3PE3A 1XYVA 3IMCA 4MW4A 4NQZA 4XJSA 2NVUB 1UJ2A 3E53A 1SA0B 1CJKC 4PGFA 2GEFA 2W9XA 2PUFA 2FZWA 4Q4AA 4WWHA 2ILVA 1N6KA 1YUNA 1EAYA 1PSWA 3RC9A 1AHIA 4A15A 1J00A 2GN9A 2R1TA 4IZHA 2R1VB 3IP1A 5FI3A 3A0UA 5HS4A 2O50A 1EX1A 1N9GA 1ZOIA 3GVCA 4IPTA 5A7GA 3VZRA 4X3OA 3WIOA 4BC0A 1VZ2A 1KXJA 3DHNA 3PYXA 3QKSB 5KJCA 1XDGA 2XTZA 2JLQA 5L6LB 2XA2A 3A10A 1ZHFA 1E59A 3M34A 2VTKA 4HDRA 3D3NA 1RYNA 1XDDA 1ISRA 2PZEA 1HQDA 1HE2A 1T25A 2B4QA 2PYIA 1TXGA 4BE9A 5LYYA 3GT0A 3D31A 4EAQA 3EC2A 4PRLA 1DXHA 2G08A 4E5DA 2OAEA 2AW3A 5AVYA 1CS4C 3JYPA 2PIDA 2Y0BA 1Z34A 5HF9A 5HIJA 3H42B 4EPXA 4M9UA 1U0HC 1HDEA 1J2YA 3DTVA 1XRLA 3T7KA 1XJQA 2PZKA 1Z6GA 3ESYA 2Z9DA 5TQ0A 1T1IA 3E15A 2CLLB 3SAJA 4DJJA 2Z3VA 2EERA 3C5HA 3JATB 1RXIA 4KQ1A 4LXUA 3SNKA 1DCFA 4UEQA 5KWEA 1EKXA 2H07A 2ONZA 2FRVA 3HU5A 1SVKA 5B2ZA 4J7CA 3BBPA 4TTAA 1C7QA 3H1BA 4B3TB 5FFMA 3CE6A 3NV7A 4LZJA 3SEFA 1HE1C 2NXWA 1Q83A 4FZ3A 3T41A 1KO7A 2XOXA 4DIBA 1XKQA 1ADBA 1E5LA 1XA0A 2W2QA 3WXBA 4EHJA 2B0JA 5EJ5A 1P0PA 5JO0A 3DFMA 4OXKA 3PGKA 4EIWA 4CQLB 2C2HA 1O9GA 1SY7A 1ISIA 5AOBA 1MB9A 3GVHA 2AN4A 3H5LA 1JRLA 4QEDA 3LNTA 5CH3A 3SKXA 3SR0A 4YAWA 3B1ZA 3S28A 3ZDYB 2RH8A 1R5OA 1EEXB 4N4AA 3V48A 3M1AA 2XQFA 5BV0A 2VI5A 3VHQA 4G5SA 5JH7F 3Q3JB 1QCYA 1ZH2A 4IDNA 5H81A 3ZY5A 4DQ0A 4D9GA 5DNUA 3QGMA 3QJGA 1R0LA 2CXXA 2V3VA 1T35A 3U1BA 2E4YA 2FGJA 4KQ6A 4R8RA 3RTGA 4MOWA 1J5EB 1MH1A 5KOHA 3ICPA 2O8DA 1OLSA 4YI3A 1XDZA 2FWJA 2Z2JA 2QTNA 1SVLA 4FT4A 5IUKC 5EYPA 2ZYRA 4RA6B 1JS1X 6NULA 3CLSC 1G9TA 5EQJB 3KEFA 1MJ5A 1K3UB 2REBA 1LBQA 3V42A 3Q85A 1YVUA 1R6DA 1OC2A 3HK2A 5IYZB 2QHXA 2GZSA 2KX7A 3GA0A 3ONWA 1I33A 1KK2A 2WF9A 4FFPA 1DPFA 2P4SA 2DHRA 4LGCA 1FLDA 1PNTA 4PW0A 5E8JA 5ADUS 2JLRA 4HNVA 2XF2A 3BDIA 3KJIA 3IPLA 1I3LA 2R5WA 4JKOA 2RBGA 3N0VA 4DNPA 3AKZA 3FCOA 2A1TR 4MRPA 3BCUA 1QIIA 1PG0A 2Y1OA 3IVGA 3F73A 2H3HA 1GCOA 3B78A 1RTKA 3E58A 2Q1SA 4J4BA 3L9WA 3ZU2A 4DWVA 4CR7A 1BYIA 3BHNA 4MPJA 5HKOA 1Y34E 4YT8A 1NVAA 1FF9A 2PX3A 1NVDA 4HQOA 2BGMA 4MGHA 1E1RA 2BR3A 5LQUA 3FDIA 2WJWA 3KB2A 3E70C 1V26A 5DF1A 4ENQA 2O8NA 5KSYA 2C9BA 3WQSB 3WQBA 2NU6B 5G0UA 5GGXA 2IYOA 1K4MA 1D1TA 3OT1A 2XUDA 1ECJA 5DNVA 3SDSA 2I7VA 1X92A 3QBDA 3UHPA 4YS6A 1GPH1 3EIXA 5AJZA 3RAFC 4RM2A 1XHEA 4JITA 2IU0A 5LCXA 3REQA 2AXEA 1JQKA 3OIDA 1J0BA 5HNKA 3D4IA 1C3LA 3BGSA 4ZO4A 4O2LA 4ZVLA 1ZMTA 4C0BA 1IULA 3TFOA 3UBTA 2YV5A 4H1TA 4PX9A 4NDNE 3DHWC 2LV8A 4KAJA 1V8ZA 3UT6A 5HPYB 1QVVA 2G80A 3R7NA 4KFCA 1RE0A 2QPOA 3B9BA 1VL6A 3GD5A 1KDZA 1SZCA 3W1VA 3MMXA 1WUJS 2LPMA 1GQQA 2IW3A 2F1KA 3NGMA 1KL7A 4RY9A 1E6MA 2A5DA 5JSZA 2YS6A 1ZRMA 3LBYA 4P93A 3RVLA 1TK2A 2H2HA 1T9HA 2GYVA 1EJ0A 3DVLA 3PHCA 4ZVRA 1O94D 1X8LA 4L3VA 2FW6A 4PHGA 1T8PA 1O0SA 2GB4A 3DNFA 1U0LA 1YRWA 3BGWA 4DLNA 1F7UA 1JA9A 4JBHA 3WA7A 4MMYB 2BFBB 2C3OA 2KWIA 3ME5A 5AI5A 4C0KA 3V1LA 3O8QB 3ASVA 1YFZA 4EBFA 1FFCA 3I0MA 1KYWA 3RS3A 2PANA 3L6EA 3SQWA 2I33A 5AUPB 5KTSA 1XXHA 4N01A 1DLIA 1R6BX 1Z6AA 1E79A 1AQIA 1P5JA 3M5CA 4C4YA 2WJ6A 3V32A 5FD8A 2R44A 3IJEB 5ESWA 3K7EA 4B6JA 4C88A 5C3MA 5DCYA 4DNOA 2VJPA 1V39A 3U48A 3HJGA 9GPBA 1GU1A 3FHTA 2UVDA 4NX2A 1CQIB 2QG6A 4K9NA 4DYHA 5LB2A 1YFJA 4WBXC 4CUKA 3HNOA 1SCDA 3A9SA 4J4TA 3TOZA 3ZUGA 4BX8A 1N77A 3JQDA 3ROXA 5AICA 2C54A 3LCJA 4F8YA 2YS7A 1RSZA 2F8LA 2YRFA 3H5IA 1K8XB 3QLVA 1NJSA 2DC1A 3PFIA 1RJWA 5ED0A 3E61A 2Y1KA 5FOQA 3Q8MA 3JV7A 1T5OA 4NF2A 2YR0A 2WYIA 4N65A 4F7DA 5HGXA 2Y6VA 4FS8A 2YYAA 1POWA 3ZVNA 1LH0A 2AQIA 3DMPA 3WL5A 5J5VA 4NPCA 1BZYA 4D9CA 5HKKD 2NN3C 4GPAA 1YACA 3T7SA 3ERCA 5E7MA 2XMZA 1KMMA 3I72A 4DE5A 3T3DA 2PD6A 2P9YA 3FF4A 5EKDA 4R1SA 5EESA 5KAMA 3QKTA 3H3XA 3VPHA 1R4NA 3OZSA 1TGYA 2Q5CA 4A16A 4F4UA 1R4MA 4MCAA 2QUZA 4XWGA 4YP7A 4F9FA 2MJLA 1KI6A 2AWOA 1Z68A 1OPRA 5EWJA 3LRTA 3P9SA 3KR9A 4D4GA 4ZOLF 2XRYA 3BZBA 5LFAA 1CS0A 1L4HA 1S2OA 5T57A 1T5TA 3SK0A 2OAQ1 4TRMA 4Z7JA 3WDSA 1CETA 5K09A 2UZAA 1NW3A 1ZIDA 1W0CA 1PV4A 4NU8X 1ZVQA 4Z3KA 1AG9A 2QMYA 5L7TA 4IUBS 2PKQO 1PFKA 5HP4A 2VP5A 3NAMA 4ROTA 1GAEO 2AXPA 2QXYA 3L8GA 1DBPA 3KFVA 4GC9A 1ODJA 4L8YA 5H9VA 2AOTB 4F5ZA 1I94B 3VYRB 1OXBB 4FW8A 2M6RA 3GCGA 4GH5A 3W5IA 1ZJYA 3MAJA 2HRQA 3GG2A 3HRHA 4I66A 5CCDA 2R84A 3LS2A 3O0TA 5DRYA 1FUUA 1W8DA 5IBQA 3UB3A 4CM9A 5FTKA 4DCMA 4KPEC 2N1MA 1RKXA 1Y1RA 4TTVA 1Q14A 4P86A 3EW9A 3ZX4A 4U02A 5AHOA 1U0TA 9ABPA 5JU6A 3GQBA 1RQ7A 3PJFA 4WNYA 4LZNA 4B4WA 1BJRE 3OZAA 5HJ5A 3FX2A 1FB5A 3EUWA 3NHYA 1Y1KE 4PPFA 3A70A 1DWPA 4JGGA 2W4MA 1YFLA 2HI0A 1H3EA 1QIEA 3CG4A 4WEQA 5JD5A 2GF0A 3HABA 1JEQB 4HH3C 5GV8A 3H0CA 4JIGA 3SBEA 1NXXA 2LIPA 2MYTA 1DELA 3LKZA 4PX5A 3WK9A 9LDTA 5DK6A 3QF4A 3RSLA 1OREA 3EVNA 3CNEA 4C7OB 4OVKA 4WZBE 3ESZA 2O57A 2OD7A 4ZQEA 3ACBA 1LPAB 3GEHA 4TT3A 4PTLA 1T2AA 4WNAA 4ZI7F 1UWVA 3U7FB 2ST1A 1EP1B 1PGJA 3LT4A 1QKKA 1ZRSA 3WGLA 2Q8PA 3GDGA 1VB3A 3HDGA 2WQZA 3FAZA 1K7YA 1IJFA 1U1CA 3OZCA 1E2PA 1GUFA 5CTJA 3VPDA 2JAHA 2WTMA 4WJLA 2VKQA 3E9YA 2N1BA 3EMDA 4QJIA 2NT4A 5FBKA 1X19A 3SHVA 2HMYB 3GAFA 1IEVA 4H7IA 3OHSX 3SOPA 3R0JA 1WD7A 1ZCAA 3UOWA 5CB0A 1NBAA 3K9WA 4F3TA 2V98A 3ZXSA 4KIWA 5AW8A 1Y6JA 4M0KA 5HF8A 4M55A 2C7RA 4EPYA 1QH0A 1BJTA 1EFKA 2EZ4A 2FWPA 3H11A 2E5FA 4BRWA 4OXYA 1EJBA 1MRNA 4E4RA 1P8JA 1F20A 2PQMA 3IBCA 3A4YA 1F0PA 5FUQA 5AH0A 4BKMA 4IW3B 2C5GA 1CJVC 1O87A 4EEZA 2YN4A 4F04A 2ZOSA 1WXGA 3ZVMA 5DE3A 1Q0LA 4RUKA 1NVVR 4RVNA 1SULA 1ZN7A 3Q2OA 4J2HA 1GG2A 5GM1A 4AU1A 1G66A 4Q7MB 5AIBA 1E4EA 5IANA 1RM0A 2AOUA 2PZ8A 3SZMA 2Y2UA 3Q1LA 4X8LA 1QH1B 3JZAA 2RGWA 4ITUA 5LZ5A 1DBRA 1G20A 4K9LA 4AMGA 4MGYR 2BEUB 4BS9A 4LCEA 1HKUA 1T2NA 3U4QA 1KKMA 3UAWA 2P5UA 3B36A 1U4OA 2PDAA 2WLTA 2HA6A 3DAHA 2ONJA 2VT3A 3SZ3A 4DLZA 1CQJA 2CBZA 2TMGA 3F7TA 3JQBA 5EMKA 3SDBA 3PUHA 2M32A 3TB6A 2GKSA 1E6KA 3LGAA 2B4RO 1V6AA 3KKMA 5JPIA 4DBVO 1P17A 2BFOA 3D6FA 1L4EA 4OYHA 4XQEA 5C1IA 4BIMA 4R41A 1XZFA 5BURA 3ABZA 1YJQA 2VPYA 1W49A 3L40A 4ZI5A 3GBVA 1KY3A 3H1EA 2IHZA 4RACA 4WLNA 4DNQA 3O75A 4OLAA 1U8UA 4LI0A 2JJ8A 2ZWOA 1MABB 3QKIA 5BR1A 2IXEA 2JIBA 5DGDA 4MI9A 4BAUA 3QHAA 4MMXB 5H83A 5AKKA 2B37A 2X4LA 2NU9B 4FYXA 3L05A 2ERCA 4G5FA 4LZAA 4XR9A 3AHEA 2NG1A 1JJAA 1JIKA 1SQFA 2Q49A 3NCHA 1RM5A 1C4KA 5CXSA 2I2CA 5EAIA 5EQDA 3I1YA 4QUGA 5F1YA 2R60A 4ZRNA 1JHQA 3B9PA 1RYBA 3NT2A 5AK4A 1JUDA 1RBQA 1CC1S 1VIDA 2V6BA 1P7VA 3EPRA 2ARKA 3JYOA 3JZFA 4FJ1A 2NUTB 4N5NA 3WNCA 4E94A 5H5JA 1SKUA 1UEJA 5H4GA 1H1DA 4QTYA 2NACA 3PNOA 5FFFA 1PVDA 4DABA 1IHUA 4BOYA 2DE0X 1MX5A 5HCUA 3EGDB 3LYLA 1RAGA 3MB5A 2FEKA 4LBYA 2Q7OE 4B85A 4FSXA 2VSQA 2Y76A 3M82A 4IJUA 1SVMA 2WA1A 3A9UA 4MYTA 5HZHA 5CVEA 1UFRA 2XVAA 3OH8A 4P31A 3T7IA 3I6MA 5DISB 4ZHQA 5FTNA 2GESA 3IR5A 1SVNA 1ZEMA 3PKZA 4TSFA 1DUIA 1Z12A 3TD2A 2CL6X 2VUIB 2FG5A 2XMBA 1YD7A 2O8EB 3RNLA 1LF5A 4RPHA 3HY4A 1RPTA 4LHEA 3VKUA 3O90A 1OI2A 1ZITA 2JNWA 2OHVA 3GJ8A 4GGMX 4Z0HO 4LGYA 2ORIA 1U1IA 4XGKA 4RU1A 1YE3A 4PX3A 4QDZA 4BZZA 3PFNA 4ZANA 3RBAA 5C5EA 1PZMA 3P52A 2CKMA 1B0AA 3MQ4A 3E1GA 5FOXA 3I4CA 2UUBB 4LVUA 1KZ4A 1XCMA 2AYYA 3GA7A 3HDVA 2D7CA 5D01A 3CLSD 3VU3A 3D4PA 1DL5A 4AD8A 1H1LA 1KORA 2J3MA 2CWWA 1NT4A 2W0SA 3L46A 3NOQA 3ZWAA 5C7LO 4DA4A 2GCOB 1M2VA 5DI9A 2FHPA 3EZ7A 2AN3A 1L7XA 5JS2A 3GLKA 4KGDA 5FDFA 2NXEA 4MUKA 3AFGA 4MW0A 5G02A 4JYZA 5JD3A 4NU6A 3D0RA 2C7BA 2Y1WA 1YDFA 4WKCA 1QP4A 4Y1EA 2PAFA 5EP2A 5LZ8A 4BN4A 4XIGS 3WV5A 3SXPA 1E5DA 1HLPA 2JARA 3RIMA 3V8MA 4J91A 5D5HA 1YDHA 1YJBA 3MOIA 4NEQA 2HV8A 2OO5C 4LSWA 2VAWA 5U9CA 4FUQA 3LBHA 1HDZA 4WOBA 1A9RA 3IMKA 5ES4B 4E09A 3VR6A 3IYLW 1B6TA 1YI1A 1CJCA 3W5VA 4QUBA 4DBLC 2ZLBA 4CIDA 4EA8A 2RSLA 4TWIA 3MLAA 3V7NA 3MJCA 1DJQA 3ZW8A 1G2IA 1R15A 1EQUA 3AGQA 2X0FA 2O4UX 4B45A 1AT1A 1CR2A 2J3LA 2Z1MA 3WK7A 1T3HA 4LSZA 4CDRA 7REQB 2WZBA 2YIMA 1NFRA 2RHWA 3C8HA 3AF4A 3BRCA 4KYUA 1TFUA 4X7MA 1MD9A 2DP4E 2AL7A 5JAZA 4U7TB 1RMTA 3QU7A 3N3AC 4BNDA 2D5IA 2P3SA 2UV8A 3ZK7A 5EIOA 1YRAA 4HUJA 5ECWA 2WRZA 3R9WA 2YX1A 4KK4A 2PS0A 3EASA 1KAEA 1V37A 4KIFA 3MFQA 1QTRA 2XYQA 3I64A 4QO7A 3UEOA 4YAUA 1U0OC 3KQWA 2Q5IA 1XTRA 3V4ZA 4JU9A 3K6KA 2BY4A 1ICIA 3E18A 3DL7A 1R4AA 3E9DA 4F6RB 5ECGC 1HFJA 1DXQA 3TBKA 1Z63A 3N7AA 1R4ZA 1RJDA 3EIQA 3R3VA 1UWCA 3FZQA 4LZLA 1PU2A 2VYCA 2QTVA 4CTNA 2P2NA 4DA7A 3G0GA 1MEJA 3PXXA 5C8DA 2Y92A 4MB6A 4YRTA 5KTTA 3FGPA 1ZYUA 3IPAA 1Z0DA 2R3SA 1Y7PA 1Z4LA 1JFFA 3V8RA 4EKEA 1N2JA 1VGVA 1I4DD 4Z9FA 2EAUA 4JJ6A 4KQXA 2EL7A 3AOEA 4RYDA 2VIIA 3NFRA 4KWHA 4EJ2A 3O7WA 1INLA 1ZU5A 4JKYA 2CSXA 3QYJA 1J90A 1CP3A 4PCUA 2HT1A 3JASA 4PFQA 4JDPA 2BSAA 2GF9A 3FR8A 1VIAA 4IVRA 4IILA 3GP8A 3HWRA 5F2NA 1A5TA 2X6RA 4XEHA 3WRXA 2ZRQA 1AKVA 1D1SA 2X9GA 2VT7A 3GRAA 3R0XA 2C58A 3V55A 2CXRA 4DV2B 4Q1BA 2ZCUA 1HGXA 1GZHB 2INGX 3QELB 4ILKA 3RFXA 2CJYA 4BLWA 1Y9AA 3PPWA 2JVJA 5K3EA 4K1LA 2IF0A 1L4LA 4I7EA 1NWHA 4P5EA 2ZRFA 4QOHA 2CNDA 2HK7A 3BTUA 2OZPA 2WV7A 2YBDA 3QP9A 1HSZA 3AOGA 3R4CA 5IYZF 3VU9B 2IU3A 3V46A 3GD7A 4B79A 1XYYA 1K6IA 1YO6A 3HDQA 1CUGA 2EFCB 2VDRB 3DBHA 1E3QA 1Y89A 4WLFA 1N7IA 2XTJA 3LV8A 2GPTA 1QBGA 3PEEA 1E3JA 3DL4A 3HJAA 1YSCA 3K9NA 4Q66C 3W5UA 2PJRA 5J59A 3GEEA 3OWOA 2YVLA 5F3DA 2HQOA 3I32A 3KYJB 3HKEB 3C4QA 3VR5D 1SXQA 2VHYA 1G19A 2FLVA 4CMEA 2QMQA 4N7JA 1FFWA 4RYLA 4OQEA 3U31A 4ZA2A 3G5AA 3HCAA 4CCAA 2AN5A 4ESHA 3IBTA 1TQ2A 3I12A 3STYA 1R6AA 4KNWA 4L95C 5F1PA 4RPJA 1G5IA 3CURA 3JAWA 4P80A 2H7XA 1AUXA 1OT5A 1SC3A 1XX6A 1GN8A 3TRHA 3K0SA 4BBJA 4K46A 2ROQA 4WJKB 4TV8A 2A9QA 3DPUA 2GD0A 4BRSA 2OFXA 4QKQA 1EFUA 1L7AA 4J29A 2A3NA 4UTRA 3THWA 1L4GA 3L02A 1NL3A 4ALNA 4BWFB 2W6OA 5HJ7A 5HZGA 3IEMA 5ERYA 3NT5A 4LF9B 3O83A 5K8IA 2OCLA 3VKFA 4F96A 1ULBA 4MS3B 4ZGGA 2JBHA 5KVQA 1IVYA 3OE4A 4PANA 4ZYYA 1EZ4A 3K0BA 3T5GA 3GRVA 3AM5A 1QF7A 1RXEA 2ZUUA 4E03A 1BXGB 1SC1A 5FPKA 4DPKA 2J87A 3LY7A 1MRSA 3DKKA 3IHLA 2RB5A 1IPEA 1DG1G 1BS1A 3JYQA 4N6OA 4Z0NA 3SMVA 1TEHA 1U2GA 1ZOSA 3FG9A 4UDXX 5BVGA 5AJYA 4O2RA 1SOVA 2M1ZA 3L8FA 3TVDA 4XRRA 3UKJA 4AF7A 3DAOA 1VMAA 3OETA 4OKSA 4DFDA 5HF5A 1N5DA 4NCNA 4J1TC 2GNPA 2HNKA 2YOFA 3JVUA 4Z0PA 3SG0A 5IDQA 4MKGA 4HAZA 1MEOA 3VSDA 3VPAA 3L7LA 4C3VA 1GKUB 2J5KA 1H2AS 4EQ6A 3RUHA 1RQPA 1XZCA 2BMFA 3KQLA 1FA9A 1CY1A 1URPA 2FEMA 3KVRA 2J07A 2PL5A 4LAFA 2X8JA 4KTTE 4OUDB 2H7CA 5F9MA 4CIBA 1TUIA 1KR5A 3D6VA 3WWPA 5K3DA 2VAVA 1SBCA 4R68A 3TBHA 1BSVA 4MHTA 2O8FA 4TKVA 3ZPXA 4QOFA 4N0EA 3WGVA 1B15A 2N9UA 2OGUA 4PGHA 1VSQA 4DW8A 4ERNA 3FYUC 4ZYWA 2AE1A 2HCTA 4JP1A 1PR6A 4CW7A 2X2PA 4B4OA 2IX9A 3AXSA 4R1UA 4F60A 4MJ7A 1PJCA 4U3JA 3ADDA 3L18A 2KS6A 3AESA 2XIQA 3JQAD 5TPWA 5F2KA 4UPEA 4PNEA 1E2MA 1NYRA 2W90A 3BGVA 3CINA 3LO5A 3Q7PA 4XB2A 1SWVA 3IVAA 3W3AA 3DMYA 4NK4A 5C4MA 3EXEB 4OB7A 2WM2A 1LC3A 3ZVKA 1Z2OX 2IPAB 4BU1A 1X1TA 5K6TA 3L0CA 3RFTA 1S01A 4MVJD 4CT5A 3K2BA 5CT9A 5IZ4A 5FHQA 5JRDS 3ZCPA 1J1IA 1MO4A 1ZM2A 3PQ4A 4IGIA 3WR5A 1C9YA 4TS1A 1RKQA 4NJOA 1XQXA 4GT1A 4P3KA 2L82A 2OWEA 4F4CA 1BU8A 5AVTA 2RHTA 2EG9A 3JQAB 4G67A 1UXHA 4DJFC 1P31A 1JIIA 2PL1A 3O4IA 3QFTA 5C32A 2OWDA 1WOMA 4JI0B 2AFHE 1OASA 5KYXB 3BD8A 3N58A 2OTCA 2GWHA 4QELA 3FNEA 2HMSA 2B25A 5KDDA 5AHXA 3LFUA 4M38A 2VRNA 2VXYA 4YCJA 3HJUA 2NYAA 4O29A 1YI8A 2J0VA 2DQ4A 3BWYA 4ZRMA 1CDZA 2DT5A 3WKCA 4G0ZA 4H1HA 4WQMA 5D5QA 1O9BA 2X7XA 3U40A 1I01A 2ZRKA 2CL5A 4G9BA 3UC9A 4KSYA 1JFVA 1PS8A 1TUEA 5A02A 4G0WA 2ZRNA 1CPYA 4OJTA 3RC3A 10MHA 1BA2A 4RHTA 3QKRB 2B5WA 1MTOA 1GAXA 2DCMA 4M21A 5LMUB 3W9SA 1NUAA 4U00A 1IY2A 4MRMA 1G3IA 3GFBA 3EIEA 3VYWA 5E6RA 1RRPA 1M8JA 1O6GA 4BQIA 7YASA 1PK7A 2CNOA 4F45A 4RIHA 1E3EA 5I3CA 4YFVA 1DBWA 2AN9A 1YJAA 4QG3A 3AR2A 2QLFA 1OV6A 3CTPA 5HCIA 1G20E 2HJWA 2KI5A 3KYDB 2OHFA 4IX1A 2B35A 2B4TO 2W6JD 3E7FA 3OJLA 3RS9A 1GY8A 4EY7A 5LQAA 3F6SA 4UE2A 5JEEA 4ENPA 3OQPA 3OQHA 4BCDA 4TVOA 5LP1A 3L4BA 5ESXA 1HFKA 1B93A 2AFIA 1GU7A 4OEHA 4A2WA 2JZNA 2V74B 1NYLA 1T0HB 3BMNA 4ND8B 3WKEA 4C7VA 4UAJA 4E2XA 4GMHA 1RCFA 1YMUA 2P6OA 4GI3A 2DGDA 4QUHA 2EGUA 2OZEA 5KU1A 3SSAA 4EPVA 2CLDX 3UIEA 1WDMA 2WZQA 1GKLA 1ZX1A 3CLHA 2MDTA 3D1VA 2VF2A 2PGAA 5DP1A 3TEFA 1BVHA 3INTA 5E7IA 4V0QA 2WJAA 4ZRDA 1HEUA 1OWPA 3LZDA 4UTPA 2VNJA 1RZUA 3EXIB 3GLHE 4ZV9A 4EB6B 5JS7A 1AO0A 3T94A 5H8WA 1B0UA 4BPRA 1DTSA 4RAQA 3VVLA 4C22A 4R6WA 1JF8A 1FSFA 2JFZA 2QTRA 1PX2A 1W5EA 2ZRIA 3DPIA 2EJTA 3CVYA 1FFEA 4JGBA 4KGXA 2WB4A 4KR7A 1RABA 5FWXB 1Z0ZA 5HS6A 4F3KA 1QVZA 1NJFA 4UUAA 3UMRA 2H63A 3FNBA 4O3FA 3L6UA 3OUUA 1H22A 4OGLA 4R4JA 3T52A 5A4AA 3TDKA 4BVKA 3ZE8A 4E5VA 3HWSA 2PO7A 1DAIA 2TMYA 1IUPA 1JDNA 3L1HA 2AJDA 3LVFO 3SS7X 1HPLA 1UBRS 2ECOA 1K7SN 3U6BA 4Q3AA 1WXEA 4JLMA 4TL8A 1KC1A 1JA0A 3KT6A 1ZRHA 3QVMA 5KMGB 4H16A 5C18A 1E62A 3IRUA 2PJUA 2P4HX 1QONA 2V6MA 5ILGA 2BP7B 3DBIA 4D56A 4A92A 5FIUA 4W9NA 4C0WA 1FE8A 1NM5A 4YNBA 2YZKA 3DQPA 4LE0A 3W2EA 2V7QD 6AT1A 3UG7A 3D3WA 5KYUA 2D4HA 2IE0A 1IN7A 3OY2A 5J4YA 2JGDA 3U3KA 3BA1A 5DCWA 3BWCA 3CPEA 2HRCA 3D3JA 1KSJA 3G5MA 3QKUA 3H99A 3HMKA 4OL9A 3CPSA 4UBOA 4G0XA 4XPIB 3E4DA 4D57A 2Q29A 1DIAA 1K75A 5B7NA 3WGNA 3IEVA 3IFSA 3GROA 4WXEA 1PKEA 4GG1A 2OFWA 3Q15C 3B8HA 5DWDA 3USZA 4FM9A 2DTDA 1RYHA 4HS4A 3OJOA 2OFPA 2L2QA 3KU4A 5KUTA 4C30A 2R96A 3HXMA 1JBKA 4OQMA 4NYIQ 1C2YA 3LLVA 2XUOA 5JMWA 5DM70 4DR1B 1TQDA 3GJZA 1F7VA 1NN0A 1CR4A 2WVJA 3I9NA 4BGDA 1QK3A 1WJGA 3B2QA 3U7RA 4ESEA 5KYGA 3R8CA 3DE5X 5IX8A 1TK9A 1VLZA 3MQ2A 4MIOA 4MGZR 1FCJA 1ICEA 2QX4A 2FX2A 2P75A 2FPRA 2VYNA 4NMWA 4QIHA 4X60A 4E88A 1RJ9A 1R1DA 1FJHA 3CM0A 4LYJA 4DCCA 3W5DA 2FGKA 1QGUA 3VR0A 3E5HA 3FB4A 4PLGA 5K6AA 1E8MA 3Q7QA 3OCVA 3GFPA 2DR3A 4PCLA 3DULA 3PFHA 1RWQA 4UM5A 3CH6A 4G01B 4UU1A 3UJ9A 1GPUA 4A6EA 4E5NA 3CW2A 5AXCA 4XVUA 1GN9A 4PYLA 2BHRA 4QBFA 4WGGA 3BJEA 2IEYA 4LDZA 1XTSA 4MP6A 1FS6A 3UMGA 1W35A 3G2HA 4YO8A 2J4CA 4LWZA 2XECA 3M1LA 4HKTA 4NPHA 5BQ5A 3RS0A 2ID8A 5IF9A 3KXIA 4WL0A 2Y9MB 4D9HA 2JVIA 2ISQA 3IE0A 1Z2CA 2LNDA 3QLTA 5FEMA 5IDWA 3QFCA 4HRXA 2EKPA 4QXMA 1G5FA 3TVTA 3R3XA 1NXSA 1MOZA 4PYJA 3GLGE 3EG9B 1EP9A 1D2MA 2QZJA 1T13A 1HT1E 3TKAA 4D4HA 1TKRA 4CCYA 1TZBA 1AKTA 1TD1A 2NXJA 4KXVA 3OIYA 5DO9A 2ACEA 3C6YA 1TU0A 2O0KA 3EPPA 3LY8A 5J2UA 4K86A 2BGGA 1YKFA 4NR0A 3GELA 4HFRA 2CLFB 2XA1A 3VZBA 1IEXA 3H04A 5MN6A 3DV2A 4R1NA 3L82B 3SBXA 1I6KA