1Z88A

Crystal structure of lys154arg mutant of mature apha of s. typhimurium
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
208
structure length
208
Chain Sequence
TLNPGTNVAKLAEQAPVHWVSVAQIENSLTGRPPMAVGFDIDDTVLFSSPGFWRGKKTYSPDSDDYLKNPAFWEKMNNGWDEFSIPKEAARQLIDMHVRRGDSIYFVTGRSQTKTETVSKTLADNFHIPAANMNPVIFAGDKPEQNTRVQWLQEKNMRIFYGDSDNDITAARDCGIRGIRILRAANSTYKPLPQAGAFGEEVIVNSEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords AphA protein
publication title Structural and mutational analyses reveal the functional role of active-site Lys-154 and Asp-173 of Salmonella typhimurium AphA protein.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 72
structure length 208
sequence length 208
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2005-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1z88A00
5A3QA 3E81A 3QU9A 2RARA 3WK9A 4CF4A 3DAOA 4J03A 5ALEA 1EK2A 4EZEA 5AVUA 2FPXA 4NV0A 5AVWA 4Y2SA 1RKQA 2JGAA 1U7OA 4B6JA 2W43A 3PCTA 2B1QA 3W5BA 3ZVNA 4Y2PA 3SF0A 3E58A 5AW0A 1L7NA 3NAMA 4OCZA 4YCLA 2B0CA 3ED5A 2CFRA 1VFPA 3ZUPA 3QUBA 2NO5A 2MU1A 2YY6A 2YBDA 2AUTA 5AI0A 3ZW7A 4I9GA 2HEGA 1RLMA 5AW7A 2C88A 1X42A 2YJ3A 2YMMA 2WFAA 4OHFA 2CFTA 5ALKA 4EELA 3ZX5A 4Y2XA 1ZD3A 2HCFA 2RB5A 4RESA 2MSNA 5AI6A 1ZJJA 2WF7A 5AM3A 2BDEA 1VJ5A 2FPUA 4AS2A 4DCCA 2WHEA 3OTQA 5ALZA 5AK4A 2FPSA 2IYEA 5ALJA 2YFYA 1FEZA 2G80A 4NWIA 3WKDA 1Y8AA 5AVSA 3A1DA 2ZBDA 1Q91A 1Z4MA 4G63A 1O03A 3QU5A 5T41A 3W5DA 5AI5A 3KBBA 4UM7A 2GHTA 3FM9A 2I34A 5ALPA 2R8EA 1TJ5A 3E84A 1EK1A 4DFDA 1WPGA 2WF5A 1T9ZA 3OPXA 2FEAA 3ZU6A 3U7FB 3NALA 2ZG6A 1SU4A 3U13A 3QU4A 1RMQA 3WGUA 2B82A 1Z5GA 4BX2A 5AM2A 4XQ0A 3UM9A 3ET4A 4F72A 1O08A 2W4MA 3N5KA 4UW9A 1K1EA 5ALDA 4I9FA 2HI0A 5AVQA 1RKUA 2Q5EA 3AR2A 3RF6A 4UARA 2I6XA 2QLTA 3WK4A 2IOFK 2C8KA 3OCVA 4EENA 5AW3A 3N28A 5ALGA 4CF3A 3FZQA 3P96A 3VAYA 2D2VA 3WKEA 1U7PA 2RBKA 3SD7A 2CFSA 2AMYA 5AKIA 2YJ6A 4BBJA 5AKEA 1Z88A 3N8GA 3ET5A 5IS2A 2YMLA 4UMEA 3PGLA 2WF6A 4C4RA 3EPRA 5AI8A 4BNDB 1WZCA 2P27A 3GYGA 5AW8A 2JAUA 5AKHA 4Y2QA 3SKYA 5AVZA 3QXGA 4CE6A 2BDUA 1N8NA 3OCXA 4UASA 4Y2YA 4AS3A 3WK5A 2JARA 3S6JA 2C4NA 3L0YA 4UMVA 4ZEVA 3QNMA 5AI4A 3B9BA 4BNDA 4YCMA 2OBBA 3M9LA 2Q4TA 2P9JA 1RQLA 3WKAA 3E8MA 4JDPA 3HLTA 1Z4LA 3L1VA 3ZWKA 1Z5UA 2YN4A 3SHQA 3UMBA 3FPSA 2WF8A 2G1AA 2PKEA 5AVTA 4E88A 5AW5A 4KYTA 1TJ4A 1YJ5A 3TLMA 1ZD4A 1LVHA 5AKXA 4XPZA 4YCNA 2ZBFA 2IOHA 3RFUA 5AIBA 4OFZA 3MN1A 2AGVA 3AR4A 4HYTA 4UU0A 4Y2TA 5ALFA 3MC1A 4BKMA 3ONNA 4KX5A 5AM5A 3PDWA 1U02A 3K1ZA 4C4SA 1ZD2P 2FUEA 1ZRNA 2ZOSA 3CNHA 3ZX4A 3WK6A 4UM5A 3SMVA 3D6JA 3QX7A 2EATA 2YMPA 3A1EA 4DWOA 1RRCA 2QYHA 4Y2VA 5AHXA 5AIAA 1L7OA 1NNLA 1YV9A 3L0CA 4QQFA 3B8EA 1SWWA 1QH9A 5ALIA 3L8GA 4UATA 3IJ5A 3L0BA 3L7YA 3J7TA 1CQZA 4BX0A 3FVVA 2G06A 5AESA 3WK8A 3KDPA 4EX7A 1L7MA 3AR5A 3FGOA 5ALMA 3ZTYA 3U7EB 1AQ6A 5AVRA 2AH5A 3I28A 3NANA 4HGRA 5ALRA 3AR7A 3EF1A 1TJ3A 2PQ0A 4Y2RA 4EEKA 1U2TA 4DW8A 1ZS9A 2I7DA 3WKBA 2FPWA 3AR9A 5AI9A 3ZVLA 3I1YA 3DV9A 4QJBA 3R9KA 5ALVA 2C9MA 2I55A 3ESQA 5ALXA 2G08A 3QLEA 4O8CA 2GMWA 5AK3A 5ALYA 1LTQA 1ZRMA 1L8LA 5AKLA 2OM6A 3EF0A 3W5AA 1ZOLA 5ALHA 3NRJA 4JB3A 4FE3A 2GO7A 1RDFA 2G07A 3I6BA 1RPZA 5ALQA 1J8DA 3MMZA 4YGYA 5ALOA 5AW1A 4RETA 2OA0A 4OD0A 5FP0A 1T5SA 3ZTWA 1L6RA 4HGPA 2ZBGA 5AW4A 2B1RA 1PW5A 2FUCA 3KC2A 1YMQA 4G9BA 1RKVA 3DNPA 4KNVA 3L8HA 5AM0A 4GXTA 2JAWA 3WK7A 2I54A 3QUCA 5AKZA 3WKCA 4BYGA 5ALTA 4XOUA 3N1UA 2GFHA 4GIBA 1IWOA 2O9JA 4NFLA 5AICA 1RQNA 5JJBA 3AR8A 2YJ5A 5AKYA 3NIWA 3WGVA 3QGMA 2IOFA 4KX3A 4YIKA 4KN8A 2HHLA 2R8YA 2C8LA 3L8EA 4XE5A 2R8ZA 4ZEWA 3A1CA 3A3YA 5A3RA 2B8JA 2WM8A 4IG4A 1NF2A 1J97A 3OCZA 4EX6A 2G09A 1VJRA 5ALWA 2VKQA 1Z4PX 2ZBEA 5AK6A 3UMCA 2HF2A 2P69A 2NYVA 3L1UA 4Y3UA 2FDRA 2P11A 3R09A 3EWIA 5AVYA 1YS9A 1Z4JA 3B9RA 1CR6A 5AKGA 3ZI4A 3KD3A 2G0AA 4FFDA 4CNQA 4L6AA 1L7PA 2PR7A 3R4CA 3U7GA 4Y2UA 2EARA 2BY4A 4J2TA 2O2XA 1WR8A 2FPRA 3OCWA 5IT0A 2NO4A 2HOQA 3IB6A 4BX3A 2X4DA 4UAVA 5ALSA 5AM1A 3OCUA 2R8XA 5AM4A 1KYTA 3W5CA 1RLTA 4KNWA 1Z4QA 1QQ5A 5AK5A 5E0OA 1XPJA 2DQSA 2HDOA 1QQ6A 1NRWA 5AKJA 3IRUA 2WF9A 4UMFA 2CN1A 3UMGA 1F5SA 3CZ4A 3FPBA 4L57A 1N9KA 3N07A 2FI1A 2HO4A 4ZEXA 2IA5A 5AKKA 1JUDA 3PGVA 1Z4KA 1Q92A 1ZD5A 4H1WA 2GHQA 3DDHA 4HAIA 1SWVA 2ZXEA 3U7HB 3ESRA 3HYCA 4UU1A 2HX1A 1WVIA 5AW6A 5IT4A 5AVXA 2JAOA 4F71A 3SLRA 1QYIA 1S2OA 4AP9A 3BA6A 1Z4IA 1TE2A 2YJ4A 4L6CA 5ALUA 3AR3A 3U26A 4UAUA 3NASA 4HGNA 1U2SA 1RMTA 4Y2JA 5A3SA 1L8OA 1XVIA 3AR6A 3M1YA 1RMYA 1QQ7A 3QU2A 3U19A 3SKXA 3QU7A 3OCYA 3ZWDA 4NAVA 3I76A 1Z4NA 1YDFA 4YH1A 1RC8A 2Q4RA 2B8EA 1T5TA 3L5KA 2RAVA 4C4TA 1MH9A 4HGQA 1S8OA 2I33A 5AVVA 4MUMA 5ALLA 3F9RA 2W11A 3ZVMA 2HSZA 3NUQA 4BEVA 4CF5A 1YNSA 4YIHA 1RLOA 3KZXA 5AW2A 4HGOA 3KOOA 3BWVA 3L8FA 1TA0A 4UMDA 3QUQA 5ALNA 2ODAA 4NABA 5AW9A 4FYPA 3QYPA 3QUTA 1Z4OA 2B30A 2YMQA 3MPOA 4PNHA 2HF7A 4IFTA 2OYCA 4BEWA 4MWOA 2EAUA 1XP5A
chains in the Genus database with same CATH superfamily
1ZGAA 4MROA 5A5EA 3S5UA 4M2LA 2JBAA 1J0CA 3WGZA 5B7GA 5AUNB 2IPNA 2ID9A 1FDSA 1KXZA 2REQB 3N8IA 1SC1A 3FCOA 2QOEA 3V42A 3RTDA 1OY1A 1TVKA 4E1BA 1FVHA 2C29D 2GO1A 1FOEB 3ZJ4A 3RRMA 4C7KA 1LSSA 4W9NC 2BHSA 3L4JA 4K9KA 1VL0A 3SF0A 3IHLA 3JQEA 4E6PA 3OJFA 2V6BA 1CR2A 2ZBUA 5KS2A 4PO1A 3QLVC 5DMHA 1CZNA 3S3TA 1VFPA 4B35A 1CY7A 2C04A 4U3JA 3ESDA 3ITKA 3LC2O 1GKKA 3VGJA 4NFSA 1R0RE 1N3BA 5L6MB 1FUUA 4YUYA 3CG4A 3CWCA 4M0KA 2C88A 2QN2A 4FC7A 1I13A 1X42A 4OBXA 1T43A 2R8OA 3ZBQA 5IRCD 3FROA 4ARSA 1RC0A 2NVOA 2NYUA 2X0EA 3SBEA 1U1IA 3K9QO 4ALIA 4GKVA 4MCIA 2XUIA 1V5EA 3QYJA 4RD6A 3YASA 4MQUA 3DO6A 1DKRA 4G0YA 4I2NA 4JC5A 3IDAA 1JJAA 4LHXA 2ES4A 2PT9A 1ABEA 2MSNA 2PWAA 5H1YA 3GAAA 4ZVPA 1S6YA 3KXLA 2OKCA 3ASZA 2CYBA 5BR1A 5J9FA 4D0GA 2FPSA 2VF8A 1PL6A 4MV3A 4Q24A 4EUEA 1N1EA 9GPBA 4U4AA 3FNIA 4I1YA 5KNBA 4B2YA 1UFVA 3F5SA 2QORA 3NYQA 2G4CA 3A1DA 4B3TB 1Y4UA 1VBNA 4RHCA 2FLKA 2CZQA 3BHJA 3U37A 3W5DA 2LE0A 2QRNA 3DEHA 1GPNA 2QTCA 3NBFA 3OJEA 1OE0A 3AUJB 1QZUA 3Q1KA 3TTWA 1JDZA 1XTVA 2XUOA 4IIVA 1H65A 4QSHA 2GPWA 3CVXA 1RE0A 3OZAA 3ZU6A 2CCJA 3GEHA 3NBXX 4ZU6X 5G40A 3NALA 2ZG6A 3S1AB 4OMDA 4F11A 4UOZA 2GBLC 4ZYYA 3H1EA 3NTOA 3Q3CA 1PWXA 3UGTA 3BGDA 3G5TA 3MJ4A 3BKXA 2DSTA 2KB0A 3P2KA 1UBSB 1IAQA 2EKQA 4MUGA 1B7GO 2R6R1 1G3IA 2D1YA 3AHHA 3I52A 3QTBA 5DLPA 4DMLA 2R8RA 1G8SA 3MG9A 1JXAA 3Q3GE 3QFHA 4CYMA 2JLXA 3AXTA 1FSSA 5HZHA 6Q21A 5KTTA 1QORA 5EINA 3RF6A 3ZHCA 3G0DA 2QLTA 3H9JA 2YH2A 3OHMA 2FSFA 1WD5A 3ZW9A 4CMCA 2JGEA 2ZTLA 4GAEA 4U8GA 3SYTA 3PPXA 2HSWA 3N28A 1OLUA 4LC1A 3I53A 4CF3A 3H7AA 2IV2X 4DREA 3W1VA 3O3NB 2QZJA 2VT6A 1A76A 1CDOA 1QRAA 1KXJA 3D7RA 4R0MA 4UM9D 1U7PA 2J9GA 2RBKA 2Z1NA 3PEFA 3W9YA 3WJ2A 3IOYA 2OESA 4NQZA 5FNVF 1V1MA 2EL9A 3TLYA 3K9CA 4GPBA 3UAXA 4F93B 3QEBZ 5BUZA 1GPH1 1TLFA 1CRLA 2EIXA 1GEGA 3PXGA 2B2XA 1AT1A 4AB1A 2EG9A 3ROGA 2ZTHA 3ZNNA 1EQUA 5IBCA 3GJXC 3M6XA 4FTWA 4ID9A 4K9RA 1BWPA 2ADMA 4HDNA 4L74A 4C4RA 3H2KA 4DEVA 1WZ2A 2GNPA 2QN9A 4B79A 4RX1A 3EBLA 3BD7A 5IKPA 2F1OA 3CRNA 3GYGA 3WGGA 3CSUA 4J0DA 5AKHA 1IN6A 2QAIA 4Y2QA 4ALLA 3C3PA 4YPVA 2ZM6B 4UPDA 2FSUA 2ZJBA 4EY4A 5ERGB 1PGPA 4HXGA 1N36B 1S2MA 2G7ZA 1U9CA 2YY5A 3A6EA 3IIIA 1NVKA 3OCXA 4KAXA 4UASA 5FO1A 1YI8A 1KDZA 3RUAA 3PFCA 4TWBA 4X71A 4CM1A 1FNCA 2OGZA 4MPTA 1YDMA 3G2KA 3K31A 3RS4A 5CD1A 3FGZA 3CZRA 1S3IA 1IATA 1JEDA 2CLOB 2HLDD 2YYYA 3HU1A 4RPKA 5GM2A 2JGMA 4LISA 1HDYA 4MKHA 4UMVA 3UN1A 3WP1B 4EZIA 2IEDA 4QXPA 4ZEVA 4JP8A 5JEDA 4TN5A 3A6HA 4X44A 4YCMA 1BEZA 4I50F 2Q1YA 4INOA 4WEOA 3NJRA 2IIBA 1OGIA 1JHOA 1U28A 1BFKA 3R7NA 4DSOA 4KO1S 1B41A 1KGDA 3DZFA 5ELXA 4EWLA 3BQ9A 1WA5A 4NI5A 2OOKA 5DLYA 2J5QA 3OT1A 1NBAA 4KGDA 1K8XB 4RHYA 2J6CA 4H2DA 2Z5LA 4ZI5A 4BVAA 1BE1A 5AVTA 2VF7A 2GPTA 1V7CA 1VIYA 4JHLA 5AW5A 4E88A 4PFQA 2FEWB 4CW7A 3FIUA 2G7MC 2QTVA 4TVBA 3H6KA 3RFFA 4IP0A 4REQA 4BRZA 1ZCZA 4H6XA 3JX9A 3HBFA 1VMKA 4KKVA 1ONBA 1NF8A 5IUNC 1GNQA 1X14A 3EVEA 2FSPA 3B2QA 3HBMA 3IE1A 2WG2A 5JD6A 3A0RB 3NVDA 3VJMA 4MQMA 3OE1A 3FVRA 3MMNA 4MCAA 1E79A 4S1TA 1PHRA 4MP6A 2J48A 4G0NA 2WHXA 4HWKA 5JPDA 2DM6A 2ODWA 3LHDA 3T3MB 1CJTC 5LZ9A 3NAZA 2HF9A 1ST3A 3KQQA 3I1FA 5JNWA 5B5SA 2VSOA 4WKGA 1FFHA 3BE5A 5KNLA 5FT9A 2ONYA 5K0NA 4C7BA 2BVNA 1KAHA 4X95A 1B2RA 5IWCA 5K99A 1VDMA 4WNIA 1G7TA 3UHOA 3KUDA 3TZCA 3DEJA 5EE0A 1ZWLA 3SZRA 3CH7A 4UXIA 2PX6A 2ZCUA 4FFBA 5IDXA 3UOGA 4EJ2A 2F00A 2P9GA 2VP4A 1A71A 5BN3A 2OCYC 3JWJA 3MELA 4R71A 4CFYA 3LCUA 3VKGA 3L2OB 2P7HA 5HS6A 1JEAA 1H1TA 3L8ZA 1BKYA 3MJTA 1TM2A 4G85A 1JDTA 1S3FA 1W87A 2IXBA 3OCJA 2ONJA 1CQIA 5D3ZA 1NVTA 4QULA 1I94B 1G9XA 1ARZA 4JFAA 1UDAA 1VJ0A 3PQ2A 4NLLA 1E98A 1H8HA 3VBEA 4NARA 3UEOA 1JDNA 3EFOB 3NUZA 2XYQA 1JLRA 1T1GA 3FPFA 3HYRA 4KQIA 5ALMA 3ILHA 2QX7A 1B1CA 1IHOA 2J4DA 5LBUA 2F43A 5BSGA 4FE4A 2JIBA 4KFUA 4OSPA 3ZY2A 1TJ3A 5KCMA 2Q7OE 4QQNA 1A69A 2VHWA 4CDGA 3DEKA 4R0VA 2BEUB 2QYSA 3FKSA 3C3BA 3ZZTA 3ZD6A 4DLTA 3IQEA 1BFUA 2FPWA 4RWEA 2WNHA 3BC1A 1Y7TA 4JJFA 4MGYR 3BTVA 2GPAA 5CB4F 5IF9A 5LQMA 4OXKA 4ER6A 5K0TA 4UCWA 3ZWBA 2AJTA 3QLEA 4X93A 6LDHA 2M6RA 1IWBB 3RYTC 1HDOA 3GP5A 1CYEA 1FTYA 1H3NA 1X86B 1K63A 5IU6A 5IH3A 4HFRA 1M2FA 1N3IA 1Z47A 3QJ5A 4F3CA 4JB3A 5EJ6A 2KSQA 5DP1A 3PPWA 4XIFA 1D8AA 2WVHA 3IP1A 5IF3A 1AK2A 3MMZA 4MQLA 4RV9A 4XD7D 4IEFB 4A82A 2ZDQA 4CFSA 2WSYB 3DAYA 5CMLA 4ZICA 4O1IA 1Y1RA 4C89A 3WLKX 4L72A 1JE0A 2D13A 3ZTWA 1L6RA 5ARBA 2NPOA 1YFJA 2YOHA 5SYAA 2VG8A 2PJDA 4MW1A 3IR6A 3HUTA 3LYAA 1GPYA 2P0YA 4E07A 3PHIA 4CLEA 2RBGA 2W6OA 4AY5A 1W9HA 2H07A 2O3TA 2VPPA 3MGKA 1QRUA 1BRTA 5LUAA 2BFEB 1S96A 1ECCA 1Q0ZA 3DKRA 4EF6A 3CZQA 3CVWA 2QRMA 4PLYA 1Q5PA 2EWVA 4HN4B 2JGKA 3ZQJA 5BQOA 6CHYA 1KK1A 4E5UA 2ZU0C 1YZYA 4ZA2A 4MJLA 4CEHB 1KIMA 1P45A 3JYNA 3W6OA 2H59A 1QC5A 2X5XA 1IY9A 3P9YA 4BNMA 2CE2X 3E9MA 3JVVA 4L7VA 2ONKA 3N2KB 3VR5A 2IS2A 4TYQA 1E6CA 1NUTA 1TCBA 3DKIA 3URKA 1TYCA 3NS7A 4R8VA 5M5BA 2A1IA 4RK4A 5BR7A 3KSZO 3M70A 3E2MA 4FUTA 5TDHA 4XYBA 3VTKA 3PQ3A 2O4CA 5I4IA 2BZSA 3TX6A 1NUSA 3QKWA 5TARA 1QU2A 1J97A 1TKBA 1W49A 5AJTA 3ROZA 1LC3A 2G09A 4NBSA 4AULA 4O1MA 4ND7A 3X1JA 3VDNB 5AK6A 4E22A 5KU1A 3UAGA 1EPUA 3HNRA 3UATA 1QVVA 5HOQA 9LDBA 3JRWA 4R9NA 5JH7F 5LZ2A 2JCGA 4X84A 1WKCA 2Y93A 1T8PA 1T6YA 4IMRA 1QHYA 3PJEA 5JISA 3DE3X 3O9ZA 4U8HA 3B12A 1YVEI 1NLUA 3ELYA 5CPBA 421PA 2OPHA 3HUUA 5K3OA 4AAYA 1KI7A 1NLMA 1MR3F 1RWVA 4JI2B 5K0FA 2XVAA 2GBFA 2LKCA 3L7LA 1UC9A 3TKLA 3N7UA 4CMEC 4KRGA 5ER6A 3WL8A 3R9WA 4C9BA 4QUBA 3QTLA 3NHYA 5EWJA 4N47A 2Z8YM 4RQAA 4LV5B 1U0HC 1RNLA 3MS7A 2M6LA 5IVPA 4B74A 4Q18A 4X92A 1T5BA 3DWIA 4QFBA 5ALSA 1CW2B 1V47A 1GLNA 2YRFA 4M0LA 3X1ZA 4DKXA 3KT8A 4A91A 3U2QA 1ZSNA 1IN7A 1II8B 4EI9A 2AF4C 3KHKA 3NG1A 3EFHA 3PD7A 5DTRA 3EPKA 3HJGA 2O20A 4L8YA 4Q4DA 1V8ZA 3CBQA 1KEEB 1RBZA 3U16A 2XIJA 4TVOA 4R98A 4OQEA 1MORA 5LYJF 1WXDA 3LDAA 4GZLA 5E0OA 5LQRA 2X5KO 1YCFA 1YUMA 3IP8A 3INTA 1EA5A 1S8NA 1NXOA 3HN6A 4CMIB 2QV7A 2WYUA 1JHAA 2PMDA 3DMFA 3VU1A 3FSRA 3EIHA 3E2IA 4POAA 3FMFA 2FPKA 3HU3A 1MW9X 1AMOA 1OFVA 2D59A 2FX5A 2OY0A 3G13A 1XR3A 3GCGA 4KIUA 5IKMA 4Y0AA 2P5TB 5CLJA 5JCXA 3SHVA 4PCAA 2NWQA 2GKSA 2D1QA 2P35A 2XZLA 2ERYA 1BG6A 1A9ZA 5E2BA 1GTMA 1HMYA 1VE6A 1OYYA 1YE5A 2Q3DA 1P33A 1W6UA 1TYAE 2ARKA 4A16A 4Z53A 4L6IA 4W1SA 3SZUA 4BFTA 4K6MA 1F2UA 1UM9B 2F67A 5KAPA 3BCRA 4O4JA 4FQ7A 3M6LA 3NC1C 4KE9A 1JZTA 4QT4A 1ZSYA 1KZ4A 5K0SA 1MB2A 5BYAA 4YONB 4B48A 1ODKA 1OTHA 2ZTSA 2RIRA 5CA1F 2ZVQX 4X66B 1GU7A 1O0SA 4NIMA 2Z5VA 3Q8MA 3GEEA 2DFVA 2QXTA 5DHRA 2NGRA 3SGLA 2BDTA 1D4ZA 1ANKA 3VNSA 5JSQA 3FPLA 2Z5FA 3CF2A 4FJ0A 3A4MA 3DE4X 4MIKA 3A32A 4I55B 2QQFA 3JQ6A 5BSTA 4CM6A 4ZEOA 4TZ6A 2D5CA 2DFPA 2VWHA 1W0KA 1OH7A 2Q6LA 2GILA 1RXWA 4WLUA 1OZ0A 4YAWA 3EXFA 3IQWA 3CG0A 3OFKA 2W6MA 4RJKA 1V11B 1WU8A 1I7LA 5CDUA 2FN9A 1KI4A 5ADUS 2NU8B 1ISHA 2BPOA 3BMOA 3LBYA 2VP5A 5EHIA 5KBYA 2PK3A 1D1PA 3ISVA 3LZ6A 3HXTA 3O4FA 2IOQA 4C0XA 2GPJA 2XMRA 4Q9AA 2EZ9A 1Z6GA 1N4DA 2IPXA 5JV5A 1KY2A 4OFWA 4BX9A 5I7UA 3RUFA 1JPNA 1OIVA 3IJRA 4LW8A 1PSWA 4C6HA 4KTTE 3NT2A 4NZYA 1F3LA 1EVKA 3EZLA 1MAVA 4XDZA 3VPGA 1TAGA 4AF6A 3L5KA 4NBRA 1ZISA 1Y7IA 3GDOA 1T3HA 3VX3A 1MJNA 2B8WA 1ZH4A 3HCFA 4ZVLA 1RHMA 2HRDA 3KWLA 3MTBA 5TSDA 2JDID 4JL8A 1BMTA 4Q4LA 3NUQA 4X65B 2XDQB 1IHPA 4AJNA 3I92A 2FWAA 1H2RS 1ZN2A 2Y66A 4NJMA 4X8HA 3HJAA 4J0CA 5HR5A 4NKRA 2QZZA 4H15A 1SOMA 1BVHA 1GL9B 5KYGA 3P7MA 3EOZA 4ZHQA 2C58A 2VUTA 2P3LA 4RIHA 2Z6VA 1X7YA 3LY5A 4Z0TA 3V1UA 4E2ZA 5JS1A 2HO5A 1G20B 4CLRB 3A1WA 3ETHA 3L6OO 2QG9A 3AKCA 1Z2AA 5FOXA 4KWIA 3QY0A 16PKA 2LDXA 1SVMA 1O96B 1C7QA 3AONB 4X1YB 2HT1A 2LXNA 2I62A 3DAOA 4JBYA 2CLSA 2FMFA 3TX2A 1VE9A 2PSJA 1XLUA 4R2KA 4L51A 1TTTA 4YRNA 1E20A 3RT7A 2JGAA 3A1TA 3MWEA 3QF4B 4RZXA 2FQQA 4XWOA 1US8B 3BK1A 2GTPA 1BS2A 4JR2A 5DISB 4Z0HO 3I5MA 2UKDA 2QIPA 3H11B 1FZQA 4ZAYA 3PLNA 2JAPA 2R8PA 2PA3A 3NAMA 3HJRA 1UXJA 3UK0A 1SXJD 4C0SA 2D7DA 2C07A 1NZFA 2GYUA 2WFZA 5EP1A 1R0WA 4NZZA 4Q7QA 2WVAA 4IQFA 3CVOA 2HEGA 1GOTA 2A3NA 4OGWA 1TM5E 2OPBA 4P2GA 4S1PA 4FLMA 1WPQA 2ZIXB 3AJ9A 1QF7A 5FR1A 2YJ3A 2Q2OA 1U0TA 1FE8A 1W5SA 1CUJA 2MR6A 2PJZA 3LKZA 3T5MA 1RI5A 3GOHA 2QR2A 3M3PA 2AW5A 2BEVB 4EPTA 1JBEA 1QP8A 1YCGA 4TLMB 3VXKA 1ZD3A 2C9ZA 4ZO6A 2VJYA 1XXHB 2IZ1A 1OI4A 1R9NA 3SSMA 4HLQB 4C21A 1LCIA 4M9QA 1CEYA 2R97A 4Q4AA 4AYTA 2O23A 4V38A 1M2WA 4P1ZA 4YRZA 2P41A 3OQVA 3ZK8A 1H5UA 2H5JA 3G8AA 3OTQA 4G24A 4QNMA 1TZBA 3Q8LA 2QTFA 3D9QX 3IA2A 2GN2A 3P5BA 1BMDA 4II3A 4NE2A 1QHSA 3VHXA 5LSAA 4KO2S 3ZLJA 3IP3A 1VPWA 1L5WA 2CE7A 4D57A 4KQGA 1W0JA 1IUNA 2O06A 2G9QA 3LW7A 1NOJA 3LKVA 1STOA 4TTQA 1F51E 1LSOA 2R6HA 3R3UA 1P9LA 3GLQA 4P2BA 1P31A 3SX4A 3B3QA 1G5RA 1GVHA 3LYUA 4B81A 2Q9CA 4ODIA 1I1NA 4MLDA 1P80A 3PL5A 1WUJS 1GY8A 1YQQA 4IDHA 1QQAA 4PO8A 1C0PA 1A4RA 2RGAA 2W6QA 4Q47A 3U7FB 2QRLA 3I9KA 3U13A 1KZGB 2UYCA 1E1NA 3RKUA 1NQ5A 3QU4A 2J0SA 1GFZA 3JQ7A 4EW3A 3BKWA 3HACA 1XQXA 4QTZA 3P9NA 4OYLA 4XQ0A 4LY6A 2Q5JA 2WLSA 1EG2A 4I6GA 1LDYA 3BB1A 5CHEA 1CLEA 5IYZA 4KO4S 3KJIA 2OMEA 1X15A 3U9TA 1I7NA 3PHCA 1QYVA 4J07A 1XZEA 4QUDA 2NX2A 5TEVA 1VECA 4L0MA 3QVVA 1JWBB 4M86A 4XJTA 2O1XA 3W34A 1QZTA 3ODGA 1JDUA 2OAQ1 3T7SA 4A6PA 4XX0B 5C8XA 1LX6A 3G2LA 4PYLA 1H5QA 4KWTA 2PGAA 3KHSA 4JXXA 3P0EA 4OKNA 3KU4A 5CT9A 1T29A 2CXHA 4KG7A 3Q7SA 4EGAA 5MGNA 1R9JA 1K92A 3K2BA 1JHPA 3FZEA 3Q9UA 4U9IS 3EEBA 2QHXA 2P2LA 2UUBB 3QMVA 4HSGA 2ZJ0A 4OJKA 5FI5A 5FUVA 1MRNA 1TM3E 2IKQA 2H4XA 2WDPA 3GVIA 4RZSA 2UZ4A 1OJ7A 3ILXA 4AWXA 3WLFA 4WXEA 4OQ4A 4LBZA 1JB9A 1JWAB 4D2IA 4TV8F 3QPCA 3REOA 2QMUA 2VYNA 2OXFA 3K9NA 3C7KA 5HG0A 5IS2A 4F4DA 3OTWA 2JFPA 1NURA 3PGLA 4TMXA 3VC7A 2RB4A 3B53X 1A04A 5IM4F 1BJTA 2J32A 1S8AA 3MS4A 3VHQA 1B14A 1T35A 1O8CA 2ENUA 3EE6A 4QYIB 4BNDB 4EG8A 1AHNA 4B73A 3GFPA 5AW8A 1UJMA 1Q0TA 4JLPA 1VZ2A 1YVPA 1K9VF 3OOSA 4O08A 2BDUA 4BLSA 3LNTA 1G41A 1BTOA 4EW6A 1PR4A 4X62B 4WLEA 4OL9A 1G6HA 4MS4B 2DWQA 3G7UA 5TPWB 3UYKA 1V5WA 3URMA 1I4TD 4RKEA 1FRNA 3PQ7A 1ZIPA 4L4RA 2XVMA 1R4MA 4PF1A 4C5BA 1P91A 3N2IA 1JQDA 4AF8A 1VBKA 2JLWA 3RFCA 4KQKA 4OQZA 4ZZ1A 1JQBA 3ML1A 2HGSA 5IK2D 3KUUA 4EHBA 4CUJA 1WOMA 1DWQA 1WABA 5LP6C 4PX3A 1CY2A 3ZIDA 2ZYRA 2VPTA 3WYEA 1SZCA 1XLVA 3LUPA 2IJGX 3L01A 1DP4A 1LBIA 1Q20A 2P5YA 1JYEA 4EMUA 4ZREA 1LY1A 3FYCA 3PX3A 5T4HA 2H1OA 5SY4A 2W83A 4L16A 3VVBA 4FMDB 4CBVA 3ZXUB 5K0EA 1KETA 2YW2A 4Z1MA 3ZWPA 2BR4A 1KI6A 1SQGA 2PX8A 3FZYA 1GCGA 1W5AA 3UHAA 5JI3E 1JXMA 3LCJA 4H7HA 1JHXA 1NE2A 1BXZA 1PGJA 1UJNA 1T36B 3WGNA 1CDZA 2VPIA 4QBGB 1Q50A 1QCDA 1QJ4A 1U1GA 3ETDA 3IEPA 1XZIA 3PXBA 4JP5A 3VC1A 3VJKA 3IUPA 4KYVA 3R44A 1PK8A 1EE9A 3JPWA 3Q5GA 4EMTA 1M10A 3V4RA 1JU3A 1E3EA 2J85A 3WHKA 2BSAA 2D1SA 4Q7MB 4EUNA 2V97A 2I78A 5LVAA 2FPGB 1IB6A 4JK3A 4JZKA 2AE2A 4D82A 5JXIA 5KOJA 3HU2A 1J8FA 2CBZA 4IDFA 4I1RA 3WIDA 2FN4A 3E9EA 3WNZA 3U09A 4JKOA 1MH1A 3STTA 2QQ0A 5CFMA 2XD4A 2Y9MB 4D4GA 4KVGA 4UPVA 4Y2VA 5ANRB 1DINA 2XQFA 1SC4A 1DTSA 2QUBA 4PLHA 1R7RA 2Q3HA 1YQDA 3HKCB 1NNLA 4JAVC 3DE0X 4R01A 5BOSB 1IBMB 4BFYA 1EVLA 4W5NA 3K4QA 2NSDA 3DYVA 3MUOA 2IODA 5DWVA 4BXOB 2G5PA 4LS3A 5EZYF 3L0BA 1X1SA 3QG5A 2HREA 3RAGA 3DMRA 3NX4A 5SY6A 3HY4A 3RK1A 1C2TA 1OZHA 3NATA 4HQNA 4J7XA 5JAUA 1T15A 5FXMA 3TW8A 5G02A 1E9VA 4CM7A 1PJ8A 3AOEC 4H1VA 1V0JA 1ZD1A 4DCPA 5ITWA 4N40A 5KHLB 1AA9A 1JWLA 4NCAA 3NT5A 5HKAA 1BC5A 3RVQA 2ZAMA 1L7DA 4UBKA 3AUFA 3ICCA 4ITRC 4KUHA 5ALRA 3GC6A 3PT9A 4QJ3A 4NDZA 1KP3A 1Q15A 3IP6A 3R9XB 1WVMA 4RCVA 1EM8B 1EZ1A 3MRTA 1XU4A 1K2WA 3NC0C 2Z95A 5GP1A 2F1HA 2BR3A 4ML3A 4B80A 2E85A 1S9DA 3SI7A 3NV7A 2ZUVA 2HMSA 2V7QA 2ZJ1A 2C5AA 2I6QA 4N0PA 4P6VF 5BVHB 1JEYA 1AO0A 1P3DA 2VQSA 4IHQA 2GD0A 5IW8A 4ZMSA 2C9CA 4G84A 3AEUB 4AY3A 2RGGA 4GOOD 2BTQA 2Y71A 2XDAA 3VO9A 1JXOA 5ULLA 3NRJA 2YJNA 1B0ZA 3QK7A 4JEMA 3GMIA 3MLEA 3E27A 1ZI8A 1SCAA 1WHSB 4OB7A 2B92A 5GM1A 4IJ6A 1Y9EA 2ANBA 1SCIA 3DMNA 3T7JA 4K9LA 1IULA 1FLVA 2VH5R 4FX2A 1E3TA 2CT8A 3TXYA 2FEOA 3NDRA 1XZCA 2UVQA 3EGDA 3L8HA 1WS6A 1DKLA 3H1BA 4IIHA 4QSMA 2I4RA 4GDMA 2HSDA 4W4TA 4XQEA 3TWOA 5IVHA 1IXKA 3E7FA 1QOQB 3U4HA 4TQUS 5AXBA 4JUBA 4BMOB 1M2OA 2BHLA 4O2AB 2FSVA 4ND5A 4M46A 3GGPA 3MBOA 1QK3A 3PNQA 3EPLA 1TC1A 3M4YA 1E6KA 4AF7A 5CXUA 5AICA 3TNJA 1UWVA 2ONZA 2PYZA 5LA6F 5IKXA 3IUMA 1C3XA 3S7TA 2A6PA 4RPIA 3RU7A 3A6KA 4BQRA 1L5LA 3ZDDA 1YUBA 2B9EA 2ZT7A 3OZEA 1L4MA 1PKEA 2HA7A 2QLFA 3ANYB 3N59A 3GWGA 3C3XA 3GFFA 4KMOA 4N01A 1SH7A 3B9PA 1B0AA 4N0EA 3TMKA 5IDWA 5DEIA 2ZYAA 1HT1E 3E5NA 1SOAA 1ZP6A 2QAJA 1RIIA 2I3BA 1Q0HA 4RTOA 4EW1A 4UVHA 5FWYB 1E1RD 4MGKR 2IDKA 1GZDA 3D7SA 2XZPA 4RHXA 1VE7A 1JLMA 4X64B 1GYRA 5TIIA 1FJ2A 5JYCA 1FU4A 1CFZA 1GQRA 4XW2A 2HQ1A 4D8WA 2E55A 4R84A 1HPLA 4X7BA 4S2UA 3WSWA 4B6OA 5GONB 2GN6A 3R3JA 1WBBA 4L9RA 3HBLA 3DLHA 2O05A 3MTDA 4HEQA 3VUEA 4XTCS 6NULA 5AVYA 2VEOA 1UZNA 4PRZA 2W2LA 4DCJA 3ANLA 1JQKA 4B6SA 4D56A 4JBLA 2VPQA 5CAEB 4CLDA 2D62A 4L6AA 4FNGA 3RE1A 4XD2A 4EG7A 1W0KD 3O84A 4PC7A 3IOBA 4ARCA 1WCYA 4BVKA 3V00A 4ON9A 1N2CE 2CVQA 4YMWA 4HMPA 5FPYA 2J4FA 2GAFA 4OHRA 4JJ8A 2QG4A 2JF0A 1Z68A 5KX5F 1NMSA 2I80A 3ANMA 4OB6A 5TVKA 4HX2A 1N8SA 4A4DA 4LG1A 1B6SA 3D6VA 5CA0A 2DR2A 4BV3A 2D3WA 1NI3A 2IYXA 4O4IF 4YLEA 5G1PA 3WGOA 4I99A 2TMDA 4X20A 1T24A 4N6NA 1UMDB 4CKBA 3T9AA 1L5ZA 5G4KB 4FFWA 5CBPA 3FUCA 4OJYA 4RD2A 1YIAA 2NYAA 3GZJA 2VNAA 4ZT2A 3H97A 4G23A 1UIRA 2P9BA 3C6YA 3OSZA 4WJKB 4GI7A 2QM3A 3ZCSA 2XCSB 3A2MA 3IRUA 4KQEA 1YZTA 1F5SA 2FCRA 4U7HA 3TZQA 3QKSB 3JVUA 1VOTA 2F17A 1THGA 3BQMB 3Q41A 1NNI1 3GJ3A 3KJGA 2HYIC 1N6RA 2R84A 4MWBA 3V8MA 5BN4B 1JHZA 3G5UA 2O0LA 2C8VA 1WQ4A 3JV7A 4X1OA 1GQFA 3SYLA 4JYZA 5EZQA 1NAHA 5AKKA 3LGAA 4B47A 3N5CA 1JUDA 1O58A 1MCZA 5P8WA 3V7UA 1JKFA 2B20A 3ORHA 4YXWA 3C6XA 4DSUA 2BMWA 3VO1A 2WKWA 5FUXA 3U0VA 3IAAA 3PHJA 1LTKA 2GHQA 2P2DA 3W9SA 5GOZA 2UYHA 3K8ZA 1AOXA 1LRLA 4IIDA 4FCCA 2ZXEA 3FN4A 1LDGA 2PD3A 4YI5A 1HMPA 4C7VA 1BE6A 3QUSA 3RTAA 4PZ9A 5LPNA 2RGXA 4D98A 2AFVA 3SLRA 4DLSA 2RHRA 4P7KA 4DNOA 4D3FA 4UQLA 3TECE 1TZCA 3IHTA 4MIEA 3GEGA 4MRVA 4OQYA 3AHJA 1XAJA 4LDJA 3OPMA 4TTVA 3W8RA 3NJ8A 2MYUA 4GLLA 5FBKA 3U7QA 4AMZA 1OWMA 3AUXA 3KSBC 1VJGA 1WW3A 2PA0A 3GBVA 2GXAA 1QO0A 4IVPA 1IHUA 1EK6A 3MBKA 4IHKA 4YQZA 3HJNA 3VDQA 1K6IA 2PGLA 3QU2A 2Z08A 3AOGA 1EK0A 4WK6A 1XF1A 3BE4A 3QU7A 1JDBC 2FEPA 4CKZA 5INTA 5BPHA 1F0NA 4JI0B 3ZWDA 2J41A 3AIMA 3K0FA 3NHBA 2I2AA 3WYFA 3H4IA 2G88A 2CUNA 5CT5A 4J75A 3K70D 4R40A 3CNLA 2CVHA 3WS7A 4FSXA 1IEWA 5IC6A 3WR5A 2BJHA 2H54A 4CR6A 2IHUA 3MNFA 3REGA 3NB0A 1GZ6A 5ISMA 1W88A 2H7XA 1V8OA 3DP9A 1QK5A 3TCKA 4ALKA 4P3XA 2AXQA 4OFBA 3QX8A 3ULKA 1QWOA 2WNIA 5C9ZA 1Q0LA 1HLPA 2WYHA 5D01A 2DOKA 3DZGA 1JJIA 4D97A 3ZY4A 3ZVMA 2IBMA 4P82A 3KUKA 5KYXB 3AFIA 1RRVA 1X39A 2IPLA 4DLPA 3GG9A 3TOSA 1RLOA 3VRHA 2AC4A 3X2EA 2IBTA 4ZO7A 1XDSA 5FOTA 3A3OA 2WSBA 4Z3OA 2B2NA 1Z06A 2BEKA 4PFKA 2G5CA 5AOBA 2DBZA 3VC3A 3ZV7A 2Y6VA 3QOFA 4R51A 1W0JD 1A72A 4HB2A 3F3MA 2BGKA 3MPOA 1SBNE 1Y7PA 4I3FA 1VL5A 5EN4A 4WZAA 3GIWA 4HPWA 1DAKA 5H68A 1ZNXA 5J2UB 4YRKA 3WIOA 3V7WA 1O94A 3KJZA 1LZKA 3FUUA 4DCUA 2XQGA 1IBSA 1OFHA 1KU0A 2HMAA 1Z7EA 3OEHA 5I5GA 5EKDA 1FIUA 1U3FA 3SXUA 1NI5A 2WAOA 2VSXA 3H2HA 4JB8A 3HR8A 3JQCA 4FYHA 3AEZA 5EZSA 4YMIA 5EJMA 3PCTA 3GRCA 5JC8A 2J6BA 4P9NA 2D74A 4WZBB 2IELA 2PO7A 2PO5A 3EG5A 3MWGA 4Z8YA 1R4ZA 1B0UA 3F98A 2CC2A 2D2IA 2VRWA 2XAAA 2AFHA 1QVWA 3FSEA 2I7TA 4QPJC 3ENVA 4RGVA 5DGHA 5DWQA 4BO9A 2IEIA 4L5IA 1LNSA 3KQSA 3GUHA 1NVVR 1DX6A 3ABOB 1CIJA 1P73A 2B0CA 3JWEA 4LJKA 3IT2A 8GPBA 5A5DA 1B0PA 2GZDA 3UJBA 5BNIA 2JGDB 9ATCA 1NXVA 1TK9A 4G1CA 5E6UB 4QRDA 1I9GA 2HTEA 3RVDA 3WL7A 1C80A 2D0PB 4URFA 2Z8YA 3E9NA 2P2SA 2F1IA 4K9QA 2QVYX 1V5IA 4G8CA 2Q2VA 5F1YA 1KYVA 2HA3A 1T2AA 2PMBA 2QRVB 3OU6A 3RIMA 3SBDA 2QTNA 1G2PA 3KTAB 3DUWA 3RIXA 1FNMA 3E8SA 4QBTA 1C9KA 4TMVA 5AVJA 5A1JA 4EKYA 3BBLA 1PVVA 2EQ5A 2IRWA 5B4TA 3DV2A 1DQRA 4MVJP 2CMHA 2HJVA 2TMYA 1M1YE 4KWEA 4WQMA 5DU2A 1RQRA 4BQNA 4OU5A 1EP2B 1Z8DA 1YZUA 4S1WA 1NDUA 3A1UA 5ALJA 3VYUB 4N5IX 3IGFA 3KX2A 4HUTA 3ZIUA 5E7IA 2HJ9A 1Q0PA 3IMEA 3K9HA 1ZW1A 4ZAGA 5GQSA 2ZTVA 4IRMA 1H0KA 4LBVA 1Q6ZA 3V55A 4RM3A 1BKSB 1KA9H 4OY3A 4ALJA 1C14A 3KBBA 4BNXA 4KGXA 4F60A 4Q7LA 4XWTA 4YQYA 1J8YF 2AKAB 1KZYC 1KQPA 1L9KA 4R31A 3MD9A 4Q3LA 5JZOA 5DASA 4FS3A 2O19A 4P8RA 2L18A 2CHFA 1CB0A 4IINA 4KZKA 4BWFB 1Z74A 4BP1A 2NG1A 2XUDA 4CLOA 2VHXA 3QVXA 3R0ZA 4HMQA 5KWJA 5JJLA 2XB4A 3F97A 3OC0A 2NPFA 4D74A 4YJGB 4DDVA 4WL0A 4LF5B 5DHFA 4ZU3A 3E7WA 3W5UA 1ETUA 5EJ8A 4UW9A 4IXMA 4EBBA 3QYAA 1XD2B 1ILWA 2J9RA 1D9ZA 5LLTA 1P5JA 1J2EA 5H5JA 2VL7A 1I5OA 3UOAB 3NHAA 5TQ0B 1QR2A 2G71A 1FL9A 4XM0A 3WA7A 3P2EA 1YK1A 5IAEA 2C7GA 4KH1A 2BRUC 2EL7A 2DQ4A 1T1SA 2ZUTA 4GUDA 4LMPA 3X1WA 3PDIB 3ABZA 5DHAA 4ZJZA 1L4FA 2OO5C 3OD1A 3JYOA 2XMBA 1N8TA 4R8LA 5CPFA 4F5DA 1KSFX 1W1WA 3T3OA 4J76A 4KDEA 4ESEA 2J3KA 1CULC 4O4LB 3JXEA 3E3NA 1E1CB 1SCJA 5THXA 2NQ2C 2QRUA 1KMMA 2DPHA 2YZMA 3LE8A 4R81A 1OLSB 4LJ9A 2PL5A 4WVLA 1NGSA 2E5LB 3ET5A 2EP5A 2A3RA 2P0EA 1Y1PA 1Z5PA 2DWCA 1VKNA 3KDSE 3PUKA 4Z1OA 4NH0A 3E0QA 5GV8A 4TRJA 1K5PA 2WIBA 4H0CA 1VKZA 1CUAA 2G70A 5D1HA 3TS1A 2C61A 1FMCA 1DPGA 1FDVA 1F4LA 3H2JA 4RD3A 4UAGA 3V2IA 1QU3A 3QOXA 4RORA 3QKRA 2QG6A 4WXRA 3I4LA 4CFZA 5CFRA 3SZOA 2KW5A 4UNQA 4DCOA 4Y2HA 2B25A 3DEFA 3NIBA 2YICA 4IKPA 1EDBA 4IXWA 1O7JA 5JAHA 4KLNA 1D0VA 4FNAA 5CLGA 1QG6A 3NM4A 5H82A 1KZ9A 1U7HA 4D80A 4XX1A 1TT7A 3LGSA 4IMJB 4NYJR 4PYNA 2OBBA 5FTJA 4DCTA 4AG5A 1OILA 1SULA 3N76A 4RFSB 5HMMA 1NQOA 4CDRA 1R8SA 3WKAA 1A2BA 3A58B 3FKQA 3KELA 3EARA 3R5JA 4MPJA 3T1NA 1YJAA 1QG0A 3THYB 4LC9A 1B3BA 1KH3A 3JY6A 4TKUB 4ZO8A 5L8VA 1WUYA 3OTOB 4D44A 2QMYA 4DUGD 3NEJA 3U4CA 3ORQA 2WSSA 2EKBA 4BQOA 5DNUA 3G0IA 2IXEA 1K2VN 2Z58A 1T91A 2X1VA 3UOWA 1G2OA 1NI4B 4XPZA 3K09A 2I2FA 4POOA 5KOYA 2OUKA 1LJLA 1CVLA 1E5LA 2JA2A 4LIPD 5ES3A 4B2LA 4AXBA 3G59A 4FR5A 3WQBA 1VC2A 1L5YA 2ORED 4GW3A 5K0CA 1NWCA 1O95C 5EMHA 1AZWA 3UFXB 3GARA 4YN3A 2IEAA 3KRTA 3Q2OA 3T3EA 4KX5A 3UK7A 1DUVG 1PYOA 1BGVA 2QX6A 1U02A 2IX9A 5DIFA 2J7KA 2WE7A 3QKIA 3WZMA 1CUCA 3LBFA 3IP9A 1DIOB 3ZHZA 4OBBA 1NNEA 4C5AA 3RVOA 5D8DA 3GIDA 2EYUA 5JYDA 3AHIA 4D4JA 2NSHA 3FYTA 5I9TA 1PAUA 1JKXA 3NOVA 4QOEA 1DCFA 3UH0A 1ODLA 3J7AC 4C0JA 2JLUA 1BX1A 3PEWA 1EQAA 4GWLA 3IEUA 4PN7A 4V0RA 1E2KA 1FS6A 3L0CA 4RIIA 1T9GR 1WPRA 4XRGA 2ORVA 4R3WA 2XX3A 3DTNA 1SKYE 2RI6A 4MQ5A 2ECPA 3TLGB 1LRJA 4ONEA 4CIDA 2XMZA 4CV0A 3L4SO 3HNOA 3GEDA 3DL2A 3AINA 3R8CA 5DN6D 1AHIA 3M9WA 4PYRA 2G1JA 4X91A 3SHOA 1YACA 3OJOA 4QOFA 3RTCA 1NPYA 3WK8A 3LVRE 4BB6A 3T3GA 2Q27A 1NNSA 4XSVA 1KS9A 3PHLA 4AMGA 3PEUA 4L8WB 4JI8B 1JPVA 1QMGA 1VIVA 1KKLA 3F6CA 1YRBA 2PWBA 1JA9A 2ADFA 3ZYCA 5A4AA 4ESOA 4XWKA 3I28A 1WB6A 1T9HA 1T2UA 1XF9A 4ZRDA 1O6FA 1Q44A 2P1ZA 3AVXA 5JZBA 3L6DA 2YXLA 5CJ2A 2G3YA 4JLDA 5LQJA 3KL2A 4LTMA 1JVBA 3UK1A 1RHKA 4BAZA 1Y48E 4KXXA 1LFDB 1T0PA 4YUAA 3AR9A 2HHCA 4KXFB 3ZVLA 1QIIA 4WA8A 3EFOA 5KWVA 2O8VA 3DV9A 1KJJA 1UR5A 4K26A 4UEQA 2I55A 1Y3HA 3UJ8A 1W29A 3D6HA 4HNSA 3WBFA 5AKLA 5E9WA 3I6ZA 3W6NA 1UWLA 1Y9DA 4TS4A 5BW8A 2ZRFA 1ZQ1A 2R2AA 3RIHA 3UXEA 2L82A 1U8AA 4U0KA 2CJXA 1ODSA 4X6UA 5DT2A 4ZHSA 3B60A 2QXYA 5JADA 4PR3A 1RDFA 3LGXA 4DDUA 4RK0A 4MRMB 2V5UA 3GFRA 1SD5A 3K0HA 3RHZA 5IVKA 3Q6MA 3VPXA 3FNHA 2GLTA 3FYSA 2LR0A 3N3BC 4F96A 5KSWB 3HZHA 2QL9A 4EGSA 5BVGB 2FUCA 2NVUB 4BNJA 3IVMA 1WCXA 2EFHB 2FGKA 2W6PA 3PGXA 4GHWA 5FUWA 4MDEA 2J45A 2QN1A 1W85B 2QVCA 1RC1A 1Y1TA 3WHPA 1NW8A 4MVJH 2DC1A 4HQFA 4PQRA 1E3LA 4AUNA 4ZV7A 3PFWO 1CRWG 2IUEA 3HO1A 5F77A 4LXUA 3DOOA 2QSYA 1NR7A 3E4DA 4GIBA 2ODTX 3M6FA 3CKYA 4IKEA 3MD0A 3WE7A 2RGCA 3STYA 5JTTA 1MRSA 1ZM4A 3ROFA 2V96A 2RGBA 3HGQA 2R5FA 3KOXA 5I7FA 3LBIA 1UL1X 4O5OA 3NXSA 5G53C 3I2FA 2CK3D 3HN7A 4TL7A 2ZI7A 3WJAA 2C98A 3F7MA 2BFEA 3U60B 2Z3WA 3ONVA 4IDOA 4JVNA 2HBZA 4B6EA 3D4IA 4QM6A 2QLBA 1UT8A 5AHRA 3B78A 5CDSA 5LKAA 4QFCA 2CV0A 1MLDA 4JVMA 2ZXFA 1VMAA 3ZW8A 1UKBA 3H3FA 3NETA 3EG9B 2O2GA 3JVIA 4H0FA 3N2KA 4MIOA 5DOVA 1E5QA 2WUWE 3D3KA 4CM8A 1JTEA 1X6VA 3JVDA 1XA3A 3PDJA 2GCNA 1NY5A 2AR0A 2OKGA 5TB5A 3FTFA 1Y4AE 4E5SA 2OVFA 4YUZA 1Z7GA 4NNJA 2R48A 1OH6A 1CRZA 4WIAA 1DDOA 3ONFA 3TDKA 4R5MA 1H2FA 4FXPA 5HBRA 1I8TA 1BEUB 3CLTC 5BWMA 3OJXA 5LU8A 3AFHA 5K5EA 4TSRA 5LIPA 3QIVA 4V0QA 3RAEC 1RD4A 3DCJA 1Y1LA 1DLJA 1S8FA 2RG7A 1OC2A 4E2YA 2NV2B 3EA5A 2FPRA 2P4HX 2LTAA 2ZYVX 4ND4A 5CCDA 3SEFA 1DRWA 3WV5A 2BFPA 1XVAA 3UJHA 1R4NB 4JN6B 3IYLW 1P5RA 4G4JA 2R8XA 1D2HA 1FQWA 1N7JA 2Y1FA 4HAWA 5I8WA 3LRXA 2HZ7A 2WA2A 5EYPB 2GEKA 1ZVMA 1SY7A 1W35A 4U7DA 1Y7HA 1Y8RB 1C81A 3AFGA 2RGDA 1HNNA 3DXYA 3ENQA 2BZ0A 3ND8A 2B7BA 3O92A 2QRGA 2DBVO 1NMYA 3OZGA 3UG6A 3RLIA 2VHCA 4DNQA 5ADHA 1JIIA 1HEYA 4FUQA 5LD2B 1IY2A 1W48A 4W1RA 1DDIA 1JMKC 3QE9Y 4D6YA 4ZTBA 2RFLA 1LRKA 1FVXA 3IE0A 5FLYA 1HE1C 3UCFA 2E49A 2IEYA 3BTUA 3QI7A 4PWYA 3EW7A 5AKJA 2H8GA 1CP3A 4TROA 3WIEA 4TTIA 4EK9A 4L2IA 4EYQA 1II8A 3CZ4A 1QUFA 3E3OA 4TLAA 2G9RA 1X38A 3BICA 3PC3A 3R74A 1G7SA 4N8EA 1MABB 3GD7A 1NTRA 1KWGA 3MS2A 4EB8A 2OFWA 1KEEA 5FADA 4HS9A 4BFLA 4FT4A 1ZNZA 3HCDA 1ORWA 8MHTA 4RDHA 1CZKA 2IA5A 4CU2A 3K6SB 1PNVA 5LXTA 1ZM9A 3DB2A 3LHFA 2H9YA 1LV7A 4BVBA 1Z4KA 1C9JA 4CMIA 3V46A 1WUIS 2Y2UA 3CNNA 1L5FA 1LNZA 1ZD5A 2XUKA 5JSHA 3H3JA 4PLTA 2Z43A 4X6XA 1EX7A 3ASYA 1H6AA 3KZVA 4KQFA 3JD3A 1NXPA 3ECSA 4XGNA 2WJJA 5HDQA 5IN5A 4Q37A 3M83A 4RXUA 1BEEA 3TE7A 5BSEA 4TLDA 3ESRA 5K7SA 2FLVA 1EGHA 3NBZC 2D0OB 1O87A 3RVLA 1AKMA 2Q5FA 3X1MA 1C4XA 4RDCA 4DSTA 1XJQA 4URYR 3KZCA 3SS8A 4Q05A 3B38A 3C5VA 1UZLA 2RHDA 3M8KA 4JLKA 1UM9A 4FOLA 3E1SA 5C8YF 2YFKA 1LF0A 3OUZA 2IHYA 3OZ7A 1FTGA 2R00C 3HDGA 2GBLA 3OIFA 4S1NA 1ESZA 4KKXB 3F73A 1LPPA 4ID3A 1GQ2A 1BVYF 2GZ3A 3SP1A 5AP9A 4XGKA 5FBZA 4RPCA 2C82A 3AJ8A 2I4OA 2YW9A 3H1GA 3NXKA 4MXDA 1UEXC 4W7IA 4YJ2F 4LXHA 4I55A 3UWDA 1VYVA 3OHPA 4MS3A 4ZGBA 3ZD7A 1TUIA 1K68A 2PUFA 1WKVA 3MJEA 3FGPA 4BO6A 4EYSA 2O2SA 2XKAA 2PFSA 5KVSA 1KDYA 1YDFA 3ZQ4A 1APBA 1UT5A 1EM6A 1H22A 2FSHA 5TR9A 4S12A 1U3DA 2CLCX 1PZHA 1NC3A 3LC0A 3I3OA 4HGYA 3WGHA 5IM4A 2BLNA 3KQKA 3HJTA 4CMHA 4CU5A 1J7JA 1U11A 2FE4A 5I7VA 3K92A 2H2HA 3ONDA 1N5OX 2VKTA 4WLNA 1YNSA 5DN9A 2VAPA 3KTOA 4A27A 4TSKA 5FNZA 1Z22A 4HDAA 4OMUA 4QBHA 2J1LA 3Q1LA 3OQIA 5CNJA 5D6OA 5GPBA 1KJQA 2PUVA 4MYUA 1QVRA 4MW2A 1QP4A 1MOZA 3I0NA 5M04A 3CH6A 4HUQB 2GBCA 3L02A 4H7KA 4IOMA 4NABA 5DBFA 5JXHA 3DZIA 3R3XA 4XDGA 1B2LA 2CKMA 1U8UA 5CJJA 3WGJA 4RS3A 1RYEA 4W5WA 1C7JA 2DUMA 1R00A 1O5OA 4MKFA 4KXUA 3EWSA 5HX7A 5JXWA 3ZDQA 2Q9UA 2B3DA 2GPYA 2D2EA 4Q01A 3WLRA 2BBWA 3NDIA 4ZO4A 1HETA 1TZJA 3RAFC 2WJWA 2HK8A 1QQTA 1VJDA 2NZJA 4AK9A 4NV0A 3S2EA 2JCYA 3JRNA 2H4JA 5K20A 1PGQA 2WIFA 1RKQA 1U7OA 4M0PA 4OK6A 4W1QA 1JLHA 3RWOA 1K08A 1EDOA 1MMFB 4L3WA 3R23A 1Q0SA 1G20A 1QV6A 5A4DA 1YB4A 4CLRA 4RSHA 2IY8A 3EEFA 1TQDA 4WADA 2FWBA 1E60A 1JAIA 1YR7A 5E7QA 1O96A 2QM0A 1L1RA 1O6ZA 3FWNA 3H9GA 4MW9A 4RLHA 3IXLA 5AR1A 5CLQA 4DA0A 4D92A 4RY8A 1MRZA 1WUHS 1ZPDA 4BIIA 3JQFC 2YASA 5CK5A 3TVDA 3QF4A 1H94A 4RSMA 2AB0A 1XDBA 4DLKA 4MV9A 4NE9A 1SUSA 1KFEB 3H11A 1Y0BA 1DEOA 5AVKA 1P1HA 4G2NA 3PYXA 3IDQA 2OHVA 1OI7A 4QOHA 2VBIA 2ZRNA 4RFLA 4E5KA 2NSYA 3KHUA 4RESA 1JLKA 2AR9A 3BWMA 1I2ZA 2JPDA 3L8DA 3OOWA 4US0R 3VA7A 1ZWKA 2V6JA 4LXTA 1XPOA 3ADDA 1TMKA 1ZJJA 1LH0A 3W5SA 4BIMA 4EFNA 3OLYA 5TGZA 2RE8A 3AUUA 4IIFA 2ZJ7A 4XVUA 4NMWA 4IYJA 5CG1A 4XFKA 1N7IA 1FNDA 2CNNA 4LF6B 2FXIA 2ZETA 2BC9A 1VRWA 1NVWQ 5HCNA 1X1TA 5JZMA 2BEVA 4HNAB 3RUEA 2HU2A 5BRNA 2BBSA 4X8MA 3SXPA 2CLIB 5C2JB 1XXHA 4BCDA 1Q91A 3DS8A 4RF5A 1VFNA 1Z2NX 4I4TA 3SZGA 1Z08A 1L5QA 4JYCA 4BGIA 2HAEA 5ALPA 4G8JA 3R3ZA 4MR7B 4BRUA 1XCGB 2XNHA 2WTUA 3VR2A 4KLRA 2FEAA 5KQPA 4OKSA 2FP4B 4XPIA 5CGQB 2A33A 2GCPA 4DQKA 2QBYA 2PRKA 4KQCA 1GLGA 1QO9A 1XL1A 4YY3B 3KP1A 3A7DA 3L8CA 4QU9A 3I0MA 2O1EA 4Q9DA 4RBNA 1WUTA 2H7VA 2R44A 2PLNA 3EW9A 4RJ2A 5F5NA 3QVKA 5FL3A 5ITVA 3M82A 2PCJA 5ALDA 3RSOA 4KQHA 2NU6B 1J06A 4MKRA 3SE7A 4CKWB 3ZLBA 1SURA 4LFAB 2Q2QA 2NVBA 1EX6A 3D7NA 2ZPUA 3JWHA 3KOMA 3AR2A 3MIIA 3DAHA 4E7OA 2R1TA 4AYWA 2L2QA 2ASEA 2OCPA 4JLMA 4UBJA 1SOUA 4IF6A 1COWA 2IOFK 5BWOA 3SQDA 5I7OA 1WKBA 1MXHA 3KQVA 3ONWA 3K0SA 4MDHA 1OZAA 3GVCA 3HCBA 4BP3A 3ENKA 5I8PA 5FTMA 1N6HA 2PFKA 1RACA 3C24A 3LI2A 4LQ4A 3C3AA 1YH3A 1L5GB 3U3KA 1M1UA 3D0OA 2CFOA 1C5KA 1YB1A 3MTAA 3QHQA 1F0KA 2KI5A 3CTMA 2ZRAA 1K66A 3O8QB 1RRFA 2QENA 4XX0A 2QVZX 4JI3B 1ZJ4A 1EGQA 2HHAA 3BZBA 3WQHA 1QHNA 1Q2UA 1I33A 4A8JC 1R6UA 4LJAA 2H1SA 3VAAA 2YJZA 3KM0A 1CUGA 3EAGA 4OJMX 1ISGA 1GPBA 4ZZ3A 2NZWA 2YUTA 5JSZB 1E89A 3PENA 4IGAA 5T4FA 5TPZA 2X9NA 3UGQA 1UJ2A 4XQCA 3W5JA 1IZ9A 2JJ8A 5JHHB 1M73E 1ESNA 2TSYB 1DUIA 1W2GA 1R10A 3RFXA 3U9LA 3RR2A 1ESEA 3SG0A 5HBGA 2BKAA 3TJZA 3IPXA 1IOWA 1YCDA 4D9BA 2VJLA 3LTNC 3ZDCA 1A9OA 3IAEA 4EPXA 1N8NA 4QRHA 2OK7A 2QUZA 4EKNB 2GNOA 1ILEA 5CTJA 1X7GA 4GYJA 3LK7A 3RYHA 1SXPA 1V8FA 1G3UA 3N39C 1H42A 2DKFA 3I9V1 3L0YA 1IJBA 1U6KA 4CRWB 1WV1A 1HYGA 3B6EA 3FR7A 4KXQA 4QYIA 2Q1TA 4JVOA 4TQAA 2CCGA 4BNDA 2PKYX 4HWGA 1PJAA 1TW3A 3G2IA 3PFHA 4LE2A 1O95D 1QYDA 1TQHA 1XELA 1L4KA 4DBZA 3U4GA 5KNCD 3WNQA 1RJ9B 5C8VA 1Z4LA 3L1VA 2G04A 4II2A 1KOJA 2QUKA 3ZGLA 4MS4A 1N9GA 3MWFA 1LF5A 1ULBA 5TPWA 1L5VA 1I24A 2UUOA 2VDRB 3GRKA 2ICAA 3LZCA 4B40A 5J4KA 4RVCA 3BIXA 4EA8A 2V3CC 2XNKA 1KEUA 2A9RA 3C5EA 4AJPA 3T7IA 1MZPA 4MQFB 3KOYA 3B89A 1Z6QA 3TLMA 2XB6A 3W3ZB 4MGZR 2RCNA 1RZRA 4PFSA 2X1MA 3M6WA 3WYNA 1P5FA 1U9IC 5FFMA 3A37A 1JIUA 2A5GA 4K6KA 4A0RA 5I5EA 5LDDC 4X3PA 2Z6UA 3ZJTA 3TVTA 3P0IA 4EITA 2X4IA 4F84A 2C78A 3HCNA 2QJOA 3MC1A 2ZKIA 1WTCA 4MV4A 5H4HA 3ONNA 5E3HA 1VBFA 3OF5A 4X9XA 2D6FA 4DGSA 3Q7TA 3VR3A 4MV6A 2PSHA 3V3KA 2PS0A 3SKVA 2G63A 2DFTA 3MIZA 4LVCA 4B3SB 3OZUA 1MGPA 2H48A 3RVMA 1FSPA 2FUEA 3O8BA 2CV2A 1ZRNA 1ZUIA 4JASB 3P9CA 4EAQA 2Q62A 4BMSA 5A5GA 2HRZA 3EVBA 4J9VA 4PLCA 3G82C 1W5EA 2RGUA 3IKLA 2G77B 1AZTA 3I42A 4M1WA 3GAFA 3KYJB 1H2BA 3OHSX 3PDCA 4GPEA 4S1OA 5HJEA 1OAKA 5T4EA 1GZUA 2C7BA 1Z26A 2H2DA 3CN7A 2AWNA 5BMVB 1DKOA 3WIVA 1JG3A 4G5QA 2FPGA 3IHWA 2OZVA 4ABYA 4NPCA 1QONA 3RREA 3QVGB 2ZAIA 1OXBB 4V1CI 1PEKE 1P81A 2B4RO 4YASA 4PX2A 3GNTA 2KWIA 1ZX1A 2VJPA 2DZDA 2JHFA 4QECA 4NZ9A 2XXJA 1PEDA 3QVJA 4TLBA 5JOQA 3VNVA 2A94A 3HKCA 2VQEB 1C4KA 4ENTA 3ZTYA 2A5JA 1SUBA 3TL2A 4ER0A 221PA 4E2WA 2FX3A 1IUOA 2A58A 4BXOA 1WCV1 2CWWA 2IT1A 2XR1A 3LUCA 2IXDA 2QY9A 2AE1A 2UUPA 3CPHA 2OXRA 2DSNA 3CLRD 4JYBA 1UBFA 1Z15A 4OJQA 2ZSEA 1Y9AA 4QKQA 1F14A 4P7JA 4DTIA 2D4AA 2C84A 5CLFA 3HJBA 4H17A 4J29A 2YZ7A 1A5AB 2VRCD 1Q7GA 2WD8A 1HE4A 1DC8A 2IS4A 1LTQA 1P2GA 1ZRMA 1COZA 2NM0A 2GD6A 3H83A 5ELLA 5CDTA 4E13A 2DWOA 3PC4A 4YJDA 3D0RA 2GD2A 2PJUA 5LDGA 4N0DA 1IUPA 2GEUA 2VT3A 1MPXA 3EYAA 3R9XA 1EM8A 3LA6A 3KQOA 3N2NA 1U3WA 1DWUA 1TGVA 4Q3NA 5AO9A 1Y1KE 4WBSA 5K8IA 4WN3A 5LQAA 3T4UA 4Y1GA 3ZCUA 4AWAA 3FRJA 1E7RA 2PLFA 3T5CA 5BVHA 1CS0B 2CNDA 3B8HA 2VNKA 2H7YA 1EFKA 2IZOA 3NHMA 1Z28A 4OVKA 3BHMA 4BMXA 1KHTA 3UAVA 3BREA 3EQ8A 2YS6A 2FZEA 3QBTA 2P79A 3AEUA 4G9BA 1WHTB 1W59A 4MUYA 5EE1A 1BHO1 1PK7A 3RS9A 3MJDA 1E32A 1AKVA 1II9A 1U4NA 3TH5A 1RCFA 3WKCA 4MW5A 3AP2A 5LU9A 1QGUB 2C7OA 3GGOA 4ZT7A 1V4NA 3P9RA 1J70A 4DCMA 2IYZA 5AQEA 3N1UA 1UDRA 1L5MA 2QR5A 3GVXA 3SSAA 3PSAA 4FEGA 2DUJA 2H3HA 5I3ZA 4XEUA 4MI3A 4C43A 1E1QD 3UFBA 1Z17A 3PQ6A 5JVDF 1EZ4A 1RYDA 4HNQA 2CD7A 1WXQA 4BJHB 4KN8A 1ZQ9A 3CCCA 1H6CA 1KRXA 4G1UC 4XJSA 3DWGA 3U0BA 1HV8A 3QEMA 5FEUA 2B8JA 2YVKA 2F3RA 5CB6A 3G89A 2C20A 1J7KA 4KYUA 4BLWA 2Y4NA 1HC7A 3KAJA 4CQJA 2P6RA 2Q0HA 5G1OA 4U2CA 3WGTA 2BI4A 3GP8A 2XYRA 2FYTA 4LMBA 3U3MA 4BWYA 4EY3A 4FJ2A 3W1WA 1CF4A 2PUGA 2EHJA 3CKKA 1BVRA 1EWTA 2AX4A 2NYVA 2QTTA 1PKXA 3FSGA 2GZRA 4J0JA 5GOTA 3IIEA 3S2FA 4DG8A 4DLNA 1A88A 2AZTA 3ILSA 2FRDA 5BW4A 1UH5A 3COYA 1WZIA 3CE6A 3HHPA 3P9IA 4GP7A 3VDRA 1X1AA 1MQ8B 3EWIA 1D1QA 3DC2A 4JY7A 4MYSA 4J2HA 2XI4A 4M9ZA 1F48A 3UGKA 4DA8A 1LTHR 1Q22A 1XVLA 2G0AA 2HLHA 3GUUA 1Q1NA 3E18A 2BGJA 1DQSA 1M1YB 1PR3A 4BWGA 5ICGA 3ZDAA 1T3GA 1MF7A 1FLNA 3AH8A 5JQGB 2WZBA 5CT4A 2PUAA 3VMFA 2DKOA 2X6QA 1GPWB 4RKWA 3LPCA 4P0PB 2Y05A 4R3NA 1CRQA 5I9SA 3RADC 5C3UA 5DRTA 3P45A 1WO8A 1YU9A 2FWMX 1N2OA 1EBBA 4UAVA 3GJ8A 2QV0A 2QLNA 4FKBA 3VVLA 3TR6A 2BHTA 4JUDX 3EASA 3ETCA 4WN9B 4AWBA 5CAEA 1GNSA 1OXUA 1BXKA 1OBCA 2DEUA 1KPGA 3G17A 1ADJA 2Q7XA 3OFVA 5L7TA 2HPVA 1PV1A 4PPFA 1L5NA 4ETNA 4DVGA 1XPJA 3KYBA 4I46A 1CU1A 1I0ZA 3QOWA 3K2EA 2GVDC 4MUFA 1G16A 1KR5A 2WWIA 1LBTA 2QKYA 3WICA 4X63A 4C4ZA 3BWEA 3BWXA 3K1JA 3X1KA 4TWAA 1YRAA 4NNPA 1YJQA 1SQ5A 3II6X 1PJBA 5JPIA 5B4UA 1Z0KA 1FU7A 1ZONA 4HZUB 4TZTA 4XFJA 3AVQA 1UMDA 4NFHA 5CFLA 3KG2A 1LC0A 5G4KA 4EHAA 3KKEA 1GKYA 4Z0PA 1BD4A 4NV1A 1FP6A 4PIMA 4BE9A 1SUIA 1JEJA 4COOA 4EA6A 1OT5A 1UKCA 2G6BA 3E9ZA 5KCZA 1AN9A 1J07A 4G3XA 3K20A 4AJ1A 1KP9A 3K8QA 2EJCA 2LPMA 3PC2A 4R7TA 1ZK0A 4FMCF 3F7OA 4GH5A 3QKSA 4OUKX 4DYHA 3DFIA 3PTZA 2X0FA 3WY9A 4A73A 5A62A 3C98A 2BZ1A 2R0QC 4KLZA 5JRDS 2YKGA 4LF4B 3RYFB 5JXGA 3LECA 2JAOA 5CDYA 5H0IA 1ISMA 3LPDA 4QQKA 4ZV4A 3GXBA 3FTDA 5CDHA 1XEWX 3C85A 3I2KA 3HZZA 3CUEF 3LW8A 4I1OA 3JQBA 3SHWA 1B6GA 3ASUA 3NBKA 1KZ7B 1EG7A 4YHBA 1OPRA 2BFDA 3O4GA 4L6CA 4O8ZA 4QM7A 4NECA 2O48X 4BTEA 1GILA 1R12A 3RSCA 2EHDA 4NE7A 2Q2WA 3UWPA 3CWZA 4K05A 1GGNA 1GARA 1QQ7A 5F2KA 4R1UA 1AG9A 1FVFA 5FO0A 3RVNA 2QVGA 3RVJA 5C18A 4IJQA 4UCXA 3Q6NA 3HVRA 4FZ3A 3IVGA 2D5AA 2KMLA 2Z2XA 3OIDA 2VYVA 1NPDA 4NAVA 4OMCA 4QDZA 1EX1A 4IIJB 4ARVA 1UK9A 2PKRA 2OHJA 2HJWA 2O57A 4DLZA 1VLJA 1G1AA 1F2TB 1YD7A 3PRKE 2Q4RA 5P21A 2YWDA 1T5TA 3L1KA 1UOQA 2VHYA 1D8TA 1Z0UA 2RAVA 4Q3EA 1X74A 3NHPA 2BI7A 3OIYA 4RMNA 1NVGA 1Y89A 3AV0B 2REOA 1A8HA 2ZI4A 3K5WA 4NU0A 1X8JA 2W11A 2ZJ2A 3BMQA 4D46A 1QZZA 3NW9A 4WFIA 4GEGA 2EZ8A 2IZ7A 1FDTA 2V3VA 3DPSA 4LCJA 1H3FA 3RS2A 1O8BA 3WOVA 2LV8A 4CTOA 1JFLA 2I1VB 4HLUA 4HGOA 4PGFA 1CC1S 4GMGA 4DIEA 1TUEA 1KKUA 4X45A 2P2GA 3U1TA 1KZ1A 4J90A 1SUWA 4OI0A 2NO9A 2YN2A 3KSUA 4YMGA 2VFAA 4ENWA 2H16A 1ADGA 1MBZA 3DLAA 4D9NA 1GWNA 1FUEA 3WL3A 3FCCA 5JO0A 1XP8A 1Y1QA 4WBNF 3DVAB 3A70A 1D4AA 3VH3A 3D2BA 1S7CA 1PX2A 1E3WA 3A31A 3EBPA 2CHQA 4ECAA 4OQFA 1LLCA 4AO8A 5ALEA 3TSWA 1TQ6A 1RZVA 3JARB 5AVWA 3QKTA 3MINB 3VZRA 1NYTA 1H3EA 2VXCA 2BKLA 3GH1A 1KE2A 2Z6AA 2XYPA 4NESA 5BYJA 2E4YA 3PDUA 4PVCA 3ND7A 4ASUA 1QLWA 5J2UA 2BGWA 2ALJA 4MRAA 4OBEA 2HV8A 1G5HA 1KAOA 2FOXA 4NEHB 5TEWA 4QJ5A 4YCLA 1FTNA 1OLOA 2VYCA 3IMCA 3X43A 4XWWA 4D02A 2W6CX 1G6Q1 3VPSA 2IP2A 2MU1A 5D3KA 2QY6A 1AUOA 2YY6A 1NVVQ 4IV8A 2NUTB 4ZTZB 3C70A 3DKKA 4IPTA 2ZUEA 3AF5A 4IO0A 3WYGA 1PTJC 3EIFA 3HEBA 4WZBA 1OPXA 5HF6A 3PX2A 3WB1A 1G66A 3F6PA 1P18A 2N9UA 4DDHA 3N2LA 3G9QA 3RRYA 2HCFA 1FX0A 3MT7A 3DEIA 4G6ZA 4E5PA 3WLJA 2QL5A 1XTKA 2I67A 3B1YA 5I7AA 2P5SA 3UYLA 1LK7A 3ZHTA 2IUSA 4C4XA 2DXIA 2FZ4A 2JGDA 1ENPA 3AQ4A 1T1IA 5E6UA 5L4NA 4FSDA 2F59A 4KPEC 2FPUA 2P9YA 5JCJA 3SEAA 2AQKA 2R6ZA 4LTDA 4DWWA 4EQ6B 3FYDA 5TPZD 4M7WA 3JQGB 1IXYA 2QRVA 3ABIA 3PC8A 4B34A 5U9CA 3GF4A 3M2TA 4IDCA 3JQAA 4H6WA 1ZC3A 4O0MA 1M72A 4LOAA 4ATNA 2QTGA 3JQ9C 2GD1O 1NBMA 3LXXA 3BD8A 4FJ1A 4HGZA 5FEMA 2HQSA 3CW9A 4GOLD 1RU3A 3I73A 5JBNA 3S2UA 5MN4A 2AQIA 3EGOA 5TS2A 4ZI7B 4QRIA 1RCTE 3I9JA 1YSCA 1UMBB 3ROMA 2OECA 2HQOA 3T12A 3G2PA 3P9QA 2IDZA 4NAHA 2C1ZA 4RMHA 2XMCA 4LI0A 3M4NA 4WKNA 2YWXA 1SU4A 1F6BA 3N2YA 4NPAA 3MK31 4RHFA 5BRAA 1WJGA 5K01A 2A9VA 2QX9A 3MOGA 4ND3A 2B1IA 3PC6A 5DNAA 3PHGA 4QTXA 1G2QA 1B6RA 4UTZA 2Y1OA 4ANFA 3TTXA 1EIZA 1B8VA 3ELUA 5JD3A 2QLMA 4ER5A 1IBCA 3QEOA 3UAYA 2A9PA 3PFGA 5L7WA 4FWTA 5K3FB 5HGXA 1K7XB 1VPDA 4LRWA 5KYXA 1UXGA 3CB4A 3ETNA 4G2TA 4H7FA 2VDNB 2EJBA 3FPAA 3GI1A 4MUAA 4REOA 5F3WB 2PSEA 3E3LA 4BX8A 2IYQA 3WBKA 1HYHA 1CZLA 4UDXX 4WHMA 3VX4A 2AZ4A 4YYEA 1HNXB 1CVRA 3OEYA 4J6FA 4QUHA 1OWPA 2B7LA 1GPLA 3TM5A 1QCCA 3B7GA 1N2HA 1QG2A 3FZQA 4ZRNA 4KJZA 1GD1O 3I4CA 4P92A 3VAYA 3A4NA 2XYHA 4Q5IA 5C34B 1I4LD 1BH2A 1CRPA 2ZSDA 1JLSA 2C57A 2GJKA 2HADA 8LDHA 2PX3A 2OZPA 1P39A 4LJ4A 4AN1A 1HZZC 1NL3A 4H4CA 1U63A 2HWUA 2GAOA 2WWTA 1GKUB 2W90A 3NKFA 1PGOA 1N0WA 3PDIA 1AQIA 4OA5A 5BSMA 1QJCA 3RLFA 2LGJA 3VJLA 2BKVA 4I0WB 3W4JA 2RDMA 1D2CA 1J8MF 1NRIA 2JAUA 4O4LA 5AJYA 3LKBA 1P75A 5AVZA 2JLBA 1E1CA 2CV1A 2EDAA 2O8BA 4AYXA 1VL1A 4XB6B 2OB2A 3PK0A 3U3JA 1OLSA 2JFBA 1YQWA 3EC1A 5LQUA 2OFXA 1MP0A 2JARA 4TL9A 2NP6A 3AHCA 2D5LA 2VPZA 4RJJA 5KKNB 1UDXA 3KU1A 3GLKA 4PLGA 4C4OA 2ZYSA 2JVJA 2FOLA 3QNMA 4XGQA 1FNBA 2VHTA 4JQOA 1P3Y1 1X1CA 2QMHA 1E5VA 4M76B 5KTSA 3NM5A 2IW1A 3TDMA 2C2OA 1IZYA 3MFYA 4EUFA 3LPAA 4QG3A 4ADSG 4MVJD 1R0BA 3UTCA 3NYRA 4K6HA 4NYJQ 5EE5B 1CUDA 1BSVA 3R7WB 1DADA 4JT9A 1JFSA 3Q3IA 4DLWA 4TMFA 2HA2A 1DTWA 3AW8A 4X0EA 3FTCA 3I2IA 3ZWWA 5K09A 1I7QB 5JNRA 1TM4E 2GTHA 2GETA 3JASB 3T3PB 3U5ZB 4ZVMA 1E2JA 3X3HA 1P19A 3QVLA 5A6SA 4M53A 5NULA 4G8DA 1K0UA 1Z2CA 3I83A 1GG9A 1YO6A 3QQ5A 2DECA 2XMGA 2ZQ5A 4JBHA 5ADVA 1H0HA 3LAWA 4MB0A 4RFSA 4Y6LA 2X13A 1M2KA 2B4AA 2B2CA 4IUBS 1LVHA 3GUZA 1OAAA 3LH5A 3AQIA 2D2XA 2CXQA 2F8SA 1OXVA 1E69A 3OPYB 3X1XA 5CFZA 5IDQA 3FNFA 4ZCTA 2O52A 4YT5A 1NM5C 3V3TA 4PTZA 4MVYA 1FFWA 3LNCA 4TKUA 3W6ZA 1ND6A 1OBOA 4UU0A 2CDAA 4IVQA 4WJZA 5K1ZA 2K87A 1PJ2A 3C3DA 5DTIA 3AY7A 5AM5A 4EVRA 1VHLA 3MJSA 4EHDA 4CL8A 3CHYA 3K1ZA 4CCSA 2OHGA 4KXLA 1Y6JA 3ISTA 2DWPA 3M5DA 4RHTA 5FTKA 2UYOA 1TK3A 3U17A 1E0JA 1XJ5A 4XJVA 1IMOA 1Z2DA 3KKQA 4IIGA 3A3KA 4M98A 5HM8A 3UFXA 3K2IA 4C3ZA 2HWXA 1RRCA 2W2MA 2GA8A 5G2OA 3Q3VA 2PUCA 1I01A 1HQCA 3RVSA 3VH1A 2EG5A 1F0YA 1HTBA 2O2CA 2I6TA 3CLSD 3IO5A 1QTIA 4GP9A 4DMGA 2CB0A 1HA3A 3LIPA 3ZVKA 1M1ZA 1WMBA 2FTKE 5ALIA 4ZTUB 2IZ5A 5C4MA 1DFGA 1IQ0A 3KJXA 1ZIDA 2Q2NA 4PPYA 2XTMA 3H5WA 2ILVA 4LZZA 1PNOA 3MHTA 1KI9A 5E7MA 4QARA 4I3HA 5FYDA 3VPHA 3IPYA 1TJNA 3KBOA 5THKA 4QL3A 3MMXA 1OOEA 3B1FA 4I6JA 2DBQA 3ZNQA 5KEIA 5A05A 2QVBA 3T34A 3GT0A 1JJ7A 1UC5B 1XTJA 2HK7A 4Z51A 1C7RA 3B5JA 1S7GA 5J5VA 3TLGA 4Q3BA 4ZCSA 3V1MA 4EEKA 2JLZA 1CY0A 1ZS9A 2YN0A 1QRDA 2H2AA 4WESB 5E1MA 4UHJA 3ETGA 4CV2A 2W8BB 2CNOA 2AFRA 2YWBA 3K0BA 3PA8A 3ZHSA 1XTPA 3NHLA 3CLVA 1PJCA 5CB0A 1DJNA 3CRZA 1ZLXA 4TMZA 5G0VA 2D0DA 2GMWA 4IWNA 1XG5A 1AGRA 1CTQA 1JV2B 2HV9A 1CUFA 3L92A 4UREA 2QP3A 3GZNB 2OSBA 3EXHC 2B5WA 3LY8A 4JL6A 3D4OA 4DRYA 1V8PA 4YAKA 4TT3D 5DCYA 1ZM7A 3JALA 3EQZA 2PANA 1DQNA 1F4VA 1OLXB 2MSCB 1FUYB 2JNWA 3DKVA 4Y30A 3VPBA 3OG9A 4CM9D 1EUDB 3BDIA 4DMUB 4DBLE 4OD0A 4MWZA 5HPYB 2IX3A 1CR0A 4PRLA 5BYBA 4DCSA 2O8EB 3B6JA 4V0OA 3MGBA 3WYDA 1EWVA 1F06A 3FWYA 1VMIA 4PV7A 4AUEA 5H3CA 2FA9A 1VHQA 1UADA 9LDTA 3DMTC 2F8TA 1LWOA 1UANA 3SYKA 4AY2A 3MOIA 1PV2A 5EC8A 1PE0A 3OX3A 3RRZA 3S99A 3SJUA 3QUCA 3SC4A 4UUBA 1G3MA 2ZRMA 5DGDA 4MRMA 1ZH8A 4YJHB 4YP7A 2C9YA 2C59A 3Q9SA 4WEQA 3KE8A 1KOFA 1UKZA 1Y6RA 1W93A 1XZJA 3G88A 5BVGA 1HQKA 2NVUA 3C3WA 2F1RA 1E2FA 4OQDA 4RZUA 2RHGB 3RCBA 4GKBA 1W85A 2CXNA 1XNJA 3OI7A 2AC2A 3OE5A 4HSEA 4Q1AA 4EM6A 4ZDKA 4ZOQI 5HKKA 4HNTA 2LIVA 2HHLA 2P75A 5FL7D 3W5IA 2JBAB 1PFQA 5DLQC 4DJEC 1HLGA 2HXGA 3QLUA 5K3DA 5LBTA 4Z3DA 2OR3A 2WM8A 4DUPA 1Y37A 2GFIA 3QVUA 4YAIA 3DMHA 3GNSA 1P60A 4YRFA 1HX7A 3IV7A 1IYZA 1UT6A 2F62A 2ZBEA 2FWJA 1HOTA 2JIRA 4BQSA 5JCPA 2Q6IA 1KHHA 4LSGA 1THZA 1HY3A 4PSCA 3BX1A 4U39A 5M7EA 4LJ5A 4U3JB 3D5QA 3AYXB 1YFZA 3HXLA 1T0UA 2R7AA 4QZVA 1Z4JA 1P4RA 2QP4A 4HD8A 1UP4A 4MWGA 3U44B 4ND1A 1ES9A 3DJYA 1JL3A 2WT4A 3FLMA 1AGPA 3G9TA 4NYMR 3MAGA 4YP0A 1GU1A 3ZI4A 3GK3A 4TGLA 3EG9A 3KOUA 3UUGA 4F45A 3V6LA 4ZIRB 1WV0A 3BGOS 3R4CA 4JWKA 2CVZA 3IMKA 2HNAA 4IKOA 1HR0B 5LQCA 1TFRA 2BY4A 2R8BA 3JSAA 1RWKA 4QPDA 4V3CA 1K0FA 4K3UA 5BORA 2VF2A 2O8DA 3VYTB 1XN4A 2WEKA 1AX9A 3I58A 3R0JA 3BZUA 2Z83A 2JL1A 4FINA 4MYTA 1ZIOA 3F1KA 4YAFA 2PVPA 4EIWA 1AGYA 1N7GA 1Q1BA 1EWKA 1ZBDA 3G0OA 3VNQA 1SXQA 1DAMA 1JYSA 4B3FX 3C6QA 1XMXA 2Q45A 1IDN1 2H6EA 1XRPA 1P9WA 3KFVA 3FFXA 3KQUA 4DEYA 4EY7A 3GRUA 3ICVA 3B2NA 3GJ0A 4TUYB 4JL5A 4KGVA 4R2IA 3IUBA 3VDXA 5JSZA 4K86A 4RXMA 3JRXA 3HPRA 4WOJA 2VF5X 2XJ9A 1R4NA 3GA7A 1NRWA 4P35A 2NV0A 4IGKA 3TVYA 1WF3A 2ZAYA 4BUCA 5EYPA 1QHXA 1K3FA 3F4KA 2FPLA 3OTIA 3W3AH 1HE2A 1Y8RA 2WZQA 2FFHA 2X0JA 3GRVA 2FEKA 5DYIA 1H2YA 4PYJA 2HWYA 3ZVRA 1P0MA 5HIJA 3MXOA 2BM1A 1QR6A 1L8AA 1Q2XA 1SVNA 1XZFA 3NM6B 4MLZA 2APJA 1U0GA 3DZ8A 3WZ2A 1FF9A 3MT0A 4WKPA 5BT9A 1UUFA 3C4QA 1Q1QA 2FPOA 3IDZA 4DXDA 3PYMA 4F5ZA 4YRMA 2SICE 2WVGA 2XA2A 4V3BA 2O2JA 1KDVA 4L9AA 5AOAA 4A1FA 4E7PA 3U7HB 3IDFA 4XQGA 3UMSA 5BSVA 3DTVB 1CT9A 1XV5A 5JJCA 3M34A 5I4KA 1I6WA 1NXXA 1Z0SA 3GCDA 2FR8C 3IUEA 4E15A 4RPJA 1QE0A 5AW6A 3FPJA 1NG9A 4G0QA 4A2QA 1N9ZA 1J42A 2VR1A 4F71A 2WSMA 1MEEA 2IYFA 3N0WA 3PV0A 3IODA 3MCVA <