1Z88A

Crystal structure of lys154arg mutant of mature apha of s. typhimurium
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
208
structure length
208
Chain Sequence
TLNPGTNVAKLAEQAPVHWVSVAQIENSLTGRPPMAVGFDIDDTVLFSSPGFWRGKKTYSPDSDDYLKNPAFWEKMNNGWDEFSIPKEAARQLIDMHVRRGDSIYFVTGRSQTKTETVSKTLADNFHIPAANMNPVIFAGDKPEQNTRVQWLQEKNMRIFYGDSDNDITAARDCGIRGIRILRAANSTYKPLPQAGAFGEEVIVNSEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mutational analyses reveal the functional role of active-site Lys-154 and Asp-173 of Salmonella typhimurium AphA protein.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Hydrolase
molecule keywords AphA protein
total genus 72
structure length 208
sequence length 208
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2005-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1z88A00
4EZEA 1YV9A 1RKVA 4HGRA 1Z4NA 3SHQA 4UMFA 4I9GA 5AI6A 4XQ0A 3NASA 3IRUA 4UATA 3I28A 3OCYA 3AR6A 1RPZA 1RQNA 5AM2A 1U7PA 3W5BA 2AH5A 1S8OA 4BEVA 2O9JA 1RLMA 1YNSA 1YS9A 4L6CA 3L8HA 2D2VA 1ZJJA 3OPXA 1T5TA 4J03A 3IB6A 2C8KA 2VKQA 4UU1A 3W5AA 1LVHA 5ALGA 4ZEVA 3QLEA 4I9FA 1VJRA 4YIKA 2HHLA 3OCZA 3R09A 4NAVA 4CF4A 3SKYA 4BKMA 3OTQA 3HLTA 3QU5A 3E81A 3L1UA 4IFTA 5AKEA 2CFRA 3L7YA 3ZVNA 2FUEA 2OYCA 1Z4KA 3QU7A 2B30A 4BYGA 3OCVA 2FI1A 3ONNA 5AIBA 1U7OA 1Z4JA 2ZOSA 3KZXA 2B0CA 3OCWA 2HCFA 1YJ5A 1O03A 2ODAA 1J97A 3U7HB 4UMEA 4XE5A 4XPZA 3OCUA 1S2OA 2YJ5A 1RRCA 2B1RA 2PKEA 5AVSA 2G0AA 4Y2JA 2HO4A 3L8GA 2WF5A 2FPSA 1Z5GA 1NF2A 4CNQA 2FDRA 1MH9A 3NANA 4H1WA 3U7FB 2MU1A 1XP5A 3AR9A 4UARA 2R8EA 1T9ZA 5ALOA 3TLMA 1ZS9A 2JGAA 1NNLA 4Y2RA 4UMVA 2JAUA 3ZTYA 5ALUA 4BNDB 3R9KA 4Y2SA 3I76A 4HGNA 5AVUA 2FEAA 1QQ7A 4ZEWA 4EEKA 3F9RA 4Y2XA 5AM4A 2EATA 3PGVA 3AR4A 4MUMA 4OFZA 5ALJA 2G09A 1N8NA 1SWVA 4HYTA 4Y2QA 4YCMA 3L0YA 2C88A 2HF2A 3ZVLA 1Z4LA 4CE6A 1T5SA 5ALMA 5IS2A 2GMWA 3CNHA 2YBDA 1X42A 3WK5A 2YJ4A 5AW9A 4Y2PA 1AQ6A 4MWOA 1XVIA 3NRJA 4DW8A 3EF1A 4OD0A 1NRWA 1IWOA 2YMQA 2RBKA 3ZVMA 1Z4IA 2WHEA 4UAUA 1Q91A 2OA0A 5AKIA 4IG4A 2ZBDA 1QYIA 1ZD4A 3B9BA 3ZTWA 5ALRA 5E0OA 5AW7A 3ZX4A 2HDOA 3L8FA 3AR8A 5AW4A 1EK2A 2IOFA 4B6JA 3N07A 3WK8A 5AVXA 2NYVA 1Z4QA 2WF9A 2YN4A 4O8CA 3KDPA 1JUDA 2QYHA 2ZBGA 4Y3UA 3VAYA 3U7EB 1L7MA 4XOUA 1K1EA 4DWOA 2BDUA 2BY4A 2IOFK 2IOHA 1KYTA 5ALDA 4UMDA 3BA6A 1U2TA 4JB3A 2OM6A 1RMTA 3SF0A 3MMZA 4HAIA 5AI9A 5AICA 3AR5A 4Y2UA 5AW8A 1RC8A 3HYCA 3B8EA 3MPOA 4C4SA 1L8OA 2GO7A 2Q4RA 2I34A 3N8GA 4RETA 3IJ5A 3A1EA 2YMLA 5AVYA 1SWWA 4EX6A 3U7GA 3N28A 5AW5A 4BNDA 5ALEA 2BDEA 2AGVA 1FEZA 5ALPA 4E88A 2GFHA 3ZWKA 3UMGA 2OBBA 5A3QA 3W5DA 4NV0A 1Z88A 1VJ5A 2WF6A 2P69A 5AVRA 3J7TA 2I54A 4Y2YA 4ZEXA 2G80A 1YDFA 1L7PA 3SD7A 1O08A 3K1ZA 1XPJA 1Q92A 4AS2A 3KC2A 4EENA 1QQ6A 2AUTA 3QNMA 1EK1A 1CR6A 3OCXA 2ZG6A 2HSZA 5AKHA 2JAOA 4C4TA 3ESRA 1TE2A 2I6XA 1U02A 2WFAA 1J8DA 3EF0A 5A3SA 4OCZA 3MN1A 4EX7A 5AI4A 3QUTA 4FE3A 1RMYA 3PCTA 3QYPA 2ZBEA 3S6JA 3UM9A 4G9BA 5AM3A 2DQSA 5AKJA 2Q4TA 4EELA 2AMYA 1WPGA 3QX7A 5ALIA 2YY6A 4Y2TA 5JJBA 3ED5A 2YMPA 5ALYA 2P11A 2X4DA 4KYTA 3WKCA 5AW6A 1RLTA 3L0CA 4KX5A 4UM5A 3UMBA 5AK5A 3A1DA 5IT4A 4BBJA 4DCCA 4HGQA 4L57A 4KN8A 2I7DA 2Q5EA 3BWVA 3NALA 3RFUA 3SMVA 5ALLA 5AM1A 5ALVA 5ALSA 2PQ0A 5AW0A 1RQLA 2IA5A 1TJ4A 2R8YA 2C8LA 4L6AA 4HGOA 2YJ6A 5AK6A 2G07A 2WF8A 3KBBA 3KD3A 3EPRA 4NWIA 4G63A 4F72A 5AVQA 2JARA 4NFLA 3FGOA 5AKLA 5AVWA 2W4MA 4J2TA 5AKXA 4Y2VA 5ALWA 5T41A 3QU4A 4FYPA 1WZCA 2HI0A 4CF5A 2ZXEA 4C4RA 1VFPA 1TJ3A 4CF3A 3MC1A 4DFDA 5AESA 2I55A 3FM9A 3L8EA 2GHQA 3QUBA 3WK9A 3NIWA 1SU4A 4GXTA 5ALZA 3QUCA 3AR3A 3DNPA 3AR7A 1LTQA 5AW3A 3SLRA 2ZBFA 4F71A 3L0BA 1Z4OA 2EAUA 5AM0A 1L8LA 2NO5A 2FPWA 1YMQA 1CQZA 1PW5A 3QU9A 2C4NA 3ZX5A 4QQFA 2B8EA 3E58A 3QXGA 5ALHA 2P9JA 4UM7A 2W11A 5AKYA 4YCLA 3FVVA 3ZI4A 1RDFA 4YH1A 2FPXA 3SKXA 3GYGA 2PR7A 3U26A 2RAVA 1Y8AA 5ALQA 3WGVA 5AKZA 4YIHA 1RKUA 2RB5A 2GHTA 4FFDA 3ZU6A 3CZ4A 1TA0A 3L1VA 2FPUA 2CFSA 5AKKA 1F5SA 1L7NA 2RARA 4YGYA 1Z4MA 4YCNA 3QGMA 3WK6A 2CFTA 5FP0A 4PNHA 2YJ3A 2YMMA 3M1YA 2HEGA 4NABA 2WF7A 2HOQA 4AS3A 4BX0A 3I1YA 3E8MA 3ZWDA 3U19A 5ALNA 1U2SA 3QUQA 3WKDA 3ET5A 5AW2A 2G1AA 2G08A 4BX2A 1ZD3A 4RESA 3EWIA 5IT0A 3W5CA 2G06A 5AM5A 2JAWA 3ZUPA 3I6BA 4BX3A 3NUQA 4BEWA 3DV9A 3WGUA 3AR2A 4UAVA 2C9MA 4GIBA 3A1CA 3FZQA 4UASA 3UMCA 5ALXA 3PGLA 2P27A 1QH9A 2I33A 4HGPA 1RKQA 2R8ZA 3ZW7A 3E84A 2O2XA 3R4CA 1QQ5A 1RMQA 2R8XA 1ZOLA 4UW9A 5AIAA 5ALTA 2HX1A 1ZRNA 3DAOA 2IYEA 2EARA 3A3YA 4KX3A 4OHFA 1ZRMA 3M9LA 5AI8A 1N9KA 2NO4A 3B9RA 2B8JA 2FPRA 3WKAA 3U13A 1WVIA 3FPSA 3WK4A 5A3RA 1ZD2P 5AK4A 5AVVA 2W43A 2B1QA 2MSNA 5AW1A 5AVZA 4UU0A 5ALFA 1Z5UA 5AKGA 1Z4PX 5AI5A 1TJ5A 1ZD5A 5AVTA 3N5KA 3RF6A 3ESQA 4JDPA 3N1UA 2QLTA 5ALKA 5AI0A 1WR8A 3PDWA 5AHXA 2FUCA 3ET4A 3WK7A 4KNWA 3D6JA 3QU2A 3FPBA 3DDHA 2CN1A 2HF7A 3WKEA 2YFYA 3KOOA 3WKBA 4KNVA 5AK3A 4QJBA 3L5KA 1L6RA 3P96A 3NAMA 1L7OA 2B82A 4AP9A 2WM8A 1RLOA
chains in the Genus database with same CATH superfamily
5IM4A 2QN6A 3EMVA 3OMXA 4KPEC 4MGYR 5C5IA 4HGRA 3C3CA 2ZUVA 2QENA 4JGBA 3R7LA 4E3WA 3AEUB 5B58C 1I4DD 2QNBA 3C6KA 3ISTA 4PO3X 5IJAA 3CCCA 1FL9A 3BN3A 5JPCA 1W7AA 2AOVA 3NEAA 3AZPA 5CH5A 2ZBQA 1S8OA 4O2BF 1HYBA 3ANTA 4XEUA 4N9QA 1XKLA 4KQIA 4DA8A 1G2IA 5KWSA 1QRTA 3OP1A 4JUDX 1GZSA 2R11A 1QKKA 4PPGA 4C03A 4PPFA 2O0KA 1ICEA 3RIXA 5DYWA 3NH6A 1T5LA 4TVKA 2NSLA 1YTLA 3BZUA 2PYDA 4HAZA 4K6HA 1WTCA 2WWVD 3L6RA 4Q3BA 3VHRA 3C43A 1KSGA 1RACA 3D7LA 2VNHA 2ZI6A 2AC4A 5HKOA 1ZG3A 4BKMA 9ATCA 1E94E 2Q1XA 1GNSA 3VISA 2PGJA 2XUFA 3FX2A 2X2PA 3L1UA 5L40A 4IGAA 4GX1A 5F2OA 1SJ9A 1FVOA 1KF0A 2EFCB 3GRCA 4HDNB 4GM0A 5EE9A 1KI7A 4MPRA 1PGJA 2QPTA 3DFUA 1IEVA 4BGUA 3I0NA 4I1UA 3IAM6 1PRYA 5FFFA 4BZQA 3DMFA 1BEUB 1S1CA 2E5FA 2HB6A 2PBLA 2JS7A 3QKWA 4ECAA 7MDHA 4LW8A 2FF5A 5SYNA 3IBGA 3VRHA 4HKTA 1FP4A 4CU2A 5KMGB 1PTKA 4MQBA 5C1PA 3SS9X 1X7WB 3O4RA 1NATA 2NXJA 4YCBA 5DI3A 3RSFA 1S3IA 3TKLA 5CVVA 4D5GA 4B80A 2PSDA 4ZT2A 2B8WA 4DUYB 1J97A 1TZMA 4C5AA 1VRWA 5E0KB 3EGEA 4RQUA 2V7QA 4IHJA 5E9AA 4DWWA 5ITZA 2W37A 1L4UA 2B1RA 4HB0A 3FJ1A 3LW8A 5P8WA 3RT1A 2XVYA 8LDHA 3R7WA 2P35A 4OBWA 2VXBA 3KIPA 4Q47A 4QYSA 5GV8A 3MTGA 4CV2A 3GFPA 2H31A 3T4XA 4GEKA 1RBYA 2XD9A 3B1YA 5B1EA 2IZ0A 2REOA 5DYIA 5IVDA 2P9FA 2J07A 5JVDF 5ALOA 1CHDA 4G25A 4XCVA 5DW0A 1XTKA 1GEEA 1JPJA 1RR6A 4MYDA 1KDRA 1XXHB 2A1TS 5KQMA 3QVXA 1CUDA 4RTMA 3GLQA 1LS6A 1BCRA 2O4CA 5ADUS 2C9YA 1M74A 2J3LA 1TIPA 1T29A 3MW8A 4XM2A 4ML3A 4GWKA 4N65A 4RA9A 1V8ZA 2X77A 1A3CA 2AIRA 1BX1A 1AQYA 1OH5A 2PBRA 2ZRIA 4ZAZA 3T3OA 1GCGA 4DR5B 1NUPA 3F9RA 1K7EB 1AM4D 3REQB 5K8CA 4TYMA 5ECYA 3H0KA 3GLTA 3WV4A 3PE4A 4B32A 1Z7BA 5DGDA 2WYOA 3JAMA 2GBGA 1EYZA 2XBLA 1MORA 3BMQA 3DMPA 3I8XA 1XG5A 4K3UA 3E18A 3FJYA 2CXOA 4RMGA 3ZVLA 2O2CA 3A26A 4NHEA 5CLQA 1AO0A 1JDBC 1SUSA 3LUFA 1JAXA 3MS4A 3CZ9A 2ZM5A 1I2DA 1LLQA 1SZJG 4MUYA 3FFWA 5IK2D 1OGJA 5CCEA 5JZVA 1KJWA 2PUDA 2EKZA 5C7LO 5K09A 2E18A 4ZZ3A 4QZVA 5AJYA 3VH2A 3NRJA 3DEZA 6AT1A 1XVVA 1IWOA 3EGIA 2I29A 3FGNA 3G0GA 1TZ2A 4OJQA 1UXKA 3ZDEA 4GDFA 4EDHA 5K01A 3PXUA 4H3KB 1DWQA 3D8TA 1LLFA 2WJWA 5A5GA 2PGDA 4NNOA 2H4JA 5AKIA 1BWSA 4F86A 3LRTA 3DKPA 3HGMA 1E4OA 3EZ6A 1SBQA 1CUBA 2Q27A 1U8CB 3LRXA 3O2JA 3HS3A 5B2ZA 3T99A 3K6RA 5C7YA 2I67A 3RAGA 3AR8A 1R18A 1Y7PA 2OHFA 3IXLA 3PCXA 4P31A 4JBNA 1QKJA 1WW3A 4CG3A 2DWCA 1R5JA 3TD9A 1KK2A 1YDWA 1YRWA 5SYMA 2OFOA 3RK1A 4JVOA 1SPXA 2RGNC 2C2KA 1ZXXA 4Y6GB 3B1XA 1LW7A 1V0JA 3QVOA 4O8CA 4U1RA 1N2XA 3OT5A 4O2AF 5LDHA 4LHSA 1H8HA 4J4BA 2DKNA 2XWJI 1U2DC 4Z9XA 5IKMA 2OGSA 3QBVA 3RVRA 4CMIA 4EB0A 1NHWA 3K0AA 4GX2A 3TIGA 1MB2A 1LA2A 2Q2OA 1JV2B 1ONNA 4YX9A 5HK9A 2IOHA 3H04A 3JQ7B 1OW3B 3WBFA 1SC3A 3MTIA 2OHIA 4FFBB 3FHOA 1NOJA 1UWVA 2IU4A 4LZLA 2EEZA 4DC9A 4RD4A 4UU8A 1FA9A 3AR5A 4U6SA 4EKDA 1GCOA 1JR4A 3HB4X 2CE2X 3GGCA 4RHCA 4XQEA 3RS8A 1YJQA 3E7DA 1ZU5A 3FFAA 5D1HA 5AOBA 1V7CA 4BMCA 4MGKR 1WKVA 1IQPA 4XX0B 3ZWCA 2IYVA 1TLFA 1Y7IA 1E9SA 5DCLA 3W9YA 4IS2A 2HIHA 4RK0A 2HZBA 3ZE9A 3DBIA 1BW9A 3FWNA 3KT0A 3S2UA 5B4UA 1Z6PA 1XZNA 1A7KA 1KXZA 3FZNA 3MIZA 4LXIA 3U2QA 1AXEA 4LOHA 4H6WA 1L5GB 4FUQA 5FTMA 1UJ2A 3HM2A 5CLGA 3ER9A 4TUYA 1GWNA 4E88A 4OHZA 3CZCA 3W05A 2FFQA 3SHWA 2JC3A 2JFVA 3X1JA 3TRHA 4QVKA 3V3KA 4BS9A 1AKVA 4XDZA 5CXQA 2DGDA 2F8MA 5EHNA 2RGAA 1RZRD 4P0QB 2A78A 1NVMB 3EE6A 1ZHOA 1MIHA 4AJ2A 2HT1A 4NE7A 1KS9A 4UNNA 2X1MA 4CKWB 4DQDA 1V41E 2VTBA 1QWOA 2QLNA 4LTNA 3D5QA 3Q9NA 1E8DA 1YDFA 4N6OA 2QN7A 1OGIA 1QONA 3TIFA 2P78A 2PH7A 4DLTA 4QKQA 1C50A 2JI6A 2V96A 1UPTA 4F4CA 1LJLA 1VL2A 5FAKA 1JQLB 1JHOA 3PS9A 3W7BA 3QG5A 3KS9A 1DGQA 1GZ6A 3D6UA 3EBLA 3R0IA 2WM9B 5AKHA 3UQYS 1O6GA 5KOHB 2HXSA 1E7QA 1UBJS 1ZI6A 2I6XA 3AEUA 3B7GA 4KQGA 4R1PA 3RC1A 4EBBA 2VT6A 1E6WA 1SXHA 1XPOA 2PH5A 4OFBA 3TTUA 4B6PA 1B23P 5LJIA 2CMKA 1PL7A 2NLOA 4NONA 3TR5A 1XQVA 1KSJA 1FMLA 2GLTA 2X6QA 3WBKA 1MEOA 3KEOA 1IUKA 5KYUB 2B1IA 3QQ5A 3KL2A 2WYIA 1XDWA 5KNCD 2YJNA 2P40A 1GSHA 4BNZA 4MJ7A 3L84A 4KJXA 3JTMA 2F1RA 2IXAA 1J2JA 2FPIB 3I52A 1V95A 2KBFA 5LZ8A 3MERA 2X0RA 1NR7A 2ZUEA 3STYA 3S81A 1V7ZA 3NTLA 1D7OA 1Y3IA 3QTLA 4UVGA 1W36D 3SQXA 2QV7A 2DM6A 1E9BA 2P2YA 3ADPA 4Q1DA 4WZBE 5EJ8A 1WV0A 1TCAA 2NU7A 1IC6A 2YQ4A 1X1BA 4MPDA 4UM5A 4KR6A 5CW1A 4YONB 1QG0A 4A2QA 1WOMA 2HSDA 3LP6A 4G1VA 4LTDA 4QDKA 4BFWA 1SG6A 1BE1A 4HQKA 4TKLA 1PUJA 2Z4RA 1J39A 5L53A 1TUBB 3DEFA 1IB6A 2OHHA 1JEEA 3DDSA 2J9YB 3PVCA 3BWVA 1P9OA 4TQ9A 4V3CA 2QX8A 3RBVA 1QE3A 2YVAA 4OLJA 4AMGA 3OPNA 2R1UA 5BN3B 1SXPA 1H8ED 4LJYA 5ABPA 4PZZA 2G1KA 1M7BA 1MOSA 4H3SA 4PIPA 2V4MA 1EXWA 1HEIA 4C0KA 1YBMA 1EESA 3I23A 1SRRA 3CISA 3O1JC 4NSNA 4ZO7A 5HX7A 2O5CA 4MQLA 3TQOA 1Y98A 5IEJA 1ORWA 1A7UA 2G6TA 1T2AA 2EWVA 4F9FA 2KQUA 1D2NA 5HSGA 4B8WA 3B6MA 3QFFA 4OGKA 9MHTA 4AWBA 3E9DA 2JNWA 4EG1A 1YBVA 5LLDA 2JLAA 3ESCA 3NTXA 3TRIA 1VCIA 1AHHA 2VYFA 3RC9A 2O05A 3O82A 4WADA 4LV6A 3O3OB 5E3HA 3MJCA 3E5MA 1PDOA 4XVRA 2AQHA 2PYZA 4OJKA 1F6WA 1Z0ZA 4ZZ2A 1F8GA 1QYRA 3AIKA 3RW9A 3MTAA 2XECA 5JSZB 3TL3A 2Y1WA 3MJVA 4FFMA 1TJ3A 3Q5EA 3TGLA 3IQDB 1OI7A 3PK0A 4TRRA 1QVAA 3MD9A 1BCRB 1MC5A 3BREA 4DRXB 5TF4A 1G16A 2VJDA 2UZ4A 2RI0A 1C0IA 1BXRB 1E2PA 4KB5A 3JAKA 4TWIA 3JQBC 3PUYA 5E9JA 4OM8A 1E0DA 2JLBA 2BFCB 3NDRA 4J2OA 4UHEA 3O3MB 4UULA 4O5AA 1S9HA 5FIUA 5JOQA 3TZCA 1MC1A 5CVUA 3OEYA 4FTWA 1U8YA 2YWEA 2WKQA 5CH3A 4X64B 4AX8A 4LECA 2J08A 4XRGA 5A5FA 4ER7A 3CPEA 4RE5A 4ZCTA 4FN5A 1UEXC 3QKTA 3K8QA 2IHBA 1T2CA 3G79A 5BNZA 1KR2A 2YUTA 4H4CA 1J00A 3GVCA 2QV0A 2F43B 5DHPA 4WBNF 4RZHA 1KFCB 3ZN2A 3BMNB 2JI9A 1JKJB 3RRNA 4M1OA 2OC4A 3V55A 2QIOA 1CUJA 3CUYA 2RAVA 1EAMA 3UBMA 3Q4GA 4O02B 3RGWS 5CLJA 1UAYA 4I19A 1AS3A 1PR6A 4UHJA 1QE0A 4KXMA 4DHWA 2A7XA 1EAYA 1PZNA 2OHOA 1BGWA 3HCPA 5L95A 1R1DA 4OF4A 5JADA 4X90A 1DB3A 2O50A 4GKVA 4HEQA 4Z7OB 4WNAA 3EIUA 3I9LA 5DHTA 4AF6A 4WZAE 3UHPA 1DQPA 1G2QA 2IXTA 3BF7A 1WETA 5G1OA 2QYTA 1BC5A 3IBSA 4GM1A 3MBKA 4MTLA 3RPEA 5WRFA 1IVSA 4NU0A 2WF7A 2Z08A 3ER8A 1OSNA 3NT4A 1IAQA 4Y6RA 4AS3A 2AEEA 3O4GA 3ONEA 4BX0A 2H2AA 1J0XO 1U0LA 3S99A 3ZEIA 4EQ6A 2ZWPA 1TU0A 3CEPB 3LE8A 2O20A 5ALNA 1CRLA 3MBOA 4F93B 3GJ5A 2WC1A 4FQ5A 1RP1A 4L4RA 2Y1OA 1DJNA 4LDZA 4WN9B 2V5VA 4V0QA 3RU2A 4Z4HA 2B3DA 3EGXB 2UU9B 1AZSC 2JI4A 1E2LA 3ABQB 4U2DA 3VH3A 5FRDA 2IGTA 3BD8A 2QM7A 1QVRA 1V71A 3EMBA 3BXXA 5LZ2A 4U02A 2VQFB 2AA3A 2YWXA 1ZJ6A 4PHFA 4TS4A 3W3AH 4B6QA 3I6BA 1M6NA 1EE2A 4OG2A 4R2HA 2ODEA 4PIMA 4F6RB 2D59A 3T5MA 5HQTA 3W77A 2NUAA 3FWZA 4GPAA 4TM7A 3DJFA 1ECJA 4Y7CA 4B46A 4ZJZA 3C8ZA 1ZVVA 1UQTA 2R6R1 1S9DA 4JHLA 5H9WA 4XWKA 1BX3A 2QK4A 2QMZA 2RHGB 9LDTA 3BTOA 2XADA 2HX1A 5IDQA 1C0PA 3T1YB 5HCUA 3ZLVA 3TMYA 1J0DA 1IK4A 4Y6LA 1QRDA 3TOCA 2H16A 3LGAA 1W36B 4YT5A 4N01A 5JCJA 3WQSB 2JGEA 1SC9A 1TC1A 1X39A 2I80A 1H0SA 3BWDD 4WFKA 3W5VA 3WWCA 3UHFA 1RFGE 2HC9A 3PD0A 5DIFA 1LS1A 1L5QA 4RHUA 5TPZD 2D4HA 5IH7A 1DC3A 3B1WA 2W43A 2PX2A 4KQHA 2VG8A 1C3EA 3DKRA 5EN4A 4EFLA 4RTLA 4G5XA 4QUKA 3EGCA 2YHBA 2J0EA 4PLPA 3ZNPA 2NT3A 3PHBE 5EWLB 3AZOA 3DA8A 4DM4A 3NTOA 3R5JA 1AK1A 1CRZA 4PBSA 4U7TB 2FGKA 5AHOA 3CBQA 3OQMA 3FDZA 4KMRA 5K8TA 1KI8A 5K0GA 5L4LA 5FEUA 4NIMA 2FSPA 3L0DA 3I01A 5AVTA 1SUEA 2Y8EA 3N5KA 1VIAA 1SXGA 2XQJA 4TV8A 1UMDA 4WV3A 1GQSA 1WDMA 2R2AA 4U2CA 3Q7RA 1DDGA 1LC3A 2FSFA 1QGDA 1MGPA 2B5VA 5AHXA 4TL6A 4WINA 1GGEA 3ZY5A 1XK6A 4J91A 1UM8A 5DSZA 3C39A 3DE6X 3WYAA 1NC1A 3JWJA 4YJ2A 2HBYA 3L41A 4UXJA 4WEQA 3FPBA 2GTHA 2O2HA 2X15A 4KFRA 1K68A 3G02A 4H35A 4CM4B 2AB0A 2ZRMA 1T34A 2TMDA 2I1LA 5HFJA 3ZHZA 4R3UC 2AS0A 4IXTA 5JI3E 1IN6A 1E5DA 1FU8A 2YVQA 3FRJA 4W5OA 2H1RA 3IEMA 4B33A 1VBFA 1K3UB 2UZ3A 2EFYA 5LQRA 3ADDA 2V5UA 1WMDA 2XKAA 3BRWA 1K08A 3A27A 4IX9A 5IMSA 3KQVA 3P9ZA 2FFHA 2V55B 3U3RA 5BYAA 1ZRHA 1USIA 2H1IA 4EZEA 1ZKMA 3MWJA 3AKEA 4OKSA 1WDWB 3BL6A 4G23A 3SJ7A 2IKSA 4R2KA 3KKQA 4FDMA 3NM4A 1PR0A 1ZN7A 2ONKA 4M9XA 3WX0A 2Q4DA 3IRUA 2O8BA 1EINA 3FZEA 1FFGA 4YAWA 3T0FA 4US1R 4F46A 2GCGA 1SK8A 1NUHA 3F8WA 3JVEA 3OJWA 3QEJA 1YS9A 3IAM1 5AUPB 3WL5A 3C14C 4J0CA 5JXIA 2MSCB 1OFGA 3MXTA 1O5OA 4O2BB 2V7EA 1V9CA 1HSZA 1EDEA 3ANSA 5HE9A 2ZZNA 1C1XA 4JJGA 5BVHB 5JVDB 4QJ3A 4JUAA 1ZHHA 4WLUA 2RB4A 4Z51A 5FUQA 4BLRA 1I7QB 3AH8A 1UFQA 1BDHA 2BUAA 1IWPB 2H1LA 3AFGA 1WMSA 1KI4A 1LQ2A 1OYWA 4BDTA 1JFTA 4HDMA 2XVMA 5T8KA 2ZUFA 1B2RA 2I6SA 3OJFA 4IFTA 2WNSA 2JIPA 4IDOA 2C2XA 5TQ0B 5KSYA 1HX7A 3OQPA 3PQDA 4YQFA 4B34A 4XIGS 4KYIB 4CM3A 3I09A 5HS6A 1DFHA 3X2FA 4AKHA 1TKBA 3H3JA 3AY7A 2I4OA 2PUVA 3OLZA 1Z0DA 2O2SA 2QXTA 2GN4A 1CUVA 2HM7A 4H7PA 1J33A 2H1WA 3A6LA 4G4IA 4MK4A 1WVGA 1U80A 1Z28A 2HA0A 5LB4A 3SIPA 3WAGA 4G0XA 3DOIA 1X1DA 4D81A 3QMPA 4FMCF 2H4HA 3JPWA 4RH0A 4D0RA 1Q57A 1N6HA 3K1AB 1MBZA 5BV8A 2EBUA 4Y98A 4ZAGA 4BWYA 1T25A 3FOFC 1D2GA 3C5EA 4I9NA 5ELLA 1VPWA 4JROA 3ZS8A 1CB7A 3IX7A 2MYNA 3HEMA 4I5IA 4UNPA 1W19A 3LZDA 2RH8A 1B2LA 1HNXB 4MH0R 4X41A 2Z5LA 2J41A 3UT5B 1E2DA 2ZI9A 3X44A 1L7VC 1ORDA 4PX3A 3DH0A 4IRMA 1XP5A 1E2BA 1SKYE 3RFXA 3TG8A 4MW6A 3PSAA 2FEOA 4AULA 4EHKA 4QXAA 3REOA 3R0JA 1X3LA 4PZAA 4LC9A 1RJ9B 2DQKA 4F4IA 1H22A 1U11A 1FUEA 1AQLA 1P1BA 1TB4A 4OQLA 4CMKA 5T8KC 5BNIA 4I1RA 2X22A 3MUFA 3QVSA 5JHGB 2WSSA 3Q88A 4L08A 1XMJA 1ZNQO 2Q45A 3E9YA 4OFZA 5IKXA 3O93A 3D6TB 2OCPA 2VA9A 4HXYA 2G1JA 1WRBA 2GCIA 4W1SA 4KYVA 1B8OA 2R00A 1UBFA 3WLHA 4PHHA 3OEED 3VX3A 4CE6A 4E0BA 2FUNB 4S05A 5KTPA 1FNSA 2FEPA 1SUFA 2PKRA 2A9RA 2OLKA 4IVNA 1PJRA 1YS7A 3N9IA 4TLMB 3ERCA 3CBGA 4NU8X 1JSZA 3NTQA 4XSHA 3VV2A 1WULS 2YZMA 3VR3A 4KDFA 4BNJA 1YS2X 4BBZA 2A0YA 5KHOC 1I7NA 4Q7MB 4QAQA 4ENTA 1J8QA 1BQ4A 4BUCA 3G13A 4L74A 1OXTA 4QAJA 2FW1A 3Q72A 3GAMA 1BWPA 1Z0IA 2XTJA 4LYAA 2JD1A 2GNPA 1W85B 5F5LA 4M6WA 1EH5A 2NAFA 3B6EA 2WU0A 3TAXA 1CFZA 3C7KA 4XFKA 4YMWA 4ZVNA 2CV1A 3RVOA 2G25A 1B8VA 3LKZA 4J2HA 3RYCB 4HFNA 4KR7A 3P7MA 3UUWA 1DX4A 2FHSA 1QFMA 3QF7A 3HCNA 4TXNA 6PFKA 1MDBA 2A30A 2C0PA 3RSZA 3JATA 1YS1X 4TSFD 1G6OA 1KEPA 4AIIA 4TTQA 4KDRA 1N2CB 2XQKA 1GZHB 1YJAA 4OOEA 5KKAA 3LYUA 4TL7A 1Q83A 1R0KA 4DR2B 1WV1A 2A5GA 2Z6VA 3HLKA 3LX5A 2XOEA 4BQSA 4YUVA 2K7ZA 4N4AA 4F2PA 3ASVA 3EQ8A 4RO0A 4LSGA 3VPXA 1P7CA 3KOWA 3KR1A 1F6DA 1R4AA 2ACEA 4BGEA 2Z6QA 3F7OA 1A5BB 2H8KA 2JAXA 3D0QA 5G0SA 4NQRA 1LX7A 3SZMA 4B3MB 5E4TA 1OXKB 2QUJA 4Q1VA 5EJ9A 3HYCA 1WHSB 1NI4B 1OYYA 1VPTA 4NNJA 1TPZA 1UKZA 4CT5A 3C7CB 2BELA 2QN8A 3BRWD 4MA5A 4CT4B 4HVLA 4CIAA 3DEJA 3DXXA 3R6DA 4C3VA 4EJ6A 2W7TA 3Q8WA 3JQGB 1VCHA 4KGVA 1V8FA 1P0QA 1AXRA 1DG1G 3KB2A 1OCEA 4MUFA 2BFAA 4UEWA 4BO5A 3DV2A 3VKGA 5JNVA 3AX6A 2W2VA 3MYYA 2C2HA 2CNOA 1I4OA 1N2GA 2MCFA 1JFFB 6Q21A 3FNFA 1D5CA 4K6FA 3KR2A 4KC0A 4W7HA 4EKNB 5GY7A 4PSAA 2FMFA 3IAS1 1GRCA 2YFKA 4WD3A 1DKNA 2QHXA 3QOWA 3M5PA 1Q2XA 1Y9DA 4TMVA 1FFSA 2MSEB 2FY8A 4EW1A 5EWLA 2CJFA 4V0RA 2QSZA 3ZKAA 4PLZA 1DKUA 5JBQA 1EFDN 4I4TF 1G5IA 1XV5A 2VF4X 4LCJA 3SG0A 3B7WA 2OT3B 4N8DA 3NVDA 3L7JA 2QVZX 1KC3A 3FPAA 3KC2A 4AS2A 5C9ZA 5A0TA 1EUCB 2VSFA 2M1XA 1E3EA 2MT9A 2ZI7A 3LVQE 1GTVA 2VJBA 3JD2A 4FGUA 2O7QA 4BQIA 4YPVA 4Q16A 2P2ZA 5DNDA 1LPPA 1H3NA 1ZUWA 3HR7A 4EAAA 1CR2A 4IKEA 3EDMA 3AILA 1PGNA 2BSQA 2ACKA 5M3BA 2XBUA 3ED1A 5A4IS 1OT5A 2P9EA 2FN3A 4DJTA 1DKLA 2CDNA 3I9NA 4KBYA 4FE3A 2AWOA 3SFZA 4RPHA 2HZ7A 1I24A 1W9HA 5GV7A 1ZISA 5G41A 4X1KB 1YD7A 3CNQS 2ZB4A 3PEUA 2WKWA 1PJLA 3JR7A 3LPNA 2VYQA 4XCXA 1ZW6A 4ZI7A 3H4IA 1ZIPA 1C1XB 1YQXA 5AKJA 4YP6A 3I8SA 2J3EA 4QYWA 3W6PA 4DLKA 5BVHA 1NUTA 1Z33A 3NBKA 5CTAA 4B4WA 5L45A 4KMOA 2XE8A 1NPDA 1BOFA 2CWWA 2ZVJA 1O5TA 4TMYA 1PFUA 4XM1A 3QFRA 5D5QA 1OBOA 4FHGA 5JD6A 3P0EA 2GAOA 4AWXA 3WLTA 4KXQA 1SA0A 3DWIA 4G4SP 2EU8A 2ZIUB 2PMDA 4Q9DA 1HBJA 2WG0A 3OX4A 1XZCA 3I6MA 5E4FA 2PUGA 4B6SA 1XCJA 3M6LA 1B6RA 2BFEB 4BBJA 1UBRS 3ZI7A 1Z17A 2R0QC 2GAIA 5EIXA 3IOBA 3M5DA 2DHEA 5K51A 2Q5EA 3KXDA 1JWLA 1NFRA 3AUSA 4DJJA 1AUPA 1ULZA 4KWEA 2AZXA 5CJPA 1P72A 3ID6C 4Q66C 5K6AA 2IA5A 2WUEA 4MJ3A 1PQPA 1TM7E 4OQXA 1NVFA 3VPDA 2FWMX 4XDYA 2UYOA 2SCUB 2EZ4A 2YCBA 2ZYVX 3IQXA 3WQRA 2PWAA 1Y9AA 3WHIA 4X84A 2WF8A 3AERA 5SZIA 1G2PA 4BZWA 3GLIB 3DO5A 4AY4A 1E9CA 2XUOA 1GYRA 1GO2A 3EPRA 4DC1A 1EVKA 2JARA 1CK4A 4M0FA 3AVYA 5BQ5A 1BE0A 1GGMA 1QV9A 2XRFA 2HJVA 2R1TB 4OA8A 2R60A 4D41A 5MFPA 1TEZA 2B34A 1G3MA 4GMXA 1O95D 4NCJA 5L6LB 5C4MA 3H1EA 4C2AA 2AW5A 1URPA 3AESA 1B74A 3MOGA 3IKJA 1DDIA 3P2IA 4HAOA 4HBGA 5LJLA 1NVGA 5DHFA 2J0SA 3AFHA 2D5IA 4WEOA 4C2BA 4P4GA 2IEIA 3JQFA 2CMDA 4LYFA 3E03A 4Q4HA 3H84A 3TSYA 3OUZA 1L7AA 2OY0A 3GPBA 4QQ8A 1YWGO 2DSNA 2HQBA 1SZPA 1C29B 1JA1A 3GA0A 121PA 3KB1A 4NV3A 4QTYA 5K0SA 5GINE 3CEHA 5DN9A 5DCYA 3JD4A 4K9DA 5H82A 4M36A 3PA8A 2Y1GA 4ZYTA 5LOVB 1YZQA 2VPPA 1T8PA 4A0QA 2GEBA 5BR4A 2C3YA 1LLUA 2YOFA 2LPMA 3VJLA 2O3JA 2MYPA 2EAUA 5CP8A 2ZJ0A 2Z2IA 4G85A 4TLAA 3A6PC 2E21A 3D8RA 1SIOA 3FIJA 1B0UA 1PFVA 3GJYA 4LMPA 2HA3A 2V4ZA 2ZRCA 4X20A 1QK3A 3NUZA 2IEAA 1P3DA 3CW8X 1YACA 3C8DA 3JTEA 3RIHA 1BXZA 2J9GA 2WHPB 4PANA 2XB2A 5IVIA 3HCRA 4QLAA 3CSDA 3FLMA 4UC0A 2DQYA 2NSDA 3QKRB 3SF8A 2R1VB 4FFVA 4LMAA 2HWYA 1WMFA 1T9KA 4B75A 2HLPA 1GPMA 2QGZA 4Q3EA 4US2R 2FRDA 4B6FA 4BJHB 3GLVA 4GH5A 5IKOA 3WMGA 5BSRA 3PHIA 4WY8A 3LO8A 1E5TA 4QU8A 1DPFA 5AKZA 3TR0A 3SKVA 2NNLD 2RB5A 3RAJA 2DSTA 4RDXA 2XPCA 1ZXBA 1Y7TA 2F00A 1WCIB 2CLDX 1MO6A 3UFXB 3HCWA 4MR9B 3NAGA 3CR3C 5IPFA 3LLMA 2R7KA 3NC0C 5JAOA 5LYJF 3ZD9A 3HFRA 3A6GA 4CEHA 3G85A 5L4NA 5GZ3A 1E20A 3BQ9A 3WOVA 1OF1A 2BR5A 4Q00A 1XEXA 3C6YA 1SBZA 5B5SA 3O3NB 1SVKA 5CK4A 4TQUS 1F0KA 4JVSB 4O3MA 1GUAA 1KMNA 2I8LA 2X0FA 2AW3A 2FR8A 5CX1B 2ZCJA 1DAEA 3V4PB 3N7TA 4WX2B 3PB3A 3PPVA 5DYYA 4NATA 3CJTA 2JLZA 4KNYA 1IK6A 3TZKA 4IMPA 5EPOA 1Z25A 4IZIA 1R0RE 5HDQA 1I9GA 4JVNA 4CMAA 3GZTB 1W0CA 4PS0A 1J5PA 2ZDGA 1RSZA 5CHEA 5AJTA 1NRJB 2G06A 3AHJA 3N74A 1RWMA 3TDKA 4JNCA 5A4KA 1LV7A 4EF6A 1E9FA 1JPNA 2ZBPA 3IELA 3FUCA 3LPCA 3I5YA 4MEJA 4GGMX 1DE0A 4HN9A 1J49A 1TCBA 3UMCA 4CL0A 3ZVRA 3DP9A 4DMRA 2VP0A 2RBGA 2C0CA 2GARA 3KJXA 4O4JF 4PYIA 3W8FA 3JQAA 3FVWA 1V6SA 2WAYA 3QLVA 5LMUB 1G20E 4TMWA 5AIAA 3B20A 4W5QA 1VMKA 4JV5B 2XWBF 4MVJG 4WK4B 3TPCA 1RZVA 2B4YA 3W2EA 4WESB 1VI6A 2I22A 2D4AA 1OZHA 3EAFA 5F9HA 4EA7A 5C5CA 1VKZA 1COWD 2ONCA 1YDMA 3GCZA 4R8KA 3CE9A 1NLMA 4J0JA 4R31A 4ZCMA 2ET6A 5ARBA 2JBAA 2MINB 1CY1A 5AK4A 4BN5A 2NZUG 2XRYA 1QS0B 4I2NA 1N8SA 4X0EA 5CB0A 1J2RA 4U7JA 4KU4A 4DE5A 2H8GA 4CIBA 4LJRA 4C0JA 5F7OA 2X7XA 1VSTA 3QXXA 3BXEA 4ZODA 1V8OA 5C8YA 4GWLA 1XXLA 4FU0A 4ZJPA 1QG4A 1H2ZA 2HPVA 2K2QB 3VPAA 4IDQA 1FPMA 1Z5UA 4IDFA 3FTNA 1UKBA 4TVOA 4FMDB 4DRXA 4BLVA 2R2GA 1U2GA 1IDOA 2GK3A 3F90A 1BFUA 5JJIA 1E5LA 1NMEA 1ATZA 3BS4A 3TOVA 5TY0A 4OSPA 4QDZA 1H2RS 5CEFA 1P2VA 3TRJA 2QTRA 1NC3A 7ABPA 1JMVA 2PZGA 3DE5X 1G4AE 4TGLA 4WCDA 4DV1B 1GQ2A 3OQIB 4NYJQ 3RHTA 4P81A 3VV3A 4JBXA 1K06A 4CKBB 3WLJA 4PWYA 2BMAA 4RDCA 4KWHA 3TX6A 4YT2A 1N6KA 3A9UA 5I48A 2H7YA 3L1IA 3H2GA 3EGWA 3RVMA 4CG2A 3D6JA 3BMCA 4MPJA 3IKMB 3G1UA 5JMPA 1I7SB 3MINB 3LLUA 1ND5A 2YHSA 3A9WA 2BPOA 3LFTA 1E7YA 3GQBA 4JLKA 4LG1A 4R0VA 1KE2A 4LJ5A 2JAPA 4MWEA 1WPXA 3JVDA 3DDZX 1L6RA 2PX6A 2LKCA 4AQYB 1WKBA 4R0NA 2XR1A 2FZVA 1OBHA 3IDQA 1JKJA 1AGPA 2W2PA 5JARA 2PQMA 2R4QA 3FLEA 3ZDZB 3ZYZA 1YV9A 3FUWA 3OCJA 4FIZA 1KSHA 1LKZA 3SHQA 2QN1A 4QYXA 1GYQA 4I9GA 4XQ0A 1Z3CA 2XDWA 3ZK9A 4M0EA 4I50A 1O0CA 1GZ3A 2Q41A 3K2IA 5FORA 4IG9A 4FM9A 2XZOA 3NGLA 4R2XA 2AN4A 521PA 2I66A 1FMCA 3L7LA 1YOVB 4RY0A 1A9XB 5F1PA 5HKBA 1FW6A 1CEYA 5AWFC 1X8XA 1XNJA 2IS6A 3IC5A 3UWMA 4L7VA 4ZI7F 2NU8A 4JDUA 1W75A 5A6SA 1FYDA 3W5AA 2C29D 1LVHA 1UBSB 2C5LA 5EWMA 5KZMB 3ZY6A 3MGBA 5C31A 2WKSA 5DK4A 3RVNA 1HMPA 1I4WA 2WFMA 3BQNB 3MUEA 1Y3CE 2IYFA 3DDNA 3SKYA 2VJQA 1S89A 1BZYA 1E92A 2BD0A 2Q0HA 3VGJA 2Y77A 2W6CX 3DEAA 4PNPA 2XT0A 2H11A 4FX5A 1KQNA 4D6YA 1RT9A 3OKCA 5HBGA 1M2JA 4LWOA 3GJ0A 1KJQA 1WM1A 1FNDA 1ILWA 4KQMA 5EIBD 5J5CA 4BCBA 3ILYA 5GP1A 4B6RA 1BYIA 2E55A 3JYQA 2PGOA 2BF7A 4BYGA 1HF3A 3OZIA 3PLAE 4XUGB 3LQ4A 1DPGA 4WFQA 4ZWNA 4M2LA 3HSYA 2AI3A 3E8SA 3GN2A 3M81A 4X63A 4JODA 2E4AA 2I6UA 3ZLJA 2ENWA 4I1IA 3ZR4B 1CVRA 2YINC 1KO1A 3DOOA 3IODA 3KZXA 1XEWX 1MF7A 2WIKA 1KKUA 3RS9A 2R7AA 3ZZNA 3T8YA 2HRBA 4BKUA 3ZVKA 4ZYXA 5FLXA 2RSLA 2WJIA 4CKCB 4K9NA 1UK8A 5IFKA 3H2YA 4OHWA 3NKLA 1XKXA 2JCBA 4ZN6A 2WKPA 1GFZA 4I81A 4U2FA 3DT6A 1CC1S 3BG5A 3FBWA 1SU6A 2WF5A 3VYRB 2W6ID 4K6KA 1N5MA 4FKZA 5BN4B 4H1HA 4WESA 5H3CA 4IJQA 4J0KA 2RGYA 1ISPA 1PHRA 5F7XA 3D7MA 5EFZA 4ARSA 3LWNA 1TYCA 1T3TA 2OLEA 5DASA 3NU1A 4CFZA 4DDTA 4XM0A 2OP1A 4TTJA 4ZMRA 1FPQA 1GNPA 5L7WA 2BGLA 2H6EA 4M1YA 2ZPUA 1TM1E 2C7VA 4N3NA 3CCBA 2CK3D 4EJ0A 3O8DA 3GA5A 1E6MA 2YJTD 3I76A 1M1UA 2R1ZA 4HFJA 4X62B 1BHJA 1GAXA 2ZGVA 4X3CA 1IQRA 2CUZA 4C4PA 1TRHA 3DYVA 1Z0UA 4G0NA 2QM0A 4NF2A 1M34A 3FDZB 4L3OA 4CRWB 4Z8YA 1RPJA 3LHKA 3C6QA 3DLIA 4NCNA 2ZRLA 4GEGA 4OAQA 4Y2XA 4PN7A 4K40A 4X3OA 5BOSB 1BMFA 1XJWA 4PGMA 3TVTA 1S2IA 2NO1A 2G09A 3NNSA 4AZ3A 2XXAA 3V2GA 5A7FA 2X41A 4Q34A 3GA7A 1ZM9A 2DWQA 4E6PA 1V16B 1W96A 2WMDA 2ZWOA 2G4VA 4MPPA 4W8OA 1GSIA 2YZ7A 4Y1RA 3AWDA 4GR5A 2YJZA 1Z0FA 4JVMA 3ICWA 3A4TA 4OK6A 2WTAA 3BMXA 3IUNA 1KI1A 3OC6A 3IMFA 3VR4A 1XTBA 4IIYA 1NUUA 1WSAA 3R41A 1Z4IA 3KXPA 4D9IA 4RSRA 5EC8A 4DY4A 1ZH2A 3UCEA 1Q0UA 2ZWIA 5ILGA 5IF3A 2OCGA 1I4EB 2VC2B 3B7PA 4NFYA 4IYRA 3BUSA 3GT0A 3I0ZA 4D3SA 4W9RA 2CUNA 3B3QA 3GAZA 3ACBA 2QDXA 1JHRA 2PLFA 3TTSA 3WRYC 5JD3A 3CLUD 3E82A 3H2SA 3ZQJA 1KFEB 3KXLA 1NL3A 1UOEA 5CG1A 5A9SB 1I5EA 2GCOB 3WK8A 5C1BA 2Q7OE 4EFNA 2RHOA 2BBSA 5DLEA 5FJIA 1ABBA 3I9FA 3FCCA 3LUDA 4JYCA 4NICA 3AFNA 5TR9A 1Y1SA 1U8TA 3BWBA 1PZHA 3ND8A 3NXSA 5D51S 3RK4A 3F7MA 1AKYA 1JQ5A 3BXFA 5EIFA 1UDXA 3JSXA 1F2VA 4BNWA 1TVEA 3VAYA 4RFVA 3UA3A 5I9LA 5FYDA 1DADA 1RJGA 1US8B 5CJ2A 4NQZA 3I9V1 1JI0A 3TI9A 1ZICA 1N2IA 4TN1A 5KYUA 1TUBA 2C61A 3H9EO 3Q6IA 3SP1A 4UMDA 3TVYA 3SS8A 1JEYB 2EFDB 2FRXA 1UK6A 4F4FA 1DXHA 1VXRA 5EHIA 1GA1A 2W6OA 2IHTA 3ZEAA 3H6KA 2MINA 4NYJR 1N77A 1KYZA 5FADA 4GKJB 1M5UA 1L8OA 2GRUA 3AUYA 1DEXA 4WAUA 5JXHA 3N8GA 2X42A 5FAXA 5K8JB 2VWQA 4ESVA 1OFTA 4C0HA 2DUJA 3RC8A 2WFLB 4AXXA 2CVQA 1X1TA 2BE9A 3VO8A 3G6WA 3U7GA 1L8AA 2RK3A 3T9FA 4A8HA 4YRNA 5A6VA 3KO8A 3HBNA 4FOPA 2BGNA 1DCKA 1Q19A 2JIZD 1FYFA 2YN2A 2ZRAA 1JNXX 4MI3A 3OIGA 1I7PA 3O1HB 3TPZA 2QSJA 2PT7A 2NZ2A 3VYSB 1KP2A 2BFFB 1JJIA 3QVLA 4HDKB 3BD6A 5GWXA 3SLGA 4GSYA 4FYHA 3OZTA 3X0DA 2FCAA 5FWXB 3RQSA 3RI3A 2Z2KA 3NWEA 3TIVA 3VTFA 2HK8A 3ORRA 3G2MA 3GOHA 3P5SA 2ZPAA 4ZCLA 1BVHA 4Q7KA 2IIBA 3OMWA 1YK0A 4O4LA 2IEGA 4EY5A 2VAWA 3Q98A 2QOEA 3EFEA 2FZEA 2J7PA 2XNHA 1FDSA 3EZLA 2ZPTX 3GO4A 3IV7A 3V4FA 2B25A 3V1NA 1ZJYA 4BGIA 3ROKA 4CKBA 2J5QA 2JKVA 4IWYA 1NE7A 4ZI5A 5JQWA 3EY4A 3BMCB 3NHZA 2E2WA 1KOJA 1YB7A 3HVIA 3LYAA 4LXTA 3MBIA 1T8TA 9LDBA 4G86A 4HNAA 4MVJP 2PMBA 1I1HA 1YR9A 3BTUA 3OA2A 4O3FA 4XOIA 4FHFA 1RXCA 2QTLA 2G0NA 3GBVA 3JY6A 2WP8J 2O2EA 3FW1A 4OLHA 2R7MA 1JWAB 1NQUA 5IBCA 3DFKA 3B89A 5EMMA 1WXEA 1KQOA 2VJYA 3MSXA 3Q1KA 2Z4TA 3WGTA 3TQFA 4ACBA 4GXRA 4GUAA 4NG4A 4OHKA 4EELA 2IXDA 3RVSA 3UWDA 1JFVA 1UM9A 5ITSA 2O57A 1KMMA 5KC8A 2PUCA 2HJSA 5JC1A 1PWYE 3QLVC 1YL7A 4DF3A 1THTA 2A35A 3MCTA 1Z8DA 1I2CA 2PD4A 3EWNA 2JAQA 5G0WA 5F5XA 2A92A 3BILA 4G4JA 4EI9A 1YZ3A 1RM0A 4MVJE 4IW3B 1JXAA 3UMBA 2Q5QA 1HTBA 1TMKA 1UMDB 4QDUA 4DSUA 4AS1A 1M1ZA 1OHHA 2WUWE 1AHNA 2EVWX 3ELWA 3N6VA 1EIWA 2VIIA 3NBZC 2UZ0A 2XKBA 3K94A 5JNRA 2I7DA 3H4MA 4C7OA 2GVZC 2I4IA 3A1UA 1Z8NA 1P91A 1FDUA 5AM1A 1SAYA 2ZRJA 3ZK7A 3JWPA 3I73A 2WYVA 4L4UA 4B3RB 2DJ5A 1A8UA 1ISFA 1PNTA 1RKBA 2HH9A 2PRSA 2D06A 2VEOA 4JJ8A 3T5BA 4L6AA 3H97A 5B3JC 4NBUA 4L3VA 1MNQA 1QIDA 2YIDA 3LD9A 1DDOA 1WW2A 3Q15C 4IGKA 4IIFA 5B1IA 3TSOA 4CLOB 3O2QB 5IUJC 1JALA 3LGXA 3O5AA 4US0R 4N39A 4GRDA 2D0PB 1MLDA 2VXCA 3D4BA 1ZK3A 3IUYA 4Q4LA 2LBPA 3BIJA 2ZJ7A 3VR5D 2VHUA 4YCDA 3AYXB 1JKFA 3WDMA 4YRLA 4A73A 4DZZA 4QWWA 5UKDA 1QH8A 2GFQA 4FT4A 1TAGA 4Q37A 4NE9A 1XZAA 2FN8A 4P4UA 4KVGA 4EL0A 3F2IA 2X86A 1JEYA 3NHRA 1FK8A 2V8OA 2ZZMA 3ANLA 1RXEA 2WMNB 3STVA 4DLZA 2ONYA 2DQZA 3NV7A 2VDWA 4JOSA 4W1QA 3T06B 2DTDA 3TLBA 3K5IA 2F1KA 3AKCA 4LJKA 1TL7C 3OZEA 1CUIA 1PSDA 2VYCA 3MWYW 2H5EA 2XUGA 1JEDA 3PFHA 3QUBA 1RCFA 3EVZA 4QHTA 4MKZA 1FS5A 1P7VA 1GAJA 2P6OA 5SZJA 2R8RA 4D8TA 1V8BA 1X1QA 3IDSA 2PJRA 1H2EA 4RIEA 2Q9BA 3VR6D 2QT9A 1FNMA 3G7SA 3I72A 4EWLA 5JSHA 4YEDA 4M99A 1XHEA 5A06A 2PXHA 3NHYA 2FZGA 3KLNA 1XTPA 5A02A 1N0WA 4RIHA 5DJ5A 5EUQB 4JOCA 1ZIDA 3MLAA 5TC4A 5LDGA 1DUVG 3QU9A 1LI5A 3ZX5A 3SYMA 3LXMA 1FLNA 4L9RA 2AMVA 2GZ3A 2B37A 5DX8A 2W11A 3D3WA 3OOSA 3OLXA 3RYFA 3KZVA 3GZNB 1I4TD 5BT9A 1PTJA 2BMFA 4Q6WA 2QQ0A 4DC0A 4G24A 1Y5MA 4J1QA 3BB1A 4RJKA 5BNFA 4MHOA 4XX0A 2Z09A 1WBBA 1GADO 1XP8A 2F43A 2ILVA 1WXFA 3E9CA 3VTZA 3CH6A 4BV8A 4EG5A 1VE5A 1DX6A 2VRCD 4KLZA 5K3FA 4JVLA 2X0JA 4TRJA 4FI3F 3WZMA 4AZWA 3RB8A 1CUWA 1DRWA 4FFDA 3C98A 4LHXA 4LFCB 4POAA 1N2SA 4L4XA 3GUHA 4IFEA 5F2KA 1MDFA 1M6VA 1HDOA 2RJNA 3IUQA 1N2HA 2XSZD 1C3VA 3PDIB 1ZGGA 4Z9FA 1E1CA 3UPUA 3LKDA 3KM0A 3LO5A 3GH3A 4OXKA 4QYTA 1BEEA 3AP3A 5LUBA 3EXIB 1HI9A 3ORSA 2CDBA 4AJNA 4YXFA 3EPKA 2ATVA 2NO7A 2Q0SA 3ISJA 1K88A 4PNHA 4Q39A 2GEUA 1GQYA 2JFBA 3BULA 3NHAA 4GZ3A 4JHXA 3MQ2A 3L0SA 4NABA 3WQQA 4BP8A 3J81k 2VT2A 1SXJE 4Y0AA 4CQMB 1T0HB 5KI6A 3BEDA 3UV7A 4LC1A 4Q4JA 4RGQA 3HRKA 1SZCA 5I7FA 4DGQA 5AVJA 1RS0A 3K3PA 1GITA 3N8KA 3QUQA 3A0RB 4PW0A 3WKDA 3HADA 3U6BA 1I5OA 4R5MA 1ZK2A 1QFXA 1FFBA 3HDTA 1E9DA 4LWQA 2DULA 4IY1A 4YRRA 5FTWA 3VNRA 5IT0A 4L5YA 5A9SA 2VDKB 1RI3A 1L3BA 4YP0A 4Z7NB 2Q3MA 3GMSA 4TTRA 4WECA 2BGGA 3I2FA 1V1RA 3NHLA 4MIYA 2ZUSA 1Y6FA 4P6VF 4UAVA 3FZQA 2J5XA 3WDKA 2D1QA 2GBFA 1E59A 3IQHX 2ZT5A 2NYUA 5DIZA 5FUVA 2ZTVA 3ROEA 4HGPA 4DLSA 4PS1A 1BJRE 2HNKA 4LK2A 3HI6A 4V0ME 2B0JA 4JJAA 1VM6A 4E07A 3U80A 4GMKA 4F91B 1Q1BA 3B36A 2BCGY 2XMCA 2PTGA 3RODA 4DQVA 5LD2B 4JBGA 3EYWA 1BHO1 2IPAB 3HYSA 4EPRA 1LGYA 3ASUA 4BNIA 4F3YA 2C96A 1CUGA 4Z5XA 4JJ4A 4YO7A 1DQRA 3IQZA 5L7YA 3I1FA 3RTGA 1MRSA 3CR7A 1SH7A 4WXMA 1ZGCA 1U8FO 2JGLA 1T9BA 2NO4A 2GNAA 2R6JA 3LC1O 4JMPA 2YXDA 4K05A 3NBFA 3JASA 3PF9A 4YJGA 3S29A 3FPSA 1P80A 3IT2A 4OYLA 5J2TF 4B73A 2OBMA 2OORC 1QH8B 1RWBA 3DUFA 3TFWA 3MUNA 4FIDA 2QI9C 4O6VA 3VZPA 2GPTA 4BLUA 2HA2A 1JLSA 3VPFA 1LBSA 1TAUA 4GF5A 2ZB8A 2A0KA 4KFSA 4FYIA 4F1JA 4EPXA 2CF6A 2QD3A 4MTCA 5ALFA 1ZM3A 1E2JA 4Q7JB 1NSTA 1PGOA 4BQFA 2ZVQX 5CNMA 2H59A 4MWTA 1T8RA 3LDGA 4ZQBA 1DBSA 3O4FA 3W7AA 1CW2B 1DIHA 3FCUB 1OWMA 2IKQA 1N5IA 4GOXA 1WXDA 2PNJA 3WWYA 4C6RA 5LL6P 1J20A 4C30A 2N75A 3HWX1 3LUKA 4DT1A 2FUCA 3HU5A 1IPHA 1E5VA 4PBTA 4H27A 1Z22A 5KVSA 1QU2A 3TQIA 3DD5A 4OYYA 3G0CA 1YC2A 4AICA 3IURA 4FQ7A 4JUIA 2ZSDA 2Y99A 2VPQA 3KR0A 2XUPA 1U8ZA 2PCLA 2QQEA 3OOJA 1PJBA 1ONBA 1Y0BA 2EJVA 2R68A 1KZ4A 3BYZA 3DVSX 2CYAA 1N1EA 3GR6A 4OKNA 3BAFA 3LECA 3S27A 4PLCA 2P6RA 5I9IA 1ZH6A 2GBCA 2P41A 2QGNA 4PGAA 3CFYA 3WGZA 4HDAA 1CUAA 1V8PA 4X66B 4YJHB 3L4BA 4G0QA 4K9SA 1OR8A 4BJ6A 1QYVA 1OASA 5E1DA 4ZA2A 5IP5A 1GIAA 5GQSA 4DUPA 2GBLC 4JC0A 2L2QA 2YQZA 2H7XA 3K9CA 4PSKA 4UXIA 1YCGA 4Z0PA 3GMTA 3VPCA 4JLAA 4BO0A 1TGYA 3D5EA 5I4IA 2AMLA 3TNDA 1JQDA 4I4CA 4NE2A 4CL2A 3D8BA 5A2QA 6REQB 1Z2AA 5ITVA 1PZGA 4IVQA 1O5IA 4EG0A 3OHPA 4CTJA 1X1SA 1ZWLA 3W8DA 4BEVA 4OK5A 1VYUA 1ODTC 4B45A 3HXKA 2E6KA 4CEHB 1M1YB 4WUVA 3K8YA 1UT6A 2IUSA 4BAGA 4R5HA 4TWRA 2DR0A 4X00A 2WSIA 2WRZA 4BX9A 2WWYA 4JLOA 1GFWA 2DERA 5HQ3B 3Q5GA 4AJHA 4L07A 4LI3X 1LPAB 3RHSA 2O8CA 4DR4B 3PYLA 4BBAA 3EEQA 5KYGA 4YMHA 4MV8A 4CF4A 3UJBA 3JS5A 5JAPA 3IVMA 2HU2A 3M82A 3CM0A 3ZWPA 1U90A 1S8FA 1DBVO 4C06A 3V32A 4LZWA 3DPSA 1EK0A 1RWQA 3P2JA 4ZK6A 4R54A 1U0RA 5K8LA 2ZSIA 4PHTA 3NVAA 1V25A 4XYEA 2PLAA 1NKVA 1I94B 1X9HA 2VSOA 3WRXA 1MRNA 3T54A 5EFOA 3H13A 1YJ8A 1C80A 1T91A 4RAOA 5DI9A 1O96B 2DFDA 3ZXXA 4HNTA 1IIBA 3CZQA 3U60B 4KQ6A 1L5HA 1NVWQ 3ZBQA 3UK1A 5A1JA 3OCWA 1JHDA 3EMDA 3JR3A 2KM1A 2AKEA 4KK3A 2WD8A 5CDGA 5GAJA 5LKAA 2WLTA 4S1WA 4O08A 1RADA 2FN7A 3I1JA 3QPAA 4ND7A 4RQTA 5FV4A 3OTWA 3UAGA 1NYTA 3IDZA 3BD9A 4FQ8A 1EUZA 1FUYB 2EP8A 2HA6A 4ZV9A 1EFTA 3FG9A 5JANA 4HRYA 3MYRA 1P62B 2C4HA 3OY2A 5C5DA 1Z34A 3LBHA 5A4JA 3EA5A 1Z5GA 4W8GA 2DPLA 4UCWA 1PT8A 4QELA 4RLSA 2ZJYA 3NANA 3B5IA 3HXPA 2LW7A 2VDPB 4WN9A 5JAMA 3AR9A 4WJKB 5FUYA 3G2KA 1VI5A 4WKNA 3RC2A 4O33A 4M9ZA 4Z0HO 2GXAA 2J09A 1BFDA 3LA8A 5HS4A 3BHJA 3E5NA 3WLKX 1JW9B 4L15A 5EZYF 1F0PA 1FFHA 2KW5A 2YHUA 3UM9A 3ADBA 2P8SA 1S4MA 2HKIA 4BVAA 1W59A 1GR0A 5K8IA 3WGIA 2ZSEA 4PC7A 2PNFA 4JZKA 1R6VA 1SXIA 2BN4A 2J9FA 3ABSB 4GAEA 4O2AB 1E64A 1P2UA 1RI2A 1FRZA 4ZD6A 3FN4A 3LVFO 4ID9A 1G8PA 5IJ0A 4L51A 3WFZA 1OV6A 2LRHA 1HQYE 1ECPA 2NQ8A 2PXXA 1T4DA 4GYKA 4TL9A 3SDBA 2R8OA 1W88B 3EIEA 3DO8A 4QOIA 4OP2A 5TSDA 2QJFA 2YDXA 4P5PA 1VMEA 1W9MA 2QTHA 5CK5A 3IPRA 1XWIA 5JSZA 1J4AA 1M83A 3PNSA 5G4KB 4RCZA 4PC3A 1R4NB 2Q99A 2ZIFA 4JLSA 4TMFA 5E4JA 5TS2A 1H3EA 1TX4B 4MWOA 1HDCA 1O95A 1WCWA 4OJMX 4OD0A 4X93A 4DM7A 5KSWB 1ABEA 4AZTA 1GTL1 2IOYA 2FETA 1JU9A 2JVJA 4RFLA 5HEKA 1W5EA 3K4HA 5EOVA 4BNNA 3ZVMA 1DMSA 1KAGA 2WHEA 3PVZA 4Q4JB 1JPVA 2NX2A 1TA9A 4KREA 5AUQA 1XDBA 3U9LA 1XB2A 2EQAA 2F3TA 3C4QA 2PZAA 3E7WA 4J43A 4ZVSA 4IEEA 3L0OA 1XTTA 2YJGA 3MVEA 3IKLA 3LAWA 2HDOA 4NH4A 3UV6A 2RC6A 3ZX4A 1QO9A 4OAOA 2X4GA 3KU4A 5EUCA 1V5EA 3GV0A 4ZI7B 3WGJA 3WIEA 3RJZA 3EULA 2PX5A 1ZIYA 2R66A 2VL7A 3K16A 1SHUX 1ISRA 3OKAA 4KODA 1PJ2A 3OPMA 3D7KA 2PY6A 4DXDA 4ND5A 2C31A 2PUTA 1WY5A 2O7VA 3BIFA 3T3PB 2PYIA 1ACLA 4ISBA 1ZDMA 4ZOCA 2BBWA 3KTAA 2QYHA 5COQA 4PLHA 1EG7A 4FLEA 4WGGA 1HE2A 1BHQ1 3BFVA 4I3GA 4E5KA 3T3DA 4ANFA 4DWOA 2BV3A 1PEKE 3MB8A 3SC6A 1PD0A 3TPFA 1SIWA 2P3SA 2R6GA 3ANXA 1GN8A 3QWAA 4QVGA 3RG8A 4BFSA 3Q12A 2JB9A 2KI5A 3GVPA 4Q3AA 1H5NA 1U2TA 3ZDQA 2OM6A 1RMTA 5AI9A 1VIYA 1JYEA 5AW8A 2ZE5A 3B2NA 3PXAA 4HT3B 2CBXA 2R3SA 4IO1A 3H9JA 5ESRA 4NENB 1EXDA 4M88A 2Q4RA 5KNDD 4YJKA 1ZVQA 2CLSA 1Z6AA 2CNLA 3R0VA 4UNIA 5TQJA 2CWDA 3IR5A 3TZLA 2FLVA 1R0YA 2NN3C 2F1JA 2V6GA 2W5UA 4FHZA 1LK5A 4KKVA 4AJIA 5EINA 4BO3A 4A5OA 3K9GA 1YCHA 4M9QA 1S2MA 2A5YB 1K4MA 2ZRPA 1D2AA 4AJJA 3MPUA 3SGLA 2GX6A 3TRFA 3D8SA 3MWGA 2XEDA 4CCSA 2QM3A 1YHZA 2A3NA 1QHIA 4CCAA 5BQFA 2HCTA 2OBBA 3E1GA 5LWHA 3L0PA 1KO5A 1C8KA 3LBFA 4MKIA 3DQPA 1N3LA 4LRYA 1FDOA 4YMLA 3LBAA 1A9PA 2UVPA 5EXPA 4IDNA 2G9ZA 2CCKA 2NYAA 2XYHA 4NK4A 2I54A 1AA9A 1VG0B 2XGSA 2D2FA 3AM5A 3GIWA 4LQCA 1NOKA 3K0CA 1RBMA 4HNHA 3R9IA 1MQ9A 4BLWA 3TK1A 1OFIA 2F59A 4LRWA 2YNMC 4CGYA 2V9CA 4BEBA 2XTZA 2A9VA 2ORVA 3QE4A 1TUGA 4FSDA 1FFCA 1LRJA 1M2EA 4PRZA 1YIDA 2F1OA 1ETHA 2J7PD 2OCBA 2GN2A 2QRKA 4Q48A 3FTEA 1M9NA 1ZSNA 2J3IA 3FWHA 4H15A 4JL6A 1TOAA 3AEQB 3QPUA 1AXGA 5FCDA 5GVRA 1TE2A 3ESRA 4MYSA 4C4TA 1UR5A 5A3SA 4KRGA 1D03A 1OXUA 1F60A 1UKEA 3MMSA 4BMNA 1P39A 2BMEA 1BXGB 4QDOA 2FEXA 3B9QA 4LGYA 1VLMA 3N70A 3P5BA 3L7MA 4XGQA 3QYPA 2FG6C 4RVGA 4CKEB 5I9BA 3FPKA 4EZIA 3D59A 1U9CA 2HLDA 5LN1A 3DC2A 2X2EA 2RONA 1QMPA 5DLYA 1N9GB 1TPYA 2QUBA 5CT8A 1PV1A 2BONA 2C2MA 3IESA 4WNIA 2P8JA 1IUPA 1PS9A 1M76A 2NQ2C 4E5VA 1YKGA 3RVKA 3OKFA 4UEOA 1O2DA 3DHVA 3ZCQA 1DAPA 4CJXA 5MGNA 2P11A 3JQ6A 3NHKA 3DF7A 4OL0A 1MAVA 4CKWA 3HFJA 3NV9A 2X5OA 1L4MA 4DLAA 2Q1YA 2VYND 2KHZA 2ZJOA 3E23A 4D9HA 4RTOA 2WQ6A 3KDSE 1N6PA 2F8LA 2ZYWX 5C7OO 3KPVA 4DNPA 1BDMA 2E82A 2VTDA 3RFUA 5J9FA 3U0BA 4TVBA 1SKUA 3DC7A 4GICA 3SMVA 3FHTA 2YYSA 4CLXA 2V1XA 3GJ8A 1QHXA 3ZJVA 2PRIA 1U8UA 3WYCA 4CKXA 1SN7A 1TJ4A 2HRRA 3RSQA 1IN5A 2JANA 3QKSB 4PGFA 1X7YA 3LXRA 1LDNA 3BIWA 2CEKA 3WLLA 2WYWA 1GZDA 5TLSA 4BRSA 3HVRA 1VOTA 5HF8A 1NQXA 1KZGB 2RHMA 1Z12A 2PXAA 5FUWA 4PLGA 4DR7B 3PHJA 4ER3A 4X85A 5HOEA 4F6RA 3FOCA 4EHNA 1JEQA 3FFXA 1XO1A 1XYYA 2CW5A 2XYRA 5FPKA 2BTEA 3NMUF 5FPHA 5AXDA 3DUWA 1Y37A 1JG3A 2UV8A 5ECWA 5F21A 1DZ3A 1S8AA 2XMBA 1U0FA 3JQRA 4HQLA 4J2TA 4WKPA 1NBWB 2NUTA 1ZQ9A 5DBIA 1PF7E 1IZ8A 3LY9A 4MRMA 1M2HA 4UJ3A 5IJXA 3S70A 4CF5A 4TKVA 4NYIQ 4RZ2A 3X1ZA 2FVXA 2Y9MB 4DFDA 1W0KD 2CDAA 2DHCA 3L8EA 4WL0A 4F38A 5FUXA 1EFKA 2FX3A 2Q4EA 3DM9B 3STTA 1R9JA 2OV1A 4NENA 4IGIA 2V8BA 1YZTA 1F4VA 1RC0A 3JATB 5MN4A 3LI2A 3O4VA 4B74A 2I65A 2ACVA 3JQ9A 2POQX 5FOXA 1J25A 1A27A 4QXPA 3GFRA 3QUAA 2J5KA 5ENVA 3WJAA 1O0BA 4HAYA 3OT4A 2VJCA 5E6UB 4CFSA 4HJXA 4UJ5A 4X71A 3F1KA 1OX6A 2DR3A 4HL6A 1F8FA 1P29A 1XCMA 2FPWA 2FK8A 3OIDA 2V45A 2WPNA 4ZKEA 4EKEA 1OBFO 2DXIA 3DLTA 1ZNWA 1XZDA 2H2IA 2RGCA 4MVJI 4PINA 4QXOA 3TZBA 4C4OA 4HUJA 4RPCA 5KU1A 5FB3A 1WMBA 4A2CA 3PNBA 5H70A 2DPHA 1PBTA 1JDBB 2GVDC 4RACA 4XKJA 5EXSA 5FBWB 4JXXA 1MAHA 4PLWA 4KXUA 4QUJA 1PX0A 2HSWA 1UMCA 1WSDA 4AN1A 1E7SA 3R75A 3TFQA 2HMVA 3D8UA 3OBBA 1E1LA 1R0CA 1U7ZA 4GD3Q 4EM6A 3SKXA 4OQPA 3N3BC 3L7IA 4KMSA 4S3MA 2WU8A 3BK1A 1RCTE 1YQWA 1M6YA 3MWEB 4DOMA 4YCSA 3TLZA 1FTSA 5PNTA 5FA8A 5EWJA 4CQLA 4RKYA 4RPIA 1XJCA 3R3JA 1GLNA 2A5FA 2HDHA 4U6QA 4X54A 4HUQB 1D4OA 2FUG6 1E2GA 8ADHA 4RTSA 2ILTA 3QFCA 1P5ZB 4B2IA 3CRQA 1GARA 3IS3A 4DCPA 2EFHB 1KTVA 2V65A 3P8ZA 1R7RA 4L8VA 1JQAA 3L1VA 3TEMA 2ZYDA 3VKWA 3B60A 4REQB 1V9LA 2GWHA 1K8RA 1NWCA 4ZOLF 3RSGA 1Q20A 4HDQB 2L69A 4NMWA 4KIWA 1KMCA 5CT6A 4EGSA 4V0OA 2W0MA 4G1CA 5JCOC 3C8MA 1XELA 2HEGA 3A6DA 4JB8A 4MS3B 2OZPA 4FNMA 1GL6A 2VT3A 4Q9JA 4L2IA 4RH3A 3RBZA 1N32B 1FQWA 1B3RA 2Z5FA 3E8MA 3JSAA 4URHA 2G9NA 2O5EA 4F5EA 2QEQA 2D2IA 3BM5A 3AHIA 3DHEA 1D6MA 1QB7A 1TYEB 4LBYA 3UXHA 5KQRA 1QV7A 1ZA2A 2PFKA 2PWPA 4FS3A 4NKRA 5CCDA 3WWDA 1F06A 5BSEA 1YZFA 5IT5A 3QE9Y 4RESA 3M5WA 2H48A 3LCVB 4MSUA 5AH0A 4G5YA 3G0IA 2HHAA 4KSBA 5J59A 2WILA 5AUOB 1DOZA 1P2DA 1SB9A 5I9MA 3UJNA 3MEQA 3JZMA 3ROTA 3AR2A 3W8EA 4F3TA 3A9RA 2Q6TA 1Q3TA 2HBQA 1EDDA 3I53A 3OZAA 4YRCA 3AJRA 4MA4A 5CBPB 3R3VA 3QYAA 5G1PA 3GRRA 4ESEA 1OAKA 3RR2A 3GFFA 5H81A 3C3EA 3I9V6 2JRCA 3TG2A 5HUQA 3ICCA 3QEOA 4MEBA 4WKGA 1YRBA 3K5HA 1KJZA 3P52A 2ID9A 2QUAA 3IH5A 3PJFA 3C6XA 5CIQA 4KX3A 4JXKA 5DNCA 5DN6D 3CRRA 1G17A 1I3MA 3EUFA 2RGRA 2ATXA 3MSCA 4JEHA 1XRQA 4ZQGA 2PV0A 4OSEA 1SNYA 2B8JA 4OHMA 1AT1A 4XIIA 4BO6A 1NVBA 4MKXA 5A6SB 4D3DA 4DQUA 2GZHA 5KNCA 1L4FA 1NNEA 1UP7A 2WT4A 3ZNOA 3LQQA 3NOQA 4PZ9A 5BV7A 5A3RA 1H6CA 3NBYC 3GJ4A 4RCYA 2B61A 1Y4UA 3MXOA 1THMA 5HG0A 3EIXA 4J1TA 4WXYB 1OC4A 2FE4A 1XVUA 1YKSA 3LUPA 2QL6A 4KXNA 3TCNA 5BUQA 1U81A 4N3GA 1VSBA 3KDAA 4OLAA 4G0OA 1GTJ1 1PDVA 3R7DA 5SY4A 4ACAA 4B4OA 2CXPA 2WM3A 2VP2A 1A04A 2ENUA 4O4IB 3RAPR 2UZ1B 2ISSD 3R9WA 1JSLA 1OAAA 1ZD5A 2WDZA 4RJJA 5DXFA 3LIPA 5GJWC 1I10A 3DUFB 2HHHB 2AD5A 4PZYA 4FSHA 1RRMA 3H8JA 3N1UA 3H5LA 4JDPA 4MVJM 2BGRA 2HPHA 4YI5A 1F51E 1WTAA 3TIIA 4D4KA 4RTKA 3ZV4A 5I7RA 1UADA 3FVRA 4JK3A 5J63A 5TGZA 4BNMA 4U7WA 1NI5A 2A7QA 3FMVA 4R7ZA 4AXBA 4FZ5A 1X1EA 1KIMA 3Q2IA 4PAQA 4E5YA 2OHXA 1GGHA 4IINA 1EFHA 4BNTA 3BHNA 2WG1A 3BMOA 3WKEA 5T3UA 4AYWA 1SD1A 2BTQA 5CXXA 1PZEA 4IDGA 1EM8B 1MC8A 2QG6A 1GRNA 2AE2A 4V0MA 2GI4A 5IEBA 2A9PA 2I4TA 4GL4A 4DA7A 2JJ2D 4TZTA 1N2JA 2VWGA 4G8BA 2X0EA 1CIPA 3VYVA 3UAZA 2I9KA 4TSKA 1NBHA 3QXCA 2JZNA 2KE5A 4TT3D 1PFQA 4N0EA 4BC1A 3PFCA 2CJWB 1W1WA 3PEFA 1M7GA 2BGTA 3LC2O 3L3BA 2AN3A 1KRHA 4OXXA 3P2OA 2XUIA 1ZY2A 2KS6A 3EGVA 3LPDA 2J9ZB 3NWOA 3OCYA 4HWTA 3DM5A 3LL4A 4IJVA 1MTOA 2PGLA 4LDPA 1C7QA 3ZYCA 4BZPA 5KTMA 4LQ4A 4DY6A 2DPMA 3L07A 4L1KA 1CJKC 2IV7A 1PJ8A 5K4AA 2WHXA 5IYZA 1KVUA 3DMRA 3VTAA 5LD2C 4E94A 4GLOA 1A82A 2ZJFA 3NKFA 2JCXA 5F78A 3TAHA 2W4IA 3AIOA 3MTBA 3EIFA 4IKPA 5A05A 2O8DB 2C2WA 2ZKIA 5ALGA 1PJQA 3C1OA 4CIWA 4Q4AA 3OX1A 2OGWA 2WBLC 3U4AA 3V00A 3OCZA 3RYCA 2WINI 2CB9A 1R9MA 4P22A 5ARCA 3KKPA 3EN0A 4HOYA 2XB6A 4AUEA 3SEZA 3LGSA 4F6CA 4RGBA 2ZJ8A 1C9EA 2C5HA 4IZOA 4LEIA 3DV0A 4ZXFA 3AIIA 5KOIA 1Q74A 4OHOA 3RHFA 2CFRA 3SLKA 1RXWA 4YROA 3PDUA 3NTRA 1PQWA 1IRIA 2DCMA 2IYPA 2VNAA 3GJ7A 5HE8A 2NO9A 3WNBA 1RXVA 4E22A 1AHPA 5CVDA 1ZUHA 3GCDA 4MRMB 1UFRA 1NBOA 1YA4A 3BBPA 3R2JA 4R2LA 3ZWYA 5JE8A 2XOKD 3HWWA 3GGDA 2RBEA 4EVRA 3ADCA 4ZARA 3AP1A 2W2TA 4NZYA 2W93A 3N0RA 5CM2Z 2HCFA 2PKQP 3NYIA 4DKXA 1KQFA 1MG5A 4LHZA 5LP6A 2XXBA 2ZQZA 4XYLA 4KN6A 4B84A 4IIJA 4UMEA 3ZDYB 3L2OB 1FB5A 3K2EA 5KTOA 1SD5A 1BXKA 4LMRA 4TM8A 1YB4A 2OE2A 2QZSA 1MABB 3GEGA 3S1LA 1NXQA 3INGA 2A5DA 1KOGA 4MB2A 1NF2A 2O07A 1DQYA 3PUKA 1MMFB 2BFDB 4FZVA 2IH2A 1TO2E 3OM0A 3PWSA 3WGMA 1P8JA 2CHEA 4CT0A 1RD4A 1T9ZA 1U0HC 4BHTA 3X1DA 1QQAA 1HNZB 1C8BA 3HMKA 4JJFA 4CM8B 4MR7A 2Z57A 2X2FA 3Q3JB 1FDVA 4MDYA 5KNCH 2ZU0C 3EVAA 1Z16A 4FR2A 1NPYA 2FEAA 2A9FA 4TXJA 4X6YA 3ZU4A 4DBLC 4NG5A 3DOUA 1ZYUA 1TM3E 1KQ3A 3CTPA 4M55A 3IP6A 2B7CA 4DMLA 4ZVQA 1JTVA 1FXSA 1YIOA 3OZVA 3NDPA 1YDHA 4GI7A 4PQRA 4QBFA 1UEIA 3AUFA 3JQAB 3NWJA 2ZB2A 4FHCA 1XVAA 4MR8A 4PNZA 5F12A 4OHXA 3R3SA 5I7OA 1NMXA 1L4EA 4FMCB 4HYTA 2IP4A 1WMAA 4WZ6A 2QGFA 1RJDA 1T5SA 3WDLA 4B7ZA 3VMFA 3BXPA 3AW8A 2X6RA 3CO5A 5J4VA 1WU8A 3OIVA 1X42A 4U5QA 5H0IA 4WMLA 3H2IA 5FOVA 2VDWB 3TD6A 3K0AB 3OT1B 4NV1A 4Y2PA 1RAIA 2F1HA 4WNYA 2ZUTA 4NPAA 1K2WA 1L7BA 1OH7A 4YMSA 3N8DA 4MV9A 4UBNA 5DRYA 2HA5A 3MJSA 3NDIA 1WD5A 5EWJB 5CA0F 1U2GC 1P1IA 1I0LA 1XNGA 2J67A 2YWHA 4U7HA 3A1WA 4UTNA 4IOJA 1RXUA 4UFPA 2W2MA 1GOTA 1W6RA 3LM8A 4KQCA 4N7BA 2NXNA 4IG4A 1A76A 1PCXA 2R44A 2A9QA 3K0FA 3N2ZB 4HRVA 5K3OA 1TQ4A 1XTRA 1YFZA 3IP5A 5KQLA 1VXOA 3AI3A 5ITZB 1ZR4A 1M34E 3GLHB 3IAEA 4GSKA 1E9EA 1K8YB 2PPVA 3TZ6A 4A8JA 3KFXA 3O8QB 1CE8B 3L06A 4LDAA 4D7AA 1ESDA 3EQ7A 3DZJA 3PHCA 4ND4A 1NV9A 4HQFA 8OHMA 2DP4E 3EZYA 4JC8A 1XNQB 2QB5A 2YWRA 2AN5A 4YP9A 2Z30A 4P3YA 1AKNA 3PKJA 1A9QA 2GZAA 3SQOA 4EHIA 1JUDA 3UFBA 4OYRA 3UT6A 3I32A 1WXWA 2KLHA 4BMZA 4BXOA 2GBPA 4ICIA 1NBIA 4YALA 1B00A 3UZUA 1WKCA 3I1IA 2B69A 4RNDB 3B13B 3LCCA 3SM3A 4GX5A 5BSWA 3K5WA 1TC2A 4RV9A 5D7NA 1M1XB 4CI0B 1NQVA 2CNWA 1H9AA 1YS6A 2ID4A 4MR9A 1E61A 1P5FA 3ZKWB 3S44A 3HUEA 4RFSB 2XIQA 1L5NA 3RTAA 3CX8A 3D6FA 4OM7A 4BRUA 4C1BA 2YNMA 1P3Y1 2B8TA 2EZ9A 3VKFA 3VVMA 1I6WA 1GN9A 1AZWA 3B8EA 3L7NA 4FE7A 1AG9A 1DZIA 5DHRA 3NT5A 1PFWA 2EZUA 4W5TA 2NP6A 4W5NA 4DR3B 4A1OA 4RHFA 5IXJA 1PO7A 4NOJA 1JH8A 4Q3DA 4B0OA 4TTVA 5EXDA 3U3KA 2WB4A 2CBGA 5DLPA 4PZ0A 4JBYA 5B2FA 3IILA 1DTWA 1JT9A 1UZAA 4WY2A 2WABA 2XQVA 4YP1A 3G1WA 4E13A 5K2OA 5CURA 5DV9A 4RZQA 1UKVY 1XRJA 5I3ZA 2L82A 1Q7GA 3PPYA 2FPPB 4PEVA 4YV2A 5CYGA 3IEPA 4BO7A 4GT1A 2H3HA 4YUZA 4PYNA 1QX4A 3CT4A 2YRWA 3FPLA 3MQFA 5LP6B 3GBPA 4RZSA 3TWOA 1P9NA 4DPKA 4F6LA 4EPVA 4ZCIA 2OV4A 1UFOA 4JP5A 4L8YA 2FZWA 3QFSA 4NK5A 4N0MA 4IAOA 1UCFA 3GRFA 5IAGA 1MABA 3FTPA 3JARB 5ITWA 3RS5A 4MARA 1W29A 3N2KB 5DMHA 5EKSA 1NBAA 2HQOA 1QC5B 2NW6A 1DG3A 4UNQA 2V6JA 5LYJA 5JNWA 2ZIWB 4J75A 4E03A 1NJGA 2OO5C 4P2BA 1L7PA 3KOXA 3KSRA 4JQOA 3T9DA 2ZJBA 2XJ4A 1LFAA 2HD4A 4P98A 1B8NA 2NYRA 2RH4A 1PR9A 1U5BB 3ASYA 1KVTA 4FKBA 2QQ5A 1HNNA 1I51A 3QNMA 3SC4A 5JS6A 3O21A 4BWGA 2H08A 4L5IA 5IM4F 4TV9B 4JJKA 4LYGA 3W79A 3SHOA 1XTZA 2BHLA 2JAOA 2JGKA 4KPUA 3UTDA 5MN5A 2IHYA 4MKFA 5BO5A 2XA2A 2D1SA 2ZJ1A 4ZQIA 1PWXA 4JI8B 1NMYA 1Z35A 3LT1A 1NZJA 3HCCA 5CPFA 4CM7A 4V0SA 2AOWA 5AI4A 1QOQB 4BQRA 1E58A 5LZ4A 4CLEA 2OQIA 1LWOA 4GOND 4Z3DA 5NLLA 4UDNA 5K6TA 4EA8A 1U65A 1IOLA 3BWEA 4HAWA 4BTEA 1Y6QA 1RLIA 3SVLA 3VR2A 3W3AD 5JS2A 5EI5A 5EMLA 1VG9B 5G4KA 3GX1A 1R0LA 4GGPA 4M7WA 4B7UA 2YIMA 3V33A 4BNVA 2R79A 2FR8C 2V7GA 3FGPA 3EEOA 3O7WA 5AXCA 1WPGA 1NMQA 1VCOA 1ZCAA 3QX7A 4J16C 1ECLA 2Y0EA 3QV2A 1DQSA 4Y9DA 5JJBA 5ADHA 2AFHA 1NYLA 3EBOA 5AOVA 1S4QA 3U3DA 1W2HA 4Q1BA 5TPWA 5JQGF 2CFIA 2UXCB 3QI2A 5CA1B 1F38A 3BDIA 3UH0A 3MGCA 1OWLA 3K0HA 2VT7A 1MIOB 2OFXA 3KVOA 1U2QA 3QPVA 3U16A 2IELA 2MWMA 1GP2A 1UL1X 2YHIA 3UNXA 1GILA 3MT0A 2I8CA 4KN8A 4O4HA 1GRRA 4J7UA 4E5UA 5LLTA 1X0XA 1V5GA 3GUCA 3F3KA 3MWDB 3TW0A 5JALA 4N6NA 1E1QD 1KZ1A 2AI2A 4V1CB 2C83A 1L5ZA 3GWGA 3G5AA 4M9UA 3SXUA 5JH7F 4V2UA 3DBVO 3RDPA 4D9BA 3GT4A 2B36A 3GEEA 3RKRA 4P38A 2CNWD 4OHRA 4FSXA 2R96A 1P18A 1XQXA 1AGRA 2O2ZA 5AK6A 2VUTA 1Q3HA 4LVNA 2JDID 2J4FA 4G4SO 3RAEC 1JHVA 4GUDA 1TKRA 5C4IA 5KNDH 3E05A 4ZQFA 2NPOA 3C4VA 3IJEB 3TLCA 3UHJA 4LZAA 2CHUA 3FNHA 4I0WB 2Q3HA 5KNLA 3QKSA 4ITUA 3OETA 2EKBA 3FOBA 3AEKB 5AKLA 5EERA 2W4MA 1IZ7A 4FWBA 5BN5A 1JZTA 2SBTA 3N8IA 3BORA 1QPGA 4X1IB 2FGJA 2LCQA 3T52A 5EHZA 3WI7A 5MFZA 2AVDA 3S1SA 1AF4A 3EZFA 4G41A 3CT6A 3IAUA 5FL7D 4CDGA 2ASEA 1SVLA 3UOGA 1UJ6A 2C9DA 3TE6A 5J58A 5LQJA 2ZIXA 3WK9A 3ZCXA 2WQ7A 4KXXA 1EWTA 5LP6F 2NVUB 2Q28A 2EGUA 5JHHB 5LBIA 1LTQA 2Y0PA 1D4ZA 1CZUA 4JYAB 4MGEA 1ID8A 1MTZA 3DZIA 3CF0A 1JMKC 4D99A 1CY2A 1Q0LA 5DTEA 5CH8A 1JKMA 4EMUA 3WQHA 3HDGA 4NOKA 5BMVB 3DHNA 4F7DA 1BRMA 1PW5A 1YH3A 1PJ4A 2DF8A 3HZHA 1ESZA 3SBXA 1U3WA 1K5DA 4RHYA 1M3SA 2B8EA 2DAPA 3E58A 1U04A 2R5FA 1Q22A 1HQCA 4GNRA 1QK5A 1YRHA 4K26A 5KOYA 3K73O 1A8SA 2HWWA 2I3GA 3C3AA 2R1TA 1ZOOA 1K9VF 2YC4C 2UYHA 4O59O 1T43A