1Q0ZA

Crystal structure of aclacinomycin methylesterase (rdmc) with bound product analogue, 10-decarboxymethylaclacinomycin a (dcma)
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
297
structure length
297
Chain Sequence
SERIVPSGDVELWSDDFGDPADPALLLVMGGNLSALGWPDEFARRLADGGLHVIRYDHRDTGRSTTRDFAAHPYGFGELAADAVAVLDGWGVDRAHVVGLSMGATITQVIALDHHDRLSSLTMLLGGGLDIDFDANIERVMRGEPTLDGLPGPQQPFLDALALMNQPAEGRAAEVAKRVSKWRILSGTGVPFDDAEYARWEERAIDHAGGVLAEPYAHYSLTLPPPSRAAELREVTVPTLVIQAEHDPIAPAPHGKHLAGLIPTARLAEIPGMGHALPSSVHGPLAEVILAHTRSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of aclacinomycin methylesterase with bound product analogues: implications for anthracycline recognition and mechanism.
pubmed doi rcsb
source organism Streptomyces purpurascens
molecule tags Hydrolase
molecule keywords aclacinomycin methylesterase
total genus 105
structure length 297
sequence length 297
ec nomenclature ec 3.1.1.95: Aclacinomycin methylesterase.
pdb deposition date 2003-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1q0zA00
1MTZA 3C8HA 1ACJA 1MJ5A 3OG9A 5SYMA 3STWA 7YASA 3UUFA 4C87A 3JW8A 1LNSA 2DR0A 5IVKA 2ES4A 2XQGA 4MEBA 2C5FA 2D5LA 3EBLA 4TPKA 1E8MA 2VQ6A 2C4HA 1YB6A 3AJAA 2W22A 5JAHA 2WIKA 2OQVA 4EY4A 3WI7A 4DSAA 5KWIA 3AZQA 4W1RA 3I2KA 4WJLA 1DINA 1J06A 1CUDA 4E11A 2QUAA 2J3DA 5JAPA 5AI9A 2Y1KA 4ETWA 3RLIA 3LP5A 3NOXA 2PU5A 1THGA 4FNMA 3GA7A 1GKKA 3QZUA 4EY8A 5K3FA 3C6ZA 4GHWA 1ZD3A 5AM2A 1W52X 1W76A 1TKRA 4BATA 1R1DA 4PW0A 4C4XA 3FSGD 4HXFB 1LBTA 4C89A 4QLOA 1FJ2A 4FNGA 5AK6A 2HU7A 5E4JA 5JD4A 3C70A 5AM5A 1BCSA 2VSQA 3BWXA 5E2IA 3G0GA 1YCDA 2VJDA 4PSCA 3K6KA 5BOVA 1WHTA 3G0DA 1VJ5A 1KEZA 1ORWA 1N5MA 1AUOA 1ZD4A 3C6XA 2JGJA 5CXUA 1XZIA 3Q0TA 4UHBA 3S8YA 5CH8A 4B9EA 3VDXA 1A8UA 3A70A 1JJBA 1X70A 1ODSA 5E4TA 5JADA 3VJMA 1ZIXA 3G9UA 1EB8A 5AKEA 4AX4A 1QONA 2JEYA 1T4MA 1WPRA 2GYUA 2GBCA 2WUDA 2WHPA 3FLBA 3HRHA 4B85A 4H7HA 2VATA 3WK7A 2G5TA 4BDSA 2AJLI 5AI8A 2O7RA 1U65A 1XRLA 4K6GA 4CG2A 3ZI7A 2C58A 4Q3LA 1GPLA 5IVIA 1BROA 1YR2A 2WIGA 1DT3A 3WIBA 4JH0A 3BDVA 1GT6A 3MVEA 1EDEA 1ODCA 5ALPA 2K2QB 2ZSHA 2H1IA 2BAGA 4A16A 3I6ZA 5ALIA 2PSHA 5EHNA 4P9NA 1O6FA 2XDWA 1Z68A 5ALFA 2PL5A 1QIJA 3IUMA 2DHDA 1Y37A 4X6UA 1ORVA 2ONCA 1CPYA 5AK3A 4INZA 1GKLA 4UHEA 1Q84A 6YASA 3VVMA 1ZJ5A 3R3XA 2WLSA 3QMMA 1VA5A 1OILA 3L1HA 4F60A 1ZJ4A 3G02A 3I2GA 3WZLA 5JALA 3HXKA 4IQ4A 2CMFA 4TVKA 3JYHA 4Q3OA 2CJPA 2QTBA 5CRIA 3H1BA 1WPXA 2VJBA 1EI9A 5CT4A 2HA4A 3MGAA 3DKKA 4Y2YA 3O9VA 3IURA 5CT9A 3WL5A 3WL7A 5EFZA 1CUUA 4XWGA 5A7HA 4QDZA 1LPSA 1YA8A 3G9TA 1HBJA 3SWWA 3RM3A 1VOTA 3DJYA 3BDIA 3FOBA 3DNMA 4E46A 1WOMA 5CH5A 3IDAA 4L72A 2XMBA 3V9AA 2VT6A 5HK9A 2XLCA 3PI6A 5ALHA 4Y2PA 2C0QA 4LIPD 4ROTA 1LPNA 1P0MA 1UT6A 5ALWA 4WFKA 1ACLA 2JGEA 1O6GA 1VZ3A 2YASA 2XE4A 3I28A 1JJIA 1LPOA 2XQJA 3W05A 5AM1A 1TQHA 4K6HA 1QE3A 4BBZA 2PUJA 5K3CA 2DQYA 4GBGA 3KD2A 4MEAA 3ZV7A 2XUKA 2WFLA 2XQFA 2WIFA 2VA9A 2OCKA 4GW3A 1QFSA 3F8SA 3IA2A 4OCZA 1CUYA 4Y2JA 4A23A 4KE9A 5AI4A 4XIIA 4U2CA 3NUZA 4P08A 3DLTA 4K5QA 1XRPA 4H7EA 4LHEA 3AIMA 5AO9A 3MUOA 4H18A 4BVKA 2H9YA 5JZ9A 2XMZA 4EB0A 2B61A 1PJAA 5AK4A 5AKGA 2OGZA 2DHCA 4Q1VA 1HQDA 5FUMA 3EF3A 2OCLA 3W04A 3O4HA 5IVDA 2QZPA 3BL8A 4Y2RA 1HLGA 4QZVA 2BGRA 4K6KA 4X93A 3TRDA 5EIHA 3QVMA 3WKBA 4AB1A 3FLEA 2VAXA 3R41A 4OUKX 4C88A 1QIMA 1WM1A 2NW6A 3AFIA 4QDXA 2PKYX 4BCCA 4XVCA 1S8OA 5HQ3B 1XZMA 5EIAA 3W2TA 3EIOA 4X3CA 4DLNA 2V9ZA 1EINA 2Z3ZA 1W1IA 3C45A 1QIFA 4BC0A 1YAJA 2VJAA 5IKXA 1GZ7A 4Y2UA 2ACKA 1XLWA 1CVLA 4F5ZA 4G1FA 1X2BA 2O2GA 3KOOA 1FFAA 2WTNA 2XUPA 2HA7A 3DOIA 1HDEA 4C4YA 1XZJA 3DKRA 3OM8A 3BXPA 1GQRA 1BE0A 1XKLA 3H2IA 4BZWA 5LKRA 5AIAA 4RE5A 5AKLA 5CT8A 3B12A 4FDMA 2PSDA 5J3JA 2XUAA 4X85A 5JANA 2EDCA 5HQ3A 1D07A 2HA6A 4OD0A 4B9AA 4H7FA 4NZZA 3DD5A 4EY5A 2PU7A 5CMLA 1JU4A 3B3QA 1XZDA 2V97A 4H35A 4QEKA 2AJCA 1XZGA 1XROA 2AJ8A 1BU8A 1L7AA 1ZI6A 4UBJA 3G0IA 2V96A 4H7DA 1CUVA 4C6HA 4EY7A 2R8BA 3ZLTA 1CIJA 3E0XA 3W9BA 3WWEA 1MAAA 4KAAA 4YPVA 5CT5A 4PF1A 3FVTA 2WU4A 3S2ZA 4B0OA 4OB7A 1VZ2A 4X90A 3L1IA 1GPNA 4NS4A 4AO7A 4BP8A 4WFJA 3O0DA 1DWQA 4O08A 3D0KA 4QA9A 5DJ5A 2PX6A 4UHHA 2VF2A 1XRQA 1DTEA 5K3DA 1TIBA 5K5EA 1GXSA 3QYJA 3HYSA 3RK4A 4BTLA 2XUJA 1C7JA 3KSRA 4PV7A 1EK2A 4ZV7A 1NU8A 2CEKA 3WWCA 5BWCA 4LXGA 1VLQA 5AKKA 3IB3A 4ZRDA 5AKIA 1QIHA 2GBGA 5DWDA 5AIBA 4W9RA 1SCKA 2PPLA 5ALOA 2WIDA 2ZVDA 3G0BA 3U1TA 3ZPXA 1AMNA 4B81A 1W75A 2BKLA 5ALEA 4CIBA 3DEAA 1FSSA 5LLSA 2EDAA 3RARA 5AKYA 5CBKA 4G4GA 1QO7A 4FBMA 1E5TA 3AILA 4B82A 2PSFA 5T4BA 2Z5GA 3HJUA 4ARBA 2B4KA 4BCDA 1J2EA 1JT2A 2FJPA 1XZCA 3IUJA 3I6MA 2PSEA 1QIKA 3N0TA 2JF0A 1G4HA 1L7RA 3I2JA 4MWTA 3F67A 3WL6A 3R3ZA 3M82A 3D5EA 4BAZA 4BRZA 4W63A 1UKAA 2Y2UA 3HABA 4CG3A 4J0KA 2JEZA 2Z8XA 1CUCA 2J4CA 3WL8A 1THTA 5HF6A 5KWJA 3F97A 2FJ0A 5DYTA 1AC5A 4OU4A 2EEPA 5HFNA 1XQXA 5ALZA 4OSEA 3ESAA 2XI4A 5AI0A 3V1KA 1MNAA 2OCGA 5K3BA 4BAGA 5DNUA 5BWBA 1MU0A 2WHPB 3D3NA 4DGQA 2DQZA 4DYHA 1Q0ZA 2I78A 1CUXA 4WCVA 3PICA 2J4FA 5JARA 2ZJFA 2WILA 4W1SA 2VAVA 4G8BA 5F4ZA 1SOMA 3WA7A 3OPMA 4UBIA 2RHWA 4XJVA 4KAFA 3AZPA 2ZYSA 5LZ2A 4B84A 4I19A 3VJKA 1JU3A 5AKJA 3FAKA 3D7RA 5AHXA 4QWWA 1QGED 1EVQA 1EXWA 5HF9A 1GGVA 5AM3A 3WK4A 2HA3A 4Y2XA 3DS8A 4N8EA 4BP9A 2X5XA 5T4HA 3STVA 4UBOA 3BJRA 1UK7A 3C8DA 2V98A 4H77A 3WMRA 5AOBA 3FLAA 1YS1X 2B20A 5FXMA 1U2EA 2OCIA 4NVRA 3GUUA 2OXEA 5EI5A 4GLBA 4ZI5A 3UUEA 4MQLA 2HU8A 4OB8A 3A6ZA 4EUSA 2Y6VA 2JGKA 2OQIA 2BJHA 4J0GA 4LXIA 5ALXA 1MN6A 4LKOA 4P92A 3YASA 1HPLA 5C81A 4HXEB 1CR6A 3GZJA 1MAHA 4Y2QA 4BVJA 4Y2VA 2AJBA 4X94A 4WDRA 2X8BA 4RE6A 1ZD5A 3IUNA 5LKAA 1XZLA 5AKZA 3G0CA 4OB6A 5DYYA 3PF9A 3BIWA 1QIIA 3C5WP 1B41A 1QIGA 4FLMA 5DYWA 3PFCA 1MO2A 4EBBA 3FBWA 2QJRA 2WJ3A 2PBLA 2WUGA 1LPPA 5EGNA 2BUBA 2ORYA 2I3ZA 5SYNA 4ZREA 4FBLA 4G9GA 1YB7A 1H2YA 2QKYA 4M0EA 5FLKA 3G8YA 1UKCA 4JUIA 4G9EA 4V2IA 1CUEA 3E1GA 1B6GA 2CZQA 5FOQA 2XMGA 3VJLA 2JBWA 1QTIA 5LIPA 2CBGA 5AK5A 3E3AA 5I8PA 3WK6A 2P8SA 4CCYB 1EVEA 1R9NA 4BYMA 1QZ3A 2IITA 2XUFA 1DT5A 5CT6A 3IIIA 3ANSA 5HKBA 4WY8A 4H7IA 1XZKA 3O95A 2XMSA 2XQKA 2UZ0A 3OTQA 3RKSA 3ED1A 2WKWA 2C5GA 3FYUB 4LYEA 5DNVA 4FFWA 2JGMA 4OYYA 1X2EA 1R50A 5BV7A 4CCYA 4X71A 2HFKA 2BFNA 1U4NA 2XUGA 4C01A 1LPMA 5AM0A 1FFEA 2GZSA 4W1PA 4JNCA 1IUPA 5KREA 2JGFA 3D59A 4MYDA 4U2BA 3DOHA 4KRYA 1RWQA 4C4ZA 3I1YA 4FTWA 3WJ2A 1E89A 3ESCA 4L3WA 2W6CX 4DNQA 5ALKA 4UUQA 3M83A 4DTCA 3H17A 4U2GA 1HL7A 1TCAA 2HL6A 1CUJA 1I6WA 4N5IX 3QPAA 3V1LA 2HHAA 5D3ZA 4Q05A 5ALVA 1E66A 5CH3A 4DM7A 1LPBB 1MT3A 2QXTA 4YASA 4AN0A 2I03A 2ZYHA 2B9VA 3JWEA 3DQZA 4PNZA 4N8DA 3QPCA 4PSUA 5LZ9A 3WZMA 3HACA 1H2XA 4PSDA 1XRRA 1VE6A 4MQMA 1K6EA 2PVSA 2AJDA 2G5PA 4KACA 3FVRA 1LZKA 5I9IA 2XUHA 4J0IA 4QE3A 4QDOA 1CUWA 2VJCA 1F0PA 2ZSIA 4UBNA 4XX1A 3B5EA 1QIDA 4JYPA 3UMJA 1HKHA 4FWBA 3FCXA 2ROQA 3KXPA 1IUOA 5H3HA 1VA4A 3IUQA 4AXBA 1JMYA 3BJMA 3DL4A 3H18A 4X97A 2JGLA 4QWMA 1K8QA 4P93A 5ALJA 2OAEA 3VKFA 4HTAA 3I1IA 3FYUA 5LZ7A 1A88A 2ZYRA 3VISA 2H7YA 4BB0A 2HU5A 2FUKA 3WWPA 2Y6UA 1J1IA 1QO9A 2RHTA 1LGYA 2XMRA 1JJFA 1G66A 1TAHA 3HC7A 1ZGCA 4BDTA 2O2HA 3PE6A 2QRUA 4DNFA 2XUIA 3BE8A 3H0CA 4KE8A 1AQLA 1ETHA 1OXMA 2PM8A 1CUAA 1XKTA 1CFJA 3H2JA 1Y7IA 4DNOA 4U2EA 3I2IA 3DCNA 5IVHA 5C7YA 2XT0A 4QDTA 3R3UA 4FLEA 4Y2SA 1ZOIA 3WKCA 1H2ZA 2OPHA 2GBFA 2AXEA 5EHXA 1GPKA 3WKAA 1BN6A 2I3DA 1H22A 5HFAA 5ALTA 2BCEA 1CUHA 2XQIA 1NX9A 4B0PA 3IULA 4N8SA 3H2GA 2WU3A 4AO8A 2QR5A 4L9AA 1K5PA 3ILSA 4QLAA 4YK7A 4ARAA 3BIXA 2XUDA 3DDUA 3V1MA 4CCWA 3WK8A 2ZJ6A 4DMKA 1KU6A 1SCIA 2HA2A 4BRSA 3O4GA 2OLEA 5FKJA 3LIIA 4DMHA 2HIHA 1ZI8A 2WUFA 1WCYA 4DSZA 4EA6A 3A2NA 4G8DA 3F9CA 1IMJA 1EA5A 2XUOA 4J7AA 2VEOA 3X3HA 4CIAA 5ESRA 2QUBA 5AOAA 5CXXA 5EHZA 1FFCA 1F0NA 2HRQA 1E8NA 1XQWA 5LZ8A 5HZGA 1OCEA 1N8SA 5JYCA 2RONA 5CURA 3WYNA 3CCBA 5K3AA 1EB9A 4GDMA 2OGSA 1BEZA 2G4LA 1DX6A 1L7QA 1AGYA 4IHAA 5C8XA 2VTVA 1MPXA 4DIUA 2PSJA 5KBYA 1IUNA 2Z3WA 3R3YA 3ANTA 4KJXA 4IH9A 3QMWA 5ALMA 1LLFA 1CEXA 2GBIA 4HRXA 4RNCA 2RAUA 3QM1A 4BCBA 1A7UA 3DYVA 4HS9A 3VXKA 1MX1A 4H7KA 1XLUA 4UPDA 1KU0A 3HSSA 3M3DA 1JMKC 5AKHA 3D2AA 2YXPX 3N2ZB 5ISMA 2J3QA 3BF8A 2QXUA 4QNNA 4CI9A 1M33A 1H2WA 2XMDA 2DSNA 5DLPA 1LPAB 1PV1A 4J03A 4GWLA 3C6BA 3HLKA 4TGLA 3HI4A 5JAOA 1TRHA 1ZGBA 2DCMA 3K2IA 1XZFA 3WQHA 1FFDA 1UK8A 3TJMA 2WFLB 4UHFA 4X91A 5JZSA 3C5VA 3IBTA 1WB5A 4FHZA 3HZOA 4KAJA 3G7NA 4KE7A 2YYSA 2QOEA 3G9ZA 1AKNA 3R3VA 4UBLA 1EDDA 4Y9SA 3O9MA 4J0HA 1EDBA 2WM2A 1UOQA 5AOCA 1LZLA 4J0CA 5T4FA 3ZWQA 3O4IA 4U2DA 3WWDA 4UFPA 1ZIYA 1R88A 5ALDA 3LS2A 3ICWA 4BE4A 2WIJA 4BVLA 1JI3A 5JAUA 4UBMA 1ODTC 5CTAA 1EHYA 4X92A 1UZAA 4DNPA 1C4XA 5LZ4A 1W4LA 5AI5A 1QJ4A 5E4YA 4BC1A 3TGLA 4F0JA 2JGIA 3QMVA 3FNBA 1RP1A 1K63A 5C8ZA 1DQZA 2HRRA 5AP9A 5HCUA 3STTA 1C7IA 2QVBA 1XFDA 2XUQA 4MYSA 4B6GA 3FYTA 3FCYA 2IIVA 2WQZA 3R3WA 2JIDA 5JZBA 3H19A 4A5SA 1AX9A 1SC9A 3H04A 4HZGA 3DYIA 3GROA 5LYYA 1QFMA 1IZ8A 1MX9A 4ZWNA 2O7VA 2ECFA 1ZI9A 3QITA 5ALUA 1TCBA 5DTIA 1G42A 3EQ9A 4I3FA 5AJHA 1ZD2P 3ICVA 3VVLA 3I2FA 5LP1A 5FRDA 5ALQA 4DMCA 5A7FA 4AZ0A 1DWPA 1XRMA 1LBSA 1UXOA 3OOSA 2CB9A 4NMWA 4H0CA 2XLBA 3EQ8A 1WB4A 1USWA 4ZV9A 5LZ5A 2RI6A 3WWOA 5A7GA 5EIEA 4BE9A 2HADA 1N1MA 5ALGA 1P0IA 1WB6A 1RYYA 1NU6A 1WHSA 3FYUC 3H2KA 1CV2A 3R0VA 5ALRA 3CCCA 4Q34A 3LIPA 1UK9A 1FFBA 1XLVA 3PUIA 3C87A 3SX4A 2Z8ZA 4KEAA 1J07A 5C8VA 2HDWA 5AICA 4GI1A 4I4CA 4Q3KA 3BF7A 1YAHA 3D2BA 2Q0XA 1VE7A 2HA5A 1XRNA 2QJWA 4DMFA 4BTVA 2G63A 4PO3X 1EX9A 1DU4A 2OGTA 3A2MA 4YX9A 2GYVA 4BZZA 5D6OA 5AKXA 1N5RA 1DX4A 1JKMA 2WG2A 1AZWA 2XMCA 1BN7A 3DL7A 5FPQA 3O4JA 2WJ6A 2D0DA 2RGUA 3GBSA 4X7BA 4ZXFA 2FX5A 1Q83A 4ITVA 2X76A 4CG1A 1P0PA 3WJ1A 3ESBA 4OYLA 4AO6A 4Z49A 3AINA 3TEJA 1DWOA 2HA0A 4E15A 1CRLA 1XQYA 2QM0A 4UHDA 1TK3A 1UFOA 2ZJ7A 2XB6A 1A8QA 5K3EA 5JD5A 3WKDA 3IVMA 1YASA 3STUA 5CW2A 4UFNA 5IH7A 3H1AA 3NWOA 1U8EA 4GEGA 2O2IA 3D4LA 3W9UA 2PUHA 3STXA 1Y7HA 5D3KA 5K3FB 5D7BA 4OU5A 5AI6A 4AQDA 1CLEA 3FSGA 3AIKA 4IH1A 2BUAA 3I6YA 4GXNA 3P2MA 4RPCA 1W6RA 2HM7A 2OG1A 3H2HA 5ALNA 4J3JA 2RIPA 4D9JA 4WDQA 5FPPA 3A2LA 4B7ZA 1XZBA 2GZRA 1TCCA 4U2FA 3WK9A 5ALLA 2WSLA 1E8DA 2CUTA 3GFFA 1G5FA 2WG1A 4MJ3A 4KYVA 2QS9A 4FFVA 4EZIA 3V1NA 3QBJA 5JATA 2WHRA 5EHQA 3PF8A 1IZ7A 4F21A 1CQWA 4AMZA 1BS9A 4KE6A 4HRYA 5A2GA 3E4DA 2H7XA 3EQ7A 3I2HA 1QOZA 5JIBA 1SFRA 3OC0A 2R11A 4KR0A 1UOPA 2WUEA 4M0MA 3KDAA 5JASA 2OAGA 3NGMA 4JYMA 4X6XA 2ACEA 2C0PA 1R3DA 4FOLA 4CFSA 1CUBA 3ZLVA 4UHCA 1E3QA 5AH0A 5T4EA 1CUFA 4MWSA 5AM4A 5FDFA 5ALYA 3U0VA 3OURA 3MUNA 5YASA 3W06A 2Y2VA 3GELA 1ZICA 3KWFA 1EK1A 3K9BA 4HXGA 2WHQA 5DTJA 3AIOA 4J0DA 4J0JA 1CQZA 1H23A 5HKAA 3ESDA 5A6VA 1XZHA 4H7JA 1AURA 2CKMA 1F6WA 3FWHA 3STYA 4BAUA 2WG0A 1R4ZA 3F98A 1P0QA 3WLAA 2BUCA 2XMQA 2GYWA 1R9MA 4X95A 3QH4A 2WTMA 4G5XA 5I7UA 4E14A 1XQVA 3M81A 3CN7A 4FLFA 3LLCA 1YSCA 4OPMA 1PFQA 1BRTA 2ZYIA 1QLWA 4LYDA 1MNQA 1T2NA 4AZ3A 3Q8WA 3WIOA 4Y7DA 4UBKA 4WY5A 1IVYA 1A8SA 1ISPA 1QTRA 1JFRA 3SC2A 3SK0A 5HK8A 4X00A 1CUIA 1UK6A 4G4JA 3T52A 2QT9A 3F96A 4UFOA 3V48A 3CN9A 4JEIA 1BCRA 3PFBA 4GECA 3AUKA 1XZEA 4MXDA 3LCRA 4AN1A 2HFJA 1CUGA 1YS2X 3WYDA 3L1JA 2WFMA 1VXOA 4IH4A 4AMYA 4HAIA 2E3JA 4Y2TA 2LIPA 3R40A 1VXRA 4HVTA 2BGNA 5FV4A 3G9XA 2IX9A 1UKBA 1UWCA 4B83A 1DQYA 4G4IA 1EH5A 4EHBA 4PQEA 1VKHA 3ZLUA 3C6YA 4X6YA 3T4UA 5ALSA 3C43A 2DHEA 3WKEA 1GQSA 3QPDA 5HF5A 4KRXA 2WFZA 1SCQA 1XZAA 3CXUA 3WK5A 1F8UA 4EY6A 3D2CA 5FP0A 1CUZA 1UOOA 3KWJA 3HEAA 4IO0A 2DFPA 2QMQA 4FKBA 4ZGBA 4RGYA 4WFIA 4W1QA 5HF8A 4K2AA 4QDUA 4FMPA 2H7CA 3PDCA 3AZOA 4L0CA 5A71A 1K4YA 3PUHA 4N5HX 2VT7A 4B80A 2WJ4A 1QIEA 4Q82A 1CUSA 5JD6A 4G8CA 4M0FA 1Q0RA 5DNWA 5A62A 4LXHA 4S0XA 1MX5A 1YA4A 1BEEA 2YH2A 2C7BA 3WA6A
chains in the Genus database with same CATH superfamily
1EX6A 4JFRA 4X24A 5G53C 1MTZA 4P98A 3EGXB 1U7DA 1TKBA 1MJ5A 1T6YA 4KHZA 4LSZA 4RORA 2YV3A 2Y0EA 3PQDA 3FZNA 1L8QA 4HGQA 4R5HA 3T1NA 4B6QA 3T54A 1K08A 4TWZA 2F3SA 1DADA 2IZ6A 2FRDC 3SNKA 5GZ6A 4AY5A 1EIZA 2ES4A 1U0JA 2BKEA 4IGKA 2NX2A 2CJXA 4DAOA 3IRUA 4KO8A 2CXQA 1N6PA 2HC9A 3EBLA 4MUEA 4MVWA 3AGQA 3C74A 1GQFA 2QTNA 1UM9A 1MVNA 2AFVA 2WICA 1E1RA 2VQ6A 2C4HA 3PFWO 4TT3D 5ICFA 1VHDA 3KOYA 3W3AA 2AEMA 2W22A 5EIWA 5I9TA 3W4KA 1S8NA 4ML3A 5JAHA 4IIVA 5LXTA 2KBEA 7ABPA 2VZ0A 2X1VA 1G0OA 3HUUA 3VR5H 3JQFA 2QDXA 2JG3A 2A4MA 3NXSA 3WI7A 1RAFA 1Y4DE 3FH0A 4AJPA 1AN9A 3PQ6A 3L7MA 2X42A 4PLTA 1TM1E 1P4AA 2VJLA 5E3IA 3MNFA 4J1SA 3AEUA 4MPJA 4RHTA 3W6OA 3P2OA 1AKTA 2RG1A 4OHXA 3KEFA 3V2HA 1Z2NX 4WJLA 4MI9A 2UZIR 2AS0A 2QUAA 3HLYA 4TRNA 1ZS9A 4O4IA 1ZU4A 3PP8A 3PX2A 1UP7A 5JAPA 1SRRA 2F8MA 2R4UA 1T2CA 3IHKA 5FUYA 5IJ0B 1YOBA 4ZT3A 5LA6A 4DAEA 1J33A 3W2GA 3LP5A 3NOXA 3Q2IA 1R64A 4RESA 2VYCA 2A84A 2ATCA 4HBZA 2BBTA 2NSHA 4FNMA 5DGDA 2ZBUA 1C2YA 3BPSA 3M1YA 3G7UA 3A4IA 3QXXA 5BURA 1GYRA 2YFKA 2ZSFA 1H0HA 3O6VA 1Q77A 3PDIA 2VK4A 1U9CA 1U4SA 1SY7A 3BYZA 3PUKA 3P0RA 1Q5PA 4JLUA 3UT0A 3QZUA 4DR7B 2JHGA 3ZI0A 1DKLA 2MMGA 3C6ZA 1FLDA 2IY7A 1ZD3A 3C3DA 4GHWA 2GCOA 2VP0A 5A2QA 1RWMA 3QIAA 2NO1A 2VSNA 1W76A 5F7ZA 5JDIA 4N0DA 2FZEA 4YXWA 2BSXA 2ZR7A 4KMOA 1TLFA 4IUDS 1KH1A 4LY0A 1UPUA 1WQ3A 3HO8A 3L0IB 2Q9CA 4UUMA 1B73A 1H05A 4FVTA 4K9RA 3DZ8A 3OJFA 3TTSA 3HQ4O 2D0OB 2BEVA 4LA4A 5JAIA 1V3UA 5KKNB 5HUQA 2ABWA 1JHXA 1EGMB 4FYKA 1Q7EA 3GLIE 5AVVA 3QELA 3TLCA 3CLTC 4L7VA 1FJHA 2GN8A 2ZYVX 4OXYA 1US8A 3L43A 3SPXA 1I4WA 2JLQA 3ETLA 4F7WA 4FM9A 3OMLA 4ZTUB 2GPBA 3W7AA 2HU7A 3CV3A 3OCUA 5E4JA 3OJLA 3C70A 3K2QA 3BSSA 4I4NA 4QVGA 3EVCA 5JD4A 1VC2A 5DHAA 5IT5A 2HNBA 4BMYA 2ZTMA 4QTUB 3M4YA 5B6PA 4FQ5A 1VKNA 4HNAB 2JFGA 3BWXA 3LC7O 4A7PA 4DXAA 4UCXA 1O96A 3H8WA 3K31A 1JDSA 3A4LA 2VJDA 3U81A 1YJ8A 2G4VA 2NYVA 3K6KA 3MFYA 5BN5A 5BUCA 4PLGA 1JIXA 2ZWOA 4IWYA 4IKPA 1CKEA 4M9QA 2IQ5A 5FWYB 4ZOBA 4N49A 2W8BB 3SZUA 1AUOA 2GXAA 3CA8A 1ZMBA 2FP3A 1XZIA 2QQFA 4KR7A 2IH2A 2JNWA 1SUFA 4NICA 4CT5A 3DMGA 1DX9A 4NBVA 5HKLA 3MTJA 4MA5A 3UCXA 3ZU6A 3M2TA 5JROA 3OQMA 4US0R 4YRGA 3ZJVA 3VU1A 2JLVA 2OT3B 3MGGA 1JIIA 1JJBA 1I4DD 1ODSA 5E4TA 5FULA 5JADA 3WL3A 4W8GA 3GIDA 3FPJA 1FMCA 3K0SA 1ZIXA 1OE0A 4OK6A 3G9UA 4ZARA 3IBYA 3R76A 3CX4A 1KDYA 5AKEA 3FGPA 3ETCA 4NYJR 4D0NA 4ZI7B 3LUGA 4REQA 4E6EA 4DOMA 3CUKA 4ZAFA 1JG2A 2GJKA 2IGTA 5CCXA 3MRTA 3GRPA 1SG6A 3E7WA 2I87A 3EYWA 1SUWA 1ZMTA 4B3HA 4QELA 1V8OA 5FI1B 1FMJA 4PBRA 4A82A 2QBYA 5HS6A 4B8ZA 3CWQA 4MRRA 4LTMA 5IS2A 3DOUA 3E48A 3KDSE 3ELBA 5AD1A 3SM9A 1A27A 5CBPA 4HSEA 5ER9A 1LJ8A 2NO6A 2UZ1B 3U61B 2REBA 4UCFA 1QC5A 3ZBTA 5D6NA 2P69A 1PNRA 2R65A 2ZSKA 4D3YA 3H5WA 1U65A 1KS9A 1SZPA 3DZFA 4WK0B 1L3CA 2C58A 1GPLA 1IZZA 2P5SA 2WK1A 4J90A 4LWOA 1X77A 5D51S 5EQTA 2PZEA 5IVIA 2H0AA 2XA9A 4MKHA 4YRPA 4BMDA 4GKJB 3KSBC 3ROKA 4ZYUA 2GFQA 1QV7A 3RYFB 2DT5A 1Q16A 1NI4A 4XD2A 2WIGA 4NHEA 3WP1B 4IJUA 5EXTA 1DT3A 4D81A 4ER7A 3NIDB 3T6KA 3NFRA 2DETA 3LX8A 5A9SA 5AW1A 2VZ8A 3WIBA 3OJEA 3NEJA 4HQ6A 3BDVA 4JOSA 4BIIA 2EIHA 2FK8A 2OD2A 3FFAA 1PSZA 1EDEA 1P81A 3PPYA 3AM1A 1ODCA 5ALPA 2ZSHA 4DKXA 4A16A 1VRCA 3I6ZA 3NRBA 1AD2A 1XDBA 5ALIA 3Q8LA 3RHZA 3PFGA 5EHNA 1HETA 1QPBA 2XTMA 3HVHA 4M8NE 5EESA 3K8ZA 1U3CA 3DE2X 1DAHA 1O6FA 3CH6A 3LQ4A 1JXOA 4XQGA 1CF4A 4BFVA 2I7CA 2QE7A 5E9QA 3R8CA 3LWBA 5I3CA 3RADC 2O8BA 1SH7A 2AEFA 5CK5A 1K3FA 3RS3A 4MV8A 1OJLA 2PL5A 3EIQA 4A2QA 1E1YA 2AMYA 2MR6A 5JH7B 4KQ9A 1IFXA 1OFUA 3K96A 2VXYA 4YC7A 1N4DA 2BF7A 1CQPA 1PWXA 1FTYA 4KQHA 3SOPA 5MN6A 1KH3A 1LVGA 2C4KA 2DWCA 3HCFA 1T8PA 4RSRA 5JFTA 4D25A 1QF6A 3WSWA 2HBQA 3VKVA 2J7KA 5HR5A 2V59A 4IF4A 2PLFA 1E2PA 1IEXA 1HUQA 3ZHRA 2EC5A 5AK0A 1O57A 2OO5C 4U7TB 3ZZNA 3MWGA 3ZIAA 1CPYA 2AMLA 2I76A 3DBVO 3JVUA 3OQ1A 3WIEA 4INZA 4A4DA 4NOMA 1KP9A 1Z37A 4DBLE 4HNVA 4UHEA 1RFLA 1M1YA 1GCIA 3KT3A 1Q84A 5GGYA 2B92A 3IVAA 1VLVA 3VVMA 4JQOA 4F91B 1XU9A 2DFTA 2HR1A 1VTKA 2NIPA 5G1PA 3AR6A 5E6RA 5IAGA 3CVXA 1ZH2A 3P2EA 4D9EA 5KQGA 2WJHA 2P2LA 2EGUA 4LC1A 2V3VA 1E5LA 4MUAA 4CMAA 2JIQA 2XH8A 3L1HA 4EEKA 1LBQA 5A3SA 4HWTA 3T41A 2O8VA 3L4EA 1N2ZA 2Q41A 1ZVQA 1GD1O 1GQOA 2ZUCA 3D5TA 3I2GA 1L1QA 4QRHA 1NHWA 3I4CA 5TEWA 3TQSA 3V33A 1C41A 1JLLB 4D9GA 2EG5A 5CDTA 3HXKA 3PEEA 5DE3A 3ZHXA 3HNRA 1TEXA 2ZT7A 1GIAA 2PRSA 5THXA 2CMFA 1UPFA 1D7AA 4IYRA 3UV7A 2BEWA 2N46A 1BH2A 4LHVA 4BXOB 1Y6FA 4Q3OA 4JKIA 3NIFB 5AVYA 3PXCX 2CJPA 1XRSB 2EGGA 4U8GA 3ICQB 2I0FA 1JSLA 1RBYA 1LJLA 4DM4A 3QSGA 5FQNA 3NCHA 5CT4A 1UKZA 2V9PA 1JU9A 4X8LA 3MGAA 1HXHA 2QGFA 4V39A 5IP5A 3UKOA 3W3AD 3U5TA 5BNIA 1QANA 1BOFA 1OV6A 2FZGA 1DKRA 2C4VA 1LDEA 1W34A 1E9RA 4NDNE 3GDFA 1R4NA 3ZWNA 5ADHA 4JV5B 1II0A 3SYRA 1ANKA 3U37A 3NVKI 2ZB4A 4UEKA 4DIOA 1R66A 5A7HA 4ALKA 4LZNA 1NP3A 5TQ0B 5GJCA 2GI4A 2VFAA 1JP7A 3V32A 3G9TA 2P9HA 3K8YA 3ONEA 3ZDZB 1FW8A 4M98A 4RWZA 1VOTA 1XFAA 3OLVA 3T9EA 5K8JB 2EJBA 2XSZD 3BDIA 3H1FA 4EPTA 4HGZA 1LW6E 1DXHA 1WOMA 4E46A 2JAPA 3AF1A 1L7EA 4F46A 1H8EA 2X0IA 3GA5A 1UBKS 1GZ5A 2WTAA 2XMBA 1CE8B 1J23A 1T2DA 5F3WB 1WVGA 4AX8A 3EE6A 1Y3CE 3IEVA 5I7WA 2XYHA 2XRZA 3DKIA 5G40A 1RI2A 2RE8A 2XOKD 1OASA 2VPZA 2XLCA 3OIYA 1SA0B 4AI6A 1X1AA 4EX7A 2C0QA 3REQA 1F3OA 1UDBA 3IBSA 4I81A 1LPNA 3ENQA 2NXCA 1NQXA 2NU9B 3RCBA 1ACLA 4B2IA 1QO0A 1YQTA 5LP6A 1E7YA 2I65A 2YASA 1HNNA 2J9YB 3GH3A 5KOJA 1Q7RA 1LPOA 2XQJA 3N8NA 1XTKA 1OIWA 4FYIA 5AM1A 2HREA 1ZK0A 1SBZA 3DDNA 4PZAA 4OQXA 4YJHB 2FQYA 2EW8A 3BCHA 2A1UA 5I8WA 5JYEA 4BXOA 1OFHA 4HPWA 1PK9A 4R5MA 5FLEX 4BBZA 4EGJA 1KK0A 1R8XA 2AOWA 3EZLA 1P8AA 2LKDA 2ZCVA 3FMOB 5IJZA 4RX1A 1XIVA 4DWVA 1UFRA 4YUWA 2O0JA 5CVUA 1ZVJA 1FDUA 4HHEA 4L9RA 4O02B 2GAOA 4FYYA 3K7EA 5CX4A 3PPIA 3QF7A 3RABA 3CVJA 3VNAA 3TW8A 5A1TA 2OM6A 2VA9A 3GW8A 4PU0A 4QXRA 4XSHA 1IJKA 2H18A 4ZT4A 5CD1A 1PL6A 2OCKA 5FUXA 2BGLA 4GW3A 3B3GA 1BDBA 3C8UA 1M6YA 3W90A 2XT9A 1EWQA 3KJEA 2P27A 2Y1EA 1QHYA 3LH5A 4A23A 5DBHX 3SY8A 1OHHA 4KE9A 4JVMA 3HJFA 2GEUA 2TMDA 4BYGA 4JENA 1W5AA 2R8EA 2WMNB 1QQ7A 2VL7A 3A31A 3B1XA 3E5MA 1CJTC 3D8HA 3W2IA 4DCJA 2VF5X 4Z7JA 2K5UA 4EI9A 3NUZA 3ZK8A 4JI8B 4X8HA 1O2DA 5H9WA 1IBLB 2HSZA 3ENWA 3K6RA 2E4UA 2YJ4A 1ADFA 1YRAA 1R8YA 1U5BA 1T5SA 3FDZA 3I6QA 3B78A 3P94A 4LHEA 4WL0A 5ITWA 3MUOA 1IBSA 1P2SA 5GWXA 4AWAA 1V9CA 4YAKA 9MHTA 3CUWA 1I5RA 3LXXA 3LBFA 3PITA 1ZNYA 1CJBA 1JXQA 2NZ8A 5F35A 3QE2A 3ANMA 4MDHA 5LB2A 3VZQA 4A8JC 4ETNA 1M83A 3HSKA 3IUPA 2AWOA 3VO1A 1SVOA 2RBEA 1H5QA 4YCLA 2GGSA 2FYTA 2DR2A 2PUEA 4CCWA 3DG9A 5AK4A 2PH7A 3QPBA 1ULUA 4PYJA 2OGZA 1VDMA 2AYZA 3NHMA 4HVAA 4QD3A 2BTQA 4Q1VA 2VH2A 2QZJA 3W5DA 4Z3OA 3O92A 4JT2A 1ULBA 3V4ZA 2P6OA 4UZSA 2CN1A 1LTHR 3IAAA 3RUAA 1IUKA 1F06A 2Y76A 5TX7A 4D8YA 2ISSD 3VR4D 3G82C 2CT8A 4LISA 1N2HA 4NBKA 1I8TA 3LYHA 3FPEA 4NOKA 4AFNA 5I7VA 3CLRD 1SK8A 3EFOA 3HXLA 2H11A 3UPUA 3KPWA 1IN6A 1D2HA 4PTZA 4RPIA 4EW6A 3GJ8A 2XCTB 4JI2B 2GJ4A 3CLUC 2IYOA 1HLGA 4HZIA 5IARA 2BGRA 4J49A 1OU0A 4Q21A 3R6LA 1RZVA 3QE3A 5JCZA 4ZDWA 5A4MS 3JQPA 2EKPA 3VO9A 4ZCPA 1ZSYA 3WKBA 4CN9A 2VBCA 4K46A 5KTNA 1GPBA 1V1RA 2VWGA 2JANA 2M6RA 4OUKX 1K27A 2JVIA 3B52X 3IEXA 4KB5A 5TVGA 4DY4A 2WD7B 1AO3A 1SQSA 2DQSA 2R00C 2VQSA 4E2WA 4QDXA 3FIUA 3HDHA 5ED0A 2NAPA 1K7YA 1U3TA 2PKYX 3FCEA 1YB5A 2PWZA 2FZCA 2X0NA 3ORHA 4QPJC 4R41A 4WKCA 2OC9A 4BBAA 5EIAA 1C4WA 1QUFA 3AHJA 3HCPA 1C7QA 3EVAA 2AN5A 2ORIA 4YCBA 4BZQA 2GQ0A 4M0PA 4TXMA 3OQ6A 2H2HA 4NJMB 2C5SA 2UZAA 3KVRA 4KC0A 2Q4EA 2XECA 4DLNA 4RDCA 3AI3A 4Y1GA 1WZ2A 2Y9PB 4C76A 2C2ZA 3C45A 4L50A 1ZJ6A 1Z4MA 2G1JA 2HX1A 3PYXA 3GFGA 1OLXB 3EG9A 4CEJA 1N8NA 1W0JD 4D98A 1CHNA 2Q3MA 4GKAA 1K6JA 2RC5A 3WMGA 1NYTA 3MCVA 2C4TA 2GYYA 4M8LA 3TIFA 1VLHA 4B3BA 5HOQA 2B83A 2QV0A 4B32A 4KQ2A 5EPOA 5AJTA 2HBYA 1NY5A 2ZCUA 1XMXA 1X2BA 2O2GA 3BC1A 4XKJA 4YB8A 4EI8A 5IHPA 2PMFA 2B94A 3F1KA 1YFZA 2PZBA 3B60A 4LTNA 5EERA 2WTNA 5EJ5A 4YAWA 3VYSB 1NQOA 1TE2A 2Q6TA 4YUYA 1LBIA 3JQAD 1XTBA 3DOIA 5A1JA 2CGEA 4WZBE 1VPVA 2GN1A 2V74B 4DCPA 5JZMA 2ZXUA 1CTQA 4J6FA 4PBTA 3OM8A 5JPDA 2CCJA 1GQRA 3GPLA 4FXPA 1XKLA 1RAIA 2R7MA 3CTMA 4Z8YA 3WLIA 4PC1A 3SZLA 1BH6A 4KBGA 4NYMQ 4TUYF 1SUEA 2FSUA 2VO1A 3F7MA 1HDRA 5ECYA 3EG5A 5KTPA 1OBCA 3FM9A 1NJ2A 4Z5XA 4K7JA 5AIAA 2O3QA 4J91A 1XZ8A 5AKLA 2YWFA 2EJCA 4Y1RA 1L5VA 2VKQA 5CT8A 3HUFA 4B2YA 3ZW9A 6NULA 4YYEA 3HI6A 5DCYA 5J3JA 1PJCA 4MQ4A 5BQPA 2XUAA 4NBTA 4YREA 4IWXA 2CXOA 2V0CA 3TDKA 4KO3S 3U13A 1ZVMA 1BX0A 3ZHVA 1IB6A 1U0FA 1V11B 3ABZA 2EDCA 2WMDA 4AJIA 5HQ3A 4YRJA 3ZY2A 5EJIA 1D07A 4OD0A 1GTL1 3AVOA 3F6EX 1KI6A 1NV9A 1J00A 2ZXEA 2VDUE 3SP1A 2CLFB 3U9TA 4DLSA 2H57A 4RKFA 1RR6A 4LYHA 3SIWA 1Q1EA 4H7FA 1HDZA 1A4RA 3RC7A 4MYCA 4YJHA 1QUEA 2E1PA 4N3CA 2CLSA 5REQB 3DFMA 1G20B 3NTXA 1KAHA 2OV4A 2WD9A 3GJ6A 3B3QA 4QUHA 3T4EA 3HN2A 4XDZA 3MQ2A 2O0MA 3TLGA 3EZFA 2JJ2D 1YHYA 4ZQGA 3W4JA 1XMPA 4QXPA 3PLNA 2C9BA 4DUGD 1XZGA 1BNCA 1XROA 4UW9A 1H85A 1YB4A 1GZ6A 1ZI6A 2C92A 5CG2A 3BAFA 1LJUA 3KNZA 5KAPA 5HRUA 2YZ7A 4GM1A 5G0VA 2V96A 1E96A 2CE2X 5FF9A 1HE3A 4H7DA 5F77A 3QTTA 4MZXA 4XARA 4QYSA 3ZLTA 1KORA 3W9BA 1NXPA 1J0BA 1EFRD 1HSOA 1KMCA 5EP3A 1X1RA 4MUMA 1MAAA 1VHLA 4ZGWA 3KL2A 3BSYA 5JYBA 1CJCA 2I5PO 3X1MA 4HPJB 2X8JB 3NHWA 5LUAA 4F93B 3CTPA 3JX9A 1NLMA 1VJRA 2GBPA 3S2ZA 4GOOD 2FSHA 4B0OA 1KS2A 5KNDD 1XEXB 4LMRA 1FUUA 1Q20A 1F8YA 4KKXB 4WBNB 1K8YB 1GPNA 1E61A 4I5FA 4GDFA 3R6DA 4BP8A 3G49A 4DLXA 1Z3IX 4YRKA 1F7VA 1FC0A 2O5CA 2P6UA 1ENYA 3D0KA 2BHRA 4QA9A 3E1KA 3T9CA 2BFFB 3EXFB 4WESB 5ESWA 1A2KC 4UKDA 4ASUA 2VHWA 3IMFA 3NANA 3WB0A 1G3UA 3MD0A 1WZEA 2PLNA 2RGBA 3ZS8A 1E63A 3O3OB 3I9FA 1IXKA 1XRQA 4O4JA 1J7JA 2I33A 4OQPA 1TIBA 1MBZA 3V7UA 3ZHCA 1TTPB 3QYJA 5C1IA 6REQB 3PC7A 4G81A 1SXIA 1W8IA 1IONA 1X0VA 2BZ1A 2XZDA 1Q0QA 3MPUA 5J23A 3FJYA 4MRAA 4LCJA 4LQCA 4D8VA 5EE3A 1K5HA 3ABSB 1C1XB 1KR2A 5K6RA 1EK2A 1MORA 2XCQA 3GDWA 2GF2A 3P0EA 3A36A 1LI7A 5BP7A 2AEEA 3NBZC 4R3NA 3W77A 4LNHA 1IY1A 1PR9A 4KLZA 3R4CA 4YV7A 1JLSA 1PEDA 2J31A 3RUEA 2JFZA 1ZRHA 3ITEA 4KR3A 1PBNA 2FEAA 4A0HA 3CR8A 3FRIA 2ADMA 1VLQA 3M4ZA 3CNLA 4NU8X 5DHUA 2DLCX 2QRGA 3IB3A 4Z4HA 5DCUA 3ZNOA 4KN8A 4Z1MD 4BNWA 2C7GA 1NP7A 3B2EA 4NZMA 4EL0A 3KR9A 3OAAD 1Z2PX 1NVTA 1RLIA 3KR1A 1J22A 2OECA 2JBAB 2I1QA 2W5UA 2YY5A 2ZATA 2IHUA 3BMOB 3K30A 3PC4A 5FNVB 4A6DA 4ZOCA 3EZXA 2VCYA 1Z6YA 2WIDA 2QGZA 3O5AA 1H9BA 1X1SA 2ZVDA 3G0BA 4NMXB 3B1YA 3ZPXA 5CNKA 1AMNA 4WK6A 4KW7A 4EG5A 3FJOA 4MTLA 3ORSA 1FUKA 5EUQB 1Y1SA 1FSSA 4UOQA 3SC3A 4AJNA 1JG6A 4OQFA 4DRZA 3WAGA 3VPXA 3A3KA 1OD6A 2D2XA 2OY0A 3FUCA 1ZD1A 3L79A 3MJEA 2QLMA 4EKGA 1CBUA 1LK5A 1E5TA 3AILA 1N57A 2CLHB 4XB1A 5ICMA 3KKMA 2P5YA 3I61A 3HJUA 1HH4A 1E1QD 4Q18A 5DW3A 3PWZA 4LV8B 3FFXA 1L7DA 1J2EA 1TMKA 1UC4B 3KVVA 4FFBA 1IM8A 4KXWA 4YXFA 5BQ3A 3A1CA 3EXG2 721PA 1U8AA 5BUZA 3SGLA 3FCAA 1QIKA 2A35A 2Q21A 3VKWA 1A82A 3HBJA 4Q6BA 3DMHA 3MRSA 4JSYA 1V5GA 4GX0A 5E6UB 1WB9A 2A0XA 2J8ZA 3F67A 1OGIA 4QXMA 1WHTB 3M82A 4LDAA 1YQWA 3GPBA 4AT1A 4BRZA 3COWA 4KWHA 4W63A 4UAUA 1J2JA 4D4GA 5CDGA 2DPMA 4DCMA 2JFQA 1JFTA 2UKDA 5C4GB 1NZDA 3THYA 2Y2UA 3HABA 4QSHA 3WAJA 2FMFA 3M8KA 1V7CA 4RZIA 4PGFA 3JQEA 4WLNA 5EKXA 3PV0A 4JLPA 2Z8XA 1UP6A 2CL7X 2YXLA 1ENZA 3SF8A 2ZUEA 1OLSB 3D3JA 4N3GA 3A28A 5ERYA 4CF7A 3AU8A 3ENNA 4L85A 5FV7A 2FZVA 5HFNA 1A0OA 1X8KA 1XQXA 4WCDA 4WT7A 2P9CA 2AD1A 3ILVA 5JNWA 4Y98A 1SHJA 2ZVPX 5ALZA 1PKEA 3JZIA 2FLVA 3SICE 2W00A 2DFLA 2JLZA 1M2VA 2E2WA 2RAPA 3JWPA 3KKKA 1G7CA 2ZYUX 2FFQA 5DNUA 4L75A 2IU6A 2EBWA 1U7WA 1NBME 1MU0A 1TLTA 3N3BC 3PSHA 2IZ0A 1IM2A 1BQ4A 2FP4A 1TAGA 4G1CA 4UVGA 4XASA 1RS0A 4J7UA 5A5EA 2MYTA 1U7PA 3EGXA 3PIDA 1PGNA 3A9TA 4D0SA 4JB0A 1ZGZA 2WP0A 3S81A 3BB3A 3ZY3A 4YV1A 3II6X 2BY4A 2H2FA 3QTBA 3R0ZA 3L8EA 3PICA 2J4FA 2X6QA 2H4YA 4HDQB 1XDSA 5JARA 4P38A 2DKOA 3WDKA 2WKRA 1MENA 1CDEA 4TRMA 4W1SA 3KQPA 2VAVA 3T9DA 3VC1A 8GPBA 4I1VA 3V6LA 1DQRA 4ACBA 4RQTA 4WD3A 2Q3CA 1OC4A 3ETNA 4Z9XA 1T4CB 1E6MA 4MICA 3ZWYA 1Q7TA 4GBMA 4C3OB 3EFHA 3AZPA 3THRA 1G17A 4I55F 3I04M 5LZ2A 2FMXA 2GAAA 4M3NA 4M49A 1VYHA 2OQRA 4YHHB 1FXSA 4IPTA 3T61A 5AHXA 3MBIA 3B5JA 3KOXA 4Q9DA 1II8B 2KBFA 2HRDA 1QMGA 2XQVA 3M34A 2FG6C 5FO1A 1H6AA 3RV4A 2R7AA 4PY2A 1SCAA 2CK3D 1EBFA 2XRYA 3K6JA 3LA8A 4ED9A 5JNVA 4EYQA 1YCGA 4H08A 3WK4A 2HA3A 3O8DA 3NM6B 3ZNNA 4XTCS 4DHWA 3GP8A 4L78A 1OZAA 5IAKA 1ZLYA 2VPQA 3IIKA 3KTAB 4LFCB 3DBLA 4GI5A 1E79A 3BCUA 1OXUA 4ZEOA 4BP9A 3AF2A 2X5XA 5T4HA 4E5MA 2O8EB 1I6LA 1FYDA 4TMWA 1Q7CA 4YMVA 3H3JA 1D2AA 1KI8A 2EX4A 3C8DA 3QEMB 1KOGA 3MG9A 1M2OB 3RVJA 3TIIA 4X65B 4QPPA 2F9MA 2ZSAA 5EXSA 2B20A 4CUJA 3PZBA 5FXMA 3VPHA 2VHUA 3FNEA 4NVRA 5L3QB 3JQQA 2QG9A 4ZI5A 3WGTA 2OOKA 2NU7B 3GWGA 4RPKA 1C9MA 4AUEA 4PWZA 4EUSA 3BE5A 2A59A 4XGKA 4RFSB 3IELA 3F2IA 2JGKA 3L0SA 2DUMA 4GVXA 4R9VA 2YIDA 3ZXIA 4ZVVA 3T35A 4UE6A 4K2HA 2IYRA 1TYEB 1O94D 3V2IA 4Q9NA 1SIBE 1VYUA 1HPLA 4JU9A 4BVEA 4CLEA 2VTBA 4RTSA 1T9KA 2JJ2A 3F4BA 1KJZA 7ADHA 2O3SA 1CR6A 1PLLA 4ZFNA 2PAFA 7MHTA 1WXHA 1MAHA 2OK8A 2Z57A 4LV6A 3KBOA 3DLAA 4QICA 5D7NA 4BVJA 1Y42X 3UH1A 2O4CA 1DBWA 2AJBA 3FCCA 4TZ6A 1Z17A 1VMKA 4H60A 1D04A 4WDRA 1OXSC 3T7EA 1HO3A 1IRXA 2ZU0C 1F1BA 4F4CA 4X8OA 3UJBA 3PR3A 1FU7A 1UFKA 4NCJA 1IMOA 2R7NA 3EARA 5AWFC 3IUNA 4GLLA 1RHQA 4FT4A 4ABYA 2N1BA 4HVCA 5IBCA 3ADKA 3ANNA 3FNRA 1PEAA 1Y4SA 3KQHA 3DA8A 3L40A 3AEXA 4P0TA 2XVMA 1ONNA 1XD9A 4HKTA 1WETA 1Z45A 3BIWA 2PZGA 3I9V6 3LUBA 3R6GA 4IX1A 4L6AA 3PHLA 4M9ZA 3UC5A 3CJTA 3WV4A 1QIGA 1UXHA 3KVNA 3LHSA 4FC6A 4JEHA 2AOTA 2XXAA 2PJRA 3CLHA 1NYLA 1W6UA 2MJLA 3KRTA 5DYWA 5A02A 2P79A 2QU7A 1L4EA 4DREA 1XTTA 1MO2A 1R0RE 3GZTB 1RYHA 1U1EA 2O48X 4E2YA 4E6PA 2P8JA 2QAIA 4HY3A 2AG1A 1RJDA 2WJ3A 3BILA 3HPRA 4V0KA 4J3NA 3ZDYB 4NY1A 1KYVA 2PBLA 2WUGA 3ZVKA 4KAXA 3TTTA 3G9QA 3OFKA 1N6RA 4IHKA 1NVKA 1LPPA 1XNGA 1L4HA 2SKCA 5EGNA 5U4XA 3SMVA 3T3MB 4E5DA 3U44B 1EBUA 2NQ2C 4F04A 7MDHA 1PYOA 1JFSA 1NKTA 2RBKA 3NWJA 3V8MA 3UC9A 3ZWVA 1NF2A 2DKFA 1DEKA 1QE5A 1REQB 3G2LA 3KLOA 4J2OA 4JD5A 3OTHA 1X87A 1W46A 4B7XA 2R1TB 2X4DA 1K5DA 1AB6A 1HFEL 1UKCA 2D1FA 2J46A 1NATA 4JUIA 4BJHB 5L4NA 1CUEA 1N3LA 3E1GA 2OZPA 4MW9A 4F86A 3QKUA 1G6HA 2P6RA 3WGZA 2XMGA 4P86A 2GCGA 4UCQA 2CLKB 1DO8A 2ADFA 3KVOA 4FZJA 1U0LA 1VCHA 3ELWA 4HO1X 5F73A 5TF0A 3TOSA 3Q0EA 3USES 1JSCA 2G9ZA 2AZMA 3KHUA 5TS3A 2GD1O 3SNHA 1VKJA 2BJWA 2B25A 4TL8A 5LIPA 2JAHA 2AZTA 4LYAA 4X20B 3TIVA 1USVA 4HNQA 1VCNA 2NU8B 1N2SA 3O73A 2ZAGA 2FWJA 4EG4A 2VT2A 4FHCA 4O2AF 4DABA 2VDPB 1H9CA 4PPNA 2HZBA 4XCXA 4AULA 2GPJA 1OYOA 1YK1A 3VR6A 4DLUA 1R9NA 3KKNA 4QRDA 5JMOA 2JJYA 1XTSA 2IITA 4G5FA 4G84A 2W6MA 1NQUA 1Y7PA 2YUIA 4BNUA 3VKUA 5HIAA 1NI4B 1FX1A 1VG9B 3OZEA 1E1KA 2HWKA 5C8YB 2X9VA 3BWDD 3ZDBA 2E55A 4G5QA 3ANSA 3BD6A 1FSGA 2XRMA 2JAUA 1W44A 5JBIA 5LQKA 3AB7A 2ZRLA 2DJ5A 4N65A 1JS1X 5EIBC 1TAUA 3BZBA 4GC9A 3Q7EA 2NO9A 3OX2A 4QOSA 1FRVA 2DT8A 4JXKA 4LE0A 4OQEA 3L4BA 4W5HA 9ABPA 4CEJB 4CMHA 1TMGE 3INYA 5KX5A 1EXMA 1JLMA 4PZDA 4ZYTA 1CZNA 3GZNA 1ND6A 4W7HA 4WZ6A 5FUVA 3K9FC 2RD2A 4JVNA 4LYEA 1EDZA 3HR4A 2JGMA 2WDPA 4RM2A 4OYYA 1X2EA 1LDBA 1JHVA 1NFRA 3GJXC 3T5BA 1B23P 1KE1A 1KPGA 3NQ41 5INTA 4JC8A 3ORFA 4NR0A 3TZ6A 1KSHA 3IV9A 3QE4A 5JNUA 2Y4NA 2BFNA 1AHIA 1EHIA 1USIA 2WPDD 4F8YA 3NTUA 2QUIA 1JEEA 4G0QA 3LBAA 5JHHB 1E20A 1Q21A 1EK6A 2HQSA 1W2WB 2IXAA 2JZOA 3T5MA 5GMOA 4ESVA 1LPMA 3K9CA 1CZOA 1FFEA 1R0BA 3E82A 4PAWA 1C30A 4W1PA 1PZNA 3R3SA 4JNCA 1DBIA 5FL7A 4ZO9A 2NTYC 1ODFA 1B2RA 1NMYA 4UREA 4ZRNA 4JLDA 2X1HA 2NV2B 1OXXK 5D5QA 5AVOA 1A77A 4PX5A 1PJTA 3VPGA 3DOHA 3LP8A 2Q3LA 3QLTA 3K5IA 1SXJA 1AH2A 3AUYA 3TCKA 3Q1KA 3WWYA 1JSRA 3IP8A 1RWOA 2YWCA 3MINA 2DWQA 4LOHA 2C7PA 4L3WA 5DIFA 2RAFA 1E94E 4LJ4A 1X92A 3OZUA 5FR1A 2QPLA 3M83A 5CFLA 1GLVA 3X43A 4EKYA 1FUIA 1A04A 1E1QA 3QG1A 1NMQA 1I01A 2ZPTX 2CDCA 4NEGA 3TUIC 4RLQA 2GX6A 4U2GA 4PAQA 3M0EA 3PD7A 1OF1A 2QD3A 4EDFA 4BP1A 2C00A 4PNHA 2XBUA 4D6XA 4D80A 4YMUA 4I55B 3DDSA 3L0DA 3L0ZA 2Q8QA 2G36A 2Z08A 4URHA 2HHAA 4OHKA 1VE5A 3WYCA 4LCBA 4MOWA 4AWXA 2W2KA 1AUVA 2WM9B 1TJ4A 2EQ5A 5MFPA 3WHKA 4NV0A 3LUKA 5L3SB 1O9BA 1SVIA 5CH3A 4AU1A 2JA1A 4PR3A 3WHIA 1YZKA 4RPJA 1ESCA 3GLHE 3OF5A 5FAXA 3T99A 4LHWA 1VJCA 4YIKA 1TLLA 2GJ9A 2REXB 1GGKA 3O74A 4FIDA 3JYQA 2OWEA 2YOHA 4KPYA 1PJRA 1AKWA 5DLDA 1MT3A 2W9XA 4L5JA 4X7MA 4IG9A 4C5AA 5EE0A 3ITNA 1I1OA 2B9VA 1E0SA 3LCCA 4D42A 3DQZA 3W8RA 1G2PA 2GERA 2LCFA 4PNZA 4UUBA 2PZKA 4N8DA 5E95A 3UT5B 2XTNA 3U60B 4JT8A 1AGPA 1PL8A 4EPRA 1L7BA 4KP7A 1Y8ZA 4WZAB 4JJZA 5FUWA 3D4IA 1ECLA 4S0ZA 3QPCA 1I94B 3ES9A 1EVIA 2WWHA 3F5QA 3I76A 3WZMA 5LZ9A 1CD5A 1N6OA 3VPAA 4B3RB 3LHKA 4E1VA 4XM0A 1KYXA 1VE6A 3IESA 3O90A 2JCGA 2OENG 3BORA 4BLUA 3RREA 1NR7A 4HDKB 2QVXX 2DG2A 2OORC 3LW8A 2D0IA 3DL2A 4KACA 4PSKA 3ODGA 5KNBA 3R7SA 3KLNA 2YC4C 4CKBA 2O8CA 2KYRA 3FVRA 1N3IA 5I9IA 4LAFA 4J0IA 3F73A 3SLGA 1V47A 2WQ6A 1JVNA 1NXXA 3GVPA 4Q5IA 3ZWDA 3FKJA 4QDOA 4PXAA 2EZTA 1Y6RA 4D02A 2FU5C 1DMSA 1F0PA 4KXQA 3WVNA 4BPBA 1QH1A 3LQFA 4B4OA 2NZWA 2QK4A 1PR0A 5BR1A 5JXWA 3A6GA 5EWLB 1GWNA 2AG0A 2I1WA 2V45A 3I34X 1QIDA 4KVFA 1SG0A 3AG6A 4UJ5A 3I58A 2KHZA 2YW2A 4FPXA 3X2SA 3SCZA 1XTZA 3RIEA 4BNIA 2D8MA 2PWBA 2X6TA 3AQ4A 3PK0A 5JMPA 3WGMA 3FCXA 1B74A 1FK8A 3PEVA 1K2VN 2HHLA 4CQNA 1GP2A 4AS1A 2IY8A 2DKNA 2ZP1A 4NQZA 3CQ9A 3ER8A 4JJIA 3AF0A 3BXEA 3PNQA 2INGX 2PBZA 5LQCA 3IUQA 1BMFD 2ZVJA 4FJ1A 3CIOA 2P30A 3BGOS 3QYFA 5E0OA 4AXBA 1Z6PA 5KSZA 1JMYA 3X1JA 4MP8A 2CKDA 3T3GA 1XP5A 1X7GA 4G97A 1ZCAA 4HR7A 3NHAA 3H8SA 2BEWB 1OX4B 1E0AA 1LDGA 2JGLA 4N5NA 4G2TA 1C8LA 8OHMA 1RC0A 5DH9A 5A0TA 3PKIA 5IKOA 1IY0A 3CG0A 2OAEA 4ZP1A 4JL6A 1LWNA 3I1IA 4IZHA 5B53A 2ZYRA 1RE1A 1E92A 3B6KA 1E4VA 1AK1A 1JHMA 3VDRA 1NMZA 3G8DA 4ALMA 1YR6A 4QXAA 3MSXA 1IQRA 2CDNA 3IDOA 2H59A 4H27A 1NPTO 5J2TA 4YPOA 5CA0A 5I4IA 1J5XA 4CT4B 5CXSA 3IR6A 5B3LA 3ROPA 3WWPA 5FPPA 1FSPA 1J1IA 4RULA 2RHTA 1N5DA 2IXDA 4LOLA 2XMRA 1J2UA 1PZGA 3PFNA 2QR3A 4AIIA 1YR8A 1AK2A 2PVPA 3PFHA 1ZGCA 2CFRA 3IX7A 4CQJA 1KFBB 4MDYA 3ZV6A 1L7XA 3N7UA 4BDTA 3D0OA 3CX7A 2X0FA 1YF3A 1U8TA 3GJQA 5A3JA 5HUHA 1NXQA 4HDNA 2J0EA 2CV1A 2AG5A 2HTFA 1R00A 2PIAA 3QBVA 1DAPA 4FHEA 4TXHA 1AQLA 1ETHA 1WCV1 2ZBQA 1PL7A 1QF9A 3CLSC 1XBTA 3E9CA 3PRHA 3RNOA 1K97A 5EJ2A 4I5IA 4CMIB 4X1YA 4G37A 5FI0B 3CF4G 4GXQA 1CFJA 2OXTA 3H2JA 4EJFA 3CRMA 4YDQA 1HK7A 3AP2A 2M6KA 5TGDA 3RG2A 1SBIA 4U2EA 3U4QA 4DEVA 3N75A 1G3QA 3DCNA 3G0HA 2H1RA 5CLJA 2ZJ2A 4CCAA 5IUNC 2NTNA 1G291 2PD6A 3K71B 1CY8A 2RJOA 3JASA 4OQLA 3ICEA 5L6MB 4QDTA 1H8ED 2ZIVB 4G01B 2IOHA 3B85A 4FLEA 4YJFA 1VFNA 1ZMOA 3BWMA 3IVCA 4JL5A 4A0FA 3U5ZB 2OPHA 1IEWA 3A14A 5IFKA 3SM3A 3AY7A 1K9VF 3VPFA 2G7ZA 1RYEA 3WBKA 1QQBA 5FOXA 2BFBB 3ZD9A 4ZEWA 1ST2A 2DWPA 1YJXA 2C82A 1DBQA 2A33A 2IKQA 3TMAA 1LFAA 3RSQA 2NGRA 4DMLA 3AR2A 1XYYA 4NBUA 3IUYA 5ALTA 3LI2A 4J4TA 4KQEA 1APBA 3C4VA 1NX9A 1UBCA 1TM5E 3HCOA 3OIWA 3GCZA 4GWKA 1U3FA 5T64A 2EEZA 4NARA 4AD8A 2LP4Y 3TL6A 5TMPA 4NZNA 3ONDA 5F33A 4HVLA 4N7RA 3P1JA 2GPSA 1Z3CA 2WYWA 3NYRA 4R1LA 4ZC8A 4XLTA 3H0EA 1IOWA 3ILSA 5T67A 2YYAA 3O0TA 3KYDB 4QYIB 1SHTX 1HZJA 1PFKA 1BU5A 1A97A 3WK8A 1ZLXA 1OX5A 2FRXA 4JBLA 4R1TA 4RV9A 4QVIA 4AUMA 5BUQA 2I6UA 2CYAA 3SEFA 4DMKA 1RJWA 3DE1X 1U7XA 1UBSB 1KU6A 2MR5A 3A26A 4H4EA 2HA2A 3W79A 5A9RA 1J5EB 2VP4A 2QT1A 3LFTA 2BRUA 5FKJA 3FHJA 2D5BA 1RM3A 4ARZA 4DMHA 2Q4BA 2OHGA 4QTZA 1I4OA 1MJHA 1IULA 1DIHA 1E1CB 1YZUA 1ZI8A 3UMYA 1L4MA 2C4WA 2WUFA 3BQNB 2IV2X 3MXTA 4O33A 3MWYW 5FORA 5LQAA 5FWDA 3STHA 1YL6A 3SX2A 4BJ6A 4E4RA 5ITSA 3OP1A 4ZYLA 1W49A 3PWSA 1CY4A 1K7FB 3LCMA 4REQB 1AKVA 4U9HS 3MWLA 2XUOA 1X15A 1Y6ZA 4IIBA 2CE7A 5DRYA 3LX4A 4C4SA 1L5OA 4E3ZA 4R8RA 4BX3A 5HW0A 3UBTA 1LI5A 3KB2A 3ORQA 3AK4A 3LQYA 2QTRA 4J7AA 3KCQA 3Q6IA 1KJYA 1R6DA 3T1OA 3TRIA 4B1FA 1P44A 1QQAA 4IHJF 4RLHA 3GVHA 1BWRA 1FFCA 1T0IA 1W4RA 4CMBA 1PZMA 4IW3B 3KZMA 1E8NA 5JD3A 4AK9A 5LZ8A 1EFUA 1VSQA 3OJ0A 2VBGA 3H6HA 2VHYA 4HDRB 5E3HA 4RJTA 5JYCA 2ZRGA 3KL4A 2QMYA 5EOVA 1XMOB 3ZDAA 1KP3A 3Q6NA 3UJ6A 3O91A 4D5GA 1LDMA 4LSMA 1J8MF 1GQ2A 4F3RA 5AVTA 1WZCA 3CVYA 4XEHA 5BWMA 3G13A 3MT7A 4CIWA 2ON6A 2O7NA 1MQ8B 3BWYA 1SC1A 1L7QA 4QJBA 4UPEA 4IHAA 1O7JA 3D9QX 4GOXA 4WAUA 5DTQA 4NBNA 2F8SA 2F4NA 4M9SA 5FB3A 5C8XA 3TWOA 3GCGA 4GXTA 2CXSA 2OB2A 4A91A 3SQNA 3ZV5A 2WJWA 3RS0A 3H5VA 3I83A 4DT1B 1W9MA 1G63A 2CSXA 1UKEA 5LD2C 1RM5A 3IKJA 8ABPA 1NI3A 3K4HA 1JFFB 4ZIRB 1VSTA 4PAOA 3U7JA 2OZKA 2ECOA 1V35A 3ANTA 3GVIA 1T10A 1TQ8A 3OM9A 4MHOA 4Q3DA 3H5IA 4Z4EA 1Z38A 3TG8A 1QAOA 2GBIA 1RYMA 4RK4A 1FL9A 3MYYA 4IDEA 4RNCA 2W42A 3I9NA 2RAUA 4B17A 1N7GA 2ZUBA 1V16B 1WMBA 1KZGB 2ERCA 3AB3A 4BCBA 1SD2A 5LB4A 3TTYA 2XA2A 2LR0A 1VJGA 4JLWA 3RSSA 3ONWA 4JJGA 3AI2A 3R7WB 1O1YA 4J3FA 5M2QA 3T3IA 1D4AA 4HWPA 3DXFA 2ZGVA 3ZGYA 4XJSA 3T12A 3NLLA 4B87A 3W3AH 3I9JA 4CQMA 1EQ2A 5DSZA 2VZ9A 5BNFA 1NIJA 3CUVA 4UPDA 1QU2A 3OE5A 4PINA 1CRWG 3IAM1 1PFUA 5FBRB 3TRJA 3DOCA 3GRAA 4O1HA 4IMJB 4URUR 1GA4A 2YCLA 5DSTA 5JPCA 2AOTB 4INAA 5FO0A 3LOPA 2X8JA 2JHPA 2ZUUA 3HYRA 5ENVA 2ZB7A 5LBTA 2YWDA 1S01A 3K9WA 5FAKA 3QELB 4CI9A 2FN8A 4CDMA 3KC2A 1D2MA 1TT5A 1SKYE 3E81A 4E5VA 4BLOA 3UMMA 3Q5GA 4RY8A 5BV8A 4LJ6A 3BEOA 1ACMA 4R9RA 3SKVA 3NHYA 1PV1A 1HFWA 1Q74A 1X1QA 2XEDA 1XTPA 2PK3A 3JWGA 2G5GX 4TTJA 1M5UA 3NHSA 4Y6SA 5A3VA 4TGLA 4LWQA 5FTWA 5JAOA 3GEMA 4YRRA 1ZK4A 2UUCB 4TL9A 1ZUIA 2C94A 3V4OA 2H52A 4C2BA 4JDPA 5ABPA 4OHOA 4O4HB 1KQ3A 1Z16A 1XZFA 1W36C 1AGNA 2PIDA 2HLHA 3B8HA 4JSRA 5LR6A 3O26A 1TVCA 1YJ5A 1TQ6A 3NW9A 1N1GA 4GR9A 2CVHA 1EEHA 1T25A 1WVMA 3Q3EA 1JEYA 1CF2O 3D1JA 1NUAA 1PQYA 4HEJA 3R9XB 4YCMA 4B6SA 4KRFA 5BSTA 3G2PA 3E9MA 3CLUD 4N18A 2O07A 4EO4A 2QLFA 4RZSA 3TQFA 5B58T 1P62B 3W4IA 2GWRA 3HZOA 2J87A 2O8FB 1N6LA 1LX6A 3MS7A 2IXFA 4OL9A 4N0PA 3Q3IA 3G7NA 4KE7A 1PV4A 3I3SR 2Q46A 1GAXA 1AKNA 1Z0JA 2F6RA 4BTEA 5IZ4A 2NP6A 1TTHA 3PNYA 3QNWA 1CQIB 3OC6A 4D4MA 3O9MA 4MR7A 4HQLA 2BV3A 2P3OA 1WUYA 2EBFX 2O2YA 2OHHA 3EAQA 1EDBA 3GH1A 1CZKA 3MAJA 1C4KA 5B12A 3VNUA 4R71A 2VZEA 4TQGA 4RAQA 1CYEA 3GD7A 4OIFA 4S3MA 2ZE8A 1LZLA 2C2HA 4J0CA 1EUQA 3VV2A 1IXYA 4L08A 2VF8A 4U2DA 3SF8B 1FB5A 2HEGA 3FDZB 3EWNA 4KV9A 4UFPA 3FYDA 2FPGA 1I1HA 4PLZA 2CDBA 2JRLA 4ENSA 2ZT5A 5TPWA 1H4QA 1Z56C 3K4QA 1COZA 3DP9A 3LS2A 4G1EB 2R9VA 2Z1NA 4H7PA 4I99A 5CB0A 2FEMA 3S2YA 3PRYA 2A57A 3VMFA 3EZGA 1VG1A 3MD9A 1TU4A 4LFAB 1JI3A 3OLXA 2OC4A 1KSJA 5JAUA 1RPTA 5HRAA 1JKJB 2PLRA 4IY1A 4NI5A 2DGDA 1KO1A 4REMA 3TSYA 5G0UA 4U7DA 5K8VA 1YQXA 5CTAA 4YJFB 1J8YF 4OBEA 5DIZA 4JI6B 1BO6A 1CSEE 1ISMA 1I33A 2B2XA 4RQUA 4UNQA 2PRYA 4I4TA 3B1ZA 1QGZA 2IK8A 3LBIA 3MB5A 1Q7GA 2PCLA 2WWGA 4X92A 3DTVA 2CYCA 3E2MA 3H65A 1ZM4A 1TVMA 2GPWA 4HQKA 2VR1A 5CU7A 5EINA 1RPJA 3S2IA 3O2JA 4JYCA 1RCTE 1EVJA 3WGLA 4F0JA 4U5XA 3TEMA 1EFVA 3SFVA 3OE1A 1JDBC 2IRWA 4UNSA 4TUYB 1CETA 1KFCB 5B6IA 3DHWC 3QMVA 3QE9Y 1RP1A 5F76A 2BDTA 5C8ZA 4XAQA 1FMFA 4JDUA 4KWEA 3QLEA 1P77A 2J9FA 3DSRA 5F3DA 3UJCA 3IPRA 4RDHA 1KARA 4C30A 4IS3A 2JFBA 4K05A 1ZA2A 4QXOA 4ZZ3A 2EU8A 2CJWA 3HKCA 1AT1A 1ZHFA 3UBMA 2P9TA 3QXJA 4DZZA 2X3YA 1V1RB 1MJGM 1TIPA 3NI2A 1C3EA 2GUWA 3CZ4A 4QUAA 1QHHA 3K1JA 3ND6A 5ESXA 1XG5A 2PGJA 2XTJA 2JATA 3FCYA 4FMDF 4QHSA 5LBUA 1ZJWA 1X7ZB 4JFAA 2F43A 4C20A 1Y6GA 5AXBA 5DGXA 5L3SA 1T34A 3NJ8A 1YNOA 2Q5IA 1PKXA 1RAHA 2JIDA 5JZBA 4JSTA 5F21A 1IJBA 3H19A 3WAKA 3H4MA 4P2GA 4FX5A 4ZMSA 2CJYA 1EUCB 4KJZA 4ZVTA 4I55A 1GNQA 5L9AA 1PGJA 2JZNA 4CM8A 4V1CI 5CB4F 2CLDX 2RH4A 5KYXA 2DX7A 3GLUA 2ZJYA 5C52B 3TLEA 1FQKA 2NUTA 1WD7A 2QTZA 3Q3GE 1WDMA 2GD0A 5D5PA 5ELXA 1DQNA 2JL1A 4LZOA 3EXHA 4PYQA 4ZMBA 1MV8A 4GOMD 5K51A 4ZKDA 3D54D 3HEMA 1KAGA 2GZ3A 1WMFA 3EEQA 1CJKC 3DYBA 3OUZA 4KXUA 4MRVA 3TF5A 2C7RA 4QUJA 1RWNA 1LCIA 2YYZA 4I3FA 3J81k 2PO5A 5FPHA 4ZTZB 1ZD2P 3PKZA 4KI0A 2JD1A 3FF1A 1TQ4A 4XDYA 4DEXA 3IBCA 1GGFA 5ECDA 3S0JA 3U7EB 4KR9A 5KU1A 1I2CA 5EE1A 1M1ZA 3H6KA 3A3YA 1W1UA 4ENVA 4PHTA 2AN9A 5TMDA 4PO1A 4AZ0A 5A7FA 1DWPA 1SM4A 2BE7A 2VJPA 1EXNA 3DCIA 3P27A 3VPSA 3M5PA 2CXXA 4JYAB 1EFPB 2N1MA 2WJGA 2XLBA 4H0CA 4N1AA 4CLXA 2J07A 3GPDG 4EF6A 1KI2A 5EN4A 4BEJA 1Z5OA 1PS0A 1Q1ZA 4OBWA 3JQ9A 1M1XB 1QKKA 1VBKA 5LZ5A 2YNMA 2XZOA 1RRMA 3OAAA 2J08A 1NN3A 4K9MA 1S2LA 3ROFA 4DCGA 1AHNA 4OHPA 2ZWIA 1XVUA 2ZUTA 4L8YA 2CC2A 1U0HC 4P54A 5BWLA 1U80A 2QZ9A 2JJMA 1TJ5A 2HPZA 1VLJA 1WHSA 1Y3AA 3LJKA 3M4XA 3FYUC 4MS4B 3QY0A 1G18A 4DSTA 4MB0A 1MX3A 3ADOA 3KUUA 4Y6LA 3CCCA 4Q34A 2FZ4A 3VYTB 5BOSB 4FHFA 3G89A 1MVOA 1HORA 1XLVA 2QV7A 3QXCA 1UBUS 2Z8ZA 1NKSA 3S1AA 2Q99A 5CTJA 3T3EA 4ARCA 4AVYA 1V41E 4L57A 1NE7A 1PP4A 4K26A 3PE3A 2V6FA 5J1SB 2BW0A 4WPGA 3DZBA 1A5BB 3NASA 5REQA 2R6DA 1PD1A 4GLOA 1XWIA 4FEEA 3DMPA 2P91A 2VYNA 2WYVA 1P1IA 2P78A 3Q8MA 2BN4A 2JFPA 3A05A 2Q8NA 3ZOZA 3REFA 2NADA 1F8GA 3N6RA 4F9EA 4FSHA 4KVGA 4XYGA 2J3IA 2EFHB 2IYVA 1QQTA 1LFDB 2E6KA 2JJ1A 4IDBA 1N2JA 4LXUA 4OV6B 4RVSA 5BN5B 5BT8A 1DTSA 2GESA 5IEJA 4DR3B 3Q9UA 3MGKA 4ZALA 4YX9A 3B9QA 2Y27A 4C14A 4G0WA 2FR8C 4L8GA 4BJ5A 2VUSA 1UL1X 2X8AA 1BWQA 4DIMA 3DVSX 3IP9A 1E77A 3G2HA 1V5WA 2XMCA 4GP9A 4EBFA 5DHSA 3WRWA 3AY0A 4TV9F 1Q2XA 3CZMA 1KSFX 2XKBA 4QUIA 1E4EB 4C29A 2OHJA 1E4YA 4NCXA 2RGUA 4YBZA 1EYZA 3EZ2A 2M6LA 5DN6A 1C9DB 1UJ5A 4ZU1X 4YJ2A 2VLIA 2EFJA 3KXDA 3OZTA 2ATVA 2B6HA 2VJMA 1RAEA 1N2GA 3DGEC 3KKOA 2WF7A 4UUPA 1L9KA 4MJ7A 1MRZA 4L15A 4LBWA 5JVDA 2F7SA 2I4NA 2YWHA 1ZM9A 2B7LA 3VSDA 3BGDA 3UV6A 1QKJA 3GG9A 4GKVA 2FPIB 2LTAA 3AVUA 1ISJA 1KDTA 3M6AA 5L95A 2FX5A 2IE8A 4DIDA 1D5CA 1H1TA 1OYWA 1Q83A 3ZNQA 5KCMA 2DUNA 4L1KA 3L6CA 1XU4A 2Q50A 2W37A 3B9PA 4LRUA 1SXGA 3VSAA 4URYR 5L53A 4NK4A 3WJ1A 5EJ4A 2PO7A 4JLBA 4HFRA 4HCJA 4AO6A 3AINA 3HDYA 3O3NB 2C2YA 3A1VA 1NTOA 1RI4A 4JBWA 3TEJA 4ABTA 2R48A 2HMTA 3IQIX 4GO1A 2HA0A 5A6SA 4F72A 1G6OA 1CRLA 4X64B 2F3QA 4UHDA 1FP4B 4Q02A 3EUEA 3F2VA 1Y7LA 2GA8A 4BX2A 1O77A 2XB6A 1XA3A 3KE9A 1XVLA 4JN6B 4LDRA 2IBMA 2HJRA 3PRJA 5JD5A 4FS3A 3IVMA 1YASA 2FR0A 2GKGA 4K9NA 1JILA 3KJHA 5CW2A 3STUA 2RGNA 1U8EA 2Q8PA 4TS3A 4GEGA 2O2IA 2ONKA 3D4LA 1DAFA 3W9UA 1KP2A 2ZAMA 2GM5A 4MX8A 3ZCTA 4ONEA 5D3KA 3L8HA 1CZHA 3VVCA 5EUMA 4FR0A 3NAGA 2V7BA 4C0BA 3ERCA 1VKZA 3BKXA 2XTZA 3OESA 1FLNA 4MRNA 4OBBA 3SFZA 2AOXA 1T5OA 2JAQA 3DMFA 1G21E 4BGEA 4OF4A 4RPCA 1KKLA 1P2UA 3FYHA 5HRCA 1VMDA 1JDTA 1E1RD 4GE3A 2G6BA 2WE8A 4K1LA 4TYYA 4X0EA 3UHFA 2PDAA 4D9NA 6GPBA 1FVHA 3MWKA 3UK6A 3WNQA 4MW5A 4Q3BA 3OZXA 3RS4A 1CS0A 4J3JA 1JQKA 2N47A 3LUCA 5J4VA 3ZGZA 5SZIA 3QA3E 4BQFA 4EZBA 4MR9B 4OMUA 1U6KA 2ZUDA 3RANA 2PMEA 1JNYA 2GZRA 5K3OA 4U2FA 3WK9A 1V16A 4MYUA 2PQ6A 3ZBUA 1EVLA 1U5AA 3WLNA 3GK3A 4ETIA 3JV7A 3BCSA 1QTQA 5A4IS 3IQEA 3S3TA 1IEVA 1TMYA 2VOEA 2ZRAA 3EVNA 4LZLA 3SFTA 1YIAA 3ITDA 1C7ZA 2IXGA 1A4IA 2QS9A 3IP3A 5CX1A 1IK4A 2P6PA 2R86A 1P1FA 2MDTA 4L2IA 2F55A 4BUJA 5ENZA 1ONOA 2IVZA 3L7YA 4WIAA 3RVSA 2ENWA 1WW2A 3JARA 3OD1A 3VDMA 4E21A 3B89A 3GUVA 4LJ5A 3V1NA 2IP2A 4PX3A 3AERA 1TW3A 1M0WA 2ECQA 4RD3A 3RASA 2RGAA 3QBJA 5CFNA 1DKOA 1H69A 1LV7A 3EOZA 3WLSA 2RH9B 2WFAA 2J3LA 3GIWA 2AOVA 2G1AA 1UWVA 2QN7A 4ISCA 2FN7A 4QLBA 1NFQA 2Q5FA 2WZCA 2R1TA 4L28A 4PZCA 1KSGA 1TF2A 4K9OA 2RGCA 1NVFA 5GJBA 1O87A 2GZAA 1HYQA 2RSLA 1SOWA 3EQ7A 2W2OA 1ZC3A 2GF0A 1U9YA 1ZQ9A 4KLRA 3QVXA 4PG4A 4TV8B 4Q3AA 2BBSA 3RAJA 4KOAA 4MUKA 5HX7A 1TNDA 4KDFA 3GVXA 1O03A 2PGIA 4J43A 4KOEC 3ZCXA 3CB4A 2R11A 4J2TA 5TARA 2CUNA 3WLRA 1UOPA 1U9IC 1L7MA 2EFEB 2VPWA 1U3DA 4Y30A 2WUEA 4L0QA 2SKEA 4M0MA 3KDAA 2FK7A 5JASA 2P2NA 1UCFA 3NGMA 4F92B 2OFFA 3D5QA 1HDXA 3FMFA 4JYMA 2PWYA 4X6XA 3W5VA 3CZCA 1PJQA 3KYBA 4R3WA 2FFAA 1ST3A 4B6JA 4QNMA 1Z4LA 1QRUA 5JBQA 3U09A 1JIQA 3DBIA 1Z08A 2TECE 4PSAA 5CA0F 1RQNA 3S8YA 1IHXA 2YWGA 3ZJYA 1E58A 4CFSA 3BGVA 1Z5ZA 3AP1A 3R44A 4MW7A 1A5TA 3ZLVA 1S3SA 1EGHA 3BK7A 4PZZA 3V46A 5CBPB 4UHCA 1FVFA 3TTWA 3JQ8A 3GI1A 2GK4A 3PEWA 1QZXA 4AM8A 2JFNA 3AUAA 4GLJA 5FFFA 4MWSA 4IV5A 1WL8A 3IKTA 4M99A 5ALYA 1WUKS 3UIEA 3OURA 3KE8A 4D97A 4D8WA 5H80A 1EUYA 4PPGA 4ITUA 4D5EA 2Y2VA 2ZROA 3UK7A 4CZ2A 3DXZA 4OI1A 1XMJA 3KS9A 4OXIA 1MMFB 5KHAA 3ABRB 2ZPAA 4C07A 3SX0A 1BMDA 5B1DA 1GLGA 2CYBA 1B3RA 3OPYB 2AEJA 2YS6A 2H4FA 1D2RA 2F3RA 2ZWVA 4HXGA 4POOA 3VSEA 4TYNA 3GLIB 4AC9A 2PS1A 1FNDA 3AJRA 4F3CA 3THOA 1XX6A 2Q7XA 1H23A 1NRXA 2Y1XA 3R0JA 4BO1A 4BO3A 1SB8A 1UKVY 4Z2AA 5HKAA 4HQNA 2NPFA 5JI3E 1A98A 1WLSA 4HB3A 2X5OA 3ENKA 5A6VA 5C3MA 1PR5A 2M32A 4NBSA 1D2NA 1XHEA 3PR1A 4F4JA 1IIBA 5C5CA 1AURA 1GYQA 1F6WA 1KPIA 3IQGX 4OA5A 1NT2A 5GIPE 2VIIA 1FNBA 1KI3A 4MR7B 3ZDFA 3EWSA 1NIPA 3F98A 4DMGA 1NLZA 3EBOA 4A2PA 1R74A 1S2NA 1ECPA 5ER6A 3WLAA 3LUJA 2XMQA 2FQQA 2G80A 4GC5A 4QAJA 4X95A 5B3AA 5ARBA 2A7XA 3AJDA 3ODPA 4G0NA 1DXOA 2G0AA 3K0EA 1TO1E 2WT4A 4MS3B 4Z3DA 4MZDA 1EWTA 3VNQA 1S2OA 1LU9A 1XQVA 3OFSA 4J9UE 4MLCA 2BGIA 2ZU6A 1J99A 5JBNA 3CVOA 3LLCA 4LOIA 3RJMA 5CDHA 1EFHA 2IYFA 3PRKE 3A0UA 6ABPA 5IT0A 1OOEA 3CSSA 4OG2A 2C04A 2ZSDA 3IA7A 5EXDA 4OH1A 2BI4A 2CLIB 2R0QC 1PFQA 5LLDA 1KZ7B 3SQMA 4RAOA 2I2DA 3FOWA 1QLWA 3PX3A 3PIIA 3UGQA 4GYKA 4WZAA 4QATA 5GZ1A 2DTEA 3Q8WA 1RXUA 4P2BA 4US1R 3WIOA 2WB4A 4HH0A 4Y7DA 1N36B 4KHPB 4CJXA 2MSLA 1CULC 1GHTA 2AW5A 2QT0A 2A9FA 4GI3A 5K0EA 4MW4A 4B6EA 2RJ3A 5I9BA 2A1UB 2IYEA 2FPXA 1XVTA 1UK6A 3GLTA 5F12A 5G3ZA 3LT4A 5EJ6A 2G1UA 4MIYA 4U6SA 3V48A 1MCZA 3ZX5A 4CKBB 2O8CB 5KINB 3CN9A 3L6DA 4INJA 4PCUA 1TJPB 3KQNA 3PFBA 2GNAA 2AYYA 2ZWAA 2V7EA 1N2CE 3J7TA 4HAWA 4CKCA 3PIRA 1EVZA 4F4HA 4MXDA 3RK1A 4ZVSA 3W5BA 2ENUA 3LCRA 4P83A 4EHHA 4ZOLA 4U2KA 3ZOKA 1AK9A 1ZCJA 2Q6KA 3HO6A 4W9NC 4DY6A 5DGIA 2RKBA 1YS2X 2VDVE 4J0EA 5E6RB 1P9WA 1M2EA 2VG8A 2FY8A 3EEFA 1M8JA 4UEOA 2ZSEA 1VXOA 4PFQA 4Q01A 4YMLA 4BJ1A 1EFAA 2ZI4A 1M6WA 2UYGA 4GR4A 1HOXA 1E6KA 3BWEA 1UJ6A 4RD6A 5KTYA 3DEKA 2DU8A 2E3JA 1HOTA 4EMBA 1W7AA 1TD9A 4LZJA 3KWMA 2B69A 3EEBA 2CL0X 2D5CA 3Q98A 3G23A 1E98A 4TQ9A 5CLHA 3CGGA 3M9WA 5CLLA 3AY3A 5JWRA 1HYGA 3P4YA 4NMHA 2OBNA 1S2MA 1K5GA 1UWCA 3C8MA 3GEBA 5KYVA 4BQSA 3IIJA 4G4IA 5KVQA 1Q6ZA 1PW7A