1Q0ZA

Crystal structure of aclacinomycin methylesterase (rdmc) with bound product analogue, 10-decarboxymethylaclacinomycin a (dcma)
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
297
structure length
297
Chain Sequence
b'SERIVPSGDVELWSDDFGDPADPALLLVMGGNLSALGWPDEFARRLADGGLHVIRYDHRDTGRSTTRDFAAHPYGFGELAADAVAVLDGWGVDRAHVVGLSMGATITQVIALDHHDRLSSLTMLLGGGLDIDFDANIERVMRGEPTLDGLPGPQQPFLDALALMNQPAEGRAAEVAKRVSKWRILSGTGVPFDDAEYARWEERAIDHAGGVLAEPYAHYSLTLPPPSRAAELREVTVPTLVIQAEHDPIAPAPHGKHLAGLIPTARLAEIPGMGHALPSSVHGPLAEVILAHTRSAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords aclacinomycin methylesterase
molecule tags Hydrolase
source organism Streptomyces purpurascens
publication title Crystal structure of aclacinomycin methylesterase with bound product analogues: implications for anthracycline recognition and mechanism.
pubmed doi rcsb
total genus 105
structure length 297
sequence length 297
ec nomenclature ec 3.1.1.95: Aclacinomycin methylesterase.
pdb deposition date 2003-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1q0zA00
5C8VA 1U2EA 3M82A 1XZLA 5YASA 5ALUA 5DYYA 3FYUC 2VJDA 3DJYA 3H19A 4MYSA 3K6KA 1NU6A 4AXBA 2XUHA 3H2JA 5JASA 1Y7HA 5A62A 1AZWA 2VJAA 2OG1A 2PSHA 4CCYA 1CUXA 4I3FA 2ZJ7A 4CG1A 1JT2A 1Q0RA 1Z68A 2J3QA 2BUCA 3DKKA 5AIBA 3FCXA 2QKYA 4DMKA 1N5MA 4FLMA 4F60A 1CEXA 2XB6A 1R9NA 3NOXA 5C7YA 4B9AA 4BZZA 3E4DA 1A88A 1LZLA 2HA0A 3DKRA 3U1TA 1HL7A 1WOMA 4JUIA 4AB1A 2EDCA 1GQRA 3PF9A 5JZBA 3PE6A 5AM3A 2VJCA 2OGTA 1BN7A 1QO7A 5KWIA 4ROTA 4BYMA 1GZ7A 1HDEA 4Y2YA 1YB7A 4B82A 2QRUA 3SX4A 5HQ3B 2OCLA 5AOCA 4HXFB 1ORWA 2CUTA 2VAVA 1VA5A 4JYPA 4Y2VA 1ZIYA 2BUBA 3PF8A 5FUMA 1QIIA 1SCQA 2WIJA 4QNNA 1QE3A 1CUZA 3WK4A 5LZ7A 4GECA 2W6CX 3OC0A 3FVRA 2GBIA 6YASA 2EEPA 1WM1A 4DNPA 1K8QA 3NWOA 4TGLA 2OLEA 3E0XA 1LPAB 2HU5A 2Y2UA 3GROA 5CXUA 3LIIA 3GFFA 3UUFA 4N8SA 5HK8A 5LZ9A 2HA6A 2I3DA 3VJMA 2YASA 3BIXA 1VZ3A 1UWCA 1QIFA 1QOZA 4P08A 1YCDA 3DOIA 2JGEA 4GEGA 1Q83A 3A2LA 1TIBA 2QUAA 2WFMA 2XLCA 5BWBA 1JJFA 1MN6A 1XZCA 2XMZA 3FNBA 2ACEA 3G9XA 4J0IA 4ZRDA 4X97A 3DEAA 5AO9A 1GPKA 2Q0XA 2D5LA 4KE6A 5DNVA 2ECFA 5EIAA 3UUEA 4FFWA 4KE9A 1PV1A 4BVKA 5AM1A 4BATA 3WMRA 1W6RA 4X91A 1W4LA 2C5FA 1DWQA 4LYDA 2ZSHA 1IVYA 3ESCA 3KD2A 3PDCA 3WA6A 1BS9A 3CN9A 1JKMA 5ALZA 3FLEA 1G42A 1E66A 2ACKA 3DDUA 1P0MA 3I6ZA 2PSFA 4QDZA 4C6HA 2QM0A 2H1IA 4CIBA 4J0KA 4FKBA 2AJ8A 5CH3A 4Q05A 3HZOA 4FNGA 5ESRA 3GBSA 4B7ZA 4BDSA 2XQJA 3BIWA 2JGKA 3ED1A 2QJRA 1GQSA 1TCAA 2PUJA 1GPLA 1F0NA 3FSGA 1YSCA 4X00A 2I78A 5IVKA 5JIBA 2WIGA 2RIPA 3A2NA 2Z3ZA 5IKXA 1ZD5A 3E3AA 4OU5A 1LBTA 5AKEA 4QEKA 1MAAA 2XE4A 2PBLA 2PU5A 2BAGA 2WTNA 2DHEA 5HF5A 1ODSA 5FDFA 2QJWA 4ZXFA 1QIHA 3R3YA 5DNWA 1FSSA 3ZLTA 4NS4A 3IUNA 4UBOA 5FRDA 1LNSA 4BCBA 4J0GA 1VA4A 3RKSA 1M33A 4I4CA 1ZJ5A 4Z49A 1EB9A 5CH8A 4BRSA 1CUIA 4XVCA 1WHTA 1T2NA 2ZYHA 2CKMA 1LZKA 4QDTA 2ORYA 4IH4A 2K2QB 2XI4A 1AQLA 4N5HX 1LPPA 1CFJA 1EI9A 2ZJFA 2O7VA 1XKLA 2B20A 2DHDA 4J0HA 4AN0A 2Z3WA 4Q3OA 4MQMA 1DT5A 2JGFA 4KRXA 5KWJA 4LIPD 4KACA 1MX5A 3C5WP 1XZBA 2PX6A 2BGRA 2XUPA 5HF8A 3V9AA 1GPNA 4V2IA 4J3JA 1SOMA 1AC5A 4UBNA 4PSCA 3IURA 2HA3A 3VKFA 4W9RA 3I1IA 4BC1A 2JGLA 1SFRA 3DNMA 2HFJA 4GLBA 2QVBA 4UPDA 4U2CA 4HS9A 4B80A 4Q3KA 2VATA 4G9EA 2OGZA 4P92A 3KOOA 3WWEA 4L72A 1DQYA 2BJHA 3G02A 1JJBA 3L1HA 5FKJA 1ZI6A 1XZGA 3IUMA 4OD0A 1FFAA 3QMWA 2HA2A 2WU4A 3WWDA 3U0VA 4BAGA 4QLAA 3W9UA 4WJLA 3H1BA 3C6BA 1UZAA 3V1KA 2AJLI 1R88A 4UHCA 1Y7IA 4WFKA 5EHQA 1LPOA 5E4JA 1UOQA 5SYMA 4YK7A 4PF1A 1U8EA 1ZGCA 1LGYA 4DSZA 3BXPA 5I9IA 3F97A 4UFPA 1J1IA 5A7FA 1CIJA 3WK9A 5KREA 5FLKA 1XZEA 1EA5A 3KSRA 1TK3A 3ICWA 2XMDA 1EDEA 1OCEA 5HZGA 3FYTA 5AK6A 1UK7A 2HFKA 2AJCA 4S0XA 4DTCA 4FMPA 4H0CA 4UHFA 1P0IA 4J0JA 1FJ2A 1L7RA 5K3FA 1LPSA 1VE7A 4C87A 4AN1A 5FPPA 4MXDA 5AK4A 5ALRA 1NU8A 5AKYA 1E8DA 4BP9A 1Q84A 3WJ2A 1DQZA 4CCWA 3N2ZB 4UBJA 2DSNA 4Y2UA 3DYVA 3KWJA 3B12A 1WPXA 2WUGA 3G0GA 5CT4A 3PUHA 4OB7A 5JATA 1CUCA 4DM7A 5K5EA 5EHNA 3R3WA 4GDMA 1J06A 5D3ZA 1ZD3A 1VKHA 1O6FA 4X6UA 1XZFA 1BCRA 4G4JA 3H18A 3L1JA 5AM4A 1QZ3A 4Y2QA 3IULA 3WLAA 5EI5A 4G5XA 1ACLA 3STXA 1YAHA 3R3XA 5DLPA 3C8HA 1QTIA 2DFPA 4YX9A 3QMVA 2CMFA 3HRHA 1J2EA 1MPXA 4E14A 5J3JA 5EFZA 2C7BA 2PVSA 4QA9A 4Y7DA 4IHAA 2H7XA 3GELA 1ZOIA 1YAJA 1FFBA 1CLEA 3LP5A 3O4GA 2JGMA 3A6ZA 4U2GA 4UFNA 1CUVA 5ALFA 1D07A 3H2KA 5AOAA 4Q1VA 1ISPA 4H7IA 3ESAA 5AKZA 2XMSA 2X5XA 2V97A 4DMHA 5CTAA 4H7EA 4N8EA 1XZJA 4WCVA 4Y9SA 1K63A 1YASA 2VA9A 4X6XA 3H1AA 5K3FB 4Q82A 4H18A 3WK6A 1QIKA 4OU4A 3GA7A 3EQ8A 3O4HA 1UK8A 3PICA 3WK8A 5C81A 3OPMA 3QH4A 2DQYA 1BROA 4TPKA 2XDWA 5FOQA 2PUHA 1XROA 3S2ZA 4Y2TA 2B61A 4PQEA 2PPLA 3W06A 3STVA 3O9MA 4GI1A 5AKIA 2WFLA 4UBMA 2B9VA 2HU7A 3WK5A 1OXMA 2O7RA 4J03A 1EDDA 4WFJA 4DLNA 2FJ0A 3A70A 5AKGA 4AQDA 1W75A 5JZSA 1WPRA 2PKYX 3WIOA 2HA4A 1KU6A 4FBMA 4G8DA 1AKNA 3W04A 1TKRA 1XRPA 2GYWA 4B83A 4EB0A 1E3QA 2WUDA 1ZJ4A 4M0FA 2DCMA 3WI7A 3STTA 4B6GA 4BBZA 4E46A 5DJ5A 2GBGA 4H7HA 4AO8A 2PU7A 4W63A 4WY8A 1YA8A 4ETWA 2XQFA 3TRDA 4J7AA 5CH5A 1P0PA 1DWPA 4BTVA 5E4TA 2W22A 4A5SA 3ILSA 3H17A 3C5VA 1MX1A 4ZREA 4EY7A 5ALIA 4XJVA 2VEOA 4HZGA 1IUNA 5EIHA 1DTEA 1C7JA 3WJ1A 1QO9A 1KEZA 5A71A 1AUOA 1MNAA 3WYNA 2QXTA 2V9ZA 3QBJA 4X71A 1K6EA 4DGQA 1H2YA 2WHQA 3HABA 5DTJA 3F98A 2WILA 5T4EA 4BE9A 3WL6A 1EH5A 5JAUA 1MX9A 2QS9A 3H04A 1QTRA 5EHXA 3C6YA 1XLUA 4EY6A 2C0QA 1XLVA 2WSLA 4G4IA 3DQZA 2XUDA 2WKWA 1BU8A 3I2HA 3ICVA 2HA7A 4BC0A 3LLCA 3I2KA 3VDXA 3RK4A 4DSAA 4ARBA 1EK1A 5JYCA 5ALTA 3WWOA 2WIDA 4CFSA 3N0TA 3AZQA 1GXSA 3ZPXA 4XX1A 1QLWA 5DNUA 4HTAA 3D3NA 4X85A 3I2IA 1ETHA 3BF8A 4M0EA 3WQHA 2ZYIA 4DIUA 1EHYA 3STYA 4Y2XA 4OPMA 3YASA 3EBLA 2CJPA 3D5EA 4Y2PA 1ZI9A 4MWTA 2HU8A 2OCIA 1ZICA 4ZV9A 1WB5A 3QYJA 2JGJA 3WZMA 5AI4A 4EY4A 1E8NA 3R3VA 5HKAA 1PJAA 2P8SA 2NW6A 5IVIA 1XKTA 1CUHA 2GBFA 5EGNA 5D6OA 5JAPA 2WUEA 3QITA 5BWCA 4N8DA 5JD5A 4JNCA 5ALYA 1LPMA 2WFZA 2HDWA 2G63A 2PSDA 4C01A 1QIDA 1USWA 1X2EA 2IITA 4H7KA 4FTWA 2AJDA 1H23A 1CUWA 4W1RA 5HKBA 4UBIA 4EA6A 1DINA 4BTLA 1N1MA 1IUOA 1QIMA 1LBSA 3Q8WA 4PSUA 1RWQA 4RNCA 4B0PA 4GWLA 4FHZA 2EDAA 3I2JA 5FP0A 4UBKA 3WL7A 4LYEA 4OCZA 2ZJ6A 3SK0A 5JADA 3B5EA 1UK9A 1EXWA 3LS2A 3QVMA 2HL6A 3ZV7A 2D0DA 2I03A 3DL7A 4RPCA 1UT6A 1JI3A 3O95A 3AZOA 1C4XA 1AMNA 3VVLA 3BE8A 3WZLA 5AM2A 3CXUA 2XUAA 4OUKX 4EZIA 1YS1X 3RARA 2XMGA 2VT6A 1XZAA 2BCEA 2XUKA 3FOBA 1HKHA 2WTMA 1N8SA 1MU0A 3M81A 5AJHA 4C4ZA 2WM2A 1EVQA 2BFNA 3P2MA 5DYWA 3AIKA 5IVHA 2CB9A 2PL5A 5ALSA 4BVLA 4DNFA 1U4NA 2I3ZA 4P93A 4U2BA 5SYNA 3V1NA 3VISA 3IUJA 4RE5A 2XT0A 4LXHA 5LKAA 4QZVA 4J0DA 4UHBA 1XRMA 1H2XA 2OPHA 2BKLA 3WIBA 4JYMA 5AOBA 4KYVA 4W1QA 4IQ4A 5E4YA 2QR5A 5JANA 3FLAA 2X8BA 2HRQA 2VTVA 4FOLA 4HXEB 1YR2A 4MJ3A 4WDRA 4K2AA 1ZD4A 4MEAA 5JZ9A 2C0PA 3ESDA 3KDAA 4Q3LA 1XRLA 1R3DA 1VJ5A 1UOOA 4ITVA 2QTBA 4QDXA 5I7UA 5D3KA 3FVTA 4AZ3A 1H2ZA 4QLOA 3ANSA 1XQWA 4LXGA 3K2IA 3HEAA 2HA5A 2XUJA 5H3HA 2QUBA 1TCCA 3FWHA 2O2HA 2XUGA 1THGA 3H2IA 4BP8A 2OAGA 4X93A 4BVJA 4L3WA 3KXPA 1XQXA 2Z5GA 1RYYA 5K3CA 4AO7A 5K3AA 4P9NA 2G5TA 3I2FA 2WJ3A 5DYTA 1H22A 2FJPA 3G9TA 4HRXA 2VQ6A 2O2GA 1B41A 3TGLA 5EIEA 2OQIA 1NX9A 4BRZA 1CPYA 2VF2A 3V1MA 4OB6A 4HVTA 7YASA 2ES4A 4OB8A 1MNQA 3RLIA 1CUGA 5ALOA 1BN6A 3WWCA 4HRYA 4GW3A 4NZZA 3G0CA 1XRQA 3HSSA 4ZI5A 5HCUA 3WK7A 3AILA 4MWSA 5JAOA 4H77A 2JGIA 3BDIA 1DU4A 2WUFA 5JD4A 4GBGA 5ALNA 3EQ9A 1A8QA 2H7CA 1XRNA 4U2FA 3T52A 5I8PA 3G7NA 3AFIA 4KAJA 5AP9A 2Z8ZA 1CR6A 3HLKA 2HRRA 3QPAA 4AMZA 4K6KA 4X94A 2Y2VA 3T4UA 4WFIA 4X3CA 1CUJA 1CUBA 4EUSA 5AKJA 2WFLB 5K3BA 3RM3A 1Y37A 3AZPA 4EHBA 3D4LA 3IUQA 3BJMA 3R0VA 4G9GA 4F5ZA 5BV7A 1VXOA 2ZVDA 4Y2JA 5CT9A 5LLSA 5ALGA 1ACJA 1K5PA 4PNZA 4JH0A 4CI9A 3O4JA 3OG9A 5JALA 1JU4A 1ZIXA 4G4GA 1BCSA 4PO3X 2XUQA 5CXXA 1L7QA 5ALQA 4OYLA 5AI6A 2E3JA 4WY5A 1S8OA 1EDBA 3BL8A 4UHEA 2WIFA 1YA4A 2IX9A 2OXEA 1SC9A 1XLWA 1UOPA 3G0DA 2YXPX 2GZSA 3ANTA 4G8CA 4UHHA 4B0OA 5A2GA 3NGMA 2HADA 3LCRA 5DTIA 2OCGA 2V98A 1JU3A 4EY5A 4X90A 1UKCA 1VOTA 4N5IX 3JWEA 3V48A 3C87A 1CUFA 1R1DA 1CV2A 2VT7A 1JFRA 2ROQA 3C6ZA 1RP1A 4BZWA 5AI8A 2X76A 3HACA 1MTZA 4INZA 3M3DA 3CN7A 3I28A 4E15A 3VJLA 3F9CA 5A6VA 3VXKA 3DD5A 4KE7A 1JMKC 2H9YA 1E89A 1QGED 4FLEA 3WWPA 4K6HA 3I6YA 1P0QA 3I6MA 4EY8A 2WQZA 3D2CA 1E5TA 3STWA 3OTQA 3IB3A 4U2EA 4O08A 4E11A 5LYYA 5CT8A 5CT6A 2WG2A 3ZWQA 1UKAA 3JYHA 1QIEA 2B4KA 1CUYA 5AH0A 4BDTA 4H35A 1MT3A 3FYUA 4G1FA 1F0PA 2GYUA 5LZ4A 4J0CA 3WKEA 1XZIA 3R3ZA 2WJ4A 3BDVA 2VAXA 2GYVA 1XFDA 2GBCA 4EBBA 1LPBB 1VXRA 1LLFA 3QM1A 3FYUB 3H0CA 5K3DA 1I6WA 1R9MA 3D2AA 3QMMA 5JD6A 3EF3A 5HFAA 3MGAA 1JMYA 2G4LA 5IVDA 4NMWA 4F21A 5JAHA 1N5RA 3LIPA 2PSJA 1EINA 3O0DA 4FBLA 4RE6A 2UZ0A 2R11A 1A7UA 1GGVA 5ALEA 1TCBA 2QZPA 2LIPA 4D9JA 3WKCA 1ORVA 1HQDA 3FAKA 4ZWNA 4XIIA 4YASA 1QONA 3WL5A 2WHPA 2Y1KA 3O4IA 1ZGBA 3SC2A 3AJAA 5ALJA 4LKOA 4C4XA 3CCBA 1WB6A 3HYSA 2ONCA 4WDQA 1TQHA 1GT6A 3R41A 3DLTA 5ALWA 1T4MA 1FFEA 4BE4A 1U65A 5ALXA 2QOEA 3UMJA 4IH1A 2ZSIA 5JARA 4K5QA 4L0CA 2OGSA 5IH7A 5LZ2A 3HJUA 4UBLA 5AKKA 3IA2A 4OYYA 1CUAA 3EQ7A 4HXGA 1DX4A 2BUAA 3WKBA 4C4YA 1L7AA 1LPNA 1CQZA 2IIVA 1XZHA 1ZD2P 3I1YA 4DMCA 5CBKA 3AIOA 4K6GA 1AX9A 2XMBA 4DMFA 2OQVA 5EHZA 2WLSA 3C8DA 1CVLA 3F8SA 5AI5A 3C6XA 4U2DA 3EIOA 3H2GA 1AGYA 4AO6A 1MJ5A 2RONA 4PV7A 5ALPA 4QWMA 2R8BA 3QZUA 4FWBA 1WHSA 4KE8A 4QWWA 3WYDA 3VJKA 2YH2A 4B9EA 2WG1A 4PW0A 3G0BA 4UHDA 3FCYA 4BCCA 4CCYB 1G66A 2WG0A 3Q0TA 4AMYA 1DX6A 3R40A 1MO2A 1BEEA 2CZQA 1GKLA 3KWFA 2ZYRA 4FNMA 1UK6A 1UXOA 2XUIA 1MAHA 4JEIA 3DL4A 1F8UA 4LHEA 4Y2RA 4QDOA 1EB8A 4H7JA 3STUA 3PUIA 3WL8A 5AI0A 4X92A 2QT9A 1FFCA 2O2IA 2RHTA 5LIPA 4A23A 3TJMA 3D2BA 5ALHA 1VLQA 3DCNA 4RGYA 1CUUA 1WB4A 1AURA 4XWGA 3G9UA 3PFCA 4H7DA 3MUNA 4IH9A 1ODCA 1FFDA 1BEZA 2HHAA 3C70A 1X70A 5C8XA 4W1SA 3ESBA 5CURA 1C7IA 1ZI8A 2C5GA 3WA7A 1UKBA 2RI6A 4AZ0A 4KEAA 1XZKA 2BGNA 4UFOA 4C88A 4MYDA 3IBTA 4M0MA 3C45A 2JBWA 2WJ6A 2WHPB 5ALDA 2RGUA 2DHCA 3MUOA 3I2GA 3L1IA 1CQWA 3AIMA 5F4ZA 2CEKA 5AM0A 4ZV7A 1IMJA 1QIGA 3H2HA 1B6GA 1PFQA 5AKHA 3JW8A 3HI4A 2WIKA 4G8BA 3V1LA 2WU3A 3OURA 2Y6UA 5CT5A 5E2IA 2AXEA 4C89A 3AUKA 4HAIA 1ODTC 3FSGD 5K3EA 5LKRA 4BAZA 2J3DA 4KRYA 1XRRA 1EVEA 4L9AA 1EX9A 4KAAA 5AHXA 4Q34A 5ALKA 3GZJA 4F0JA 5ALLA 2C58A 1XQVA 4KJXA 1OILA 2WHRA 1TAHA 1J07A 4H7FA 3DS8A 3TEJA 4IO0A 1QJ4A 1X2BA 1WCYA 2JIDA 2C4HA 2RHWA 1W1IA 4KR0A 3O9VA 2GZRA 1G5FA 4CIAA 3ZI7A 5ALMA 3E1GA 4X95A 1EK2A 1XZMA 2QXUA 5AKLA 3S8YA 5BOVA 3QPCA 4FDMA 5D7BA 3BJRA 2PSEA 1CRLA 4QE3A 5ALVA 3BWXA 2XLBA 4DNQA 1IZ8A 2XMQA 3AINA 3MVEA 3M83A 3VVMA 1R4ZA 3NUZA 5FXMA 1HPLA 1W52X 3HXKA 1HLGA 4A16A 3WKDA 5DWDA 3HC7A 3C43A 5C8ZA 1XZDA 2J4FA 4FLFA 1K4YA 1BRTA 2DQZA 1G4HA 5CMLA 4KAFA 4X6YA 2Y6VA 3W2TA 1R50A 3ZLVA 1JJIA 3D0KA 4YPVA 1HBJA 4LXIA 1CUDA 2XUOA 2YYSA 1W76A 1QFSA 5AI9A 4MEBA 3W05A 1VZ2A 1SCKA 1CUSA 5HF6A 3FLBA 4W1PA 5HQ3A 1BE0A 1H2WA 3GUUA 1SCIA 1O6GA 4CG2A 4CG3A 3QPDA 5KBYA 2H7YA 2V96A 1UFOA 4GXNA 1VE6A 2XQGA 4AX4A 3F96A 3PI6A 1DT3A 5LZ8A 2ZYSA 3OM8A 3DOHA 5HF9A 3D7RA 2DR0A 4ZGBA 2Z8XA 4ARAA 5ISMA 5CW2A 2OAEA 4OSEA 1A8UA 3K9BA 1QIJA 1Q0ZA 2G5PA 5T4HA 2RAUA 1CUEA 4BAUA 3IDAA 2J4CA 4BCDA 2HM7A 3A2MA 5LP1A 1YB6A 5HK9A 4NVRA 2XMRA 3DYIA 5AKXA 3OOSA 2XMCA 4GHWA 2XUFA 3SWWA 3WKAA 1E8MA 4B84A 3G8YA 4TVKA 3F67A 4I19A 2XQKA 5AK5A 2QMQA 1DWOA 1KU0A 5AICA 5AIAA 3X3HA 1IUPA 2VSQA 4DNOA 5AK3A 5AM5A 5A7HA 1GKKA 3W9BA 1A8SA 4QDUA 4UUQA 1IZ7A 2AJBA 1YS2X 5FPQA 4B85A 3BF7A 5A7GA 2HIHA 3ZLUA 2FUKA 4PSDA 5T4FA 4MQLA 1QFMA 3G9ZA 3CCCA 5T4BA 5CRIA 4BB0A 4X7BA 3IVMA 4B81A 4Y2SA 4DYHA 3D59A 5HFNA 1F6WA 2PM8A 1TRHA 4FFVA 3B3QA 2JEYA 2JF0A 1XQYA 3G0IA 3R3UA 1THTA 2FX5A 3FBWA 3PFBA 2XQIA 2CBGA 2JEZA 5FV4A 2VJBA 2OCKA 3IIIA 5LZ5A
chains in the Genus database with same CATH superfamily
4BMSA 3SE7A 4ZDWA 1FRVA 1U2EA 3M82A 3H1FA 4PBSA 3WL4A 4D0LB 4DIMA 4JAVC 5CM8B 5F1KA 4JLKA 3EGIA 1RR6A 5J5CA 3J81A 4FZRA 4EVSA 2ODAA 3GGJA 3FYUC 5KNCD 1SKQA 4TTVA 4UEWA 1BHO1 3MFYA 1YI0A 2X23A 2R8PA 1Y0BA 1NLFA 3QVVA 3ZVLA 4ZKDA 1N2SA 2G4VA 1O95D 3B9BA 1F0YA 1DWUA 1FNDA 1LI4A 1H6CA 2XVYA 2AVDA 3OMXA 1GILA 4MIYA 1K4KA 1VL2A 2Z56A 4EQZA 5I7EA 5E95A 3U3KA 3DKVA 1C7ZA 1YHNA 4HADA 5IJ9A 1JVNA 4ND2A 3QFCA 1G55A 1OXBB 2BDEA 1QHSA 2BGMA 3IILA 2B82A 4UARA 1C0PA 5GIOE 2MSNA 3LF2A 4A2WA 5A62A 2VJAA 4RM3A 3ER9A 3KYCA 2IBTA 1Z83A 2XNHA 2R84A 2BEVA 2WD7B 4GVXA 3X1XA 1BVYF 4LJYA 4PO1A 2CUZA 4Q9NA 1P7PA 5IAGA 3GLGE 3B1YA 1CUXA 1LH0A 1UDCA 2NO1A 2GCEA 3IALA 3KQOA 3LQFA 1GQOA 1NV9A 2WWIA 4O2BB 4BZPA 4XM1A 1Q0RA 1Z68A 3ZHQA 1ZJZA 1Z5VA 5JE8A 3O8OA 3VPCA 3GPDG 2ZTLA 4EVQA 2JBAA 2UDPA 5AW8A 5FT9A 3ASUA 2GO7A 2V7QA 1U28A 1N5MA 1TJNA 3X0DA 4DMKA 3QXXA 2EWWA 2XB6A 1KZ4A 2NQ8A 1R9NA 4B6RA 4AW9A 1X0VA 3W6PA 4BZZA 4QRDA 4ZIRA 1W1WA 4DJTA 3HJTA 3VAZA 2HA0A 2IY8A 2ZXUA 1WOMA 1JQDA 2TMYA 3BWEA 1I5OA 3DDSA 1FBNA 4X8OA 1QZTA 2QM7A 2X77A 3JWHA 4FJ2A 5A3VA 1XZQA 3JQFA 4JUIA 3TYXA 3EHEA 4O4LF 2V03A 4ID3A 3UXYA 5FWYB 4LJRA 1KZ9A 3BH6A 2ZBPA 3P4UA 4NBSA 5L7YA 2VJCA 4DJEC 3TIGA 1KVRA 2QQ0A 2OGTA 3KWMA 1BN7A 3R7BA 1P2GA 1X19A 2QU8A 3LX5A 3QRWA 4ROTA 2DUNA 1DRVA 1JAYA 4LC1A 1YS6A 2H59A 3QWHA 4Y2YA 4B45A 1J90A 3K6SA 2WWRA 2QRUA 4OXIA 3I62A 4HXFB 4EG3A 1M1ZA 5BYAA 2P3LA 3IBFA 4IIVA 3TH5A 4LYJA 2M6KA 2BEWB 3W5HA 1Y4UA 4CM6A 5FUMA 2B5VA 2I54A 2BSQA 2RMKA 4HEQA 3WSWA 1Y5IA 2DR2A 2I7TA 5FYQA 1T6BY 1GFIA 1KEKA 5ED4A 4YP7A 5I7OA 3D3KA 3FR8A 4OHRA 1X6VA 4GAEA 1KARA 3FVRA 4JLBA 5DASA 2F90A 4BS9A 4LBVA 1JKXA 5HQJA 3O8RA 1UBGA 4FGJA 5J5VA 3PZRA 1U7XA 4M1ZA 2Q3EA 4GR5A 1L5GB 5L3VA 3CUKA 1VQ1A 1PSZA 5L3QB 5CNMA 1C8LA 3KJNA 5CIQA 1PHPA 4MKGA 1KS2A 1HNWB 1WZEA 1CTQA 3E0XA 1LPAB 2FWJA 2HU5A 2YVUA 1ISJA 2A5DA 3IOMA 4N7RA 2BEUB 3FDIA 4BVBA 1NPYA 5CXUA 3TRJA 1L4EA 1NLUA 4L9WA 4AUEA 1BTOA 3A4MA 1KMIY 1JLRA 4JNKA 1GU0A 3A06A 1ZN8A 3C3WA 3K1AB 5FUWA 1H66A 5HK8A 3CR8A 3QWIA 2QVCA 4X1KB 4TYPA 2HX1A 3BGDA 3TCKA 5BQXA 1GAXA 3NHWA 1ZL2A 5LDDC 4H1UA 1SCDA 4C6TB 3I05A 1GGKA 1M1YA 3GGCA 1UUFA 1IQ0A 2H00A 1R16A 4NLLA 1A98A 1UWCA 1I4DD 2WF9A 2G77B 4RCYA 3MJVA 4PC1A 1BWQA 1WMAA 3DVAA 4YC7A 3WYAA 1A4IA 1M1NA 1QOZA 2GSDA 3A3PA 3WS7A 5CEJA 2ZJZA 1JHQA 4FCWA 4MUXA 3MB5A 1YCDA 2AV6A 3DOIA 3DEIA 4DUGD 1RXIA 4ZYUA 4YFVA 5EZQA 4AWBA 1BNCA 3LV8A 4EEZA 3DXYA 5LBTA 1Q83A 3A2LA 2XMPA 1Q7CA 2XPCA 4LECA 4NG4A 1TIBA 4QBHA 4KNVA 4ZVRA 4F7WA 2UUBB 4TZ6A 3N3BC 5BQOA 1V6SA 1JEDA 1R0RE 2KS6A 2NUTB 2Q07A 3BK1A 4RY8A 4RDIA 2CUKA 4XEUA 5E2BA 2B8JA 2OBYA 5JNRA 2K4MA 3EPJA 4P3YA 4KYTA 1CJVC 2ACEA 3ILHA 1GAQA 3G9XA 3PP8A 3HVJA 4J0IA 3IX7A 3LDAA 3TGWA 3HMQA 5AO9A 5REQA 3C4QA 3GJ5A 3UGTA 3K2QA 1OLXA 1HE3A 4Z1MA 4JB3A 4ZDIA 1EJ6A 5LXTF 2DT8A 5IFKA 1FVOA 5H80A 3FY4A 2ODEA 3O1LA 3EEIA 4YVFA 5C5EA 2IH5A 1Y4ZA 5C7LO 1VP9A 3DLAA 1ESNA 1JTFA 4UXIA 3EXHB 4WZAE 2R8OA 3OCZA 4JBIA 5EIAA 4NBVA 3DOFA 1XDBA 1PK7A 2J7KA 2ZUUA 1P5JA 2FEPA 4ENVA 1NR5A 1KVQA 3EMDA 5AM1A 1O95A 4BATA 4M76B 2RGYA 1IM2A 3GRPA 3L3BA 3FDZB 1E2FA 4X91A 1NMQA 1C3XA 1NFFA 1W4LA 3TKYA 4PPFA 2WVHA 4I4TA 1GZ3A 3TZEA 4EHDA 2F43A 4F2DA 1GRRA 3HB0A 3U7QA 4ESVA 4QKQA 3ICPA 3PQ4A 3SZMA 4C7XA 2X2OA 5LQNA 1FJXA 4GL2A 2XEXA 3B82A 2P0AA 3PDIA 1US8A 4J4TA 3TLZA 3AKEA 1IVYA 4KC0A 4JODA 2ORIA 1NVVQ 4RJIA 1M76A 3P1JA 4TL8A 4ES6A 3ESCA 5KYUA 4MS4B 1KI3A 3V7WA 1JG4A 1IN4A 3CN9A 2QHXA 5K6AA 3IMFA 4PYLA 3AJ8A 3FLEA 4BWVA 4QHYA 1II9A 1SOUA 2YX1A 5LXTA 2L0XA 1G42A 3DLCA 4ZU3A 5HEKA 3FM9A 4EGQA 5F9FA 5JWHA 1N6NA 2PBRA 4MVJI 1LWOA 2QQ5A 3QUQA 2Q3BA 3UMJA 2QMUA 1P9WA 1AQ6A 3D6JA 1SOAA 1QE5A 2LCIA 2QM0A 1WUKS 1X74A 4FFRA 4UTOA 4DZRA 1DUSA 1E1CA 4I4NA 4FKBA 1BIFA 3TW6A 2JB9A 2QP4A 3IQEA 4BRUA 3WLKX 2IYVA 2Y1OA 4B3MB 3HZOA 2W2TA 3T7RA 4I55F 1TF5A 2C0CA 2W6PA 1CZRA 3SF8A 1HNNA 2JD0A 1GQSA 3GFRA 1QGOA 3SZUA 3V2UA 4QNRA 2PKQP 3IQZA 1MAUA 3TL2A 2JRCA 4YAUA 3VZSA 2VDUE 1IXYA 1YZVA 4MMZB 1U2SA 3A14A 1T9GS 2NX2A 4FOPA 3A2NA 3EAQA 3DP9A 4DRXA 2COUA 4MWOA 2ZS9A 3FGPA 4AF8A 5IKXA 4JYAB 5LLTA 2W5UA 4H15A 4HLCA 4IO1A 1KE2A 1LBTA 3QBTA 1W36C 1HDYA 4IDCA 4QEKA 4WZAB 3CLTC 3MQFA 4G0XA 3BXHA 3GXOA 1SCUA 3HDTA 5B1SA 1PZMA 3MJEA 4IHKA 2QE7A 3L7YA 1Y1PA 3RYCA 1KY3A 2ALJA 4XCQA 1CJBA 1QDEA 1YI1A 2DHEA 2QU7A 5HF5A 1JHOA 4A0QA 1NPDA 4F5WA 3NDPA 1TEHA 3LK6A 2QJWA 4ZXFA 3VC2A 1IY2A 3K31A 2F8MA 3ESRA 1XWWA 4RCVA 1G7TA 4IHJA 4LK3A 3VRHA 2FG5A 5JS8A 1YQQA 1FSSA 2FSPA 2O2SA 4G97A 5F5XA 2OA0A 3ZLTA 4J16C 3HKDB 4BN0A 4UEKA 1B0PA 3ETCA 5FRDA 1Y3DE 1G6OA 1SQ0A 4OMDA 1QO0D 1Z0UA 2DLDA 1VA4A 3K8ZA 4KO3S 4IP0A 1QH8A 4XSVA 3RNLA 3UFXA 1WMEA 4C2UA 1U1DA 3U4MA 4W5NA 4GXRA 2CFIA 2DG2A 4IV5A 4XWYA 4BRSA 1VYHA 4TTIA 1CUIA 2R1VA 4AT1A 5M29A 3I9V6 3U1BA 5KNDD 3KEGA 3PQ7A 2ZZNA 2ZYHA 1NAHA 1E63A 4DV6B 2ZB4A 2NU9B 4IH4A 2W71A 3DDHA 2CXHA 2G82A 2R7KA 3K9NA 3KJIA 5CHYA 4EABA 1UXIA 4DXAA 1CY6A 2FDXA 3GFVA 2P4UA 4QUBA 1ZX1A 3LPMA 5CFPA 5JWRA 1LPPA 2C29D 1VL5A 2PX0A 4X66B 4I3HA 1EI9A 1HOTA 2ZJFA 1CERA 1R27A 4J0HA 2ATXA 1N2JA 3MSCA 4AJ9A 5M2QA 2V7PA 5LQCA 4KRXA 1ZUWA 3FUUA 5AVZA 5KWJA 3RS9A 5JAQA 3WV5A 3EOZA 4ACAA 1Y9JA 3SHOA 1N7JA 3PXDA 4XIYA 4I6GA 2QL9A 1SQ5A 2XAUA 3CMMA 1FJHA 4OIFA 4YP9A 1VDMA 2I33A 1H0KA 4EPVA 2JC3A 2OCAA 1XZBA 1B7GO 2PX6A 2ZS8A 2ZR8A 2BGRA 2YHIA 1K66A 2Y1FA 3I5MA 4QREA 5A9RA 3KSZO 5KVCA 2XUPA 5HF8A 2OORC 1TZ2A 2OFOA 4X8HA 2AD5A 1HUQA 1U1IA 3JARA 3AF6A 2ZATA 4WINA 4YMVA 1N0IA 1KFBB 2Q6IA 1AC5A 1ZH0A 1NLMA 2BGJA 5D2CA 5J43A 3UFBA 2I6UA 2HJGA 1GGFA 5C18A 4BUCA 4OUDB 1DEOA 2HA3A 3N7UA 1JIQA 1Q14A 1EA7A 2GHTA 1ZLXA 2GJSA 2O8NA 3MWEB 1JLLA 4LY6A 4N3NA 4U5QA 3UMSA 4A8TA 4B17A 3B3GA 3GNTA 5KQMA 5JXHA 3OQOA 2CXUA 2F9LA 2ZG6A 4XGQA 2UXBB 2FSVA 2GN9A 2G1KA 1V95A 4HS9A 5HBRA 5HTKA 2NVOA 2WU0A 4LNAA 1U9IC 1DLJA 4TMKA 1UPFA 1EFUA 2E37A 2OESA 3ADOA 1WUTA 4BEBA 3NEPX 5T8KA 4YIHA 4JROA 1RZUA 2NV0A 4YDRA 3SAJA 3B9QA 4RX1A 3GYBA 3L7MA 3QU2A 3TIIA 4UUBA 2BM1A 1IH8A 1L4UA 2OGZA 3JQFC 3K05A 3KOOA 4UASA 4UUAA 5J47A 4D45A 1UZLA 4XDGA 4L72A 2HEGA 4L8YA 2FFBA 5DE3A 5KIAA 1DQYA 3E8XA 3O3NB 3VFDA 2ZJAA 1E18A 4BVHA 1T43A 1CNFA 1I36A 1ZW6A 3G02A 4A0GA 1BX1A 1JJBA 5FKJA 2OV6A 5B2EA 5JBIA 1ZI6A 8ABPA 1M6WA 3IUMA 1K88A 3OZFA 4P2BA 1CDDA 2W2OA 5IAJA 1F1JA 4C5CA 1NW9B 3FMPB 4HNVA 5A7GA 4U0KA 4UPEA 4BXOB 3OLYA 1ZVQA 3RG8A 3WWDA 4YECA 2H6EA 3KUXA 4ZOQI 4LHYA 4O25A 3KR2A 4QLAA 2I4OA 3UG6A 2FN8A 4MUGA 2JAPA 5JNTA 3OT1B 1K8RA 5ERYA 4BQPA 3HBNA 3H11A 3ITEA 5F5NA 2A1TS 3HBMA 4DTIA 1NDHA 4PG4A 5L51A 1HTTA 3KLNA 5FTJA 3LUAA 4AIIA 3OO1A 1E4VA 1BG6A 4G0NA 1Y7IA 2XRYA 3L6EA 3T06B 2IIPA 5EHQA 1XXLA 1LPOA 3PUWA 2DWQA 3ZZ1A 2IUEA 4JXKA 3GVHA 1I6LA 4RHEA 4P38A 1JAIA 1U8EA 3CWZA 3EDMA 1FNCA 3ZW9A 4D8XA 3OOWA 2VYQA 1N1EA 1SVKA 1GG5A 4MV4A 1PBNA 2C4UA 4IVPA 2AMVA 2GBLC 3F97A 5DW3A 5A7FA 1XD9A 3L46A 4YALA 3ZVKA 5FLKA 1RCFA 1KP3A 3NIWA 4MQBA 4TZ0A 2Q7XA 4ZD6A 1MVLA 2RAFA 4YP0A 2XT9A 6REQB 5K0FA 5IDYA 1WUYA 1EA5A 4ZP1A 4EA8A 4R68A 4IY1A 1TK3A 4ZN6A 4YRSA 1LS1A 3ICWA 2AIRA 4PS1A 3UKJA 1RI2A 3LRTA 3PFFA 4TL6A 1EDEA 4CR6A 5BW5A 1OCEA 3GJSA 4OHVA 4ZC8A 4D8WA 4D82A 1RZ3A 5AK6A 1R8JA 2XAAA 1GD1O 5A4IS 1YOBA 4PYJA 3QF4B 1D4ZA 1UFRA 2ZIAA 2WQ7A 2G0NA 3T5CA 2JRLA 1DOHA 3KE8A 3AUUA 4A2QA 3KJXA 2RCYA 4YV7A 1J9ZA 1N0WA 3PZBA 1FJ2A 4WH0A 1ZU4A 3NHMA 4DY4A 2MHCA 3ACCA 3AM4A 3N87A 5F2NA 1UDRA 2I9PA 2VRBA 3BJIC 3CM0A 3FSEA 1Y7TA 3O8DA 1Y81A 1LPSA 1RSZA 2QPAA 5EZYB 3U13A 3N2GA 3RHTA 5FAKA 3K1JA 4HATA 1PR5A 3NVKI 4Q3AA 1T8SA 4TMYA 3DXZA 4LZNA 3ICCA 5ALRA 1R6TA 3P71T 3U9LA 2V59A 1AVTA 4RMJA 2G9RA 4A8JB 4E5UA 1ZINA 2IHZA 2WE8A 4RA6B 4RD1A 2OP1A 2NOAA 3DV9A 5U4QA 3SJZA 4IGAA 3HB4X 4ND1A 1Z13A 1YZGA 4DBLC 1CLUA 4K0KB 3AESB 3WJ2A 2JA2A 1M1UA 4MVWA 3SN6A 2YJTD 3VR6H 2C3UA 4F4DA 5IWAB 1X7XA 2R8RA 3DTVA 1QCDA 3TUIC 4CTOA 3DL0A 3HR7A 5LYJB 4R2XA 2FSFA 5F4BA 2P75A 3GXBA 4L51A 4KG7A 4L9SA 3NBYC 3TQOA 2D1SA 5GTDA 2C95A 4HWRA 5F77A 2P9YA 2WSSA 3QVTA 3RUFA 1H3EA 2R25B 1XVAA 5ECDA 2IZ5A 4JU8A 4PXSA 3G0GA 1WPXA 1Y1RA 2CWDA 1WVGA 4HH4A 3W9SA 3PUHA 2V7XA 3AGPA 5KQRA 4RVHA 5KYXB 3ET5A 3V5NA 1G41A 2EFHB 4X63A 3PL1A 4GDMA 3QLJA 1KL7A 3OPYB 3QFFA 1J06A 3QP9A 4FGKA 3DEKA 2XCRB 2C2OA 2Q5HA 3DCJA 1KH3A 4TSKA 2DPLA 1I3LA 1L3IA 1YKFA 2QVZX 4X60A 1KSFX 3DZGA 2HRZA 3HCOA 4G4JA 1W2HA 3IKMB 2D59A 3OUZA 4WPGA 5T67A 3DGFC 2BHRA 2NAPA 5CIYA 3T4XA 1TT5A 4ACBA 4MI9A 3EIEA 4RS3A 4DUPA 1XD2A 4GU5A 4R54A 2B1JA 5F64A 3SEQA 3ZDFA 1O97C 3UMFA 3K70C 3O0TA 2IXFA 1P9RA 2P3SA 3I9V1 3PSHA 1NA5A 4XYEA 1P2UA 2R6R1 1RLIA 2BP7A 2QYHA 3GU3A 5CYPA 5F1OA 4D3ZA 4DWVA 4GI2A 5KTYA 4HUJA 4AJ4A 4EPWA 2R6FA 5JASA 2EFCB 2J0UB 3B36A 3PRYA 3HFGA 3HZHA 4YI3A 5KSPA 2XODA 1WD5A 3U7QB 3FOEC 2DPMA 3HRHA 3F5MA 1R0CA 5TEWA 3P9NA 1J2EA 2BZGA 4Q6WA 5AR1A 2CXQA 1ZH4A 5B7GA 1Z8NA 3DPUA 5EFZA 2QI9F 1HF3A 3ISTA 4YQZA 1N2HA 3SBDA 3ZNPA 4C30A 4TM8A 5H3LA 1K3TA 2CFCA 2O4UX 3JQGA 5KNCH 3EPLA 4XH9B 3RTGA 1TVMA 3PUVA 3CKLA 4J75A 2GN4A 4OQYA 2VRCA 3W79A 2BF4A 4N5MA 2ILTA 1ZOIA 3OZGA 4H1HA 3GLFE 5G3ZA 5ADWA 1K27A 2PD3A 2W11A 4FSXA 3NLLA 1SU7A 3VAYA 5JNUA 2O8EA 4P4UA 2E18A 2C59A 3ANXA 3EJ6A 3KKPA 5E9AA 2P5UA 2FPPB 5AHRA 2ZDHA 3LP5A 1IU9A 4YRGA 5A1JA 2JGMA 3A6ZA 5B3AA 2HCTA 4WMLA 4MKHA 4V39A 3TVDA 1RXWA 3RTDA 1EUCB 4Q1VA 4LDNA 5DH9A 4P53A 1UC5B 3ED5A 2HQRA 4H7IA 2Z9BA 1T36B 3D6TB 3ESAA 3Q3JB 3V55A 4YMUA 621PA 2OKCA 3RVQA 4X1YB 1FDUA 1PR9A 2R2AA 3HFSA 3N8IA 1H8HD 2ZDQA 4ARUA 3VISA 2YZGA 1L3CA 1E62A 1TW3A 4WIAA 4C1NA 4D1YA 5COAA 4PZZA 1S01A 3C3JA 3CH4B 3DDCA 2HIGA 2WAXA 4F11A 5AXCA 2F1OA 3DBHA 5IEBA 2PJDA 2VAPA 3K15A 2OCDA 3LYHA 1MV8A 4N8EA 4M6WA 5I5EA 1XZJA 3H9UA 1KEPA 1BGXT 2XZPA 1AS0A 1E2MA 3L1UA 4PQGA 4WCVA 3TSOA 2VA9A 1Q11A 4FONA 2I7XA 2EZ9A 1G21A 4YT4A 2XKAA 1NVWQ 3R7NA 3WK6A 4E3ZA 4JXZA 1QIKA 3L0CA 4AG6A 2NACA 1U3DA 1JQJC 1BFDA 1E0SA 1UK8A 3PICA 4Y8VA 4BVAA 1PYOA 2H4XA 3GDWA 1NI3A 1EAYA 4PRYA 4EFMA 1JYEA 1PJRA 1CJKC 3P9YA 5C81A 2NGRA 2JDID 4WZBB 4Z7NB 1OT5A 2IXAA 1L9XA 2QQEA 4ND4A 1V4VA 2GK4A 3K0KA 3QI2A 5HIIA 4B4WA 2DQYA 1JFLA 3P32A 1EWQA 2PL3A 2ODBA 2G6TA 4W7IA 1JG1A 4JR1A 2H2WA 4PZ9A 3CB4A 1W25A 1UM9B 5DLDA 4NYIQ 4EG7A 3ZE1B 1T3ZA 4PQEA 5JS6A 2PPLA 2GFQA 4YRZA 3O9MA 3BHJA 3KK0A 4E2FA 1FRFS 2KQUA 3K09A 2Y99A 4ZVLA 2FWPA 2BFDA 1I1OA 1THMA 2QPTA 2WFLA 1JDJA 4NU6A 2HU7A 3DM5A 4AN4A 3RUCA 4DHWA 3G2MA 2E0IA 2RHHA 3P4XA 1D3AA 3F8WA 4IMRA 3WHPA 2B3DA 4XE5A 3JD1A 3RS2A 4MR9B 4Y0VA 2OT3B 1WB9A 2QP9X 3MPOA 4J03A 4IBOA 4BFLA 2FJ0A 5FNVA 4ZTZB 4JMPA 1E79D 1C30A 2YYAA 1XL1A 3JD4A 3FCCA 2Z6QA 1UJNA 2PKXA 4KV9A 5SZKB 1UJMA 4WLVA 1T10A 2DUJA 1E3JA 3TB4A 5AJYA 3HB9A 2PH5A 2W2MA 3F6RA 4MIEA 2IGTA 3WIOA 4NJMB 4DQVA 1RWXA 5KNDH 1YRQA 4K7JA 1YZNA 4UQOA 3ZDZB 1PJCA 2O8BA 4NC9A 5LSAA 4PYIA 3IXQA 3F2VA 3IVCA 2XVAA 3UCEA 5JC8A 3AONB 4UQLA 1FSFA 1DO2A 1PNQA 3Q7RA 3SLGA 4MRMB 5EESA 3PXEA 4KR9A 3LPLA 1Z6GA 4N3CA 3CCFA 2IYSA 3LQQA 1E1MA 4MLCA 4B85A 1PR1A 4NE9A 3D6VA 1Q91A 3GW8A 3OE1A 1YKGA 2QL6A 2ZANA 2G17A 4P31A 4H6PA 4II3A 4ZRNA 2Y0EA 4J29A 1JEJA 3GLQA 3JTMA 3PFNA 2R3SA 4KIJA 5BWMA 3OZVA 4Z1MD 4WY8A 1JLKA 1WQ4A 3BFKA 3ITKA 4XUDA 3OJEA 3FWPA 3OQ1A 4ALJA 4ETWA 4A15A 1ORIA 1H3FA 2ID8A 2V6IA 3IESA 2GTIA 3CJQA 3KZXA 2X8LA 2VBGA 1P0PA 3GCDA 3PPWA 3FCOA 5CH5A 5KWVA 3L8FA 2WP8J 3NDBB 3LQYA 3MS2A 1W47A 4WZBA 1P1BA 4OLJA 1ID8A 4UTXA 2Q2VA 1FTWA 2AUMA 3ILSA 3WB9A 4ZTUB 2NO4A 5JDCA 4IJ6A 3RIMA 3C24A 2HPAA 5FBHA 4OQEA 1MX1A 2PVCA 4EY7A 1NVGA 4ZAVA 2VEOA 3AXSA 4L75A 1QV9A 1DXOA 2JHPA 1CD5A 1BQ4A 4HBGA 3I92A 4FYYA 4CTMA 3QTTA 2O20A 4GL4A 4XDHA 1DTEA 3RYCB 2G40A 1IJBA 1C41A 1WE2A 4M89A 3WJ1A 4DIDA 2OXRA 1AKMA 4P84A 4QTTB 3R7LA 2I29A 3DTVB 3TQSA 1NBAA 3WYNA 2Y0DA 3MTGA 3QBJA 3SVTA 3WLOA 3PQ3A 2GK7A 4G0VA 4X45A 1K3UB 2GILA 3MT7A 2POQX 1PGNA 4OHXA 1RPJA 2WHQA 1U2DC 3EIXA 1U0TA 4D6YA 1NXQA 3P2IA 4UEOA 2O2EA 1N33B 1T5IA 3HABA 3A28A 5DTJA 2YWGA 4PSKA 3WL6A 1EH5A 3ZU6A 4BLQA 1NUTA 2E82A 4IQ8A 2QS9A 1AKQA 1M8PA 2IFTA 2JIRA 2OHFA 1ZZGA 4PX5A 3U0BA 5EHXA 1XLUA 2OK7A 4EY6A 2XCIA 4HQFA 1QP0A 2GTPA 1G63A 2E4WA 5EIWA 1XLVA 2WSLA 2Z4RA 3ELWA 4S1PA 3I2HA 2WUWE 1WXFA 4KFUA 3ROEA 4K9QA 2ZPTX 3LLCA 4C0XA 4FYJA 1GEGA 4RIHA 1MVOA 4V0ME 5EJ5A 2EERA 1HORA 1PJQA 3DAFA 3L0YA 2O6HA 3IHWA 4R84A 2IT1A 4R31A 2C4WA 1QK5A 1ACMA 3X2FA 2IEGA 3PYLA 4B34A 1U11A 2Q2QA 1G2QA 1G6Q1 4LXUA 1UEIA 4CFSA 5CFQA 1N2OA 2DFLA 3PIIA 3N0TA 2W6OA 5DGDA 4BLTA 5L53A 4D0RA 1Z2OX 4QVIA 1JWBB 4EJMA 2FW1A 2B34A 4GT1A 3H87A 1JHVA 1AQIA 3QUBA 1GFZA 3HYTA 4TTQA 4E70A 1ZCFA 4GPEA 2QN6A 3RU7A 2H7VA 1Y80A 4C20A 5GZ1A 4H6VA 1YFKA 1TQ6A 4CQNA 4QULA 1EK0A 1HL3A 3DE7X 3I2IA 2FZVA 2NSJA 4M0EA 4ON9A 1MG5A 2ZE5A 4LMBA 3CQ9A 4N0MA 5TGZA 1Z4MA 2R8XA 4S05A 2YXDA 5IUJC 4JQCA 3IERA 5KNCA 3HI6A 2ZRCA 4KLZA 1M2JA 1SD2A 1T1EA 4YRJA 4OPMA 4D42A 1IRXA 5JS7A 4RMNA 1SCJA 1CRPA 2IYQA 2YHAA 4Z99A 4LDQA 4BFXA 1CG6A 3EBLA 3AR7A 2NZVG 2POCA 2YDYA 1P33A 2NO7A 2Q9AA 2QI9C 3K9WA 4XDZA 3TSZA 3A9CA 1YCHA 2CJPA 3AB7A 3M6VA 5CA0F 2PJZA 2YXBA 2QG9A 2WWWA 1XCOA 1ZUIA 1NKTA 2HU8A 2IYRA 1C1DB 2P9HA 1LQ2A 1MH1A 1P61B 2B25A 2OZKA 2YV3A 2OGUA 4F96A 1P6UA 3LG2A 3LGXA 2JGJA 2O48X 3WZMA 3K8YA 4MI6A 1ZDMA 3IBGA 4P4TA 3R3VA 5A3SA 1W5BA 5EL0A 1YIAA 3CW8X 3MF4A 3MRXA 3O2SB 3RHSA 1QHNA 3HN2A 2C8JA 2PZBA 5BOSA 2XTNA 3L5KA 3LDHA 3CS3A 3NXKA 3TR0A 3ZLJA 4O2BA 1H0RA 3CE6A 5A1TA 1S2IA 4LC0A 3UKDA 1X38A 5EGNA 5D6OA 1T5HX 1VRWA 1XK7A 4H31A 4FEEA 5LBUA 1KYWA 2G36A 2WW8A 1REQA 1Z06A 3D2LA 3SSMA 3F47A 4EB6A 3THXA 1E77A 4UHKA 4W6ZA 5JAPA 1U2RA 2QRLA 3LDUA 4YT5A 1ZK2A 2B83A 5BWCA 1AHHA 1KNQA 4NBUA 2YV2A 2Z4TA 3UWMA 1A3CA 1D1PA 1N2XA 1E9CA 4G9BA 4L4ZA 3VAAA 1WSAA 2IWRA 3LRXA 4RZHA 2WFZA 1CHNA 2H5JA 4ZVQA 4LRSB 3M6LA 4E5VA 5HRUA 1KIFA 3DT8A 2WWHA 1LQUA 2IH2A 4KQIA 4L16A 4UCWA 1KERA 1P60A 4HGPA 5CU7A 3CZ9A 1ZW1A 1USWA 3KXIA 1P4RA 3R6WA 1ISSA 3BEOA 1W4RA 5JDCC 1Y8ZA 2ZJ5A 2WOJA 2VQSA 2HZ7A 2ZYGA 4IPTA 5LBIA 3O84A 4B8WA 1BS1A 2A0YA 2PCJA 4W1RA 5JPIA 4DDHA 5HKBA 3FCAA 3PKZA 1PZXA 3AUAA 4HUQA 3ULKA 4EA6A 4JI4B 1N1MA 1OBCA 1IUOA 1JU9A 3JY6A 1TF2A 3MIZA 3ECAA 2DJIA 4MGKR 3O2JA 4KLRA 5A3QA 3RRNA 1LEHA 4DDMA 4M8SA 4M98A 4F2PA 4LW8A 1VCNA 1NRJB 4WXMA 3TW8B 1RAAA 4RNCA 4B0PA 2JCXA 1MGOA 2ZIWB 3GF4A 1NSYA 2FR1A 3KYDA 1L5KA 5FP0A 4JLMA 1R12A 3W5AA 3AETA 2YOHA 4A27A 1PT6A 1NL3A 1U0FA 2GHIA 2BGTA 3IUEA 2GEDA 2YV1A 3NBKA 4BIMA 2IC5A 2DAPA 1JG2A 1NI4B 4LYEA 1GRVA 5KQGA 1BMFA 1DFIA 2VQ3A 2ZJ6A 3WOHA 5A4MS 5K7SA 4LRXA 2EX1A 2IHJA 5H0IA 2B4AA 3ZHUA 4JL5A 1H1DA 4OGGA 3CJTA 4EHFA 1EXWA 4AAYA 1N8NA 1QH0A 4DFDA 3PC8C 1GARA 3EVFA 4H1TA 5G02A 1QGAA 2I2DA 3DL7A 1NBIA 3H5VA 4DREA 3AR3A 1JI3A 5K20A 1OTHA 2IZ1A 4F8EA 5DHUA 1ZEMA 2V74B 2E4ZA 1ABBA 1ZIPA 3NWEA 4IIHA 4P7FA 3TMAA 4D2IA 4OGWA 3GPCA 2F48A 4ITRC 3FUCA 2RIRA 4X3OA 5FD8A 2VT6A 3W5VA 3HDJA 4IGKA 5C5DA 4O33A 1IIRA 2QD3A 2VHZA 3N7AA 4GE3A 1LVGA 3U3OA 4IJWA 4C4ZA 4JJZA 4N6NA 2E4VA 1CY0A 1EVQA 5FHQA 1NQ5A 4RFSA 3S2EA 4CE6A 5JCZA 4KPGA 5KJ1A 4UUMA 2BFAA 3HVRA 3T3DA 3LYAA 2WSYB 1MCZA 2O2JA 5HM8A 2NZXA 5BYKA 3F5DA 1YMVA 2PL5A 5FLXA 1N2CB 4BVLA 3OTGA 1Z6XA 3AFMA 3K09C 4W82A 3ZV3A 2JI7A 4NPCA 3UB2A 4HTFA 3LL7A 4OOEA 3V80A 1YZUA 4MV6A 3ZNOA 1L8OA 4AP6A 4JGIA 1CIPA 2MYTA 3KEMA 4D92A 4XJXA 3CU5A 3F8TA 3KPVA 3GDOA 3RVMA 5EP3A 4Q1DA 1T1IA 3T8YA 1Z6QA 4QZVA 4U7HA 3MWKA 4YYEA 4CV3A 4DBZA 5ITZB 2I62A 2CJWB 3GRFA 1JWAB 1CE8A 5TC4A 4OXNA 3PQDA 1IN8A 2GZAA 4TQ9A 1P7VA 2IHTA 3WIBA 2IP2A 1Z3IX 4C4PA 4TSRA 3ODPA 2RHCA 1V45E 5DEIA 3Q8LA 5F9MA 2AFIE 3WB1A 4I1SA 4L02A 3MUFA 4D3SA 2WWFA 2OB2A 5HJEA 4X24A 1BFKA 4NBLA 2FCAA 5BQPA 1Y63A 4KBFA 4ENPA 4FGSA 3TZLA 1MHPA 1QHEA 2VTVA 4HRAA 2P8JA 3BFXA 3CLHA 3LBYA 2QRKA 4KOAA 1WTAA 3LLMA 5A5EA 1JZSA 3D8SA 4ILEA 4MWBA 1FS6A 2P9TA 4WDRA 4EL0A 1R2QA 1PW7A 4QXQA 2H92A 2B98A 3PB3A 1NJGA 2RDMA 3FPAA 4DIOA 1XXHB 3E27A 2C0PA 3QMPA 4CL2A 3S1SA 1IXZA 2WU8A 3ESDA 3KDAA 3EFOB 4Q3LA 4YAWA 5IANA 3RUHA 3AV3A 5CVUA 3HXPA 4C7JA 3HRKA 4UNQA 5ICMA 1G8YA 1UOOA 4LWQA 4DA7A 1KQNA 5JISA 1S2DA 2PZEA 4Q3DA 3ZE0B 2BPOA 4YV2A 2NUBA 3U7JA 4DEYA 1Y1SA 3FMFA 5HJ2A 2YZ2A 3LBFA 1G59A 1ZJJA 2VWGA 2GF0A 4UD2A 4LYAA 1XQWA 1LRLA 5KYVA 3VHRA 1RVV1 4B6PA 3B1VA 4I5FA 5LP6C 4G0MA 1JTEA 3BFJA 3HCRA 4MW0A 1ATZA 5CLQA 1BJKA 1OPRA 2PHZA 2HA5A 3K2IA 2PEYA 5HM6A 1KFJB 3CZQA 1EMDA 3FWHA 5K03A 2P9JA 1K5HA 3PFGA 4D4MA 4ERXA 4UE3S 1R0ZA 3NC4A 4TL7A 3H2IA 5DHPA 4GYYA 2AMLA 3ZQ4A 1E3MA 3UGQA 4L3WA 1Z38A 3AFNA 3QXHA 1JQKA 4WRRA 3RLFA 3T0IA 4O4LB 1GZ6A 3K9FC 1SUBA 1L7MA 2BDTA 2RCNA 3Q5DA 5IAKA 1BW9A 5KO2A 2IIBA 1DGQA 2SCUA 1IY8A 3D0RA 1UAYA 1QNFA 1VE1A 1XEWY 5K3AA 4TKUB 1B0AA 1R8QA 4CODB 2YV5A 5LMCA 4YMHA 2ASVA 3QEBZ 2FEOA 1X9GA 3N3AC 3SC2B 5CFOA 5I8ZA 3K8OE 2IXBA 3U9TA 1PLLA 2VEDA 5BQFA 1C7QA 1FYXA 2AN4A 3GCZA 3L7BA 4D25A 2OGWA 2GWRA 2HN9A 3ELDA 3ECSA 4MLZA 4HRXA 4WOCA 3W3ZB 2V6FA 3D6NB 3OCYA 3BTSA 2C42A 3P2JA 2JLZA 1VGVA 3ACBA 2WMOB 2VUHB 4PGFA 821PA 2QNIA 3TGLA 1E9BA 4Z5XA 1NG9A 3DMTA 1GHTA 2DFTA 4HNTA 3D6HA 1V9LA 1YXMA 2DULA 4IDQA 2O1EA 4W9MC 4ITUA 1YQEA 3V1MA 4D5GA 3CLUC 1SQ6A 2N3ZA 2Z95A 4ZOEA 4ADSG 3E6AA 4EENA 2ES4A 3ER8A 4DJFC 2SKCA 3H9CA 2WMYA 2JFOA 1M9NA 1Z0SA 1C3OA 1TADA 3CEAA 1HDGO 1WVIA 4M86A 5T3UA 3PIRA 4AY2A 2I67A 5F7JA 4MAMA 5DP1A 1JDBC 2VZLA 1QQAA 3DVLA 3NAQA 2BMDA 1QDUA 4MWEA 4YBRA 4WE3A 3JVDA 3P9KA 5GADl 3GAAA 4PEVA 2BM9A 2ZJ8A 1R0WA 6AT1A 4DCJA 4HT3B 1H2BA 4I0WB 4QARA 4EHNA 1TQ2A 2GXAA 2WZQA 1QHHA 1VBKA 4EVRA 2X0JA 1NDQA 4BX2A 4NZZA 1FC0A 1W2GA 4R1NA 2EW2A 3HSSA 4LVNA 4OJKA 4RY2A 3UXEA 4CNBA 5EZSA 4RTQA 3CXRA 3GLSA 4EFNA 4KDFA 1S8FA 3A1UA 3G13A 3HNPA 3KTAA 4PG6A 4DZZA 1M54A 3E9YA 4JT2A 4K40A 1S0UA 4Q7JB 4CKWA 1DU4A 2OBNA 1Q1AA 2A35A 5FQNA 3HM9A 2YJ4A 2YWBA 4LQLA 3GLGB 3NHPA 2ZRIA 1LBQA 5EWLA 4TT3A 3MN1A 2CDAA 3UAGA 5DT9A 3OX1A 1JN0A 3RJ5A 4GBMA 2N0SA 5TGTA 3WQRA 1I2ZA 2C94A 4IX1A 4O4JB 2P2LA 2FHSA 3AFGA 5HILA 5EZYA 4TXMA 2YVLA 1UBEA 4TV9A 3VNUA 4OAQA 5J1SB 2WD8A 4YROA 5EKSA 1I0LA 1D6JA 3VNAA 1Y9DA 4KAJA 1ZO8A 4XARA 8LDHA 1IQRA 4R7GA 1JX6A 3RSFA 5LQSA 1D7AA 1FFHA 4D8UA 4CMCA 3K0AA 4BO2A 3U61B 2XJ9A 4EGFA 2F67A 3R8CA 3KQPA 1QGDA 4M0KA 4TROA 4DS3A 4GMXA 4YRIA 3DMFA 2GPJA 3O8CA 4HYQA 1WEKA 2D1QA 4BV8A 4MRVA 4QEDA 4X84A 3ZCUA 1T91A 2Y2VA 4MI1A 4G5YA 2J7PD 4K0RA 4BU1A 4V24A 2WYUA 2FX2A 5E6RA 3IR5A 1HMPA 1Y34E 5FOVA 4XYGA 4B76A 2H2FA 5KX5A 5C4GB 1CUBA 3KQMA 5C2JB 3QQPA 5A2QA 4P58A 2HQSA 3A6PC 5C1DA 1IB0A 1TM3E 1RQGA 1SAYA 4J9UE 4PG5A 4XIGS 3A1WA 5EJ8A 2RFLA 3SIRA 4G9GA 4ND8B 1SZJG 4PZDA 4RMHA 3AUXA 3NOOA 2DF8A 1U4SA 4MKZA 1M1XB 3CR7A 2J5XA 3AY6A 5H5JA 4NOLA 4F5ZA 4B2YA 4Y18A 1XTVA 3OUUA 1FS5A 4B32A 1F3LA 3ZDBA 1XFAA 3SC3A 4Y2JA 3PDHA 4GRAA 3TGPA 2FETA 3C7TA 3ND8A 4BMOB 4IWYA 1T5DX 3QBDA 1GL9B 3MWFA 9ATCA 5DBFA 5ALGA 5CXSA 4MKXA 1ACJA 4I4TF 1K5PA 1XG5A 3EFHA 3E18A 1U0SY 3K96A 5MN5A 1C1XA 1Z4JA 3OZRA 4V0OA 4N65A 4F3TA 3O4JA 3WTBA 2QUJA 1OU4A 1TZMA 1NJ6A 1V1JA 1U2GA 2FP3A 4JMLA 1E2BA 4GRDA 5SY4A 4KFCA 5B4UA 1NF3A 3M6XA 2CFOA 2XUQA 2ZGVA 1TYAE 3DYBA 5H70A 3QU7A 2J09A 3DZBA 4P3PA 4RFVA 3JRXA 1EZ4A 3FUXA 4MJLA 5ALQA 1AOXA 3S5JA 2ZWOA 4OYLA 2VHVA 3KKQA 4LV8B 5AI6A 3GLFB 2Q4RA 4LOLA 3KSDO 3LW8A 4AJIA 1S8OA 2VA8A 3WGYA 3P9QA 4BP3A 4G37A 2B9EA 2Y3IA 4MVJF 3U4CA 2EU8A 1EGVB 2GQ0A 1BD3A 1OWNA 1D09A 1HM5A 1UPBA 5AVKA 5TQ2B 2WIFA 3D4NA 1RQ7A 4B87A 2WKPA 3PUZA 1JZQA 5FH9A 2FPSA 2Y0CA 1IJFA 1STOA 4JX8A 3TI7A 4RZUA 4BMYA 2PD4A 3G0DA 5JQWA 1XUOA 1IE3A 3OP4A 4W9NC 5CM9C 2O8VA 1RKBA 2QP3A 3A0RB 3HLYA 3G2HA 1UM8A 5L7WA 4UHHA 3N6XA 4HQKA 1A9SA 4TS4A 2XECA 1XR3A 2QX6A 3COPA 3EGVA 2ZE8A 1P4GA 5DI9A 5HW0A 3ZIUA 2OVFA 3I34X 1DUIA 3PNKA 3BKXA 5JO0A 1C3OB 5DTIA 2OCGA 3AJRA 2GERA 5JQGB 3HHEA 2AZ4A 4K6MA 5ITSA 1Q57A 4DLSA 3G0OA 1OAAA 4P82A 2DP4E 3IEPA 1RHUA 1UXHA 3C87A 4OMUA 4LRQA 4E30A 1E7SA 2P9GA 1J8QA 1V16A 2VT7A 1JR2A 1WXWA 1KK1A 1V6AA 3DZDA 1LSJA 4MO9A 4NZOA 1CEEA 1P4HA 5KOJB 4BZWA 4K9LA 4G81A 2GHRA 4CM3A 5BURA 5AI8A 1KQGA 1Z6PA 3HCFA 2X76A 4J1TC 1E7YA 2JLRA 3KP1A 1RAEA 4BN4A 3CN7A 3I28A 4Q03A 4BLPA 3O8BA 1WQ1R 1AA9A 4EEXA 2NADA 5D87A 2O5EA 3JVUA 2WVAA 4YMSA 3LPNA 1GR0A 5EE3A 3TIFA 3ZHTA 4YLYA 2R4TA 3KE9A 2DFKB 3FGNA 3NW9A 4PR0A 4JQZA 3TPFA 1PQPA 3V1TC 1OFUA 5GGYA 5JVDF 5HXAA 1QYVA 5T6BA 1N3LA 3KLOA 2DPXA 2H9YA 3U3XA 1IHOA 3W90A 4FHCA 4OKSA 2RHOA 4LMPA 5JH7A 2D7DA 3TBFA 1JXMA 1XA4A 3EEFA 1VPDA 3HH8A 3I6YA 3CONA 1Z2DA 4EQ6B 4U3JB 5EAIA 2VHQA 3UWKA 4FHFA 2Z9CA 1TUBA 3W4IA 2O8DB 2WQZA 3AKZA 2HBRA 2H1HA 4CMHA 5BT8A 1SVLA 3VZDA 2FMTA 3IR7A 2CHUA 5DGCA 4EX6A 5CIWA 5LP6F 1VLZA 2OXTA 3K1YA 4Z0NA 1BGVA 3MCTA 2R60A 2O6LA 2WG2A 2B36A 1S2GA 3NJRA 2QY6A 3P2KA 1Y7LA 3B7PA 2B4KA 5KU1A 3P0IA 4K9KA 1CUYA 5PNTA 3FIUA 1W0JA 5DRTA 4CF4A 4ZGWA 1PT5A 5FFMA 5KYXA 3BZWA 2LTAA 1DC5A 2QLTA 5HVNA 3QLTA 4H35A 2AQKA 4RVUA 3BICA 1KAQA 1GV0A 2BR5A 3CNEA 2EJTA 2XIQA 3GG9A 4G1FA 5TF0A 5C4IA 5TR9A 3ONVA 4CKYA 4HNAB 4AXXA 1FSGA 1A5TA 1IL0A 2HUPA 4IJKA 3AL3A 4QRHA 4M1YA 2X40A 2QRZA 2WJVA 1AQYA 2IYUA 4MUHA 1GUZA 1NIJA 3R3ZA 5FPHA 1AXRA 1IOVA 2WJ4A 2ZQYA 3OQBA 4KP7A 1OASA 1SA0B 3ZEAA 1BDHA 4LF9B 3U7HB 4IOMA 1XFDA 2GBCA 4TLCA 4DUGA 2PD6A 1YI8A 3QENA 5SYAA 4KCGA 3CIFA 3B70A 3BCSA 2WHYA 1V16B 2B8WA 4JDPA 3B9RA 3KL4A 1DBWA 5D51S 3UAVA 3R9IA 2V65A 1YJAA 3N5CA 3QM1A 1E32A 4MW1A 5H4GA 3FYUB 4LFBB 2NPIA 4KN9S 2ZE7A 3ABQB 1N0HA 2CLOB 4R1SA 1I6WA 4R8RA 3AR4A 1OR8A 1V3UA 2F4NA 3TZHA 1KDPA 3B6JA 3DE6X 4BLVA 1FPQA 2OUIA 3EF3A 5HFAA 1R5NA 3O90A 1K7CA 4GOJA 1E2DA 1V71A 4D6XA 3EEOA 2Z6AA 3MGAA 1JMYA 2Q1YA 3LC7O 2QV7A 2IVFA 2QA5A 5IYZA 4IRUB 3V34A 3L04A 2YW2A 2PUCA 3R1IA 2PWBA 1ZITA 1QKIA 4P4LA 3HEBA 1JF8A 1R37A 1P5FA 1EINA 1CP3A 1O5TA 3ZZUA 1JA9A 4V03A 1B6RA 4OGLA 1GYQA 2JIZD 2PUTA 5G4LA 3SX0A 5JXJA 2XA1A 3QE9Y 4EW2A 1FXSA 4ESEA 4BUJA 2HRCA 3BIJA 2RAPA 3HL4A 4DA8A 4S24A 1N6PA 2B0JA 4NMMA 3ZJ4A 5IXJA 3UMYA 2FLKA 2VPXA 5AW6A 4FYXA 2LIPA 5T8KC 4D9JA 3WKCA 2HU2A 5IWCA 5K3OA 1UIRA 3FAKA 4JA2A 3TM5A 5KCZA 2R1ZA 5BSKA 3IQFA 3UOGA 4DZTA 2PMFA 3HUUA 1Q1BA 2QB5A 4G8JA 4YASA 4JEHA 3QVLA 1Y3AA 1I3MA 1QU3A 2CNOA 4XLZA 3C6QA 3R5KA 5CUQA 4AC9A 2DETA 3WL5A 2JIMA 5BN4A 2ZWAA 4KITB 1ZIOA 3L1KA 2WHPA 1NTRA 4E5PA 2EGGA 3OWXA 3QHPA 1G3RA 2JIOA 4Q4LA 1UBSB 3SC2A 2HBYA 1ZYUA 3L05A 1QYDA 1W1UA 1UZNA 3TJZA 3AJAA 3LMKA 4BE7B 4ECAA 3Q1LA 1U8UA 1QP8A 4CG0A 3E9RA 2IUFA 5DRYA 5E0OA 3TG8A 1QGZA 4EJSA 3OX4A 4C14A 1WB6A 2P67A 3AHIA 4KGDA 1R4NB 4JITA 4DJJA 3DEZA 3GWZA 4WDQA 3LI2A 4LXYA 3VUEA 4U39A 3ORRA 4IDNA 1ZONA 4KXYA 1E60A 5ALWA 1VE9A 4CKCB 4PE5B 2FN3A 1C1XB 2C3OA 2A9PA 4E33A 1YBHA 1U65A 3D5QA 1LLCA 3ZI4A 5ALXA 2YWXA 2QOEA 2UAGA 3PS9A 1ST2A 3OTOB 2J0QA 5DGIA 1SC1A 2Z5VA 4MB6A 3ZNQA 5BWNA 2OKGA 4RK1A 2YICA 2Q21A 5JARA 4RMIA 3E0QA 4Z7JA 5LZ2A 2HNBA 2P7IA 2I65A 3MNFA 2X86A 3CBGA 4YUWA 1NBME 3BL6A 3Q6NA 5FNVB 1J23A 3IA2A 4HQOA 3W8EA 5IC6A 1G291 3ZCPA 4PZUA 5CEFA 4G63A 1R0XA 3LDFA 1KSJA 3IOYA 3P0JA 3LCUA 4WKPA 4DLAA 2V3WA 4RAOA 4C4YA 1N9KA 5TF4A 1TE2A 3NIFB 1RYBA 3SE0A 2C2HA 3SFZA 4MTLA 2I6TA 1PSDA 1IXRC 2IIVA 4HAWA 1HE5A 3ASYA 5B1DA 4TVSA 2J3JA 2PZJA 2UVPB 2NUPA 4J6EA 1R0LA 1U94A 3GGDA 4TMFA 2IPOA 2ICAA 2O4CA 2ODNA 3MGKA 2GPAA 3H86A 5K8UA 4RV4A 4C7MA 1V8ZA 4M6WB 1UPUA 2HHCA 4FPXA 3AUTA 4XTCS 1Q6YA 2XADA 3EMVA 4FT2A 4ZXPA 5TQ2A 4D98A 2KLBA 2P90A 3EBOA 1BXRA 3MCWA 1A97A 4DDWA 3SI7A 5AI5A 3QX3A 1PFVA 2D2FA 3C6XA 3FFXA 2Q9CA 4RMGA 4BBAA 4DCSA 4KSCA 4U2DA 1J7KA 2HK6A 3TTWA 2VDLB 1ZMRA 2E2WA 3WO1A 2GPSA 4M9SA 3H2GA 2ACVA 1KH1A 4FFPA 5BMVF 3K30A 3CBQA 1CZKA 3OBIA 5BYJA 2OILA 5THQA 1H69A 5FWYA 4R0VA 3I83A 1MPTA 1EFAA 4EJ2A 1IY9A 3NWPA 2WZBA 3WLPA 5KTPA 1SU6A 3QZUA 1G0NA 2XH8A 2YWDA 2HNKA 2ZUWA 4NAUA 5A04A 3Q2OA 4IXWA 3G2NA 3OE7A 3T0FA 4YR9A 1SBHA 2WF5A 4YUAA 1NC3A 1NI5A 4PZ0A 2DQKA 3MILA 4QRIA 1WHSA 1GTVA 1P4AA 1R0SA 3T4EA 1PZNA 1II0A 2A9OA 3B7GA 1CULC 3KSUA 3DTVD 2LZ0A 2AZXA 2HCBA 1T9KA 4YJ2B 1ML3A 3WLIA 4CLHA 1QDLB 3FCYA 3ZDYB 1QV7A 4CCYB 2J6BA 5DF1A 1WSDA 4ZCSA 3MPUA 4AD8A 1ZVMA 3V4ZA 5KJCA 1ENYA 3UENA 2SNIE 2WWXA 2CZQA 2XWQA 1UQTA 2OO5C 3LXUX 1J1UA 4E5YA 4V38A 5BMVA 1KEVA 2J9FB 2FH5B 2FPPA 2XUIA 3AEXA 3DDOA 3FKSA 3HN7A 3Q7TA 4JEIA 4C76A 1JEOA 4NYJR 5DK6A 4Z9BA 3ZV5A 3AVXA 2CLCX 1G7CA 2PGLA 5EP1A 2G09A 4YMLA 4DR4B 1W88B 4H7JA 3GOQA 4WKBA 4CRWB 2GK6A 1YK0A 2VXBA 2YZKA 3PT5A 1R0YA 1AQUA 5AI0A 4YUYA 2NSYA 2QT9A 3OAAA 1FFCA 1KIAA 3IO5A 4NNPA 2OHOA 4WL0A 4ZT4A 3FTDA 3EUEA 3NNNA 3F2IA 4DIBA 1CJCA 1O6ZA 1Q77A 3TJMA 2P78A 2VKQA 1W7AA 5G4KA 2BGKA 1QOQB 3NG1A 4HGNA 5BN4B 3NHAA 2DPYA 1FDTA 2AE1A 2Q9UA 1WZIA 4S2UA 1PVVA 1CUUA 2CDBA 3O82A 1WB4A 4RGYA 1TUEA 5CM2Z 2WINI 4D99A 2GLXA 4RF2A 5DT2A 4EITA 2FSVC 3CLSC 1XZPA 4MAFA 2GJ4A 1OH5A 3GFPA 1HG0A 2HR1A 4ZEXA 1N9GA 4INAA 4JT9A 5FTMA 3TSAA 3GVXA 2CV1A 3ONWA 2QZZA 1MHTA 1HH4A 3FVVA 1VHJA 2FUNB 1DJOA 1OLSA 2RARA 3WP1B 1EFRA 4XASA 3C70A 4O4IA 2W6ZA 3ZWKA 3OJCA 1YVUA 3I58A 1U5CA 3KZ1E 4LE0A 5H8WA 1UKBA 3T3HA 3A6DA 1O2DA 4QBGB 5EWJA 4KEAA 2ONJA 1XZKA 3TMKA 5B55A 3HJCA 3KB2A 4QJ5A 4B40A 5AVUA 5JZOA 1FZQA 4GOND 3I0MA 2I99A 5B30A 3S8EA 3H5AA 3HKBA 1CVIA 5JNWA 1TM5E 4KKXB 1FNNA 2GCOB 3LQ1A 3M1AA 4MS1B 4NYIR 3HB1A 3I2GA 4PGMA 1RZVA 1F7UA 2VXOA 3QVKA 2G0TA 4E4TA 4RNDB 1FX0B 3U16A 2O8FB 3D1LA 1MIOB 3AIMA 2PX5A 5GONB 1VJCA 3PJDA 1E9RA 2PUFA 3KOYA 2DEUA 2XGGA 3BWDD 2X41A 4FE7A 2WJHA 1VYVA 3KLPX 3H9EO 4A4DA 1N78A 3QOYA 1RRVA 1YQXA 1QCCA 1QGUB 4YCLA 3ONDA 4AZ0B 1PFQA 1NBEA 5AKHA 5ELMA 3JW8A 5FUXA 3I09A 2XE7A 1YE8A 3ZWYA 3S5UA 3LKBA 2EYQA 5AVSA 1PHRA 1VSTA 3G5LA 1AXGA 2Y6UA 2UVDA 3NP7A 3AEUA 5E2IA 4QQRA 4D56A 2PL9A 2YJ5A 2F3RA 2OZLB 2AXEA 4C89A 4LAFA 4JQOA 2IYOA 2D2EA 3HVUA 4HAIA 1ODTC 2MYPA 5K3EA 2EKBA 1L5VA 1NVFA 1ETUA 2J3DA 3FDFA 3NRJA 5E8RA 5ARCA 3V7FA 1TPYA 1TM2A 1EVEA 3H9QA 4WWHA 3ZK9A 4BVFA 3L0DA 4YT8A 3AG5A 1B73A 1G9XA 3KOUA 3PRJA 4YJFA 2ZYDA 4MA4A 1D1SA 4PGGA 2QN9A 3Q88A 4Q34A 5ALKA 1RLJA 5DSZA 5ALLA 1AQNA 3M6WA 2X6TA 4FIZA 2Z5LA 2ONKA 4C08A 1OILA 3N8DA 4EG4A 5IUKC 1H93A 4K9OA 4LOAA 3SHQA 4LQDA 3ABRB 4AX8A 2WSMA 3Q8KA 4QU9A 4H7FA 1JEYA 2CXOA 3HV2A 2NV6A 3GY0A 5C7IO 3DS8A 1TTPB 3IVAA 3R5FA 4DQKA 4WZBE 5B58T 3WE7A 1U7PA 1YTLA 1ABFA 2IS6A 2OHIA 1R8YA 3M9LA 1MFZA 2FW9A 4IO0A 5B3JA 5A4AA 3G7SA 1X2BA 4AY3A 3EOBI 4X6LA 5AJXA 1IBCA 1OZGA 2H11A 3LT5A 4JLUA 4ERNA 3PCTA 2EHDA 4Y1RA 4FIDA 4Q4DA 4MW9A 5EJ2A 3TQRA 3IVXA 1W1IA 2V54A 2Z09A 4Z2AA 1KQFA 2E4XA 1P7ZA 3OLWA 3RTAA 4KR0A 1M8KA 4UNSA 1ST3A 1M2HA 1H5QA 4URVR 2VAMA 2UYOA 1ZNXA 4OHBA 2X5JO 4KWEA 4CEIB 2ADMA 3T1VA 1T0PA 1RQRA 2AI1A 4HDNB 4URYR 5ILOA 2F3TA 2D0OB 4CIAA 2IUUA 3FOCA 4DA4A 1ODLA 2Q3MA 3E53A 3E1GA 3FRIA 3I32A 4X95A 3IOCA 3UXHA 1FFXB 3IMCA 4R01A 3VR2D 2PRKA 3WGHA 4G3XA 3L8CA 1C8VB 3BJZA 3DE0X 3NBAA 2WBLC 3G17A 3QELA 5EYPA 3DH0A 3H2SA 1MIOA 1XV5A 4GPZA 5TMEA 3RAPR 2YMQA 2ZJ3A 2ZIXB 4HXYA 3G8DA 4KPEC 1OLUA 2HCFA 3O9ZA 2FQ1A 3GUZA 4LDZA 3OT5A 4OL0A 2GEKA 3W2FA 4C06A 4LJ7A 1WIWA 2RG7A 5IKMA 2A8YA 1PJ8A 3AETB 4JCCA 3FMIA 3IDOA 4EFKA 2H8KA 3WRWA 2R7NA 2BBOA 2BMVA 2YMLA 1JVBA 2WF6A 4US1R 4YO7A 3ZEIA 1IZ8A 2B6HA 3AINA 2OHHA 3O8QB 2XQVA 2WE7A 1DS6A 1SU4A 1DZ3A 1LVUA 1Q7BA 1R4ZA 2A9RA 2J0VA 3I9MA 4WZ6A 1DRWA 3GX1A 5FXMA 1HX7A 4A16A 4BGVA 2YHUA 1DELA 5EA2A 3WLHA 3WGZA 3CX8A 3RUAA 3VNQA 5AFSA 3V2IA 3HC7A 2ZAMA 1V1MA 1YJ8A 3BGVA 1WY5A 3C43A 3EEBA 1OVGA 2EHJA 5CPBA 4YPOA 3KJZA 5DMHA 3TZ6A 1MRZA 2WK1A 1EVZA 3HJRA 4WLNA 4WNAB 2X8JB 4FLFA 4ZT5A 4A82A 5HKKA 5G1OA 3TQIA 4DILA 3FWZA 4R16A 2HPZA 3UH0A 2IXDA 3BERA 1ULBA 4XLTA 1ZSVA 3R7AA 3P26A 2QBYB 1TFRA 3QV2A 3HJAA 3DB1A 5G4KB 2ZR9A 3IO3A 1LC0A 4BMVA 4EGCB 4ARCA 1Y42X 3K6SB 3DLPX 4FFBB 2GH1A 4IM7A 1R50A 3W2TA 1SQFA 4RTRA 1GPUA 5MGNA 1ODFA 3D0KA 1YHYA 2JATA 3GA0A 1CUDA 4CCAA 1E3WB 4O2AB 1Z6YA 1OH6A 2XUOA 3L43A 1GPH1 2ZRFA 3UOWA 1GIAA 3UFXB 2CL5A 1BCRB 1LJUA 1VLLA 1WXDA 3ROGA 3G8CA 3RKUA 1K5GA 2K87A 3NYQA 4N4AA 5KNDA 2BKAA 2C07A 4F12A 4V0KA 5AI9A 5I3CA 5KB3A 4MEBA 1DZIA 5KVSA 1MF7A 4Z4IA 3X1KA 4TTTS 1S8NA 3WSVA 5IBRA 1XEFA 3GZTB 2VTEA 4BNTA 4Y98A 5DNEA 4NHOA 2CD9A 3SXPA 3GOHA 4KFRA 3CPEA 1BE0A 1CEYA 1TLTA 1H2WA 3RFFA 3GP8A 3F71A 3PDUA 4ZT7A 1SCIA 1O6GA 2JCSA 3BGSA 3QPDA 4MUEA 4YEDA 2IV3A 5BSGA 3G2QA 2V96A 3AY3A 3ZU2A 1AK1A 1PZFA 4JVLA 3I5UA 3KQVA 4NYMR 2VPZA 3WDKA 1IVSA 1CNMA 2ADOA 3HPRA 4CHTA 3PD1A 2P11A 2R1VB 1OWMA 3OICA 3O03A 1A9YA 1FOEB 3RVKA 5LZ8A 5IMSA 2GXUA 1EFVB 4P83A 4J4BA 4DADA 4L4UA 3BXOA 1CU1A 3D7RA 3DOHA 2DR0A 2OLJA 4RACA 1K0UA 1MQAA 1YS4A 4G86A 3SHFA 5DCLA 4ETMA 4A8PA 1C50A 1RCUA 4ZA2A 4IDPA 3BXGA 2AHOA 2OAEA 4FGUA 5CW2A 2O3UA 1U04A 1YMQA 1Y3HA 3HUDA 3MT9A 4CKEA 3T3PB 1IQUA 1HFKA 4DVJA 5T4HA 1JAHA 4DG5A 2XBMA 4GR9A 2C2ZA 3TEMA 5EGSA 1UH5A 4RTPA 1H5NA 1T2AA 1M5RA 1U1EA 2EJWA 3AVOA 1SUWA 1UFVA 2PKCA 2C31A 4AK9A 4BCDA 3D0QA 3CZ4A 4Q3BA 4RDXA 1UBOS 3GCXA 4INOA 4RENA 2WYIA 1BU5A 4O2RA 1V11A 4GR4A 4LSWA 3R77A 3RFTA 4JEMA 1YB6A 4EI8A 4EHKA 1J24A 3GNSA 5DISB 4YAKA 1OBVA 2XMRA 5EXSA 3RSLA 3ITDA 1KTVA 1W5SA 2VWQA 1MC4A 1YQGA 4FUTA 3U31A 4BY9E 3QEJA 4XUEA 2BT4A 2HIMA 3OOSA 1WG8A 4FS3A 4Z9FA 3JQBA 5BOSB 4UE6A 3KQHA 1DRKA 9MHTA 3CYFA 4LHSA 4GZLA 3SWWA 1DAFA 3WKAA 3GNQA 5JRDS 1KAEA 5B53A 2PGAA 3G8YA 2DY0A 3PKJA 1ICEA 1NW6A 1S9DA 4YQYA 4WCFC 5E6SB 4D9NA 5CA1A 1RHMA 4B75A 1XJQA 2WKQA 4JELA 4DT1A 1KY5A 1VRVA 3A9SA 4LQCA 4DSTA 5IM4F 2DY1A 1E4EB 2MSKA 4XYMA 3DFZA 2DWOA 2E48A 3RUEA 1YO6A 1TF7A 3ON5A 3EVDA 2EQBA 5F3WB 1QLHA 2C7OA 2X2PA 3KT6A 1VG9B 3PDJA 2PQ6A 2VH1A 2GTHA 2VSQA 16PKA 3V8QA 1QS0B 3IKLA 4MRAA 4HDSB 2DTEA 2GVDC 2W4MA 4C7OA 1G7SA 1A8SA 5I47A 4ZOLF 3ZGXA 2OZLA 3CR3C 4QDUA 1BE1A 4MV8A 3SS8A 5FPKA 2N1BA 1C3JA 1QSGA 3KLBA 2XOEA 4IJ5A 3QELB 5IN4A 1A8HA 1JHAA 4RKQA 1GFWA 4B3FX 2HF9A 4P8RA 1Y3FE 4FYHA 4M3NA 5E6RB 4BFZA 3RRMA 2W2LD 1U02A 3ZWVA 1SN7A 4XWOA 3SS9X 3RYTC 2BMWA 1RMQA 1DBSA 1CR0A 2VK1A 3BGOS 2H52A 4MUFA 3ENNA 2VDQB 3CISA 2VJPA 2HSEA 1T5SA 2PLNA 4JT4A 1CQJB 2ANBA 4RY0A 1SMKA 2NXEA 3DBLA 2J1LA 1ECBA 1EUYA 3LFTA 3M6MD 4DKJA 3KQKA 5CGZA 1P45A 1IQPA 1FX0A 2NLOA 5HPYB