1Q0ZA

Crystal structure of aclacinomycin methylesterase (rdmc) with bound product analogue, 10-decarboxymethylaclacinomycin a (dcma)
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
297
structure length
297
Chain Sequence
b'SERIVPSGDVELWSDDFGDPADPALLLVMGGNLSALGWPDEFARRLADGGLHVIRYDHRDTGRSTTRDFAAHPYGFGELAADAVAVLDGWGVDRAHVVGLSMGATITQVIALDHHDRLSSLTMLLGGGLDIDFDANIERVMRGEPTLDGLPGPQQPFLDALALMNQPAEGRAAEVAKRVSKWRILSGTGVPFDDAEYARWEERAIDHAGGVLAEPYAHYSLTLPPPSRAAELREVTVPTLVIQAEHDPIAPAPHGKHLAGLIPTARLAEIPGMGHALPSSVHGPLAEVILAHTRSAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords aclacinomycin methylesterase
publication title Crystal structure of aclacinomycin methylesterase with bound product analogues: implications for anthracycline recognition and mechanism.
pubmed doi rcsb
source organism Streptomyces purpurascens
molecule tags Hydrolase
total genus 105
structure length 297
sequence length 297
ec nomenclature ec 3.1.1.95: Aclacinomycin methylesterase.
pdb deposition date 2003-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1q0zA00
3A2LA 4UHDA 5AK5A 2HL6A 1DT5A 4B80A 1YA8A 4UUQA 5K3AA 1EX9A 3QM1A 5CRIA 5HZGA 4QLOA 5JALA 5EHQA 2OAGA 4QWMA 2BUCA 3H2IA 3S2ZA 1GPLA 1CUZA 4I3FA 1QGED 4W1PA 4AO8A 1QIKA 2ZJ7A 4JYPA 1CUAA 4C87A 4AX4A 4KEAA 4H7JA 5FDFA 1BN6A 2QUBA 5CH3A 5AKLA 4H7FA 1T2NA 1ODCA 4Y2TA 4IO0A 4G4IA 4N8SA 1WB5A 3IUMA 2ACKA 4GW3A 3MUNA 2JGJA 3WK6A 3QPDA 3D2AA 1F0PA 3O95A 5DLPA 2CBGA 3C6XA 1QIGA 3C5WP 1QO7A 3CN7A 2WG2A 5FUMA 4UHCA 4MWTA 3DCNA 4H7IA 4BYMA 4DSZA 1LBSA 1R1DA 2VJCA 5ALTA 1L7AA 1XLVA 3R3UA 2CKMA 1XLUA 5KWJA 3H18A 4F21A 2ZVDA 3WWCA 4X3CA 5EIHA 5I9IA 1G66A 5AI8A 1JMYA 4WY5A 5IVDA 1U4NA 3I2GA 5AKZA 3WWOA 3VJLA 1CLEA 2WIDA 3STWA 2QM0A 4UBOA 4Q34A 5ALXA 1ACLA 5DJ5A 2WJ4A 1WHTA 1U8EA 5AO9A 2OGTA 3K9BA 2JGIA 4DM7A 3ESAA 4DTCA 1UK7A 3F98A 3LP5A 4PSCA 4PW0A 4H0CA 2HA5A 3HACA 3R3WA 4Y2SA 4G4JA 3AILA 2RONA 1BS9A 3IIIA 1CUWA 4FFWA 4DGQA 5F4ZA 3PF8A 5LP1A 1XZJA 1XLWA 1MAAA 3I2HA 3FCYA 2HA2A 1YAJA 1UOPA 2QMQA 1LLFA 1JT2A 4PV7A 5CW2A 3P2MA 2DFPA 3DS8A 4LXHA 5AI4A 3F97A 2UZ0A 4DYHA 5AKKA 1AQLA 1CUUA 1EVEA 4BTLA 1IZ8A 2P8SA 3U1TA 1KEZA 3WKCA 1H2ZA 2ROQA 2GZRA 3WA7A 3WK4A 4FNMA 2YXPX 4GWLA 2XMRA 4WDQA 2PU7A 5AIAA 3I2KA 1UXOA 4X71A 2WJ3A 5E4TA 4E11A 5C8XA 5H3HA 4FBLA 1GKKA 1ZD2P 2PUHA 5ALEA 2I3DA 2I3ZA 1GPNA 2QS9A 2PU5A 4J0GA 2WIKA 5LKAA 1H2XA 1CIJA 2D0DA 3FBWA 3ICWA 1XRLA 1EXWA 1K63A 2QR5A 4YK7A 5ALIA 5HKAA 2ZYSA 3IUNA 3ANTA 4OD0A 4FMPA 1J07A 2QT9A 4AXBA 1IUOA 4FOLA 2HU7A 1WHSA 2OLEA 4CIAA 3AIKA 3W04A 1VE6A 1XROA 1J2EA 5AOCA 4J0HA 2K2QB 1XZCA 4KRXA 1R9NA 2BJHA 2HRQA 1GGVA 4H18A 3A2MA 4BE9A 5E2IA 5EI5A 1WM1A 3R3YA 5AM4A 3D0KA 2ZSIA 5AHXA 4ITVA 1WPRA 5CBKA 1CUYA 3V1KA 3RLIA 4DSAA 3H0CA 5CH8A 1CPYA 3GELA 4XWGA 5AKGA 2VT6A 1LPOA 1ODSA 2QZPA 5ALUA 2DR0A 2Y1KA 5LZ5A 2AJ8A 1N5MA 2OQIA 5AK6A 2OQVA 1MJ5A 2QTBA 4BCCA 4OB7A 5ALSA 4AB1A 2C0PA 1E8MA 3FSGA 2HA4A 1UT6A 2VAVA 1J06A 1CQZA 5DNWA 4U2CA 3G9UA 4PNZA 1CUFA 1OXMA 2XMQA 3R41A 4B0PA 3NGMA 1ZIXA 1Q0RA 5DYWA 1MPXA 3W9UA 4FLFA 2C0QA 1IZ7A 3O4HA 3ZLVA 4ROTA 1WB4A 3I1YA 3V1LA 2Y6VA 3G0CA 4MJ3A 3RM3A 1XZLA 1YR2A 3MUOA 4Q05A 2PL5A 1FSSA 1JJBA 2JGFA 1T4MA 2HRRA 5A62A 3VVMA 5JD6A 1SFRA 3HJUA 3X3HA 3D5EA 2XB6A 3IURA 2OAEA 4B6GA 4DNPA 3LLCA 1XFDA 2FJPA 5ISMA 3R3XA 4WDRA 3RARA 1SCKA 4XIIA 1E5TA 2WHQA 2XMDA 4ZREA 4KACA 2H7YA 2H7XA 1KU6A 5ALNA 1UKBA 5ALYA 3WIOA 5ALKA 3QPCA 1X70A 2HADA 4QEKA 4B84A 3WWEA 4QWWA 2XMBA 4KRYA 1EVQA 5KWIA 3A6ZA 2ZJ6A 1ZICA 1LZLA 3NUZA 4J0CA 2XMGA 2J4CA 4EHBA 1ZIYA 3HSSA 5HK8A 4Y2RA 1YA4A 1XZFA 1WOMA 2XMCA 1MX9A 1RWQA 2BGNA 3C87A 2HA6A 2PBLA 5CMLA 5A71A 5CT8A 4FHZA 3C8HA 4W1SA 3FYUA 5HF5A 5YASA 2IIVA 2Z3WA 3G9TA 2DQZA 5I7UA 4B9EA 1YB7A 3PDCA 1DQZA 2I78A 1P0PA 1SCQA 1TRHA 2J4FA 4C88A 1XKTA 4TGLA 1PFQA 3VXKA 3WJ1A 4X85A 2DCMA 1UOOA 1XRPA 1EK1A 3EQ9A 4U2DA 3STYA 1HLGA 2XUKA 4BC0A 3WLAA 1EDEA 4F60A 4G1FA 4X97A 4FFVA 5EGNA 1VJ5A 3ZWQA 3VJKA 1D07A 5BWCA 1XRRA 4HXGA 2Z5GA 4LKOA 3IULA 3WL7A 4EUSA 2GBGA 1MNAA 4FKBA 2ZSHA 4LHEA 4KJXA 3AFIA 3O0DA 4H7DA 1CUIA 4UBLA 3VDXA 2W22A 5ALVA 2PUJA 3DEAA 2W6CX 2JGEA 1MX5A 3O4GA 3LS2A 1VOTA 4BP8A 1JU4A 2JEZA 3HEAA 2DHDA 2WTMA 1VXRA 3L1IA 1CUJA 4NS4A 2YASA 1ODTC 4MYSA 1ORWA 1AZWA 2VJDA 4GECA 1A8SA 1GQRA 5LZ2A 1YAHA 4W1RA 3HZOA 1VXOA 4FNGA 5ALPA 4J0DA 2XUIA 1BROA 4AMYA 1TQHA 5JD4A 1YS1X 2IX9A 1QIMA 4D9JA 3C8DA 1GT6A 5T4HA 2XLCA 1CUXA 4RPCA 5AM0A 1A8UA 4X6XA 2GBCA 5JYCA 1LZKA 5JZ9A 4OCZA 3KXPA 1L7RA 2B61A 3WA6A 4EB0A 1BCSA 5ESRA 3WL6A 4UFNA 4UPDA 4X91A 4L0CA 4B9AA 2BUBA 5BWBA 4HVTA 4UBJA 3HABA 4Q1VA 3KWJA 3OOSA 3WWPA 1LPBB 4QDXA 1VZ3A 5JAHA 2B9VA 1XQVA 2G5PA 2C5FA 3C6YA 3EQ8A 4Y2UA 3AINA 4X93A 3T4UA 4WFIA 4X00A 5LLSA 1RP1A 4AMZA 1QFMA 3QMWA 5HF9A 3SC2A 2C58A 4A16A 3H04A 1H2YA 3QBJA 1W76A 4A5SA 4BVKA 2HA7A 1SC9A 4NZZA 5HF8A 3DYVA 4K6HA 4U2EA 3DL4A 2VF2A 2WUEA 2WFZA 1XZGA 3WQHA 2OCKA 4F0JA 2HA3A 4G4GA 3W05A 5HK9A 5D7BA 2QKYA 4G9GA 3STXA 2EEPA 1QIDA 5A7FA 1MTZA 3ESCA 1IMJA 2HM7A 2I03A 1A88A 5ALFA 4CG2A 4BTVA 4JH0A 3FYTA 2JF0A 5IKXA 4QE3A 1R50A 3OG9A 3PF9A 4N8EA 4EZIA 1CRLA 2ZYRA 4C01A 3BJRA 1EDBA 5LYYA 4UHHA 2E3JA 2V96A 2RHWA 3OPMA 1NU6A 5AIBA 4M0FA 4HAIA 1SOMA 3PUHA 2ES4A 5C8ZA 1ISPA 1CUBA 4RGYA 5I8PA 1VE7A 4A23A 5SYNA 2HHAA 5FXMA 4BZWA 5EIEA 1R9MA 2RAUA 3GUUA 3FLEA 4J03A 5FLKA 2FUKA 2BCEA 3BJMA 4QDZA 3WKDA 2Z8XA 2WIJA 5CH5A 5JADA 3DQZA 3TGLA 2XUAA 4MWSA 3V48A 2HDWA 2XQKA 1QIHA 1EH5A 2VJBA 2QJWA 3BF7A 2WG1A 4UHFA 3DJYA 4ARBA 5AM3A 5AH0A 4GEGA 5CT9A 1TCCA 2WLSA 2WU4A 3I6YA 3FSGD 5CXXA 1XZAA 4NMWA 2GBFA 2O2HA 2Y2UA 3FNBA 5CURA 3D7RA 1EDDA 3F67A 1VLQA 1ACJA 5AK4A 4ZXFA 5AKIA 1CEXA 4GLBA 2PVSA 4P93A 1DINA 3WK7A 3BXPA 1EB8A 3LIPA 1RYYA 4KE8A 5AI9A 2C7BA 3ESDA 1Q83A 1KU0A 2XUQA 3QMVA 4PF1A 4RNCA 2XUGA 1H2WA 4QA9A 2WJ6A 5E4YA 2XLBA 1C7IA 3C45A 4Q3OA 1CQWA 3OTQA 3N2ZB 2H1IA 4H7KA 3DD5A 1UWCA 2HIHA 1SCIA 3EF3A 2OXEA 3M83A 1XRMA 4IH4A 3WZMA 3PFBA 3H17A 3G9ZA 1MAHA 3MVEA 1UK6A 3H2KA 4V2IA 5AJHA 4ZV9A 3CCBA 2HFKA 1HL7A 1F6WA 1F0NA 1LPSA 3WYNA 2PSEA 5EFZA 1XZEA 3DNMA 1XKLA 2OCGA 3FYUB 1TCBA 2FX5A 3KWFA 4P08A 3O9VA 4AQDA 3RK4A 3ANSA 2Q0XA 1H23A 1QONA 3M3DA 2WFLB 5K5EA 1DQYA 1AX9A 1BEZA 3K6KA 1YB6A 2VT7A 4IH9A 5LKRA 2VQ6A 5DYTA 5CTAA 5HCUA 2HU5A 4M0EA 1PJAA 3AIOA 1BU8A 1CUEA 1ZGBA 5DWDA 5EIAA 1CUVA 2NW6A 5BOVA 4G8DA 3OM8A 2XUPA 4BDTA 5KBYA 3STVA 5D6OA 2VSQA 5AI6A 3DYIA 5IVKA 1YASA 4DLNA 4MEBA 3BF8A 1UK8A 1I6WA 1R4ZA 2PM8A 3I2JA 3FVTA 4EBBA 3BIWA 1Z68A 4C89A 4MYDA 2RI6A 5CXUA 3WIBA 3R3ZA 5CT6A 2HFJA 3BE8A 4JUIA 5JD5A 2WUGA 4LYEA 1DU4A 2RIPA 1UOQA 1XZIA 1QTIA 4B82A 1DWOA 3F8SA 4BAGA 5AKXA 4HS9A 4QNNA 5LIPA 3H1BA 1MO2A 2EDAA 4W63A 4B7ZA 3QH4A 3FOBA 5DNUA 3JW8A 1AKNA 1XRNA 1R88A 2FJ0A 4XX1A 1U2EA 4N8DA 3ZLUA 4YASA 3HC7A 3WK5A 1S8OA 3AZOA 3E1GA 4OU5A 1THGA 1HPLA 1BN7A 5JZBA 2PX6A 2DHEA 4ZRDA 2G63A 2AJLI 5ALHA 3UMJA 3PE6A 4AO7A 4DMCA 2YH2A 3T52A 4Q3LA 2PSFA 2EDCA 4I19A 3K2IA 4DNFA 1BE0A 3FLAA 2C5GA 5DYYA 2QJRA 3WMRA 2XUHA 2XUJA 5T4FA 3O4JA 4CCYA 4ETWA 4W1QA 4BZZA 1YCDA 1P0QA 2VATA 4IQ4A 2O7RA 1ZD5A 3CCCA 5JATA 2QRUA 4OYYA 2WIGA 4MQMA 1EINA 1LGYA 5DNVA 2OCIA 2WFMA 3F9CA 4X6YA 2GZSA 1CR6A 1O6FA 4OYLA 4C4YA 5AM2A 2ONCA 1JJFA 5ALMA 3NOXA 4C4ZA 5C7YA 3PI6A 4X92A 1E66A 2AJBA 4QZVA 3QVMA 3JYHA 3G8YA 3TRDA 4BAUA 1TAHA 1IUNA 3H19A 5ALZA 4EA6A 2OG1A 2QXTA 1J1IA 2WUFA 1Y37A 5K3EA 2XI4A 4UBNA 1U65A 4FBMA 3QPAA 2V97A 3KOOA 1JU3A 4LIPD 1A7UA 4AZ3A 3U0VA 1A8QA 2XUDA 3ZLTA 4X6UA 3M82A 1MT3A 1E8NA 1L7QA 3TJMA 5ALRA 1PV1A 2AJCA 5CT4A 2OGSA 4WY8A 5AI0A 2PSJA 4ARAA 4IH1A 1K6EA 1XQYA 3C43A 3LCRA 3I28A 4OB8A 3DOHA 1E8DA 3R0VA 4BATA 4J0JA 1NX9A 4DMFA 3AJAA 3I6ZA 3WL5A 1X2EA 1DWQA 2BKLA 4YX9A 5ALDA 3ESBA 4EY7A 1GQSA 1H22A 3FYUC 4M0MA 4FDMA 2QOEA 1ZJ4A 4Y2PA 3ZV7A 4ZGBA 3QYJA 5AP9A 2PPLA 3G02A 4KAJA 4X94A 1VA4A 2Y2VA 4BC1A 4DMKA 3D2BA 1E89A 3WKAA 1K5PA 5JAPA 4J7AA 1WB6A 1B6GA 1JI3A 1EHYA 3V1NA 3IA2A 4UBIA 3SX4A 1Y7IA 1ZI6A 2VJAA 5LZ4A 3Q8WA 3DLTA 5LZ8A 2HA0A 1OCEA 5K3CA 4KR0A 1NU8A 4Y2XA 3FAKA 1EK2A 1QTRA 4HRYA 2OGZA 5T4BA 4Y2JA 1N8SA 3CXUA 1ZI9A 2IITA 2GYVA 3PICA 4LYDA 2XDWA 1TK3A 4U2BA 4QLAA 4KE9A 4LXIA 2PSDA 1CUDA 1Q0ZA 5FRDA 3TEJA 3SWWA 4PQEA 4CIBA 5JZSA 1C4XA 3AZQA 3V9AA 3H2JA 2WUDA 3D4LA 3FWHA 4PO3X 1DWPA 5HQ3A 5ALGA 1G5FA 1CUGA 2B20A 5FP0A 1CFJA 3HI4A 1MU0A 2X5XA 1AUOA 1VA5A 3HYSA 2WHPA 4BVJA 1M33A 1DX6A 5K3DA 1BCRA 1YSCA 1G42A 4O08A 1JFRA 3VVLA 3IUJA 3B5EA 2XT0A 5D3ZA 2HU8A 3E0XA 4BE4A 1R3DA 3HRHA 3G7NA 3EBLA 4HZGA 1B41A 3E4DA 4K5QA 3NWOA 1W75A 3ZI7A 2Y6UA 4G8CA 1LPMA 1QLWA 2R8BA 3C6ZA 2XMZA 3G0BA 4EY4A 4WJLA 1UZAA 4Y2YA 2ZYHA 2JGMA 7YASA 4GXNA 4B85A 3O9MA 4QDTA 2ORYA 5FKJA 2VTVA 2C4HA 4PSDA 5LZ7A 5A2GA 2VA9A 5K3FA 1MX1A 4Y7DA 1N1MA 3WWDA 4QDUA 3WZLA 3WKBA 1ZJ5A 2B4KA 4K6GA 4KYVA 1JJIA 4TVKA 1X2BA 3EQ7A 1THTA 5LZ9A 1QO9A 4UFOA 3I2FA 3WYDA 5ALOA 2CJPA 3SK0A 1BEEA 1W6RA 4KE6A 4X95A 4UHBA 4RE6A 3A70A 2CEKA 3A2NA 5E4JA 1AGYA 1TCAA 2CB9A 2XQJA 3DL7A 3Q0TA 5AM1A 3GROA 4WCVA 2Z8ZA 1CVLA 1JKMA 4H7EA 4Z49A 4N5HX 2JGKA 4NVRA 3GZJA 3STTA 1BRTA 3H2HA 3VJMA 4F5ZA 1UKAA 2H7CA 4BP9A 1XRQA 1CUCA 5BV7A 1FFBA 4BVLA 1LPNA 2DQYA 5FPPA 4BRSA 2GYWA 2AJDA 3PFCA 1AMNA 1UKCA 3WK8A 2V98A 2XQIA 1ZI8A 3W06A 1ZGCA 3VISA 1W4LA 1QFSA 2XQGA 2RGUA 1MN6A 1QZ3A 2WQZA 2JGLA 5AOBA 3IBTA 3VKFA 4B81A 3BDVA 3UUEA 3OURA 5ALQA 1XZBA 2OCLA 5ALJA 3L1JA 2XUOA 1FFDA 4CFSA 4G9EA 2QUAA 5C8VA 1XQWA 4HXEB 4L9AA 5D3KA 4KAFA 5JAOA 4GI1A 1HBJA 5JIBA 2DHCA 3GA7A 2WSLA 1QIEA 4S0XA 4INZA 5IH7A 3B3QA 1JMKC 4FWBA 4ZI5A 5AKEA 3WKEA 4B0OA 4CCYB 4X7BA 4E46A 1K4YA 4UHEA 4MQLA 2GBIA 3DKKA 5IVHA 1HDEA 2PKYX 3BWXA 4KE7A 4H7HA 5AKJA 5AICA 3I2IA 4E15A 1G4HA 1EB9A 5FPQA 2CMFA 1IVYA 1MNQA 2R11A 4QDOA 4ZWNA 3O4IA 3M81A 2XUFA 2BUAA 1FJ2A 3QITA 4K6KA 5EHXA 5HFAA 2GYUA 4DMHA 3GFFA 5HF6A 4U2GA 1UFOA 1F8UA 3YASA 3S8YA 4TPKA 3IUQA 1ZD4A 3BDIA 3H2GA 5AKHA 3G0IA 1IUPA 3WL8A 2X76A 3RKSA 2WILA 1QIFA 4EY8A 1Y7HA 4OSEA 4C6HA 4FLEA 4JYMA 2RHTA 5T4EA 5HKBA 1FFAA 4FTWA 3KSRA 3QMMA 5K3BA 3AIMA 4RE5A 1GXSA 1QOZA 3R3VA 1AC5A 1DT3A 5DTJA 4DNQA 3WK9A 4GDMA 3L1HA 3V1MA 4BRZA 5JARA 2WIFA 4YPVA 3CN9A 1XZHA 4BBZA 4P9NA 1OILA 1AURA 1C7JA 1W1IA 5A7HA 3QZUA 3BIXA 1GPKA 4BB0A 1VKHA 1N5RA 4H35A 2AXEA 3I1IA 5JASA 2ECFA 2D5LA 3GBSA 1P0MA 4OUKX 3E3AA 4I4CA 3WJ2A 3FCXA 6YASA 1CUSA 3WI7A 2H9YA 2V9ZA 2ZJFA 5KREA 2QVBA 3ED1A 4DNOA 4H77A 3OC0A 4FLMA 1QJ4A 4JEIA 1ETHA 1LPAB 1VZ2A 2WKWA 2Z3ZA 4X90A 4BAZA 1E3QA 4UBKA 3HXKA 5CT5A 2BFNA 4Y2VA 1CUHA 2WG0A 4MXDA 1O6GA 1GKLA 5HFNA 1XZKA 5DTIA 3W9BA 4HRXA 2ACEA 3JWEA 4Y2QA 3KD2A 4C4XA 4HTAA 1LPPA 4W9RA 2XQFA 3F96A 3IVMA 3BL8A 4N5IX 5SYMA 4U2FA 5A6VA 2X8BA 4CCWA 1WPXA 5C81A 4CI9A 3LIIA 4IHAA 1HQDA 5J3JA 3C6BA 4CG3A 1TIBA 1ORVA 1YS2X 3D59A 5ALWA 1P0IA 5AI5A 1USWA 2QXUA 2OPHA 4GHWA 5AK3A 5HQ3B 2G4LA 4K2AA 1QIJA 1WCYA 2BAGA 2BGRA 4Q3KA 2WHPB 4WFJA 2JIDA 2XE4A 4CG1A 4BDSA 2J3DA 1XZMA 3IDAA 4EY6A 3D2CA 4UBMA 1DX4A 3PUIA 5EHNA 4J0KA 3R40A 3HLKA 2O2GA 1CV2A 4XJVA 1LNSA 5AM5A 4B83A 3KDAA 3EIOA 1LBTA 2O7VA 2WFLA 5JANA 2WU3A 4XVCA 2VEOA 1EI9A 3ILSA 3I6MA 2JBWA 2O2IA 2WHRA 3FVRA 4Q82A 1XZDA 3G0GA 4WFKA 1TKRA 2WTNA 4OU4A 4G8BA 3UUFA 3G0DA 4BCBA 2G5TA 4L3WA 1ZD3A 3G9XA 4G5XA 4AO6A 2VAXA 5K3FB 1Q84A 4J3JA 5EHZA 3C70A 2JEYA 4LXGA 3ZPXA 3H1AA 4HXFB 4AZ0A 2LIPA 4PSUA 4L72A 3DDUA 1FFCA 2YYSA 4AN1A 3C5VA 3AZPA 3N0TA 4ZV7A 4P92A 1HKHA 5FOQA 5ALLA 2XMSA 2CZQA 2PSHA 4Y9SA 3IB3A 4JNCA 3MGAA 5AKYA 4MEAA 4J0IA 5FV4A 5A7GA 3STUA 3DKRA 4DIUA 5AOAA 4OPMA 5IVIA 4KAAA 1DTEA 1XQXA 2J3QA 3DOIA 3AUKA 4E14A 3W2TA 4OB6A 3B12A 1QE3A 4EY5A 3FLBA 1QIIA 2WM2A 2DSNA 3ICVA 1ZOIA 1UK9A 4AN0A 2ZYIA 1GZ7A 1W52X 1K8QA 5JAUA 4UFPA 2CUTA 4BCDA 1EA5A 4GBGA 1FFEA 3D3NA
chains in the Genus database with same CATH superfamily
5M3BA 3CSSA 4WBNB 3EZGA 4Q02A 5A4AA 1DJQA 3MTGA 5FOWA 2YNMD 1G8JA 1PL7A 2PO7A 1TVKA 2ERYA 3TQHA 4BZXA 2VHCA 5K3AA 2C4TA 1RQXA 4L16A 2VLIA 1QAOA 2OBLA 4Q4HA 4UASA 3QU2A 5CRIA 1PX0A 5HZGA 2REQA 4EZEA 5EHQA 3ZVMA 4X64B 2ASEA 4F9FA 1R64A 1XX6A 4J9VA 2J3EA 4LYJA 5LP6C 4D26A 1RXEA 1NI5A 4QWMA 4RD3A 5JCJD 5JT1A 4NOKA 2RAPA 3UT6A 4HX9A 2RIRA 1XXHE 2L0XA 2GHIA 3H2IA 3S2ZA 1XHFA 3KSBC 1KHHA 1T2FA 3FX2A 1NTRA 1ORTA 2XZPA 1XQ9A 2R9VA 3T9AA 4I3FA 1F5SA 2QR2A 4JBWA 3ITKA 4WV3A 4LBYA 2ZRDA 4GBMA 2KS6A 2Q62A 3A27A 4TXLA 5BW6B 3RJTA 1FNBA 3RUFA 1ZCJA 2IP4A 1PGOA 1G7RA 3H5TA 3PZBA 1A7AA 2AFVA 7MHTA 3EHDA 1LSOA 3MCAA 2I1VB 3NHMA 3ZZUA 4RZIA 4V0KA 3ZE0B 3FN4A 4WOJA 4KEAA 3RU2A 1WF3A 4AIRA 4MUFA 3PCXA 3VKUA 3OH8A 4MKIA 4ZO8A 4NTZA 5H68A 4BKOA 4LGMA 5JRZA 4K03A 2B3DA 5TNXA 1BN6A 3CRZA 3GLGB 1D5CA 1HO3A 4YJFB 2Q1TA 5AKLA 3TLYA 2OFXA 3R5FA 4KW7A 1J49A 3NWPA 1AU9A 2XTAA 3NAGA 1KZHA 3TAUA 3WNBA 4URUR 4DA9A 4IO0A 1GA6A 4MK4A 4BNDA 4M4SA 2VPWA 1R6BX 1WB5A 3AR7A 1JFLA 5IEJA 3U6KA 4FYPA 2CCJA 2AUTA 3GPIA 1KZ1A 4GW3A 5ECDA 1UPCA 3MUNA 4BFTA 1AVTA 4HNTA 1FP2A 1UH5A 1TZMA 2CDNA 3LF1A 4WGGA 1G1MA 2IEGA 3QTLA 2IHYA 4YCCA 4NK4A 1YMVA 1GPAA 2PH7A 3VU3A 3D2AA 1F1BA 4XD2A 2VYVD 2CBGA 3IQZA 3QKSB 5DLPA 3RSGA 1SHZA 4S1TA 5FI0B 2I9KA 2LUOA 2QPOA 4HYQA 4YY3B 4YCNA 1NHGA 4KSBA 4JP8A 1D3AA 4NCIA 3IP8A 3O8LA 4LCJA 2RCNA 4R2WA 4QTYA 4MLCA 2FX3A 4MWTA 2IV3A 5TV2A 3OZGA 5BYAA 4NYIR 2Z95A 3ICQB 4Q4JB 1FQJA 3N3AC 1KP2A 4U7PB 1RDFA 3T5GA 5BO5A 1V26A 4O63O 4C08A 2Z2ZA 3DEFA 1YCFA 3R3UA 3ZJVA 3KPUA 3H18A 4F21A 4F71A 3FZEA 3HN6A 3WWCA 4X3CA 4BKQA 1OBFO 1YXMA 3TZLA 1C80A 1H5UA 1P1HA 3F1KA 4JCCA 5I9IA 4NJMA 5DHQA 4G5FA 3KLPX 2NIPA 2I65A 1XBTA 4NFYA 3RC7A 4FI3F 3GF4A 2W8BA 4QU8A 3B52X 2RKOA 2GR9A 1JDPA 3KHKA 1V11A 2GTIA 2QE7D 3TIXB 3W8EA 1ZITA 5J2TB 3KQUA 1VKNA 2R6R1 4D0RA 3CRQA 3ORQA 1P1FA 4X6LA 4CM1A 1PJ8A 4F8YA 2QPAA 3FVVA 1N7JA 1JA9A 2A86A 2C7VA 3AOEC 4UBOA 4EFNA 4N48A 4A8PA 1ACLA 4DARA 5AUQA 3KR1A 3NWEA 4DLTA 4MWGA 3GEHA 1NF8A 3O47A 2QVGA 4LPKA 2JFXA 2OGTA 4ZOLF 2JGIA 5EXSA 4D6PA 1C3VA 4DM7A 2P9QA 3DMGA 5BMVA 4DTCA 3AIIA 4RJIA 1NPYA 3VKWA 3ZX4A 2XT6A 2CE2X 3AILA 3LRTA 5H8WA 2RONA 1ZJ6A 2AF3C 4TOIA 3HZRA 3T3HA 3ZHSA 4YUXA 3FTDA 3MWEA 5GJVC 3W5IA 1S8AA 3ML1A 5LQJA 3F90A 5IT5A 1Z39A 4QUBA 4FFWA 3CX3A 2ID8A 4XFDA 5L7YA 3ITEA 5LP1A 1RZRD 1XZJA 2J0UB 4DUGA 3I2HA 2PQ2A 3EGOA 3WFZA 2CXNA 3SOZA 3DUWA 1Y6JA 3PEWA 2HJHA 4NQRA 5KYXA 2MIIA 2HA2A 2R7KA 3K73O 3TL6A 1SQ6A 1HRKA 4EJ0A 4TS3A 5BQPA 3Q0EA 3SS7X 5LU8A 1LLFA 2KLHA 3MBIA 4RXUA 5KYYA 4J4HA 3JTEA 4BVBA 4E7OA 3H86A 2PLWA 3P2MA 3H5IA 3DE6X 3BKXA 4I4TB 3RUEA 1U81A 4LXHA 5M29A 4AUEA 2CLKB 5FOQA 3QYFA 1NF3A 2TMDA 1ZUIA 1AQLA 4NAHA 2AX4A 4GI7A 5EJIA 5KTMA 1DJOA 1EVEA 1KQFA 5A6SB 3TLXA 3RANA 4MZDA 1RMQA 3U1TA 5IM5A 4A26A 1H2ZA 3HE3A 4DDKA 1D0VA 2NYRA 3EH1A 4DEXA 2VRCD 2X2PA 4REOA 1P73A 2NWQA 2P9EA 4YRZA 1RPAA 3AW8A 3HGQA 1E0AA 2ERXA 4GWLA 1VI2A 3W3AA 4R2IA 3HDHA 1J7KA 3G49A 4WDQA 2Q49A 1H4TA 2V1XA 3BGSA 1EVJA 2Q4BA 2RHRA 4XM1A 4AJHA 2E4XA 9LDBA 4KYTA 5EWJB 1ULTA 3IHLA 4PQYA 3F49S 4AT1A 4WHMA 3DM5A 4BLPA 2Y1DA 5D7NA 5E4TA 1E2EA 4LS3A 4QXQA 2PUGA 1H05A 3FMGA 1OJLA 1GUAA 1OWMA 4FBLA 4MUMA 3U26A 3TD2A 4N0PA 3BMOB 2FAXA 2FPLA 3IOYA 3IQFA 1GKKA 3L8ZA 2C57A 3N2YA 4RVNA 1SCUA 2WE7A 3I01A 5NULA 4LRWA 1S4QA 4YRAA 2FMHA 4L0MA 2AF4C 2I3DA 1GPNA 4I8IA 4GAEA 1WUHS 2QRJA 1U2GA 1ECBA 2HSGA 4B3JA 3JATA 2NSHA 1OX4A 3UKJA 2PUTA 1AQYA 4EPRA 2WVAA 5AW5A 1HDOA 2WIKA 1TMOA 5K4GA 4TLCA 2XODA 1W581 3ZLBA 3ZIUA 4L5AA 2X1VA 4JLMA 3FBWA 3G8CA 3DGEC 1SQGA 2PL9A 1XRLA 2GK7A 4GMHA 3S7ZA 2X77A 4D4IA 3QE4A 4N1AA 4TN5A 5F7JA 4YH1A 1WKBA 2QR5A 4KXNA 2VJKA 5ALIA 3ANTA 4YWHA 3BH7A 3SQOA 3KZVA 1T1EA 3IMKA 3OUUA 3ODPA 3ZG6A 3MCWA 4QM6A 2JLAA 3P0FA 1J07A 2IUYA 2VPTA 4HPWA 4JJKA 4PY2A 3EDYA 4M1KA 1RJGA 3THYB 4E2FA 3CURA 3GZNB 1N5OX 4OHOA 2A9PA 1MP0A 1PT5A 3V3KA 4BEJA 5K01A 5KWSA 3L8FA 4GSKA 2HDNB 4FOLA 5HE8A 2HU7A 3QA9A 1O8BA 4D9CA 1F12A 1NF9A 3TW8A 4ARSA 2BVNA 4G9BA 4L5YA 4HV4A 2A14A 2EWWA 2Y92A 3ET5A 4HUJA 1WULS 3M6VA 2OLEA 3GJ7A 3H05A 4TTVA 2BLLA 2EU8A 4Y1EA 5FA6A 1RM3A 3LLMA 1LH0A 3NM4A 4G8JA 1EVKA 1OA0A 2J46A 3OI7A 4N82A 5ENVA 1MXHA 4RQAA 3HP4A 5FBQB 5G4KB 1XROA 5H16A 1IVNA 1Z2PX 3CIFA 1J2EA 1YRQA 4JBHA 4OBWA 4LRSB 4P80A 4OO3A 3SMVA 5LYJB 3QLTA 2K2QB 1YR8A 1VHDA 1XZCA 2GUGA 1WQ4A 4U00A 3INYA 2OUKA 5DX1A 1NBME 2PZFA 1XKXA 3IAS1 1D2NA 2ZYGA 2BJHA 1MB2A 2JAWA 4ZEWA 4RLFA 2PANA 4H18A 1Z73A 2Q2QA 3EIQA 3PYLA 5E2IA 3S2UA 3L8CA 5HYVA 5LQSA 4LKRA 2Y71A 3WLKX 2DUWA 3OQBA 1HYGA 3TKYA 3ZXXA 4LRUA 3D0OA 4ZJZA 5C5CA 1ZN2A 4ITVA 4KN5A 5AHXA 5EQFA 3GARA 1MGPA 2IYEA 2H2HA 2Y27A 2M6LA 4PO9A 4DJDC 5CBKA 4MVJE 1ZM3A 4ER0A 3N3BC 4IIYA 4LPSA 1II0A 1CC1S 1E2DA 1OI3A 1TM5E 4DB4A 4LJRA 1CS0A 2GM3A 2JK0A 1WZIA 5JI3E 3VR2A 3H0CA 3MRXA 4UZSA 5DK6A 3VR3A 2PYIA 4EI2A 4WOBA 4LVUA 2ZRIA 3GEIA 4M53A 2I4LA 1N1GA 2C9CA 2CFCA 3IXLA 5AKGA 1ORIA 2NO0A 3K09A 1JHAA 3UO8B 2RGCA 5IC4A 3B6MA 1BW9A 3O6VA 3VPCA 5AJVB 4BNIA 5ALUA 1SC3A 4AZTA 3ICOA 4FVTA 4CMEA 1KAEA 1EFUA 1WVGA 3LWZA 3PHBE 3PPXA 4M8KA 1ISSA 5DFAA 5KDLA 1HYBA 1QC5B 4OHYA 1Y9JA 1J0BA 1IATA 3TKLA 4HTFA 1PDVA 4P5DA 2G72A 2R0QC 2VDUE 1Y42X 4LCBA 1ZSYA 4MQUA 4BIMA 3GO4A 1E2IA 4NCNA 3ZZNA 4CQNA 1WXEA 2CC2A 4NCHA 3G5MA 4JP1A 1SBCA 1XHLA 3EODA 2QTBA 5ARCA 4ZAYA 2MSKA 4QX6A 4OB7A 1DRVA 4MIEA 1TKAA 2JFYA 1PSWA 3PEEA 3Q3GE 4OKNA 3QVUA 1RJWA 5J5VA 2K87A 1YZVA 4KXYA 3SFTA 3UHOA 2IGBA 5CB4B 4G0MA 4Z2AA 8ADHA 4JJ8A 3PEYA 4D8VA 4PZCA 1WVIA 2O8NA 4GVLA 2P77A 1L4FA 3IE2A 4WXEA 2PBZA 4EFMA 4R1UA 1UBCA 2J0QA 3IPXA 5DNWA 4U2CA 3ROXA 1CUFA 4YRSA 3T9EA 1FX1A 2A5YB 3EDMA 4DUYB 4EF6A 1P62B 1N9ZA 3NGMA 5JRJA 1IPEA 2D7JA 4LHWA 1KMHA 1WZNA 2GBPA 2B2NA 3TZEA 2CFOA 4F85A 3E9DA 3KOYA 3OU6A 3KJQA 1KYVA 1OVMA 1DG9A 2C0QA 2GEKA 2RI1A 4N5NA 1IZ7A 3F6PA 3O4HA 3P0RA 1NBMA 2BFPA 5KQPA 3AG6A 3WV4A 5T3YA 4EIWA 5BYBA 4DMLA 4PZ0A 3GX1A 4CM8A 4TVBA 2JGDA 3UG6A 1HFJA 4EATA 3ND9A 4ZCTA 1SKMA 1WDWB 3MWJA 5TGZA 1KEEA 3PPVA 3TE7A 3UMVA 4RY9A 2YXEA 2TMGA 3QUCA 2W6MA 1QR6A 1R5JA 4OHPA 5E2AA 1U90A 1KMNA 2FZVA 4MJ3A 4F4IA 1XZLA 2AFIA 4Q05A 3RHTA 5BUZA 4ZCLA 1JJBA 3EDCA 5C34B 2GO1A 1PZFA 1KFEB 1T4MA 4XDGA 2PGJA 1M76A 1P3JA 1MG0A 2VDMB 4M21A 3FFWA 4OLFA 1NUSA 3BRWA 4LJ6A 4XQCA 5LB4A 1XJQA 4AULA 7ABPA 2CDAA 1JAXA 2Q9AA 1T9ZA 4IGEA 3DAPA 3LUAA 1SFRA 1RCFA 3HJUA 3LD9A 3MJCA 2F3QA 3P9CA 4U7FA 3ZGLA 5GVSA 1US8A 1R0LA 4HJXA 3RVBA 1GDDA 1ZIDA 2PWZA 3PVZA 1TVEA 1KSGA 3LLCA 3CVJA 1A8HA 4CIDA 1XFDA 3VI3B 2WTAA 4LC1A 2KMLA 2AHOA 2D8AA 3ITDA 3BAFA 1A50B 3ESQA 4NMLA 3CZMA 3R1IA 4W7SA 4ECAA 5ISMA 1U0BB 5A0VA 4LZZA 1GL6A 3RARA 1FLNA 1VE9A 1NATA 5JHGB 3OIFA 3QLUC 3NKLA 2ZSBA 3LZCA 4G4SO 3NTRA 1NW8A 2Q0HA 1EFCA 3EOBI 4YTEA 3HYCA 4MTCA 2NU6A 1RIFA 4ZZ0A 1JG6A 2GDZA 1P2SA 5JTUA 4X0EA 5H4HA 1UXJA 4G24A 5B7GA 1J2UA 4CMJA 1NMZA 3L0IB 3KZNA 5BSEA 4JQZA 2QL6A 1OB2A 1SCDA 1I8TA 3QLJA 3RWMB 5ARBA 2RGXA 4RENA 3WIOA 5IRCD 4WZAA 5ALKA 2YHIA 2OLJA 1MIOB 1WTAA 3D3EA 4RHTA 4OJQA 1X6VA 5JYBA 2A0XA 1LTKA 3AB7A 3R7SA 1KAGA 1KJ9A 1QH8A 2BSAA 1T15A 1P7WA 3HV0A 1EVQA 3PNYA 4AVYA 1TVKB 4HJRA 2DPGA 1KK2A 2ZJ6A 3GCGA 1I9GA 1Q0UA 1WABA 2P0YA 2V6FA 3M4JA 4Q4HB 4RO0A 3C1AA 3JX9A 1NT2A 3NUZA 1TYZA 4J0CA 2DTEA 2XT9A 3PENA 2IEBA 2REQB 3A4TA 5EL0A 4EHBA 4LRTB 3T5AA 2DYKA 3GIDA 3H4VA 2NZ8A 4NL4H 4UMFA 5DLDA 5HK8A 4I3HA 2ACWA 3FYSA 4E5PA 1ZX1A 3FRHA 3OIUA 4JBXA 3JQRA 3H9JA 3VU8A 1VL8A 4I9NA 5AHWA 1I1HA 2FW9A 1JR3D 2GESA 4HB4A 1J24A 2BGNA 1YS4A 1T3ZA 3C87A 4V0OA 4C4PA 1X1RA 2PBLA 4HVCA 5BXYA 1M1XB 2PZLA 4PCVA 5A71A 2P9FA 1QCYA 3JQFA 4FHZA 4B4DA 4C3UA 2O3UA 1E3MA 1PLJA 2CDCA 4W1SA 1E7MA 1PJLA 1W0KA 1CS4C 2ZB2A 3IC5A 3S8EA 4PONA 3Q88A 5KNDD 5EUMA 2Z3WA 4DA4A 4H1WA 2CXHA 3JY6A 4U9IS 4OLAA 1GSOA 3TXXA 5DTRA 3HNRA 5AW1A 5KTOA 3R3HA 1QF7A 3G88A 4ZOLA 4IDCA 4CBVA 1YB7A 2IZZA 2PX0A 5KSWB 3QVKA 3W2HA 2I78A 1GZ3A 4YV7A 4V03A 1TRHA 2AD1A 1FDSA 1V7ZA 3WYGA 5FUWA 1XKTA 4TGLA 4KLCA 1KZGB 2OE2A 2YWJA 4TMXA 4RM2A 1MOZA 1QVAA 1UBJS 1PFQA 2CVZA 1M2KA 1ZAKA 3GVXA 3W5DA 1Z2AA 1LSJA 2DCMA 2NXNA 2ORED 1YRHA 2P2ZA 2PEYA 3BBLA 3I92A 1BDIA 3IMEA 1JGTA 1K6IA 1Q22A 1TT7A 4JLJA 1L4BA 1KXJA 2V0CA 4U2DA 3K9WA 3OPVA 1LXCA 3RHZA 4QBHA 3STYA 1FOEB 2YHBA 3K8QA 5AHRA 2G07A 1KGSA 3UAWA 4IWNA 2COEA 3IP7A 4G25A 1RRVA 3JVIA 3A9TA 1EEHA 5ANRB 2XUKA 3IAM1 3UJPA 2IYOA 3WLAA 2QTGA 1EDEA 4M7PA 4ENTA 2DRIA 3DE4X 1YV9A 3ENWA 4G1FA 4QHYA 2BN4A 5K6RA 4V0QA 4FFVA 1I36A 2XY4A 4L50A 2F67A 4HWGA 2JAQA 3BGDA 4KKXB 1D07A 2I3AA 4MW7A 1L1EA 3L5OA 4KODA 2BZSA 5ILQA 3QE3A 3EPPA 2RKBA 2Z5GA 4U4AA 5F52A 2AD5A 3IULA 3UC9A 3KUUA 5EA2A 2ZSHA 2J1LA 2B5OA 1VL6A 1WDTA 3AFIA 1SG6A 2H06A 3AUAA 3X1KA 3SQXA 4DLRA 1UFQA 5KSOA 1PVDA 1TTHA 4UBLA 2IZ1A 1XTVA 1Q7EA 3GT7A 3INGA 3RYHA 1ZOOA 3JYOA 1GA4A 1PYOA 2EP8A 3IEKA 1Q1AA 2JGEA 1PZMA 3TW4A 4WXMA 2HIGA 1M1NA 3AM4A 4MQ6A 3GUCA 3O4GA 2P4QA 3B2NA 3HY4A 3IEPA 1E1KA 2O05A 3QU4A 1DARA 3W79A 2XRZA 4MKRA 5A3VA 8MHTA 1QQ6A 8GPBA 5I7WA 5JVDF 4C43A 1JU4A 3HEAA 4DDTA 5BSTA 3CY6A 3PXXA 2HK6A 2KQUA 2PIAA 3L1IA 2PLFA 3BGWA 4N18A 1MA0A 1E2GA 3NOQA 5IANA 5JYEA 4R05A 3EF1A 3NNSA 2W8BB 2POQX 3FGPA 3JQ6A 2HN9A 1O5TA 2OV3A 4YQYA 1V11B 2YHAA 4GEKA 5CB0A 1MGOA 2CMKA 1FXUA 2OPBA 3L41A 4LTDA 2X1HA 4XUEA 1AZWA 2JI9A 2VJDA 3LY5A 3DXZA 3ENZA 2VXOA 1A8SA 4GECA 3RJZA 2VP4A 3B2QA 3KOXA 3S0JA 2QDXA 1C0PA 3DMRA 3OEED 3FUXA 2IZ6A 5BR4A 1ABBA 2EJTA 3D0RA 3HSYA 1YZTA 5A5FA 5BSFA 3GRCA 1Y34E 3X2SA 4ND8A 3QMPA 3QKRA 1U2ZA 1U2PA 4OUDA 3COJA 2Q1XA 4UTXA 1U8UA 3N2GA 3SM3A 4QGFA 1HETA 4IJUA 2UZ3A 3CG0A 5F21A 2QW0X 3VC2A 4LYYA 1A5ZA 4KITB 1YO6A 1YS1X 3ZE2B 5BNTA 2LVBA 1QIMA 2H1HA 1YDGA 3E9EA 3L0OA 3MWEB 3GAAA 1YR7A 3P9XA 4OH7A 3WAGA 2EKBA 3OJFA 5FFNA 1A5BB 2Q2WA 2Y4OA 5JBIA 2GF9A 5HIJA 3FRJA 5T4HA 2Y9PB 2GFQA 1CIPA 2WVJA 3E5HA 2CNKA 3OWOA 1ZPDA 3A6GA 4OVKA 1AB5A 1GRCA 2VK1A 3OE5A 3T7JA 1DX9A 5THKA 4R1NA 5KYXB 4LDQA 4IMIB 3CX4A 1JWAB 2H1RA 2N9UA 1A3CA 2DVMA 2QDKA 4TV9F 3SQLA 4DA0A 4PX5A 2O8CA 5IU6A 1SXGA 4MHSA 1F51E 3DUFA 5FUXA 4C05A 4HAZA 1M10A 1L8OA 1N3YA 1Q77A 3KAJA 5KYYB 3KR0A 5CVCA 5KYWA 2WQ6A 1AGRA 3PUXA 1GU0A 3TCNA 1JW9B 1SURA 3AQIA 1A9RA 3C3EA 2QQ5A 1L7RA 3AM1A 3HN2A 1RYZA 3FGNA 1G0NA 1D4FA 2IU4A 5FNZA 4IZOA 2XF8A 2ZI7A 1FUIA 4A8HA 1JHMA 3BHMA 1E2NA 1XN1A 1ZCBA 2CFTA 3LW7A 4JODA 4KXXA 4YJGA 2RSLA 1VGVA 3MK31 1M2FA 1BCSA 5ESRA 2F2TA 2RHMA 1UBRS 4UFNA 3ZDYB 4B6QA 5EHGA 3UPTA 4X91A 4MWDA 5CEFA 1Q7TA 1QMPA 2CXUA 1WBJB 1SM4A 2VNIA 3FHLA 3HKCA 3U3MA 4CETA 4JOBA 4L0CA 3RTCA 5ESDA 2QZSA 2IUSA 1NAIA 3K20A 1P60A 4WADA 4XCQA 3WB1A 5BWBA 4YMSA 5L7WA 4UBJA 3I62A 3PA8A 3HABA 5J2UF 2F3PA 1JBQA 2E5FA 3IPLA 4Q4AA 5CJJA 3OOSA 5EXPA 4WPGA 5TRTA 1NMYA 2PX8A 1OH8A 1EZ4A 1UBTS 5AOVA 2G5PA 2OHOA 1P1RA 1RKQA 3SBDA 5ICMA 3OIWA 4QBFA 2A67A 4Y2UA 1V2HE 2X7HA 4X93A 1ESNA 3VPFA 5C7OO 3R0IA 5F9FA 4G1VA 4EYQA 3TQSA 3NC4A 4LNHA 1NQXA 1RP1A 2C2OA 5B4UA 1XOIA 4AMZA 4HQ6A 3F47A 1N0VC 1D03A 2QD5A 3FGOA 1G3QA 1DXHA 3QMWA 1SCUB 3VSCA 3ZE1B 2C58A 1JEQA 4P98A 1HYQA 3H04A 4G23A 2GAIA 5T6BA 2VPQA 3QBJA 4J6FA 1W76A 3DHYA 1OX4B 1MC8A 4ETIA 1ZA2A 1RBMA 3ZU4A 4F5EA 4JITA 5HWSA 4GZ3A 1Z63A 2FMKA 3R8CA 2H3EA 1H5QA 5HF8A 3CVUA 3DYVA 4U2EA 5E9QA 3ON5A 1XZGA 3QG5A 1ZEMA 3WQHA 5I01A 4MCIA 3I4CA 5CGQB 4BEWA 2V45A 3Q8MA 3TS1A 4HNSA 2HA3A 2P9GA 3VAYA 3W05A 3H3FA 5BPHA 5HK9A 5D7BA 1EQAA 2VK4A 2W8ZA 3VV2A 3ZZTA 3LBAA 3WDSA 2AI1A 2JJ1A 3KR9A 3KVNA 4XQEA 2HHLA 4BZQA 4CM9A 4EPWA 1GG2A 1SPBS 2XVZA 4RF3A 5EPUA 1DQNA 1OU0A 2FK8A 1WZCA 1QIDA 3ASVA 3ASUA 3SICE 1MTZA 3ESCA 3BT7A 3UGTA 2XOXA 3T3NA 2JLWA 1ENPA 2HM7A 2JJ8A 3ONVA 3NHYA 1PR9A 1SBNE 1NPTO 4R81A 3TW8B 2B8JA 1O3YA 1A88A 2VHEA 4FMCB 1YQDA 2Z6AA 4E4TA 1MQ9A 2DBQA 3FUWA 4JH0A 4OHWA 3RRXA 2JDID 2JF0A 3TWOA 4F2PA 2QSZA 3W9SA 1OH7A 2PS1A 1TM7E 2H57A 3OG9A 4UZEA 3LKZA 5IK2A 3WGLA 1RLJA 1IBKB 2FWIA 3T0FA 2P69A 2ZYRA 3ENQA 3L7OA 4M87A 3IEXA 1YDFA 1Q20A 4C01A 4MKXA 5FUYA 2UYCA 4FFLA 1IVSA 5EESA 5M34A 5LMUB 1ZCZA 2JJ2A 3OPYI 4DSUA 4CEJA 2OQRA 1SK9A 3CH5A 4FXOA 3V8RA 4X44A 3OPMA 1Z22A 2ZRKA 3AV3A 4M0FA 4HAIA 2GBLC 3HFJA 1CRQA 2ES4A 1TYAE 5FJIA 3PD0A 1ZL2A 3MPOA 1MJHA 1AT1A 2DTDA 1VE7A 3SJZA 3LY9A 3TM5A 4E2YA 4A23A 2XYGA 1CS0B 4IV0A 5EIEA 1M0WA 1NNEA 2XGGA 5TEWA 3PSAA 5JPDA 1I6LA 5AD1A 2RAUA 1L4YA 1FMFA 1P80A 1AS2A 2IXDA 3MELA 4GKAA 4MMXB 2VDLB 3O7MA 3QIAA 4J03A 1FJHA 1NY6A 3I6QA 5AUNB 3NORA 5B1YA 2B0CA 1E18A 5F64A 3GXBA 4HQKA 2ZI9A 4KMSA 4YO8A 1QU2A 1OXSC 1D8AA 3WP0A 3GJ6A 1GAWA 1OXUA 5CH5A 2FQ1A 2ID9A 3DQZA 3QVJA 4GR5A 4R2KA 5CX1A 5IKMA 1RW4A 2Q6OA 3TZ6A 4AJEA 1N9GA 1SQ5A 4JEUA 4A0GA 1X19A 3QQ5A 4IV5A 5JSFA 1SD2A 4K2HA 4R1LA 2DFKB 1QHFA 3JVVA 4CN8A 1SBIA 4C7XA 4ND6A 2RC5A 3PX3A 1HR0B 1V37A 3IXMA 4G2NA 3BF7A 4KXVA 1AV6A 4YV2A 3HDVA 4UHFA 5BN4A 4KRFA 1E7SA 1AQ6A 1OX6A 3GLHE 4L6AA 2G28A 3QELB 5AM3A 3L6RA 5F12A 3W8DA 1JZQA 4WA8A 1EAMA 4YV0A 2AMLA 1KVRA 2HEIA 3PHCA 1YB4A 3L7DA 2JC3A 1O97C 4H08A 1BHQ1 3FMIA 4MQ4A 2DJ5A 4E94A 1E9CA 4UM9B 3DTNA 1JHRA 4BO6A 5GMOA 1Z47A 3FSGD 3ESRA 4CM7A 5CXXA 1CQJA 2GJKA 4M49A 3D6NB 4NMWA 1NQ5A 1E3TA 1KMHB 2WTBA 1KAQA 2BP7A 2CXXA 4MV6A 4IG9A 2AQHA 4O4HA 3FKSD 5CURA 3QUQA 5K0SA 4QLBA 4FSHA 1OW3B 1IEWA 1EDDA 1X94A 4YRCA 1PNRA 1XIVA 1DRKA 1VLQA 1BNCA 2YZMA 3P0EA 5AK4A 1OXBB 5JSZA 1P2VA 1VKZA 4CM8B 2FU5C 2JGDB 4ZXFA 3LFUA 4YCAA 5HIIA 4CMAA 1A5AB 5AKIA 2D7DA 1KEEB 2P9JA 1N8TA 1C8BA 4B3GA 2F8SA 3BEDA 2O07A 5FNVA 3ROMA 2G7ZA 4OX9B 4RD4A 2AFIB 4EI9A 4BMPB 2O4UX 4FYVA 4TV8A 3GFTA 4CWAA 1GRQA 4YUZA 3ZE6A 2C4VA 1QH1A 4P2BA 1SHJA 5BW4A 1MW8X 3RW9A 3OLCX 1WO8A 5BSRA 4HLQB 5CM9C 3BFXA 4KE8A 3I5MA 1EZ1A 4V02A 1XMVA 5BMVB 1BX0A 2AMFA 3I37X 4PTYA 2M32A 5JSHA 2HYIC 1QYCA 1US8B 1KU0A 2I6XA 1T0UA 4HH0A 3RF6A 4ZT4A 2Q3FA 2XUQA 3CEHA 5AVKA 2NPFA 4CLXA 5EZSA 2ZM6B 1TI7A 2COUA 4PF1A 3BXOA 3R20A 4KJZA 3ZBUA 1NVXQ 1H2WA 4UNRA 2XLBA 2JBAA 5B1SA 5F77A 3WRYA 5LQMA 1EXMA 3KL4A 3LHDA 1C7IA 4QGBA 2R68A 5EP3A 3JAWA 3JQBA 4BN4A 1D0IA 1APBA 5LMCA 1ZESA 4RZSA 4XOIA 3IAHA 1H9BA 3E53A 1EUCA 1JQDA 4ZYWA 2O8VA 3LMKA 2ZBPA 4JC0A 2WUVA 5B53A 3V1YA 1QZTA 3MJTA 3EGDA 2MT9A 4XFJA 4WBSA 4WZAB 3WLQA 2QUJA 2YHIB 3N86A 5CLQA 4JI7B 1ZG3A 2WHXA 3C1TA 1U31A 3QBVA 1KAHA 1KYTA 2WMYA 2PVPA 1QH8B 2ZJ8A 1V8BA 4OGWA 1XRMA 4RIHA 1ZM4A 1U0JA 3GDGA 4R68A 4R8RA 3QXSA 1J22A 3I9JA 1C3JA 3FZYA 1V45E 3KXIA 5DGIA 1TVMA 1K89A 2JGAA 1KQGA 2E9SA 1LQ2A 1F4VA 1B1AA 4FMDB 3TRJA 5IMSA 1UK6A 3H2KA 1BX1A 2QZJA 3IPCA 3RVMA 1OZAA 4B40A 3NG1A 1FUKA 3OQPA 3ZQ6A 1BRMA 4OQYA 4K9PA 2HFKA 3O8DA 2JAOA 1K4MA 3A7EA 1NP7A 4QOGA 4AG5A 4B3SB 1KTVA 2NADA 4NZNA 4X7RA 3B1KA 3KTAA 1JKXA 1I51A 2QG4A 1S8NA 1B3BA 2V5VA 3L6DA 3OF2A 1XZEA 2CLHB 1B2RA 4ALJA 5GM2A 5EZYB 2AN9A 1K86A 1RP7A 3RVNA 4U7JA 1XKLA 1DAOA 1NBWB 1Z4KA 5LWHA 1NNLA 3AOGA 3LVRE 2C7RA 1CYEA 5IAEA 4KLRA 2WZCA 4RKWA 1BYIA 3FFTA 3KWFA 3L4KA 3U3KA 3JQAA 5FQOA 4AQDA 3LZ6A 2YWCA 4L3VA 2Q3HA 3ANSA 4MB0A 4YHBA 4N76A 1H23A 1DELA 1Z17A 2RKWA 1OIWA 3UEOA 2R5FA 4QOIA 1RRKA 2QN2A 2UYGA 5FTJA 1J42A 1DQYA 3N7TA 1BEZA 5IFLA 1FYVA 1J2TA 2VQ6A 2GPBA 5JEDA 3WGMA 2ICAA 1D9XA 3DBLA 3PUKA 1JQBA 1NASA 2WWRA 1NOJA 2HU5A 1KJIA 4LVOA 4M0EA 1EK5A 5K8IA 3ANNA 1BQEA 3EPJA 3O8QB 3CRRA 4OP1A 2C9MA 3MD9A 4Z4IA 1NWCA 1BU8A 4ZT5A 1JU9A 2CHGA 3VRHA 1UJMA 1ZGBA 2AZ4A 1S3SA 1JV2B 2QLBA 5EIAA 2NW6A 2HLPA 1BX3A 2OV8A 4HFRA 4QSHA 4D45A 3LHIA 2FEKA 3ZWOA 3JRNA 2D2EA 3DCJA 5JH7A 1YVDA 5EJ5A 2IYTA 1R7RA 2VSQA 3MS7A 3VNUA 3L9WA 4BFVA 4DV5B 4TYYA 3CF0A 2J08A 4JX9A 4NH4A 5CAEB 3T41A 2IKQA 1N0HA 2OB1A 1YASA 2Q4DA 4YJHA 1W5AA 4X54A 1WMDA 2HF8A 4CE6A 3LUFA 3V32A 1UK8A 3HDJA 3EVNA 2ZUTA 2WM3A 3G85A 3BMXA 1TYDE 1R4ZA 2AN5A 4OJMX 1DBSA 2P75A 4JKYA 4MV0A 1PFYA 1DJNA 4K9RA 3L77A 5HQTA 3VV3A 4FX2A 1PV4A 1RR6A 4JLUA 3O8OB 2ZKLA 4AZ0B 3RTGA 4C89A 2SHKA 4YNBA 1A9ZA 3TVYA 2ZIEA 1DKOA 3PEUA 1PQUA 1YBMA 2Q3CA 4PLVA 5C9ZA 5EUBA 5COBA 1SA0A 4QUEA 4J9UE 1M1NB 4KVFA 1W46A 2H16A 2HFJA 4RJKA 4B3XA 2D1FA 3ZR4B 2TYSB 4LF5B 5HOQA 2QNIA 3EZXA 3ZHYA 4EO4A 3OHSX 3L84A 3B1WA 2QN9A 3BE8A 3NUGA 4J49A 2WUGA 2GD6A 3IQWA 4FP9A 1E1DA 2Q27A 2R62A 4AJ4A 1QYRA 3U16A 1DU4A 3DLAA 1UOQA 2LPMA 2Z83A 1TEZA 1NMXA 3DT6A 5AUOB 1NQUA 4F2WA 3D7LA 5G0UA 3TIFA 4KXQA 3NDRA 4JZKA 4NYJQ 4G1EB 2RAFA 5AQ1A 5DE3A 2GRAA 3ORRA 3L0BA 5JE8A 3V4PB 1XLTA 3LGAA 3BL5A 2AN3A 3AK4A 2P35A 1F20A 4GYKA 4K9LA 2C4UA 4QNNA 2J09A 4EG0A 1NMEA 2QTRA 2E1PA 3KKLA 5LIPA 3LC1O 3ME5A 1BVUA 1MO2A 1HE8B 1RI1A 1VSUA 4ND8B 3QKRB 3E3LA 4W63A 4OUDB 4B7ZA 5ELXA 4TLLB 3G5UA 3N2GB 4FEGA 1KEKA 3TTVA 3WLNA 2WWIA 2WTXA 2A8YA 4ZAZA 3O1HB 1G5IA 1GUBA 2G80A 1R88A 3PUZA 5ICSA 2VZ0A 5ECGC 5LPNA 1U2EA 2NU7A 1EBUA 1NQWA 4N8DA 4JA2A 5A05A 5EKDA 4WX2B 5KC9A 2YZ2A 1U7PA 2RGWA 3EAFA 3D5QA 3K8ZA 3L0PA 4NCJA 2QVCA 4MP8A 2Y99A 3AZOA 1H6DA 1NUHA 3C3JA 4FT4A 4L4ZA 4LEIA 2LR0A 1ODJA 3AFGA 3FH0A 2V8BA 3QBEA 1Z62A 4NV0A 2IZ0A 3PUJA 3W7VA 2PX6A 3IVGA 4JSYA 4ZRDA 1B8UA 4OOFA 4MS1A 4RMNA 1K8XB 5ALHA 2BFAA 4DG8A 2IWRA 3T52A 4Q3LA 2ZSUA 4DYVA 2I6QA 16PKA 3I52A 4B6SA 1Q0QA 2O8CB 1WUTA 4J2TA 2GSDA 2GRJA 3ELUA 4Z9YA 4KR7A 5TC4A 2FZGA 3LRPA 2HF7A 2DLDA 4GI5A 3BFPA 3WWYA 1XCBA 1UJ5A 2ZI3A 3W6OA 5CK4A 2GJAA 2P6OA 1ML3A 3BOSA 3GY0A 2QJRA 4MVXA 4Q37A 2YZGA 2XUHA 4BFZA 4OLBA 4LY3A 4UKDA 1D2GA 3B13B 2ONJA 1TK9A 3N8GA 3Q11A 1XV5A 5FTMA 3ZJYA 2W6JD 4YJGB 1RRGA 2GZ3A 1YCDA 1RABA 1T26A 1YE5A 2VATA 3P26A 3CUUA 3MTAA 5CYOA 5CFQA 3NKFA 5D87A 1OU4A 3ZXSA 3CCCA 4HZIA 4NZOA 3BIOA 1KPHA 1ZH8A 3HKCB 5CDFE 3ZI0A 1P2BA 3O73A 4FN5A 2QRUA 1U3DA 4DZRA 2OORC 4GICA 2XNHA 2VNSA 1XP5A 1F9EA 4P83A 4Q4AB 2YDXA 1HT1E 3KT0A 1LGYA 1L5WA 2GHQA 2OCIA 2FPUA 3ONDA 4WVLA 3OSZA 3GOHA 1VLLA 3F9CA 2P4HX 1KOLA 3A25A 1NW9B 3T1YB 1G8GA 2WF5A 2C9BA 5B3KA 1T8WA 3UN1A 4B43A 5IMBA 2D59A 5F2NA 2IYRA 1NLFA 1W35A 2GZSA 4LC0A 3W2GA 2Z2YA 4H59A 1RMTA 3A11A 2GN2A 4MQFA 5FWXB 1SBTA 4XUCA 4FW8A 3ZQJA 1JJFA 4JJ4A 3SXUA 2QR3A 3MIZA 4RHEA 3B70A 4U0JA 2J6BA 3PTAA 2R79A 1ZH0A 4K7JA 4PFQA 3BERA 3NEYA 5H9VA 1JEQB 4C4ZA 8AT1A 4DIFA 4ZU1X 3U44A 4MVWA 1I94B 1G3RA 1JRLA 3QVMA 3OAAD 4PZLA 1ECJA 4UDXX 4WK0B 3OPXA 4DQDA 1IJKA 1E0KA 1W30A 1MZVA 1TAHA 4FHFA 5BSUA 5KNBH 4C29A 1YJAA 2BGTA 4E6PA 1Z8FA 1ZNQO 2GOYA 3TF5A 1S2DA 2POCA 4GX0A 1V1RA 1I3KA 2BH9A 2ZJ3A 1YMUA 3OJXA 4QQRA 2I87A 4TMWA 2PUCA 3QKUA 1XMSA 1QHNA 3E70C 3QPAA 1LDGA 2DWOA 2FG7C 2V97A 4BVAA 3IT2A 2GO7A 1XT6A 2ISQA 4HWOA 4N0DA 4BFUA 2PWBA 3NEAA 4LIPD 1ACMA 1U2SA 1YDMA 5A9RA 2Q1YA 3U0VA 2ZRNA 4LZNA 5JQGA 4P0QB 2L17A 3C3AA 2IY9A 1R9GA 1WSBA 3S5JA 4C7OB 4FGJA 4X6UA 1M8KA 1OLUB 5I3CA 2RGDA 2HWWA 4D0NA 1KZ6A 2GX6A 3TJMA 3G8DA 1C3LA 1PBNA 3MJVA 2O2XA 1S01A 2AJCA 1QP8A 3RVQA 4WY8A 2MINA 1JG7A 1T25A 4ARAA 3OY2A 1K6EA 2COKA 2G9VA 3ORFA 3U7IA 5KCZA 3N05A 5CDFA 2W4MA 1VIMA 3AL0C 5LMZA 1E8DA 1QFYA 1MW9X 2C2WA 3EZ6A 2PRZA 3OZIA 5DWQA 2OUIA 1YOVB 5FBRB 4BATA 4E0BA 5ITVA 2NSDA 3ZVKA 1NX9A 2J9GA 4CEJB 3A06A 3AJAA 2W2PA 4MVYA 3H4IA 1LBIA 2O0KA 4JVSB 3CF4G 3WC4A 2Q99A 4GOKA 4AJIA 3AM5A 4JHLA 3UAOA 2JW5A 4O1MA 3RI3A 5A5EA 1DRJA 1KH1A 5L6LB 5ALDA 1U0EA 1J5EB 2CE7A 2WWTA 5JNSA 2QMEA 5JZVA 4HGPA 1QLHA 4R2HA 2DPMA 3AW9A 1TZCA 1EGQA 5IAAA 1TA0A 1RJEA 2JIPA 4Z86A 3H8SA 3TECE 3KKOA 1AS0A 1PWHA 4IIBA 2A7QA 3LHSA 4R8LA 1FQKA 5GIOE 3UK2A 4XEHA 1H3NA 4KH1A 2XZDA 1L4NA 4W5RA 1UKEA 4RPLA 3F46A 5EERA 5FYDA 2EFCB 2CSXA 4COKA 4NYMR 3B1VA 4FQ5A 1U0OC 1A82A 3JRXA 4FR0A 1WB6A 3OE7A 4C0WA 3V1NA 3BCHA 1K66A 2JCXA 2B5WA 4AF6A 1YFJA 3SX4A 1L5LA 4EARA 5CX1B 1Z2CA 2VJAA 3NANA 3Q8WA 3LVBA 1ZY2A 1UKVY 1N9GB 4LF7B 1AKMA 3KE8A 4ZQGA 5F2OA 4C0QC 2HCRA 5K0NA 5LZ8A 2C9DA 3VZPA 1OCEA 5K3CA 3BK2A 2FPGA 1LY1A 1W36D 4ZVRA 3UVEA 2ZFUA 3BN3A 3AJRA 2IY8A 1PI3A 1ZQ9A 2O2YA 1EK2A 2OVBA 4HRYA 4G4SP 1OFGA 4NFLA 5L4LA 3AHHA 1N5JA 2CLCX 4Z0HO 4NNOA 1OLSB 1T9HA 1YCHA 4R6WA 2O8EB 3G2JA 1Z0FA 3U40A 2E1RA 1ZO8A 2HUNA 3C41J 4IDQA 5T57A 2EKZA 3ECCA 1ZI9A 3DAOA 1FXWF 3NETA 1GYRA 4PSVA 5GJWC 4LYDA 3A1SA 4YRBA 2XDWA 4HR7A 4ZT6A 1CQJB 1K97A 1S2LA 2ZBGA 4UULA 1AH2A 3NT4A 3Q9UA 3ZV4A 2O3RA 1YS6A 4EUKA 1X7WA 4U7GA 1DAFA 2XTNA 3FSRA 1BWPA 2BHTA 3MWDA 4R2XA 2YJGA 4O4HB 1GRVA 1ESDA 5THXA 2E5LB 3IB6A 2ENUA 1YR3A 2WMNB 4WNAA 1XEXA 2YOGA 1ZK3A 3P32A 1GPMA 2X2FA 4LGVA 4OLJA 2A94A 3SE0A 3ZXUB 3TEJA 3KJIA 5JSZB 3SWWA 3BGVA 2R1UA 1VMKA 3JXEA 4PQEA 3GLFA 3QUBA 5JZSA 2FSVC 1K9VF 2J33A 4I7EA 3WE7A 1EXNA 4FIZA 3D6JA 3IMGA 2I99A 4R3WA 5AR1A 4JIMA 5FNVB 2OZVA 3TUIC 3E35A 5KYGA 4IZIA 2CCKA 1GTZA 4PU0A 4JXXA 4HB0A 4UNQA 2VRWA 3FWHA 2GPWA 3VHLB 1QH1B 1UBHS 4Q19A 4KB5A 1O7JA 4U39A 4PO3X 3EPLA 2FFHA 4M38A 5DM70 1PR5A 3ESXA 2DULA 4RSMA 3ZBPA 1GZ5A 3BD8A 1G5FA 5B6JA 2C2ZA 1MAWA 4BUZA 1G3UA 1Q74A 2CJFA 3FSEA 2G6TA 4F91B 3NXKA 3DMTC 5F51A 3CNLA 4PTZA 4ZXPA 5KNDA 5EIWA 5AMXA 3OP1A 2F1JA 3EXG2 5KQSA 4D8XA 1D2AA 1EAYA 2RHBA 2YTZA 1RHJA 4WAUA 5CFZA 1YSCA 4KR6A 1H8HD 5CNMA 1RPJA 3OOJA 4KOAA 4EHIA 5HS4A 2BSQA 5EMLA 5TVGA 1XFAA 2YX1A 4XDHA 1RKUA 2C2KA 2XT0A 1GJRA 4B32A 2HU8A 1TQ6A 3E0XA 5JI2E 3CVOA 3JAWB 2JFQA 1E59A 1WLSA 1SUAA 2J7PD 4PLHA 3FF1A 1B41A 4A9AA 2QNBA 4MR8A 2KYRA 1AUXA 2A4KA 3BH6A 3SIPA 3L92A 4NXMB 1EUCB 3CTPA 2Y6UA 3OFND 5DHFA 3IE0A 9ABPA 3MPUA 2W7TA 4REQA 3EGDB 2K7FA 1FZTA 3IOMA 4C03A 4BQEA 1POWA 1SR8A 2C2BA 2R8BA 3ZCSA 2WD7A 1R0XA 1P0FA 3C6ZA 3KSUA 3P2JA 1A98A 4KXUA 3SVLA 2HT6A 2BEVA 1BU5A 1RVV1 4YAKA 4LF4B 3V2IA 4QQ8A 3EEIA 1HSOA 3G0BA 1G38A 3LUPA 1FB5A 4EY4A 2O5CA 2YWBA 3BSYA 5JOQA 2OWEA 2I4IA 4Y2YA 5LLDA 1WHSB 2PNFA 2NNLD 4YRKA 4F46A 2I6SA 4ZK6A 4IIJF 2BGUA 2EBWA 1KC1A 4BMDA 5KEIA 3L8MA 2AYYA 5KX5F 4RHYA 3MJDA 2I54A 4WXHA 3QTTA 4HEQA 3NTQA 4R3UC 1G8MA 3FBTA 3IKLA 3F78A 1R74A 5LZ7A 4Q4CA 1PWEA 2Z57A 3EZ2A 2JH3A 3KTAB 4BP1A 1CP3A 3KB2A 4GKJB 1ODLA 1SU4A 3GPCA 3NIGB 1LBHA 1RWBA 2Z08A 1LF0A 2HREA 1DG3A 2B1QA 2IUTA 2IXGA 3IO3A 3O7WA 1VE1A 3SKXA 4BGDA 3V42A 4NNJA 4DMRA 1FP1D 2ONYA 2RH4A 4OGGA 1K8YB 4EENA 1TQ8A 3EFOB 4KVGA 4ME6A 3RWOA 3TSWA 4KYVA 1JA0A 2C1ZA 1THTA 1L1QA 3MTEA 3MYYA 3RV4A 3TQFA 3WRWA 2I8CA 1MHTA 1HDCA 5K6TA 3I2FA 1HFEL 1YIDA 1DO2A 1GCOA 2GARA 3RUPA 3QE9Y 5ALOA 3HNPA 2B78A 2Q1WA 1EHIA 3DBLB 5KYVA 4ZCMA 2F1RA 1OKKD 1Y0BA 1LI7A 4CR6A 1Y3IA 1BDHA 2YJNA 3LUHA 1WMEA 5B7QA 4NCAA 3BMNA 3IT1A 4U5XA 4UHBA 4Y8VA 4RE6A 5JNVA 1QHGA 2CEKA 1KH3A 1XKQA 3ETCA 2P4UA 5E4JA 1AGYA 2DC1A 3QFHA 1E9AA 1AE1A 1WSAA 4Q1CA 5CCEA 5CDSA 1QU3A 1H3FA 1T4DA 2QUHA 3ETLA 2PGIA 3QXHA 4QL3A 3ULKA 3GD7A 5FBHA 1NA5A 2YYYA 5KNCA 5DHRA 3SBOA 2TS1A 1F2TA 5JH7B 2BD0A 1EX6A 3EDRA 1Y1LA 3C5EA 2CWWA 4LI0A 2DEUA 3AHGA 4XI9A 4ZZ2A 3RRFA 1KVSA 1MOQA 3VZRA 3GZJA 4YPOA 3JTMA 2P4SA 3STTA 4OTZA 1C9MA 4YJHB 3H2HA 3VJMA 4F5ZA 1I5EA 4QKQA 1K5GA 2HPZA 1VPDA 4PYOA 4HUTA 2Y0BA 2VAWA 5C8YA 1KPGA 4N5DA 1LFAA 1B2LA 1EWYA 3KAPA 4BX0A 1CVIA 3OQ1A 1IHXA 2PL1A 3BXEA 3L7NA 2P5SA 1LPNA 5JSYA 1PGQA 3GLFE 5IS2A 3TR0A 1WNTA 1GGHA 3DF9A 5AFSA 4HP8A 3IP5A 1E2UA 3UJ8A 3WV5A 3GPLA 5LQCA 2GAFA 3KUXA 3S27A 2GXUA 1G6KA 2AJDA 4CI0B 4FGKA 1SA0B 1EIWA 1ISRA 2CEAA 2V98A 3IR6A 4N9QA 4J16C 4PAGA 4HKTA 4LJSA 4RK6A 4IRUB 2YWHA 4L74A 1S9HA 3UNXA 4A3SA 4BX3A 4ZYTA 4MRMB 4DR5B 1PR1A 3WWZA 3FPKA 2ATVA 2Q6TA 3QX8A 3P94A 2UDPA 2XWBF 1XK6A 4HBGA 1NQOA 3X1JA 2R6GA 2R96A 3RCBA 2QMZA 3QX3A 3D2LA 2RGUA 3U17A 5IJZA 2DMRA 5MN5A 2WWFA 5U4XA 1M8PA 3OOWA 4W8OA 4FFRA 4UDYX 4JC5A 1R8QA 4NHOA 2A84A 4XGRA 3EVEA 3VKFA 1ILWA 5I6DA 3L04A 2E4WA 1P91A 2H29A 2Z1MA 3K96A 3L1UA 4LV8B 3BB1A 4OAPA 3OURA 3UUEA 4AP9A 3PC8A 5AW6A 5JR3A 5H5JA 2C07A 1U3UA 1QO0A 1E3LA 3C98A 5U1PA 4C0SA 1N33B 1IBLB 5D5PA 1WCV1 1IZZA 5E7IA 2XITA 1NURA 3WDLA 2VQFB 2Y77A 2EGUA 1WEHA 2PUFA 1FFDA 4IJVA 4M76B 4ZDIA 5AVQA 1I33A 1L9KA 1HFKA 3NP7A 4CFSA 4DCCA 4G9EA 5BQ5A 1A5SB 2BRUC 2JLUA 2EKLA 2J0EA 3GRPA 4AJ9A 5JXIA 2OSVA 4HNVA 3A1DA 1XQWA 3D1JA 4JV5B 4PC2A 3I58A 1T6NA 1Q17A 1Y3FE 2VSNA 4UAUA 2PKQO 3B2EA 3C3WA 4WI1A 4YAWA 3THYA 1E20A 1K8RA 2I62A 1D7AA 5JAOA 2ECOA 4QTTB 4XKJA 3ZQKA 5FWYA 3BFVA 3HVJA 1QNFA 2WJJA 5EIOA 3WADA 5COQA 3M34A 5LP6F 3AY0A 1HBJA 4MA4A 4MS1B 3DC7A 3OESA 4MPJA 3T4XA 1L4UA 4H60A 2BKXA 4DQ0A 4GF5A 4CV1A 1IOVA 4NLLA 4GFDA 3II6X 1OREA 1QIEA 1P9OA 5DWVA 3VH3A 4DPLA 2QP9X 3ZE7A 4KR2A 1FY2A 1G9XA 4IJ5A 4WNYA 3F6BX 4XJTA 2SKCA 4L2IB 1GTMA 4DOMA 2ODTX 2CLMB 1Y82A 2VYNA 2WOOA 3TH5A 1GTVA 4XLZA 2W6ID 3ABZA 1TDJA 2Q5OA 1TM4E 3KJNA 4A8TA 1IQUA 3U62A 4B6RA 1YACA 4D0GA 4UU7A 2QU7A 3BILA 5T5QA 4MQLA 3R7LA 3ND7A 5DM0A 2C31A 3DAGA 1VI5A 1HDEA 4DQKA 2PKYX 4AUKA 1ZLYA 2Y1FA 3FKQA 3EYAA 1H5NA 4MGKR 3WMXA 3WG9A 5K8CA 2MSWA 1Q95A 3H9QA 4D9KA 4KE7A 5B1IA 2ZE6A 4ZZ1A 4JJAA 1QF6A 1P2DA 1G4HA 5CFMA 4QYWA 5FPQA 1PFWA 1GP2A 1MNQA 3O90A 4RF4A 1LW7A 3NAZA 4U1RA 4LECA 2R11A 3DBOB 3HP1A 4RGQA 5JAQA 3HU1A 1GAEO 4HGZA 4ZWNA 3MZ0A 2LCFA 3FNEA 2WHEA 2XUFA 1QPBA 1DAHA 1X7HA 4C5BA 2WB2A 1I3MA 2JLSA 4JD5A 2BUAA 3GP3A 1EE2A 1FJ2A 1VRWA 4L0QA 4UNIA 1UXGA 1J4AA 4KQ2A 2IXFA 4UD6A 3F1LA 1DVRA 4MQFB 4HNGA 1W7AA 2FR1A 2X0NA 3MOGA 5DISB 4N4AA 1MAVA 1U3WA 4U8HA 3SXUB 3TLCA 4K6MA 1X9HA 1K7XB 4LN1A 4DR7B 4MW6A 4DEYA 3HJNA 1IHPA 4NESA 2PS0A 2VBIA 3FNGA 1M1YA 1QHXA 3QKWA 1EVLA 5FYQA 3VYSB 3HVRA 2BSXA 4XGNA 3SEFA 2QUIA 4IEEA 1OFUX 4LWOA 3FE2A 2DY0A 1I9CA 3E05A 4RDCA 2NOAA 2VOJA 3V00A 4G0NA 2Z4SA 1LQTA 3L6EA 1MOSA 3S8YA 1UDCA 3HJRA 4MJ7A 1ZJYA 4YACA 3H2GA 1XELA 4LMRA 5AKHA 3AKCA 1E2FA 3HUFA 3MJEA 3TTUA 3WYCA 4CLEA 2PKRA 4K9QA 2XZLA 4QRIA 3DOEA 4YMUA 1RAGA 2CZGA 1NQAO 4C6SA 1NDHA 5F1KA 1OB5A 3LUKA 1Y7HA 3ZDQA 1BXRB 1TJPB 3LUGA 4RVSA 2TMKA 2YW2A 1NJ5A 3IRVA 5LUBA 3I5UA 3JQPA 3KSRA 3J81A 3IUBA 3NHLA 5JQGB 1OXVA 4Y6OA 1TQ4A 3N8DA 3C24A 1ISGA 3K8OE 1KK1A 3SHFA 1TA4A 2PD4A 2NAFA 3T34A 1KKMA 4MW1A 4A92A 5IM4F 5EUQB 1DT3A 2C3OA 3C74A 1YHYA 5FIUA 3D64A 4LE0A 4X3PA 1I4WA 3ETEA 1L7PA 4GDMA 2HLDD 1W2GA 4XSVA 4BJ5A 2ZRGA 4DG9A 4F38A 2MINB 4YPVA 3PHIA 3CN9A 2RGRA 2NO4A 3MQ2A 2IU3A 1XZHA 4RVUA 5JROA 1AQJA 4I1OA 1BMTA 5IVPA 1QP7A 1O1YA 1ZN9A 1Z7WA 1TGYA 3AY3A 5E1OA 2JIOA 3H9CA 1C5KA 4KQJA 1MDBA 2OD2A 4MI1A 3H1FA 3ER6A 4BNHA 1JWLA 4KDRA 2DERA 4BB0A 1VKHA 3HBFA 3ABSB 4MR9A 4RNDB 3MMSA 4BEVA 1QVWA 4NC9A 5CG2A 5KNBA 1M2JA 3GZTB 3I9NA 2FLKA 5KTRA 2BGIA 2WNIA 2W98A 4NR0A 1N6IA 4EKIA 3CPJB 1GV1A 3HWWA 2PH3A 2ZJ1A 3AT1A 4FNAA 4K28A 3EK2A 3F5QA 4II2A 1MENA 3E3AA 3G7UA 4RPKA 2NTNA 6YASA 3EARA 2ZRCA 3R0XA 3BZBA 3ZTTA 1Z8NA 2KM1A 2G1AA 2ZSJA 3Q3JB 3REQA 5JZMA 1XZNA 3DM9B 1G6OA 1X74A 2O5VA 5BQXA 2H9YA 2V9ZA 3KKZA 5B6IA 3A0RB 4WK6A 3SMQA 5TEVA 3K0CA 4JJZA 4DNOA 5IZCA 4ER6A 1II9A 1TKCA 2AQ8A 1E0JA 4ZDKA 3OKPA 1THMA 4NBUA 4KBFA 1NVVQ 1C7EA 4JEIA 4R3NA 4ZALA 2YJ5A 3OFSA 4O4LA 1LPAB 2Z3ZA 3X1ZA 2IW3A 2G9UA 4EM6A 2Z6QA 1E3QA 4CU2A 5CT5A 3WHIA 2BFNA 4Y6QA 4FD2A 5CCXA 1WETA 2Q0QA 1M34A 4MDFA 2WG0A 2P7IA 1QFZA 3QNUA 4F9TA 3F7NA 2IC5A 4PLYA 4DLXA 4KPFC 3DV9A 2FPGB 2W58A 4OHRA 1OFUA 5KPJA 4WUTA 1L5NA 2ACEA 2ZJ5A 4R7GA 3GRYA 1KDVA 4FB5A 1R27A 3KD2A 1MX3A 2AS0A 3QX9A 4HTAA 1ZD8A 1H85A 2WJYA 3Q5EA 2FWNA 5TB5A 3JARA 5KINB 1YHZA 2P3SA 2XVYA 3HM2A 3OTWA 3V97A 7REQA 3IVMA 1KVUA 1O95A 3BRSA 3OJLA 3P2YA 2ZSKA 2F64A 4HADA 5SYMA 4YCLA 1A1SA 2X8BA 4XARA 3KYJB 3TSCA 5FUQA 3D43A 2XXAA 1KEPA 1USGA 2VLBA 5AW3A 3AQ4A 3MWDB 3RQSA 1NN3A 4ITRC 1W88A 1Q2UA 3CMCO 2BEUA 2ZEJA 2C5EA 1DXYA 1SVMA 3PDHA 1JAIA 1XEXB 2XVXA 1KO8A 4WNAB 1MHPA 5HILA 4CI9A 1ZH2A 2VJQA 4Q3CA 3VR6H 4C4OA 4PWYA 1OA1A 4C9BA 5BORA 4LJ8A 4CG3A 3I9V1 3MMZA 3HV2A 1NXVA 4MUBA 3E81A 2QG9A 3HG7A 4YJ3F 5AVZA 1IBMB 3D02A 3I3SR 3FWKA 1YS2X 2VQDA 3P9SA 4M0LA 5A1JA 2PG3A 2W42A 1KS9A 2QN3A 3PP8A 1YVPA 1ZS9A 3KYDA 4R16A 1OZGA 3A3NA 3IEMA 3LCVB 1FPQA 1I6MA 1USWA 4ZU3A 3Q4GA 2GCEA 3QLVA 1U0TA 5AK3A 4C4RA 1ECGA 1RKVA 3DR3A 3PFWO 2O7SA 4F7DA 1QIJA 5C5DA 4N39A 2I4NA 1JLHA 1GM5A 5ELLA 3JU3A 2DWUA 3S2SA 4GI3A 1PAUA 3PB3A 4Q3KA 4WFJA 2XH8A 1G0OA 2XE4A 2QT1A 2QL9A 1AOXA 3ZWXA 4EY6A 3MT0A 3PIDA 1GQYA 2Q8PA 2RHHA 3QKTA 5EE5B 5JQWA 4G2TA 3PUIA 5TPWA 5FFFA 2G04A 3R7WA 2NUAA 4J0KA 3HUEA 2ZQ5A 4JB2A 3LY8A 4L27A 5ICFA 3U3ZA 1PS0A 2MYTA 4DLLA 2AZXA 2YFQA 5P21A 1YCGA 1IRIA 2YVKA 3OCYA 4EG7A 1TW3A 3KS9A 4GLFA 1NV8A 1QHIA 3B5JA 1OD6A 4L8YA 4KI7A 1LFDB 2GEDA 5GGYA 1QHSA 1WMBA 2QRZA 3AB8A 2O7VA 3DP9A 3OJOA 1GLVA 3NWBA 2EERA 3NT5A 4LK3A 2WU3A 1ZJJA 2XSZA 5IHXA 1Y9DA 1I3NA 4R54A 4N47A 4REQB 2R4TA 3I6MA 1R0SA 4X45A 2WD7B 1CFZA 1MO6A 2R751 2X8JA 4GC9A 1TK2A 1Y8ZA 2BEVB 4MV5A 2ERCA 3RVPA 3ZNNA 5K8TA 2PGLA 2QIPA 2IV2X 2BKEA 1SCNE 1O89A 3O3CA 3BTSA 4FYKA 4J1SA 4QOHA 2ZRHA 2BFMA 5FA5A 1XZDA 1L8LA 2E6UX 4EKDA 3V1UA 2H08A 1XMQB 2DLCX 4Q9KA 2XYHA 1G98A 3NHAA 4WFKA 5D3QA 1J1UA 3A1UA 1ORHA 4POAA 3I76A 4G8BA 1GEGA 4OU4A 4Q1EA 2XCQA 3UUFA 1JAYA 2UXCB 2G5TA 3JQGA 1XI2A 2ZRJA 4L3WA 3G9XA 4EEXA 2CFSA 3D6MA 4G5XA 3HDYA 3B36A 3QUSA 3ADCA 1U7WA 2OECA 4LWPA 2IIBA 1YZLA 2BR4A 5FB3A 5FBKA 4URVR 1EM6A 1Q84A 1BJRE 2FE4A 4XWOA 3KNZA 4MMYB 4E5YA 4FI3C 4PIVA 1D1TA 1O97D 2QRKA 1XVTA 4LXGA 4PZDA 2JIQA 1JDBC 3DOOA 4A0RA 4DBLE 4K8RB 4DLPA 3TPZA 3JQFC 1SB9A 2LIPA 2JI6A 4L3OA 2NXEA 4LMPA 4TYPA 3V4ZA 4F4CA 1AG9A 4LA4A 2VT2A 1QLJA 2ST1A 3D31A 4MUAA 4W82A 3DDUA 1U5BA 4AN1A 2ZDGA 4O2AF 1HQKA 2LCIA 1RYMA 3LX5A 4ISBA 2QL7A 3AZPA 3IOCA 4KC0A 4Z8YA 4ZV7A 3B6JA 3WNZA 4RELA 3OQIA 1CZRA 4C0LA 3GJZA 4CTNA 1I80A 1M54A 1Z38A 3CLUD 3OFJA 2Q5JA 4Q3DA 3VU1A 1U9JA 2CZQA 1B14A 3Q98A 2H1VA 4XDZA 1A4XA 4EF5A 4ANFA 3NRCA 4GKBA 4URWR 3PC4A 4DANA 4EG8A 4DRZA 3BMNB 4NE7A 1JNYA 2X9NA 4FDVA 3IB3A 4KK4A 2H52A 4LHSA 3PNLA 4OEHA 5EKTA 3MGAA 1IJFA 1KO7A 3IOEA 1SU8A 3EUWA 3A1WA 1Z0IA 2X7XA 4II3A 1XVLA 4MEAA 2J3JA 4MITA 2H4YA 3VTKA 5A7GA 3EZLA 3JD2A 1MA3A 3T38A 5AOAA 2OV4A 1SH7A 1YVUA 1F2TB 3IR7A 3PWTA 4N40A 4Y98A 5DYGA 2QW8A 4P5PA 4E33A 1KMCA 1INLA 4IIHA 3AUKA 1OV6A 2WZQA 2VO1A 4W99A 1IXKA 1NC1A 6REQA 1UKZA 5BV1A 1YFKA 5HUHA 3GDFA 1I7NA 2IYWA 1T2AA 2QVLA 1HV8A 3WB0A 5C8YB 1COWD 1FX0A 1P33A 4XQ9A 4CNBA 3WRVA 2WMDA 3G5LA 5KJFA 2PT7A 1DRWA 1A2BA 4XJSA 4D9IA 1FTWA 2VPXA 3Q2OA 4EELA 3RAFC 1UODA 2YRFA 7AT1A 1Z26A 1ZH6A 1GITA 4UUPA 2DSNA 1W5SA 1ZGAA 2H0RA 4REMA 2I2FA 3NO4A 3UJAA 1P1JA 3WY9A