2CT8A

Crystal structure of aquifex aeolicus methionyl-trna synthetase complexed with trna(met) and methionyl-adenylate anologue
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
497
structure length
465
Chain Sequence
b'MTLMKKFYVTTPIYYVNDVPHLGHAYTTIAADTIARYYRLRDYDVFFLTGTDEHGLKIQKKAEELGISPKELVDRNAERFKKLWEFLKIEYTKFIRTTDPYHVKFVQKVFEECYKRGDIYLGEYEKEPSYFFRLSKYQDKLLELYEKNPEFIQPDYRRNEIISFVKQGLKDLSVTRPRSRVKWGIPVPFDPEHTIYVWFDALFNYISALEDKVEIYWPADLHLVGKDILRFHTVYWPAFLMSLGYELPKKVFAHGWWTVEGKKMSKTLGNVVDPYEVVQEYGLDEVRYFLLREVPFGQDGDFSKKAILNRINGELANEIGNLYSRVVNMAHKFLGGEVSGARDEEYAKIAQESIKNYENYMEKVNFYKAIEEILKFTSYLNKYVDEKQPWALNKERKKEELQKVLYALVDGLFVLTHLLYPITPNKMKEALQMLGEKEFLKELKPYSKNTYKLGERKILFPKREG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA (74-MER)
publication title Structural basis for anticodon recognition by methionyl-tRNA synthetase.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Ligase/rna
total genus 161
structure length 465
sequence length 497
chains with identical sequence B
ec nomenclature ec 6.1.1.10: Methionine--tRNA ligase.
pdb deposition date 2005-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08264 Anticodon_1 Anticodon-binding domain of tRNA
A PF09334 tRNA-synt_1g tRNA synthetases class I (M)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.730.10 Mainly Alpha Orthogonal Bundle Isoleucyl-tRNA Synthetase; Domain 1 Isoleucyl-tRNA Synthetase; Domain 1 2ct8A03
2.170.220.10 Mainly Beta Beta Complex Methionyl-trna Synthetase; domain 2 Methionyl-trna Synthetase; domain 2 2ct8A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2ct8A01
5DEOA 1QU3A 1XNJA 3SYTA 2BTEA 1NZJA 1M8KA 2Z09A 4MUFA 2JAXA 3ZJVA 2CV0A 3D6UA 1U3DA 3PNVA 5F23A 5KCMA 3INNA 1YUMA 3A05A 1F7UA 3L92A 4Q16A 1N2EA 1O94D 4G5FA 4HJRA 4PBRA 1TEZA 2IJGX 4K0RA 3RK0A 4EG4A 1O95D 3CVXA 2YXNA 4PBSA 2C5SA 2EL7A 4PBTA 3RFFA 5DK4A 3FHJA 4K03A 1M8FA 2CV2A 4EG3A 4ZCQA 2X3FA 4R0NA 4L2IB 1S4MA 3AG5A 3H9BA 3TQOA 3ND5A 3ZGZA 3N8HA 1EE1A 2ZP1A 1T9GR 2D5BA 3A4IA 5FO1A 5TEWA 1H1TA 4I6JA 4MVCA 4NZPA 1KQNA 1MRZA 2E0IA 1O96A 3UOWA 4PY2A 3H99A 3U1VA 1N1DA 1BS2A 4JFAA 3IOBA 2JANA 2O5RA 1KKUA 1N2BA 1OWPA 3G6KA 5J58A 3SEZA 1KP3A 2QJTA 1PFYA 1GAXA 5FNZA 1IQUA 4DE5A 1QRTA 3X1KA 4G5YA 1MJHA 1XNGA 2GOYA 1YI8A 1JILA 3CLTD 3ZXIA 1G59A 1MC1A 1M8PA 1MAWA 5JBNA 2A88A 1DNPA 4EG8A 2X1LA 1N77A 3L93A 2QUKA 4L2IA 3NBKA 2TS1A 3VGJA 3UC5A 3X1JA 4HJXA 4I6EA 1JGTA 1GPMA 3VRHA 3RBAA 1Y42X 1H3NA 4DJAA 3HGMA 4CDMA 2NZ2A 1IVSA 1U3CA 3FH0A 4ZCTA 2AKEA 2CUZA 3GLVA 3MXTA 1VL2A 3NV7A 2WQ7A 1JIIA 2DXIA 2NSYA 3Q10A 1D2RA 2AG6A 3QE4A 3PXUA 1Q77A 3HZRA 1ZJWA 3FY4A 3KT0A 4MUJA 1K97A 3P0IA 1JEDA 2J09A 3QTTA 4MWBA 2H29A 3CLSD 3Q12A 1MBZA 3M5WA 4XFDA 1WZ2A 2YWBA 4CT0A 1V8FA 2IP1A 2Z3VA 4WSOA 3SDBA 2DUMA 2YY5A 1LW7A 4YP5A 1T6XA 4R2MA 3I05A 2DERA 3Q4GA 1YUNA 1MB9A 2GM3A 1VBNA 1O96B 4AQ7A 3DLAA 2J07A 4MW5A 3H05A 4YMIA 1J70A 3CVYA 1OBCA 3TZLA 1I6LA 4MWCA 4JZYA 5KHAA 1G8GA 4KPUB 3JXEA 3SZ3A 3KT8A 4MW7A 4ARCA 1WKBA 3IMGA 4MUKA 2V0GA 1O97D 3FI0A 3AKZA 3A04A 5DASA 1COZA 1GTRA 3RHSA 1YULA 1QRUA 4MW0A 2RE8A 1OWMA 3COWA 1H3FA 3IUEA 4A91A 2A1TS 1NUTA 4Q93A 5H7XA 1GTSA 1MAUA 4ZT6A 4NATA 4QBTA 4ZCSA 1A8HA 5AHWA 3DO8A 1IHOA 3KT6A 2G36A 4UZFA 1EUYA 2PZAA 4MW2A 4EG1A 3MLBA 2CV1A 2DEUA 3CLUC 3COYA 4ZT7A 3ZXSA 1FYDA 1Q19A 1K92A 1Q15A 1KAMA 3MLAA 1OWOA 1RQGA 1JECA 3VU8A 4KR9A 4AS1A 3N2YA 1NP7A 1H3EA 1N78A 1N2IA 4MW9A 4J76A 3ZJTA 2WB2A 4YP7A 1T6ZA 4ZT2A 3IDFA 3MUEA 2WQ6A 1EFVB 1WJGA 3IVCA 4KPUA 3UY4A 3AL0C 1NUPA 1EXDA 5TGTA 5FO0A 3HFJA 2QUJA 1KH3A 3P0JA 2HGZA 2J08A 4HK4A 1TYAE 1YIAA 4S1OA 2BYTA 3N05A 3IVGA 4WNYA 4DDKA 1X6VA 4TS1A 2A7XA 2CFOA 4DLPA 4JXZA 4ZT3A 1WQ3A 4MVXA 5LLTA 4NX2A 3OTWA 4ND6A 3BL5A 2X0KA 1JMVA 4EG7A 3KT3A 5KWVA 2CT8A 2I1LA 2CYAA 3IH5A 4RUKA 1PG2A 2QTRA 4MUEA 1O0BA 2PG3A 1UFVA 3CLRC 1VLHA 3G59A 3TNJA 1MOPA 1J09A 1IFXA 3CR8A 3GMIA 3LE8A 3G5AA 3LOQA 1ILEA 1R6UA 1QRSA 4EGAA 4ZCPA 3GUZA 3TS1A 1NUUA 2E18A 3E27A 1U0BB 1TFUA 3IOEA 2J5BA 4GRIA 1HYBA 5TS2A 2AZXA 4H3SA 1N2GA 1VBMA 2OV4A 2B7LA 2HZ7A 4MUHA 4U7JA 5HUHA 1B6TA 4DDMA 4I6GA 4X0EA 1EFVA 4F3RA 1XJQA 3F3MA 4E1AA 3HL4A 1U7DA 1R6XA 1YIDA 5HUJA 3ZJUA 2PXHA 1N75A 4BWVA 4MWEA 3IUBA 4EF6A 1I2DA 1WXHA 4MW1A 4FZJA 1GZUA 4NAHA 3COZA 4R2LA 4KKVA 3IMEA 1TYBE 4F4HA 1IRXA 4QREA 2PZBA 1QJCA 3DV2A 2DLCX 3FG9A 1JZSA 1WXIA 1JEEA 4KR7A 1TYDE 2QTMA 4KR6A 4OUDA 1Q11A 1PFUA 3D6VA 3KFLA 2EJCA 4ARIA 2R5WA 1O94C 4MAFA 1KH1A 3FOCA 1SURA 3HV0A 1U7XA 3HMQA 3TQIA 1O95C 1I6MA 5DB4A 3ELBA 1FFYA 1NI5A 3QTBA 3RK1A 2A1TR 1KAQA 4DDHA 1JIKA 3CVUA 1I6KA 3AFHA 3FETA 1TYCA 4ZCRA 4EG6A 1PG0A 1MB2A 2A4MA 1ZH6A 3TZEA 5K0SA 1JIJA 2D13A 2V0CA 1EFPB 1KQOA 1NSYA 1F9AA 3IODA 2HMAA 1OWLA 3S3TA 1K4MA 2JA2A 2YWCA 3H9CA 2PIDA 2WSIA 3RJZA 1LI7A 1KH2A 1WOYA 1R6TA 4HPWA 1J1ZA 2PFSA 3SZGA 1N3LA 4P2BA 4NAUA 4CDNA 4G6ZA 4ZT5A 1JHDA 1KORA 1N2OA 5TEVA 1J21A 4JYZA 1KQPA 4MULA 2PZ8A 2VXOA 3C8ZA 2E89A 3ISJA 1WY5A 2DPLA 1QNFA 1X8XA 3NBAA 1OWNA 3ILVA 1KR2A 3P0HA 4MUNA 4OJMX 2A1UB 1NUSA 2A86A 1QQTA 2J4DA 1NYLA 3CLTC 5HG0A 3IVXA 3PNYA 1ZUNA 1J1UA 3PNBA 3FIUA 2RD2A 4MUIA 2CYCA 4GU5A 1P7PA 1VBKA 1GLNA 1IQ0A 1LI5A 1M1ZA 1M8JA 1N2JA 3CLUD 2VTBB 3FNRA 1OBHA 3AIIA 4MW6A 3UK2A 5LM3A 1T9GS 1NUQA 1V47A 2DR2A 1XNHA 1WXFA 3PRHA 1EFPA 2A84A 4OUDB 1M8GA 3DPIA 3K9WA 1ULHA 4MW4A 2X1MA 5BNZA 4NDAA 1TQ8A 1KP2A 3FWKA 1EUQA 4EG5A 4JXXA 4CQNA 2OQ2A 4XSVA 5IJXA 2XRYA 5H16A 3CVWA 2CSXA 3CLSC 1OD6A 2D54A 4MLPA 3SEQA 1G8HA 1T6YA 2ZUFA 3H97A 4U63A 1N2HA 4YBRA 3N9IA 1O5TA 4XFJA 1QTQA 2IELA 5J5AA 2A1UA 1PFWA 2QJFA 4MVYA 4J75A 2ZUEA 1IH8A 4MUGA 3A2KA 4MQ6A 3CLRD 1QU2A 3UMVA 1PFVA 1WQ4A 1F4LA 4UZEA 2VTBA 2Z08A 4RPIA 5LFAA 3ZIUA 3IOCA 2H2AA 1O0CA 1F7VA 1WXGA 1JZQA 4MVWA 1J20A 1IQRA 3FDXA 3P52A 2XRZA 2QUHA 1ZH0A 3AG6A 3CA8A 1GN8A 5K0TA 5EKDA 1CT9A 1M83A 3SP1A 1O97C 3LCJA 3K32A 3CVVA 2DETA 3MMXA 2GKSA 3ND7A 1O6BA 4ND7A 3COVA 2QUIA 4EFKA 3X1MA 4YP6A 2E21A 3IMCA 1K4KA 1NURA 3ZUGA 5IHXA 4DNXA 3OP1A 3ND6A 1EJ2A 4MWDA 5J59A 1G8FA 4ZT4A 2CYBA 2QTNA 2QJOA 4U8HA 4QRDA 1WXEA 2O8VA
chains in the Genus database with same CATH superfamily
2OEPA 2QY9A 1MB0A 1A5ZA 2BTEA 1N9GB 2C1EA 3HEMA 4G9BA 4BE9A 4RQTA 1DZ3A 1Y8QB 4IF4A 2JIBA 4MUFA 1E1QA 3VC3A 1T26A 2O2JA 5DNWA 3ZJVA 4EFLA 3W1EA 4AC9A 4N7BA 1ICEA 5JWOA 1TUBA 3D6UA 2XUJA 4E51A 1BN6A 2CEAA 3ASZA 4AD8A 1ISJA 1TZCA 3O7MA 2R7AA 1ORHA 3H2GA 3STWA 4HJRA 3H5NA 4PIMA 4XVHA 1HNZB 2UYGA 1S2OA 1Z7EA 4EG4A 2N0SA 2X7HA 4L9AA 4MOWA 4C4SA 4B1FA 1QVWA 2HBQA 4EL0A 2XZOA 2Q4RA 2WYIA 1WTAA 1T8YA 5KX5A 3BMCB 2VHCA 3MJDA 5CYPA 2C97A 5EFZA 2CV2A 5JS1A 1K7XB 2CMGA 2X3FA 4R8MA 3T3GA 1NIPA 3FPEA 4C3UA 4O1IA 4H18A 1NF3A 2FE4A 3LCRA 4UW9A 2PGAA 5CHEA 1WBDA 2WJHA 3AB3A 3NAMA 1QOZA 3IJRA 2WF6A 4EJ0A 2EQ5A 4IIJF 4IOLA 4TS3A 1Y5LA 3HUTA 1AUPA 1P44A 4A3SA 1PQYA 1JLRA 2CLKB 3LC2O 4CMEA 3TAUA 1KDPA 3DDNA 3NHRA 5E4TA 1WNFA 1BCRB 2W2QA 1X80A 2XDWA 1O0SA 3RIHA 4E09A 3USCS 3I9KA 4A0GA 3OZRA 1Q2XA 2NZYA 5HFAA 4J9UE 3BOSA 2G8NA 2M1ZA 4PC7A 5CEEA 4KL8S 2WABA 3IB6A 4ZVSA 3NBFA 5EXSA 3SKYA 4CJXA 1FXWF 3QELB 2DWPA 4P3KA 5H4HA 3O2NA 3BAFA 1P19A 1RWVA 2B99A 3Q9NA 3QOXA 4L76A 3PX7A 5DNVA 1K2VN 4ISBA 1OB2A 1MD9A 1KYQA 4JJFA 1E2KA 2P41A 2DHDA 3BWYA 2IEIA 2ZXUA 1M1YA 2WQZA 2R0QC 3KC2A 3U39A 1P4JA 2XQVA 3EXFA 3A1FA 3ZZUA 5BN3A 3FWYA 3NIBA 1S0UA 2GEDA 2JEYA 2W6ZA 3FVQA 4FDMA 4C6TB 2FPSA 2UUAB 4XM1A 1SA0B 3R40A 4F3YA 1QRTA 3SNKA 3OQOA 1ONOA 4A1OA 3RD5A 4G5YA 1MJHA 3QVWA 5BNTA 5JRDS 1N0HA 1XNGA 4QZVA 3LPLA 2J4FA 3G2KA 2O7NA 1A7KA 1NVUQ 4IJ5A 5LZ9A 3ZXIA 5AI6A 2AN9A 1M8PA 3LU1A 3WJ2A 4GR4A 4X1KA 2QI9F 3PFKA 1CNFA 1I6WA 4FHEA 4LOKA 1LA2A 3JVEA 3PKJA 4NBVA 4TWJA 3KWJA 2BZ0A 2XEDA 4V3CA 3EFBA 5ALKA 2OV2A 5FNVF 3RGWS 1EP2B 4DR6B 3X1JA 3F49S 4I6EA 1J1IA 3Q7IA 4FNAA 4U9UA 5J63A 3AFGA 1IM2A 3UJ9A 2CJYA 2B5OA 1CU1A 2CLMB 4ENUA 1XZMA 1IEWA 4YONB 1RBQA 3WAJA 1QFSA 1T4MA 1VE6A 3FGNA 4H7DA 3MJSA 1AK9A 5DGHA 4BEBA 4RD2A 2QW8A 2FMHA 4E2XA 2I9KA 3BPSA 2FX3A 3WRYA 3GZJA 2AN3A 4EHDA 3BJMA 4KLZA 3QEMA 3OD5A 4LJ8A 1HX7A 4Q05A 1GNQA 5DLQC 4LYYA 5M29A 4C01A 2G0AA 5TT0A 4CCSA 3OTGA 4D9EA 4NKRA 1LX7A 4BQFA 2PUAA 4PYKA 2C8KA 3P0IA 1K8RA 3UAWA 3W79A 1LWOA 4JODA 3J81k 4ZMSA 4TUYF 4HB2A 3ZD6A 4O4LB 1PZEA 1Q7EA 2MINA 2NXWA 4PC1A 4YMVA 5AHXA 3P71T 2AR9A 2N3ZA 4LZPA 1V8FA 4YA6A 4D81A 2B2NA 3V4RA 3TAXA 1ZHFA 1KK1A 1Q7GA 2B4RO 4R1TA 3GW8A 3NT4A 1F6DA 3Q0TA 4FOTA 4AY3A 1E3JA 3NGXA 2POQX 5JMOA 3PFNA 4QUDA 1U0EA 5AMXA 1T8TA 3WKAA 4BC0A 1IZ9A 2OP0A 4FGUA 5BT9A 1XTKA 3CVYA 2CLLB 3AIMA 3IERA 3PA8A 2W2LA 4W6QA 4FONA 5CDUA 4KAXA 5KHAA 5HF5A 2QSYA 5HK8A 1JIVA 4FMCB 1EAYA 4OQEA 4HRXA 2PFGA 1CQIB 4GC9A 3WKBA 4F2GA 3ZVKA 1NG9A 4N40A 2P4EA 1OLSB 3OHMA 1L5HB 5GIOE 3RSGA 2DLDA 3VZBA 2RGAA 4JEHA 4LYGA 4WX2B 1QVAA 3X1DA 3R5SA 1OXMA 4EJSC 1XRPA 1L8LA 2EWWA 4BPRA 3QXXA 4H17A 1U8YA 1CUJA 1KE1A 5B6PA 3KZ1E 3QVTA 4EUFA 3VA7A 1YMVA 2G5TA 5KNLA 1H3FA 1SKBA 2C92A 2V0NA 4P53A 1GSIA 3H4MA 4B3DA 5D3ZA 4QXMA 4BFZA 4PHGA 4QBTA 3RF6A 2YN4A 1G42A 3AERA 3D0RA 2CXHA 4TTJA 4OD0A 3LUFA 3QYAA 2GVDC 4X5OA 4D9CA 3VNUA 1Z2EA 4DOMA 1ONPA 1KMQA 3MLBA 3ONEA 3BRQA 2PA3A 3SU8A 4PO8A 5BO5A 3ZXSA 3T9AA 4YFVA 2EW8A 1M67A 4GKJB 2QMZA 1A5TA 2OVBA 5IUJC 1DIBA 4QLAA 2WSSD 1DAKA 3C0KA 3U19A 3IBYA 3EBLA 5TRTA 3LQFA 1Y80A 4KRYA 4OK3A 1B2LA 3P0EA 1UWCA 5D3QA 1FLDA 1V48A 2O4UX 4R2XA 1JIQA 3LDUA 3PC2A 1EZ4A 1GNLA 1CY7A 2W2MA 1P62B 3IDFA 4FPXA 2FFHA 3ZBPA 3D8BA 2OVFA 2W2KB 3GVXA 3MA0A 3IJPA 3Q2KA 3KU4A 4LJSA 1C9KA 2HWYA 3TZHA 2D2VA 5FO0A 2WJYA 3LCVB 2AYZA 2PS3A 3NOQA 4MIOA 4MS3B 5ALMA 3UOGA 1YI1A 3IOYA 1II8A 1NT2A 5CJPA 3OQ6A 5EG5A 3RUFA 4G1MB 4EJ6A 1Z18A 3N2ZB 2RHWA 2DY1A 1YIAA 1O5IA 3HU3A 1G2PA 3N0VA 1GVNB 1O54A 5HKBA 1QKJA 2Q5JA 4EYQA 5LJLA 1MXFA 3G17A 2AJBA 4NENA 1YVRA 4RHUA 4DLPA 1KGDA 2JBWA 2JFQA 4JP2A 1YVPA 1Q0PA 5K6TA 1X8KA 1ADGA 3T7AA 4H7PA 4RH0A 4RK4A 1K7CA 2VJMA 4ZZ3A 5T41A 1ESMA 3VOTA 4ARBA 3BWMA 4C7BA 1P7CA 4DCOA 1JPVA 4GRAA 3A27A 2D2EA 2WTBA 3NASA 4X1IA 1DRVA 1TT5A 2J3HA 1PVDA 3LE8A 4TTSA 4YAEA 4TM8A 3I9JA 3MD9A 4NBUA 1WB4A 1E69A 3QFRA 4C9BA 4EGAA 5LIRA 2VYFA 1IY1A 1IEQA 2HXGA 4NCJA 2JLUA 4NPHA 3NTRA 3HFSA 4HWOA 5E9WA 2GILA 4O2BF 3A7DA 3C48A 2VP6A 4L0MA 2JFOA 2H17A 1ESCA 3SZRA 3WFZA 4H3SA 1I36A 1QBGA 4I1UA 2AEEA 3JYHA 4JH0A 1IXYA 2P27A 3LD9A 3MTBA 4JQYA 1ZD8A 1JV2B 3OTQA 3FDFA 3IHLA 1KSHA 1E9RA 4S1NA 1UBHS 4Q1EA 1FFBA 3SKVA 5SV2A 3N7TA 5ESXA 3BDAA 1CUWA 2O54A 2GSDA 4I1YA 5AVXA 3MSCA 1DZIA 4QYWA 1KR5A 1MHPA 1Z0IA 4H6WA 4K2AA 4LVNA 5DJ5A 1PWYE 4H3HB 3U9TA 4GXTA 5H1YA 5JCOC 5LQNA 3DBHA 1GZUA 4DC0A 3OBBA 4KQIA 1U0TA 4J0GA 5JNVA 3C5HA 3IMEA 3SQWA 4DIDA 1S2IA 3C8HA 1SG0A 3GQBA 1MX1A 3KJNA 4WH0A 2AW3A 1W0JD 3C4VA 3C6ZA 4M7OA 4NONA 4F6CA 1L5ZA 4RESA 2HWUA 1TUGA 2CDNA 4KXUA 5KPDA 3K9FC 1ZMRA 4JGBA 3ZV5A 3B6KA 4KVZA 1HG0A 4JDUA 4PQYA 4ZHQA 3I1JA 4TT3D 4X62B 5MGNA 4B0OA 1Z3CA 3A3KA 2BONA 3KWFA 4FFOA 1RMTA 4RH3A 2Y1EA 3COJA 3JQ9C 4KDRA 3T4EA 3D2CA 3KRTA 5E1OA 4ARIA 1XX6A 3V2UA 2A92A 1FRFS 2QG4A 2OM6A 2WHQA 1X7WA 2X5OA 3IT1A 3S1LA 1R5BA 5IM4A 1A97A 4LF8B 2AQ8A 2MOKA 3VHXA 2XMGA 3AF4A 2BFAA 1FUUA 1WLYA 5G02A 4IQ8A 1PGNA 4PAGA 1D8TA 5LUBA 1GN9A 4D92A 1UUFA 4UTRA 5KQPA 3HKCA 2C3OA 4FUTA 1QR2A 1VL1A 4U0JA 1QDEA 4QLBA 3UXHA 3OFJA 3DL0A 2A2ZA 4KVGA 1CZKA 4CU5A 2PANA 5F7XA 1RZRA 3GT0A 3GFQA 2EKDA 2CKMA 1ZNQO 3AVQA 2RH9B 3EMDA 4ZRNA 4C4ZA 4D0LB 3ES9A 4ZCRA 4X65B 1OZ0A 1ZM7A 5TX7A 1H2WA 1JMKC 4O3FA 3BWDD 4PZ9A 3TZEA 1RPNA 2ZI3A 3OETA 2VHJA 1A9XB 4MQEB 4EZBA 4ZC1A 1OYWA 2G04A 1Z17A 1XZIA 2QZZA 4IS3A 4CHTA 2F1OA 2XECA 1K4MA 5HCUA 3H9CA 1Y1PA 4TKLA 1WDLA 1FDIA 1TK3A 2ECOA 5C7IO 3HYRA 1Y5IA 4R7TA 1RAFA 1OW3B 4NWIA 3IO5A 4KNWA 2ORWA 4YRDA 3TI7A 1QZ3A 1MJNA 1V4VA 1KI4A 2VDWB 2YFYA 3L8ZA 4UBNA 4JI5B 2Y1FA 5A04A 4FZRA 4B79A 3PQ3A 3KUDA 1JHDA 3D6JA 3D8NA 1A9QA 3EH2A 3W6PA 4CGYA 1KQPA 5BSKA 1EX1A 4URXR 3KOOA 4GOMD 4YRFA 2LP4Y 4N41A 2PZEA 2XNHA 4G26A 5KYKA 2ZBPA 3DONA 4L50A 3RSZA 4AJKA 4B6SA 4ZCLA 1D0VA 1E79A 1I80A 3Q7RA 4M3NA 5F52A 3F9CA 5H9WA 2DPLA 4D99A 5CM2Z 4AJIA 3HXQA 1CUIA 4LTMA 1H0KA 5CT4A 1BVUA 3OTHA 3KWLA 3DTNA 1P2BA 2QN1A 5BWMA 3RAEC 4J3FA 1IJFA 3U5ZB 4K8RB 3PD7A 4AO8A 2PR7A 3ZNOA 5A5FA 2Y9PB 2QVLA 1R9NA 3DFMA 1EXWA 3PDCA 4MVJM 2Z5VA 2ZIWB 1ZW6A 1LI5A 2PX8A 4JUAA 1NN0A 2PRIA 3KXDA 1QF7A 3FSGA 3R0VA 5KTKA 2RHTA 2VTBB 1A50B 1KETA 2YOFA 3WWYA 3V4ZA 2FX2A 1UT8A 3DHYA 2FFJA 4B7XA 3ZVNA 4MROA 1EBUA 2HFKA 1WD5A 4DNPA 3F8TA 2IY7A 1H6BA 2NZUG 4TRJA 4KPEC 3B38A 4QYIA 4LNHA 3AUFA 4Q9NA 4UXIA 5AM1A 3L6DA 3IRVA 3RV4A 1IXKA 3KX2A 4NARA 3ER8A 1PR0A 1L5SA 2YBDA 4QUGA 4PQEA 2DPGA 2DUWA 1RDFA 2O50A 4PAOA 4MUYA 2PL3A 2AMVA 3HEAA 1EFKA 3T6KA 4RKWA 2OBMA 3HU1A 2R4QA 2MSCB 4KYTA 3RUAA 5FJJA 1PSWA 4QUAA 2DYKA 1V2HE 5FOQA 4CDRA 3OJEA 4ZDJA 1IHXA 1SUSA 1U63A 3D4IA 2RGYA 4JASB 4OHFA 5D87A 5I7UA 3EODA 3OZVA 2CXTA 2P3SA 4NZYA 2ZJ2A 2BEKA 3Q8MA 2XJ9A 3CF6R 2CVHA 5YASA 1X1QA 1E2QA 1ZN8A 4IQ0A 3G5LA 2JKZA 4IOKA 1ULBA 4G23A 4IIDA 4OKNA 1U7HA 5KTMA 1FJHA 5ALIA 5K3BA 2Z9BA 3K1ZA 2Q6LA 3VR3A 1YZTA 3U5TA 1UK7A 2SCUB 4LJ9A 3V8BA 2XKBA 2OXRA 2HLPA 2B4TO 1G6Q1 1P0FA 4TZKA 2RGRA 1LBIA 1QHIA 3WLEA 4QKQA 1XTRA 4ODIA 4TZ6A 1WL8A 2QZSA 1OKKA 3WSWA 5ECYA 4P2GA 3O31A 1C1XA 1U1IA 3R9XA 1WQ1R 4YP1A 3AHDA 3L7AA 2JFHA 2C29D 2G70A 2QRNA 3IDZA 3LXRA 1PN3A 3CA8A 4V0KA 4C2BA 2FF5A 4TMTA 3WL8A 3L0DA 4R40A 5HCIA 4CZ2A 2HEGA 2I8AA 5ILGA 5A0VA 1O3YA 4AN4A 1G5QA 3RVDA 5LU8A 2H1LA 2QMEA 2H3HA 3EXAA 3F4LA 3V7FA 4AZWA 4K26A 2CFRA 1ONSA 2IIVA 3IUJA 4NU5A 2K87A 4EELA 3AESA 4X6LA 3ROPA 1OVGA 4NTZA 1XA3A 3T9EA 1ODIA 2AMFA 1UZUA 3IR7A 3WDKA 4HRYA 4AIRA 1RWNA 5I7SA 1QTNA 2HLDD 1K4KA 2CK3D 3G1WA 3QBDA 1JG4A 3HJTA 4KV7A 1IOLA 2QW0X 4LKOA 1DBWA 4TL9A 1HTBA 5JSZA 2PMWB 4FSHA 2V7EA 3AUXA 3AW9A 1PT6A 2P0EA 5ALRA 1J90A 3SF8A 5KJ6A 2OE2A 1Q3HA 3IHWA 3NVAA 3UYLA 4YYEA 5M7EA 2FMXA 2ID7A 4YAKA 1U1DA 4X61A 3E81A 3VYWA 1PJQA 3OM9A 1OH5A 2FMTA 1D6NA 3HJCA 3SYTA 1YZ3A 2WYWA 3GEIA 3Q88A 1JR2A 4QWWA 3CRQA 2Z09A 4EJFA 4B33A 3B1FA 2XZTA 3UPTA 4WOBA 4HSGA 2VVTA 1Y6QA 4BXOB 3CZRA 2A5GA 5J9FA 4I3HA 3F90A 3HCNA 4HMQA 1N4DA 3K9LA 1RHJA 1TIBA 3EOBI 1R4NB 2HTFA 2QL5A 3ITEA 4IUYA 4OL0A 3UW1A 5F23A 1H2RS 2Z2XA 5EJ5A 4P7KA 1X0VA 3T06B 3R75A 5LKAA 2C4VA 4LYHA 3A1SA 3DV0B 1S9DA 4MZXA 3ZH2A 5DSTA 4MQUA 1PWEA 5KJEA 2ZUVA 3HWX1 4GH5A 1G63A 3P9KA 3S2IA 3D3JA 2BMWA 4PLYA 1FZQA 2GXQA 2F90A 3VPGA 4C6RA 5F1PA 2WINI 2ZDQA 4A6PA 2ZIUB 1BHO1 2WG0A 3HZZA 4PPFA 2FZEA 1KK2A 4L5IA 4C0QC 4CMBA 2V3VA 4YJHA 1N3IA 1AKYA 2WOJA 4XSGA 1I0IA 1MT0A 2JLQA 3C3DA 4Y9SA 3K0BA 4ZOLA 2YUTA 3LNCA 5CYGA 5ADVA 3U16A 2OXEA 4UFNA 1Z0ZA 3E1KA 2DFLA 4HUQB 2C5GA 2ZSIA 4L8WB 4M83A 3SQOA 5COBA 1LF0A 2P35A 2ZYAA 1MA0A 3D7MA 3V42A 5L6LB 5EIHA 4LPKA 3BGOS 4JV5B 2AS0A 1MRZA 2IYLD 1VLLA 3A1TA 3LYHA 4IIFA 1JDZA 3IQIX 2BR5A 3MMZA 4R31A 1NVXQ 1D8AA 2I4RA 1BOOA 2RDMA 3FNIA 1FMTA 1AZSC 3AVXA 1LX6A 1N9GA 3IOBA 1OGYA 2LE0A 3NNNA 1YMUA 1Y8QA 3RVSA 5JMTA 3EYWA 3KLNA 5KC9A 4QUHA 1FP1D 1I4OA 4LW8A 1OWPA 1CERA 4QQ8A 5EQJB 1C8BA 1VZ3A 1XZPA 3ESZA 5C9ZA 1A2BA 2GM4A 1PD0A 3GIWA 1X7HA 4BBAA 2PD6A 1NW5A 3OWXA 1DQZA 1UM8A 1E9EA 2YW2A 4CLOB 2FWPA 1BS1A 3ZWMA 4BQSA 4E1BA 4R2IA 4N48A 4J16A 4H1VA 1L5VA 1OIXA 2ZXEA 4UJ3A 1SRRA 1RXWA 2GBPA 4EYGA 2GOYA 3ZQ6A 4C7KA 4AW9A 4YR9A 4IWNA 1BFUA 1GV1A 1XGKA 3BMCA 4JJAA 1HO3A 1FX0B 1PJ4A 1H4SA 4N0MA 2XWBF 4RYDA 1U0SY 4D97A 2EWVA 2Z9CA 3CJQA 4D5EA 1MV8A 4AS3A 4RPJA 3V6MA 3MJ4A 4CIXA 1D1TA 1TO2E 5AVVA 3VNAA 1YR8A 5TPZD 4IJKA 5KVVA 3Q3GE 3MBKA 4B84A 1ZUWA 3EQ2A 1X7XB 1H3NA 4D80A 4QUEA 5GTDA 4CMEC 1C50A 4DT1B 2UUCB 3I01A 4GYJA 1FUYB 3R9WA 4JAVC 3WWZA 4KPGA 1X38A 2AVNA 2HT6A 4DVJA 3EUFA 2VTEA 3QELA 1BKDR 4WKGA 4UULA 3V1YA 2VNAA 1IOVA 1E6MA 1E89A 3CKYA 5B5SA 3B9PA 1UZAA 3EASA 3IBFA 2EJUA 3B70A 4BKOA 3G8BA 1IB6A 5FWDA 3WQHA 1Z39A 4WJLA 2B6HA 4CETA 2YQZA 2A59A 3DXFA 4C2TA 2J31A 1VSBA 5C37A 3CEMA 2ZG6A 3ENWA 2F6RA 3PE6A 4TXHA 3WRVA 2GZ3A 5AKZA 4GSKA 1PGOA 2Q45A 3DAHA 4W99A 4C6TA 2NV6A 2Z3VA 4OLAA 4JBLA 2YL2A 1SA0A 1JI3A 1HG1A 2EX0A 4FE4A 4YEDA 1ZGHA 2Q6IA 3L07A 1P7WA 4V0RA 3TPFA 1ZD1A 2JCVA 2ZRCA 2HC9A 2X4GA 1OZAA 1V9LA 4R2MA 4OMUA 4P3OA 2ODNA 8AT1A 4BO9A 1KTIA 2HADA 3FPKA 2PLWA 3UG7A 7ABPA 4BVFA 2V65A 3DWGA 3H2HA 1D6MA 3ZY4A 3ANYB 3RIGA 4MW5A 3QFHA 1EK0A 2VH2A 4BGUA 3FSEA 1A8PA 4V0ME 3UJCA 4ARVA 4OGKA 2V7WA 4JZYA 4K86A 2F1RA 3ED5A 2X40A 5AK3A 1IE3A 3EIUA 5NULA 4B8WA 1G19A 1JE1A 3AOGA 3MUOA 3GWZA 3W5JA 5JZVA 3TL6A 2CUNA 2QX4A 4UHKA 1J49A 2BGTA 2KQUA 2WAOA 1FP6A 5A4DA 1IBSA 3B60A 3JZMA 4HNAB 4KQMA 2GEVA 1QOQB 2IW3A 1QVZA 4GMHA 3GVIA 5JZSA 4Q6WA 7GPBA 3RHSA 3SC6A 4K6FA 5G3YA 5A1TA 1SOUA 3M49A 4IUDS 2HIMA 1FB5A 1GFSA 2X0RA 1DJPA 1OWMA 4PLGA 2O8EB 1L1QA 1LBTA 3H3JA 2FRDC 2A1TS 3HB1A 1NUTA 3JTEA 4GG1A 4WK2B 4ZI7B 1KI2A 4PGGA 1PLLA 2EKBA 4CM7A 2WTNA 4L9SA 3SSOA 4YYZA 2IVZA 5CB0A 3KT6A 4O4LA 4F04A 2FFAA 2HQRA 4EY8A 1PR4A 1A2OA 1X1SA 4A0QA 5B1HA 1NVDA 2XYRA 3JPYA 4FYVA 2IZ1A 4WA8A 2XNJA 2IL1A 1CY2A 1Z13A 3CX4A 3O92A 2GAIA 4QQFA 2DQSA 2XKKA 3CRVA 3GDGA 4KHPB 4CM8B 4JQOA 4A23A 1ST3A 2GTIA 3N2YA 4J90A 4ZOAA 1N78A 1XXHB 4YRKA 1L9XA 3O9ZA 4HVCA 1AH2A 5E2BA 3PF9A 5GM2A 3CEJA 4BWYA 1KZ4A 1YQDA 3NRBA 3BZBA 1AB6A 1C9JA 1XTSA 1UBLS 3KTOA 4PVCA 4Z1MA 3B48A 2BH9A 2JD1A 1RRGA 1A98A 2ORYA 4GMGA 2C5BA 3ZD7A 2RONA 4K6OA 4ED9A 3VR5H 4P3NA 5TGTA 4JYCA 3K0SA 5BW6B 1T2DA 3AL2A 2OQIA 1N5RA 3GXBA 3V55A 1CQIA 1VB3A 1MB3A 1J00A 5E7JA 1EM8B 5JHGB 1ZK3A 3H8VA 1TYAE 2MCFA 4QVIA 1VBFA 4OB8A 5EESA 1EUZA 1PKEA 4BLVA 2CLHB 2BHLA 2H2GA 3R6GA 3ZDEA 4QNNA 2KMLA 3L0IB 3OURA 4TS1A 5BNIA 3N2GB 4FN4A 2W2VA 4QM6A 1A5SB 4MVXA 5LLTA 5CB4B 3PXDA 4ND2A 2BMEA 3RARA 1IHPA 4X8LA 2G82A 3OFSA 1Q2UA 5TNXA 1X1AA 2VQ3A 3DGEC 1NMQA 4HYEA 3ZQJA 4CT4B 3I6QA 1J5EB 1GRCA 2ZRLA 2COEA 3IEUA 4INPA 2A94A 4TS9A 3ETGA 5DHRA 1FTGA 4XD7A 4NCHA 3VSEA 1PNVA 1NKSA 5DGCA 4HDOB 4WN3A 4FYMA 1EK5A 5IARA 4LDJA 2IZ6A 2JA1A 5LKRA 4G0OA 4R8SA 2YWJA 4DKXA 5EUCA 1KDRA 1RKXA 3PZBA 4KHZA 4LNUB 1MEJA 5HP4A 4XDGA 3GRPA 1Q92A 1QG2A 1X9HA 2QBYB 1BA3A 4MMZB 4K9NA 1G98A 5BSMA 5E1DA 1SELA 2AFRA 3W6NA 1NQOA 3U80A 1T5TA 3L05A 4QAJA 4EHFA 1DRWA 4EB0A 3IP5A 3I30X 1ORTA 3IQWA 5IWAB 2W2KA 2B21A 4JQCA 4IIHA 5TQ2A 1LK7A 5KINB 3RAFC 2E49A 4YJGB 4HWTA 3UQYS 4BVEA 3DC7A 3MB8A 1D03A 3P97A 1RC8A 1W9HA 1P77A 2F67A 1NJSA 4MS3A 2J5RA 3DZFA 1DEAA 1Y81A 3IUBA 1I32A 1SVMA 1EUCB 3VU9B 3F97A 3RYIB 1Y3CE 4TXLA 3D6NB 2SKDA 4AQDA 2VRCD 4RE6A 3KE9A 2D1YA 3WFIA 4BMYA 3DMRA 2GJ8A 1SOWA 3KLPX 3DOHA 4U00A 1B15A 3GQVA 4MI9A 2QHXA 4F4HA 8ABPA 4JCCA 5C3MA 2ODQA 1TIPA 1VE5A 4DNFA 3N74A 3LP6A 1J2YA 4GR9A 1PBNA 1DEOA 2J87A 2WYVA 4D9MA 3KOYA 3PE4A 1TB4A 4OAOA 1O08A 2IT1A 2A0XA 5J47A 3SJUA 3JWHA 4B2IA 2JL1A 1RXVA 2IUUA 1QYRA 2HK7A 3L79A 1FVHA 2GJKA 2XUIA 4FS3A 4YJ3B 1G2OA 4OP3A 1WCWA 4NJEB 4XCVA 4KIJA 1FU4A 1T13A 3KDPA 3IL2A 2XGJA 3M6AA 5DB4A 1JHOA 1D7OA 1CY1A 4RIFA 2DKFA 1IN7A 4DDHA 3CVUA 4FDLA 4KIFA 4BV3A 2ZEJA 3TFWA 1QM5A 2K5UA 1L7MA 4CKCA 1ODKA 4R1SA 5KU1A 2GBFA 1E5TA 1NJGA 3G2PA 1ZD2P 1N2CE 2G6TA 5IVHA 3QPDA 2JFZA 1UDWA 1YD7A 4Q12A 3AUJB 5LQCA 3HDGA 3K1TA 3PGLA 2O2IA 2QD1A 4OSOA 1P81A 1Z33A 3E9RA 4YRAA 5IAAA 4D3YA 3H3FA 3HU2A 1OQAA 2X2PA 3B1VA 2KJQA 2CDCA 4RS4A 3RFVA 4IFEA 4MXDA 2QZ4A 2QU8A 3W1VA 5MN6A 1THZA 1LPMA 5EJ6A 4FCCA 4EO9A 1O4VA 5H3CA 3RQSA 4C3ZA 3RBZA 4L6IA 4M53A 2Z95A 4QXAA 4MTLA 4ARUA 4ZT5A 3W2HA 5K2OA 3EMVA 1HV8A 1RJWA 3OJCA 4QPZA 5F33A 1NATA 4J7UA 4MGEA 2GXAA 4UUOA 1BE6A 2VXOA 2RH8A 3OQHA 4B0PA 2QN6A 4E07A 5BSUA 2P2SA 4G5OA 5KPJA 3KQKA 3RGGA 2GWHA 3B3QA 4OJMX 4JL8A 4QATA 1M2GA 5FWYB 2P1RA 4MQ4A 3RC7A 7MDHA 4OI0A 5EYPB 3U7JA 1GU7A 2NSHA 2FJ0A 4JUFA 1EFAA 3JD2A 3JRXA 3PC7A 3LCCA 4ZU1X 4H16A 3SWWA 3SJZA 2RD2A 4WBSA 4E70A 2IU6A 1TM3E 2QM8A 3E7FA 3G2NA 2HMTA 4ESVA 4Y9UA 2QTFA 2H1HA 3TX6A 3LO8A 1JBKA 2ZRAA 4N3GA 1LC0A 2XQFA 1JH9A 4D2IA 1IC6A 1Z38A 3K9NA 2BFMA 3W3AD 3CG4A 1R8QA 5JO0A 4NXMB 4I14A 1H2BA 2FPKA 3C4JA 4BTLA 1XDBA 3KYBA 1F5NA 4M8SA 5ECDA 2QIPA 2FF7A 2KYRA 1RLOA 1HXHA 2B92A 3BGSA 3CVOA 1HYGA 2W37A 4IW3B 1OASA 4MQEA 4ZQGA 4B76A 5K0EA 1A9XA 1O8CA 3RS8A 4CF6A 2D1RA 1J22A 1M8GA 5CIQA 4CMIB 2J7PD 4UPEA 2Q9CA 1QHGA 1O94A 2O59A 3HMKA 3FFBA 1C80A 2OBYA 2VJKA 5IX8A 1UJBA 1ID1A 4JJIA 1H65A 3WLAA 3U4GA 3A9RA 1T2EA 1LTHR 7MHTA 4OHCA 5ERYA 1UDXA 2VDWA 3VC2A 1L7BA 1UL1X 1OC4A 1GZHB 2V6MA 3G9XA 1U1FA 4Z9BA 3ILHA 3E2PA 4J7AA 3FTPA 1UK8A 1JNYA 3HACA 2VBGA 4OIMA 5FI0B 2OAEA 2CSXA 3JWGA 3C45A 2G17A 3AVYA 2OZLB 2BV3A 2MMCA 4HUTA 3WLIA 3PX3A 4D42A 1ZZGA 5JD3A 2INGX 1YJXA 2ZCVA 3HJHA 3S55A 2ZUFA 4BL5A 4AWBA 3DW3X 4B3IA 1GG5A 1XTIA 3PTLA 3DEYX 1F2UA 4FFVA 3EXG1 2NM0A 1PHRA 3OCWA 4U2GA 3FLEA 3TE7A 2VNIA 4J75A 4LXHA 4Z2YA 4YROA 5AM5A 4KFCA 3LXUX 2PUGA 4ZVNA 4YRPA 4TN5A 3OJLA 1RP7A 4ZI2A 1WSDA 4OGWA 2VTBA 4FZ5A 2DULA 2W4IA 3W9YA 2ZGVA 4OAPA 5LOVB 3DAPA 3AOEA 4L78A 1A7AA 3FBTA 4MGYR 3V7NA 5CW1A 6ABPA 2WIFA 3F6RA 4US0R 5CX4A 3LCJA 5CDFE 1E2BA 3IT2A 3RVOA 2VPWA 3B6JA 3LPAA 5AHKA 3ILYA 3NCTA 1NHGA 1NVVQ 1R16A 3KL4A 3LQ4A 3NM5A 5B37A 2AT1A 1LXCA 2D5AA 2Y68A 4BVKA 2JFWA 2OHIA 3R44A 1V25A 3E9YA 1BCSA 1QIDA 1T1IA 4D98A 1Y3DE 4XGKA 1W4RA 2FW1A 3T0FA 4B47A 3ONNA 3SGLA 4MO9A 3DBIA 1QZUA 1DFGA 2JAWA 4KGVA 3UJ8A 3H5TA 3AXSA 1COWA 4DLSA 1RWOA 4CKZA 4NEGA 4IHKA 4JR0A 4JP8A 3GLIB 5IJZA 1FSFA 3L7JA 3V9AA 3GMTA 3I9MA 2HF8A 3FYUB 2GK7A 3NHAA 2SKCA 5LNK1 5DTIA 3QE0A 1WXEA 3FOBA 1A8SA 4LV5B 2IS2A 2BAGA 1H8HD 1XNJA 4FMPA 4X63A 2A5DA 1X9GA 2K7ZA 3VR4H 2NUBA 5FL7D 3Q8XB 2HV9A 3FPGA 4IHJF 3EVZA 4I5GA 5DDIP 4F93B 2IYAA 5DHTA 3W90A 1XZFA 3EFHA 4PLCA 3S2GA 3U48A 1DKUA 3BGWA 1QTRA 4EMBA 1FBNA 2EATA 2MT9A 2SCUA 2WIKA 3V4PB 4ETMA 4R71A 3W2TA 2UUBB 2BSAA 4GECA 5E9JA 2AKAB 2HCBA 4UARA 3SZUA 3T99A 1J33A 4EL5A 1P2TA 2A33A 3KYIB 3LAWA 1SXPA 1N2EA 1VYUA 4JEUA 4WDQA 3U3MA 3V2IA 1LSOA 2JFNA 3JQEA 2FRXA 3MGBA 3QXHA 1Y3FE 1F1JA 1NY5A 2AWOA 2IYOA 1E1YA 1HDOA 1AKRA 4F38A 3BTVA 5DK4A 3S5JA 4B75A 1LB1B 3OLXA 1XVTA 3QRWA 2EGHA 1E5VA 1EXDA 4F8YA 3CF2A 1A2KC 2I2CA 1RZ3A 1FFGA 1VFPA 3QJGA 1NOIA 3CB2A 2I4MA 1DC8A 4EJ2A 5KSZA 3L02A 2X22A 3N87A 2A9OA 3H9BA 3S99A 1STOA 4MV0A 3ZW7A 1YB2A 1GZ3A 4L1KA 1UMBB 5E4YA 2O6HA 1DGQA 2X4LA 2FX5A 3OX4A 4H7FA 4XQEA 4L7QA 5FULA 1Y8ZA 2WU3A 3F7TA 1T9GR 3RAJA 3VDQA 2IV7A 1TTPB 5GV7A 3FJ1A 2WJJA 4D79A 5K51A 3KOMA 3HXLA 4L6AA 3DYIA 4V0OA 1SHJA 4YUAA 8GPBA 3VTAA 3DLHA 4LKRA 3EK2A 3PGXA 2PMKA 1RLJA 2ENUA 4LRYA 4CVNA 4PY2A 2VQEB 4L02A 3H99A 1T91A 1PS9A 3GZNA 3O91A 4RZUA 5KQSA 4WERA 2VDVE 3TLBA 5DNAA 3LMKA 3LIIA 3H7AA 4W82A 5AXDA 4WNIA 1T5SA 1PT9A 5DGIA 3W8EA 4BJ1A 2PGLA 4C76A 3EPJA 3MGCA 4CFZA 5FPKA 4B2LA 1QGYA 5DO9A 4BXOA 3SQNA 3FZGA 3MJRA 3O6VA 3VZDA 4FX2A 3GG9A 1DEHA 3OKCA 3V4FA 4BV2A 4DJEC 1LQ2A 3CF0A 4NYJQ 1M2OB 3E22B 4KH1A 2A78A 3CM0A 2H48A 1E3IA 3C3PA 4IJMA 1GY8A 4F46A 2JJ1A 1SKMA 4RJLA 4DIFA 5LP6F 1Z4IA 4NAVA 2OKCA 3WZMA 3I4FA 4Q15A 2QD3A 2X1LA 5HJ7A 4HP8A 3G3EA 3G2IA 4DY4A 2B37A 2BLNA 3JD3A 2G4VA 3T7RA 5JXIA 2EGGA 3FNBA 5IVKA 2TS1A 3A06A 3QKTA 3FDZB 1NPDA 3WDMA 4C22A 3D2AA 1GPMA 2O5VA 3MN1A 9ATCA 1Z8NA 1RVV1 4KZPA 4MUAA 4KIWA 4HUQA 2FWMX 1KJQA 2CNWA 3LY8A 5KS2A 1G3RA 4CNQA 1RRFA 4F9TA 5IM5A 3D64A 1A69A 2GI4A 2V7VA 4RFVA 2YQ4A 2RKBA 2Z3WA 2FDXA 4RFLA 2JHPA 2IK8A 3L8FA 4RQUA 3TM5A 3MYRA 1E8NA 3VR6D 3ZU4A 3BHMA 3N0RA 3HZRA 3JQQA 3AF5A 1QH1B 1C4OA 3IUQA 1IZ7A 3U4CA 2VH5R 3ETHA 3PS9A 3F9IA 5ALTA 3LGSA 3LPNA 1N33B 1WMFA 3B13B 2E7ZA 4J0CA 2XWPA 4I3GA 1KI9A 2OLKA 2YMQA 2G5PA 3EHEA 4HVAA 5L4LA 4FSDA 2RKOA 5DXFA 3OEED 4B31A 4E5PA 4KQ2A 4PHHA 4DSAA 1Z5VA 4C1NA 1GTVA 3LA6A 5BQOA 4CLOA 2XCTB 1R0KA 3LBFA 3OA2A 3ZK7A 5BY2A 1I7DA 4D8VA 4TXNA 1X2BA 4ZRDA 4D9BA 1DIAA 4CIYA 1HE5A 4HH1A 4O1MA 1XTPA 1P2VA 1V1JA 4H4CA 5FTMA 1WY7A 4TVOA 5JARA 3PITA 3RE1A 2W6JD 1WMAA 4JROA 1YWGO 4OMDA 2N1BA 2Z43A 4C0KA 5JS7A 3WYNA 1POXA 4TV8F 1FX0A 4KOEC 3FLAA 4BWGA 2F1IA 3IBSA 3CO5A 3UKJA 1G1AA 3RFCA 3KOXA 3OFNA 4XIFA 3AQIA 3IO3A 2Q1SA 1E2DA 2P1DA 1DHTA 3FKJA 2DU8A 4CIAA 5DV9A 3KR0A 1DDGA 4ZAZA 5G1OA 5IYZB 5TB5A 1LSJA 3HKEA 4KPYA 1XJ5A 2YJ6A 4DT1A 4D9FA 3C7TA 2DHRA 5J2UB 2WG1A 3NBQA 1Z68A 2IDMA 1YS9A 2VN8A 3LHIA 1U9CA 5IAKA 1RI3A 3DE0X 4HAIA 1TCAA 1OBFO 2HYDA 3HJNA 4G8JA 4S1TA 2IPAB 2KE5A 2PIAA 2XGOA 4DDUA 1KRHA 1XLVA 4YIHA 4XR4A 4WBNB 4ZT6A 4UEKA 3NHJA 4YRLA 2XUPA 4KREA 4MDFA 4KXQA 3ZGVA 1G9TA 1GADO 2Z8YA 3LLSA 4AZ0B 1M73E 4CIBA 3ERCA 5FBRB 2YNMA 3B6MA 1ZP6A 3OWHA 4YRSA 5EJ4A 5FI5A 3BTUA 3L8MA 5ALJA 3RW9A 4B2PA 4DA8A 1QHNA 5HF9A 4OHWA 3LQYA 4HZIA 1R8SA 2V7GA 5CK5A 4KIUA 1ZLYA 3FMGA 1KZYC 4BMXA 4YT2A 1WCXA 2AC2A 1ZUIA 1NP7A 3DHNA 4Q9AA 1UXOA 3MPOA 3KL2A 3WYCA 4WQMA 2QZJA 4JUDX 2W42A 1K68A 1KFJB 4M9SA 4OA5A 4G84A 4KXLA 3RU7A 1FFXB 3GRVA 2ZRNA 1USIA 1TM5E 1UJNA 1ZI8A 4EB6B 3FTEA 1CEYA 3LY7A 3GJ4A 3N2LA 3AF1A 3DE2X 4H1TA 1T9HA 4TMZA 4ZA2A 3WI7A 4QTYA 1QYCA 4IF6A 4XOIA 1Z3IX 2GRUA 2F7SA 3M5PA 5BT8A 3ZE6A 4HNAA 1V11B 5DULA 1JHAA 2WF9A 1YSCA 2W4QA 2P9GA 1R6VA 5GY7A 1UIMA 1XZKA 3WWOA 1ACLA 4OFXA 2BJVA 4GKKB 3N2IA 3Q6MA 3VVLA 1M0EA 3C5WP 4KSBA 5BR4A 1UOPA 2O8EA 5AUOB 2ZJ6A 3OTWA 4ZMRA 1HBJA 1XFAA 3OZSA 4ZI7A 3KSBC 2VSFA 4C4XA 1JVBA 2CT8A 1F06A 3L8EA 3OEWA 2O3RA 3QF7A 3C3AA 1AK1A 3EGDB 3IH5A 2WT8A 4LY6A 4O08A 4OQDA 4POAA 3I6MA 2EWMA 2YZ7A 1O0BA 5HZMA 1IN4A 1RC1A 4GOKA 1OU0A 5ILQA 4AZ3B 1SXQA 4HDAA 1IM8A 2W11A 2C88A 4BB0A 1FDWA 1NBWB 3N8IA 3RYFA 6GPBA 2R2AA 1BEEA 1A7JA 2VA8A 3OMXA 1KSFX 1SCBA 4QX6A 1QFYA 3IDAA 1U5BB 5D86A 4AJ1A 2ZS7A 5L8VA 3GP8A 2TECE 1NAHA 1JIXA 4M0MA 4YWHA 2W0MA 3LDHA 5P21A 3N6RA 1XXHA 4R2WA 3N2NA 4RE5A 4EFMA 1LPPA 3OSZA 4UDYX 5HOQA 1Z2DA 1PW7A 2HU8A 2YV5A 5FOUA 4LY9A 4NL4H 3I28A 4I6GA 1G8KA 1KQFA 1GU0A 5T3YA 1I1NA 4H7JA 2OSVA 1SBNE 1SKYE 4UM9B 1SHZA 2GPSA 5LWQA 1VGQA 4F4IA 1PK7A 1XKXA 4ES6A 3BQ9A 3G9QA 3R8CA 4AQYB 4DBVO 2IKSA 2B8WA 6REQB 1AGRA 3K0AA 5AICA 3PR2B 5FPSA 4ZQFA 3JSXA 1TI7A 1EM8A 4EMUA 2R8YA 3ZD9A 2BW0A 3D4BA 3F6YA 3QMVA 1THTA 4RD3A 2ODAA 2PKEA 1QE0A 1BXKA 5FA8A 3QU9A 3ZIAA 4XGRA 3N2GA 1P5HA 1YL7A 5HHTA 3HNRA 1IRXA 1DV2A 4EDHA 4QREA 2X7XA 3H2JA 3NUGA 2RHOA 2Y77A 3JQ8B 2VJQA 4BNMA 5J4LA 1XMXA 1CP2A 1JZSA 1JMYA 2C07A 2VAMA 2ZIEA 4U6QA 4WCVA 4L22A 1Q1EA 4UUMA 2VLBA 4WE3A 5TV2A 5EZYB 4QE3A 1U3GA 4TM7A 2OLEA 5LP1A 4PRZA 4ZFNA 4XB6B 1E32A 5H81A 1KGSA 3OIDA 4ZALA 5H80A 2OCIA 1H2FA 4S1WA 3W8NA 3QWIA 4FW8A 5HK9A 1W2HA 1XROA 2GN2A 3FOCA 3HV0A 4FCVA 1XYVA 1H2XA 3EGXB 4F4UA 1WA5A 2JLSA 2QLLA 2YYAA 1NJFA 3LP8A 4LNUA 4X84A 3COPA 3P0RA 4YRGA 5CGQB 5FXMA 3PKIA 3HPQA 3PJDA 2G9RA 5GAJA 1ECBA 4QFMA 4JJ6A 3KD3A 2UUPA 3TFQA 4JQZA 4Y6SA 3WTCA 5HILA 1WXWA 4JLOA 3STHA 1R18A 3U9LA 1TAQA 1JALA 1R1DA 2DR0A 2B8JA 4G41A 1VDMA 4PS1A 5K0SA 4IV0A 1RQNA 3SJ7A 3BMQB 3FROA 4HGZA 1UKBA 1DUIA 2H1SA 4I46A 2V0CA 3JQBA 4C4RA 1NW4A 1NOKA 4BMPB 5CRIA 3EARA 4LF9B 1EUCA 5AKIA 3VU9A 3ZKAA 5AK0A 5GINE 3RYIA 3CR7A 4BO6A 1WOYA 2WUVA 4B3GA 4XEHA 4OY3A 2GPWA 4QHSA 4FHGA 4QPNA 4A82A 2WHYA 4LK3A 4P2BA 4HLDA 3K70B 1M0TA 5EL0A 1RFGE 1JQAA 2IHZA 5IJ0B 4CDNA 2FWRA 1XO1A 3N0WA 1H4TA 1KORA 1LRJA 4UASA 3KXKA 3H4IA 3MWFA 4NCBA 1KIMA 1WU7A 4RPHA 1DWOA 2VFAA 3FM9A 4MRMB 3RJ5A 2PZ8A 2Q5OA 2WSYB 5FLKA 3EDOA 3S44A 2CMHA 2P65A 4I2NA 2XMRA 1K66A 5DT9A 4YJ3A 2DBQA 3GOHA 2J5KA 4NJEA 1CZNA 3TDKA 3TG2A 1ZM3A 3RCBA 4J7XA 4URUR 4LHXA 1QCYA 3SX0A 3U7QB 2HRDA 4B09A 2CXOA 4AZVA 4MVJA 2XLCA 5CVJA 3PNBA 2BDEA 1DS6A 4W9RA 1BE1A 2OHJA 3GNTA 1MVLA 4IMPA 3BBLA 4TLAA 3GD7A 4X45A 5AJYA 3AHCA 5DLEA 5HJ5A 1IQ0A 4J0DA 3PEWA 2RAPA 1XIVA 2B5WA 4OGFA 2IUEA 3G6WA 3KPJA 3UK2A 1IZYA 3H5IA 4QDOA 4QUJA 4H35A 4IIYA 4C1BA 1YA6A 5DLDA 4KTVE 3IVAA 1UDRA 2GZHA 2E4VA 2I8CA 4QEKA 4W63A 3QVLA 2IGBA 2V6GA 4BVHA 4I9FA 4RAQA 1OA0A 4DLTA 4D26A 3HQ4O 3OIGA 1NNEA 2BMVA 1Y7HA 3D3WB 4JOCA 4XIIA 3TQHA 1G2IA 1VSUA 3TTXA 1HRDA 3Q7QA 1YZVA 4ADSG 1MG0A 4X54A 3UHOA 4LHEA 1AJEA 1CY6A 3TCXB 5A5EA 1E1LA 1W85B 2W8ZA 2W2LD 3FVTA 3IPXA 3WLTA 3ZLBA 4DPKA 4EBFA 1J0XO 2G28A 2IP4A 3KCQA 4MMYB 4CQNA 1XCPA 1QYDA 2XRYA 3AY7A 4LDNA 1HUQA 4B87A 4DLRA 4I5EA 3RTCA 1E6CA 1MJ5A 3QPBA 3QYPA 2WV7A 1F8FA 2J9FA 2GBIA 4JC0A 3KU1A 4NMHA 4TMXA 4EKEA 4YMUA 5LZ2A 4AX4A 3TZQA 1ZAYA 2EIXA 3HHPA 4JP3A 3RS3A 3GJ5A 1B93A 1XA0A 3MERA 4UU7A 2QX8A 3GAMA 4NYMR 3GH1A 3KVOA 2V7QD 3BL8A 4L07A 4TL8A 4Y1GA 2OCGA 2HRQA 2GPAA 4ZVUA 5FWYA 2PO7A 1X39A 4F2PA 1HURA 5EYPA 4IZOA 4TMYA 1ZNXA 2ZITA 3BUSA 5K05A 2A9FA 1VTKA 1VE7A 1QV7A 3FGPA 4MUGA 1ATZA 3K9GA 4MQ6A 3SYLA 5IJ9B 3WIEA 4AKHA 3ZZMA 4DCTA 1E6UA 1QZXA 4Z8YA 4KACA 3DULA 1O57A 1MF7A 1JLHA 1Q7TA 2FOXA 4MP6A 2ZYDA 4LCBA 3NC0C 4UNIA 1E2EA 3PEYA 2JRCA 3M6IA 3TDMA 4LV8B 2H3EA 5IDWA 4OB7A 1Q12A 3AG6A 3WICA 3HDQA 2P3OA 2PN1A 4C06A 3L0ZA 5K0TA 5EKDA 4H0FA 4DWOA 1HEYA 1O97C 3DS8A 3SAJA 3CVVA 4CUJA 2EIHA 2P3LA 2DSTA 4E1VA 1P1KA 5HQTA 2I6SA 5BWOA 1BMDA 5EJ9A 2P9BA 3T1VA 4B74A 3GOQA 1P9WA 4XB1A 3X1MA 3VPDA 4ZQCB 1D2AA 4PLFA 3TAHA 4HTFA 3UXMA 1ZJYA 3X1WA 3QMWA 3E9DA 3PQ6A 3PQDA 4JI1B 4R1MA 5I47A 5A02A 1BWQA 3H6GA 2Y05A 4AY5A 1KI8A 4HYTA 3EZFA 1MG5A 2CDRA 2NTJA 2WU0A 4IWXA 5J4YA 4DRZA 1U90A 3PC6A 3VJMA 1SUEA 4Z9YA 1PQUA 1H5UA 2OZLA 4XUEA 1AGNA 2WTXA 1S01A 4MWDA 5J59A 1BRMA 2ZYTX 3FPFA 4ENPA 3WO0A 1WWKA 5C7YA 1Q1GA 1K88A 4QRDA 1JPJA 1P61B 3M0EA 5FWAA 2Q0XA 3CX3A 2RGWA 1VL6A 1VIDA 3WMWA 5B2FA 1SVWA 4DQVA 4PCVA 1OMOA 5FL3A 4B3RB 4MLDA 3DP9A 2LCFA 1RJGA 3E2MA 1KZGB 1KO1A 5HIKA 4CIVA 2GNAA 4WXPA 3SLGA 4RSRA 3EFOB 2COKA 4F8EA 4L16A 4HX9A 4NBWA 5AI8A 2RI1A 4WA7A 4Y9DA 1UJMA 2Q1UA 1ZRHA 1E3MA 1UJ6A 3G2HA 4HGQA 2QXUA 1E0JA 4BRSA 1TEZA 5GM1A 4EENA 3GLIE 5LOVA 3KV3O 5C53B 3ZBTA 1IULA 4PBSA 4CBVA 1MIOB 1R15A 1Z37A 2WDZA 2QRMA 1SXJE 2HA2A 2Z1MA 3OH8A 4TYWA 4H3VA 2WAXA 1NJ8A 2WFMA 3DDCA 1HA3A 1Z4OA 5DISB 3SXPA 3FFAA 1M2NA 1CY4A 2FG5A 2Y3IA 4M0DA 5JJLA 3VC1A 4YAWA 1SVOA 5EE1A 3ZV3A 5IC5A 5BMVF 1B8OA 3ONWA 5LXTA 4XYMA 4ZCMA 3WNCA 3BK2A 1G6HA 1RFLA 1JG1A 3QYJA 2LZ0A 3C6XA 1X87A 4Q4HB 2BKUA 1EE1A 1SZCA 4WECA 3TOSA 4QSHA 2GN9A 3VPBA 4E03A 1LLQA 2AI1A 2QXYA 3DOJA 3TW8B 4C0LA 2A4KA 2X0IA 1VDZA 4L73A 5E2IA 4DIUA 1C0KA 1D0IA 3PQCA 4JOSA 2O8NA 4BP9A 2CFSA 3UOWA 2HZBA 3UMGA 3ER9A 2CLCX 4OXYA 3FYUA 1QB8A 3GBSA 5PNTA 1HRKA 1V5FA 4YAJA 1RXIA 2HIHA 3UAOA 4LWPA 1Y9EA 1YA8A 4JNCA 3QSGA 5UKDA 1B3BA 2QRHA 2G09A 2VT2A 4Z53A 3M6XA 1KKUA 1OFVA 3NHLA 4P5PA 1O6GA 5JVDB 1YQTA 5FPTA 3EX7C 1OH6A 4RU1A 1BDMA 3SEZA 1GZSA 4I55A 5EP1A 1K3FA 2ZVJA 5SY6A 5JCXA 5FTJA 2IWRA 5ADHA 5HSGA 3R3JA 1TQ4A 2B34A 4PXSA 2XVMA 1TLTA 2AE2A 3TZCA 2JF0A 2HRCA 2DTEA 1YI8A 4IJ6A 4DPLA 4XIGS 2UZIR 1DG9A 3LC7O 4HAYA 1UEJA 1VP3A 4NVRA 3ZHYA 2XUHA 3QBEA 1HDYA 4HNUA 2O0JA 1N77A 1KRXA 4CG0A 2Q5LA 3HCBA 4CQMB 1DCTA 1M2VB 4YASA 2JARA 3TTVA 1RWWA 1TNDA 3ADDA 2FQQA 3NBKA 3A58B 4LHVA 1CULC 3E53A 5FLEX 3TBFA 3FCXA 5ICFA 5F9FA 2GLUA 3GY0A 5U1PA 4YMLA 5JPDA 4GE0A 4W5OA 1BGXT 3LZ6A 4QT4A 3AEXA 1AKEA 3OKAA 5GV8A 3L0CA 3ST7A 3OZFA 1NF8A 2PUJA 4OH7A 3LBNA 4U2DA 4OQMA 3E9EA 2GARA 4UREA 4M99A 2D4HA 4KDCA 5IVIA 4K3VA 2E5WA 2PVPA 2WWHA 4K6KA 1FLNA 2JATA 2WZBA 1W6UA 4MYTA 3STTA 3NX4A 2LCIA 4XIYA 2D4AA 2FSIA 2BZSA 3MS2A 4LJKA 3IUSA 3T3NA 3E7WA 2AOVA 2YVKA 4OQYA 3BRWA 4WLUA 3VAZA 2X3UA 2WFZA 4DA7A 1A4XA 3KT0A 1PJSA 5L40A 2XE7A 1ZEJA 4N47A 4E4TA 1WVMA 5LQSA 4DILA 1AQNA 3LHFA 3ELWA 1L4MA 1M2FA 4F2HA 4YC7A 1HEUA 5HKAA 3HVRA 1WXQA 1SCKA 3AI1A 1W2WB 2AXEA 4ZI3A 2XTAA 1N57A 1ZD4A 1BEZA 5J4KA 5KYNA 3UM9A 2B36A 4ZEVA 2EP5A 4E7PA 2F3PA 2A0WA 4D3FA 2C0PA 3VKGA 3C1TA 1M2OA 1LW7A 2BKEA 3T1HB 2JH9A 1Y4SA 3PIIA 1W36B 1CXZA 5DPMA 2PAAA 1R4MB 1RAAA 3D2BA 4IJWA 3JYQA 1TEXA 4M1SA 5DBIA 5H02A 3PNKA 4HB0A 3HCRA 4TTPA 4DM3A 4GKAA 3Q8KA 5F7OA 1QGZA 3V2HA 1QONA 1N8KA 3WSTA 2XCQA 1YTUA 3JARB 3ABRB 5CLIA 3TD2A 3TZLA 3U0BA 2JLYA 3FSGD 3G8AA 4GLJA 4I50F 5DTJA 3QV1A 2IEDA 1CLEA 4UQOA 1UDCA 2XR1A 3KT8A 4OXQA 4BUZA 2WB2A 1Z47A 3D3NA 3WG9A 4ALJA 3IMGA 1UBEA 2L17A 2V0GA 2KBEA 2EQBA 2OECA 5KTSA 4RH1A 4J1TA 2AW5A 3DHWC 4IOJA 2Z8XA 1CEQA 1DAOA 1N5OX 1O89A 2BUCA 1E1RD 3NTQA 4NI5A 3UJPA 4CYMA 3GWGA 4UM8B 3IQGX 3AI7A 1GM5A 3SYKA 1SXIA 3KNZA 4P80A 2BCGY 1A72A 3BJRA 4MW0A 3C5CA 4UHBA 1DAFA 3DO6A 1PD1A 1KYYA 3JQAB 4ZAVA 4X44A 4EARA 4P7JA 1L3CA 3FPBA 4XTCS 3UXYA 3NIWA 1G8PA 1KS2A 2A5LA 3HZOA 4QYSA 4YH1A 3FTQA 4BBPA 1LQTA 1S2DA 4CKWA 4UZFA 3E1GA 1UBNA 3Q3JB 4QDJA 3T1TA 1EUYA 2GKOA 3ZLTA 3ND8A 4LXTA 3PXGA 4OP1A 3EA5A 2W6NA 1YV9A 4G1VA 3O38A 1YONA 1U0FA 1Q15A 2NOAA 1V7ZA 3UVEA 4EEKA 3QEOA 5ICGA 2QK4A 1GGNA 1LF5A 1P60A 3GVCA 4AFNA 5C8YB 3VR3D 3GPIA 4N39A 3MCWA 1QMGA 1JQ3A 1VKNA 2NVBA 4FTWA 2CVOA 1UBRS 3EDMA 3GLGE 4X24A 1UADA 3KR9A 1GZ7A 2QTBA 1QLHA 3AEQB 1NRWA 1SWWA 3MJFA 3P9QA 3RTDA 1XU7A 3MW8A 5B57C 1FCJA 3IHKA 1AQYA 4EVSA 3IE1A 4HZUB 5EQFA 3T0GA 4GKBA 4NICA 2QGNA 5KVAA 1RWKA 4C2AA 1NP3A 3SI7A 2RK4A 3FCYA 5IYZA 3O3MB 2V98A 3G7UA 3KLOA 4GX5A 1YOVA 2D0DA 4GO1A 4AN0A 4F71A 3GARA 1E2JA 3LFHA 4QYTA 5J2UA 1AV7A 2CHQA 3LQQA 5KOJB 3ZWDA 2FN7A 1IPFA 1K7SN 2J3DA 3QLJA 2AGVA 2HAEA 2ZB3A 4DMRA 1DC3A 1PNTA 3OE1A 5L95A 2CFOA 3FIJA 4NX2A 4EKDA 2GZAA 1S6YA 3IOMA 2EFYA 4BO5A 1DKRA 1TKCA 2V3WA 2O1SA 4WBNA 2I1LA 1D1QA 1NX6A 4WLVA 4MYUA 4L9WA 4N76A 2EBFX 3RVRA 1ND5A 3G59A 3BCHA 5DSZA 2ECQA 3TNJA 2OXFA 4AZ0A 2ERCA 3QIVA 3A14A 3OEHA 1NXOA 1PYOA 4M0KA 5AQ1A 2VWQA 2YWDA 2QYSA 5J23A 2FZVA 3FAKA 3I2FA 1D5WA 4D6YA 4KCGA 1RI5A 2ZSEA 4U7WA 2CEKA 2HSZA 3MT0A 3R5KA 2A8YA 4WOKA 4YI3A 3SBOA 5JAZA 1NTRA 3PNOA 2EW1A 1JX6A 2X1VA 4DA9A 2J5BA 3HR7A 5EJEA 4AULA 4X60A 4ZEMA 1FY2A 3LLVA 1I0LA 1GA4A 4DS3A 5JQGB 5C3UA 4FU0A 4A8TA 5LD2C 1NULA 2HPZA 2P5TB 1GQFA 4RACA 4EB6A 2PXCA 3LP5A 2PUFA 4DIEA 5L4NA 3OT5A 2R6R1 3SHWA 1SCJA 1J2RA 1SC4A 1J8MF 1IOWA 1ZC3A 3DEKA 3L8YA 3H13A 1KL7A 4JVNA 1KHTA 4OXNA 5A2QA 3RADC 1V11A 3I4CA 1KMIY 4BLTA 5JQWA 2VZEA 1KJ9A 1U7UA 2IHKA 1F5SA 5KSYA 2Q6TA 5A7HA 4PCAA 3LUHA 2JDID 1SU8A 4KKVA 4G1UC 1YE3A 5J1SB 1AUXA 3E4CA 3GLHA 4BHTA 2KW5A 2WKQA 4N12A 5AKYA 2IX9A 3TVDA 4EX6A 3KETA 1QANA 3OD1A 3UFBA 4DIMA 4CI0B 2H5IA 2Q3DA 2OCKA 4Y2UA 5CNKA 4HNGA 1E1DA 4NABA 4FYJA 3V7YA 1B6GA 3TTWA 2FKNA 1KEUA 2VNSA 1B74A 3AHHA 5BSTA 1PX2A 1GTJ1 1ZOLA 3B1ZA 1S8OA 2EF1A 3GYBA 1QFMA 3F5DA 1RAEA 1VIAA 2QLBA 3SIPA 4WBXC 1CKEA 3NG1A 3PE3A 3KKEA 1U5BA 4N0PA 4R83A 2J9YB 1TFRA 2OCYC 2JJ2D 2VWPA 3L7DA 4RK7A 4UZSA 4BGIA 4YQFA 5LU9A 1VKHA 5L3QA 5ALDA 2WAMA 3AJ9A 4H77A 3TSZA 1AM4D 5B7QA 3HCCA 3ZDDA 2XITA 2MU1A 1TVEA 4OAQA 1E5DA 2J4CA 3FD8A 1E64A 3LC0A 4Q3BA 3C6QA 4U2CA 4KWIA 1T1EA 4BKPA 3OIWA 4PLWA 3GFGA 3N2EA 3KZXA 3AI2A 4K9MA 2CJWB 1JG7A 1SIUA 5I8ZA 3U62A 2O2XA 3PRYA 1PR3A 3H9EO 5CH8A 1YASA 4Y9RA 4Z8XA 5BNFA 5CA1B 2PNFA 4COKA 4HHEA 3QH4A 3NCHA 5NLLA 5BV0A 6REQA 4B6OA 4BZWA 2FPIB 1GR0A 2VSXA 2IPXA 2P7IA 2XKJE 3HXKA 5L7WA 4C5AA 4RZXA 3ROKA 4ENVA 1SQFA 2GLTA 1NHWA 3SZGA 1KEEA 3O8CA 4XCXA 4FYHA 2FXIA 1WDKA 2V6FA 1OE0A 3R1IA 2ZQZA 1SQSA 1WUTA 1QQ7A 1JLSA 1UFRA 5TEVA 2C3MA 4EY5A 2EBHX 3JQ8A 2XCRB 3REQA 4FB4A 1ECCA 4FE7A 3VSCA 3Q0IA 1PSZA 4UBKA 5EZYA 3TSAA 4LJRA 1L4NA 4NZMA 1EVLA 3NBYC 3RTAA 3NI2A 1P9RA 1RXEA 3X2EA 5FTLA 1BMQA 2G8LA 4IDOA 1ADJA 3IP9A 4XXHA 5B3AA 4HAWA 2A1UB 3F67A 4TTVA 1AE1A 5CTJA 3EGXA 1ML4A 1NYLA 1CUBA 3KB1A 4NESA 4QOHA 5J5CA 4CR6A 1FNNA 1EBBA 4PO1A 4CKYA 3CCFA 5LC1A 1EJ6A 1YS6A 1JDUA 3N1UA 3TBHA 5T6MA 5BSHA 1P7PA 3GEBA 4FYWA 1C7EA 1NYRA 3T5GA 5LP6A 1X1CA 3T7TA 5EXXA 1HC7A 1RHMA 2JZCA 3EA4A 4HQOA 3OX3A 3C8MA 4E32A 1SCUA 5C8VA 2RI0A 1L5RA 3CKMA 1C2TA 2L69A 1R0SA 2QL6A 2ZK7A 2Y76A 2VUIB 4LBYA 1IBKB 4OHYA 2LDXA 1BEUB 1T5DX 1CQWA 3I1YA 4MS1A 3BMQA 1G3MA 4RNCA 3U3XA 3LY9A 5AKGA 3QBVA 2FGKA 3PX2A 2QE6A 1GILA 4AKEA 2ODEA 1GDDA 3JQBC 1ZWKA 2J1LA 2OK8A 3BULA 2XMCA 3HJRA 3FLBA 4KXFB 1T9BA 5SYAA 4RQAA 1B3RA 2XJ4A 1I4EB 4WLFA 4QPPA 3MUFA 4G9GA 3OF5A 5F1KA 4IKOA 3A3YA 1WULS 1YRQA 4A15A 4QC2A 2W4MA 3CVWA 5E8JA 4D6XA 3CUKA 4E33A 2ZRFA 3C97A 1F6BA 4CIWA 3IEMA 3EOZA 2XGGA 4NYMQ 3ACCA 5CIYA 3GCXA 1FUKA 2REOA 3IS3A 3LNTA 1MIHA 4FOLA 1AKUA 5B1SA 3TW0A 4LJ7A 3CHYA 1DOHA 4BQRA 4O2LA 2R1UA 3MWLA 1WG8A 3ILSA 3K9BA 5AOVA 5JISA 4D56A 3LX4A 3H97A 1G6OA 1KYIA 2PV7A 3AV3A 3EGIA 4DR7B 4YBRA 2DKNA 4UNPA 3GNLA 4UFPA 3FF4A 3JR3A 2NZJA 1N0VC 3HDHA 3P2EA 4N3AA 4Z7JA 4GDFA 4K9PA 1D07A 2Q7DA 2V7BA 5JZ9A 3RO7A 1P2FA 1PGJA 1V9SA 3JQFC 1WQ4A 1MQ8B 3QKUA 4PAWA 4ZQIA 3LOUA 3RR2A 4UZEA 2YWXA 3Q9SA 3QV2A 4JP1A 4PM4A 1Y4DE 3U40A 3UV3A 1DXYA 4MKFA 4TV8A 1I4TD 1L2TA 4CHGA 1F7VA 3U7IA 2D0PB 3JW8A 5EXEA 1S2LA 3D81A 5AW6A 1EEHA 3MPUA 3R3HA 3OU7A 4QDUA 3QY0A 3K32A 3KZMA 4E3WA 1WBJB 4LGYA 2GS9A 5FTKA 5LA6F 2GEKA 3DFUA 3NHKA 4D44A 4Q24A 5TF0A 2QA5A 1YQGA 2YJ5A 4TLMB 4MKXA 4BFVA 1XTUA 2FRVA 2ERXA 2AG8A 4D0RA 4L72A 5LQMA 2HNKA 4KQWA 3MT8A 4QJBA 2O06A 1KAGA 2ATIA 1JQJC 3AM3A 1FP7A 4XJSA 5CFOA 4DXDA 5IHXA 4WW0A 3HN6A 1ETUA 2PKYX 3NHMA 4PS0A 3FB1A 2ZRMA 2H57A 1KDZA 4EITA 5EEHA 2VHXA 3OP1A 4S2UA 2QMOA 4TYQA 2XZPA 4LBVA 4KQ1A 2D62A 4MV7A 4PSDA 1FDUA 4K0KB 4HLUA 4R8LA 1J56A 5HS6A 4XGNA 4XASA 4RDHA 2RARA 3BBPA 3OTIA 4Z6KA 3WKDA 5DEOA 2Q41A 3HJAA 2KWIA 1DRJA 2HK8A 4II3A 5CT6A 4CMJA 1FJXA 2PVCA 5AKXA 1EQAA 2XT6A 2ZAGA 3BAZA 2BDUA 4Q01A 4Z9FA 3RVQA 3I9V1 4MYSA 4IUBS 1TMYA 5MDHA 2GCIA 1LV8A 1CNMA 5FEMA 1DI0A 3QXCA 2NTNA 3MCZA 2UUOA 5IP5A 3PNVA 4P4TA 5IJ9A 2HV8A 1QV9A 4TZTA 4DXHA 4KR2A 2XQJA 1T3LA 2QQ0A 2I78A 1FLAA 5BW8A 4Y7DA 1TW2A 3IXLA 4OLFA 4RGYA 4YV1A 1UAGA 3VKFA 1BHJA 1QIHA 3DE4X 1K8XB 5SZKB 5CDYA 2AN1A 5B58T 4AF7A 1NASA 1YZNA 2WV9A 3JD4A 3LWBA 3NONA 2ZJ4A 4N5MA 4I4TB 2H63A 2YASA 4K9DA 2BEJA 3OQ1A 1CUAA 3GGPA 3O2JA 3UB3A 1ZZEA 2C2YA 3QYFA 1M34E 2F3QA 2QWXA 2SHKA 1K1EA 3L7LA 1PZHA 3FMIA 3P4XA 1SUIA 2HF2A 3AWIA 3Q15C 3EEOA 4I8IA 2XGSA 2ZP1A 5JYBA 3ICEA 4CTOA 2CW5A 3WGIA 2J3QA 1E2GA 4AY4A 4LWOA 1TE2A 3PICA 2FEOA 1H1TA 3HKDB 4I6JA 3EW7A 3VTFA 4WASA 4ZOQI 4M6WA 4JNKA 4UHFA 4J4BA 2PT6A 3THXA 2ZRDA 4GBMA 1NA5A 1GNSA 2ABWA 4RK5A 5IWCA 2G1AA 4EUNA 1ULZA 3TOCA 3FVVA 3PI6A 4RSGA 3PQEA 4G56A 1B41A 1XL1A 1NVWQ 1K4YA 5CFRA 3QF4B 1XE3A 1I5OA 4MINA 1K08A 1CUGA 2EBWA 3EFOA 1FBTA 1UBOS 3ZV4A 1TQ2A 1YZHA 2OAP1 4XM0A 1I14A 5KTYA 5JDCA 4M38A 2G1PA 3X1KA 4TWZA 1BX0A 4G2NA 1PE0A 1Y6FA 4UMDA 2DH6A 3EXHC 1PO7A 2IYEA 4GUAA 4OREX 1MIOA 3SPXA 2B98A 2JVKA 3OUTA 1Y5MA 1GO2A 4Q03A 4PX3A 1C4XA 2FZCA 2O3UA 5F2OA 3ZWWA 2MYUA 3ABOB 4YRIA 5CW2A 3LI2A 3ZHTA 1T43A 4IL5A 3L04A 3LTNC 1WDWB 3C1AA 4C0JA 3DM9B 2QN7A 2PSFA 1CUHA 1KPIA 2I7VA 2VHUA 4M21A 2CXPA 5JXWA 1FSPA 4EVQA 4RA6B 3FCEA 5GONB 3I2YX 1ZWLA 3QG1A 3L01A 4NCIA 2BGIA 3AONB 4Q4HA 2QG6A 1HT3A 3LFUA 4II7A 3Q3EA 5GP1A 3VXKA 1U1CA 3SD7A 4AT1A 1U3CA 1QGAA 2OWEA 4ETWA 3ENVA 3E8MA 3LT4A 3TW8A 4DQUA 5L3SA 4K40A 1JL3A 3IIIA 3C3WA 4AVYA 1P33A 3GRZA 1Z5NA 3MMPA 3V8NA 2GN1A 4P4GA 3WNVA 2FZWA 5B7PA 4KYIB 3BE6A 3FAZA 3KHKA 5E1BA 1DIGA 3K73O 5JE8A 1DUSA 1S3IA 3WGVA 4I8XA 1O6FA 1CJBA 2WICA 4IUCS 2YBEA 3WA6A 3C7AA 4Q37A 4AMBA 4M0UA 2AR0A 3E5RA 1EHIA 1N7GA 2FTKE 1E2NA 2W2XA 2X5JO 5JVDA 3UT5B 4P82A 3AY3A 1MBZA 1SFRA 1SZJG 2GPBA 4MR8A 3MNFA 4FB5A 4TTTS 4DWWA 3AYZB 5FYQA 4O63O 4YS6A 1FYVA 3OC6A 2IP1A 4AURA 4PR0A 4AJNA 4UTPA 1X2EA 1N0WA 4HAUA 2HHLA 3HKBB 1PVVA 1PSDA 3VUFA 3GDOA 1EYZA 1B1AA 1P5RA 3NWPA 2RGEA 3A3NA 1NMSA 3N6VA 4DJFC 1JEYB 4B48A 4BIIA 2PSSA 3OZXA 5DMXA 2W6OA 4ND4A 4RO0A 3KQVA 5C80A 1C30B 2MYNA 5AYVA 5BR8B 1CZOA 3IQFA 1EP3B 2HRRA 3H05A 4NHEA 4NK5A 4CQMA 4WKBA 1TVMA 2WOOA 1FVOA 1M2VA 2AJLI 3NO4A 4B81A 1H4QA 3BFPA 4Z7OB 1EB8A 5EMNA 4W9MC 1HDGO 2VKTA 1Q17A 4U3JB 3RC1A 4F60A 5EVCA 5K20A 5AXBA 2JG3A 4ARCA 1ORRA 3K5HA 3UWKA 1WKBA 1VE3A 1MMFB 4ZEWA 1O97D 1EGMB 1GFZA 3AZPA 1M6NA 1OROA 3MFYA 4KO4S 1EM6A 1E0AA 3VI3B 3DMTA 1COZA 4O4JF 2I7TA 4HNHA 4XTRA 4PCUA 1QGOA 4HS4A 3ZLUA 1G8SA 4DIKA 3QX8A 5KYWB 2QPOA 3H0CA 4JXKA 1XRJA 4DCNA 5EUMA 2VQFB 1EFHA 2D2XA 1ISMA 1KPHA 5HA5A 1AKWA 1PI3A 3IV7A 1SVIA 3OQPA 3ORRA 4TRRA 4CLDA 4YCAA 1PP4A 3HLTA 4G07A 4XOUA 1EWRA 2VOJA 1YIOA 3RVLA 1TTHA 3UT5A 4PLHA 1OVMA 9LDBA 4GLOA 1I24A 2CXUA 2BD0A 3ZE8A 1SKYB 3CNOA 3LBYA 4REQA 4DJJA 4ID3A 2GYWA 4LN1A 4YJKA 4EYOA 2CV1A 4ZT7A 1ODCA 2PT7A 5TJ9A 3INTA 1WOMA 4ZOBA 3PT9A 2JZOA 2EP7A 3AEKB 3O1LA 4H6VA 5BN4A 4DV0B 1W75A 1DADA 2JFGA 4P4NA 3IE0A 2B94A 4V03A 3ESQA 1R4MA 5F35A 4GOND 5C8XA 2P78A 3EMBA 1H3EA 5DN6A 1XEXB 1JKFA 4MW9A 1ADYA 1Y3BE 2G4CA 3E2IA 4Q4LA 1PNQA 3H5VA 3TR5A 1AUVA 3NYWA 5I48A 2R96A 4M1KA 3FUXA 1PWXA 3JARA 4HWRA 4R41A 3U3JA 3VBCA 4BAGA 3TKLA 3F98A 4MYDA 1LLFA 1PIWA 4FLFA 2VYNA 2H4XA 3TCKA 5KOHA 1RPZA 2W5UA 1W8DA 3ZV6A 3HK2A 5IABA 2EU8A 2PGNA 2HSJA 1M75A 3BRCA 3MB5A 3MWDB 5ESRA 3X2SA 5A6SA 2WSBA 3TX2A 2F55A 1N7JA 3EQ9A 5DYGA 3G9ZA 3ONDA 4LC1A 2XUZA 3CWCA 3TVYA 4C20A 3H9GA 2IZ0A 3Q3CA 5A5VA 2H11A 4LRTB 1XCJA 3K5PA 4RTPA 1VG1A 4P35A 2V7UA 3VHRA 1PEKE 5KREA 3GA5A 2L42A 4RV5A 1MC4A 1TJ5A 1YQEA 5JT1A 2B1QA 1RZVA 3BDVA 2V59A 5LB2A 3JQAA 1JJFA 2X0KA 4BFCA 3G2MA 4GI5A 5BV7A 2QY6A 3O4JA 3ZYCA 4W4TA 2F4VB 1P8AA 1COWD 2BOVA 5ALFA 4Z99A 4F7WA 3T7KA 1N2XA 1ABBA 1YHZA 1G8AA 2JCSA 3W3ZB 4Z7NB 2P0YA 2ECPA 3CR8A 4UHEA 1XD2B 2RHMA 2GO1A 5KWJA 2P2DA 2ZRGA 4OQFA 1D9XA 4OVKA 1C81A 3TI9A 4ZDKA 5B12A 3A6HA 3ZUPA 4FFSA 5IMSA 2GCOA 3FNGA 4RXMA 3UHFA 5C8YA 1DQYA 1HE3A 5C5EA 3IA7A 1OTXA 2XD4A 4MGKR 3X44A 1TLFA 2AZXA 5HQJA 1HDIA 1OJLA 1WCV1 3GR6A 2NP7A 2AZ4A 2IYFA 3T9DA 3AEQA 5E1MA 5IKEA 3EGCA 3ZE0B 4PSKA 2RAVA 3WV4A 1L7XA 2FHSA 2WSLA 3EIOA 1K5HA 4OHZA 1NWCA 4FIZA 4ALKA 4HZUA 4BNDB 2K6GA 3ZCRA 1Y1SA 3S27A 2EYQA 3T7JA 3N8GA 4FR0A 4AM8A 4QU8A 1R9GA 1RE0A 2PXHA 3BFXA 3GLQA 4M87A 2CSUA 4G67A 2CVFA 1UKAA 4OB6A 3UWSA 4BZZA 1P0PA 3BIJA 4RGBA 1QFJA 1KS9A 4LTDA 4TMFA 4KITB 1R37A 3CSDA 5KOJA 5K8VA 3KSZO 1OYYA 2ZIAA 1NWHA 1WMSA 1NF9A 3CPSA 2COUA 3OEYA 5ERXA 3SC3A 1UKCA 1XVVA 4NPCA 4PSCA 4XVCA 2YH2A 4FFNA 4KE9A 4M2LA 4EQ6B 2CFIA 4DKJA 3FG9A 4F5YA 1UZMA 3GDFA 3SR0A 4GLBA 2CDBA 5JLAA 1NBMA 4IZHA 3UJ7A 2OGTA 2RJOA 1U8EA 3WGOA 4FI3F 1EDBA 5GPBA 1MAAA 2MJLA 2H9AA 1G8YA 3D3KA 1GV0A 5EIOA 1EUDA 2VWGA 4ESOA 3ROZA 2H18A 4YDQA 1I5RA 3U3DA 4OXRA 4ABTA 2R1TB 2BI4A 3TTSA 4FYXA 2XQIA 3HMQA 3L0BA 3VU1A 1M7GA 4UBOA 4MIKA 1I6MA 1EBFA 1WU8A 1Y8CA 1U6JA 2PR2A 2PRSA 3VSDA 3WP1B 2R1ZA 2VZ9A 5BYKA 5ALQA 4H0NA 3GCWA 5BWBA 1Z16A 2CCGA 4MCHA 1GYPA 1U8CB 1UPFA 2PRJA 4UMFA 4YT5A 2YS7A 2EKQA 2WJAA 1TYCA 1U7PA 3OIFA 3AFIA 3F8SA 5DCYA 4O0LA 2Q9BA 2AFIA 1Y37A 4Q1CA 3Q1KA 1TF7A 4RZIA 4MR8B 2YCBA 1DMSA 1J2JA 2RHRA 4TSKA