2CT8A

Crystal structure of aquifex aeolicus methionyl-trna synthetase complexed with trna(met) and methionyl-adenylate anologue
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
497
structure length
465
Chain Sequence
MTLMKKFYVTTPIYYVNDVPHLGHAYTTIAADTIARYYRLRDYDVFFLTGTDEHGLKIQKKAEELGISPKELVDRNAERFKKLWEFLKIEYTKFIRTTDPYHVKFVQKVFEECYKRGDIYLGEYEKEPSYFFRLSKYQDKLLELYEKNPEFIQPDYRRNEIISFVKQGLKDLSVTRPRSRVKWGIPVPFDPEHTIYVWFDALFNYISALEDKVEIYWPADLHLVGKDILRFHTVYWPAFLMSLGYELPKKVFAHGWWTVEGKKMSKTLGNVVDPYEVVQEYGLDEVRYFLLREVPFGQDGDFSKKAILNRINGELANEIGNLYSRVVNMAHKFLGGEVSGARDEEYAKIAQESIKNYENYMEKVNFYKAIEEILKFTSYLNKYVDEKQPWALNKERKKEELQKVLYALVDGLFVLTHLLYPITPNKMKEALQMLGEKEFLKELKPYSKNTYKLGERKILFPKREG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for anticodon recognition by methionyl-tRNA synthetase.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Ligase/rna
molecule keywords RNA (74-MER)
total genus 161
structure length 465
sequence length 497
chains with identical sequence B
ec nomenclature ec 6.1.1.10: Methionine--tRNA ligase.
pdb deposition date 2005-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08264 Anticodon_1 Anticodon-binding domain of tRNA
A PF09334 tRNA-synt_1g tRNA synthetases class I (M)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.730.10 Mainly Alpha Orthogonal Bundle Isoleucyl-tRNA Synthetase; Domain 1 Isoleucyl-tRNA Synthetase; Domain 1 2ct8A03
2.170.220.10 Mainly Beta Beta Complex Methionyl-trna Synthetase; domain 2 Methionyl-trna Synthetase; domain 2 2ct8A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2ct8A01
1T9GR 1EJ2A 2QUJA 3SEQA 1I2DA 2DXIA 4ARCA 4RUKA 2E21A 4DDHA 3A2KA 1GLNA 2YWCA 5J5AA 2DETA 4YP6A 1U0BB 1OWPA 4HJRA 1NUUA 4EF6A 1O0BA 4EGAA 2PZBA 2BTEA 3IMGA 1F4LA 3PXUA 2CYBA 3CVYA 1Y42X 1LI5A 2X1MA 4J76A 4MUFA 4ND6A 2O8VA 2ZP1A 2CV1A 1PG0A 1KQNA 3N8HA 4PBTA 4MW0A 1LW7A 1R6TA 1K4MA 3D6VA 1H3NA 3CLUD 1TFUA 3QE4A 1WJGA 2E89A 5FO1A 1N2GA 1G8FA 3FNRA 4U7JA 4DJAA 1QRSA 3COYA 3ZXSA 4ZCRA 3H99A 4OUDA 1K4KA 3CLUC 1IVSA 1KH3A 2NZ2A 4JXXA 1TYDE 3ND7A 2JAXA 1LI7A 4L2IB 1QTQA 4H3SA 4YBRA 4MW1A 3VU8A 3ZJTA 3VRHA 3Q12A 2QJFA 5IHXA 1WXGA 2GOYA 3MMXA 4ZT2A 1M8KA 4XFJA 4MUJA 2QUIA 1J20A 4MLPA 1N2IA 2TS1A 5AHWA 4QRDA 3KT8A 1N78A 4AQ7A 4MUHA 2JA2A 1WOYA 1IQUA 1T9GS 3CLTC 4MWCA 2A7XA 3IUEA 2PXHA 3A05A 3OTWA 3P0IA 4G5YA 3G59A 4NX2A 1JZQA 4QBTA 5DASA 3KFLA 1JEDA 3VGJA 1J1UA 2R5WA 1NI5A 4MW7A 2CUZA 1RQGA 3RK0A 2PIDA 4NAUA 4JFAA 1VBKA 2CSXA 1SURA 1MAWA 1WXHA 2HGZA 3SZGA 1V8FA 1YIDA 1QNFA 1PFVA 1N3LA 2E18A 2HMAA 1JIIA 2A88A 4MW4A 1M8JA 1N2JA 3X1MA 1JIKA 1Q77A 1TQ8A 2D13A 3ZJVA 1KORA 4MVYA 2H29A 3AG6A 4I6EA 4E1AA 5F23A 3H9CA 2CV2A 4G6ZA 4KKVA 4KR7A 4L2IA 3UOWA 3A4IA 2WB2A 4MUKA 4GRIA 4WNYA 4MWEA 2IELA 3UY4A 5TEWA 2CYAA 1MRZA 1O95D 1F7VA 1OWNA 3IMEA 3KT0A 1MB2A 1GAXA 4G5FA 4PBSA 4I6JA 3ZJUA 4EG7A 1H1TA 4NAHA 4K0RA 3ISJA 4K03A 1IHOA 2AKEA 2J4DA 3BL5A 3FIUA 3N2YA 4ZCQA 1XNGA 5H16A 1J21A 3H05A 2QJOA 1U3DA 1OD6A 3PNBA 4ARIA 1VLHA 1QJCA 4BWVA 5DB4A 4MUGA 3IH5A 1QRUA 4ZT3A 3P52A 3IODA 2ZUEA 4CT0A 1PFYA 1F9AA 2A1TS 1N2HA 1S4MA 4HJXA 3SYTA 4HK4A 3ZGZA 1NUQA 5EKDA 3JXEA 2DR2A 2EL7A 3COWA 3CLTD 1VBNA 3CA8A 1K97A 1OBCA 4QREA 1NUSA 3DPIA 5HG0A 1O5TA 4EFKA 1O96B 2V0GA 5TEVA 1I6KA 4J75A 4S1OA 1G8GA 1FFYA 3IVXA 4UZEA 3RJZA 1JZSA 2BYTA 3ND6A 1U3CA 1Q19A 3IMCA 3P0HA 4DDKA 3CVXA 3P0JA 2VTBB 1NZJA 2OV4A 1FYDA 1IFXA 2QTNA 1YI8A 1DNPA 1T6XA 2H2AA 1YUNA 3INNA 3IOCA 1QRTA 3SZ3A 4WSOA 1F7UA 1WXIA 3Q4GA 1OWMA 4MAFA 3RBAA 5HUHA 4AS1A 1WQ3A 1N75A 2V0CA 3FWKA 1J70A 3L93A 3FI0A 3N9IA 4ND7A 5JBNA 3IUBA 1YIAA 3M5WA 1M8GA 1QU2A 1GTSA 4CQNA 1JILA 1GZUA 4KPUB 2QUKA 2XRZA 2WQ7A 1O97C 1KKUA 1IQ0A 3N05A 3SDBA 3CLRD 1KQPA 3FETA 3LOQA 3HL4A 4ZCPA 3PNVA 1KR2A 2CFOA 1OWLA 1O96A 1O95C 1H3FA 3AFHA 5LM3A 4MW2A 3CVUA 5LFAA 2OQ2A 4ZCTA 1X6VA 5IJXA 1NYLA 5HUJA 2CYCA 1Q11A 2X3FA 4PY2A 2O5RA 1P7PA 2VTBA 1IH8A 3K9WA 4EG1A 1O94C 3AKZA 2AZXA 4MUIA 1XNJA 1KAMA 1EFPB 1JGTA 1N1DA 4R2LA 3X1JA 3F3MA 2Z09A 2PZAA 3G5AA 3GUZA 1EUYA 1I6LA 4MULA 4KPUA 4NDAA 4MVCA 3KT3A 1TEZA 2A4MA 3AIIA 4Q16A 3DO8A 1TYBE 1MAUA 1XNHA 3FH0A 3RFFA 3U1VA 1U7DA 4U8HA 3GLVA 4YMIA 2GKSA 2PFSA 1EFPA 4CDNA 4ZT4A 2HZ7A 2J5BA 2DUMA 1YULA 3CLSD 2WQ6A 1MOPA 2Z3VA 2IP1A 2D5BA 2DLCX 4R0NA 2X1LA 3NBKA 4MWBA 1H3EA 1QU3A 1T6ZA 2VXOA 3HV0A 3QTTA 1NP7A 3S3TA 1R6UA 3OP1A 3CVVA 4MW9A 2A1TR 1D2RA 3IOBA 1JECA 1M8PA 3H9BA 1K92A 3FY4A 1WKBA 4EG3A 1Q15A 2J09A 2QTRA 4UZFA 5BNZA 3IOEA 4MUEA 1X8XA 3RHSA 1JIJA 4MW5A 3TZEA 1M8FA 1TYAE 1MB9A 2AG6A 5KCMA 3HMQA 5KWVA 3PNYA 2X0KA 3MLAA 2J08A 1J1ZA 1WXFA 4A91A 1OWOA 2ZUFA 1GPMA 2B7LA 4EG5A 1U7XA 3HZRA 5FO0A 1NSYA 1MC1A 1CT9A 4ZT7A 3FHJA 2A86A 5J59A 1O94D 2J07A 3C8ZA 1KP2A 1NUTA 5J58A 4RPIA 2NSYA 1A8HA 4YP7A 3LCJA 1ILEA 4Q93A 2A1UA 4F3RA 1ZH6A 5DK4A 4MWDA 2IJGX 3IVGA 3HGMA 1EFVA 3SP1A 4NATA 2D54A 3CLRC 3QTBA 2PZ8A 1NURA 3G6KA 1KAQA 4R2MA 1QQTA 3GMIA 1OBHA 1O97D 4MUNA 1JHDA 1KQOA 3MUEA 1N77A 3DV2A 2A1UB 1UFVA 4JYZA 5LLTA 3DLAA 1O6BA 3E27A 1ULHA 1G8HA 1JMVA 4EG8A 4ZT6A 4DLPA 4EG4A 3PRHA 5K0TA 4EG6A 3NV7A 1R6XA 5H7XA 3ILVA 1I6MA 4I6GA 3TQOA 1T6YA 3A04A 4XSVA 2JANA 1EXDA 1XJQA 1MJHA 3UMVA 4MQ6A 2RE8A 4KR9A 4KR6A 1GTRA 3ZIUA 1PFWA 4OJMX 3RK1A 5DEOA 3AG5A 3UK2A 4DDMA 1IRXA 1JEEA 4DE5A 3FDXA 3MLBA 2XRYA 2I1LA 2QUHA 1GN8A 1YUMA 4FZJA 1EFVB 3TNJA 3TZLA 4MVXA 4NZPA 3IDFA 1PFUA 1M1ZA 2RD2A 4F4HA 4GU5A 2PG3A 1KH2A 1BS2A 1IQRA 1ZJWA 1WY5A 3ZUGA 1O0CA 5FNZA 5KHAA 2A84A 2CT8A 3L92A 1WZ2A 4JXZA 4ZT5A 1N2EA 4XFDA 3COZA 2EJCA 5TS2A 2G36A 2YXNA 1VBMA 1N2BA 4MVWA 1WXEA 4X0EA 4DNXA 3CLSC 2CV0A 3ND5A 1MBZA 1WQ4A 3D6UA 3X1KA 3LE8A 4U63A 2QTMA 4P2BA 1KP3A 3Q10A 3ELBA 3H97A 1N2OA 1COZA 3IVCA 2E0IA 2WSIA 3K32A 4HPWA 3AL0C 2C5SA 3NBAA 2Z08A 2GM3A 1G59A 1EE1A 3MXTA 3ZXIA 3KT6A 1VL2A 1KH1A 3CR8A 3I05A 4JZYA 1HYBA 1B6TA 3SEZA 4YP5A 1V47A 1J09A 2YY5A 2YWBA 2QJTA 2DPLA 4TS1A 1NUPA 3HFJA 4CDMA 2DERA 1TYCA 4ZCSA 1M83A 1PG2A 3COVA 3FG9A 5K0SA 3FOCA 3TS1A 3UC5A 4OUDB 1EUQA 3CVWA 4MW6A 3TQIA 1ZH0A 2DEUA 1ZUNA 4PBRA 5TGTA
chains in the Genus database with same CATH superfamily
4MQBA 5AVVA 4UEWA 3CE9A 1FU7A 3DMTC 2QTVB 2ZYVX 3NLLA 3QZUA 4XQ0A 3AEQB 4HN2A 5BSKA 1V11A 1PTJA 1YR8A 2ZG6A 5IJZA 3KE9A 4UBOA 1NL3A 4GMKA 5DX0A 1M6YA 1KJIA 3Q40A 1BN7A 4JKYA 3SKVA 1OB5A 3SFTA 1RT9A 2VATA 1QHEA 3TLGB 2H52A 1SXJB 4PNHA 5FRDA 1U0BB 6CHYA 2JIRA 2EFEB 3DDWA 3IJRA 2IOQA 3MD0A 4QARA 5JCOA 3WGLA 5ED4A 2C8JA 5B7QA 3HM9A 4I8IA 3B9RA 1GJRA 4J76A 3AR6A 1B16A 4ZVKA 3C74A 1Y8CA 1NLFA 3EXFB 4RZXA 2NUAA 1Q20A 1JAXA 5REQA 3P2MA 1G2PA 4R0VA 1R6TA 4LYJA 1JALA 1KSHA 2MWMA 4ZHQA 4LS3A 1WJGA 4YR9A 4KZPA 3WE7A 5GONF 1L4KA 4G1FA 4OXXA 1XV5A 4WCVA 1U9CA 5THXA 2AVNA 2QN8A 1P0MA 3RBXA 2BPOA 5F1KA 4F4FA 5C8DA 2RIRA 1ONPA 3ESZA 1T8RA 5HX7A 2QJWA 1VKOA 3LHDA 4RTMA 1BD4A 4MDHA 3VNQA 1BX3A 3F6SA 1OFHA 1QYCA 3NNDA 1Q1QA 2X40A 1ZRMA 2P6RA 1G6Q1 4AWBA 3ZJTA 2Z5VA 1V6CA 3QXJA 3IALA 2W90A 5FWAA 3A6EA 2Q7XA 5FJIA 1U2DC 3DGFC 1RIIA 5G1PA 1NBMD 2GOYA 3DJYA 4UXIA 5GOZA 4FLFA 3D2LA 2G6BA 4KMRA 1R0RE 3T5PA 1YNSA 3EMDA 3BH6A 4XFJA 3WYDA 5JJ5A 5CYPA 2JEOA 4GL2A 4YCDA 2XOKA 4YBZA 1ISFA 1K88A 1N3IA 2A3NA 1TQDA 4BP3A 3ZHRA 4D92A 3U19A 2J0SA 4MV5A 5B1HA 4BNGA 3SC3A 2HD4A 1ODSA 4W8OA 2OG1A 2OC4A 3I83A 4HAWA 5AO9A 2O8FA 1XU7A 1MQ8B 3ACCA 1VDZA 1WMFA 3CLTC 4GSKA 4DR6B 2EKZA 1G5IA 5BR8B 3C16C 1A77A 4AJNA 3P0IA 3E3OA 1JZQA 3RFXA 3PVSA 1JEDA 1OX6A 5JAHA 2XBMA 3QBVA 3GG9A 4PAGA 4CT5A 2DQSA 4NZMA 2JFVA 4YWHA 4GQBA 1HOXA 4EFMA 4XYBA 2ATCA 3F9RA 5HGJA 4ZGGA 4HADA 2BFNA 3R5XA 4G41A 2I22A 1QFYA 4J0EA 4CBVA 3VNAA 1QYRA 3QVMA 1MAWA 2YVAA 3LU1A 3UT5A 1NUAA 1TU3A 5EXPA 3GA5A 3SAJA 2VDMB 3JVIA 3OFSA 3FVVA 4TV8B 4UBIA 1ZH8A 4MW4A 1IY1A 1M8JA 2FKAA 3PFWO 5CT5A 5A7FA 5LD2C 1JIKA 3TZHA 1GKLA 2LTAA 2CXNA 4FJ1A 1I80A 1JF8A 2ZRQA 3LW7A 4ENRA 3JR3A 4QFCA 4RPGA 5GADl 1T2CA 3OQBA 1DBVO 2ZJZA 3UOWA 1NNUA 1PI3A 1XTPA 2Y1XA 1CQJA 3DMGA 3KAKA 3NAZA 3TSAA 4ZIRB 2GTHA 1CUHA 4DGQA 4JHXA 3T3NA 3H4VA 4L95C 4OQEA 3SLRA 2PUFA 2C8LA 2C4VA 3CZAA 4N9QA 4BHTA 4WY2A 3QITA 4P0TA 3ADBA 4X3PA 3IAHA 3O3CA 4WK6A 1UAGA 3FYUB 3C6YA 3KLMX 4JJ7A 4JUCA 4UTOA 3O8OA 4Y1GA 4AZ0B 2RKOA 4WZ6A 2N42A 4O4JA 1OAOA 1H1TA 1QO9A 2GN9A 4WVFA 3BBLA 2E3JA 1PK8A 4X7BA 3I9KA 3KTDA 2GPAA 2ZSEA 3X1YA 5CVTA 2PJRA 3OHMA 1J2YA 4Q0MA 1QYDA 2NLOA 3NUZA 1XT6A 2XWPA 3BMQB 1OD6A 3BKWA 2QV7A 1GUZA 1YHZA 2Y93A 2ZYGA 2IU4A 3P4UA 1N2ZA 3PFKA 2WYIA 4N3NA 4WNAA 5YASA 4OQXA 2X5OA 1EEXB 2YRFA 3ENQA 4R1MA 1IZ8A 1DO8A 1U8CB 3F6EX 4OHBA 2ZUEA 3G1UA 3QE3A 4AECA 3FR8A 5K03A 3ZGVA 2DTEA 3KQHA 4LGCA 3R3WA 2V6JA 1WOMA 2ZSBA 4GI1A 3LWNA 4GWKA 3F6CA 3VYTB 1IY9A 4EUKA 4TMFA 2BM8A 4DDVA 1O7JA 2Z4TA 1V8ZA 3RT7A 4W9NC 1OBCA 4QREA 4G1BA 3UWOA 1O96B 2JCGA 3HH8A 1Z38A 1Y5RA 1JZTA 4PFSA 5BYJA 4EJMA 5LMCA 5FWXA 1CQIA 4NCHA 1ZL2A 4RTOA 3QPUA 3UXYA 4FJ0A 1UBKS 4JUFA 4AY6A 2UYCA 4UFOA 3U17A 3ZLTA 4OREX 4XQGA 2VF8A 3I1YA 5ADUS 3FAKA 1PVOA 4TRJA 1MRSA 5A9RA 2J9FB 2NADA 1FZQA 3Q2KA 1CR4A 2NACA 3WGYA 3E6AA 4JLNA 4AXXA 3HXOA 3LYHA 4HFJA 2QTNA 2ROQA 3HCEA 3WOVA 1WDLA 2BFOA 2JFGA 3IBTA 3INNA 1XFDA 2UVPB 2ZRIA 2ZRPA 4JA2A 4K2HA 4RV4A 1DKRA 1A9RA 5L95A 4ABTA 1C1XA 3FTNA 1F7UA 3OJLA 1D2HA 1NXQA 2VN8A 1F2DA 4TRNA 4RIFA 4L5BA 4CKWB 4IILA 1GAJA 3KPUA 1IZZA 4D82A 2OBMA 4FP9A 2N1MA 1DBRA 2H0QA 3P2KA 2V1UA 2OXEA 3QHQA 4HF7A 1G9XA 1A98A 1B2RA 5CM9C 3QX7A 5F77A 1UR5A 5AVOA 3V8VA 2EEZA 2FFHA 4DR4B 2VJBA 2IL1A 2Z2ZA 3WLKX 4GI2A 3PEYA 2VJPA 4QDOA 1KFCB 1AN9A 1TM7E 1EZZA 2IA5A 3OT5A 1N7GA 5IG2A 1DJNA 4AO7A 4JGIA 3OQVA 1B8OA 1G3IA 1K1EA 5JJBA 5IKPA 2AN4A 4DCPA 1G64A 1NLUA 5F1OA 1BOFA 1NBIA 3CC8A 2GD1O 5EE3A 1OILA 4JVSB 4ZCPA 5EC8A 3ZCPA 3D1VA 3NT2A 3WK8A 2C2ZA 3CRMA 1FEZA 3BSSA 3EE6A 3BE5A 3SF8B 1SC1A 4A73A 4QXQA 1ORVA 4O8CA 1IUKA 4C0AC 4UE6A 3BFKA 3NIDB 1JG6A 4K26A 3CGWA 2P9EA 5INTA 4N49A 4YCBA 3ZCVA 2P2LA 1Z06A 3NH9A 2OZPA 2XZOA 4LY0A 1N9ZA 1L1EA 2VJOA 3GD7A 4G0ZA 3H0EA 4U1RA 2O5RA 1N2SA 1O9HA 3GNSA 3KZOA 3RVQA 3HUUA 5TT1A 3TOXA 4II2A 5NULA 3KQKA 1EUDB 3CH7A 3I34X 2Y66A 3DA8A 2F9MA 4FE3A 1EUCA 4RHEA 3T5MA 2EBFX 2X8WA 1S02A 4GM0A 4MS4B 1BW9A 1DE0A 2VH5R 2VT6A 2ZWPA 2Q0XA 4G0YA 4QXMA 4IDNA 4J29A 4JBIA 4CKBB 4FEAA 2AF3C 2WAAA 5K4HA 3DFMA 1U4NA 1S7CA 2RAFA 4MRMA 1IPHA 2DLDA 2DHQA 2Z1DA 1E2QA 1H8ED 2DZDA 4H0FA 2RHCA 2VYVA 4XD7D 1RI5A 3VI3B 4EGQA 1RE0A 1REQA 2YFKA 1JV2B 2NNWB 1JQLB 1W52X 4AQDA 1U7DA 1H2RS 1KWGA 3H84A 1OGIA 3KEQA 1PWXA 3I4CA 4UVIA 4OB6A 4D9HA 1YK0A 3IAEA 1XYVA 2G80A 4TL7A 4EKIA 2I71A 3KZCA 2XBLA 3Q88A 3FNGA 3IVMA 1TCCA 4AG6A 2BAGA 1Y8QA 4KQFA 3R7BA 5JSQA 2ZUDA 5ARCA 2H2DA 5HF6A 4RF3A 4K9DA 2DLCX 2P35A 3W5IA 1RCUA 4XDZA 5CHEA 4AT1A 1F5SA 4IDFA 1SD2A 4U7PB 5FPHA 2A1IA 3PKJA 3K9CA 3O5AA 1OLXB 3MWJA 5K0LA 4A6PA 5JMTA 1H3EA 4U6SA 5I3ZA 1UMDA 3BVPA 4KXYA 1CR6A 4PR3A 4DLRA 4KAXA 4ZD6A 1PJTA 2YNMA 3KYCA 4KXUA 1RYFA 1UEXC 4Y2PA 4CF4A 1R6UA 3CW9A 1NGSA 4POOA 1B8PA 1ZMTA 2HO5A 1I2MA 4I19A 3RS4A 4UTPA 2MDTA 5D00A 3FY4A 2FWMX 1BHO1 2J09A 2ZJ4A 3IBGA 3S7TA 5CDGA 2J6BA 6NULA 4JI5B 1YR6A 2D0OB 1A9ZA 4XEUA 4NNOA 3OSUA 2EIXA 3LVBA 4K6MA 4A36A 3VR4A 1CULC 1OAAA 2C5BA 3TQFA 1OZHA 5KJFA 2DMRA 3HMQA 1F38A 5KCMA 1J9EA 3UBTA 1MOZA 1Q1EA 4NHEA 1DG3A 4C2AA 1UBLS 3E8MA 3UA4A 3QPAA 2BFCB 4ZA2A 3FOEC 1AQUA 1ZVQA 2VFAA 2C2YA 2HNKA 3GW8A 4NYJQ 3KYIB 5CH5A 4EG5A 4U3JA 4G5GA 4O0LA 2DR0A 2ZULA 5K3DA 4BTLA 5TIIA 4NE2A 5CJJA 2V9CA 1BVUA 3EXG2 3LA8A 1KGDA 5FTJA 2DFVA 2HWYA 2MSCB 3WMXA 1WU7A 4MKHA 3Q8KA 4FYWA 3ASYA 3P2YA 4ZU1X 3LLMA 4KJXA 2W2NA 2GVNA 1U2SA 3K20A 4WXYB 4F3RA 4L9AA 2B5VA 2HSGA 1WVMA 3AVOA 3KJXA 4L6IA 4U2KA 2OV8A 5JC8A 1FFBA 5JR3A 3R6WA 2JRCA 3HBLA 4EARA 1NBME 2D54A 4TLEA 3ZZUA 3E5HA 2QTBA 3CJRA 1S2MA 4CUKA 4BO8A 1OVGA 1OZGA 2FJPA 1SHZA 2GZ3A 2Y1KA 4HQ0A 5DWDA 4DG8A 3EEOA 1KAQA 2PV7A 3RAFC 9ABPA 3NEYA 2BLNA 1JEAA 1Z16A 3IAM6 2FDRA 4CF7A 1P6QA 1W4AA 2OYSA 3F4LA 2HDNB 1PT6A 4ER7A 4ZKDA 2PSSA 2ZKIA 3T9FA 2V7PA 4TKUA 1SCQA 1SUWA 5FUVA 4FOTA 1UANA 5TY0A 2WWIA 1DJQA 4GNKA 5JSYA 2YL2A 1ZVVA 1YMQA 2ERYA 4ENQA 5IAJA 3KUCA 4EECA 3RVSA 1JQKA 4IG4A 1KI7A 2BEWA 3D0KA 5ALJA 1QQBA 1HDEA 1NR5A 4Q12A 5I9SA 4MO9A 5FOWA 3KQWA 4IZHA 4QEDA 3ZKWB 4C4SA 1DHTA 3K1YA 4EG4A 3BXPA 1FTSA 3O8QA 4PM4A 2XKJE 5HPYB 1UBGA 3NV7A 1V2HE 3MQFA 3FBGA 4MVJG 2VR1A 1Y7TA 4ILKA 2FWIA 1TADA 2AFHB 2R2AA 2FPIA 3B20A 3PPYA 1E89A 4XUDA 1EGHA 3WGIA 1DQNA 2PUAA 4O02B 3TRHA 1LQ2A 4LQDA 3VPFA 1WPGA 2VNHA 1DC6A 4HWRA 4LTDA 3G6WA 3WBBA 3GNQA 3JYNA 3DW1X 1A8UA 1ZJJA 5BV7A 3DPUA 1RI4A 2RK4A 3GT0A 4XPZA 5JFOA 2FPGB 4PPNA 5JNLA 1CC1S 3HR8A 4L4ZA 4UM5A 1T9KA 5C51B 4DC9A 3NHKA 4I3GA 4E94A 3Q6MA 4YALA 3SNKA 4I55A 1UBFA 4OX9B 1XCGB 3MTIA 3EIQA 1Y3IA 4ER3A 4QDUA 5HJEA 1TKRA 4BNVA 1SNYA 3FHCB 3PVZA 4L6AA 2ZRJA 2C77A 3IKJA 3WGGA 4JJ8A 4Z7NB 1QRRA 2Z3WA 1HF3A 4IYJA 4M49A 4MQEA 3VNSA 1VYUA 3EPJA 3DE6X 2G63A 3HY6A 3K09A 3G0OA 4P7GA 2P78A 2O2ZA 3CUTA 1WY5A 3TLXA 2ODNA 1M9NA 3P1JA 2CLCX 4BMVA 4NOMA 1NI4A 3BB3A 4MA5A 1EBBA 3DZHA 1NF2A 3UNXA 1T91A 2Q27A 2ZUVA 4CV0A 3AUYA 5COAA 3RYHB 5AVKA 3KLNA 4TTRA 3RROA 4N12A 3KBOA 1YSCA 1CUSA 2D3TA 1QIDA 5AK5A 3BZUA 4K3VA 4KRXA 5TS2A 2OB1A 5ITVA 1TMGE 3OM0A 1FSZA 3VPSA 2DHRA 5BSVA 3IJPA 1GILA 3VH1A 2O2JA 3H42B 1VM6A 2H4JA 3CW8X 1Y9AA 4YEDA 3O82A 3SGLA 1UBJS 1XLUA 1NVTA 1QGOA 1QLWA 1O95A 4HDKA 2PXXA 3TXYA 5LXTF 4JL8A 4KL8S 1YDFA 4DCSA 1QAOA 4WMLA 2HW8A 2QE7A 2HR1A 3ZR4B 5MGBA 1E7SA 1A5ZA 4FBLA 4JC4A 5AOBA 5FWNA 4P7FA 1LLDA 2QP4A 3DYIA 4KN9S 2WUDA 3F1LA 4XFKA 4RPCA 4DHEA 1FFDA 3WGZA 4KBGA 3VZSA 3IILA 3LRPA 4BMYA 5FEUA 3OIGA 3P71T 2WOOA 1UDCA 1AB5A 2GM3A 3GBPA 2GCPA 1GHTA 5KJ1A 1A7JA 3MXTA 3E7XA 3OJ0A 1KI2A 1PHPA 2AMJA 1H9AA 2D1FA 4D4IA 4N0QA 3V7YA 3HCFA 5A4IS 2NAPA 4NTZA 2I9KA 2P1RA 1J09A 2PLWA 1PD1A 3HA7A 3K6SB 4KODA 2IXBA 5HKLA 1IN4A 3F96A 1PG2A 3W1EA 4PZZA 1TYEB 1YJ8A 2AH5A 3HN6A 4NU6A 2PX0A 2CL5A 5EQTA 4Z6KA 1C3OA 2XE6A 5A4JA 3GGJA 1BMTA 3KSZO 1OBOA 2YN4A 2XGMA 4GYKA 3UJBA 2FAXA 3VAZA 1HTBA 1ECPA 2EZUA 4N3CA 4BNWA 3VZQA 2FUEA 1HQCA 2FZWA 2NU6B 3F0TA 1UC4B 3L0CA 2DFNA 3NAGA 1RWQA 2AHOA 5I9BA 2Q2VA 5A3VA 3TXXA 3ZJYA 1F8XA 2JLBA 1HMPA 2XT9A 2BVNA 3C4VA 4GZ5A 3VA7A 3GT4A 3I6YA 4QASA 4AJPA 4BU1A 5JAIA 4OBWA 4OHUA 2FPKA 4IMJB 2WAXA 3JQ9C 4YNBA 4BRSA 2ORED 5C4MA 4ENPA 1J0AA 1SY7A 1E3WA 2G4LA 1G7TA 4QXOA 5CA1B 3EXEB 1Q0RA 3DE5X 4F45A 1HH4A 4H4EA 5CDTA 2X1MA 5IYZA 1KYYA 1G8PA 4ZEXA 3VNBA 3NHAA 5KKNB 2Q6TA 5DNEA 3EF0A 4V2IA 5ESXA 2BELA 1ILWA 4QPZA 4F38A 5TB5A 1A9QA 3FPGA 2OXRA 2J6CA 1H3NA 4K6OA 1XZQA 3ECCA 5FQOA 1SVIA 3GEBA 1IULA 1NVXQ 5DPMA 3W8DA 2V3WA 3KQNA 3FNRA 1A3CA 1UPUA 3GP3A 4D9EA 4PLZA 4EZIA 2JCYA 4XD7A 3OFVA 4UHKA 3KTOA 1W36C 1S2DA 1T15A 3LFTA 4B2YA 2FR8C 3CLUC 3UMJA 2NZ2A 1ICEA 4E4RA 3L1KA 2Q5QA 4JKIA 1YR9A 1F06A 1K8YB 1XD2A 4X62B 4BCDA 1EGQA 3R0IA 4CI9A 4HXEB 3GAZA 3PQEA 4PRYA 1FX1A 1I10A 2XWJI 3UYKA 3VPDA 3OOYA 1B6GA 4A8TA 4RKRA 2NP6A 1I4LD 1TT5A 2B4YA 1MQ9A 1FDWA 4YJHB 4GC9A 1KF0A 5CA0F 3KCNA 4O2LA 1HV8A 1ODKA 5IAGA 3WGNA 1KKMA 1VE9A 3KZKA 4B3BA 4NKRA 4ZEMA 2OPBA 2VTDA 4M0LA 2JFFA 1YDEA 4I50F 2W9XA 4O4HB 1BE8A 4IQGA 2QUBA 2MMCA 1IM8A 4WASA 1I51A 1YB1A 1I7NA 1DAEA 3BTUA 4L5JA 1FUUA 4LXXA 2FW8A 3R23A 5KS2A 5KVVA 4WFJA 2QVBA 2WJ3A 1J8YF 3UKDA 2HEIA 5JJLA 3DPSA 4BZXA 3A1DA 2AEFA 5IBRA 2P9TA 4YGXB 5AXDA 5DASA 1J1UA 2WF6A 3LUHA 4U9HS 5T8KA 2R5WA 1O8BA 2OL4A 1KMIY 2XMGA 4LV6A 4P4UA 5F2KA 5B5SA 3OO1A 4S0XA 3WLOA 2H00A 3EVAA 2WSBA 4I0WB 3AXSA 3RTBA 3GO4A 2YJ4A 3NT4A 1VQ1A 1OLSA 2RGEA 2IPAB 3PGA1 3PHJA 4D9JA 4EBFA 3D0QA 3LX8A 1RAEA 3BK7A 2L2QA 4UU1A 3CZRA 3WQSB 5ES4B 2KS6A 2YV2A 4OSPA 1B0UA 3A1WA 5EMMA 1M6VB 4M53A 5C1OA 5TC4A 3AILA 2UYHA 1JE0A 1YASA 5KYVA 4AG5A 1HYQA 1RYNA 2PXAA 5C34B 2GZSA 3OKFA 3V8RA 4RHTA 1XNQB 3H9CA 2B1RA 2YQ4A 1POXA 1RKXA 3QPCA 2C61A 2HJGA 2YHIA 5K3AA 1MABB 1NJ6A 2YS7A 4G5RA 3SJZA 4AMZA 1TE2A 1T35A 1PYGA 4WNYA 5ERXA 4F46A 3OC6A 4MS3A 1DINA 2I3ZA 2WYVA 1OWNA 2IZ5A 4DMKA 1RZRA 1T2VA 3PIIA 4ZQEA 4NNPA 1H05A 1CEQA 4F8EA 3R40A 1OE0A 5B64A 3VSCA 4QUDA 1LX6A 3E58A 3HO8A 3PXDA 3KDPA 4CM9D 4MP3A 5JYBA 3AEKA 3ET5A 5T5QA 4CV1A 3LUCA 4LVNA 3R9KA 5I9LA 3EUEA 3ISJA 1RMTA 5B3LA 3BAFA 4PPYA 4QUEA 3GLIE 5KWJA 5FLEX 4EENA 5AYVA 3TI7A 3PNBA 3HXTA 1L6IA 4RV9A 1X9IA 3PHHA 3BFPA 3R0VA 3LM8A 1H5NA 1CZOA 3IODA 1V39A 4BFZA 4F8YA 1F9AA 3SICE 3I32A 1EWVA 3FPJA 1WMDA 5EQJB 4X9XA 3RIXA 5I7FA 1XQ9A 1A0OA 1Z4MA 1ZOOA 4EUFA 3PDWA 4J2TA 1GQYA 4PPFA 5EKDA 4PYJA 2P5TB 3M2TA 3OZEA 2DX7A 1G4HA 3FN4A 4HEA6 4LYGA 3DMTA 1NHGA 3P2JA 4RVGA 2DTDA 1YCDA 2X14A 5DGIA 4TVSA 3D7RA 5MHTA 2VRBA 3W9SA 1EE9A 4NCKA 4RAQA 5A02A 1UQUA 5CXXA 3CTPA 2VF5X 3NVKI 1U8TA 2XHZA 5CXUA 3WGMA 2C7QA 3AHCA 1U3TA 5E0KB 3AP1A 3JD2A 4Z3KA 1WRBA 2BSQA 4DWOA 4UNPA 4OXKA 1RWNA 1YQDA 4KV9A 2VTBB 4X6UA 4KLRA 1JXOA 2F17A 3AP3A 5DSTA 1YUNA 3V1KA 5KEIA 1E5VA 1NMEA 5FT9A 3SZ3A 2ACKA 1ZCAA 1LPSA 4KNVA 4Z8XA 3EPLA 2Q1TA 5CFZA 4U0KA 2B4QA 5CW2A 3JQ8B 1I4EB 2R6HA 2PUVA 4UNNA 4XGIA 3GEDA 2RGCA 3GDWA 4PZLA 5DGXA 1WQ3A 5KKCA 1D7AA 1K5PA 4QU0A 3KB8A 3HCPA 2ZR0A 4MARA 2GX6A 5FWYB 4G0UA 3N9IA 3TW8B 4S1NA 3M5WA 5KJCA 4LHVA 3RTAA 1CUXA 1H5QA 5JZSA 3D2AA 3HR7A 1DBQA 1R6BX 3OJCA 4FC6A 4DREA 4Y6OA 4ARSA 3Q0IA 2F1JA 2G5TA 3MCWA 1DQRA 2VZ8A 4LFCB 5M7EA 1J2RA 3IEVA 1ZG3A 3DLHA 1Z2EA 1YONA 3VJLA 3KJIA 2XYGA 3DBHA 5E1OA 1E60A 1BD3A 1P0FA 2GBPA 3COPA 1NXVA 3HL4A 4FI3F 2HQSA 4IIEA 1XX6A 1DTWA 4G8DA 4LMAA 3VDRA 4BKUA 1XTQA 2C00A 5CLHA 4CCAA 2FPOA 1CBUA 1Y3CE 1Z5VA 4K7JA 1N92A 4U7GA 1CB0A 2VHJA 2Z0MA 3B53X 3P2OA 4GL4A 4L5CA 4WKOA 5EEHA 3T3MB 2JAOA 3B1XA 3PBKA 4C30A 1P1RA 1RWKA 1NVGA 4RULA 2EERA 2D5AA 3UMFA 4V0OA 2BFDB 1JFFA 1MZPA 4JB3A 2OHIA 1A9YA 4FUTA 4I9HA 5A0FA 2AUTA 2COUA 1I7DA 1XALA 2FXIA 2VJMB 2R86A 2IYUA 2XUDA 4QE3A 3ROGA 1PWZA 1UKYA 4AYWA 3OEWA 4YDSA 1VIDA 3BK1A 4EG1A 3K9WA 4YO7A 3UJPA 1UC8A 4IL5A 1T9BA 2FH5B 1A7KA 1VBFA 3K92A 1MJNA 2BHRA 3C15C 3UWSA 1X39A 2P2ZA 3N2LA 5BW6B 2H7CA 4J3NA 5HTOA 4NU0A 2GVZC 2FEAA 3IP5A 2I0FA 5FB3A 3ZGLA 2WHPA 4J3FA 3JRNA 3AERB 3P9PA 2YS6A 3NBFA 4D5GA 2Q3CA 1TCVA 1J0DA 2HKIA 2A59A 2QJRA 4KQCA 2AQ8A 2GBGA 2D1SA 2HA2A 3K2QA 4KDRA 4EFLA 4L4XA 4ID9A 1SC6A 4OV6B 3TSYA 3RFUA 5HVNA 2VCYA 2ZSJA 3EEFA 3RF7A 1VRVA 1E6CA 1SQGA 4OXRA 3ZCTA 1VRWA 4CDNA 1RPAA 3B9QA 1B0ZA 3OJFA 2HZBA 2D2EA 2V74B 4DDTA 2DUMA 2G25A 4BRZA 8MHTA 4X24A 3Q9UA 2I6FA 2ECFA 3NC0C 1ZGZA 2OCIA 2Y0DA 4ZFNA 4ZGBA 5JCJD 3QMPA 2E7ZA 3GFGA 4CTNA 2FW1A 2F90A 3AFMA 3AVXA 1JDVA 2WT9A 1H93A 1YB6A 4YRPA 4REQB 5CGZA 2CUTA 2Q8PA 5FPSA 3NYQA 2FEXA 3KQPA 2HRQA 5FADA 1P0CA 3SC4A 2ECKA 1IHXA 3ORYA 4RVOA 1OYWA 2XLCA 3BH7A 3TFWA 2UXCB 3A1NA 1V3VA 5K0NA 1YS2X 2B78A 1J42A 3V48A 1EZ4A 4UAJA 2BKAA 4YP1A 1AMUA 4OXQA 2GPYA 4ZV4A 3A58B 1PJLA 1QGUB 3EHDA 3IVAA 3FPFA 1Q7GA 4LI0A 4LOJA 3KWLA 4DLXA 1ECJA 4QQ8A 4J6EA 2IQIA 2AK2A 1PKXA 4ZU3A 121PA 2ZIZA 1OFUA 2VTVA 4EY5A 1DC5A 3UJ3X 3DE0X 3DE4X 1ZA1A 5T8KC 3KKPA 2B7LA 1FW6A 1DAFA 1TCAA 3RVRA 1NSYA 2V7QD 2IY7A 3Q7PA 4P1ZA 3HPRA 5BWMA 2VZ9A 2ZSHA 3I73A 2AKAB 3RT9A 5DK6A 1XUOA 3EGXB 5CG2A 2GF0A 5HYVA 3AP2A 1RYEA 1DUIA 2D59A 4A0RA 3DAPA 4RY2A 1X7XB 4JJAA 1CF2O 1LBTA 3QY9A 1E77A 2VJDA 3S6JA 4AF7A 4W5QA 3NVMB 5JQGA 3V8MA 1A96A 3VVCA 3AR9A 2I03A 2APJA 2MR5A 1AKTA 4LGMA 3ZWKA 1N0VC 4PX3A 1W49A 4YC7A 3ZY2A 3EUWA 1O5IA 2VAVA 5JI2E 4K9RA 1J24A 1SD1A 3GFBA 2Y68A 2IJGX 4RJTA 5JTTA 2GA8A 5JE8A 3VOTA 5K2OA 4QPPA 1PZFA 4XM1A 3A4VA 3D3WB 3RU3A 1VL6A 2GFHA 2OILA 4PNPA 4MPRA 1PW5A 2Q5IA 5K6AC 2R65A 2O8EA 3NHRA 4PYMA 2JFBA 1D4FA 1NXWA 3E7DA 4KTTE 4N48A 5GV7A 2IXAA 3IXQA 3AIKA 1WSBA 1EIZA 2HHAA 5GTDA 3K5IA 4DAEA 1HDZA 2ZRGA 3ZKAA 1FFHA 2Q2QA 4MR8B 2WF9A 3EVDA 5ED0A 2CJWA 4FYMA 4B4VA 3ACDA 5T67A 1P5JA 2CCKA 3I9V1 3DHWC 1E0AA 1JKFA 3T1YB 1FP4A 3AIOA 4G4SO 1VCOA 5DYIA 4F60A 4US2R 4N5MA 2UXDB 1V37A 3IQDB 1RRMA 4F93B 4Y30A 1AMNA 4RGVA 3LF1A 3ECSA 5EIBC 3UUWA 4HYTA 2CVQA 5KNBA 3MHPA 4YCNA 4IHKA 3OA2A 5IDYA 1TCBA 4BLSA 2BEVB 3KC2A 3KKKA 4EDHA 2C5AA 2P9QA 3HACA 3RJ9A 3LY9A 3E0XA 1WAMA 1D7OA 3DOCA 1Y82A 4HOYA 4S0ZA 4DJEC 4EW6A 3F5QA 1U5CA 3U9LA 1J25A 1Z5NA 4C2TA 2PPVA 1SUDA 1K6IA 4X97A 1CUZA 2XRFA 4CM9A 5IJ9A 4A8PA 1W6RA 1PFWA 2CXOA 2JGKA 4KOEC 1PGQA 1MT0A 3H4MA 4FIZA 5IXSA 4MUXA 2P9GA 2ZYAA 1H2ZA 2C20A 2UKDA 3FDXA 2P0EA 1YA8A 4CIVA 3CRRA 2B9EA 1CF9A 4BUZA 4UTXA 1TIBA 4QDKA 3I61A 1SOAA 5ICFA 3TLYA 4LHSA 1BXKA 3VU0A 4FFPA 4XKJA 2J31A 2PSDA 3QEAZ 1G20A 2QUHA 5AOVA 1NE2A 1T2FA 4N6NA 2OO7A 3IDFA 1ADJA 2WVHA 1Z4NA 4AROA 1E2DA 4I08A 4UC0A 2R60A 4UULA 2Y4NA 2Y3IA 4FCWA 2P8SA 3CZQA 4M0MA 5CVUA 1T1JA 5BSMA 5BQ3A 2QW8A 1ST2A 3PI6A 4PGAA 5MFZA 5HNKA 1Y6ZA 5ICMA 2CZQA 3ENVA 3U4QB 3M6FA 1Z25A 1XQXA 2ZI9A 2ZYIA 5FA8A 2R11A 4D42A 2WIFA 2YIMA 4F3NA 5JJIA 4CM1A 5EIFA 2QKYA 4CCWA 1AD2A 2C82A 4TMXA 3MTBA 1P1JA 1XMIA 3L07A 3RSSA 5BT9A 4R2JA 3OBBA 4UCFA 4XTCS 3MCUA 1QVVA 1U0OC 5TQ0B 2CHUA 2ZB2A 3C7CB 2PGJA 4EHHA 1WNTA 3ELUA 1PX0A 2I6SA 2YNMC 4Z2YA 3N2KB 3V1UA 1QYXA 1S0UA 3PCTA 5JSZB 4YWJA 3SVTA 2P7HA 1EK0A 1E3SA 2HN9A 5G1NA 2QVCA 3CLSC 4IF4A 4JR2A 5CT6A 3V4RA 3JW8A 3HV2A 5JANA 4KWIA 1Q92A 2GF9A 2IXEA 4HMOA 1NN5A 5WRFA 4P2BA 5AW2A 4GBJA 1EFAA 2XDWA 4N65A 1V25A 3ANLA 5ALRA 5JTUA 1J8MF 1URPA 4OLBA 4PPGA 2PH5A 2IEYA 3LF2A 2C9ZA 1WV1A 1BNCA 1WMSA 2HPAA 1BEZA 2JCXA 1CJKC 2O3RA 3EQ9A 3ITEA 2YOFA 4HPWA 4RANA 2QIPA 2J46A 3C3PA 4ESHA 1MOQA 3OSZA 2P0YA 3KP1A 4TTIA 1RZRD 1OI7A 2BMDA 2PLNA 2JGDB 2VXCA 4LYHA 4NJEB 1F5NA 1KHTA 3TR6A 3ZU6A 3KHKA 2Q6VA 3CR8A 3QUQA 4OD0A 3QY0A 4EW1A 2JBAB 3LDGA 4DMLA 3THYB 1G41A 1NFQA 1U6IA 1DFIA 2CEAA 4LSWA 5IMSA 2BFPA 2W6OA 5COBA 5AM0A 3DL7A 4QTXA 3RH0A 1KYXA 2DSTA 3RSHA 1S2NA 4HC4A 3STUA 4O2RA 1J23A 1HGXA 3MJTA 3HTXA 3PEEA 4YRZA 4F1KA 2B3TA 2CKMA 4M36A 1O08A 3DWGA 5ESWA 3RUDA 4XX0B 4BQOA 4KQEA 2QTFA 2D2IA 4OIFA 2FPRA 4GQAA 3EEQA 3G8BA 3N2NA 3S2FA 3SEQA 3DEKA 2WYOA 3TYXA 2IW3A 1CDOA 1JLRA 2G77B 4RO0A 4KI7A 5AXCA 1EX9A 2X9VA 3I2IA 1RHUA 3ESXA 4C0JA 1KEEB 1GG9A 3SD7A 1YRYE 3MVEA 5EIHA 5J5AA 4KXMA 5IFKA 5JY6A 5I51A 3FUUA 3RQSA 4HVCA 1MKYA 2D8AA 5G4LA 1ZN8A 5GZ6A 4DN6A 7YASA 5BWCA 4NS1A 2VSOA 4RHXA 1V5GA 4WOBA 3U1TA 5KYTA 4LJ9A 2VYQA 1U1FA 2W00A 3UPDA 1XCPA 3I28A 2AJTA 1HO3A 3EF3A 4XVHA 4HEHA 4GC5A 5LDGA 3HA2A 1ECBA 1EX7A 2JAUA 4B45A 1KNXA 3ZV3A 5AW6A 4CEHB 1NRJB 5AI8A 4MW0A 2PX5A 4F9EA 1UPXA 1COWD 2OCGA 1PR6A 5JZMA 1QZZA 3INYA 3TTXA 2CFCA 1TFUA 5LUBA 2CDRA 4MK4A 4C05A 1AURA 4YJ3A 2R1ZA 3KAPA 1QOZA 4NR0A 1SGWA 4N5HX 4WTOA 1JQEA 4R01A 1S1CA 4DJAA 2ID8A 3ET4A 3V4OA 3AETB 1NVWQ 1OJLA 1N57A 4MQFB 1JG1A 4FPXA 2NZJA 3EH2A 2E37A 2TRSB 5CBPA 3X1WA 1T4CA 3W06A 2XE7A 3NJ4A 4JS0A 3RYFB 1THZA 3G8AA 3VU8A 1N5LA 2X3UA 4HS4A 3PS9A 1IY0A 3B1JA 5AKJA 1Y9EA 4B3IA 1XQ1A 4CF3A 4DIFA 4TKVA 1KK1A 3LS2A 4KJZA 4KYTA 1M2OA 1V5IA 1WXGA 3L8ZA 3ZQUA 4FE7A 4BKRA 5BN4A 3IEKA 5K4AA 5JALA 3EDOA 3IOYA 5EYPA 1XKXA 3QMVA 1IWOA 2FSFA 3NWJA 5B3JA 5C32A 3O83A 3EK2A 1KEVA 4EWLA 3GJ6A 4NBKA 1UKEA 2VJAA 2ZRBA 3A3OA 3I0NA 1GZ7A 1P9WA 4HZIA 5AHWA 3WQRA 4FKBA 5K45A 3N7UA 4CL2A 4RZIA 4P4NA 4BFCA 4HXYA 2A67A 1Z8DA 1LBEA 2VPZA 2WTEA 3B8EA 3C24A 4EHLA 4EY8A 1PTKA 4W9MC 4LXUA 3ZDAA 5MGNA 3K5HA 1XL1A 3CF2A 4NMHA 1W48A 1LLQA 3A05A 4F4DA 4UUAA 4JBHA 2QGNA 3KSDO 1GA4A 5EZ6B 2XXBA 4MW7A 4D98A 2VPIA 2CFIA 2JEYA 2ZBGA 3O2QB 5A4FS 5BORA 4ITVA 1Y9JA 2WMYA 4C9BA 4PNEA 2C5EA 3LIIA 4V3CA 4AMYA 1I3CA 2M2IA 5CXQA 5IXYA 3ZNPA 1E5QA 1UP4A 4KXNA 3HKCB 3OESA 1YA6A 1P9OA 3SIWA 1L7EA 3QG1A 1EHYA 1CUGA 1AGYA 1TDJA 3IB3A 2HMAA 4MEJA 821PA 1TAQA 1XAIA 4YREA 3G5TA 1BVHA 1HL3A 2CE2X 4Q1AA 2AQHA 2FGKA 3B48A 3TE6A 1B73A 4JENA 1GADO 1ENYA 2ZEJA 5LR6A 2QGFA 3PKIA 3MPUA 3K2BA 4GR4A 5DP2A 3KQQA 1C1YA 3L5KA 3EQZA 4DCUA 4TYPA 2WKWA 5JCPA 3EHEA 4MH0R 1F8UA 5T41A 1OZFA 1U3FA 1H8EA 2GTIA 2HWWA 5FWXB 2B35A 1ZHFA 3F71A 1AF7A 3KPJA 3MNFA 4JNKA 4EHDA 3ZBPA 3EIXA 4CM6A 3RTEA 1O77A 4A5SA 3BB1A 4WFKA 2AX3A 4BFTA 4NP6A 5AI6A 1DZIA 2TSYB 3R7SA 4ZK6A 3ABOB 2EFGA 4WBNA 3K35A 1LWOA 2NZXA 1QUEA 3QLUC 1O54A 4L73A 5J2TB 2NTNA 1JJIA 4Y98A 3P27A 2O2GA 2PMFA 4QTYA 4OA5A 2VAPA 5JZ9A 5JJKA 4X8MA 3H05A 3BRQA 1GDTA 2OZVA 5BQOA 4BWVA 3UV6A 4UDXX 3DAYA 1R8YA 1V35A 2ZTSA 3DUFA 4PZ9A 5G0VA 1ZR4A 4CEIA 4IHJF 5EXTA 4RX1A 4B81A 3OAAD 4N4AA 4RQBA 2HTEA 2O9JA 2CL0X 3KYBA 5C1BA 1OT3A 2P2GA 1EXNA 2IYQA 2F64A 1CWUA 2A9QA 2H4FA 2IIPA 2WQZA 2XCQA 4FFVA 4D02A 5LQDA 1PQWA 3D4PA 3CLTD 5FL7D 4RK6A 2HRCA 4KEAA 3WGHA 3CX8A 1N5OX 1XAHA 4OQNA 4Z0TA 4BP8A 1XN1A 3IAS6 2ZCVA 1YZNA 4YT4A 1HZJA 1PEYA 3HDYA 3HKBA 5LNK1 4UZEA 2JZCA 3R0ZA 3GPIA 1LF0A 1K7YA 4F7DA 2FQXA 1YIOA 2PJZA 1NP3A 3REQB 4TPKA 5EWJA 5DBOA 4IDDA 2ZIVB 1A9SA 3VH3A 3JQCA 1UBMS 2OUIA 3GGPA 3GJ7A 1A9XA 1R6VA 1ZC3A 2QZ4A 4KDEA 4GSYA 1Y6RA 1TVCA 3DBOB 2RHBA 5LOVA 3EF1A 1W25A 2B7CA 1JYFA 4CU2A 1LQTA 1JKJB 3I2KA 2QF7A 3DEFA 3LZ6A 1WXIA 2BMAA 1NU6A 2FUNB 2J3HA 4Z49A 4R8RA 3ZS8A 4BLWA 5BPFA 5JY1A 3FTEA 5HQTA 1DC3A 3OQJA 2YFHA 2QZJA 3VDNB 2PUDA 1XAGA 1Y4AE 3NBQA 4TT3A 2JI8A 4GZLA 2PX4A 3A9RA 3VM6A 5LJLA 2PJDA 1LZKA 2PGNA 3K1AB 2WG1A 1V71A 3C2QA 3H2HA 4P81A 4BV9A 1BSVA 3KDAA 3QE0A 4X94A 4ESOA 2CWDA 3CH4B 3GNTA 3DTYA 5A3JA 1GZUA 1ZONA 2WHRA 2QMZA 4AZVA 1JU3A 3HK2A 2B83A 1P9LA 2B4AA 5DLPA 3U48A 4DCMA 4QJ5A 4B7CA 1VPDA 2H16A 2BT4A 2IZ1A 2K2QB 3DO6A 3PCXA 4HFMA 4NZYA 3HN7A 5FUWA 3UGKA 3W7VA 3HJRA 3L8HA 1KIMA 2I1WA 2XBUA 2YZGA 3PNVA 3QVVA 2LD4A 5CPFA 5C8YB 3TLBA 1TZMA 1ZR2A 1OWLA 3O4VA 2IZ7A 2VNKA 2PL1A 4C4AA 1ZIPA 4TXJA 2WHQA 5A5DA 4IV8A 4OMCA 2Q5OA 4OAQA 5HKKD 1DC8A 3ZHVA 4MRSA 3O4FA 4EPVA 5K0ZA 5EJ2A 4P86A 2W11A 3BUSA 4DBVO 3HU5A 4ZO9A 1W87A 5DGDA 1WA5A 3Q6NA 4MO2A 1DDGA 4MVJM 3THOA 2FP4B 1YE5A 3Q15C 1QFZA 4C14A 5I7WA 2FRDC 5I48A 1U4SA 1J0BA 3ZHUA 1OF1A 4TZKA 1N1DA 2X0DA 5L4LA 5C37A 3EVEA 2XIQA 5CLIA 4NFHA 5JBQA 4B46A 3V34A 3ZCQA 4CTMA 4Q4AA 2ADMA 3W3ZB 3SM3A 5D3MB 4EI9A 2VP3A 4YAJA 1N25A 4PG6A 2P5SA 1QQ6A 2ZWMA 3HO6A 1NKVA 1EUYA 1YZKA 3C70A 4XM0A 4OEHA 2A4KA 3MILA 3SS9X 4NDAA 4D44A 4GPZA 3GLFE 2SICE 1SHKA 3S4YA 4CMEA 5J2UB 3QVSA 1MPTA 4LVUA 3E22B 3IVRA 4E5MA 1JR4A 2ZKLA 3NBUA 3VHQA 4XYLA 2W6ZA 1U4OA 3B36A 3ZZ1A 3VR1A 3RGWS 2J9YB 1GEEA 2NU7A 1CERA 2RJNA 1W0KA 3JQGA 2BFCA 2PFSA 1DARA 3N8DA 3GJ8A 4G3XA 3RKSA 3W77A 1WD5A 4CM7A 4BWGA 3QVOA 3FJ1A 1BKYA 2VPPA 2GLTA 4IZIA 2WQ6A 3GF4A 1E2GA 2QRVA 5CTAA 2P67A 2HMUA 2BZ1A 3BRSA 3WLNA 3WRWA 4N5IX 2QMYA 4XJVA 4C4TA 1WB9A 2HPZA 2R8EA 2EQBA 2P2YA 3LPDA 1RLJA 5IN5A 2P9JA 4K9PA 5CB4F 3HJAA 1XQWA 3A0UA 3QTTA 1KZYC 4IQ8A 2XE8A 3LECA 3PQ4A 5HILA 4IJ6A 3SZLA 2HIMA 3U0BA 3DXFA 4K9LA 4MW9A 4RTJA 2A1TR 4TWJA 1KK0A 3DEZA 3U7FB 4WDQA 4Z7JA 1KY5A 1Y3BE 4KRYA 2VKTA 1U0RA 4ZVVA 3RTDA 3PGVA 3MQ2A 4J90A 4US1R 3VQTA 2A9RA 3KSMA 5LXTB 3V3TA 1Y9ZA 1JIJA 2I7CA 2WVJA 4YAUA 1GP2A 4H35A 1EP9A 1NQUA 5CXSA 3D4OA 4DQUA 2C07A 4KPGA 1SVKA 1K8RA 3NWPA 1P18A 4HAXA 3CXRA 2WIDA 5B58T 3WTBA 4XWTA 1ZK1A 1UXGA 1UPFA 5LP1A 2AOWA 2B99A 2UVDA 3JYHA 4R69A 3Q6IA 4RJIA 1W73A 4JJEA 3EZGA 3QNMA 3WMFA 4I1OA 2E1PA 5DRYA 5CEJA 5BR7A 1XROA 4V0MA 3FHJA 1TO2E 4ZI7A 5T6MA 2Q2NA 2QR5A 3HWX1 2D00A 5EJAA 1MCZA 1B23P 3DEAA 4HSGA 1Y37A 3Q7SA 2BM0A 3HXPA 4OB8A 2NQ2C 5AOAA 2V59A 3GMDA 4P5PA 1TVMA 1CZRA 4NBSA 5D5HA 8GPBA 3GH3A 4JP5A 3NO4A 4FMCB 4FR5A 1H9BA 1ZH6A 4NC9A 5DSZA 3KVVA 1UIMA 1VIYA 2QZ9A 4MWDA 4AN0A 4CMBA 2EF1A 4HQRA 1JLMA 3ZY5A 3A1TA 2FJUA 4RESA 4NATA 1QGDA 1CZKA 3WV5A 4WOCA 1SCUA 1UFKA 2ZJ2A 3SLKA 3TZ6A 1L5RA 1YQ9A 1G5PA 2VYND 1JI3A 2RDMA 3UQYS 1X80B 1RQXA 2GFQA 4S35A 5ESRA 1JHAA 2E4ZA 3H1FA 3QBDA 2D0PB 1U8YA 1CQPA 4HP8A 4ZODA 5ALGA 4JI3B 3RV3A 1A8IA 3J81A 1ECCA 2O5VA 3HCNA 1TA0A 2V7BA 1Z0ZA 2XY4A 3IESA 5CCDA 3TX2A 3EBOA 2O7NA 3H9QA 3LCUA 5AXBA 3IAS1 1VJ1A 3E9NA 4RLQA 1EG7A 3V2HA 4TV9A 4P3KA 4B6FA 1RJ9B 2FF5A 1M34A 1FTYA 1OTHA 1SZPA 5AHXA 3IQWA 1ZHHA 4EMSA 3ED1A 1BE0A 2WJJA 3GFOA 3MJ4A 5CIQA 4ZVQA 4AY5A 4DXDA 1BXZA 1ZCZA 2Z57A 4I5IA 3T52A 4C6RA 2E4AA 6AT1A 2VP9A 1GLVA 1P44A 1HG1A 3EPHA 4NCAA 2F4NA 4UUMA 3V3KA 3K9QO 1X8LA 2QHXA 1YMUA 1ZC4A 4GD3Q 5J4HA 1NMZA 2O6LA 2RE8A 2NUPB 2XCUA 5KZMB 2MINA 3HR4A 2HHCA 3K0CA 5EN4A 3ZHYA 5FP0A 3PGJA 3D8BA 4QWMA 3UCFA 3VHXA 3FZYA 5KTOA 3UZUA 2B4KA 2DCUA 1DKUA 5LA6B 4RVCA 1VZ2A 1N1EA 2H8KA 4ZKEA 2CXTA 2XRYA 2O3JA 4G2TA 4BFYA 3UKOA 4X7RA 1EDEA 1GN8A 1JJVA 2A30A 1KJJA 1M74A 1W96A 1OMOA 3RHTA 2HYIC 2W6NA 3IUYA 1C4OA 2JK1A 3CBGA 3E9QA 1IOWA 1O9BA 3DCIA 4CLRB 4XGRA 4F4HA 3MAAC 3JQPA 3FPSA 3V4PB 1NULA 3RUAA 1VJDA 1XZPA 2X58A 3F8WA 3ZWVA 4YP0A 1FNNA 3EEBA 4IDBA 3I92A 1Y1KE 2H1WA 4UKDA 1ORDA 1KKLA 2M6SA 3GEMA 4Q7KA 2Y1DA 5KNCD 2EWMA 2QENA 2I66A 4CTJA 1U8XX 3A1UA 4TTVA 4UVHA 4XZ3A 1WZ2A 1D8TA 1FS4A 1MMFB 1Z07A 5DTIA 3SCZA 1N2EA 4JJIA 5GP1A 1JA1A 4BQSA 4EHFA 3U3ZA 1ZSYA 3K1ZA 3ZGOA 2PUGA 1GFSA 3BIXA 3ONFA 1XYGA 3K0FB 3PGMA 3UN1A 2PT9A 3GDFA 3FROA 3SJAA 3ZG6A 1YGPA 3H11A 1GU1A 3WYCA 1L1QA 4FHDA 3EVFA 5C4GB 1MB3A 2P3QA 2FSHA 1MBZA 3SBDA 1DQSA 2ZT8A 3GARA 4LDAA 3TGWA 1QS0B 3ZHQA 1EWYA 4C5AA 1I4DD 2IZOA 4IIVA 2K7FA 2VYNA 5IANA 1COZA 3DAGA 1QWOA 4TKLA 2OCDA 2C2OA 2ZAMA 3LOUA 2WSIA 3AUFA 3N76A 3QVTA 3CKKA 3WISA 5BT8A 1EZ1A 4J6FA 3NBAA 5LLDA 5EWLA 4YPFA 5I4CA 3EXEA 3C0KA 1PEAA 3AOEC 2R4QA 3RU2A 3WDMA 4EGFA 2VQ3A 3L8DA 2JAWA 2IPNA 1XIVA 3DMFA 3I05A 3WLMA 1M1XB 1NFRA 4YP5A 2W93A 5DNYB 4UNIA 3W4IA 2W2LA 4HS9A 5IEBA 1DRKA 4CU5A 1M83A 4BUCA 1WTCA 1UWLA 1C2TA 4YB8A 4BBAA 2Q41A 2FSGA 3OZBA 1UJ4A 4O1HA 3U4AA 4E5YA 1ONNA 4BJ5A 1HTWA 4UATA 1BDJA 2C3OA 4M1ZA 1XKTA 3JPWA 4U2BA 2Z5FA 5JS8A 1EUQA 4ZCLA 4YT2A 3M9LA 1EB8A 1YHYA 4P3YA 4PCAA 1E2IA 3ZE0B 1YZUA 4ALMA 2FETA 1TGYA 1KRWA 2P41A 4KO1S 1M54A 3G5LA 2QNRA 1EJ2A 2ZRAA 6PFKA 1DKLA 1C9EA 1P4SA 1QO7A 3H6HA 1IZ7A 5KC9A 1I2DA 1JQAA 1MV8A 3BJMA 1QVAA 1TT5B 1TK3A 2CDCA 4F3CA 3L2OB 3UG6A 4QFDA 3X1XA 4TUYB 1XBTA 3K31A 2PMEA 4RY8A 4BEVA 4L07A 1N6NA 1CUIA 1JVNA 1TUBA 2GO7A 1RYZA 3D1LA 3IMGA 3U5ZB 3VJRA 1HQDA 3R6TA 3HCBA 3WXBA 2HYDA 2HO4A 4ND6A 4EZEA 1KI6B 4J2HA 1T9ZA 3MWLA 5CVVA 1D8AA 2DH6A 2IHTA 4TLAA 2CV1A 2Q3FA 1IATA 2PKQO 3KHSA 2FOIA 1MRNA 4KAAA 5JAZA 2C84A 3WYAA 4HWTA 1SKUA 5JVDA 2AT1A 3H5AA 3CLUD 4B3XA 1RAAA 1GA1A 4Y18A 1FTGA 1LKZA 2QXTA 1SQSA 3NOVA 5I7RA 1NBMA 3RNOA 4URXR 2R5FA 1LBIA 1W8DA 1MX3A 3TCKA 4EUSA 2HRBA 4HXFB 3H8JA 1FDUA 1GKIA 1X1SA 1SXJE 2ZK7A 3VU9A 4B6GA 1CZHA 4F11A 4DV3B 1LVGA 4AY2A 3CT4A 2O4UX 4KN5A 4RHFA 1WDKA 3L7LA 5KVQA 3RM3A 1TYDE 2BOVA 2RJOA 3CZMA 5C7IO 1NIJA 1UAYA 1XU9A 1DAOA 4L2IB 2V4ZA 2HPHA 1I94B 2H31A 1NQVA 2GPWA 2C0QA 2HAEA 4E5PA 2YDYA 3PNOA 4WKCA 3E9EA 5KSWB 5LD2B 1U63A 5REQB 1HE2A 3R5HA 2J3LA 1N5JA 3TIIA 1LFDB 2DFTA 1P4JA 2OORC 2KMLA 2PRZA 4YCAA 2UV8A 3UWKA 2XD4A 3DE1X 3SQDA 1R2QA 1XTVA 1YOBA 1GPAA 1HT1E 3GPBA 3QEOA 3E9RA 1E99A 2E85A 1M66A 2Q49A 2YHIB 3S8EA 2CLLB 1TVKB 5ENDA 4GLLA 5F2EA 3T7IA 1LPOA 2TS1A 3B2NA 3PE6A 2IS6A 2G9VA 5JXGA 2QE7D 4GDMA 3IUPA 3M1IA 4PSUA 1K4YA 4X92A 1U8FO 1S8OA 4J0CA 3C5EA 3RB8A 1NVVR 4YMUA 5IKMA 1T9GS 1A9TA 2OXCA 1V95A 4ETMA 5DCWA 4CQLA 4DLSA 5K8LA 1TZBA 2PRYA 2ZI7A 4TMVA 4LOKA 3G59A 2OESA 1H85A 3JQ6A 3OQOA 1YKGA 3LG2A 3M8KA 5FUMA 3UWMA 2WKRA 3PYXA 4LYFA 1YFJA 3L7IA 3VBEA 3JS5A 4WY8A 2OV2A 3NRCA 4GWLA 2BEUB 2NN3C 2X41A 4I4NA 4ANFA 4F04A 4HNVA 3DT6A 2HCBA 1KI1A 4NZNA 3PD7A 3OE7A 3PQFA 4Q9IA 3ETGA 4NG5A 1ZM7A 2OHXA 2QIOA 1KE2A 3FB4A 5L6LB 3EPRA 2BUAA 3VKFA 1T0BA 1I2CA 2IZ6A 4R16A 1E1LA 2IOFA 4WLEA 3D3EA 4LYAA 4Z9BA 5JCZA 5KB3A 5AUPB 4C0SA 2CDBA 1UZLA 3GBVA 3QEMB 3DFUA 5LP6A 3H4IA 5KYXB 1YZYA 1IY8A 1E6KA 2P2SA 1WW3A 4GRIA 4QPDA 4CN8A 3S2GA 4HKTA 3UY4A 3M82A 1IBLB 4A82A 1II0A 5GY7A 5AW9A 3EWNA 3MGCA 3ZDFA 5FI5A 5KYNA 1NTOA 1DVRA 1RRGA 4PBSA 1GAXA 5IF9A 1V6SA 4BP1A 4BNDA 4KMSA 4G4SP 3W3AD 2L0XA 2CMGA 5JYEA 4PF1A 1GQRA 1KMQA 1QE5A 4K46A 1GL7A 2J4DA 3JZAA 4MLZA 2P6PA 3K1TA 3PIRA 5C5IA 5AKGA 1XZ8A 1XTTA 3I23A 1HDXA 2YHUA 2HREA 5BSTA 4C3ZA 1NIPA 2W43A 3DHNA 3JQ8A 4Q9DA 1ORRA 2QG9A 4MUGA 3UC9A 4P8RA 3F6PA 3IQXA 4M7WA 1J0CA 1KNQA 2OYRA 3WADA 2HJHA 2PLRA 3WVNA 2P9YA 3ESCA 4L57A 1S3IA 2A1TS 4NYMR 1NJ5A 3HB5X 5FUYA 5KMGA 5MN6A 2E5FA 3TJRA 1M2EA 1K7SN 4GPTA 4LJRA 3TEMA 3CCFA 4GLJA 5CU7A 1E1NA 1VBNA 1XCLA 2Y77A 2OCBA 2H4XA 2I7DA 1A8PA 2JKVA 2WWWA 3U26A 5KYWA 3DE7X 4A15A 4G2NA 3DOFA 2GWHA 3BTVA 3IV6A 5ICEA 3T12A 1PNOA 2D7CA 3UFXA 3VDMA 1TF2A 1ZI8A 2GCOB 3GELA 1DU4A 1KO5A 5DSXA 1XRNA 3T3PB 2VQFB 4B0OA 4QWWA 4OA8A 2C4KA 4DSUA 2O48X 4IINA 2ZRHA 4F3YA 1PUJA 3H5WA 4I99A 3G2QA 4WLUA 3WA7A 3AM1A 4YJFA 1TU4A 5E7MA 4ZJPA 4QJIA 3CINA 1H2BA 1WDWB 4QICA 2W4MA 5J1TB 4DLWA 2OZLA 4R3WA 3M33A 4AXBA 3ESRA 3GJ5A 1YI8A 3S1SA 1U0JA 2O7VA 4NLLA 3NW9A 1UMBB 4JHLA 1PJ8A 1QP8A 1H1LA 2QU7A 3OC0A 2BFDA 2F48A 1ACMA 2RHHA 4WZAA 3PL5A 1TAUA 1WNFA 5HFNA 1PZMA 3FYUA 4R8MA 4AZ0A 1P77A 3DP7A 1B00A 3VOSA 1NMYA 3QFSA 2XGSA 3LQKA 1QH1A 1SCNE 3WK7A 4PVCA 5CBKA 5HS4A 4DV2B 2D4AA 2JHAA 4Q34A 1A82A 4PICA 4WESA 3NDRA 3AVWA 1K8ZB 1SC9A 5B1YA 3VMMA 3FPKA 2VQDA 5EZYB 5L3QA 4I14A 4FFBA 1NM5A 3RS8A 2JFWA 3LW8A 4UOQA 5HBGA 2JVKA 1QFJA 2XNHA 1YJCA 2Y99A 3SKXA 4V1CA 3PQCA 1NXTA 2GRAA 1M2NA 4GBMA 5AM2A 3V1LA 1E2UA 1EGAA 3TQHA 2V7WA 5B6PA 3V42A 3W2HA 4KXFB 2WQ7A 1PDWA 1O97C 2JKYA 2PY6A 3UATA 1VKJA 1OA0A 1NW4A 2GZAA 3CIFA 5BOSA 4ZI2A 4ZQBA 1P2TA 1I01A 2X9LA 3NX4A 4E7OA 5KNBH 3FLBA 2ENWA 1LJLA 4FBGA 4MWZA 4RPLA 5HEKA 3EFOB 3K16A 4FFOA 4MMZB 5FHRA 3P9NA 4DCJA 3PEFA 1WX1A 4NPAA 1O96A 4AU1A 1JHXA 3QOXA 4K9KA 2ZYUX 4WEQA 4JLJA 4XPIB 3UAYA 4QO7A 3C8MA 4HL6A 4CXMA 3WYFA 4X64B 3FF1A 2E5LB 3Q11A 2GZ1A 2EBUA 4PTZA 4YT8A 1R0SA 3ZQ4A 3IP3A 2CYCA 5TJHA 3I9V6 2JGNA 2X3FA 3FZGA 3H5OA 4C0KA 3V33A 5BWBA 2HL6A 2ECPA 1ORHA 4C4ZA 1NQAO 4H1TA 4JNCA 1KAMA 1IK4A 1WO8A 1ZK4A 2VHXA 4GPBA 2GYWA 4MXDA 4LJ7A 5B1IA 4CEJB 3GGOA 1L7PA 4HAOA 2H5EA 1SVLA 1KYQA 2LDXA 2Q0HA 1YB2A 3O4IA 4LZPA 3ITKA 4OSOA 4Y9DA 2OXIA 5KTNA 3JARB 3QLTA 3E4CA 3LUPA 3L4KA 2H0RA 2A4MA 5IX8A 1OASA 2FHSA 4ZTZB 4Y2JA 1R0LA 4Q4HA 5DHSA 1SVSA 3FH0A 3QKRA 4JYBA 4RL4A 3KD2A 3PJGA 1JPUA 1PUXA 1AQ6A 2A2ZA 2N1BA 3DLPX 3ETNA 4OLJA 5CAEB 5B2FA 1KYZA 1RCFA 1SIWA 2PA0A 4MVJP 1XEAA 4UARA 5EESA 3ZV5A 4F2PA 2QTHA 1XKLA 2W5UA 3KSBC 1UWKA 2J32A 2SECE 4EB3A 2P65A 3N0XA 2B8NA 4J0DA 2Y76A 2VCEA 1P8AA 4CKBA 3ELDA 2ZM5A 2UZIR 1EPUA 3RSQA 3RKUA 5H4GA 4TXNA 1JHQA 1T0PA 4KGXA 4DUGA 4B4WA 5BN1A 1HR0B 5FFMA 1XMQB 4JI1B 1P73A 1CUAA 3CR7A 3OPXA 4R4JA 2WPDA 3ABIA 1BJKA 1U5AA 1H0SA 5ALHA 1T6ZA 1T5OA 2AC4A 3OE7D 4DPLA 1VPEA 2ALJA 2JJ2A 4HAIA 3S70A 4D0NA 1A2OA 1K7XB 1CS0B 3GLKA 1S2IA 4EL5A 3QXXA 5FL3A 5BSHA 3PC7A 3PXBA 2Z2JA 2VLBA 3LQ1A 3IL2A 3ZW7A 1NNLA 3RC8A 1DWPA 1PJRA 2IYNA 3H5TA 3TZEA 1WKVA 4PO3X 3D43A 1IXSB 2W71A 2QBYA 1I3LA 4MQMA 4NL4H 1UDXA 1AQIA 2QRNA 1JHMA 3EEIA 3AR2A 5EE9A 3SYLA 3M34A 4E1BA 4QU5A 2X1HA 2QNBA 5A3SA 4C22A 3B70A 4UTVA 1ZICA 3NHYA 3KJNA 4QNMA 1K6EA 2AUMA 4H77A 5JHHB 4QYWA 3KL4A 5DEIA 3STHA 4NULA 2CXRA 4EABA 4L0MA 3GFFA 3HLKA 4B2IA 1NY5A 3FM9A 4IJQA 2OHGA 2V7XA 3KALA 4G5OA 5MF6A 2BGWA 2Q21A 1L7VC 3CRVA 3BRWD 3RUCA 4CDGA 2FPWA 3L77A 5LZ7A 3P0RA 1GNQA 1WZEA 1X1CA 3KVYA 4Z9FA 5F21A 5BY2A 1WUTA 3D7LA 3M9WA 1JKIA 4AZTA 4EY4A 1KOGA 4NMWA 3MZ0A 4FBMA 1NC3A 1LX7A 2I3BA 3JQRA 4W5OA 3N0TA 2ZU0C 3QF4B 1VB3A 2XGGA 4PS0A 3VZRA 4J4TA 1NG1A 4DKXA 3IVGA 5U9CA 3HS3A 3LHKA 3IDOA 3DVQX 2E6KA 3NKVA 4D80A 5B6IA 3GCDA 3LGAA 1OLXA 1MB0A 2VK8A 1VE5A 4GMXA 4LXYA 3THXA 3S99A 3DBIA 4LZLA 3OLCX 2FMKA 5I4BA 3KYCB 4G1UC 3PUXA 2YBDA 4XJSA 1APBA 2W6CX 3N2GB 4DVGA 3QLVA 3U7JA 5J4VA 2WTAA 2KPOA 5BSUA 1KJNA 1YS7A 4TS9A 4YJKA 2J9GA 1DRWA 1TK2A 3FCYA 2FP3A 3WB2A 3R3YA 4MZDA 4K9QA 5D2CA 3HADA 3BB4A 2NUAB 4EG8A 4B7ZA 1UM9B 2O7RA 3MT7A 4IUYA 1OKKD 3PRHA 3KKQA 3LXXA 4HCJA 2V7TA 1SQ6A 4EG6A 5J40A 1VSUA 2DKFA 4ZVOA 1KDTA 4OI0A 3CFYA 1QM5A 1VHDA 2I3GA 1ZMRA 3N6VA 2HOQA 2REOA 3UMVA 4CKCB 4GR5A 3AHEA 3HYTA 1XRRA 5FORA 2I2BA 4UDOA 2REBA 1QGZA 4LK3A 4C7JA 2P6OA 1HDYA 1WCXA 1SMKA 3UMRA 1P39A 3BE4A 2M6LA 2REQA 2YV5A 2I5PO 3NIWA 3V1NA 1W76A 3GUUA 2JD1A 1GFWA 1WP4A 5IBPA 2XADA 5KOHB 1Q7CA 2QT0A 4K86A 3VV3A 4G0NA 3S8YA 1K68A 2FF7A 3D0OA 4MVXA 4P08A 3QFTA 1D2CA 3KEOA 3DVRX 1ZI9A 3Q8MA 3S1AB 5EHXA 1Z73A 5ENVA 1JQJC 1P33A 2JGDA 3N74A 4BO2A 1XZLA 3VSBA 2G1UA 4A7PA 3SIXA 3K1JA 1HE8B 5DBIA 5DTEA 4LGYA 3HKEB 3I0MA 2XXAA 1TQ4A 4PLFA 1RSZA 3ZD7A 5FOXA 4JB2A 4RV5A 4EITA 4DWWA 1W36B 4FJ2A 2GNOA 3GIWA 4ZZ1A 1CR1A 2NTEA 1W1WA 4DF3A 2VP5A 4M37A 1GOTA 4GE0A 1T1RA 2F3SA 4XRRA 5HBRA 3DKIA 5ECGC 3TAUA 5L6MB 1E7MA 1T4MA 4FFDA 4CMKA 4EK9A 1FYVA 5LKAA 2HCFA 4XR4A 5I7UA 3FNEA 1XDUA 1MH9A 4CIWA 1K98A 3GFTA 4H2DA 3UF0A 3LXRA 3ZOZA 4YUWA 3TAHA 4FS3A 3B6JA 1U0GA 3QX9A 3TEJA 1YB5A 1ID1A 1V9SA 2Z2KA 3HVJA 4F3TA 1NI4B 1UPCA 3G2OA 3DDNA 4UAVA 2WJGA 3LUBA 1FQJA 1U90A 1ULUA 2ZBQA 8OHMA 1QFMA 3U7GA 4CPDA 4B8YA 5TXGA 4JLWA 3GRCA 4ECEA 3JD1A 1E1QA 5L53A 3UB4A 2XEXA 4D9NA 2YHAA 2PZJA 1GNVA 5J3JA 2RARA 3C7AA 4JZYA 5CA0A 1TMOA 1CDEA 2GWRA 2H5IA 3ZVKA 4DNFA 4H1UA 2IHVA 3CKMA 4ZCSA 3PICA 4K6GA 2PO7A 4FQ8A 3VI4B 3R5SA 4PC6A 3TLAA 3M49A 1QH9A 1U0NA 4YV2A 3AFGA 4IDCA 1UXHA 5EHNA 4FOOA 4DKJA 4LZWA 4MPPA 1ZUNA 2WF8A 6REQA 4DV1B 2I1VB 4OB7A 5KQPA 5L7TA 4BVHA 2ZS7A 5EIAA 2EKDA 3KEFA 1KVRA 4WNAB 4NV0A 4LJKA 2HLPA 4EPYA 3UMYA 2LCIA 3OIYA 3OPVA 1J0XO 2P3SA 1CIVA 3PXAA 5E0OA 1ZK3A 3K0KA 2GK3A 1DBIA 2EDAA 2ANBA 1CX9B 3A6ZA 3PB3A 4UBKA 4TSRA 3IELA 4X1IA 3U49A 3HRHA 2CNKA 2FDXA 5C35A 5EYPB 2AOUA 2R1UA 2G4VA 3I2JA 3KSAC 1XP5A 1C3OB 4DA4A 3IIKA 2PUHA 2X0NA 4HDKB 2UXBB 1I2ZA 2OVFA 5CFMA 5L7WA 1RW4A 2DUUA 3FR7A 2AW3A 1ENOA 1HYHA 1CETA 3X2FA 5CVEA 3HDHA 5CR9A 1RR6A 4EJ2A 1K7FB 2M1ZA 3EWAA 4IHJA 3F9CA 1TVEA 4MDYA 4HEQA 2E89A 4ZGWA 1LGYA 5D6NA 4JUDX 3EZNA 4C4PA 3PEUA 4LWPA 2ZJBA 1CYEA 2O8DA 1QMGA 1Z68A 3MC1A 3ETEA 3DQZA 1UJ5A 4GKVA 4Z53A 1YRLA 2NYUA 3FWHA 4L6CA 2JAXA 4GBED 3KXLA 4C6HA 4PLCA 4FHGA 4NE7A 5G53C 3GEHA 5IYZF 4ZAYA 4HNRA 3OCUA 4HGPA 2QJFA 2VBFA 3VRHA 3L7OA 4DXHA 1WLYA 2ONKA 4E3ZA 1II8A 5AJTA 1EFHA 3PXXA 4JROA 3BCRA 3IPXA 4MQUA 1VECA 2I2FA 3MA0A 2IF0A 5JPIA 1EUZA 4BGIA 3E23A 3LOPA 1M2JA 5ILOA 2D0IA 4WI1A 4R68A 4EHNA 2FVXA 3EQ2A 3EODA 3RUHA 4YXWD 1BKSB 4QATA 1EWRA 2C54A 1OXMA 4IXTA 4V0LA 3FTDA 1DAMA 2CB9A 4Q1VA 5LIRA 1M3SA 1P6XA 4G4GA 1O58A 4KG7A 5CYOA 4G37A 3WJ7A 2DBQA 4QBTA 4CKEA 3KFLA 1VLMA 4H15A 2W83A 4KQIA 4B4OA 2HPVA 2BISA 2RIPA 1E2NA 3F1KA 4DM3A 3SDSA 5JNRA 2XCRB 2PWBA 3K94A 1IDN1 4BV3A 4Q7JB 5LQSA 5TF4A 1J2JA 4NAUA 1YTUA 2G67A 4RHCA 3RVMA 3ROZA 4JYCA 2SNIE 2WWTA 3ELYA 1MEOA 1VKNA 1GPJA 1W75A 4I81A 4KIUA 4UM7A 5CRIA 4ZYWA 2IH4A 1DADA 3DUFB 2O2HA 2D4HA 4A0FA 3JQQA 4ZZ0A 1IBKB 5KWSA 1OIXA 1L4LA 2JBWA 3M89A 4P84A 5BN3B 1XF9A 3AYZB 4HNSA 3LBAA 1JWLA 3QXHA 4MMXB 4JBWA 4O5OA 5C18A 4CQMD 1W19A 3BIWA 2FFBA 4R2KA 3PSAA 3SZRA 2IHUA 2NTVA 2W2VA 1M1YA 3W7AA 1KORA 2FG6C 3R3JA 1IJFA 4FR2A 4HXGA 5H3LA 5BUZA 3SXUB 3KQMA 4XA8A 3NASA 2AZTA 1S3FA 3NATA 4WIAA 4MUKA 5KTYA 2X5XA 2FN8A 3DE3X 3K0AA 3VR5A 4ER6A 1IDOA 1YBMA 1P75A 3IMEA 5HJ2A 3OZAA 3SBEA 1VI6A 4FW9A 5BQFA 3UOAB 1LBSA 1A04A 1MB2A 3M6VA 3SG0A 4DM7A 3B1KA 4A8JA 4KGDA 1RU3A 4EG7A 3JYLA 4KAFA 4YVFA 1P80A 1PT8A 2ADOA 2VUHB 3I3OA 2FU5C 4K03A 4RQAA 3P2EA 5AJYA 2HLNA 3MOIA 3UENA 3FIUA 1OLUA 4PQYA 4WL0A 4FSDA 1VXOA 3KOOA 1ZS9A 3NVAA 4WA7A 3DTVD 4RS3A 2H5JA 4S1WA 3GLTA 3EXG1 1RYDA 3G7SA 4DXAA 2V7UA 1RWBA 2VNJA 4YMSA 2P2CA 4FCTA 3D4LA 1M5TA 5FBZA 1N2HA 5JG7A 2OV6A 4B80A 4BFLA 3FNHA 1SXJA 2JGFA 3ZGZA 4X44A 4HT3B 2SCUB 2UZ1B 2DR2A 4LNUA 2G17A 5KQGA 3U3MA 3QF7A 3BHNA 1G19A 2LWIA 3GGSA 4PFQA 4Y6GB 3WWEA 1OLSB 2BW0A 3OEED 1CVLA 4NOLA 4PLVA 4UCQA 3KKLA 5ITSA 2HNAA 3U2QA 2L18A 2ZOSA 2BIFA 1Z6GA 3PA8A 3BMOA 1UINA 1G21E 4II7A 2HT6A 2F55A 1LBHA 4EUHA 3WAJA 1JMYA 2ZXEA 3KLOA 3PF8A 4KNYA 1U31A 2QL7A 4R8LA 3CN9A 2FZVA 3QH4A 3PK0A 2G9NA 1D6MA 4Z51A 3WDSA 3ZHOA 4DCTA 1G63A 4ZO8A 2CLDX 3LLVA 4WOKA 4KKXB 3GDHA 4FSXA 4XOIA 4AULA 1KJQA 1EFLA 2H2AA 2OEPA 1VIMA 2AGVA 4PLYA 1R16A 4U3JB 1VSBA 3CM0A 1SBTA 2AEEA 3RTCA 3CUUA 4KQGA 3RAGA 1T0IA 2YHBA 4MCAA 1GTMA 1RBQA 1DSSG 4Y2VA 3VTAA 1ISPA 3FNQA 3P9QA 2DG2A 4PZCA 3OPYA 3NHUA 5J63A 5JXJA 3Q5EA 1NW5A 4NARA 3BFJA 4RKFA 1DRUA 1MU0A 4D3DA 2JBHA 3ICOA 4G89A 1T8SA 3DMNA 5JBNA 4RTSA 3IERA 3LXMA 2HHJA 1M8GA 4UDNA 5ERGB 3EVCA 1FDOA 2JJ8A 2JK0A 1TKCA 1BRMA 3Q98A 5IKOA 4Y2SA 5PGMA 3ZCSA 5ELXA 3CJTA 3GJXC 1XCBA 3PITA 4XB6B 3IEMA 4G63A 2EOAA 3KK0A 3NRJA 4EX7A 1IQ0A 2FZLA 3SDBA 2WICA 4IYRA 3H3JA 1X7YB 1LY1A 1DGQA 1E6WA 3EIHA 3IHWA 5KPJA 3LNCA 4JU9A 5L4SA 2FB9A 2Y1WA 3H2SA 1UXJA 2ODTX 5DX8A 1GDDA 3BORA 3P9YA 4Q9LA 4ZOLB 1RWWA 4TQGA 4MGHA 1RJGA 3T8YA 3P97A 2L17A 1LVUA 3PUKA 4JDPA 1G9SA 3PC6A 5H8WA 3HCWA 3CVUA 2ERCA 2IHYA 4I9FA 3BQ9A 3FHOA 4FNOA 4B09A 3AGPA 5LA6F 2BI4A 2DFKB 5EEGA 2NT3A 4PGHA 4FDAA 5EXDA 4BAGA 2FJ0A 2PV0A 1F2VA 2K2WA 3UFBA 2JLYA 1JR6A 1YFKA 3PLRA 1IZ0A 4RTNA 3NVDA 3K8ZA 3SMVA 1Y1LA 3AJRA 4OXYA 4HFRA 2JJ2D 4Q7QA 1IJBA 2OLEA 2YJTD 1LTKA 2V3VA 4FEEA 4EQ6B 1GSHA 4KSBA 4D8VA 5KOYA 3BL8A 1JXMA 2OZKA 1ZM3A 1KC3A 4TLCA 1DWQA 1X13A 2V9ZA 4UUPA 4RD1A 4C6TA 3QFCA 4CE6A 3ICVA 4U7TB 2FPSA 4DANA 1VPVA 1F0YA 1J6UA 3K3PA 1W1UA 1GAWA 1YK1A 1DRVA 2J45A 2VDKB 1SUEA 2OFWA 4R84A 2YYYA 1VHWA 1HOTA 4G24A 1YVDA 4ZO6A 5F7ZA 5JAQA 2A5GA 3JY6A 4BUJA 3KQOA 2FPGA 5JW6A 4KFRA 2FQWA 2OP1A 3MAGA 4O4JB 5DM0A 3GLVA 1OHHA 5K0GA 4O3FA 1ZO8A 4ON9A 4YMIA 3FJYA 3UMBA 2ORWA 3I1IA 3QX3A 5KNDH 3C3AA 1WUYA 2CY0A 3I9OA 1CK4A 3U1BA 4AJ4A 1TQHA 2W8BA 2Z3VA 4MJXA 1KYWA 2I2CA 3ZE2B 4EVRA 1BDIA 5LZ2A 4XLLA 3M81A 1M2VB 5KHOC 1A97A 2CFRA 1P2DA 1QKIA 2VBIA 3ENZA 4XD2A 1VDMA 3NOQA 4IWYA 1AK2A 4CM4A 3RUIA 1NMQA 3NBKA 2FUG6 3E48A 3EG9B 3ANYB 3FBTA 1TM3E 4FKZA 4OYLA 4Q24A 3T3HA 2EC5A 2PGIA 4LJLA 4B79A 1IEWA 3GP8A 2I99A 1BU8A 4R7GA 3F4BA 1RM3A 2XZDA 2XZPA 2ID7A 4FGJA 1P1IA 2BMEA 5HF9A 1VTKA 1SKBA 2QRGA 1SCIA 4MVJD 3OJWA 3V4ZA 4TV8F 1YI1A 2CK3A 1M8PA 3V80A 1C4WA 5A0VA 1SCUB 1B93A 2QTRA 3G5UA 2R3SA 2DM6A 1OU4A 3IEXA 3L6CA 4AJLA 2WWYA 3KZ1E 4NJMB 4ZK2A 1QKKA 3FNFA 3TW0A 3DHEA 4GECA 4WAUA 4O25A 5IAOA 1T3SA 3V1MA 2CK3D 1YHNA 4J0FA 4DMUB 1WZUA 4NE9A 2OCKA 3RIEA 4PSKA 1YZTA 2NXCA 1VI2A 2J08A 4CF5A 3U4MA 2JFHA 3A25A 5IJ0A 3W6ZA 1EYZA 1UDAA 1LFAA 4FSHA 3TB4A 1GPMA 2W6MA 1SXIA 2Y0CA 1P3JA 4X1OA 4EVIA 4ENSA 4HGOA 1A7AA 3U3KA 3BWCA 3I8OA 2OLKA 3VPBA 4IH4A 4JB8A 2R79A 5BMVA 2XDAA 4B43A 1DBPA 2PA3A 3EAQA 2YJ3A 5AHKA 4R3UC 2EWVA 2YVKA 4D56A 2BH2A 4H3VA 4IDPA 4MUMA 4RSGA 2V7GA 4PQGA 4EAQA