2CT8A

Crystal structure of aquifex aeolicus methionyl-trna synthetase complexed with trna(met) and methionyl-adenylate anologue
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
497
structure length
465
Chain Sequence
MTLMKKFYVTTPIYYVNDVPHLGHAYTTIAADTIARYYRLRDYDVFFLTGTDEHGLKIQKKAEELGISPKELVDRNAERFKKLWEFLKIEYTKFIRTTDPYHVKFVQKVFEECYKRGDIYLGEYEKEPSYFFRLSKYQDKLLELYEKNPEFIQPDYRRNEIISFVKQGLKDLSVTRPRSRVKWGIPVPFDPEHTIYVWFDALFNYISALEDKVEIYWPADLHLVGKDILRFHTVYWPAFLMSLGYELPKKVFAHGWWTVEGKKMSKTLGNVVDPYEVVQEYGLDEVRYFLLREVPFGQDGDFSKKAILNRINGELANEIGNLYSRVVNMAHKFLGGEVSGARDEEYAKIAQESIKNYENYMEKVNFYKAIEEILKFTSYLNKYVDEKQPWALNKERKKEELQKVLYALVDGLFVLTHLLYPITPNKMKEALQMLGEKEFLKELKPYSKNTYKLGERKILFPKREG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA (74-MER)
publication title Structural basis for anticodon recognition by methionyl-tRNA synthetase.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Ligase/rna
total genus 161
structure length 465
sequence length 497
chains with identical sequence B
ec nomenclature ec 6.1.1.10: Methionine--tRNA ligase.
pdb deposition date 2005-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08264 Anticodon_1 Anticodon-binding domain of tRNA
A PF09334 tRNA-synt_1g tRNA synthetases class I (M)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.730.10 Mainly Alpha Orthogonal Bundle Isoleucyl-tRNA Synthetase; Domain 1 Isoleucyl-tRNA Synthetase; Domain 1 2ct8A03
2.170.220.10 Mainly Beta Beta Complex Methionyl-trna Synthetase; domain 2 Methionyl-trna Synthetase; domain 2 2ct8A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2ct8A01
3ZGZA 4E1AA 1JEEA 1KR2A 2QJTA 1Q19A 4NAUA 3MUEA 4Q16A 5H7XA 2IELA 2CFOA 4NZPA 5TEVA 1WXGA 1A8HA 2QUKA 2PIDA 2DLCX 1KP2A 1J21A 1PG0A 4MW4A 2JANA 4NATA 2J09A 3G6KA 4ZCSA 1YUMA 4TS1A 3A2KA 1EJ2A 2GOYA 3P52A 5K0SA 1ZH0A 4ARIA 1JGTA 1LI5A 1OBHA 1G8HA 1T6ZA 1NP7A 3IUBA 1N75A 3A04A 4I6JA 1T9GR 1XNGA 3QTBA 4MVCA 3IOEA 3K32A 3RFFA 4EFKA 2WSIA 2Z3VA 3H05A 2CYCA 1O6BA 1HYBA 4YP7A 4G5YA 1O97D 3COZA 5KWVA 1KP3A 4ND7A 5DASA 4CDNA 3INNA 3TQIA 4DJAA 1LI7A 3HL4A 3TZEA 4EG4A 1N2JA 1NYLA 3X1KA 3X1JA 4DNXA 2VTBA 3QTTA 1I2DA 1XNHA 4KPUA 2NSYA 3G5AA 3IMEA 3RK0A 5BNZA 1O94D 5F23A 3LCJA 1O0BA 3IODA 1QQTA 1JZQA 2AKEA 1GZUA 1TYBE 1QRUA 1WXIA 1PFVA 3FI0A 3P0HA 2O5RA 2GKSA 3AG5A 3FHJA 3VGJA 1VL2A 1I6LA 1TYAE 5LM3A 2BTEA 4J75A 3H9CA 3PRHA 4RPIA 1O97C 1WJGA 1OWOA 3RK1A 2DEUA 3P0JA 1WQ3A 3VU8A 1XJQA 3IVXA 3KT0A 4R0NA 4MWEA 1CT9A 1YIAA 3CR8A 3SYTA 4EGAA 1IH8A 1ULHA 3CA8A 1EFPA 1O94C 4GRIA 2H2AA 1JILA 3SEQA 3FIUA 1V47A 1FFYA 1G8GA 4J76A 1OWLA 4PBSA 3L92A 2QTMA 1EXDA 4WSOA 1JEDA 1FYDA 3MMXA 2WB2A 3H97A 1I6MA 3N8HA 1JZSA 5J5AA 5DK4A 1X8XA 4MW9A 2C5SA 1COZA 1N2EA 2J08A 4XSVA 4ZT2A 4JXXA 1NUUA 5J59A 1JIJA 3IUEA 1TYCA 1WXHA 1TYDE 1S4MA 2TS1A 2AZXA 1KORA 4MW0A 1J20A 3CLRD 2QTRA 3KT6A 4I6EA 3UMVA 1JIKA 1KQNA 4PBTA 4MVWA 4G5FA 2A1TS 2ZUFA 2E89A 1GTRA 1NURA 2DERA 2PZAA 5EKDA 2Z09A 1R6UA 4MWDA 3TQOA 2J07A 2J5BA 1NUPA 1N2OA 1G59A 1JECA 4MUGA 4KR7A 3IOBA 4PBRA 2J4DA 2H29A 5DB4A 5JBNA 3UY4A 3F3MA 5FNZA 3CLTD 1ZJWA 3RHSA 2QUIA 1KH1A 1J1ZA 1G8FA 3ZXSA 3UK2A 4XFJA 1GLNA 4BWVA 2AG6A 1MB2A 4QRDA 3IVGA 3KT3A 1WXEA 5KCMA 1V8FA 5TS2A 2VTBB 1PFYA 4KPUB 3DV2A 3RJZA 3K9WA 3ND5A 1NUQA 1I6KA 1M8GA 3FDXA 1O96A 1N78A 2CYBA 2CT8A 1M1ZA 2NZ2A 3GMIA 4DE5A 3FETA 1M8JA 1XNJA 2QJOA 2X0KA 1KKUA 3AG6A 2QTNA 1QRTA 2D13A 1Q15A 4EG5A 1JMVA 3FWKA 3CLTC 1Q11A 4JXZA 5FO1A 5DEOA 1VLHA 2QJFA 5TEWA 4MW7A 1H3FA 3TZLA 2PG3A 1JHDA 2VXOA 1WOYA 1GTSA 3DPIA 1F4LA 3FY4A 1H3NA 1OD6A 2IP1A 3NBAA 1EFPB 2YWBA 3HGMA 5HUHA 1NUSA 1M8PA 3ISJA 3CVVA 3KT8A 1J70A 1PFUA 2A84A 2JA2A 1SURA 4U7JA 1OWNA 5HUJA 1N2GA 2ZUEA 4PY2A 4KR6A 4KKVA 4OUDA 2B7LA 3SDBA 2DETA 2OQ2A 1N3LA 4WNYA 2CSXA 5HG0A 4R2LA 1J1UA 3DO8A 2A4MA 4XFDA 4UZEA 4ZT7A 4MW6A 2HGZA 1KAQA 3VRHA 2X1LA 1YIDA 1N77A 1U3DA 4EF6A 3FH0A 3ZXIA 3PNVA 4EG1A 5J58A 1MJHA 4MULA 1IQRA 4U63A 1O5TA 4MQ6A 4YP6A 4MUIA 2E0IA 2ZP1A 4YBRA 1KAMA 2PZBA 3IOCA 5TGTA 3Q10A 1NSYA 4EG6A 3CLUD 4ND6A 3ZJTA 1GPMA 1QJCA 5AHWA 2A88A 3MLAA 1U7DA 3COWA 1Q77A 3D6VA 4UZFA 4HK4A 1F7UA 3IMGA 4K03A 1JIIA 1O95D 2DR2A 3AFHA 4H3SA 1QNFA 4S1OA 1QTQA 2WQ7A 1ZUNA 1YULA 1UFVA 3AIIA 1M8KA 3IMCA 2JAXA 3CVWA 4ZT5A 3D6UA 3MLBA 1OWMA 1WKBA 3NBKA 4MUEA 5LFAA 3ND7A 1VBKA 4ZCPA 2QUHA 1O96B 4MVYA 3CVYA 2CV1A 3SP1A 3RBAA 4CT0A 3H9BA 2IJGX 2YY5A 1U0BB 3CLUC 3COVA 4F4HA 5FO0A 3MXTA 4JYZA 3IDFA 1EE1A 4U8HA 3PNYA 1T9GS 4QBTA 2X1MA 3CVUA 3ZIUA 1YUNA 2A86A 2DUMA 4EG7A 3HFJA 3CLRC 4ARCA 1BS2A 3ILVA 4A91A 1O95C 1QU3A 4HPWA 4ZT3A 1KQOA 3H99A 1K92A 2I1LA 1H1TA 1TQ8A 2HZ7A 1K97A 3IH5A 2RD2A 1MOPA 2A1TR 1YI8A 3COYA 1EUYA 4MUJA 2O8VA 2XRYA 1N2BA 5H16A 2A7XA 4EG8A 2A1UA 4FZJA 4NAHA 1U7XA 4KR9A 2XRZA 5IHXA 2PZ8A 1IQUA 1EFVA 2G36A 3PNBA 3ND6A 3GLVA 1VBMA 4L2IA 1MB9A 4DDMA 4OUDB 2V0GA 3HMQA 4I6GA 4P2BA 4F3RA 4DLPA 3BL5A 3M5WA 3C8ZA 1U3CA 1QU2A 4K0RA 2DPLA 2WQ6A 2EL7A 2BYTA 1DNPA 4MW1A 4HJXA 3OTWA 3SZ3A 1LW7A 2QUJA 3I05A 3A4IA 4RUKA 1P7PA 1PFWA 1TFUA 4YMIA 2CV2A 1H3EA 2R5WA 3L93A 1ZH6A 2CV0A 3DLAA 1K4MA 1IRXA 1T6XA 1X6VA 2D54A 1MC1A 4GU5A 3P0IA 4CDMA 3FOCA 1Y42X 2DXIA 3CLSD 4X0EA 1KQPA 4MUKA 4DDKA 4AS1A 4DDHA 2PFSA 4R2MA 2YXNA 2X3FA 2V0CA 3KFLA 1IHOA 3Q4GA 4MUHA 3S3TA 3U1VA 2HMAA 1N2HA 4MUNA 1OBCA 3OP1A 2OV4A 3CVXA 2CUZA 4JZYA 4ZT4A 4ZT6A 1F9AA 3SZGA 3QE4A 3JXEA 3N05A 4NDAA 2YWCA 3ELBA 3N9IA 2E18A 3AL0C 1WZ2A 1WQ4A 2RE8A 1MAUA 3UOWA 5IJXA 1GN8A 3IVCA 4NX2A 4EG3A 2E21A 1J09A 1ILEA 3G59A 4ZCTA 4YP5A 3FNRA 1N2IA 5KHAA 1IVSA 1KH2A 2GM3A 3CLSC 1RQGA 3TS1A 2Z08A 5LLTA 1IFXA 4MWBA 1B6TA 1O0CA 4OJMX 4MUFA 1NUTA 4MWCA 1K4KA 4MAFA 1EUQA 1PG2A 3LE8A 3X1MA 4ZCRA 3FG9A 1M8FA 1OWPA 5K0TA 4Q93A 3SEZA 1D2RA 3HV0A 1N1DA 3ZUGA 3LOQA 3TNJA 3NV7A 4MVXA 3AKZA 4CQNA 1R6TA 1WY5A 3HZRA 2PXHA 4MLPA 2EJCA 4MW5A 1QRSA 3Q12A 1R6XA 2CYAA 4AQ7A 1VBNA 4G6ZA 3GUZA 3ZJVA 4MW2A 2A1UB 1M83A 1F7VA 1T6YA 1KH3A 1GAXA 1EFVB 1IQ0A 1MAWA 1WXFA 1NI5A 3N2YA 4JFAA 2D5BA 4L2IB 1MRZA 3ZJUA 3A05A 3PXUA 4ZCQA 3UC5A 4QREA 4HJRA 3E27A 1TEZA 1NZJA 1MBZA
chains in the Genus database with same CATH superfamily
1FX0B 1MVOA 3F96A 3H7IA 2XA2A 3DQPA 4BX2A 1E92A 2QRVB 3MS7A 2PMCA 3KPJA 4KE6A 3SY8A 3ESBA 1QIGA 1GTMA 1R00A 3Q6NA 1C7FA 3SZLA 5A2GA 2PIDA 2FVYA 1PJ2A 4FE3A 1Z0DA 1JEJA 3AT1A 4OJNA 4EY5A 3D8UA 4A5SA 2HLHA 1Z62A 4D81A 4UNQA 4OXNA 1Z16A 3H9GA 1Y4AE 2QT1A 1KO7A 3EGOA 4GEGA 3AWDA 4KWEA 1XDSA 5SV2A 4QDKA 4FWIB 1EHYA 4Q1CA 3R24A 1EWKA 3B13B 4RAQA 1ZHOA 2P11A 4TLLB 1OBHA 1NHWA 2IHKA 4C03A 1N34B 3UJ6A 5HJ7A 1EJ0A 3F1KA 1VE6A 1NQWA 1YZTA 3E9EA 3OPYI 5TSDA 2I91A 1P4HA 2REOA 2Q62A 2WTAA 4BFVA 4Q3NA 4ALJA 3N5CA 5A4KA 2VDUE 3LCCA 4Q4CA 1WBBA 1RABA 3L8YA 5LLSA 3BSYA 3RFFA 3W7BA 1UH5A 1FRFS 4YR7A 3QW4B 1VI5A 2VHVA 1NLFA 3H2GA 4CLOA 1HNXB 3IDQA 3AESB 2GBLA 4R05A 4ZO4A 4B35A 1AMNA 4RIEA 1J06A 3B1VA 3ZHOA 3EPPA 2AB0A 3C7KA 3THYA 2HYIC 1I36A 3COZA 5DN6A 3V32A 2CDCA 5CD1A 2GETA 4C6SA 1C8VB 3T0IA 1P75A 5LOVA 1QLJA 3F6SA 1QVZA 2ZJ7A 3EMVA 3F5MA 1L9XA 3U0BA 4B4DA 2G8NA 1YIOA 5DWDA 3HR8A 4ZAGA 3ZQ6A 3FWHA 3TLCA 3DE1X 2BBTA 4UM8B 3REGA 2JK1A 3S29A 4HQOA 1I2DA 3CWZA 2VDQB 3SEFA 1UXOA 3ANMA 4F8JA 3TVYA 1V7CA 2D2FA 3BM5A 1UBTS 3A3YA 1MA3A 1C7QA 4LJKA 4PFQA 2OXFA 4XLLA 3U80A 5JARA 2GN6A 3ORFA 3IJEB 3CF6R 4ZYXA 1U1FA 4ZYVA 3RS8A 4DNQA 1QSGA 3WL5A 1BRTA 1JEQB 3E7WA 2Z1NA 3SVLA 1JSZA 2PLNA 3GLFE 1A97A 3OLXA 4FFRA 4QXQA 4XM1A 5JEEA 3R44A 1RHKA 1G5RA 3SICE 4H17A 2TYSB 4RHUA 2IXGA 1RJWA 3F46A 1M2JA 5CAEB 5LWHA 2QUZA 1CDDA 3A1UA 3N39C 1A0OA 2R68A 1K8YB 5JANA 4D80A 1XEFA 3ZHTA 2AN9A 1IIRA 1GAEO 2YIJA 3SKVA 3FOZA 2JVJA 3THRA 1M75A 4KGZA 1XFDA 3VU8A 4ER3A 3ZZNA 2Y1EA 1DBWA 3UFXA 1G2OA 2BFEB 1KOFA 4JLUA 1SQSA 2XVXA 3IIMA 5A62A 2QLMA 5EUQB 2FJUA 1V4NA 3ZBQA 4BJ5A 1JAZA 4BKUA 1T9BA 2QMYA 1JQEA 4DLZA 1GL6A 1V39A 4JYBA 2HWWA 3IA7A 4L6AA 2EX1A 1RC0A 2XTZA 3NBFA 4RK6A 4WZ6A 5DZSA 2PX4A 4E4YA 4WBXC 5AUNB 3UXYA 4EYOA 3UWMA 1XL1A 5KYVA 5JOQA 1LPSA 5MFZA 5HMLA 4DCJA 1WHTA 2BDUA 4LHWA 3O4HA 2RONA 3QOXA 4CZ2A 4EKIA 3GJ6A 1JZSA 4C0HA 1AUVA 4HWPA 4RXUA 4UBIA 3R7SA 3KB2A 5C8VA 3BICA 3GJZA 1RBQA 1ZKMA 2NU7B 3PDHA 4PCLA 2UUBB 3LO5A 4W6ZA 1YL7A 2O4CA 1NBAA 3QMMA 4GNRA 3S28A 4MR8B 3SYMA 1G38A 4LC0A 5EHQA 4DY4A 1ZMXA 3T52A 4EPYA 5FWDA 1XXHB 5M04A 3BUSA 3CTMA 3OU6A 1YJBA 3RT7A 3CW8X 5LZ2A 4HAXA 4BNWA 3D4OA 1I9GA 2GF2A 2DPHA 4MUYA 1O9HA 3UMVA 1AUXA 1POXA 4YRSA 3GCWA 5JR3A 3D0QA 2X40A 3QPCA 5K0JA 1LGYA 4G5FA 4NCKA 2Y2UA 3PUHA 5BUSA 3O9VA 4R7GA 5KOJA 2DERA 3NAMA 5ALPA 2PZAA 4RO0A 1AT1A 4J2TA 4CKBA 2CVZA 3D2LA 5E0OA 3I4LA 1ZN9A 4LCEA 4E15A 4WDRA 2J07A 4RLQA 5F98A 4MQ4A 4ZPJA 4GM4A 4B43A 2J4FA 1S01A 4RC9A 3WIUA 3FW1A 3OD1A 1ID1A 1T4CB 4POOA 2E48A 2CB9A 2JATA 3RTBA 2J4DA 1TM7E 2EEPA 2GEKA 3ENWA 4REOA 3ZZ1A 2ZI3A 2P1DA 3V6MA 2VBIA 2WMDA 1JJVA 4WV3A 1L5SA 3OX3A 4B2IA 2BY4A 3A1NA 3HJBA 4U5XA 4A15A 4Q4AA 3ESAA 5GGYA 2VF4X 3JZIA 1M0TA 1T2FA 4Z7NB 4PR0A 2AG6A 2PHZA 5ICFA 3T4XA 2FMIA 3KT3A 3ETLA 3EHDA 5K3SA 3A58B 3RTGA 4EYKA 1EM8B 3C74A 1V7ZA 1K98A 1XMSA 2OV1A 1A9YA 2Z5FA 3IPRA 4H1UA 3U09A 1E8MA 1UPTA 2VTBB 3DF7A 1M0WA 4EH1A 1TK9A 4WY5A 3AUXA 4PCUA 1JU9A 1KU6A 3G02A 1LF0A 4PFJA 1I6KA 4F92B 3PWSA 1G6KA 4JBIA 5J4LA 1QF6A 4AWAA 4CQJA 3CW2A 1V4BA 3DDOA 1O96A 3CSUA 1W93A 2G88A 2IYOA 3CG4A 3NZEA 5BSUA 3H84A 4C0WA 1VJDA 4BVHA 4TTQA 2O0LA 2H2WA 4UVHA 1QFYA 2RHDA 2XV1A 4BPRA 1DDGA 3LXMA 4YS6A 4U7HA 1B00A 4KSYA 1C30B 2OHGA 4JROA 2DQYA 4X60A 5A3SA 4PGAA 5B1IA 5BUQA 2IVFA 4B3GA 3WICA 2UYQA 2X0IA 1KERA 4DM4A 2D13A 1YQXA 2Y3IA 1EWVA 3B9RA 2HOQA 1JS1X 1KIAA 2JI8A 2O5VA 2P9FA 5DEOA 4PZCA 4DR2B 1QIKA 3LQ4A 3JD1A 3SHOA 2A0YA 3AUJB 4MHSA 5E4JA 2FZGA 4D9IA 4JJ7A 2GXSA 4TVOA 3OQIB 3WZ2A 1GNRA 3UG6A 4BU0A 4MWSA 1UXIA 4WMLA 4E4TA 1U63A 1OSNA 5DJ5A 5AW6A 1JHRA 1WBDA 1GQ2A 4W9MC 3MD0A 2G63A 4JP3A 5I7AA 5K3EA 5FBRB 2BH2A 4I55F 3LKZA 2V98A 2Z57A 1QORA 5ESRA 5AVKA 5J1TB 5F7OA 1BCRA 1QE5A 2NXWA 3EE6A 3JYQA 4N54A 3TGPA 1H42A 3VC7A 4U7DA 3ZCRA 1JP7A 1IBLB 1YR8A 2KW5A 4R8RA 5CW2A 5FFFA 1OPRA 3THXA 5L9AA 1A1SA 9LDBA 1WUKS 2DFVA 2GHTA 3PP8A 1YWGO 2WJVA 4WBNA 3W4IA 2YRFA 2YRXA 3L6OO 2A9OA 3SWWA 5DRYA 1PJTA 2YHBA 2R7KA 1K3FA 4FDLA 5JYDA 3SR0A 3KQSA 4QO8A 2PL9A 1L5HA 1MIOB 3HSSA 4JQOA 3WMFA 4RDHA 2HK9A 4YAIA 3QIVA 1PJZA 2PGOA 1EQUA 1WKCA 2VO1A 2B1GA 3GGGA 3GRFA 4LJ7A 4UNPA 4CL8A 2C8LA 1OFUA 3ELWA 3H4VA 3MTJA 4G4SP 3LBFA 1PEYA 3ZU6A 1CUIA 3KTAA 4X3OA 3O0DA 2XF2A 1I51A 2BKVA 3TQHA 4MWZA 2JBAA 4EF6A 5DYWA 3K71B 2C7QA 3EDCA 1VL0A 2EJBA 2RSLA 2WIKA 3DHNA 3MOIA 4CM4B 5K01A 3ZBPA 5D51S 1VMEA 4XJSA 2FHSA 2O6HA 3H18A 2YW2A 4YQZA 1NV8A 4IDPA 1T5DX 3K9NA 1QR2A 2D59A 4MP8A 4QPNA 1LPAB 3M6IA 4M4SA 5TNXA 4CGYA 3GLHB 5TT1A 5IKPA 5G2OA 4C7JA 4RKYA 3VJRA 2AXNA 2H17A 3TCXB 2EOAA 3Q10A 1W59A 1U65A 4QVKA 1U1DA 4X91A 4BX0A 3CLUD 1E62A 1UEJA 1WLYA 2J0EA 2YV4A 4U9IS 3BPSA 5KZMB 1IWOA 1X1BA 2ZJOA 1J9GA 1SVUA 3M6WA 1L1EA 4MEAA 3NBZC 4P92A 4INAA 5AHKA 5F78A 5ARBA 1M1UA 2WUVA 2DULA 3OQ6A 3Q2IA 1DC3A 3I2GA 2AN4A 1ZMTA 2ZTHA 3LX6A 1D1TA 2FMFA 4OGFA 8MHTA 4OXYA 2Q29A 5EPUA 4YJ2A 3V7YA 3PHJA 1QNFA 1ULAA 1QH0A 2L42A 3RTEA 5F4BA 4X1KB 3BMNA 3VVLA 3LL7A 1GGEA 4RMIA 2QORA 5DHUA 3T1VA 2ILVA 3AI7A 5G1PA 3UT5A 3EULA 2CZQA 2BFCA 4FFBB 3T35A 2Z8ZA 2GKGA 3TSYA 1MEEA 4LKOA 2YXLA 4JJFA 4E5MA 3ZGNA 1KWGA 1GLGA 3DTVD 2F7SA 3ZWAA 1WXXA 3H16A 3H3JA 4DUZB 5J9FA 1M7HA 2XUDA 4UM9B 5DYTA 2FDCA 1Y3BE 2W83A 4PFKA 3D02A 5FO0A 4BMVA 3PT9A 3SLRA 5IBPA 1KZ6A 1RYZA 1W4ZA 2QNBA 2W98A 2ZE5A 4NTZA 1UDBA 2PLWA 4F86A 3T7CA 1EZ4A 1W4RA 2CC2A 3HL0A 1S7CA 4PRYA 4QBTA 5F3DA 3QLVA 4G8CA 3D8TA 3P2YA 2UZAA 1JUDA 4P3KA 1QIJA 1T1RA 3TI9A 4CV3A 5EQTA 5CBPB 1U8CB 4O1HA 3IQXA 2XE6A 4XIJA 1XWIA 2A5FA 2G5PA 3MK31 2JIDA 1QO7A 3C5WP 4MV5A 4ZARA 5BSWA 4M9UA 2G8LA 4PF1A 1M54A 3GLIA 1JXOA 3H0EA 1K92A 2I3DA 2QVGA 4N5LA 3HNPA 4FHCA 4TWIA 1EFKA 2HZ7A 4HXFB 1QQ6A 3AUYA 2FPSA 4Q02A 1JJFA 3VAAA 1IBMB 3DTVA 1EIWA 2Y4NA 4D9FA 2ZETA 3AEUB 3R3YA 4ND5A 5JS1A 1GU7A 1HBJA 3JD4A 3VSAA 4EJSC 2FLKA 4RVHA 3DMTA 2H5JA 1FNNA 3OUUA 3G5UA 1I5EA 1IQUA 3QNWA 1XHLA 3INYA 4L9AA 5DHQA 1RLTA 3NLLA 3C3KA 4BLTA 5JVDA 2CSUA 4A5OA 1Z2PX 1STOA 1YE8A 2B37A 3H1BA 1ORIA 2VQ6A 5J5VA 3A6GA 4HN2A 1NRWA 3BHMA 3NV9A 5FPYA 1QC5A 1C0PA 1K8RA 1N2XA 3CPJB 1TVKB 1U3CA 4MRVA 1FX0A 4LOIA 1DC4A 3LI2A 1RXEA 5LVAA 1DNPA 2A9KA 2HT1A 4OLHA 1PQWA 4YFYA 2QRVA 4Q9KA 4E1VA 2WWTA 1WW2A 4MVJF 5DXAA 1P61B 2YTZA 2GERA 4H3HB 3LH5A 721PA 2FKNA 3M8KA 3WDMA 4KP7A 2ZGVA 1SCAA 3MUNA 4FMBB 1E1NA 1NVFA 1OFUX 5BNIA 1E1DA 2DHEA 2P68A 3K5WA 3OHPA 4Z4QA 4MRSA 4B3JA 4OOEA 2B5WA 2JLQA 4HGOA 5CX1B 3WGUA 2QI9C 3I9LA 3P71T 4QU5A 2ADFA 4PO8A 2OQVA 4F4FA 3KHKA 2I62A 1UADA 1KZ4A 4DJFC 3TPCA 2X3FA 2YVKA 4QDXA 4U2EA 1P8AA 2NZXA 5CEEA 2W48A 4I0WB 3O2JA 4MH0R 3NXSA 4GQAA 2IV3A 3ETJA 1XAIA 5T41A 3R1IA 3MVEA 1OLOA 3AEXA 1KTVA 2Q6IA 2Q2VA 3MMNA 4M8SA 3AESA 1KI8A 4W5WA 3W5VA 2FXVA 4EO7A 5HPYB 1U8YA 4FE7A 4Q9DA 2EZUA 2WLTA 1RXIA 4JB8A 4ASUD 4P6VF 1QH9A 3MSXA 1DIRA 3KZ1E 1RQ2A 3RRZA 2VZ9A 2EW8A 1Q20A 2W2QA 1RJFA 1VCIA 1Y1LA 4AB1A 2ATXA 2VL7A 2I3BA 2XD9A 3GLUA 1FBTA 4OQPA 1JHYA 1HDRA 3H17A 2AK2A 1N2IA 3P9ZA 2BSQA 1QHXA 4D9MA 3DOJA 3TG2A 3OPNA 3A6DA 3U6KA 1IIBA 5JXWA 1H1LB 1HO3A 3F8WA 5A02A 1NJ6A 1SIOA 2GZAA 3GRYA 1JEQA 2OHFA 3DOFA 1GUZA 4IIJF 4YBZA 5FNVA 2OCGA 4CNQA 1Q7CA 5CFOA 1EUQA 4BO4A 2R751 3IO5A 4URUR 4WCVA 4P2GA 1M8FA 1SUDA 4IOJA 5EZYB 5K0TA 4NE9A 4Q93A 3K8YA 1D2RA 3H1TA 1S5PA 2DH6A 2P35A 5CAEA 1SN7A 3DWEX 3T3HA 5ALLA 4QQ8A 2V8OA 2RBGA 3OKFA 4CQNA 1BG6A 5T4HA 4XQGA 3OTOB 1JTEA 4JN6B 4C2UA 3IEKA 4HNRA 4BIMA 2EJCA 2EARA 2V74B 4F1KA 1U9CA 2WBLC 3CX7A 5A9TA 4AG5A 1U0GA 3B9BA 1VJGA 2JCSA 2BFEA 3KZCA 2W2LD 4JSRA 3VISA 4C43A 2OOKA 4IX1A 2WHRA 2X9GA 1M1XB 5I5EA 3GUZA 1TMOA 4GX0A 4C07A 5EWMB 3HJCA 3OQNA 1F2VA 3KSZO 4Z8YA 1NAHA 1PNOA 1GSIA 5CXXA 1EINA 4CTOA 2H6EA 3DL7A 1QDUA 3O0TA 1TM4E 2QLTA 4IEEA 1W4AA 1MX9A 3BIXA 1XBTA 3O6VA 3UJAA 2QDKA 3MA0A 3RJ5A 2DOKA 3O73A 4EARA 4IILA 2I22A 4UTNA 3TEJA 1LCIA 2JLVA 4H4EA 5HTOA 1VYHA 2F9LA 3WWDA 1FRZA 2OENG 1O4VA 3E27A 4HTAA 1FDRA 3O03A 2BKUA 1LWOA 4WESB 5FTLA 2NU7A 1OHHA 3KAKA 4E7PA 2RC6A 2VATA 1YQ9A 2QTFA 4OFBA 1SQ0A 2E4ZA 4M87A 4MR8A 1U81A 2W2LA 4P08A 4YCBA 5B6JA 3WQQA 4QO7A 5CFZA 3LHSA 1XXHA 2FW7A 2Q21A 3F7NA 1Z2DA 3E2IA 4W99A 4XDZA 1P6UA 4YJHB 1AV7A 4DMFA 1XNQB 1V8BA 1NT4A 2BI8A 2J09A 3U7GA 2DE0X 1IG3A 4FOLA 3VR5A 1NMEA 3CUTA 1PGPA 2A33A 3IVMA 3GI1A 3D6NB 3M9LA 1KI6B 3MCUA 4L0CA 2KQUA 4GGMX 4UBOA 1QAMA 2UVDA 4LTMA 4QRIA 3Q8MA 2ZU0C 1ZQ9A 3KK0A 1NP7A 2O19A 4WGGA 4BV2A 1N75A 2GFIA 4KQGA 4ML3A 5FA6A 1AZSC 1P5ZB 3FGZA 1PLJA 3MNFA 2GCIA 3EC1A 3QENA 1IN1A 3SYLA 4L6CA 1RM4A 4FMCF 1YFZA 3WJAA 1T4CA 5IM5A 2PQ0A 4KUHA 1HLGA 2P4QA 3PV0A 1YZGA 2C2HA 3I5XA 3U4CA 2CWDA 2Q28A 5T3UA 1BGVA 2QD2A 3EA5A 4JENA 4F2HA 4CMKA 2WSIA 3M83A 3C3EA 1N1GA 3H5NA 4N3GA 3H05A 3LVQE 2HMTA 5TQVA 5ES4B 3I61A 1M6WA 1CZLA 3OPVA 1JQKA 2JS7A 3GRRA 3NHFA 1Q7RA 1IB0A 1SXJD 4ZOAA 2CBZA 2IHNA 3I8OA 4OL9A 1SB9A 3TQIA 2BWJA 4FKZA 3DBOB 3OZAA 4YRRA 4ENUA 1JR3D 3CZ5A 3EEBA 3IEUA 3LPDA 2QN2A 4EPWA 1EM8A 1DC7A 3A1WA 1GQOA 1R50A 4KTTE 2WU4A 4OKNA 2WAAA 4WA8A 2QZPA 3FRIA 2VTBA 1THZA 1EA5A 2LNDA 4P4GA 4JI7B 3IAXA 1VHJA 4MPJA 1JIXA 3IMEA 5CUQA 3TN7A 3CSDA 1FDOA 3WG9A 2C8JA 2B98A 1JZQA 1KYIA 4H9GA 1XF9A 3STYA 3BFVA 3PYXA 3FRJA 4LOAA 2IYYA 1KZGB 1XROA 2CXPA 2VA8A 2FY8A 3PFBA 5HS6A 1NN5A 1X38A 4GKKB 4V38A 2D2IA 4M9ZA 3B78A 1P1CA 1POWA 2Q6LA 3B3JA 2EFGA 2VZEA 4LC1A 1B3BA 4H3KB 3K70B 4JV5B 3LG2A 1HQCA 1LY1A 3KHUA 3HY3A 2JF0A 3B12A 1C30A 4FGSA 1AK1A 4JUDX 4FS3A 4E3ZA 3CBQA 1E3JA 4MIYA 2QRPA 3ICQB 1ORHA 4I9HA 5FBLB 5GJVC 4H7PA 4NU8X 1GXSB 4J0HA 2RGUA 3VKUA 2H06A 1XG5A 2C1ZA 2HAEA 4AW9A 5C32A 4TVBA 4R83A 1CQPA 1RJDA 1YS7A 2A5LA 3C16C 3OQIA 1N2CE 4QYMA 3IVXA 3TE6A 4ARAA 5IULC 4MA4A 5BR1A 4O2BF 4MWEA 3CR8A 3NHPA 3VYUB 1ULHA 5D86A 2E5WA 4MV6A 1J2RA 2AL7A 5TR9A 2CW5A 4ZYYA 3LYHA 3AXSA 2BMDA 2C9OA 1IN7A 4KXYA 2OZKA 4EGSA 3LX8A 1TDJA 3KDAA 1QTRA 1L5NA 3T3MB 3K09A 3U4DA 5LP1A 1HR0B 4JMPA 2BMJA 2WP0A 2QTMA 3NRBA 4Q3OA 4ZZ3A 3K70C 5HS4A 1HMPA 4FGJA 1UKBA 4UE3S 4YCSA 5FFMA 3BB1A 4B46A 4EYQA 2DBZA 2CNDA 4CLHA 2FPXA 5CIWA 4LHYA 2IEZA 1H5NA 3QEBZ 1M34B 1CJSA 1MIOA 4DMRA 3B20A 4GPBA 5K1ZA 3WK9A 3FTPA 2DUWA 1UP4A 3QG5A 1S3SA 4JXXA 2FMHA 4M0DA 4U2FA 2AE1A 3KQYA 3RKSA 3ELYA 5I9SA 2QY6A 2DT8A 4BLSA 1N3IA 1N33B 3Q40A 3UXHA 4CL2A 4HDOB 1OTHA 2BFOA 3P20A 1NQAO 4K8OA 4BRZA 2JAOA 2OT3B 2APJA 4IFBA 1PW5A 4DJ5X 2O6LA 4RWEA 5F2NA 4CM4A 5ILOA 5LA6F 2AC4A 3ID6C 3L1IA 1IEVA 3UIEA 1SCJA 1F4VA 1JAHA 1PJ8A 1VCMA 4BQNA 3JPYA 3RODA 1J8YF 3GCDA 3D6AA 3GLHA 4WKBA 3CURA 1NFQA 4NFHA 1N7JA 3KJQA 2IYPA 3E0QA 3OZWA 3MN1A 5B1YA 4N6NA 3FFTA 1XTPA 3Q98A 4GHWA 3WOVA 4JJ4A 4ZVQA 4MQUA 3D4LA 1MW9X 3L8FA 3FDFA 1QGUB 2BGLA 1YQGA 2CEAA 1MB4A 3NTQA 4PPNA 2JPDA 4UM9D 1G8YA 5L3QB 4K9NA 4CV1A 4JT9A 2WU3A 3PA6A 4LRQA 1U0NA 4WZBB 1G5IA 4KYVA 3BULA 3BZWA 4E5KA 2VPWA 3MCAA 4B6QA 5A4IS 1KYXA 2LKCA 3ZNQA 621PA 2GT1A 3W2IA 2ODNA 3W5HA 4AKHA 1V8PA 3PXBA 3UO8B 1W5FA 4V0KA 4E12A 1FMCA 2JZNA 4FEAA 1RJ9B 2R2AA 3DEJA 1E32A 1EH5A 5CFNA 4X1KA 5IXSA 1LPBB 4G5RA 2AVDA 4L4ZA 3G9UA 4ZVTA 3ND5A 4KV7A 1NUQA 5CB6A 5I48A 4FDTA 1E3QA 3EFHA 2H1WA 4FFBA 4MGKR 1NVWQ 3CISA 3MD9A 1FFXB 1HA3A 3ONEA 4GP6A 1XLVA 3KTFA 4XIFA 4QQRA 3S2FA 4KFRA 3OZSA 3M4JA 1N78A 3TD2A 3WRWA 4ZYWA 5I7EA 4RKQA 1KBQA 3AV3A 4CTNA 2AQ8A 1FXUA 4IAOA 5KU7A 1NN3A 5JLJA 5CA1F 5A4DA 4FX2A 4U7PB 3DS8A 3FDZB 1NR5A 4NMLA 3GPLA 2FX2A 3MILA 2HYDA 4WLEA 4X6LA 5JPCA 2P5YA 2QP9X 3ZOZA 3SZUA 5T7BA 2JLSA 5CBPA 1AM4D 1PE0A 1HY3A 1TOAA 2LUOA 2O1XA 2J67A 4AK9A 3BFPA 2O7VA 3N2LA 3OLVA 3HXLA 4BNMA 1KYQA 5F21A 5FA5A 4LSGA 3IA2A 2QJRA 3GU3A 1QE3A 3DPIA 4C3OB 1X1QA 2R48A 4XE5A 3M89A 3BK1A 5DLEA 3LWNA 3HGMA 3WYFA 1CF9A 2EGHA 4OQQA 4UMDA 4OK3A 6NULA 4Y2UA 1AQJA 1QGED 1YRHA 4OKSA 5C7LO 3AEUA 4LDQA 2VA9A 4KRYA 3OLWA 2XBMA 3W7VA 2VOEA 1XPRA 1NPTO 4MWGA 1ZD3A 2PRSA 3HJHA 3I0MA 3FUCA 2POQX 3KIPA 3Q41A 2YVUA 1KMMA 3Q3HA 1E7RA 2QD5A 3QRWA 4DPKA 5C52B 3KJFA 3CPEA 4AWXA 5FBHA 3GD7A 3PCTA 4HFNA 4JGGA 5DTRA 3WNBA 1R0SA 4LRSB 4KR6A 1MQ8B 2CFSA 4OBEA 4DWVA 5M7EA 3Q7SA 1T1GA 3EGVA 1R3DA 4JLAA 4PTLA 1BFUA 1N0UA 1V1MB 2ZWVA 3CV3A 2Y1LA 3FHCB 221PA 3B7PA 3PHBE 3WB0A 4F7DA 1TVKA 5ICEA 1V11B 2XGSA 1Q5PA 1YJAA 3T9BA 3FMGA 3GOHA 4KO8A 4KQEA 4NE2A 1JPUA 2RMKA 3HJNA 2EIHA 3PHIA 1IOLA 2VH2A 3FH0A 3C6BA 3HKDB 4HZIA 4M88A 3PNVA 4BVEA 1ECPA 4PICA 4J1QA 4MULA 1BFDA 3BXFA 1GUYA 2VPPA 4KK3A 5B53A 4EJMA 2W5UA 5CX1A 1ZEMA 3BXPA 3OJOA 5HQTA 5KJCA 2CB0A 3VV3A 4EZIA 5I4IA 4V0NA 4Y9SA 3OIFA 3T54A 1FVXA 2VSFA 3LUCA 3WHIA 1NYRA 1I7LA 2E2WA 4KRXA 2HRZA 4F5EA 2GO7A 4MI1A 2QAJA 4UU0A 3W78A 3VR4D 5F5LA 3JQ8A 1QJCA 2XE4A 5EHNA 3HGQA 1RDFA 5B12A 3PSHA 2IBSA 4WK4B 3BTUA 2BR4A 1ZAKA 4CL3A 1ESMA 3HCFA 5HUQA 4B4VA 2NUPA 3KVYA 4LDNA 2C2KA 4EEKA 3LUPA 4QOEA 1EI9A 2PMDA 2ENUA 3ZWPA 3N8GA 4GE0A 3MRSA 4H3SA 4H6VA 5KAMA 2Q7XA 3TIGA 3ABSB 3D4PA 2CHVA 2XZOA 5BYAA 1IK6A 2G5GX 2ZSEA 4YRMA 4QE3A 2ID9A 3QE2A 3L4KA 1ODCA 4MGHA 4U5QA 3RS7A 5FL7D 5GZ3A 3O2NA 2OL4A 1NG1A 4JP5A 3RG2A 2PYDA 3FNFA 4YLYA 4IRMA 1VZ2A 2HL6A 4FOSA 1U2PA 2HSWA 2DSNA 4K9MA 4GKBA 2RKOA 1AVTA 2WJ6A 1H1LA 1RTKA 2PUWA 1QIDA 1P2BA 2NXJA 3SIRA 3LLVA 3GR6A 3KE8A 2GLUA 4MPDA 3RUAA 1W5TA 1HM5A 4UVDA 5EZYA 4IW3B 3OFJA 2ODWA 2MHCA 3DYBA 2FN9A 2R11A 1HT1E 4LY6A 3FZYA 3HP1A 2R8ZA 4NG5A 4XM2A 4HRAA 3ZD7A 1EFCA 1USGA 4KR3A 2EYUA 4J29A 4OG2A 4P0QB 4NYJR 3P97A 5DEIA 4CMJA 4F3YA 4A2CA 1ZK3A 4QWWA 1X0XA 2DCMA 2PQ6A 5IJ9B 1HQYE 4UM7A 1KQOA 3GUYA 1I0ZA 1KS9A 1YA8A 2Q99A 2X77A 4FN5A 4HQNA 4MKGA 5FL7A 1DWUA 1E94E 2P40A 4GZMA 2UUAB 2ASEA 4DSTA 2XWJI 4TGLA 1OZGA 3R6DA 1O8CA 3D8HA 2J5QA 4LRXA 1N2BA 1IPHA 5K8CA 4GOJA 1LC3A 1Z3CA 1X86B 2GN0A 3CCFA 2X5XA 3IP6A 4PLGA 2X9NA 2PCLA 3CM0A 4G9BA 5FOUA 3TIVA 3TGWA 3WRXA 4LXUA 4P5PA 4MJ3A 4PSDA 4IMIB 4BX9A 5BQXA 1CP2A 2ACVA 4RNCA 2Q7OE 2WJ4A 2A5YB 1H0KA 1RYHA 2Y2VA 3I9OA 3FCYA 2EX4A 4NOJA 1GRQA 4BRSA 4V1CB 3G17A 5CT9A 3W04A 1BJKA 5ALWA 2WTEA 4DLPA 3A9TA 3QQ5A 4YCJA 1RI4A 4HRVA 4PYQA 2NO7A 3C8ZA 4Y30A 4WESA 3WX0A 5BORA 4B3RB 2EL7A 2Y66A 4N03A 4FN4A 2Y99A 1B74A 3K9GA 3ADKA 3NPAA 5FTNA 4OIMA 1YGPA 1VHQA 1CV2A 1H3EA 2TECE 1Y6GA 3ZS8A 5JW6A 1IHXA 3GQVA 3V2UA 1NNLA 1FSPA 4QJIA 2WW8A 1BWPA 1GUDA 2AHRA 2Q4BA 4YJHA 4KQFA 4DHEA 2AF4C 2G82A 3R5XA 4DG8A 4ESEA 2CV0A 4GR5A 2HSZA 2XAUA 4OJYA 4XSGA 2A35A 2MMGA 5FV7A 1ZESA 4PX3A 1FL9A 2CL6X 4D4IA 1KI6A 3OZCA 4OYLA 5IM4F 2W8BB 4M8IA 3RVQA 5IJ0B 5AM0A 5FEUA 1XP5A 2IXFA 3N0TA 1PL0A 3ACBA 1VKOA 2JIQA 3JVDA 3LDHA 1JNYA 4DM7A 3CRNA 1TM3E 1Z0KA 3DLIA 3KFLA 4A7PA 1G291 4C01A 4XVCA 5J4VA 3RAPR 1SG6A 1QDEA 4MQLA 4D74A 1H8ED 4YUYA 1HGXA 4AUNA 1OAAA 5MFPA 4HLUA 4KYUA 1BSVA 3A3OA 3KRTA 3ROKA 5CB8A 3ABRB 1ESDA 2PT5A 1K5GA 3NM4A 4DLWA 4L85A 5JZBA 1MVLA 3HN6A 1X9HA 2O2CA 3QOFA 5H3CA 1KEKA 3LPAA 2P2ZA 3ELBA 2SCUB 5ICGA 1EDBA 1ZUNB 2H92A 4QU9A 3SHVA 4ZQIA 4AN4A 4RK4A 3IAFA 5SZIA 1JDSA 2VPYA 1QP0A 1IZZA 1MAUA 5L45A 1OMOA 3HDJA 5FUYA 1JIUA 3WIVA 5KWSA 2PH3A 2XB2A 3IBSA 1XTUA 3IPYA 2L18A 5JD5A 1DBPA 4LSZA 4UDXX 1MH1A 2GFHA 1USKA 1XEAA 2HXGA 5LLTA 1Y9EA 2XJ4A 1DUVG 1A3CA 3E70C 4MWBA 3DVRX 3L8HA 4XQEA 1J39A 1EEHA 4OJMX 2WFLB 1H8EA 1PDVA 3P2OA 2HMYB 3Q7PA 4N5MA 3VDMA 5LYJB 4RE5A 5H3HA 5HBGA 3O3NB 3T5GA 4RHEA 2BEUB 2VHXA 1Z63A 4HB0A 1AF4A 2Z4SA 1JHOA 1HZZC 3DZJA 5C53B 4PZZA 1UT8A 3IKTA 1C8BA 1QE0A 1GXSA 3C3DA 3IIIA 4KDCA 1PZMA 2IDKA 4Q4HB 2QSJA 1B8PA 3V4ZA 1CNEA 5A2QA 4ES6A 3QWFA 3RSQA 5KSYA 2QK4A 1M1YE 5K5EA 2C9CA 4HEQA 3BH6A 4YCNA 1N7GA 2BGKA 4XJXA 1LK7A 5IKEA 3TO5A 3IUSA 4XPIB 5GOZA 3BWXA 2DTEA 3VYVA 1UMBB 5FULA 1K86A 2GPTA 3OUTA 2A1UB 1W0CA 4KN6A 2WZCA 1SZCA 5IAKA 4DSNA 5I4KA 1OH8A 2C88A 3T5TA 3G8YA 4ZANA 4RXMA 3C7CB 4DC9A 1FU8A 1INLA 2EWWA 1GA1A 2A14A 3ITNA 3L7KA 1IUNA 1MAWA 1VXRA 4UULA 3VI3B 2EG5A 3ORYA 3S55A 1O3YA 3RC2A 4BNLA 1CUVA 3INTA 1ZGGA 2PPLA 4QDZA 4X8LA 1KA9H 2N75A 3G8CA 2PT7A 1EBUA 4TV9F 1H4QA 1CDOA 1NZJA 1Z83A 2RB5A 1MBZA 1RWVA 1M34A 3DSRA 1KR2A 1KY4A 4XUGB 2UUPA 3TZKA 4PXYA 5IKXA 1E3WB 2WVAA 3AUUA 4W6QA 3TUIC 5TQ2B 1DKUA 1N9ZA 2Y93A 2R00C 5TEVA 4F21A 2YYAA 4HOYA 3MCZA 3M1IA 4ZO7A 2FA9A 4V2IA 2F55A 2XUZA 3K4HA 2AH5A 3CH5A 2FEAA 3CNOA 4NATA 1GPWB 2FMTA 1FFDA 4C6RA 3S1SA 1TAGA 3OTGA 1L5OA 4E22A 1YUMA 4CQLB 3NMUF 3C2QA 1UPAA 2OC9A 3L0PA 4BMNA 1BX3A 4LRTB 4YMVA 3PQEA 4EMSA 5TT0A 4Z3KA 3KAJA 4KQCA 3MS4A 1E2EA 1H9CA 3M6FA 4OFXA 4DDWA 1YUBA 2R8XA 4KQIA 1KGSA 4D92A 4FINA 2QNIA 4MJXA 3OJLA 1ZVQA 2OBMA 4CW7A 4C0KA 2AD5A 4AP5A 1L7RA 2TMGA 4QC2A 1QGUA 2P9CA 3UG7A 1QIHA 3HADA 3KJEA 4Z53A 2L17A 1XF1A 3AFOA 5L3QA 1SK9A 4O02B 1NLZA 1C41A 3BDIA 4LBVA 4WZBA 2WYWA 2JEYA 3UB3A 4HSGA 3VO2A 4B87A 4BLWA 5KJFA 1BEUB 2VR1A 1QV6A 3BEDA 1E9VA 4MO9A 5DASA 3TEMA 5GADl 1LI7A 4MTLA 2RHRA 3K05A 3B1FA 4LBYA 4W1RA 1TCCA 1I13A 3T5DA 1M2HA 3AB3A 2GK3A 1RJ9A 2CDRA 2G4CA 3ADOA 5E1OA 3K6JA 1JAXA 1OXSC 3TKAA 3QTTA 4IFIA 1N3BA 1DJQA 1SUCA 3H65A 4PLWA 4YQEA 1YZUA 5KWIA 1TJ3A 3PC4A 4NG4A 4QFCA 1N0WA 5BWLA 1ISSA 2P6PA 1FFXA 1RAIA 1NYQA 3I23A 2IYNA 4G37A 5TY0A 4S1PA 2XOKD 1U8UA 3FZQA 4JGIA 5AW3A 3CRZA 4PHTA 2IUTA 2H8KA 1PX0A 2GKSA 4MV1A 2F6RA 1NNEA 1I6LA 1L8QA 4CIVA 2WNIA 2VT6A 1G98A 1FQOA 3FDZA 3OA2A 4HRYA 4CLRB 2Q9AA 1PTJC 4D46A 5AIBA 4FUTA 1QH1B 4QASA 3GHYA 4R1UA 5KB3A 3KXIA 1WLSA 1O97C 4CM7A 3FVRA 3HUUA 5B7QA 4FEGA 4TSFD 2IRWA 4NICA 1J42A 3RBZA 2G1JA 4BNNA 1Q1EA 2YWJA 2FPIB 5IG2A 3CRW1 1VPDA 2OA0A 3IKLA 2WHXA 4M98A 5HGXA 3ZDBA 3O2SB 2X0EA 3FSRA 3SQOA 4Z49A 5EIHA 4Y6RA 4IHJB 5E4YA 4ZICA 3ZV7A 1MPTA 1O94C 1VMKA 2XOKA 4GRIA 1SUFA 4IDBA 2H2AA 2IEDA 4MWOA 3YASA 1P7VA 2P3LA 4WFQA 4ECAA 5LZ9A 2HJVA 5J4YA 2ZWOA 1LBTA 2OUKA 4G9GA 1HWYA 3DD5A 4JKYA 4H2DA 3ZOKA 3RU7A 3MOGA 4ER0A 5JDCA 3QHAA 4XX1A 4D9HA 4ZV9A 4CNBA 2BKXA 4WGFA 4N0PA 1C8KA 2JGMA 3L7LA 1NU6A 2COUA 2ZWPA 3OT1B 5E7MA 2QR3A 2ZRKA 1W2WB 4ZOLB 5IW8A 2FPKA 2IYEA 5CDSA 1OV6A 2KE5A 4WLFA 2JFXA 1V1MA 2VAMA 2VF8A 3R0VA 1U99A 2NXCA 4XSVA 5KJ1A 1DARA 1V11A 2MTBA 2IBMA 5I01A 4EPXA 1IWBB 2QX7A 1KVTA 1IZYA 1R74A 2PO7A 1J20A 4K1LA 4KWCA 1XKQA 3HKDA 2QTRA 4XIYA 2EF1A 5JWRA 2BZGA 1JIKA 1T3HA 2QTWB 1XIVA 3JVVA 1VE1A 1I1NA 1ZD5A 1YRYE 4YCDA 3RVBA 2GLTA 5YASA 4NCBA 4Y0NA 2A1TS 3GLGB 1T15A 1Y5RA 1WD7A 4HGZA 4D0RA 1NURA 4DA4A 3J7TA 1E9AA 2IXTA 4MRRA 3P9XA 3ZLUA 4PYJA 1MC5A 4RJIA 5EMNA 5JUWA 2VH5R 2CBGA 1B42A 3NATA 4H59A 4UXIA 5ALQA 3UAVA 4F97A 2J7PD 2ZT6A 2P4HX 1AZWA 3CZPA 1D2EA 2MSKA 4COKA 1Y3CE 2NZWA 4MUGA 5H5JA 3RNOA 3ZBTA 2CXXA 2PVSA 4D3YA 2GA9A 2CL0X 2FJ0A 1L7MA 4NV0A 5C7YA 1N7HA 3MEQA 3UY4A 3GPCA 3FZGA 4PC2A 2ACWA 5FNZA 2VTVA 4JHLA 1G2QA 1BN6A 1G8FA 1RAAA 1UANA 1WUTA 4NNOA 2Z04A 3DEYX 3C1UA 3AVXA 4Z1MD 5SICE 5I7FA 5K8UA 5HDQA 2BFNA 2MSEB 2O3JA 2OUIA 1DRUA 3FLAA 5J40A 2MYPA 4LAFA 4YPOA 3OY2A 1BKSB 3DUWA 2YINC 3UJPA 2HPAA 3ZX5A 4FYMA 4UTVA 5BY2A 3ENQA 3P9NA 2VK8A 1WZNA 4RPJA 3SC4A 3TRKA 2G0AA 3EPRA 2VHWA 3FDXA 1JT9A 3SC6A 2J7PA 1XI2A 1T6BY 3WHPA 1NQOA 4OL0A 1FUKA 2JGRA 1YJ8A 2NADA 3AR5A 3CVJA 3CUVA 4PYKA 2G04A 2QW0X 1E6UA 4M7OA 4GZ3A 1AGPA 1W29A 2QTBA 3D3WB 2XZTA 1K2WA 3LLMA 3PCRB 3REFA 4EG5A 2C2MA 3DXFA 2CNLA 3D81A 2R7MA 3HPRA 1XD8A 2CZGA 2XMQA 4J9UE 5IJAA 2VAXA 1CBUA 1RE1A 3TNFA 4AJJA 4Z1MA 2O8NA 1DEHA 5GINE 5F9HA 3HH8A 3PC2A 2JW5A 5WRFA 5JMWA 1LDBA 4B4KA 4A0SA 1NJGA 3OH8A 4DUGD 3GNTA 1E60A 2YXPX 1GV1A 2O23A 3D2AA 3DTTA 3P9YA 4PGMA 5CPFA 4ZOCA 4RGQA 5IJ9A 2IFTA 4ND8B 4Q3DA 4R6XA 4JQCA 4D44A 5C8XA 1E5QA 4HUJA 4FOTA 4BQSA 2YJ5A 1ZCJA 3U1TA 1XCJA 5HUHA 2IH2A 4I50B 4LN1A 2UXDB 3RVLA 3JQ6A 1MC8A 3JALB 4JLMA 6CHYA 1B3RA 3Q2OA 3E15A 2QJWA 4XZ3A 4TQ9A 4YAJA 1ECJA 3TJZA 2QN9A 5BSMA 3G0CA 2X7XA 3D1JA 1U2EA 4I1IA 1JQ3A 4UDOA 5CEFA 5JNSA 3HYCA 3RWMB 3PZBA 4FSDA 3HBJA 3QV1A 2AFHB 1N2GA 1UP6A 1MKYA 3UK6A 3ZXYA 3TRJA 3TPZA 1E4YA 2P4EA 2QROA 3IELA 4AZ3B 4V1CA 1R7RA 3OX2A 5B3JC 2C00A 3P1JA 3S2UA 1HEUA 4DUGA 5HQJA 5JPIA 2PL1A 2Q27A 4QOJA 1PBTA 3VSEA 1A7AA 2HLNA 5AVRA 1IG0A 4MW6A 1DAMA 3L05A 4CM9D 1HTWA 3U9SA 3C8UA 3W3ZB 2QG6A 1R6DA 2YWRA 3ZGVA 1DPGA 3BN3A 4NYMQ 5THXA 2BL4A 3SQWA 5D5QA 1FX1A 4Q1AA 3ZNNA 1JYSA 3FTNA 1AXRA 2GZMA 2QGFA 3UWOA 4PW0A 3K35A 4ZI7B 4K1XA 3LC0A 1AHIA 4RNDB 5BP7A 4K2AA 1SEVA 3L18A 4TMYA 1RWMA 2AEFA 2W8BA 3CEAA 3UV7A 4MYHA 4AYWA 5IJ0A 3DZ8A 1VKNA 1TKCA 3MWJA 1P8JA 3VX3A 4F71A 2FRDC 4JYCA 3AVVA 3HPQA 5D87A 4P5EA 3WIBA 3UJDA 1NR7A 3FCCA 3WGLA 2C0CA 4DIDA 1F1BA 3FYDA 2P7IA 4A27A 2A88A 3PEWA 2XVAA 1G0OA 3BGSA 4CM9A 6AT1A 1V71A 1BQ4A 1HZZA 1Q77A 1ZRMA 4DMGA 2VF5X 5IAGA 3A32A 1OX6A 1NMYA 2B30A 2J30A 2CNNA 2YWFA 3ZCTA 1SUPA 5G0SA 2Q4DA 2SCUA 1YASA 3K7EA 1CQWA 1PNQA 1ZUNA 5IBQA 2EFCB 3WSVA 3S8YA 1XQ9A 1FYEA 1WETA 3BTSA 4KJZA 1YS6A 5F3RA 3U19A 3O7WA 5CP8A 4N9WA 3AF4A 1PSZA 1X92A 2AOWA 3WGNA 2FWMX 1KAEA 3T9AA 3SE7A 4NV1A 3GLIE 1REQB 3JAKB 1FFAA 1CJUC 2CV1A 2JEZA 3KX2A 1PCXA 2P75A 2CLDX 4M0UA 2IH4A 1XJ5A 2WFLA 5GP1A 2P2GA 3MXTA 3SN6A 1JJBA 5LYJA 4E46A 1EE1A 4IEIA 2BR3A 1NFRA 3MJRA 1RVV1 1G4AE 4M8LA 3GGJA 2BEUA 1RPAA 3ANLA 4DCOA 5IT5A 1X94A 4JI4B 1HRKA 1L5QA 4JCCA 4C22A 1ADGA 1JFRA 3QEKA 1DAIA 2I2FA 3T99A 1K5HA 4GI1A 3IO3A 4UNSA 2C0PA 4OA5A 4UMEA 5CTAA 4EK9A 1A2BA 4HEJA 4EOGA 4Q4HA 5KOYA 3QWHA 1YQWA 4OK6A 3R8CA 3SZRA 1M2OB 2VT7A 5K3AA 1OASA 2I1LA 2ZRAA 3OZIA 2BISA 1A9PA 2I1QA 1DQYA 4R8LA 1WMDA 4MKZA 5IAJA 5IK2D 4KQWA 3NGMA 2QPOA 2X41A 3COYA 4M1ZA 4KBYA 4NBNA 3R76A 4N82A 2YVQA 4XPIA 1GV0A 1OYOA 4B3DA 1CRQA 1K7XB 2G5TA 3UEOA 1UMBA 4JT4A 5KNCA 2Q2WA 1SQ5A 2A1UA 3QJYA 4RY8A 4RTJA 2G83A 1BVYF 4C3UA 1SQ6A 4F45A 2EKLA 4C2BA 1L4EA 1CP3A 2VYVD 4IGEA 1YZ3A 4YNBA 2B92A 2MU1A 4O0LA 1JFFB 4H7DA 5CFLA 1JFSA 2GX6A 3EXEB 1LLQA 2G71A 1IE3A 3UF0A 2AYYA 3Q8XB 2ECFA 3IRUA 3SBXA 3DAPA 3ICEA 2H1FA 4MXDA 2WQ6A 1A5AB 4FNMA 2CVHA 3RVJA 5B2ZA 4G0UA 1E3WA 5IK2A 4DIBA 3HB0A 3DLTA 3JVEA 4LYDA 4REQB 5TQ2A 1PT7A 1Q1GA 1A2OA 2KI5A 1BCSB 1QYIA 4E70A 1JLKA 3IS3A 5DW3A 1BJTA 3R5FA 3BE6A 4JIGA 3SFVA 1V3VA 4FQ5A 2H1CA 4P0PB 4C0XA 3H75A 2BLNA 3Q2KA 3RI3A 3VR5H 1IRXA 1KR5A 2VJKA 4MPRA 3TNYA 2HX1A 4CQLA 2ERYA 5C80A 3KPWA 1C50A 2J3QA 2VYVA 4YMUA 1IY9A 1SH7A 2BGNA 1A88A 4FNOA 5AI5A 1KYWA 1GGFA 1XRSB 3CXRA 3OC6A 5AKEA 2J6HA 2G5CA 1XMJA 2LV8A 3MM4A 4LNUB 1EU1A 3VSCA 1PK9A 5JWOA 1Y6FA 1KE1A 2JGDB 5BOSB 4XRGA 1L4LA 2MSNA 1ESCA 4UUQA 4B81A 2HMAA 5AVOA 2WF7A 2QG4A 4MUNA 5EJFA 4F6CA 5AJUA 1N8KA 1QP7A 4DABA 3GYGA 3G79A 3LQYA 3KQVA 4ZT4A 2VDNB 5DBHX 3AY7A 2ECQA 5ALYA 4II7A 3VMMA 1A9XB 3VJMA 1II0A 1KYZA 2PPVA 4E14A 1TTQB 2YYYA 3NAGA 2WUGA 4E33A 1GEGA 4UOZA 3Q3CA 1MOQA 1P2TA 3F4KA 4G0YA 2WHQA 4O2AB 1WZ2A 3TG8A 4YI5A 421PA 5KYTA 4FLMA 1GPKA 3M34A 3ILSA 3IVCA 5HRCA 2BBSA 3L5OA 4XQ0A 1I3NA 1ZGZA 1V2HE 4QTZA 2RKWA 1AKNA 5HKLA 2H7XA 3CLSC 1RQGA 1BHQ1 1IMOA 1XTBA 3T3NA 1HSZA 1MDFA 4JYPA 1Y5MA 3K0FB 4EWLA 1QNLA 3NEAA 4Q03A 4YDSA 2MMCA 1VJTA 1SC3A 4QUHA 4ZVRA 1QG2A 1EDDA 1C3EA 1T1IA 3LE8A 4QYIB 1E58A 2VIIA 4JLBA 4H60A 4WQMA 5K3BA 3FJOA 1UODA 4CLRA 1NMXA 4M0FA 2BBOA 4K9SA 4HQ0A 3RFVA 3Q87B 2R4TA 2XA9A 3BGDA 1QH1A 2JFGA 4BFZA 4NYIR 1EXVA 4PS0A 1Y8ZA 3B1KA 1GCUA 1MRNA 3HU1A 1S8NA 5KTMA 4MGYR 1M7GA 1NQVA 3WLHA 1NFFA 2J9XB 5JNRA 3RSSA 3KR9A 1EHIA 2FPIA 2H4YA 4EX6A 4E2YA 4ALIA 4EF4A 4BNKA 1OA1A 2KWIA 2GEBA 3K72B 3O26A 3W5CA 4DMKA 1A4UA 4X84A 4XQCA 4GOXA 1NN1A 4NDZA 2V7VA 4IHJA 1QV7A 2BMVA 4NBTA 3V8VA 4AICA 1AB6A 2BN4A 1IM5A 4ZAWA 4KRFA 1LV7A 1QFXA 2QXUA 1EB8A 1XXHE 5EHIA 4O5OA 1F8FA 1RZUA 3I1FA 3DAHA 4YYEA 4WEQA 1KAHA 1MC4A 1Y3IA 1PS8A 1V1RB 1BHSA 4EPTA 4B7AA 3QU9A 4F2GA 1Q92A 3ZJUA 3A05A 3IEIA 2ORWA 2NMVA 2WWHA 1GGVA 3L41A 4NEHB 4JL8A 4EB6B 1JDNA 2XX3A 5EGSA 4AROA 4TYNA 1TEZA 3OT1A 1Q1AA 4ABTA 4ALKA 1CY6A 3DCNA 4TUYB 2Y68A 4ZU6X 4Q15A 1NV9A 2GWHA 3F49S 3MUEA 4MYSA 2ACKA 4NBWA 3HYTA 4QUIA 5DGXA 4ZV4A 4IS3A 1VIVA 4OSEA 2WWGA 1SCBA 3KQPA 3LXUX 2QUKA 5DWQA 2ZRLA 4EO9A 2DLCX 3SHWA 2GH1A 2YIMA 1N4AA 3RQIA 3ASZA 5D3QA 2NOAA 3IIEA 1Q95A 5LD2B 3LUJA 4KSBA 4XRRA 1WMBA 4BLRA 4HYEA 1AA9A 1RZRA 1Z6QA 3L1VA 3GLGA 1NNI1 4FFDA 5KTYA 4QLBA 2ZRPA 4Q37A 3G0OA 3A10A 2J3IA 4Y2JA 5G40A 4QSMA 4RZXA 5FEMA 3UTCA 3TBHA 4KPGA 4BGEA 4R3WA 3IUBA 4DRYA 3DHEA 3RVOA 1Z0AA 3ZWOA 1EP3B 1SKYE 2A5GA 3SCZA 2QRQA 3UW1A 4M0MA 1GZ6A 1Q21A 1WP4A 1XWFA 2G09A 3N0XA 2AQKA 2IGTA 4KBFA 4DLNA 2R1ZA 2AZ4A 3GCXA 1RS0A 4ZN6A 1E7WA 1AOXA 2XBUA 1B2RA 1NMZA 3AZOA 3JZDA 1HDOA 1YR1A 4YP7A 4RF4A 1Z3IX 2FPUA 3AXTA 2CE7A 2Q6KA 3UMJA 3IQGX 1OROA 4Z4IA 2DPXA 1D0VA 3K8ZA 5FI5A 5L3RA 5IVKA 2O8FB 1DTSA 2G6TA 4FHGA 2B21A 3X1KA 5LD2C 2IS6A 4GPD1 4OM8A 1XNHA 5JH7F 4H7FA 3I9MA 3PQDA 1KK3A 1MD9A 1T8PA 2GZSA 4OVKA 1PQPA 1JKFA 3IODA 4BO3A 2WWWA 4RLFA 4BO9A 1GZUA 1RIIA 5HSGA 5LDGA 2D7CA 4LYGA 3FPSA 5AFSA 3WXMA 4BB6A 3QF4B 4UFNA 1KMIY 3H2YA 4IMRA 5AI4A 3W3AH 3WLOA 4GPAA 1CUJA 4YH1A 3ZK9A 4YUWA 4JDUA 1LQTA 4B6GA 2PGDA 8AT1A 1JG6A 3VGJA 4L4UA 4NBLA 4DCNA 4EI8A 3KKEA 2NNWB 1IXZA 1YA6A 3D3WA 3AHFA 2EBWA 3I9NA 4ZC1A 3EODA 4IVPA 3RLIA 4ZDJA 2I0FA 1RE0A 2RAVA 3KVOA 2C2OA 3CY6A 1QHSA 4J75A 4Q9HA 2PX5A 5DBEX 1JJ7A 3MYRA 1PK8A 3NALA 3GAMA 3PQ7A 1B8UA 4XD7D 5B3JA 3L7IA 4U2CA 1GPAA 4PONA 1NNSA 3COSA 1LZLA 4P4UA 1VA5A 5EIXA 2FJPA 5IVDA 3NVKI 1OTYA 1TQ2A 3KT0A 5FQNA 2NVUB 4Z99A 2GHRA 3RHZA 3PITA 3W5UA 5B6PA 5C8YF 1X3SA 3H04A 4LJRA 1Y80A 3WGGA 4CMGA 2HBRA 4ND8A 4G0XA 2VHTA 1YJQA 2VDMB 5D6OA 1DC8A 4EMBA 3TBKA 3EW9A 4JJGA 1C3JA 5A5DA 1AE1A 4RTSA 1PZFA 4I50A 2HF2A 3JALA 4I1YA 3V8QA 1G8GA 1PP4A 5GGXA 2F3SA 2IUUA 5DP1A 4CN8A 5A05A 1EXDA 4UHFA 1DQSA 1L5MA 3JWIA 4MCAA 1FYDA 2ZAOA 3DGFC 3ZK8A 5AI8A 4B6PA 4UPVA 1YCHA 3AR2A 2AFHA 2FRDA 4K28A 4LIPD 1EG2A 1TVMA 4AZ3A 2Q8PA 2QG9A 3GLHE 3EB9A 4V02A 1X8XA 3JRNA 4D4GA 4NHOA 3VTKA 3FHOA 2PV7A 4RY2A 1SKUA 3F6RA 1NKSA 3GZJA 2BGTA 2YHUA 5K4HA 3KZXA 2BGRA 3WWZA 2Q3JA 5GPBA 4OU4A 5J5CA 1GGNA 2R1TB 3A4VA 3I3OA 2FSFA 3KUKA 1KORA 1QX3A 1IHUA 3KJGA 1XTKA 4I6EA 4NSNA 3VU9B 5FBVB 1VPWA 2VJBA 5K0ZA 5IN4A 4G1BA 3R7BA 1K5PA 1H6DA 1NVDA 1U7OA 1MU0A 3DCJA 1UJCA 4O0MA 4IUYA 2PLAA 3GVIA 4RWZA 3R74A 3QOYA 4ZI7A 4ZYUA 1AKUA 4RS4A 1KJNA 9ABPA 3ITEA 4PYIA 2J5BA 1JKXA 1E1CB 2AHOA 4HAOA 1DE0A 3CZQA 3F6YA 1X1CA 3I53A 3OHMA 4D9NA 3KQUA 3X43A 4WE3A 1JECA 4QJ3A 4W8HA 5TRTA 3RAFC 1C0KA 2A57A 2KSQA 2G07A 1UM8A 4HP8A 1TMYA 3C98A 3F3MA 4G89A 4HQ6A 5H4GA 2O8DB 5L40A 3UCXA 2X9QA 2Y1OA 3QI2A 1J1ZA 4C4RA 1ZHHA 3ZXSA 4WADA 1ZSYA 4JNCA 4BX8A 5K6AC 3RIEA 1TIPA 4QAJA 2IHVA 4O4IF 3T9CA 3U3MA 2Q1XA 3OZEA 1Q0RA 5I8ZA 4FYHA 3NEPX 1FVHA 5DT2A 2JIZD 3U9TA 3E9MA 4LGCA 5ADVA 5KNDH 3RJZA 3G89A 4M0LA 2H9AA 5FLKA 4D3SA 3PJEA 2OGTA 4G0MA 4W7IA 4F6RB 5A0VA 5DIZA 5K2OA 2P9QA 3H0CA 5I6DA 1BGWA 3IQDB 3QE0A 3KSRA 2C2GA 1AK2A 2Y77A 3JAKA 2CYBA 4OCZA 4YRDA 3AJRA 3FETA 1M8JA 1MJNA 1NVTA 2B8WA 4NBRA 3ITKA 5E7IA 3GFRA 4B47A 4HKTA 2VP3A 1IN6A 1TF2A 4M1QA 4C9BA 4G4JA 3G0BA 1T3GA 1JMVA 2DPMA 2R8BA 4RF5A 4A6DA 1WULS 1TKAA 5FO1A 5EJ4A 1RLOA 4YK7A 2Z30A 3ORSA 4NE7A 5AHOA 3GO4A 2ZBQA 2OECA 3WY9A 1DAGA 3EOAI 3KZMA 3HJTA 1YOBA 2JIZA 1OJLA 3VC3A 2V59A 2BHNA 1R9JA 3EJWA 1HMYA 3M3DA 2C4TA 1M2OA 2Q5FA 3PGA1 4QYSA 1SHKA 4P3OA 4TRNA 2G1KA 4Y6SA 1R0LA 3SBOA 1R15A 5DTEA 1E69A 1ISMA 2DSTA 3HDQA 4XFKA 2PU7A 3WGYA 1CS4C 1DEAA 3QFFA 2I4OA 2RHTA 2XQFA 4RPLA 4DRZA 4LFBB 4F91B 2FPMA 4R81A 4Y2TA 1J97A 2PUHA 1VECA 4CU5A 1GFZA 1PFUA 3NNNA 4Q39A 1Y9ZA 2AOVA 1SURA 2XYQA 2R7LA 2ZYVX 4KXQA 1RPZA 2B9VA 2Y1XA 3RCBA 5KTOA 4LE1A 1JFFA 1TECE 1VSTA 5B3LA 4RDCA 4DQLA 3EXEA 5KQPA 1KEUA 3COJA 2IE8A 2AMFA 4OI1A 3FYUB 3CZRA 4R2JA 3BCUA 1DIOB 3T8YA 2DTDA 2HTFA 1TO2E 4QL3A 3JWJA 3R0IA 4ZTUB 3I12A 4ZT7A 3QUSA 4WFKA 4S1VA 4REQA 2WWFA 1T2VA 4K86A 3RRYA 4LJ9A 1BCSA 2DHCA 2IXDA 3FDJA 3UUEA 3KUUA 5CITA 2XCQA 3PFWO 2JI6A 4H15A 4II3A 1RM5A 1Z7EA 1NXWA 3LNCA 3DBIA 1ZW6A 1YRLA 3ANYB 5AVUA 3IKJA 3BDAA 4XB2A 1UM9B 4AI6A 1I7NA 1ICEA 4M86A 5FXMA 3NHUA 2YVLA 4K6FA 4RXTA 3NAQA 1TC1A 1ZIXA 1AKVA 5J47A 3DVQX 4PYLA 2ZUVA 3OZVA 2ZRDA 2GZ3A 3HDVA 2IU4A 4LNUA 3EFEA 4ND6A 2K5UA 2VF7A 5FX2A 2I87A 2IOFA 2JGDA 5BOSA 1WUHS 5L8VA 3CQ9A 4CDGA 4YRZA 3FYUC 1L7XA 1YCDA 2RFLA 1U7DA 3GIWA 4F93B 3EIUA 2C82A 3UB4A 4KMMA 3RIYA 4RGBA 3MWFA 2XCIA 1QZ3A 4MWTA 4Q19A 4E5DA 1A9XA 3IMGA 1P74A 4FHDA 4YAUA 4HQKA 3EZXA 3VR2D 2ONJA 3IPCA 3B89A 3A70A 4O2AA 1PJRA 3DFFA 3IMCA 2JAXA 3CVWA 2H5LA 3AIMA 1FS6A 1J0DA 3E2PA 4BNHA 2H0RA 2LCFA 3WRYC 4Q4LA 3FPLA 2W6JD 4RK0A 2JNWA 2Y6UA 1R4AA 1YVRA 1UQTA 1Y7LA 2OEPA 5HEKA 4C7VA 4CYMA 2PMEA 3PR1A 3WNDA 3F3YA 5G4LA 2XUHA 3ZI7A 1Y81A 4DIOA 1Y8RB 1P0PA 4DLTA 1T8RA 2W6QA 4UJ5A 4BP9A 3K0FA 5LXTB 4FT4A 1XLWA 1TJNA 4I4TB 4AJHA 4B0OA 1FW6A 2F1OA 3ADPA 3QWAA 4W9NC 3ZTWA 5B4TA 1QP4A 5GTDA 1MO2A 4QYIA 4QVGA 3ZD9A 1EK5A 2BT4A 2OKGA 5BN5B 2R62A 4E08A 4BE9A 2A86A 1C8LA 2P6OA 1ABEA 3PVZA 1TUGA 4NFLA 5AJTA 5DSXA 4ARCA 4HD8A 4NWIA 2HCJB 2W2KB 4R1QA 2PV0A 4PGGA 4LOHA 3QVJA 4OFZA 4HPWA 3VTZA 1EEXB 3AVTA 1KS2A 4CM8B 4EW3A 5E3JA 5HGJA 4LZOA 1FJGB 2AWNA 1YS1X 2JK0A 4HSEA 2VTKA 2W6JA 5EZSA 1K97A 3AR3A 4BTEA 3HFGA 4Q05A 3FNIA 4HAIA 4GLLA 2QVYX 3K1JA 4XI9A 1P9WA 2ZI5A 1A72A 1SB8A 3U3JA 3K5IA 3AFGA 2R97A 1T5OA 4N0DA 1X1EA 2QP4A 4MGEA 4WRRA 3FX2A 4EIWA 4RTOA 3GX1A 1V96A 1L5WA 1TZCA 1PF7E 1U7TA 1BKYA 1V1RA 1YZYA 3U3XA 2VXCA 1PDWA 4MICA 2OBYA 5F4ZA 5A04A 5IZ4A 1PO7A 4TX1A 4PLFA 2VZ0A 3RB8A 3KKOA 4F3RA 5LQMA 1GPH1 1XSEA 3KNZA 4EB6A 4TLAA 3M5WA 3TL3A 4DCGA 5FA8A 2HZBA 4ZQHA 1X7ZB 2WV9A 4TUYA 3AJ8A 4CIYA 1PGOA 1MO6A 3PXCX 1J2EA 2P9HA 3LBIA 1Y7PA 3QPAA 4EPRA 4BUJA 1X14A 2YX1A 1U7HA 5FPSA 1F6WA 3A4IA 1NUAA 3TX2A 2PIAA 3MB5A 5CM9C 3STHA 3W6NA 4RTPA 3E5NA 1NQXA 3IHKA 2XTNA 4ACBA 1DKMA 1Q3TA 4OHPA 4ZOEA 3H5IA 3MINB 4R2WA 4G65A 3VDNB 5D00A 1EQ2A 1QVAA 3M2PA 1QUFA 2C98A 1NMQA 3MCTA 4KVAA 2OSBA 5E0KB 2J5RA 4JP8A 5M3BA 4XOIA 2JFHA 3HVJA 3A1VA 1ZXLA 4ZREA 4EFNA 3B52X 2I1WA 2IEYA 3I5MA 4J4BA 3RROA 4P36A 5K8VA 3B6KA 3S3TA 4X7PA 3AHHA 5JNWA 4TWAA 1ZM9A 1JSLA 3R7LA 2A9RA 2EEZA 1UBJS 2AMYA 3W2EA 4JX9A 1S0UA 4DF3A 1KJYA 1MFPA 4ZO9A 4EA8A 4TQUS 4R7ZA 3KLPX 5AK5A 2GPYA 3E22B 2ZT8A 5C5DA 4J6FA 5AKXA 4U3JB 3R9XB 3O31A 1GCAA 4NZ9A 1ZU5A 3KSAC 5CU7A 4RBNA 2O8FA 3RC7A 3OM8A 4OQYA 4OTZA 3L4BA 4JVSB 4MPPA 1G1MA 1OV4A 4R16A 2TMKA 2DC1A 5ELMA 3RIMA 3VDRA 4BVAA 4QM6A 1RAEA 1V6CA 1MFZA 1XCPA 5F77A 5E1BA 2ZSAA 5CJ2A 1CNMA 4LG1A 5GM1A 1PZXA 3UAYA 5CXSA 1RWOA 3IQWA 1VG0B 3A1DA 2DBYA 1P2VA 3QF4A 3LQ2A 4FOPA 3L01A 4TROA 5SY9A 3UGKA 2V7WA 3ECSA 2WR8A 1N92A 1WVMA 5E7QA 4DQXA 3X2EA 1NN0A 3P9IA 4EELA 4YP9A 3NONA 2GD1O 4EUFA 3R8FA 3B8EA 1XPJA 5FUXA 3VH4A 5FWNA 5AVWA 3T3OA 3OA0A 1XZDA 3LK6A 4OATA 2B1IA 3AKZA 3IDAA 1SUWA 4WPGA 4Q47A 3B5JA 2WMYA 2J85A 1WY5A 2FZCA 1XDWA 1QR6A 2GI4A 5AO9A 1OI2A 2NVUA 3BG5A 3EVDA 4IYJA 5EJ8A 4EY8A 4UNNA 1AGNA 1UKZA 1VLQA 3PVCA 3K0BA 5EXPA 1PKXA 4DG5A 1VJ5A 2TMDA 3AF5A 3ROEA 5TS3A 1ZO8A 3GPBA 1VYTA 4I2VA 4AJPA 1C7IA 3K9QO 4DSAA 5ALEA 5LJIA 4YMTA 4INPA 4WJKB 4I5FA 4A10A 2VBFA 1JWBB 2NVOA 2HTEA 2FPPB 4ITUA 4XWGA 2R7AA 2ZATA 2M32A 3ON5A 1GUAA 3T1HB 5BQOA 1ADCA 2IDJA 4QFDA 4KYIB 3DNFA 3RSFA 2O2GA 3P2IA 4O8CA 4KODA 3KBBA 4PWZA 1X1RA 4U6SA 1W85B 1A9ZA 3GA7A 3AM4A 5LFAA 1OFVA 4URHA 4E1AA 1SMKA 3RT9A 2B8TA 2Q0XA 4IDDA 1VGQA 1QS0B 4ZJYA 2CLSA 5A3VA 5JCJA 1H69A 1L4YA 2OAQ1 4NZPA 1PIWA 1CQZA 1AY0A 2DFTA 3OAAD 1AKRA 2R1TA 2PTGA 3OCWA 3LNTA 5CFMA 5K6AA 3C6MA 2V5UA 3LDUA 3WL8A 1O57A 4LFAB 3S8EA 4ZJPA 3VU9A 4D9GA 2IYFA 2HNKA 2CMDA 1KFJB 2CL7X 3T1NA 3K20A 1X1AA 1ZUD1 5DF1A 4YUZA 5DBGA 2BDTA 3NB0A 4OBXA 4DHWA 5DNYB 1BS9A 1SZDA 1UK7A 1UIRA 2ZTUA 2WHPB 2IBTA 1DRVA 2HEGA 3DT8A 4L72A 1E1CA 4BS9A 3L7AA 1D8AA 3ZW8A 3PVSA 3CU5A 3N3BC 5KYWB 1A96A 1WNTA 3LUHA 1P18A 1UOOA 4KH0A 3C6KA 4KVZA 3U13A 4G8BA 1N36B 2X7JA 3ZDYB 1Z7GA 5HFJA 1ADFA 3OAAA 2O8DA 2VSNA 3PPWA 3D4IA 4QPJC 3H8VA 4A3SA 5KYKA 5I47A 2IYLD 3MTEA 1F12A 2AGVA 4ND7A 4U2BA 5EUCA 1UFQA 2VF2A 1F2DA 2E1RA 1E3SA 3DVSX 3TZHA 4G24A 1JHVA 2HADA 4LY3A 1FXSA 2QW8A 3QF7A 4OYYA 1O87A 1MCZA 2VP0A 3VR3D 2GD2A 3RSHA 2JDID 3K6KA 2YBDA 1JA0A 3G5AA 3WLSA 5KKCA 4F6RA 4DDUA 2RAUA 3BYZA 3GB9A 3U5TA 3SYNA 2AKEA 1LBIA 2CFTA 3UPTA 1YE3A 1FDIA 1HDCA 4PO3X 1JG4A 3TYXA 4DQKA 3S2SA 4GXNA 1IY0A 1FVOA 3OF2A 2ENWA 2GVDC 1V9CA 1GVNB 1RWXA 3Q5DA 1DQNA 3FI0A 4XEUA 1I2MA 3PLAE 1Q1QA 1YFLA 1HYGA 2RGDA 3DPUA 2RHLA 3GDFA 1PJSA 5SZKB 3EEOA 2WUDA 3FTFA 1UT5A 1BDIA 4RVFA 3T1OA 4ZPXA 1GQRA 2Z56A 1XMIA 2PVPA 2Q4TA 4IX9A 2W4QA 3STUA 3S68A 5KYXB 3HXMA 1QMPA 4RPIA 3WYAA 2PMBA 4PN3A 4QDTA 1W73A 1NP6A 1XZFA 1OWOA 4KQJA 3L2OB 3RK1A 2DEUA 1CS0B 1HYHA 3JQFC 1SCDA 2QRJA 2WIAA 1Z34A 2JDIA 4QTXA 1I3CA 3WLIA 2WE7A 5L4NA 1Q91A 2I8CA 4LK2A 3SIWA 5HYVA 1IH8A 1QCYA 4YA6A 1VCNA 1S89A 1VKZA 2YRWA 4G23A 2I9KA 4B0PA 1SBIA 5FTKA 2D8AA 3ZV4A 1N25A 3OZBA 4KIWA 1KI3A 2XOEA 1Z4JA 1C9JA 1RWNA 3BMCB 3LBYA 2AE2A 1CUEA 2I33A 1UXHA 4RHYA 4ZVMA 3GLKA 3TBFA 4YRKA 4DS3A 4MVJE 2OO5C 3PFFA 4CIAA 1PR3A 5KOIA 1P5FA 4KQ1A 2IGBA 4GKAA 1DV2A 1RNLA 3N8HA 2X0RA 2Z0MA 4I4LA 5DU2A 5FWYB 1KRXA 4LZAA 1CETA 4Z3OA 4BTLA 4HAZA 1Q0QA 1KDPA 1E3MA 2JGIA 3OEYA 2RGBA 4M1MA 1JG1A 1YC2A 2BHTA 2W7TA 3FYUA 1SY7A 3MTGA 2V7GA 3NHWA 3O8QB 5TXGA 4D2IA 5JAMA 3NT2A 3A11A 4PM4A 1VCHA 1N6PA 4TL8A 1FNSA 2I7CA 2IP2A 1ZJ5A 3GN2A 2TS1A 4IV0A 3CINA 4JT8A 4COOA 4ENTA 1NX6A 1ORWA 3GPIA 3KVRA 1RMYA 2C5BA 2G7ZA 5CM8B 1GDTA 3FCUB 5SYNA 3OLZA 3V9PA 1IZ8A 3TKYA 1N2SA 2JRLA 1FJ2A 4ZU1X 4XTCS 5C4MA 3WRYA 1UM9A 1YDMA 1BDBA 5U1PA 2AT1A 5CXQA 1CVLA 3ET5A 5FTMA 3NT5A 5CDTA 4OGKA 5CXUA 4F9TA 2OLEA 3G2OA 4HAVA 5LYYA 5A6SB 2OK7A 2C5HA 2VJNA 4KR7A 4DCTA 5GJWC 3ZWBA 2IEAA 3HYLA 4CETA 1KAGA 1QOPB 4LCJA 4W9NA 5JSZB 2K7ZA 3CF4A 3KAQA 1MQ9A 2ZCUA 4QVIA 3PX7A 2C42A 4E3WA 4RJ2A 2J3EA 2NAFA 1CPYA 5TMEA 4D4MA 5IDXA 1KJQA 3HJFA 5F2KA 1Q0HA 3TNDA 3KS9A 3U48A 2ZCVA 4O4LF 1DOZA 3DC2A 2EC5A 3OBBA 4QOSA 1W34A 5I3CA 2H08A 2XTAA 3GW8A 4IWXA 4ZGBA 1VMIA 5JCOC 3IT3A 2HU8A 3N8KA 4ND1A 4BQFA 3BWCA 3R6LA 1J2YA 1ZOPA 2EHDA 1LJ8A 2FSSA 5DYGA 1ODTC 3I04M 3NTOA 4N3CA 2YZGA 5TMPA 4DCCA 1VHDA 1XTRA 2I66A 1Z5GA 2YYSA 3QXGA 3VKFA 4XWOA 3IKVA 1GWNA 1Y8RA 2J59A 3MOSA 1UBFA 2GVZC 1KMHB 1U8ZA 4XGKA 3U3OA 3CX4A 4J4HA 5NLLA 1ZCAA 3NHKA 4I4TA 5C34B 4MCJA 3TX6A 4CCWA 4GW3A 2ZS9A 2WG1A 1YKSA 1YD7A 1HT2E 3F6PA 3FWKA 3FN4A 2XYHA 4HGYA 3IT1A 4MGIR 4V3BA 4MDEA 5BN5A 4L57A 2OG2A 3IIKA 2P30A 4FE4A 4ME6A 4UBJA 5KSWB 3NBXX 3TIXB 3PQ8A 2H16A 1I1QB 3TLYA 5AVZA 5EWLB 3EFOB 1O08A 1EFTA 1YC5A 2CJXA 5FIUA 5HZGA 2W2KA 1SVLA 3GJSA 2B6HA 3JYOA 4B80A 1K06A 4HV4A 1AGRA 2C3OA 4BXOB 1QV9A 4CM8A 1CU1A 3ZHVA 4PCVA 3FNGA 3RADC 3IQFA 4KQKA 3TFWA 3BD9A 4QECA 1BMDA 2YWBA 2XB8A 2ZQ5A 4M1WA 5I9TA 5LZ8A 1QLHA 3H5TA 4MR9B 5KNCH 4TTJA 2XF8A 5ALVA 1BFKA 1HDIA 2FFHA 3HACA 1P3Y1 1VDZA 3L43A 5EXDA 3WQSB 3WFZA 1DG9A 3OZTA 5BPHA 1RTTA 2AUTA 3TZCA 1GT6A 5BUCA 2B2NA 3LZCA 2ZYUX 4MITA 4RM2A 3LFTA 3ZVMA 3SJZA 2ID8A 2VP2A 3GGDA 2CNOA 2QHXA 2ZI9A 3DWFA 2OILA 4LQLA 4UMVA 4WNYA 3LTEA 2F43B 4DV4B 2R6ZA 4WDQA 2M6KA 4ND4A 1ECFA 1X7ZA 2A4MA 4LJ4A 2QM7A 4XJVA 2D5AA 4HWSA 5ECWA 4BMCA 3L7MA 3LQFA 1ND6A 3MPOA 2MT9A 3A25A 3JWPA 5AKZA 2A0WA 1V37A 4MLZA 4FX5A 1ZRSA 1Z8HA 2YQ4A 5AM5A 3RUFA 1O58A 1K68A 2EYQA 3IHWA 1HOTA 5HVNA 3ZXIA 2ZZMA 3CKKA 3O1LA 3KLBA 2HJWA 1SIUA 5AQEA 4B71A 3AFIA 4YPVA 1MJFA 1Z6YA 1YDGA 2G70A 2XUPA 4G0QA 4JSYA 4LHZA 3W6OA 4DPMA 3MINA 4ZEXA 3OQBA 4QUAA 5LP6F 1AO0A 1WIWA 4OXIA 1PW7A 3EIFA 3OWXA 4DCMA 3T3GA 3HXOA 2XB4A 2FMUA 1V7PC 5EAIA 1N3YA 1X7YB 4Y18A 1Z7YA 5ALUA 5BW5A 4IIHA 4KMSA 4ZU3A 3QIAA 1A8UA 4LE0A 2BFAA 5K6RA 3O84A 2AXPA 3BORA 2P6NA 1KO5A 5FI1B 1M76A 1NA5A 4NEQA 1ZICA 4FJ1A 2HXSA 5K0FA 1UAGA 3ICCA 4HL6A 2XYPA 5EE5B 2QV7A 2B4AA 4DBVO 1GT91 4HGPA 1MMFB 4PR3A 5E9WA 3MIZA 4IIGA 1BIFA 1F7UA 1XELA 1Z39A 2YXEA 4JC5A 4TTSA 1D9ZA 4O4JB 3TOZA 4QICA 5IDWA 1ODLA 3E22A 3BQNB 3DV0B 4KMOA 1BVHA 3ESYA 4KREA 5CLQA 3PC3A 4U3JA 2GYVA 3GZTB 3R9XA 2YIVX 1V3QE 1XVVA 3MLBA 4J7XA 4KWHA 2KM1A 2C7BA 2ST1A 4Q34A 1RXYA 2ZI7A 4GVPA 4MUEA 5DX1A 3ND7A 4MHTA 3VX4A 4NI5A 2DGDA 4IWNA 3LRXA 1OBOA 3UMYA 2JG3A 1R8JA 1U8FO 3BFXA 4I9GA 4OHYA 1RCFA 4Y6GB 3OKCA 1PSWA 5A9RA 1QK5A 3PFCA 1LB1B 2FWIA 2IJGX 3EYWA 2HJSA 3MTIA 1RYYA 2IQ5A 4IKOA 4U00A 3MTBA 2F00A 4B17A 2ZDGA 1N1EA 3P4XA 4EECA 1H93A 2PKQO 3E8XA 3QU5A 5JJLA 3RABA 1LW6E 3JD2A 3GJ0A 4WERA 1D4OA 1ULUA 4MX8A 4PINA 4FFLA 1K7YA 1MB3A 4PWYA 3A4MA 4BYGA 4R0MA 2ID7A