4KL8S

High-resolution structure of anaerobically purified dm. baculatum [nifese]-hydrogenase after crystallization under air
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
279
structure length
279
Chain Sequence
b'AKKAPVIWVQGQGCTGCSVSLLNAVHPRIKEILLDVISLEFHPTVMASEGEMALAHMYEIAEKFNGNFFLLVEGAIPTAKEGRYCIVGETLDAKGHHHEVTMMELIRDLAPKSLATVAVGTCSAYGGIPAAEGNVTGSKSVRDFFADEKIEKLLVNVPGCPPHPDWMVGTLVAAWSHVLNPTEHPLPELDDDGRPLLFFGDNIHENCPYLDKYDNSEFAETFTKPGCKAELGCKGPSTYADCAKRRWNNGINWCVENAVCIGCVEPDFPDGKSPFYVAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic [NiFeSe] hydrogenase small subunit
molecule tags Oxidoreductase
publication title Structural foundations for the O2 resistance of Desulfomicrobium baculatum [NiFeSe]-hydrogenase.
pubmed doi rcsb
total genus 85
structure length 279
sequence length 279
chains with identical sequence T
ec nomenclature ec 1.12.99.6: Hydrogenase (acceptor).
pdb deposition date 2013-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
S PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 4kl8S01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 4kl8S02
3UQYS 1WUJS 5A4FS 5JT1A 1UBUS 4GD3Q 3USCS 4IUDS 4UCQA 4UCWA 1UBJS 4UCXA 4C3OB 4CI0B 1YQ9A 5JRDS 3CURA 4U9IS 3CUSA 4UD2A 3USES 3AYZB 2FRVA 4UPVA 1UBTS 1YQWA 4KO3S 4UD6A 1UBLS 4U9HS 4UE6A 4KL8S 2WPNA 3ZE9A 5JSUA 4UPEA 1UBKS 1E3DA 1H2AS 4UQPA 5ADUS 1WUKS 4UE3S 4UQLA 4KN9S 4KO1S 1UBOS 5JSYA 1UBMS 1CC1S 5A4IS 1WUIS 1WUHS 4UE2A 4TTTS 4IUBS 3MYRA 3RGWS 4KO4S 3H3XA 3AYXB 4IUCS 3ZE7A 3ZE8A 1H2RS 5JSKA 1FRVA 1FRFS 1WULS 5JSHA 4URHA 1UBRS 3ZE6A 4KO2S 4UEWA 4UEQA 4OMFG 5A4MS 3ZEAA 1UBHS 5D51S 1YRQA
chains in the Genus database with same CATH superfamily
4KFTA 1T0HB 5AIAA 2EW2A 2EFCB 1TMYA 1VBKA 2PKQO 1CP3A 2YHBA 4URWR 4FJ2A 4B7ZA 4G63A 1GADO 2N3ZA 4OA8A 3V8QA 1U0TA 4A4DA 1TW2A 2ASVA 2X7XA 2XOKA 1GZ5A 3R0IA 4XOUA 3UMVA 1Q0RA 4PPFA 1LFDB 3AC0A 5AKLA 4FCCA 4QUDA 3OQOA 4I0WB 2ZUUA 2FQ1A 4JASB 2REQB 2ZJAA 4O02B 1NQUA 5EP1A 1FSZA 4D3FA 4ZEVA 1QFMA 2DUWA 4O1IA 3NVKI 1RYDA 3FI0A 1E6MA 5HGXA 3E4DA 4EKGA 4G1UC 4LZWA 3VGJA 1UEXC 4JVMA 1OLUB 3OI7A 4WH0A 1L5FA 2DULA 5AVQA 4B4WA 4OGFA 4W5JA 3T3GA 1Y1RA 2DFTA 2QX7A 3K5WA 4XGIA 5BSGA 4I9NA 3C6BA 4C0BA 1JTEA 3QKTA 3FYSA 1V8ZA 3UEOA 3QOXA 4BQIA 4YS6A 4YAIA 4Z4EA 4ICIA 2VDWB 4A2WA 1DRJA 3DDHA 2QL9A 4EY4A 3FCXA 1XNRB 2OMKA 1EFLA 3DHNA 1KFKB 1F4LA 3L0OA 1R4ZA 3VKUA 3GA5A 2BEWB 1X38A 3S6JA 4N65A 1NNLA 3PFCA 4ZVQA 1HGXA 3NXSA 5C4IA 2Y05A 2EIHA 1KVQA 2DPMA 1VGRA 2QR5A 3O21A 4AJ1A 4AL4A 3WLIA 3ZXUB 1Y9ZA 3BX1A 5EJEA 3P0FA 1XJ0A 4B46A 4EHNA 5KVVA 3LKDA 5FOVA 1FP2A 2VWGA 3LY8A 3RT1A 1CUWA 3HY6A 3NPMA 2XVMA 1V6AA 2IA5A 5I7AA 3UHJA 1L3CA 2QVCA 1YF3A 1X1DA 1NVVQ 4JJKA 1W73A 5ALMA 3DXFA 1A4RA 4MMZB 3GR6A 3AFNA 3LDAA 1PNRA 4OK3A 2Z95A 4FFDA 3TXAA 3IIJA 4V0OA 5HM6A 1F8XA 3NU1A 1RC8A 4L9SA 5T4HA 1AD2A 3ASZA 4ERXA 1UBTS 2NPOA 4DYHA 3ZWKA 5EHZA 1O5OA 2V4MA 2WD7B 3BD6A 4LKOA 1Z38A 4AVYA 1KS9A 2P3LA 2X9VA 3SZGA 3FWYA 3INRA 4BU1A 1IQUA 1Y6ZA 4G0YA 4F93B 4WBNB 4B6EA 5ADVA 1BE6A 4JKIA 4UU0A 3A6LA 4ISBA 4BQNA 1ZZEA 4LZJA 3UJNA 3ET4A 1HNWB 4G89A 3OBBA 1QH8A 3INGA 5LDGA 5C37A 1AV6A 3I0ZA 3EXHC 3O8QA 1V95A 3DNFA 1KMCA 4PWYA 3GLGA 3C5EA 3C8UA 3GRAA 2XYGA 3KSMA 4GXNA 5AM1A 1UCFA 3QRWA 2YRXA 1UPAA 4MWCA 4X63A 1AUPA 3T38A 2H51A 1BFUA 3WMXA 4CF4A 4EF4A 5J2UA 2VDRB 1XVUA 2X5OA 3OPMA 4LF6B 1E2EA 3DOCA 1JFSA 1TJ5A 4H6VA 3U3JA 2BY4A 4B75A 1M9NA 1Z28A 1KJ8A 3FYTA 4NBSA 4BV3A 2QVGA 2GHQA 3BMOA 4F1WA 4YMIA 3E2IA 1H93A 3K31A 1X19A 2V5UA 3FIJA 3E61A 3R24A 4MVJF 4O29A 4ZAVA 3QMVA 3UTCA 5C46F 1QUFA 4KRFA 1A82A 4EL5A 1G3QA 1RADA 2C5AA 1FRFS 3OIDA 5ALKA 2O0JA 2E4ZA 1TO1E 3OKAA 4E5DA 2WE8A 1YJ8A 2YJ5A 3EC1A 4A9AA 3QSYA 1KRXA 4HWTA 1AO0A 3G8DA 1K0UA 3ANNA 3STXA 3AOGA 5DNUA 1JJAA 5C7LO 2NACA 3C43A 4LXYA 4LSWA 2AA3A 1KZ7B 3ILXA 4H1TA 4HLNA 4ZOLF 5CVEA 3GGGA 2QSZA 4G2NA 4AJKA 3T3PB 4I81A 3DEFA 2PT9A 1CNEA 1Z7EA 2FLKA 3IRUA 3U39A 1ULUA 4RULA 1JXAA 5JYEA 3I5UA 1W94A 1L1RA 2RC6A 4LRYA 4K6OA 2IOFA 4IIEA 2NP6A 1L5QA 2AT1A 3QG5A 2F4NA 4PR3A 3QX9A 5JSQA 3GG9A 4ZCQA 3ZE7A 2X0JA 4L51A 5B1SA 5KTSA 1TX4B 3KQQA 4A6DA 4X24A 3GMIA 3IUBA 1JA9A 3RUEA 1H66A 4AK9A 4KI0A 3BULA 4FFVA 4RVHA 5FPPA 4UNRA 3JAMA 4WECA 4DJJA 1WMBA 2W2NA 3LF1A 3NWEA 2H1RA 2O1EA 3P94A 2C7GA 1CUFA 2CW5A 2QG4A 1PG2A 4JKOA 4RHYA 1T6ZA 5AUNB 2DY0A 4WX2B 1P29A 3X1ZA 1GCUA 1ZVQA 2WWFA 1NN3A 5HMLA 3LT1A 4BVHA 2CSUA 3OFKA 2PX8A 1OY1A 1RR6A 3QKIA 1G18A 5TNXA 3RDPA 5LNK6 1T1IA 4I1UA 3FLMA 1PZGA 3P0JA 2L82A 4EGSA 3TBFA 1S2IA 2UUAB 1JEEA 2EBUA 1C7ZA 3HP4A 2QN3A 3VC3A 3B9PA 2X9LA 3HDTA 3V55A 4OHYA 4E1VA 3L8EA 4R2XA 4V02A 4BVFA 2WQ7A 1SG9A 1SQ5A 2RHHA 3LWBA 2VYCA 1CJVC 2I1VB 3H1BA 3BXPA 4LCJA 2KHZA 4BP3A 2LXNA 3ZTTA 2ZZMA 2FZGA 1ZH2A 1E1NA 2ZTMA 3H5VA 1K27A 2H0RA 1SQGA 3HBLA 2B6NA 3V9PA 4DLBA 5JJBA 2OBFA 3LF2A 4CLXA 3HWX1 4X62B 1EFCA 2PL9A 1B1CA 1T5IA 5THXA 3SEFA 4HAXA 1L6IA 4YP5A 4BCCA 5DI3A 5HVNA 4M8SA 2ODQA 2W6JA 3M6UA 1JPNA 3SI7A 2CXUA 3LZ6A 1Q11A 4DR6B 4MYRA 1P33A 3FZYA 3ZG6A 3BHJA 5KYKA 2O48X 3DO5A 1JHRA 5F64A 4EVIA 4J3JA 3CIOA 4RJTA 1MABB 3G6KA 3O9ZA 5EJFA 4HB3A 4DIOA 1QG0A 3DMFA 2P0EA 2YQZA 1BO6A 3ER6A 3HUEA 4IMIB 3RANA 2XOXA 2RGEA 3S40A 3OZCA 4I1VA 3UJHA 3K9LA 1QNFA 3O0TA 3UPDA 5T6MA 4BCBA 4KHPB 2A14A 5K0LA 4QTYA 4OAQA 4G0UA 3KS9A 4PZEA 1F9AA 1H3NA 4MUKA 3P5SA 5FWXA 1H5UA 2VYFA 4YUZA 4ZEWA 4O8ZA 4F1JA 1NYQA 2FMXA 2YCLA 4B33A 1PFWA 1IOZA 1I2CA 4QOFA 1VGVA 2H63A 4BUCA 3NANA 2ONZA 3ILHA 3LGSA 4LGVA 5L95A 4EEXA 3R3UA 1NM5A 3CSUA 4RJIA 3WMRA 3I6MA 1EWKA 3ABQB 3E1KA 2QRVB 5AQ1A 2BFAA 5CAEA 1E63A 1OYOA 5ESXA 1YIAA 3LQQA 4LZLA 2XUPA 2ZXFA 3PQ6A 4DMLA 1L5OA 3NUZA 3AIMA 3I3OA 4NU5A 1XF9A 3MFYA 4IJKA 5C9ZA 1GKUB 4MLCA 5F51A 4ZQFA 4MX8A 2CC2A 5F7JA 4CM4A 3KQMA 1Z88A 3QH4A 4JX8A 4AX4A 3CUSA 1XCPA 3VA7A 1U0BB 4LF5B 3CXUA 2ECQA 3RRZA 2EU8A 2JJ8A 5JWRA 3GT3A 5JROA 1NBWB 3DBVO 4LXQA 2YYSA 4DVGA 5K3FB 2BZ1A 1VMIA 1ZJWA 1YZKA 2AJBA 1LBTA 3PFFA 2ZULA 4IDDA 4BQFA 1Z4MA 4PCUA 5MFPA 1CJCA 3ACCA 3HCBA 5EHNA 3ASUA 1LI7A 1YT5A 1OFUX 4C01A 2W00A 2FPIA 1A72A 2Q1YA 1HK7A 3QTLA 2HTFA 1WDTA 2XNCA 1JU4A 3FOAA 3DVQX 4QPPA 5BYBA 2C4KA 3K0CC 1QQ7A 1CUAA 3WNBA 4ZYTA 3X2FA 3RIEA 3MWEA 1LK7A 4E5UA 1BHSA 1KVUA 3BUSA 3CE6A 1NW6A 2AI2A 2J5QA 4IRUB 1E0SA 3WJ2A 5JXWA 1TEZA 1U4SA 5LUAA 1Q1AA 3VZSA 3H75A 4DC1A 2V7VA 1HLFA 4RCZA 5DB4A 4EB8A 2AYYA 2PH3A 4QBIA 3FF4A 4WFQA 5IVIA 4NKRA 2VDMB 3OIUA 1KTIA 2VPZA 3LFUA 2Q1XA 4DCSA 1EJBA 3ESQA 4C4SA 4X7PA 1FL9A 1UF9A 1UPXA 2P2SA 1YI1A 2PRSA 2Y1DA 3DDOA 3NIBA 4C6HA 3FHOA 5M5BA 1EUCB 3AFGA 3GUYA 3KT8A 1CUEA 4GD3Q 1EDZA 2ORWA 3I53A 1AG9A 1E3JA 1H4SA 2H1CA 4DIFA 5IAOA 4XQCA 4O4LA 2XQVA 4R8VA 1AZWA 2PH5A 3KR2A 3HEBA 1KYZA 1GHTA 1AKRA 1RWVA 2CZGA 1Z4LA 3ASYA 3ZKWB 4D3XA 4R2KA 2FMUA 1MAVA 4KWEA 4E94A 4O25A 1JQAA 3SBXA 5GJVC 1D1QA 2BTOA 2G3YA 4X91A 3WICA 3K5HA 4Z9YA 3GAAA 1WDWB 1QG2A 3V1NA 2FPWA 5AUPB 1XAGA 4HADA 4TLDA 4FLEA 1R50A 2DRIA 2OFFA 1QHYA 1M7GA 3CNNA 4HAUA 4AF6A 3AU9A 2O8FA 1GL6A 2C0CA 4BX2A 4XOIA 3CUWA 5EKDA 1NXPA 5CDHA 1RRGA 4UUPA 2B30A 2YVQA 1RI4A 2OBMA 3OE7D 3NH6A 2PUEA 2GWRA 4HWOA 1TYBE 2IZ0A 2RAPA 2B78A 2AJLI 2GR9A 1RJDA 4DR3B 1T8UA 2EZ8A 3WIDA 5CLFA 3KWJA 3ODGA 4TS1A 5JSYA 5H80A 3L1HA 4N8SA 2PWYA 4W7SA 3WG9A 4YJFB 1B43A 4BP9A 1BGXT 1UKZA 1H2XA 5IULC 2CLDX 4DLYA 3ORYA 2ZE5A 1GTL1 2N9UA 1ZN8A 3AUTA 4XEHA 1IVNA 1GWNA 1EDBA 3LZDA 3MTEA 4LI0A 3FMGA 1KRWA 4PV7A 2W7TA 3ROPA 4D0LB 2PZFA 2VS1A 4RA9B 2AG8A 1K3TA 2IZ5A 3LD9A 4DV3B 3CVOA 3KWLA 4L4XA 1UMKA 1XRMA 2EAUA 4M4SA 1S8AA 3AUYA 3G2KA 2D1SA 3EXIA 3ZGVA 1WL8A 3WWDA 1OGIA 1VP3A 1M0TA 4QU9A 1WSDA 4FJ1A 1TUIA 3TPFA 3V4FA 3GLTA 3WJ1A 4TYYA 4DLVA 1AS2A 5ITZA 2GZ3A 4Q1DA 4BP1A 4J76A 1HZZC 5K2MA 2IYLD 2AJTA 1IRIA 1YZGA 4TYNA 4QGHA 8ABPA 3F5FA 4TKZA 4F4CA 1GLVA 1OUMA 2R8XA 1NUAA 1Y1LA 5JVDB 3W8EA 4DAEA 1QHXA 5I7FA 1T3GA 2V7TA 5EERA 1L7BA 4NEQA 4NPCA 3KEQA 4AMVA 1QZXA 2H2FA 3KZ1E 521PA 3C4QA 3RFXA 3X43A 1Q2UA 3ZKWA 2ATVA 1QQ5A 1G98A 2ZETA 3I01M 1YKFA 4BV8A 2QL5A 1WY5A 3LUPA 1N2OA 3L0PA 1CEXA 2MDTA 3USCS 4BRUA 4D2IA 2B5VA 4FMCB 5BWOA 3IE1A 1GR0A 4LTNA 2OZLB 5IDWA 5K0FA 4AG3A 2XB8A 1E7QA 2JCXA 4ED9A 2GBLC 3TNJA 5LU9A 1HT0A 1V8OA 3MS2A 4JS0A 2XE8A 4BLQA 1BROA 1BNCA 3E7DA 3IEPA 3DNMA 1ANKA 1C0KA 1UPUA 2GBLA 4RESA 5CT8A 3SSMA 3I2YX 3IO3A 3Q87B 3GFOA 4RFSB 4CHGA 1YJQA 4KDFA 2V45A 2ASEA 3OT1A 1DARA 3EXFB 3GP3A 1LDEA 2A5YB 1DEKA 2QX8A 3KDSE 3GLIE 1FIUA 4BLVA 4QXRA 4UEQA 4ZAZA 3N0XA 2E4UA 4M1TA 1IK4A 2BFCA 4RX1A 5DIFA 5JO0A 2MU1A 5EWJA 4OH7A 4JITA 4RGQA 2BMVA 3PICA 2HU5A 1DAMA 1RCTE 4EO4A 4EKYA 5KQMA 4HYQA 4H0FA 4BAUA 2Q6IA 3DBRA 2LDBA 3PDJA 1DC8A 4DCJA 3O8CA 1TCCA 1IXYA 4KO3S 4PBTA 2ODWA 1FJGB 3HVIA 1E0AA 4AY6A 5A03A 2A1TS 3A6JA 3TMKA 2HIAA 2FUEA 2COUA 1XHLA 2GCGA 4GSLA 1NVVR 1CS0B 2VXOA 5ICEA 1S01A 2B7CA 4UUBA 3O6VA 5A06A 4HAIA 5FPQA 4IRXA 1WBDA 2HLDD 5AHKA 4YALA 2CVFA 2YWJA 2IH2A 2JIRA 1QM5A 1BZYA 2PMEA 2BJWA 4WBNA 3W9BA 2CMKA 1QOPB 2YIJA 4DNXA 4MDFA 4Y7CA 4Y1RB 3E9EA 2MIIA 1IJFA 2H85A 4CVNA 5LA6A 2DH5A 3PXEA 2J48A 4V39A 1J1UA 1OHHD 4H31A 5ADHA 2G72A 5CJJA 4YIKA 3DL2A 4JVLA 1SBTA 3K2IA 2EARA 2D5IA 4BMNA 5A6VA 4P80A 2ON6A 1T10A 5A2QA 3OWHA 4YMLA 4EYQA 4KV9A 3IXMA 4K0KB 2R00A 4Q3AA 4FCTA 4PO9A 1D8AA 1Z5GA 2WFLB 4FFWA 4OFZA 1TU4A 2PS1A 5COQA 5DGCA 3CONA 4TMYA 5GAJA 3MERA 3E8MA 4RGVA 2HC9A 3OICA 1Q7BA 1GYRA 1Z82A 4FYWA 4BPBA 1EFPB 2I7TA 3ZDYB 4GSYA 4JL8A 3WQRA 3IUNA 4M0CA 1JSZA 2C98A 4BLPA 4NYJQ 1QIGA 3VMFA 3B20A 5L9AA 1VJ0A 2J33A 3AESB 1U8YA 4RDXA 4WXHA 1EX7A 4NU0A 4CFYA 4YMHA 1IZ8A 1PJLA 4ZYZA 4IIGA 2B34A 1XPRA 5AVXA 3CLUC 3MFQA 2PWAA 3WLOA 3B5JA 2C4NA 5CT5A 1DXQA 3NH9A 1TQ2A 1BD3A 4JUAA 1BU8A 5BW4A 3HTXA 1BWSA 1ZESA 2C4HA 4BO3A 3W1WA 1IBCA 3OO0A 1OXBB 5D5PA 1D6SA 3Q72A 3B7PA 4XWWA 2XCIA 4AWAA 2HYDA 3KK0A 5KUTA 5LM3A 1W4RA 3HDHA 3EPJA 2G63A 2W6PA 2BHTA 1X80B 5DISB 3OBIA 3PFBA 4P33A 4GMKA 4W7HA 3W2IA 1C8LA 1PR6A 4J6FA 4EEKA 3QNMA 2PXXA 2C59A 1P62B 1A9YA 1XJQA 1FXWA 3C2QA 4WESA 3GHHA 3D6NB 2IPOA 3OMLA 3SDZA 3T34A 4MOWA 2EJBA 3DF7A 5F12A 4N0DA 4BTVA 7MDHA 3U44A 9GPBA 4GMFA 1X13A 2D0OB 3DBLB 1ML4A 5B36A 2A0WA 3E9DA 1E98A 3ESAA 2ZYVX 1KZ6A 3GAFA 1X15A 1QHNA 3CCCA 3QPDA 3K8ZA 2WV7A 3AR5A 2X0NA 1QANA 2DPLA 3JVVA 1FYEA 1ZEMA 1AKUA 3NW9A 3O9VA 3RUFA 4F4JA 2I4MA 4RNDB 3VR5A 1N92A 2OHOA 3EE6A 3KJZA 4LSZA 3PFKA 4B40A 3M3HA 5ITVA 4CUZA 4A0HA 3KPWA 2JRLA 4G97A 4WINA 1NFRA 1O9GA 1HYQA 1SHTX 1O95D 2P67A 4C0SA 3A14A 4DLNA 5FUMA 4LUCA 3PHGA 1WWKA 5BYKA 4W1SA 3OZTA 4GBED 1F4VA 1NBHA 1IATA 2QGZA 3GRCA 3IV6A 1NMXA 2GK4A 1M74A 2A7XA 5EZYA 1LDMA 1CC1S 2QKYA 4FYIA 5ALRA 4OY3A 3D7RA 3FI9A 1OH5A 4OHRA 3PQ2A 4M1MA 1PEDA 2P1RA 3M6FA 3SS8A 3IIIA 2LDXA 2YV5A 3ZWOA 3ZY2A 4QODA 5DU2A 3ZH9B 1PR9A 1FYDA 4R5MA 4N9WA 2GYWA 1SKYB 5JH7F 3PT9A 3OTHA 4UAVA 3RVNA 3USZA 2GJAA 4YRAA 2QRHA 4I1PA 1XRRA 5A4FS 1XZEA 4F2GA 1QONA 1VTKA 3A9UA 5A5GA 3KE9A 3RODA 3VPDA 4RGYA 4N76A 3ECCA 3OFNA 1N5OX 3EXIB 4ZEOA 3R09A 3MMZA 1KOFA 3VI4B 5ABPA 5JADA 2AZXA 2OG1A 2PT5A 3O2QB 4PC2A 3L07A 4DNQA 2R84A 3SM3A 2BGLA 2ID8A 4C1BA 5CFOA 2E0IA 4GW3A 3PC2A 3I9JA 5FHQA 3JTMA 5JLAA 2V4ZA 4RETA 3HYSA 1CK4A 1Y7LA 2YVLA 4GSKA 4M53A 4YCDA 3GEGA 2CJXA 3L43A 2GMWA 5AO9A 4ENWA 4PG5A 4IJ5A 2SHKA 3R76A 4AECA 1KQOA 4OSOA 4URUR 4R8SA 2JIBA 4ND2A 4RK4A 3OY7A 3IIKA 3O8BA 3P5BA 4MJ3A 5ES3A 4YYEA 1PGNA 1ZSYA 4DMGA 1EIWA 3R5SA 4V3CA 4FUQA 4MK4A 5K3FA 3A9VA 2ONJA 3ZLTA 2ESRA 2JJ1D 3CH7A 4BDSA 4WKBA 5CG1A 4CTMA 7YASA 1NLYA 3GPLA 1EWVA 1NHGA 2CL7X 4QFBA 4G85A 1JG2A 4NP6A 2QW0X 4IO1A 1C5KA 2CXHA 3BMNB 3RJZA 2PWPA 3HJFA 4LOLA 5JAIA 5HZKA 4S2UA 3KCNA 2QS9A 4J2HA 3BMXA 4D8XA 3PNYA 3OVMA 2YNMA 1A8UA 1QHEA 1IHOA 2FN7A 4CM7A 1LKZA 2B4YA 1YVEI 3FWPA 4Z3KA 1ORDA 2TMYA 1A7AA 3VR2A 2CBXA 5CT4A 4DKXA 5K9ZA 3QLJA 3AHHA 1CUCA 1YRAA 3UQYS 3L8ZA 2WABA 4Z0NA 3IT1A 4N6GA 5EVJA 2O1WA 4UPEA 4A8PA 1VI6A 2UVPB 4Y9UA 1M2JA 1MJFA 4V1CB 1XPOA 2OBNA 4P1ZA 1QPBA 5KI6A 3QUQA 4F11A 3EEBA 1ATIA 3DFZA 1NONA 1WV1A 3IDFA 4Z54A 1ZSNA 1HG1A 1Z5NA 2V59A 3D3WB 2V4UA 2C54A 1C14A 2ZIXB 3H5LA 1PE0A 4M0KA 2J08A 1DOHA 3FLEA 2BBOA 3BGOS 5HDBB 1T5HX 4JD5A 5DCLA 4EA7A 1NATA 1UBSB 2P6MA 3KUXA 1PHRA 2WYUA 3QGMA 5UKDA 3VZCA 5AM2A 1MKYA 4EJ6A 2PUGA 3KQUA 2DGDA 2OK8A 1F2TB 2C9DA 4YRRA 4Q3EA 3RV4A 3SIPA 2P9HA 2ID7A 1N2BA 4EABA 1RC1A 3ORRA 5KKCA 1EJ6A 4XSHA 3DCNA 1CDDA 1X7HA 2XHZA 3HS3A 3I9FA 2HZBA 5ELMA 1IB6A 2YUTA 2ZU6A 4JAVC 1BJTA 2I3GA 4P0TA 1X7YB 2R7MA 3A6ZA 4IFTA 3CNOA 5J2TB 2ZJ8A 4O4HB 5JD3A 1UBOS 2ZUVA 2NXEA 4QGAA 1FPQA 2WY2D 4ZOCA 2ZE7A 1LWOA 3ANLA 4XSVA 4JP8A 3UANA 4QQRA 1NFQA 2C96A 1PIWA 2GUGA 1S3IA 2Q5QA 3EA5A 5J63A 2Z6VA 1SXHA 1U2PA 4JA0A 1AHNA 3JQBA 4DARA 4X1KB 1GPWB 1N3YA 2XZTA 1JJFA 3BRWA 1YAHA 1EXNA 2BKVA 3MB5A 2BCGY 3DTNA 4R6XA 4Y6GB 5TIIA 3V97A 3CGGA 1S2OA 2R1TA 5TJHA 3OEED 1JR4A 3REFA 1KY5A 1FYFA 5EC8A 5FBVB 4XD2A 4YRLA 5G4KA 3EOAI 4FQ8A 3CCFA 5IKMA 4GPBA 2A1UB 3SR4A 5CEFA 3BN3A 2P4HX 1HDGO 2AFRA 2FWMX 4GI1A 1H9CA 4XGQA 1XD9A 3BCSA 1BVYF 3D43A 4S12A 3NR2A 3QELA 4Q4JB 1ZCZA 3KYDB 1NW3A 1OF1A 4WKPA 5E0OA 4X66B 3FYUB 3DOJA 1J1IA 2IFTA 2QHXA 1Z6QA 3MZ0A 3DDSA 1R0KA 2GEDA 2AFIB 3BMCA 2JLXA 3BFVA 3IPAA 2PWBA 3M6WA 1FC0A 3O7WA 4BFSA 2R7KA 1ENOA 4LNAA 5CEJA 1CX9B 4EHIA 5J4VA 1RPJA 4HH3C 3IULA 2R4QA 2CSXA 3DAPA 3I34X 2W4MA 2JCBA 1XZNA 1J39A 2F6RA 4CTOA 2ZKLA 4TMWA 1KZ4A 2JKVA 2O05A 4WFJA 4NENA 5K3AA 1I0ZA 3ETGA 5IC5A 2A9FA 3IAS6 3DG9A 1N9ZA 3WLQA 4HS4A 1KP3A 1P1HA 1KYQA 2FKNA 4XX0B 4WT7A 3BFXA 3FDZA 4MYHA 5AW7A 3RSOA 4DT1B 1P75A 4FBMA 4KXQA 4BIMA 4C7XA 3CBGA 4GMXA 4OLAA 3DMTA 4MCJA 3L8HA 2OV1A 3CY6A 2A78A 1RJ9A 2IPNA 1YU9A 3EFHA 1PR5A 2QAGB 1Q0PA 5BT8A 3VC1A 3CLVA 5JASA 3ZS9A 3H87A 3WVNA 3QUBA 4B5LA 2F64A 1WW3A 2FW9A 2HNKA 2I9PA 2PGJA 3NT4A 5A0VA 4C3OB 1O9HA 5JI3E 1RYYA 2IPAB 2V6BA 3CRMA 3NJRA 3VOAA 3W06A 4UCFA 3THXB 1XFAA 3UXEA 1C8VB 3DTVD 1QHFA 1OWNA 1W1UA 3I6YA 1I32A 1JDPA 1XMQB 1MMFB 4IJMA 4G9EA 3L0CA 3QYAA 5C5CA 4Y2HA 1XSEA 1DAHA 3OLWA 2CD7A 4YK7A 3VHLB 2A9RA 4KJXA 3QZUA 4G1BA 4FS3A 1Q91A 2OZLA 4PG4A 4UXHA 2F1OA 3LUKA 1TIBA 1N7JA 4JQZA 1NR7A 5GVRA 1MX1A 2O07A 4E5VA 4CIYA 6REQA 1TT5B 1QIHA 3PTZA 4II3A 5AYVA 4ZIRA 1QVVA 1RE1A 2C1EA 5D3MB 3GLSA 2J3DA 3VO2A 5DM70 1HE5A 2XGOA 5TGDA 3GGJA 1WAMA 3P9ZA 2Q7OE 4RENA 1M2FA 2PUCA 2I65A 1NR5A 2WJHA 4D56A 2ZYRA 3EYWA 1X1CA 3WK7A 4L4RA 3ZBPA 4BU0A 1EP1B 2LCFA 4X20B 5D2CA 2ZIZA 1TC1A 3WQSB 4E51A 2AD5A 4XCQA 1X14A 3O5AA 1Z2EA 4KGZA 1R66A 3I6ZA 2GCEA 3EPKA 1XRNA 1GGVA 1MAWA 1XTZA 1RVV1 3FVVA 2FXVA 4KXYA 4XWAA 3FR8A 1BXZA 4JBHA 4P58A 3CVYA 4RSHA 5B2EA 1OIVA 3FFTA 4FDMA 3DE7X 5JVDF 3FCCA 2O2GA 4L0MA 1JQBA 4EDFA 1WXIA 3V34A 1KFCB 4Q05A 1CV2A 1M6VB 2C8KA 3SDBA 5HMMA 2KM1A 1YB6A 1JFTA 4BEVA 2H3HA 3M9WA 3T3OA 3O8NA 1NDQA 4X3CA 5HTOA 1EG7A 2WDPA 1SUEA 2FDRA 1MJGM 1KAOA 1FFHA 1S2DA 2O4UX 2JF0A 2Z3VA 3QITA 4EPWA 1RIFA 2GCIA 1ENYA 4QU8A 1KF0A 4RJKA 4ZRDA 4B3CA 1VL6A 3HFJA 3LWDA 3HRHA 5CM2Z 3ZDXB 2DWCA 5FKJA 4ECEA 4P0QB 1KZGB 2R3SA 5LB2A 4ND8A 1KYYA 2CY0A 1BGVA 1N4AA 1JXOA 3FMIA 3FVTA 5B4UA 2JZOA 1JZTA 3G0CA 3SZMA 4TSKA 2ZWPA 2R8YA 5J5VA 3DP7A 5LZ2A 4DJAA 5DMXA 3W5AA 1ZD5A 4FEGA 4NH4A 1YBVA 5FOWA 5CDTA 3E0XA 4KL8S 3TQIA 4YONB 2IEAA 2ZBRA 2NX2A 1F8GA 2GOYA 1E79A 4D3YA 3QNWA 5JFOA 4INOA 3G9TA 4RZIA 2XZDA 4PZDA 3PHBE 1T9CA 3M70A 5TQ0B 1XNQB 1PW7A 1RJEA 2CJWA 2PL5A 5IBCA 4JI2B 3N75A 5LQNA 4A7PA 2AEMA 3DJFA 1YBAA 5TVKA 3C87A 3MAAC 3NASA 3U4HA 4PN3A 4LYDA 2XYRA 2CLSA 3LQ1A 2H7CA 5E6UA 1MABA 5FJJA 1EGAA 1UFRA 4ZI3A 1XD2A 3LP6A 3MCWA 4IFBA 4FB4A 4C0AC 4EA9A 2VXCA 5CW1A 2V7QD 3TOVA 1WXFA 4HDNA 1OWPA 5HPYB 3ZDRA 1XNGA 4DBVO 4NX2A 4G36A 3RD5A 4PXAA 1P6XA 3WRXA 4PX2A 2MSDB 3PUKA 2C4VA 2B20A 2EW1A 1Z83A 2XTNA 2YN2A 4MH0R 2ADMA 1GFSA 3H5AA 3ZVNA 2DFNA 1T8RA 1OV6A 2V1XA 3EZXA 3PIDA 4H77A 5IYZF 2N1MA 3HZZA 3W5JA 3WQBA 4CV1A 3ZGLA 2HRDA 3GEDA 2OV8A 4KLNA 3S8EA 2J0UA 1U0LA 3HLKA 1QOQB 3JYHA 2PH7A 3N9IA 4GVLA 4KEAA 5TMDA 3W0LB 1NTRA 2GZDA 1Z75A 3TQCA 2JGJA 1BDHA 2P4SA 4G1FA 4AUNA 4ND7A 5M7EA 2HRZA 2WA2A 3QIAA 1K9VF 1P2SA 4Y67A 3F6EX 1QMPA 3TECE 1SVMA 4TSFA 4GS5A 5LPNA 2JFOA 5KTMA 3OURA 4FHCA 3T7EA 4M8KA 1IZZA 2C1XA 2QE7A 4FE7A 4LQDA 4MI9A 5CVCA 5HXAA 3IKTA 3AXSA 3ZQ6A 1BOOA 1ZN7A 2DWPA 4XGRA 4HNVA 5KPJA 3LM8A 1B6SA 3CZ9A 1UJ4A 4FFLA 2CDNA 2BBTA 2WQ6A 5T8KC 1VL5A 3E3AA 1LDYA 1W5EA 5KQRA 5DIZA 1Z0IA 1ZGGA 3K8QA 1OZ0A 3C97A 1JQEA 2GN8A 3CU5A 5H59A 3MEQA 4G1MB 5DYGA 4MRSA 3EPHA 4OKIA 1VLLA 1CY7A 5E2AA 4CDMA 4MI6A 3U62A 3S70A 3ZY4A 1ZOPA 4OMUA 2TRSB 3AIIA 1VFPA 2W0SA 3T5CA 4UM5A 1WNFA 1Y42X 3RJMA 3FPFA 4MRAA 3F0TA 1MRNA 3CC8A 4OQNA 3EHDA 1MPXA 1GRNA 2C95A 4YWJA 3HXMA 3EXEA 1U5BA 4EA6A 3HM2A 3V8BA 1ZICA 1QRSA 4GT1A 3L1UA 4LCBA 4LWZA 3UT6A 2J5KA 3VZRA 4BNIA 1F5SA 1QVRA 4C0JA 2BHLA 3E35A 3SQDA 1XLWA 1J90A 1Y98A 4EHKA 3TPZA 3CW2A 4PQRA 1P5ZB 2X5JO 4E4YA 4ETMA 5FJIA 3HUDA 3G9UA 4Z3DA 3CLHA 3PYMA 4ASUD 3LUGA 3P9CA 4BX0A 3EQ7A 3ISJA 2Z4RA 5KYXB 4MP3A 4BNDA 3VKVA 3D4IA 1BTOA 4KZKA 2G76A 3VDQA 4YP6A 2GN0A 1J24A 2J7KA 3VU3A 3R0XA 3NNNA 4C4YA 3WWPA 2DZDA 2DM6A 2J0SA 2COKA 4UEOA 1KQ3A 1FZTA 3AL2A 3ID6C 3I28A 5BNTA 3ECSA 5JH7A 2WYHA 4PQYA 3NRCA 1PDVA 1DIGA 4Z4GA 1Y4UA 3A2MA 4CT0A 1HDZA 3GA7A 5JDIC 4E5KA 4O4IF 4CQJA 3ZE8A 4A3SA 5B1DA 5CG2A 1V2HE 3AQ4A 3ROKA 2GJ4A 2YBEA 1CXZA 1M1ZA 2HU7A 1NVBA 4U8HA 4F3YA 4P0PB 3FYHA 3K5IA 3DLPX 5CXUA 2GJ8A 4EX6A 1EDEA 5FBQB 1H2ZA 1A97A 2QVBA 1HBJA 1U6IA 4UTXA 1KR5A 2C7VA 3DEAA 4BN0A 4EZIA 2M98A 2YOFA 1C9YA 1G3UA 2BEWA 2VAXA 4GICA 4IMRA 4MYSA 3WO1A 4MP8A 2ERCA 2AN3A 2BEUB 3T3EA 3VGPA 3R5HA 5BNZA 1O8CA 1OXKB 3TKAA 3ZHBA 5BWNA 5JI2E 1XRQA 4Z3OA 1P4JA 3QPAA 1YHNA 4RHFA 3RKUA 4JJ7A 4EB3A 5LXTB 4G01B 2EATA 1HOTA 4A16A 1U8AA 2MHCA 2DUMA 3NTRA 4EIWA 1YK1A 1F6WA 1GAQA 3OA2A 5FTKA 3K0HA 4FIDA 4AW9A 4X90A 4BMSA 4Q9AA 2JEZA 4ZPJA 5AW4A 5I3ZA 2FP4A 2IHBA 1XZKA 4L08A 4B73A 1P1RA 2KBFA 3K73O 1VG8A 1D7OA 2IGBA 1PK7A 2ZSDA 3VJMA 3O31A 2E18A 3DE0X 4TRJA 1VCMA 2C2KA 3ZHRA 3ZU4A 1CJSA 1GILA 1J5PA 3K4PA 1WUKS 2QRNA 4UUOA 2FFRA 1EAYA 1ECFA 3C6XA 2ZBVA 3I73A 1LV7A 4MCIA 1SG0A 1ZGZA 1GV1A 2M9MA 3ESCA 3SZRA 3OLXA 4JLUA 1NVGA 1Y6QA 2C9YA 4Z7QB 1U4OA 2CXQA 3N8IA 2C77A 2OAGA 4KW7A 1K2VN 4WZBA 2HLDA 2INGX 2HA6A 4DIMA 1G6KA 4IEEA 5TPWA 1IN4A 1XR3A 2H1FA 2JAUA 2FAXA 4UCQA 4JYAB 3ZIDA 2V97A 4Q9JA 2IDJA 3Q3IA 1I3CA 2CVOA 3KC2A 3KEFA 2GO7A 3AX6A 3P1JA 3O0DA 2JAQA 2MYPA 4X60A 4ZANA 5IZCA 4K9PA 1ZUWA 3VZPA 1SU4A 5B4VA 1GITA 1L7QA 1VJRA 2XSZD 2GETA 2RHCA 3NEYA 4POAA 2YDYA 3IOMA 4KPUB 4U7PB 1BHO1 2GN4A 5IEBA 2EBWA 1UFQA 1LF5A 3BMOB 1X92A 2Q4RA 4LX0A 4Q7KA 2IX9A 1HQYE 3B2NA 3SXUA 1KR2A 3S27A 2AIRA 5EEHA 5C32A 3KJGA 1SUSA 2GZAA 4GRAA 1X6VA 4PSUA 5BWMA 5JQGB 2UXDB 1AGPA 4QGBA 1YCDA 3CR8A 3IB6A 1GSOA 2QMUA 4OLFA 1V16B 4Y2UA 2PSHA 2IWHA 3ZNPA 2YZNA 3G5LA 4BQOA 5IPFA 3QBDA 5NLLA 3EGIA 1JPJA 3IHLA 3ONNA 4CMAA 4YCCA 1AS3A 4HUQA 5KQGA 1D2MA 5LA6F 2B21A 3N3AC 4I19A 1PRYA 4KVAA 5AVKA 2G8LA 3W7AA 5J4KA 1FB5A 2Q6OA 5GM2A 2IYXA 2QJRA 3TI7A 3LCCA 2Z1NA 3HCWA 4WBNF 2IT1A 1J2UA 2FB9A 1TDJA 2Q3MA 5HS6A 4D4MA 4IXMA 5I9MA 3GRRA 1NZDA 3A31A 2XJ9A 4WUTA 5ICMA 2W93A 1O94D 1DDGA 1EZ4A 2C3OA 1OD6A 2H2AA 4GP6A 2QTMA 4O1MA 4O4JF 3H86A 1J6UA 1U9JA 2I8LA 4DIKA 1K88A 4V0NA 4J3FA 1JFVA 1YASA 2FW6A 1TKCA 4DT1A 4P92A 5ALXA 4FFOA 5AW8A 3OTOB 1II0A 2ZB8A 1XYGA 4NYMR 4DILA 4S1TA 2FSVC 3B1KA 3FNHA 1AMOA 1VKZA 3AR3A 2HO5A 5EZQA 4UCXA 4C4XA 5BXQC 2ZG6A 1LK0A 3F7OA 5AW9A 4CYMA 1QF6A 4JK3A 3EDOA 1KSGA 3DUFB 2JG3A 3O26A 4QBGB 1XZAA 3BXGA 3T4XA 1BEUB 3NBQA 2WLTA 4JX9A 2AWNA 4CLOB 1P74A 4KPUA 1TJ3A 3SBEA 4A1FA 1GV0A 1WS6A 2W2KB 3TD2A 1WUIS 1YS4A 3DKRA 4QBFA 2HF9A 1J06A 1Z0KA 5P21A 2B36A 4G0NA 3ZW8A 3R4CA 3JVEA 1ZNZA 3UOWA 4Q7QA 1NVKA 2CNWD 1USKA 3JWJA 4NCIA 2A5DA 5LLDA 3GHYA 4QHTA 3KVRA 1OPRA 2UXCB 1CUYA 2HNAA 4KRXA 3U4AA 1RXCA 4KUGA 2VZEA 1DZ3A 1A2QA 3DEIA 1I4OA 4Q15A 2JGDA 4KAXA 1MQSA 2CWDA 2RGYA 5B7PA 4CKEA 1XN1A 3SQOA 1W93A 1YR7A 3ZY3A 4D9GA 1N6RA 2CE7A 1LB1B 3E6AA 2PMDA 5HW0A 1PK8A 4HLUA 5D3MA 3K15A 1KOJA 5KWSA 1SHKA 2B0CA 1RZUA 2FQQA 4KQEA 2ZJ4A 4L0DA 5BO5A 4MRMA 4QEDA 4L07A 2QTLA 3B6JA 4IIJF 1XMOB 1Z5OA 4HEHA 4F96A 3UK1A 3ZWQA 3O8LA 4V24A 4WK0B 2CNKA 4GRDA 3SIRA 4LNHA 1GM5A 3GI1A 1Z8DA 1FP4A 1XTSA 3M49A 1L1EA 2CD9A 5KIAA 1C8BA 1LLQA 1XMXA 3N2EA 1YI8A 2KMLA 3ICOA 1FDIA 5AKGA 3G0OA 3H8JA 3QYFA 3BGIA 4LXUA 4QT0A 4UPVA 5EXXA 2G1JA 1PEKE 5JZVA 2F8TA 1ZM4A 1GTJ1 1UXHA 1G9SA 3JVDA 4FT4A 5F7XA 3HUFA 1FNSA 1HEYA 1HTWA 3B60A 3PKJA 4XCXA 1Y0BA 3GW8A 3GZTB 4P7JA 5H1YA 4YT8A 3MCZA 3GT7A 2Z6QA 1E3MA 1RKBA 2OM6A 4KR7A 2AX4A 1GSAA 5G0TA 3K1TA 3B1VA 3P4UA 4K28A 4A10A 3GWGA 4GVXA 1KYXA 3HCEA 1FX0B 1V9SA 5BMVF 3RYTC 2PD4A 1VIDA 1UM8A 3PPXA 1IIBA 4ARBA 5CK5A 1P5FA 1E9VA 1BIFA 2OBLA 4LNUA 4G0VA 4J0IA 2HB6A 4K9LA 4HT3B 1HL3A 2R1TB 4Q4HA 5HEKA 1FNBA 2ONYA 5I01A 3PF8A 2C2GA 2QN7A 1MVLA 1HE3A 4TLBA 1Y8RA 4UM9B 2OXEA 3AP2A 3QU2A 2PS0A 3GLGB 2AW3A 3HU1A 2VDNB 4MARA 4P5PA 1PEYA 5AI0A 4CEJB 3CLTC 4JKYA 5LQJA 3U6KA 1PUIA 1CWUA 4JT4A 4Q4AA 4LC0A 3ZU5A 1E8NA 3P2IA 3NO4A 2DERA 4WZAE 1WDKA 3THWB 1UQUA 4YUXA 3P0EA 4LW8A 3QHAA 3OZ7A 4H3VA 1O0BA 5TF4A 5BUZA 1QRDA 2YWBA 4LRQA 3SZOA 4ZI7F 3E23A 1T4DA 4U7TB 4UAUA 3L6CA 4AJNA 2YZMA 2ZGVA 3JQ6A 4NH0A 5DNEA 4ZAXA 3D64A 1CW2B 2N75A 2OUKA 5HBRA 5JSHA 1NASA 2E82A 4JI3B 3RHZA 1P5RA 2WHPA 4DDMA 4PYMA 3CNLA 5KNCH 2VSNA 3Q9SA 3B3QA 3OQJA 4R8MA 2F8LA 2HDHA 2NT3A 1A8SA 4O4LF 5C7YA 3FZEA 2JRCA 3QVGB 3J7TA 1NBMD 1RBMA 1NN0A 3ISVA 4F3NA 4F91B 1DC4A 3NBAA 2I29A 2OVBA 1N2CE 3K0KA 3KR0A 5F35A 3R7AA 3SYRA 3QU4A 5A3VA 1FZQA 5H81A 1E0JA 3NHKA 1J2JA 3T5MA 2I7CA 3SY8A 4X93A 4OO3A 4DW8A 3P97A 1SHLA 2PXAA 5FL7D 1MX3A 5TS2A 2WD8A 3F7MA 4MGKR 1CJUC 1YQUA 1U3FA 2V3VA 3UT5A 1CZLA 2CXOA 2VHUA 5G2OA 4JLJA 4F8EA 1Q1BA 3D3QA 4I1YA 3V9AA 3A1UA 2LRHA 3DV9A 3F5SA 2G70A 4N18A 2C03A 1JTVA 2NVUA 4BQQA 4TS3A 1SK8A 1SELA 5FI0B 2NO0A 4AM8A 4RM3A 2IYFA 2OCDA 3UH0A 3QU5A 4B87A 4QFCA 3ZYCA 2Y6UA 2O3JA 1ZM3A 4UVEA 4RZXA 4DZRA 4I1OA 4EB6A 5ALWA 2JLZA 2YVKA 1GPYA 2A35A 2EG9A 5AJWA 5KEIA 2YINC 4QNNA 3SYLA 4EKNB 3GJ0A 2GXUA 5IBRA 3ABZA 1WZNA 4KSBA 3QEAZ 1J2YA 1Z47A 3X1XA 3DXZA 4QUJA 3G9XA 1SQFA 4L5BA 2BW0A 1X1AA 3T1YB 1AZTA 1F8FA 2G8NA 1CZUA 1FSSA 1TF5A 3LHDA 1LQ2A 1QGDA 4TTPA 2WSIA 1XROA 2L17A 1KE2A 3SYMA 1Y8RB 2PX5A 3WKEA 1OFHA 2XRMA 3L6EA 4MJXA 2F17A 2EKLA 4MP6A 5C1BA 2IE8A 1MA0A 1PKEA 2HPZA 3IBTA 3LCUA 3LT2A 5G0SA 1PJCA 4BO4A 1I5EA 1XP8A 5GZ1A 5AHXA 2B8WA 2PRJA 4LZZA 3AR8A 1PHPA 3AJAA 1OAKA 3KQOA 4IMPA 2JS7A 2CJPA 1S8FA 1M76A 3CPHA 4O08A 4BMDA 2JATA 3RSGA 2ZT5A 4G8JA 1BC5A 4HTFA 2D0PB 2GYYA 4IFIA 3LDUA 4JR2A 4ZODA 1JAZA 5HFNA 3KXKA 1IJKA 5AJVB 4IOLA 5EMLA 3RBXA 2WT8A 3PD0A 2VL7A 5F2OA 3FX2A 5LC1A 3ESRA 5IT4A 4EFNA 5DPMA 1F2TA 5DSTA 1P2VA 1KSHA 5JRZA 1IMJA 2PFSA 3EIXA 2NU8B 2C7PA 1BX3A 2WF7A 2R62A 2O7QA 1DKUA 3CRQA 5EXEA 3RASA 3ETLA 4I7EA 4LJAA 4QPJC 3AY7A 2PO7A 3I4LA 4MQLA 2EFDB 3T99A 1YS2X 3PFIA 5AFSA 4BWVA 1U0JA 3RRYA 2OFWA 2OQRA 2QQFA 3BCRA 1OIXA 2FN9A 5FPTA 3BK7A 4UNQA 2FOXA 2IP4A 2BDUA 1M8FA 3ANYB 2JGLA 1X8JA 3U4GA 4HS9A 4Y2GA 3J7AC 1XVTA 1M2OA 4KKXB 4Y2TA 4D4LA 1LPNA 3F9RA 3LDHA 3KDPA 3ONFA 1KYTA 3OAAA 5CFZA 5J4LA 1I36A 2XODA 1ISHA 1YHZA 3F5QA 3I01A 2QZZA 5AXCA 4YQEA 5BR7A 5LP6F 1E62A 2GGSA 1E5TA 2HCRA 2Q5EA 2VRCA 6GPBA 1FSGA 1K06A 1JR6A 4DV1B 1Z7BA 4EB6B 3HSSA 4GLBA 3ROXA 4ASUA 3GIDA 3TLBA 4DPMA 2YNMC 3ETCA 4YJDA 1KGDA 2Q8NA 1IOLA 4AZTA 3T5PA 3L7AA 2Z8YA 4KQXA 3Q7IA 4DLSA 2WILA 5ITWA 3JQ9C 4F2HA 2ZI6A 1S8NA 4E13A 1Z6XA 3FAKA 1CZRA 3SX4A 4OUDB 1M2VB 2R85A 1VYTA 3UOGA 1DBIA 3WLTA 2E1RA 3IFSA 2GD2A 2ZYWX 4PGMA 2XUJA 5FAXA 1HNXB 4KPEC 2DCUA 2PGNA 4UBKA 3AHFA 4FEYA 1U3VA 3DE3X 1QTRA 3MIIA 2WA1A 2FPIB 3IP5A 3LBIA 4R16A 5JEEA 3VKGA 3K70D 3ADBA 2XGGA 1GFZA 1AK1A 1MEEA 1Q44A 1BCSB 3CLTD 3ETDA 3NQ41 4EVRA 5C1OA 3HM9A 4QBKA 1QAOA 4MVXA 1BQEA 1J42A 4WXYB 4YPVA 3QPCA 3EODA 5HSGA 4PEVA 2W11A 3PENA 1TZ2A 5DX0A 3OUZA 1DFHA 3QX8A 5JSFA 3VJRA 1M73E 5CIQA 3WGYA 1ZMRA 2QDKA 2OYRA 4IQ4A 4EOGA 3TQQA 3FTPA 1CUHA 1CRPA 4FEEA 2Z30A 1DG3A 3FOFC 1UAGA 3TZBA 1E3TA 1GGNA 2ZWOA 1QO0D 3IAS1 2Z83A 1R0ZA 2DWUA 2VXBA 4BMZA 1TZCA 1U80A 1X87A 3WSWA 1GKKA 4AAYA 2KX7A 3RYIA 3DHYA 4TOIA 5DTMA 4UTVA 3CJTA 1B2RA 1TU3A 5JCXA 2OORA 1JE0A 3DLIA 2UUBB 1Z08A 2JH9A 3D8TA 1L1FA 1W19A 1QIIA 3GJ3A 4TTRA 3F7TA 3DVAA 3VKFA 1G4HA 3NCTA 3LCJA 1W34A 1CS0A 4ZOLB 3R23A 3GRFA 3KFVA 4PIMA 4BS9A 4YPOA 2F4VB 1OFVA 2H4YA 4P3XA 1TU0A 2Y93A 4A6XA 3AR9A 1T9GS 1UP4A 1HFJA 3NAZA 1UC8A 4XM2A 3ENWA 2XGSA 3TIXB 5I9TA 2VK1A 2VNSA 3L7OA 1NXXA 3G68A 2WIGA 3MELA 1Z0FA 1ZRHA 4J03A 5K45A 2QI9C 3WIVA 3SK0A 4M7PA 3IPCA 1G16A 3N6XA 1L7MA 1AE1A 4MPPA 3WBBA 2WICA 2IS1A 1T2NA 3PQFA 1MT0A 3EGXB 2RFLA 2J9RA 4ZCRA 1TTPB 3FUUA 3IOBA 3IX7A 3PDWA 4L4YA 2WF6A 4WZZA 2XZOA 1ISGA 2N42A 3OUTA 1Y3IA 5JAMA 5TLSA 3AOEA 3T3DA 4Q00A 5ERXA 3VTKA 4AMBA 1M2WA 1CJKC 3F90A 3TLZA 5HCUA 3VO9A 1IEQA 4INJA 1DAOA 3F8SA 3QJGA 4RY8A 1ZWKA 4M36A 3BJZA 1WOYA 4Q9LA 2B8JA 2JFUA 2HCTA 2PE5A 1VHDA 3CG4A 4I3GA 3EJWA 4OQQA 4WK6A 4B6PA 2Y99A 4HKTA 4OU4A 1GFIA 2OV4A 4TMXA 1KFJB 2H08A 3TW0A 3AESA 5KVSA 1Y8AA 1YI0A 4BASA 3D0KA 4IO0A 1RLJA 2AJDA 3LUFA 3UMBA 1RVDA 1RXUA 2P90A 3FB1A 1BCSA 5CD9A 3EMVA 5AM0A 3FROA 1E2NA 1WLYA 5A04A 2UDPA 5FA6A 2GF0A 5COAA 4JC5A 4E2ZA 4F4DA 3OCZA 3QUAA 4Y6RA 4BNNA 2YWRA 4INAA 3MRVA 5FORA 3IKJA 2RHWA 4OCZA 2AJCA 1WULS 2EVWX 1LBQA 4RPJA 4U7WA 3CZMA 4B3BA 1N3IA 4LRWA 1WHTB 4M8IA 2JH8A 2QXYA 1E1QD 3OY2A 1K7CA 1P3Y1 1YB2A 3IUJA 3PNVA 2EFJA 4TV8B 2H5JA 2C7RA 1K97A 3A10A 3EC2A 4N03A 1A8PA 1KETA 2AQ8A 3LLMA 4UZEA 3EG9A 5FTJA 5K01A 3TEFA 1PX2A 3E5NA 3EK2A 3Q9NA 3L79A 3VBCA 3OOYA 1N0WA 2X5XA 4UUMA 3EX7C 1US8B 2BRUC 3A9RA 4MVJH 2IZ7A 1NR1A 3REQA 2Q3CA 3KAKA 5ECWA 2JIZD 3WBKA 2VHCA 2CMHA 2G6TA 4C7BA 4FYJA 2R6FA 1GYQA 3IBSA 4F6RA 5GGYA 2FOIA 2XMRA 3CWCA 1HEUA 4ZTBA 4C7OA 4LXGA 4RUKA 2BGRA 3OWOA 5AKKA 4YQZA 3N8GA 4A15A 1HA3A 3HYLA 3AF0A 4NFLA 1GG2A 1PJSA 4ZXFA 1Q92A 4RTNA 1CS4C 1FFGA 2BT4A 1CQIA 1RZRA 1QZ3A 4BMVA 2Q3EA 4YH1A 2X0EA 2ISQA 3LCRA 2PPLA 3P27A 4B35A 1SZPA 2OO5A 1FFXB 2ZWIA 4OXYA 3CVWA 2I87A 1SBQA 2H2WA 1HE2A 2M32A 3QFHA 4Y7DA 1NVFA 3IVRA 2H3EA 3HCOA 5JPCA 1ZQ9A 3ETHA 1MDBA 1OXVA 3N0VA 3T9FA 4E46A 1G17A 3RC7A 1N0VC 3F6BX 1F17A 3L8MA 4LHWA 2AC7A 1H3FA 4OQXA 1Z6PA 5AK5A 5TQJA 4UBJA 4QL3A 3V7FA 4TSRA 3FN4A 3K32A 4G5RA 4RFSA 2Q0SA 3DWIA 1KZHA 1T2VA 4G0PA 1NV9A 1GRQA 1U9ZA 4H7KA 4AJ9A 3FPGA 3UAXA 3L6RA 1C7RA 4FHGA 3QX7A 2JDID 5ALYA 2FVXA 2NU9A 2HUNA 3ZD6A 3U48A 2HLNA 1Z29A 2PSFA 1F60A 1MN6A 4X7BA 4IJUA 4KIJA 4UHBA 1VPTA 3DMDA 1ND6A 1XZBA 3NOVA 2J7PA 4Q02A 5KNCA 2FEMA 2C92A 3MCVA 4C0QC 2ZJYA 4XLZA 3ZV7A 5C8XA 1SU7A 3LY9A 2P6PA 1IB0A 2ACWA 3N7AA 4MKFA 1JRLA 1UINA 1EFTA 1REQA 1YIOA 4U7FA 2P9JA 3D3JA 1T9DA 5TT0A 3WFIA 1N77A 4PRKA 2AFHA 3Q88A 4YJ3A 4DM4A 5B55A 3EWNA 3NRJA 4GH5A 1ZIPA 1SY7A 4HG2A 3MGGA 4JZKA 4Q3BA 5JAZA 2P3SA 4HPXB 3OQ1A 1OX5A 4FKBA 1HZJA 4MJLA 4P84A 2JLYA 1P9RA 3DFKA 4JSYA 3RQSA 3R5JA 2Q2VA 1VCIA 3JAWA 3QBJA 4UQLA 3QE9Y 2J9FA 1QR6A 1ORWA 1LPAB 4LMAA 1KZ1A 6LDHA 3G0DA 2E21A 2P0YA 3MJRA 3OUUA 4KO4S 4IUCS 4LJ9A 4PSVA 3SM9A 2KPOA 2I3ZA 3L82B 3QV2A 3WHKA 1U65A 3WK6A 4AY2A 2XCRB 2NNLD 4G0WA 3PXCX 1N3LA 1C80A 3L8FA 4LA4A 5IN5A 2W8BA 1QDLB 3M3DA 4ZVVA 1DG1G 4OM7A 1PAUA 2QLJA 1XV5A 3EIWA 4JOBA 2HAEA 3MSXA 1C3LA 1JIUA 1FS6A 2DKFA 3GPBA 4GM1A 1H0KA 4GUAA 5KAPA 1V71A 1LVUA 4HQOA 4RELA 3REOA 4O1HA 4OVKA 1Z56C 3OEYA 1VL0A 3QSGA 3COZA 1KH1A 5FTWA 4KR9A 8ATCA 5IKPA 2ZI7A 5CPFA 1HE4A 5EQTA 5JNRA 2P9EA 4MIYA 1RKUA 3F97A 1XZHA 5AK3A 1VA4A 1XALA 1B8VA 1FTSA 3ZDBA 4YJFA 1I1QB 2O7SA 5TT1A 4RF2A 1NP6A 5CJ2A 5BRJA 2AB0A 4M7RA 1IY8A 4YT5A 4N7BA 2IYTA 1MTZA 3RTDA 1SUAA 3QFTA 4KPGA 4INPA 4BIIA 3IGFA 1GRRA 4XPIB 3HPQA 1ZOIA 3CKMA 3JWIA 4NNPA 3KZOA 1GCGA 2VIIA 4NRDA 4ZO4A 3WDKA 1ZL0A 2N46A 5DNCA 2RKBA 2AR9A 1ENPA 4GBGA 3GRPA 4IV0A 1FVFA 2WUEA 1R27A 4MW1A 3PNSA 5BMOA 4QM7A 4H3SA 3SN6A 2Z58A 3Q2KA 4HDKB 5CD1A 1EFAA 4CM6A 3PVSA 5KWVA 4RMGA 1OH8A 5AVSA 3MGAA 4A0RA 3PUHA 3NHMA 1P4AA 2WLSA 5H3LA 5IC6A 4QASA 3JAKB 3ZDAA 1OI2A 5JT1A 3L8CA 2GN6A 5ENZA 1ZISA 1EHCA 1KI7A 2QVXX 3FSJX 3QWBA 3M4YA 4FGKA 1P17A 1O77A 1H65A 4JT8A 4UTRA 3AIOA 4WV3A 2V55B 2QTZA 1RC0A 2G4LA 4REOA 4CM8A 1GL7A 2VBIA 1CR0A 3NHYA 3SJCA 1GL3A 2M6RA 1OT5A 5HDQA 2DOKA 3CEHA 3MLAA 4JROA 2AOTB 4O4IA 3JQCA 4HR7A 4M1SA 1K6EA 2H2DA 2WZQA 4CFSA 1HFKA 4MW7A 3LAWA 2XRFA 3WGHA 1DKQA 3AG6A 3UY4A 2FRDC 3ZQ4A 4W4TA 4D44A 3WAGA 3EPLA 3OTWA 1AXRA 4LDNA 5IXSA 4LKRA 1LI4A 4NJEA 5C4GB 3D4BA 2AFIA 1PZXA 5CGQB 4NABA 1F0NA 2OZPA 2EC5A 1IMOA 1QVZA 1YA4A 1PDWA 1PYOA 4FGJA 3ANMA 2B37A 4HDNB 4S1PA 1WSAA 1XLVA 3IIEA 3TMAA 3TPCA 3ZGZA 2O2HA 4IHJA 1OH6A 3K16A 2QN6A 3N2YA 1LXCA 5E4FA 3FSRA 1ISRA 2HDOA 2PZJA 1KXJA 1Y3HA 3T3NA 1L5HB 2DR2A 4LJYA 3LWNA 4I2NA 1ZPDA 3SHOA 2H54A 3L4BA 1UFOA 3OCYA 2ZRPA 1YSCA 2CNDA 4Q24A 2HRQA 2R96A 1HZZA 1MCZA 2RHMA 3AERB 3CEPB 3KKMA 5HZHA 3UH1A 5JAOA 4CF5A 1ZIXA 2Z56A 1EGVB 2H1SA 4GZ6A 3WFZA 3S3TA 1X1RA 2G5CA 2PNFA 1B3RA 2QUIA 5ALPA 4LJ8A 2W2PA 3WGKA 1ZONA 4TYMA 5CA1A 4QU0A 4UZSA 4YA6A 3Q3GE 4UTOA 2FEOA 5ALOA 3EC7A 1XWFA 3NC0C 5FV4A 4Z4CA 1PUXA 1JQ3A 1ADBA 1KO8A 1O03A 1R6TA 4LX8A 1FFBA 1RACA 2P2GA 4IJQA 5KO2A 4AUEA 5KTRA 1GZ6A 5I3CA 1Z13A 3KOOA 4RLSA 3DR3A 4URFA 5AI9A 1V48A 2FPRA 1UJNA 3LRPA 4XDHA 5KTTA 2C57A 3KLBA 3SF8A 1PJ3A 2XIQA 3KU4A 3OOJA 4D5EA 1VOTA 1N7HA 1Z4KA 3IALA 3NWPA 5JDCA 3WAKA 4ZJUA 1TQ4A 1TW3A 5ALZA 9ATCA 1RP1A 4H4DA 3NHPA 3RAPR 1QRUA 1I9CA 4K0RA 2AG6A 2QZ4A 4S2EA 2UZ4A 2MINB 4PGGA 4DMMA 1V1MA 4GVPA 4P5DA 1SD5A 2WF8A 2YV1A 3ANTA 3D6MA 4HV4A 5BXYA 5A02A 4J0QA 2XDWA 3AEQA 1Z6YA 3L0DA 3NT2A 4DXAA 1N1GA 3E84A 3UJBA 4A92A 3S5UA 1DRKA 2P9TA 3O1IC 3RUIA 5BOSA 1IQPA 1YZTA 3BPSA 3IS3A 3VPBA 3U7JA 2RMKA 2WSMA 5FRDA 4JYBA 3VU8A 2R48A 2H07A 1TK2A 5CVVA 3W05A 3UAOA 2GZ1A 3MQ4A 3NTQA 1HXHA 4B3JA 5D84A 2PYIA 3RQIA 2PSJA 2NP7A 2GAIA 1E20A 3OZIA 3IAM1 1MT3A 1WHSB 3V7WA 3OMXA 4ZRNA 1YTLA 4Q6BA 4RLQA 5IZCC 1FP1D 2Z98A 4LE0A 4A0SA 4RMHA 1G21E 4RSGA 3CGWA 2IYVA 2YJ6A 4MMXB 4GKJB 4IS2A 1W88A 1DEHA 3SHWA 4K86A 1J0BA 1PVDA 1CJTC 5ILGA 3PCTA 5E1OA 5K8IA 4S1WA 4KMOA 3UWKA 1RWMA 4R2JA 3PHIA 5DJ5A 3TBHA 2W58A 3UHAA 4IDFA 2VQSA 2F43A 3DZBA 1PFGA 3K30A 3MGCA 5G4KB 2I8CA 3E3MA 3IMEA 1EG2A 4E4TA 1PJBA 1GR1A 1UBRS 3FNIA 1HDRA 1PFVA 1S3SA 4QUKA 4WCFB 3HKBA 4H18A 2WF5A 1OASA 5HIIA 4C08A 4M9RA 4DC9A 5CYFA 1MIHA 4NICA 4ENQA 5DLEA 5FTMA 5JC8A 2E7ZA 4PAWA 4CQNA 3D1VA 3ISTA 2FMTA 1EVIA 1FU7A 3W9YA 3W8NA 4KH0A 3R74A 3I6IA 4IHQA 3ROEA 2ZSJA 3VPFA 3QP9A 2VPYA 4JJEA 2P2LA 5K0ZA 3I5MA 3ZNOA 4F9FA 5EJAA 1ZD4A 4R5HA 5CTJA 4BNTA 4DFDA 1FY2A 5KSWB 3THOA 1L8QA 4JU9A 1HL7A 1M2HA 1SHJA 3C45A 4H3KB 1KWGA 3P2EA 1JKIA 4KR3A 1TM4E 4K26A 4M83A 2X86A 2ZAYA 1J8FA 1IBRA 4EZEA 5BSUA 1OZFA 1PZMA 3V8PA 1ZVVA 1A5BB 1QF7A 1ZCBA 4WY5A 3QXHA 1ADFA 1G5TA 1M1YB 3BJMA 2QD1A 5EMHA 3IAXA 4X5OA 3BYZA 1ZHHA 3C5CA 4L3OA 2LKCA 4UULA 4E14A 5E38A 3JX9A 3VVMA 1ZLXA 1W5TA 1PL0A 5H5JA 5J23A 2LV8A 1M6YA 4X1IB 2XA2A 5E4YA 4ZMSA 4HZUB 3RRJA 2QRZA 2FX3A 2NVBA 3RAJA 5F5NA 5DHRA 3HNRA 4BN4A 1T1SA 3OQIA 2DFVA 1IBSA 1I14A 3LPMA 3O1HB 3C3YA 1QRAA 3QFSA 2IYOA 2XY4A 2FMFA 2JL1A 4D9FA 2RGUA 3HL0A 3G8BA 1R1DA 1YU6A 1ILEA 1TZKA 1A3CA 2JFPA 2QMYA 3LT5A 3QU9A 1BEEA 4K03A 4OQZA 4PANA 1B8OA 4U7JA 1Z15A 2CBGA 1M1YE 3DC7A 4CEJA 3NONA 1KKMA 1RQ7A 1E2LA 2QRKA 2J30A 3HGMA 3N2GB 4LDQA 5LJIA 1XU4A 4BNUA 2JK1A 3HKBB 5IAKA 1R9MA 1PWEA 2QV7A 3GRUA 3G5UA 5EFOA 4G5YA 4GYWA 3RJ5A 2HD4A 1GJRA 2A4KA 4QYIB 4RF4A 4REQB 2ZRLA 3PD1A 1O0SA 3K9HA 2CZQA 4BMOB 1RHQA 1EWRA 1E3IA 1TQ8A 4JR0A 3R8XA 3SPXA 4D3DA 2IY9A 5KJ1A 4MEBA 3GFPA 3A37A 1NRIA 3L6UA 3GK3A 1SU6A 5J40A 3MJHA 4MQFB 3TO5A 1UC5B 3UXHA 4Y1GA 1G0OA 3DC2A 4FWBA 3RU3A 1BE1A 5TARA 5EXSA 4BLSA 5EKTA 5LMNB 2EBFX 3H0EA 3I9V1 5TGTA 3CRNA 4M87A 3ZE1B 1RJWA 3IJ5A 1DOAA 2P8JA 1L5LA 2ZJ0A 4KV7A 5JSUA 5BV7A 1OBHA 1X9GA 2JGKA 3A6DA 3NDRA 4LMPA 4Q21A 4YTEA 1F2UA 1R0LA 1ZNWA 4MGYR 4RJJA 4JI0B 2DXIA 3KHKA 1AQJA 2FX2A 5CB4F 1VP9A 4MKZA 1P44A 4UFPA 2NSJA 3DAHA 3EA0A 1QG4A 4RDCA 1ZAYA 2CHGA 4TLAA 1C8KA 1T4BA 2E6KA 5H9VA 4QDXA 1TXGA 3OMWA 5JWHA 1ECPA 1GPUA 1TLTA 4LRSB 4IF6A 2C84A 2O8EB 4TWRA 3BB1A 1SXJB 4Q7EA 4LECA 5B7QA 4FFBA 4BZQA 1VHWA 4TLCA 2BFEB 5AW2A 2LIVA 2IZOA 3H11A 3NPAA 5I4IA 1U3WA 1O54A 2IXEA 2FPPB 1R8YA 2Q7XA 4U3JA 4JELA 1AKWA 1QQTA 3CH5A 3DT6A 3RJ9A 3WNDA 4B6JA 1VRCA 5E7MA 2DE0X 1PJAA 3CVXA 4G81A 3MTIA 1GCAA 1H0RA 2HXYA 3T7JA 1N33B 2BHSA 5EINA 4OKSA 4B3SB 1OBVA 2EX1A 4MUXA 4ZJZA 4U0JA 2QTNA 2DTDA 1R0WA 4WLFA 1AMUA 3E9MA 2ZJ7A 3VR3A 2BI4A 1BMTA 2GILA 4XYMA 4WNCA 1K08A 4PE5B 1WB4A 4AWXA 3WI7A 3FPAA 1NVTA 1RLMA 3UCFA 2RKWA 3DPIA 1JLMA 2CF5A 1L1QA 4HNAB 3PPWA 3S2ZA 2ID4A 2J4CA 4N3NA 4BPRA 4YXFA 3PUYA 1QU2A 2AYZA 2HI0A 2PX3A 4DYDA 1C4OA 4LOKA 1WPGA 1SG6A 4RY2A 1NQTA 3THYB 3OX4A 4PHFA 1Y1PA 1CDZA 1B00A 1FRNA 3FW1A 3L05A 3OG9A 2IXGA 4FONA 3KZKA 1EM8B 1WUTA 4P3YA 1T5DX 2XNDA 1E92A 1AHHA 2MR5A 4RPLA 3OEHD 1MOSA 1BMDA 1CE8A 1MXFA 3WL5A 3GAZA 4ZOAA 3SF8B 4GR5A 1TQHA 2L42A 3AHGA 1IH8A 3ZWAA 4B85A 3RPEA 5HR5A 4L4SA 1J5EB 3KFLA 1FXUA 2P6UA 3EIQA 4TLEA 4BFWA 3GLFA 1EXVA 3EGVA 2FFBA 4LJKA 4ZVOA 4BKOA 4Z6KA 3W7VA 3L40A 4MPTA 3R7WB 2AL7A 1UKEA 1C9KA 1XVIA 2X14A 3TIGA 4EI2A 1IPFA 3TEMA 3E5RA 2JARA 5TJ9A 3VVBA 3MWEB 2QRLA 3IEXA 3JSAA 3VVCA 2NSDA 3ONDA 3L7NA 5LKAA 4N5IX 5KOYA 5THKA 2IYRA 1QQAA 1H1TA 3MB8A 3M33A 1SXJA 3F73A 2EG5A 3AB3A 1YS7A 2PD3A 3NETA 2AZ4A 4PM4A 1Z8FA 2HK6A 2KI5A 3LC2O 4QUIA 3N87A 4TM7A 3OX1A 3T9DA 4EI7A 2IEIA 1IHUA 2F9MA 2PUAA 3IPLA 4I08A 5DNVA 4CF6A 2YJ3A 1WPQA 1N0HA 2GCNA 1P4RA 1QH0A 3DYIA 3ZJTA 2DKOA 3BRWD 1HRDA 4RD3A 1RJFA 3DL0A 3QUCA 4NFYA 4JGIA 5IMSA 1M1UA 3ELUA 2YHUA 3DE1X 4EY6A 3V8MA 5AVWA 3QY9A 2IEZA 1P0QA 1XRSB 2HA5A 2RK6A 4HO1X 3THXA 4BJ5A 3WL7A 1IM5A 2QTHA 3PFNA 4Y1RA 1CY4A 4OB6A 4HUJA 5KOHA 1L5NA 3TGWA 1UPFA 3T1VA 4DTCA 3Q0IA 3HLTA 4FS8A 5CFNA 3WL6A 5DW0A 5MFZA 1SMKA 1M34A 1YRLA 1OWOA 3V6LA 1G4AE 1Q5PA 2L0XA 3RVBA 3MJFA 5I5GA 4JH0A 4P3NA 5TGZA 5I7HA 3C3DA 4N5DA 1QB7A 4HUQB 1D2RA 3HXPA 3SHVA 1J4AA 1RHUA 3U31A 4A2QA 3RHTA 1J49A 1FMLA 1B4DA 4N0PA 3UAWA 3K9FC 1L4NA 3AIKA 4UCWA 1IXKA 1EKXA 1W8IA 2J3HA 2JPDA 3BZUA 4IVPA 2V6JA 3WZ2A 3MUNA 4RE5A 1JHXA 2VDUE 1A1VA 1SVOA 2I4RA 2O6HA 3CCBA 1Q12A 3A7DA 3T9EA 1J8MF 3T7DA 3W90A 1SFRA 3RT9A 4EG0A 1X80A 4XUEA 3FDIA 1QYCA 4QX6A 1R5JA 2AG5A 1XCBA 4PNZA 1K86A 4R9VA 3RVRA 3AILA 2X76A 4ZQEA 3U9LA 4OF4A 4NF2A 4ZD6A 4JUIA 5B30A 5B3LA 1AMNA 1PR0A 3O1JC 1TFRA 2PUTA 4ITUA 1JG4A 5JYDA 3OQIB 4KJZA 1QG6A 3GDOA 4WLNA 2BGTA 1QS0A 5BVHB 3BEOA 3LKZA 4DQKA 1W48A 1YRQA 5L3SA 2E5WA 2X4DA 3QLVA 4BMPB 4DRXA 5JD5A 3H2JA 1SIWA 3WGTA 1QDUA 3ZGNA 5KPDA 2A3NA 2NQTA 4FFNA 2ATIA 5AW1A 3P2OA 3IQHX 4PZ9A 1BVHA 2ZSHA 3DT9A 3G02A 1K7EB 3L7DA 4YJGB 1FNNA 1UBKS 2Q4TA 3AW9A 4GF5A 4JQCA 4WACA 4X3OA 4C14A 4U8GA 5KCZA 1DJQA 1BS9A 4LZOA 2DAPA 5ETJA 2A1IA 4BMCA 4M76B 2DH6A 3C1AA 3KD2A 1R16A 4G65A 4ID9A 4E33A 1OA0A 2FZKA 4W1RA 3OE5A 5B2FA 2Q0HA 4S1NA 2AMLA 2HHAA 1QGED 3BE8A 3OZWA 4S04A 1CUVA 3I2HA 2OM2A 3WK4A 4QZVA 1QLWA 2ZPTX 4NTZA 1VMAA 3AB8A 1G20B 1P61B 1XB2A 3B5IA 3HKDA 2TSYB 4B83A 5IVPA 2WUVA 3E22B 4H7FA 4PZAA 4ZRMA 4LPSA 1E9RA 4MZXA 1W0JA 4I8DA 1ZD2P 4CL3A 3WXBA 5J47A 1LZLA 3AR2A 3VI3B 1XXHB 4HATA 3K0SA 5I7UA 2B4AA 5FI5A 3TTSA 2Q9CA 3A1WA 5ARBA 5GV7A 4AZ3B 1X3SA 5DEIA 1E1RD 1VQ1A 2GPNA 2VBGA 5I4CA 1DQPA 2FYTA 4NYIQ 4RKQA 3K9WA 1ETUA 4TL8A 1ZD1A 4O2AA 5CXXA 2VHVA 5FV7A 3VYUB 3AHJA 1Q0HA 1GT6A 5T3UA 1NSYA 2CL5A 2XA1A 4QELA 1LQUA 5AW0A 2OHFA 3Q1KA 3QENA 4HTAA 1J0AA 3D8BA 3ITEA 5AXBA 2HBQA 2AI3A 2B35A 1WW8A 3GLIB 3E48A 4UXJA 3UBTA 1FXWF 3DYBA 4F7DA 6PFKA 2Q5OA 1ZI6A 2W2OA 1DAKA 2IIPA 3CZPA 2IUTA 3FPCA 3RUPA 3ZW7A 2HPVA 2I4TA 2IHTA 2W71A 4YUAA 3H5WA 1JYSA 2O2DA 5EJ4A 3IP7A 1ZUHA 1TO2E 2NN3C 1Q3TA 2AXEA 4DIUA 3GEHA 3QE2A 5DN6A 1GTZA 2GHIA 2RI0A 3C41J 4D99A 4LYHA 3K6SA 4UMDA 2GN9A 2HR1A 1WPXA 1KEPA 2AMVA 5BVHA 3GELA 3MYRA 2FE1A 1YNSA 2PZBA 3DCIA 4H3HB 4N5MA 3ZWYA 2VTBB 1UM9B 1W85A 1LTKA 2HJGA 4HVLA 1P0CA 3TI9A 3TLKA 4ZHQB 4N3CA 3QI2A 4Q1AA 3HVKA 3SS9X 2ZB2A 4JBNA 3VYRB 1WETA 2VDJA 5JCJD 2RDMA 1Y9JA 2VP3A 3BICA 5IVKA 2XEDA 4KGVA 3AL3A 4CXMA 1VJ1A 1L9KA 2WFZA 5DN9A 4D6PA 4LBZA 4U9UA 4EW1A 2W37A 2VF7A 4NEHB 3TUIC 3BA6A 3PUJA 5HF9A 2YZ7A 1RABA 2YXEA 4KLCA 1HETA 2IYWA 1ZK1A 2RB5A 2RJ3A 2WU1A 4KX3A 3RTEA 4EMSA 1DX9A 1RWXA 2JEOA 3E18A 5HUJA 3WMEA 4BZXA 1E99A 1SU8A 5DYIA 3QPBA 4MQBA 1KEVA 3MUOA 4AS1A 3SU8A 1V3VA 3FFWA 1KEZA 1N8NA 2JZNA 2OK7A 1NJFA 4ZO6A 4YT4A 1M5UA 5K8VA 2GHTA 1H5NA 1P1JA 2B83A 2BFPA 3MMNA 3GCWA 4OHVA 4R3WA 1VSVA 5T4EA 1FTWA 2HX1A 4RD0A 1Y7HA 1V3TA 1ZCAA 4IHJB 3NHZA 2GLTA 4MQEB 3T95A 4DG5A 2BM0A 3KOMA 2A4MA 4DQVA 4UFOA 1NBAA 2OCYC 4TWBA 1THGA 4MEAA 1GGJA 4WVLA 5DBOA 4CLDA 2VQFB 3W5CA 1JDTA 1LNQA 5MF6A 4NEGA 1P4SA 1EU1A 1NE7A 1GIAA 3H4TA 1CP2A 4TXHA 1GY8A 1NI5A 2CYAA 3CF4A 4ROTA 2A9KA 4IY1A 1H6DA 4FUTA 2NZJA 4GPD1 2P91A 4FZJA 3EVEA 4PONA 1M75A 3GWZA 2I71A 4JEMA 4JBWA 2ADOA 4QXMA 5IWCA 3SOZA 3TLMA 3DZ8A 4B84A 3BBLA 2J9FB 2RGRA 3BWCA 1A96A 2QLBA 1A77A 1MIOB 3W5IA 1K6XA 3WBJA 3PEWA 4BZZA 2O8DB 3D3EA 1GAWA 1VB3A 3PK0A 3HMQA 5EHXA 3AVWA 2X2EA 3WFJA 2IF2A 1C3XA 1BSVA 1XN4A 4GMHA 4HFJA 3BWEA 5ITZB 3AGQA 5K0CA 2GZ2A 1F0KA 5FQNA 4B3TB 4YXWA 1G6Q1 2LWIA 4IOKA 3T1QA 4TKUB 3V3KA 1T1JA 3KQVA 1POXA 1Z25A 3OM9A 1DT5A 1QGUB 3L7JA 3T1OA 3N8NA 4UMFA 4M54A 5KJ6A 5LOVA 4B8YA 4KQ2A 1Z17A 4HP8A 1LLDA 1XELA 5FADA 4B3RB 1NPTO 2OR3A 4E2WA 1J9ZA 1D4FA 2JI8A 3DD1A 4TWZA 3TQFA 4OUKX 4CKCB 3OQVA 3UGJA 2J9XB 4FMDF 2AR7A 2O3QA 2X0RA 2XE6A 3ZHQA 3L0YA 3AOEC 1CEQA 4M9SA 4Q3LA 2ZYDA 1HH4A 4MA5A 5B58T 2HHJA 2WTUA 1Z5WA 4FZ5A 4LMBA 2APJA 1I01A 5BQ3A 1XMVA 2VUSA 3KVVA 1DAPA 2E55A 2G1AA 4H7JA 1U81A 4MRPA 4OV6B 3ZHSA 3O94A 4WY2A 5JAPA 3AM4A 4LDJA 3L8GA 2N1BA 2HK8A 3M5CA 2ODPA 1EHYA 4HGPA 2B1QA 2Q5LA 4OXQA 2WHYA 4WOJA 4BQRA 3WX0A 1VHTA 1PZFA 3ROQA 2ZUDA 2ZITA 2A84A 2VJPA 2L19A 4HB2A 1W36D 4NCXA 3MAGA 3L7CA 4RD6A 121PA 1WMDA 4OKNA 3TZCA 3MRXA 1DXYA 2QB5A 3VPCA 3FNEA 1CULC 3EISA 4WNYA 2YDXA 1QVWA 5EKXA 4A0GA 3N8HA 1OWMA 4F2WA 2UYOA 3NATA 3OPXA 4QT4A 1DKRA 4B6GA 3VU9B 1V35A 2XKAA 2FUG1 4DHWA 5JISA 2WAXA 2ZYAA 4IHKA 4UNIA 4NENB 1NL3A 5A2GA 4DUZB 1X2BA 2BFEA 2DPHA 4NBUA 4JC8A 1BH2A 3JPYA 1PJRA 3IHKA 5AVZA 4NS4A 1DIHA 2PK3A 4J2OA 1G8FA 3EF1A 2BM1A 1IBMB 3NHJA 4CGZA 4K5QA 3REQB 3K70C 3BXHA 1UANA 1E4VA 1QTNA 3PFGA 3I2FA 3Q9UA 1ZK4A 2G9NA 4BJ1A 2BM9A 4BO9A 4QG7A 5LR6A 1OC2A 3GLHE 3OWXA 1UKVY 2OECA 3VPXA 2GEVA 5G3ZA 4MLDA 4DDUA 1XIVA 1R6DA 3DOOA 3IDQA 1ISIA 5ALIA 5DYTA 1GEGA 2R1UA 4YDSA 4BTLA 1OXSC 4WL0A 2QP3A 3ELDA 4IFEA 4N1AA 2XDQB 2QX6A 3ZJ4A 1JI3A 3UMFA 1WB5A 3H1AA 2BHNA 4GE3A 4JGBA 3WHLA 4XWOA 3TTWA 3TD6A 3OC0A 4AG5A 1YR2A 4F3TA 3IQXA 1N2ZA 2ZYHA 4CETA 2FW0A 1CE8B 2HY7A 4ZCIA 2O8CB 2ZYUX 2AOTA 4IGIA 3DZDA 1NP7A 3TZQA 3AH8A 1JMVA 2EQBA 3AM5A 1Z07A 3BTSA 5SV2A 1TT5A 2PKQP 5EUBA 1UBJS 3BFPA 3NWJA 4U2FA 3SBDA 5C1PA 1DNPA 1T3TA 1XEFA 2D1YA 4LJ6A 4LEIA 2W6OA 3VR4A 4AX8A 3LDFA 2R8RA 2JHFA 4J07A 2V9CA 3BRSA 1TIKA 2DBRA 5EPUA 3P0IA 5JBQA 1SC3A 3RV3A 5T4BA 3SYKA 2OCAA 4KX5A 1K7YA 3L7BA 1RZVA 1UMDA 4EI9A 4OU5A 5DHPA 2VH2A 2VHJA 5CR9A 1D03A 2PKXA 3U0BA 4W1PA 3N0WA 3U13A 4TXNA 4B2LA 4EQ6A 2AXPA 3IP9A 4Y1EA 4DEXA 1MR3F 4ER5A 1FK8A 4TV9B 3B1XA 4BNLA 1VECA 3BSSA 3KQYA 2Z6UA 3H1EA 2J6IA 2ZUFA 4E31A 1E5VA 1DBVO 3PPYA 4JJFA 4ALKA 3IVAA 1SJ9A 4BNWA 5E3HA 4AI6A 1RXYA 1Z2NX 4OYYA 1RKVA 4Q48A 1H85A 5DCYA 5F3RA 3GLQA 2ZIFA 3HNOA 8MHTA 3V4LA 4CWAA 5T4FA 4NDZA 1TAHA 1E60A 2CLEB 3CH4B 3D1JA 4LGCA 2I4NA 4BFTA 2I6QA 3DULA 4DSZA 2Q8PA 3IP8A 4OOEA 4R0MA 1YFKA 5EKUA 2X19A 3FMOB 2DJIA 3RE1A 3T5GA 4KQKA 3HABA 3QFRA 4CMEC 1JDVA 1AHIA 4GRIA 4LAFA 4PY2A 4TSFD 4IZHA 2GARA 4OHUA 5GOZA 4OB8A 5JHHB 5CVTA 1EA5A 3EZYA 4BVLA 2O2JA 2ZBUA 3PCXA 1KAQA 3IOYA 3MJSA 3PHJA 4MVJI 4XIJA 4M88A 5P8WA 2GXQA 1K5GA 4FZRA 3ITNA 4HNHA 2ZRJA 1M8PA 1XDBA 2ZCVA 3E5MA 2AOVA 1FJ2A 4P4GA 3QELB 4XTRA 1DUVG 1HURA 1W44A 2OKCA 4MUJA 5EXDA 1CBUA 4B34A 4PTZA 1ORHA 4EMTA 5JAQA 3AR4A 3NHWA 1FW6A 1U9IC 2OXFA 4ZZ1A 3FPJA 2DETA 2RCNA 2WJWA 4L0QA 2C07A 4RA6B 4PC6A 3ZCQA 4UARA 5LP6A 5JSKA 4DJFC 1SQ6A 3WDLA 1A4IA 4QYMA 4B3FX 5HIKA 1XQ6A 2ZXUA 3K9BA 5TQ0A 3QVLA 4HXFB 1QH9A 2PKWA 1ORTA 5EG5A 4BNFA 2IBSA 4DZTA 1E3QA 3ABOB 1ESZA 1Y80A 1E2IA 1EUCA 2BTQA 5EUCA 2X4IA 1PJ4A 1NDHA 4XQEA 3PR1A 2SCUB 2V7UA 2A9QA 2PX2A 1ULHA 1W5BA 1YONA 5CFMA 1JECA 3OP4A 1YDMA 4J91A 4J0FA 1Y5RA 2QPLA 1IHPA 4IIHA 1O6ZA 3CISA 3I04A 1V6CA 4MS3B 3VOTA 4EQ6B 1D9XA 1U5AA 1QP8A 3JQ8B 1ATZA 1NJGA 4PS0A 1FEZA 1EP3B 1FFSA 3HDGA 4IF4A 3TCXB 1N5MA 3IJEB 3D2LA 1UXJA 2O2EA 4DDTA 4MUGA 4V0SA 4LG1A 1LY1A 1PSWA 2CL0X 4GKBA 4UBNA 1VIVA 4WZBE 5EAIA 3FKQA 4A2PA 3JV7A 2BF7A 2GBPA 2VDWA 5B3JA 3UYLA 5ADWA 3IPXA 4C7KA 1N5JA 2DBVO 1LPBB 4UW9A 3EVCA 4JXKA 1UBCA 3LK6A 5DWQA 4EJSB 1XE3A 5GIOE 4CG2A 2QY9A 2HK9A 1ZUIA 4PHCA 1GN8A 2PZGA 4O4IB 1PR1A 3SMQA 3MD9A 2QJFA 4ZOQI 3DE6X 2HJRA 4J0CA 4W8GA 3U7HB 4AJPA 3WLJA 1IUOA 5KSYA 3AEZA 3WLHA 3JR3A 1JMKC 3DD5A 3MMSA 1Q0LA 3NBFA 2POQX 2R6CA 5HILA 1N2IA 2WHPB 1E6CA 1TD1A 2X13A 4R6WA 3ED5A 3U1VA 1D1SA 1UIMA 2W2LA 4QATA 4EBBA 5HCNA 4ACBA 4R1TA 5A1TA 1PEAA 4Q9IA 3TR5A 3WIOA 4M1WA 4NLLA 4D3SA 1T6NA 2JAOA 2SKDA 2P1DA 3EIUA 2PIDA 2WVAA 4A6EA 1E69A 1CSEE 3FFBA 4BTEA 4Z4QA 3TQSA 1A69A 4HRVA 2MYTA 3O8DA 1A27A 2RCYA 5F2NA 1A9OA 2J9YB 2YXLA 3GLHB 3U61B 4N39A 1TAQA 1VJ5A 2C31A 4JEUA 5D6NA 1Z2OX 5H4HA 4YECA 4G23A 5ERYA 2VEOA 4EP1A 1JEQB 1CQZA 2O7RA 3DO8A 1FMJA 1TTHA 3QOFA 4JNKA 4KWCA 5EQFA 5FNZA 3MNFA 1CIVA 1VE5A 1G8PA 1K4MA 2PLNA 2AD1A 3LHIA 2FRDA 1NW4A 5DHAA 4DCGA 1J56A 4TS4A 1I7LA 4P7FA 1NQOA 3LWZA 1HM5A 5E4JA 2NUPA 5G1NA 3SNKA 5H0IA 2P6OA 3FOWA 3I4CA 5JHGB 1C0EA 3DMRA 2OTCA 1U4NA 2HSJA 3RLFA 4F2DA 3TF5A 1M6VA 2W6CX 3F9CA