4KL8S

High-resolution structure of anaerobically purified dm. baculatum [nifese]-hydrogenase after crystallization under air
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
279
structure length
279
Chain Sequence
AKKAPVIWVQGQGCTGCSVSLLNAVHPRIKEILLDVISLEFHPTVMASEGEMALAHMYEIAEKFNGNFFLLVEGAIPTAKEGRYCIVGETLDAKGHHHEVTMMELIRDLAPKSLATVAVGTCSAYGGIPAAEGNVTGSKSVRDFFADEKIEKLLVNVPGCPPHPDWMVGTLVAAWSHVLNPTEHPLPELDDDGRPLLFFGDNIHENCPYLDKYDNSEFAETFTKPGCKAELGCKGPSTYADCAKRRWNNGINWCVENAVCIGCVEPDFPDGKSPFYVAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Periplasmic [NiFeSe] hydrogenase small subunit
publication title Structural foundations for the O2 resistance of Desulfomicrobium baculatum [NiFeSe]-hydrogenase.
pubmed doi rcsb
total genus 85
structure length 279
sequence length 279
chains with identical sequence T
ec nomenclature ec 1.12.99.6: Hydrogenase (acceptor).
pdb deposition date 2013-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
S PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 4kl8S01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 4kl8S02
3CUSA 3AYXB 4U9HS 4UCXA 3RGWS 2FRVA 4KN9S 1FRFS 4U9IS 3USCS 1YQ9A 4UQLA 1UBTS 1FRVA 3ZE7A 2WPNA 5JSKA 4UCQA 4UD6A 1YQWA 4KO4S 1WUHS 4KO2S 4URHA 1WULS 4IUCS 1CC1S 3ZE9A 1WUIS 4UE6A 3ZE8A 5JSHA 4UEWA 1UBOS 3ZE6A 1UBRS 5A4MS 3UQYS 4OMFG 3USES 1UBKS 3H3XA 5A4IS 1WUJS 5JRDS 5ADUS 1E3DA 1UBLS 4UPEA 5JSYA 4KO3S 3MYRA 4UEQA 1UBJS 1YRQA 4UD2A 4UCWA 3ZEAA 4UE3S 3AYZB 1WUKS 4UE2A 5JSUA 1UBMS 1H2RS 4KO1S 4TTTS 4CI0B 5A4FS 5D51S 4IUBS 4C3OB 4IUDS 4KL8S 4UQPA 1UBHS 4UPVA 3CURA 1H2AS 5JT1A 1UBUS 4GD3Q
chains in the Genus database with same CATH superfamily
1JHYA 1N2CB 2DLDA 4M86A 4DMKA 2IS1A 1IN7A 2VJBA 1E8NA 1NHWA 2AKAB 3MCWA 4FI3C 2OAQ1 2GBCA 4WQMA 4XWKA 3AI2A 4G8DA 4Q3EA 3VTKA 1VPEA 3RM3A 2VF5X 5IUNC 4CEHB 1SHJA 3QVXA 4CG3A 4MX8A 2O9JA 3ETLA 2XWQA 1BS1A 4YJHB 2D00A 2HRQA 1PR3A 3OPVA 4QG7A 3I6QA 3HB9A 4R9VA 5F4ZA 5HDQA 4B31A 2Z3ZA 3C8DA 1WXGA 1WVIA 2QVYX 2H9IA 1KYQA 3CT6A 3H17A 3K5PA 3NNDA 3RASA 5TR9A 1Q16A 1Z8FA 2AUNA 2O7QA 4QU5A 3WGVA 2PSEA 3ZU3A 2VCEA 4BNXA 1H69A 4POOA 1ZO8A 2P4EA 1JSZA 1DAKA 4O5AA 1DFGA 2J31A 4IHJA 1M8KA 2FY8A 4OXKA 5IN5A 3SKYA 2ZWAA 3VHXA 4NS1A 4M1QA 5JSZA 1Q3KA 1DAPA 4DG8A 4E5YA 2XGJA 1HYEA 1Q57A 3DD5A 5J1TB 2R6ZA 3MOGA 2VP6A 1MO5A 4UVEA 2H59A 1XKXA 4L4UA 3B6MA 2JEZA 1Q74A 2QU7A 3OKAA 3QU5A 4K9RA 3WWPA 4DQXA 2JG3A 1M0SA 3H2SA 4ZOLB 5LCXA 3TK1A 1MG0A 2P0AA 3W2HA 4C76A 3P9IA 1SBNE 2VZ9A 1VLHA 2B9VA 2Q7XA 2RBKA 3FHJA 2ZROA 1BYUA 1FDOA 2J3EA 5EE0A 3U1VA 3VYVA 4KXFB 1MC1A 5G3YA 2QLLA 3ORRA 4ZHQB 5AW3A 5EXEA 1KERA 2O6HA 2RG1A 3JQ9C 4R8LA 5E6UA 3VNAA 1JXAA 1ZK4A 3T7KA 4ZI2A 1R4NA 2VQEB 4IO1A 2NXJA 1LDNA 3OZFA 3LSYA 5JMOA 1I7NA 3EZ2A 2MSEB 2HMTA 2BONA 1F48A 3MWEA 3ZCRA 3THWB 1U99A 4MTCA 3NBYC 1SU8A 3LQ2A 3STUA 3NMUF 3K0EA 4BKQA 4DT1B 4Z54A 1ZUWA 1RLUA 1ZN7A 4H1WA 2Q27A 4M0KA 5AW5A 3IILA 3GXOA 2F00A 4DIMA 5CDFA 4YP5A 4HNAB 3TSWA 2BI7A 3ZBQA 3IUJA 1SZPA 1U7TA 3L5KA 1M6NA 4HRXA 4KK4A 4YXWA 2E85A 3STTA 1T1IA 4Y2PA 5I7OA 2YJ5A 1WPXA 3HLKA 4HF7A 2V0NA 5B7PA 2H9AA 4GM4A 3ENZA 3D59A 4QDJA 5I7HA 1KI6B 1A9XA 1JQ3A 1QZXA 4WN3A 4ZZ3A 3FHOA 2WKRA 5TEWA 5A03A 4MWSA 4WOCA 3TEFA 1RMYA 1C3OB 1N9ZA 4GR4A 3TPFA 4EL5A 4UPDA 1SG0A 4J4TA 4FNMA 1JX6A 2A78A 2O50A 2PTGA 4EUKA 4OH1A 1Y7PA 2JLZA 2QZ4A 3TKAA 3KKQA 3PE6A 3QEOA 2LW7A 3KK0A 1TTPB 2ZJ2A 2DJIA 4MJLA 1SUDA 4N0DA 4NX2A 4UAUA 5AW8A 2V3CC 2GKSA 2V5UA 1RYDA 1ZJ4A 3COYA 4ZREA 1AKQA 4ZYWA 2IYUA 5AM3A 4GGOA 4YECA 4FDVA 3JQGB 2O8CB 3FRIA 4WKGA 5KYNA 3GLGB 1RYBA 1VKRA 3WL7A 2B6NA 3ZKWB 4EATA 1OBCA 4EFMA 4QC2A 4IBOA 2PYIA 3W0LB 3ZUGA 1AQJA 1NV8A 3C6QA 4ZXFA 5BQPA 3I6MA 2Z1DA 3TVYA 3WP1B 1MOQA 2H3EA 2O4UX 1A5ZA 2QLTA 3O7WA 5AK0A 3VYRB 5KSPA 4UDYX 3OFJA 2BLLA 4ZAYA 2D1SA 4N65A 5FOXA 3AO0B 2WSSA 4E1AA 5K0CA 2E5LB 1XZQA 1H94A 1TRKA 3ED1A 3LDFA 3TI9A 4XARA 1JHXA 2JGAA 1B0ZA 1E61A 5G0VA 3DTNA 2Y1WA 3HJCA 1M7HA 5A5FA 1D07A 3KXLA 4D0LB 2HPZA 2I80A 3QKRB 4CYMA 3SK0A 1EUDA 1EUZA 1GR1A 1OX4A 2HF8A 2JZNA 2Y1FA 3OCXA 4M8LA 1RMTA 5ALXA 3FHLA 5AOCA 3SAJA 4YRRA 4LEIA 1XN1A 1IXRC 1WEKA 6AT1A 3ITNA 1XPRA 2B5WA 1BCSA 4OXRA 1BKDR 1KDYA 1ZEMA 1E66A 3JAWA 1BVYF 1JHUA 1ONPA 3AERA 3M5PA 1VFPA 4IDFA 5CDYA 1Q1AA 4J9VA 3QEBZ 2VBFA 4YK7A 1C1XB 2IYWA 4CCAA 3D8BA 5GGYA 1JEJA 4PHHA 2YR0A 1ZNZA 3R5KA 3U9LA 1T9AA 3CHYA 3KTAA 3HVJA 1S9HA 2C5EA 1R0KA 2YICA 4KXUA 1YTLA 2R1TB 4HQKA 3KSBC 1QMGA 3MAAC 4QVGA 4JYCA 3PP8A 3JSAA 4KNWA 4GBED 3R7LA 3SZMA 4CUJA 3T5AA 2K7FA 1LFAA 4DCJA 2A2ZA 2J0VA 4L22A 4GYJA 2QN9A 4KSCA 2QUKA 3RTCA 3V8QA 2Z6QA 1Y8RA 2QZJA 4JZKA 3K1AA 1C7FA 2OKCA 5EKTA 3KLMX 4LRSB 1P1CA 4PSAA 2FZWA 3VOTA 2AEEA 1J00A 1IOWA 4EPVA 2XKKA 2NIPA 4IQFA 4WKPA 5FWAA 4OHYA 3L0SA 3W5VA 2V6MA 1SQ6A 2H18A 2DPYA 2YL2A 1ESZA 1SHTX 1VPTA 2EG5A 3O94A 4HQLA 5C53B 3TMYA 2Q9BA 2G9ZA 3BXGA 4H6VA 1LRJA 1AGRA 1L5RA 2FEOA 2OQIA 3GPIA 3NB0A 5FR1A 3TB6A 4U7WA 4DARA 2GCNA 1UKCA 1A8HA 1X0XA 1E79A 3ETJA 3OKFA 4GGPA 3PHLA 3ZK9A 2FEMA 3GEBA 4NOMA 3DBRA 1UMBA 2BIFA 3V34A 3WRXC 1A8SA 1SCUA 3E9NA 3I1IA 4JJAA 1XD2B 4C3ZA 4DIEA 4CCSA 4RKRA 1V45E 4GP7A 1YUMA 4LQCA 3RSFA 3SVLA 1VZ3A 1YV9A 4GWLA 4V0NA 3CLHA 4L08A 3IV9A 3ZGZA 2Y1DA 1JLMA 3ZOZA 1C4WA 2V7QA 3GJTA 1ZVVA 2K2WA 3PRKE 1CR2A 3R23A 3QVMA 4WKCA 2BH2A 4M7OA 1JEQB 5EE3A 5BV7A 3IT3A 4MQFA 1FC0A 3O95A 1PJQA 3VJLA 1UT5A 4Q3CA 2H0AA 4DNQA 4TX1A 3R76A 3EAFA 4WY2A 3VU1A 4HFRA 2IE0A 2RK3A 4MEAA 4DRXB 4PG8A 3RS2A 2DFVA 3A3YA 4QUEA 1KMQA 2OHGA 4L8YA 2KMLA 4XFDA 1N6NA 1U9YA 4TQAA 3L40A 1MNQA 3DD1A 9ATCA 4QTTB 2VDNB 4W5HA 4F6RB 3D6MA 3FKQA 3UAOA 4MA4A 2Y1OA 5DHQA 1J7JA 2FR8C 3UATA 4A36A 2JLUA 4IFBA 1O9GA 1WX1A 3F5DA 1Q83A 2WM9B 1QVRA 2FFQA 3AVVA 2GN0A 2ZIEA 3INGA 3N2ZB 2VSFA 5CHEA 4LNUB 1YVEI 4DVGA 2IEBA 3KZ1E 1H9CA 2P2ZA 4P4SA 5FAXA 4KG7A 4LUCA 4E13A 2QZSA 5LSAA 2C3YA 5GV8A 4KXXA 1GQRA 1SOAA 4KPUB 1BVUA 3WO0A 4A91A 2PVSA 4MYCA 2D2IA 2DQZA 1R88A 2C1EA 2ORYA 3PQ4A 4M22A 1T8UA 2TRSB 2C84A 4EA6A 5HQTA 3NT5A 2PX6A 1UKAA 4F72A 5KPJA 3QBVA 4M7PA 4TSFD 4P83A 1IZYA 1Z13A 1RWOA 1Y3CE 4F38A 1YDHA 5BUCA 1LPPA 2YYAA 3PXXA 4YCAA 5K09A 1XZ8A 2WJJA 4G5SA 1JH8A 1F38A 3ENQA 3FUXA 3PITA 1COWA 4KQFA 4C4SA 5HJ5A 4LYYA 1JQKA 4KIUA 4M9ZA 3PT9A 3EC7A 3WDMA 4GECA 5JJBA 2N0SA 3BOSA 2P91A 1PHPA 3LUPA 4KMMA 3LOQA 5K6AC 2HJ9A 2WT4A 4X7PA 3Q3HA 1UJ2A 2V7TA 2ZU0C 4GL4A 3ZDAA 3UK1A 3O4FA 4PG6A 5KOHA 3FDXA 2H2HA 1ZU5A 3IP6A 5EWMA 4Q9NA 1XPOA 1RPJA 3AM4A 3A14A 2O6LA 5BV2P 3EPRA 4L4YA 3QPAA 4W7IA 2QK4A 1VA4A 1JFFA 1VJDA 3G5TA 4XOUA 5HIKA 1Q2UA 1ENOA 1LSJA 2KM1A 5IARA 1Y33E 3WGTA 4E09A 2BCEA 4C4RA 3UOWA 4JJIA 1DQSA 4L9WA 5JSFA 5EEGA 2P2CA 2WHYA 4MGKR 4QOGA 1OX5A 4I50F 4Y9SA 3EXG1 4F84A 1UJMA 3HJAA 1FX0A 3KRTA 2P67A 2A94A 2NADA 4OTZA 1X15A 3SNKA 1DPGA 4QGSA 5MHTA 1PS8A 1KH2A 1USKA 1X38A 1YONA 2RARA 3LFHA 4V2UA 1R0LA 4NENA 1CUWA 3HBAA 3Q72A 2PGAA 1TU4A 3A27A 1P4AA 4GC5A 5TXGA 4DA0A 4U7GA 4ZJZA 3CYFA 3MEQA 3WBBA 3F9IA 5FJIA 4HH4A 3CRMA 4MLCA 2Q1YA 2RE8A 5JDCC 4K8RB 5SICE 4JI3B 1ISSA 4IDAA 1DU4A 1VBFA 1EJ0A 4K6OA 4RHUA 3R7WA 5E4FA 1DBPA 1PWHA 2YWJA 1Z36A 2VDWA 3Q7EA 1N7JA 5JVDB 3STYA 4B46A 5BN3A 2QDKA 4FFVA 3O1JC 3OPMA 4KX5A 4GMDA 1IEXA 2O23A 4NMLA 1CUJA 1G2QA 1U3TA 2C77A 3IKVA 3QENA 1QAMA 1BX1A 4KMOA 1OVMA 1W8IA 4Q16A 1I2BA 1KZ9A 4IV8A 4DAOA 3VNUA 4Q5IA 1QLJA 4NS4A 4NBUA 1GRVA 1EDZA 4LDQA 1G17A 4CRWB 1RPNA 1SR8A 3ADKA 3D4OA 4P32A 2R1VA 4NDNE 3GCGA 3REOA 3KSAC 1BFKA 4DCMA 1P74A 1UFRA 2DY0A 4N7RA 3J80A 4DR3B 2ZBGA 5IAEA 2B1QA 2FCAA 3JQDA 4LE0A 2JH9A 1Q17A 2QN7A 4MUIA 4QUGA 2FFBA 4N1AA 4E5MA 5JFGA 4R3NA 1HX7A 4Q7EA 4JVLA 5C5DA 3E3NA 1K8XB 2X1VA 2BDTA 3WK4A 3ROZA 1QGUB 3U7JA 3CVUA 2EOAA 1VIVA 2J09A 3DP9A 1MJHA 3ND7A 2PZGA 4OAOA 1RZUA 4HDNB 3WWDA 4DQDA 5LYJB 1L5NA 4AM8A 5DM1A 3HNOA 3EIFA 3DF9A 4ZDWA 5KO2A 1EX6A 1UJNA 4M38A 3MTQA 4FPXA 4TGLA 4WK2B 1YJAA 4ZOAA 2ZUTA 1K3FA 4PGHA 3A58B 1DWQA 4R68A 3QLVC 4YP0A 3H3FA 1IL0A 5U9CA 5CCBA 5BT9A 1EVEA 4H31A 4QJIA 1X8LA 3DHNA 3KZXA 4EKDA 2PUDA 1WZEA 1NA5A 3M2TA 3WNCA 4EX7A 3SQWA 1I24A 4X1KB 1VYUA 1OUMA 3EBPA 1V6CA 1KZ6A 1M1UA 1RPTA 4FOPA 1UK8A 5T7BA 4EGCB 4WVFA 5HM8A 4HNGA 4Q39A 4RS4A 1SXQA 1ML4A 1ADBA 3TQQA 4P81A 3VH4A 4A4DA 4JBLA 4DTCA 1V6SA 4CKCB 5CXUA 1TD9A 4CEIA 4KN5A 5BQXA 2V7BA 3GMIA 1O6BA 1EG7A 1T0BA 1W85A 4P98A 6NULA 1G59A 1HSZA 3HMKA 1ETUA 1SBTA 2WMOB 4O4HF 4Q3BA 4G0NA 5B64A 3VSCA 1JIKA 2FUG6 4FI3F 2AK2A 4FE4A 2AC4A 4K1LA 4YCSA 1YHNA 3SS8A 2HA3A 3AX6A 4LY6A 1ODLA 1MZVA 2XCLA 5FRDA 4LV5B 5A3SA 1FMTA 3DZHA 4C4ZA 3AHDA 1C4OA 1WZNA 2PQ2A 3HA5A 3VFDA 3B3GA 4HQNA 3V1TC 3KR0A 1S1CA 3JQCA 4FIDA 4FX5A 3OC6A 5B7GA 5K3OA 3BDIA 3GRRA 4OQMA 3MJRA 4LC1A 2A6PA 1YS9A 4EHKA 1U5AA 4WNIA 1M8JA 1IZZA 2CVQA 3AZPA 1SCKA 4JX9A 3KT8A 4XYEA 4HZIA 3OH8A 1Z8NA 4L51A 3AUUA 2P62A 5KYXB 5K7SA 4D8TA 1G21A 4RDCA 4X64B 2CHGA 1TA4A 4AJOA 4EM6A 2CDRA 2WKWA 2YH2A 4HPJB 3LQFA 3C7DB 2XYQA 1J5EB 2YS6A 3GEDA 5BWNA 3DNMA 1BEUB 4KE6A 2WKQA 2OFWA 3EEIA 3UMRA 5KTMA 3HRHA 1XCOA 3NWEA 2I76A 4J49A 3DPSA 2G6BA 4M1TA 1MTOA 5AJHA 2F4NA 4MP8A 1X70A 5BV1A 1Q0SA 2P3QA 2I3ZA 1PQWA 2YYYA 1L4YA 4A0HA 4KPGA 3AI3A 3K0CA 4G0QA 4L8WB 3A4LA 1KR5A 3T9CA 4YMLA 2QT9A 4NVRA 1ZINA 2AL7A 2GM9A 4MQBA 4G0VA 4RVDA 1EFHA 2OZLB 3H2GA 2XUDA 1Y6ZA 1XZJA 1GUFA 5IJ0B 1BNCA 2HREA 3HEAA 3JAKB 2Q0SA 1CIVA 821PA 3BMQA 4G3XA 5IBRA 4E1BA 1V1RA 3V6MA 4DZTA 1ABEA 1EUCB 1P2SA 2H2AA 1P4GA 5AHWA 4ZV7A 6PFKA 1VHQA 1G3MA 3I12A 5A4FS 2WMDA 6LDHA 2OCPA 3N2IA 4C22A 3TJRA 2PVCA 1UINA 1OYOA 1YKSA 4GMXA 5BV8A 2AJTA 2VDVE 4HZGA 5F7ZA 3WL8A 2CEAA 2DFTA 1UP7A 3OJEA 4P22A 4FEEA 2IL1A 3KQKA 1WP9A 3HFRA 2CFOA 3AJ9A 2ONCA 2REQA 3A6DA 3FMIA 2NGRA 3NIDB 3NBUA 2R1UA 1XPUA 3O26A 2IP4A 2Z57A 3L6CA 1JL3A 1K7EB 5BWCA 3H42B 4NOJA 3E70C 3GJYA 3QPCA 2ZB4A 2VH1A 3I62A 3LPAA 2Z8XA 1BXZA 2EERA 4RHXA 5H83A 4NXMB 2FZLA 1D03A 3RPEA 1XNQB 2OV6A 2Z5LA 5HK8A 4Y2XA 2F3PA 4ZAXA 2AYZA 2BRUC 4KO4S 4KXVA 5LMCA 2V7PA 4JCCA 2Q3LA 4YP6A 4N18A 3D4IA 4CMKA 2DULA 1OILA 5BWOA 3X1JA 3B7WA 3IB6A 4QTXA 3DE6X 1HY3A 1KFBB 3L8FA 1M66A 3HPRA 5ERXA 4X00A 1P0CA 2ZJ6A 3U3DA 3IERA 4IOKA 3IAM6 2IUEA 5A06A 1RXEA 1TRHA 3O8DA 1J22A 2H17A 3PNKA 1T9CA 2AMFA 1SC6A 4HN2A 4E2XA 1GPAA 2YY5A 4FDLA 2QUJA 4DJTA 1OT5A 2B2NA 2GVNA 1MIOA 2OBLA 2WU4A 4PC3A 4J76A 1Z9BA 5DU2A 5HPYB 1ZD8A 4K3VA 5I47A 2G9QA 2OQRA 4EYOA 2JLVA 3IJRA 2OGWA 4ACBA 1HNWB 5K8UA 3MRVA 4YTEA 3S2SA 4CMIB 3L7CA 5AHXA 4JJEA 4BVKA 1Z0FA 3QHPA 4QTZA 4TSFA 4O6VA 3L0IB 4CR8A 1TUBB 2AE1A 5F21A 1FA9A 2VHTA 4D92A 5H3LA 4GAEA 3BMCA 5I45A 1XZLA 1W0KD 2OC9A 3QHAA 5TJHA 4D56A 4UHBA 4DIBA 5IN4A 4RTPA 3NDBB 1F0PA 4NFYA 1QGOA 1DAOA 2N3ZA 2WIKA 5EJ8A 2JAUA 1RWPA 5JRJA 4OGLA 2UUPA 1IU9A 5DTEA 3DYBA 5DASA 3ZXYA 3MAJA 4Z3KA 3PGA1 1ZA2A 3DEYX 3EZNA 1VYVA 4G07A 1GGHA 2GD6A 2AEJA 3EXHB 4I9HA 1ODFA 4GEKA 4JDUA 5F1KA 1PFVA 3CR8A 4FWBA 1C5KA 3T3EA 3VX3A 5J47A 1UDCA 2UVPB 4DPLA 1R0YA 2WIGA 1EFCA 2G7MC 4QOJA 3DBOB 1YZTA 1FFXB 4I9GA 4BEBA 1GU0A 3N2NA 4RGQA 2Y3IA 3SR0A 2F4VB 1M2WA 1EFUA 1NJSA 3KTDA 3ZGOA 3HKBA 2BMFA 4O8ZA 1Z62A 1QHFA 3RS5A 3NIFB 5JXGA 4GXRA 1N78A 3IGFA 1NG1A 5JWRA 1TQHA 4OXYA 4XYLA 1JFVA 1DZ3A 1SKBA 3W05A 1EX1A 1LQUA 1YOVA 4TLEA 4UEOA 1RQPA 2AUMA 3D43A 4MB2A 5A04A 1IXKA 1N2CE 5EXDA 2HK7A 1KFCB 3QWAA 5EPEA 1RE0A 1QKJA 2FF5A 3G23A 1CR6A 1IIBA 4DIDA 4NTZA 4YONB 1E7YA 1V2HE 3N8IA 4V1CI 2ZJ8A 4B75A 4PZPA 2QD3A 2WVHA 4UBLA 4N6GA 2CMGA 2AMLA 3C70A 3MIZA 1INLA 1NQ5A 4NU5A 1WUYA 4J29A 4IZ6A 4DXDA 2VT6A 1FL9A 4YCDA 3QK7A 1VHLA 2JJ2D 4Q0MA 5DK6A 3K9NA 4OLFA 2O2DA 3LQQA 1UKVY 4YQZA 5IJXA 1K7SN 2JJYA 4RV5A 4B9EA 3FYUB 4NJMA 2D8AA 4GXQA 2N47A 1KWGA 1EESA 3RKRA 2J07A 1DAIA 3OO0A 4JLWA 2WU0A 4MS1B 3Q1LA 3R75A 4DV4B 3HP4A 1KYYA 1WUHS 2BEVB 4WUTA 3T7DA 5BVHA 2NV0A 4PSVA 4Z3DA 2P75A 2OHJA 5HILA 3O9VA 2J9YB 3LFUA 4JS0A 3IMGA 4Y2VA 3P32A 5IEJA 1XRQA 3P9RA 1JI3A 2IDKA 2B5VA 4GUDA 2BT4A 3NWJA 1A04A 1HO3A 1CRQA 3ABRB 3EAGA 4PX2A 5E2AA 3HDJA 3UNXA 4QODA 5ERYA 1YA6A 3R3VA 2XJ9A 4LVCA 4TMFA 3RIGA 4JNKA 3IIKA 3E6AA 2PXXA 3ACDA 1Y81A 3B12A 3EIXA 4RV4A 5I5EA 2WUVA 4GDFA 3CH6A 5G02A 3DZ8A 2ACVA 1JHQA 4BCDA 1BRMA 1K6JA 1RRGA 2XI4A 3HUDA 2JBWA 3ROQA 3LDHA 4G8BA 4HDSA 4NAUA 4ASUD 4XW2A 2JRCA 4HB3A 3AOEC 2GD0A 1TTQB 2HRCA 4OMFG 3UY4A 3WWCA 2FDXA 1JHMA 2PDAA 2E89A 3A37A 4QXPA 1PR4A 3HYRA 4FYIA 5K5EA 1H1LB 2VWHA 3D2AA 2OFFA 2Q6LA 3HXQA 1PIWA 1I33A 2WSMA 4WW0A 2NZXA 4C2AA 4QQRA 1VMIA 1JPJA 2BDEA 1NZDA 1WXQA 2GWHA 4UQOA 1I32A 3VXKA 4QYTA 2VBCA 1A2OA 4E08A 3NBQA 3B3QA 1DB3A 1FJHA 3FPEA 3GCZA 1KK3A 3FAZA 3MD9A 4JYZA 5E7JA 4U9UA 1A9SA 3OTOB 1MCZA 1M2HA 1IHXA 1G8PA 1USIA 5F35A 3C5EA 3RR2A 1T3LA 1CZKA 1WCIA 2JHFA 2EX4A 2WFLB 4IRUB 3DFMA 1IEVA 1PCXA 4MYUA 3P0EA 2QYHA 3LF2A 2ODQA 4Z0PA 5KYYB 3SYNA 2FR1A 2P5UA 5DW3A 3AB3A 2PMDA 1U2GA 1YRWA 3MA0A 2HL6A 2ZRJA 5IM4F 2YWHA 5BNWA 4CCYA 1LI5A 2E5FA 4F3TA 1Y3IA 3RBXA 2Q5JA 3QSYA 1ZQ1A 4BGIA 2QTGA 4MW7A 5AESA 3HYTA 5K8LA 3MUOA 3ONFA 4UXIA 2CDBA 4JBNA 1ZR4A 2W37A 5CK5A 4TQUS 3RIYA 3Q2OA 5JBQA 2NT3A 3UFXB 4DDUA 3KAPA 1F2DA 1WMAA 3V8EA 1YDGA 3ORFA 4EHJA 2JI8A 1XTVA 4ZFNA 4ENTA 2FK7A 3ZHUA 4C3OB 3DHWC 4YGYA 3UMSA 1M0TA 3OAAD 1UMDA 2G70A 4Z0TA 4AULA 2HJGA 3M3PA 3U3RA 5AMXA 4DF3A 3DKIA 5TF0A 5GM1A 1O5IA 2FSVC 1M34B 1SKMA 2VJYA 4LIPD 3KQTA 3CVXA 1FQWA 2I6GA 4OHOA 4MKFA 3ZK8A 4FP9A 4K8OA 3VH1A 1HFWA 1DC4A 2CDNA 2DTXA 4TVBA 4PYJA 4Y30A 4YLYA 1RNLA 2ISQA 4BP1A 3WJ7A 2D6FA 4I1PA 6REQA 1J8QA 1NNUA 5A9TA 3LWNA 4CKZA 5FWDA 2QMUA 2UU9B 2J3LA 2ZSAA 3TLMA 3K92A 4TTPA 4B3DA 3GLFB 2H5LA 4QDTA 3MW8A 1YRBA 1UEJA 3TDMA 2WQ6A 2IVZA 1SXJC 4X20A 4H9GA 5GJVC 3WIUA 3LP6A 1TAHA 3EXEB 4G37A 4NYMR 4QEDA 2FSUA 2FXIA 3PD0A 1O96A 4JOBA 3GLIB 1ODTC 4X5OA 3L6EA 2A9QA 1CHDA 2GF9A 2I5PO 2CXNA 4ZRNA 4ZA2A 1DFHA 3IIMA 5KNDH 5JTUA 4JLOA 3OQIA 4DB4A 4O4LA 1VE5A 2DH5A 4DSAA 3I83A 5CIYA 1RYNA 3ZJVA 4WL0A 1TGVA 5D3KA 2XX3A 4U2KA 4ZI7B 3WNBA 1XNRB 1TD1A 2ZWVA 1KJ8A 3PICA 4EZEA 1W2HA 3GG2A 2OQVA 1CZLA 1Z0UA 2FPPB 2QQFA 4GR5A 1NMEA 2OCBA 3OLQA 4NBVA 4CLRB 5KYWB 1UAGA 1Y9DA 3TLZA 2MSLA 3HJUA 3P4XA 3BSFA 1R5OA 2C4NA 3BGWA 3WGGA 3ZN2A 3W34A 3FCUB 4BKPA 4PRZA 4BO7A 4HAWA 3I8OA 1O97C 3CR7A 3C85A 3GJ4A 4L3VA 3VU9B 3GCXA 1U0HC 4N3BA 2O3RA 2JLWA 4PC2A 1L5WA 2XPCA 2JD2A 1R16A 4F11A 3G0IA 3CCFA 3IEUA 2C78A 4JKOA 3TEJA 1WUJS 1C0KA 2HNBA 5DSTA 3CF0A 3L7BA 3T54A 1B2LA 5IKEA 1IZ9A 3FUVA 4DA8A 3D7KA 4AJPA 2GS9A 2AFHA 3PWTA 3KWJA 1H4TA 5F3RA 2YWXA 4UEQA 3ZXUB 5C7LO 2FV8A 3MJCA 1N1GA 4U7FA 3R9XB 1AT1A 1VL6A 5A9RA 1RQ7A 4IGIA 2R8BA 4YCNA 5K3EA 1SKYB 1GZDA 1UIRA 1NW3A 4I8IA 1FW8A 1TCCA 2NNLD 2DEUA 4AJ2A 3PSAA 2I4MA 1I1HA 1F6WA 4IP0A 2MCFA 2Y92A 2BSXA 2DWQA 4A0RA 1SEVA 5JAZA 1FIUA 3GLUA 3RANA 3AW8A 5MN4A 4PLZA 2VJMB 4G1MB 3W04A 3OKPA 3UBMA 2HWKA 2WLSA 1HR0B 1ORVA 4GXTA 3JYOA 4P2BA 1NVBA 2QTHA 1P39A 1W0KA 5GONF 1F8UA 2AJCA 3HXMA 1SBIA 2FB9A 3D4LA 3OLVA 4B6SA 1TUEA 3P7MA 4PLYA 3DAHA 2CMKA 5ES3A 1DBVO 4ID9A 2GZSA 2QF7A 2P1RA 2KLHA 3NFRA 1RLJA 2VDOB 1WB5A 5PGMA 2D7DA 3W9UA 1UBHS 3AHJA 4QPCA 3GT7A 4IJKA 1K5PA 3E1SA 3G0HA 4HZUA 1XT6A 3LBYA 3SYLA 3DZIA 3V9AA 2OV4A 4FNOA 3IDOA 4KEAA 1R1DA 1W47A 1Y4ZA 1XALA 3B2QA 4KUHA 5DYYA 1EGHA 3QVLA 3ZDDA 2A84A 2WG2A 3GI1A 1ZLYA 4UVHA 5TE9A 5KTYA 4RGVA 2BFCA 5ICSA 4QHYA 3RHZA 1VRVA 4PPFA 3ROPA 1QYVA 2PQ6A 2WWTA 1GNSA 1R0CA 2VS1A 4E51A 1FRVA 3BH6A 5KNCD 3FVQA 3KQVA 3OCJA 1F3LA 3AEUA 4XKJA 2X42A 3IDSA 4HAZA 5BXQC 3O92A 3EPHA 4P7FA 1ND5A 3FSEA 3H8JA 2M6KA 1Y3FE 4O2AB 3GNQA 3L4KA 1GQOA 1TK2A 2A9FA 4QBIA 4CEHA 4FB4A 1ISJA 4D1YA 2O8EB 1UT8A 2ASVA 1P1HA 4GVPA 2RGRA 1E9BA 3OPXA 2GXUA 2NVUA 3REGA 4ZGGA 2Y6UA 3CX7A 4BMCA 1Q1EA 2FKAA 3RLIA 5HVNA 5JPDA 2CWWA 1EFDN 3QFHA 4YT4A 1XMPA 2YHBA 1L8XA 2JJ2A 3FUUA 1ZMXA 1MR3F 3LT5A 4KTVE 4B7UA 3RFCA 3KV1A 3HBMA 5BY2A 3HHEA 1F9AA 1Z47A 3JQAB 1E7WA 2B8WA 2A5FA 4A0GA 5LQNA 2QM0A 3GGGA 1WMDA 4E07A 3O84A 1Q3TA 1V6AA 4XQCA 5B30A 3PE4A 3W3ZB 2C4TA 4NXNB 1Q1NA 4OU5A 2O8BB 5KWJA 1QHHA 3K8QA 4OHXA 4C88A 3RRJA 2VUSA 3KL2A 3L6OO 1HK7A 1VG9B 4ZOLA 4AF6A 5FUXA 1IXYA 2J67A 4N7MA 4PINA 1E0DA 2HLNA 5BV0A 3RYCA 1AMNA 4RZIA 1TB4A 5CNMA 3HZZA 2F8SA 2KX7A 4DLTA 2VVTA 2OK8A 1HQYE 5CG2A 3NP7A 4TYYA 4WHMA 1RBQA 1M75A 3GFQA 3UMCA 3CVVA 3CXRA 4Q01A 2IUTA 4IFTA 2PMFA 1CK4A 4XVRA 4HVLA 4OB8A 4ASUA 2F9FA 2WBLC 3MINB 2PIDA 3KL4A 3THWA 2DLNA 3BRCA 5CHYA 3SIWA 4HUQB 1R4ZA 2WJHA 3WC4A 2G08A 3R4CA 4DT1A 5F5XA 1U4NA 3EULA 3PLNA 4M9QA 5E3IA 3EW7A 2B82A 2WJGA 3TUJC 4DUZB 3IDFA 3TUIC 4JOQA 1K6IA 4HNAA 3RF6A 4QOIA 1D5WA 3LRXA 4QEKA 1N0HA 1WR8A 4RO0A 2AJDA 3T7EA 2XUGA 3EA5A 1SPXA 1U5CA 5A3JA 3CF4G 3ZTWA 3JD2A 3WYAA 1IBCA 4HB2A 1XTSA 1YC5A 1JH9A 2FQ1A 3SQOA 5CD9A 1D6NA 2IYRA 4KL8S 5LXTA 2GI4A 2ZIXA 1JR3D 3UJDA 2DPHA 3N8HA 4IL5A 5BR8B 1SXPA 3U40A 1KFEB 4QRDA 1CFZA 5HIIA 2C2GA 3L9XA 1DAMA 2GTPA 2Q21A 4TXJA 5IMSA 3KQYA 2WUFA 1M9NA 3V8RA 2QW1A 1W1UA 5C7YA 2M1XA 4PTYA 4IG9A 4FYJA 4A82A 2QX9A 3TGPA 5K6RA 3A2LA 5GOTA 2P9FA 4EGFA 4K6GA 4PLVA 4PRYA 2OY0A 3QNMA 3OPYB 4M1EA 1CG6A 2QNBA 4MMXB 1UBTS 3JQGA 1VP3A 3T9DA 1YDEA 5E0OA 3GLGA 2O8CA 3F6EX 3WQRA 3ZKWA 1Z5WA 2JASA 2UZ4A 3GMTA 4O1MA 4I19A 1AC5A 3EQZA 3V00A 5JASA 2C7BA 5J5AA 4X97A 1O1YA 3TQSA 2MMCA 3H0KA 1E4EB 3OAAA 3RRFA 3O8OB 1AS2A 3S1SA 2O2IA 4B1FA 4EF4A 1HZJA 2BFMA 3LLSA 4ISCA 3AI7A 5I8ZA 3W9BA 2BFWA 1TM3E 4UU1A 2IV3A 3F96A 2PGNA 4DCGA 5AQ1A 4XTCS 1UOPA 3AL2A 1DKMA 1E64A 5DNAA 4WEQA 3VSAA 3OE1A 4DWWA 2BBSA 3S8YA 4KIWA 4QUKA 3HJTA 4ZCIA 2C99A 3QKRA 4R2LA 3ZJ4A 1GFZA 1A3CA 3HKCB 4XCQA 5CJPA 5IJAA 4HT3B 2IHKA 1JG4A 4B2LA 3FVRA 2FPRA 4NEQA 3LPCA 5JAUA 1D3AA 1HI9A 5A05A 2ADFA 1I94B 3VNSA 5EJ2A 4MR7B 2V4MA 3D8RA 2WKPA 2ZRBA 4C7VA 2NPIA 1IHPA 2CBXA 2G09A 2UV8A 3PC7A 4TSKA 2XMRA 3E9QA 3TOCA 4K3UA 4PSDA 4K9LA 1XG5A 2W6QA 5AJZA 1V11A 1L4LA 1XCBA 1ZUNB 3GFVA 3LC2O 1L7VC 4Q4DA 3K9LA 1FVXA 3HN7A 4HLNA 4F8JA 1CYEA 1QGAA 2G1UA 3BL8A 1IHYA 2R1TA 3DEJA 3I45A 5EP1A 2W58A 1K08A 3KXKA 1B6RA 3VC3A 3I9KA 2O2GA 2WHXA 1XMSA 4ICIA 1L4BA 4Y2GA 3QFRA 3STVA 4H0NA 2P6PA 2XLCA 3QWBA 4BP3A 4BQFA 1NXXA 5T6BA 4BV3A 3E9YA 3FNRA 1HKUA 1SHLA 1TPYA 2C3PA 2PX4A 4JQOA 5EIFA 3L4SO 3F5FA 1CB7A 1GTL1 4D99A 3EPJA 1X1AA 3G2OA 2UYOA 2EBFX 3WOVA 2GK6A 3QEKA 4OHUA 3KSRA 4FQ8A 4NICA 5JQGB 5EJ6A 2Q2QA 2RD2A 1UZNA 1V9LA 3AUAA 4A0FA 2NSHA 3ANLA 4P86A 2VL7A 4IOLA 3UUWA 2PZBA 3PQCA 1NQOA 4OK3A 4HAUA 1O95D 1SCBA 1A69A 1MEEA 1IWBB 4NG4A 1LTKA 3X2SA 2NUPA 2PSSA 3ZY4A 3QUQA 5JADA 2XCRB 4HEA1 4H7JA 3PWSA 3L2OB 3RWMB 4Z6KA 2Z2XA 3UHOA 4OBEA 1TMGE 5TNXA 2QLMA 3FPKA 1IBRA 1X8JA 4MWGA 2LP4Y 3GZTB 5LMUB 2IS6A 3PYLA 1JEQA 3WLEA 3MGBA 3E22B 1R50A 3K0FA 4YMHA 1WOYA 1RI4A 2IW3A 2C2WA 4ZWNA 1JN0A 421PA 2JFXA 1NRWA 4XTRA 5EE1A 2AEFA 2GF2A 4DRXA 4XFJA 2CUZA 4Z2AA 2LD4A 4F2PA 3KBOA 5AJVB 1K8YB 1Z4OA 2DCMA 1W1WA 4F6RA 2H9YA 2YMQA 5JXIA 3L49A 3WGUA 4J0CA 4OMDA 1UKBA 4BFSA 3TG2A 1E62A 5HBRA 1XJWA 4MAAA 1OMOA 4OHMA 1LF5A 3HABA 3WYEA 3VDRA 4WLNA 1YZKA 5EZ6B 4LNUA 2P41A 3FPGA 4I99A 1E3WB 4XGNA 5CYGA 1V8ZA 1NW6A 1P17A 1T4CB 1W9HA 3BMOA 3ISJA 1ESEA 3KUDA 1U0SY 3M3HA 1OFGA 1P4JA 3GHHA 3HM2A 3MZ0A 3DMFA 4ECAA 4OMUA 1EGQA 4Y1EA 4W1RA 5LBUA 1X94A 1PVVA 1RAGA 4BQNA 1RM0A 3A7EA 2PMCA 5J23A 3CJQA 4JODA 2OL4A 3LTNC 1Z2CA 4M37A 1I4WA 1W88A 2FN7A 3N58A 5BOSB 1MLDA 5BW6B 5IVKA 3AY3A 1SHKA 2LIPA 3NCTA 5D85A 5KNCA 3TM4A 3LLVA 3FRJA 3OZ7A 4JUIA 1DC6A 3N0WA 1KEZA 1Q77A 4PIMA 4RETA 3USES 4LYHA 3V4ZA 4GMKA 5KUTA 2QR5A 3N7AA 4BFWA 1F60A 1E3QA 2HBRA 2RHRA 4NWIA 5JJCA 1II9A 1UM9A 2Y1CA 3D3EA 3KR1A 1CJBA 4FM9A 4B0PA 1NUPA 4EI7A 5ADUS 1TA9A 3PFIA 4BQQA 3EOZA 5I7WA 1GV0A 1SUIA 1XF1A 2NZWA 4F2GA 3NETA 3OFVA 5BVGB 3QA3E 4ND8B 5HW0A 4RXMA 1GT91 1OLUA 3I5UA 2WJZB 2PGLA 4UOZA 1RQ2A 4ZDIA 1UPCA 3M4YA 4NZYA 4HP8A 4BTEA 3F3KA 2CE2X 1L1RA 1B6GA 3UAXA 2YVAA 3RC3A 2H65A 2RGDA 3CIOA 3GD7A 3OZVA 4KQWA 3A05A 3X1KA 2R6FA 3B7GA 4YX9A 5I4KA 2UXDB 1CEYA 4MUXA 4FC7A 1XRMA 1R8YA 2MYNA 1XA0A 4H0FA 1X13A 1F5SA 2Q6IA 1SVWA 5FB3A 3EEBA 1HBJA 2OOSA 3I6IA 3BFVA 1VBNA 4PZDA 3ORQA 5TVGA 4AFNA 3KVNA 4ZQFA 5JCPA 3UAYA 4CEJB 3MAGA 3AYZB 3OJ0A 4FFMA 1TA0A 5AK3A 1RTKA 1UF9A 3H13A 3IODA 4PX5A 1M2EA 1U7OA 1Y9JA 1G60A 2FUCA 3UH0A 5M2QA 3ZZMA 5SY6A 2FPMA 3PHJA 4JNCA 4ZN6A 4IINA 4RHEA 2CVFA 1OH5A 4AF7A 3Q2KA 3RABA 3C3PA 2VIIA 2PL1A 1OGIA 3QV1A 1L3IA 1R0RE 2WWWA 4L5AA 3TB4A 5A9SB 4DBLE 4DV1B 4TV9A 1V4BA 1EJ6A 4ZVTA 1JMYA 3OIWA 1H4SA 2XMQA 3AIMA 3PZBA 4Q4JA 1M1NA 2X2EA 3EYAA 1QKIA 4GKAA 4IEIA 2VSNA 1G7TA 3UJ7A 1GG9A 4XI9A 1DDGA 2H7CA 4JR2A 3CRNA 3L9WA 4WBNA 4B33A 3CTMA 2VTBB 5IAOA 1YMVA 5CFLA 1NLMA 2TSYB 1KDZA 2QL5A 1Z33A 1B23P 3O8CA 4LYAA 1J6UA 2VJPA 4Z9XA 4XLLA 4M83A 4RMNA 2P4QA 4EQ6A 2E9SA 1YCFA 2Y1XA 3EQ7A 3JYNA 4OUKX 2GILA 3O8BA 3WA6A 4YACA 5JNWA 2O20A 2VBGA 2VUIB 1S3GA 4EYGA 4GSLA 1QYRA 1GZ6A 4QUBA 1DQNA 2HJSA 4FFPA 5ITWA 4DB2A 1M2KA 2CXSA 3FAKA 2JBAA 5KQLA 1JR3A 2X4DA 2X6RA 2AKYA 3P0IA 3OT1B 5EKDA 2RJNA 4O08A 1Y82A 4D6XA 4Q7MB 2P69A 1C2YA 3PEUA 4HAIA 4XX0A 2BP7A 5CIWA 3QE4A 3IQEA 4R1NA 1ODJA 3CH5A 5CPBA 2QMZA 5G1PA 3CA8A 1UBOS 2OP1A 4W5OA 1FUYB 1SQGA 1T2VA 4JVSB 1GFWA 1E5QA 1U8CB 4DA4A 4A0SA 1ICIA 4X41A 3C3JA 1KYWA 1NR1A 2J33A 3WNQA 3WXBA 3G79A 3ZGXA 1C50A 1YZQA 2Q3HA 4H4CA 3ZLUA 1XL0A 1BCRB 3JD0A 5I9NA 1NWHA 5C4GB 5JC1A 1IQ0A 5EWLB 1UJ4A 3WHLA 4PN7A 4AY2A 4CG1A 1E9DA 4MLPA 2WTBA 3NDJA 4PR3A 2RKBA 4IILA 4QXMA 4C08A 2WTXA 5C1DA 2BWJA 5FFMA 3HKEB 4MCHA 4N76A 4RE6A 4EA7A 4ILEA 4J75A 4URWR 4RQTA 3AHGA 3KSUA 5FBLB 5IT0A 1HC7A 1XZAA 2B0CA 1RYEA 1E6EA 2YDYA 2YZ2A 3CUTA 3MCVA 4FFBB 3KT3A 4RD1A 2JJ1D 4RFVA 1YS1X 1FDIA 2J6BA 3BREA 4K26A 5IVDA 4RPHA 3FPLA 3UT0A 3Q5EA 2PLWA 5GMOA 1PW5A 4HG2A 1QP0A 3AM3A 4KKXB 1EP9A 3V1UA 4MKXA 4N03A 1Z15A 1CQIA 1SIWA 4NULA 4QOHA 5F7XA 4F96A 2C61A 3BICA 2WDPA 4YJ2B 3DE4X 4XVCA 3W2IA 4EW2A 4JK3A 3AVOA 3PRJA 3CVYA 3VOSA 5L51A 4QPZA 1OAKA 5CITA 1E1CB 2OT3B 3DWGA 3O8RA 3K9FC 3BHNA 2YN4A 1FFSA 3NVMB 4FONA 4FR5A 3EGCA 3HDTA 1POXA 4QPDA 2H1OA 3N2EA 1S8AA 4FZVA 2NO6A 4B32A 1OXUA 5LM3A 1M34E 2UYHA 5BUZA 3L41A 4U4AA 2JA1A 4MUNA 3RCBA 4Z4GA 5ADVA 4EUHA 3JWPA 2X77A 4LS3A 4GX1A 3T7CA 3B70A 3EBLA 4ZD6A 2ZUEA 2Y66A 1L1EA 1ZIPA 1FVFA 2AHOA 2OZLA 5K99A 4NCJA 2VO1A 1Z7YA 1XXHB 3BCSA 3EASA 4M76B 4D5GA 3L93A 2PS1A 2VXBA 4IJUA 1W4BA 3PC8A 1OKKD 2XCQA 3H4VA 2GZ3A 2EFHB 3VI3B 1I6MA 4YB8A 1EUCA 4IR7A 1K4YA 5CX4A 5B3JC 5AM4A 1ZVMA 4YCBA 4K6CA 2ZTMA 3Q8MA 5JZBA 2R8EA 3E2IA 4Q3DA 5MDHA 3GLIE 1PFWA 1T43A 3AY7A 3AYXB 4Y6GB 3ZXSA 5KWEA 1U3GA 2QRJA 2FWPA 1G8HA 1S96A 2QRMA 4LZOA 4RWZA 1XZMA 1KZ1A 1Z16A 2O54A 4PO1A 1U3VA 1T2UA 4M0MA 4BV9A 2HMWA 3TMAA 2IBSA 1O95A 1H8HD 2BH9A 1MH9A 1DELA 4G4GA 3QVOA 1Q0HA 3QPVA 5KJFA 2QTVB 1K27A 3GPDG 4JQZA 4DUGD 1YQWA 2OMKA 5IZCC 1OWOA 3FZEA 3NONA 4RA6A 4BGUA 1U31A 2A35A 1X8XA 3A9SA 3A1EA 2Z2JA 2MSWA 2X9GA 4UULA 4EKIA 4AO8A 1NPDA 4XB2A 2F3QA 3NTQA 3I6YA 3L6DA 4QQ8A 2XF8A 4C29A 2POQX 3MHPA 4RY8A 1HE8B 1R0BA 1YIDA 4RABA 3O0DA 3D3JA 4IX9A 4RF5A 4A26A 3HV2A 3OICA 4B3FX 4IXWA 1Q0TA 4LJRA 3CNLA 1JPUA 2QJRA 3DAPA 3LUHA 4C7MA 1T26A 1UBRS 3LWBA 3OEYA 3DQPA 3M49A 2AZMA 1BX0A 2IEZA 5CFOA 3IDQA 2BY4A 4KDEA 3LZDA 1ZXXA 5AVTA 3TFQA 1X7ZB 1J2UA 3O7MA 4D9FA 4AJKA 1YI1A 3LX8A 1Z6ZA 1SULA 2NO7A 2J0EA 2Q4TA 2YWBA 3I2KA 4WLEA 4JEMA 4F1KA 1K8QA 3MSXA 3QGMA 4FS3A 4YAEA 3UUEA 5BMOA 1K7XB 3AK4A 1P7PA 3EIEA 3LDUA 4IDPA 2B5OA 1GSIA 3ABSB 5TQJA 3PNVA 2QMHA 3RARA 2ZSIA 3O31A 1NHGA 1WQ4A 1DIBA 1XHLA 3DE1X 4YRQA 3SFTA 3TI7A 3WFIA 3H97A 2YFYA 1PSWA 3GOHA 3QP9A 4EI8A 1XTIA 5LLSA 1ECJA 2ZRPA 3QE0A 4ZVUA 2RHMA 1G7SA 1DDOA 4Q1BA 2C00A 2FGJA 2Q8PA 1EBUA 1TUBA 1DRUA 4JC5A 3TTXA 3DYVA 3FNHA 3OQ1A 3UMGA 4FLMA 2FHPA 2QSYA 1NYQA 4LECA 4PG7A 3WZ2A 5JD4A 4OQXA 2W98A 4AUMA 3MTDA 2I22A 5EHIA 3HLYA 2C83A 3DFUA 4DMFA 2NU6B 1A71A 5J4HA 1K2VN 4FHFA 4WNAA 3S3TA 2BGJA 4QLAA 1WCWA 3FMPB 4I9FA 1BQ4A 2QUZA 1ORIA 4COOA 2W70A 1TMYA 1GGNA 4LGVA 2G72A 2J5BA 3EXHA 3LCRA 4BFLA 4MI1A 2OHIA 2FPIB 2ZIWB 2QAIA 4R98A 3CM0A 3OEWA 2UVPA 5DHPA 4NKRA 3PSHA 4DIOA 5JSUA 4JOCA 1FFXA 1UJ5A 2WT8A 2UZ0A 3CMCO 4BYMA 5I51A 2UXCB 2IS4A 2ID7A 1WPRA 2XA1A 4FZRA 1JE0A 2DBYA 4GU5A 3R74A 1ZDMA 3I9V6 4XR9A 1DCFA 3ANXA 3HDYA 2IPAB 5AW4A 2EEZA 2Q41A 1GXSB 1QQ5A 1TYAE 4ITRC 2V9PA 4LWPA 2HSWA 1HG0A 3HB7A 4OKSA 4YMWA 4KQ2A 4BNNA 3QTTA 3VJRA 3ERCA 3TTWA 3RVNA 3WAJA 3H1BA 2ZRIA 4B3TB 4IDQA 5A5GA 2X22A 1EWRA 1SU7A 1HE4A 1CEEA 1WO8A 4KRGA 1K66A 4B85A 4RU1A 2GDJA 1FJXA 2YJ4A 4G6ZA 1NIJA 4MARA 2YNMD 1W5AA 2ESRA 4KUEA 4QYMA 4B79A 1D1SA 2COKA 5HTKA 3V4RA 3FNGA 3P0JA 4HN4B 5GWXA 3L4EA 4BZXA 4ZV4A 1KOGA 2IXTA 1RR6A 3K1JA 4Y1GA 2BZ0A 3CRVA 4IF6A 2R5NA 1AS3A 1X1CA 3A6LA 1BDJA 2IX9A 4J0KA 1KZGB 4W8HA 1I14A 1PJZA 3VA7A 1QIJA 1GQFA 2WWVD 3PR3A 5AM2A 5LWHA 2VT3A 5KSOA 1X7YB 1JAZA 2XECA 3U6BA 2HNAA 5GINE 2DXIA 3QBEA 5B4UA 2XUQA 5L4NA 1XUOA 2R4UA 4NZZA 4G01B 1QF7A 3JQAD 2J32A 2PZLA 3CPSA 5F33A 5HJEA 1TKBA 1X2BA 3KHKA 2O19A 3Q0EA 3GLRA 4HMQA 3IVCA 1JWAB 1QTIA 3CLUD 2Q0XA 1MVNA 4G81A 4DCSA 1EFAA 4MS1A 2NTNA 2AOUB 3WGZA 2Q4OA 1WAMA 3AJEA 3IELA 3WO1A 3PX7A 1XDBA 2CFCA 1FDUA 1CQZA 4YPVA 3Q7PA 4MV1A 1XAJA 2C04A 4PGFA 4NIMA 4Z7NB 1HSOA 4FMPA 4L6AA 4PPYA 3WSWA 1YRLA 1IEQA 4ETWA 2Q6KA 1PR1A 1RCFA 2E4WA 1NTRA 3SJCA 3NWPA 3L02A 5CRIA 4ZGWA 2G4LA 3D0RA 3GAAA 2IOHA 3R3XA 4XLZA 5CLJA 4RH0A 3RVMA 2BFDB 1LWOA 3FOWA 1QUEA 3LL7A 1P62B 1UQTA 1IEWA 3S7TA 3V1NA 1NQUA 1NF3A 2BM1A 2J9FA 3CTPA 1RYYA 2YHIB 3IYLW 4TYPA 5JZMA 5BR1A 2PPLA 1YJQA 1OJ7A 5L45A 3NNSA 3R6DA 4EHIA 4MYRA 3CZPA 4FBGA 2JI9A 5DYTA 1EP3B 5FPSA 3U9SA 3C1OA 1JT9A 3RO7A 3D02A 1ZVKA 4DCPA 1TJYA 2JCSA 5HWSA 4U8GA 3AJ8A 1J0DA 3E1GA 5HQ3B 2P40A 1N9GA 1YZVA 2NTEA 4YBZA 1BE0A 1RIIA 1SAYA 2DERA 1KTVA 3EQ6A 3OSZA 2ZZKA 3BWVA 4BB5A 1Q0RA 4ZZ0A 5BMVB 4RZSA 3ZEIA 5MFZA 1MDBA 4YMVA 1Y4AE 2I9PA 4FEGA 5AHOA 5DDIP 5KBYA 3EH1A 3G85A 3I3SR 4FWTA 2OCGA 1NYTA 4KLZA 3VPXA 5JATA 4EP1A 4MV3A 4QEZA 5GZ1A 1SXGA 2JW5A 1BKSB 3NYIA 1YHYA 1XZDA 4HRVA 1XTTA 3O2SB 1QDEA 4II2A 3CLKA 2IHZA 1E9RA 3PFCA 4U2CA 3RQSA 1G8KA 3LLCA 1BGXT 1JHZA 4UUMA 5KYYA 1PJBA 4PFQA 4ZVLA 3BXHA 4RKFA 1NBHA 3T1HB 2JVJA 3JZIA 3T1QA 2JJ1A 2PL5A 3AFHA 5K0NA 1YL6A 2OV2A 3OUZA 3WYCA 2V7UA 4J6FA 2E6KA 1WTAA 4P8RA 3I2FA 1V16A 2V9ZA 3UCEA 4CF7A 4TXNA 1MB4A 4X62B 4P4NA 5IAJA 3P2MA 1JDVA 3KQLA 4WCDA 3PNMA 2VSQA 5IVIA 3EHEA 3SDSA 4F4UA 5JS8A 3EQ2A 1QIKA 3N7TA 1KNQA 4X63A 3SNHA 1T2FA 2RH4A 3I05A 4BX9A 1GARA 4M54A 4W9RA 4WACA 4Y2JA 3KFXA 2Q9AA 4Z3OA 3FIUA 4PR0A 4MHTA 3V1KA 1KK2A 1SBHA 3WWOA 2FSSA 3BFJA 5HRUA 1R74A 2Q49A 1KDOA 2H31A 4DL9A 4MWEA 5EJIA 1RHRA 4MKRA 4AU1A 4DWVA 2XNCA 1QV7A 3OI7A 4OX9B 1TKCA 1Z6TA 3PLRA 2BI8A 4G0YA 4LVOA 4V0ME 5DEOA 3Q3GE 1P60A 1CUBA 1XZPA 3D3KA 3NNNA 2UYQA 3AP2A 3LGAA 4TXLA 3S2UA 4F3YA 3S44A 1T8PA 2QI9C 4UVIA 1ORWA 3GLFA 3PL5A 4HYQA 1KYTA 4MKZA 3DAGA 5LUAA 4DR2B 1MJNA 1OKKA 3UGKA 4F4HA 3EXEA 3TLJA 4AS2A 3JU3A 1EFLA 5LQRA 4UEWA 3DFZA 1XJ5A 1G8YA 5BSRA 3RHTA 4BNZA 4G1CA 3M1YA 1ZRSA 3RK1A 2X0EA 5I3CA 1KHHA 4QZVA 3FPSA 4G25A 621PA 1JLRA 5FHRA 2ODEA 3I2IA 2C0PA 3G5UA 2ZJBA 4M8NE 3IA2A 3DLPX 4IZHA 1ZZEA 2HXGA 1P7YA 3A36A 3CNBA 1BXKA 1LW6E 2CVOA 5AK4A 1H8HA 5DWQA 4ZI7A 2QL7A 3FTCA 4I08A 1D2GA 2WD9A 1DKPA 4AJ4A 4D9BA 3OQBA 2GBIA 2W4QA 3T34A 1A9TA 4BRWA 1II0A 4DCVA 1NJ1A 4DUGA 2FPPA 4QX6A 4MZXA 1S02A 3HVUA 4B3JA 2GFQA 3WNDA 1NBIA 4EMSA 1KSGA 2JFNA 4CQJA 2JGNA 4P5DA 1S7GA 1A82A 4C3UA 5T4FA 2P8JA 4PFSA 2XZTA 4J07A 4L0CA 3S27A 2Z2KA 3TW0A 4OY3A 1GQYA 4DNFA 2CD9A 2ZRCA 4EA9A 5ALVA 2NG1A 2B21A 3SPXA 1ITZA 1RHKA 3RYFB 3TG8A 3ZWXA 3R8CA 4IHJF 2VTEA 1L4UA 1GQSA 4EKGA 3HHPA 5J59A 4U00A 4XRRA 1T24A 5EMNA 3GUYA 5LQJA 3THXB 5LJLA 2PRJA 1UBJS 1V26A 2ZJFA 4A8TA 2CDAA 5CFNA 4O5OA 4OFWA 1MT0A 2PWPA 4LMRA 5BSVA 3X1MA 3RHFA 3OMWA 2RHGB 2O7RA 5E9WA 3RK0A 4KIGA 3TS1A 3DUWA 4QYSA 3L6UA 3WLHA 3PFGA 4WA7A 1OH6A 3OSUA 3R9XA 2V7EA 5A2GA 4S04A 2Q4BA 1KQ3A 1Z18A 2AR0A 5AM1A 2F8MA 4CKXA 5JXHA 2W6OA 4F4IA 1PUXA 1TU0A 4XFKA 4V02A 3E61A 1HEUA 1MU0A 2JGFA 2YWFA 4MWZA 2ODTX 4A3SA 5KX5B 4PEVA 4X66B 4XSHA 2IC5A 1J90A 2VJMA 3W2GA 4AJIA 3TZQA 3OG9A 4WCFC 4G5OA 4NHEA 4OI2A 4OQZA 4QU0A 1FZQA 3LCMA 3DGFC 4ZANA 2BUAA 1GGJA 5T6MA 2PRYA 1DSSG 3A6GA 4R71A 1R4AA 2B8JA 4F5WA 3HUFA 4I4NA 3LWZA 3A6ZA 4QUHA 1YR3A 1P45A 1ODCA 4LJSA 5EGNA 4B6PA 3N2KA 1JAIA 1K4KA 4KITB 2QMYA 4N4AA 2V97A 3GF4A 4Y6SA 3RU7A 3AR2A 1U2DA 4R0NA 3HV0A 4C07A 4CMJA 1AKEA 1X86B 2DPXA 2YXLA 3OOJA 4YJ3B 3ZVLA 2AC2A 2H4WA 3TOXA 2ZCUA 1ONBA 4BMDA 3S5UA 5IJ9B 3BJMA 5CH5A 2B83A 1GGFA 2IEYA 3M81A 5T3UA 2J3JA 1T13A 4BASA 1M8GA 3ZE7A 3CPJB 3ZHXA 3ZOKA 2TMDA 1THZA 2IZZA 4JJ8A 2OAP1 3G13A 1XVTA 4LHEA 4OXNA 1XRRA 4Q1VA 1JU3A 1JVNA 2B35A 4XDHA 1RABA 1VLJA 3TJMA 1P75A 3HCCA 1N8TA 4BO2A 3EZYA 1H2XA 1YH3A 3ODPA 2ZYWX 3TH5A 4FEAA 2PBRA 4YUYA 3ZE9A 1JALA 1VMKA 2ZETA 3TRIA 4D4KA 4FJ1A 3IE2A 1VSBA 3WNVA 3JQEA 4TXHA 3CSUA 3BXOA 4PC7A 3OHSX 2LXNA 3SF8A 1Y3DE 2NW6A 2PX0A 1NY5A 2YNMA 3AFGA 2IHUA 3BAZA 1IIRA 3SU8A 1CQJB 3TCNA 4BTVA 3N3BC 3IL2A 1ZRMA 5CJJA 2V8BA 3RAEC 2O8EA 3X1YA 1OLXA 2AV6A 1AE1A 2XGSA 5DLPA 3VTZA 1J09A 1VXOA 2GB4A 2GSWA 5EA2A 4KWHA 1L9KA 5FTLA 1WCXA 3VUFA 1FVHA 1PX2A 2I7CA 2X13A 4A8HA 3RFFA 1D1TA 3BULA 4UU7A 3F7OA 5IT5A 3N1UA 4TMTA 4WJZA 4W99A 5J5VA 2FPGA 3JQAA 3N05A 4DKXA 2YJ6A 4ZEOA 3SLRA 5DM4A 1DC3A 3Q7SA 2PX2A 3HB5X 3VTAA 4ATNA 2W8BA 3QKSB 4EG6A 2IV7A 4UTVA 4KI7A 1VE6A 1ZRNA 2P4HX 4RJLA 5DNCA 1TQ2A 2C2XA 1IPHA 4AIIA 2J48A 3FFTA 3PKJA 4R69A 4YFVA 1M74A 2PR2A 2VEOA 2Y1EA 1I1QB 1MA3A 1JUDA 1Y6JA 1G6HA 2DWOA 1L7RA 4YMUA 1RXSA 2C54A 2GK7A 2PBLA 3IIIA 3EG9B 4YCJA 5ENVA 3S4YA 3WISA 1JKIA 3MXOA 3DO8A 1ZOPA 1GPUA 4YT2A 4WZAB 2Q29A 1QE5A 2J9ZB 4M8KA 4N0EA 2X40A 4GKVA 4HD8A 4EQZA 1JZSA 1GZUA 2PM8A 3T41A 1B2RA 3BQNB 3CSSA 4LBVA 3WKEA 1LLFA 1HLGA 1UWVA 2ATXA 4CG2A 5DTJA 4IIJB 5FT9A 2AEMA 3WGYA 1U0TA 5THQA 1GUZA 4JGBA 5JJ5A 5IPFA 5F3WB 3IPXA 1T4GA 1QO7A 1Z4IA 2OP0A 3FFBA 2BFBA 2X0IA 3BJIC 3HPQA 3IT2A 3KPWA 4XD2A 2VWQA 3UGJA 1LVUA 1E77A 2FPXA 1E2DA 3LUJA 3MINA 4MVWA 4RZQA 4II3A 4Y6PA 1OBHA 2PRZA 3I1JA 4HUQA 4RY2A 1E4OA 2MINA 4KVFA 3WX0A 1EE9A 2WAYA 2H2WA 2OZKA 5A2QA 8ABPA 4DV0B 3HUEA 1JIXA 5G4KA 1BG6A 1KY4A 1YJ8A 2OB1A 4UFPA 1UP4A 3OZWA 2DPMA 4HLUA 1K6MA 1RDFA 2IT1A 1WM1A 3FLBA 5T3YA 5TRTA 5CB4A 2QQ0A 2J9RA 5E9QA 3OLCX 2PD6A 3FIJA 5AKXA 5KYUA 1VLLA 2Q5LA 3BGVA 3M5CA 4CU5A 2XQJA 3AHHA 3JZFA 5K4AA 4KP7A 5JFOA 5A62A 3EA0A 5F2OA 2B0JA 4LOHA 4XWWA 1PZEA 1QDUA 2D8MA 3O4JA 1II8B 4CXMA 3U60B 1VJRA 3QU2A 3KQQA 1FZTA 3NHMA 4PXYA 4RF4A 4EJFA 5J2TB 1B76A 4WD3A 3CLSC 3NVDA 1LEHA 1TU3A 1QWOA 4FEYA 3PT5A 4NNPA 1EE1A 4W63A 4YWJA 1SVUA 4GPTA 1K3TA 2HA6A 1ZJJA 2QPTA 4RM3A 3C6MA 3IOBA 3MS2A 1P2TA 1CHNA 3OPYA 4LSZA 5LP6C 1JILA 1KORA 1R27A 1TW2A 3L8GA 1BJTA 1PLLA 3R6GA 1HLPA 2AQKA 2EGUA 1D0VA 3AF2A 4RVCA 4ZO7A 1EAYA 1HT3A 4G56A 2HSEA 2XZLA 1Q7BA 4LMAA 1L7QA 1VSVA 3L0CA 4PO3X 3U26A 1DLJA 1GNPA 3QM1A 1E4YA 1RHQA 3E05A 3ETDA 3ROEA 3WYFA 3VMFA 1ZS9A 2GN1A 3O2JA 1X1DA 2WM3A 4S1PA 2NYRA 1UKZA 3RJTA 4F3KA 3E7DA 3A9RA 1C9YA 1THMA 2G71A 4BNDB 4DY4A 1JQ5A 1N5JA 1P6UA 3LA8A 4R8KA 4KRFA 4LRXA 4O2BB 4UXHA 2Z56A 1RAFA 4PW0A 1D8TA 1DJLA 3ZBPA 4NV1A 3SZGA 4OJYA 3TSCA 2GTHA 3ED5A 4KGZA 3K9HA 2CZQA 4HBZA 4YMSA 4WK6A 3RBVA 2UUBB 4OSEA 5CVDA 5LJIA 3ZD9A 1LK0A 4FNGA 5SV2A 4I4LA 3QBDA 5DB4A 1I4DD 4YAOA 1OGYA 1EHIA 2XMZA 4GNKA 4UVGA 5CM8B 2IU0A 1KMNA 3AF0A 2XB9A 4KQEA 3V2HA 1Y6GA 3NHPA 2W6ZA 2YXDA 1HH4A 1S8OA 3CX6A 1H93A 5KNBH 1Z5OA 1PWYE 3LQ4A 1ZUNA 3REFA 1A4UA 1RZ3A 2CJFA 1XTQA 1YI0A 1MW9X 2XHEA 1WMBA 5COAA 4EZBA 2Q3JA 4W9MC 3CZQA 3IUPA 4H08A 1CNEA 2P9JA 3JR7A 4EF5A 2FNAA 1GAXA 5HUJA 2BF4A 4EECA 1N2OA 3ZZTA 3IIEA 1U2PA 5H16A 1XQ6A 4KR0A 1P9WA 1KOFA 1R6AA 2EZ4A 2WP0A 4NQZA 4N5MA 4HWOA 1SHUX 1NVVR 4XWAA 1DZIA 4G63A 3D6AA 4RNCA 2BFAA 3BORA 3TRDA 3GYGA 1WY7A 4QREA 3PCXA 4Q00A 2Z30A 5JPIA 4S3MA 1ONOA 4M4SA 2HIGA 3PXCX 2I03A 4RVHA 3RODA 1GPKA 3DFKA 1LRKA 4RVSA 1GU1A 3UC9A 3C6KA 1JHOA 2IQ5A 3TCKA 1AGYA 1XX6A 1GL9B 1WHTA 3I04M 4AUNA 1YMQA 3DMPA 3CZRA 1FFWA 4IHKA 4NBTA 3WBKA 2BFFB 3PJEA 4NNOA 1KDVA 3MIIA 1O6FA 2RI0A 1IONA 5BXYA 4RJKA 5E1MA 3VSBA 5K20A 1FSGA 2HJRA 1LWNA 1H2AS 2I2DA 1S3IA 1VPLA 2QX8A 2Q7DA 3OIVA 3ZDFA 2FK8A 5A3RA 1RXVA 1TC2A 3AM5A 3NHUA 1U2ZA 2O1EA 3LBIA 3FKJA 5CD1A 1WBDA 4PVDA 1Y80A 1ZN9A 2ZULA 2IHNA 3O6VA 1QQBA 1M1XB 1MJ5A 2PGXA 2W6CX 3QXHA 4M0EA 4OI1A 1D7OA 2I4TA 1KQNA 2GX6A 2EP8A 4X45A 4IDGA 2NUAB 4G86A 3ZS8A 2CJYA 3HA3A 4L95C 1LA2A 3QKTA 5DPMA 5A0FA 1R6XA 4AMYA 1ZKDA 2XDQB 3WL6A 2XXAA 3RGGA 3SFVA 1KMIY 1FE8A 3M6IA 3ZLTA 4QPPA 1G20E 2VP5A 3ITEA 3ZBTA 5JH7A 2I8AA 3AR7A 1PRYA 2E4VA 1X7XB 2D1YA 2ZAIA 2MIIA 3DP7A 4UDOA 3QFSA 5IKPA 1N6PA 2X8AA 5DP1A 4MW2A 4CM7A 1TVKA 2E37A 3RROA 2VOEA 4S0ZA 3VNRA 2VF2A 1JZTA 1RM3A 2E87A 3DZCA 1PT9A 3QXSA 3R3WA 1RBMA 3ESAA 1NKVA 3FA2A 4FJ0A 4HNSA 1KE1A 3TLEA 1P2UA 2YCLA 4WLFA 2B30A 4EJMA 3FB1A 4WY8A 4NCIA 5DLQC 2IP2A 2YZNA 2FX5A 4UBNA 1NX6A 2C2ZA 4EMBA 1NNEA 3KYJB 2X9LA 3IV6A 1T4CA 2H3HA 4MRNA 4NZMA 5DYWA 2PMKA 3G88A 2JFWA 5AKJA 3M70A 3D8SA 5EHXA 4OGKA 3UQYS 3IVXA 4NONA 2VPXA 2O57A 5FWXB 2WIFA 3KLPX 4JU9A 1CJCA 4IDNA 3BWMA 5F7OA 1V1MB 2ARKA 3C8HA 4TYMA 3KFLA 1ETHA 5EHNA 1Z4LA 3DF7A 2QI9F 5YASA 2HK9A 1R9GA 2Q2NA 4INZA 3DE0X 1KAGA 5IH3A 2SKCA 4ER7A 5BOSA 1YACA 4PLGA 4AKTA 5JD6A 5B12A 5KAMA 1H3NA 3DG9A 4FYHA 1KRHA 1DP4A 2D0PB 5CLHA 4YRSA 4GDMA 3NIWA 3GQBB 1A9OA 3EGOA 4XGRA 1WKVA 4ER6A 1XU9A 5IWCA 1UFQA 3QV2A 1E94E 4OPMA 3E7FA 1J21A 3E9CA 1Z88A 2IHYA 2VQSA 2YUTA 3PQ8A 4ENSA 2J87A 5FR2A 4A6PA 4C6HA 5A6VA 4M49A 4L9RA 2NVOA 3P9QA 2HM7A 5D5PA 5FPYA 2I1WA 4RTMA 4CTNA 5BVGA 1E8MA 5KAPA 1P9OA 3IP1A 1O7JA 1VG1A 2I78A 1QIEA 4CQMD 4N40A 4F21A 3U5TA 4H59A 1Q15A 1VE9A 4EDHA 3LPLA 3OQNA 4L9SA 1J4AA 1ZIDA 3IQZA 4ID3A 1CZUA 2PZJA 3U44B 1PDVA 4HXFB 2CL7X 3RSHA 2JLBA 1ZNWA 2UVQA 5IC5A 4JT8A 2BKEA 2ECOA 3OIUA 3PQ2A 3VPGA 4FDAA 4FSDA 2BLNA 4F06A 4KNYA 1GN9A 4EY4A 1FNSA 2J30A 2V6GA 1Z4JA 2BGUA 3PA6A 2C0QA 4AF8A 4EEKA 2JFFA 2P9QA 1IM2A 3PXBA 5EQJB 4Z5XA 4ZVOA 4IZIA 2FW1A 1ZHFA 5G0SA 3UA3A 4EUNA 1EZ4A 2VG8A 3W5HA 2G1PA 2YRWA 3ZQUA 2XJ4A 3P9ZA 9ABPA 3V46A 1T3SA 4O4JF 2XDAA 1ABFA 2IU4A 3I37X 4K03A 4O59O 1NRJB 4UBKA 3UKJA 1W36B 4EX6A 4DDVA 3M83A 2BI4A 2PPVA 1EX7A 3GJSA 4UTOA 1Q0PA 2N1MA 3ES9A 5A9SA 1ZH6A 2GVDC 2XGGA 4FDMA 4C4PA 3NC0C 4AWBA 4FOOA 3VU8A 2CJWB 1Z6QA 4C4XA 1U9IC 3A9WA 1XRJA 2NTVA 1LB1B 2E3JA 2FPSA 3DVSX 1KDPA 4DCOA 4J7AA 1GPH1 1KFJB 1ZFNA 3IVAA 5DM0A 1AV7A 1PZNA 2J5RA 1P5ZB 4UHEA 1M3SA 3WRYC 4BMNA 4MR8B 4WV3A 2GHIA 4ZT5A 5K3FB 3F8SA 3VH3A 3EDCA 1TMKA 1TUIA 3DT6A 3OZCA 4KKVA 3KOYA 5DVZA 2VTBA 2R66A 3B9BA 3H8SA 4JLSA 5JAQA 1VBMA 2QORA 2XBLA 3TTSA 4ZVRA 5D5QA 1A2BA 5IAGA 5JWHA 3V4VB 3IP8A 2OGSA 2SICE 3F9CA 4I9UA 4OSOA 5F2KA 1UC9A 4JELA 3V2IA 4NV0A 3H65A 4MYTA 4KRXA 3D9QX 3PNYA 2I91A 4QLOA 5K01A 1VI6A 2DBVO 3X43A 4UE6A 3HJGA 3K70B 1OWNA 1KVTA 1T8RA 1IAQA 1OLOA 3AUJB 1IHUA 2I7XA 3BB4A 1B8PA 3I1YA 1MGPA 2V6FA 4FDUA 1VP9A 2I2BA 3KLBA 1EFPA 3TZ6A 2GETA 1Y5NA 2R84A 5FBVB 1SUBA 4J1TC 4UXJA 2YKGA 4OQDA 3WWYA 5LD2C 1KVSA 4KC0A 2YBEA 4D96A 4HGNA 1JDTA 3IUYA 1DO8A 4DGQA 3IH5A 1GPDG 2JD0A 4LCJA 3IQDB 2PKQP 3DOIA 4LXTA 3UV3A 4ALMA 2C8VA 2ODWA 1F0KA 2GH1A 2CXOA 2WHQA 4BB0A 3CVWA 1K89A 1WJGA 3N07A 3RIEA 3PGMA 5L7TA 3LZ6A 2AFVA 2FG6C 4U39A 5JZSA 4P58A 3ZI4A 1JA1A 1V1JA 2A1UB 4D9CA 4KR6A 3AF3A 1FXWA 1BCRA 3R0ZA 5ESXA 1JLSA 3E9DA 1PT8A 3IAHA 4JX8A 5EWLA 5DGHA 2P78A 1ZD5A 4ZT7A 1KU6A 2ZRNA 4DMHA 1TLLA 2ZR9A 1QFSA 3D6JA 4X3OA 3G02A 1MG5A 3M3DA 1PFQA 1JZQA 1Z34A 3QW4B 1FNNA 3HKEA 4JY7A 3DW3X 4KODA 4XUCA 5DBOA 1AKYA 5DNEA 2WT9A 1XCLA 4PZ0A 3PC4A 3V42A 4FFBA 2E4ZA 3ZDBA 3O4IA 4IXNA 4DZZA 2RHJA 2UYCA 4JUAA 4LOIA 2B1JA 4EUEA 3N70A 2Y6VA 3JWHA 4ED9A 4R84A 3IHTA 1Z08A 2EXXA 2GPSA 1YS7A 1COZA 2B1IA 2ONKA 2Q0HA 3D1JA 4N01A 3KE8A 4O4IB 5K2OA 4W1SA 1IXZA 4YAKA 3WXMA 1V8PA 2WYUA 4M8SA 3FW1A 4BJ3A 2VTDA 2I55A 5EVJA 5C8YF 1DOHA 1VKHA 1YB2A 3P0FA 5IMBA 1BROA 3BTUA 5ES4B 2CNNA 3WTBA 3CY6A 4UNRA 2XODA 5K0GA 2V58A 1GWNA 3CIFA 4NPHA 4U6SA 1X6VA 2BMJA 2JLSA 4RUKA 3GX1A 2CJPA 4L78A 1O5TA 5G4LA 4ZMRA 2ZB3A 4D4GA 3HRKA 1BDIA 4RJTA 2XVXA 5BSWA 2XYRA 4UM5A 5IS2A 4YV1A 1VIDA 1QIGA 5ALTA 5CA1F 5THXA 2B98A 3GFRA 3KALA 4FYVA 3T1NA 1V9SA 1ELOA 3A06A 1MGOA 2PHZA 3AL0C 1AKUA 1XLTC 4ABYA 4A92A 4BMVA 2V4UA 1CJMA 1P2BA 4HCJA 1XXHA 2G04A 1SOVA 4AT1A 4AZ0A 4X44A 5JPCA 3PD7A 1OYWA 2WTMA 3DBLB 4GRIA 1KMCA 1NONA 4FSXA 5D7BA 4Z9FA 3R0VA 5HKKD 3EIHA 2YN0A 4NC9A 1PZXA 3VR4H 3ISTA 1EINA 3MS4A 2LBPA 4UZFA 3TE7A 1OBFO 1RU3A 2C8JA 2KI5A 3ZBUA 4QUDA 1KU0A 5LBIA 4K9DA 1LPSA 3K6RA 3Q3CA 3N5CA 4KDCA 2W6PA 5D6OA 2QTVA 3AESA 3TAHA 1TF7A 2ZYVX 2X0KA 4C20A 1QSGA 2F3RA 2QG6A 3HG7A 4G0OA 4L3WA 5CVTA 5EJ4A 2W8ZA 4XPIB 4GX0A 3ZQ6A 3UCXA 3BQ9A 2C82A 1NDQA 2QAGA 3HCWA 4FGWA 4KQGA 4MWCA 3KJHA 4GE0A 3RJMA 2GPNA 5D01A 1AOXA 1KXJA 1PZHA 1IN6A 2F3UA 2V6IA 3IJPA 1UK7A 1I7SB 2ZBEA 1FLNA 2GVZC 3K15A 4QBTA 1NXWA 1PNTA 4Q9DA 3O9MA 4ZPJA 5DTIA 3BZUA 4J0FA 1KMHB 3O8LA 3ZQJA 1R12A 3ICVA 5LU8A 3ZW7A 3AJAA 4QNMA 1AG9A 1N6OA 3OECA 4MW5A 5ENDA 4B7CA 5LP6F 2N46A 4A2CA 1ZMTA 4LJ6A 4M7RA 4WBXC 1CLEA 1X7ZA 1TZMA 2LIVA 1GL3A 4UASA 3W9YA 2BJVA 2PUBA 2QN6A 4CM1A 4CGZA 1SUPA 2OR3A 1TAGA 4PGGA 2QMOA 4G84A 4LHVA 3KZCA 3E7XA 1KJQA 2MYTA 1KI8A 2QUHA 2AK3A 2YZGA 1LSOA 1S89A 2D7JA 2Z1NA 3DBVO 4XDYA 5HFJA 3V7UA 4AC9A 2A1IA 3IUBA 4N5IX 4B4OA 4D82A 2LZ0A 1KVQA 4EFDA 3A10A 2FE1A 5DLDA 2OXFA 1J49A 1LW7A 2C88A 3AUXA 2E4XA 3HGQA 2OGUA 221PA 1JVBA 3IBGA 3IR5A 3C5CA 1R5NA 1YK1A 3PFKA 3R77A 1N32B 2NZYA 4QGGA 3ZU5A 1CS0B 1JTVA 3D7SA 4MR9A 3KSMA 1GNQA 2ZITA 1NVWQ 3B6IA 3DXZA 3N75A 3RG2A 4HGOA 1DADA 2ILVA 1DRKA 1FPQA 3C5VA 1FK8A 3G5MA 3QMPA 4XUDA 1ISPA 1TJNA 2CVHA 3CNOA 1H0RA 3IP3A 4J3FA 3RVSA 4RTSA 2WV9A 1K06A 1ZCJA 3DE2X 1BJKA 4MVJE 1UK6A 5IUKC 2W2KB 4IQGA 3LHIA 2NU7B 2O52A 3CWZA 3HDHA 4I55A 4EYEA 2H29A 2F3SA 4PHCA 3K31A 2RMKA 3RK4A 1KZ4A 4KO1S 3E53A 4IIGA 2R8XA 2VK4A 2ZAOA 4ZCPA 1J0BA 4R2JA 3T38A 3NC1C 4CMEC 1KEUA 3QKUA 2BBWA 4H77A 4BFXA 3DDOA 1RYFA 2RIRA 3QEMA 4BQEA 1IVNA 4FN4A 3KT6A 4FKMA 2FPIA 4AN0A 5IEBA 2IOFA 1EHYA 2CHUA 1ZH8A 3QVUA 4FKZA 4WFIA 1D2AA 1HZZA 2G25A 3LY7A 4PN3A 3DE5X 2IZ6A 3S29A 4A5SA 4CQMA 4BZPA 1PN3A 2IKQA 5D1HA 1G5FA 3GJZA 1NBWB 2C9BA 1OXTA 3HO1A 5FO0A 2AJBA 3K8ZA 3BT7A 5T4HA 2QD2A 1XDSA 5JTTA 1ZRHA 1XHFA 3NJRA 5H5JA 4MKIA 3M5WA 4TV8F 1Q7EA 5TJ9A 3RT7A 3FYSA 1P6XA 1B00A 1JDBB 5E7MA 1LNSA 4LSGA 2XTJA 4JXKA 1FF9A 3IDAA 4B6FA 5BNZA 2H2IA 3EUWA 4US1R 1Y5IA 2Z98A 5IBPA 3T9FA 2WR8A 4PPQA 2HPHA 5I01A 3CG0A 4W5QA 2VWGA 1XTJA 4L27A 5FIUA 1IPFA 2J4DA 4ROSA 2ONJA 1JJAA 3L3BA 1HM5A 4URHA 5HKLA 5J58A 3EAQA 4IICA 3LSTA 3LWDA 4YASA 1H5NA 3I4CA 1Q0ZA 1QORA 3A4VA 1GA1A 2R8RA 1N6RA 1P81A 3DHVA 3IDZA 4Y2YA 16PKA 2I2FA 3GO4A 5CVUA 4DIUA 1LDYA 4Q4CA 1KQGA 1E3MA 1P3DA 1N5OX 4QPJC 1X9GA 4WGFA 3QXJA 1DV1A 1W9MA 1XWIA 2GJ4A 4GBMA 5E4JA 4B17A 4DJJA 5IT4A 1U8UA 5KREA 2JBHA 3OVMA 4NF2A 3E3AA 4MJ7A 1KS2A 3MC1A 4KXQA 1K4MA 1ODSA 4GZ6A 4N48A 2HA7A 1Q1ZA 1U2EA 2Y27A 3RREA 3GA0A 3Q7QA 2HEGA 3DEFA 1T25A 2AOUA 3I3OA 1H2ZA 3CMMA 4AECA 3GLVA 3JARA 1WXIA 3A6HA 3ZDXB 2B4RO 1NUAA 4WWHA 3GP8A 1HA3A 3KUKA 4PBSA 3HN6A 3ND9A 4X6LA 1OAOC 3BIWA 3W77A 3SM9A 1LNQA 4JP2A 1QS0B 2ZUFA 5JD3A 5AW9A 2IDJA 1VECA 2XUFA 3M4JA 3WGLA 721PA 3WGOA 1V7ZA 1NQVA 4MUKA 2QJTA 2OYCA 1RM5A 3QLTA 4WZAE 4LPSA 3WI7A 5ADWA 3ZX4A 4J2TA 2EX1A 3SIXA 1EG2A 2FH5B 3F2VA 2IKSA 5CNIA 3I23A 4FK8A 4M1YA 4O4LF 2ECPA 4OHZA 3ZTYA 4R2HA 3DAOA 4M8IA 2YHIA 1Z7WA 4HGZA 4LF9B 4DWOA 5IU6A 1C0EA 1JV2B 1BTOA 1DWPA 1PJLA 3NWBA 4DXAA 3CJRA 4QJ4A 5JHGB 3QVVA 3P2OA 1XTZA 2QM7A 3T15A 2CXUA 3PPIA 4X92A 4YVFA 1MN6A 1EB9A 2E49A 3C3EA 4IWYA 1OE0A 3DB2A 1VE3A 4WE3A 5EMLA 5LBTA 2D3TA 1KYZA 3EXFB 2A5LA 1S1MA 2XXJA 5DHUA 5FQOA 4DLNA 1QGZA 4E03A 4BKRA 4GQIA 3HN2A 5BMVA 4BC1A 1UWCA 2B1GA 5SY4A 3RKUA 1Y9ZA 4QGBA 4RCZA 1Y6FA 2A0WA 1TUGA 4CL8A 2LCFA 3QU9A 1G2PA 3LY5A 121PA 3UV7A 1Z5ZA 1I0IA 2I0FA 4UNPA 4G0MA 4RHYA 4RKWA 2J85A 4I4TB 5FXMA 1OFHA 4X7RA 1PD0A 4P0QB 3ETHA 3E3MA 1NW5A 2AH5A 1M8PA 4JLDA 2X15A 4ZO6A 3CKLA 3VHXB 4B0OA 4FHDA 4L2IB 4BZWA 3D64A 4D80A 3R3YA 1Z12A 3KXDA 5FA5A 3FG9A 2BVNA 2HH9A 5KVAA 1W5TA 3IQFA 2H5JA 2QSJA 2E4YA 2IIBA 2V6JA 4I5IA 2W2PA 4CFZA 1NKSA 4PLHA 4BLTA 2IH2A 5BUSA 3GOQA 3F8TA 1ZIOA 2Z09A 3K1TA 1UBUS 1G6Q1 1DEXA 4NPAA 6GPBA 5DHSA 4UJ3A 1QG0A 3IVMA 1EFKA 1G8GA 4UZEA 1KNXA 3RGWS 3S7ZA 4JI4B 3PHHA 3R7DA 1GQ2A 3LY9A 4OL9A 4CVNA 2XEXA 5F9FA 2JIRA 2JIBA 2PG3A 3BDVA 3N0RA 3LBFA 4D8YA 1QFXA 1R4NB 3IUNA 3BSYA 4GQBA 3HZHA 4X85A 3SSMA 3RYIB 4E3WA 5E3HA 2VC2B 3BB1A 5JSKA 3TXYA 3LKBA 3CG4A 2ISSD 3R8XA 1TXGA 1CNMA 5DK4A 4B09A 4YLEA 3MWEB 4PYNA 1M7GA 3DDZX 3VYUB 4LNAA 2EV9A 3WLQA 3B1FA 2AXPA 4DLKA 2R2AA 4EEXA 2XGMA 3KQOA 2A3RA 2JCGA 3QI2A 4UMFA 1E0AA 2IGBA 1Y1KE 3AIIA 5B3AA 3KKEA 3DE7X 1NLUA 4MP3A 5BW5A 1NSYA 2CXRA 2VDJA 3F2IA 3FTPA 3JASA 1DUVG 2ASEA 5EWJB 5LKRA 2FZEA 3N5KA 3G2PA 2BR4A 4OYRA 4R2IA 4K9NA 5FPHA 5THKA 1D1PA 1QM5A 2FUKA 3AONB 4YT8A 3PUYA 2AWOA 3I0MA 3OE5A 3O1LA 4JLAA 3KJZA 4WT7A 3CUYA 4YR9A 5BORA 4RVNA 4HH0A 3F9RA 2WU8A 4KN6A 4N82A 4YXFA 5HKKA 4RTKA 1XK6A 4GO1A 1SKQA 2PS9A 3DFFA 2BGIA 3LUBA 4HDAA 1SXIA 3GP3A 1B7GO 3V80A 2V59A 3EB9A 4MVXA 4Q9LA 2GBPA 4LYGA 1TTTA 2W6JD 1H2EA 4QLBA 3BQMB 5JAMA 1STOA 2RGUA 3GB9A 2FZGA 1FLAA 2JLAA 3CGGA 4L85A 4M0FA 3OLYA 4ZQGA 3TRJA 4YYEA 2H11A 1IJBA 1XFAA 1Y8AA 3L8MA 3NV9A 3MF4A 4Y6LA 3TAUA 3EXIB 1MENA 1RZRD 1IJFA 1OH7A 2IELA 2UUAB 1Z74A 4BQOA 4JSRA 2FEXA 5FBWB 5CBPB 3GA5A 2HDOA 1E0KA 3LY8A 1T3ZA 1UT6A 3UANA 1TM2A 1CUCA 3BKWA 3M4XA 4R8MA 2NO4A 5ARDA 5TT1A 3UW1A 1NYRA 4HUJA 5M7EA 1F51E 2EFEB 4L9AA 4G0PA 4R6WA 2FAXA 2EBUA 2GBLC 3VZBA 2MSNA 3RVPA 1HE2A 3RYFA 4E21A 1UXHA 1LNZA 1WTCA 4Y18A 3V7FA 2NUBA 2ODBA 3MT9A 3Q12A 1ZW1A 2VHYA 4E6EA 4TWBA 2ODPA 4BCBA 1Q1GA 3HCPA 1XDUA 3MYYA 1MAWA 4R1TA 3T3IA 2O8DA 4CR6A 1KSFX 1UBFA