4KL8S

High-resolution structure of anaerobically purified dm. baculatum [nifese]-hydrogenase after crystallization under air
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
279
structure length
279
Chain Sequence
AKKAPVIWVQGQGCTGCSVSLLNAVHPRIKEILLDVISLEFHPTVMASEGEMALAHMYEIAEKFNGNFFLLVEGAIPTAKEGRYCIVGETLDAKGHHHEVTMMELIRDLAPKSLATVAVGTCSAYGGIPAAEGNVTGSKSVRDFFADEKIEKLLVNVPGCPPHPDWMVGTLVAAWSHVLNPTEHPLPELDDDGRPLLFFGDNIHENCPYLDKYDNSEFAETFTKPGCKAELGCKGPSTYADCAKRRWNNGINWCVENAVCIGCVEPDFPDGKSPFYVAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic [NiFeSe] hydrogenase small subunit
publication title Structural foundations for the O2 resistance of Desulfomicrobium baculatum [NiFeSe]-hydrogenase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 85
structure length 279
sequence length 279
chains with identical sequence T
ec nomenclature ec 1.12.99.6: Hydrogenase (acceptor).
pdb deposition date 2013-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
S PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 4kl8S01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 4kl8S02
4IUDS 4KO4S 4UPVA 1WUKS 2FRVA 5JSKA 4C3OB 1UBTS 5D51S 4KO1S 3USCS 1H2RS 4U9IS 1E3DA 1YQ9A 1FRFS 4TTTS 1UBLS 1UBHS 3ZE9A 4UE6A 1UBJS 4IUBS 4KN9S 3UQYS 1H2AS 4UD6A 5JSYA 4U9HS 1WULS 3ZEAA 4UEQA 5A4IS 4GD3Q 4UE3S 1WUHS 5A4MS 1CC1S 3H3XA 4UCXA 1UBMS 4IUCS 5JRDS 3RGWS 3ZE6A 4UPEA 4UQLA 4OMFG 1FRVA 4UCWA 3CUSA 4CI0B 4KO2S 5JSUA 4KL8S 1WUIS 3AYXB 3MYRA 1YQWA 4UEWA 3ZE8A 3USES 1UBOS 1UBUS 4UQPA 1WUJS 4URHA 1UBKS 5A4FS 3ZE7A 1UBRS 4UCQA 5JT1A 1YRQA 5JSHA 3AYZB 4UD2A 4UE2A 5ADUS 4KO3S 3CURA 2WPNA
chains in the Genus database with same CATH superfamily
3IURA 4HC4A 2I1QA 1LCIA 3EEBA 3KPUA 3O4IA 4Q3NA 3PUHA 5HUHA 1NDUA 2PV7A 4DJEC 3H2YA 4R6XA 2AK3A 2VZEA 4OYHA 1VMAA 1M8FA 4XH9B 9LDTA 5KYYA 8LDHA 3DAFA 3E4DA 1ZI6A 3GAMA 4MKIA 2GWRA 1W2GA 2B7CA 1NBAA 2XWQA 5KYYB 1URPA 2RGWA 4GGPA 3E9EA 3TIIA 4WZAA 1R9GA 4JKIA 2F43A 5BV0A 3JATA 3UJDA 2GN4A 1ESMA 1UFKA 3QX7A 4O25A 3ROEA 4TL8A 2PPVA 2B30A 4WKBA 3OJCA 4G5YA 2F43B 2G5CA 3C2QA 3EDRA 3JATB 3VTAA 3WO1A 5KHOC 3BPSA 4LWOA 3RSHA 3GRYA 5AKZA 2YWFA 4NHEA 2ZIXA 4QECA 1Q7EA 2H17A 4W5TA 4KLNA 3LVRE 5D85A 4CLRA 5B57C 2ZIXB 2LDXA 3MEQA 1IMJA 4JXKA 1G2QA 1TCAA 2DUUA 4CLRB 1FMJA 1O8BA 4TS4A 4WTOA 3VR6D 1EESA 4A23A 4GD3Q 3L6EA 3Q7QA 2FMXA 4GI5A 3FTPA 4X24A 1NXQA 3TAHA 1H9BA 5F9HA 1VJ0A 2WIAA 3ANXA 4IZOA 5HQ3A 3M6UA 4QDZA 4I6EA 4EHHA 3EEOA 1IDN1 3JTMA 3NH6A 1COWA 4L78A 5IX8A 4AN4A 4KDCA 4FZ3A 5HQ3B 3BWMA 1M33A 4M9UA 5C81A 2DXIA 1SAYA 5IVKA 2HTFA 2ERYA 2WQ7A 2DFVA 3DOCA 1LJ8A 2PVCA 4EB0A 3Q85A 3ZCPA 2A88A 2OHOA 1CVIA 5E3IA 3KOUA 1SHLA 3TWOA 3H0KA 3PQ6A 4YGYA 5KB3A 3P2MA 1GNTA 4OD0A 1DXHA 4CBVA 5KJ1A 5FEUA 1U5BA 1D2NA 1HI9A 4R7TA 5FLKA 4AWXA 1AURA 1J56A 1QV7A 2BM0A 2IIVA 1T1SA 1YAHA 4UCWA 3T5MA 1U5BB 1P6XA 3H65A 3CO5A 3OFJA 3RTGA 4C0HA 4F3CA 4R0MA 1KIAA 5ABPA 2UZIR 4HDCA 3UB2A 3R5JA 1KYZA 3LCJA 3QLUC 5BN4A 2VYCA 3ECAA 4CIYA 3RFTA 1X9GA 3A4MA 3H04A 3IEXA 2FWPA 3EN0A 4HATA 4M22A 3NTRA 1TKAA 3PFWO 4XSHA 5BN4B 3ZBPA 5FA6A 4WBNF 2VRNA 3IAFA 1N2XA 1RAAA 3ZWNA 1A9QA 4WZBE 1SELA 3GVXA 3IJEB 4U0KA 5EP4A 2IY9A 1RM5A 5DBEX 2G6BA 3FDFA 4IIJA 3KD3A 4QDTA 5TJHA 1Y80A 3ICQB 2HIHA 1O77A 1AS2A 2PKWA 4FHFA 4DSZA 4IIJB 5AXDA 1GL7A 1ZQ9A 2CXTA 1OASA 5EA2A 1XLUA 1IN4A 1FLNA 1H6DA 3IELA 3VOTA 2VQEB 4NV3A 2FX2A 1PZFA 1CUHA 1CUSA 4LYHA 5EJMA 4RPGA 1RHKA 3EZFA 4FOTA 2P2CA 1T2EA 1W6UA 2AE1A 2XUDA 3AYZB 1WUYA 2MSNA 3QXHA 1JQJC 4LRUA 2ZIFA 2WMDA 2Z8XA 4ER0A 2E21A 3T4EA 3C24A 4JIGA 1JU9A 5IEBA 5G1OA 4POAA 4ZOQI 2MOKA 3BE8A 5CHYA 3SF0A 4RLFA 3WLLA 4HUJA 1X77A 3NEPX 3DAPA 4K1XA 3F6EX 3HNRA 2R8OA 3I2KA 3LU1A 2CDAA 4CIDA 1BIFA 2B0JA 2R2GA 3OQJA 1NLUA 2B92A 1V16A 2JIQA 4CZ2A 3BN3A 1A50B 1PDVA 2VH2A 2QIPA 3O9ZA 3OC6A 1MMFB 2GBIA 4ZAFA 3B1WA 4YQYA 3A1DA 1V16B 2BD0A 3WMXA 3VNVA 3KLBA 2DSNA 1Y3DE 3PDHA 4FI3C 4WA7A 4TLAA 3NP9A 3S2SA 4ND1A 1ZYUA 4EUHA 3MAAC 4LTMA 2O3QA 3OEED 1TM2A 3AZOA 1X3SA 2YC4C 4CTKA 5J2TA 2OZEA 2VSXA 3HB7A 1G7TA 2GJ4A 5NLLA 4QGAA 1SURA 2WKPA 3FPEA 5GGYA 5BRJA 2GTPA 3E9DA 4GBMA 5J2TB 1TNDA 4G9GA 9ATCA 4YCMA 2A5JA 2TMKA 3KBBA 5KTYA 2CSXA 5MFPA 3PQ3A 1YB2A 4ITRC 2H2HA 2HU7A 3G2NA 1IBRA 1PVOA 1JJ7A 2EZ8A 4NDAA 4PFKA 4RDHA 4JENA 3T7RA 1WULS 4J0FA 4BWFB 4CT4B 2W48A 2GJAA 3D81A 1ECBA 1H69A 1UEXC 3G49A 1QB7A 4DCNA 3KEQA 3AFIA 4KUEA 3AM5A 1SXGA 1XTIA 5AH0A 5T6MA 3UJ3X 2B25A 4MIEA 3FZGA 2AG0A 1XJ0A 2EW8A 3N8GA 1BGXT 4D3ZA 4FDAA 2QS9A 1G5PA 4WESA 5ETJA 1XC7A 4CTJA 1TYZA 1AQNA 2ZUVA 3IUEA 1QHNA 2MYTA 3AVPA 3X1JA 3DV9A 4WESB 5CHEA 1V39A 2C07A 1U9CA 3ONEA 2WE8A 4F9GA 4EG3A 1N9ZA 4GPAA 1AUVA 1JVSA 1LLDA 1Z6YA 4TMKA 1ETUA 4BNHA 3T1OA 2VIIA 1DDGA 1SVOA 5I7VA 1I94B 3NAQA 1D09A 4LQ4A 4FYMA 4DCGA 4JJ4A 1E1DA 4R2JA 1IQRA 3ONDA 4XASA 3NHUA 4H1VA 1PGQA 1PG5A 3ZIAA 1SVWA 4BN5A 4DMHA 4KL8S 1VHTA 3E9MA 3I1JA 2BHNA 3TS1A 3OOYA 1PJ8A 4QT0A 3BCUA 2VDWA 4PQFA 1TF2A 3GRZA 4PZYA 4GZLA 3C3YA 3R9IA 3D7SA 2IEIA 4R8RA 2VDWB 3PFCA 3E8XA 1E7MA 3UV3A 3OIDA 3ITNA 3GVHA 1F3LA 4OBEA 4ZVNA 1E1NA 4P22A 1RZUA 1KL7A 3PQ4A 4AJEA 1SCKA 2DHEA 5FA8A 4BV3A 1YRBA 4DNOA 2RAUA 2Q3EA 2ERXA 1JHMA 1W5AA 2FOLA 1U0RA 2HA0A 3I1YA 3R7BA 3RRXA 4RQAA 1K6EA 1GSHA 1I3OA 5KOHA 1SUWA 2A35A 2E3JA 1X8JA 3LT1A 2B5VA 4S0ZA 5G0VA 2C2OA 4BVLA 3FI0A 1AGRA 1N6NA 2CF6A 4BLOA 5KOHB 3PX2A 3U1TA 1U0FA 1WSBA 4ZJUA 5DCLA 2XNHA 2P3LA 2AKYA 2PV0A 1QMPA 4M1TA 5GZ1A 3VDXA 5FUXA 1QTIA 1BYUA 1UXHA 2PZFA 3F73A 4ECEA 1YBHA 4BP8A 2K2WA 1YZKA 3VI4B 1M9NA 2VJDA 4H3SA 5H3CA 1RC1A 2VBFA 1IZ7A 2HWXA 3GRUA 1R0ZA 3I34X 3AB8A 1SXJE 2D3WA 4XJSA 2ZCVA 1Y1PA 1CUEA 2Q1SA 2QT9A 3GLUA 4XPIA 5L3RA 1WRBA 2UVDA 3PL5A 5LQKA 4BNLA 1K5DA 2OG2A 2VAPA 1RQNA 1G2PA 3FPSA 4H08A 4NYJQ 3USCS 4AD8A 3I6YA 2X2FA 1Y98A 2ONCA 4TV8F 1GZHB 4NF2A 4XPIB 1I13A 2Y2VA 3QLEA 3OX3A 5CFMA 4EL0A 1HDZA 1O95C 1U28A 1YQ9A 2JFFA 3PIDA 3ES9A 3W5DA 5IHXA 5ER9A 3SKVA 1GQQA 2J3DA 4I14A 4ZVOA 1WBDA 5BR4A 2P9BA 3AMVA 3DCNA 1QYRA 2EZTA 1JAIA 4IFIA 1XTTA 3N2ZB 3H2ZA 2H7XA 3DBRA 1X13A 5H59A 1WU7A 1V7PC 4HN2A 4FC6A 2WPDA 3QMWA 4JKYA 2HEIA 3DBRB 4QUAA 2WFZA 3CT4A 4YMWA 2PT5A 1ZM9A 2HA5A 2O5RA 1YZLA 3UAWA 4BU0A 4ZI7B 1O6CA 1KH2A 1ODTC 1ZK3A 2WYOA 1YSCA 3NOOA 4GU5A 2VCYA 1CFZA 3AUXA 3RRYA 4BMYA 2RIPA 3LDAA 5C46F 1C3VA 3ZVMA 3GP8A 2CJXA 3LMKA 1CB0A 1Y7PA 5IBQA 1KI3A 4NOMA 5ESWA 5GY7A 3FOZA 4CMHA 1QV6A 1YA8A 4QICA 3KK0A 1W0JA 2NNLD 4DPLA 5BOVA 2ANCA 2YNMC 4M89A 4Z0PA 5KPJA 5ITVA 5BPHA 2ODWA 3JW8A 5THXA 4D97A 2RGNC 2WOOA 3QUSA 2EU8A 4UQLA 3DWGA 4LOKA 3VBCA 1JIUA 1XXHA 2ZE5A 5FOSA 2FFQA 3FCUB 5LXTA 2E4WA 5IU6A 2MYNA 1EFKA 1Y7LA 2MSWA 4K86A 4JHLA 2VBIA 3E8SA 1XXHB 3ND9A 5HMLA 3VYVA 4XLLA 5LXTB 4JOCA 1Y6ZA 1A72A 1UM9A 2CMDA 2UUCB 4JT9A 3F0TA 4LXYA 4GUAA 4XM0A 1L7XA 2BMAA 1EEXB 1GZ5A 3WP0A 1UM9B 2OHJA 3FB4A 3LFUA 4BQQA 2HPAA 1N7JA 2FEPA 2R86A 2ZYUX 4CFSA 1QU3A 1YE8A 5F4BA 3WYNA 1G20A 3HA7A 4LY9A 5DTMA 4OHZA 2WB4A 1MAAA 1SC6A 5C18A 5K0NA 1G20B 1QRTA 2NQ2C 3IQDB 4CMEC 3UGJA 2VA8A 4KXFB 5SZIA 2OAP1 1ADFA 3GR6A 1JFSA 3ZBUA 5HIKA 2BBOA 3DLIA 3PNBA 1THZA 4P98A 1P60A 2J3KA 3PA8A 4PC2A 5KNCD 4UBNA 3BXFA 3V2HA 3ZVRA 5CK5A 4MQFA 4ZYZA 3AF6A 4KPYA 2G63A 3RS3A 3C39A 4KNWA 2W6ZA 4J03A 3D0KA 3OWXA 4ZEVA 5AW9A 3TJMA 1L4BA 5AI5A 4ZAVA 3A2NA 3L8CA 4ZCQA 2ATXA 3CU5A 5HTOA 4B48A 3TUJC 2VK4A 2IU4A 2V6FA 5CB0A 4HQLA 4QPZA 1MAUA 1Z35A 2ES4A 2JH8A 3EIQA 1S2IA 1T2DA 1U9JA 3TLKA 4FE4A 4BLTA 4UTVA 1NUPA 2D7JA 4BO7A 3WZLA 1LRJA 4BCBA 3EZ2A 3DYVA 5D51S 4AFNA 3R3XA 4GIBA 4KR9A 5IYZF 3TZEA 3VSDA 1YHNA 1YMQA 4Q4JA 3LHFA 2PX0A 4ZV9A 3GWZA 1U8CB 1USKA 3P19A 5JCZA 3K35A 4PN7A 4L85A 2EERA 1MPTA 1LLFA 2HLDD 3DULA 3DTVA 4P82A 4KGZA 1V11A 1TA0A 3FMPB 3LBIA 1JG2A 4GWGA 1U9ZA 3ZLUA 5CNKA 2BLLA 4RTNA 1NMXA 3DTVB 3BBPA 4XM2A 1YJXA 1V11B 1CIVA 2GSDA 1SOMA 2MT9A 2OR3A 5IDYA 2Z95A 3SDBA 1BVHA 3KKMA 2C0CA 2OV4A 2HSJA 4U7TB 4B85A 3FPJA 3T5TA 4UHFA 2BMEA 5IH7A 5KU1A 2RG7A 4M53A 5C8YF 1LJLA 4Z0NA 5A4DA 5IUKC 3HJFA 2ZYVX 1E3MA 1DRVA 4E13A 3WNBA 3O91A 4PNZA 4BFUA 1UAAA 3VAYA 3ZWKA 3P9PA 5ELMA 1YQUA 4XTCS 1R6DA 3F7OA 3O6VA 2JLQA 1XRSB 2PUHA 3FPBA 4HWSA 3U17A 2BKUA 2GPJA 1USGA 2HO5A 1Q95A 2O1EA 3W9BA 3JYOA 3W1EA 4UXHA 4ECAA 3Q8LA 4MWBA 3ZZTA 2RGEA 3Q7TA 1E3EA 2EGGA 4XA8A 4RSMA 2OAGA 2PX3A 2QPLA 2VDPB 3GFTA 1FNMA 4NX2A 5P21A 4YV2A 2CXQA 3QV1A 1YQEA 2D54A 4FQ8A 3AHFA 3GELA 1MLDA 3OWHA 1VPTA 1Z8NA 3DA8A 3IAM6 2PX5A 4OPMA 3EG9A 1G7CA 2VFAA 4AMYA 1RWVA 3T7JA 5HIAA 5I6DA 4B3MB 2QRHA 4ALMA 5I7AA 1QZUA 2AG1A 3EG9B 1HDCA 1UM8A 3I4LA 4ENVA 4KXYA 5LKAA 1XVLA 5H9VA 3M3HA 5ALMA 1E2FA 1C81A 1U3FA 4GMDA 4NZYA 3DONA 1MQSA 4L4XA 2HW8A 4L74A 3VO8A 4OGKA 4EHLA 1X1BA 4F56A 1GR1A 3DH0A 2FPMA 5ALJA 3RSFA 1BDHA 4ENWA 4CF5A 2PX2A 4ZRDA 1P6UA 2G28A 4D9BA 5JNWA 3MBOA 4D4IA 1T0IA 1E4YA 3R77A 2O8DA 4MWGA 1L5MA 3MXTA 3CSDA 1ZUNA 5J1TB 4ZEMA 4H9GA 4RD2A 1F12A 1HBJA 2GDJA 3BWXA 4RTRA 3C5HA 1ZUNB 4XR9A 1RWBA 2WWGA 1RLJA 3KKKA 1TM1E 2RHDA 3OZCA 4ZOLA 1Z39A 2DYKA 1NTRA 3GU3A 2P67A 3HCEA 2CUTA 3A1NA 3D54D 2P9EA 4FOLA 4HDAA 3C6KA 4Q9DA 4U7GA 4ZOLB 4LNAA 1U0HC 1ULSA 1H66A 1KI2A 2H4XA 2H4WA 3FYSA 3KJEA 3W3AA 4UZEA 1JIJA 3AHDA 3AHGA 4HNVA 4KQMA 3OLCX 3OTWA 4LF7B 4QYWA 1EFCA 1JPUA 4ZI7F 3EPKA 2BM1A 1OBHA 3TLBA 4ND2A 1F4LA 1KHHA 4GFDA 4NU8X 5ERXA 4OV6B 5JNRA 1NVWQ 2WM2A 1ZRHA 2VRBA 1U1DA 2ZI6A 3MG9A 4IX9A 1T91A 2LDBA 2QMUA 4L6IA 4N7MA 1EUYA 3CPEA 1QF7A 3EPRA 1YHZA 3F98A 1LBQA 3IIJA 1EK6A 5B64A 1FRFS 4RV4A 1TZKA 4GR4A 3NHLA 1QOPB 4QRDA 3GFFA 4WXRA 1VHQA 3NFYA 1DEXA 4RL4A 3WO0A 4DV7B 3WK8A 4YBZA 1Y82A 1GTJ1 2X42A 2XRMA 1ZK0A 5C3MA 1T9CA 2VHCA 3B89A 5HCNA 4B79A 1TOAA 1DTSA 3KQMA 2FHSA 3ZDAA 1L8QA 2FUG6 2JH3A 3UJCA 1YFZA 2NZVG 2D5BA 1B6SA 1KYYA 3CUUA 4X45A 4BNKA 1FMTA 1Z4JA 1MBZA 4UBIA 1R0XA 2A0WA 3KLOA 5EE5B 4F1KA 3UBTA 1ZH2A 3GAFA 3GYBA 1KY3A 1Y34E 3T3IA 4DB4A 5TEWA 4P0PB 2TRSB 4ER5A 4WZAE 5K4AA 1ZSYA 3N2NA 3OQNA 3GHYA 1HYQA 2VOJA 3NX4A 5KSOA 2JJ1D 3IEKA 3EH1A 3L49A 4QQFA 4RABA 2ISSD 4BNVA 5KC9A 5F33A 4F9TA 3K5PA 4GI3A 2XZTA 5CH5A 3UV6A 4YRLA 4QPCA 4HN9A 3SBXA 3K3PA 1CUCA 4B3XA 2VTKA 1Y6RA 4NULA 1OWLA 1KA9H 4Q3AA 2G7ZA 3RV3A 3TLYA 3TQOA 3GZTB 2MSKA 3O5AA 3PPVA 1I14A 1GPDG 4G9EA 3KZKA 3OMLA 5L7WA 1AC5A 1M34A 1GFWA 2GPTA 4GYWA 1TRKA 3ZCUA 2CLFB 5CPBA 3H8WA 3LC2O 2J8ZA 1MVLA 1M34B 1SCNE 4UM8B 4MS1A 2ZBFA 4LSMA 3DEJA 3OWOA 1OBFO 5LYJF 3FHJA 4MS1B 1RP7A 2ZT7A 1DFIA 4TKLA 2M2IA 1YASA 4RD6A 1KO7A 4C9BA 4W9NC 1NRWA 4OKNA 1DBPA 1C8LA 4DM4A 3LGXA 4A1OA 4LV6A 4TTJA 1M72A 2I78A 5DYWA 5KOJA 1H1LA 2XH8A 3H4TA 3HUDA 1FK8A 4DCTA 4IQ0A 4KWHA 2OHVA 3QWFA 5KOJB 1CJTC 1H1LB 4II3A 1UEJA 4LDJA 4XGIA 3F6CA 5EIFA 1ADCA 3OJEA 1SVSA 4YECA 3CLSD 1U3GA 1LSOA 2BM9A 2PWZA 3CZCA 3OIGA 4K6OA 3TRFA 2CB9A 1HTWA 1O6ZA 3QJYA 5K3SA 2RK6A 3K0BA 5GV8A 1A5ZA 3NKLA 3I9NA 4IHKA 3MD0A 5FQNA 2OBNA 1TRHA 1SRQA 2PSDA 2QQEA 4UUNA 4P32A 3MOGA 4EF6A 4I6GA 3U1VA 1P0PA 2CY0A 3HVJA 3UHFA 5EZ5A 4FGKA 2PMWB 4J0KA 3AKEA 3OP1A 1L7DA 1GNLA 2BGWA 4X3OA 3JXEA 4EYSA 4CMCA 1P33A 2PBFA 2ZJ6A 1U65A 3JYLA 4B84A 2NSJA 1C0EA 3HWSA 3NBUA 1MX1A 2DZDA 3TX2A 2NM0A 3B1VA 2PZBA 2PN1A 1NQOA 2ZUWA 3QZUA 4KPGA 1K92A 2EJTA 4RZHA 4TMWA 5I3CA 4PO8A 1PL8A 2K7ZA 2QRQA 5AK0A 1S9HA 5FUYA 2AVNA 2OZVA 2WW8A 1PI3A 4KQGA 2ZE8A 3JPYA 3KBOA 3ROXA 4DE5A 4KO1S 4HAWA 4HD8A 5FULA 1GU7A 2UXCB 2P75A 3HN7A 3IERA 1XU4A 1H2YA 2RHHA 3HVRA 1JNYA 3FAZA 3O0DA 4G56A 1FXWF 4DAEA 1DLJA 1LPMA 4E5SA 1F7VA 3VR0A 5C7IO 1KFBB 1WCXA 1Y1SA 4C89A 4EGAA 1SC1A 3DKPA 4MO9A 2FXVA 2QVYX 2HMSA 3A1FA 4HAZA 1GILA 4FJ2A 2ZUBA 5AK3A 4B4KA 3ESQA 2A1TS 3HCAA 3WNDA 4TZ6A 3TD6A 3KFVA 3FDIA 1SUPA 2NAFA 2C4WA 4P2BA 5KDLA 4K9MA 3R8FA 1KDRA 4KMOA 1BMFD 2QD5A 3NW9A 2G9RA 2R44A 2W22A 3U37A 4JQOA 1IN7A 1VIDA 1VFPA 3LRTA 4GS5A 5AVKA 5EHZA 2HA7A 5IK2D 1NBOA 4FSDA 4POOA 1XTKA 2NSHA 3SQOA 4QM7A 1ISFA 4Z4EA 3WAGA 1OGYA 2G25A 1I30A 3QMPA 2IW3A 3BCHA 4DMCA 2CJYA 4A0QA 2EJBA 4K5QA 2OEPA 2OBFA 3R41A 3WADA 4B5LA 2GEBA 2PWYA 3NGMA 4V38A 2CHFA 2HL6A 1RRFA 1Z0KA 5JSZA 2ZREA 2DPMA 3A36A 2IOFA 3EMDA 4WY2A 5CLQA 1ZM4A 1LW7A 3NBAA 5JSZB 2A5GA 3GLHA 2AZDA 3DEYX 2QF7A 1MP0A 3NCHA 2PLRA 1DOAA 3D3KA 3FRHA 3M4JA 4ES6A 2O7QA 5JQGF 4AG5A 1YBFA 4CDGA 4OGWA 5JS8A 4N5MA 5G0UA 2YY6A 3CW2A 3AL2A 4G8JA 4WL0A 2ZSIA 2Q8PA 1XAIA 2V7WA 2L0XA 3D6UA 3K1ZA 3LC0A 2C2XA 1ONOA 2RGNA 3PTZA 4RKFA 5FTWA 4AMZA 3RVMA 4CQJA 4EUFA 4CM6A 3V00A 5K0FA 3JQEA 5COQA 3VR6H 1ZEJA 2W42A 4YCSA 2A9KA 3GUHA 4H18A 4MQLA 3RQIA 4QLBA 2VN8A 3AUJB 3ZHZA 4HWOA 4LV8B 4YVFA 5C4MA 1JPVA 4MHTA 4L9WA 4BLVA 5FNVF 1MPXA 3QU7A 3H99A 4OMUA 2HADA 3HJUA 3PRHA 4G65A 4HAOA 3CWQA 1NXWA 2E37A 1JKIA 3TUIC 4A6EA 4B3SB 3CEMA 2HHCA 1WSAA 4YMIA 2P4HX 4DDKA 2OXTA 3QOYA 2Q3HA 3MELA 4JL5A 2IZ1A 5BSRA 2OL4A 5KJCA 1T4GA 1KSJA 1KQGA 1UMKA 1XVIA 5EXXA 4BBAA 3QPVA 2AT1A 2YFHA 4JB8A 1T6BY 2YJNA 3A1TA 1A8UA 3P2OA 4X5OA 5JC1A 3A6ZA 3WFIA 3ZY2A 3PQ5A 4G5GA 3K6KA 3E5RA 2ZUDA 3IOEA 3LCUA 2DBZA 1OXSC 4M1KA 1UFRA 1AQYA 2FNAA 3BM5A 4GC9A 4I6JA 3QP9A 1AHPA 2JHCA 2DLNA 5ANRB 4TXNA 4K6GA 3TE7A 3ZLJA 3FCYA 1QPGA 3IMFA 3QHQA 5HRCA 2W7TA 2IW1A 4LNUA 3WKBA 2VNIA 1LPPA 2C03A 2PZMA 5TC4A 3MT0A 2EKZA 3PGMA 2XUHA 1WF6A 2PL9A 3QBVA 4LNUB 5GINE 1OZFA 4NU6A 3TDNA 4EBFA 2H4HA 2Q3JA 3ADCA 5IANA 3ILHA 4COOA 4FYPA 4CHTA 1HFKA 2PQ0A 3G2HA 3P9XA 4H0FA 4LUCA 2XLCA 4EATA 1AIPA 2IGBA 3C6QA 5TJ9A 3HMKA 4QXMA 4W4TA 4UDNA 4LZWA 4B3FX 1EX7A 1PW7A 1DHTA 1SB9A 4GOLD 3L4BA 3TDMA 1X94A 2NV0A 5K3AA 3FCOA 1NT4A 2VXYA 3BZBA 3KWLA 4RZUA 1Z38A 3T5BA 2FSSA 4KQ9A 4TSKA 5IT4A 4W82A 2OHGA 3LNCA 1Q0LA 3GDHA 1XCLA 2FQQA 1ZRNA 1CYDA 4P4LA 4X1IA 5JJCA 4MGEA 1QHYA 1KAGA 2GCGA 2XOXA 5DIZA 3V34A 5IN4A 1P2DA 4YMTA 4X1IB 1QYWA 4Y9SA 2BZGA 2VUTA 3H5OA 1LV8A 5DMHA 4B4DA 5T41A 2PYZA 1RE1A 1JHQA 1MT0A 2FPXA 3A4VA 3M6VA 5TB5A 1I2BA 4CTOA 4EA8A 5JEEA 2OCDA 2XMDA 4QXPA 4CE6A 4I55A 1J7KA 1D7OA 1H0KA 3D6AA 1CJUC 1U2RA 1NY5A 2GZ3A 3IAS1 4OBXA 5P8WA 2G1JA 1T2UA 1EVIA 3JQ9A 3OE4A 4CL2A 1IM5A 4FJ0A 4I55B 4LVUA 4Y0NA 2UYHA 4OAPA 4EG1A 1EKXA 4MTCA 3LUGA 1WHSA 3I39X 1WCIA 1PV2A 2OV3A 2IYOA 4J1TA 4PAMA 1G8HA 2ZSDA 3K72B 1XRMA 2W4IA 4LXHA 3SMVA 1J97A 3I0MA 1WHSB 1H2HA 1WCIB 4BFSA 4ZDKA 3UBMA 1ZESA 8AT1A 3S6JA 3M1LA 2QYTA 5F77A 3W8NA 3ZW7A 3EBPA 16PKA 1E4EA 4LYDA 1L4EA 4WJKB 2Z8YA 1ZIDA 2I7XA 1DVRA 1YJAA 1HNNA 2QGFA 2QN3A 2QX8A 3DC7A 3P0RA 4DWJA 1JH9A 5MF6A 1KC3A 2JKZA 3KXPA 2ZTLA 4RF4A 3OZRA 3U0BA 2JZCA 1EZZA 2NWQA 1ZA1A 1GOTA 1Z7EA 1CY7A 1Q0HA 3TXAA 2B94A 3CPSA 2WJWA 4QOJA 4WY8A 4PG5A 1Q6YA 1ILWA 3T7IA 4AUKA 4DQXA 2R4TA 5IAOA 1ARZA 4RV9A 1CUYA 1TJ5A 5IJ0A 5B1SA 3ANMA 1E0AA 1EP1B 1P8AA 3GFPA 2OV8A 4PFSA 1DX9A 4D8TA 4DILA 5IJ0B 3O82A 3CB4A 4K26A 1WMSA 4BE7B 3ZJVA 2EJUA 3JQFC 5JZBA 3WNVA 1JN0A 2R8EA 1JLHA 1OAKA 4P84A 4ZOBA 4QJ5A 3FUVA 3C6XA 2HCRA 1T3GA 3TEFA 3PNVA 5FI1B 4JI8B 1Z7GA 2JJ2D 1ZN8A 4UBLA 3TZBA 3EGWA 3UPUA 4JYAB 3NWEA 1E0JA 1NJ2A 3E22A 3A8TA 2R5WA 4YLEA 5CLJA 1L4NA 3I42A 4BZQA 3W1WA 2IFTA 3IOMA 2RHRA 3E22B 1HLGA 1TCBA 1G20E 2ZPUA 4R68A 3IBSA 3JR7A 4AJNA 2C9ZA 4GKBA 1BWRA 2YOFA 3C4VA 4B3RB 5BQFA 1IVSA 5BXQC 2O06A 2CLLB 1UQRA 1OFHA 2RJNA 4IXNA 3V97A 2HK7A 1Z74A 3WWOA 2CHQA 3UG6A 1D4OA 1CY8A 1U0SY 4BNIA 2OBBA 2AZXA 1CBUA 6LDHA 2GZSA 4AU1A 4DV0B 3BE4A 5KZMB 5G4KA 1P9RA 1XZDA 3U7JA 3TOVA 3CUEF 2IHTA 2XUGA 3AL0C 2R6ZA 3D5EA 4M7OA 3WVNA 3LX8A 4RO0A 5G4KB 4TTTS 4PTYA 4GAEA 3EE6A 4FFLA 3GNSA 1RHMA 2ONJA 4TTAA 3OTOB 2G7MC 5AKEA 1EM8A 3SVTA 3OCWA 1O97D 1RU3A 5EQJB 3ZD8A 5FUBA 1PX2A 1RVDA 3S2GA 2C95A 2F00A 1EM8B 2FEAA 5AVJA 1P7CA 2DBVO 4UTXA 1PFGA 3CLRD 4WUTA 1KE2A 3V48A 4XWGA 4KSYA 3S2ZA 2Z57A 1JBKA 1B6RA 2QX7A 4ARZA 1Y7HA 2Y1XA 3LO5A 4W5QA 5ARDA 4H7EA 4J1SA 2RGUA 1Y6FA 3PEVA 3NS7A 4JLOA 3RVQA 2LVBA 3MMPA 4ARZB 4BVJA 5DFAA 2QVCA 3QM1A 3ZYZA 1P8JA 3BAFA 5KNCA 3RK0A 1XPOA 1FDUA 1E58A 5FD8A 1R2QA 2HF2A 4MV1A 4TZTA 3TOXA 5AI4A 1Y3AA 4P0TA 3T4XA 2X9NA 2SBTA 1PYGA 1XRLA 1GZSA 1AX9A 5H7XA 1MTZA 3QBEA 4AY6A 3AWIA 1U1EA 5D87A 5CLLA 2PK3A 4N12A 3JVDA 1IBMB 4D26A 2IPLA 5FWNA 3H2BA 3TX6A 4ERNA 3THRA 4MI1A 2HRBA 4FEEA 1P75A 2ECQA 1Q6ZA 2JBHA 2PGXA 2I1LA 3EIHA 2GM5A 5CVEA 4G09A 4UPEA 5AKLA 1CSEE 1R8QA 1R00A 3UMBA 3KOWA 1FW8A 2R8ZA 4LTNA 1NN3A 1QQ5A 4Q48A 1DRJA 2GASA 2OPBA 2W71A 3K9WA 3R6LA 3G6WA 2JH9A 1W36C 5DI3A 2OXFA 4DCPA 5J58A 2PFSA 2WB2A 2PLWA 1NYRA 2HLDA 2XBUA 3NV7A 4Y2HA 5DI3B 1GZ7A 3BK2A 1ZSVA 3BGSA 3NWJA 4UATA 1RJEA 4ZVMA 2V7QA 4JLJA 1GSAA 3TQTA 2IDJA 1G3QA 1GA4A 3C15C 2ZYHA 1KARA 1L7BA 4ZO8A 2OXIA 1IONA 4RXUA 2WABA 3AUSA 3ICPA 3H9GA 1U1GA 2R1UA 1TQHA 1DZIA 5CVUA 3EEIA 3TW4A 1PDWA 3D2BA 3QVWA 4HLNA 2QG9A 2ATCA 3AKCA 4KTVE 4A0GA 3KAQA 3ZQUA 4EYOA 4TZKA 2JCXA 5CGZA 3DZCA 2ONZA 4ZARA 4WBNB 1ULHA 2H9AA 3MA0A 4ZI3A 5AI8A 2QJWA 6ADHA 3VUEA 2ECFA 2DQSA 2IHYA 3LOUA 5DH9A 1JQAA 5E9JA 4UHEA 2CEKA 3KQPA 1KI9A 1U4SA 2XKBA 3FOBA 3IUSA 4NZZA 5HE9A 4BP1A 3HO8A 1CVLA 4XFJA 5KQMA 2FWAA 4CM3A 5E4FA 3TRIA 1FP4A 2I6QA 1NUTA 2YJGA 2X3FA 5LWHA 4LXQA 1EQ2A 3B20A 3IE1A 3WG9A 1YK1A 4LJ4A 2BHTA 3FOFC 1PKEA 3I5XA 5A5EA 4KO4S 4R0VA 4IDFA 2XYRA 1NW9B 4RVNA 1UJNA 4Q21A 4Y3UA 1XVUA 5DGHA 1HKHA 3VR4A 4DLTA 3P1JA 1NOIA 1GDTA 4TUYF 2QTHA 3FH0A 2LKCA 4LDRA 1AK2A 2A9QA 2AZ4A 1IHYA 1SUBA 3OT5A 2FUKA 3C3CA 3ZR4B 2WAOA 3NUGA 2PVSA 3FI9A 5TR9A 2YJ5A 2F2TA 3K0FA 2F8MA 3E8MA 2OZLA 3ICWA 1J1IA 1ZN9A 2B7LA 4URZR 4BE4A 2R1VA 4BEBA 4GW3A 5K05A 3K0FB 1QRRA 4TMXA 4WERA 3S2IA 1KP9A 2HNBA 2OZLB 2EKLA 3O8OA 2WHXA 3A3NA 3KR9A 2R1VB 3T8YA 1JXOA 1HPLA 1T15A 3VISA 2HBZA 3O8OB 3BBLA 4KVFA 1XD9A 4QBHA 3CO0S 1E59A 4MRVA 2EBUA 4QEZA 3PGVA 2QROA 4LK3A 5CB6A 3Q2IA 3HVUA 1HLPA 3K32A 3O4RA 2FPGA 5JJKA 4X8OA 4QYTA 7ADHA 1ZMBA 4Z4FA 3UEOA 4MJLA 3TW8A 2FPGB 4MB2A 5ICCA 4J9VA 5MGBA 1VSVA 3UPTA 4S04A 3TW8B 3MMZA 3OE7D 4JU8A 4XCVA 1XZFA 3IVXA 3LT4A 2NTYC 1BHQ1 3X3HA 3GP3A 1E3SA 1HDXA 1SG0A 1IRXA 2L42A 4WVFA 1G55A 1P1FA 3HR7A 1Y9AA 4NK4A 4U00A 3VR2A 3FYTA 2HSWA 4NZOA 1BD3A 4V2IA 3DYIA 2ZZKA 4LQLA 4Q9HA 4YUYA 4XWAA 1F5SA 1R6XA 2LBPA 3PS9A 2OXRA 3PRKE 2PH1A 4HX5A 1M2FA 1NC3A 2W6JD 3ACDA 3CIFA 3KHKA 4MW9A 3T3HA 3CS3A 4MA0A 3I3OA 3C87A 5A4AA 2OMEA 4O33A 1IHUA 4WKPA 5DF1A 4PCVA 3Q15C 4KYIB 4BO2A 2Q1YA 4JLUA 4WDQA 5H5JA 5SYAA 3S1AA 3T9EA 3K6SA 4DS3A 2AWNA 2D4HA 3LHSA 1TAQA 3DO6A 1R16A 1XZBA 4H7PA 1AHIA 2G1KA 3AG6A 4UEWA 3S1AB 2F1OA 3VPXA 3K6SB 3GLGE 1U1CA 2ICAA 1QG4A 4WN9A 3D4LA 4NIMA 5F7ZA 2IIQA 3IBYA 3ELDA 2R6FA 1ZKMA 3SWWA 4WN9B 4MS4A 2NU9A 3D6TB 4GYKA 4WASA 3TW0A 4ZKEA 2BYTA 1Z0UA 3VKHA 3BD9A 4K9SA 1M34E 1Z5ZA 1RKQA 1W44A 3COSA 4MS4B 4N7JA 5EUMA 2NU9B 3TINA 1JNXX 1VL5A 2ZJBA 3NKVA 1KTVA 4WNCA 4OLHA 4PEVA 5JD3A 1YZNA 1IZZA 1FTYA 2B34A 1H2ZA 3KWFA 2FP3A 2AUMA 3ZDRA 4Z7OB 1T3HA 1GTZA 1HZJA 2B98A 4IOKA 3R7NA 3TEMA 5A5FA 4CIXA 5JS7A 5I9LA 1I4WA 3A9RA 1LTKA 2XTAA 4EYQA 3TGWA 1S8AA 2KJQA 4REOA 1KOJA 3T1NA 5JZ9A 3SDSA 1I6MA 1E32A 4F3NA 3ND7A 1CYEA 2COUA 4MV5A 3L4KA 1S2NA 4NYIR 3MZ0A 3R74A 3TLCA 2NSDA 3CNOA 5CEJA 5CCXA 2GHQA 3WGZA 4QOHA 2C97A 2OC9A 2WZDA 4YMLA 3GH3A 2QRGA 2HDNB 4X66B 4JLKA 2J87A 4XGQA 4V0KA 3KKOA 3AHCA 4RMJA 4RUKA 3UK6A 2GBLA 1K8YB 1PEDA 2J5XA 3KP1A 3RM3A 3TM5A 3DLBA 3WGKA 3HM2A 2F9MA 3IPAA 4JNCA 4JGBA 1RYBA 2YQ5A 4WFQA 3SCZA 1IAQA 5EJ4A 1VCNA 2WVJA 3K9BA 4YS6A 3GUZA 3KCQA 5IEJA 1D2GA 4WXPA 2HC9A 3D8BA 3IOBA 4MVJI 4Q39A 2F3TA 5ESXA 3D3WA 2VRWA 3HB5X 4FFNA 4TV8A 3GK3A 4IUBS 4AKGA 3E7WA 1U2PA 4DJJA 1Y5RA 3D3WB 4MO2A 4HAYA 2D1SA 4TV8B 2DTDA 3RSLA 4RPLA 3T99A 3SFVA 4A3SA 1VRWA 3RBAA 1ZJJA 2EFGA 3C41J 4ALKA 4BJ3A 5DWDA 2GVZC 4FVTA 3PUZA 2O4UX 1FB5A 4IW3B 3PFHA 2R1TA 3R40A 4LNHA 1UPAA 2IEGA 2NO9A 2E7ZA 1R12A 2VJKA 2X6RA 4UOEA 3QXSA 4NBRA 2R1TB 1V9CA 5HWSA 5FPTA 3D2AA 3N76A 3DDCA 5AW2A 1SXIA 3WRXA 3ZCRA 1QVVA 4B3JA 3VR3D 1VLHA 1BXKA 1SC9A 3BZWA 3I6IA 5JTTA 2VQSA 2P6RA 2Z1NA 4RMGA 4BQNA 2IYLD 3G8BA 4RIFA 3PRJA 5AVRA 2WYWA 1TEZA 5AVOA 2K5UA 2II6A 4D43A 2EEPA 4IG9A 4EGCB 3UUEA 5A3JA 5HYVA 3N0RA 1ZXXA 4AX4A 2AQ8A 1BQ3A 2YUTA 1B93A 2XCTB 2AX4A 2QU7A 1Z6TA 4ZCMA 4LPKA 4N54A 5BP7A 4BRUA 4OO3A 3NUQA 4UTOA 2R7LA 1TZ2A 3UFXA 2XX3A 1X1QA 1H6CA 2QPTA 1OVMA 3X1KA 3WLEA 4X60A 2KBEA 1VLZA 3CNLA 3RYHA 1KZGB 3UFXB 3WGIA 3DPIA 5LUBA 1PS8A 2WTXA 3RYHB 4AS3A 1D0SA 1OAAA 5FT9A 1MXFA 2X3YA 3DLTA 1RLTA 1JT9A 4M9ZA 1GLGA 3PGKA 2IY8A 5JU6A 1PEYA 2C2ZA 4G5HA 5J47A 4ZVTA 5A7HA 3CE9A 2Y6UA 4GPBA 3OIYA 3OFVA 4Q9KA 1VBKA 1VLMA 5HIJA 5KWJA 2XYGA 3MJDA 3PL1A 4RHEA 4MYHA 1M1YA 5IAKA 3R7FA 2XE6A 4EY6A 2VSNA 2IJGX 1NOKA 3AR3A 3HP7A 2X5JO 4S0XA 5KTSA 5AO9A 2P4QA 1M1YB 1P3DA 3VYSB 3RIGA 4MPDA 1YAJA 2DHRA 4ZAGA 3EC7A 4OHWA 4G1BA 1IEQA 1F38A 3KKEA 2SKEA 1T9KA 2BFWA 3CNHA 4B2IA 1UXOA 5JCPA 2LPMA 1ODFA 4FYXA 5D01A 2RBKA 1A96A 2DUWA 5CB8A 1IVYA 2WMYA 1JT2A 3DV2A 4LXUA 3K9QO 1Y4AE 1E5TA 1N7GA 1Q14A 3TZQA 3W2FA 3JQFA 4CKCA 1KK3A 1NOJA 1RXUA 2JIRA 4RD4A 3RUAA 3U19A 1IUOA 1TXGA 3UMCA 3DFUA 1S5PA 4FZ5A 4O2AF 5AXAA 5EJEA 1EFHA 4CKCB 3UENA 1HQYE 3FYHA 1DL5A 1I24A 1DO0A 3PEUA 5EWLA 4GHWA 4ID9A 1FS5A 2ON6A 3ZY6A 2P41A 2FZCA 2ZWMA 3KJNA 3V8NA 4BBPA 5I9SA 1UXGA 2M6SA 1YA4A 3BE6A 3IHWA 3IMGA 5L3VA 2C9MA 1X7YA 4L95C 4RK7A 3IVMA 1MG5A 1T34A 3GRRA 1GRVA 2L17A 3H1AA 3IQGX 3TOSA 3ZVLA 1Q7CA 5C3UA 3NPAA 4OB8A 1X7YB 4GX1A 3SXPA 2YICA 2OFOA 4ALJA 5EMJA 3KVOA 3A1WA 3JQ8A 4I1UA 4X6YA 5TVGA 5F2NA 1DZ3A 5IYZA 5FWDA 3FMGA 3JQ8B 2PXAA 4S2UA 5IYZB 1ACJA 4LVCA 1GNRA 4FZJA 4JI3B 4FB4A 2IS4A 1OTYA 4JBYA 4IIDA 4TWZA 4PZ9A 4EG4A 2JIZA 3I62A 3WNCA 1E3QA 1Q0UA 4HLCA 1KR2A 4LDPA 3R0ZA 4BJ6A 1ZBQA 1GRNA 3M9XA 2HU5A 3SQWA 3HCRA 1EI9A 3O7WA 3OJ0A 3BOSA 3GCXA 5GJWC 4BRWA 3RAEC 4M2LA 4E6EA 4LE0A 3J81k 2RH4A 4EG6A 1N3BA 5C8YA 3O1JC 3OLVA 2ODPA 1KERA 4HVAA 1C50A 4JJAA 3IT2A 4FR2A 1P9LA 1G6KA 3EIXA 5C8YB 4NEQA 5K8TA 2WKWA 4LGYA 4XR4A 4V02A 5IBRA 2PT7A 2WFLA 3LC1O 3NEJA 2AB0A 4O63O 1T24A 3D6FA 2VHEA 3TNDA 4M38A 2IXTA 1R8YA 3AVUA 3I53A 2WFLB 2Y4OA 2I76A 1KK1A 2D5AA 2CKDA 1KYXA 1KJWA 3VGPA 2NXJA 2DPGA 1U8XX 3THXA 2J3MA 5JXGA 3G23A 4V0QA 1QKIA 3AF4A 3THXB 2QTBA 3VJLA 1SD2A 3MLBA 3KEMA 2FN9A 1QGOA 3AR7A 4R9NA 2YR0A 4HX2A 1H4QA 1JDTA 4TPKA 3O8BA 1YFLA 1GYPA 1E2QA 1A7UA 3HB4X 4KHZA 1USVA 4YWJA 4GC5A 3ZE8A 4YGXB 5H3LA 1OHHD 2BGRA 3UB4A 1QIEA 3NTQA 1UBOS 3L0YA 1OPXA 3TTXA 4UQPA 4EELA 1A71A 1GPJA 4CKWA 4DIEA 2X5XA 1FS6A 5G2OA 1NXPA 3FVQA 1P1RA 2B83A 1Q0RA 3LYAA 3S7ZA 3VH2A 4BECA 5LJIA 4HLQB 4M4SA 4CKWB 2LE0A 1SBIA 4BMZA 2A5FA 4GE3A 3COPA 4HH4A 4RENA 3FUXA 1Q92A 3QPDA 3UJ7A 4GGMX 3TQQA 1TIBA 4XUDA 5M04A 4WN3A 3FFAA 3E4CA 4BHTA 1C5KA 1KH1A 1CHDA 4X97A 3WZMA 1KMHA 1H3NA 3PD7A 1L8OA 4MVJP 3GLIE 4EJ6A 4H1UA 3RSGA 4XYLA 1PK8A 5GWXA 4DIOA 4A8JA 2QM3A 1KMHB 2ROQA 4YMVA 5JALA 3ZJUA 3DOOA 3GUVA 3R9KA 4JZKA 4PBSA 4JL8A 4QYXA 3A11A 4MI9A 3TNLA 1E4OA 5K9ZA 2P2SA 4A8JB 1LU9A 2A0FA 4EK9A 3T35A 4EVIA 4G26A 1KO8A 1P74A 3HCOA 4KAAA 5E3JA 2O3UA 3WGHA 1IIRA 2ZJZA 5EXSA 3ZHQA 3JRWA 3N6VA 3PR1A 4P4UA 5KQLA 5LSAA 1OB2A 2PZLA 1J2YA 1P73A 1G8FA 4LJ7A 3LP5A 4NBTA 4DMLA 1WMDA 4Y1EA 1CUFA 5FPKA 1DMRA 4UAGA 1NHGA 3ZWMA 4OH7A 1D2HA 1P0QA 4NDNE 4V0MA 2NU8A 1XZMA 1BXGA 1N6OA 1AHNA 2ZR9A 4ZI7A 1EIWA 4K3UA 3NI2A 5IKMA 5BNIA 4HMPA 2H59A 3E9CA 1I10A 2BGMA 2NU8B 1BXGB 2JHPA 1CULC 1C29B 4BO9A 1PDOA 1PP4A 1YH3A 3ZE9A 4HBZA 4C03A 5B1YA 1Q7TA 3ICCA 2VLBA 3JR3A 2G76A 5DRTA 1RMTA 1Y8QA 2H5EA 4YJFA 1ZZGA 1DPGA 2IU3A 5AVQA 3C3EA 1Y8QB 3V8QA 4KH1A 3ZEAA 3D4OA 2JAHA 3MT9A 4YJFB 1GL9B 4GM0A 2VJAA 5EN4A 2PE5A 2EOAA 4WFJA 2ZYTX 1PJCA 3QY0A 1C41A 2C7VA 5EZSA 1ZA2A 2FZVA 4QD3A 1W47A 3ORYA 1DXOA 3RH0A 1BAPA 3MAGA 1ZMXA 1XF9A 3LW7A 3N2GA 3PQ7A 3ZU2A 4BKPA 1GTRA 2XXAA 1JG3A 2J0SA 2W5UA 1LH0A 1RWOA 4K0RA 4RIIA 2CL5A 3N2GB 3QFCA 5FUQA 2XXAB 3NASA 3M3PA 4OQEA 4EFNA 1NY6A 2VPQA 3FB1A 3O74A 5KU7A 1QOZA 3FSRA 1D2MA 3IEUA 5EOVA 2G17A 2X6TA 4QOEA 1OFTA 2G8LA 1UOOA 4JLNA 4BVHA 5JC8A 2I3DA 3FBGA 1BOFA 1YVEI 4JC5A 5BQ3A 2VTDA 3L8GA 1BN7A 1YZUA 2H2IA 1VPWA 3ABRB 4XQGA 4EYEA 1BH6A 4KZKA 1SWWA 1YZHA 2VYFA 1SVKA 2QN2A 3MTIA 4V0LA 1QP4A 3LTEA 4B9AA 2H2FA 4HQFA 1CF4A 2O6HA 1XDSA 1WB9A 5EMMA 3B6KA 2QTVA 4KPEC 4YAEA 5FFFA 3WLKX 3SLKA 4I8IA 1MX9A 2E4UA 4GOOD 3C5CA 2BFEA 2QTVB 1I1NA 1WPRA 2YHSA 3PBKA 2ZIVB 4D7AA 1QAQA 4Z9YA 2BFEB 2XTMA 3F49S 3WSVA 2R85A 4KN8A 3PGJA 2DR2A 2XDYA 1LX7A 3FUTA 3MOSA 1VE5A 4C0QC 1N75A 3UC9A 1NVFA 2P68A 3PJFA 4L0CA 4EWLA 2Q28A 4OGLA 1B0AA 1J8DA 2VT3A 4AT1A 1Z8HA 3N74A 2M32A 1KE1A 1Y81A 4JYMA 3DMNA 1UANA 5LYJA 1W6RA 1HYEA 1ZM3A 2ACKA 3NIFB 3JVEA 5CX1A 4ZODA 1ADYA 3H8VA 3IAAA 3KJHA 1L5WA 3L8MA 2G1AA 1C0KA 4ZQBA 4ZVVA 5LYJB 4OQQA 5CX1B 1V8ZA 3BF7A 1DKMA 2GAJA 3Q9NA 4UVDA 2GHIA 1VE7A 1UK7A 2PO5A 5AVWA 4JZYA 4OHKA 3PQFA 2G08A 4WVLA 1OOEA 2NTJA 2NO6A 1N2CA 5FQOA 1W0CA 3RI3A 5H16A 2H9YA 2WEKA 2C5GA 121PA 5K8VA 3PNQA 5JY6A 1N2CB 4UEOA 5KC8A 3EFBA 3LHKA 3SBOA 2XA2A 4FN5A 3D59A 1J6UA 3OJXA 5JNSA 2I4OA 1N36B 3CKLA 2JA1A 2Z2KA 3GRAA 3QFHA 2ZBPA 1UP4A 4RQTA 3WK5A 4MITA 4CU2A 1UQTA 4FD3A 2R68A 3UH0A 2O59A 3H17A 1O0SA 1A2BA 3IALA 4RSHA 1I6WA 1HRKA 1VIMA 5DBFA 3M6IA 3X1MA 4EM6A 1OBVA 1ACMA 1GKKA 2PKQO 4IOJA 5JADA 1Y8RA 1QTQA 1ZU5A 4JUBA 4LY3A 4F84A 2UZ4A 1P44A 1D2CA 2GEFA 5EKTA 3MTGA 1Y8RB 5FBHA 1P5RA 1R0BA 4KYVA 4YPVA 3U31A 5L4NA 2WF7A 2NSYA 3SHWA 4DXAA 4LDNA 1UWVA 2P90A 1WZ2A 5FDFA 1SU8A 1UBHS 2FAXA 5E6RA 4N5HX 5FJIA 1LJUA 4CUKA 2DKNA 3ILVA 5I47A 4PHGA 4EFKA 1KJ8A 4WKGA 1WKBA 2PZ8A 4XTRA 4P4TA 1FXWA 4AJLA 2PUAA 3PPXA 4O4IF 4GNKA 3Q6NA 4CM5A 1Z2NX 2H52A 3QFSA 4QDXA 4A5OA 2WBLC 1V7QA 4X1KA 4HH3C 1Z6GA 1NDHA 2OILA 2OYSA 4MVJM 4UAUA 1IY8A 1SH7A 2UYCA 3GGCA 4X1KB 3GJ4A 2HJWA 1J8VA 3NO4A 1FSPA 1GPBA 5GVSA 5KVSA 3PC3A 1O6GA 4RDXA 5JI3E 2J0EA 1Z0ZA 3U6KA 2VQFB 2CL0X 4GM4A 5L4SA 1GCIA 2F1HA 2XRZA 1AUPA 2DULA 2V74B 2X8LA 1ZD4A 2DUNA 3QVSA 1FYXA 3FAKA 3NIBA 4M55A 1Z82A 1FJ2A 2HQ1A 1NQWA 4Q24A 2ID7A 1CDEA 3HRHA 2P5SA 3C0KA 2E4ZA 2WYUA 1PK7A 3P2EA 1DQNA 2QTRA 2XUJA 1PTJA 3ECCA 3OFKA 1FNSA 3OOSA 1MV5A 1W30A 3O8RA 2P79A 1XKXA 3U81A 1IMOA 4HAXA 2J41A 3I04M 2RE8A 3MJTA 2FW0A 1E4VA 2YJ4A 1SOVA 3IQIX 1UPTA 5T8KA 4KO2S 3VAAA 3Q87B 5CYGA 4UBOA 4X44A 3V5NA 1IH8A 4RIGA 1ODJA 3QVXA 4FGZA 1OWNA 3DDUA 3GJ7A 1L2TA 1AKYA 3RRMA 3SYTA 4NJEA 3ZHSA 2KYRA 5H0IA 2QRUA 5HM8A 3T5AA 5JQGA 3EVNA 3GRPA 1QANA 1RTKA 3OU6A 2JI9A 3EVEA 1CJSA 4NJEB 4BNJA 3PD1A 1YR6A 4DA9A 1ODIA 3FWNA 5JQGB 5KCZA 1CNEA 1WMEA 2FMKA 2W2TA 4XX1A 2CXRA 2GZHA 1MGOA 4RZIA 4ERXA 1YTLA 5JOQA 3E1KA 1U4NA 1GU1A 1LK7A 4WI1A 5DHFA 1ZP6A 2I1WA 3D0QA 3F8WA 1E89A 1SGWA 1ZJ6A 1MEOA 3IUNA 5DOZA 4BRZA 3TLXA 2JKYA 4E5KA 4FPXA 4Y9UA 3HBAA 4UOQA 4RY9A 4JA2A 3IO5A 3JQAD 1BA3A 3IPLA 3ORQA 4BASA 2GBGA 3RKRA 3S81A 1MXHA 4Q66C 4HJXA 3T3GA 5IN5A 1XDBA 2D5LA 3OCCA 5HILA 4D82A 3OE7A 2WUEA 5FNVA 2CDCA 3LKDA 3QG1A 1FMFA 4LYJA 1QP7A 4G25A 4MGYR 5BN1A 3CXUA 2I2XB 1KPHA 3I8SA 4MGKR 2X1LA 5FNVB 4JEHA 4M46A 3LS2A 5IT0A 4B6GA 1IUPA 3IESA 1SEVA 3I4CA 4MVJF 3DUWA 4D74A 3WQHA 4LBZA 1E99A 5SY4A 2VJPA 5I7UA 5HQTA 3IP5A 3MERA 4G67A 1Z6QA 2W11A 4C3OB 4LZLA 3TG2A 3U60B 3IT3A 3I0ZA 3T5PA 4OUKX 3A3KA 5KNBA 4NYMR 3VTFA 3L7YA 4PSCA 4CFZA 5AM3A 2BL4A 2GFIA 1AXEA 1JKJA 1VPDA 3R9XA 2P0YA 4P35A 5SZHB 4A0RA 1ZCFA 3EW9A 3DEAA 3IOYA 5G1NA 1JKJB 1JSZA 3HNPA 3BVPA 1OXXK 3R9XB 3HYRA 2I2AA 2OD2A 2BRUC 2QR3A 1EHIA 3TM4A 1A82A 4QULA 2PGIA 5IZ4A 3AM1A 1PV1A 3B1XA 1YKGA 2YDYA 3E82A 3B3AA 3OU7A 4GPTA 4IVNA 3MWGA 4OHOA 3SYMA 5EGNA 5TY0A 3QLTA 2GKGA 4JB3A 3PCXA 4L8VA 4UHDA 1SKMA 5G3ZA 4U0JA 4N49A 2QV7A 2H51A 3OO0A 1NF2A 3O9VA 5AKJA 3VVBA 1KO1A 5CDSA 3HUEA 1Q3TA 2BR4A 2GAFA 3ZIUA 4GQIA 1KFEB 4J9UE 2YMPA 1XYGA 3Q6IA 4RF3A 3U3KA 1DBSA 5DTRA 3ZNOA 2IA5A 5JO0A 3KXIA 1PD0A 3S2FA 1PZMA 1DKPA 1UXIA 4H7DA 3WXBA 5C4GB 4DRZA 1FX1A 1Q74A 2YXNA 2O23A 3RC9A 4E4TA 4HNAA 4ONEA 3P71T 2GZ2A 3O3MB 3GT0A 3R23A 4LOJA 3QXJA 4HNAB 1FPQA 3OZVA 4HBGA 1VLQA 1ZUWA 1VCHA 3FGZA 2WJGA 2ZETA 5AQ1A 1DIBA 1PF7E 1X1RA 4OQFA 5AKHA 3UMMA 4LSWA 4NPCA 1OQAA 1SVIA 4N8SA 1IY2A 2VC2B 2ZTHA 3DMTC 3NRJA 1U7WA 1WUIS 1Y4DE 2GDZA 3AYXB 3DDZX 3TSOA 5AVVA 4NH0A 1V47A 2IUSA 3IAM1 1KKUA 1U0OC 4E09A 3KELA 3Q2OA 3JAWA 5K0TA 3DOEA 3NFRA 4K9DA 3MW8A 4CGYA 1T13A 3JAWB 1HYGA 3B6MA 2GWHA 3FGOA 3OA0A 5B1HA 3NNSA 3TR0A 4CDRA 5CIYA 2P1ZA 2Q5QA 3A2KA 1B8NA 1H5QA 4DLWA 2XMQA 2J08A 3TIXB 3DT8A 3O8DA 5AIBA 4A15A 2XWBF 3AF3A 3EJWA 4FD2A 1ZINA 2G0AA 4JBNA 5DLDA 5UKDA 2QMQA 3GX1A 2HIMA 2RC6A 4BNMA 4PTLA 3BQNB 3MT7A 4IIVA 1NV8A 2BC9A 1UJ5A 2F8TA 1PR4A 2YW2A 1J4AA 2D1RA 4Q9AA 2HGSA 5E7QA 3OQHA 2ZJFA 3PKIA 1EAYA 2WJAA 4W6QA 3THSA 3BQMB 5K3FA 3I2FA 2CHGA 5CFRA 1Y6JA 3SKYA 1K27A 5I51A 1W35A 1K4MA 1B8VA 2GCOA 1Q57A 3IGFA 4IRUB 4JT8A 5K3FB 3KZMA 4N5DA 5A1JA 1JDBC 1LS6A 1VHJA 5CDTA 1DIRA 5EIAA 2GCOB 1CQPA 3V4FA 1O94C 3URMA 3CURA 4YRNA 3HEMA 1ZK4A 4TTPA 3U5ZB 5JE8A 4BMPB 5D7NA 3B85A 3IT1A 2ZB8A 2J48A 2PMKA 3R3SA 1IN8A 2IXEA 3U1BA 4YT2A 1M1YE 1G18A 1S01A 2RHCA 3RIEA 3ESXA 1VGVA 1LFDB 3CT6A 1BH2A 2OGTA 3ESCA 3P9RA 4N3NA 2I55A 4NBUA 5AOBA 3G0BA 2BE7A 1YRWA 1EFDN 4RZQA 4CVNA 2R7KA 4PLWA 1IZYA 3RS2A 3C7TA 4HN4B 2P3OA 3NHPA 1KZHA 3GJYA 4ZC1A 3VZSA 3DVQX 4IMPA 4AKSA 4XJTA 2QTFA 4D57A 3LQFA 1YI1A 3WOVA 2G5TA 3I6MA 5CDFE 2Z43A 3C74A 4Q3DA 3C8HA 1XTQA 2ODBA 1QQ7A 1HDOA 4CEJA 1KEVA 1N0WA 5JAHA 2EATA 3FZEA 1E9AA 4M8LA 5JUWA 5D8DA 3MUNA 2FTKE 3NPMA 4CEJB 1JWLA 1BCSA 4DC1A 2ASVA 3OUTA 3OZUA 4BEWA 3HXOA 1OZAA 3E18A 3EC2A 2HLPA 4OHUA 1RMQA 2HD4A 1AKRA 1BCSB 3VNQA 2QVZX 1VMKA 2OORA 3CG4A 2HDWA 4KV7A 5HKBA 1EGHA 3LQQA 1PO7A 4GXQA 3GPDG 3EK2A 4C0WA 2CCGA 5EJGA 3FTQA 1DCTA 1NIPA 4RVSA 2ZUTA 2OBLA 2UZ0A 5ECGC 2P5TB 1SVNA 1C7QA 1Z22A 1A0OA 3JYHA 3PPWA 2QM0A 4LAFA 4C14A 1UMCA 2HJHA 3ZBTA 1NQTA 1PWHA 2NSLA 1H2FA 1LPSA 1OGJA 3OM1A 3OPNA 3AEQA 4X3PA 2YWHA 4F2PA 5B7NA 1UMCB 4TL6A 1BOOA 2W8ZA 4RX1A 4RJLA 4AG6A 3AEQB 3P9SA 4DLVA 5LVAA 1GL6A 4BKOA 3QQ5A 3R6GA 4RDCA 2AH5A 1JMYA 5GZ6A 2OXEA 2JZNA 1V25A 2CHEA 3D2LA 4KQ2A 4CKYA 4CODB 5ES4B 1UKZA 1K8ZB 3M5PA 4YRGA 3RS4A 1R18A 1PL0A 2WAAA 3ORFA 3LUFA 4HGPA 4RZ3A 3RWOA 1XWIA 4WCDA 1RC8A 1P1KA 4WINA 2B9EA 3TVYA 1CTQA 2ENWA 2GEDA 3A10A 2O2CA 1KFJB 1WUJS 5F1YA 2RI6A 2IH2A 1C7IA 1G16A 1MG0A 3MXOA 2CD9A 1UODA 2ZIAA 4S24A 4B6RA 5DM70 5ELXA 2ZI3A 2EG5A 3N8HA 4XEHA 1ES9A 1D4FA 3RV4A 3TVTA 3KYJB 4TLCA 4ZT2A 3BGIA 1NC1A 1WVIA 3DL4A 3IVAA 3A70A 1A5TA 1LI5A 3PUWA 1JPNA 4FX5A 4EQZA 3AG5A 3A9TA 1VE6A 3Q8XB 4JV5B 1VLVA 2BFFA 2D0IA 3DZJA 4KPUA 4PG8A 3Q8KA 1JAYA 1FUUA 1HNWB 2RHOA 3ZJTA 2BFFB 4KGXA 1CD5A 1LNQA 1NJGA 2WNSA 4KPUB 2HKIA 1Z2CA 3V1NA 3SVZA 1T0BA 4OLAA 3SM3A 1SUFA 3B53X 4PX2A 5DTJA 4Q9IA 2XIJA 2PL5A 4TN1A 1V2HE 1YV9A 2WJJA 1QPZA 3GAZA 2FX5A 1JU3A 4NONA 1TB4A 4RIEA 5FBVB 4DPKA 1DRWA 2GUWA 4ESHA 5IBCA 2GRAA 5K3CA 5CXUA 1UH5A 3QVLA 4IFTA 2OZKA 2WWTA 4B7ZA 1PFWA 4DJDC 3L04A 2GX6A 2X14A 3FNEA 3VDRA 4YC7A 4C78A 4DSTA 1L4KA 2QY6A 2WF8A 3C7CB 1XZHA 3G0OA 4RETA 4C04A 1RAIA 2JNWA 4JJIA 1ZD9A 1PR3A 4Z0TA 3SIPA 2DFTA 5DNVA 2RGXA 3HZOA 4YMHA 4Y2PA 1MC8A 2NTNA 3EY4A 4TUYA 2AXNA 1FX0A 3CX3A 1NNI1 1OHHA 2IX9A 1CUIA 3DDNA 1C9DB 3GNLA 3N0VA 4H27A 4NOKA 4YRFA 4TUYB 1XNRB 1L7MA 3TLGA 1FX0B 2PX6A 3FROA 4WFKA 4OXIA 2H1RA 2J4CA 3NLLA 4XD7D 3TLGB 2WSMA 2AC7A 4HCJA 3QYJA 1T8TA 4HXGA 1V2GA 4AJJA 5K0GA 2XNDA 1JECA 5CM8B 2VCEA 3I12A 3ZXXA 2FJUA 1Q19A 2WT9A 3CH5A 4V0ME 5E1DA 2PRJA 3EUAA 3WR5A 4OLJA 2C83A 1E1QD 4E46A 2WTNA 4I1OA 1OI4A 2XQJA 3I05A 5DGIA 1UDAA 2UYYA 1CS4C 1QWSA 3ZHBA 3EAFA 2DVMA 2XMGA 5E7IA 5JAOA 4ZO7A 1DTWA 1L0BA 2YS7A 3C3BA 4RK6A 4XDGA 3V8PA 3OZSA 3J7TA 4HVLA 3RGWS 1DP4A 4JD5A 1DTWB 3DMPA 3HXLA 1A8QA 3OOWA 4IZ6A 3SJUA 1ZITA 5CW2A 3PYXA 5KMGB 2J5RA 5GJBA 3KT6A 4XIIA 1E96A 1UMDA 1XQYA 5DBGA 4MVJD 4YREA 2IELA 3KYCA 1DXYA 3GT7A 4XLTA 5AJYA 1B4DA 3AIIA 5JQWA 2XUOA 3ADPA 3DGFC 1UMDB 2EXXA 2LR0A 3N70A 4L5JA 4QE3A 4JDUA 4UTPA 4RY0A 1ADJA 5SV2A 3U3JA 3TNYA 1YVUA 3KU4A 4RD1A 5IFLA 1HDYA 1IUKA 1WDKA 5KNDA 1RCTE 2QRKA 2QUBA 2WE7A 4Q19A 2FMIA 3OIUA 1C0IA 3QE0A 5IARA 2AFHA 4QPDA 6YASA 1G63A 4MUHA 4YAJA 3NTLA 5M7EA 1JHOA 4Q7MB 1T8WA 4XI9A 2AFHB 2XA1A 4KSBA 5EXPA 3RFVA 1TYBE 5DZSA 1UKCA 3EEQA 4JP5A 3U7GA 5INTA 1GAQA 2YMLA 2Z5GA 4HFNA 1H4VB 3IQXA 2FDRA 2FRDC 1P2UA 4XCXA 4MVYA 4KQWA 4L08A 2ECKA 2OLEA 2XNJA 2ZI9A 3M6LA 2PAAA 5DV9A 3V9PA 3AESA 5B7PA 1CP2A 4E11A 1XF1A 4DM7A 4OHXA 3CYFA 2I87A 1RPAA 5IC5A 3AESB 3QBJA 1ZIYA 1DOZA 5IMBA 2QRPA 4R2HA 3NBMA 1KMIY 1T5OA 1NBIA 4NLLA 3UUFA 5JROA 3GXBA 1KOGA 2WF5A 2Y0PA 3F5SA 2R0QC 1YQQA 3EPPA 2SECE 3GY0A 3C8UA 4ML3A 2AI3A 2VDMB 3N8DA 2O1WA 1G8AA 1Z9BA 2RI0A 2JI6A 2F48A 3FFWA 4UHJA 4BBZA 1N5OX 1J42A 3N2IA 5A9TA 3L3BA 5J23A 4B31A 2I8CA 4A5SA 3Q0TA 3OX4A 3WKEA 1E9EA 3ABQB 4CXMA 2Z9CA 2H1WA 1DBQA 1FFEA 4DEVA 1QGED 1N2CE 1LK5A 4AWBA 4ZT7A 1NX6A 1VJDA 4FEYA 4MUIA 4E70A 4E08A 5F3RA 4RA9A 3O1HB 4YJ2A 1NKSA 1RWNA 2VDRB 5CJJA 4M1OA 3REQA 3IIMA 3NBKA 1TKCA 1K06A 1L7AA 1TEXA 2CMGA 4RA9B 3SEFA 1DC5A 2NQ8A 4YRIA 1UJBA 4KMMA 4WK0B 2FN3A 3CV3A 3E7DA 3GG9A 2DRIA 2HREA 3ZU3A 3T3DA 1VHDA 1RW4A 2ZRIA 1C1DA 2F4NA 5DE3A 3GA0A 2W2KA 4K6KA 2VP9A 2JI4A 5H4HA 3TBFA 4MVWA 1QIGA 2HXYA 3PNYA 4M21A 1B14A 1TJYA 4TYPA 2V7GA 4IV0A 1NM5C 5DULA 4UNRA 5HIMA 1KPGA 1I80A 3QWAA 1T5SA 4PYNA 4H6XA 4US0R 5HBGA 1NW5A 1OZGA 2ZJ3A 3L7DA 2PCJA 1ESZA 1KZ6A 1HA3A 4TWIA 1T36A 1YS4A 3CUYA 1GXSA 2OCIA 3D3EA 2VZ8A 4RD3A 1T36B 2E4XA 4QA9A 1GXSB 2MR5A 2P6OA 1Y9EA 2X0NA 2G06A 3CHYA 2Q4BA 3CONA 4H35A 4UMVA 1JHVA 1QC5A 2EVWX 4BTVA 2XQKA 2GNPA 3PHHA 4J49A 2PX8A 3I9FA 5AXBA 5AVYA 4FB5A 1GGVA 1ISSA 1QC5B 1R6VA 3H84A 5HFJA 4P3KA 2W2OA 5KYKA 4ZIRA 4UULA 4M98A 2H29A 2IHNA 2VWHA 1EBBA 2VHUA 4M8KA 3TJZA 4BN0A 3K0KA 4ZIRB 4IJKA 2DBRA 3E2MA 4YRPA 1IATA 3P32A 1WG8A 2UVPA 4INJA 1ZIPA 3GPIA 1GTL1 1AE1A 4AIRA 3FHTA 5B1EA 1ADBA 1KAMA 3H1GA 3LBFA 2UVPB 4LJ8A 4B1FA 1P3JA 2UXBB 2OO5A 4DJAA 4I9UA 3RS8A 3MGAA 3HWRA 2FZKA 1WY5A 1USWA 2ZT8A 1N3YA 3HUFA 3DMTA 2QUJA 4R69A 2VF7A 2QZ9A 5EWJA 4CG1A 5C80A 1K75A 3KOYA 2ZSEA 1H8HD 1S7GA 1YB5A 1CFJA 2WIJA 4OXNA 5DBOA 3RS7A 1FFGA 4JKOA 5EWJB 5A4FS 2Q2NA 2OM6A 2J3IA 2WJYA 3CVVA 2DU8A 4KLAA 3KXLA 1QHIA 4IQFA 4AECA 4OL0A 5ITZA 2AN4A 3WFJA 4A2CA 3CA8A 2Q5OA 1JJFA 1PQYA 2QL7A 4BO8A 2DFPA 1Q21A 2CD7A 1CHNA 1A95A 3GDOA 3P97A 1N1GA 4KRGA 5ITZB 5F21A 2IUFA 3QLJA 2WR8A 3FY4A 4P3PA 1T6YA 3NVKI 4NNOA 2IL1A 5ALHA 4YRSA 3NT2A 1SQSA 2E9SA 3E27A 3GBPA 4Y6OA 5F5LA 4YY3B 4N76A 4ARCA 1G5TA 1U02A 4HTAA 4DEXA 3VKWA 7MHTA 1AGXA 2Q3MA 2QK4A 2XYHA 3H2JA 4KO3S 4M0UA 4ZTUB 1LQ2A 1ORDA 5KJ6A 4FM9A 1I1HA 2ADOA 2COEA 4D8YA 1A27A 2RHWA 1V3VA 3VO9A 4QAQA 1KZ9A 1MB9A 2AEFA 2WWIA 3NGLA 1EE1A 3QH4A 5DLYA 1DC3A 2TMGA 4F2DA 1C9EA 2P2GA 3W5JA 3ZZ0A 5KUTA 3F8TA 3U44A 5CK4A 3SOPA 1G5QA 3E7FA 3K70D 3NHFA 2Z3VA 4ENQA 5JO9A 5JXWA 2IZZA 2BP7A 3U44B 3KKQA 3JQ7A 2GA8A 2FGKA 2NUTB 3EHDA 2OG1A 3LLUA 2BP7B 3V3KA 2QTAA 1MORA 1RM0A 2RIRA 3FPHA 3JQ7B 4O2AA 2IHKA 5KQRA 2PU7A 4FR0A 5KYWA 2B21A 4J4TA 4LJ6A 1WZEA 3LUJA 2REBA 1HE3A 2I7CA 3T1VA 2GD6A 5KYWB 3T3NA 3ZHOA 3G89A 3UJHA 2HV9A 1SB8A 1E9DA 2D2XA 1EQAA 5AM4A 3UQYS 5BWLA 2P8JA 4G5SA 3VYTB 1CPYA 3KPYA 3ER9A 3F6BX 3L7MA 1U90A 4HAVA 4WOBA 3LV8A 5LP1A 1LRKA 1NQAO 1TVCA 3RFUA 3TCKA 2AOXA 1TO6A 4DV5B 3QF7A 2B3DA 3WRVA 1N6PA 1CV2A 1V5GA 2OXCA 3EAGA 5LBTA 3ZEIA 2GESA 3EH2A 5IUJC 1T3LA 4CCSA 1QTRA 5DGTA 2J5BA 3CRW1 4L51A 1Q1GA 4WX2B 3UWMA 1FJHA 3F8SA 2G07A 3PK0A 4RQUA 4B0OA 1GGKA 3JQGA 1YJBA 4K6HA 1OIVA 4OM8A 1L7OA 2GAIA 3FKQA 5JR3A 1JJVA 2G04A 3HN6A 1JHXA 2IE8A 3A3PA 2QQ5A 3JQGB 1D9ZA 4B40A 2QXTA 5IULC 2ACEA 4DZTA 5HDQA 1B76A 1U2TA 4MYRA 1NVVR 4M1YA 1XAGA 6NULA 1GIAA 1WZUA 1X1TA 3AP1A 3UYKA 3EPLA 2HHHB 2XQGA 3FXAA 4R9SA 4Q12A 3TPFA 1W19A 5A5GA 3ZWOA 3UXEA 4YYZA 2XA9A 1IQPA 2A9OA 2R2AA 5I7OA 4TXHA 3E3OA 3MVEA 3JRNA 3PGA1 2PGNA 4Z1MA 2HWKA 1K7XB 2W6MA 1BS1A 2N1MA 2YHBA 2QP3A 1W94A 1QJCA 2B0CA 1FDRA 1O4VA 3U4QA 1TAGA 2NZYA 3FSJX 3ZN2A 2P9QA 1XYVA 4X85A 3GPCA 4HH0A 5AM2A 4RMNA 1H2XA 4ODIA 1UJMA 3ZCXA 3OZGA 4AJKA 3ZZ1A 3U4QB 3R6TA 5A9RA 2V58A 4E51A 2C9BA 3AB7A 2VWGA 3ED1A 1SU7A 4M0EA 1Y1TA 4EI9A 1BKYA 5C53B 1UPUA 1ST2A 4NZNA 4OFZA 2PU5A 2AQKA 1SBQA 1THGA 3TYXA 1L1RA 4HB4A 3RFXA 3FPGA 3R0QA 2HCBA 2G5PA 5IDQA 1UXJA 2JFVA 2C42A 4TS3A 4CYMA 3GDFA 1NJ1A 3VPBA 1JJBA 3SX2A 1LDEA 1IC6A 3JWIA 3JU3A 4U7PB 1B26A 3E7XA 2YV3A 3OT1A 4R1NA 1YUNA 2X4IA 4H17A 2YRWA 4P3XA 4QXOA 5JSHA 1A2OA 5CTAA 1F0NA 2XHEA 2OVFA 3CZ5A 1W93A 2W6IA 3OT1B 3UOWA 2WFAA 4HB0A 4A2WA 3HO1A 1IZ8A 1RYZA 1Q17A 1YRLA 2OCGA 1N2BA 3SGLA 1L7VC 2O8EA 2BOVA 5KYXA 3HL4A 4OI4A 2CV1A 4BFTA 4K2AA 2YYYA 3F3SA 1MD9A 1PFKA 2XVZA 2O8EB 5EFOA 4OHMA 2ZYAA 5KQGA 5KYXB 4OQXA 3SU8A 4YJ3F 1XNQB 1BRMA 4F1WA 1BD4A 2H2AA 4JP2A 5A0FA 1N5KA 1PGNA 1T3ZA 3U2QA 1BN6A 3PT9A 4CHGA 5LU9A 3CZ4A 1V4NA 4ZYUA 4A73A 3LRXA 1HE2A 4F4FA 1SK8A 3N5CA 2PQ6A 1HH4A 2FFJA 3PHGA 4PIMA 4PVCA 3PJRA 5B55A 2JHAA 3P2JA 1R8JA 1YC2A 1R1DA 2H57A 2H5IA 1EFTA 4ZOCA 1HNZB 5ALSA 4BMVA 4D4MA 3GUUA 5JCJA 1Z47A 4JR2A 4O0MA 5I9BA 2EP7A 3LYUA 1WJGA 1UKVY 4E2YA 2OOKA 2AMLA 1G8JA 4R3UC 5AVUA 1CQIA 1VJ1A 2FY8A 1TEHA 2OD9A 3DYBA 3HV2A 4N0PA 4PPFA 2HQOA 5FL7A 3TTVA 5DO9A 4UMEA 1AO0A 1CQIB 2FW1A 3GLRA 3N87A 1Q3KA 4HDKA 1E2IA 2GBPA 3RU3A 2CWWA 4P38A 2VK8A 1WS6A 1LLQA 2QEQA 2VPYA 1TFRA 2GH1A 1DIOB 2I3BA 1PIWA 2WJIA 4HDKB 3VDNB 2DBYA 4UZFA 1OREA 1JB9A 4DTIA 2ZG6A 1XO1A 1XZEA 1UBFA 3H0CA 2PGOA 2W9XA 2DWOA 2ZWIA 5HFAA 1L7QA 1PE0A 2QVGA 3B60A 5IM4F 5LMUB 1HL3A 1K1EA 3TLZA 4YRBA 2C29D 3SEAA 3Q0IA 2DT8A 1JI3A 1DV1A 4PSVA 4A91A 4CM1A 3M5CA 4DIUA 1KVUA 2V6JA 4HVTA 5K3OA 2YYZA 1JSXA 2JCGA 4G5OA 2CFSA 3ENVA 4MUNA 2I6XA 4IO1A 4N9QA 5CVVA 1P81A 3WMWA 5JZVA 3R0XA 3BMCA 4DJTA 4DAOA 3V9AA 4F8JA 5JLJA 3GHHA 2D06A 4IRMA 4MKGA 3AEZA 2NX2A 4MCHA 5LJLA 1NLYA 1K3FA 2FA9A 1XKLA 1QVWA 2XTJA 3GZJA 3BMCB 1GPWB 1IHXA 2F1IA 4L02A 2H7CA 4FNGA 1UR5A 3ZU6A 4YV7A 1OXKB 2YN2A 1U04A 4HR7A 4L6AA 3PFNA 3EPJA 4JS0A 1QGZA 1B2LA 2CVHA 2EFCB 3Q11A 1FDWA 3WV5A 1G8YA 1ECLA 5AKXA 1ZICA 3JARA 4DLUA 4JC8A 4DSUA 3ONNA 2JZOA 4BJ1A 3JCZA 3DXYA 4HYEA 3UGQA 3JARB 4DGQA 4BQIA 1W7AA 1AGPA 1E7QA 1KGDA 3ZJ5A 1UF9A 2BPOA 2IP1A 4FDUA 4FYWA 5DX0A 1XGKA 3GJ8A 1J2TA 4FJ1A 4RESA 5EY5B 3TSZA 2WF9A 1GZ3A 1BWSA 1S0UA 3IEVA 3QKSA 1KMNA 1ZRSA 2X7JA 3PRYA 3BJMA 3ZE7A 1MA3A 4FMPA 3UAOA 5M5BA 4GSLA 3JQDA 4HJRA 5JTUA 3QKSB 1BC5A 4OIMA 2PRYA 3L79A 1EGVB 4CN8A 1WDTA 3O8QA 1XMJA 2X4GA 2V54A 3G1UA 3K15A 3OICA 5LZ8A 1BU8A 3NNDA 5TNXA 4E5DA 3O8QB 2ZU0C 3TLEA 2Q5EA 5ESDA 6AT1A 3WB0A 1JLMA 4AY3A 2P77A 2QN6A 4PO1A 5TMEA 2GKSA 2GVDC 1B8OA 2FLWA 5BNZA 3ROZA 4YXFA 5ENZA 5GM2A 4BO4A 2P1RA 1S8FA 2PR2A 3GCGA 3MMNA 3OTIA 4B3DA 2G72A 2V7VA 3CX4A 3OJOA 1VKRA 2AN5A 1T5IA 1A9OA 1T5DX 3HCWA 1OLSA 3JQ6A 3KJQA 4HLDA 4LEIA 3KT3A 3RHFA 3C70A 1PNQA 4RPKA 4AM8A 5HTKA 5JDCA 1EDDA 1OLSB 1E2NA 1DIGA 3CG0A 3NWOA 3QRWA 4QREA 3ZWDA 1PNOA 4UNSA 5FWAA 4F2GA 4FN4A 2C0PA 4QWMA 2CDRA 4Y2JA 4EZIA 1B74A 3FX2A 1U2ZA 2YDXA 3AY6A 1LF0A 2G82A 1VIYA 4ON9A 4IJQA 4H7JA 2VNAA 2Y1EA 2PZJA 4RHXA 5CCDA 4AC9A 2MIIA 4ZJZA 2XT9A 5AJXA 1XN4A 5KYTA 3UM9A 4L4SA 1GA1A 1RYEA 4U9HS 5B2ZA 4XFDA 2GO7A 3RT7A 2E4VA 5FWYA 2EL9A 1GYQA 4PGAA 4WA8A 5YASA 4Q4CA 3NTUA 3DS8A 3WKCA 5FWYB 4B80A 2PR7A 2QP9X 1FVOA 1OXTA 4WLFA 2G77B 1BGWA 5IKEA 3E23A 5K6AC 3PF9A 5J4LA 2PJZA 3H3XA 1VHWA 2H8GA 2VDOB 3BEOA 3W79A 4OI0A 2XQVA 3P4XA 4O4IA 3FTCA 4DDVA 3KUXA 2V96A 1RLUA 2VDLB 1EXWA 2VUUA 2ZXEA 4JLWA 3RR2A 5KTOA 1J2UA 4O4IB 3PYMA 5CLIA 1KEEA 3VKUA 1KMCA 5BSTA 4BX8A 2GHTA 3GEEA 4OXQA 1KEEB 1KJIA 2EJCA 1COZA 1J25A 4C5BA 3K2BA 4QKQA 4DQVA 4BPBA 4PZEA 2AFVA 1DIAA 3WK9A 4C0XA 1I0LA 4DUGD 2Z2YA 3NONA 5LMNB 5D00A 1PAUA 3V32A 1KIMA 2YTZA 5F98A 3TTYA 2VSYA 1K8RA 1JRLA 1A4XA 4M83A 4R54A 4WCVA 1CEXA 5JNLA 3Q7EA 1BXRA 3PR3A 4R41A 5DP2A 4DVJA 2BMJA 2YV5A 5DMXA 2O8BA 1R6TA 4P7KA 1BXRB 1NW8A 1Y7IA 2Q3DA 2O3JA 4JLBA 4WHMA 3X43A 5GADl 5SICE 1HL7A 2O8BB 1WY7A 1UEIA 3KXDA 4GSKA 1Y42X 4DL9A 4GSYA 1LC0A 1L1QA 1D2EA 3GLQA 1OFUA 2KS6A 4DPMA 1NSYA 3O4VA 4EO4A 1APBA 4AK9A 4EJFA 1F17A 2P9HA 4IOLA 3B36A 1PYOA 2ATVA 1T3TA 1I1QB 1QO9A 4NG5A 5TQ2A 2HEGA 4ZDJA 3OQPA 2AGVA 4KIJA 4LCJA 4NDZA 4NBKA 3OETA 2Y1OA 3WIOA 4CEHA 4C4YA 1F2VA 4DDHA 2JIDA 5TQ2B 4D44A 2DGDA 2ID4A 3KUKA 4QQKA 1WWKA 5EQFA 1HC7A 1FFXA 2ZBGA 3EVGA 3ZWQA 5B2FA 4P3YA 4LZOA 3G2IA 3IMKA 1PJAA 5JISA 3AHJA 4H1WA 5KHAA 1AQUA 1EP3B 2DQKA 1FFXB 3HWWA 1MOSA 2P9CA 4JL6A 4MWTA 3MS4A 3PEWA 3I9MA 2ZGVA 1LF5A 3P9QA 1KY4A 1M83A 2O14A 1LRLA 4NJOA 2XMPA 2C9CA 2HXGA 4WJZA 3GDWA 5HP4A 2P0AA 4UVHA 3F6RA 1A5BB 2QG6A 4GDMA 4WEQA 4CLDA 4HYTA 3P9YA 2G5GX 3ZQKA 1W76A 4BJ5A 1E6KA 5J4YA 2I4TA 3K1AA 3SJCA 1A7KA 4GYJA 5AICA 3RC3A 4AJOA 4IBOA 3M1AA 5BXYA 4NR0A 2HM7A 4PU0A 3K1AB 4MVJA 4RVUA 1KQ3A 4A03A 2PA0A 1E61A 3OFSA 3Q9UA 1DUIA 1N1DA 1VPLA 2KE5A 4HNSA 1TDJA 1DIHA 4YO8A 1RQXA 3EISA 3QKIA 5B1IA 1INLA 3VKVA 3PUJA 4RORA 4Q9LA 3A1UA 4AJ9A 2V5AA 3QE4A 3EVAA 1DAMA 1RM4A 1TM5E 2J6CA 2R5FA 2YFQA 3CLVA 4LYGA 4O02B 3SS8A 3IEMA 3GFQA 1XLVA 2VBCA 3ORHA 1OU4A 3R5XA 3O7MA 3JD0A 2XDWA 4TTVA 2NTEA 5FV4A 3UJ8A 4G63A 2OQ2A 4WH0A 5MHTA 3KQQA 3WYEA 3L1VA 1NW7A 1MT3A 3AM4A 4AKEA 2FPPA 4CRWB 3C3KA 2HMWA 4UDXX 1LPAB 3I04A 2JRLA 1M0EA 1RXSA 1X80A 4B73A 2FPPB 3DAYA 4URWR 4HUQA 3NHMA 1X80B 1DFGA 1M2GA 1GV1A 2BEUA 3KJIA 2YFYA 2H4ZA 4PHHA 4HUQB 4Y7DA 1CNFA 3DC2A 1AQJA 2BEUB 3PIIA 2CDBA 4EMSA 2QSYA 1VC2A 1A9YA 3B1JA 4XB1A 5CJ2A 3CEHA 2A92A 2XAUA 1LS1A 2XADA 4S1TA 2YIVX 3HKCA 3OE5A 1CQZA 4MQ5A 4X64B 4ZVLA 3P2IA 1P9WA 2GN1A 4MRNA 4YROA 3G5LA 1LBTA 4G36A 5I48A 1ZPDA 2GCPA 2J7KA 1SC4A 5J59A 2OK7A 3IO3A 3WYAA 4IHQA 1N2HA 5IJ9A 4W7IA 5HRUA 1BW9B 1FNNA 3OURA 1DOHA 3OESA 5IJ9B 2HLNA 1Y0BA 3EARA 4X3CA 2I33A 1OFIA 4PONA 3VR5D 2R11A 3DR3A 3PHCA 1V1JA 1MEJA 5FADA 1H23A 2DWQA 3CNNA 3ZI4A 2Q6TA 5JAMA 2FH5B 2WLSA 3HADA 4UBJA 4XIGS 1NUSA 1GU0A 3WMFA 3D64A 1AHHA 1UJ2A 5HKOA 3ZZUA 1CRPA 4NBWA 1SXQA 1XTVA 2ZRBA 4FQ5A 3PYLA 4OM7A 1GAJA 4CM4A 5AI9A 3EFOA 1DQPA 4YP0A 3GGSA 4WK6A 1LDYA 3DEIA 2WG2A 2GEKA 1KJJA 3H9EO 3HZZA 1QO7A 2BWJA 1Z2AA 3EFOB