3RNOA

Crystal structure of mouse apolipoprotein a-i binding protein in complex with nadp.
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
233
structure length
233
Chain Sequence
AVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSKSPPTVLVICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTGLVTQCQKMDIPFLGEMPPEPMMVDELYELVVDAIFGFSFKGDVREPFHSILSVLSGLTVPIASIDIPSGWDVEKGNPSGIQPDLLISLTAPKKSATHFTGRYHYLGGRFVPPALEKKYQLNLPSYPDTECVYRLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apolipoprotein A-I-binding protein
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 75
structure length 233
sequence length 233
ec nomenclature ec 5.1.99.6: NAD(P)H-hydrate epimerase.
pdb deposition date 2011-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3rnoA00
3RSGA 3RSSA 3RSQA 3RTAA 3RT7A 3ROZA 3RTEA 3RTBA 3ROXA 2DG2A 3D3JA 1JZTA 3RNOA 3RS9A 3RU3A 3RRFA 2AX3A 3RO7A 3RRBA 2O8NA 3RTCA 3RTDA 3RU2A 3ROEA 3K5WA 3RRJA 3RREA 3RT9A 3ROGA 3D3KA 3RS8A 3RTGA 3RSFA
chains in the Genus database with same CATH superfamily
2PX3A 3UXMA 2YBDA 2GHQA 4U8GA 5ICGA 2NPOA 1RADA 4W8OA 5EERA 2ISCA 1RXUA 3AWIA 3GVHA 3I42A 3TPCA 3BTUA 4Y7CA 3RIHA 2MYNA 3IAS6 5CYGA 2VN8A 2JJ8A 1FCJA 4P3YA 1EFVB 3SBOA 5LVAA 1Z0DA 5BQFA 2PL1A 3BYZA 3TLKA 5ICSA 3FPAA 2AQKA 5CD9A 2OXFA 4H27A 1SJ9A 2C3MA 3KZOA 1M1YE 2FFRA 3PFIA 1H65A 4C3UA 4JQSA 1VLMA 4CTNA 1ZVJA 1G21A 2CYCA 3FOAA 3KV3O 4LOIA 1T26A 1ZITA 2P6UA 5DNDA 3EVZA 1J0AA 2GPWA 4UZEA 2I3ZA 4FILA 1PNQA 5EXSA 3N28A 2ECKA 3K5HA 4CN8A 4L5CA 2LKDA 4ZQHA 1JJBA 1P0PA 2OQIA 2R4UA 1SQ5A 3F96A 3LFTA 5FCDA 2OQVA 4RTKA 3WADA 5T7BA 2DCUA 1YFZA 3LU1A 3O8OB 3D1VA 4WY8A 5HVNA 2PXHA 1KK2A 3P4UA 2XXAA 4K0KB 2AC4A 4B71A 2O2HA 4TZTA 1T6ZA 3KETA 1ATIA 2E4UA 3KLMX 1KDOA 4Y2UA 3FRJA 1QHHB 4C0WA 5K0CA 3GH3A 1ND5A 2CVHA 5EXTA 2GZSA 3AP2A 4J7XA 2A14A 4IX1A 1FBTA 3IILA 4P2GA 3RSFA 5C8VA 3DEHA 1KEUA 1FJXA 1A8PA 1B42A 1WNTA 1P7WA 1TJNA 2PGOA 4H1UA 1QLHA 1HV8A 1Q1GA 1BHSA 1TADA 2Y4OA 3RUDA 5DCYA 1TO2E 2F67A 3SCZA 1T3ZA 3LBIA 1HT3A 4ENPA 3KEQA 2VWQA 1PO7A 2DY1A 3RS0A 4TLDA 3SKXA 4JB3A 1EFRA 3JQAD 1P77A 2G8NA 2QN7A 3BJRA 4CWAA 5IN4A 4EEXA 2C8LA 3KE8A 5AVTA 1PR4A 1NW6A 1DDOA 1OX6A 3T3PB 3ZU6A 4F85A 3K5WA 3N58A 4ZAYA 1ORHA 4XVUA 4Z1MD 4MVJF 1Y8ZA 2ZSUA 1W0JA 4Q05A 2CJYA 3K0EA 1U0RA 3QI7A 5DKFA 3E23A 1Y7TA 1ZWKA 2Z30A 3EPRA 4YI3A 3TB6A 4DUPA 1MO2A 1N2OA 1VMAA 3BGSA 4R7ZA 4UUOA 5LXTF 3DW3X 4ZAXA 2W9XA 2WM3A 4RTMA 3EUAA 4MAMA 5BNZA 2BM9A 4BE9A 3A6FA 2VSXA 3AIMA 1GRCA 3QXSA 1KEPA 3QEOA 1VDZA 1VL0A 3B6KA 2G83A 4IH4A 3TL3A 4YRCA 4KFCA 2JLVA 1QHIA 4F0JA 2Z3VA 1HE1C 4V24A 3EEFA 4ROSA 1W5FA 4W1RA 5H16A 3JALB 2BFDB 4F9TA 5AW3A 1G5TA 1RC0A 4M49A 1TQHA 3NZEA 2Q6KA 3ZX4A 4HLNA 1L7EA 1HNXB 1XPRA 1MX1A 3FSJX 4OXQA 4W5OA 2B35A 1T35A 2BISA 1PF7E 3HKEB 5IUJC 2P2LA 4G9GA 3O93A 3ESRA 1W1WA 2ZRIA 1PZXA 1RBZA 4R1LA 4XEUA 3I5YA 3EW7A 4H31A 1DT3A 1M0WA 4H08A 1E2HA 2W6PA 2HCJB 2KPOA 2OZKA 1D1QA 4EOGA 1FOEB 3QU7A 4YJ2F 4AP5A 1BXRB 1GZ7A 2GKGA 2VPPA 3L84A 2C5FA 2G28A 5G1OA 4EATA 4DADA 2GSWA 2HSDA 2XTAA 2OZLB 4K6OA 2AE1A 2IPOA 4U8HA 1PFUA 2DR0A 1N0IA 2QXYA 3FOEC 2NU7A 2R79A 3EGIA 5ALUA 2ZYTX 1CQJA 3S6JA 3ZEAA 3NCTA 3THYA 3A8TA 3K1TA 2VSNA 3HDVA 4NULA 5LQRA 1KDZA 1HTWA 4MR9A 2OXTA 1MA0A 2ZUTA 2B0CA 3NFRA 4GLBA 3QVOA 2R6ZA 1WCV1 1XU4A 2FOIA 3HGQA 3ZIDA 1JVBA 2C20A 4U2GA 4MW0A 5HF8A 3VO1A 1B6SA 4J3JA 1T36B 3K09A 4KXVA 4K9DA 5FPQA 3X0DA 4Q4CA 4Y6SA 4J9UE 4NCJA 1UKAA 1AT1A 1FPMA 1IDN1 2FK8A 3ITNA 4G0XA 3O83A 2AI1A 4DPLA 3KWJA 3LO5A 5LZ2A 2YW2A 2P41A 2OLKA 4G0WA 3RYIB 5LP1A 3ZXUB 3ETNA 4ND1A 4M1WA 3MTAA 3SM9A 3QWIA 1OJ7A 1RBMA 3MT9A 2J3LA 2PQ0A 1EUCB 3TECE 3K0AB 5DTRA 1OWPA 5A1JA 1FB5A 2GEDA 2ZI6A 1WXFA 1E6WA 1SQ0A 2ZAMA 4OBEA 1EX9A 4U7JA 2V96A 1MB9A 3CLRC 3L18A 4D46A 3WIVA 4U9IS 1PQPA 3DVAA 4TRRA 2H5LA 3UMSA 3EA4A 4FNOA 1JILA 3OEWA 1IZZA 3JQ7A 4DNQA 1ZJYA 1V1MA 2J3DA 1YASA 2BFOA 4HUTA 1BA2A 2K6GA 1P45A 5ITSA 3QV1A 1CY8A 3W5VA 4KPGA 2W4MA 4CL8A 7REQB 1GXSB 2BVNA 4B48A 2QT0A 1J0CA 3A0UA 3EZYA 2DSNA 4MQ4A 3OHSX 1E79D 3TBFA 2BEUA 2XVXA 5KYVA 2UAGA 1W75A 4FKMA 4LZNA 4OFZA 1JBEA 2H92A 3HCFA 3N2YA 3Q1KA 4M38A 4F4DA 3RH0A 3F6SA 5FXMA 3OC0A 1ZH0A 3JD1A 3OA0A 1WZEA 3FKSA 1UP4A 3VDXA 3FMVA 3R7SA 1P1RA 5J58A 4RTNA 4B3IA 2FDCA 1NNUA 1BS2A 3L4KA 1AB6A 4QVKA 3RU9A 2OCPA 3LUKA 4IJQA 3ZIAD 1AGPA 4G0MA 3WKBA 3VZCA 2YHAA 3PR2B 3UT6A 2CMKA 1A5AB 2HCBA 3BXGA 5EXEA 4GO1A 4JGGA 5EE9A 1JSZA 1WU8A 3K05A 1ILEA 3HB0A 3K9NA 4WLEA 2ZCVA 4L5BA 4LWZA 3WLKX 2J5KA 3IEPA 4U6SA 3JVVA 4CFSA 1K8RA 2DFPA 1BGXT 4UU7A 5DXAA 2WMYA 3RAJA 3QYFA 4GICA 1TZCA 1TZBA 2Y68A 1FVXA 2PL3A 1DJNA 4MKZA 1KAEA 1UFRA 1ACMA 5J4YA 2JGNA 1E96A 4AROA 1BCRB 2M98A 5CCXA 1I51A 3PNPA 4GH5A 1V3VA 5I5EA 2FSPA 1EBBA 1KRHA 2C29D 1VG8A 2CF6A 1VYHA 1YFKA 1H0HA 1U4OA 1JXOA 1ZGAA 2CXNA 3HCRA 4PGMA 2HHCA 3VR4H 2NOAA 2HR1A 5CLGA 5DO9A 4KR0A 5GGXA 1E3WB 1TCCA 1T4CB 2ZSFA 4OHMA 2Z9DA 5AHXA 2L19A 4EABA 1OSNA 3CR8A 4FXPA 4DMRA 1XSEA 1Q1QA 1F1JA 2W70A 5ALNA 4BCDA 3EPLA 3ICVA 4OXNA 3EX7C 5D5PA 1ZK1A 2Y3IA 3BH6A 4YA6A 4OQFA 2MDTA 3WYGA 4CKWA 4FI3F 1BXGB 1A2KC 3DP7A 3ESAA 4Y98A 3SX4A 4G1VA 2VHTA 2Q62A 1UZUA 1B16A 2OBYA 2V0CA 2X0KA 3DJYA 2HAEA 1K6XA 3BIJA 1FTNA 4EGJA 4TT8A 4JK3A 1JFTA 2AWOA 2VP6A 3T3HA 3HYNA 5CIYA 2HYDA 3N5CA 3DHYA 2HB6A 4H7PA 4MW6A 3B6MA 4G1CA 4UNNA 3C14C 1N2IA 1K3TA 3V80A 3AHJA 1G5PA 2VNKA 3B60A 3GN2A 5CLFA 2O20A 3H5LA 4M54A 3ROTA 1IXYA 1RCUA 5K8UA 1ZESA 2P9YA 4KV9A 3OD5A 3ILVA 4CCWA 2Y1DA 3QOXA 2I80A 4CMIB 3FDZB 3MERA 3TMYA 1PJQA 2C59A 1I10A 4DUYB 3IURA 3RIGA 4A7PA 1W52X 4LXHA 4E2FA 3M82A 1DIHA 1UJ6A 4IHJB 2G8LA 3ADPA 4E31A 4B4VA 1FYEA 1I7PA 4UE3S 3FYDA 4BZZA 2NO6A 1BVRA 1I36A 1II8B 1EWRA 4E2YA 5ALGA 2JHGA 1Q3TA 1FP4B 1A4UA 2XF2A 5TQ0A 1V5EA 4BC1A 4CEIA 3KQMA 1E9VA 3AOEC 3E3NA 5DT2A 4KLZA 1ZOLA 4OK5A 4Z49A 3MT7A 4ZOLA 4GZ6A 1U7HA 1KDRA 3ABRB 1J8MF 3E18A 3W3AD 1WKCA 2IY9A 3LT4A 2UU9B 4IIDA 3F1LA 5BOSA 1ESCA 4LJSA 3PQ6A 2RB4A 2ZJFA 3EODA 2OBFA 1EKXA 3I64A 3W1VA 3WRXC 2CGEA 4C87A 4DLNA 2UZIR 4OP3A 1PT5A 5HSGA 5K9ZA 4DV1B 2QUHA 3GFVA 5I9MA 4ER0A 2D2XA 2JGKA 1XCBA 2NUBA 3LUGA 3T7SA 4TZ6A 5FUYA 4Z3DA 4PAGA 1XFDA 4FDVA 1JZQA 4MUBA 4LJAA 2FP4A 2FUKA 4I8IA 1WWKA 3E3MA 3GRUA 3A6KA 4PSDA 2BFFA 2X7HA 3DWGA 3U3XA 4FFLA 1TVEA 2ZETA 8AT1A 1Y6QA 5H68A 2I4IA 4Z0PA 2YMQA 3N74A 1SKAA 1MW8X 4KIGA 2P2NA 4KMSA 3WY9A 2BEJA 3M3DA 2VEDA 4F6RA 2UZ1B 1OXVA 2Y1OA 4ZEXA 1KEEA 3PUWA 1FFAA 2OILA 1XD8A 4TKLA 1SUFA 1QHYA 1BJKA 4Y0VA 3VHXB 3TGLA 5GVRA 2PKWA 2BKXA 4W7HA 5CIWA 3EVNA 4RENA 3LKDA 1NQVA 3SAJA 1ZU5A 2I8AA 1T9KA 2C77A 3CLRD 5C9ZA 3HLKA 2WWXA 3F3SA 4LHEA 1MIOB 5CP8A 4XUCA 3PQDA 4WWHA 2OV8A 4YI5A 3JWEA 3T94A 3O2JA 4Y2QA 2D1YA 2VJYA 3UYKA 5AVRA 3EXHB 5I3CA 1XCOA 2B30A 2SNIE 1UADA 1V1RA 2I78A 2V58A 2ZJ3A 3K9CA 1N6LA 2VA9A 1RLJA 4WGGA 4EVQA 1TW2A 3VFDA 3MJHA 5AKHA 1YJ5A 1F2TB 1H2ZA 3QUSA 2PLFA 1WBDA 4XWTA 2OSVA 4DPKA 3FUWA 4YX9A 2PMDA 2AOVA 2PYZA 2FVYA 1YIOA 4N39A 3SZOA 4H18A 3L8ZA 4PLHA 3CF0A 1M74A 3L4BC 2O2JA 4II2A 2GB4A 2EJCA 2ZJ2A 3D5EA 3F46A 3UMGA 1NAIA 4QWWA 2R97A 2OPHA 1CD5A 1CJUC 4GE3A 1V9SA 4GRAA 5IMSA 1TD9A 1Y4DE 1MO5A 4R0NA 1BO6A 4CEJA 1NR1A 5B2ZA 5IAJA 5KYTA 5JCOC 1SHUX 3TRIA 4EB6A 4RHTA 5BYBA 4HMQA 1U2QA 3TE7A 2IBSA 2PUDA 3C7TA 2BTQB 4N7RA 1RPZA 3Q98A 1F06A 1UZMA 2QIPA 4KVFA 4AF8A 4DQXA 4LDZA 4DA0A 4DLBA 4HTAA 3UAZA 1KPGA 1SN7A 1EHCA 1PW5A 3QLJA 2B5OA 3OZAA 2KS6A 2P75A 4DEVA 3EWAA 1DOHA 4G9EA 1P2TA 1MORA 2Q07A 2CNLA 2Y27A 3IB3A 3O2SB 5LA6B 1NE7A 2G72A 3HKCA 3R3WA 2FUEA 2C4UA 4URXR 1VPVA 4BEJA 3DCYA 5IPFA 3K5PA 1RWQA 4GI2A 4UM5A 4ZJPA 1UT5A 3OE7A 1JH9A 3QU4A 4LJ9A 4HLCA 2QB5A 4NK5A 2G1KA 4AB1A 5CURA 2UYGA 2QE7D 4L78A 4Z53A 3X2EA 2I65A 1U7PA 2V55B 4N5IX 1C7RA 2RC6A 1TTTA 3DUFB 1QHGA 1U65A 1H5QA 3DXFA 5D01A 3F5QA 1P1KA 2AS0A 2WSMA 3O9VA 2ZJ8A 1E18A 4H59A 2C1EA 1Y8RB 3RUPA 2QLFA 4EGSA 2V6BA 2ENWA 3VVLA 2VP2A 1JMVA 1G20E 3M2TA 3I58A 4Y3UA 1O3YA 3RYFA 4QJ4A 4EJMA 5I3ZA 3ECCA 3TQQA 1CUWA 5FI5A 3WGMA 2ID9A 1ISMA 1IC6A 1KYWA 3K9BA 4ID3A 1SA0B 1XMVA 2Q4EA 5DSXA 1CRQA 4AMVA 4K9OA 3DAPA 3FCYA 4Q03A 4WDQA 1GL6A 2WKRA 4N0PA 4NZYA 1XMXA 3X43A 2V7XA 1PR5A 3A2LA 2JBAB 1O87A 1Z45A 3AKCA 3LQRA 4S12A 4WT7A 3V1MA 3L3BA 3AR3A 3CEAA 3OTWA 2BE7A 3MRSA 2G1PA 4WINA 1C3LA 3S4YA 2POQX 4CM4A 1OYWA 1D0SA 1I5OA 4I1UA 3ZS9A 2B2NA 4L02A 1ES9A 1Z6QA 2V8OA 4L27A 1NVUQ 1DQZA 4LGVA 8GPBA 3T3GA 1IFXA 1USGA 4R2IA 3O9MA 1LDYA 1WUIS 3IIJA 4FZ3A 4A15A 2Q3JA 2DFVA 3L7JA 1IN6A 3I0ZA 4M7PA 1KVTA 1OA0A 1H2HA 4YMGA 3TINA 1MO3A 2EP5A 2I6UA 4Z0NA 4MHSA 3WGVA 2ZTSA 4ZK2A 2WB4A 3ENVA 4UHFA 1X39A 1QYDA 4C01A 2DEUA 4JJ6A 4OJQA 1QAQA 4DNPA 5TLSA 1HRKA 4BEVA 4WCFA 5TSDA 1JHYA 4OAPA 2I54A 3ANYB 3HZZA 3W5BA 1DXOA 1U1FA 1YJAA 3P52A 4LQDA 4NBWA 3A3PA 5A6SA 2OO3A 3R2JA 1FSPA 4DLXA 1CU1A 4HB3A 4NMWA 3A6EA 4YVFA 3RS3A 4C7VA 2YV3A 1I0LA 2C7QA 1WCYA 2G1AA 3THXA 1AHIA 2HSJA 4P86A 4J4BA 1ORTA 2F1OA 2F64A 3NLLA 3GL9A 3KQVA 1D6MA 2JATA 1GPMA 1JX6A 4K5QA 2IH2A 3PC8A 5ESRA 3C16C 1NBOA 1U2PA 5FAXA 1K4KA 4G5XA 4EI9A 4I4TF 3OICA 4KDEA 2A9QA 3OMWA 4BNVA 4KSBA 5AOCA 4PFKA 2O8DB 4RHFA 1O03A 2VFAA 4XRRA 4XX1A 2Z5GA 5E2BA 4C03A 4ZVRA 4C2AA 4JASB 2D00A 2CVOA 4HDAA 4O4LB 4OLFA 2OP1A 2R6FA 5DXJA 5KSPA 4NIMA 3CZRA 2NTEA 4N0QA 1NWHA 1X7YB 3I83A 5K6AA 4JLWA 1MHPA 4KMMA 1Y8AA 4FHZA 3JZDA 1EDEA 1IQUA 1YB4A 1R88A 5JWRA 3I1YA 4X61A 2P2YA 1EM8A 1Q5PA 3GFTA 1UK7A 4TV9B 1OD6A 3X1MA 4BWGA 2FQYA 5DYGA 1DC7A 3H9QA 5A9SB 5DW3A 1NXSA 3WBFA 3P5BA 3A1NA 3GAZA 1RACA 1TM4E 2YN2A 3IE1A 3AVUA 1U8UA 3ZWXA 3RT9A 3ZEIA 2X9NA 3PXUA 3DV2A 1FF9A 2IYOA 4XJTA 3SYNA 2JARA 1G42A 3COSA 4OUDA 3BHIA 3GJ0A 4INZA 2BGLA 3A1DA 5CDYA 4K6FA 3H1BA 2P5UA 1TLFA 3L7DA 4RIFA 4RZHA 4B3XA 1TPZA 1YOVA 3GQBA 2WKSA 3Q3VA 4AKTA 2BFEB 3Q8MA 1PV4A 3KUCA 2O2EA 3J80A 2ICAA 2OCIA 3CE6A 3HVUA 4IH1A 3BCSA 1HQYE 2P1DA 2ZBPA 4KCGA 2P1ZA 4N82A 1QO9A 3BIXA 3KUUA 2W48A 4LRTB 5GWXA 1WAMA 4HDMA 1JE0A 2IUYA 4I3FA 4L0DA 4C4ZA 4JBIA 2ORWA 4C7JA 1F4PA 2NQ8A 3R6WA 4M1SA 4KREA 1U98A 4G36A 4IDDA 3CRQA 3CUWA 1GFZA 4G5HA 4ND8B 2QW1A 3ZVLA 4Z9BA 3VAYA 1S2NA 4U5XA 3W78A 4G5QA 3PDIB 2JJYA 5TQVA 5L9AA 4X24A 1P4SA 4ZAVA 1KMNA 3KTDA 1YB5A 2PD3A 3HU2A 1X0VA 2RKOA 3UTCA 4QPNA 5KNDA 3UUEA 1TVKA 1V8OA 3TUIC 2PL5A 2VOJA 3E5RA 3UEOA 3OEHA 1MEJA 4DBZA 2HGSA 2KYRA 4IWXA 4GMFA 3ZI4A 1WMSA 3GP3A 4H77A 1OH8A 4UUMA 3HBLA 3JR3A 5BSHA 3DMYA 3HFJA 3SX0A 4BQIA 4DUGA 4Y2JA 1HG1A 4G67A 3KKMA 1XYGA 4D41A 4LIPD 4F38A 3X3HA 5BR7A 2GYUA 5CNMA 1THZA 3GV0A 2OO5A 2WZCA 4RK1A 3G6WA 4NOKA 5DIFA 4WBNA 4RTPA 5DX1A 1DCKA 2C9DA 3E27A 4WACA 1N3IA 3F7TA 2P7HA 2OHGA 4TSKA 3I4FA 3MT8A 4CDMA 2FEAA 4FYKA 4ALMA 2V0NA 4A1FA 4DFDA 4PGGA 1H22A 3I9OA 3P27A 5LLTA 1UPTA 2FHPA 3LCUA 1VYVA 2ACWA 1WCIA 3O82A 1WKBA 4OKNA 2QW8A 2QG6A 3BQ9A 3UOWA 3VKWA 1B74A 2FPPA 2O3JA 4GM0A 4Q1BA 4XFDA 5K3DA 4WZBB 1MVLA 1NJSA 2QAGA 3WYBA 1UANA 3NDJA 4MYCA 1L4GA 1OXSC 5D2CA 3TI9A 1JIIA 1SUWA 2BONA 3PPVA 4K9KA 2P7IA 1VDMA 3TW0A 2WU3A 2V1UA 3A7DA 1Z17A 3QVLA 4XOIA 3H5TA 3HI6A 3OO1A 4UM8B 3UOAB 3UWDA 2UXBB 4YJGB 1UMCA 5JDCC 3QKWA 3L0CA 4OCZA 3B8HA 3S1AA 3CNNA 3DOOA 3PSAA 4FFMA 2XGJA 1Y80A 1ENPA 2M6RA 1IJBA 3IAHA 1UQUA 1CZOA 2NZXA 3M5WA 4BJ3A 3LQYA 1E77A 4F56A 1NIPA 3V8MA 3LBAA 1BMQA 1PUJA 2WZBA 2ZVQX 1RIIA 3EH2A 4LF6B 1U1EA 2R2GA 2AD5A 3B9RA 3QENA 2QZZA 4DR2B 1YJCA 4O2BB 2DPYA 5IP5A 1IUNA 1NW4A 1X8KA 1VI2A 4QXAA 4RXUA 2NPFA 2OHFA 4PG8A 1KE2A 4B09A 1OW3B 2R11A 3DE5X 4MGZR 4R2WA 1JSXA 3DEFA 5HR5A 1KMQA 1QORA 3PTAA 4C4PA 4KB5A 1U63A 3T06B 2EZ9A 1FYVA 3D0OA 1KQFA 4LF8B 1I1QB 2A0FA 3UXEA 3ZX5A 1JT9A 4B2IA 3O0TA 3T99A 4C0HA 4HZUB 4Q9NA 1SXJB 3DAFA 3VVCA 2EDAA 4A2QA 4D3YA 1LNZA 5GINE 2G5GX 3AF5A 3LF1A 1E7MA 1R0CA 3AUAA 4H1WA 4OB8A 4ZV4A 1RI2A 2VXYA 1ESDA 4OV6B 2V4ZA 2O05A 3FUUA 4Q7JB 3TTUA 1WDKA 4C3ZA 5FFFA 3FPSA 2OENG 3NWEA 4G5RA 4KX5A 4O25A 4W63A 3F78A 1Q74A 2HU8A 3UVEA 1I6KA 3VM6A 4DA9A 5HF9A 1G9TA 4B81A 1PBNA 2QU8A 1J99A 1OLXB 3ZH2A 1N2EA 2ZJ7A 3BPSA 2XUGA 1B0ZA 4ETWA 1AUVA 4I5DA 4W4TA 3NMUF 2W2TA 4GRDA 4IMPA 5IAKA 3EBOA 5I9LA 5B3JA 1HF3A 2BMAA 3FKQA 4WXMA 5IKEA 3REQA 2IS6A 4GFDA 1OAOC 3GF4A 3AI2A 5NULA 2BWJA 2ACKA 4FHEA 4D9CA 3LZ6A 5AIBA 2PKRA 1OH5A 4ER6A 4B3FX 4W1SA 3GDHA 4HBZA 2WLSA 3H75A 4NC9A 4MLZA 4B3CA 4DMHA 4MO9A 5B6PA 3HB7A 3QZUA 1UFKA 4OF4A 1KBZA 4A0FA 4A8JB 4JLMA 3SJBA 3OFNA 2OE2A 4H7EA 3GEIA 4JI5B 3ZC3A 4V1CB 4CR7A 1YVEI 1IAQA 1VJGA 3FBWA 3C3EA 3EWSA 2ZT6A 3O74A 4OFBA 3DYVA 1E5QA 5A3SA 4K0RA 1J24A 4OHWA 2Q21A 4RDHA 5CX1A 4E13A 5JSUA 2BHTA 4A8TA 3TFQA 1N5IA 5CA1A 1WSDA 4H3KB 4A26A 3HLTA 3WGHA 4K40A 4QNMA 3WICA 4Q47A 3KWMA 5DP2A 1NBMD 1P91A 2C97A 4MQFB 4CG0A 4EPRA 3L79A 1JTVA 1U7WA 4EG3A 1GUFA 2AZ4A 4LGYA 1BW9A 2Z5FA 3IA7A 4JJKA 4BAUA 4CZ2A 3D6VA 3AUFA 3LWBA 2C5HA 1MR3F 3OZSA 2G0TA 3PQFA 4OLJA 5HF5A 3NC1C 2XMCA 3NV7A 4KIUA 4U0JA 5K3SA 3VYTB 4CQMD 2B5VA 4JYCA 3AEKB 4CCYA 1ADGA 4CKXA 3LJKA 4BNGA 1LC3A 1J5XA 2RC5A 3KOUA 5CGZA 4PN7A 4UZSA 3ZQJA 2G70A 4EJSA 3PE4A 3QTBA 1LBQA 1A98A 3GFBA 1UMDB 3VR4A 3P2JA 1UWKA 3TSCA 1CERA 2H2DA 3QELB 4YHHB 3VNBA 5F3RA 1XVAA 4JZKA 4F86A 4LNUA 4LZZA 1M8JA 4BBAA 3MMXA 5JAIA 4KTVE 2GZDA 3QHPA 1V7QA 2GBIA 4TTTS 2JCBA 5JAPA 3LC1O 5KWIA 1EK1A 2Q0QA 1G5HA 2J3KA 1HFWA 2R751 3E2MA 3JQGA 4AG6A 1N5LA 1QQ6A 1Y3IA 1NYQA 2P9CA 3SFVA 3KVVA 3BWEA 1E1RA 3U1TA 1NR5A 3EF3A 2HCFA 4K6GA 3AUUA 1IL0A 3SVTA 3LX8A 1EFPB 4MK4A 4H35A 1PLJA 1XU9A 3AR2A 4TWZA 5P8WA 3DE1X 1F2DA 2B69A 3FF1A 4NZPA 3LSYA 3N8NA 2R1VB 4BV2A 1FFHA 4EJ2A 2YW9A 4WIAA 3QE0A 1C80A 1YJ8A 3HI4A 3BSWA 2QD5A 4C9BA 4BQEA 1VB3A 2RONA 3VU8A 4EQZA 3IGFA 5M29A 1L1FA 1JIQA 2O7RA 4AF6A 1S2IA 2BFPA 4OGLA 1PR9A 4L6IA 3HACA 5AFSA 3AUTA 3PDHA 4GPD1 3VHLB 5K3AA 2Q6LA 2NO1A 2HA0A 5KWJA 1NFFA 1OBFO 5AW5A 3VAAA 4IZOA 2EVWX 1OH7A 2G7ZA 1YMQA 2X40A 1A8SA 5HMMA 1P1IA 5CT6A 1E3LA 5LPNA 1FLAA 3EXG1 3NM4A 2WDZA 4RX1A 2O3QA 4H7IA 3UTDA 2C7RA 5JNLA 1W2WB 1X92A 3LCMA 3TEJA 3M6VA 3D6NB 2R7NA 3GI1A 4WTOA 2I4MA 3WOVA 2Q5CA 3WRVA 1K08A 4KQ1A 2GCGA 1U8EA 2VWPA 2CNKA 2HLDA 2HSWA 4OI4A 4QBIA 1SC1A 2FJ0A 1E6CA 3HL4A 3OOEA 3ZQKA 1KEKA 1YTUA 3K9HA 4BFTA 1Q1BA 2Q29A 2NTVA 4UTXA 3CE9A 4NBSA 1S2DA 4U7TB 3CYFA 2HV8A 3H84A 2NLOA 1FFEA 3PFKA 4TL6A 1KEWA 3RDPA 4MWZA 3WP0A 4DMLA 2ANBA 3OQ6A 1CUDA 1I13A 5KOJB 1WCXA 1IWBB 4IPTA 2HMYB 3O4JA 4US1R 2I0FA 3D3NA 4F2HA 3FHLA 4KE8A 5BWCA 4CF4A 4M6WA 1REQB 2PVPA 4PSCA 1GZ6A 4QL3A 1J8YF 4HGZA 2IOFK 1L7XA 1ZGGA 5LJIA 3CF2A 2DFDA 3RNOA 4Z3OA 3BRQA 4LZLA 2FDRA 3QPAA 2GS9A 2DPGA 1JEJA 3FXAA 2DETA 2OUIA 2QRPA 3S2EA 2P5SA 1V35A 3RS4A 1GKUB 2H2IA 3GEDA 5DNAA 2XQFA 3KYJB 4ZCLA 4D26A 1ISGA 2JIBA 3IAS1 5DT9A 2R1ZA 3JVEA 4MQBA 1I1OA 3BK7A 2VDNB 3RFVA 1LBTA 2REBA 3SZGA 4ZYUA 4TVBA 1GFSA 1AY0A 2OYCA 3I9V1 5K4AA 4GD3Q 1B0UA 1WXEA 5EJ5A 1EE2A 1Y81A 3IPXA 4DLZA 4AKSA 1GZ5A 3D3JA 3PFCA 5BW4A 3U7EB 3HXQA 2X41A 4R8MA 3VR3A 5IBQA 1BWRA 4N1AA 2YNMA 2AOWA 2J8ZA 5EJ8A 2YJ5A 4R9UC 4ZODA 4BDTA 4NBVA 3C0KA 3PVSA 4OGFA 3EUEA 2OAP1 3A70A 4H3SA 1QR2A 3O8QA 4OQXA 16PKA 5JCXA 3T7JA 1CY2A 1KETA 2B4YA 3NKFA 4MV4A 1UJBA 3M9WA 5CGQB 2QR5A 1I32A 4QHYA 4UBNA 3PL1A 4BMSA 4ZVUA 2EJTA 3VPHA 2IE8A 1VGQA 2EQBA 3O84A 5IWCA 3FMOB 1QJ4A 1Q6ZA 4LDQA 5EWLA 4NH0A 3UICA 5JSZA 3H17A 2YFHA 1E9FA 2ZAYA 1FMCA 1SK9A 1RAHA 3JWGA 1N7HA 2NZVG 1PTJC 4RH1A 1VGVA 1M8FA 4OHZA 2JFXA 3X1YA 1SVIA 1USWA 2GBLA 2HIHA 1E2NA 3HO6A 4HWOA 1BS9A 3GRFA 2IEYA 3HY4A 4TUYA 5MN5A 2EGUA 2WSIA 3JS5A 5DHAA 5JE8A 4LXYA 4M0FA 1N5RA 5IASA 2Z4SA 1JG4A 5EHIA 5KC8A 3GLQA 4FCTA 2A8YA 3EDMA 4J0JA 4AC9A 2R96A 1FFXA 4QQ8A 3V7UA 3DTNA 3C70A 2I6SA 4ARCA 3G8DA 5B1IA 1H2AS 2QY9A 4ZRNA 4JLOA 3JASB 2W83A 1LQ2A 1ZMOA 1DMSA 2R3SA 1NMEA 1DRWA 1YK0A 2RBGA 1I7NA 1V7CA 3AVPA 3E0QA 1XI2A 1QKKA 3NEPX 2NW6A 2R6HA 4S1OA 3VC1A 3V4RA 4HYEA 3ADKA 2H2WA 1YOBA 5AKEA 1Z4MA 5TS3A 2HF9A 1R4MA 4NPHA 1R0LA 1YGYA 1RRFA 2E4WA 2VRNA 1JIUA 2Y1XA 4HRXA 5BYJA 4LN1A 2I66A 4FWBA 1TD1A 3BWMA 3FSGA 1K6EA 2GFIA 2NZYA 3H19A 2ASVA 1E3MA 1LRLA 1AKUA 3EARA 4GKAA 3ICCA 4GBMA 4RZ3A 4AO6A 3OT5A 3I5UA 3OZRA 3PIDA 1GPKA 2I1WA 3H9GA 3N7TA 1YDWA 1WPGA 4TYWA 2WEKA 4XQ9A 1GCUA 4DMCA 4GP7A 2O1SA 1H2EA 2D1RA 2BH9A 1JPJA 3KEOA 2B4AA 3O47A 5GZ6A 3QY0A 1SUIA 4O4HA 5T8KC 4J43A 5HM8A 2DX7A 3CUUA 1TUGA 2DT8A 1AK1A 3I2IA 4KQWA 4ZYXA 3EH1A 1C1HA 1XKLA 2UYYA 2I4RA 2K4MA 3Q3GE 4EPXA 4NEQA 2FPIB 4EKEA 3U44A 2BIFA 3K71B 1BX0A 2KBFA 3LXXA 3HY6A 3RM3A 4JYAB 3GJ6A 4X3CA 1AO0A 3LYHA 4L5JA 3FNIA 1MV5A 1WW2A 4KNVA 4TL7A 1I4WA 1DQYA 4PYLA 4Q3NA 3VV3A 2J5BA 3R77A 4G3XA 4UBJA 2J3QA 4M1EA 4IKEA 1N8KA 2LRHA 4YJKA 1AQLA 1Z8HA 2X5KO 4LSZA 4P34A 3BE6A 1G3RA 4IX9A 4MA0A 4HCJA 1HE5A 4LV6A 4NICA 4ZI7B 3SLKA 2IK8A 3RWOA 4C05A 1NJ5A 1TGVA 1MUUA 2O2SA 3R7FA 4ESVA 3T3NA 1QFYA 2PZFA 4MIEA 1T0PA 3C6YA 2O14A 4S1NA 4BPRA 1GADO 4IVRA 2ERXA 3DEJA 4NBTA 2F43B 2LDBA 2VHYA 1M6VA 2RI0A 3P8ZA 1PDOA 4RELA 3IT3A 2V98A 1IEVA 5FPPA 1HDGO 4MMYB 3DOIA 4HWPA 4PG7A 4XGKA 4F97A 1NY6A 2KE5A 3SJAA 4O5OA 4EHDA 3R9XA 1B3RA 1C0IA 4MYRA 4UHEA 3RYTC 3ZGLA 3HWRA 3ZE0B 3ZWQA 1SQ6A 3D8NA 1USIA 3BMQB 2RHOA 3JQAB 2WD8A 3PRHA 4MVJD 4MW1A 2ZULA 2IYVA 3QSYA 4D3FA 3KE9A 1AKQA 2B8NA 3P0HA 1NBWB 1E8MA 3NBZC 1T15A 5CXXA 2AN3A 1EUDB 3DEAA 2IJGX 2JH3A 2QROA 1NG1A 1V47A 4KRXA 1AUXA 1G8AA 2C5EA 2KI5A 3IDZA 9LDTA 4OQNA 1FXUA 1M3SA 2GPNA 2J0VA 1XTJA 3AC0A 5J9FA 2FG6C 1C9DB 4IIJA 4KWIA 1JHVA 2ATXA 4V38A 4ZVTA 3D8SA 1C1DA 4XVHA 3GRRA 1YBMA 1BMFA 2AUTA 1B3BA 2X7JA 3ASZA 3PC3A 5H81A 4ECAA 4G65A 4JMLA 1D9XA 3BREA 3RSHA 2O8BB 1TRHA 3KWFA 2YXDA 5JECA 4A10A 2V97A 2JCXA 1JFFB 3E9RA 4PZUA 3DLTA 1J33A 1NLMA 3KXPA 3ZGYA 4ZVMA 2OHXA 3VR0A 1UBGA 1PEDA 3TQHA 5BSGA 3V1NA 4Y6OA 2CV2A 2PRSA 2HSZA 3U13A 4MICA 4GP6A 4Z51A 2EATA 2ZYVX 1E7QA 2B1GA 3TR0A 3I76A 3L5OA 3P1JA 4DAEA 3DCNA 1J2UA 1MQAA 2ODEA 1GRVA 4ZO6A 3ZVKA 3SSMA 2N42A 5JS6A 2FKAA 4EHFA 1MG0A 3LG2A 4QOFA 1UAYA 4B7ZA 1US8A 2HMUA 4G0OA 1R6XA 4MQMA 1NC3A 3R8XA 3WDSA 5LL6P 2GI4A 1L7PA 3V8RA 2FRDA 3AZQA 4A0RA 4JI1B 5B1DA 4AFNA 1J42A 1T2DA 1L8QA 3G9QA 5JTTA 1YC2A 4KFRA 2XYRA 2IX9A 1DX4A 3BRWD 3LBHA 2NXCA 1RXVA 4JI7B 2GPJA 3RVMA 4NEHB 3ZU5A 3E48A 2X15A 4C0QC 2P91A 2YQ4A 5K8TA 4YDSA 4D44A 1SO8A 4DHEA 3SG0A 5KTNA 2O54A 2ZBRA 1NDHA 5ESDA 4BVHA 4M83A 4PE5B 1EWQA 3KYCB 2NXJA 4EUSA 1PZNA 3KIPA 4FOPA 2OCGA 2BI7A 1D5WA 2PS9A 1PK7A 1WVGA 2M1XA 2JHCA 1M1UA 1WJGA 1EP1B 3GMTA 4M1ZA 4PRKA 1LS1A 1E3SA 4HATA 4DCTA 4QDOA 4QFDA 3QVMA 4MRAA 2ZITA 3H5VA 1WL8A 1HZJA 4UFNA 4FZJA 4RWEA 2W00A 4J8PA 1BOOA 1KKLA 4GXRA 2QMUA 2J9XB 3FVQA 1SELA 3K31A 4YAUA 2Q5EA 1NXPA 4Q18A 2FWAA 2ZVDA 5BWBA 2C82A 2Q9CA 5LMZA 4TRNA 1TT5A 2R8RA 1T9GS 1TX4B 3P2IA 4DE5A 4JYMA 1OFTA 2X4GA 2XXJA 3DPIA 4FXOA 5H7XA 4AJKA 4WBNF 2RHJA 1J06A 4UFPA 5LBTA 4NV0A 1CFZA 4NJMA 5DEIA 2JLUA 4OEHA 1F2UB 1UF9A 5AXDA 4YCCA 2V3WA 3ZIUA 3ORHA 4F5DA 1GZUA 5SZHB 3X2SA 3HB1A 4DWJA 1CUSA 1OILA 4WLUA 3CLUC 3UJ7A 2HY7A 4WXPA 5DHPA 5BYKA 1EP9A 2E3JA 4JL8A 4FFBB 5SYMA 2VI5A 1ISPA 4YHBA 3VI3B 1ZM9A 3A14A 3IPYA 3MHTA 3TLBA 3NC4A 3QYAA 1KFBB 4LQLA 4OYRA 3BXXA 3GLHB 1Q92A 2FQQA 2CVFA 4J0QA 4PC1A 3CUYA 3P32A 3G7NA 3WWOA 3ZY2A 2Y6UA 4HQKA 1KC3A 3PEEA 1C0KA 5H02A 2OOSA 2YV2A 3RRYA 1WXIA 4Z99A 2VHQA 2PUCA 5T4EA 2FMXA 2FQ1A 1ZO8A 1KEZA 2PUHA 2WJJA 2YVKA 3OLXA 4C5CA 4M21A 5KYNA 3EISA 4JP5A 1TU4A 5HF6A 3MLEA 4CXMA 4PY2A 5E7MA 4YRQA 1RBQA 1MENA 2B1IA 4A5SA 4FGUA 1XQXA 1VA5A 3PQ7A 4BKQA 1RPTA 1DAHA 2ZYAA 1KYTA 5EZQA 5FL7D 1XNGA 2QTHA 2W6ID 5JDIA 2E4AA 1JEQA 5FBKA 4B7AA 4OXIA 1UMBA 2ZIFA 3A9RA 3GDGA 1BHJA 1LK5A 3CURA 1X1DA 4LTMA 2BEVA 4ZDKA 5CBKA 4MINA 3N0TA 5B2FA 3HTXA 3M4ZA 1FP2A 3BXHA 3BGVA 2HWYA 1QG0A 3TQRA 5TJHA 3UZUA 2IYNA 1F0PA 3ZZUA 2HXGA 4K9PA 4WUVA 1XN4A 1XAIA 2ZRBA 1GQYA 4F8YA 4TYYA 1QGUA 1PSWA 2QTLA 3LAWA 3P9QA 5DSTA 1ZJZA 4YR9A 2AUNA 1P7PA 2R5NA 3IUYA 3KYDB 3GH1A 3OQIA 4FNMA 1GDHA 5E3HA 4S04A 3JY6A 3TK1A 2W6NA 3HYSA 3TPZA 5HIAA 1EESA 2JZNA 2RCYA 4IDGA 2C7OA 1MW9X 1I2DA 1EZ4A 1NUSA 3OOYA 4LJ6A 3AHCA 2VDWB 4F8JA 3QUAA 4QOSA 3R7DA 4DYDA 2NN3C 1MJFA 3FPCA 1U90A 4AJJA 2FA9A 1N34B 3CN7A 4FS8A 2VXOA 2PY6A 1SBTA 4JU9A 3PP8A 4J0EA 4JL6A 4TLAA 3N2ZB 1GA1A 1AGNA 2R7LA 4O4IB 3RANA 4YMLA 4YJ3A 4B6OA 1P6XA 4EO9A 1AQ6A 1T8SA 1TKCA 2WWHA 2XKJE 4PC3A 3OQPA 3U56A 5E3JA 4QYIA 3F49S 4Z4QA 1TYCA 3Q9SA 4GX1A 4C4OA 4MWEA 2RK4A 3IQFA 1OVMA 1SBCA 2I6TA 2ZLBA 5B6JA 4CI0B 1CHDA 3UW1A 3ZDYB 5ABPA 5EIEA 2X5XA 1LTHR 3H2KA 3KT8A 1YXMA 1Z0UA 2RKWA 1LDNA 1P72A 1K4MA 3ZDXB 2BFBA 4JH0A 2YRWA 4DIOA 4MKRA 1Z2NX 1K5HA 1PFGA 5FUVA 3EW9A 2WBLC 1Q7RA 3IODA 1S1CA 3D0KA 4M1TA 5K3CA 2IL1A 2GF9A 5CA1F 1U4NA 1SCAA 1BAPA 2MYTA 2FZWA 2VZEA 3H6KA 4P38A 1KWGA 3FUXA 1CUZA 1S9DA 5IKXA 4RVHA 1KY5A 3TQTA 3ZNPA 2ZYSA 1QH0A 2Y1EA 5KKAA 3W4JA 3W77A 3ZWCA 3TVDA 2ET6A 2G82A 2HF7A 4EG0A 3EY9A 2VUIB 3EC1A 3N2KB 1NUTA 4WASA 2Y71A 3IV7A 4ZCRA 1KI6B 4W5WA 2WSSD 8MHTA 3EQ8A 2Q3LA 5B7QA 4RCYA 2Y2UA 3UB3A 4WFQA 2WVHA 3A27A 2OVFA 1GUAA 4HD8A 5AM4A 2FZ5A 5THXA 4IDQA 5A3QA 4N65A 1N4AA 4GIBA 1SVOA 4AKEA 1IQ0A 3PRYA 5T5QA 1ZISA 2EQ5A 1GA4A 1SD5A 1NVVQ 3HKBA 3O6VA 2IYYA 5JD3A 5FWXB 2Z6AA 5L40A 1N78A 4LOKA 1OLOA 1ULBA 1W5EA 2GPBA 2YICA 3RG2A 3VU3A 4Q9DA 2OUKA 1R16A 2VPIA 2AW3A 5KNCH 3VKVA 4A4DA 5JAOA 4OTZA 3T9DA 4X0EA 1AMNA 3IR7A 3W06A 2P2CA 3I1FA 4I81A 5C1IA 3V4VB 4AZVA 4RF5A 2K87A 3EFEA 2V7QA 4ZU6X 4X8MA 3ZWBA 2F8TA 4OH7A 4UPVA 5E95A 2XB9A 2IDMA 1QDUA 4V0KA 1SOVA 4L8LA 1CJMA 2HMAA 1XD2B 2FU5C 2YWEA 3O3CA 1T0JB 4TMKA 1GIAA 2JAPA 1JWAB 5B30A 2DFNA 4JS0A 4FB5A 2HW8A 4FLMA 3DD1A 1L5MA 2QTAA 1YBFA 1Z75A 2VRCD 1HLDA 2PLRA 3I2YX 1D0IA 4LSWA 2RGEA 3TFOA 4QIHA 3VSDA 5K01A 1GSOA 4R3NA 2PV7A 4WZBE 4EGAA 1Z36A 1MTZA 1LEHA 1DPFA 3L93A 3ONEA 4JIMA 4RFSB 3SVLA 3DE7X 5A05A 3C3YA 4PFQA 1DTEA 5FLYA 5EAIA 3RK1A 3W04A 4P81A 2BH2A 1EVJA 2IOYA 4RJJA 4MV6A 4TKVA 4JXXA 1Z8NA 3E1KA 1VLHA 3LX4A 2ONCA 2IEDA 4FQ8A 2R8YA 4P98A 3DVLA 3KAQA 5BSTA 1DV2A 1ICEA 1AS3A 2FXVA 3TSYA 3VOSA 2AMFA 4AJ2A 4BEWA 1ORDA 2CY0A 1WXGA 4DUZB 1KYXA 1OMOA 2QMQA 5F7JA 3GUUA 1X1EA 4YT8A 3CUVA 3K1AB 2PDAA 3CLUD 4QYMA 4B80A 1G2OA 3S7ZA 5REQA 3NIBA 4R2HA 1CT9A 2GK7A 1C1YA 1CTQA 1E99A 2LBPA 3AY7A 3E03A 1AN0A 3JQ8A 4PS0A 3OPXA 1F20A 4PIVA 3ZJTA 2FPLA 2VPYA 4ARIA 4UTOA 2QTVB 5CUQA 2XNDD 3ONNA 3BICA 2ZCUA 4BZWA 3CVVA 5DX8A 2YJZA 4D0RA 3I0MA 1YQDA 1JDUA 1DCFA 2HU2A 1F0YA 3I6IA 3O38A 4P32A 1JKJB 2JS7A 1VA4A 1LX6A 1BCSB 3CVXA 1GPYA 1SXJE 2JFQA 3N8GA 5ALSA 3AKEA 3KL2A 2QN8A 2ZS9A 3KD3A 2BUBA 4P35A 4PCVA 4XFKA 5I7AA 1UR5A 3GMDA 3M7IA 4DWVA 5EWMA 1MB2A 4QOHA 2RGYA 4QDTA 5G0VA 3HRIA 1QCYA 2NU9A 1V1JA 5EYPB 3P9RA 1OXKB 2BGNA 1YAJA 1EMDA 5CYPA 3IQEA 2GPAA 5ULLA 1SBZA 2GEFA 3O1HB 2XZDA 5KYKA 4Z4IA 3OIWA 3AUYA 2EWWA 2PZLA 4DM3A 1U2DA 1WG8A 3SF8A 3PC4A 4B44A 5G40A 2C0PA 1MQSA 5FTKA 1DC6A 1M2KA 1UAGA 1UL1X 4JYBA 2VDRB 1NP3A 1PZMA 5AHOA 4OM8A 1DCTA 2D7CA 2XRYA 4E5VA 5J4HA 3HU1A 2FOLA 4X6LA 5HZMA 3IUJA 1DJQA 1M1NA 4NESA 5U9CA 1E61A 1A9YA 2VT7A 1O6CA 1JQAA 2GCPA 1OBCA 4LX0A 5DASA 1WS6A 1XHFA 3Q7PA 3F7OA 2YN0A 5A3VA 4JSYA 5CM2Z 3SK0A 3G1WA 2GD1O 3R5KA 1JYSA 5FTMA 1O2DA 3FM9A 5F3DA 5A5GA 1ZUNA 1YGPA 4BHTA 3RSZA 3I2JA 1GPWB 1TA9A 3BORA 2PSDA 2AOUA 4JI0B 5TGTA 2GN1A 2O2ZA 2Y0EA 1GPJA 3PCXA 3N86A 3RC7A 3AGQA 1PUXA 2HPHA 1JAIA 2IUTA 3KUKA 3OOJA 4WESB 4AG5A 1PJSA 1VKZA 2BFAA 2HU7A 3KLOA 3QWAA 5C8YA 2H57A 4R9RA 1ZLXA 1WTCA 1NNI1 2OBLA 4DCOA 3OH8A 4XX0A 5EA2A 1MRSA 1Y7LA 3BWVA 5G0TA 3K6SB 5LYJA 3JU3A 2I03A 1VL5A 4DS3A 3WHLA 1Y48E 4CLOA 2HWUA 4I55B 3GLIA 1Z47A 1JR3A 4RZ2A 2XECA 4G37A 1A1SA 4KODA 1SCBA 2W43A 4NFLA 3UJ9A 1U2EA 2Q46A 1R6TA 3E9YA 1UH5A 2A35A 4WK0B 4TUYF 4MWSA 4F2DA 2EOAA 1XJQA 2YUTA 3RTGA 1KZ4A 1P1BA 5FYQA 1R3UA 3K8YA 4NP6A 4K9NA 2VZ9A 3QLUC 2A9PA 4L51A 1L8XA 4HVCA 3EZGA 3EIXA 4HZGA 4TYMA 1G6OA 4ZK6A 1UC5B 4DQVA 2A5YB 4EHJA 2KLBA 1ELOA 2C9BA 1J9ZA 1VIAA 2YY6A 3DA8A 4XUEA 2QAIA 1TJYA 3F4BA 3NDPA 3OWHA 2PH5A 2QTWB 4ZZ2A 4QOEA 1P0QA 2ZUCA 2J9RA 4R98A 4WLOA 4ND5A 1M72A 2QVLA 1R0BA 2IZ6A 2JNWA 2Y0BA 4WRRA 1E2LA 1QGZA 2K7ZA 5F33A 2HJRA 1O9BA 1ZOOA 4B6EA 4M0UA 4P7KA 3PHJA 1K7SN 1AK9A 2MWMA 2OGZA 4RHUA 4TMZA 2O9JA 2WWTA 1M1ZA 4U2KA 3T5AA 1ZXXA 1UJ4A 1ZMTA 3GEPA 3P45A 4BMNA 3QFHA 5EHQA 5J2UA 1YB6A 5DM70 3A9UA 4J91A 1MT3A 1PK9A 1DDIA 2EL9A 2F8SA 4AMGA 1SVWA 4D56A 5EGSA 5I51A 4TKZA 3ZHQA 4M9CA 1ZNYA 3U4GA 1NQOA 4PC2A 4MS1A 3DDNA 4GKVA 4O4HF 2CL5A 4OL9A 4XIFA 3W6OA 1XBTA 2B2CA 4QTYA 2WQ6A 4JSTA 1KOFA 5GV8A 4G1BA 3HN7A 5FFNA 2JA2A 5BVGB 3JQRA 3PHLA 4P4SB 2ZIAA 5JBQA 1P19A 3OOWA 5LQDA 1HTTA 1JIXA 2AMLA 2PJDA 1YL5A 4M8LA 2JA1A 2O8CA 3P9KA 2HDWA 2ZRLA 3TZLA 3DBRA 3P97A 4GLOA 4J0CA 1H85A 1QGDA 2OV2A 4ALKA 3ZD7A 1HK7A 4M89A 1G1AA 3RC1A 4Z5XA 3FWPA 5IMBA 5HJ7A 1MC1A 1CY1A 3D1LA 3PE6A 1PVVA 4HB2A 3ZCVA 4BE7B 1VTKA 3ZDDA 1V8DA 2PUAA 1Y82A 1LW7A 2HUNA 3AEUB 5A2QA 5IDQA 2GAJA 2MU1A 2IP4A 2R48A 1AXRA 5EZYB 5BN5B 4AKGA 5KHOC 3NETA 1PYOA 1ZICA 2D5IA 5K8CA 2C4HA 4L2IA 5J5VA 1Z28A 1PT8A 1ENOA 3WL3A 5CJ2A 3RCBA 3S1LA 3VPXA 2B37A 4DIUA 1H0RA 1QRUA 4GOJA 1OBOA 1L7QA 1TAUA 1H2BA 4NYIQ 1DXYA 4GNKA 2GCOB 1TJ4A 3BD9A 3E1SA 4M87A 2MSKA 4BDSA 4ENSA 1LK0A 4GPAA 2WAMA 1XL0A 3VPGA 4DBLE 3D0RA 2R60A 3DB1A 1W0JD 2WJ4A 2B9VA 2JEYA 5FBHA 3HBNA 4HADA 4JU8A 2OBBA 3QMMA 4J16C 4IXMA 4KDFA 1JJAA 1QONA 2GZRA 3H83A 4UMVA 3RSOA 4MUFA 4DANA 2GEUA 5JPDA 1D2MA 2WE7A 4RZSA 5ADUS 4U7HA 4WHMA 4MWGA 5AESA 1QJCA 3ZCQA 5IDWA 4IIJF 1P39A 3TDKA 1P2VA 4Z7QB 5IXYA 3AL3A 5I7VA 3WIEA 5AP9A 4PC7A 3N8HA 1ZS9A 4C4RA 3I61A 2ZJZA 3ELUA 1KIAA 1C9NA 2PHZA 4B34A 5G0SA 2BM0A 2MSLA 2IU3A 3CNOA 1F8GA 3K32A 4YMWA 5D6OA 1RBYA 5JG7A 4H7DA 2ZB3A 4QJ5A 2PMFA 4H16A 4YP6A 4DLUA 2VT2A 2DYKA 1NMXA 3EIOA 1GY8A 3IBCA 2JI7A 2VAWA 3IP3A 2I2CA 3ZCTA 5BVHA 1CJTC 5EJ7A 5KBYA 3C3WA 3BIOA 1MGPA 2F90A 5TT0A 3RO7A 2C00A 5IF9A 1VPLA 1XRRA 5TY0A 2X6QA 3FWHA 3OE1A 3QUQA 4JI8B 2FDXA 3BMNA 4YAWA 1DX9A 1W30A 1B00A 1UPXA 2WNHA 4CM3A 4I0WB 4BKMA 1MH1A 1S01A 4MQEB 3B82A 1X1QA 4MUKA 4RA6A 3AB3A 4B83A 5CG1A 3UF0A 2QP3A 1Z5OA 4MV0A 3PUXA 5F9FA 1ADCA 1H4VB 1SZJG 2JJQA 4ALIA 4JEUA 2JGJA 4V2UA 5C35A 1YQWA 2UDPA 3F9CA 4URWR 1Z0JA 1DO2A 2Z58A 2EWMA 4ZHQA 4HGQA 5KTMA 2A57A 4PWYA 4LY9A 3TTYA 3VR5H 1XAGA 2XB2A 4N5NA 1H9AA 2Q3FA 3NYWA 3R1IA 3UKDA 3WL4A 3UYLA 3VZPA 2BFNA 5ALZA 1IHYA 3ZBTA 3G0GA 5SV2A 3DJFA 1PLLA 4OX9B 3L4SO 1IQPA 3DMDA 3ODPA 5JQWA 1I80A 5CRIA 3AYXB 4E03A 5KVCA 3RRJA 1QK4A 3OC6A 4RVGA 3MCZA 3K5IA 4DB2A 1P3Y1 3LNTA 2ZJ0A 3WQHA 4W5QA 3HZOA 1LI5A 4G4GA 3KP1A 3VKGA 1KY4A 2ZB4A 1FIUA 2H6EA 3EXIA 1BYUA 4U02A 3ECSA 4L3OA 3RRXA 4EPYA 2J5XA 3EHDA 3GEMA 1SOMA 5CU7A 4AWAA 3VMFA 4Y9TA 1M2WA 1V7PC 3VYUB 4GOKA 4ARBA 3RRZA 4M76B 4B40A 2H3HA 1RCFA 2ES4A 2HNAA 3IQIX 3GHYA 1ABBA 2X8WA 3D4LA 4DNOA 1YE3A 5ALVA 4Z8XA 1M83A 1E2PA 5LLSA 3DDUA 5TX7A 3KLPX 5AOVA 2VC2B 3C3MA 2PYIA 2E5FA 5CFRA 2Q8PA 1EB9A 3NJRA 2F8MA 4GGOA 4BMXA 2Z0MA 3V97A 4XJVA 3MYRA 5KQRA 5BWNA 1GGKA 2ONKA 4HXEB 5B1EA 2C9MA 2X8JA 1NVVR 3AHHA 1D2CA 4Z0TA 1YI8A 2XWQA 4ESOA 2PLNA 3I23A 3I28A 3ILSA 2VQEB 1PR1A 1JNXX 1N5MA 3A6PC 5JISA 3ZR4B 4DW8A 4OXXA 2RMKA 3VI4B 1TFUA 4UTVA 3I5XA 1PGJA 2VKQA 5AM2A 2PMEA 1JB1A 1SU7A 1DELA 1OYOA 1YHZA 2B36A 2V59A 2PH7A 3H7IA 4QECA 1GGFA 3RRFA 3X1DA 1NPDA 5DGHA 1Z12A 4LTDA 2EZUA 1C3VA 1Y8QA 1PHRA 2GCNA 3AEQB 4FHDA 4DLVA 2C4KA 3FKSD 4M0MA 1QP0A 3TTXA 3RABA 1UWVA 1L5ZA 2FEKA 2RGCA 2VXCA 3B3JA 1Z6XA 3NPAA 4WK6A 4MWTA 3ZD9A 1GG2A 2W98A 1RRVA 3O8NA 4ZO9A 3HE3A 3H1PA 1HEUA 3SICE 3WDKA 4RCVA 1ULHA 2X1LA 1D4AA 3AR7A 2QPLA 3SHTA 3HB5X 2ZRGA 1YB7A 4MDYA 1QS0A 1QIEA 5BN3A 4HNUA 3R5SA 1QZXA 5FADA 1Y7HA 3K16A 4KBYA 1JFVA 1R6DA 2PR7A 3CX6A 3LK6A 4LOLA 1IMJA 2AQHA 2CEAA 3BH7A 4YRTA 2AJTA 4TVOA 5FPTA 4ZEWA 3NAGA 3ZTTA 3EF0A 3ZWYA 1E89A 5IABA 4QYTA 1CZUA 4AY5A 3QG5A 3B5JA 3FLMA 2AJLI 1MVNA 3GYGA 5D5QA 3RF7A 3SIRA 3UBMA 3WWYA 4E33A 3SEAA 3QEBZ 2MMGA 4N12A 4KXMA 1AZLA 3AQIA 1I7DA 5BO5A 1JPNA 4V0RA 4LQ4A 3HXOA 1MX5A 4H6PA 2JIZA 4F2PA 1N2SA 1CRWG 1ONBA 2PS3A 3OY7A 3UAVA 2CL6X 3VHRA 5IKPA 1JHRA 2IOQA 2P6MA 1NJ8A 3COZA 1JFLA 5EIBC 1QPBA 2ABWA 2BV3A 3WGZA 4CIAA 1G2PA 1X7ZA 5BWOA 4XWKA 5F98A 3DMTA 1W5AA 1O6ZA 4Q1EA 5JEEA 1U28A 2E6UX 1C4KA 2V3CC 1T2AA 1G8YA 3E7XA 2NO9A 3EAQA 3DLBA 2R9VA 1CRZA 1PS9A 1V5GA 5AKGA 2P4SA 5CFLA 4UHBA 2E2WA 1MC8A 4KYIB 3NFYA 4NCNA 5INTA 5CBPB 2AF4C 5DM0A 1CEYA 5FH9A 1RYBA 3ZE6A 4F4UA 5BV0A 5L3QB 4V02A 1BX1A 4Z7JA 2EP7A 5A02A 5IC5A 2C9ZA 3R20A 1Z88A 4Q9KA 3OF5A 5DDIP 2OB2A 2WNSA 2M9MA 3V4LA 4PO3X 3P9PA 1QOZA 3BFVA 2RHBA 3LUAA 1R5BA 4FYXA 4YJ3F 2JGRA 1TYZA 3IUQA 4MVXA 5AKYA 2XMSA 4AYWA 2IHVA 1E3JA 3TCNA 4M0CA 1DKOA 1ID1A 4IRMA 4MWCA 9ABPA 2EX0A 1B4DA 2R84A 1QIIA 2ZE5A 1XCMA 2CDBA 4YRNA 4EY7A 1QHFA 1VCNA 2PUTA 3L6DA 3AJDA 2EFYA 4A5OA 4DIFA 1G5FA 1PD1A 5JS2A 1G8PA 1FC0A 5JAMA 3KT0A 3O8LA 4PAOA 5BMVA 3LL7A 2A30A 3GJRA 4Y1FA 3MCTA 3ZHYA 4OYHA 5KWSA 5FF9A 2XKKA 4EA8A 4ZEVA 4R16A 2AKEA 4EMTA 3QOYA 4HQLA 2IUSA 2VHUA 2ZW9A 2P4HX 1SIUA 3D81A 1AS2A 3IR5A 4WCFC 3ROQA 1SG6A 1RRMA 2B61A 4G07A 3SPXA 3WKCA 4UM9B 4YJDA 4HN4B 1GNTA 3D59A 4IDNA 4M7WA 1E8NA 3U31A 2B1RA 3S44A 3BFXA 1FYDA 4RVOA 4HV4A 2J85A 3DZFA 3GCDA 2A9OA 1FEZA 4Z1MA 3TW8A 1WMBA 4EP1A 5HK8A 4MW7A 4MKFA 3SBXA 4PX3A 3S27A 1D2NA 3BMCB 4PQFA 1BD3A 3A6ZA 4TZKA 3I9MA 1A97A 4RJKA 1IN1A 3DLPX 4RK5A 1HBJA 2BGGA 3UGJA 5IT9A 3OZIA 3RS5A 2IEBA 1VE7A 4OFXA 4YECA 4OI0A 1IVNA 5AW4A 1XDDA 3EJ6A 1BQEA 1JW9B 1CP3A 4WLVA 4FDLA 3BCRA 1CB7A 1H3EA 2WB2A 2YZGA 4RLQA 2P77A 3T1QA 3ZW7A 3NKLA 5K6AC 1I30A 4HNAB 3UT5B 1GILA 3MGCA 4MH0R 3MCUA 3KBOA 3BGOS 4P93A 2H1CA 3DEIA 2QG4A 4MV1A 3RYCA 5AJXA 4FS3A 2A0KA 2PQ6A 5CEFA 1N7GA 1OH6A 1ESNA 4E07A 1E1NA 1CUGA 2BI8A 4F1JA 1HGXA 2ZWOA 1X9GA 4F2GA 1U9IC 3LA8A 4L5YA 4IQGA 1A8IA 1XVUA 2Y76A 3E6AA 4X3OA 1GLVA 2IHJA 2BEWA 2DRIA 4LRXA 5B12A 3BX1A 1DARA 3AU9A 5IYZF 3IMCA 2C2YA 1Y0BA 1A4XA 1UM9B 3MELA 3RKUA 2W6JA 5FA5A 2QYSA 1M73E 3KV1A 2JEZA 1GNQA 1C8LA 2IFTA 2EJUA 3Q3CA 2GCEA 4JDUA 1L7NA 2UYQA 3NHBA 5FI3A 4ZYLA 1P4RA 5EMLA 2O3UA 2I4OA 1U7XA 5DGXA 5HTKA 1KP2A 4RHXA 1G2QA 4CIWA 2B99A 4KGZA 3K9QO 1MF7A 3NVDA 3B1KA 4YP1A 1Z4PX 1TECE 3IVCA 3C39A 1YK1A 4NRDA 1RI1A 1W0CA 1TUBB 5FUQA 2AXPA 2VHWA 1QBGA 2I6GA 3PUKA 2ZIXA 4QTTB 3WLJA 2GM4A 1HYGA 5ES3A 1E9DA 1MB4A 3BE8A 2E4YA 3VH1A 4XR9A 5FBZA 4DRXA 1GPLA 2CLMB 4UNQA 4BFZA 1ID8A 2Q9BA 1NUQA 1VSUA 5EE0A 3QNMA 1IB0A 4KAJA 5CFQA 1EIZA 3EVAA 3JQPA 4FFRA 4S0XA 3OPNA 4Y1RA 4OHFA 3KKLA 4AYXA 3BEOA 1ZNQO 4J07A 3N59A 2G4VA 4Y9DA 4BFSA 4DMGA 3OM0A 2HK9A 5AOBA 3VVBA 1WY5A 3BDVA 4WPGA 4X5OA 4HH0A 3NU1A 5EJGA 4PFSA 2IGTA 4RHCA 1T8PA 1ZEJA 4B79A 1GU7A 2AEEA 4CM8B 2F1IA 2VDLB 3LO8A 3NJ8A 4QOJA 3ZNNA 4CL0A 4RIGA 4Q9JA 3ZJYA 1BDJA 2VAPA 1EWVA 2WU1A 1ZEMA 3HO8A 4JJ4A 4KH0A 4X1OA 2Q3HA 4JY7A 1JHUA 2IP1A 1IBRA 2WFZA 4NYJQ 1INLA 1YIDA 3WXBA 2C54A 2WM8A 3WL6A 2IEAA 2VYVA 1XEXA 2MSWA 4KWHA 5ADWA 5TGDA 4HK4A 2ZRKA 1AIPA 1DWUA 3VNAA 3A36A 3I01M 1HMYA 4CF7A 3KQTA 4F06A 1EU1A 1Y6ZA 3OE7D 4N5HX 2PUGA 1FMJA 2A9RA 5FHQA 5JS8A 2DE0X 2XHZA 5KTOA 5AYVA 1LBSA 4AZ0A 4HAYA 1SHJA 4D4HA 2UXCB 1VHWA 2J45A 5EIBD 3ADOA 4EX7A 2ZR9A 3GFQA 4TTSA 1QO0A 4CQMB 4JYZA 4NYIR 3A9CA 1GWNA 2FCAA 3SMQA 1C3EA 5DTJA 5DHSA 1FNBA 1XDWA 3ELBA 4PRLA 1YB1A 4UJ3A 3BXFA 2BTOA 1FZTA 1CUJA 2C96A 5F52A 3DMHA 4EUHA 2PQMA 1W2GA 5CM9C 2PSEA 3B3QA 1L7VC 1LPAB 2ZXFA 2D0IA 4TN1A 5HJ5A 2EXXA 1ZRMA 5L4LA 1CS4C 2W5UA 4OK6A 5JXHA 2OOKA 2V6FA 4OM7A 4ZC8A 3LOUA 1SULA 1S4QA 1YTLA 1CJVC 2B82A 4LZJA 4NLLA 5F21A 5C1PA 2JD0A 5DLDA 1FTYA 2G4LA 3HNOA 1C9EA 2GLTA 2OM2A 4P4NA 1WXWA 5BSUA 5F23A 3L77A 1TU3A 3ZQ6A 1KZ1A 4J03A 3DMPA 2FWRA 3FWYA 1ORWA 4FYPA 4UUBA 4HI0E 3SR3A 4MKGA 3W9SA 5C8YF 3L01A 1KI3A 1RJ9B 1D6NA 5EKTA 2HXSA 3MGGA 1KF0A 1BDIA 1ZK4A 4AS2A 2BJWA 3NNDA 4P7BA 3ZHZA 2Q5JA 3TSWA 3TRDA 5LYJF 4BEBA 4XZ3A 2O1XA 4U3JB 4NE2A 1EJ2A 2O06A 4ZT5A 2D8AA 3GNSA 4XQCA 3S2GA 4ALJA 3QX9A 3MWDA 2R86A 1K27A 1MABB 5FUWA 2EG5A 2J0SA 1YACA 1J1UA 1PJCA 3LUPA 3DL0A 4HTFA 3A1TA 4YRFA 1FDWA 1JXAA 2ZWAA 3LDGA 4LQCA 1KZYC 4CIBA 5IJ0A 4OLHA 1U2GA 1DFHA 4DDMA 3F5MA 3I62A 1N7IA 1OOEA 2OD7A 1NQTA 2NT4A 1F8UA 2XMQA 3PEFA 1ACJA 4IV5A 2QUJA 3A32A 3WYDA 3MZ0A 3RAEC 1UJNA 3UV3A 3KAPA 3C6ZA 2G1UA 2RGUA 4R71A 5WRFA 1TIBA 1V48A 1QC5A 3L7CA 1DC4A 4N7MA 3ELDA 1KSJA 5AQEA 4LC9A 4B3DA 2YHIA 3KALA 4GPBA 1GCIA 3UV6A 1NMQA 4ESHA 4EPTA 4RIEA 4BV8A 1DIOB 1PVDA 5B3JC 4PXSA 4C22A 1JU3A 4N5MA 5T6BA 1W96A 3TTSA 1UXKA 2QRVA 5FKJA 1X7WA 1ZAKA 2WIBA 3G0BA 1BNCA 5GIOE 2ARKA 2W2KA 4O6VA 2ZK7A 4ZU3A 1H8EA 4MX8A 4HUQB 3N3AC 3W5CA 3B5EA 3BAZA 1UEXC 4FOTA 4ZICA 1BE1A 1R9MA 1YQTA 3UATA 4KMOA 3HEBA 2WWFA 4GBGA 2NT3A 3OP4A 4O33A 2NYRA 2BY4A 1DAGA 5LXTB 3WA7A 3P2KA 4H6WA 3L1JA 1YJXA 3TUZC 1P4JA 4W7SA 3E7PA 4XWAA 3ZV3A 2X6TA 2GHTA 2AW5A 2D13A 3GNQA 3A7EA 4HGYA 4WDRA 3HJHA 5DYIA 2CBXA 1HNZB 2BUAA 3A4MA 4JAVC 3DZKA 1BX3A 4IG9A 5EXPA 1G55A 4JJAA 3IOYA 5KWEA 3HK2A 1A3CA 3RBXA 4X8OA 5DI3A 4HWGA 2FWPA 1N2ZA 2IIQA 4G0VA 3JARB 3N3BC 1MZVA 4LV8B 1KZHA 5IKMA 1FLDA 1T3HA 2IV3A 2QTMA 4KLRA 3SP1A 3NNNA 1OQAA 1GTSA 4CBVA 4BXOB 3L7LA 4A3SA 3S2ZA 3K8OE 2GOYA 5I4KA 2ZPUA 2HDNB 1KAOA 2REQA 4XB2A 4E6EA 4EY8A 4BO6A 5A5DA 4XDYA 4Z86A 4ZXFA 3UK7A 2IKQA 5A7GA 2EERA 1C3OA 2AKYA 1WHSB 1W581 4IRUB 4KQXA 4EJSC 2C5SA 4NFYA 3ZDQA 2E82A 2OT3B 5FBQB 1TIKA 1UJ2A 1F3OA 2HDOA 1HE2A 4RZXA 5KMGA 3IRVA 1SBYA 1XTPA 3NVKI 1WO8A 3MG9A 4XWYA 3ESQA 3SXUB 3CNQS 2KM1A 3TAXA 4D3XA 3SYLA 3R6GA 4LBWA 3MNFA 3RFUA 4B4DA 4WNYA 3UA3A 5JQGA 1OV4A 2H9YA 2BTEA 2GCIA 3D2CA 1SXQA 4RV4A 1U0TA 2AZMA 3CC8A 5EFZA 4JQYA 1DKLA 1XALA 4UC0A 5HIIA 5K20A 4PYQA 2N3ZA 3GX1A 3L1KA 4KPUA 4N3NA 2VAVA 4PHFA 4FR5A 5ALEA 4O2AF 4KR9A 5KNDD 2A9VA 5EUQB 5NLLA 3WGIA 4MAAA 4IMRA 4MI1A 2J9FA 4A2PA 3OEHD 1UC9A 2JVKA 2Z1DA 4PLVA 4DSZA 4DDTA 4WVLA 2CLCX 2A1IA 3N53A 5C18A 4KN5A 1DXHA 1Z7GA 1Q44A 5A4JA 4DUGD 1QG6A 5DTMA 2IDZA 5CEJA 1FUKA 3TZHA 4A6XA 1E94E 1G6KA 1ONSA 1XX6A 4M2LA 4DIEA 2X42A 2WYHA 4P22A 1A9RA 3MTIA 2FMHA 1GGMA 2I3DA 2JGLA 3V32A 4FYIA 3K4PA 2A5GA 1GLNA 4L73A 3SHOA 3W2HA 3A06A 4B3SB 2LDXA 5LZ5A 2CFCA 1NQXA 3P7MA 3S40A 1ISIA 1SOUA 2N9UA 4NY1A 3AETA 4ZQBA 2XR1A 4QDUA 1W4LA 1Q19A 1SU8A 2FSGA 4UMDA 1KEVA 3T7AA 4F92B 3E2IA 4JSRA 4OL0A 1FNCA 2XT9A 2YOGA 5HK9A 1VBNA 4LC1A 1FQWA 2O5RA 2CYBA 3EG5A 1N2JA 2FPOA 1NN5A 3S5UA 5KNDH 4ZVKA 1XWIA 2FMFA 2HRQA 3HKDA 3T3DA 1GV0A 4HZIA 1CPYA 4EW2A 2F9FA 3CWZA 3RVRA 4LJ8A 1DAMA 3F1KA 2R1TB 3EDYA 4F46A 2WOOA 1A9PA 3BKXA 1FDUA 4UHHA 1KR5A 2J30A 4QHTA 4X63A 4ZD6A 3WO0A 1WBBA 2E87A 3K2EA 3WLNA 5BQPA 4ZHQF 5BWMA 4N9QA 4FYHA 3QBDA 3VV2A 4G81A 3GCGA 3WDMA 2OZEA 3H1FA 2JANA 1ZG3A 3DS8A 5BR8B 3IHWA 5A9RA 3IESA 4LJ7A 2AX4A 3AYZB 1OX4A 4MGKR 2WD7A 3D02A 4JBHA 3RJ9A 1OV6A 1YA6A 1ST2A 1TPYA 2DKFA 3EGOA 1D1SA 2IVZA 4BNXA 3OQOA 4HEA1 1XDUA 3SHVA 1LDMA 4BGVA 2X8BA 3V34A 4D9BA 3OCZA 2R2AA 5L8VA 4O3FA 1BRMA 1L9XA 3E8MA 2FX2A 2Q1YA 3IH5A 1EFAA 5H59A 3INRA 5JI2E 3ME5A 2VTBB 4CCSA 1TT7A 5LUBA 3W8RA 2VTDA 3LP5A 1ISRA 1W5TA 3L8FA 3O9ZA 3CISA 4PSUA 4MB6A 1XXHB 4XIYA 4FWTA 2ZZNA 2LGJA 3SYRA 4CTJA 2Y9MB 1A2OA 3DBOB 1CP2A 2YFKA 1QRSA 2F3UA 3ZBQA 4RMGA 1S3SA 3IAFA 2I62A 5HWSA 2BGIA 1J7JA 1C1XA 1E2DA 3L7KA 1XKXA 3BXPA 1UKBA 1GNLA 1XJWA 3B38A 3D4BA 3MJFA 3O95A 1SBIA 2D2FA 1UQTA 4RACA 3LT5A 4X41A 1ZCBA 2AG1A 2ZATA 3RUCA 4CT0A 3EC2A 1XHLA 3FFAA 3LRPA 4I50B 2FAXA 3F67A 3R0QA 2VP9A 2XMPA 3QNUA 4MGHA 1YZ3A 1Z2PX 2YNMC 4KO8A 1IEWA 1Q57A 4CDGA 3HNPA 2J59A 1Z08A 2MJLA 1V96A 3IXMA 4HDSA 3INYA 4YV0A 2GXAA 2DQKA 1P5ZB 2EV9A 4OG2A 1WX1A 4R9NA 4ZQEA 1VLQA 3FYUA 2NUAA 2ORIA 5JJIA 3C48A 3RAPR 4HDNB 1LPNA 1ZJ6A 1A50B 5EJ9A 4ND7A 1DGQA 1JVSA 4RD3A 4D4KA 4ID9A 2PVSA 3WGLA 2BFCB 3Q4GA 5H82A 2AUMA 3IPRA 2I34A 3SMVA 4EM6A 3VNVA 1CIJA 5AJUA 1MU0A 5I7OA 4U7PB 4U0KA 3WMRA 1C30B 1XAJA 4LAFA 2WJIA 4OQDA 4MI3A 3OFND 4Y6RA 4XJXA 3HBMA 5TEVA 1ZNXA 3RVLA 3RVOA 5K8VA 4XAQA 4MVJG 5A0TA 2C04A 1QRRA 2B9EA 3OZVA 2GBLC 4IVPA 4IFTA 1P5JA 1H6BA 2LP4Y 4QXRA 3LDFA 4TMTA 4FPXA 4L6AA 3VYWA 1RAFA 4WH0A 2H52A 1UCFA 4EBBA 2VHZA 4BN5A 3EUFA 2QS9A 4NXMB 3G8CA 2UKDA 3CZQA 3LWDA 3V4OA 2IWRA 3IDQA 2J41A 4O1MA 1T4DA 4TKUB 2QR3A 1U8XX 3BFKA 4NMLA 1NJGA 5K0EA 3WLRA 2RKBA 5DYWA 3TYXA 1Q1NA 1DX6A 4HVTA 2PNJA 1C14A 3D6JA 3E84A 5GONA 1LSJA 3D6UA 2PGLA 3CV3A 3QVUA 5EWJA 4BU0A 4WA8A 1VHLA 2GAAA 2QENA 4C20A 4D74A 3HWX1 1VL8A 3GFFA 3ROMA 2R5WA 3IQGX 2QY6A 2BBSA 3EXFA 2IVFA 5ETJA 2PZBA 2A9JA 5E4TA 3SKVA 2QTRA 4BIIA 3ORQA 4L0QA 4IDBA 3ZJUA 1R6VA 4NV1A 3MINB 4GHWA 3RV3A 4BNHA 3UJ6A 3KTAA 4BQOA 4BVBA 4ENRA 2P35A 1HDZA 1OI3A 5AUPB 5K3BA 4D80A 1EA7A 1OFHA 4XPIA 3WLQA 4ZQIA 2H1SA 2RDMA 3D6AA 1K5GA 1S7GA 1U3FA 3HJGA 5AKIA 3IUNA 5ALPA 4BNJA 3ETDA 2PSHA 5JAQA 2B7CA 2X77A 2ZE8A 3C97A 4YRDA 4N76A 5AK5A 3K70C 1P1CA 2CDNA 2Q2OA 1P5FA 2Q41A 2Z43A 3H7AA 3A26A 4IQ8A 3PHBE 4I3GA 5CJJA 4DJEC 1G9SA 5FEUA 1NJFA 2PCLA 2PKYX 1NQ5A 1YC5A 3B7GA 3L0SA 1OTYA 4RQAA 3EFOB 4WN9A 5L4NA 1E2GA 1VL6A 3EEIA 4TSFA 2I4LA 3CRRA 3H65A 3UMFA 3RADC 2AVNA 2VKTA 3E5NA 4QUIA 3ABZA 3L02A 3DC7A 1RYHA 3WKAA 2AFRA 3RSCA 1ECGA 2ZTUA 4BLUA 1USUA 3KEFA 4HL6A 4NU8X 1HUQA 2AFIB 4FBMA 4TZ0A 2FPUA 3K0FA 3JZFA 4D8YA 1MJ5A 1CVLA 1UFQA 4MIKA 1E2IA 1P2BA 1RHUA 4NYJR 4D82A 1JUDA 5MFZA 2QGNA 3CX7A 3UKOA 3IBGA 4B73A 4S35A 5FNVF 2VJMA 1XOIA 3E3AA 3KK0A 3EYWA 5BMVF 4E70A 3U4HA 4Q4HA 1OXXK 3LDHA 5J59A 1CF2O 2WIDA 3CGWA 3AUSA 3IJPA 1HT2E 3DOHA 3FD8A 3A25A 1W8DA 3DE6X 4GQAA 4AYTA 4TS4A 3M1YA 5JH7B 5K6RA 3B9PA 2B8WA 1QOQB 4HDRB 2B7BA 5TIIA 2R7KA 4A03A 3IEXA 4BLWA 1U81A 3N9IA 4AMUA 3FE2A 2V4MA 4IXTA 1NV9A 1RXYA 4FLFA 1FFGA 1E4YA 1LLUA 1ZIXA 2OCXA 3EXG2 3IBYA 3SZMA 2PRZA 3O4VA 2HLDD 2P65A 4FNGA 2I4NA 4KBGA 4C04A 3RU2A 4NG5A 2FSSA 3ONDA 1SC4A 1LKZA 1O0BA 4EGFA 4BLSA 1TI7A 3QPCA 3IAAA 5CK4A 3X2FA 4CMAA 2NTYC 4KQIA 1JWBB 2ERCA 4RA9A 3T1HB 3BTSA 1FMFA 2VP3A 1P2GA 1U99A 1WD5A 4M9SA 4FYJA 1XMPA 1QH8A 5KQPA 3I92A 3U6KA 3KHTA 3T41A 2DP4E 3I12A 3UJBA 2NP6A 1Z0ZA 3F47A 3GFGA 4JEMA 1V16A 3OWOA 2YOFA 4O8CA 1J56A 1T6NA 1E66A 4DJFC 3REGA 2WVJA 4J94A 1QKIA 3E7DA 3I4CA 3JAKA 1CZRA 3NXSA 4X20B 4YNBA 2PX2A 1KFKB 3UJAA 3VA7A 3E9ZA 1U2RA 4ZT4A 1AOXA 3T34A 5AIAA 4KBFA 5FPKA 1KSHA 3KQWA 2FPRA 1R15A 3AUJB 3D3KA 1J2EA 3ESDA 1E92A 4YP9A 5GVSA 3RI3A 5LOVB 5JVDA 1AF7A 1ZLYA 3BJMA 3HC7A 3GJ8A 4JLPA 2DCMA 3OZEA 3FW1A 1ZM2A 3AKDA 3WQQA 2B1QA 1CR0A 2QNBA 1LH0A 1MDBA 2HT6A 2R8BA 3R3YA 4CTMA 1V95A 5KJCA 4PAWA 4X45A 4WFJA 3RVKA 2WYVA 2C7PA 1L4NA 1ZI8A 2DECA 4JWKA 1HKHA 4CPDA 4JX8A 4JNCA 4DIKA 1GQRA 2HZ7A 2WFLB 3GVXA 3SSOA 4K3UA 2C03A 4UEOA 1EXWA 3PCRB 1XL1A 4PLFA 2FRDC 4IZ6A 3WL5A 2RIRA 1N2GA 2AN9A 3VR3D 5JW6A 5KX5A 1PHPA 3FTEA 3PUJA 1RLMA 4PLWA 2HREA 3C98A 2YNMD 4RNCA 2P9TA 1ZI9A 1Y9ZA 2G9NA 4N01A 4PONA 4OI1A 2N1BA 2XGMA 4UXHA 1L8AA 3QEKA 1I9CA 2QUAA 4CQLA 4J1QA 1M54A 2FR1A 3DE0X 4IIUA 4C5BA 1SAYA 5HMLA 2F55A 4LFBB 3JATA 1QIDA 4YDHB 3PUVA 2H5EA 2FZCA 3ZJ4A 4XKJA 4L4SA 3IUBA 1NX6A 3WB9A 3RVJA 1XJ5A 3Q8KA 4IO1A 3UG6A 4JKOA 1W34A 4DLRA 4FT2A 3D31A 2FN8A 1QU2A 1UBTS 2ALJA 1YRLA 2JJMA 1NBME 5AK0A 5LU8A 5FUXA 5ES4B 1Q2UA 4D96A 5DHUA 3QKUA 3H2HA 1QQ5A 1PG0A 4UVHA 1P33A 2B25A 3FJYA 4PRZA 1IN8A 1MTOA 1GAWA 1XTUA 4WNCA 1R27A 4X62B 3EBPA 1AKMA 4JUDX 4HWTA 1JEYB 2AOTB 3OIFA 3V48A 1JXMA 3U7QA 5J5CA 4WZAA 3CVJA 3PPWA 2PX5A 4XASA 4DY4A 1R74A 3QVGA 3KLNA 3WWZA 3OFSA 2PZMA 5IT4A 3FVRA 3T38A 4C0LA 3CLTD 2QLJA 1IULA 5KYYA 3KKOA 2YX1A 5EL0A 2FPSA 2HF2A 2RJOA 3IELA 1IK4A 3ASUA 3NVAA 4R3WA 4TMFA 3PQEA 2QX4A 3UM9A 5G0WA 4JD5A 1WETA 1TQ2A 4D8VA 4MJ3A 4EY6A 5BN1A 1C7ZA 3DSRA 4YRKA 2W6CX 1Z22A 3CKLA 2ZEJA 3FSGD 4JEHA 4O02B 5JO9A 1Q0HA 1VL2A 2HADA 2NUTA 3ZU4A 5KZMB 5CVUA 2RGWA 1YZQA 1NFRA 3TZ6A 3T1TA 2OC4A 2WWRA 4GEKA 1M5TA 4UUPA 1WU7A 1XLTA 1W85A 4IS2A 1JDBC 1E5DA 3C6BA 4G0QA 3WFJA 3K70D 3AUXA 1SMKA 4KYVA 1ABEA 4RGQA 1VG9B 1J22A 1P1HA 3T3MB 5M5BA 1Y3HA 2ANCA 1EVLA 2EFEB 4ON9A 4KACA 2VRBA 3VO8A 1BWPA 2W8ZA 2VSYA 3EG9A 5EJAA 4EYGA 2W2XA 2AD1A 3W3AH 4ER3A 1MOSA 3OZ7A 1CR1A 1G21B 1KPHA 1T2FA 2WPDD 2X7XA 3LI2A 1UWLA 4JODA 4UVIA 3R7LA 3RPEA 5JDIC 4R8SA 5HRAA 3ISJA 4E3WA 3NI2A 5ICMA 2IYRA 4TV8A 3VZSA 3ZWVA 5KVAA 1M34A 1ZN9A 2Y1WA 3NBKA 3T5GA 3V3TA 1XMQB 2QORA 3JQ6A 4C6RA 1E2UA 3QPWA 2VVTA 3H0KA 2D2EA 3HLYA 1T8YA 2WJVA 2X1MA 2GK3A 1QH1A 2JFOA 2P9HA 3GJZA 4G8DA 3H9UA 2FEWB 4RULA 4HDCA 2XXAB 1GARA 1R9GA 3OZXA 3RRNA 2RHWA 2J4FA 2VJNA 3B3FA 4IDOA 4P6VF 3W8DA 2RK3A 4F3NA 3GXBA 1I7QB 2OEPA 3PE3A 1KMCA 3EXAA 1TUIA 3EULA 1E58A 1V3UA 2YL2A 3HYRA 3TLMA 3VU0A 2VNAA 4ZI2A 3BZWA 4MUMA 5DISB 3GGOA 4XGQA 4G5YA 2OGWA 5I48A 1E7WA 3NWBA 3AF0A 1EVIA 3L7OA 4HYYA 1JKIA 1TCVA 4KI0A 5AVVA 1TRKA 5AW0A 5IX8A 4YQEA 2GNPA 1J39A 4RM2A 5AKXA 3O90A 3SN6A 3UV7A 4B2LA 4MIOA 2O0HA 3Q0TA 4DSNA 5JMWA 3AVYA 2AMYA 3HRKA 3NBQA 5HKOA 2ACEA 1JQEA 1XZDA 3MWKA 3ZLUA 4NU5A 3MS2A 3LXMA 5K5EA 1B6TA 1SZPA 2W2QA 2VEOA 2XDAA 3TMAA 3ZOZA 2SKEA 1YCDA 4PO1A 2X9VA 5FJJA 3U4QA 3BQNB 1K92A 4TWIA 4MITA 5DTIA 1PV1A 1KQNA 4RYLA 1GSIA 3NT5A 3N6RA 3B3AA 4XM0A 4H6VA 5DK6A 3DM9B 1PQWA 3A4YA 5KNBH 5L3SA 3NJ4A 2PYDA 3QMWA 1PJ4A 3FJ1A 2JD2A 1IN7A 2ZFUA 4WBSA 4DTIA 4EJFA 3L0ZA 4EFDA 1E8DA 4KRYA 5LDDC 1HE3A 1SHKA 1Z4QA 4OATA 1BMFD 3W0LB 1JQKA 1UMKA 2FW6A 4JB2A 1XWFA 3N8KA 5CVCA 1RHKA 1VCIA 2OHIA 2CXUA 1N0WA 2HCTA 2Y93A 3B1WA 3OSUA 2PT7A 2C4WA 3QKTA 1N1MA 4PCUA 1NDQA 1RTKA 3H6HA 1XWWA 3SS9X 1JQJC 2CUNA 4MTLA 5KREA 2YZ2A 3IXLA 1W49A 2CKMA 2ZUBA 4R2LA 1GL9B 3KQYA 4JL5A 4XEHA 1KFCB 2Q5LA 3WK8A 2WICA 1JYFA 4HR7A 3ETHA 2OCBA 2R6GA 1YRYE 4ZO8A 3CG0A 2ZRCA 4X90A 2PH3A 4DQUA 1P2DA 3A3NA 3SLRA 3H0CA 3HMQA 1KO5A 2EG9A 1WLYA 1Q0QA 5KSZA 4X6UA 5AI6A 5JXIA 2EL7A 1PWZA 5JJCA 2BGTA 4MYTA 1NE2A 5F76A 1YQEA 2D0DA 1IY0A 1OR8A 3QG1A 2AHOA