3RNOA

Crystal structure of mouse apolipoprotein a-i binding protein in complex with nadp.
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
233
structure length
233
Chain Sequence
AVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSKSPPTVLVICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTGLVTQCQKMDIPFLGEMPPEPMMVDELYELVVDAIFGFSFKGDVREPFHSILSVLSGLTVPIASIDIPSGWDVEKGNPSGIQPDLLISLTAPKKSATHFTGRYHYLGGRFVPPALEKKYQLNLPSYPDTECVYRLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Apolipoprotein A-I-binding protein
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
source organism Mus musculus
total genus 75
structure length 233
sequence length 233
ec nomenclature ec 5.1.99.6: NAD(P)H-hydrate epimerase.
pdb deposition date 2011-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3rnoA00
3RSQA 1JZTA 3RTAA 3RSFA 3RNOA 3RTBA 3RT7A 3RO7A 3K5WA 3RTDA 3ROZA 3RRJA 2O8NA 3RTEA 3RREA 3RRFA 3ROXA 3RT9A 2AX3A 3RSSA 3RTCA 3RU2A 3RSGA 3RRBA 3RU3A 3ROGA 2DG2A 3ROEA 3D3KA 3D3JA 3RTGA 3RS9A 3RS8A
chains in the Genus database with same CATH superfamily
2I6FA 4FVTA 4G8BA 4G1MB 1K0UA 4RQAA 5TX7A 4C6RA 1JA1A 2C9ZA 4KWTA 3BD9A 4O33A 5K4GA 2VHQA 1UMKA 3GLHE 1EUDA 1U7WA 4XAQA 2OEPA 2XXAA 3BEDA 2D8MA 4Q4LA 3I4LA 3GV0A 4Q39A 3NV9A 4KC0A 1VCMA 2GO1A 3LUHA 3MSXA 3V46A 5BNTA 1EK2A 3MN1A 4TVBA 4HH4A 4JITA 4N3AA 2I2DA 5CYFA 5EY5B 4AN1A 5K05A 2I3GA 3HKBB 4MUNA 4FILA 4G0MA 1THMA 4ABTA 5I6DA 1YE3A 3FZQA 1J09A 2QUJA 4JB0A 1THTA 5CJ2A 3EFOA 3L7AA 1SEVA 5AJUA 5EYPA 3MEQA 2NVBA 1A5TA 1Z6AA 2CUNA 4KN8A 4PAMA 4RK4A 5EERA 4BVKA 5IKMA 4L8YA 3I2HA 3Q9SA 2DBRA 3CNNA 4W1QA 3MGGA 4QOSA 1NW7A 2BDUA 3R7NA 3B9PA 4DREA 4S05A 3WLTA 2GBFA 1MORA 1HR0B 2WAOA 1EFUA 1C81A 1W19A 2J3HA 3F6RA 2Q4BA 5B58C 5BUCA 4GS5A 2FF7A 4FBGA 1WZNA 4LC1A 3TTWA 3CVOA 1WCWA 2AEJA 2EFJA 1F2DA 1GITA 2YYSA 3DGEC 4G65A 3IVAA 3VXKA 1XZHA 3ILYA 4RXUA 4Q1VA 1TLLA 3GCGA 3UT6A 2YVAA 4BB9A 1KOGA 3H2SA 3C87A 4BXOB 2E1PA 3EVGA 1U8YA 3NCHA 4PBTA 3ROTA 4B82A 5I5GA 3QV1A 5D3MA 2OO7A 4WADA 1LPSA 1P9WA 3CA8A 3O03A 3PTAA 1Q1QA 1L4YA 4MKIA 1ABFA 3P9CA 3AFNA 2N9UA 1Q3KA 3WL8A 2JAPA 1IFXA 4HRYA 2VDWB 4MQEB 4OFXA 4GP7A 1KC1A 3CE6A 3M7IA 1JDBC 4HNQA 4RD2A 2QPOA 5IKXA 1QQAA 5NULA 1E3SA 4HCJA 4HNGA 4FW9A 1P2DA 2FKNA 2W6ZA 1G6KA 4PYLA 1NX9A 1BKYA 2BI8A 4A8TA 1S4QA 5HZGA 3B70A 1P4JA 2RAPA 3D1VA 3K2IA 1JN0A 4YHBA 1CK4A 3TVDA 1KTVA 2AYXA 2WU3A 1Y3CE 3AF2A 1MB0A 3QE3A 4GLJA 1QR2A 3RHZA 3TRDA 2OBBA 3RD5A 2XYQA 2CVFA 3UPDA 4AW9A 4R0MA 1ML4A 5JAZA 2C9YA 4TKVB 1JJIA 3UY4A 1SKAA 4DA7A 5ITVA 2JAQA 5EPUA 4J75A 3F97A 2H2WA 3WOVA 5C2JB 1Y1SA 4DILA 3BQ9A 4RY0A 1PGNA 3QWAA 2V7UA 3BDAA 3I8XA 5DNUA 3GI1A 2FN9A 3LCCA 4KOAA 4OYRA 4C08A 1KZ9A 2IU0A 4PTZA 3TI9A 1FRVA 2FU5C 3WWZA 1I5EA 4ER5A 1S3GA 2W5UA 4TUYB 4KQHA 4BO3A 3KQPA 3FOEC 3E1SA 4I55B 1W96A 3BDVA 1K8QA 4JBGA 2EDAA 1EDOA 4ZC1A 1X6VA 4P1ZA 3MPUA 5HW0A 1WXIA 1ZJ5A 5BQOA 2VFAA 4OBBA 1YT5A 3BWDD 4OX9B 3T1NA 4MO9A 1BU8A 4GW3A 4ZV9A 2RK4A 5F7JA 1ETUA 3R5FA 3Q6NA 1KK2A 1TL7C 4BFYA 2LDBA 2CUTA 3B7GA 1RT9A 3WSVA 2DUJA 1LTHR 1NQVA 4HWRA 2F1RA 1F3LA 4ND6A 4BNYA 4JD5A 4AKTA 3HUTA 4JC4A 2FWAA 1MFPA 1J5XA 5GZ1A 4E5SA 4MKXA 1HL7A 5JUWA 3LHFA 4IJMA 3OMXA 1IJFA 4XSVA 3I83A 4FMPA 5AM1A 4LYJA 3CLSC 4NZ9A 3CBGA 4GE3A 4Q3CA 5TR9A 3T7JA 1KE1A 2MSEB 2ZQ5A 3QPUA 1D5CA 5JECA 3D7RA 1HDXA 4Q34A 2Y6UA 1WSAA 2RDMA 3BAZA 4MGZR 1VG0B 3RYHA 1AN9A 1QJ4A 3VKFA 3FTEA 4TS3A 1SO8A 1E6LA 3C3MA 1IEWA 4OP2A 1EFPB 1FVXA 1SCBA 1N2JA 2UUAB 1LVHA 1T0IA 1QYIA 2IDZA 2VDLB 4S1PA 4MSUA 4G0ZA 5TJHA 1XEXA 3GUCA 3Q98A 2XQKA 3PWZA 4BLWA 1DQNA 2CEKA 2QRLA 3N2GA 5BNIA 3V4RA 3B6EA 3OQVA 3CCCA 1ZXXA 2QTFA 3H9JA 2OTCA 4KSCA 3IL2A 4D9JA 4C01A 1Y7PA 4KYUA 2OXIA 3WWPA 4N01A 4I4TF 1ZR2A 2YYAA 2YV3A 2WUEA 3HA7A 4P4SA 1YQGA 5EA2A 2C2MA 3ST7A 1HNNA 5KYWB 2BH2A 1B8UA 1FUIA 3T38A 2F1OA 1QH8B 5H7XA 1KMIY 4ZXPA 3KQMA 2YIJA 1UOEA 4XVCA 3IFSA 1RE0A 4JLDA 4JQZA 5ES3A 3IA2A 2DP4E 3QFCA 2BFDA 3TMKA 2ZJAA 4CR6A 5HPYB 1T6XA 3BSYA 3QVOA 5EOVA 3COYA 3RIYA 5JWOA 1FNMA 3PF9A 2A14A 4DUGA 1YFLA 1BW9A 1QUEA 1S2MA 1WBJB 2L0XA 3G8DA 4WD3A 1UJBA 1PK7A 3UOWA 1A5SB 5JALA 4F60A 3T9DA 1ZZGA 1W36C 1VPEA 3ROXA 1UFQA 2EZ8A 5T41A 1EIZA 1XMJA 4GLLA 5KB3A 2CHVA 3EEYA 1GZ6A 3D8HA 4RK0A 4B84A 2OQIA 3BJRA 3EGCA 1TW2A 2JHGA 3THXA 3QMVA 3VPHA 4MUAA 3TCNA 4RGVA 4WMLA 3NYIA 4B83A 1CF9A 2W11A 3DC7A 2WVAA 3LO8A 2UU9B 2C1EA 1W2WB 3VR3D 1FCJA 1Y1TA 4RJTA 4BFUA 1GFIA 5L95A 3R75A 3VJLA 1PT5A 4E70A 2G07A 3AOEC 4KMSA 1NNEA 4FEEA 5EUCA 4YO8A 3DCYA 2O8FA 4N7MA 1V2GA 1QQBA 2J5KA 1KQGA 2BM1A 3QJYA 4ZWNA 1WNTA 3D2AA 4FMDB 2AYYA 5K0LA 1XU4A 3MWLA 4GX5A 1NKSA 1CYEA 4R1NA 3ISVA 1ISHA 3FFBA 3CY6A 5LLTA 2RHTA 1FMLA 1I4TD 4CIWA 3HZRA 1HG1A 2N0SA 2WP8J 3CVXA 4QRDA 1D2MA 1LSJA 3IOBA 3TOCA 4DV3B 5L8VA 5L7YA 1J97A 4JR0A 4WXHA 4NAVA 1OYOA 1L1EA 2WQZA 2XWPA 3IBFA 3PWKA 2X42A 4GI7A 3I5UA 4Y2RA 4AJOA 5I47A 1EP2B 3K70B 4DB2A 5DGHA 2D8AA 4B3GA 1PCXA 5JZMA 3TH5A 1BRMA 2MWMA 1H85A 1R4NB 2CCJA 1SR8A 3FG9A 4ZOAA 5DHFA 2WJHA 3ECCA 5LDGA 3TOXA 4DNPA 3AWIA 2AG8A 1N1DA 1G0NA 2C5HA 2CLHB 1CE8B 3KXKA 1DAMA 1WPGA 1A1SA 3NTRA 4KDCA 3HBLA 1I7SB 3ESQA 3F2IA 3AL3A 4LXTA 2E49A 3UJ3X 5JASA 4LAFA 2P40A 2R4UA 1QCCA 1A8SA 2Y92A 1XZIA 3GLGE 2V03A 1Y42X 2CF6A 3DXFA 3ZLTA 1M2FA 4YWHA 4RH0A 4LXIA 4Y9RA 1L5MA 1SCIA 4PS1A 5A1JA 5L3VA 3WGIA 4F85A 3EVFA 3ODPA 6CHYA 2K87A 4Z4EA 3OVMA 2QBYB 3HKDA 1KOLA 2RHCA 1HNZB 2X1VA 1D1SA 4MUGA 2C61A 4H1WA 2GVZC 1QGED 3TLXA 4AWXA 4I9UA 1SHLA 2XV1A 4IJ5A 3ETHA 1U0EA 2FK7A 1Z2OX 2QYHA 3QXGA 1PW5A 1G9SA 2XUQA 4ETMA 5JCOC 3U0VA 2GO7A 2GLTA 1JEJA 1XE3A 3DV0B 2VZ0A 1R6AA 4HUTA 4ZZ0A 1K68A 4PSKA 4ER7A 1ULSA 4L3VA 3M34A 1LDNA 1M6HA 1NMSA 1REQA 1Y82A 2GOYA 2H5IA 3MINA 1W1IA 1RXSA 5HDBB 3DEIA 2D6FA 1ODSA 1T34A 2PRSA 2X2EA 4JOSA 3PX2A 3AUXA 5CLGA 5AI4A 3VSCA 3Q2OA 4P92A 4EENA 4F6LA 4OQEA 2ID8A 3RIMA 5D5HA 2YXPX 3BCSA 2O07A 3C16C 4MWDA 3UBMA 5KJFA 3ZQ4A 4EB0A 4PHCA 1FNSA 5FB3A 2PYDA 5F3DA 2Q2VA 4ZRNA 2P65A 3JAKA 1KO5A 1X3SA 2FQYA 3FSRA 3FSGA 4EKIA 1XNHA 2Q3MA 521PA 5I48A 1EGHA 2JLUA 3IV7A 4AJ9A 1DRJA 3BHMA 2HT6A 1IEXA 1XCGB 3PTZA 4OP3A 4S0XA 5BT9A 4YCMA 3ZHOA 5JH7A 4FEYA 4S04A 3ZNQA 2PVPA 3V8BA 4OQDA 1J0EA 3GGCA 3OLZA 4JLVA 4XUDA 3X1KA 1ZCAA 2RBKA 5CXSA 1LY1A 2Z6UA 4UMDA 1OC2A 2CCKA 2QN8A 4CM7A 3OETA 2J9FA 4HWOA 4WZAA 2AT1A 4Y8VA 1YL5A 2WJ4A 1G1AA 3IE2A 4G5XA 5CVEA 3H0CA 1DDOA 3K1YA 2BJWA 3ZWOA 1P0PA 3SE0A 2FF5A 5H59A 5TMBA 2RHGB 4NMWA 2D1SA 2ERCA 3LDHA 4KPFC 5CVUA 2B4AA 5CM8B 2IYFA 1X1CA 2BCEA 1B76A 3HNOA 1E1DA 4MWTA 1N5OX 2PJZA 4KRGA 3CVYA 4TTTS 1DTWB 3PCTA 2GPTA 3H5LA 4NPHA 4B2PA 4CMEA 4EPRA 1RI3A 1POXA 1D2CA 2AK2A 3TQRA 1P77A 3TDKA 4PNPA 2CBZA 2GCOA 3HFGA 4DIBA 3UO8B 4DXDA 2XMGA 3G0OA 4BNTA 4BO5A 2DBYA 3S3TA 1QP7A 2O50A 2DFPA 4QATA 4RSMA 2XNCA 1EFCA 2DSNA 4NF2A 2FJPA 1I7NA 4AX8A 2YJZA 3CUWA 4LMRA 4ZV7A 3V7YA 4E5YA 4DM3A 4B47A 4G4JA 1LWOA 3V4VB 3WYEA 4QUBA 4YJGB 4LK2A 3SZMA 4C0HA 4IUBS 1WHSA 3KD3A 4HAIA 3BKXA 1DBQA 4FFWA 4MH0R 4M1TA 1E6EA 3OEHA 3PDCA 1PT6A 3LU1A 2GM3A 1XTPA 3Q87B 1E3EA 1CS4C 1L8LA 3CWCA 3D3NA 4O5OA 5B1IA 2C54A 4BFCA 5BN5A 4RVNA 1JH9A 4TRJA 4IGEA 1EE1A 2PZBA 3N8KA 3PGXA 3COVA 1D04A 3FLBA 1T5OA 5FWAA 3EZ2A 4IRXA 4FC7A 1XFAA 4QSMA 1VKZA 4H17A 5HCUA 4RTKA 3BTVA 5JZ9A 1EX9A 2BONA 3PK0A 2F8TA 1RABA 1IHXA 1L5SA 1IYZA 2JD2A 4ZMRA 1Z28A 4HLQB 4C7MA 5KC8A 4URHA 1IMOA 4JJZA 4R3WA 4MW4A 5AJXA 4OKIA 3LXUX 4HDNA 5IBQA 5TPZA 4BJ5A 1E1QD 4V2UA 2NP6A 3A37A 4WNIA 2Q0XA 4YRLA 3R3JA 4BB6A 1R15A 2LVBA 1KFEB 2FDXA 5FWNA 1JKFA 2H7VA 4RIEA 3NVKI 1FVHA 3QU7A 3EPPA 5FADA 4QKQA 2HMAA 2OLEA 2HYIC 4LJ7A 1KP2A 2OBMA 1FTWA 1UDXA 4OGLA 2O5EA 3S1AA 5KOIA 2JRLA 2BUAA 1OGYA 5JIBA 3I1JA 1E3QA 3KNZA 1YONA 1WBBA 4QJ4A 5KCZA 5F2OA 3MWGA 3NWEA 2QPLA 5U1PA 3S1SA 3ADBA 3BRSA 1LPOA 1SBTA 1XTZA 3D6VA 5SYMA 3CGWA 5KNDH 1R66A 1NBEA 5UKDA 1ISRA 2AFIA 2CYCA 3AY7A 3VHXB 2XCQA 5BN4A 1UODA 5EVJA 5LA6B 1NN3A 5TVGA 3PE4A 1RWXA 1PWYE 5TJ9A 1X8JA 1YR9A 3AX6A 3SVLA 3FWYA 1W87A 4HC4A 1Z4QA 4KQMA 2IZOA 2ZETA 1E1KA 3DKRA 2DUMA 3A2LA 2J0UA 1UC9A 4QTTB 4RD6A 3JQBA 5DNAA 5BV8A 4CIAA 2NX2A 4L8WB 4ND5A 4UULA 5ICGA 2B1GA 4IJQA 4CIBA 1GAJA 5FTNA 1ZAKA 4B6QA 1ZD9A 1ZJJA 3IR7A 1RWWA 3KUXA 3OH8A 1E3MA 1ZGGA 4CTOA 4UBLA 1JEYA 1AN0A 3NWPA 1GGMA 4ENVA 1II0A 2B4KA 1PN3A 3N3AC 1E2QA 3KWLA 3LUJA 2C59A 3O1LA 3WMGA 4WNYA 4FCTA 2WU4A 5BVHB 2P8SA 3ICWA 1XRPA 5IT5A 1IJKA 1DIAA 2J9GA 2ZRPA 3CS3A 3A28A 3C7KA 5P8WA 2J4DA 3E7DA 4JROA 1R9GA 1LJLA 2WJGA 4K9SA 4L51A 2G4VA 2ZB3A 1T4BA 2D1RA 4LWPA 4Q4HA 5C7YA 1NJSA 3LF1A 1DEKA 1U0FA 2VBGA 1KEPA 5AJTA 4TZ0A 4M38A 5H68A 1YFJA 4ZDIA 1Q0TA 4B3BA 5B58T 5DNVA 5JD5A 1RVDA 5AKLA 5D00A 1SK9A 2QLFA 3SQOA 4CU5A 2CE2X 2FW6A 3VNSA 4G86A 3W7BA 4EBBA 1LDBA 1GG9A 5BRAA 2R8ZA 4R5MA 4D0LB 1GNTA 1I51A 1QIDA 3RH0A 5E0OA 4I9NA 2FPSA 1E2MA 3H97A 2ZE8A 1DXQA 2IEZA 4LNHA 4HRVA 2AWOA 1R2QA 2DX7A 4BQQA 1G6Q1 5I7OA 1GA6A 4U0KA 2KLHA 3WWOA 5FTWA 4LJ4A 1Z8HA 4M2LA 2H1SA 2RIPA 2DLDA 4GIBA 3W5JA 1ZJ6A 4RGBA 4KBFA 2H52A 5E7IA 2DR3A 2VDPB 3DLAA 4CEIB 4NCHA 5JROA 1J8MF 1NUQA 3BOSA 4JSTA 4OCZA 2PXXA 2QL5A 1P2GA 5C18A 3O8CA 5BPHA 1WQ3A 3RTEA 3HUUA 5HF6A 1MG0A 2BH9A 1YL7A 3GFQA 2AX4A 4V39A 3BQNB 2JVJA 1DT3A 4IJ6A 4U02A 1Z2CA 5BWMA 3O94A 4MTCA 4FYKA 3WNDA 1S7CA 5TC4A 3ORQA 3PSAA 2PANA 1GQQA 1VJGA 3V8QA 4DEXA 1I6MA 3R6WA 3E3MA 3G02A 2W8ZA 4PNEA 4MV0A 2QJFA 3JPYA 2AS0A 4PPNA 1P73A 3LC1O 1VLVA 2W6QA 1A69A 4ZDWA 4LFAB 3RLFA 2SICE 4IYRA 2I2CA 3UHFA 1ZCFA 2K2QB 1PJAA 3ITKA 3A1WA 1BO6A 4LXQA 4RW0A 4B80A 4F3CA 2B0CA 4FQ7A 2AUTA 4CKYA 3D6NB 1Q1BA 1U9ZA 1MZVA 4PQYA 4XGNA 3BAFA 4DLTA 2YWHA 1JF8A 3RUCA 2VRCD 3U4AA 5JI2E 3C4JA 4NE7A 4M53A 3KTOA 4QAQA 2BY4A 1Z75A 5FFNA 1ST2A 3TZCA 3CR3C 1C7JA 1N3LA 1I3LA 2Q7XA 2P9EA 3COSA 4X1YA 3SU8A 4KRYA 3MRSA 5DULA 2C8LA 1ETHA 1Y8AA 2O5VA 3SHTA 1ZSVA 1U8UA 2B61A 2LW7A 2QRPA 1QO7A 3PXGA 1U9JA 4YJ3B 2QVYX 3ZNPA 1ONNA 3DBIA 4ARZA 1JVSA 1LRJA 2QRHA 4PGMA 4XUEA 1G21E 3SZRA 2C5AA 1FU7A 2G8LA 4N65A 3OT1B 2O4UX 2O5RA 5BV0A 5JRJA 5TMPA 3ZGOA 2H7XA 2X5XA 1X7WA 3IP7A 4RZUA 3VAYA 1ZRMA 1N7HA 2ET6A 3SHFA 3CW8X 1ISIA 3AOGA 2V9PA 4RNCA 3DOCA 4GU5A 3KXIA 2R1ZA 1ZW1A 4GZ6A 3IPRA 3MBKA 1F4LA 5EIBD 3B51X 1PX2A 1SC1A 3OURA 1CDEA 3WS7A 2XT9A 1JG1A 4C3UA 2JZOA 5TPWA 1KO4A 3NC4A 3LMKA 3ETJA 4L0CA 3ZKWB 1RZUA 3VVMA 4B6SA 3NHSA 2X3YA 1XWFA 5BNFA 2XIJA 1RJFA 3I09A 3LBHA 3B1XA 3T99A 3V7NA 5EKXA 3VSBA 3OWOA 5LYJA 1VHLA 1GKIA 3GRKA 2A5GA 2DJ5A 4ZAFA 2QRVB 3BSSA 4D4MA 1ZVKA 3GVHA 3N39C 3OLWA 5DHRA 1XZDA 4M88A 1S6YA 1I4DD 2BMDA 4JP2A 1IZ7A 4ED9A 2ODPA 3GNTA 4TYNA 4RKYA 5K8LA 5HA5A 1UMCB 1KJWA 1JQ3A 2R8XA 2DLCX 3NXSA 1P2UA 2FZCA 4HAZA 4ITRC 1F8XA 3ZEAA 3ANTA 4BFLA 1U7XA 1KWKA 4HH1A 3OP1A 4K9PA 3W9BA 3IUQA 3DO5A 3TNJA 4GVLA 1CFZA 4AWAA 4EY7A 4DPLA 1E0DA 2IWRA 3S2ZA 1P7VA 4BGEA 3U5ZB 2XKKA 4DA8A 3I6QA 4QVIA 2HNKA 3SXJA 3GIWA 3L8GA 4DV1B 4QE3A 2YJ6A 4QUJA 4X63A 2I7CA 4I4TB 1YOVB 4GM0A 4MV5A 5IN5A 3WR5A 2O8BA 2WVHA 3PXXA 1BWRA 2JGEA 4RZ2A 4A8HA 2L82A 2FEAA 4D0NA 3OAAA 1UFVA 1A8PA 1O95C 1K6MA 1NXOA 2A86A 4PR0A 4PO3X 1U5BB 1UBKS 1T25A 3PLRA 2DWQA 4PZ0A 3PUVA 2FMFA 4LBZA 8AT1A 3DEYX 1UBNA 4MCAA 1LLDA 1XF9A 4FXPA 4NONA 3NCTA 1WB9A 3HDHA 1ZK0A 4XYMA 2VP6A 1OX4A 1Q15A 2NU6B 2QYTA 4MI6A 3BMOA 4H31A 1U4SA 5K3AA 5LLDA 3QNMA 4DA9A 4CM3A 3R4CA 3DCIA 2C20A 4EX6A 1UFRA 3GA7A 1KPHA 4C20A 3Q3VA 2H57A 2X9VA 4MW1A 4EH1A 1UQRA 4ND7A 1GT6A 1Z7WA 1QDUA 5SYAA 3IODA 4ZGBA 1ORHA 2IX9A 3ANYB 1O77A 3SE7A 1N6RA 1I3MA 3ND5A 4OI0A 1SBNE 4LOLA 1EINA 4C89A 2QZ9A 2QIOA 3AF4A 2C3UA 2UDPA 3JSAA 1W9MA 4KQCA 3WRXA 5ITZB 1K3TA 4YDRA 2CFOA 1LVUA 2X7JA 4GPEA 4FIDA 1WRBA 1M6VA 4OAPA 3FAKA 5BMOA 1P4GA 4C78A 3HM9A 1AU9A 3HV2A 2C99A 3K8OE 3R9XA 4BIMA 4LHVA 1CY0A 1SKUA 1C8KA 2IXAA 2HL6A 2WP0A 3AVOA 3NOVA 4B4KA 1XQ6A 2QZJA 3Q7RA 4ND8A 3VHRA 4XZ3A 2XPCA 1SCAA 4GKAA 3UUEA 4MAMA 3TW8A 3K3PA 3VGJA 4MEBA 2FUEA 2VBFA 4I7EA 4G0XA 1L5HA 4UC0A 1CFJA 1V95A 5CCDA 5F76A 1IM2A 1ST3A 2W00A 4URZR 5AUQA 1Q6ZA 3CEHA 1LX7A 3PHHA 1YVUA 4AY5A 4CKCB 1QTRA 1Y6JA 1N2CA 2Q1YA 5H8WA 5DYTA 1LUAA 1JFLA 2FQWA 3JQCA 1HXHA 1VG1A 3A3PA 4A7PA 5DMXA 1GNQA 4N5DA 2DCMA 2UVQA 4D26A 4WK0B 1CQJA 4EA7A 4YLEA 4X95A 1LBHA 1TI7A 4DMCA 1U65A 1OKKD 1CY8A 3GN1A 5A3SA 3BORA 1AKEA 1MABB 3F98A 4O3FA 3WJ1A 3PQDA 1FTSA 3JVIA 2ZITA 4NPCA 1WUKS 2Q9AA 4EGQA 1SRQA 2GT1A 3PDUA 1NPTO 2AOUB 5T3UA 1SVLA 4GI3A 1SB9A 3OWXA 2HPAA 2AJBA 3DP9A 4HLUA 3RNOA 1OB5A 4MVJM 4IJKA 4O8ZA 1V5FA 3DEKA 3KT8A 4INZA 4AX4A 2VF4X 1MMFB 1WW8A 1XXHA 2G1KA 3PR1A 3V9AA 5HRAA 3FWPA 1S9DA 5LN1A 3U3DA 2FWIA 2IXDA 5FNVA 2BV3A 1JG3A 1Y8CA 2PFGA 1B6TA 2CNNA 2OVBA 4IGFA 3I5MA 1KSJA 1NE7A 1Z6PA 2WLSA 3DDZX 3QWHA 3PFNA 1K7SN 2AOVA 2CLOB 4Q66C 4BX9A 1UT8A 3KB1A 4QG3A 2HNAA 1T1EA 5C7LO 4MRSA 4L5BA 3LQ2A 3DDHA 5FUWA 5AVXA 3OCVA 1C1DB 1ZD5A 2A5LA 3RS2A 1RLMA 3TRKA 4EFMA 3D3JA 2V7BA 3DMTA 2PU7A 1DTEA 1J4AA 2RONA 3H6HA 3VZCA 4X1IB 1JWLA 2RBGA 5AFSA 3IOCA 5CDSA 3BX1A 3O83A 2YBEA 2GDZA 3O21A 3R77A 3TVTA 2R25B 4BZXA 2WABA 3VA7A 5JYCA 3KQQA 4L0DA 5ISMA 5HQJA 5L51A 1MOZA 1P1RA 2G67A 1JEQB 2AC4A 2XT0A 3CTMA 4DIEA 1NVUQ 4O2BA 3NYQA 2BEWB 5HZMA 1LS6A 3SXUB 3NC0C 3ZJ4A 2HGSA 1ZOIA 4X8HA 1C80A 2W2LD 2QRZA 1XK6A 3KIPA 3ZW9A 3IERA 4IJVA 4QJBA 4XCXA 3RFXA 4BQOA 2H4ZA 2VH5R 4EKYA 5LYJB 1BFKA 2W8BB 3UWPA 2HQBA 2XDYA 4MEAA 5ALMA 1DQPA 1Z36A 3ZTTA 4N48A 4H3SA 4TSFA 4QU5A 4RAOA 5KSYA 3NRCA 5IABA 3A3YA 1SUDA 3OOHA 2PLFA 1PJSA 1QAQA 3RG2A 2DFKB 3DWIA 4BLSA 1SZPA 4EJ6A 2QWXA 1UDRA 5HCIA 5E9AA 5I9LA 5LU9A 2PYZA 3DV2A 1UXIA 2FSUA 5JU6A 2QX4A 4D4HA 4CF5A 2VBCA 3MT0A 3SX4A 3AVUA 1SG0A 4R01A 3KHTA 4F84A 2Q0HA 1XTQA 2I4LA 1LDYA 2CZQA 2PQ0A 3X3HA 5DTIA 6Q21A 2FPWA 3I53A 3B1YA 5AVTA 4N47A 4EI9A 1CDDA 5JYBA 1XLVA 2Q5OA 5G4LA 1AKWA 3KQWA 4OY3A 3TQSA 3WDMA 4WESA 4DXAA 3UWKA 3M1AA 1WV0A 1P31A 1OY1A 3IT1A 4JA2A 2X22A 3WLIA 1WUJS 3RYIB 2TS1A 2RGRA 2G9RA 4ALJA 4GP6A 4AJHA 4M9UA 1ES9A 4C0LA 1IZYA 4Q7MB 2F48A 4LYEA 2IIBA 5EZ5A 4L0QA 4B2LA 2BFCB 1T5TA 2CNLA 4MICA 2R1VB 4J43A 1JDUA 4Q5IA 1YDEA 3GDFA 5HEKA 1A9TA 3ZQJA 2OYSA 2Q2NA 4N6NA 5J1TB 1ZGZA 4Y1EA 4AKIA 1JR3A 1KAEA 3K1TA 4IHJA 5GTDA 4PRYA 1ZNWA 2VATA 1Q19A 4MI1A 3U31A 5EJ9A 1ZOOA 3JWGA 1D2EA 2HU8A 1N2HA 3OQ1A 1L5YA 5FPKA 3FXAA 4LF5B 2XUJA 1H3FA 3IOYA 1TMOA 3MJVA 2ZCUA 3LHSA 3C3EA 4OGWA 3LPDA 3PS9A 1XA0A 3WLSA 2D2XA 1KYIA 3HE3A 3K5HA 1V4NA 3A10A 3TIVA 1CP3A 1P8JA 3JAWB 2J33A 3P4XA 1BX3A 2E5WA 1YTLA 1DJNA 4ETNA 3D5TA 5J5AA 2Y1DA 4P84A 2WSSA 4V0LA 5AHXA 2X5KO 3R6DA 1M7HA 3K0FB 3CN9A 3ZZTA 4LF6B 3G2HA 4UEKA 2JZCA 2C9DA 5C4GB 5IDVA 3NHZA 3M6XA 3ZE2B 5GZ6A 1X19A 3B9RA 3DQQA 2O2CA 4GQBA 3B3JA 2D1QA 4R0NA 4ZAGA 2CZGA 2BPOA 2Y27A 3GHHA 1BGXT 2P2SA 2VZ9A 4MKHA 4QXAA 4YBRA 2E18A 4PANA 1NVVR 1EFHA 2PT6A 2QGNA 4JP1A 3TW6A 3ER9A 2OAQ1 3LLMA 1YU9A 1Z4NA 2J67A 2ZJ2A 2AQ8A 2WZDA 1FXUA 4ZAVA 5CK5A 3LH5A 2JCYA 3CWQA 4CMEC 4HQNA 4W7SA 3GEGA 1SCUA 4DG9A 1UC8A 3ABOB 2EFCB 1UP6A 1XAJA 4NZMA 4G8JA 5KWJA 2PGXA 3DAOA 4U2GA 1V7QA 2D0IA 2QTAA 4LTMA 5B12A 4E12A 3ZJTA 1JHAA 3AIMA 5BXQC 1GWNA 4RX1A 5KCMA 1G17A 1NU6A 4LJKA 3JASA 3OX3A 4FUQA 5DGIA 4Z9FA 5FHQA 5IZCA 3AEZA 1AKYA 2RGNC 3R5XA 1HH4A 2IIVA 4JZYA 2DG2A 3TJRA 4EGJA 1OR8A 4D9IA 4DGQA 2D13A 3UGKA 3TF5A 5FF9A 2F3UA 2J5RA 1Z5OA 3GT7A 1F5NA 1IMJA 1M1NB 3C3WA 2R79A 3GA5A 3F4BA 5EC8A 5B6JA 1ADFA 1TDJA 2MYTA 2A57A 3PCRB 4O02B 4WY8A 1BCSA 1X1AA 3B8EA 5SZJA 2IY9A 4N8DA 3I1FA 3CPSA 2HFKA 4UOQA 2W0SA 2IGBA 4IDCA 3LWBA 4WXPA 1WZ2A 3MT9A 3F9IA 3VR6A 2ORYA 1A88A 5DEIA 4BN0A 2BGGA 1RXCA 2N47A 3TB4A 4D96A 2JARA 3HJRA 3C8ZA 2AL7A 4J9UE 3W8EA 2P4SA 1RTKA 1B7GO 1SXGA 2PH1A 4R4JA 2ENUA 4F45A 2GNAA 4AG5A 4PTLA 2NU8A 1U1FA 3BSFA 1KJ9A 4ZQHA 5ALOA 2QM7A 3EFEA 3OA2A 3BK1A 4A73A 1SVIA 3GUZA 4R1TA 1G6OA 3H2KA 4J4BA 3I9FA 1XRSB 1SKQA 5IC5A 3U3ZA 4NJMB 2P3OA 1PR3A 2X0RA 2TRSB 3KR2A 4RIFA 1CVLA 5HSGA 4BMSA 3MSCA 4KFCA 1C7FA 3QENA 2FEMA 4D4LA 3IUNA 1ZNZA 4DANA 4HV4A 2J9YB 4NH0A 1H22A 3WJ2A 4BL5A 5BQXA 1RYMA 2I87A 5J2TA 2DERA 2H1IA 4M7RA 1HEIA 4IFTA 4JOQA 4QHSA 5FR1A 1QS0B 4E1VA 3EHDA 4EAAA 5A5DA 5TQVA 2V3WA 2OMKA 2ZRIA 1A0OA 3N9IA 4RVFA 5IDXA 4WXYB 1K08A 4IWYA 4ZVKA 1JP7A 1W30A 1W5SA 5FORA 2DULA 2R85A 5IPFA 4IDOA 1Y4DE 1CKEA 4D0SA 4UDNA 1FU8A 2P41A 2W6CX 2ACKA 2IITA 2PGAA 1Q0ZA 2P9YA 4ND4A 4UCFA 1UDAA 3DWGA 5LBTA 3MUEA 3NRBA 2EV9A 3LQFA 5AYVA 3BBPA 2Y0CA 1PWEA 3CT4A 4BVLA 2NTJA 3GXOA 3FYSA 1VSTA 2HLHA 1CRWG 1Z6ZA 2ST1A 1OXUA 2QE6A 1Q1ZA 2QL6A 4RKEA 3SY8A 1J2JA 3Q3IA 4EW6A 4G67A 2NNLD 1ISJA 3OQJA 4XWKA 4L75A 2FX3A 1IC6A 4TMWA 2B3TA 1NIPA 4FCCA 4KR9A 4U7GA 1W6RA 3SEFA 5KX5A 1E1CB 2HR1A 4XGRA 3BE8A 1X86B 3QWFA 5I7RA 4MR9A 4TLLB 3R3HA 5GVRA 3L8EA 1EUYA 5DLEA 1OZ0A 3JZMA 3QEMA 4O1HA 2QN3A 1IPHA 1UDWA 5DTEA 2F55A 4C4YA 5L3QA 1C1HA 2OMEA 2SCUB 4K05A 2ZW9A 3NYRA 4DZTA 2O2YA 1ILEA 2CYBA 2O48X 2Z2KA 1KIAA 2IU6A 4O4LB 4D7AA 3FTFA 3FRJA 2GBPA 2PBLA 3MYYA 2FHSA 1S96A 1C0LA 2VSXA 3H83A 2RHWA 3MYRA 4NCXA 1JGTA 1P29A 4YK7A 5JE8A 4AP6A 2IHNA 2YN0A 1O4WA 3IPXA 1GGFA 3G2PA 3P19A 4HZUA 4FJ2A 3UH1A 9ABPA 1GRNA 3B9QA 4MCIA 4HNUA 4C6TA 3GVCA 1JXAA 4Y2SA 2OXFA 4F2GA 4DV5B 3I23A 3RTDA 3LX4A 2YFKA 3ZWVA 3C4VA 3FDXA 1COWD 4N3BA 3RFVA 1IOLA 3FTQA 1BE6A 3B6IA 2IE0A 3NHLA 4I1SA 1QH1A 4UVHA 4DVJA 2TECE 4OB6A 2X9LA 4PLZA 4XASA 3ZHYA 4EA6A 3A1CA 5FBHA 4RS3A 2QN2A 2DOKA 2P5SA 4IDQA 1CJCA 5FLEX 4CKZA 2MJLA 3ZBUA 4OQ4A 5IJWA 3WAJA 2I91A 2O2EA 3E9QA 1W59A 2HRZA 4G37A 4P5DA 3D4PA 1JQAA 3HXPA 4GI2A 4MVJH 1UDCA 3I64A 1NASA 4OATA 4CODB 5C8DA 3SBXA 1QIJA 2C9MA 2PCJA 3RSZA 1JG2A 2J3QA 1GG2A 3BH7A 3IPLA 4ACAA 2GZSA 4ZCLA 2H5EA 4QGHA 1PJCA 1Q92A 2CVZA 8MHTA 1AUVA 1WKCA 3H0KA 4GRAA 2RK3A 3ZWQA 4ZVVA 4F1KA 2XDQB 4ZDJA 3IV6A 5JJCA 2HWYA 2W42A 4KZKA 1RI2A 4EMTA 1QO0D 2CVPA 3I4CA 1ZKDA 2HRDA 3HRHA 3LBAA 3OMWA 2DHCA 4KFUA 4ZVMA 3RU7A 4TS9A 3TG2A 2JI4A 4PXAA 1U7OA 1BN7A 2XOEA 2VRBA 4XOIA 4UQOA 2JLZA 5DW3A 1DO2A 1YE8A 4KLNA 5BUQA 3E5RA 1QRDA 2XOXA 4ETIA 5H82A 5BSVA 5H9WA 1ENZA 4BV9A 5ECYA 4S35A 3JYQA 4YEDA 5K8IA 5DM60 1SBQA 2ZP1A 3A9CA 1PYGA 1SB8A 4KIGA 2ZAIA 3Q40A 4D4KA 2RHBA 2ZR0A 1QIHA 2GVDC 3HY4A 4NYMR 5BNZA 1YI0A 2ZYIA 1QCZA 2CBGA 4XPIA 3X0DA 4O4HA 3AR8A 3IEPA 4L4RA 1XVLA 2XB6A 4OYYA 5JPIA 2FJ0A 5DXJA 1MC1A 1H5QA 1E3IA 3OFKA 3OUZA 3GQVA 5B3JA 5TQ0B 3W8FA 4A3SA 4QDZA 4ALKA 1Z73A 2NGRA 3PRKE 1TYDE 5KWSA 3JW8A 5COAA 1J07A 2C4KA 1IVNA 2YIMA 3A9RA 4J07A 4EECA 2AE2A 2ISCA 3PFCA 4PWYA 1NFRA 4EFKA 4ZANA 1AKVA 5IC4A 2AEEA 2X15A 4GUAA 4RE5A 3I45A 5JD4A 2OM2A 1KVTA 4ZQCB 2Q3LA 1Y5RA 2P2LA 3A9SA 4NS1A 1DWUA 1L7PA 2Q2OA 3B85A 1EK1A 3QYAA 1EFVA 4UM9D 3KWMA 1SXJC 2H54A 4EQZA 5B7GA 5BV7A 5FWDA 3X1ZA 3FPGA 3WKDA 2COUA 2Y66A 4JI7B 2OHXA 3E22B 2GYVA 3KYCB 5KHLB 3QI2A 2DGDA 3L82B 4UBNA 1AZLA 4YYEA 3VOAA 3TR5A 3HYCA 1JA0A 2ZSBA 1T15A 4TMFA 3R8XA 1TVKA 4LYYA 5FO1A 3RWOA 3ZI7A 4CKEA 3EXFB 2R6DA 3NX4A 2ZI9A 4AP9A 3ZKAA 1IBLB 3F1KA 3LY8A 2B8JA 3OPMA 3WL3A 5DLPA 7ABPA 4AQ7A 3K2QA 1E5TA 3G2MA 3IV9A 3ZC3A 3U44A 3M6MD 3T9BA 3KAJA 1SY7A 1IN6A 4LE1A 4TXLA 3MTQA 2J9ZB 3OG9A 5CTJA 2H07A 1ZM2A 2P6OA 1IIRA 1PSWA 2VDKB 3FMFA 3AM3A 3L07A 4HNAA 4M8KA 1XAGA 3HXOA 1YMQA 2GXAA 2R11A 3L02A 4JGIA 1AB5A 4Z4GA 5FA5A 2YH2A 1NONA 1R6XA 2BBOA 2DZDA 4H9GA 2X9NA 3UPUA 1JPJA 4MVJD 4XR4A 1IQPA 1KKLA 4G3XA 5HQ3B 3SPXA 5CDTA 2NUAA 4DHEA 1TU3A 2QP3A 4XCVA 4N9WA 1JH8A 1H2WA 4OLJA 3R76A 3QWIA 1JIQA 2WTAA 3K9QO 1SXJE 1SOWA 4E31A 3QKUA 2XHZA 3DPSA 4NKRA 1SK8A 3M6LA 4QEDA 3IHTA 3L0IB 5CPFA 1K6JA 4BNHA 2VPXA 2HA2A 4N03A 1T8SA 5HMMA 4KQJA 3NALA 4RFSB 4WOPA 4JC8A 4W5WA 3ZWCA 4FGLA 3AC0A 5K3CA 3DBLB 4TQ9A 5AKKA 3ND7A 3W06A 4HTFA 4AS3A 2JJ2A 5DT2A 4C5BA 2XKBA 5KDOA 4REOA 4MGHA 1M6YA 1XDZA 2YWRA 4D8TA 2VPYA 3ETLA 1LLQA 2BZ1A 4ZYWA 5JQGA 2Q3BA 1OUMA 4UDYX 3VYSB 2J48A 4GOND 3PNVA 1A9PA 3A1EA 1K27A 4EAQA 2R1UA 1MAWA 3EQ2A 4C4AA 4LYAA 4E33A 5I8WA 1R37A 4K1XA 4U00A 4DTIA 4TOIA 4KFSA 3NVAA 1UEJA 1Z07A 5CYPA 2CDRA 3S8YA 1ONOA 2XYVA 2I99A 4YO7A 5F1OA 4G07A 1LDMA 1CX9B 4BWGA 3KM0A 4FCWA 5J59A 5AWFC 1U98A 3EIUA 2UZIR 5AVRA 4B6RA 3HXLA 4WK6A 5EWMB 5A9RA 2FI1A 4OXKA 4B73A 4CKBA 5ENZA 5CAEA 4ZHQF 5KTSA 4C05A 4DT1A 3SYMA 2H9AA 3H1FA 3MAJA 2BMJA 2FZLA 3PT5A 3AFOA 4H0NA 4Q18A 4DR1B 3F1LA 1E62A 2ZLBA 2K4MA 5DRTA 2D59A 2XSZD 1SBYA 3CG4A 1XPUA 2PH7A 2ZGVA 3UICA 4E3ZA 3M4NA 1E66A 2HV8A 3IXMA 4QHTA 3C45A 4EF4A 3EUEA 3CN7A 1Z82A 3NUQA 3J81k 2YN2A 3F8SA 3RSCA 2L18A 3GPBA 2PUBA 1MH9A 2AKEA 2GM4A 2A9PA 3IP1A 4H4CA 2JFPA 2L17A 3UCFA 3ZVRA 4OFBA 1W29A 3TQCA 4TLBA 1U2DA 2AA3A 2H2IA 2R6FA 5HJ5A 1Z38A 2ASEA 2QMQA 3GRZA 3ROKA 2CDAA 2ZZNA 2PYIA 2RKWA 3NONA 4Z4CA 1DHTA 2GRAA 1NF9A 3DBRA 5EJMA 3D1JA 3O9MA 1JFTA 1FQOA 4UEJA 4HVCA 4LVNA 5LWHA 4DDHA 4J0QA 1O0BA 5LQNA 1EP1B 2HADA 1S2GA 1FK8A 4MA5A 2FLKA 5B1DA 3U13A 3H17A 4KGVA 4U2KA 4YT5A 3CNHA 1SCNE 3KKZA 1XALA 3N75A 4IVPA 2GWRA 2XQIA 3AFHA 4X85A 4B85A 4UM5A 4EK9A 4FB5A 1ZMRA 3JZAA 3NO4A 2QE7A 4ZVSA 1CNFA 4B4VA 1IEVA 1VJCA 5DI9A 1NUHA 3WMEA 3EEIA 1LXCA 1U0GA 3PFFA 4AT1A 4BFSA 2C7OA 5A02A 4TN1A 1CJBA 1EFTA 1ZN9A 1Z6QA 1D8TA 4HB3A 4Y1RA 4YJDA 3ZY6A 3AEQB 1Y9ZA 1JZQA 2FR8A 4ERXA 3L8YA 2JIMA 1VHTA 1U9YA 4G4SO 4QDUA 1CY7A 3TGWA 3BL6A 2Z30A 5GADl 3NT4A 3FTNA 4FSDA 4FHCA 1MJFA 3NBMA 3PFIA 4JR2A 4QFBA 1JDPA 3W2TA 5DX8A 2VUSA 3HCPA 1CUSA 1FX0B 3I73A 5DMHA 5EPEA 1NRWA 3D0QA 4JODA 3CPJB 3DF9A 1RXYA 3FUWA 4N7JA 5ERYA 4ZZ2A 1JIVA 2IP4A 2F8LA 4R1SA 1S2OA 4TQUS 4DCVA 1JG6A 1V8ZA 5HKKD 4AROA 3LK6A 3LUPA 2NVUB 2W2OA 2HHAA 5I51A 1SUPA 2J3IA 3OI7A 3JD1A 2ZSEA 3CRRA 3PZRA 5IBPA 3UB4A 5JNUA 2UZ0A 3RWMB 5FWYA 3B38A 5KOHB 1IY2A 1V1MB 4JX9A 4ND3A 4X6UA 1ZK1A 2F1KA 3UT0A 3HNPA 4TWBA 4W5OA 1HNXB 2ZBVA 1B2RA 1VFNA 5BW6B 2YV1A 3H2JA 1G2IA 4N8SA 1B6SA 4QGAA 1MV8A 4D2IA 1Z12A 1I94B 3T3OA 2H65A 3NHUA 2ZRLA 4D4IA 1F8GA 3QMMA 5AVWA 4KWIA 2WM2A 3UXYA 1BQ3A 2XB9A 4P83A 1NULA 3A6KA 3Q11A 3OFND 1B16A 1LD3A 2ETVA 1QV7A 4Q1CA 3IQGX 4F71A 3LPLA 4LGVA 2G40A 1M54A 2C5GA 4G5SA 4HL6A 4MQ5A 1OJLA 3A9UA 4QG7A 5CXUA 2F9MA 1R0WA 2VK1A 4GLBA 1J5EB 2GETA 3BDIA 3N6VA 3ZLVA 1YQEA 5I5EA 3PC8A 1PEDA 2NTEA 1FQKA 2JFZA 3EOBI 3IAFA 4LHXA 3BT7A 4BX8A 5AVSA 3ZOZA 1NM5A 5LLSA 2P0YA 4YRNA 5K0SA 3VJRA 3WYNA 4A5SA 1HFEL 1C0PA 1QF9A 3LZCA 3QPWA 5LIRA 5J23A 1CXZA 4KOEC 2NSHA 3ESZA 3Q3CA 2OO5C 1XU7A 4UEQA 4DLRA 2IYTA 3A27A 3WLLA 1NLYA 1S8NA 1UK9A 3CRNA 3EMDA 3EGDA 3L4SO 3Q3GE 4H0CA 3WL6A 4P34A 1WY7A 2FN8A 4PZAA 2WJ3A 1M6EX 3L2OB 3P9NA 1E9EA 2HZBA 4J7CA 5LSAA 2ATXA 1J8DA 1SBIA 3DO6A 3KHUA 2Y05A 4NECA 4MHOA 5LBUA 1WTCA 3Q2KA 1G20B 1LBSA 3WK8A 1J23A 2AN4A 1N36B 2LGJA 3LDAA 2QW8A 4CDMA 3L7CA 1O6FA 3AFMA 4PNZA 5KYKA 1VPDA 2I2BA 5LXTB 3F78A 3EMVA 3RGWS 1NBME 2QB5A 3ECSA 3EDRA 4R2KA 4YLGA 5B7NA 2HXYA 2G1AA 3P5BA 1RYBA 3HI4A 1RRFA 1E4VA 3HXKA 3EGWA 3FOFC 2WTUA 2VTEA 4HDMA 4FFSA 4M1QA 1K1EA 1EWTA 2P77A 3TG8A 2RH5A 1UMBB 3D4IA 1Y7IA 4R3NA 1PWXA 3EY9A 2WYHA 4MYRA 5B1EA 3GK3A 1URPA 4OHMA 3PA8A 4WACA 3G2LA 3OZRA 3LT2A 1OIVA 1BD4A 4MVJF 3K70C 2FFHA 3GZ4A 3TM5A 4A10A 5JXJA 3D5EA 9GPBA 4TVSA 4MW9A 5KTMA 3DUFB 4B35A 3RC8A 4JDUA 3FYDA 3WG9A 1NIJA 1XU9A 2VYFA 3B52X 3KWFA 2YTZA 3FLAA 3QBVA 2W6MA 4NOJA 5H4GA 4OXRA 1KDOA 2G9QA 4JT8A 1ESMA 2OBYA 1GGEA 2H1LA 3M0EA 2EERA 4F6RA 1S01A 1EKXA 3DZBA 3ELDA 1DFHA 1I4OA 2Y1LA 2AFHE 3GAAA 4F8JA 1NDHA 3HNRA 3A25A 1Y4AE 5FQNA 3W3AH 3SIWA 3CVWA 3HN6A 2FPXA 1EDEA 2XUKA 1DAIA 1TC2A 1QH9A 3HLTA 3TIIA 4NE2A 3F3KA 2IXEA 2P78A 1MR3F 3ETNA 3MWFA 2I4MA 1N1GA 2H4WA 3HCEA 4IGKA 5BQ3A 5IEJA 3GELA 5EXDA 3SOZA 1XMQB 2WUVA 3OJLA 2PAAA 1YZHA 1J2YA 1KXZA 2ODTX 4AJLA 4B3JA 3LHKA 4CLEA 5J2UF 4JL6A 2DLNA 2VDMB 1CF4A 3TSWA 2HX1A 1FYXA 2RI1A 4RSGA 1EFRD 2VJKA 1KDTA 1QYDA 3NEPX 4RTJA 5EHZA 2PKXA 3EYAA 4TTVA 1IUOA 3RF7A 3RNLA 5KYXA 3MJRA 3IUSA 3G89A 3HP1A 5BSTA 4EW3A 3AIIA 2IXGA 2DQYA 5BRJA 4MINA 2V7EA 5COQA 4O2AB 1UWCA 2VF8A 2Z5FA 4LXXA 1Z22A 3CC8A 3DZDA 1VRWA 3MOSA 4WK4B 4A0RA 3J7AC 4XJSA 1QO9A 1RLJA 2EZUA 1RYEA 3H2YA 1V9CA 3LFUA 4YJHB 4AKEA 4DJDC 1YDMA 2WD7A 3UV6A 3VR5H 4QTYA 1Y8RB 1FPQA 5KQPA 4MKGA 1ZH4A 1X77A 4QXOA 4EARA 3WFJA 1EGMB 1RS0A 3FCYA 3BXGA 1LPAB 4C2TA 1RIFA 3BGDA 1ZONA 5IP5A 1IHPA 4LFBB 2AMFA 4MQBA 2ATEA 3SS8A 3UMGA 3VZBA 4PAGA 3JQ9A 4L08A 5AKJA 3CFYA 4A1FA 2QL9A 2C4HA 5ITWA 1DC3A 4HXEB 3BIWA 1MO3A 1G8MA 2FHPA 4BUZA 2BMWA 2P11A 1F2VA 2PGLA 2QX7A 4XLZA 4JS0A 5U9CA 4Y6LA 2C7RA 4K9MA 3MXTA 2WSIA 4Q4JA 4B76A 2CJYA 4OBEA 4AU1A 1LS1A 2XMSA 4ZI2A 1GL3A 1ZUNA 2RHOA 3IELA 1DO0A 1MV5A 1OROA 1EJ6A 2X6RA 4DE5A 5MGNA 3K6SA 3EODA 1GLVA 2OESA 2C9OA 2VYCA 4GWGA 2MSNA 4LV5B 2BKEA 3OC0A 2NU7A 4LBYA 3TRFA 5IKEA 1V6CA 1AMNA 1BDMA 4PONA 5L4SA 1BDJA 1NW3A 1KP9A 3FNEA 1Y5LA 1H2ZA 3CNQS 3LBFA 1OH6A 2PQ6A 4JENA 4K46A 1CEQA 3EZGA 3CUEF 3GJTA 1FMCA 5JADA 1JILA 2ZWOA 3KSDO 5C34B 2C4UA 3VJMA 3KX2A 3GO4A 1M34A 1RXIA 2OZKA 2XQVA 2ZTHA 4Y2GA 3PHBE 2YJ3A 2ZG6A 3GLFA 3VAAA 4B5KA 3TXYA 3I12A 2PSEA 3RBAA 2GYUA 5CNIA 1WL8A 3CRMA 2Z83A 1IDOA 1Y63A 3F7NA 4TL9A 3CZ5A 3I6MA 2DPGA 4OK3A 4Q82A 4MCHA 3G9ZA 3DDCA 3I32A 1RQLA 2OWDA 1VECA 3G5TA 3FCSB 2HN9A 3RRNA 1B0AA 2W93A 3N0TA 1IDN1 3V6MA 5K2OA 1GCAA 1QFYA 2E3JA 3W3AD 3NEAA 1RPAA 1BE8A 2KHZA 4OG2A 1OLUB 4K0RA 4MWCA 3KTAB 5LMUB 1YRHA 5BSUA 1H4VB 3IQHX 2X8JB 4Y9SA 5CBKA 1NV8A 2NO7A 4RQUA 4N41A 1ODLA 3LNTA 1UPXA 3BYZA 3I2KA 3PQFA 4YDSA 1EAMA 1C9JA 3O95A 3HVKA 4GKVA 3FUTA 4KVAA 3QFSA 1E1RD 1YQWA 2Q3HA 2X7XA 1TKBA 2ZR8A 3I6ZA 3IT2A 4KPEC 1R9MA 1DX6A 4OH1A 3AESA 1E4OA 5CXXA 3F47A 3H65A 4I1VA 3RO7A 4AY4A 2QUBA 2YZKA 4QBTA 1ORWA 1H2FA 3K09C 4LI3X 4L4ZA 1YTUA 1YXMA 1CQZA 1N6PA 4LRQA 3H86A 2BKAA 3R6TA 2IPAB 4U2DA 1C0KA 3SDBA 1DELA 5C0OE 4YN3A 1FFWA 2ZRHA 4RVOA 3WA7A 2FW7A 1RBYA 4RAQA 2WZBA 2QNIA 4X1KB 5LJLA 3ICPA 1PLJA 2QU8A 1PQUA 4PZLA 1HYBA 1QC5B 2DFDA 2QRQA 2JFOA 2ZUVA 3NDPA 4OQPA 5FRDA 1EM6A 1JG4A 2QI9F 2EIXA 3MFYA 2ANBA 3GFFA 2RJOA 2IPXA 4XPZA 3K8QA 4Z1MD 4BLQA 3V8PA 3K92A 5FHRA 4BFXA 1H2XA 4BTEA 2R6GA 5A4FS 4BEWA 2GF9A 4JLWA 3R44A 4A0SA 5KZMB 3G0CA 2I2AA 4MOWA 2ZTUA 2LBPA 4YXWD 5CCBA 2RGGA 2EG5A 2IYYA 4JNKA 1OV6A 4FONA 1TO6A 1PTKA 1G41A 1Z8FA 4UNQA 5A7HA 4OXXA 3QOYA 4MB6A 1CQXA 5DDIP 1O0CA 3FDZB 4F7DA 3SC4A 4ENRA 3K0CA 3K1JA 4QODA 3MNFA 3UK6A 4ZI7B 1P1BA 2LKDA 4R9SA 4TV8B 5EQFA 5AD1A 1A8UA 4YGYA 1OAOA 4KITB 3U56A 1CUVA 3FHCB 3MTGA 3MWKA 1YKSA 1KE2A 4JFRA 1GGVA 2GJKA 1OTXA 2IYUA 3ZDFA 1PV2A 3AB8A 3ZV3A 3LUFA 4UUMA 1Y8QB 2P9JA 2X8LA 1RM4A 4R1PA 5IJZA 1Z0AA 1STOA 2YINC 1WW3A 5BXYA 1FRQA 5CW2A 3FNFA 5KQLA 3UT5A 4MB2A 1V25A 3VR3A 4RABA 1CEEA 3KELA 5LZ5A 3QF4B 2PZEA 5I9TA 4JJ7A 2W2XA 2Q41A 3OX4A 4OH7A 3UH0A 4PEVA 3RT1A 1Q44A 4M8LA 4NENA 1AJEA 1P4HA 5K2MA 1J56A 1D7OA 1FMJA 1SQGA 1VXRA 4KAFA 3T1TA 1D07A 2FPGB 2XJ4A 4PSCA 5ANRB 3JQAD 1OD6A 1W6UA 3EBLA 5DK6A 1XN4A 1GPYA 4MLCA 1YS1X 3U3JA 3ISTA 4YAKA 1XT6A 1IL0A 1JVNA 3WLKX 4RMJA 1DPFA 5CX1A 1LQTA 1XQVA 4MRMA 4P5EA 1TO1E 5KAMA 4EO7A 3EXAA 5JTUA 1LW7A 1X3LA 3KJZA 1JA9A 5K9ZA 4ZEVA 1EJBA 3UAVA 1RAIA 4D0GA 1YJCA 3EIOA 3FF4A 1EG2A 2FTKE 1EB8A 1WS6A 1EB9A 1X94A 3IVMA 4I36A 3ZCXA 1TK2A 4E09A 2VK2A 4AJIA 5F4BA 1NYQA 3I76A 3C15C 3MGBA 3AL2A 2J41A 3GEIA 5AVZA 1OE0A 2Z2XA 2EQAA 3IESA 3TM4A 1QRRA 1I0LA 3AL0C 1KI6A 3L43A 5TT0A 1PNVA 4GOJA 3T3MB 4DWJA 3G2KA 1GXSB 3AEKB 1GNPA 5TARA 1KIFA 3V34A 3RTGA 1M2JA 3BRWD 1JDTA 5HTOA 1DAGA 3S2IA 1GDTA 1NU8A 3BEOA 3H42B 1KK1A 2ZIXB 4JP5A 2ZVQX 3HPQA 1BIFA 3F67A 3LYLA 3PUZA 4PPYA 1QG6A 4Z6KA 3I9NA 4J1TA 4F0JA 1PL6A 3HWWA 3IVXA 4YYZA 3GFGA 3LZ6A 3S2UA 3ESCA 4ER0A 5EJ6A 4I6GA 1OASA 5FWXA 5JS7A 2WJWA 5B1SA 3WLOA 1J1IA 2J3DA 3H8WA 5M04A 1RI1A 2PGIA 1QR6A 2A94A 1RPNA 3K2BA 3OIFA 3NS7A 3CF4A 4X20B 3VZQA 3T5CA 2HPHA 3KLOA 1LF0A 4GOOD 2A0FA 4R2IA 1S2LA 2W2KA 4UTNA 1YDHA 3Q15C 2PPVA 3VPBA 4I5DA 2HTEA 3NOXA 3BL5A 1QIGA 2XBUA 1M1YB 3UW1A 3PPWA 3ENVA 4L6IA 4YUWA 1EXDA 4A1OA 4H59A 4QPDA 4HVTA 1CB0A 2WKWA 3UJ7A 2JGIA 3JYHA 2F43A 2DY1A 4YUVA 5JBQA 1PJQA 4HDCA 1KY2A 4B32A 4ZV4A 2C5FA 5LKAA 1GTJ1 2NUPB 1F60A 2VJOA 1GT91 5BSEA 2WR8A 3WGHA 1K5HA 4KQFA 5G1OA 3W2IA 3WI7A 3DMDA 5ADHA 4H4EA 5ICEA 1AS0A 1DWQA 1B26A 2DHQA 5AICA 1KEEB 5EZYF 3SJAA 3QLUC 5HKOA 4LRUA 1K2WA 4Y67A 3WYAA 3SQDA 2QAIA 4MR7A 4BASA 5IJ9B 3ZDBA 4K0KB 2HQRA 3EEFA 1KPGA 1EVKA 2ODBA 2CLIB 3VPGA 5ESRA 3SZOA 3NEYA 2FH5B 4I1RA 1KR2A 3Q9UA 5JR3A 4Z2AA 4OGFA 1CR6A 4FD2A 3OM1A 3DZFA 3H8SA 3IURA 4CN8A 2WB2A 4NCBA 2V1XA 2O19A 4K9KA 1E3TA 2HHLA 2BFNA 2XMPA 1D1QA 3LRPA 4Q9KA 3SMQA 3TEFA 4B31A 5CB4F 4MI3A 1JE0A 1P9LA 2IYZA 3AU9A 3O6VA 4XRRA 2HYDA 4YIKA 1U2RA 4CF4A 3HDTA 4UXHA 2JFXA 2XLBA 2FB9A 3HB9A 5GP1A 3VX4A 1OZHA 2PTHA 3O4GA 3WGYA 1OXSC 4JLNA 5EUBA 3VKGA 1ZGAA 4NZPA 1GGKA 1VLMA 1WHTA 3KT0A 3B6MA 4G5RA 3L3BA 4HGPA 1RZRD 2C8KA 3MTDA 1JI0A 3CEPB 2NO9A 3HFSA 2WWWA 1UOQA 2W6OA 3QOXA 3OE7D 4WZBE 4YH1A 4R51A 4URYR 4P9NA 4YP9A 4RACA 1U1DA 2JFFA 3A31A 1E64A 4MGIR 2IOFK 4PYNA 5H5JA 4FE7A 3RV4A 3ZY3A 4JP3A 4TKUB 5E95A 3HCCA 5H9VA 1DXOA 4MPDA 2CDBA 1OV4A 4IHAA 2XB2A 1YS9A 4IRMA 3EG9B 1NRJB 1R18A 1EZ1A 2EYUA 2KM1A 2PHZA 3M1LA 4MAAA 1T5LA 3FRHA 4BQIA 4S1WA 4HFMA 5KO2A 1Q3HA 2HGZA 4MWBA 1YCGA 1R0ZA 3C1UA 1IHOA 1FTGA 1YRQA 3KB8A 3I9V1 1BRTA 3QLTA 4AJEA 1RKXA 3G8CA 1LVGA 4TZ6A 1G8JA 1EH5A 3MS4A 5DCUA 2PUAA 4HY3A 5ELXA 4UAGA 1VE9A 4DCUA 1HWYA 1KEUA 1T10A 2HB6A 3IQZA 2FEWB 3NG1A 1C8VB 3LT1A 2QQEA 2PEZA 3H3JA 4IZOA 5FI0B 1H23A 2DKOA 3WADA 2M32A 5GOTA 1XEFA 5BR7A 1E1QA 1ATZA 2GBLC 3QLEA 4BJ6A 2HBZA 2Q3FA 1CR4A 1RXVA 1AKRA 1X1TA 2XRMA 4L3OA 4WKCA 4MA4A 2QX9A 1LCIA 1P5ZB 4HSEA 1K4YA 2JFBA 4LF7B 4PZ9A 3U7QB 3HDVA 4M1WA 3X1MA 1MIHA 2A9JA 4IV0A 1PNTA 1E2IA 2HQ1A 3G2QA 4XARA 4ZTBA 4WGFA 2OUKA 4NJEB 4CKWB 5AM0A 1MX3A 1UK7A 4Z5XA 5E9JA 1GUYA 3SNHA 1TTTA 1YQDA 4LGCA 1ENOA 2HF8A 2HRRA 4HLDA 4M1KA 5C4IA 1O03A 3FWKA 4LHYA 4S1OA 1CNMA 1T24A 2GF0A 1OX5A 4FXOA 1QNFA 4G5OA 4L9AA 5CJPA 4DQUA 4IDPA 3SQNA 4YXFA 5EJ7A 1RJEA 4I9HA 3DXXA 1RCUA 1ZLYA 4NPAA 2ZBPA 3BZWA 3ADPA 5JHHB 2QT9A 4ZCTA 3KZMA 4CCSA 3KQUA 1WQ4A 1FFAA 1N0UA 1WP4A 3NNDA 1E5QA 3FMOB 3MPOA 4RF3A 1A2KC 4KPYA 2AX3A 1T1SA 4I6JA 4C3OB 2VNHA 4ZZ3A 4PGFA 1HE8B 3G68A 2H1FA 4XEUA 2VYND 3EGIA 4X00A 2R7MA 1M67A 2BF4A 2UYQA 5KMGA 3CRZA 5JXWA 2KI5A 2M9MA 3VGPA 2YWBA 3WLHA 1EI9A 2LUOA 5IHPA 4B3HA 2QRUA 5IS2A 1A7AA 2XBLA 3NM6B 3PPIA 1NKTA 4Y2VA 2I67A 5K6RA 1ACMA 3GW8A 4KLAA 2XRFA 3MMSA 3FN4A 3R0JA 2K5UA 4YV1A 4N3GA 3OEED 4C6HA 2IJGX 4GEGA 1LSSA 4NU5A 4CCYA 3WIUA 2IIPA 2PQMA 1G16A 1U0JA 3AKDA 1HTWA 3C3KA 1JHUA 4NICA 1RYZA 3HQ4O 1N9KA 1QZ3A 1G38A 4DLYA 1DBPA 2IXFA 3LQ1A 4B09A 2J6CA 3EPKA 3QE2A 3QOWA 3D8BA 5DYWA 3OZUA 1HRDA 1ND5A 2HV9A 3HU1A 2HIHA 3K20A 3NWOA 4A6DA 1LNSA 1S8OA 2GS9A 4BAUA 3VNQA 2IX3A 1BH6A 1XLTC 2LDXA 4HAUA 4CCAA 3F4LA 4CXMA 4GRIA 2ODQA 3PV0A 3I1IA 4U0JA 1DIBA 4PG7A 3HU5A 2QQ0A 1DEOA 4DZZA 4YT8A 5DN6D 4LECA 3WGJA 1GZ3A 2BEUB 2H2GA 3NHJA 2AFVA 4RORA 2CLEB 2WJAA 1G8KA 1DQYA 4JI2B 1U0OC 5CM2Z 2RAFA 1U5AA 5ICMA 4IJWA 4FC6A 4RA9B 1L7NA 1QQ6A 2PWAA 1PG5A 4GC9A 3DEFA 2CLKB 3UNXA 4TSRA 1W5EA 2ZS7A 2IYNA 3FR8A 4Q9LA 7MDHA 4DRXB 1QAOA 2CV2A 2ZYSA 4KQ2A 3S55A 1X87A 4C0QC 1CTQA 2XE7A 5BWCA 1M73E 3LECA 2VNKA 2ZBDA 1EAYA 1YB6A 3RUAA 4CMHA 3X2EA 3AETB 3LOUA 2OFPA 2ZRJA 4OHVA 3M5PA 2QW1A 3RTAA 1WXQA 2XXJA 3P2KA 1VB5A 5FDFA 2BFFA 3P0HA 4BLOA 4UQPA 2R97A 3GEMA 4JAVC 1XJWA 1Q16A 2X2FA 3PRHA 4FNAA 5I9MA 3W2FA 4ARVA 2MINA 2BGKA 2X4LA 2IHVA 3O8DA 3PUKA 1KNQA 1WMSA 3M70A 2JBAB 1A5BB 4YJ2B 2AHOA 3SSMA 3GZJA 3HWX1 3OUTA 5J63A 4C04A 4IIJF 4W9NA 5CVTA 3HMKA 5KNDA 4PPQA 3VTKA 1RFGE 4FGUA 2D7CA 3L7JA 3P9RA 1M6NA 4RDCA 3SF8A 1EVQA 2BC9A 1YC5A 1H6AA 4GOKA 1SBZA 3B48A 1BS1A 2FX5A 2LD4A 2VRCA 4BVFA 3QEKA 1M8GA 3IAS6 1GV0A 421PA 4ZTUB 3E18A 1R88A 2B1RA 3R5JA 4IIYA 3MTBA 3MQ4A 5CFNA 4CLOA 1VPVA 3N2NA 4QM6A 1SC4A 4FDTA 2EIHA 5B7PA 4F46A 2YOGA 5MN4A 2PS3A 2J08A 1OGJA 5I3CA 2ZR7A 2GDJA 2YMMA 4OI2A 5DOVA 1JW9B 1TM1E 3DH0A 4KIWA 3GR6A 3WIVA 2GN2A 2YQ4A 3AJDA 3JARB 2IYQA 4LJ8A 4KGZA 2IELA 4OQZA 3U1BA 3V4PB 3NEJA 1QDLB 3EX7C 5AXBA 3SMVA 2E48A 3MT8A 5CTAA 5B6PA 2XE8A 4FBLA 3OBBA 1HUQA 3F7OA 2M2IA 2XUPA 3MCAA 1AV7A 4NRDA 1U0RA 4BFVA 3NJ8A 1WEKA 4N7RA 4UOZA 4L2IB 4IMIB 4EJSA 2LZ0A 5D86A 2QLNA 1X9GA 3QUAA 4K86A 5DWQA 1O0SA 1KI3A 2R7NA 2VHXA 2P0EA 3K35A 3U4IA 4FHGA 1J9GA 1ZW6A 2PMCA 1QU2A 5CBPB 3SFTA 5KQGA 1Q22A 4G0VA 3R24A 1OLOA 2GN6A 3K05A 5DJ5A 1S8AA 3PP8A 1CQIB 1DE0A 2VCYA 5GJWC 2H2DA 4A0HA 4R68A 2FRVA 2J45A 3KR0A 4M46A 4J76A 3THOA 1RHMA 1UIMA 2F3SA 2WNIA 3DWFA 4NV0A 5A2GA 5KTPA 1IY0A 4ZVPA 3UB2A 1G60A 5DM70 2PZFA 4BKUA 3KDAA 2H8KA 3N28A 4LGYA 5HVNA 2BFOA 2Z3WA 2YV2A 3CH7A 1VLZA 2VJMB 4KBYA 4O1MA 4OM8A 5KU1A 5A1TA 4Z4IA 3GLIA 1U9CA 3FYCA 1U7UA 2CB0A 1DADA 4V1CA 2OPBA 2SKEA 5K8VA 2HWXA 2V7TA 3MTEA 4HX9A 4TTPA 3I8OA 5CIQA 3C6KA 2B35A 1P1FA 2EYQA 3NH9A 3U3RA 4F21A 2ZSKA 4NCJA 1HYQA 3SQXA 1KP3A 2ZTSA 3HEBA 5CDUA 1V4BA 1SIUA 3GC6A 5ALSA 1L5LA 1OWMA 3BMQB 4LI0A 4JI1B 5FBLB 1J25A 1TKCA 2BW0A 2JF0A 3AERA 3REOA 1VXOA 4FFBA 4U1RA 3R74A 4KYTA 5ARCA 3A6JA 4CIYA 3W2GA 1FJHA 3FYUA 1T43A 3M4JA 5AJHA 4NOLA 3BD6A 1XMPA 2UYCA 3C39A 3K1AA 4Q05A 4N40A 2R44A 3L1IA 1T3SA 5B7QA 4L74A 5DIFA 2PNJA 3OIGA 4P33A 1XPJA 3VNBA 5DW0A 1EVEA 2XIQA 4N1AA 4UUAA 4HYTA 3I62A 3PGVA 3JVUA 3DFUA 3CVVA 1HZJA 4ZT3A 4WXEA 4ZCQA 4PG5A 4KYVA 3AEUB 4RHFA 5AESA 4K3UA 2FMKA 3WIOA 3FY4A 2AXNA 4EY6A 2VLIA 4I3HA 4XX0B 4ZCIA 1E7MA 3KEMA 2MMCA 4M9ZA 1PJZA 1YHZA 1XOIA 2O0LA 1RAFA 3BIXA 3I9MA 3L6UA 3ZIDA 2XADA 1DQSA 1T6BY 4GPAA 3GY0A 3BGSA 5ESWA 2YZ2A 2WG0A 3NIFB 3UHPA 3PHIA 4CV2A 2VPZA 3STWA 2P79A 3RS7A 2JGDA 3NBYC 1KHTA 2GB4A 4L8FA 4IIUA 4US0R 1E2FA 3DTNA 3OE4A 4WA8A 4BNKA 4E5NA 3U4MA 2ZJ4A 4MK4A 4YCJA 3GBSA 4GMKA 5IBRA 1GCOA 5C5DA 3CUTA 1B8NA 2VHWA 1FZQA 3NLLA 3SKXA 1A5ZA 3EIXA 4K6KA 2CEAA 4RD4A 4QDKA 3AKZA 3ZHBA 1H6CA 1TOAA 4LDRA 5FTMA 2JK1A 2NAFA 4F72A 3M8KA 3S2GA 3B20A 1MA0A 4DUGD 3VZDA 2VUIB 3KL2A 5JLJA 3STVA 1ECLA 4HADA 4UPVA 5DBGA 4E5MA 1O95D 4KO8A 1MQAA 2AKYA 3IUJA 1BYIA 1P81A 2ZVPX 1OKKA 1J8FA 1WF6A 2WSMA 1BJTA 2P1DA 3GLHB 1O8BA 2AR7A 2B5OA 2PH5A 3UMCA 3P0FA 5JMTA 1NR1A 1EVZA 2IGTA 1Q11A 2ZTMA 4MVYA 3VAZA 4WZAE 2BHLA 1DJQA 2BEVB 1LA2A 1S02A 4M98A 2ZYTX 2VSFA 1DBSA 3M83A 4GG1A 2P7HA 4KSBA 4NABA 2FP4B 3SKYA 3VRHA 4QYIA 4W5RA 3CVUA 1YQXA 3OOJA 4C7XA 3BIFA 1U7ZA 4ACBA 1QIMA 2ADFA 3EMBA 4HBGA 2WWTA 1U3VA 3TSYA 1VPLA 2IZZA 3ENQA 4XYEA 1BN6A 3R7SA 1Z5VA 2FAXA 4IEIA 2JFYA 4ZAYA 3WLQA 1W1WA 3T5GA 3PEYA 3HN7A 2BMEA 3IQIX 1N6OA 3P9SA 1KFCB 5C1OA 4CWAA 1ZM3A 3R0ZA 2R65A 1ZK3A 4FQ5A 3V7FA 3WMXA 2OWEA 2F4VB 4QBIA 1ORVA 1ZN8A 2GHIA 4IGIA 1LTKA 1SHJA 4TTSA 5FPTA 3NTQA 2BGJA 2OBFA 5E6UB 4A36A 1W581 2H11A 2II6A 3R9IA 2Q1TA 2W0MA 4V3CA 3AT1A 4AJNA 3LUCA 1JAIA 1ATIA 2XGJA 4AIRA 5G0WA 3KL4A 4WY5A 2JL1A 3RW9A 3O26A 1Z2PX 5KVAA 1OWOA 3WWYA 3A36A 4NNJA 4L7VA 2A58A 4V0QA 1OREA 1P7ZA 1MPXA 2JRCA 1JTVA 3ER6A 3OF5A 3QQ5A 2PXAA 4PX2A 1LBQA 1UANA 3FHOA 3UFXA 2K2WA 2OBNA 4TKZA 1GNLA 2NTYC 3EAGA 5IHXA 1KI2A 3V4ZA 3TD6A 2W2LA 4B7ZA 3THWA 5KTNA 2CGEA 2E7ZA 4F4CA 3FIUA 4PZZA 1G8FA 3VHLB 2ZIFA 3JQBC 3BXXA 3LIIA 3A7EA 2Q5IA 3UQYS 3KPVA 4KE7A 4X45A 3VM6A 3HCAA 1VIAA 2WAAA 5ETJA 1EMDA 1VKJA 5GOZA 4EA9A 5BSFA 3CO0S 4O4JF 2O3UA 4W7HA 1EU1A 3ACBA 4LMBA 1ZEMA 2D7DA 5EXTA 5JAOA 2KB0A 2Y77A 2J3EA 4FIZA 1FUKA 1OFIA 3FUVA 3SJCA 3SP1A 1TT5B 3ZDYB 3L0CA 2Z6AA 3U09A 1FTNA 2J9RA 4MUBA 3UMMA 1K63A 2A9RA 4DCOA 1M10A 1KMHB 1Z0UA 1FNBA 1JYSA 4I81A 4WECA 1OW3B 1DBRA 4X62B 3FM9A 3A1NA 1QKJA 4LY3A 5AJWA 3JQ6A 2WHEA 4IDGA 4XA8A 3RQIA 4FQ8A 3FCUB 4OJNA 5JPCA 1USVA 2EC5A 1U1CA 2GLXA 2K7FA 5A4AA 1SULA 3MG9A 1PG2A 2VQDA 2HSJA 3DM5A 3NDIA 2FSIA 4EGCB 3ROFA 3UIEA 4HRAA 4P53A 1SELA 2Y9MB 1D4AA 1T0JB 2AFIE 4HPWA 4EF5A 5C7OO 3S8EA 1YULA 1E5LA 1HETA 4UHKA 4W5HA 5FPSA 4BJHB 4QGSA 1SXPA 2FUKA 4BNMA 2M6RA 1PQPA 1W4AA 2PNFA 2IUUA 5CXQA 4DA4A 2XODA 1U7PA 1UMDB 4R98A 3IC5A 1F2TB 3TLGB 3U9LA 2IS2A 2VP4A 2HHJA 2IVFA 4B0OA 3OOYA 2AJLI 4UU0A 1PQWA 3OOSA 1JDBB 1VJTA 5DBOA 4RLHA 3GXBA 1FP2A 4E03A 1KKMA 3INRA 3SICE 1DZIA 1ADGA 4KP7A 2C7BA 2HCBA 2Q50A 3AEXA 5EJGA 2OY0A 2AMJA 3ZK9A 1P4RA 5MF6A 1YZNA 2DKNA 3KVOA 2AXEA 5E4JA 3OZSA 1UIRA 3ZW8A 3TZBA 3HJUA 3OHMA 3H7IA 1U8CB 2Q6VA 2VNJA 4Q21A 1L2TA 2XVZA 3OICA 5HR5A 3EPHA 2Y3IA 4J91A 5GAJA 2RH8A 5JXGA 5ALZA 1FXSA 2IYEA 1SGWA 1L3BA 5HM8A 3OQIA 1V11A 1JR6A 3EVNA 4PRLA 4BEVA 1T2AA 3GEEA 5GVSA 4X5OA 3TFWA 3Q8WA 4WRRA 2PJUA 4GEKA 3GBPA 2FZKA 4N82A 4MPTA 4QO8A 4JYZA 3DOFA 4HX2A 5EE3A 1XDGA 4J0IA 2D1YA 5BMVB 4S1NA 1ZVVA 1TQHA 3W9UA 1E4YA 1JFFB 2HJ9A 3QXCA 2CLMB 4LRWA 3AV3A 1P19A 1Q7GA 2PJDA 1V47A 1NG9A 4OHZA 1XVIA 3RWBA 2ZJZA 1GPBA 3SJUA 4LOHA 2XVAA 1M33A 2Q6LA 1DFIA 3A1VA 3DZHA 4PQFA 2R5FA 4MQ4A 2QNRA 4JVNA 4BLTA 1YAJA 4NEQA 2ZUUA 3VPXA 4R2HA 2XQFA 1D8AA 2YV4A 5FLXA 1ECBA 1JNYA 1JR2A 1VBFA 3GROA 4JBXA 1UJCA 4OMCA 5DB4A 1ZFNA 1KYTA 3HKCB 3HU2A 5JSQA 5AJVB 2C2XA 3ABQB 1BXRB 4QECA 1XDBA 3L0PA 1C3OA 4YREA 3VO1A 1XCBA 1GPNA 4AC9A 2PUTA 1K6IA 3HWSA 2F8MA 1AQUA 1Z7YA 1VL5A 3QU2A 1G1MA 4DCTA 1VCIA 2YWXA 4L50A 1PNRA 4WJKB 5D51S 2JPDA 5TPZD 1UH5A 3LG2A 2VJYA 4MUIA 3K5PA 4EPVA 1EHCA 3LYHA 1F48A 2O9JA 4TVKA 1V8FA 3ZU3A 1E9RA 3O8OA 3N1UA 4B7AA 3KP1A 5E2BA 1M9NA 3T4EA 4DRYA 4EHHA 3A4MA 1ULTA 3MTJA 4MV6A 1XCMA 2QP4A 4J0KA 5E2AA 3UXEA 1RRKA 3C2QA 1PFUA 4IXNA 1J9ZA 5G40A 3VOBA 1TGVA 1MIOB 1K88A 1J8YF 2ZS8A 4E0BA 1OZGA 4P0PB 4WNCA 4PQGA 1KZGB 4BO6A 4Z8YA 4N5HX 4GWKA 2AVDA 2ZYGA 1E8NA 3ELWA 2VQFB 1YBFA 4WN3A 1P5FA 3PDWA 3L6OO 1C3EA 3F6PA 3KLBA 3FBWA 3MLAA 3OOWA 1T2UA 3W0LB 5CG1A 3CTPA 3ITNA 4L4YA 1FBTA 1TQ4A 4BN4A 1WUTA 1QBGA 1KJYA 1BDIA 1RTTA 1H6DA 4KV9A 4RV9A 4MUHA 4XJVA 2V6GA 3ZQKA 1DKRA 2IPLA 2ECPA 2GN0A 4ZFNA 2O7NA 4LKOA 3C74A 4JXXA 1WBDA 5KNBH 2O8CA 4IO0A 2EEZA 3BIOA 1XRNA 2DPLA 1Y1RA 4MLPA 1I1QB 4CMIB 5MFZA 2OVFA 1II8A 3CLHA 1FMTA 2XGOA 4WXRA 5K51A 4WOCA 4PCLA 1OXXK 2WU0A 5FOWA 1MP0A 1O5OA 2JJQA 4YMVA 2JI8A 1EM8B 1X7XB 3MTIA 1NW5A 3AVPA 1XELA 4I4CA 4MEJA 3T4UA 5LYYA 2PRKA 2YRFA 5KOJA 3O8BA 4E2ZA 5BT8A 1R5OA 3HPRA 5CDFA 3TOSA 5DSXA 3GLGB 4H7PA 3ZWMA 1XJ0A 1QZXA 1XX6A 3PX3A 4M7WA 4LQDA 2XZPA 4TV9A 2CMKA 4CZ2A 4EW2A 2NXCA 3AILA 1TUGA 1KZ1A 1TNDA 4KQWA 4LXGA 1LV8A 3W5IA 3WO1A 1E0JA 5KSZA 1GAXA 3IE1A 1QP8A 4F2WA 3GQBB 4MI9A 2PD6A 4E13A 4ZHQA 2HMTA 2C57A 4INJA 3NHYA 1T26A 2REOA 2C5EA 4QYSA 5IDWA 4Z51A 4IOMA 1E60A 3HDYA 1P60A 1E77A 3JQRA 4D97A 1P0IA 2EF0A 5T5QA 4YRKA 3CGGA 2BFWA 2XD4A 3AHCA 1V3VA 1ZSYA 1PEYA 2DE0X 4GXQA 4NBRA 1A7JA 4X0EA 2CFSA 1N2GA 2I29A 2PV0A 5AXAA 2QR3A 4N9QA 3RCBA 3WXBA 4GMDA 1L8XA 1VKNA 1KI9A 3NANA 3U1VA 5FUVA 3WRXC 5JVDF 1LI4A 4UAVA 3M2TA 3DOUA 4KV7A 1W1UA 1TPYA 3FI9A 3MAAC 4PLWA 4BCCA 1V8DA 3IVRA 1R6TA 5IAKA 3C8MA 1NJGA 3QU5A 1DFGA 3F7MA 3H9UA 3ZHRA 1OCEA 1MO6A 1TYBE 5CYOA 5EHQA 5CA1F 1SXHA 1HYGA 3FDJA 2GK4A 2ZK7A 5FOVA 3CLRD 3E9YA 2IWHA 2D5LA 4Q01A 2D2IA 4MDEA 2J8ZA 4L02A 1ESDA 3DLIA 4YP0A 1BXZA 1TT7A 4V2IA 4DLSA 5C81A 1M8JA 4DBVO 1NLUA 1IBSA 1G8PA 2Z4SA 5F3RA 4H7IA 3COZA 1KO1A 4LV6A 4TS1A 5LQCA 1RNLA 2MU1A 2B7LA 5DHSA 5TSDA 2XA9A 4HLNA 5HE9A 4CL8A 1LSOA 3BK2A 2FFRA 2PLRA 3OX2A 4IXWA 1VI5A 3IULA 4KFRA 4YVFA 4DCPA 4DPMA 4EY8A 1UZNA 1E9DA 1U94A 3QW2A 5SY4A 4DDTA 3KB6A 4Q4AA 1C30B 2O2GA 3KOWA 3JXEA 4EEKA 2YWJA 5L3SA 4NATA 1EXMA 4X60A 2D1FA 8ABPA 2AMYA 4ZI3A 3GUVA 2I78A 3TE7A 2O3QA 1D7AA 1BCRB 2H17A 3PSHA 3W8NA 3CZAA 3CVJA 3B36A 1HDOA 1AG9A 1N0HA 2C9CA 2WYOA 3IJEB 4LKRA 3BFXA 4LWOA 3U7IA 3QEJA 3OZEA 2QUZA 1FDRA 4DVGA 1IBKB 2BBSA 2DQZA 1RM3A 2RGYA 1E5DA 1U0LA 1D9ZA 1YI8A 3N2YA 2R2GA 3K9WA 3UGTA 3G8YA 3O47A 2BRUA 4PYJA 4YRGA 3H11B 3DVAB 3QVJA 3D81A 4JIGA 3UHJA 1FJGB 3JYLA 2I6QA 3O4RA 3PXEA 1P4AA 4HNVA 1GEGA 2G80A 4FZ5A 1R4MB 4BVBA 1E6WA 1QO0A 3E9MA 3R3WA 3B78A 1GPKA 4DADA 2HBQA 4M0MA 1SPBS 1O6GA 4YRQA 4ZAXA 1MCZA 2BDTA 1N2CE 3LCRA 3O3OB 2B78A 3AI3A 4FR0A 2F17A 3UWOA 5LU8A 2O7VA 2LWIA 5DBFA 2UYOA 1BEEA 3OD1A 5EESA 2EX1A 3WISA 1I4LD 3C3BA 4QVGA 1GRCA 4KQEA 1WE2A 2Z5GA 1J22A 3AHGA 3PUWA 4HDKA 1XDSA 3EZLA 2BFEA 5JDIC 3MOGA 5HBGA 4BBZA 3EFBA 3LHDA 3EG5A 5IN4A 1BQEA 2GK6A 3KYDB 4X65B 1P45A 2OAEA 4YALA 3AXTA 3JQFC 3U9TA 4RKRA 2W70A 2VPIA 1UP4A 2OGUA 1SXQA 3ENKA 3FTDA 1P2FA 5K7SA 2WJ6A 2G5PA 1SXIA 1XXHE 3AYXB 3MGCA 1AGPA 5ILQA 2Q7DA 4EYSA 1SAYA 1DP4A 1TUEA 2W6PA 1CLUA 2G6TA 3FX2A 2B2CA 3LWNA 2I34A 5G0SA 3SVZA 4C0JA 4Z4QA 1QG0A 3SR0A 2AMVA 1ZIDA 2QTMA 3AKCA 4HQFA 4WTOA 4OQYA 4QUEA 1FEZA 4GX1A 5DLDA 3UOAB 2O54A 5JEDA 1G19A 1U28A 1JQEA 1F2UB 1VDZA 2GRJA 3AJAA 4DR3B 1YR8A 1J7JA 2OZLA 4HDSB 3GEHA 3LS2A 4P86A 4U7JA 3WK4A 1VQ1A 4I08A 2HCTA 5EINA 3WYBA 1NI4B 2IRWA 3IBYA 5EKTA 5E38A 1YQTA 5JJ5A 2AOTB 2W58A 5AUNB 4W5TA 3K8YA 4GPZA 4LSWA 5K4HA 3LK7A 4DN6A 3MILA 4KW7A 5FTJA 3G2OA 4JUDX 5C52B 1KI1A 3WP0A 1VA4A 3VZRA 1UBOS 1UL1X 4JC0A 4EGSA 3U7GA 3QHQA 4FYWA 4BP9A 1PNQA 3O74A 2HI0A 5LNK1 3SFVA 1Z2EA 4X9XA 3JSXA 2X0EA 2PZLA 2VQ6A 4IXDA 3AI2A 4BO8A 5D6NA 2VHTA 4ZT6A 1PTJC 4NHOA 3DL0A 1QF7A 1SVNA 4U7HA 4B2YA 1P7WA 2V5AA 2ABWA 4M0LA 1A4RA 1ARZA 1JHVA 2VA8A 4MVJA 4Y6QA 4QEZA 3OJCA 5T6BA 1WIWA 4CBVA 5A0TA 5E6RB 1K7XB 3TL2A 2VDQB 2A6PA 2F90A 1K4MA 3T0GA 2M1ZA 2R2AA 2O05A 4GRDA 1HDYA 3G1UA 3ZBTA 4EHAA 1B74A 1SUBA 2B4QA 3HI6A 1DAFA 5L3ZA 4BNVA 3C5WP 3F46A 3KKPA 4P3XA 4C7OB 4EWLA 2ZBQA 4Y18A 4MJLA 1USIA 3MBOA 3A2NA 4G5QA 2MR6A 1KPIA 4L28A 3BZBA 4NDNE 3UA4A 3VO8A 3QVGA 4RD3A 1A9ZA 3SBEA 1O9GA 3BJMA 2QRKA 3BKWA 3R6GA 3RSLA 1S7GA 5FI5A 4KWEA 4HR7A 4QYMA 3RRMA 1P0QA 2X19A 2Y1EA 1IN7A 3WJ7A 4BNGA 4HFNA 4F3KA 3O2JA 1VHJA 2XNDD 1XRRA 3SYRA 4ARAA 4C7JA 3PFKA 1OFUA 4OQMA 5DTRA 5J2UA 5CCEA 2QTVA 1XIVA 3BFPA 5GPBA 3L4EA 2VH1A 3RKRA 3FH0A 4RWZA 5TGTA 3SIPA 3T5DA 3OLCX 1MO2A 4E2YA 1JR3E 1M2WA 3USZA 1OFTA 2IUTA 1X0XA 4QUHA 5AKYA 4PINA 3JALA