3RNOA

Crystal structure of mouse apolipoprotein a-i binding protein in complex with nadp.
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
233
structure length
233
Chain Sequence
b'AVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSKSPPTVLVICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTGLVTQCQKMDIPFLGEMPPEPMMVDELYELVVDAIFGFSFKGDVREPFHSILSVLSGLTVPIASIDIPSGWDVEKGNPSGIQPDLLISLTAPKKSATHFTGRYHYLGGRFVPPALEKKYQLNLPSYPDTECVYRLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apolipoprotein A-I-binding protein
molecule tags Protein binding
source organism Mus musculus
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
total genus 75
structure length 233
sequence length 233
ec nomenclature ec 5.1.99.6: NAD(P)H-hydrate epimerase.
pdb deposition date 2011-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3rnoA00
3RTAA 3RTEA 3RSQA 2O8NA 3RS8A 3RTDA 3ROZA 3RSSA 3RRFA 3ROXA 3RO7A 3D3KA 3RNOA 3D3JA 3RRBA 3RREA 2AX3A 3RTGA 3RTBA 3RU3A 3RT9A 3RSGA 3RTCA 1JZTA 3RS9A 3ROEA 3RT7A 3RU2A 3RRJA 2DG2A 3K5WA 3ROGA 3RSFA
chains in the Genus database with same CATH superfamily
1XZDA 4IPTA 3V42A 2NSDA 4EZIA 3W6NA 5B3JC 1RAEA 5HTKA 3ZR4B 1XNGA 1E5TA 1U94A 4XQEA 5EY5B 4DQDA 1CJUC 2A86A 1DL5A 2J67A 4KMMA 5GJBA 3QX9A 2C9OA 3WAJA 2HL6A 1W35A 2ISQA 2QI9F 1K8ZB 3GY0A 4U2GA 5AW6A 1F6WA 4S1TA 3JYNA 4JA0A 3WBKA 5JRDS 4WXRA 4NL4H 1K6JA 1OU0A 3UK0A 3D6UA 1MEEA 1ODSA 3EWSA 2RMKA 3HA3A 2JFNA 3KQWA 4IBOA 3ME5A 5ESRA 3PNQA 5K3FA 1WX1A 5EXSA 1V3VA 5LZ8A 1V95A 5DN9A 1AF4A 1C5KA 3UWMA 4Z0NA 2FFAA 3THWB 4DDKA 3NHWA 2BUBA 3GEGA 4HLUA 1APBA 2GAFA 4PLTA 1M2EA 3CBGA 4XRGA 3JD3A 2WF6A 3K0HA 3WMXA 3WLPA 4ZYUA 4S1VA 1W4LA 2H5LA 4TT8A 4Y7CA 4YVFA 3CPSA 2NVUB 4EQ6B 3IPXA 4GP9A 1FRNA 4QEKA 5KHLB 2DHRA 3DDCA 2AUTA 2PJDA 4MQBA 1DBIA 4PSDA 2OM6A 3ZQ4A 5J2UA 4RVFA 1WW3A 3UGQA 3Q1LA 4PGFA 4CKEB 2XQKA 1JQEA 2IUYA 2ZSFA 1NVFA 3JU3A 3IODA 3R5KA 4V03A 4I14A 1Q0QA 5E38A 5HS6A 2CJWA 1RRCA 1DRKA 3R75A 1N9KA 4BX9A 1F5SA 2EGGA 4H6WA 1W94A 2ZCVA 3TNDA 4LY9A 1V5GA 2QIOA 3VR2A 2BJWA 3IB3A 4F11A 1LRJA 2Z43A 4WZBB 2D2VA 3BXXA 3N1UA 5IG2A 2R1TA 2Q5CA 4L9SA 3WK5A 4QTZA 3OSZA 3P9CA 4EY7A 2RHGB 3NATA 4QBHA 5CXSA 4W8OA 1RQLA 4J0EA 4WK0B 4ENSA 5J4HA 5ALUA 1EXDA 2YXEA 1XQVA 4GLOA 1FX0B 5FWXB 3RRBA 2O0LA 1DTWA 2NQ2C 1TAHA 3PCTA 4XR9A 2JHGA 4DM4A 4NCKA 1FIUA 2BAGA 3RS0A 4B2LA 6ADHA 3HKBB 4C1BA 2XSZD 3G2KA 1ZJ5A 3KZVA 3W6OA 4O4JB 3PFGA 3ZDRA 1FP4B 4RL6A 2H2DA 3KZMA 3FNQA 4MCJA 2ON6A 1WCXA 3EC2A 3E70C 4NMWA 4IIJF 5TX7A 4PPFA 4FZRA 1X2BA 2GX6A 1UC9A 4NAVA 4PLHA 3C8MA 5BYBA 5AM4A 1PYOA 1PZHA 2LD4A 2XF8A 4O63O 2KS6A 2KBFA 4AUMA 1ANKA 4QFDA 3OIGA 3MTJA 1Q16A 4CKYA 5B7GA 5FIUA 3OZGA 5EE9A 4DY6A 3D4NA 3Q3JB 2WKWA 3V4PB 2UUBB 4MUAA 2FFHA 4IZIA 5BWNA 4RO0A 3NCTA 4OXKA 3EVCA 1QE3A 4AICA 3ITDA 4HB3A 2O2EA 3F67A 3IQFA 4FFNA 5ALQA 3LVQE 2YIJA 4IJMA 5JSKA 3UB3A 1JT9A 4Q3CA 2L69A 1GFIA 3DF9A 3A6KA 1KKLA 4TN5A 1L5GB 5KTOA 3DNFA 1OXKB 5DNDA 4RIHA 4Z8YA 4HQKA 4D9IA 3MJHA 1FFAA 2L0XA 4O6VA 2JIDA 3I2FA 1XTSA 4KB5A 4XUCA 2VTKA 4NZNA 4CQMB 2UYHA 3DVLA 2A4KA 3TIIA 1B0AA 3IGFA 5CLQA 3M9XA 5CHYA 4TKVB 4DR6B 3WLAA 1L4FA 3M70A 4O08A 3ICWA 1K4MA 3IIJA 1GD1O 2FK7A 5LXTA 4OX9B 4EAQA 1SD2A 4TQUS 1ZD3A 4PZAA 4RMIA 5EWMB 5EWLB 3LK6A 4HAIA 1E2GA 1E0KA 4C14A 3CVJA 4JJEA 4BDTA 3K6RA 1DQNA 1FS5A 3KEFA 4EKNB 1Y5MA 1USVA 2P9CA 4NZ9A 4ARUA 3BHMA 4AJJA 1C3EA 1HFKA 5JASA 4XOIA 4TV9B 5FYDA 1KEKA 2CJFA 4WZAE 3WIBA 3E22B 1HT0A 3BM5A 4HGNA 3KDAA 2W4IA 1FXSA 1ZKMA 3KT0A 2O19A 1VSTA 3JARB 2XQFA 3HADA 1H2WA 2WJ3A 2OQRA 3DJFA 4IICA 5ALIA 1NJ1A 1DXHA 3WGYA 2HH9A 4UUNA 3QLVA 5CYFA 4R1QA 2FJUA 1H2FA 4ZDWA 4OXQA 4JXXA 4MQ6A 4WEQA 2JCSA 3DQZA 3DPUA 3K09A 1A4IA 3RHSA 2W6MA 3L84A 1DO0A 4FONA 3AU8A 4C4XA 3F1LA 3IR6A 2CUKA 3DG9A 3OBBA 4HDNA 4C6TB 3S2UA 4EYEA 5ALZA 2EKLA 4I5EA 1U8CB 3UPUA 4CL3A 3GVIA 3HUFA 2Y66A 3S2ZA 3T9AA 4MQEA 4ZT5A 2WM9B 3QKSA 3L7OA 4FS3A 1MOQA 1LBTA 4ROTA 4TSFA 1E2PA 1I1HA 3GL9A 3TOXA 1HTWA 1D2MA 4FPXA 3QVWA 4CWAA 3CURA 2ZITA 3OE4A 4N8DA 3ETLA 1Z28A 2VT2A 1U8ZA 4H7DA 4MVJI 3KHSA 3W90A 5DN6D 2ODQA 1RKUA 2PUHA 2WYOA 4L4ZA 3GLIA 5EI5A 2WZCA 3LYAA 3B1JA 3DE1X 4BUJA 1Q57A 1FXWA 3GQBB 1DQPA 5I4BA 3C0KA 4FDUA 3FR8A 5E1DA 2AI3A 4R8RA 2HD4A 5ER9A 1TW2A 4D9NA 4Y6OA 3RUEA 3A27A 4XQ9A 5ALOA 4ENTA 3UMMA 4G5SA 4HDSA 2ZT5A 3TM4A 3HHEA 1CRZA 1HH4A 3T9BA 3VR3D 2L82A 1RI5A 4Q03A 2G71A 2FSVC 4TTVA 3I9V6 3U60B 4W5RA 1H6DA 5HF5A 1IUKA 2H31A 4HMOA 1K27A 1WDMA 1ORTA 2X0NA 4UM8B 3NJRA 1U2SA 2GJSA 1N6OA 5HILA 1NXPA 4C21A 4ZZ3A 4PYOA 1JIKA 3UAGA 4OJYA 4Y1RA 1BDIA 3EMVA 3U31A 2FCAA 4YO8A 2VJBA 3G13A 4DMHA 1F2UA 1R6UA 4FJ0A 1Z5VA 3R7AA 4ACAA 1JVNA 1ZEMA 4KO3S 1QGUB 4V0MA 1YZTA 1MO4A 1NF2A 2RIRA 4D4IA 2XNDA 4P33A 5I7WA 4Q05A 4D46A 1XEFA 3G17A 4E03A 3X2FA 1QFMA 2I62A 4F06A 2BC9A 3N87A 1Y5LA 4EG3A 5A3QA 2NX2A 3B2NA 4QBIA 5KSYA 5I4IA 1OYYA 3ZK9A 3NGXA 3KOUA 4N40A 4K9LA 4BMOB 1LBEA 1II9A 3WL3A 2FSFA 4Z4QA 2XTZA 1JBQA 2A9PA 3OJEA 1VKHA 3WYCA 3H83A 1M1YE 1LI5A 3PHLA 2W2XA 1JF8A 2E4XA 2WJYA 3R8FA 4E3WA 4HVCA 3IBYA 3UY4A 4JLDA 2JD2A 3P9NA 2JH3A 1Z39A 4FT2A 2NTNA 1UWCA 4G65A 4TWJA 3REOA 4LOHA 4H3HB 3THYA 4CNQA 2OO5A 4L8FA 1SKMA 2R6R1 1I3MA 4W1RA 4HK4A 2J3EA 4ZYZA 4UMDA 1ESZA 1QWOA 1NTOA 5EG5A 2NAFA 2HB6A 3O47A 3V8RA 4HHEA 1WXQA 2OVFA 4P34A 2PS0A 4DAOA 2QXTA 4FXPA 4QTUB 1YXMA 2WSBA 3ODGA 2TMDA 3VQTA 3G89A 5D3KA 1CQWA 1L8AA 1JBKA 2QUBA 4KDCA 4D74A 1WD7A 5CVTA 1GU7A 5AKYA 5C46F 2I7CA 1UDRA 1V1MA 2JLQA 2V6JA 3D2CA 3DLAA 3K5IA 1CNMA 4XD2A 3WHPA 4DUYB 1RRKA 1R0CA 4Q15A 3RASA 4WK4B 2FUG6 2Q6TA 3LO8A 4LQDA 2WTEA 3EGCA 1Z8HA 4ZQGA 4GBMA 2LCQA 5KC8A 3Q4GA 5FB3A 1Q83A 4GBGA 5EEGA 4BO5A 4B2PA 2IYOA 2LBPA 1PDOA 1AQIA 2A9JA 2WFMA 3EIQA 3PPVA 4ICIA 4JYMA 1BCRB 3T3HA 2PKWA 1CNEA 3KYBA 3RO7A 4DLSA 1TGYA 2QRKA 4AJ9A 2OXCA 5JLJA 2VUIB 4F5WA 3G2HA 3IVXA 4ES6A 3KNZA 5FBLB 3KZXA 4NPCA 4GH5A 2YINC 3WIVA 5LKRA 3ZUPA 2OAGA 3IV9A 3JYQA 4QARA 1QIIA 3SAJA 3PNYA 4DJAA 3Q5DA 1GQSA 1XD2B 2QHXA 4A6EA 4O5AA 4ZPJA 3UK6A 2JH9A 1XQYA 4V0QA 5DHQA 4QVKA 5JNSA 3HU1A 2F3PA 4FBGA 4WK6A 2VAWA 5AM5A 5TQ2B 1G4UR 4I2VA 3HVRA 3OJ0A 2HWYA 2O14A 3AF2A 2RGDA 4BX3A 3P9ZA 2QGFA 1UFVA 3AZQA 4OP3A 3LW7A 3O3NB 4I4TB 3A7DA 4BNDB 3P9QA 1UZAA 3B20A 4MAAA 4Z7NB 1C1XB 2A59A 3O83A 2RGRA 3RHFA 1P7YA 1DC3A 1U3GA 1YUBA 2B1RA 2X4DA 2XWSA 2XD9A 3VR5A 3ENKA 4TUYF 5CB4A 4GMGA 1U65A 3SVTA 1GGHA 1T5SA 4KGZA 3LX8A 2WM2A 5BR8B 1QU2A 2BMAA 4FDLA 4G4SO 4GOLD 1Z73A 1ZXBA 2OHVA 5L6LB 1ZP6A 3SQNA 5TPWB 5EIOA 2HMTA 2YC2C 5IX8A 5ERXA 1QK3A 2J9RA 3FTFA 1ZFNA 3TW8A 5JALA 2X0DA 3TIFA 1UWLA 3EXG2 4ZALA 1MJ5A 2ZAMA 4XSHA 4P58A 4RU1A 5BOSB 4P08A 5D3MB 4D44A 2WD7B 4KXQA 2FFQA 2FQYA 4RFSA 3LT1A 1N1EA 2FV8A 4OVKA 1GGJA 1QTQA 4G07A 4OFXA 3WJ1A 1TCCA 3DYBA 3LQ4A 2JJMA 3M5DA 2QD1A 1A2QA 1YACA 4DTIA 3AY0A 3I2IA 4JU8A 4CMKA 2F8TA 4LJLA 3VR1A 5L95A 5AVKA 5K2MA 4BB6A 3KSAC 2BM8A 2D59A 1SIOA 3BXPA 5EJ7A 3NGMA 2F62A 4HOYA 4E2XA 1DQZA 2D13A 2NZXA 4PYQA 5E9WA 4CG0A 1NW9B 5HDQA 3U3JA 2ECFA 4RA6A 4EFDA 1TTQB 2KW5A 1ISJA 4NRDA 1IN6A 1EVIA 4FR2A 4HR7A 1X1BA 2Q1TA 5HOQA 4BAGA 3CVVA 2DVMA 2WD8A 5AVVA 2RGWA 3E61A 3GRRA 2VFAA 2OT3B 2R85A 3LVRE 4QXPA 1L4BA 2C1EA 2JD1A 1C3XA 3BWBA 3H86A 4OTZA 3TR6A 1WUHS 1GNTA 2YTZA 2ZBEA 4HUJA 1Z7YA 4MRMA 1I2BA 3R0IA 4BEVA 1PQUA 1RMTA 2GDJA 4IKPA 3UAZA 5H1YA 1EHYA 1AGNA 1FUIA 2WE8A 3LY8A 3K6SA 3LCCA 5K6TA 1AXRA 4ZXPA 2KLHA 4JYBA 3GJ5A 1UPTA 1ZITA 3IAHA 3KZCA 3LUFA 2CVZA 4NNPA 1KYIA 1QH8A 2H63A 2WU4A 2QG4A 3DD1A 3O38A 2ZXEA 1LSJA 1M2OB 1QVRA 3CZCA 4H16A 4LTDA 1HSZA 4LW8A 4F60A 2OP0A 4IXWA 2IA5A 1AT1A 2FOIA 2MYUA 3CG0A 4LGMA 5HBRA 3V8PA 4EHJA 1GVHA 3JWEA 3MB8A 2R8PA 3AEZA 3U6KA 1BWQA 5TB5A 3USCS 4HYYA 3AC0A 2GLTA 3BWCA 1O94C 1NUHA 3OOWA 1J2JA 2YNMA 4KO4S 3GLTA 4ZVLA 3C8ZA 4MV9A 2VXYA 2DWUA 4WOPA 3AVYA 4JVMA 1G21A 2I2DA 2VJNA 2NZWA 1CJMA 3JQ6A 4KACA 4LRTB 3GFVA 4MS1A 4OB8A 3KKPA 2FOLA 4PAWA 4TWBA 5A3SA 3SFZA 2DOKA 4BJ6A 2RARA 1IU9A 4PO3X 3T06B 3TE6A 3UJAA 5IC5A 2JGRA 1JKMA 4FSDA 3LLSA 3EC1A 3D3JA 3SCZA 5D1NA 1MQ9A 3OM1A 5KMGB 3DYVA 2WU1A 4L8YA 2FEAA 2BPOA 1V6SA 2CXRA 4HLCA 4OCZA 1JG4A 2GLUA 2O20A 4KLRA 2QSUA 2LGJA 5IC6A 2VUUA 3EXAA 3TX2A 3A1SA 1UDWA 1OB5A 2Q4EA 1T9ZA 2LP4Y 3QFTA 3QPAA 2P9QA 4DV3B 4ND2A 1WMEA 4E5VA 5AVUA 3UAOA 3VDMA 1G9SA 4MCIA 5E4TA 3MS7A 4J2HA 4DNFA 1ZXXA 1C3JA 1H5NA 1SXJC 3HYRA 1WIWA 3UG6A 1UMBB 2FSIA 3T5MA 2XQJA 2VYFA 3P32A 2VHJA 5H82A 1K89A 1IHUA 1PZMA 1SHJA 1ONNA 4CMCA 4CUKA 2NPOA 2XKJE 5CB4F 5HZKA 2UZ4A 3KQYA 3R5TA 1XZQA 4AP5A 5C81A 1UXOA 5F3RA 1DSSG 1W19A 2QDKA 4AL4A 5KX5F 1VOTA 2W93A 2ASEA 2BW0A 2C42A 4L9AA 5D86A 3RKSA 3NVKI 1Y6GA 1RQPA 1V7CA 2WJHA 1UT8A 4BO0A 4BTEA 2VKTA 4Z99A 5AI5A 2DUWA 4PTZA 1ZH0A 2WKQA 3N2YA 3ICPA 3PWKA 4MA5A 5B53A 2PY6A 3JXEA 1W0JA 5T5QA 5CFZA 1YHNA 2ZQZA 5KYUA 5BWMA 4J76A 2GDZA 2DQZA 3DZGA 4AY6A 3KJEA 1NVBA 1JA0A 1ZC3A 3EMBA 2C94A 3K0BA 2XR1A 1XMXA 4MVXA 3DTVD 4X65B 1NBHA 5FBQB 5A04A 4OUDA 1TA4A 1V4BA 1WNFA 3IVAA 3PGVA 1AQNA 1E1CA 3ZHQA 1X15A 3FRJA 4RGBA 3L8EA 4WBSA 4Z4HA 4M0FA 2ZRNA 1E7YA 2FWAA 1U3DA 3N0TA 1N3LA 3LBHA 4K9SA 3H18A 2RGCA 3CKKA 2O8EB 3RSHA 4DE5A 1E63A 1WMSA 4U1RA 3G7UA 1FVHA 3TLAA 2X0JA 1CFZA 2VKQA 4CCAA 2VPZA 4Q02A 4Y2XA 3AVTA 3MJ4A 1JX6A 2W48A 2YRFA 5DSXA 2D7DA 4KAFA 5JR3A 4KTVE 1DDGA 4W5OA 1ZN8A 1C9MA 5GV8A 3FZNA 3KQTA 4MDHA 3A58B 2WTBA 3HO6A 4ZCMA 4KXMA 2GEJA 2CCKA 4CV3A 1VIAA 2AA3A 4BNXA 4C7XA 1XTIA 3MWLA 4JX9A 4XI9A 3IAEA 5CB6A 2SCUA 3QENA 2O23A 1UBSB 4E5MA 2HLDD 2Z3VA 4LQ4A 2R6JA 4TYPA 1AZTA 4LZOA 3S1AB 3UK1A 2A9QA 2OECA 1OZAA 2ERXA 3EYWA 1ZNYA 2A88A 4ZHSA 3C3BA 3DL0A 1KQOA 1JHDA 4AW9A 1CNFA 1CZUA 4Q3OA 1FL9A 1H23A 3CZ5A 2QE7D 3VDQA 1FBNA 2HZBA 2VNHA 2VNSA 3LC0A 4N3NA 1Z0IA 2IH4A 1AVTA 1UEIA 1TZMA 1PJSA 2YDYA 1NI4B 2SHKA 3QXHA 4I9NA 4PYKA 1U2PA 3Q11A 3T41A 3VKGA 3RS8A 4MAFA 2OB2A 3EK2A 4EP1A 3PJRA 1GY8A 3EVAA 3ND7A 3D0KA 4S2UA 1P2GA 2A5YB 3L92A 4PSAA 4Q1FA 3VRHA 5BV1A 4EELA 5B4VA 1G55A 2AEEA 2JKZA 1E2EA 3PVCA 3PD1A 3VVMA 4EI8A 5LPNA 1X38A 4LJYA 1MRSA 2Z5LA 5C51B 3MXTA 5B58C 4B75A 1RJGA 3NETA 2AOUA 4CHGA 5A06A 4DIBA 1QHHA 1WM1A 4LJ7A 4PTLA 2A0UA 3RFTA 2IBTA 4B3DA 4P80A 1J25A 3Q98A 2WINI 2WAXA 4RDCA 4ITUA 1Y6JA 1M6EX 1Z4OA 2ZXFA 4FMCF 4MJ3A 3M2TA 4CXMA 1CP2A 1U5BA 5KQGA 1DUIA 1TEZA 3ZPXA 5MN6A 4M1WA 4PN3A 3VOAA 4TYMA 3HRIA 3QWFA 1SUSA 1U8EA 4E46A 3GYBA 4H27A 1EUZA 5DM0A 5A3RA 4DCNA 4ALKA 3KXLA 1HDXA 2G6BA 5LDDC 1VBMA 2JARA 2H16A 3BMCA 5I7OA 1HRKA 1G8FA 3VGPA 1SOVA 2Q41A 2VHVA 1YC2A 2CLSA 2B69A 4QOEA 3TLBA 4UQPA 1KDRA 4TZTA 1XKLA 4HLNA 2E4VA 1CEEA 5LUAA 2B25A 2EWWA 2I0FA 4L3WA 4OO3A 5FV4A 1YB4A 2HXYA 2WQ7A 3I04M 1NJ6A 4YCAA 3ZV5A 5AYVA 1L7EA 3KSUA 3H05A 3N2KA 3TNFA 2F1RA 3ZK8A 1Z47A 4RQAA 2CN1A 2C3YA 2HWUA 3ZDEA 3T7TA 2A9OA 3SYMA 1R6BX 4ARSA 2ZFUA 1S02A 1GT6A 1QIMA 1SUEA 3H19A 4BTLA 4LFBB 2CUZA 1G3MA 2UZIR 3QXXA 2KI5A 1AHIA 2QVLA 4NZZA 3WJ7A 2DG2A 2H1OA 3H9QA 5DVZA 4AMGA 1AS3A 2HIAA 1C1YA 3PGA1 1GARA 1AQLA 2GCPA 2OLKA 3GJZA 5LMCA 4B3SB 3UXYA 3K05A 3F7TA 2PVPA 4WY2A 1IEXA 1BOFA 4GI3A 4GP6A 2BZSA 2PZLA 4MMXB 1PT5A 4QTTB 4RA9B 1B0UA 3QNWA 3GLRA 3RJMA 5DJ5A 2GNAA 5G0TA 4B3XA 1QNLA 3NDJA 4B6EA 2MYPA 2PD3A 1SVMA 3B1WA 3E18A 2OG1A 1OTYA 2X41A 3IQZA 2W37A 5E1OA 1B1CA 2NUPA 4RUKA 4CM6A 1VJ5A 4LKRA 2BE7A 4LFCB 2CXTA 2RE8A 1EVZA 1JFVA 2BFFB 3CWQA 2QTTA 2ZWOA 3VHXB 2MOKA 3KP1A 2PJZA 3K73O 4Q12A 5F33A 4CIXA 4C1NA 1ZJZA 4WHMA 1C9KA 3KAQA 2ONJA 4L5IA 4LYJA 3FTNA 3U62A 3EGEA 5C8VA 4E94A 3PDIA 4AF8A 1YNOA 4FFVA 1POWA 4FE7A 1YUMA 3BA6A 1QRUA 1EFLA 3CLRC 1GXSB 4J90A 4LBZA 1RSZA 3VU9B 3GN1A 5HXAA 2WM3A 2PV0A 3K8OE 3O4JA 3RFVA 3W7BA 2VJMA 2B4TO 4CM9A 1L1QA 3ZE9A 2VBGA 2DR0A 1JU4A 2PEZA 1UMCB 1IZ8A 2INGX 3L49A 3M5PA 5FTJA 5T6BA 4DV2B 1G59A 2WZDA 1T2CA 3JZAA 1OSNA 1D8AA 1GFSA 4EFLA 5IF9A 1F6BA 2H1CA 2IOFA 4MRVA 2G9NA 4G01B 3K92A 1NJGA 4J7XA 2A0WA 4XTCS 3L06A 1NJSA 2IYZA 2JFPA 3HSSA 3MGGA 1OC4A 1N9ZA 3QBTA 4H15A 3KYJB 3NALA 1HI9A 3PKZA 2J45A 2H4ZA 4IDPA 4TWIA 3VNBA 4X20A 1ZNWA 4CMJA 1UQTA 1XO1A 2PLWA 3FFTA 3QJGA 1BJRE 1MR3F 4X1OA 1KJ9A 2JAOA 1ZH4A 2VK4A 5C80A 4I6EA 1XPJA 3AEYA 3BSWA 3K1TA 5KYYB 2AT1A 4DSNA 2R7LA 1CUGA 1ORHA 2Q1WA 3C3XA 4YECA 4K86A 4KKVA 1HE2A 3UCXA 1BX1A 1XEWX 3KAJA 1Y48E 4G8BA 4YJ3A 4PICA 3NHAA 2BCJQ 4DMLA 1LF5A 2HREA 3HUDA 1EFVA 1IVYA 4HP8A 4MW7A 3RVOA 2ZZMA 2F3QA 5KVAA 1Q1BA 3L1JA 3U48A 2DQSA 4K6GA 1RLTA 3ORRA 4IAOA 5A2GA 3PHIA 3EIWA 4RVOA 5FOXA 1U0RA 1U5AA 2WWGA 3QVGB 4IQ8A 3SY8A 3WWEA 3OOSA 4HTFA 1X80A 5AUQA 4C7MA 1M6WA 3U49A 5KUTA 4CW7A 3H5LA 4JBWA 4QGFA 2QVBA 3VUEA 3KXPA 3BE5A 3KXDA 4XYGA 3H1AA 1XQXA 1EZZA 4UD6A 4RQTA 3EQ9A 2K87A 2XYPA 3H2SA 2HIGA 5BR4A 1FC0A 3KT3A 3QA3E 4B33A 1JDBC 4L5AA 3B7PA 4BKQA 1C7RA 1NASA 3KL4A 1KVQA 4NBRA 4TYNA 4PPNA 1D4OA 1YR9A 2JI4A 4X61A 2OQVA 1VSQA 3KWJA 4DRZA 3VZRA 4BMPB 1PLKA 3KLOA 4PLFA 1ZGGA 2R96A 3QPVA 4ZZ1A 2XBMA 2A30A 1CS4C 2AG1A 5H80A 4C07A 5IBCA 2RH5A 3SXJA 3Q3HA 4NKRA 4MVCA 1VG0B 3GBSA 1OU4A 3X0DA 2QJFA 1WY5A 1KC3A 3UV3A 3QYJA 3RUFA 2D5CA 1N5MA 3W5IA 2YQZA 1LJUA 1L7RA 2I6GA 2PQ6A 3EA5A 3IHLA 4BNYA 4GXTA 1ADBA 5JD6A 1EB9A 1VE1A 4S35A 4BGEA 4CT5A 4US1R 2O6HA 3Q7SA 1RXCA 2HQOA 2XH8A 4DLAA 1OH6A 5CX1A 1YTUA 3S2IA 3OJLA 3GCWA 3N2GB 4IG9A 2B7BA 2CL0X 3IQDB 3K7EA 2JGDA 4WVFA 2R3SA 1ECLA 2FFJA 1FFEA 4AM8A 2GBPA 3PXAA 1TZJA 1AIPA 4CFZA 1IN7A 3CINA 3ROFA 1JFFB 2W5UA 3HFGA 1NMXA 5GM2A 3PYMA 1XG5A 4RPJA 3SJCA 1AGXA 1NMYA 4AUKA 1ZZEA 4BVBA 2B8EA 3A14A 1KP3A 3LT2A 1PR6A 4CKXA 1H8ED 1OI2A 4EBBA 4US2R 1TT5A 1XLVA 2OKCA 4GE0A 4M46A 4NS1A 5TPWA 1QVVA 5EYPB 3ZU6A 1WP4A 1E98A 1XIVA 4FOSA 2YUTA 4MH0R 2DRIA 4DYDA 1DIBA 3D6JA 4IFEA 4MARA 3WVNA 3RYFB 3ZE1B 2WSSA 4BWYA 3K71B 1BEZA 1D7OA 1K8RA 2HMVA 3DO5A 2H1VA 4IWXA 4G85A 4ID9A 1CY1A 4NPAA 3CJQA 3UT5B 2CVPA 4QYMA 4A23A 4Z7JA 3FNBA 5JXHA 1TMKA 1OBOA 3R3ZA 2G06A 2YFHA 1NRWA 5TLSA 3ILSA 5KYUB 2P2SA 1CZLA 1NOKA 4HH4A 4N12A 3S29A 2OLEA 4RZQA 1M6VB 1RWVA 3OE7D 5JFOA 2Q6LA 4UMFA 3OICA 3X1WA 2HWXA 1TYAE 4WLEA 1DZIA 4CN8A 2DKOA 4JKYA 1OHHA 5B2EA 3CNBA 3BUSA 3MJFA 3KO8A 1ZVQA 4MRRA 3OAAA 1PG5A 4RLSA 4AO8A 3VDXA 3U81A 4C06A 4RS3A 3NG1A 3FLBA 4X95A 2WUWE 4P7KA 1GOTA 4UVDA 5AVTA 1AZSC 1BH6A 4PHTA 1ZK0A 3TDMA 2C5GA 2IZ5A 3HCOA 5GVSA 5K5EA 2B9EA 4FFMA 4AJPA 3B8HA 2P91A 3N0WA 3U37A 1HLDA 5JZBA 4K9KA 4MGKR 1UP4A 4E4RA 1NOIA 3KALA 3OOJA 4D8YA 3PL1A 3C85A 4D8WA 2YIDA 1XMPA 5ALPA 5B58T 1QO9A 1VDZA 3MNFA 2GF2A 4Z9XA 4OI4A 4TS3A 1OZFA 2C2MA 3DAHA 4UU0A 4GOMD 3AHFA 4AXXA 1WU8A 2UZ0A 1XCLA 2H4HA 1RLMA 3MZ0A 1QDEA 1E8DA 5ABPA 3WMFA 2CD7A 3JQEA 3NHRA 1ODLA 1N8TA 2ZRFA 3UHPA 3U80A 4B8YA 3UATA 4GKKB 4OQNA 1J07A 1TYBE 4J0GA 4GMDA 3KB2A 2HJHA 2YHBA 1O9BA 4LEIA 2RKWA 1NM5A 3HVKA 3NB0A 2GB4A 4D1YA 2JJ1A 2IDMA 2QUAA 1C2YA 1PZGA 3RFXA 3I39X 4BZZA 4MR8A 2WIDA 5EJ9A 5FPKA 3VSEA 1GCIA 1IB0A 2C7OA 1PEYA 4NZYA 3ACBA 4OJTA 2VWPA 2X8JA 1WO8A 1JKXA 1WB6A 1G7TA 1HEUA 2IZ1A 3QVKA 2W6OA 3BIXA 4N7BA 4R83A 5IJAA 1Q2UA 1M2OA 2GPYA 1U9ZA 2APJA 2JDID 2QTGA 4G97A 4MV5A 4M9RA 5EXXA 2G08A 4GM4A 4PY2A 1J56A 4EG0A 4P5DA 1FFXA 3JSXA 1W73A 2ZDQA 4UCXA 5A9TA 1DINA 1YQTA 1NU8A 3FB1A 3DMPA 4X1KB 3GFRA 4H77A 3UAXA 4TL7A 1V8ZA 2ZYWX 2BBWA 4L73A 5C1OA 2ZYRA 4ZJPA 4QVGA 2IWRA 3OTGA 2P7HA 3LY5A 4GC5A 3RJ5A 1B23P 1DOHA 4AG6A 1CY8A 1XVVA 4DF3A 5D1HA 4CI9A 3RS4A 3D7MA 3PNBA 4A27A 1PQYA 2PL1A 4ANFA 1BFDA 1KZYC 1SB9A 1X39A 3C41J 3F6BX 2ZPTX 3SG0A 2Z04A 1GQFA 4WLUA 1Y8QB 2O5EA 4P4SA 5ARCA 3H17A 3MOIA 2RHOA 3I9OA 4BX8A 1PFGA 4XIGS 1I4WA 3FMGA 2O7RA 2PLNA 1BW9B 2G0AA 3K2QA 4J16C 3OZFA 4I50A 4V2UA 1E1QA 1O4WA 4X94A 3SF8B 3DEHA 3ZZ1A 2FQXA 4F3RA 3D5QA 2EFJA 4JC5A 4IIVA 4FGKA 4REQB 2PMDA 1EYZA 1C3VA 5G1NA 2HOQA 1KEZA 1XDUA 3LUHA 2O8VA 3ROEA 1AGYA 2XA2A 2W6ZA 2G4LA 3AETB 2EX0A 3N39C 1E0SA 1XAIA 2H4JA 2Z09A 1M2KA 2IK8A 4Q7JB 4ETMA 1PTJA 3IQXA 5AICA 2CFSA 1QIEA 3I5UA 3LIIA 4YRMA 1GDHA 1B0ZA 5JNRA 3T5AA 1PFKA 1YB6A 1TKCA 1K8XB 4B7AA 4OHWA 2Q0QA 5CH3A 3OY2A 2OWEA 3OJWA 1F8UA 3D2BA 1CJKC 3F3SA 3GRFA 2D6FA 3VU3A 2MR6A 2ZVQX 4KO2S 5ALKA 5HJ5A 4IDHA 5A03A 1NDUA 3D9QX 4RPLA 3QQPA 4J1NA 3VDNB 1L5YA 3PIDA 4I4TA 3WNCA 1EP2B 4S05A 1ECGA 2PWYA 5L3QA 3EFEA 3ETEA 4YRLA 1CETA 3PHCA 4IUBS 3GLIB 4YAUA 1G8GA 3C6ZA 4N0QA 1PL8A 4A16A 2PH1A 2AHOA 5LZ5A 5IT0A 3T7EA 3F2VA 3W05A 4EUFA 4INOA 1IK6A 3PDHA 2QZ4A 2W00A 3IL2A 2ZBDA 1BCSA 5MFZA 4Y9DA 5DASA 1CQPA 1PJTA 2C29D 1N5IA 4IWNA 4MVYA 1Y34E 5TIIA 2D1FA 3PWTA 2ZJYA 3ZCPA 1R4ZA 4JV5B 1C9DB 1ZWLA 2QK4A 2O3QA 5FTMA 5BMOA 3D2LA 4I4LA 2K6GA 3AUUA 3EARA 3MGKA 4KQ9A 1CUSA 2YVQA 1WG8A 1M34A 3HBJA 1MDBA 4MCHA 3FHJA 1N2GA 3DOIA 4X44A 4DPMA 3G9UA 1Q5PA 4KOAA 1NRXA 4B3RB 2GH1A 2VS1A 1JQJC 4XFJA 3LH5A 3QVTA 4G9BA 4OK5A 4EUKA 1YHYA 1JEEA 2J41A 4GR9A 3RABA 3FZGA 2Q62A 5A4KA 3UTCA 1J20A 2GFHA 3OU6A 1JIUA 3ZD7A 1SHUX 2ZM6B 1C3OB 3A6EA 3EQZA 3NOOA 3PKJA 5TXGA 3HGTA 4WOJA 4RY9A 2P6MA 1DZ3A 1LW7A 4LHWA 3HVIA 3EGIA 5FNZA 1ZAYA 2WJ4A 2J5RA 1E99A 1RXUA 1STOA 2R87A 2X8WA 2YWEA 3AUXA 4NDZA 3UAWA 4NXNB 1SU6A 3T1OA 5L3RA 2NLOA 3A28A 4RKYA 1CYEA 4Q6WA 5DDIP 3R7SA 4LYFA 1OI7A 4E13A 1W1IA 2OV1A 3SSNA 1IJBA 1ZIYA 4MPRA 1PYDA 4ZEXA 3MD0A 3BMXA 2JGLA 3GOHA 3NJ4A 3E8XA 5K0BA 2GVDC 4UEWA 2IYSA 3UB2A 3QFCA 1LV8A 5E2AA 5H5JA 4P86A 3CRRA 2QM0A 4AY5A 2W8BA 4ND7A 1I32A 1PG2A 2JH8A 2OD7A 4OUKX 3HA2A 4PZLA 4S24A 3UB4A 1BVHA 2BIFA 4RETA 1CUJA 1D2AA 3PWSA 1ZBQA 1N4DA 2DY1A 2FPUA 2I1QA 3RGWS 3VAYA 4QLBA 4JLBA 4W8HA 2CB9A 4IGFA 1SVOA 1YC5A 2HCJB 2C4KA 5CIQA 5CVCA 4BMZA 5JI3E 1Z35A 4JLSA 1YR7A 2FLKA 1T2UA 1V45E 3IP1A 5JS2A 2BM1A 3AI7A 5FA8A 2P9TA 4ZC8A 4EDFA 3S1SA 2B0CA 3V7FA 3NYWA 4L57A 3NDRA 4Y6LA 4ARCA 3WAKA 3ONEA 5DNAA 1HNZB 1X3LA 4W7SA 1D8TA 3U40A 4DJDC 1Y0BA 5IJ0A 2Q1SA 3BBLA 4NCAA 2HA5A 1FNSA 2W83A 2QSJA 4D0NA 4EJSC 2D0OB 1P9RA 3ETJA 4IJQA 1U2GC 5EGSA 5F35A 3Q8LA 3OJFA 2ATEA 4D0RA 6YASA 3AKEA 2C3OA 2Q6KA 3I9V1 2ZYGA 1LLUA 3LBNA 5DMXA 3KJQA 1JAXA 3RWOA 3V1LA 4DMMA 1Y6FA 2WOOA 4FLMA 1SBCA 4RK5A 3FUTA 2J09A 4GO1A 4PVDA 1YOBA 1QH9A 4C0BA 3PI6A 4IG4A 4K3UA 4LVNA 3O1JC 3Q8MA 3VI3B 1PGPA 2PS1A 4WCFC 13PKA 2QLLA 1BX3A 3MCZA 3UUFA 4DWWA 4QX6A 2X2OA 4V0KA 3LF2A 5EKXA 3QOYA 3KKEA 3TR5A 2CNWA 4ONEA 5A3JA 1I6LA 3H7IA 4G1CA 3B9PA 1KQNA 4V2IA 1V16A 4CVNA 3BRCA 4BNFA 3WGMA 3K0EA 1K1EA 2FG5A 2B34A 2HLDA 3VTAA 2IY7A 5K1ZA 1AK2A 5I5GA 1BVUA 2Y1XA 5JZ9A 1USGA 1IZ7A 1U3WA 1PR5A 4QUEA 1CEQA 4I9UA 4Q3DA 3ZW7A 4XQ0A 2CVHA 3DB1A 3GRAA 1E3JA 4MTLA 4PHCA 3QOWA 3HMQA 4M6WB 1GZDA 1UKZA 4I6JA 3WFIA 1SXIA 2R8RA 4UDOA 3GT7A 4RAQA 1OKKD 4BEJA 3ZYZA 5EEHA 3JVIA 4FI3F 4B7XA 3ZHXA 4P4SB 4WUTA 1S8OA 4G5GA 4V24A 5DNUA 3IEVA 1B2RA 1EGMB 5CJ2A 2Q07A 5IJ0B 2AZ4A 5LBTA 2V7QA 5KJ6A 5KNCA 4L0DA 3LE8A 3E9QA 3PSHA 1YKGA 3OD5A 4I8IA 4KQHA 4RY8A 1HGXA 2IUFA 3MCWA 2JLZA 1S5PA 3AXSA 3B48A 3CBQA 1LDNA 3PEEA 4B7ZA 2X8BA 1LXCA 1N33B 1H3FA 2C3UA 4GLFA 4WV3A 4XJSA 4DCMA 5K6AC 3MJTA 4R1LA 3GA5A 3H42B 4X1KA 5JBIA 2DTDA 4BHTA 3AHIA 5HOEA 2I5PO 3F3MA 1M2VB 5ETJA 2PGDA 2X0RA 4RV9A 4MI3A 2YMQA 1B41A 3SZGA 1C4XA 4DBVO 1I36A 1YOVA 4MJ7A 1U98A 3UYLA 2X2EA 1EX9A 2A1TS 3WYBA 3WXMA 4XW2A 4CF4A 2RBKA 4M0DA 1RAHA 2WHEA 1VJ0A 2GBLA 1GYRA 1RPZA 3P0RA 1VYUA 3K1JA 1C8KA 4P36A 3A10A 1VIDA 1I80A 5DYYA 5TARA 1E1LA 2Q5FA 3R9XA 3VR5H 3AIIA 2JAQA 4E5UA 5FXMA 1F17A 1KQFA 4JMLA 2IW3A 3KEQA 4WASA 4CDRA 3EY9A 2ZRQA 3FDJA 2RSLA 1EQUA 5CMLA 1C50A 4IRXA 3GUYA 3C24A 5DLQC 1VLVA 4JI8B 1F7VA 4UZFA 1MXFA 1K63A 3DCYA 1FDRA 1ZUWA 2GBCA 1JLMA 1YF3A 1WR8A 5BPFA 3L43A 4P7GA 4XB2A 1E9EA 4JWKA 2DFVA 1GKYA 4QXRA 4FBLA 4UM9B 2W9XA 1G5QA 2P4EA 1KMCA 2N9UA 1I33A 3ICVA 4NK5A 3ADBA 2ZIZA 3EIXA 1W9HA 2MU1A 3EZLA 4HWGA 2NU9B 5LVAA 2COUA 2JATA 5JZSA 3TMAA 4WAUA 5A7FA 1KKUA 2J0UA 4F91B 3ORSA 1H85A 3KPVA 4B80A 5IPFA 1Q15A 4RSGA 1E3WA 3RROA 3V5NA 2Z2ZA 3WO1A 1UAYA 1BE8A 2AXQA 1NW4A 4D45A 5D3ZA 5EERA 4COKA 4HFNA 1HV8A 1XU7A 3BQNB 4EEZA 2CMDA 2O1SA 3HHPA 3FROA 5DH9A 3ABQB 3RTGA 5AFSA 5CD9A 5ITVA 1X1QA 3MIZA 4DGSA 2FZVA 3I42A 2V7UA 1Z7GA 4XDHA 1XRPA 2OXEA 4MR7A 4RPHA 2AN1A 5B3AA 2H5JA 3UJ8A 1ADCA 1AM4D 2C4UA 4FN4A 3R9KA 2JVIA 2BSAA 5EZYA 4LISA 1Y6RA 2YL2A 3BHJA 2AEJA 3DOCA 1DC5A 5IVIA 3RSFA 3N2NA 1E60A 4NG5A 4UQLA 4L16A 3FPHA 4PZDA 3O91A 1YBAA 5BSGA 2FN8A 2MMGA 3E3LA 4FDVA 4FQ8A 4TS4A 1PVDA 1GUDA 4V3BA 3WSVA 4XVCA 2GFIA 2RHTA 4KPFC 4DJ5X 4YR7A 5KKCA 1NBOA 1Y42X 1YS6A 4MWTA 1CU1A 3E8MA 4PC3A 3TMKA 1JMYA 1JHOA 4PIVA 3NUZA 1P1JA 5JG7A 3SBOA 4NATA 3GD5A 3OEHA 3C14C 2Q28A 5EINA 3QIVA 4ESHA 4H7IA 4YPVA 3DEIA 5B5SA 5I7AA 4JI6B 5EXDA 1W49A 3GFGA 3OPQA 3ER8A 3A6JA 3B70A 1W5TA 1BCSB 5L3ZA 1MJGM 1PN3A 1XTPA 2GN2A 3A1UA 3CLRD 3T34A 3LC1O 4REQA 1OFVA 2IYUA 2V5UA 5FPSA 5IKEA 2Q3FA 1NVAA 1GL9B 5DEOA 4CYMA 2Y1KA 4DM7A 3OE1A 2OZLB 5SY9A 4IX9A 3A9UA 3OURA 5JQGF 2X5NA 4MKHA 4B82A 4BN5A 3I8XA 3COZA 1SVKA 2VK1A 5B36A 2C5FA 2AQKA 2HSWA 3FW1A 3LQFA 3RIXA 3T4XA 5JISA 5K8CA 1E3EA 2QE6A 5SICE 3RAJA 1IUNA 3A1DA 4W5NA 1SCUA 2A1TR 3ZHCA 1CUBA 3BXEA 4M0CA 1V5EA 1CUAA 4KR9A 3TECE 3VJMA 2W2LA 3M6MD 1MA0A 4NBNA 2GKGA 3ZE2B 5JY6A 3L8FA 3FB4A 1A9ZA 1M83A 4L6CA 2DCMA 4TLBA 1V25A 2O05A 1BE1A 4X0EA 2C4NA 2VF7A 4YJKA 1L5OA 1SULA 5FKJA 2ONYA 1ESCA 5DHSA 4WSOA 5JWRA 4KXNA 3ZEAA 4AYWA 3QSGA 4X41A 4BLWA 1Q7TA 4CR7A 4D97A 2PWAA 3G1UA 2F4VB 1I2AA 2YXNA 4AG5A 4YCSA 4D9BA 4DL9A 5A5DA 1IK4A 1S2OA 1XZCA 4RE6A 1CRPA 1U3VA 1UZMA 2VF5X 3AL2A 5FI1B 3M6IA 4URHA 1XLWA 2P9ZA 1FSSA 1QFXA 3IXMA 3VDRA 1N7JA 4EL0A 1QZXA 4GPD1 4PYLA 1EVQA 1G6Q1 3EZNA 5T4HA 1H4SA 5DV9A 3GZNA 2J5BA 1TMOA 1ZJYA 2H1WA 3RM3A 2UVQA 1ULTA 3WQRA 1Y81A 4I5FA 1VL8A 3VISA 2H29A 2AQIA 4RD6A 5SZIA 2ZB3A 2WJ6A 1F48A 3RS7A 2AJLI 1L5HB 3C5WP 5KSPA 4CQMA 2AMLA 3WHKA 3CX7A 1UBMS 3K4PA 1LPMA 4UPDA 5FAKA 3VZPA 5DYIA 3KJNA 2J87A 3L77A 4YFVA 3CZQA 3KZOA 3E0XA 1K3FA 1P2UA 2I3ZA 4FKZA 3AGQA 4H18A 4FE4A 2B83A 1TFRA 4H1HA 1H6CA 1NUAA 1Z2CA 2R00C 2IPMA 4P53A 2M1XA 3ORHA 3IOCA 5FNVB 1D6MA 4L51A 3TIVA 2AGVA 3M5CA 4XLTA 2HF8A 1JEAA 1QK4A 4FHZA 5ALRA 4LNUB 3TTUA 4BV2A 4AS3A 3L6UA 2CLEB 3P0IA 3ZBUA 5D8DA 1XCGB 4EZEA 4LDPA 1YJBA 3TZKA 4HEA1 5LN1A 1DBVO 4CGYA 2FUNB 2J5XA 1HE1C 4Z51A 1H94A 1SKAA 4C7VA 1XPRA 2Y1CA 4L8WB 3NHFA 2H1HA 1UMDB 2VEOA 1MDFA 4FHEA 3F9CA 4OLFA 1BGWA 1MG5A 2YV2A 3QPWA 4QOFA 3WMWA 3NM6B 4DRXA 1ZI9A 3MWYW 4Q39A 1YQXA 1VG1A 3A2KA 4LCBA 1M6VA 4CQJA 1VKOA 1PLJA 3N0RA 1MC4A 4WGGA 5DCUA 2D5AA 2H4WA 2OTCA 2PQ2A 5CIWA 1XYYA 1X7GA 2VRCD 4UARA 5J9FA 5HZMA 4EPRA 1FTWA 5CCBA 1X1DA 1R3DA 5THQA 1RFLA 2H92A 3KT6A 1YT5A 5ER6A 2OGZA 3MFQA 2P9EA 1WPQA 3PRHA 1IC6A 3UPDA 2OFPA 4XB1A 1HNXB 2A9VA 2W8ZA 3OX4A 4GOJA 4W82A 4PVCA 1AKVA 3TE7A 4QBGB 4UAVA 1JHMA 1CZHA 3M34A 3F5DA 4JITA 3FBWA 4E30A 1T3ZA 3ZWNA 2PL5A 1OH5A 3PUVA 1K6IA 3G8YA 1IM5A 3IS3A 2JC3A 2Q3LA 2DSNA 3AM4A 3H1EA 3IYLW 1D2RA 4PU0A 3CR7A 2QX9A 1FXWF 2Y4OA 3EA0A 1AV7A 2AF4C 3H9GA 4QOGA 5HF9A 4CLOA 2CJWB 3QW4B 5K51A 1T5BA 1FPMA 1KAOA 2BEKA 2XADA 4BNJA 1BVRA 2AEMA 4YONB 2JGDB 2H59A 2C57A 2WSIA 1IZZA 2YY6A 4JL8A 4UOQA 2ZROA 4MP6A 5CUQA 4Z6KA 1ENPA 3LL7A 5BSRA 2SECE 1Z6PA 5CX1B 4ZO8A 5BRAA 1X0XA 2HJGA 5JQGA 2W6PA 3BYZA 4PHFA 5C8DA 5FT9A 4PNPA 4FDAA 5D01A 1GPH1 1UANA 3E27A 4Q4DA 1DXQA 5EYPA 4URWR 1YL5A 1RPNA 2XT0A 1VPTA 2JCXA 4D3YA 4FOOA 1QXSA 1G3UA 2OHJA 5EIFA 2QN3A 3OZWA 2AVNA 4Z9BA 2YFKA 1V43A 2RI0A 4L28A 2WWRA 3K9LA 4HSGA 5E9JA 2PE5A 1E9CA 1GL7A 1BRMA 2C96A 4Z5XA 2YVUA 1UMBA 4XVRA 1UZUA 2PX2A 2A3RA 1COZA 3O1LA 1A2OA 5E9AA 5DWDA 2NVBA 5AWFC 3UA4A 3JR3A 2PKXA 5C5DA 3O2SB 4JBYA 3X43A 1P9LA 4RZXA 1B3BA 1RWOA 1NSYA 4JS0A 5DTRA 5E0OA 3LLUA 1DC7A 5BSTA 4X93A 1E2BA 1UPFA 1QYDA 1P2FA 3IB6A 4LSGA 4KU4A 3IEUA 1GCGA 3LM8A 4MINA 5AJUA 4GI5A 4G09A 1TOAA 2NUAA 3TL6A 2OAQ1 1V35A 4BRZA 4KSCA 4E15A 5G40A 1Z0KA 3ZNNA 3QEAZ 2I78A 3PRKE 2WT8A 3L1VA 2QV0A 1KBQA 2HA7A 4DIMA 3PNVA 2VG8A 1H9CA 2PBRA 5HTOA 5K3SA 4MDEA 1CQJA 1HTBA 2GTHA 5BORA 1QRRA 1RWWA 1WV0A 2PMFA 4PPGA 4QSHA 4Z9AA 2I99A 1ELOA 3S27A 2X7JA 3F47A 1X94A 4YMHA 5KOIA 5KTSA 3LKDA 4LWOA 2M6RA 1EE2A 1RHKA 3WGOA 4WKOA 3A3OA 5IUKC 2EJVA 3V00A 1KMQA 4G1BA 4PM4A 2N47A 1XWWA 1YIDA 2H54A 5CBPB 3DE6X 3IKJA 3STVA 4CM1A 3LXRA 3QW2A 1XA3A 1OLOA 2CKDA 4RULA 4Y6RA 1K3UB 3ZKWA 3UGJA 3DEKA 2X7XA 3TPZA 1N1MA 3NCHA 2GPAA 4YJ2F 3P2MA 4DS3A 2OV3A 2W90A 5TEVA 3S44A 1YZLA 4U7FA 2PQ0A 4LCJA 2GYWA 1E89A 5C7YA 3ZVMA 4LHSA 4NBSA 4YRRA 2QXYA 2R8ZA 1WQ4A 4ALIA 4A2QA 1WBBA 2EBHX 2PBFA 3DPSA 4E21A 1NG1A 4TTQA 3DOHA 2VPXA 3F6RA 4LRWA 5IARA 3S1AA 4BYMA 2W2PA 3P2KA 3VR6D 1YQDA 4B2IA 1M8PA 2NSHA 1GTRA 3GC6A 3DE2X 3KPJA 3R3YA 3T5GA 1X6VA 1VKNA 1OWPA 5T4FA 2EWMA 4I4IA 5J47A 3B1XA 3GEPA 2PKRA 2N1MA 3VU9A 1PS8A 2QS9A 2GETA 5HYVA 5KIAA 3U7IA 4CLRA 1JQDA 3G2NA 3PDIB 2G77B 5J1SB 2XWJI 1R4NB 1EA5A 1AXGA 1VLQA 3N05A 5CM2Z 5ALFA 1T2AA 3B9BA 3DM9B 4H4EA 4ZT7A 5LYYA 1QIDA 2C04A 1AUVA 1M6NA 2PSJA 3N7AA 2MDTA 2CY0A 3AUYA 3JWGA 5HKLA 3AR3A 1YRAA 4Q9IA 1QLHA 2XOKD 4DXHA 3VKFA 1LV7A 1P1HA 4OHUA 2Z2KA 5D3MA 4JI3B 3HB4X 4V0SA 4IH1A 1UJMA 2BGNA 4B79A 5J4LA 3ZYCA 4E14A 5J2TA 3U7GA 2ZVPX 4C03A 2XMSA 1ZR4A 4B3GA 1XQ6A 5KAPA 3ZXIA 3AL0C 4PX3A 3STWA 2R6CA 2PYIA 3EVNA 1Q6YA 4OHKA 4PV7A 2QD3A 2JFHA 1SZDA 4OQXA 4RV4A 3LAWA 3PK0A 3VNAA 3PG5A 2UXDB 3ML1A 2RK3A 2C5EA 4TL9A 1T4CA 2ZJ6A 3EGOA 1E6MA 5CLHA 4ED9A 4GL2A 5BQ3A 1FZTA 4FYMA 3GVPA 4PAGA 5HE8A 4GVPA 1SC6A 3W5VA 4Z53A 2H8KA 2WICA 1K0FA 1MB0A 3FSEA 1QO7A 3QE2A 4U5QA 2WNIA 5F2KA 3VPBA 4CLOB 1N7IA 5BSWA 3COJA 2GN6A 5FD8A 2BGKA 1U7PA 4XDGA 3WP1B 1QWSA 2JAUA 2QAIA 3P9SA 4ZDIA 2MSCB 4RFLA 5TPZD 1H0HA 5CFRA 5MDHA 3D64A 3EZ7A 2IYRA 3IX7A 3GP5A 4ESOA 3AHGA 2BKAA 4DWVA 1E1CB 5FI0B 4XVHA 3V8EA 4DKXA 4N5DA 2DAPA 1VP9A 3BREA 1NN1A 4M1QA 5CAEB 4B74A 4CTJA 4D4HA 3SR4A 3HYTA 5A9RA 2V3VA 2Q5QA 4G5HA 4BMVA 1ECCA 1ZD2P 2C0CA 1QLJA 2QQGA 3ACCA 3ECSA 1SY7A 1HMYA 1Z25A 4W6ZA 1XZMA 4DCUA 4AI6A 2C1ZA 3H8VA 3HDGA 1UK9A 5C8YA 3WLQA 2NVOA 1I1NA 2C4HA 1MOPA 4PYJA 5I7EA 1ZHFA 1LDYA 4KPGA 3EC7A 3EASA 1PX0A 1OJLA 3AQIA 2AJCA 3QJ5A 4K1XA 4K9MA 1U02A 4YAOA 4BBZA 3PUIA 2EJTA 5EHZA 3EQ8A 5KMGA 5DNYB 1A1VA 2J5QA 5BYAA 5ALTA 2O7SA 4NFSA 2W6JA 4F3YA 5LYJA 2ICAA 3DV9A 3E3OA 3K4HA 1HDYA 3PGXA 3QVVA 2EKQA 2CL5A 3TM5A 4OU5A 3OQOA 1KOGA 1C8BA 1EMDA 4IXTA 3AB8A 2HWKA 4GVXA 2HM7A 1NOJA 3V1UA 1QH1A 5DM60 1ZQ9A 1QHNA 2Y2VA 4EPTA 4KYIB 2JI9A 4IJUA 3IQIX 1ZPDA 3WKCA 3V4RA 1UPBA 3T5BA 2FRDA 3VBCA 3ZNQA 2WTXA 5HEKA 2VCYA 5JVDA 1DBPA 3I92A 2CYAA 1FFDA 4MWZA 2YN0A 1E3SA 2VHWA 5FWYB 1IJKA 2WUDA 1PKXA 1Y3BE 3LYUA 4JVNA 3ICEA 4G2TA 5KYWB 4IILA 1XAJA 2VRBA 3E81A 4U2CA 4QTYA 4P9NA 1NJ8A 4WOKA 4CCYB 3N3BC 1HDEA 4IOKA 1R8QA 1VYTA 9LDTA 1R9GA 4UNPA 4KNYA 2DTEA 4ZANA 1W0CA 2QRHA 3A06A 3SQXA 3CEMA 3IQWA 2ES4A 5AI9A 4KI0A 5E2IA 3D6NB 4QYWA 5IAKA 3ANMA 1LC3A 4FFBA 4PN7A 4P0PB 4XRRA 5JAQA 2WYIA 2FPRA 4AK9A 3R3HA 1FVFA 3QM1A 4CM8A 3KYIB 3RVDA 3OHMA 1RXWA 3DE5X 1C3LA 4UHBA 1IHYA 3EG9A 3UGTA 3HJFA 3BB3A 3HFRA 1F1JA 2WWVD 1WSWA 3CRW1 3EQ2A 4A0RA 2VT7A 4ER6A 2P3SA 5EE1A 2Q5LA 4MKZA 3LX5A 1CUVA 3HRHA 1AUPA 2ODTX 4QJ3A 3S7TA 3EZ9A 2REBA 3K6JA 1MC1A 2OLJA 3HCDA 4HS9A 4OLHA 3I1FA 2YZ7A 3P0FA 2CBGA 4JT9A 1TLFA 2VJQA 3EH2A 1J1IA 4MWBA 2HA2A 5DIFA 1WKBA 2A58A 3N59A 1E1KA 1Y1LA 1W36B 3LC7O 4MRMB 3DMNA 2QG6A 4INPA 2IEBA 2FZEA 3F71A 2PGIA 2PKEA 2AOTB 2Y3IA 1YR3A 3DOFA 3IDOA 5AKKA 2F64A 4QPZA 1X14A 2UZAA 4GWLA 4DA9A 5B7NA 3FPBA 3QTBA 2HJSA 3NBQA 3AP1A 2GSDA 1GPLA 4EM6A 5LIRA 1BD3A 3FVWA 1W2GA 2CNNA 2V8OA 2WNSA 4RA6B 3SIPA 5GINE 4IP0A 4JAVC 1QQ7A 4XASA 2AWNA 2BELA 4MCAA 5DYGA 3TJZA 4PBTA 3FN4A 4JN6B 4D5GA 2N3ZA 2BTQB 2H00A 4QOIA 4GFDA 4KQ1A 4QULA 1JG1A 5K3EA 1H66A 1Z0AA 2EF1A 2V6BA 3U3ZA 4IHAA 3ENZA 3KVOA 2BGMA 1L6IA 1OGYA 3H99A 3OG9A 1IEVA 2QLJA 2R8OA 4D81A 1FNNA 2G28A 4DA4A 2P9HA 2PD4A 4P92A 4YCBA 5C5IA 1Z15A 3B3GA 4I4TF 3D6FA 4LV8B 3KBBA 3QYPA 4D7AA 2GEFA 3M6LA 2CDBA 3TIGA 1XZGA 4F72A 4U9HS 5I7VA 5DTJA 3QKSB 1UPAA 1CZNA 4Z2AA 1QFSA 2UXCB 3Q5GA 2XE4A 3EXHB 5LP6A 5EIWA 4EO9A 5AHOA 3UHAA 3K0CC 3QTLA 1T9BA 3OZIA 3TLYA 2G4VA 1U7DA 3IPCA 2OXRA 3NBYC 4GPEA 5LWHA 3WTCA 1SD5A 3QHQA 4FM9A 1N8SA 2BD0A 3HG7A 1O0BA 2J7PD 2Q1UA 5BN5B 2JHFA 3PGMA 2D3TA 5ALSA 2R6AA 3I9MA 3I0ZA 2C2YA 4C87A 1M66A 4G67A 3D6TB 5H68A 4Q3KA 2G67A 2PGLA 3TOVA 1OYWA 4QYIB 1I5EA 3DOUA 3DF7A 2DETA 3GDGA 5JHHB 3M2PA 4WQMA 1Z5UA 4ZN6A 3BORA 1PSDA 1AN9A 2V7GA 5LFAA 2HPAA 2I2FA 1BQ3A 2UYOA 3GFFA 1FP2A 2IIBA 3F90A 3IUBA 3ZV6A 1HX7A 3TFOA 1ESDA 4EB8A 3EZYA 4JLKA 2IEGA 5JAHA 4QXMA 3VFDA 1L5KA 1C14A 5EHNA 3F6PA 4AN0A 1B15A 5AVYA 2X2PA 1SPXA 3I32A 4QLAA 5CR9A 4ZZ2A 1T6ZA 5JC1A 4R1NA 4O2AA 4ND8B 1E7QA 1E3WB 3OCZA 2B2XA 1RT9A 4LTNA 1K6XA 3FSJX 4M8KA 1YB5A 3PQ6A 2RGAA 1G3QA 3U39A 4DQUA 4DDUA 4RF4A 5LXTF 2H5IA 2M1ZA 1QHEA 3B60A 4KHPB 5CDHA 2BE9A 1TU4A 3NC1C 3IT3A 1CBUA 3RS9A 4BFTA 5BY2A 5I3CA 5FI3A 2AJTA 1EFHA 2QTFA 1JDSA 2CUNA 2AH5A 1NVMB 2P90A 3GMIA 3P1JA 5F5XA 3TZEA 3LL4A 1MXHA 4BATA 1KDPA 2BFOA 3PQEA 3MMZA 4WBNA 2PZGA 1R18A 3GXBA 1M5TA 4ENWA 2GUWA 2E7ZA 4UNQA 1OAAA 4JKIA 2FMFA 4GP7A 1D1SA 5BUZA 4CKWA 3SKXA 3M9WA 4OI1A 3LP6A 2XCUA 4KWEA 3UOGA 1Y6QA 4TLLB 1PR3A 1U7HA 3WLHA 1XZPA 1K88A 2G40A 4UHCA 3W5DA 4QM6A 1WABA 4K6OA 4PPQA 3HYLA 5BN3B 4AAYA 2ZR9A 1Z63A 1HT1E 3E5MA 4M0LA 5GOTA 5A4JA 1VI2A 3HV2A 4L02A 3LPCA 4JUDX 3THYB 1F2UB 3LY9A 3TCXB 4QLOA 1IXZA 2IEYA 3IUYA 3SYKA 4DOMA 5ERYA 2XYQA 1V41E 2VPQA 1FMJA 1GT91 2GBIA 3WLJA 1GPBA 3ZXYA 4EHHA 2ZYDA 1UC4B 4DCPA 3NYRA 5KVQA 1ENYA 4EHKA 1XPUA 4ZOEA 2Q8QA 4BNNA 1G41A 3VYSB 5LOVA 3U3OA 4ZK2A 3BCUA 2IYAA 1HKHA 3NKLA 3DR5A 1KDVA 1UPUA 2JASA 3BOSA 5CPBA 3AUSA 4Z3OA 1SO8A 2FE1A 1TKAA 2JLBA 1PV2A 4LYAA 4LVOA 5E6SA 3PCXA 1RADA 2CXNA 2VJKA 3RVNA 5IJWA 3E9ZA 1J90A 2NSLA 3WOVA 3G7NA 2R8EA 1ZJ6A 1ST2A 1FA9A 4JQCA 4N3CA 4LBWA 3R0QA 4UBLA 3VMFA 3W9BA 4BQFA 3PUWA 2W2LD 5CD1A 2H1IA 3RTEA 1YS1X 4PXSA 3DA8A 3NEJA 2Z1NA 2RFLA 3QPCA 4A91A 1NKVA 4LIPD 4IRMA 2C83A 3RFUA 1DJPA 3DFKA 3WLTA 1GEEA 5F98A 3ICCA 5L3QB 2XLCA 2FFRA 2ZIWB 3SXPA 5BOSA 4UE2A 3UMRA 4BMXA 5HZHA 3E2IA 3UPTA 4Y0AA 3P2JA 3RT7A 1IOVA 4MQEB 3UHFA 5K09A 3PDCA 2NXWA 4KWIA 2PN1A 3OSUA 4MRSA 3HO8A 2PRJA 3EWIA 3DZCA 1FNBA 2E4AA 1DAIA 1V16B 1K4KA 4HDNB 4TKMA 4W63A 3RVJA 5H83A 3T12A 4C6TA 5KU7A 3T99A 4RXTA 1W1WA 1PIWA 3NNDA 1TQ2A 1UXGA 4EG4A 3FKQA 4FGSA 3K0SA 5DM2A 2X8LA 3PNOA 3FDZB 2MYTA 5BWLA 2ZYIA 3IP9A 4L2IA 1SXJE 3B36A 2DERA 1P7CA 2GD2A 2BRUC 1GNQA 2HF7A 2I4MA 1LQUA 1NQAO 3GLUA 1DGQA 1IAQA 4K8OA 2EJUA 2HF2A 3JZFA 4YI5A 4CQMD 4F3KA 3RE1A 3R4CA 4QHYA 3ZUGA 5F4BA 2P9BA 1QB7A 4HQ0A 4ZVMA 3A1FA 3R6WA 3TTYA 5JZVA 3FPAA 4EMTA 1FNCA 2FHPA 2QJRA 2PXXA 2RG7A 1DWPA 1SEVA 2QMHA 4G0PA 3HDTA 4L5YA 3G8BA 4MRAA 3LKVA 2P2GA 4XPZA 2G04A 4NG4A 1PVVA 2PSDA 1VC2A 3N6VA 2GNOA 3F6YA 1I4EB 4IL5A 3LNCA 1ISMA 1BAPA 1T36B 2EDAA 3BMNB 3PCRB 4U3JA 4CIBA 1COWD 2REQB 1TUIA 3LZCA 2HU2A 2XRYA 4MQ4A 1W36C 2J8ZA 2E0IA 1Z4JA 2H85A 2Y1EA 3PNSA 1KJ8A 2ZULA 4DDWA 4BX2A 1NHWA 4DMGA 5IDWA 2LE0A 3OCCA 2BP7B 2IHVA 4BJHB 4Y30A 5AXDA 2JLXA 4YXWA 4AJ1A 5JADA 1NJFA 1RHMA 1W46A 3GR6A 1CZKA 2I4TA 3DBHB 3IHWA 4JLNA 4F2DA 1UH5A 1GZHB 2OQIA 3U0BA 3T4PA 5IZ4A 3GP8A 1XKTA 2YWGA 1T0IA 1Q91A 2BFMA 4K9DA 2ZIFA 3NXKA 3WWZA 1GP2A 1E7RA 3B2EA 4LE2A 5TGDA 4PLVA 3ZW9A 4E5NA 1TADA 3CZPA 4QDZA 1RNLA 1A5TA 3DZ8A 1X8KA 1JFLA 2B4YA 4XYBA 1NA5A 2I91A 2GILA 4NZOA 3ZQUA 4JGGA 1LLQA 5ECDA 2VDLB 3U17A 1PFQA 4G1FA 1NMSA 3I5MA 1RYFA 4OHMA 4BNUA 1M8FA 1U6IA 2NXEA 3COPA 3NT2A 2FX5A 3NQ41 3RUPA 4EJMA 1O95C 2OHIA 5FWAA 4H0FA 5CDTA 6NULA 1JLKA 3LS2A 4L0MA 4DR3B 4NICA 2GEKA 2Q1XA 4MOWA 2J3JA 1FFWA 4GIBA 4PGHA 2GEVA 4Y2GA 4AZ0A 2WP0A 4ALJA 1PJBA 2CJPA 2YXBA 4O0MA 4LF8B 1JA1A 1XELA 2AE1A 2R6DA 1XL1A 4QPPA 5DW3A 4YRJA 2C4WA 1YMVA 2HQBA 3WJAA 4A2CA 3EX7C 2EIXA 3TDNA 1PK8A 3AT1A 5FWXA 1ZZGA 4ZAXA 4CV0A 1UQUA 2R86A 4B81A 2HXSA 4PE5B 5C1BA 3PR2B 4M1ZA 4I1VA 4YJGB 2XB2A 4DCTA 1ULHA 4Z4CA 4P1ZA 3R0XA 2V7WA 4LJRA 3G2LA 3GJ0A 1E2DA 1UBHS 4XIFA 3WIDA 1XAGA 2QTWB 2OYRA 2H1FA 3C16C 4B6GA 3NHLA 2Y1WA 5CDFA 4MVJP 2FUG1 4DYHA 2FG6C 3RB8A 2ZYHA 3LLMA 3IBSA 4BJ1A 2GT1A 5K0TA 3IRVA 5I51A 2WVAA 4UTXA 4H08A 1ZX1A 3MGBA 4LZLA 1U2RA 4BVKA 3K2BA 2A4MA 5DX8A 4PLCA 3SN6A 5I6DA 5LP6B 5LC1A 1Y8RB 4R2LA 1P91A 1RAFA 4Y0VA 5ELMA 3D6AA 1AGPA 3CISA 3JVDA 2CFOA 2YOHA 2YIVX 3CKMA 1SIUA 5LA6B 3CU5A 3WRYC 2XX3A 3D3KA 1RQRA 8LDHA 2QR3A 1WQ3A 4BO1A 4FR5A 2W6CX 2AMYA 2X3UA 4DLNA 1EB8A 4CKZA 3ND9A 4NJEA 2ZR8A 3JQBA 3Q87B 1GJRA 2GK4A 2O7VA 4C6SA 4HGPA 4EO7A 2R1TB 2VNJA 4KDRA 3L0OA 4M9XA 5IN5A 1FW6A 3IKVA 1FQKA 1FFCA 1EM8A 1L5WA 3OPMA 4NOJA 3V2IA 2X1LA 4MUNA 1I0LA 1WNTA 4MZXA 4RKRA 1Z0UA 5AESA 1W47A 2OPBA 3BT7A 3H11B 3QEBZ 1CE8A 1UBOS 1GILA 1Q0PA 4HN2A 3ROKA 5DXFA 2JGAA 5HNKA 1GL6A 1SHZA 1THZA 3IDAA 5JBNA 4GX0A 3W5AA 2E21A 2BWJA 4GE3A 4WZBE 3IALA 4HZUA 5LLDA 1E96A 1TJYA 4UAGA 3BULA 4UW9A 4FWTA 3HJAA 4WESB 2O2SA 1R0RE 2K7FA 1IIBA 2Z6UA 4NCJA 3ZV7A 2WIBA 1U8AA 5AW7A 1CVLA 3MOSA 4FR0A 3QOFA 1XSEA 4QWWA 4NTZA 4B6JA 2QIPA 1MPTA 4P5EA 5AH0A 3I2GA 3PDJA 5L4LA 2I7VA 3U4QA 3K8ZA 4YCJA 4Y2UA 1H65A 3UC5A 2GXAA 5K3FB 4BS9A 4FSHA 1XTRA 2QU8A 3V4LA 1YR1A 4RD3A 5JU6A 3KHTA 4M86A 1ORRA 3H04A 4B9AA 1KR5A 2Z4TA 3AKYA 3K2EA 4OFBA 2RJNA 1M2WA 1VRCA 2JAWA 4OXYA 5SZKB 1GZUA 1JXMA 1DC8A 1LUAA 2YZKA 5HMMA 3E22A 1EFKA 1I51A 4KQKA 4QAJA 3VR6A 1Q7RA 2WIJA 4PC6A 1PJZA 3K5HA 4NMMA 2Q5OA 1XOIA 2H7XA 4YCNA 3WDSA 2YMLA 4UBIA 2FN3A 1ORWA 3M4JA 4AJNA 3J7TA 4BQPA 1HR0B 4ZO6A 1VJRA 4MJXA 4Q16A 1LBSA 1MU0A 1KR2A 1BDJA 2YV4A 3ANNA 3VPAA 3ITNA 3FPCA 5ICEA 1I3CA 1NF8A 4LJSA 4FGWA 5DW0A 3QFFA 2OENG 1LWOA 1EZ4A 3WWOA 1ACLA 3BK1A 4KQ6A 4WCDA 1GKIA 1JSCA 1V3QE 1ZU5A 1EFPA 3NUGA 1YFKA 4R0MA 3GUHA 1HPLA 2I65A 4LJ4A 3WLMA 1QJ4A 5GONF 1FDWA 4EENA 3QX7A 4HGOA 1LLFA 2IODA 2JFGA 1GKKA 3KVRA 5JY1A 2R7MA 2V3WA 1P44A 5LLTA 1CJSA 3DAFA 1T5TA 2IY9A 3AOEC 3BFPA 3NHJA 4UHJA 1KOLA 1JLRA 2IOHA 3IVCA 1D0VA 5I7HA 3ZBPA 5JW6A 3O4VA 4ZV4A 4XD7A 2J6IA 4O8CA 1SBYA 2QZSA 3DMRA 2WTUA 1MOSA 2VZ8A 3MTGA 5LYJB 1SWWA 1EVJA 1XNJA 2P0YA 1CUIA 3PIRA 1KMHB 1M0WA 4BFUA 4LHYA 3L02A 4RQBA 1CQIA 5H16A 1N78A 1BIFA 3QU7A 2IYPA 1KIFA 3FHCB 1J00A 5F3WB 5AKIA 1KYXA 1D09A 1PQ4A 3DM5A 3N76A 4W9NA 1C8VB 1T6YA 4ZVUA 4AZTA 1G8AA 1EK2A 2ZRPA 2GYVA 3MT0A 2GR9A 4WKPA 4I1UA 4M3NA 4QDUA 4E2ZA 2FEPA 3AZPA 3LDGA 4B43A 2ZTMA 2JI7A 1J97A 3IJPA 2GCOB 4AZSA 4K6MA 1Z4IA 3JWJA 4JLAA 1FP4A 4WVLA 4QUGA 1CLEA 2FY8A 5J2UB 1DE0A 3TX6A 3MLAA 2HMAA 4F9EA 4FCCA 1YRYE 2IC5A 2PLFA 3C74A 2HA3A 3GRKA 3QEOA 3L5OA 3U7EB 4QBFA 1IL0A 3GFQA 1TPZA 4ALMA 4YR9A 4QNRA 4EQZA 3KD3A 1L1EA 2CLKB 2EBUA 1GSIA 4GBED 3SSMA 3TB6A 3UANA 1AB6A 1JKJB 3HXMA 3Q2OA 2LXNA 2KJQA 4GXRA 3LXXA 1E6UA 4A6DA 2YV5A 5HZGA 2WTNA 3I37X 3C2QA 3UT6A 4J91A 2ZWIA 1L9KA 2UZ1A 4UE6A 5FOSA 4QUDA 3M6FA 4O3MA 1YSCA 2IYEA 2P4UA 3HKDB 3BE4A 4OF4A 3L1HA 2WQ6A 4GQIA 3DMFA 4EFMA 4DCCA 1NN3A 3UUGA 5JNWA 1G9XA 2QN7A 3IV7A 4TMVA 5JNLA 2PMCA 4MV3A 4B3FX 4XQCA 3W3AA 2RBEA 1N2SA 1IOZA 4ZKDA 3I2YX 121PA 1L8QA 3PD0A 4UZSA 3EODA 4UXHA 3UZUA 1GKLA 3SGLA 2GN8A 1NNI1 3HE3A 4NBTA 1ZJWA 4EVQA 1GR0A 3CGGA 2Q7DA 3ROPA 1AHHA 1P17A 1QPBA 4LWPA 4PEVA 3ZWOA 5KPDA 2C59A 3A2MA 2HPVA 3I4FA 5DGDA 1ODIA 4LXHA 1QAOA 1HYEA 5CYOA 2HX1A 5KWIA 1RKQA 2PUBA 3GF4A 4PX9A 1MVNA 4PSCA 4RV5A 2OQ2A 3PJGA 3W8DA 5K4GA 5FTNA 1NVTA 1VKZA 3QP9A 3IIEA 4ZI7F 3FYTA 1G17A 4EVSA 2EJCA 4IOMA 3S4YA 4LJ9A 4YP0A 4POOA 1XTKA 3K96A 2ZATA 3L7IA 1ONOA 3R3VA 4L1KA 3REFA 1EESA 4WMLA 1CUFA 2VAPA 2X6QA 4M8NE 5BSEA 3ZTWA 3O1HB 4NPHA 4LYHA 3GH3A 4IMPA 5KNBA 2DSTA 2HADA 3HYNA 3IILA 1X19A 1OF1A 1YZFA 2A1UB 2ZRCA 1E4EB 2FEMA 3DXXA 3W2HA 4MO9A 1RW4A 2JB9A 1NGSA 3BB1A 4NAUA 5EUQB 5T4BA 2ZRKA 3V2HA 4PAOA 3OLCX 2PLRA 4RWZA 3VX3A 1UK6A 1NT4A 5JZMA 2A1UA 3LLCA 4QC2A 3EULA 3T0IA 4A4DA 5I7SA 1EPUA 1SPBS 5IXSA 2HCFA 4Q1DA 4TLAA 1YFLA 3FLEA 4KITB 1PHPA 2GXUA 1ND6A 1E9AA 3E7XA 1V9LA 2BBOA 4O0LA 1SOMA 3MMPA 4UU8A 2ZTVA 1P8JA 4XE5A 2F3SA 4F9GA 1LFDB 3EVBA 2AKEA 2IXAA 2I1WA 2O2CA 4U2DA 4ZDJA 5CDGA 1W5EA 4Y0NA 4Y98A 4EEXA 1QFYA 4C3UA 3COYA 1FXUA 2WPDA 1E3MA 5BURA 2P62A 2CNKA 4DR7B 2I3BA 2WYHA 1CZOA 4MB2A 1YULA 1C1DB 1L1RA 2AR9A 4KYVA 3GAMA 3L05A 4QGGA 2ZRAA 4RDXA 4BNZA 5FOQA 1QHXA 3E35A 4X20B 4HXGA 4ZYXA 1SK9A 4LI0A 4TTTS 2AKAB 3P5SA 3MM4A 3PD7A 4EW2A 2R9VA 4EFKA 2JFVA 4HNAB 1JECA 1UP6A 1WY7A 2QNBA 1Z18A 4YIKA 1O96B 3ZCSA 2V45A 1N0HA 2ACVA 4ACBA 3WWPA 1EBBA 4GZ6A 4UUQA 1KY3A 4H31A 4YS6A 2L17A 4DDMA 3IP8A 4NV1A 2Y1GA 2P1ZA 2GI4A 3PR1A 2XZTA 3MCAA 3OMWA 2H4FA 4I0WB 4OEHA 4R05A 5BQOA 3JASB 4R01A 1K6MA 2JRLA 3MXOA 1DJQA 1P1RA 1UWVA 2MSLA 1LBHA 1JQLB 2PRSA 2WU0A 3ASZA 1OWMA 2D06A 3IAM1 3LVFO 5JS1A 2DLCX 1QF7A 4G41A 3VJKA 2XNJA 1MT0A 1TC2A 3OCWA 1LI4A 1JKJA 2J33A 1KAMA 5BSKA 3KOWA 2VJPA 3LY7A 3RSCA 3KTOA 4C88A 3OI7A 1QQ5A 5GQSA 1I2DA 1RVDA 2IGTA 2QT1A 1THGA 3FPKA 4ENUA 3G2PA 4LSZA 4FILA 5JYBA 1Q74A 4YMTA 1RBZA 2ADMA 3CNEA 2HEIA 2R7AA 4GPTA 4KV9A 1D7AA 2IPLA 4AG3A 4Y6GB 4LXGA 3HI4A 3JVVA 2CHEA 3QLUC 4Q1VA 5IMBA 3LDUA 2NU8A 4F4DA 4TYYA 2WIGA 5KOYA 1CE8B 3LIPA 1RABA 2CLIB 2HJRA 3KTFA 4ZV7A 1P80A 1A9RA 2QY6A 4HDKB 1EDZA 1WSBA 4FQ5A 5EVJA 1UJ2A 3UMGA 3DEAA 3ZIAD 2SKDA 4TYWA 3C5CA 1A96A 3IUSA 1F60A 4C5CA 5YASA 1YUNA 3SE0A 2OV6A 1DAGA 3CN9A 1JIXA 1XTJA 3WQBA 5ILGA 3U4HA 2ECOA 1FFGA 2IXTA 4BGIA 2C2OA 3HB1A 3HM9A 2OYCA 2R68A 4EUEA 3WWCA 3SHVA 2CCGA 4F71A 5KVSA 1ZGCA 3E9EA 3KQPA 4D80A 3ZGNA 3EPJA 1KI2A 2ZRIA 4O4IA 4NFYA 2GPSA 2Y0BA 3DZJA 3CJRA 1VPWA 2DPGA 4L5CA 3FYCA 3AJEA 2H2AA 2R6GA 4L8GA 4Y9TA 5CFMA 5LQAA 1ISIA 1PSZA 2BHSA 3NBFA 1QUEA 2HJ9A 4QHSA 5ILQA 1PR2A 2EKPA 3EVTA 3WL7A 2H2HA 5KNCH 1G63A 2V7BA 4CEHA 3OTWA 2XDYA 1RP1A 2VAXA 3N75A 4IW3B 1XNQB 3IEPA 1Z26A 3LZDA 3C98A 4ZVNA 3H65A 4C6HA 1MEJA 1I9GA 5EMKA 2JBAA 1O96A 4M21A 1K3TA 3DOEA 5CGQB 1N1GA 2FPKA 1XDWA 4UQOA 1AUQA 3ZK7A 4BAUA 4WKBA 3PI7A 2O2IA 4R2WA 1M8KA 3RIYA 1IG0A 4UBOA 2ZRBA 2R4UA 3UWDA 5U4QA 3T7AA 4FOPA 3TZQA 2WUFA 3VKVA 3AYXB 2XUPA 1B76A 4L6IA 3SJUA 5A9SA 3GGPA 2OMEA 2OFOA 3AEKA 4IO0A 4BU1A 1ZL2A 1C7QA 2I7TA 4LOAA 1EVKA 3B6MA 5T3YA 3KVVA 3V97A 3IIMA 1KRXA 1XKQA 3PKIA 4H17A 4KMSA 4ZQIA 1TKBA 1CIJA 1GCUA 3IXQA 2X86A 1NN5A 2PSSA 3AF3A 3P9KA 4D9EA 5AP9A 1G2IA 1W4CA 3ZZ0A 4EW1A 3FSGA 1EA7A 1EDBA 1Z0FA 4Q47A 5DT9A 3V55A 4EG8A 1RTKA 3L0YA 2IH5A 1FZQA 1KEPA 1NAIA 1MTZA 1SCIA 2ZE7A 1G8KA 1ITZA 2HJVA 4L9WA 2OHGA 5DYWA 4YXFA 1GCOA 4G36A 4M9SA 5FH9A 2Q46A 1K9VF 1MB3A 2C61A 3MFYA 3ONVA 3QITA 1Q1EA 2DP4E 4EGAA 2YWBA 2PNJA 3C7KA 3PENA 4IDBA 2WJWA 1OXUA 2XCIA 1C0LA 1OD6A 5F1YA 3V46A 3KVNA 3DCJA 3GBVA 2DBYA 3VZCA 4IH9A 4BNKA 1A3CA 4XFKA 4DC1A 1SXQA 3VKWA 4LVUA 1TK2A 4A1OA 1P18A 4UHFA 3JQCA 1KC1A 1Z5OA 3H11A 2EF0A 3MJVA 3NORA 1Q7CA 3DO8A 4N76A 1UODA 2VDPB 4DMCA 2UUPA 3LCVB 1C4OA 3B51X 2VCHA 1N0WA 3HKCB 1P6QA 3JQGB 4KR7A 1CYDA 3MQFA 1AZWA 5KX5B 4ZYYA 3THXA 3A9TA 4O8ZA 2DR2A 2D2FA 1HL3A 2AFVA 2I6QA 3DVAA 3GQVA 3KCQA 3O8OA 4YV7A 2D4AA 4M1MA 1AE1A 1T3GA 1XBTA 2OZEA 1E20A 3IVMA 4HPXB 4K9RA 1QP4A 2CDNA 4S1OA 5JJLA 4B6PA 4TMZA 1WZUA 3FCSB 3MYYA 3VSAA 2OK7A 3AERB 4UNIA 1SKYE 4Q4LA 3ZGLA 1GAJA 4EGSA 2VOEA 4GHWA 3TSYA 4OLAA 2ZBFA 3OESA 5F1KA 821PA 2FCRA 2WIAA 3FJOA 1C2TA 2G0TA 2CXUA 3TQOA 1UOOA 5IYZF 4L6AA 1LPPA 1ST3A 421PA 3NBMA 4NH0A 5TSDA 5K45A 4WINA 2XCSB 1WCWA 2C82A 4FZ3A 3ZX4A 1B7GO 4EHAA 1O5TA 4E09A 3L79A 1P0CA 5CITA 4BOYA 3HYSA 1XRRA 1RTTA 2VUHB 2Y67A 3P9YA 1NVDA 2QTLA 1G4AE 3CUSA 3WLIA 2IV2X 4EF6A 3BMOB 4JJ8A 2GN1A 3NFRA 4K3VA 4M76B 1JGTA 1D6NA 1SELA 3O82A 2BT4A 1DRWA 4FJ1A 1FJHA 1JEQA 1L3IA 1OYVA 1AKNA 3N86A 4KRGA 4ME6A 4W9RA 2DB3A 4MI6A 2W0MA 2X0FA 2R8BA 2VATA 1P2DA 2WJAA 4Z4IA 4NE7A 2PZJA 3FXAA 1MAWA 1F0YA 1MA3A 3M83A 2XE7A 4F5ZA 1PNOA 3L9WA 5LCXA 2YQ4A 3U44B 2A78A 4N3AA 3VHQA 1T2EA 2PZAA 2ZT6A 1NFRA 2JGIA 3EZ6A 5GM1A 3K1AA 2NYUA 3A4YA 3W6PA 4EZBA 3FY4A 5FBWB 4QRHA 3HZHA 3PA8A 1BYIA 4OPMA 3SJBA 1LJ8A 2P2NA 4N5LA 2D00A 2QMYA 1H1LB 2QEQA 3E23A 3IHKA 3K72B 1NXSA 1Z45A 3L0BA 4ZI2A 3NI2A 4INJA 2WDPA 4AJOA 1RFGE 3ZGOA 5K4AA 1YVUA 4QRDA 2GCIA 3EGVA 5CPFA 4B0PA 5IK2A 4GECA 5EESA 1JR3D 4YI3A 2QVGA 4RH1A 3L46A 3FGPA 2LW7A 4MNTA 2F7SA 2GJ4A 3HKEA 3PZRA 5E6SB 3FPLA 3D4PA 3NTOA 3GBPA 5L45A 4UREA 1C29B 2AI2A 1VHJA 3GZJA 5G3ZA 5LOVB 3L6BA 2D8AA 3GIDA 1ECFA 3C8UA 4I55F 2OZVA 2VAMA 3AKCA 4AVYA 4C0WA 3SF0A 2V9ZA 1JG2A 2UVDA 4WXHA 1DKLA 3L7YA 5HKOA 1JL3A 2HMUA 2ZRDA 5H4HA 4AZWA 3AVQA 2ZZNA 1NSFA 2ZSJA 5JSHA 5IP5A 1VLMA 4C7JA 1GQRA 1GGMA 1XN1A 4PZ0A 1RRMA 5D3QA 3W1WA 2WR8A 2Y2UA 2OKGA 1AHPA 3UKJA 2OAEA 3OQPA 3W5SA 4K0RA 4PFQA 2D1RA 3SXUA 2ACWA 5C8XA 3W2TA 2Y0PA 1RJ9B 1RC8A 1SUWA 5HQJA 1I3OA 5P8WA 1IZ0A 4WJLA 1TGVA 3TBKA 2IXDA 1SXJB 2R6HA 4HX5A 1R6TA 4L78A 5CYGA 5GWXA 3RIHA 3V4OA 4WX2B 1FTNA 3STHA 2A14A 1G20E 4E08A 1XXHB 4JJGA 1D1QA 3ZZNA 2ATXA 4KQMA 2WFLA 3ZCUA 4QFMA 1KVSA 3U13A 1WCV1 1SUAA 3HJBA 5AOCA 3L6CA 4XEHA 1SK8A 4L2IB 2XKAA 1YRLA 4TTPA 4FHCA 4EA7A 2HEGA 5FORA 4K05A 2A9FA 1B3RA 1MFPA 1ZKDA 1G20A 4RK7A 3IRUA 3EHDA 1ZDMA 4QDXA 5FF9A 4DMFA 2FWMX 2P30A 4F45A 3IJ5A 2EXXA 3CUKA 2RKOA 3IMKA 5KREA 1YVPA 3FUUA 4QE3A 4IIBA 1VG9B 4X3PA 3QEKA 4HB0A 4PR0A 2A94A 5IVPA 2G1PA 3A1CA 1I7LA 1O57A 2PCLA 3CVXA 3V1TC 1D03A 3W7AA 3DFZA 1JEYA 1LFAA 2QN1A 5E95A 1OHHD 4FCVA 3FPGA 2F1JA 1M1NB 1LVHA 1Z37A 4O4IF 4PF1A 4X91A 4ZVOA 3SZRA 1OLXA 1ZMTA 2HPHA 2VSYA 4XGNA 4R6XA 1U1FA 1P1FA 4ZHQB 3Q6NA 5A02A 1EFRD 1PJRA 1U0TA 2ZUSA 2DLDA 4NESA 4QDOA 4Q66C 3AHHA 3DGEC 1JHQA 2OOSA 1P9OA 4CLHA 3BMQA 3L7LA 4KAXA 3VNRA 4DR4B 3QLEA 1P1IA 2W0SA 1OT5A 1MH9A 4H7EA 1JI0A 1GQOA 5AW8A 1ZM2A 2AUNA 3NGLA 2JIQA 2W6IA 4ZVRA 4YJFA 1QH0A 5HBGA 3N28A 3IDFA 4MS3B 1QYIA 2JFOA 1K0UA 1DG3A 3WB1A 1KEEA 5C37A 1OA1A 1VA5A 4JOBA 5IZCA 3FWHA 1MP0A 1CERA 1NVVQ 2VTDA 3ET4A 3NHPA 2CL6X 3BMQB 4KFCA 4QG7A 2BFEB 2IU3A 4TZKA 4BLTA 4CMEC 1W5AA 1G0NA 1X7YA <