3RNOA

Crystal structure of mouse apolipoprotein a-i binding protein in complex with nadp.
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
233
structure length
233
Chain Sequence
AVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSKSPPTVLVICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTGLVTQCQKMDIPFLGEMPPEPMMVDELYELVVDAIFGFSFKGDVREPFHSILSVLSGLTVPIASIDIPSGWDVEKGNPSGIQPDLLISLTAPKKSATHFTGRYHYLGGRFVPPALEKKYQLNLPSYPDTECVYRLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords Apolipoprotein A-I-binding protein
total genus 75
structure length 233
sequence length 233
ec nomenclature ec 5.1.99.6: NAD(P)H-hydrate epimerase.
pdb deposition date 2011-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3rnoA00
3RT7A 3RSSA 3RSGA 3D3JA 2AX3A 2DG2A 3RO7A 3RTBA 3RRFA 3RTDA 3D3KA 2O8NA 3RS9A 3RTCA 3RRBA 1JZTA 3RS8A 3RSFA 3RU2A 3RTEA 3ROGA 3RTAA 3RRJA 3RU3A 3RT9A 3RSQA 3ROXA 3RTGA 3ROEA 3K5WA 3RREA 3RNOA 3ROZA
chains in the Genus database with same CATH superfamily
2IEBA 2BT4A 1U8AA 4RVNA 2QTTA 1ZC4A 3DTVD 4XXHA 1DVRA 5DNDA 2WZDA 3G9UA 3OWOA 4E2YA 3T3OA 1IXRC 3HYLA 2C7BA 4FZVA 5L7TA 1DQRA 1VI6A 2XGSA 4RENA 2BKAA 5CVDA 4HPXB 3FVRA 4GXTA 5JRJA 3TG2A 1KYQA 4LXXA 4MINA 3H4TA 5EGSA 4UU7A 1VRVA 4PEVA 3BZUA 4OHWA 5DLQC 1BAPA 1G5TA 1EFTA 5TJHA 5KNLA 3OJFA 3D2LA 2BGNA 2FMFA 3NO4A 3HR8A 4RVHA 1F9AA 3BXGA 1R66A 3ONEA 4ZZ0A 4R9SA 4LJKA 5CAEB 2RGNC 3FCYA 1HEUA 4JJKA 3RRNA 3PA6A 4ZXFA 3ZU4A 2EBHX 4GR4A 4PS0A 4JYZA 4CEIA 1EFAA 2R1VA 3NJ8A 5JCJA 1VMAA 3AI7A 4ND2A 5EKSA 3DOHA 4FEGA 1NC1A 1L7EA 1FFHA 3TL2A 4G1FA 4N65A 1M6VA 3ENZA 2IZ7A 4IDPA 3SMVA 5ITZB 4LISA 1W76A 1DV1A 3W1VA 2EOAA 3B1ZA 1JIKA 4B85A 5LIPA 1ZD1A 4HNAA 1QRAA 2WJ4A 1HDGO 2J45A 3OHMA 3NKVA 5EZ5A 1O77A 1IDN1 1W59A 3GPLA 4JUAA 5D3MB 1P7YA 1ZWLA 2JJ2D 5THQA 2F3SA 2CKMA 1TTQB 3NTQA 3D6NB 1CZUA 5A4AA 3HVKA 2NXJA 1EVIA 1O9HA 5IKOA 5ES4B 4RZQA 1EFVB 3O94A 1YRQA 4EDHA 1WDLA 2VZ9A 2RH4A 4KE7A 3ENVA 4ZO4A 2QP3A 1XMIA 2X4GA 2YINC 3NPMA 5HWSA 4TLMB 4Z6KA 2YYAA 1EJ6A 4EG0A 1V5IA 5CFNA 1K68A 5DT9A 4AUMA 3AXSA 4G5XA 2G7ZA 3CLKA 4L7VA 3C6QA 4F7WA 4D8YA 4NI5A 1TU0A 4FE3A 1ZRMA 4FHEA 2G08A 3NW9A 1S3SA 3HVJA 2REXB 3QKSB 2NU7B 4JGBA 4EYEA 1KO8A 1SCQA 1GLVA 1NXQA 1TMOA 3F9RA 1NNUA 3R3YA 4J7XA 4WQMA 4F1WA 5B6JA 1RWBA 1Y8AA 1RS0A 5AW9A 1XV5A 2P9JA 3CT4A 2ZZKA 3ESAA 2H59A 1JQ5A 1D6JA 1E2QA 2JJ1A 2ZR7A 1VZ2A 3MGKA 3QVOA 3PHCA 2X1VA 4GYKA 3NEAA 3OIVA 2H5IA 4MIEA 3NIFB 2OVBA 5G2OA 4G01B 2BTEA 1Y1TA 2O2SA 2WC1A 1K6IA 4XSGA 4Y18A 3K1YA 2NW6A 5ILQA 4UDNA 5KVQA 1NN0A 3LI2A 1G9TA 3AFMA 4F4HA 4LGCA 2P9CA 1QGDA 1HTTA 4MS1B 3JAWB 1N7HA 3ZCVA 2IOHA 3A1DA 4HJRA 1K3TA 1RBMA 3IA7A 4Y9TA 5IYZF 1VLMA 3LLUA 4I5FA 4W9RA 3T3HA 1F8YA 4ED9A 1F3LA 1NR5A 3IAM6 2AMLA 1JIQA 2X4DA 1KDZA 4BYGA 2DLDA 2DOKA 3Q40A 1VCOA 4HWKA 2BC9A 3X1XA 3L7LA 3VO9A 1R4MA 1Y3DE 4UQPA 3F9IA 4E31A 4Z49A 2V65A 2Y99A 3H87A 1SIOA 3HYCA 3OZCA 3A9TA 4FYHA 4H77A 4PZ0A 2YC2C 4JJGA 3WIVA 1BDMA 1VI5A 3ZTTA 5K4HA 4TYWA 4HY3A 3K72B 5AI5A 3GUHA 7AT1A 4YQZA 3WWEA 4E1BA 3FRHA 3C8MA 3PFCA 1C3LA 1FY2A 1NP6A 1X70A 1ULBA 1EXMA 2I7VA 1NTRA 2PKRA 3NTRA 5IAJA 3GJ3A 4O2LA 3WS7A 1L5VA 1VI2A 4F6RA 3GMDA 1QQ7A 1RTKA 1GA1A 3HHPA 2PS0A 5HR5A 1NMEA 1IG3A 3HBAA 2BKXA 1ND6A 1SBZA 2PMDA 4BRZA 3KJGA 1P19A 1EXVA 5FR2A 4C43A 4CXMA 1OT3A 3EC7A 3JQ8B 2P2LA 3BFJA 1UPFA 5CCXA 1YWGO 4YRRA 4YASA 3Q9UA 2BAGA 4ZOCA 4J16C 2ECFA 5H16A 5DJ5A 3DMFA 1IQPA 2QJFA 1YB7A 1Y4SA 4N1AA 2CJPA 2HQBA 2YVAA 4UE3S 4RIEA 4RIFA 4YJGA 3MGGA 3AEUB 3H1EA 3UBTA 1M2FA 2XUQA 3E4CA 3K9BA 5AQEA 1QP7A 2CDAA 3BWCA 1GRQA 2H52A 3EA0A 3MTAA 4HWGA 2HH9A 1PR1A 3PEUA 4JC8A 3OKPA 3FWKA 3PNQA 3OU6A 4R6WA 4C88A 3STUA 2FPOA 2PZBA 2WMOB 4RHXA 1W581 3BE5A 1V8PA 2ETVA 3WB2A 1MAHA 3ROPA 3FPLA 3WL4A 5JLJA 5L4LA 3GMIA 3H2JA 5L45A 4RULA 1Z25A 4PGMA 1LX7A 4MYTA 3RR2A 1QQ5A 1SURA 3TNYA 2C5LA 4G41A 4PANA 3UC5A 5HSGA 5LWHA 3OE1A 4ZI7A 4HBZA 4Q4LA 3STYA 4X94A 5K0LA 3OICA 3VDMA 1ACMA 4AZ3B 5KKAA 3QMWA 1QS0B 4TMXA 4EJSC 5AJWA 4LXHA 2O4UX 1GL9B 3D3WA 2A7QA 4MIYA 4YT2A 3JAKB 3H2YA 3X43A 5I47A 1A82A 3NCHA 4EYKA 3FVWA 3DT6A 1QCDA 5DIFA 2I71A 3TQQA 5T4EA 4ZCRA 1X80B 3GZJA 4IW3B 1XDDA 3WNVA 4LNAA 1KI3A 3ZJ5A 1DUVG 3TJMA 4B3GA 3OPYB 2X4IA 1C7QA 5F77A 1V7QA 1EX7A 1VL5A 3D0QA 4HEJA 3U4GA 4E09A 3ZY4A 4BMVA 3GVIA 2HGSA 3EE6A 4Y0NA 3AR5A 3DWGA 3IR7A 4RKQA 4CQMA 4J4HA 4O4HB 4YUYA 3MJTA 1QCCA 2CC2A 2FQ1A 3W9BA 2IYNA 4DARA 4QTUB 4LHYA 4DCNA 2W48A 3AZQA 1H22A 1Y98A 1U3FA 2GD6A 2IYYA 4GPZA 4HDRA 5GQSA 1K2WA 3PGXA 2X0DA 4ZAYA 5K3OA 1E3DA 3UG6A 1P1IA 3AI3A 3WAJA 1C9EA 1NFFA 2REQB 5F1OA 3TSCA 1MO5A 2YCBA 3OP1A 1KJYA 4ARCA 1FL9A 3QP9A 5EE9A 3WMWA 5EIHA 2NQ2C 4CU5A 2QUBA 1TKCA 1XO1A 2HWUA 1EVKA 4FHZA 3LH5A 4JYCA 3HO1A 1WULS 3QKTA 1KI1A 1E96A 1SHLA 2AXPA 3P0JA 4MYCA 1T2CA 3IAUA 2ERXA 4CG3A 1FU7A 1U5BA 4F4IA 3K73O 4MS3A 4RNCA 3RFCA 1MNAA 4TLBA 5KO2A 2GZ2A 5T41A 4YALA 4LE0A 4KV7A 3LW8A 4YI3A 5LU9A 3CH5A 5DBEX 3HMKA 3KC2A 1FP7A 5A4DA 4NHOA 1QAOA 3FW1A 2LVBA 2W2LD 3VR2A 5IZCA 5JSHA 3IS3A 2PWYA 1NXOA 2HADA 1UAAA 3HABA 1DIBA 2IDJA 3G59A 4ZXPA 1WSWA 2F64A 4IIJB 2BKUA 9ATCA 1OE0A 1Z6AA 3K0EA 4L9WA 1QKKA 1HXHA 3R3JA 1E69A 4H6VA 2F4VB 3FJOA 3KR1A 1U3CA 2FEAA 1L3IA 3L8YA 1L4MA 4OJNA 5ALXA 5C5EA 2IY8A 2HXSA 3QNWA 4MB6A 3F3KA 1LLUA 2C7QA 3PS9A 1ZZEA 2WM8A 4NV3A 3TPZA 4OATA 3V46A 1V95A 2XF2A 3VYTB 2B8TA 4DR1B 3O3MB 4R7GA 3UMJA 3F5FA 4RE5A 3WGHA 5C8YA 2HPVA 2FYTA 1ONBA 4FMDF 1YQEA 4G4SO 2NUPB 3EF1A 3CZ4A 2DAPA 3I32A 5H82A 4R1SA 3PD7A 1YF3A 5HFJA 2E4ZA 4ND7A 1ZGAA 1GKIA 4QJBA 3RSLA 4DZZA 4Y6PA 1XU7A 5CFPA 4NBWA 1RM5A 3JQBC 3KVOA 3PSHA 1U8TA 1MXHA 1T8WA 3G0IA 4E5NA 3TRFA 2GJSA 1NRXA 2YS7A 3E7DA 2Q7OE 3D1JA 1WXFA 4BWGA 5KYVA 5AKHA 1GTZA 4NYJR 4PNEA 4WUTA 3DLCA 3LOUA 4OOEA 4PSAA 3SXUA 5K01A 1E58A 1EFPB 2BFDA 2BGJA 1VJ5A 2GBFA 3KCQA 3R7NA 4ZMBA 5KVSA 2IU0A 1Z2EA 4CDRA 2R87A 3B20A 1KO4A 1JG3A 1AKRA 1JJBA 1S5PA 1V9LA 4NKRA 2ZUFA 1AD2A 2P2SA 5B53A 3NYWA 3ZGZA 3EFOA 4YAWA 5U1PA 3LDAA 1WCV1 2VNKA 3B6JA 4ZPXA 2HJRA 3BF7A 1HZZA 3BZBA 5BSMA 1SVOA 4KN5A 1U2DC 4D8VA 3RV4A 1XBTA 1NBHA 1Z45A 1YBHA 3IE2A 4IICA 4RMJA 4KXYA 4Z4GA 1HG0A 3WZLA 1GVHA 4DANA 4MRPA 4AZWA 2IOYA 2XGGA 3DO8A 2IEZA 4ZVPA 2SNIE 1MVLA 2OESA 1QGUA 1KJZA 1NFQA 1UCFA 1BW9B 1O57A 2IHBA 4XRGA 1KPHA 3COVA 3OTGA 1OGYA 2Y1GA 4PPQA 3B9QA 4HGOA 3NVDA 4CI0B 1PSWA 3UPTA 1MHTA 3K9LA 2Q2OA 2G9VA 1E2UA 1UDWA 3CZRA 4XZ3A 1X3LA 2GZRA 1TIPA 4FOOA 3PC4A 1SQ6A 5BR8B 4J07A 4DA6A 5C1PA 1MORA 4WINA 3EF0A 3W2FA 4H17A 5FIUA 2AW3A 1PG2A 4YYZA 2GBCA 4DDUA 1LPSA 1XLUA 3M4JA 3DVSX 4ZOLB 2DM6A 4MVJG 4WIAA 2GF0A 2XCRB 5CB0A 3PBKA 2AR7A 2ODEA 1IRIA 2C82A 4A92A 1YQGA 5DULA 1CFJA 1D4FA 2NUAB 1ULTA 2HU8A 2VJDA 3QOXA 4BNYA 4PRKA 5H9WA 6ADHA 2GD1O 3VNBA 3RVJA 3BD6A 3VHQA 2J6CA 4BX8A 2ZLBA 3PE4A 3OCYA 4JI0B 3HJUA 1DDOA 2J9XB 2HDHA 3QXGA 5MDHA 4XDYA 3PQ7A 1H9BA 3GV0A 4BCCA 4YDQA 1V16B 3KO8A 2CNOA 1JAXA 4TTVA 1OXKB 2JAWA 1SK9A 4M8SA 1I7NA 1NSFA 1J00A 3NWPA 4D0LB 1UZUA 4DLKA 4N76A 3KYDA 5GIOE 1GPNA 3L8FA 3BIFA 2V0CA 4IEEA 3HI6A 4II2A 5EEHA 4YONB 4HV4A 3WISA 3EXG2 4Z4CA 2W2TA 3DCIA 3EUAA 3L1VA 1Q7CA 4JB8A 5FWXA 3UA3A 5FUXA 4OBEA 4LQDA 4CFZA 2WKPA 2QLMA 5BSWA 5IT9A 3D7NA 1ODSA 4S0ZA 2NLOA 4JI4B 2P4HX 4YMTA 4LZOA 3I9NA 5JXIA 4FYMA 1CDDA 3S7TA 1SCKA 1XELA 1P81A 3ZVRA 1A5AB 3GMTA 1Y3CE 4KDFA 3DAGA 4G5SA 4DLRA 5JAOA 5DV9A 5KWVA 2NT3A 3PNSA 2KBFA 1N5MA 4JYMA 3WBFA 4NE2A 2I6SA 4MWEA 4QJ4A 4BIMA 2EQAA 1GRVA 1O8BA 2H4JA 1MX1A 1Q1QA 1LPNA 1M2HA 2FDRA 2ZSDA 3HU3A 3NHBA 4MSUA 3T1VA 1QB8A 1YQDA 1JDUA 2V7QD 3UVEA 3AH8A 2I4IA 4KXXA 3EOAI 1KMHB 2VDVE 1WXGA 3PPWA 4V0RA 2JGNA 1O7JA 3CB2A 4MPTA 1Z3CA 2Q4TA 5SV2A 3NGMA 1ZGGA 3OIFA 3VSAA 2XR1A 4EFKA 2PUEA 4GE0A 3KCNA 1TZBA 1WV1A 2GTIA 3OPQA 4WE3A 2EIHA 1Q50A 3TNDA 1Y3HA 5HE8A 3VR4H 3ND8A 3FI9A 1BVYF 2ZXFA 4JQOA 1CEXA 1VMKA 1P4JA 3LZDA 2OD9A 1PEAA 1XMPA 5JS2A 4Z8XA 4HRXA 5JD6A 4KZKA 1JP7A 1TXGA 2GFIA 2HF9A 3ESBA 1Q74A 4JBYA 1ZRSA 2Q5QA 1KVUA 1XEWY 2OFPA 5LZ4A 3H2HA 1VJTA 4ZV7A 1N6HA 4KLAA 4YCMA 1UP6A 4P9NA 4AO6A 3CH4B 1RLIA 3GDGA 1PE0A 5IXSA 1FIUA 4A7PA 4EHAA 3CW8X 3A9RA 4PWZA 4WXMA 4FN5A 2JH8A 2J5XA 2ZTSA 5GY7A 5LP1A 2BLNA 3R8FA 6YASA 2HWWA 3LC7O 4QLAA 1UMCB 3OF5A 4ENVA 1TQDA 2DQKA 2CL0X 3B6ZA 2I1VB 3CJRA 3E5MA 4NWIA 3NHRA 2QJTA 3GJQA 5C81A 4X8LA 2GCNA 1IHOA 3KSMA 1FU4A 3M3DA 5LQDA 1M73E 1X9HA 4B31A 3PUIA 4ALJA 4MX8A 4EHDA 3PDIB 2ACKA 1OLXB 2VXCA 1W29A 4RY8A 5HFAA 1GG2A 3HDHA 4ZJZA 2IYAA 1BHJA 3C2QA 3E9QA 2IF0A 4CUJA 4DA9A 3WA7A 3PRJA 3KAJA 1R18A 2CFOA 3UWDA 4HGNA 1C1HA 3AB8A 1GRNA 2GDZA 3EMKA 2ZZMA 1E5LA 3AW8A 3JQFC 5C1DA 2E4XA 3NBAA 1UANA 3L4BA 5U9CA 1NW4A 3DYVA 3LBIA 3TJRA 2BGGA 2J07A 2NP6A 4I9GA 4MV9A 4LFCB 3NXSA 4V1CB 1I01A 1LW6E 4LZWA 1N6PA 2CK3A 4WLNA 4Z3KA 1MV8A 1W4CA 1M74A 2FPGB 1G8GA 1G5IA 1P72A 4ZO7A 4BO9A 3KVNA 5A5GA 2FJ0A 5IKPA 2VYVD 2YRWA 3BIJA 3UKOA 5LKRA 1IRXA 3MWYW 5E1MA 5IC5A 5CFMA 3I9FA 1JKJB 4TS3A 3OEWA 1K89A 1JMVA 4CIVA 1YDHA 2FR8C 4G2NA 1X7WA 2ZJ0A 1HORA 3N9IA 2JBAB 3QVVA 2KSQA 4N6OA 3TZEA 4AJNA 4C0XA 1BSVA 4JDPA 1A8PA 1ABBA 3CHYA 3K0AB 4JASB 4DWVA 5DIZA 1EE2A 2V9PA 4KNVA 2H9AA 1PEDA 3F6CA 2DULA 3X2EA 3PEEA 2E21A 4L4UA 5I7FA 1H1DA 5ALSA 1R00A 4BKUA 4JKOA 4G1UC 3T7IA 1YOBA 4CMIA 1U3UA 3CO0S 1K7YA 1Z0JA 4K9MA 4P3KA 2VF2A 2BSQA 1L8LA 1OVMA 3QTLA 3TSOA 3DP7A 4XIFA 3OIDA 4UHBA 5T67A 3SBOA 3I37X 2WG2A 1ZCJA 2R48A 2ZS7A 3ABOB 4YVFA 3TSWA 4V3CA 2YWCA 2AFRA 5T57A 2XYVA 1VG1A 2DBYA 4XWOA 1W47A 3DM5A 3ETHA 4GI2A 1O58A 2OOSA 1Y4UA 4PX3A 3QKRB 4JLKA 1KGSA 3QIVA 4EO9A 4AKIA 3RS8A 4YQYA 3PENA 5EN4A 3TW4A 5EJEA 1Q12A 1K7SN 1JLSA 1PW7A 4YAEA 4CM9D 2HSEA 3IVCA 1R8YA 1TLFA 2H3EA 4HDKA 1CS0A 3DHWC 2P6NA 3AUJB 2C0PA 2A33A 2PO7A 1FOEB 4ZDWA 4YHHB 4UE2A 1GTG1 4F11A 1K7FB 2G1UA 4NC9A 5K2MA 3BMQB 4HDNA 3QBTA 4DIMA 3RYCA 4BN4A 2G5TA 1XVLA 3NRCA 2X76A 4PW0A 2F7SA 1G66A 3T1NA 3TQOA 4NMLA 3ZD7A 4US1R 3AIIA 4TM8A 5ESDA 2YS6A 1I3NA 3SXPA 2QM3A 4XWTA 1S2DA 4JX9A 5TB5A 1DPFA 2EZ8A 4EPYA 3B6EA 1X7XA 4IM7A 5F3WB 5FL7A 2AMJA 1WBJB 1R50A 1SXJA 4C0SA 3HADA 1BGXT 2QW8A 3ZQJA 1DFHA 1TW2A 4IJKA 1JEYA 2CFSA 2OUKA 4RTOA 4C20A 3WLQA 1FSPA 3DR3A 1ZH4A 2V6IA 2X8LA 2X13A 4XQGA 1KYXA 3D2BA 4QNRA 4OK3A 1OLOA 2IW1A 3CX8A 2I22A 5AM2A 5BRAA 4C4OA 1R8JA 3HKBB 4LJAA 1I1NA 4P31A 4BV2A 4I50F 3ICPA 4CFYA 4CODB 3AHIA 3WGTA 4AS3A 5E0KB 1O9BA 1XQVA 2DQZA 1X8KA 2WG0A 1X92A 1I7DA 4FSDA 3MS7A 2AT1A 2H7YA 4YMIA 2RGGA 3D6AA 2WDPA 3VZQA 5A5EA 1IJFA 1GLGA 3QX8A 1N92A 2KPOA 4RY9A 3PPIA 4DLWA 4RUKA 2JLYA 3A1UA 4KXQA 3U9SA 1Y63A 2H6EA 3ZVMA 1KARA 1QU3A 1QNLA 4TXJA 1ZA1A 3GO4A 4RACA 5D84A 1SEPA 2ATCA 4HNTA 4QPDA 5BN4B 1USVA 1T8YA 1F8XA 3BE4A 3WZ2A 4WCVA 3LFUA 1DKMA 1LKZA 4B4KA 4BV8A 2OORC 4CV1A 4B74A 4ARAA 3L0SA 4BNWA 4CLRB 2MDTA 1HMPA 2ZUVA 4DTIA 5K2OA 1EHYA 5ALQA 2JGFA 3RTBA 3DZKA 3DZHA 4EG7A 1ECGA 4P7FA 3AEQA 5D3ZA 2F3QA 4WK6A 1DBVO 3UAOA 4GUDA 2Z8YM 3NUQA 3QF7A 4LOAA 1OYVA 4AIIA 1DTEA 1U2PA 4Y6RA 3BBLA 4YCJA 3OC6A 4BZXA 2Y0PA 2WAMA 1T2UA 4J29A 4A8JA 1A9PA 3T12A 1W5SA 3Q15C 4QHTA 3U7IA 1C30A 2RHTA 4YRJA 4BU0A 2QYHA 4B2LA 5KIAA 2HBZA 3NRBA 3QVKA 2ZVJA 4TN1A 3KLMX 4RY0A 3PDWA 1SD1A 3QFSA 4JNCA 4B87A 4BLVA 1GJRA 3KZKA 3R9KA 1XE3A 4LHXA 1AUQA 3BTVA 2A92A 4QPCA 2V7BA 3I01M 1P8AA 1H2RS 3IIIA 5LXTB 5IULC 4X97A 1PCXA 3L77A 3P45A 2Y71A 1Z28A 1QH9A 3F5DA 5EJMA 5THKA 1Y3FE 4RY2A 4CN9A 4RKYA 1JLLB 1U5CA 4LHEA 3VNAA 4B45A 3AXTA 4J1NA 4RFSB 4OQDA 2GTPA 3M7IA 4RU1A 1ZD4A 1U9ZA 1RKUA 4Z7QB 3PGA1 3FTPA 3O8CA 4KPYA 4W4TA 3RGWS 1E7WA 1Z0ZA 4RMHA 5HF9A 3A25A 5FBKA 3CVYA 1WZIA 2VP0A 4MS4B 3PIDA 1G5FA 1F4PA 4S35A 4DL9A 3GRYA 5E6RB 3B9PA 2ZJAA 3E22B 3E58A 3ZKWA 1ZGHA 4CMHA 4EBFA 5G4KB 2OFXA 3O91A 1NVKA 2HV8A 4JUFA 2ORVA 4LS3A 3QKRA 4AZ0A 3ON5A 4HDSA 3IP8A 2RI0A 3DPSA 1KE1A 3OM9A 3A6KA 1LLCA 5KTTA 4BAGA 1J06A 1ZN8A 4EPTA 4BV3A 1MRNA 1QLJA 3QVUA 3U7EB 1JAIA 3MM4A 3ZCSA 1DKRA 4YR7A 3K70D 3A05A 3UG7A 1W48A 4WBNA 2F00A 1WCWA 2W4QA 3L7NA 5GADl 1S9DA 3L93A 3DLTA 1XA0A 4REMA 3WYAA 3AHDA 3SOZA 1SPXA 1XZIA 2QSYA 3M6AA 1FNNA 4LBZA 1Y4AE 1MPXA 4FMPA 4ABTA 3IUQA 4B34A 2WHEA 1KAEA 4MLDA 1UZMA 1QTNA 4E6EA 3L02A 1XQ1A 3IAEA 3KETA 2O3TA 1MOPA 2XQVA 4I4TB 3W5UA 2YQZA 2RONA 2X19A 1MC1A 4Y6LA 2VHXA 4A8HA 3B89A 4I3GA 1R0LA 3CEJA 3L01A 1ATZA 1KY4A 1SK8A 4YP1A 3STVA 3W8DA 5D2CA 3CTMA 4YI5A 5BYBA 1G6Q1 3GLGA 1HPLA 3GMSA 2X9GA 2GJ9A 4MGHA 3C8UA 3NV9A 5HUQA 2ZU0C 3C4JA 3QE4A 1X87A 3RSHA 1H4TA 1PR6A 3OZFA 5ULLA 3W4JA 4DV6B 3GIDA 2P3OA 2BBTA 2GFHA 4I5GA 4KQ9A 3FOWA 2SCUA 4ETIA 3I9OA 1FFAA 2EG9A 2PXAA 3TLCA 4YJ3B 1U2RA 4FKBA 1ODKA 3UAGA 2IL1A 4D43A 4ZOAA 4KQWA 4BVKA 3DEZA 5KYXB 1A7KA 1S2LA 2E6KA 4K6CA 1U1IA 2HEIA 3C7CB 4OBWA 4AB1A 3C87A 2Q1UA 4Q15A 4C05A 4DEVA 4YRKA 2CHEA 1QP0A 3K8YA 2GBLC 2R5FA 3KQTA 1RMQA 1FTGA 3IODA 2E4UA 2EFYA 2XWBF 5JCOC 1T8TA 2GPSA 3MELA 1W4LA 4L4RA 4WV3A 1BE6A 2G28A 3BWXA 4FK8A 4PRZA 1KIFA 3VHXB 4F97A 3PA8A 5DX8A 1EFUA 4BFTA 1TKAA 1WUJS 3MGCA 4DCPA 2XTZA 3NT2A 2G25A 4RKRA 2ZBFA 4BMDA 1N3YA 5AJTA 2GGSA 3JR3A 1MJFA 2AOTA 1G7RA 2Q3BA 4HXFB 3WBJA 2W0MA 3UEOA 2K7FA 2TRSB 4PQGA 1OZFA 4TRRA 2Z57A 4LXIA 4TQUS 3FHTA 2X86A 1W85A 2QZ9A 4BQIA 1KQFA 3VC2A 1I7PA 4M1MA 2AB0A 4AY3A 4ZO6A 4K9OA 1NE7A 3C15C 2PVSA 2UZ1A 2RGBA 5F76A 1ETHA 2IT1A 3VC1A 4A91A 2FZVA 1WCXA 2O8FA 1JEOA 4LECA 1NQOA 3B6KA 1XLTA 3ML1A 3LYAA 3DZIA 4NMHA 4TOIA 1OZGA 3QE0A 4MQFA 4N01A 1O54A 2B8JA 5REQB 2VKTA 3GRUA 2HJ9A 2P2ZA 2BF4A 4WWHA 4H7PA 4I9UA 4ZVVA 1K5HA 2P79A 1YJXA 3KM0A 3KS9A 4D9CA 2ISQA 2FW0A 3BSWA 5TS3A 3R6WA 3A6LA 5LJIA 2R4UA 2AYZA 1IOWA 2JLQA 3MEQA 1P44A 1S2MA 4NZMA 4R1LA 1CY0A 5JHHB 5DB4A 4PC1A 4XUCA 3QF4A 4IOKA 1J7KA 4IYJA 5CNKA 4AZ3A 2QN7A 3PL1A 1NLZA 3DLBA 3DJYA 1P3Y1 3TX2A 1OLSB 2GJ8A 5DHPA 1TYBE 1Q44A 1YAHA 1W52X 3A4YA 4PPNA 3EBLA 3W3AA 2FPIA 1OVGA 1XD2B 4HWSA 4Y1RA 3LGAA 5F78A 3H7IA 4R9VA 1PHPA 2GNOA 3E8SA 3HGTA 4PNPA 3P2EA 2P5SA 3BCSA 4REQA 3UQYS 3QKWA 4JGIA 4CG2A 3LQ1A 3ORFA 4JLPA 2JZCA 2J9ZB 2FRDC 2WMNB 3ILHA 3QY0A 4C5CA 3UANA 1DRKA 2B4KA 3QMMA 3RK1A 1RRMA 1ZINA 2O1EA 2H2WA 2PL5A 3QI2A 4PYKA 4ZYLA 5JAUA 4AKHA 5DWQA 2OPBA 2DBQA 2R2GA 1G6KA 1JUDA 1P0MA 3DFUA 1HFEL 4JN6B 3GJZA 3DLIA 3FMPB 4EW1A 5HZMA 2DQSA 3DXZA 1WXIA 3CKYA 3HUTA 3TG8A 1M2EA 2ZJFA 4F2HA 1NVTA 5CEJA 1OXBB 1B0PA 4PLCA 3WIOA 3EPJA 4G8BA 4D46A 1ZCZA 1MJHA 2GR9A 2JIDA 1C3OB 1QV6A 2NSDA 2VH5R 4R5HA 3HXLA 1BXGB 5IP5A 5T64A 1HY3A 1LFDB 4R05A 2Y8EA 3ZIAA 4EO7A 1ZBQA 3DDHA 4ZA2A 4D3YA 4LWQA 5BN1A 3T3NA 1K63A 3NWOA 2VJAA 4JR2A 4URXR 4N5HX 4AZVA 1QOPB 5ETJA 4Y2JA 3JZAA 2FPWA 4EI9A 1TW3A 3OOHA 5IVPA 4FGJA 4TT3A 1X7YA 4Q7LA 4P3YA 1KS9A 4AZSA 3KXIA 1TAGA 3SYNA 5BWOA 4I6JA 1LDBA 3ADOA 4RQUA 1OX4A 5BNZA 2J9YB 3R77A 3DWEX 1TOAA 3Q3CA 1Y8RA 3CNLA 3NUZA 4Q12A 1CUDA 4J1TC 3ULKA 3UOWA 4EVQA 2Q3JA 4DV0B 4R6XA 1DS6A 4WKNA 3NS7A 1HT3A 3W1WA 4MHTA 1PVVA 1T6NA 1IHUA 1U2SA 2HEGA 1XUOA 2QGNA 4FW9A 5IJAA 1Z0FA 4YH1A 2X8AA 5BOSA 4KO8A 4Z9AA 5C8VA 1QX4A 2XYHA 5JMPA 4RADA 4YP6A 1H5UA 4FC7A 1MA3A 1SAYA 2OMEA 2PRSA 4V0LA 4OJKA 5SYMA 5CXXA 4DF3A 4H3VA 4RL4A 2I8LA 1J8VA 2XIJA 4HXEB 5NLLA 3HFGA 1NW7A 4B3CA 1M2OB 3ASZA 2C98A 1PBTA 2BELA 1RLMA 3GG9A 5AJYA 3THRA 4RZIA 2GEVA 2YWXA 2Q5CA 2JLRA 3QVTA 2YBEA 1X8LA 4JBIA 5THXA 4ZVRA 3RROA 1A71A 3V8BA 2B20A 1Q95A 2HJWA 1JG7A 2HSJA 3Q2KA 1ITZA 2G6TA 5DCLA 2FSSA 2I1QA 2Q8PA 2ILVA 2FEMA 3MOGA 5JNTA 1ZI6A 3MJEA 4HFMA 1IUNA 3EGXB 2L0XA 2W71A 1CY2A 4GE3A 1PV2A 2CXOA 3SJBA 1T24A 1TVMA 1N2XA 1HUQA 2QROA 2W2PA 1DIOB 2PX5A 1DINA 1HMYA 4GXQA 4J91A 1EIZA 3OFNA 5LB4A 1XPUA 4KREA 4PU0A 4BNNA 1WUHS 3NTXA 3HZRA 3JALA 3INYA 3EGDA 1BJKA 3ZGNA 1OH8A 3LY7A 3EQ7A 1ATIA 4GNRA 4X64B 3PFIA 1AKQA 1CNFA 4G0YA 5LA6A 4MIKA 5K3EA 3KR2A 4PYMA 3HPRA 3R6DA 1OC2A 3FVTA 4BNDA 1RZVA 5B64A 5JFOA 3OZAA 1RQLA 1UIMA 1J21A 1JG2A 3DYIA 4TV9A 1T2NA 2OAQ1 2Q5IA 4AY6A 3AZPA 1IXSB 4QYTA 3EUFA 2AFVA 3IHTA 3W7BA 1U8ZA 2BMVA 4X9XA 2SKDA 3H75A 3IC5A 2PVCA 2DTEA 1UMBA 1N2OA 1M6EX 2WABA 5DNUA 4KPFC 3AZOA 4IY1A 3ERCA 3QWBA 3CLUC 1HWYA 3KJIA 5GONB 5JU6A 5K4AA 4O4IF 1S8OA 3WAKA 4OP3A 2EP5A 1CE8B 4K6OA 4HDQB 2IZOA 1T15A 1JX6A 3IV9A 3KJZA 2G70A 2QKYA 4ND1A 3RYCB 2GT1A 4O2AA 4LE2A 1Y48E 4PLVA 1G8AA 2BBSA 1UXGA 2WM2A 5FEUA 1E0AA 4L27A 1FNSA 3T94A 3KKEA 4DUPA 3G88A 4EABA 1GLNA 1DRWA 2GLTA 3CSDA 3KHSA 4GSLA 3PIRA 4B2YA 4CTKA 5I3CA 1CJCA 4G84A 1B6RA 1D07A 8LDHA 4UQLA 3O8OA 4G0XA 8GPBA 3JARB 2HRZA 5G0VA 5LJLA 3Q8LA 1M33A 2OCBA 3LECA 4IS2A 1UJ4A 3DNMA 3KBOA 4YMUA 4CEHA 3LY5A 4R40A 3MYRA 3F74A 1M2NA 5B3LA 3A37A 4LK2A 3BFVA 2N75A 4A9AA 5K03A 4A5OA 1GADO 2AC4A 4TKLA 1JHVA 1SKAA 2JZNA 3UT5B 5J4HA 3CRRA 5I9NA 1HT2E 1U8FO 3DGFC 4NU8X 1T5IA 4O4HA 2D00A 4REOA 4OXXA 4OJTA 3GJ6A 5I4KA 2WTAA 4J2TA 2ZATA 3PQDA 1V4NA 2OFWA 2PXCA 2TS1A 4DJFC 3CLSD 2CUKA 2W6JA 3MWEB 1LBHA 1QPBA 2EX4A 2H1IA 1VM6A 2JGRA 3NGXA 3TIVA 5KU7A 2PMWB 5FJJA 5L9AA 1YJAA 1EUZA 1Y1RA 4IIFA 1KYWA 4TXHA 3RSGA 3SYKA 4CKBB 2WFMA 3MUOA 3NEPX 3KPWA 2EXXA 2IIQA 2G71A 1DWUA 3P0FA 3RS0A 1TYAE 4ZT7A 4AQ7A 1XCPA 5ALLA 3ODGA 2KX7A 5J59A 1PJBA 4OI2A 1Q1AA 2PUGA 3AMVA 7MHTA 1LTHR 3HYTA 5DGHA 5FJIA 1D2EA 4YWJA 1VJCA 2O8CA 3JZIA 3IDQA 2BFWA 4P32A 5E1OA 1IB0A 5AW6A 4DJDC 1Z47A 1NFRA 3C6ZA 4QGHA 4BECA 3IEVA 3QU4A 4QYWA 4J7CA 4ZCSA 3NH9A 2XMPA 4GHWA 4YNBA 3SZUA 3VQTA 4BRSA 4F3YA 1ZK4A 5DBGA 1IOVA 2D7JA 1KQOA 2IYOA 3HJRA 4PZLA 3WWPA 4DNPA 2NGRA 1G60A 1WPGA 2Y1CA 1E4EB 2BEJA 4IWXA 2WHPA 2IRWA 3KZ1E 2NZYA 1KVSA 2FP4A 4QHSA 1WD5A 3DOUA 3INNA 3OFND 3RRFA 3CZQA 3IEXA 4DEXA 2Z9DA 4IDEA 4HFRA 2COKA 2G1JA 1NN1A 4JGGA 4MW4A 3RIHA 1SNYA 2F55A 1Z9BA 2ZUSA 2H1WA 3GT7A 1DC5A 4EI7A 4ZAZA 1IZ9A 4GX0A 1UZNA 2NXNA 1DHTA 2XF8A 2IHJA 4ACAA 1IY0A 5LP6F 1KMIY 1L4LA 3R7WB 5IG2A 1XDGA 3OZDA 5LP6C 5F2NA 2D54A 4EEKA 1M1XB 1VB5A 3JSAA 3CUEF 3GJ5A 5JCZA 1KZGB 2FG6C 3K8QA 3M82A 3UHFA 3OOEA 3DBLB 3WYBA 4ER7A 5JMOA 2GHIA 2WTBA 1VPVA 1NMQA 2WHRA 3IULA 3IP6A 3O47A 1HF3A 3L6CA 1UXHA 2IP4A 5HF5A 4ND5A 2C1XA 2DHDA 3FRJA 3PF9A 4ND6A 1TFRA 5CB4F 4M4SA 2HK8A 5FI5A 4QSMA 3VKFA 3UWOA 4WZ6A 1UEJA 1A95A 2JBAA 4XYGA 3KR9A 1NAIA 4XARA 5HDBB 4BX2A 1DQSA 3V9AA 4DS3A 3G5MA 4P3OA 1NJ2A 1QIMA 1OZ0A 3RTEA 1EMDA 5EIEA 4QTTB 5EA2A 1A8IA 1PR3A 1XNGA 4H7EA 3W5AA 1W4ZA 5DTIA 1BH2A 4WBSA 3VO1A 1Y6JA 2VJQA 3UHOA 1TCAA 3IDOA 5DM2A 3FGOA 3N8HA 3NRJA 1W6UA 3QUAA 3QGMA 3F9CA 3MJFA 3URMA 1N2CA 1A7UA 2JIRA 3B85A 2YZNA 3BGDA 3IP1A 3GZNA 4ZJYA 1KRWA 1X0VA 3RAEC 1ESNA 2H0AA 3CLTD 1VIAA 4MWGA 5K3CA 2PZJA 1D03A 1C1XB 3ESXA 3KIPA 3ZI0A 5AVWA 3E7WA 3FMIA 2ZE5A 3RSZA 1C14A 4HEHA 1K4MA 1RI2A 2GN0A 4PG7A 5DTQA 3AFGA 3FGZA 1N9GB 3AM4A 2HKIA 2CWDA 2O48X 3MOIA 3UJBA 3KUKA 3NHSA 5KPJA 3H3JA 3QOFA 5TV2A 4LRYA 5LXTF 4YECA 5AUNB 1UFKA 2VP9A 1WHTB 4J1QA 4Q3OA 4R1MA 3PFGA 3LT1A 4V0SA 5H8WA 3ABRB 2JAOA 1KE2A 3ENQA 4YIHA 2PYIA 3IERA 2ES4A 1F6WA 4H9GA 1ONOA 4Q7KA 1PJ8A 2CNNA 3BE8A 4OHPA 4S0XA 4N39A 4UM9D 2RFLA 1J0AA 1E3EA 3LO5A 1K2VN 1BVHA 4Q1BA 4R71A 4MDYA 1RVV1 3PUXA 4L5AA 5FHRA 3UA4A 3Q7QA 1F38A 5AKXA 3HKCA 3RJZA 2O3JA 3RUDA 3UXMA 1O6BA 4XX0A 3WB0A 2A1UB 1JRLA 4U5XA 3ZJUA 1IPFA 4HMPA 4AS1A 3HVRA 4HZUA 2IOFA 3EZGA 3MMXA 4Q93A 4NATA 3Q7EA 4M76B 1XRNA 2FR8A 4RS3A 4GLBA 4NDNE 2M98A 5C4IA 3YASA 1G8FA 2CBZA 3E9EA 4F71A 4ZK6A 2GZ1A 4BGDA 3UKJA 5F9HA 1NRJB 4MVJF 4EOGA 1WUKS 4JP3A 4KAXA 3HUEA 3D8UA 1NI3A 3LDUA 3I42A 1G4UR 2HCBA 4LQ4A 3T3PB 2VP6A 3V8VA 3IEMA 4O4LA 3S2EA 4FT4A 2AHRA 4RMNA 5GZ1A 1TIKA 4BFZA 1L5OA 3ZE9A 3BM5A 4C3UA 1NBMA 1JHXA 4MS4A 3M49A 1Y9ZA 4UCQA 5CYFA 4P4GA 1G2IA 4RVSA 1IUOA 2F1OA 3ETEA 4O0MA 3IKTA 1XX6A 2ZVPX 4FGUA 4U7TB 4JI7B 3CLTC 3RU9A 4MVCA 5E3JA 4WNAA 4Z5XA 2IY9A 4QOEA 3LA8A 3I0MA 4LQCA 1YJCA 5CURA 1I2ZA 3AL2A 4AMGA 4BAUA 1YVDA 2WKQA 1KKLA 3FZQA 3MRSA 4LYYA 5IC6A 1XHFA 3RAJA 4P86A 4UMVA 4NH4A 2PH3A 1E64A 1M2VB 1PZHA 4G0VA 1DUSA 1R5BA 1G7CA 3DZDA 4IG4A 3RBZA 1RDFA 4A2PA 5BY2A 4PBRA 2ZG6A 3EXG1 3FNBA 3I64A 5KC8A 1H6DA 3F1LA 4G36A 3TOZA 2H4ZA 5JEEA 1X7WB 4ISCA 1JZTA 2VBIA 5E9JA 1LC3A 2A9KA 2ZSBA 4UHFA 3J81A 2HR1A 4H35A 4NS4A 3BORA 1Q16A 3KEFA 3ESZA 3PEVA 3T4UA 2Q3DA 4O2BF 1GPH1 1G41A 1PNQA 1V6AA 3O74A 2PGJA 2ZSUA 4G5QA 5I9SA 3PTAA 3ZDAA 2HA7A 2I34A 2PCJA 2VQSA 2D74A 3HXPA 4IVNA 5K0SA 3M6WA 1P8JA 2RC5A 2XZOA 3N6VA 4K03A 2EATA 1XRRA 2ZK7A 3K8OE 3JYNA 1GEEA 3RAGA 4DVGA 4LRQA 3LT4A 4YMSA 2FW7A 3Q87B 2RIRA 5TMDA 1AMUA 2XYPA 3DEKA 3G2HA 3LZ6A 3NUGA 5I8WA 4M1QA 4YGXB 4HT3B 2NU6A 1TF5A 2FA9A 1XRMA 1F0YA 4PHHA 1PS8A 4G65A 3ZHYA 4DCJA 5EWLB 2YFKA 1RFLA 1S8AA 2Z30A 3GFOA 4KPGA 2HT1A 2XRFA 1S1CA 4BZZA 2NO1A 2XB4A 2FE4A 1UT5A 4L8YA 2VH1A 1QP8A 3ETJA 3WLSA 5D7BA 3GLRA 3H6GA 2B0JA 1P0CA 2UUBB 1TZJA 4PR0A 4YMVA 4YBZA 1VIYA 4JC5A 4UJ3A 2Z8XA 1XYGA 2XCIA 3AY6A 3TR5A 1EM6A 2Y1OA 1H8HD 5HOEA 3E82A 1XEXA 1JFFB 1SZDA 4AY2A 2O5CA 1X1TA 3UFXA 1M1YE 4HK4A 2XKKA 4P34A 3NBKA 1T0HB 2ZQYA 3B5EA 4IEIA 2KM1A 1C30B 2R1ZA 4ZVTA 5GGXA 3TS1A 2VDWA 1ZSVA 2ZSEA 4B8YA 4DJ5X 4DOMA 1HYHA 3ZI4A 3U7FB 2YVUA 4RELA 3EHDA 1A9ZA 1I13A 4LXGA 2OXCA 1OSNA 2O2CA 2R97A 4CEJB 2VDNB 1HH4A 3WX0A 2X77A 1GSOA 2NO5A 4PLFA 5CH8A 1O0SA 3SJCA 4OAQA 5K0BA 4M7RA 3RT9A 3WNQA 1V41E 2PUDA 4YJ3A 5EQTA 5HIIA 1X7XB 5LYJA 4KITB 5IX8A 1E8NA 4J1SA 1N0WA 3KEQA 1BHO1 4NG5A 2WJGA 2N9UA 5KTMA 4E33A 5LBTA 5CD1A 4MO2A 3FDXA 3FMVA 1P1KA 2JDID 2WSSD 3H2SA 3UENA 3AUXA 1NATA 3U09A 2XSZD 3LFTA 3HCCA 4MQUA 2K7ZA 4KQEA 5DI9A 3Q12A 5E4TA 2FRXA 1KNQA 3OZGA 5F1PA 2XCSB 3JZFA 2Y6UA 1NOJA 1H6CA 1SVIA 5FHQA 5IUJC 3AYXB 2DZDA 1CUZA 1AOXA 2KQUA 4RD1A 1JQDA 4Y2VA 3DV2A 2J5BA 1PK7A 1SY7A 5KMGB 1THTA 3TLGB 1FW6A 4QBGB 1C3VA 4M88A 3UMBA 2WFAA 2QZPA 3NT4A 3EZNA 3K35A 2IY7A 1FB5A 3GGJA 5CX1A 2XOKD 3H05A 2F9MA 3ITKA 1V6SA 5KYYA 4CG1A 1EM8A 2J1LA 1QV9A 1ESZA 3ZHSA 1D8AA 2SICE 2Q6OA 2GKOA 2YH2A 3DTVA 4DV7B 4HH0A 2HRBA 4FCVA 5H4HA 5BO5A 3QU2A 1SVUA 1G98A 4IRMA 4QNNA 1HE3A 2ZUUA 3T5CA 4C1NA 4W7HA 4EA9A 4TZKA 2GZ3A 2PPLA 2YZKA 1F60A 2CYBA 4TV8B 4X8OA 4ZT6A 1HZZC 4ZVNA 2OZEA 2NVWA 1ZZGA 1E98A 3BAFA 1KYZA 4Y2UA 5CYPA 2XZDA 2XOEA 4FR0A 4CQMD 1NUUA 4E08A 4IDOA 3WFIA 1N36B 3BSFA 3DKKA 3S99A 1TGYA 4L08A 4IHJA 4DYVA 2NTYC 3BFPA 2J5QA 3KPUA 4DT1B 1RQGA 1HC7A 3NKLA 1X2EA 3EVCA 5D5HA 1KH1A 1GGFA 3TBHA 2R6FA 3PJRA 3EYAA 2W37A 1D2NA 1GUFA 4LHWA 5LMZA 5FRDA 2M2IA 2QT0A 1VJGA 2OP0A 3ER8A 3MS4A 2ARKA 4ZT4A 3PEFA 1IZ7A 2FMHA 5DMHA 3ZWNA 1M2KA 1XXLA 4WD3A 5B7PA 4EQ6B 4YP7A 1UKAA 5C3UA 5BV1A 1G3IA 4BP1A 1SZJG 3JS5A 5LQCA 2I1WA 2DQ4A 3C48A 4DUZB 2ZRDA 1KJ8A 5H3CA 1T1GA 2X8JA 3AKZA 4L2IA 3KHTA 3EEIA 5A7GA 4UBKA 2ZTVA 4KO1S 5HM6A 3I8OA 1HFWA 4RLFA 3TQTA 2C9CA 3IBYA 1E2PA 3H8VA 3U7GA 1CY4A 1Q1GA 1S8FA 2AW5A 4ZT3A 2VDJA 1J20A 4KQ2A 1NHWA 3DZFA 4X00A 1GCGA 3ZY2A 4MRMA 4LQLA 2DERA 4OHUA 1DPGA 1SVNA 4UPDA 1CYDA 2JJMA 3SEZA 1OLUB 4ZQFA 1NPYA 2Y3IA 4IGEA 3RIGA 3T7SA 3WLIA 1OXSC 1BXGA 4KEAA 1DKPA 2Q9AA 2AIRA 4YIKA 3IQWA 4AJHA 5C18A 4MQEB 1G3RA 3C3CA 5IWAB 1O6FA 1QHSA 1W88B 2R68A 5K3BA 4DZRA 4EVSA 2MJLA 1Y1KE 3QJYA 5FBQB 3ANYB 3UATA 3UMCA 4HZIA 2NZVG 3QV2A 3NU1A 1UOOA 4F9FA 4NAVA 2OE2A 1FFWA 3TH5A 1YA6A 2V3VA 5AUQA 4HGZA 2XUZA 2BI4A 3FNRA 4D3ZA 4CMCA 1C7JA 3VYWA 5IYZA 3RYFA 5FA6A 3VPAA 4M46A 1XWFA 3JWIA 1WPXA 3F6EX 3LCJA 3A31A 3EMVA 3ABZA 1W5TA 3M0EA 1JT9A 3QFCA 4RGVA 1WVMA 4U2BA 1YK0A 5BPFA 3PR1A 4AQDA 4LYEA 3K1AA 1RZ3A 3OUTA 4ON9A 3RFVA 1I5RA 1YS1X 2CJYA 2D5CA 2QY9A 2J4CA 3W78A 5M34A 5IKEA 2J8ZA 1ZJJA 3HA5A 1AXGA 1M34B 3B9BA 3NHUA 3OZBA 1BJRE 1EUCA 1FXWA 1XAHA 4MCAA 3TFWA 2DECA 2CBGA 5EUQB 2IV2X 5A1TA 3E18A 4OOFA 3QPCA 3VPHA 1LBIA 1MR3F 2VYCA 4Q21A 2JFWA 2P4EA 3GCDA 3I05A 5FBHA 3R6LA 4CMEA 4QXMA 3LBFA 4FWIB 2VTKA 1YZGA 3OJ0A 4L15A 2ISSD 3FCXA 4YV1A 5E7MA 3T7CA 1G6HA 2KB0A 3WE7A 3ZJ4A 4C89A 5BXQC 1IOZA 1AO0A 1PS0A 3QHQA 4ZRMA 2FP3A 2ZIXB 1MB3A 1RLOA 1PZEA 3LLVA 1ZXLA 4OXYA 3GLIB 1TT5B 3FUXA 4DJJA 2FFAA 2AUMA 4I1VA 3HPQA 5CJJA 2BFFB 1Y89A 2FN7A 4L8WB 1ZUNA 1N25A 3L8GA 3DKVA 5FPSA 2VP3A 3AIMA 3RVBA 3F1KA 1W0KD 3ZIDA 4EUNA 4LF4B 2CEAA 3DXFA 1NKTA 2WU4A 1EDZA 4IVPA 4OB6A 3VX4A 4A0HA 5KX5B 3IMFA 1GFZA 2E82A 2QORA 2P9YA 2B94A 1D6MA 2WK1A 3S2GA 5J5VA 3Q88A 2OBLA 2E1RA 3ENNA 3WB1A 1YONA 3J80A 1NF8A 1HYBA 5H0IA 3HUFA 1PTKA 1A8SA 3P2OA 3QJGA 1BEZA 4YA6A 2OHVA 3ISVA 2B9VA 2IHVA 4Q01A 1KAHA 1JF8A 3GLQA 4QE3A 4XCQA 2NP7A 1DG3A 2Z4TA 2RMKA 4G3XA 2OXIA 4TMWA 4B32A 3RABA 5BUSA 5HIAA 3A2KA 4CJXA 1USIA 3NONA 1V37A 4J16A 2HHAA 5JYEA 1R9JA 2ZJ6A 3DEJA 2QW0X 2GN4A 2H1FA 3U7QB 4DLXA 1HV8A 3KAQA 4PZPA 3D8HA 4ZQIA 5LQUA 3TCKA 4MQ4A 5C52B 4JJ4A 4UUNA 5CDUA 3R6TA 3N8GA 2ZXEA 5LD2B 4KKXB 1RJWA 4N0EA 3UMYA 1N1EA 3O1IC 1HSOA 3FR7A 4D41A 2R6AA 1ZK1A 1I6WA 3GCZA 3QUTA 4AMBA 1CTQA 1NRIA 3UUWA 4DPMA 1KSGA 5BVGA 1R0WA 1DLIA 3GUYA 3ISTA 4FWBA 3A26A 3OCUA 2AOUB 1G1AA 4RWEA 3SNHA 3KWLA 4FFDA 3U3DA 3JW8A 3FHLA 5TT0A 1QTRA 5JSUA 3H5AA 3IHWA 4HF7A 5FPTA 4EG3A 2DGDA 2IODA 3OZRA 3WDLA 1P2VA 3B7GA 1C9MA 2XTNA 3U1BA 2WSBA 1G8KA 3Q8WA 4FOPA 4Y1RB 3GYBA 3VZPA 2XRZA 2LPMA 3BEDA 3JPWA 1E2MA 2QYTA 4HZGA 1W5FA 2I76A 2JNWA 3K5HA 4KGVA 4BMSA 4DA4A 1JR3D 2CD9A 5J5AA 1WP9A 3EGIA 2AOUA 2P27A 4XOIA 2HA3A 1ZM2A 3VR6H 3E8MA 3K6RA 4DLVA 2J9FB 2O8NA 3RVLA 4FDVA 5JASA 3AEXA 4M0CA 1E1RA 4PWYA 1YUMA 2P35A 5LSAA 3VDXA 1PX2A 1VKRA 2JANA 3L79A 2PNJA 4Y2SA 1F0PA 1SUAA 3GA0A 1K0UA 3PUZA 4RA9B 1KJWA 4D3DA 4ZYZA 2MIIA 1OKKD 2HA5A 1OKKA 3G6KA 3SE0A 2IIPA 3AOGA 4W9NC 3V4PB 1BXRA 4W9NA 3ZHRA 4R68A 5EJIA 5A06A 2NVUA 3TECE 4BWFB 1M75A 5IMSA 2B34A 3EA4A 3T4PA 2VDRB 4GMDA 2Z1NA 1DXQA 4ZTBA 5AHKA 4C5AA 3WK6A 1RKXA 1JR2A 2RK6A 5CIWA 1JHPA 4WH0A 4EPVA 2HBRA 4HDCA 3JARA 2I1LA 2DU8A 2AN4A 4BY9E 1KP2A 1RNLA 2CXQA 2FEOA 3DBHA 3IELA 4K9QA 4KIUA 5JH7A 1RPNA 3MT8A 2PO5A 3O3OB 2X58A 3SHVA 3D8SA 2Z6QA 2ZBDA 2JF0A 3KL4A 3WGIA 1GGMA 1L8XA 3ZYCA 5CUQA 3A6HA 5GGYA 2YN0A 4FDTA 3TQHA 4XYEA 4JR0A 2XB8A 1NJ6A 2O2IA 1QF6A 2RCYA 2A5FA 4G25A 4MJLA 4LRSB 3WRYA 2YRFA 4TKUA 3MWEA 1DTWB 1H4SA 1XVIA 4PY2A 3RYIA 2W8ZA 1SCJA 1OA1A 1VHDA 3AR9A 1TCBA 1XK7A 5C1OA 2EF1A 1Y1QA 4KN6A 4UUOA 3SF0A 2HLDA 4KQXA 4LYAA 4RMIA 3TW0A 4FQ8A 1QH1A 3A9SA 5EP4A 2QMYA 4DMLA 3IIMA 3HN2A 4TSFA 4W9MC 2VP5A 2CSXA 4OMUA 4ZT5A 4BPBA 1JJIA 4IKOA 2BHRA 3DJFA 5KJ6A 3DBLA 4L4XA 4L72A 1TYCA 1T4CB 1O5TA 4CEHB 4MV3A 2R1UA 5IBQA 1XN1A 5C32A 1HLPA 2D1FA 1UZLA 2R8OA 4L0MA 5AVJA 4F21A 2HJVA 4ZHQB 5EQDA 5ALYA 5AW5A 1NBIA 5LWQA 2G1AA 1P4AA 4JLDA 1QK4A 1POWA 1E1CB 4D99A 4FLMA 4U2EA 4GOOD 4OXNA 5EZQA 2AG5A 3QLUC 4DC9A 5M04A 4CMKA 3ND6A 2CY0A 1M6NA 4JUCA 2RAVA 3QXSA 4R2MA 1GPAA 3ZEAA 4YUXA 4V1CA 1WBBA 3B70A 2QIPA 3GQBA 3O93A 2C92A 1JJAA 2OKCA 4EY5A 4F7DA 2IBSA 1SBYA 1VYVA 1PP4A 4A15A 3Q8MA 3KX2A 5IYZB 5KNCD 4MTLA 4TTIA 1GPWB 4ZVQA 1PL8A 5JAIA 2HA4A 3AR7A 4B7XA 2CE2X 1IHDA 1H2BA 1V16A 3OTOB 3AF3A 5K51A 4WA8A 2D62A 3OU7A 2FXIA 4IIYA 5LMUB 1G291 2CLSA 5KI6A 4D79A 2F1KA 2JHFA 1KC1A 1KPIA 1YI8A 4MUAA 4OXIA 4J0CA 4QXRA 3L6EA 4QUAA 2ZWPA 2J08A 2A3NA 1BDJA 4HNSA 2XTMA 2IHUA 5JAQA 2QVGA 4RTRA 3GROA 4RLQA 3JX9A 4L4YA 5JXGA 1HT1E 4X91A 1F8UA 1OFTA 2ACWA 3LQQA 4TPKA 1VP9A 1RRKA 4MV7A 4EI8A 4UVGA 5JSKA 4W5RA 3O8QB 2QAIA 1XL0A 4LPKA 4CM3A 5KNCH 2WFLA 3H97A 1KEWA 1VKJA 4DCUA 4ES6A 3CKKA 4JKIA 4ER3A 4I4TF 5KSWB 5JTTA 2JFZA 3REFA 2XTJA 4CMEC 4R0NA 2WV9A 3WP1B 2RKOA 4FFNA 2QRVB 3C3PA 1JEEA 1SOAA 3BH7A 1JDBC 1GZ3A 2NZWA 3U7JA 2BGLA 1CY6A 5FNVF 2PJZA 5EI5A 2OLKA 2YNMA 4GXNA 3Q7TA 3OO0A 4CCYA 2GVZC 3MFYA 2DFKB 2BFNA 2P0YA 3KKLA 4UXHA 2VWPA 2B7LA 4DJTA 1HFKA 1YHZA 4RJ2A 1OIWA 2A8YA 4QWWA 3EXAA 1LFAA 4YAKA 1OGJA 2MR6A 3K9HA 1YFZA 2B37A 1XZFA 1XN4A 1XLWA 2Z43A 3QBEA 2D2FA 1M2OA 2NO4A 1LNSA 3TXAA 3IEIA 1XD9A 1KFBB 3AIOA 3GL9A 4NSNA 3VC7A 4BP8A 5IABA 2LV8A 3F4BA 2QN8A 3HJHA 4QJ5A 1KO5A 4P5DA 5LUAA 2ZBVA 1Q1NA 4HO1X 2ZJ8A 2FSPA 4U4AA 1M6VB 3X1MA 3ZS9A 4JLUA 1RWWA 1ZH0A 5D7NA 2IVFA 4TL8A 4UAUA 1HL3A 1RP1A 2A0YA 2FHPA 1RI3A 2G9RA 4PXYA 3F78A 3T3GA 3WWOA 1KU0A 1CQWA 2CFTA 4ND3A 5AI9A 3MT7A 2W6JD 5CXSA 5A3SA 5IASA 5HE9A 5KYXA 2W2LA 3DEIA 4TRNA 3OP4A 1P74A 3B52X 3A3OA 1IBKB 4E5DA 4DIFA 1ZCBA 3KEGA 2O7QA 2DP4E 4LAFA 3S8YA 3K9CA 1XZBA 4E14A 3R0VA 5JBIA 2CXRA 4RZSA 3RDPA 3VUEA 3PXGA 3UXYA 1E9VA 4GVPA 2PWZA 5C7IO 2F1IA 1U7UA 3SM9A 3PJFA 4DM7A 5LOVB 1I33A 3BIWA 2KW5A 3NFRA 5H1YA 4B4VA 4L78A 1YS4A 2R65A 3BHJA 3E9MA 2C3OA 2ZBUA 3LL7A 3QWFA 4ISBA 3Q4GA 1E3MA 3LC0A 2DE0X 4QUKA 4PBTA 2X0JA 1E9CA 1CV2A 3UAZA 1UDRA 2PSFA 2QTHA 1FYWA 3GQVA 1Q3KA 1U0HC 2EWWA 5FUMA 1WOMA 4I99A 3FCSB 3GJYA 4BMZA 3ODPA 1UC9A 4PE5B 4BDSA 4E4TA 3C7DB 4X65B 2XWPA 1DAFA 1XGKA 3HYRA 3GCGA 5MN6A 3OQNA 3ZTWA 1P33A 1JEYB 1DJPA 1MEEA 1MH9A 1Z5PA 1PL6A 2XE8A 4UFPA 5KTYA 1Y81A 2IGTA 5ALRA 3CWZA 3OPYA 1NN3A 4ARVA 4Z0PA 5DN9A 3H4MA 1L5LA 2WKSA 4C0JA 5TPWA 4R8VA 4KWTA 3PV0A 2CSUA 4BNVA 4DLZA 3H83A 3NHPA 1OH6A 4TV9B 2XDAA 2J46A 4CDNA 1E3IA 4YXFA 4UW9A 3K9FC 2WSSA 1KR5A 4TL6A 4IFBA 5AHRA 5HP4A 3FWZA 2AUNA 3PL5A 2I3AA 3ICOA 4DDKA 2D13A 4FU0A 4HOYA 2H92A 3LPDA 3R40A 1H2WA 4GLLA 2C2KA 3ZD6A 1FUKA 2CNBA 4DV4B 3KWMA 1QIDA 2AXQA 3VDNB 1I9CA 4C0BA 4CLOB 4D7AA 3BRQA 4O02B 1CB0A 1T1EA 3LD9A 2XXJA 3QLUA 1OXTA 2IFTA 3UT6A 5EIWA 3B8EA 1UF9A 4U2GA 3GJXC 4P53A 3HRHA 3ZYZA 3T52A 4GYJA 1EGMB 3K0FA 3I8XA 4FDMA 4IO1A 5HS6A 3ZNNA 3ZVLA 2GBIA 3IPAA 3PD0A 4RTSA 4U3JB 3N0TA 5BW6B 1ZXXA 4DM3A 5CLQA 3PUYA 1MMFB 2H5LA 3EIOA 3ZC3A 1DU4A 2QZ4A 5I4BA 3L1JA 3EEOA 3UJ6A 1YJ5A 2O7NA 2PK3A 2JFNA 4QECA 4RZUA 2EERA 1M7GA 3L0DA 3C5VA 4EUKA 2Q8NA 3LS2A 4N4AA 3MJDA 3PT9A 2RARA 4HYEA 4Q4HA 3AESB 1W25A 4I5DA 1JA0A 5FWDA 2C4MA 4CKWA 4I1RA 2FW8A 3RSFA 5AVTA 2ACEA 4OYRA 1RLTA 1VL0A 3K6KA 1BFDA 3U3KA 4DXHA 4NENB 5K0NA 3WRYC 2PANA 5SY4A 2W6IA 3ZDBA 2B1GA 1USWA 3DWIA 2XT6A 3WGMA 1E3JA 3GFGA 4G5FA 4QQNA 3HWWA 3DOOA 3U4HA 4ENWA 4H1WA 3VKGA 2AS0A 1QH1B 4LMPA 1JH9A 1GEGA 3BDVA 3FCUB 3IT0A 3TF5A 1TK2A 4F2PA 1ZHHA 2BD0A 4DKXA 1W85B 2W2VA 2X0NA 5AKJA 4IIXA 4C2TA 1QIHA 1U3VA 1JFFA 1B8VA 1UAYA 1A9TA 1KR2A 5EC8A 3RO7A 1EQ2A 3AVTA 1UJ5A 3L6RA 4K9SA 3NATA 4OP1A 4R1TA 3DHNA 1V39A 3D3KA 4P22A 3NHLA 1MABB 2EAUA 4MA4A 4RFSA 5EXXA 5E9AA 4AP9A 4RYLA 5A2GA 1DKQA 4E1VA 2R7MA 2ZYAA 3HKCB 5A5VA 1Q21A 1E2GA 3BCUA 3QENA 2HK9A 3RG8A 4FI3F 3ME5A 5ABPA 2IS4A 3TQFA 1IBSA 3HB9A 1N6IA 3QLJA 3AK4A 3UHPA 3IMEA 1QM5A 3R7FA 2C8VA 1MP0A 5FR1A 1EEHA 1OIVA 1SMKA 2XUPA 4ALNA 1NMXA 4K40A 2PMFA 3IT2A 4IXNA 4PSDA 1KJQA 1R6VA 3A10A 5JZVA 4AZTA 3CU5A 1TKRA 4B40A 2ON6A 3B78A 4B6JA 1T3LA 3AVUA 4Q39A 4DMHA 2VYQA 3QF4B 1YA4A 4FFBA 4IILA 1NVVR 2GN2A 4FXOA 3SC3A 1TD1A 3DLAA 1NG1A 2AJ8A 2JGMA 2H2GA 5K20A 2JK0A 4WOPA 3B1FA 3REQB 4OX9B 4R54A 5TX7A 2VTEA 4NENA 1E2KA 2IXGA 3G3EA 4HB0A 1CWUA 1TM2A 4O63O 4PCLA 3MQ4A 2ZIAA 4LJ6A 4K3VA 2HO4A 4B3RB 1E1KA 1SBIA 4DY6A 5TE9A 2VHZA 5A5FA 5KNDH 1L9XA 1C9NA 1WO8A 1TCCA 2QUZA 4M0FA 1LB1B 5REQA 3UWKA 3EPKA 1FK8A 1YI0A 2MSDB 3E9RA 3N8DA 4HH4A 1OW3B 2NTVA 3DKPA 3GGPA 3ND5A 5ECYA 1KEKA 2OQ2A 1DIAA 1X77A 2ZYVX 3ZR4B 3H11B 5AKZA 2PT6A 1BIFA 3GYGA 1UFOA 4GO1A 3R0JA 3LZCA 1IZ0A 4AECA 1LS6A 2Q21A 4XEUA 3ZIUA 1MB0A 5ICSA 1IBCA 4JLJA 2WUEA 3WIUA 2FMXA 1MUUA 5HYVA 4F91B 2XECA 2XZTA 4GR5A 1ELOA 2DUUA 4BIIA 1P9OA 2W70A 5B3KA 4IDAA 3C39A 3FMGA 3OCJA 1JYEA 2XA1A 3V80A 4TVBA 3NHMA 4PYOA 3PHBE 1AO3A 2OWEA 2PGIA 2YV5A 1PYDA 3QWAA 3C98A 3FNEA 4CIBA 2A1TS 5IM4F 4LF9B 1FP4A 1O3YA 3QOWA 1NQTA 4JVSB 4LWOA 4UEKA 4XFKA 3TRKA 3ZX4A 2HDNB 4WOCA 1RVDA 2EKQA 4G07A 3HBLA 4TYQA 4QIHA 1TI7A 1EFDN 3GVCA 4ZYTA 1YCGA 2IHZA 1Y80A 1OLUA 2PQ0A 3OE7A 4HQOA 5DLEA 4EHHA 3IP9A 4GWLA 5CDYA 2XMGA 4IQ8A 1NUSA 3DT9A 2JIPA 5B58T 1M34A 1M8GA 1KJIA 1UBFA 2JGAA 2ZYSA 3BMNB 3HA2A 2ZSKA 4XM2A 4D3XA 5DKFA 2ZRNA 2BP7A 3RJ9A 1N78A 3RD5A 3GELA 1OI7A 3NPAA 1Y33E 2FZLA 3ANXA 5CW1A 1KZHA 4RKEA 1XA4A 3T5TA 4D4LA 1HE8B 1CR1A 5FPQA 1BS2A 1R9NA 4ZZ2A 2DFLA 1GO2A 4MEJA 5E6UB 4CYMA 5JHGB 3ZHOA 3U5TA 1RPZA 2C9OA 3MD9A 1RADA 2PFSA 5EJ9A 4D1YA 2A1IA 2FZWA 4ZARA 1GP2A 3FYUA 4M9ZA 4QDTA 3VAAA 1MH1A 1ADJA 4YFVA 3RQIA 3BRCA 3VH1A 3Q9SA 5HW0A 5A03A 4U5QA 4G81A 2G3YA 3HACA 1A76A 1MENA 2Y4NA 3G0OA 2Z3ZA 4HN4B 4Q82A 3B8HA 4BBAA 2UUCB 2B5VA 3R7BA 3D31A 5AK6A 5LOVA 5CVUA 3TXYA 4IL5A 4F2GA 2VTVA 3DMGA 5T8KA 2P8JA 1W1WA 1ZGZA 4DA0A 4IRXA 3W4IA 2BRUA 2MWMA 1I10A 1QV7A 1R3UA 4JENA 4C2UA 3KU1A 3PTZA 2WD7B 1WB9A 3FCEA 4IIJA 3WIBA 2V3CC 4ODIA 4XR9A 2FFJA 1T2DA 4ZGWA 1WZUA 1YJBA 3P5BA 5IXYA 4ME6A 4CLEA 3QVGA 4R2WA 4KMOA 3G5UA 4NU5A 2B7CA 3G6WA 4HVLA 1JH8A 2B8WA 4JP2A 4JVLA 3E23A 4R8RA 4AUEA 1NJ5A 1PVDA 3AR8A 2QQFA 3W8RA 3OZVA 7GPBA 3GNLA 3HB1A 3DP9A 3WJAA 4JBHA 4NOLA 1I3OA 4RTPA 4XB1A 2K5UA 2XVMA 3CEAA 4PIPA 3IFSA 1NNI1 4JJZA 5D86A 1A8UA 2A4MA 2ODBA 1QHEA 4W82A 1WCIB 2IYWA 1ZH2A 4RZXA 2XOKA 3DF9A 4TLEA 4YCDA 1FX0A 3BHNA 4WOJA 3WGNA 4HAVA 4P7JA 4JJEA 2P78A 3UY4A 5BSFA 3CYFA 3FZEA 4H31A 3DTNA 5GWXA 4YMGA 1L3BA 3K3PA 1SIBE 4OGFA 3HYSA 1ZRNA 1VBKA 5IN4A 1C0LA 1QHNA 2E5WA 4J9UE 4V0ME 4Q6WA 3S70A 4A0QA 5KX5A 3SVZA 2WWXA 1PT6A 2R0QC 3D8BA 3O9ZA 1N6LA 1KYTA 3DUFB 4Y2PA 3FBGA 2R8XA 2J0QA 1QWOA 1B16A 2PU7A 2V7EA 3ROTA 4B4WA 10MHA 3H2BA 2X6RA 3Q98A 2ZWAA 5EZ6B 2IYZA 1MG0A 3I1FA 3KVYA 1NJ8A 3Q9LA 4IZHA 5ICEA 2I54A 2ZJZA 1Q0LA 5AVVA 2Q1SA 4Q3DA 1ZD8A 1ZESA 1QU2A 2Q3MA 3A1TA 4ILKA 1P1HA 1HI9A 2ONZA 4WJKB 2V6MA 4UFNA 2VF4X 4ALMA 2GAFA 4LF7B 2W4MA 3WYDA 4AG6A 1XQWA 3QTBA 5TC4A 1X80A 1KXZA 1NVAA 3B6IA 2YXLA 2X6TA 4QODA 1BKDR 5DP2A 1ZNYA 2H1HA 2VT6A 3E3NA 1YQQA 4MV6A 4E1AA 5JYCA 5T7BA 4C2BA 1TM3E 4Y1FA 4B6RA 4BQFA 4G1BA 1P39A 3K5WA 1WKCA 4QFDA 2P1RA 4GI1A 2DR3A 1CRWG 5AKLA 2KI5A 4N5MA 4U7WA 1S3GA 1ZJWA 3UN1A 1SG0A 3S2SA 2QDKA 1HDZA 1Z2AA 2C3MA 3GWGA 5EMKA 1ULSA 1C81A 1MX3A 1R27A 3KSRA 2Z5LA 4RFVA 1SXIA 2APJA 3W5VA 1DCTA 1R4ZA 2QT1A 1GTJ1 2RKWA 4HNRA 2JI9A 4GRAA 2ZUDA 4MVJM 3RVDA 2JVJA 1QB7A 4M55A 2IQ5A 4K2HA 3M6UA 1PZNA 2M1ZA 3O8BA 5FQNA 5CPBA 1C0KA 3RVQA 3FSJX 1MLDA 4C78A 1YBFA 1PWZA 2JHGA 4LZZA 3PSAA 4PVCA 4XQ9A 3TR6A 4DUGD 3HK2A 2Y0BA 2YMPA 1I32A 2YQ5A 1QLWA 3DBRB 4ZICA 4RHUA 5JZBA 1X8JA 4Z3DA 1RI4A 1EFRD 4NF2A 3TX6A 3ZGOA 2GJ4A 2Y2VA 4OH1A 2NACA 4A23A 3BCRA 3M1IA 1MC4A 1FLDA 1MC5A 3IVMA 5AIAA 3UPUA 4XPIA 4R2HA 3FYSA 4UVHA 4JP1A 3BB3A 5AJUA 2QTFA 2ZYDA 1VFPA 2JLSA 1GSIA 3GJ8A 3QKUA 4ZHQF 1Z5VA 3ZE0B 5GINE 5FTNA 4MUBA 3WVNA 1AQ6A 1OIXA 5ALNA 2PD4A 1HM5A 3OLWA 5AXBA 4WLOA 3HTXA 2IS6A 1APBA 1LDGA 1L1RA 5LFAA 4A8JB 3L84A 5DI3A 4ITUA 3V00A 4BRWA 4LDQA 2O3RA 2YOHA 3FG9A 3IBFA 1UQUA 2PA3A 3H84A 1XKLA 1M1ZA 1ZDMA 2CDNA 3V55A 3ZLUA 2OVFA 1PFKA 4GBMA 1YR6A 1KVTA 1U7WA 1EWTA 2IXEA 3MTBA 5ALUA 4R1QA 4H7KA 3GAMA 4BLWA 4XVCA 2XY4A 1H1TA 1IEVA 2O6LA 3PGLA 4HX5A 4NCXA 4WHMA 5CGQB 4D42A 2RGRA 1QMGA 3L7KA 3U26A 5A7FA 4Q66C 4W1QA 5BVHB 121PA 2EJTA 5EYPB 1E4VA 1M1UA 2CYCA 3JD2A 3UIEA 3C6MA 3QUSA 3WMRA 3ABIA 1PD0A 1GYRA 4YRTA 3LXXA 2HB6A 5TT1A 1KTIA 4CIWA 2CYAA 1TRKA 3FRIA 4DSAA 3UTDA 2GK4A 4BV9A 3KAKA 3ICQB 3AFIA 2D5AA 4MR9A 3VKUA 2QJWA 3FCCA 5DYWA 4Z1MD 1AG9A 1VYHA 1CQIB 1YB4A 1EJ0A 4FSXA 4L51A 4LNUA 5EERA 1ZIXA 2W42A 1S3FA 1BMFA 1I2BA 4LW8A 3SU8A 1XRSB 1T2FA 1R0XA 4Z0TA 4JQSA 3EZ9A 4CR7A 1Z39A 2BGKA 4Y2GA 5DW3A 4KYTA 1K9VF 3RNLA 4RHEA 4O4JB 3JAKA 3L0CA 1U65A 1L5YA 4M7WA 1WL8A 5ITZA 3PYXA 1P73A 1JU9A 1H42A 1HURA 2R62A 3AESA 1RE1A 3OAAD 3O8DA 3NM4A 4R3NA 1FYFA 4TXLA 2VUUA 1FTWA 5DYNA 4GX2A 3W9SA 5L4SA 2H65A 1QO0A 1TGVA 3K0SA 2W6PA 1HTWA 1DQNA 1NDQA 2HXYA 2PZAA 3QXHA 5G3ZA 2ZRJA 3H5RA 3EPHA 3EF3A 4NDAA 3TINA 4A0FA 4LKRA 1RI5A 3EIFA 4HLNA 4GKAA 5ALIA 2QTMA 3BXPA 5KYGA 5E0OA 3KAPA 1E9RA 2A0UA 3RWOA 4IH1A 4TKVA 4Q1EA 3CF0A 3UGKA 3PXXA 1Q2XA 1YCFA 1CK4A 4OBBA 4DLSA 4FM9A 5FNZA 4D9MA 1G7SA 3FM9A 4RPJA 2Q6LA 4DHEA 1K98A 2CXPA 4EFMA 5EAIA 1GWNA 2H4XA 1JKFA 5DNCA 4AMYA 5LYYA 4Q5IA 1RKVA 3G1TA 4FZRA 5AD1A 3LC2O 2PRZA 3L0PA 4MYDA 3R3UA 5CB6A 1I7QB 2R96A 3PNLA 1NNSA 4NJMB 4S12A 5DBOA 5TQJA 1Q1BA 5HIMA 5AXDA 4BMYA 2QTVA 3ZXXA 3ASUA 1IBRA 1AUXA 4QTXA 3T6KA 1EGVB 1MX9A 5A9SA 4QL3A 5CA1B 2F90A 1QFMA 3VJLA 2EV9A 1RAAA 1PYOA 3R7LA 4LZLA 4ENUA 1KEEA 4D9FA 3TJZA 4LJ4A 3UCEA 2GXSA 1YE3A 1GG9A 2YYSA 2Y92A 4H6WA 2ID7A 1JXMA 2UUOA 3KSAC 1U8EA 2VHJA 2I3GA 1W7AA 3ILVA 3CVUA 1P18A 4EEZA 3ND9A 2C7VA 1MJNA 3Q3EA 2PNFA 4Q3EA 2PBZA 2BM1A 3F6SA 4WZBE 3ZW7A 4RHFA 2COUA 1B93A 4GLFA 2VWGA 3CGGA 2RCNA 4PONA 3EWIA 3UFBA 4FYYA 4E22A 3N5KA 1G18A 4TZ0A 2FWJA 2QD2A 2X3UA 1CSEE 1KEEB 3QNMA 3TDMA 4P82A 3VZDA 5F5XA 1F06A 2H4YA 1MOSA 1N8KA 2J59A 4GPBA 5F33A 2ONJA 3VYRB 2O3QA 5EVJA 1SKYB 2IUSA 1HRKA 1V8BA 1LQ2A 3K05A 3VI4B 4F72A 1E2LA 1OB2A 1F1JA 4H7IA 4CLDA 3KJEA 5KU1A 2LDBA 4UEQA 4PNZA 3KELA 1F6DA 1N1MA 1KQGA 5K1ZA 1Q3HA 1UBJS 4TWZA 4Q4JA 1N7IA 2QMUA 5KC9A 1G8PA 3FWHA 1Q14A 1QX3A 2WIFA 3OF3A 2JIOA 2OHIA 1KAOA 3QPVA 5EZYA 3N87A 4K28A 3HFSA 3G0GA 5FFMA 3PXUA 1L4HA 1E9EA 1QGZA 1QFXA 1SULA 4HRAA 3U81A 5DI3B 4RDXA 2OXTA 3D8TA 5B5SA 1U1EA 4TV9F 4X1OA 4R2JA 3ORHA 5C31A 2QRMA 3RIEA 4RLHA 3TLMA 1RXIA 2ADFA 3ST7A 3G5LA 5CVVA 3BTOA 1ICEA 2ZJ4A 4OU5A 2HIMA 2JPDA 4X8HA 1YDWA 1O5IA 1K6JA 2BFPA 1BCRB 2Z9CA 4KO4S 4O4IA 5KYWB 1A4IA 1GL7A 4RMGA 1F20A 1N2HA 1UBHS 1SIWA 2D1RA 4JBGA 2JK1A 4Q03A 4UNSA 3ZBUA 3ZHQA 1TZKA 2R84A 2BHLA 1PJRA 1Y1LA 2B35A 4HEA6 1GCOA 1LBQA 4Z99A 3GRCA 4MKFA 2BISA 1KI9A 3GC6A 5BNFA 2D8AA 1MG5A 3ZDDA 5LBUA 1P7ZA 2FX3A 3UH0A 3B3GA 3EDMA 4URVR 1E32A 5K6AC 5LP6B 2V7PA 4XPZA 5DF1A 1KEVA 1DLJA 4B09A 3RTAA 2G36A 2QLBA 4AXBA 4DWOA 2CMKA 2MR5A 3V1TC 2Z8YA 4MWOA 3EC2A 4QOGA 4K3UA 4ML3A 4PHGA 4AY4A 3MMZA 1PJQA 4B75A 5J47A 9ABPA 5GM1A 2OTCA 2YMLA 2FRDA 4RWZA 4BB5A 5IAGA 1FJGB 1V9SA 2V45A 3RS3A 3S5JA 4HRVA 1JFRA 4UEJA 3ELUA 3HSKA 5CPFA 3PNKA 1MVNA 3IQFA 2NO9A 4IYRA 5F73A 3CINA 2EW1A 1GQQA 2FUG1 2P3QA 1PZMA 1TU4A 4XB2A 2JLZA 2B4YA 4O4HF 4KACA 3FCAA 1A7JA 1OC4A 3O7MA 2H9YA 3TTSA 4EDFA 3W34A 2VFAA 2E5LB 2A5GA 4WKOA 4BLOA 2PV0A 2H48A 2WU0A 1M5TA 5K9ZA 2VJOA 4V0QA 2OG1A 4AZ0B 1JT2A 1LRJA 3T0GA 1AF7A 2B6HA 4KIGA 1E2NA 2QXYA 3IPXA 4I7EA 1UKYA 4HS4A 3HJTA 5JI2E 1SA0A 3WOVA 1BYIA 3ZLVA 2FQWA 1MN6A 3OOJA 5EKTA 1E0JA 2AOXA 3JWGA 3OQJA 4KYUA 1I2DA 3K0CA 3KXKA 4RNDB 4UATA 4LBYA 2FFQA 3JV7A 2GSWA 1EVLA 5DLYA 3V4FA 4F9EA 4D4IA 1BU5A 1XQYA 1DWPA 1K06A 4UDYX 4CLRA 2JLCA 4MB2A 2PKXA 3D43A 4PPFA 1TTTA 5DYYA 3DE6X 4H3KB 1U2EA 4JJFA 4JY7A 1XTJA 3JQDA 4KUEA 3U16A 3U6BA 4D6XA 2AKEA 3KOXA 1IXYA 1NW8A 3BA1A 1TC1A 3FGPA 2IPOA 4RGYA 1Q5PA 4RIGA 3UJAA 4D81A 3OQMA 3ROKA 2VJMA 1N5LA 2IX3A 4BO6A 3A06A 1ODLA 1G8SA 1IM2A 1SU4A 3B7WA 3A9CA 5FORA 3GRKA 1YZNA 2I5PO 4AJKA 3ZDCA 1P2UA 3DLHA 2I2XB 3VTKA 3AJRA 3UKDA 2AQHA 3FOBA 5F2KA 3G0DA 3G2QA 2AN1A 3W8EA 1KIAA 1DQPA 3F7MA 4HXGA 3LOPA 1GPKA 1N0IA 2XDQB 3DB1A 3PB3A 2BKVA 1CF4A 1NOKA 3HNPA 2GCIA 1UBEA 5CU7A 5BUQA 1L3CA 3IAS1 1N1DA 4GI7A 1OMOA 3E3OA 3O8RA 2PS1A 3S68A 4RPCA 4IP0A 3N0VA 4OQNA 4V2UA 2FZ4A 3SZMA 2XCTB 3U3MA 4TSRA 1QVRA 2ZR0A 4C0AC 1AGYA 4QJ3A 1XTRA 3GX1A 3HQ4O 2ATIA 3PLRA 4L50A 4ZVLA 5BQOA 2LZ0A 3WWZA 5E4JA 1GCIA 1KFCB 5E1DA 4J0FA 1OOEA 4OM8A 1UT8A 2V96A 3HNRA 3O8OB 3UJDA 5KWSA 2CCGA 3U19A 2CWWA 3FUUA 1VLQA 1EG7A 4ZREA 3DO6A 3O3NB 4KUHA 1H66A 1JS1X 4EJSB 5C7LO 4GPD1 3ZQ4A 4Q37A 3TOVA 5JJ5A 3K6JA 4EP1A 1G20E 1ZUD1 4RZ2A 1V7CA 2ZYWX 4OXQA 4O4JF 2AK3A 4HDNB 2XPCA 1AURA 1E60A 1L7OA 2A9QA 1E4EA 2BFAA 2VPIA 1XDSA 4L3WA 3S44A 3PU6A 5HCIA 3TGPA 4XGKA 4HB4A 4N48A 4KZPA 4LJ5A 1ESCA 4M1WA 4WZAA 4BBPA 1JDVA 2JLXA 2ZYRA 4AO7A 2ZCUA 3S40A 4EW3A 4XI9A 3PWZA 3X1JA 5EJ6A 4N8SA 1BXKA 4Y2QA 2O20A 2Q4DA 2YY7A 4IQGA 5DYGA 4CLXA 2V9CA 1JDBB 2Q2QA 3QPAA 4N3CA 4TL9A 3P8ZA 5AKIA 5EMNA 2VDKB 2ZSIA 1NLUA 3BGWA 4IFTA 3UYKA 5ARCA 2OSBA 4BC1A 1YAJA 5EXPA 3IUBA 2GILA 4XVQA 1R2QA 2OECA 2RGYA 1HE2A 2HU5A 3R0IA 5FB3A 3BGVA 1G2OA 2IZZA 4QZVA 3T0FA 5JW6A 2WA1A 1TM7E 3PXAA 2CV1A 2IHKA 3EJWA 1N8SA 4RTLA 3OEED 4K9RA 1JDSA 1JU3A 3L7IA 3TUIC 4YRFA 2HLDD 4I1UA 1DG9A 1VJ1A 3CURA 4P35A 1BGWA 1VG0B 5GIPE 3ORRA 1N34B 1I1OA 1YGPA 3EOZA 3ZJYA 4UTRA 3H1BA 3OJOA 3T5MA 3UWMA 2H1LA 3PUVA 2BZGA 3IEUA 2PZLA 1QYIA 3SG0A 2B4TO 1Q0TA 1GCUA 2R1TA 3AERB 3TBKA 2C2YA 2QE7A 3BL5A 3WLJA 4N7JA 1CDOA 1EIWA 3AB7A 1FFYA 4FD3A 4K0RA 3ESCA 2D06A 4D98A 1JR4A 4K9KA 1Y6GA 3CSUA 4P3XA 3BN3A 3EUEA 3B1KA 4GLOA 4LZAA 1ZH8A 1A9YA 4QFBA 1DC4A 5SYAA 4LBWA 4LA4A 1WTCA 1RQ2A 2A7XA 1VB3A 3M81A 4E30A 1QUFA 1VE5A 4H1VA 3HDGA 2VOEA 3KE9A 4J0JA 4U9HS 4DSTA 3SEFA 2ZDGA 4GS5A 4QEKA 2YHAA 1JNYA 1N2BA 2P9BA 4X5OA 2UYGA 5D01A 2FSHA 4YAGA 3A1VA 3AUTA 3H5VA 1AVTA 2BDUA 3AONB 1KMMA 4UTZA 2WHXA 3QVMA 4U2DA 4WTOA 1VGRA 4DNOA 1XD8A 3GBSA 2C2HA 1JE1A 4JBWA 1ECCA 3ZE7A 2C9BA 4O5OA 1SH7A 1PWHA 4UCWA 3RVRA 3VAZA 1PR0A 3O4FA 3Q11A 3ZWMA 4QPJC 5CA0A 3P32A 2VK4A 3SKVA 4E51A 1CUCA 1P5ZB 3Q0EA 3QEAZ 1IE3A 2QD3A 2QD5A 2WTEA 1RYMA 4TYMA 5IAKA 2BGTA 4A36A 2JJ2A 4EZBA 4ZAXA 1DJNA 3H7AA 4UAVA 4CV3A 1AZLA 1AS2A 1BWQA 1IWPB 2GCOA 3PK0A 4V0NA 3T1HB 1Q57A 4KR3A 1SKQA 1N1GA 1ORHA 1Z0SA 1ZM9A 1NQXA 4AYTA 4ECEA 1NXXA 1EWQA 1WX1A 2RAUA 3FIJA 3KKQA 5CA0B 1AV6A 2FWRA 1YVUA 4HWRA 1ZP6A 4DLPA 3DB2A 1GITA 3C3BA 4DE5A 4J0EA 5IU6A 1SQ0A 1FUYB 2OWDA 5JXHA 1ARZA 3DF7A 1TLTA 2OBNA 4Y6SA 1GZ6A 1IONA 4RO0A 1I1QB 3W7VA 2WB4A 4EY8A 1JECA 4QPZA 2AG1A 1YB5A 4ERNA 1GGJA 2GM3A 4L6AA 3CLUD 1X39A 3GFPA 2GEJA 3H0CA 1ZGBA 2EGHA 1WHSA 2PZEA 5ESWA 1XNQB 2VPXA 1T6ZA 2R6HA 4Y98A 4PZYA 2HNAA 2BEUA 2AYYA 3D0RA 1QKIA 2FQYA 4J1TA 1K1EA 5LQSA 4AJPA 1XPOA 3LQFA 1L7PA 2OFFA 2X22A 1SXJC 1FP4B 2DHEA 1P4HA 1VG9B 1RD4A 1ZCAA 1ZJ6A 2QRPA 3V1YA 4YMHA 5B4TA 1NXPA 3ETDA 1Y6ZA 3WKEA 4KR6A 5F23A 1OI4A 3U1TA 3HE3A 3I73A 4HHEA 3GEBA 4NFHA 5I7AA 5AOCA 2FAXA 4K0KB 1FDSA 3L7DA 1DT5A 2C99A 3QXXA 4FYVA 1O1YA 4OI4A 3TTUA 2ZRFA 4Y8VA 1L7RA 4UDOA 2X8BA 1NUHA 4YTEA 5B1HA 1KOLA 1K8YB 4P83A 3CJQA 4I36A 4TT3D 1KI2A 2E87A 4BNGA 1QHHB 2ZJYA 2PUVA 4LNHA 2DRIA