1WRBA

Crystal structure of the n-terminal reca-like domain of djvlgb, a pranarian vasa-like rna helicase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
238
structure length
232
Chain Sequence
KYDSIPVSVTGPDYSATNVIENFDELKLDPTIRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIINHLVCQDLKTAYPKCLILAPTRELAIQILSESQKFSLNTPLRSCVVYGGADTHSQIREVQMGCHLLVATPGRLVDFIEKNKISLEFCKYIVLDEADRMLDMGFEPQIRKIIEESNMPSGINRQTLMFSATFPKEIQKLAADFLYNYIFMTVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords DjVLGB
publication title Crystal structure of the N-terminal RecA-like domain of a DEAD-box RNA helicase, the Dugesia japonica vasa-like gene B protein
pubmed doi rcsb
source organism Dugesia japonica
total genus 71
structure length 232
sequence length 238
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1wrbA00
4R98A 5L3SA 2FPLA 3QQ5A 4H1UA 5AR1A 1G8FA 1KY2A 3M6AA 4AYTA 2HT6A 3AKCA 5CB6A 4CYMA 4D26A 3TJZA 3SHWA 4Q03A 1ZM7A 3WYFA 4XWKA 4MDEA 4OBEA 4TLAA 4TZ0A 4A0RA 4QBHA 1NJGA 4US1R 3IIKA 5TV2A 4HYYA 3RRZA 2ZRNA 2QMUA 3ZQJA 2VQSA 1D9ZA 2D2EA 5JZVA 1C1YA 2PZFA 4I99A 1E94E 2J41A 2V7QA 3M0EA 4JBXA 3HYRA 1U8AA 4Z54A 2KWIA 221PA 1SHKA 1OH5A 4MITA 1T5IA 3B9PA 5EXPA 1NG1A 2WIBA 1R0ZA 4EJSB 5CJPA 2HF8A 2GJKA 2XZPA 2C99A 1SXJD 4KFTA 3R9WA 1KNXA 3GJ8A 1NN3A 2BBTA 4JJKA 5AJYA 2Q3FA 1NSFA 1LS1A 2GJAA 4B6EA 4B3FX 5FPYA 4DSTA 1J70A 2HXYA 4ARZB 4Q7MB 2R9VA 1BO6A 2Q3MA 4IVRA 1RVDA 1ZU5A 4KFSA 3CZPA 4B2PA 5IK2A 4YXWD 4PO9A 2YWHA 2QMOA 1S96A 4BUJA 3GCGA 4BFZA 1J99A 1W4BA 1W0KD 2CHQA 3I8XA 4M8NE 1AZTA 1RYFA 2J7KA 2YC4C 4C4PA 1NN5A 1JJVA 3RVBA 1DAIA 3R9IA 2IA5A 1ZNYA 1U0LA 5AK0A 1JAIA 1E1QD 1S3GA 2WICA 1P7CA 1XP8A 4M2LA 2YVUA 4NCHA 5DHAA 4LBWA 4DUGD 2ZUDA 4JZKA 1T5LA 2GJSA 3UG6A 4GL2A 2OLJA 4NCJA 1ZIOA 3A37A 1KJZA 2JJ2A 1EFRA 4XD7D 2MMCA 2QAGC 3M4YA 4XOIA 3VKGA 4NE2A 1GNQA 2I1VB 1DAMA 1CULC 1LF0A 1NN0A 2DFTA 2F1RA 3K0EA 1XJCA 4WVFA 3U6BA 4MRSA 5TXGA 3K09C 4FMDB 1YRBA 3F0TA 3U2QA 2HDNB 1R5BA 3QPWA 4LPSA 1EG7A 2IYTA 3LXXA 4QGFA 4JL5A 5KSPA 3EIHA 3WHLA 5M04A 1Z07A 1G4UR 1F5NA 2EWWA 2WWXA 1QHNA 1GTVA 1YZTA 5HE8A 2C95A 2D4HA 4X8MA 2R65A 5LBIA 1HTWA 5BN4A 1ZM2A 2GCOA 2WWHA 4P4SB 2WSMA 4DLUA 1H8EA 3MCAA 3D3QA 4OQFA 3WRXC 1QHSA 1GWNA 2ZJ2A 4M1TA 4DDVA 2B21A 1GKYA 3PG5A 4BASA 3AVVA 1XMSA 3RS2A 2GEDA 1HY3A 3U7FB 2G3YA 1U8ZA 2FA9A 2H7VA 5CIWA 4F4IA 2WWFA 3U6KA 3WMGA 4DCNA 3U4QA 1ZW6A 3CIOA 4LV5B 2Q3HA 1AS3A 4D0NA 5ANRB 5JJIA 2L0XA 3ECCA 4QNRA 4KAXA 2CCJA 1TU3A 3WYGA 1OXVA 2ZJ5A 5SZHB 3AP1A 2I3BA 4TSFD 1U2RA 2BEJA 4MYCA 4GI7A 1JR3A 1JXOA 1MRSA 1WA5A 3QY0A 4RSGA 5EP3A 3VU9A 1MO6A 2J1LA 2IL1A 4C2UA 2VHQA 1TPZA 4ZIRA 4TZ6A 1TUIA 2QGNA 4MUAA 2O8FA 621PA 1T3HA 3NXSA 2XXAB 2J0UB 3K70B 2CE2X 1IHUA 2GAOA 4QM7A 1HURA 2RGNC 1CJKC 4J0QA 4RCYA 1LV7A 1W44A 3N2IA 1EK0A 3EWSA 3LDAA 1Z2CA 2G6BA 1CXZA 4MRNA 1NKSA 1U81A 4UXIA 4YC7A 2W6IA 2VSFA 3THXB 3LX5A 4GT1A 4DIEA 1RRFA 2O8DA 5JMTA 4KFRA 1C4OA 3C14C 1NBMA 2QTHA 4JT2A 4GMDA 2ZJBA 3KQUA 5J4VA 4TL7A 1MO3A 1A2KC 1G6HA 4P4TA 3AF2A 2VP6A 1AM4D 1W0JD 4IOJA 4MGYR 2WHXA 3O47A 1ZM9A 4OHVA 5CM9C 4B32A 4JS0A 2AX4A 2QZ4A 1KSHA 4BFVA 3CNNA 3AF1A 4EJSC 2EYUA 3NHBA 3NBFA 3S1AA 2IS2A 1P2VA 2K5UA 5DHFA 1G3IA 4NPHA 2C04A 5E7JA 3ZD7A 3SYNA 2C03A 2GESA 2D7DA 3NBZC 4IXNA 2FPMA 3BFKA 2YWGA 1T6NA 3LRPA 4LC0A 5A4JA 4BFSA 4BFXA 2IEYA 5CITA 5KPJA 1JPJA 2PEZA 3TUZC 2W2VA 3THYB 4D80A 2IHYA 4ZKDA 1PV4A 5DISB 3B1ZA 3PCRB 4LI0A 2D2FA 4PX9A 1E2LA 2PCLA 1E98A 4B47A 1QVRA 1X8KA 3H86A 2GCNA 1Z8FA 2QORA 2V8OA 3GFTA 3GFOA 4NKRA 4ZV4A 4JLOA 4TL6A 4W9MC 2TMKA 4CEIB 2V1UA 1JR3E 3QPUA 4MGZR 5FBLB 3C16C 2IYZA 2VF8A 4A9AA 3DHWC 1E2DA 2AR7A 2VP2A 5K8LA 1P9NA 1RZ3A 1SVWA 1VCMA 2H18A 4Q4HA 4XVRA 5SZJA 1CS4C 2GJ9A 4N0EA 3O8BA 1G20E 4LHWA 4AK9A 2WOOA 2A3RA 4FXPA 2JASA 3H84A 1KDPA 2QNRA 1Q1EA 4MRRA 1KI7A 3E1SA 1KSGA 3B1VA 1AIPA 3U60B 4M1OA 1II8A 3VFDA 2P3SA 1F60A 1GL7A 1YR6A 5EE9A 4C0AC 2ZRKA 4N3NA 4BLTA 1V5WA 3E70C 2QAGA 4KCGA 1FOEB 4GPTA 1KMHA 3AP3A 3Q72A 4L9WA 2X2EA 1NBME 1XZQA 3K09A 2AKYA 3VMFA 4AKHA 3LBIA 4JLDA 1DS6A 1F2TA 1GIAA 3ZDQA 3AVOA 1NP6A 2ANBA 4NYJR 1NL3A 5E4FA 2XZOA 4WAUA 2ZPTX 3IO3A 3PVSA 3VR2A 1FUUA 3PUXA 1MT0A 4II7A 2QM8A 1ZCAA 2LWIA 1XTQA 1T8TA 2F6RA 3DL0A 2QROA 3RLFA 2V6JA 5F9FA 1ZNXA 2FFHA 1FX0B 2WWGA 4A2PA 1H8HD 4I81A 1D9XA 3EWAA 4KI0A 3CPJB 2AXPA 2OLKA 5KNCA 3EPJA 4Q9IA 1PZNA 4DB4A 3PFIA 4TWZA 3SNHA 3QKSA 1YVDA 2ZYTX 1E2EA 1GG2A 4UNPA 5B64A 3EARA 2OCPA 4NYMQ 4Q4AB 3TIFA 3QXXA 2UKDA 5HKKD 4QRHA 5JCZA 2CVHA 2A30A 3W3AA 2IEZA 1DAEA 2JDIA 4LHVA 4OHZA 2B8TA 4C7OB 1L2TA 3NHAA 2N1BA 1E2IA 3LBHA 1G8PA 3CONA 3T34A 2A5GA 2ZI7A 2IUUA 1W5TA 3IDQA 1K8RA 4S2EA 2VP9A 3MLEA 3T06B 3VKWA 2BEKA 2QMHA 2ZVPX 4FMCB 2A5DA 1I2MA 1UFQA 2XGJA 3OEHD 2AD1A 2IHBA 4FWTA 1KYIA 2JLSA 5EXTA 1JEEA 1G1MA 1MH1A 5FOVA 4Q47A 1US8A 2WJJA 4HAYA 3SDZA 3TSOA 2AKAB 2O0KA 4IJMA 4Q9KA 4DLSA 2FSGA 4M53A 2NPIA 5F3WB 1OIVA 4TMKA 4IKEA 3B1XA 5E7IA 3KZ1E 3H4MA 2LKCA 2YOHA 2UZ3A 1P3JA 3CO5A 1OV4A 3SJZA 4PO1A 5IF9A 2ZSBA 4UQOA 1R8SA 4B48A 3DEFA 4TT3A 4WXPA 421PA 2J7PA 4D0LB 1OHHA 3BERA 2CMKA 3B9QA 3PITA 1BIFA 2VYFA 1TNDA 2WPDA 4S35A 1F2UA 2C96A 4AKIA 3G82C 1VMAA 2NQ2C 5HR5A 2FDCA 1E6CA 4TQAA 4F4CA 1S4QA 2JGNA 2GXSA 1CJTC 3JVVA 2BMJA 1LY1A 4DLYA 1G5PA 4EIWA 3GLGB 4DEXA 4ASUD 4RD4A 2VRWA 1XB2A 1GKUB 1G5RA 3EPHA 2W6JD 3W6NA 3ZS8A 1KDTA 1E99A 3I92A 5TVKA 1QF9A 1ZM4A 4IRUB 3AVXA 1A7JA 2ZS9A 4JMPA 5F9HA 1Z63A 1E96A 4DT1B 3UPUA 4QGGA 2C9YA 4EPYA 3SS8A 2X77A 1RC8A 1SXJC 1SQ5A 5EE0A 4HB2A 1RJ9B 1DE0A 3AVTA 2NGRA 4PAMA 2ZVQX 3QXSA 2VSXA 2XEXA 2FGKA 4CEHB 1XZPA 4ZCMA 3ASYA 2RMKA 3IBGA 3LV8A 4ARZA 1YZGA 2BM0A 5JI3E 4FI3C 3GJXC 5EZ5A 1Z0IA 2F1IA 2GVDC 2QY9A 2BMFA 3FVQA 1Q3HA 1FMLA 3Q7QA 4XWOA 4DDWA 5KDDA 5CDFA 4D6PA 1CJMA 4EFNA 2WM9B 1VCOA 3I4LA 2ZE5A 1TX4B 3FYHA 5DSZA 4DLTA 2YHSA 1AS2A 4Q7KA 4HAXA 1KO8A 2ERXA 1MO4A 1IM2A 3RS0A 5BYKA 5B57C 4LK2A 4V02A 2HYIC 2JJ1D 1VTKA 4JLMA 1HUQA 4TYWA 2NMVA 1JALA 2PMDA 2W0SA 4MKGA 3DOEA 4OK6A 4A2QA 3I72A 4B71A 4PC7A 1YE8A 4M1WA 3OHMA 3N5CA 4ESVA 2WWWA 5CYPA 2V54A 4EPXA 3SI7A 3W6PA 1R4AA 4B74A 4OI0A 4ABYA 1R0YA 2UVQA 3UK6A 2WZQA 2GETA 2W00A 2ZS7A 3ZLJA 5FI1B 1D8TA 2PX0A 2JIZD 4JYCA 3A8TA 4FCWA 1N5LA 2YV5A 1IN4A 3LO5A 1OXUA 2ZAMA 1U8YA 1XU4A 1J90A 5JBQA 1ONBA 1KK1A 4LY6A 4HUQB 2ODEA 2J0VA 4MKHA 1JEDA 2WSSA 5FOTA 2YNMA 3ZZ0A 1G8HA 1YU9A 1XJQA 2X8AA 4P4SA 4A0GA 1FW6A 4F38A 4B34A 4DCTA 3PUVA 4TMVA 1AQYA 3KFVA 4QBIA 1VECA 2GBLC 1PLJA 2BKUA 3HJNA 2HCJB 3A1VA 3LD9A 3NH6A 5K8UA 4K8OA 4A8JB 4IOLA 2J0SA 1FQJA 4KHZA 2CK3D 2A9KA 3LLUA 1E2KA 1R5NA 2B6HA 4E22A 4GDFA 5TARA 4HLQB 1ETUA 5EP2A 3ZZTA 2EFCB 3B1WA 4KVGA 2HUPA 4ZPXA 3RWOA 5CDFE 3LXRA 4YMUA 4AD8A 4CIDA 3LWNA 3TVDA 3CUEF 2I4IA 2Q0HA 4O2RA 4ITRC 1E2QA 3RS5A 2ZREA 2WAYA 1XXHE 1P5ZB 4P31A 3UIEA 3FB4A 4RD2A 4M0LA 4LPKA 4PANA 4TLCA 1GNRA 4KJZA 5JSZA 3I61A 3OAAD 2XAUA 4YONB 1X6VA 3KB1A 1QHXA 4KU4A 1Q0UA 1DVRA 1NI3A 1SKQA 2REBA 3LAWA 5D3MB 2EFHB 1KI2A 3ZIAD 2XXAA 2J0UA 4WZAE 5CK5A 1Z6XA 2QBYB 3EZ6A 1VHTA 1E0KA 1Q1BA 2JLXA 3DDCA 4Z1MA 2ZRHA 1OFIA 3KJHA 4IFBA 4L9SA 2C9OA 5LD2B 3HWSA 4L4UA 3CF2A 4UXJA 5DO9A 1KI6A 1S8FA 2ONJA 1BOFA 2IYLD 2FPKA 1J2JA 1KSFX 5LB2A 1NMXA 1U0HC 2GZDA 1X86B 5TY0A 1OH6A 2FEMA 1ZD9A 3RANA 3B6EA 2QP9X 2BWJA 2OFOA 4XH9B 4CEJB 4B3XA 2OILA 3K9HA 4TMZA 3SEAA 4EDHA 5FPHA 5IHPA 1D2EA 4RZ2A 1M1YE 4Q18A 1X1RA 1XWIA 1W36D 2HJGA 3EXAA 3MAAC 4R7ZA 3GLFB 1E9FA 4QC2A 2QSYA 1HYQA 2OBMA 1JAHA 1S9HA 2RGBA 2EWVA 2IUSA 1VG9B 2B7BA 1E2NA 4JVNA 2ZE8A 1W5SA 4BFYA 3AUYA 1TAGA 2P0EA 3G0HA 4PR0A 2QA5A 1OE0A 1COWA 2NIPA 2NO9A 2XNSA 3E2IA 1NMYA 3THYA 3OFNA 3IEUA 4CF7A 2NO7A 4I1SA 2XNDD 4PXAA 4QHSA 2NZJA 4JIMA 4KYIB 4LV6A 4Q5IA 1J8MF 2AXNA 1WDTA 1AKYA 3NC0C 1MR3F 3FFAA 2PX3A 1XPUA 1ZC3A 3MMPA 1KOFA 2BKEA 1OKKD 2FOLA 3TNFA 4JYBA 4WBSA 4TL9A 4CEIA 4URWR 2CBZA 2O8BB 1IXRC 1E4YA 4URXR 1X3SA 2OEPA 3KL4A 1JXMA 4HATA 3B7GA 3BXZA 1XTIA 4TQUS 2HLDA 4Q9LA 2QQEA 5DN6D 4HSEA 1IY0A 4D81A 3TUIC 1GZSA 5JCPA 3ADCA 3CF6R 3DPUA 3FMOB 3LW8A 1KO1A 4NU0A 1SKYE 4TLBA 5KNBA 1OFHA 2ZRAA 2EVWX 2QT0A 3H2YA 1BH2A 2Q21A 5HE9A 1N6HA 3BH7A 1D5CA 1N0VC 2BBOA 3C5CA 3KTAA 3AKEA 2DR3A 3DKPA 1Q22A 2IXGA 2ZROA 3KKMA 2IS4A 1IN8A 3KQNA 4RFVA 2R8RA 3QVVA 1AQUA 1S1MA 2JJ8A 1ZVQA 5D3QA 4NCIA 1W2GA 2OT3B 3BRWD 4XSGA 1ZP6A 3LNCA 1GKIA 3FKSA 1CIPA 2BIFA 4A8JC 4Q1CA 3WRYC 1IAQA 4OJQA 5EP4A 2Z4RA 3WP0A 4RFSA 3EPLA 1SVMA 2RH5A 3BBPA 1WBBA 3BB1A 2ZJAA 3T1QA 2O8CB 1RRPA 3NTUA 2GBLA 3ZGXA 4NYMR 4GP7A 2IUTA 4Q4AA 3U7GA 2FN4A 3IEVA 1YR7A 2CNWD 2IBMA 1KJWA 2BDTA 2W58A 3EG5A 4PAQA 3U3MA 3MSXA 3QSYA 3UMSA 4C7OA 3VX4A 2OBNA 2PBRA 4LUCA 4UNQA 3B2EA 4Z51A 2QL6A 1ZYUA 2QQ0A 2QI9C 5AUQA 4LHXA 2FF7A 1D2NA 1DADA 2C2HA 1UF9A 1E9BA 2WKRA 1E2PA 4E09A 5JS8A 1R5OA 2C98A 4JLKA 3RSLA 4QFMA 4RD6A 3K53A 2QE7D 2JLUA 2V4ZA 3U3JA 1ZJ6A 5FR2A 3A4NA 3TAUA 4NONA 5CLQA 5C2JB 5LD2C 1FP6A 4MA4A 3WXMA 4EPVA 2GK6A 3AF3A 4HUTA 3A58B 2JATA 1U99A 4A6XA 4RZ3A 1E9CA 2PZGA 2ZSDA 3GLIB 3L8YA 4BRUA 2BJWA 3AKYA 3OEED 2CDNA 4Y0VA 4TMWA 4B3GA 1YZLA 4BGDA 3O8RA 2PMKA 4GNKA 1G3UA 5FFMA 3MJHA 1VHLA 1I2DA 4TLDA 3GLGA 4LJ5A 4B44A 5FPSA 3EW9A 4NBSA 1KK2A 4MYHA 4LC1A 3VKHA 2H8KA 3TW8B 1LF5A 1VG1A 2ZYVX 4Q00A 1CLUA 3O8DA 2YWFA 1E1RA 4LOAA 4DT1A 2HXSA 1GM5A 2EFEB 2Q9CA 1ZNZA 5FOXA 4E03A 2GF0A 2XTMA 1XD8A 1X8JA 4CEHA 1KK3A 2PJZA 4NYIQ 3EZ2A 3NBXX 4ZKEA 4IVPA 4V0OA 2ZXUA 1Z6GA 1N0UA 1XNJA 2BCGY 1FTSA 2OBLA 1VKJA 2R44A 4GMXA 4M9XA 2QM7A 4Q66C 5EE1A 5GJWC 5KO2A 2QPTA 4AYWA 2MMGA 4MH0R 1E9SA 1II0A 2E9SA 2ZQ5A 2CL7X 2QEQA 5BXQC 5F98A 2IXFA 4UKDA 5FBVB 1CR4A 1K5GA 5KHOC 5E95A 2GKSA 2H17A 1Z47A 1R10A 4OL0A 4IDHA 2ZUCA 1QZXA 3P20A 4OHWA 1ANKA 1ZBDA 4PPGA 3NVAA 1EXMA 3PEUA 3NEYA 4Z8YA 3IO5A 1K6MA 4DCUA 2WTUA 1U94A 3NG1A 3AF4A 4W5WA 5AWFC 3VR6A 2ZSAA 2FMXA 3PUWA 5BYJA 5DLQC 1Q1ZA 8OHMA 3GJ0A 3W3ZB 2V7QD 3TGPA 4D4KA 2MSDB 2WOJA 2F1HA 3LBNA 4W7SA 2WKPA 5KSOA 4C0HA 2WAXA 1U90A 4DDUA 1E2MA 2QAJA 1NMZA 3A6PC 1E9DA 3F3YA 2ZYUX 5JI2E 3ICQB 2VP0A 2PT5A 1TQ6A 1U9IC 4DLRA 5BWMA 3LX8A 4HUQA 4DXAA 4CT4B 3ND9A 2P6UA 5KDOA 4KBGA 4HLUC 4NL4H 2P65A 3B1YA 3UANA 1RKBA 1UEJA 1KI1A 4OK3A 2PZEA 1XCMA 3WP1B 1ESNA 1P72A 5P21A 4A8JA 5IK2D 2CL0X 1N5IA 2GZAA 2SHKA 4FMBB 4D4MA 1CEEA 5FUYA 1JQJC 2OM2A 3CBQA 4KLZA 4PO8A 4I1UA 4MKFA 4V0LA 2DB3A 4MKIA 1DELA 1P2SA 1Z2AA 1KI3A 4PHGA 3TSZA 1ZNWA 3OE7A 3NBYC 2D62A 3Q7PA 1N6NA 2BVNA 3QKTA 4XVQA 4IDOA 4ZDKA 2RB4A 1GVNB 4JL8A 1PJRA 3KFXA 1UKVY 1CRPA 4ZDIA 4B6FA 4ZDJA 2BHRA 4PQRA 5EQTA 3TRFA 4A36A 2O5VA 1XEXB 3ZQ6A 1I4LD 4HLDA 4LSGA 1N6IA 4PTLA 4EPRA 2JJ2D 1EFRD 2BV3A 4LBZA 3PV0A 3IKJA 4WIAA 4C2TA 1GL6A 5E7MA 2YZ2A 1SXJB 5K8TA 3QBVA 1SZPA 1Z83A 1DTSA 2GEUA 1E0AA 4IDPA 2ANCA 4X8OA 3GJ3A 4TTQA 2QG6A 2HV8A 1HT2E 5D3MA 4WZ6A 3UG7A 4F4JA 3MUFA 1W4CA 1KI9A 1XCPA 2WJGA 4LYJA 5K8IA 5DYIA 2PLFA 4L15A 3X1YA 2UZIR 1ELOA 2GTPA 3IHLA 2N42A 2B7CA 4PZYA 2QBYA 1XEWY 2IF0A 3HP1A 4AY2A 3EIQA 1E69A 1G19A 1E32A 3I73A 3THOA 3SQWA 4BZPA 1ZUHA 4C3ZA 2GNOA 4M1KA 4DCVA 2HF9A 4LJ4A 2VHJA 2OG2A 1CBUA 3U3KA 3KKOA 4M22A 1FPMA 1OFUX 1H8ED 2YYZA 3AV0B 4MRVA 1JB1A 2YC2C 2YWEA 4Q1BA 3HU1A 5KPDA 4XVUA 3HPRA 4CEJA 3X1DA 4KVAA 2ZITA 3ICEA 3K0SA 3CM0A 2FE4A 1TTTA 2FEOA 4Q4JA 3R8FA 3GLFA 1BYUA 2WJHA 4RJLA 2OFWA 4A15A 4QM6A 1QVAA 2W2XA 4LX0A 3FMFA 2W2TA 3FFBA 5JHGB 1NLZA 1SVIA 4OK5A 2G83A 3U3OA 3X1ZA 1VDZA 1SULA 5FI0B 1ZM3A 2RGDA 3ZS9A 1G7SA 2FWRA 2FJUA 3A1SA 3BJIC 3QF4B 3CRW1 1E79A 2BBWA 3AB3A 1JQLB 1DARA 1BMFA 2IT1A 3DZ8A 1JR3D 2CLDX 5TMPA 2A2ZA 4FIDA 4PHTA 2DYKA 4I1OA 1IXZA 1OIXA 1WQ1R 2VHCA 1LS6A 3OZXA 1SVSA 1MOZA 1RW4A 4DWJA 1RFLA 4JVMA 3AQ4A 2O8BA 5J40A 4G5OA 1CP2A 2Z6VA 2C77A 3Q5EA 1X8LA 4B76A 1M34E 1W2HA 3EPKA 2W6ID 1S0UA 3KUDA 4QJ4A 3AVPA 3L2OB 3ZVRA 1KY3A 5L3SB 2WWIA 5FTLA 5DNYB 5L3QB 3IQXA 4DLVA 1D2MA 2BM1A 3KB2A 1BS1A 2G88A 3A4LA 4OJKA 1E9EA 2NPFA 5J4LA 2GXAA 5FTNA 2O0HA 1NBMD 1P62B 3SBEA 3CNOA 1HT1E 3B85A 5FL7A 4P33A 3MRSA 2BC9A 1UBGA 3R7WB 4JBYA 4X8LA 1G17A 5GJVC 2FNAA 1DOAA 4URVR 2OCAA 3ONWA 5JWOA 2FSHA 4PSVA 1M74A 2ZI9A 3IIJA 2RGXA 4QOSA 1KHTA 1HQCA 1YKSA 1XJ0A 2J59A 3PIRA 1GSIA 1YR9A 4LJ6A 1SVOA 4NHOA 2GZHA 5EE5B 1LTQA 3GLFE 1DAGA 2RGNA 1BYIA 4DSUA 4NZYA 1PUJA 3D31A 1A4RA 3QBTA 1T0HB 1OSNA 3EC1A 4QGHA 3RWMB 4BLPA 4DLXA 4L8GA 1TL7C 2PL3A 1J7KA 4OQNA 5FL3A 1IQPA 4WW0A 3SR0A 1N25A 3N2EA 4G0NA 1HH4A 2CE7A 3A36A 5AJZA 1N3BA 3KDSE 1ZIPA 4O2LA 3T15A 3IILA 2O8CA 3B5JA 2PLRA 3L0PA 4A0HA 4PC6A 3LW7A 3LY5A 2DPXA 2AK2A 1KIMA 2VIIA 2JEOA 4LYHA 1M7BA 4MUBA 3EASA 3I1FA 2IW3A 3OESA 4NP6A 3RRMA 3TBKA 2CXXA 2ZRDA 2OCBA 3BD9A 5KTYA 2W83A 4EJSA 4RKFA 121PA 4AI6A 4OQMA 2H16A 4TL8A 3QUSA 2CLCX 3U5ZB 4P32A 1JJ7A 4QGAA 4FD2A 4DKXA 1I4DD 2J87A 2XB4A 1MABB 3T35A 4GBMA 5FPTA 2G77B 1G3MA 1XEWX 1KTVA 2P2LA 3IUYA 4ON9A 2Z0MA 4M9SA 3FTQA 3P4XA 1WXQA 2DWOA 2XJ4A 4O3MA 1WE2A 3TAHA 4IFEA 2REXB 3BB4A 1S3SA 4Z8XA 4TLEA 3WY9A 4PHFA 521PA 3ZVLA 2ODNA 3AP2A 2AWOA 4BFWA 5J4KA 1UJ2A 3GMTA 3CRQA 1KI8A 1D6JA 2V9PA 1BMFD 3TLXA 3GLIA 4B3BA 4C0LA 5A5GA 3BFVA 2VLIA 2GAAA 2FFAA 1GRNA 2AD5A 2LKDA 1G64A 4P3YA 1EWQA 1A82A 1II9A 1KZ7B 2ZE6A 4KBFA 5J4YA 5J47A 1XD9A 1R7RA 4B73A 3VHLB 2HT1A 1NVUQ 1P9WA 2XOKA 1BKDR 2NZ8A 3W9YA 4EFLA 1XTJA 3PUYA 1OYYA 2VHTA 4KLNA 4LDJA 4A0FA 1EWRA 1JPNA 5HZHA 5GJCA 2OO7A 1SVLA 2OAQ1 3W6OA 1KK0A 1EFCA 2VP5A 3NWJA 5DE3A 3T5DA 5KU1A 3C4JA 3TQFA 4BLOA 4UNSA 1M7HA 3GEHA 1M2OB 5TDHA 4JLJA 2J0QA 4A1FA 1QRAA 2JDID 5JRZA 1GDDA 3D8BA 1GILA 1G7CA 4TYNA 3JZAA 4HDOB 2PH1A 2J3EA 5FH9A 5FR1A 2P6RA 3BOSA 4NYIR 2KB0A 4B3DA 4WOPA 5BQ5A 1CR1A 4G5GA 1G41A 1W1WA 2VH5R 2EU8A 2KSQA 2E1RA 1C9KA 2OCYC 3LA6A 4PHHA 3I8SA 1ZCBA 4YMSA 5SZIA 3WYAA 4I4LA 3VU9B 2B92A 2HJVA 2WMOB 5EXSA 4DB2A 4NMMA 1XTSA 5DGXA 5LB4A 4A2WA 4EQ6B 2N46A 4ZIRB 3BK7A 3T61A 2H1LA 4E07A 3ADKA 1S9DA 3EZ9A 2GEVA 4RD0A 3WBJA 4TT3D 2R6CA 4AG5A 2J7PD 1YZNA 2ZS8A 2IYWA 1GITA 1OHHD 3K9GA 3QG1A 4TTRA 5DI3B 4R9UC 3H1TA 2ZETA 3MFYA 2WPDD 4D25A 2XSZA 3GJ7A 1DAFA 2D3WA 3P4YA 3WNCA 2RAPA 1ZAKA 1KMQA 5G3YA 5A0FA 1Q20A 3B13B 5H70A 3SYKA 2J46A 3JZMA 3TUJC 3GLIE 1P60A 2DHRA 1WCV1 2J9RA 1QHYA 3PEVA 3MD0A 2DY1A 3VTKA 3VQTA 3QE0A 1XEFA 3AKDA 4BLQA 2QMEA 1YR8A 3HYTA 1Z3IX 3B82A 4PQFA 3MWJA 4EKDA 5JWRA 1W7AA 2VEDA 3EC2A 2VF7A 2ZYWX 4AG6A 1IN6A 1EFHA 1O3YA 4OQXA 4UJ3A 5AJXA 1P4SA 4BEBA 4AYXA 4R2IA 4QJ5A 4IOMA 3THXA 1Z22A 3H0KA 4O25A 4HAVA 2ZU6A 1SGWA 2A5FA 3EA0A 1WP9A 4HI0E 5FUXA 3A1TA 2QENA 2ZU0C 1XDBA 2X19A 1KO4A 2FH5B 2ZRMA 1FUKA 3CPHA 4WA7A 3DZDA 1UKZA 4L16A 4HLCA 3KXIA 4HEJA 4BFUA 3WHKA 4V03A 5B30A 3ZZUA 1PVOA 4FINA 1FQKA 4K46A 1YQTA 1IJFA 2R6FA 2ZI3A 3NH9A 1ZC4A 2EYQA 3KQKA 4QL3A 1QG2A 4AKEA 1F6BA 3QG5A 1G18A 4GP6A 1KKLA 3KKNA 4AKGA 3AVUA 3ADBA 2CJWB 2RGAA 1GL9B 1XEXA 1ZMXA 2IXEA 3HPQA 4G5RA 4LJ8A 3DVLA 2ZRIA 4H9GA 5F2EA 1NRJB 4DLWA 4BQSA 3MWYW 3QENA 2KE5A 5IDVA 2QPAA 4MQBA 1SXJA 4TYYA 3BAFA 1L4UA 2G1KA 4MYUA 1AGPA 4QBGB 1TUEA 1XMIA 2V1XA 3CW2A 4XWAA 5FOSA 3CB4A 4ZI2A 1UDWA 2F3TA 5C1BA 5H68A 5BW8A 1HA3A 2NO1A 3EX7C 1AK2A 2VL7A 4HB3A 5FBRB 1AN0A 4JKYA 1T3SA 3TR0A 4X8HA 1JBKA 5EUQB 1P9RA 3SU8A 4EAQA 4YXWA 2R6GA 4DC9A 5HCIA 1XMVA 4PPNA 1W0KA 4Q7JB 3LQRA 3A1WA 1MRNA 2JA1A 4N1AA 2E87A 2WSSD 3I5YA 3C41J 3RRNA 4URUR 1DPFA 1FTNA 3L43A 4LV8B 4LRWA 1VG0B 4MGIR 2AL7A 1E1QA 2F9LA 3KJGA 2ORVA 2P67A 5BN5A 3JVUA 3REGA 4DUGA 2VSOA 4AIIA 3QOFA 2EQBA 3HU2A 1DEKA 2QRZA 2ZRBA 4IXMA 4EPTA 3T1OA 1B0UA 3IIMA 5IT5A 4D2IA 2Q9AA 4XD7A 1OYWA 2ZI5A 1Z28A 3K1JA 1NSTA 5C46F 2D7CA 3VAAA 4G5SA 3Q5DA 4KFUA 1IN7A 1E4VA 4M9QA 4L5BA 4Q02A 3GEIA 4YMWA 2IWRA 4AURA 4NDZA 1R2QA 1NKTA 2EFDB 3QF4A 1W49A 4FCTA 5L3RA 4UNRA 1FZQA 4D82A 4B3CA 4RZUA 2V3CC 3SQXA 4GRAA 2ATVA 2ZRLA 3D7MA 1KKMA 5JWHA 3SBDA 1FX0A 3VNVA 821PA 3RS4A 1OB5A 5SZKB 4QJ3A 5JJKA 1FNNA 4M1MA 2DCUA 4PFSA 3K70D 1Q44A 4GOJA 1XX6A 1CTQA 1A1VA 3FWYA 4D4LA 1VYUA 1ESMA 2GXUA 4MRPA 2ODWA 1YJ5A 1R6BX 1SXJE 4Z1MD 5L3VA 3Q8XB 1LNZA 3L8ZA 4HAUA 1MV5A 2FV8A 4LJYA 4E5UA 2FX3A 1TEXA 4QHYA 3CX8A 4PZZA 3TSWA 5L3QA 3RC8A 1RE0A 2NO0A 4FN5A 3OIUA 1B23P 2BJVA 1Z0DA 3LVRE 3TVTA 4KITB 3IQWA 1F2UB 1N2CE 1WMSA 2CHVA 1QHIA 4K81B 4B43A 2RGCA 3PXGA 3OIWA 4JLPA 1EX6A 1AS0A 2IS1A 5KNDA 3R7WA 3DO6A 1OH7A 3FKQA 2QU8A 2RHMA 1YZQA 4GOXA 2YKGA 5GADl 4TSFA 5JECA 3BH0A 3HR8A 2GILA 1G7RA 3VR3A 2AFHE 3SJCA 2DFLA 3KUCA 5ELXA 3TK1A 2FZLA 1CU1A 5FTJA 3FMIA 3OIVA 3T5GA 2H5EA 3DOFA 1QHHB 1DO2A 2D06A 1ZINA 5B2ZA 4B75A 3W5IA 1COWD 4BLSA 3REFA 4HAWA 3OFND 4UJ5A 3K9NA 4LGMA 3GLHB 1M6NA 1ZD1A 1KO5A 3K0CC 3ZVMA 1CR0A 1Y63A 3UMFA 4HDQB 4Q48A 2GJ8A 3CF0A 3VHXA 4DEYA 2ZRJA 3WMEA 4GZMA 5UKDA 4G3XA 2REOA 4D0GA 5GJBA 3DM9B 2OESA 3OIYA 3CLVA 2XITA 1AKEA 4YLGA 4LZZA 5AJVB 3KQLA 3FOZA 1E0SA 3BS4A 2QGZA 1RPZA 1KZGB 1XD2B 2ONKA 1W0JA 3QIAA 1Q3TA 3QEJA 1NG9A 2IYVA 1XXHB 2BOVA 4HDCA 1W36B 3FGNA 2HLDD 2VPPA 4U5XA 2OAP1 4LBYA 3KX2A 3SJBA 3P1JA 4TMTA 1QBKC 2MSEB 2F43B 2ZJOA 3CRMA 4KO8A 2ZTSA 2FG5A 2WBLC 1N5KA 1RJ9A 5HPYB 1TEVA 1MABA 4JLNA 2RHDA 2IYUA 5CJ2A 1OW3B 2A7QA 2X2FA 5CYOA 5C4MA 4HZUB 2KJQA 3L82B 2P6NA 2OXRA 1M7GA 3V4FA 1XFAA 2WIAA 4MDFA 4ZCIA 2GDJA 2DBYA 3C7KA 4PPQA 4DLZA 1YRAA 1EESA 3KXKA 2NOAA 1GRRA 1OT3A 2YOFA 4DRZA 1J8YF 4URZR 2EFGA 1OJLA 5HCNA 1Z0FA 3BB3A 1G3RA 1LB1B 1CJUC 1Q1QA 4RD3A 3THWB 5FBWB 3U44B 3LLMA 4US2R 3FKSD 1UKEA 2QPOA 3PENA 5EXXA 4C0SA 1DBSA 2F7SA 2PCJA 5TB5A 3W8NA 5HZKA 5JFGA 1KI4A 2XTZA 4GZLA 3T1TA 1T91A 4H1VA 2A5JA 1HV8A 2DFKB 2XX3A 3FHCB 3IPXA 1GAJA 2Q9BA 2CCKA 4M1SA 3OF5A 1CR2A 2ZUBA 4M9ZA 1VCNA 4QKQA 4JL6A 4NH0A 5CK4A 1H65A 3L0IB 3MG9A 4QHTA 3TMKA 1NLYA 3QKRB 3AVYA 3C15C 1WF3A 3R9XA 3GLGE 3I32A 4G1UC 4KSCA 4Q21A 4DZZA 2H92A 1T4GA 3N70A 3WMFA 1P2UA 3X1WA 3BC1A 1QHGA 3B8HA 4CZ2A 1Z0AA 2ZR0A 1R0XA 2JLZA 2Z5FA 4OQLA 2KBEA 4BRWA 1E2GA 1KSJA 2BMEA 1DO0A 1SVKA 3MWKA 4OYHA 3CH4B 4BPBA 1OLOA 3PR1A 2ZAOA 5J4HA 4Q19A 4TYQA 5JSZB 3MJRA 3CKLA 4EQ6A 5DI9A 3QXCA 3K0AB 5JHHB 3W90A 4GSYA 1GNPA 1WB9A 1H8HA 2V6IA 4DVGA 4KV9A 3WBKA 3EIEA 2IYQA 3E5HA 4W5JA 5FBQB 2AWNA 2WMNB 3EZ7A 3VX3A 2YOGA 2FGJA 2A78A 2OE2A 3U7HB 5DI3A 1NY6A 3GJ6A 2GWHA 4V0KA 1IXSB 1NVXQ 2GRJA 2NG1A 3RC3A 3U61B 2DFNA 2OUKA 3QXHA 1KI6B 2ODBA 1LW7A 5CLLA 4C9BA 2VBCA 5HKKA 4LYFA 5H1YA 3FMPB 4FMCF 4CGZA 3SOPA 1SKYB 1GOTA 1L8QA 2NTYC 3RNLA 5FUWA 2CLSA 1FFHA 4Q1FA 3PQCA 2QTVB 2R6DA 3RRYA 3FHTA 3AH8A 2WJVA 1PLKA 4A4DA 4ACBA 4F7WA 2XZLA 3NDPA 1Z06A 4KODA 3OEHA 4DSNA 2ZI4A 1CJVC 1AGRA 1UBCA 1E1RD 4C0JA 2AN9A 1KNQA 3CRVA 3NC1C 2ORIA 1HE1C 3Q9LA 4V0MA 4FCVA 3VR5A 3GJ4A 3ASZA 4V0NA 3FE2A 4JKIA 4MGKR 1VCIA 3Q3JB 1Z29A 1UDXA 2ZANA 3CZQA 3RHFA 2ERYA 5KSYA 3J81k 1NVWQ 5FTKA 2IYSA 1G7TA 1R0WA 1IY1A 1G8YA 2CCGA 4C0BA 4ZI3A 2QT1A 2RGGA 2O8EB 1EFTA 3PEWA 5FOUA 2ZRGA 2QP4A 4BLRA 2PJRA 2ZJZA 3K0CA 3DM5A 3BWDD 3P27A 4OHXA 5JS7A 4JVLA 5DIFA 1XMJA 3T1VA 2JLRA 5B58C 5H8WA 4DSOA 2OZEA 4ASUA 1W36C 1Z6AA 3EA5A 5EUMA 3NDBB 3SN6A 2CHGA 2QTFA 2XTNA 3CPEA 4R2HA 2W6JA 1P2TA 4TYPA 3CX6A 3K0FB 3TKLA 3UWOA 3R20A 2CVFA 3NKVA 721PA 4JVSB 1SHZA 2ZI6A 4RY2A 2CJWA 2OHFA 1EGAA 1NVVQ 1WRBA 4PSAA 4MYTA 5EJEA 3V4RA 4A6PA 3LFUA 4U7DA 4JJZA 2F1JA 1N6KA 4XSHA 4Q1AA 3UXMA 1E0JA 1FL9A 2DWPA 3GD7A 4P4UA 1NLFA 3FPAA 2ZRFA 1OPXA 4PZLA 2KI5A 4BZQA 3KKQA 1E3MA 1A5TA 4GFDA 4JLAA 1MKYA 1UEIA 1GRQA 3X2SA 3D6TB 2WVJA 2HEIA 4M1YA 2JCSA 2RCNA 1KDRA 1RRCA 2DWQA 4B2LA 3KTAB 3L0OA 4Q4LA 5KYKA 3GPLA 2EW1A 2O0JA 3BGWA 1N5JA 3U3RA 3U7EB 3ADDA 4US0R 1W48A 3SJAA 4U02A 1TQ2A 1VIAA 4V0ME 3PUZA 5EP1A 2F3RA 4Q9HA 1Z0JA 1JNYA 5L8VA 3AGQA 3CWZA 2CL6X 1DAKA 2JJ1A 1GFIA 3AEZA 3HR7A 4O0MA 4RFSB 3AVWA 5C4GB 4RKEA 2X1VA 3R8CA 4Q01A 1KGDA 2W0MA 4HB4A 3AM1A 1AA9A 2Q6TA 3B78A 4UNNA 3W8RA 1XCGB 1OIWA 1VIYA 1LFDB 3OE7D 1ZU4A 3CR7A 3QVUA 2GHIA 4D4JA 1IONA 3GFPA 2JLYA 2VO1A 3DKVA 3ND8A 5JEDA 2O52A 4URYR 5CIQA 2JIZA 2IWHA 4G5QA 3KKPA 3ZYCA 3MGCA 3W34A 4OI1A 4CDGA 1HQYE 1RRGA 3CR8A 5LDDC 5LPNA 1G9XA 1U9IA 1JI0A 1L7VC 4NCKA 4OI2A 3KQHA 1MO5A 2ZM5A 3TR5A 1E9AA 1Q21A 1UKYA 1NNEA 4TQ9A 1OFTA 4GOKA 4HLUA 3K70C 4CT5A 1ZUIA 4ZDWA 4OKSA 1NN1A 1IY2A 2ECKA 4XIGS 2BCJQ 1YHNA 2WWYA 3RDPA 4IDQA 3LH5A 4PQYA 1E9RA 3TE6A 1G3QA 1O87A 1QG4A 3LVQE 3GJ5A 2CK3A 4ZO4A 4BWYA 4C0QC 4F93B 4A82A 4EPWA 4KYUA 2CEAA 4EFMA 2GA8A 6Q21A 1ZUNB 3FHOA 1I4TD 2ZRCA 1E2FA 1P6XA 2ZSEA 3SHFA 3CX7A 5AJWA 4YQFA 4XJXA 2C9CA 5DYGA 4IVQA 1G291 2BMDA 1Z6TA 1ZRHA 1F3OA 3IBYA 4JSYA 5BN3A 3X1XA 1L4YA 5C18A 1JR6A 2Z4SA 4W5HA 5G53C 2I1QA 5EZ6B 3AVQA 4ACAA 3PEYA 1S2MA 1CKEA 1G21E 1P73A 4F91B 4R71A 1N0WA 1TQ4A 1LVGA 3OAAA 3RYTC 4PC1A 2FZ4A 2YINC 3QEOA 1ODFA 3QI2A 4PAOA 2J45A 1DG1G 1DG3A 3ETLA 3ZIAA 2B8WA 4JLBA 1QHHA 1W46A 3K8YA 1E2HA 4U00A 4ZCLA 3RSOA 2VA8A 3QNUA 1Z5ZA 2ZJYA 5JEEA 1U0JA 1E79D 2ZR7A 3I3SR 4TTPA 1KAGA 3SC3A 5JLJA 2ZR9A 3GLHA 1QDEA 3UMRA 2C78A 1HEIA 3BORA 4OHYA 4RCZA 4XTCS 4A92A 3F5FA 3MWLA 3RABA 5FTMA 1M8PA 1T0JB 1TF7A 4I1VA 3M1IA 1AJEA 1TMKA 3KJEA 1XPOA 2GCOB 3AF0A 2ZSFA 4PC3A 2IS6A 2ZJ8A 2F9MA 1A2BA 2IK8A 4QNMA 2BBSA 4BFTA 2R62A 1XD2A 1UM8A 4TN1A 1XXHA 1V43A 4JSTA 1FP7A 2G1JA 2V55B 4CW7A 1KO7A 4KSBA 3CNLA 2ATXA 1U98A 4PPFA 4C0KA 1XTKA 1N6PA 2F43A 2OFXA 1IBRA 1Q57A 4XTRA 2FU5C 3U4QB 2JLQA 1EX7A 5FL7D 4LHYA 1HE8B 1OF1A 1T9HA 1XRJA 2GVZC 4NCNA 2QP3A 1PUIA 3T12A 2ASEA 1P75A 3SFVA 3KJIA 4HZUA 2G0TA 4Q1DA 4IEIA 2Y8EA 4ILEA 1T8UA 4RZXA 4CVNA 3ZVNA 3A4MA 4ESHA 2QRNA 4IEEA 4BEJA 3SE0A 1N6LA 2C8VA 2XNDA 1G8GA 2PEYA 3V00A 3ZH9B 5CM8B 1TQDA 1W4RA 5DH9A 1EFUA 2Z43A 4JLVA 4UXHA 5AUOB 4F92B 3HDTA 3RS3A 2O8FB 4BZXA 1OKKA 2Z83A 2AHOA 1WBDA 3EZFA 1FNMA 2A5YB 3W5JA 2P5SA 1YZUA 3THWA 4LHZA 3GP8A 3U44A 1TF2A 4IDNA 2FSFA 2FFBA 2GXQA 2JAQA 2D74A 3P32A 2HYDA 4DHEA 4G01B 4IHQA 2O8DB 4C30A 4M4SA 3WNDA 5AUPB 5DN6A 2IYXA 1S1CA 4IW3B 4LBVA 3IPYA 4B35A 2C5LA 2F55A 3GLHE 3B60A 4FWIB 2FSIA 3NIBA 3CWQA 1G6OA 1UADA 4DJTA 4ERNA 2QN6A 1FMJA 4YDHB 5GVRA 2WJIA 4LCBA 4EUNA 2IF2A 4TMXA 3QKRA 4Q7LA 5FOWA 3F8TA 2OXCA 4QXAA 1JECA 2LCFA 2WV9A 3I62A 5G41A 2VP4A 3AUXA 3S1AB 3A1UA 2JLWA 5JJLA 1UPTA 4FW9A 1RYHA 1XPRA 2ZEJA 1R8QA 1VYTA 2VTKA 4LWZA 4YMTA 4Y0AA 2YJTD 5HTKA 5FPKA 3IGFA 2IX3A 4B2IA 1IJEA 1ZD8A 3QJYA 3UATA 3K0AA 1P61B 3V9PA 3WNBA 3FDIA 3TW4A 2XB2A 4HZIA 3GQBA 2XJ9A 5KSZA 2PT7A 2IYYA 3BE4A 2ORWA 3DMNA 3K9LA 2J5XA 4LJAA 1AZSC 1GUAA 2GK7A 3SFZA 2QSZA 2OV2A 1TU4A 3BIFA 4BE7B 3I5XA 2MSCB 3P26A 3SYLA 1OH8A 5KUTA 1CRQA 1PLLA 2CNWA 4QG7A 2RKOA 4QBFA 3UWKA 4Q4HB 1KAOA 4WZBE 2G0NA 5KDLA 1G4AE 4DCSA 4NTZA 3L0SA 2XOKD 2AFIE 2FFQA 2GF9A 5G40A 4AWXA 2JLVA 1KJYA 1KDOA 2QUZA 3RAPR 1T3LA 1NIPA 1OXSC 3ZJYA 1XBTA 4PC2A 3O8CA 2NO6A 4HAZA 3VNUA 3GEEA 3G5UA 1K5DA 2ZRPA 2ZIAA 1II8B 1XTRA 4Q4JB 4Q1EA 4DDTA 1VG8A 3QXJA 5J5CA 1G5TA 2QAGB 4LJ7A 2QE7A 4RVCA 1UAAA 4OI4A 1NY5A 1KMHB 1OXXK 2IYRA 3Q85A 4YMVA 1OB2A 1F2TB 2WJYA 1TADA 3HU3A 3QF7A 4N0DA 2H57A 4AC9A 4NYJQ 1RIFA 2O8EA 5AUNB 4P0TA 2OSBA 1NIJA 3QPVA 4LYAA 1E2JA 3DMDA 1W4AA 1Y3AA 3CH5A 1TF5A 1VYVA 3C5HA 5FUVA 3OEEA 2KBFA 4M21A 5E3HA 3KXLA 1N6RA 3VR1A 1VPLA 2RGEA 1IOZA 4IOKA 4DIDA 5IRCD 2ZE7A 4FMDF 1CF4A 5KOYA 2P5TB 2HCBA 4B33A 4POAA 1NF3A 3QKUA 4PSKA 3PJRA 3SZRA 3ZD6A 3RS7A 3QKSB 4CRWB 2VHUA 4LJ9A 1Z6YA 3K0FA 3C8UA 3NEJA 1NJFA 2XSZD 4KXFB 4WXRA 2AK3A 2IC5A 1NVVR 3BFXA 3UKDA 5JRJA 3CRRA 3LQQA 4YDSA 2R6AA 1XF9A 1GP2A 1X1SA 1N6OA 1YZKA 3TH5A 5CB8A 1Z0KA 1UBFA 3AGPA 4HB0A 3VR4A 3EAQA 3IHWA 1DAHA 4JBWA 5EE3A 2R2AA 1W47A 4RD1A 2WKQA 1OXTA 3TQCA 1US8B 1G16A 1Z08A 1IN5A 1Q12A 2GCPA 5GVSA 2G9NA 1F48A 4BECA 5G3ZA 1UBEA 4JT4A 4DBLC 4Q9JA 3BH6A
chains in the Genus database with same CATH superfamily
5HIKA 3N3AC 4C89A 3O2NA 3QWHA 2POQX 3QQ5A 5AR1A 3M6AA 4AYTA 1D2RA 1OZ0A 3AKCA 4M0KA 1ZFNA 5HK8A 2XT9A 1YIOA 4FDUA 4Q03A 5FCDA 2EQAA 1QE0A 1U3WA 4UZEA 4C6TA 1YDFA 4BMYA 1LC3A 4ZQBA 1EGMB 4C5BA 4US1R 1SHUX 3M1YA 1Q2UA 1XNGA 1Z9BA 5B1YA 4GOLD 4IF6A 5J58A 1RPTA 4AG3A 1Y8QB 1O96A 3CEHA 3C3AA 3DMPA 4UU7A 1Y1PA 2I2XB 4H17A 4MI3A 1C1YA 5EMHA 4I99A 3LT4A 4WEOA 1KF0A 1GZVA 5LNK6 4U8GA 3UHJA 2B83A 2V7QA 1DJNA 5JSKA 4CKBB 1J2TA 3HYRA 1U8AA 4FBLA 4QUGA 3T52A 1JV2B 1U28A 5A03A 3ORFA 2DM6A 1J8VA 4FCCA 3AKZA 3GR6A 4X24A 3EIXA 1NG1A 2WIBA 1O57A 2HB6A 5FYDA 4X1KA 4U4AA 3EBLA 5CJPA 1ZISA 4HKTA 2I67A 3ZDEA 4C3VA 3GJ8A 2BBTA 5I7FA 2ZB2A 4EF6A 1V7ZA 4CCSA 9LDTA 4JT8A 4EUEA 5FWYA 3HYNA 2R6R1 3V42A 1Q1AA 2HXYA 1U31A 1V3TA 2GYUA 5FBKA 2AJCA 4F3RA 4O4LA 3SEZA 1BO6A 3B9RA 2Q3MA 3BJRA 2IY9A 3BHIA 3SHTA 2BRUC 3KYDA 4KFSA 3WLIA 3WV5A 2PANA 3TTSA 2YY7A 4KVZA 1E64A 4YXWD 4PO9A 2GS9A 2QMOA 1S96A 1P74A 4EGJA 3GCGA 5HRUA 1NW3A 3O95A 4ZVMA 1LBQA 3HZHA 1NYRA 1AZTA 2I1WA 3ND7A 3NOXA 4M8NE 4MUEA 3GD5A 3SX4A 1TQ8A 2PSEA 3V48A 2A0FA 2XUZA 4RVUA 1NN5A 3AHGA 1A8IA 3RVBA 3PGXA 3WTCA 5AW8A 3R4CA 3RBVA 4YFYA 1BE8A 9ABPA 1U0LA 2Z5GA 1HM5A 2WICA 4Y2SA 2PAAA 5A9TA 2EOAA 3BIJA 4DMLA 4DUGD 3WAJA 1HDYA 1ID8A 5FDFA 7YASA 1U2DA 4JZKA 7MDHA 2DHQA 3ORHA 5BUCA 3UG6A 4MR9B 2QDXA 1ZIOA 3EN0A 4MPJA 4MGEA 1WUJS 4XD7D 2QAGC 1CUCA 3M4YA 3VKGA 1GNQA 2I1VB 1DAMA 1NWCA 3JAWA 1U2ZA 4LFCB 2AA3A 4FEAA 1IU9A 2BR4A 3AB7A 4E4TA 1P91A 3DQPA 3K09C 4FMDB 3ZH2A 2Q4OA 3F0TA 5EJ4A 3BZUA 3VXKA 1EIWA 4G0QA 3KKZA 5LR6A 2ZB7A 1M2EA 3FBGA 4KW7A 2GARA 4IIVA 2JIPA 5EI5A 2PX8A 2Y4OA 1YFZA 3E6AA 3EAGA 4MINA 4KPGA 4RIHA 3RFFA 3T3DA 4JL5A 2IUYA 2HU2A 4EY3A 1G59A 3VSAA 1DT5A 4WJLA 1MEEA 3NWOA 1UJ4A 1C7RA 1CUVA 1G4UR 1T43A 4PLYA 2EWWA 4EJ0A 4J1TA 4EG7A 5I4IA 2P9FA 1M1YB 3BX1A 3VU1A 1JL3A 1L8AA 5BNWA 3HUFA 4I8XA 5CEFA 3PEEA 2YV2A 3H9QA 3N0WA 4X66B 3D3QA 1JU3A 2PUGA 2ZJ2A 3ZE9A 4DDVA 3L8CA 2BEWA 1GKYA 2DETA 1ESDA 3RIEA 2PZBA 3T3MB 1O9HA 3OIFA 2X9QA 4PAWA 1XMSA 2A9FA 2GEDA 3ANNA 4FYXA 1Q6YA 1F8UA 2W6PA 3UOAB 1DJQA 2ZP1A 5EOVA 4DCNA 3BE8A 2GLTA 4KIFA 2H3EA 4DG5A 5E1OA 4WXYB 1C0PA 5IAKA 5ANRB 1V11B 4OMCA 2B1IA 2YN4A 3ECCA 5BWBA 3QVSA 1TU3A 3WYGA 3OZFA 4B3RB 2YVAA 4ZJYA 4MICA 4IL5A 1PDOA 2RG7A 2ZIVB 2ZJ5A 1NUAA 4GLJA 4A5OA 4H77A 1KU6A 4NAHA 2BEJA 2ERCA 4GI7A 4GXTA 4YP9A 5ABPA 1J5XA 1PTJC 1YL6A 3MZ0A 3VR3D 4IMRA 5EP3A 3S2YA 2BFFA 2HQBA 2O7RA 1GUYA 2IL1A 3B1KA 5A4FS 1WPXA 3FCUB 2VK1A 5DYTA 2QGNA 4AWAA 2O8FA 4LOKA 3J7AC 5AW5A 1QZUA 5JARA 1O8BA 2J0UB 3KLMX 4WXMA 2XCUA 4YYEA 1AKVA 4G0ZA 2QN7A 2RGNC 4RCYA 3RCBA 4QM7A 3O26A 4EB6A 1W44A 3MTQA 4IM7A 2AEFA 2PO7A 2EF0A 3EWSA 3LDAA 3X3HA 2VPYA 4BO9A 2PZMA 4N49A 3VH4A 1QMPA 5AKYA 2W6IA 5LLTA 4N4AA 3FGOA 3LF1A 1Z5PA 3VVLA 3BEOA 4TRMA 1CW2B 1WKBA 1RRFA 1M6HA 1RXIA 2JIOA 1YR3A 1L1FA 2OCXA 1ZWLA 4G9BA 2O8DA 1SB9A 1JNXX 4XLZA 2Z2YA 3O1HB 3I58A 2VBIA 2X5OA 3PC8C 2DU8A 1E1CB 1NT4A 2RJNA 2QTHA 4GMDA 2ZJBA 3JQBC 4J4BA 4Y2VA 4R1PA 1MO3A 2DBRA 1A2KC 4HEA6 4WEQA 5E2AA 1GR0A 5LQCA 4JOBA 3JAMA 3O47A 4K05A 1PT9A 4REMA 3PQEA 3VZCA 5ECDA 1N57A 1KSHA 1WTCA 2WWTA 3CEPB 5JYCA 4GEKA 1M0TA 3QFSA 3L79A 3WKEA 3ZKAA 2K5UA 2E2WA 4DDMA 5DHFA 1G3IA 3C3KA 2FEWB 4NPHA 4D5GA 1IK4A 2C03A 4F7DA 2JAUA 2WF7A 2BF7A 3T7TA 4BFSA 4BFXA 1W5BA 5A4JA 4NOLA 2PL9A 1WHTB 4UTPA 1JPJA 4ALIA 1JEOA 4J8PA 2I62A 4CLXA 1QYXA 1SOWA 2ABWA 2PR7A 4MCJA 5LQSA 4CODB 1T2VA 1Q0LA 1ZSNA 3CG0A 4AXXA 2IHYA 3DNPA 5DISB 3URKA 3PCRB 4LI0A 2D2FA 5IKMA 1E2LA 2NZVG 4LE0A 4B47A 3BBLA 3MT7A 1X8KA 3GJYA 3PFCA 3H86A 3VU0A 4PQGA 3WRWA 1PJBA 4CDMA 2NW6A 2QORA 2Z3ZA 1JIQA 2HWWA 1CY7A 1KPHA 2LIPA 2D8MA 2BRUA 2QRKA 4CEIB 3NQ41 4AQDA 3D4LA 1FYFA 1XYYA 5HX7A 1AKUA 5JOQA 4A9AA 3LC1O 2CXOA 4YCAA 1BVYF 1E2DA 2AR7A 4R1OA 2VP2A 1YA6A 5K8LA 1LSJA 1AHNA 5G4LA 4ZN6A 3Q7RA 4OG2A 1V7QA 3C74A 3MMNA 4QDXA 5SZJA 2JRCA 2GJ9A 2ZIEA 2VDWA 1SEPA 3HO8A 3IR7A 3O8BA 3WQQA 3L4EA 1OBHA 3LGAA 1E7QA 3COSA 3CGWA 4AU1A 1Q83A 1X0VA 2F2TA 3HUTA 4EY8A 1V5FA 2JARA 1G2IA 3GZNB 3MN1A 3IT0A 1Q1EA 4AJPA 1XQXA 3UW3A 2UZ1A 3DZFA 2AYZA 3B1VA 1AIPA 3JQGA 4FGLA 4Q7EA 4ZCSA 3VFDA 4W99A 2XXJA 3ILSA 1FK8A 1FX1A 1GL7A 4OIMA 4N3NA 5EJMA 1HG1A 4C0AC 5C32A 1L5LA 5TT1A 3VTZA 2QAGA 5ALZA 1FOEB 4FHZA 1NBOA 5JXIA 1G2QA 3A9CA 3AP3A 3Q72A 1XZQA 3K09A 3UYKA 2MYPA 3LBIA 4HADA 1F2TA 1GIAA 1NXSA 1PJCA 2IY7A 4HYQA 4MJ3A 3QEMB 3ZDQA 1T6XA 4G97A 2ANBA 2BEVA 2XZOA 3Q9SA 2XNCA 1OR8A 3F71A 2GT1A 3IO3A 3PVSA 3DTVA 4LOJA 1RQ7A 4W6QA 1PG5A 1CRWG 3VR2A 4XPIB 4ZVRA 4N6OA 4II7A 3E4CA 3H9BA 1ZCAA 2LWIA 1XTQA 3KHSA 3KFLA 2F6RA 5TF4A 3P9NA 1Z5VA 1ZNXA 4ZRMA 4NEQA 4A2PA 2VQEB 3FSRA 4OBXA 4CMIB 2H31A 1UPUA 4JR0A 5KNCA 3EPJA 4GKVA 2IDKA 1R6DA 2HU8A 3B9BA 2BR3A 1ZGJA 3HWWA 4CCAA 2QVCA 3C45A 4R69A 2XVAA 4YAGA 3U19A 3HUUA 3IYLW 5IX8A 5B64A 3U1VA 3EARA 4R1UA 4CI0B 1QKKA 3DEHA 4NYMQ 3D9QX 5DXFA 3PKIA 3STTA 3TIFA 2PXXA 3FVVA 1QAMA 1A9RA 1Q2XA 1J8DA 5JCZA 1W88A 2VJNA 1ZN2A 4FSHA 3UCXA 3N53A 3WIEA 2IEZA 3I9LA 4OHZA 3RT1A 3G0OA 2B8TA 1M6VB 1GU7A 4CMGA 1G8PA 3CONA 3T34A 5ESRA 1M8JA 5IJ0B 4L4ZA 3HO1A 5TMBA 3K7EA 1U2EA 2HUNA 3IDQA 3MLEA 4IICA 3ACCA 2VOEA 3K20A 4TTSA 3W2HA 1YASA 5A3JA 3DEIA 2A88A 1Q95A 1R88A 2A5DA 1U11A 4FWTA 4LF6B 1H0SA 4RHXA 1NJ6A 4W9NC 5GV8A 3BJZA 1US8A 2J67A 1HFKA 3DG9A 3GJSA 4KQCA 2PUFA 1C5KA 1MENA 2OLEA 4L4RA 3SDZA 3TSOA 2AKAB 2O0KA 4IJMA 1S3IA 3I6BA 3TGWA 3WAKA 2FSGA 4M53A 1GEGA 1U9ZA 5AKJA 5IU6A 3HVKA 3MUNA 5HQJA 3B1XA 2VDQB 3T6KA 2LKCA 2XWSA 4ZAWA 1DBQA 1OV4A 3SJZA 1EJ0A 1JG2A 1JHPA 5IF9A 1UBHS 1R8SA 2ZG6A 1PG2A 3QU9A 1CS0B 1IMJA 4TT3A 4WXPA 4KWTA 4PW0A 1WKVA 4ANFA 3BERA 3PITA 4MSUA 4RHFA 3IUSA 5AW9A 4H31A 2WPDA 1EQ2A 1PD0A 3OQHA 4PCLA 5I7OA 5K99A 4YP1A 2QI9F 3U1BA 1VMAA 1YE3A 5COBA 4JXXA 2C5AA 2DECA 1WCIB 1GG9A 2D2VA 2JGNA 2O2CA 5DBHX 3DV2A 1LH0A 3EZGA 3PC8A 4ASUD 4GLFA 2VRWA 4PYOA 4IGKA 3T3EA 2BFOA 5DNWA 4EUFA 5K2OA 3JQBA 1GKUB 1YQEA 2BZSA 3EVNA 2FSSA 1OXKB 1NQVA 3KSMA 1AQ6A 2XQIA 4O1IA 3N86A 4L5AA 4DQXA 5AW0A 2G07A 1DC5A 3AVXA 2OB2A 4KSYA 5JD3A 1XJWA 1RHKA 3KZMA 4GVLA 4JMPA 4NECA 2J31A 3CE9A 4EY7A 5EVCA 1K8YB 2H1OA 5F9HA 1Z63A 5KYWB 4DT1B 1M1NA 1LJLA 3KQQA 2FPOA 2XB8A 1OX5A 1KHHA 1SQ6A 1SQ5A 2WTBA 3SKVA 1KVUA 2V3WA 1FRQA 2IEAA 3FI9A 4HB2A 1JIJA 4QELA 3W8EA 1P0PA 5KJ6A 4ZV9A 2OHJA 1R0LA 3MBKA 3TEFA 2XEXA 3GW8A 1ODIA 1XZPA 3C8HA 3FMGA 4QOHA 4ENRA 3D6HA 3IBGA 1D6SA 3P2JA 4ARZA 1DBIA 4LGVA 3I04M 5B12A 2GVDC 1X1DA 4F8JA 1L8LA 4LZOA 1SXQA 1JE1A 1HT3A 1YA4A 2W6CX 4NAVA 3BKXA 3H2HA 1IPFA 5AOCA 5JAQA 4ESOA 3KVNA 5CDFA 5KDDA 1WF6A 3FNGA 3KQYA 2WM9B 4P2BA 1EM8A 4ENSA 4DUPA 2V0NA 4M88A 4CM4B 1UT6A 4HGOA 2Q5FA 3B7PA 5JCJA 4HBGA 4DLTA 4MWCA 3KWFA 4H0FA 3NTOA 3V8PA 3HBFA 3W4KA 2ERXA 3M4ZA 3B7WA 4RZSA 5DCYA 3G1WA 4B85A 5IAOA 2O54A 2PL5A 4U2DA 2YHBA 4DARA 4HYEA 2C9MA 3LCMA 2HYIC 5T3UA 4U2FA 3IQZA 3CGGA 2NMVA 3WYCA 1W59A 2VPIA 2W0SA 1I1NA 1T35A 3OOEA 5M29A 2Q1YA 1JBQA 1YE8A 1XL0A 1HQKA 3EEQA 4LG1A 1XCBA 4LXGA 3I6ZA 2WP0A 2AG8A 5CTJA 5DGIA 3QEAZ 1XQVA 1JEAA 4TWAA 2QIOA 3NAMA 4B74A 2OUIA 2QN8A 3L8EA 4OI0A 3EVBA 3ZHCA 2IBSA 3PDJA 5L4SA 4YT8A 4IGEA 3NOQA 4OGLA 1KRWA 3L8FA 2BUCA 3RD5A 5C5EA 2ZS7A 4J0JA 2WAMA 3H4IA 3ZLJA 1KL7A 1SO8A 2H1CA 5FAKA 3J80A 1N5LA 1JE0A 1VA5A 2QRPA 3V8EA 1I1OA 4UHBA 4YCJA 4RA6A 4QUIA 5F12A 1E6UA 4EATA 3B38A 1LD3A 2Y1WA 4TXJA 4YEDA 5EIXA 4UVDA 1XU4A 4Y2TA 1K66A 2AOWA 1KK1A 3PU6A 1DTWB 3HLKA 3MJTA 4RUKA 2J0VA 3AJEA 1JEDA 1ZSVA 3R1IA 3VYSB 2EIXA 2FX2A 3FSGA 4H1WA 3EXG1 3G7UA 3C3CA 4RLQA 4UCQA 2BFBA 3P9XA 5FA8A 3WKCA 1QOQB 1C30A 1NR7A 2X8AA 4P4SA 2F62A 4O4HF 3TMAA 3O94A 4WFQA 4D8UA 4TMVA 2RGYA 1AQYA 3KFVA 1RJDA 1M0SA 1VECA 1JLHA 1NVFA 1VHWA 2CD9A 1TJ5A 3WWOA 4IOLA 1N7GA 3YASA 3PLNA 1BFUA 3OM9A 4BB5A 3BFJA 1R5NA 4LWPA 2H1WA 2H7YA 5ARCA 2C4VA 2B6HA 1DZ3A 3FUCA 4YJHA 4GDFA 2A92A 3DULA 4MKZA 2OHOA 3UJHA 4HLQB 5DHTA 3ZZTA 1YOVB 3CLUC 2G5GX 3FZYA 4MJLA 4V0QA 5IFLA 4EGCB 4TKMA 2FUCA 2TYSB 3CUEF 3G2KA 4CTNA 1V26A 4I2NA 5KYXA 2I4MA 3RS5A 2ZREA 1UAYA 1KDYA 1QH9A 1T9DA 1P5ZB 4WOJA 1FRZA 2VZ8A 4PN3A 1V16B 4RAOA 1CEQA 3NHYA 2HLPA 4LPKA 4PANA 2O3RA 2E4XA 3IB6A 3OAAD 3EXFA 1H6CA 5DHUA 3ELYA 5DPMA 4YONB 1Y5NA 2I4TA 4OP2A 5BOVA 5U4XA 4BNTA 1GPLA 3OM8A 1RNLA 1I0LA 5D3MB 5B58T 2PMWB 4W9NA 5B5SA 3TN7A 1I80A 4KK4A 3B1JA 5CDUA 1UKCA 3LL4A 2V0CA 1E5LA 3RFXA 4FDMA 2FEAA 1E0KA 3SC2B 4Z1MA 2WWVD 1PFGA 3FOAA 5LD2B 1H0KA 4G63A 2WYUA 4FZVA 2I54A 1W1UA 1PF7E 4IZHA 1VRWA 2PD3A 2QR2A 3ILVA 4NMHA 4OHCA 4Y2YA 5DO9A 5HCUA 2O2XA 5B7QA 2NN3C 1BOFA 2PKEA 2ONJA 4JC5A 1KSFX 3ROXA 3O6VA 3RYIB 1NMXA 3ZV3A 5AM2A 5BR7A 2VJQA 5B36A 4JIGA 5BMVF 3MIIA 1T4MA 4O1MA 1PJZA 1ZD9A 2WU8A 3TLAA 2BWJA 4PGAA 1NXVA 3N75A 4D3XA 2QLBA 4KJXA 4DQUA 3NJRA 2GD0A 1PNOA 1T29A 1R16A 3O3CA 2FPGA 5LVAA 1Q5PA 1YMUA 3ZV4A 4EDHA 3FRIA 5FPHA 1X7ZB 5JLAA 1M1YE 1Z4OA 3TX2A 1X1RA 2R68A 4B3JA 2VJPA 5B1IA 3ET5A 5AVTA 1W36D 1ORRA 4QUJA 3Q1LA 1ZWKA 1GCIA 3DP7A 2HBRA 4QC2A 5JQGF 1KS2A 2OBMA 4DLBA 2BDUA 4WPGA 3T4PA 2IUSA 3IVAA 5DBOA 1QP0A 1TFRA 4IDAA 3H5RA 1E2NA 4MWGA 4CKXA 3RVOA 2JF0A 3MGGA 4FFLA 5KOJA 1BG6A 1QB8A 3C3MA 2OGZA 3STHA 4AMVA 4F46A 4K9QA 3UJCA 2VTBB 5HZHA 2QA5A 1OE0A 2IHNA 2NO9A 1BJKA 2UUAB 5JAHA 4IUBS 3UMCA 3FUXA 3IULA 4JI1B 2NO7A 4IDEA 4ZOLB 2G9ZA 3ELDA 1GQFA 4QHSA 1IPHA 2HPVA 4KYIB 2WUFA 3FZNA 3W7BA 4EQZA 1AKYA 1I13A 2YL2A 3FFAA 2PX3A 1XPUA 1ZC3A 5LA6A 3MMPA 4EUHA 4LYGA 2BKEA 3V4LA 3NVMB 3P96A 3DWEX 5LUBA 4UCWA 4JYBA 2WHQA 4PYKA 4WBSA 1GTMA 4BUZA 1HETA 5FO1A 3R3VA 1QYCA 4LVUA 4WT7A 4K40A 3VBEA 1XA4A 1TZJA 1AQJA 1HC7A 4B8ZA 1TAHA 1B42A 5AOAA 4FU0A 1XTIA 4TQUS 3FY4A 2D2XA 4Q9LA 2WI8A 3I8OA 3UHOA 2EX0A 3QA3E 2LXNA 1IY0A 4HSEA 3TW6A 4Q05A 1GZSA 1Z37A 1FB5A 5JCPA 2ID7A 4M8SA 4B83A 1KO1A 4NU0A 1YFLA 1S2DA 1SKYE 2PZKA 1M8GA 1QBGA 1U0FA 3M4NA 3QFCA 4FYWA 2ZRAA 3G79A 3K73O 2V7EA 3B89A 1ZK1A 4U0JA 5GPBA 4NQRA 4BTVA 3RFCA 4EG3A 4B82A 1BH2A 3N58A 1MEOA 4ZYTA 1F2VA 1BJTA 1C7JA 1N6HA 2PGAA 1PYOA 3WZLA 2A1TS 4GPD1 1KXZA 1CVIA 3HJRA 4K9OA 3DYBA 3PGMA 4Z4HA 2BH2A 1WAMA 2J0EA 1DMSA 4WSOA 3JU3A 3PD0A 3W2TA 4RFVA 5CLFA 1JG4A 1X9IA 2KPOA 4DV0B 2QN2A 3BE6A 2AOUB 4R6XA 5FHQA 4NCIA 4GBJA 3LNCA 1JQ5A 2Y1EA 1YAJA 3FAZA 4MMYB 5ERYA 3FKSA 5JU6A 1CIPA 1DQYA 4A8JC 3D54D 1IAQA 4QYTA 3WRYC 2Z4RA 1LTHR 4ZEWA 3DT6A 2YJ4A 1FXSA 5CGQB 1PI3A 3BB1A 2ZJAA 3T1QA 1E3WB 4K6GA 3ENZA 3EMDA 3WKDA 1BQ4A 1PZGA 1RRPA 5I7UA 4WLOA 4XARA 5JBIA 3S5JA 1QH8B 1I30A 2CNWD 2IBMA 4HMQA 2W58A 4TV8F 3IMGA 4E1AA 4PAQA 3PC3A 3F9IA 3U3MA 3D5TA 3IC5A 4MX8A 4C7OA 3VX4A 1TU0A 3AR2A 3P5SA 2HA4A 4WOKA 1JHZA 3A6ZA 2QI9C 4CG1A 5CVTA 2Y0PA 4M8LA 4TXLA 2QW1A 4HRXA 2FF7A 1D2NA 1DADA 2VI5A 4HTFB 3A31A 2QYSA 2QTMA 3CKKA 1UZMA 1AT1A 2EKZA 3OX4A 3RRJA 2J6HA 2JGJA 3GCZA 4P58A 5GGXA 3NAQA 3W4JA 3T3OA 3KQSA 1BGVA 4RD6A 3K53A 4N03A 5COQA 4MCAA 5HF9A 1W96A 3U3JA 1RMQA 3GAZA 3ND5A 4L8WB 5I4KA 1QRTA 4NONA 4QFCA 5ALYA 2EHDA 2M32A 1NUUA 4ARIA 3WXMA 1X87A 1CUWA 4EYEA 1MC8A 4MQFB 3A58B 3W04A 4A6XA 2QN3A 3QHAA 5JNLA 1ZGHA 4YJFB 3RJZA 1NUHA 1JJAA 3ZGLA 2V7GA 3GNSA 5IMBA 4BRUA 2BJWA 3OLYA 1ZJZA 2CDNA 2HREA 3CLTD 3R0VA 3BD7A 3DVSX 2AG6A 4KXWA 4M89A 5DM1A 4TWBA 2O6HA 2MR5A 4BGDA 1GLGA 2QUJA 3PFHA 3ZIDA 5IVPA 1G3UA 2NXEA 3O8RA 2X4GA 3K8OE 4E2XA 4N65A 1VHLA 1I2DA 2C9ZA 4GPIB 1NX9A 1YT5A 1RAGA 4LJ5A 1FLNA 4MWOA 3SD7A 5FPSA 2F8SA 4UOEA 1JR4A 3LLVA 3VKHA 1FXWA 2H8KA 4OSOA 1JW9B 2ZT7A 3IE0A 1R4MA 3P9YA 3TW8B 3ACDA 5CVEA 3GDOA 4MS3B 1ZJ4A 4AY4A 5B4VA 1XALA 4J0EA 1VG1A 2ZYVX 4R3UC 2I8CA 3BG5A 5C34B 4RANA 5T6BA 1UK7A 3D3WA 3U48A 5I48A 2VUSA 2YWFA 1FFYA 2EG5A 4D3SA 4DZTA 3FYDA 2YYSA 1Q16A 2X6RA 4MAMA 2OV3A 1NSYA 1ZNZA 2ZVJA 3C3WA 3L02A 4R5MA 3ZE1B 5IG2A 1ZD3A 2D2IA 2XTMA 1OU0A 5E2BA 3FLAA 4CEHA 1EQUA 1DWOA 2HMVA 3O91A 3EZ2A 4JHLA 4NYIQ 4PIVA 4FX2A 4ZKEA 1WMEA 2C5GA 3F4LA 4EA7A 1FS5A 3VI4B 5ARBA 3QVKA 2VDNB 4KXQA 1N0UA 2YJGA 2OBLA 4P86A 2VYVA 5GJWC 2QPTA 2QMYA 3DFFA 2YRFA 1S2NA 1II0A 2VBGA 5DTMA 1NQAO 3TNDA 4MI6A 2VJDA 2AF4C 2CL7X 1YV9A 2IDMA 4QX6A 1GVHA 3OKAA 4WKCA 5IP5A 1FYDA 1UMKA 3K15A 4R7TA 1CC1S 1NYTA 2IXFA 4UKDA 5FBVB 2DJ5A 5L51A 1PZFA 2B1JA 5LJIA 2FX5A 1J0DA 2H17A 3BJMA 4LDRA 3U80A 4CLDA 4CIWA 1R10A 2RJ3A 4OL0A 3KWJA 4XDHA 1Y1LA 2C0PA 2JL1A 2YVLA 2I80A 3IELA 1Y3DE 4PPGA 4Q3LA 4F4DA 4J94A 3NVAA 3HDHA 2FZGA 3NEYA 2PAFA 1MCZA 2DQSA 4DCUA 3ICPA 3HYCA 4PIPA 1JU9A 2R60A 3AF4A 3I9JA 3NTRA 4L08A 4LMRA 4W5WA 3S8YA 4FW8A 4BATA 1Q1ZA 2YS7A 5LL6P 5HZGA 3GJ0A 4B4OA 1N5MA 2JAHA 2XD4A 1V2HE 3PD1A 2CB0A 4QIHA 1Z7GA 2FDXA 1IULA 2VQ3A 4MQEA 4NE7A 4XQ9A 2F1HA 3LBNA 1DNPA 4W7SA 3T95A 4M38A 1U90A 1L8XA 4HN2A 2IIQA 3EXIA 1NMZA 4Y1RB 5CU7A 3VR0A 5LXTF 4ZZ3A 1HBJA 3IESA 4GPZA 2B35A 3Q3EA 3VPBA 2WUWE 3N8HA 5HVNA 2PT5A 1VMIA 1TQ6A 4DLRA 1PKEA 4ZJUA 3LX8A 5EERA 4QLOA 4BXOA 3ND9A 5E3IA 5F21A 3UY4A 2WC1A 2QG4A 1PVVA 5HJEA 1K3UB 5KJCA 3UANA 4B7ZA 4E5SA 2X7XA 2OYRA 3WOVA 3EEOA 3KR9A 1Y1SA 2OOKA 2QJFA 4QU8A 4BVKA 3K31A 5KREA 3NANA 2F3QA 1DTEA 1ESNA 1P72A 1THMA 4P83A 5E4TA 4A8JA 5IK2D 1HLPA 1N5IA 3WRYA 1YB4A 2H0AA 3IV6A 4NLLA 4OKIA 2JIQA 4Z9BA 1VHQA 1DEAA 1F0KA 1NRWA 4Z0TA 4KLZA 4MP3A 1U7ZA 3HSKA 3NDRA 4I1UA 5D1NA 4MKIA 2DB3A 4E31A 3SMVA 1PRYA 1N2JA 1R6UA 1VOTA 3U4HA 3UJ9A 4ME6A 4EO7A 5JNUA 2BVNA 4JOQA 5F4BA 4IDOA 4N3AA 4BHTA 4JL8A 2EEZA 2QX4A 4LNUA 2XF2A 1CRPA 4ZDIA 3L4SO 1H4VB 3TRFA 4A36A 5LMUB 3KCQA 1XU9A 1KVTA 1I4LD 3ES9A 2YHUA 3NXKA 2RDMA 3IBCA 4FILA 4HLDA 4LSGA 3V34A 4KR0A 3SS9X 4EPRA 2BV3A 2JGRA 1GTZA 1M2FA 2OK8A 1J2RA 1HYGA 4CMJA 2WFLB 3PF8A 3UT6A 4EMSA 2YZ2A 3MWFA 2QUAA 2AMLA 3KYCB 1DTSA 3H7IA 2WHEA 4IDPA 5ALDA 4D9FA 1L4GA 4NNPA 5T3YA 4OO3A 2JIMA 4UU8A 3SNKA 3UG7A 1F51E 1HFWA 1PJSA 2WJGA 5K8IA 4I4CA 5EZYA 3AF5A 5IVIA 3OKFA 4I5FA 3GCWA 2IYOA 1ELOA 4NPAA 3IHLA 2N42A 2IF0A 1SK9A 2BLLA 3U4IA 5FOQA 2P9JA 5GOZA 1VE9A 4FJ0A 2O2JA 3E5RA 3EIQA 3ISJA 3WQHA 4E33A 1G19A 1NE7A 2VPQA 3L93A 1E32A 2OD7A 4FMPA 4FN4A 4BDTA 2Q99A 2JHAA 1WVMA 1DC4A 1RT9A 1GGNA 5I9SA 4NV0A 2GNOA 2PUBA 2V6FA 3KPJA 4M1KA 1KAHA 4NZOA 4XFDA 2GGSA 4DCVA 3LP6A 4WV3A 5M34A 1OOEA 2CMHA 3A4TA 4DJEC 1PW7A 1XRLA 3IUBA 3JYPA 2ZWAA 2I2BA 1CERA 3S55A 4KPEC 5BN5B 3TIVA 2IBTA 4DBLE 4D4IA 4JA2A 8GPBA 1D2HA 1FFSA 3K0SA 5HA5A 2XMDA 3DUWA 1TTTA 4EA8A 1XZAA 3FTCA 1XMQB 4XGRA 4XLLA 3AJ8A 1Y3IA 2N9UA 4RJLA 4DKJA 4A15A 5JYDA 1ISGA 1E5TA 4K6KA 4IWNA 4OOFA 5JALA 4QM6A 2A9RA 4LYEA 3MTGA 1ODKA 1WMBA 2ZBUA 2HADA 1SVIA 4EVRA 4LRUA 2G83A 4HQ6A 1SULA 2NTVA 4K26A 2E4YA 3ZS9A 3FOBA 1G7SA 2RHRA 3ELBA 1CIJA 2IP1A 2FJUA 1M2GA 2SECE 3QF4B 3CRW1 3EQ6A 2JGMA 3H2BA 4EVSA 2VUTA 1UBKS 1JR3D 4MJ7A 5EG5A 5HIAA 4Q82A 5TMPA 1FMFA 2JFGA 4OXRA 3HM2A 1OIXA 1M8KA 4LKRA 4QOIA 4WKNA 4BN4A 3VA7A 1QF7A 4HQKA 4YI5A 1E6EA 4AJ1A 2P78A 1SD1A 5CP8A 1ZMBA 3QELB 2O8BA 2DGDA 3H3FA 3QWAA 4G5OA 1M0WA 4U5QA 1CUSA 1SXPA 4JB3A 1X8LA 1USVA 1WSAA 1XL1A 1X9GA 2VF4X 1GYRA 2XUFA 5F73A 4Z0NA 1K7YA 3T4EA 2F4NA 2R8YA 3Q6MA 5CYGA 3IP8A 3PGA1 5L3SB 2OXIA 2PIAA 1X94A 3LT0A 5SY4A 2HFKA 3P9ZA 2C92A 2Q1XA 5FTLA 5DNYB 4DLVA 2FSPA 3H4VA 4IY1A 2G88A 1CRZA 1E9EA 1RBZA 3ITDA 1VE6A 3SF8A 8MHTA 5L6LB 3GCDA 4YRCA 5FA5A 3OT1B 1PN3A 1K5PA 1R4ZA 2C61A 2PS3A 3QOXA 4XAQA 5FWXA 1QYIA 2AUMA 2FZWA 5E9AA 4JBYA 4EMUA 1DOAA 1K6IA 1YCGA 4G07A 2FSHA 3HEAA 5DNAA 3WGYA 1M74A 1SCKA 4FNAA 1JR2A 1QVVA 1KHTA 4QEKA 1VB3A 2GKGA 4YLEA 4JJ6A 1XJ0A 4O1HA 3LI2A 3PIRA 4EKNB 3C39A 3M4JA 1VE1A 4IX1A 4HK4A 3IAS1 3DZJA 2VDJA 2V7TA 4JXZA 3DBHB 5JCOA 2ZSJA 1I3NA 5C81A 3GLFE 1IYZA 4II3A 1OFGA 2REQB 3C7AA 3WGGA 3W7VA 5BW5A 1PUJA 1GPAA 3D31A 3QLEA 4G9GA 1T0HB 3AY0A 4TV9A 4XJTA 3ZWKA 1TL7C 2PL3A 1Z0ZA 4RL6A 1MB0A 3VZRA 3MTIA 5FL3A 2HSWA 3ITNA 5AO9A 4CHGA 3HDQA 1EP3B 2R5WA 4LQDA 4G0NA 4MB6A 3SR0A 3GVPA 1DDOA 1JKJA 3TBHA 3FOEC 2FUNB 3ITKA 1A9QA 1LPOA 1JXAA 1YDMA 2XCRB 2O8CA 1MXHA 4LF7B 1MO2A 3I64A 5C8XA 4BB6A 4BQEA 2PFGA 4PC6A 1NMEA 3HGQA 3LW7A 4HRAA 4KE6A 2DPXA 3KR2A 3S29A 1ZVVA 3A6EA 4NCXA 1G8JA 4IVNA 2VXOA 5AKIA 4QG3A 1W93A 3I37X 5HQ3B 2BMWA 4JI0B 5GINE 3OY2A 3OESA 1C7ZA 4NICA 1Q84A 3K4PA 2BFMA 4RA9B 4BQRA 3C85A 4EF5A 1IEXA 4O4IF 5IASA 5D6OA 4EJSA 4JJ4A 5A06A 4JJEA 3JYOA 2H16A 4TL8A 4K8RB 2AJ8A 1OWOA 2PVCA 4YRNA 4FD2A 4P35A 4AJ2A 2DERA 5LU9A 4GE3A 4HC4A 4ZVTA 3ZU3A 2EGGA 2G77B 3D3KA 1Y81A 1KTVA 1VP3A 4ON9A 4AS2A 2C7RA 5HNKA 5LN1A 1IDOA 3CVVA 2IOFK 2DH6A 3U62A 5D86A 3FGPA 1CUFA 3OIDA 3A3OA 1WDMA 3FNBA 2IGTA 4U6SA 2JH8A 4TKLA 4WY5A 1CDDA 5AHWA 4YT4A 1XZDA 2G9VA 5LLSA 4TLEA 3WY9A 3ZVLA 1RQXA 2ODNA 3D5EA 2NTNA 4BFWA 5J4KA 2PV0A 3HKCA 3L5KA 5C31A 1D6JA 2Z1NA 5IAEA 2ZIXB 2PD4A 2WNHA 3UHFA 4LJRA 4HZGA 4AIRA 3VC7A 3DA8A 3A6KA 2QD4A 1GRNA 2D1QA 1VB5A 2QLNA 5DIZA 4GGPA 4KMRA 1WO8A 4EL5A 4RPCA 2ZE6A 5J4YA 1QH1A 1Z39A 3QE4A 5AQEA 1C8VB 2HT1A 4I5GA 2FN9A 3WA7A 3CSSA 1NPYA 2AYYA 2VHTA 3OA0A 4LDJA 3ZHSA 1NP7A 1EWRA 3M9WA 2BFDA 3U4GA 4A0FA 4EUSA 3DMRA 4UZFA 4MQ5A 3FNEA 1IC6A 1H1LA 1SVLA 3HDYA 3W6OA 1KK0A 3BCRA 4EYQA 3RASA 1BXRB 3NWJA 3RHTA 2C20A 2VYCA 5JNWA 3A26A 1XDWA 5H0IA 3LKVA 4XYLA 3AR3A 4WBNF 4WK0B 3BWCA 3TQFA 4DMRA 3TLGA 5H3LA 1CJSA 1M7HA 3FETA 3RUDA 3W3AD 1T4CB 4Z53A 3FPSA 4UM8B 4A1FA 2JDID 5JRZA 1GDDA 3D8BA 1U63A 1G7CA 2C84A 3CTMA 1SCNE 2QN9A 3JZAA 3R9XB 3LX4A 4DIOA 3ED1A 5SYAA 5KAMA 3NAGA 5G1PA 5TPZA 4CQLB 1JLLA 1OX4A 4B3DA 2Q50A 2HIGA 4XR9A 3UFBA 1ZRSA 1MAHA 2GO7A 1XPJA 4MNTA 4DM3A 3NCHA 4NQZA 1BWRA 3KNZA 4DREA 4E13A 3GBVA 3T9CA 1AZWA 3QOWA 3JQAD 5CVVA 4N3CA 1KARA 4RW0A 1URPA 3L7JA 3SLGA 3VU9B 2WMOB 4BKMA 4KQHA 5LB4A 1XTSA 4E3WA 4UM9B 3KZVA 4CM3A 3DFUA 2N46A 1FUYB 1ONPA 2O7SA 2H1LA 2ZYSA 3ADKA 3K5WA 3EZ9A 4E07A 3WBJA 4DC0A 4DADA 2G4VA 2R47A 1D4AA 4JY7A 1YZNA 3RPEA 3DTTA 1GITA 3NLLA 5DI3B 4MV7A 3IPRA 2ZETA 4N5LA 3MFYA 1TRKA 2IOQA 4D98A 1I5EA 3GJ7A 2D3WA 1CLEA 1U2GC 3EJWA 2ZWPA 4HDAA 5G3YA 2PFSA 3L6OO 3QOYA 5A0FA 2FHPA 1O7JA 1R66A 1DCMA 1YDWA 2AMVA 5KQPA 3TUJC 3OZWA 4UULA 4CMHA 3O3NB 1NW9B 2WR8A 3DW1X 3GELA 1M2JA 4WRRA 5F64A 3FCEA 3VOTA 4BY9E 2HIMA 3OQ6A 2AN3A 3HMQA 4RTKA 3OURA 1BRMA 4E51A 1W29A 3QPCA 4XI9A 2EKLA 2DPGA 1QO0D 1JIKA 1Y3BE 4BLQA 5DHRA 3TTVA 1