1WRBA

Crystal structure of the n-terminal reca-like domain of djvlgb, a pranarian vasa-like rna helicase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
238
structure length
232
Chain Sequence
KYDSIPVSVTGPDYSATNVIENFDELKLDPTIRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIINHLVCQDLKTAYPKCLILAPTRELAIQILSESQKFSLNTPLRSCVVYGGADTHSQIREVQMGCHLLVATPGRLVDFIEKNKISLEFCKYIVLDEADRMLDMGFEPQIRKIIEESNMPSGINRQTLMFSATFPKEIQKLAADFLYNYIFMTVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the N-terminal RecA-like domain of a DEAD-box RNA helicase, the Dugesia japonica vasa-like gene B protein
pubmed doi rcsb
source organism Dugesia japonica
molecule tags Hydrolase
molecule keywords DjVLGB
total genus 71
structure length 232
sequence length 238
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1wrbA00
4KYIB 3I8SA 2YV5A 3J81k 1IXZA 5DHAA 1ZM2A 2ZJ8A 4KCGA 1NRJB 3X1ZA 3IIJA 4TZ0A 4CIDA 3CLVA 4QRHA 2WSSD 5SZKB 2C96A 3THWB 4TYNA 1DS6A 1W36B 1KDTA 2VSFA 3VU9A 1AIPA 121PA 2GCOA 3AB3A 4JT4A 3WHKA 1KI3A 1FMJA 4OHZA 4KFRA 1BIFA 1X8KA 1R8SA 3OEED 4GNKA 1RZ3A 4YXWA 3ZQ6A 3WNBA 3JZMA 1EX6A 2FG5A 1RW4A 3ASZA 4V0ME 2H17A 5HZHA 4MRNA 3MD0A 3NXSA 3P27A 4LV8B 1LFDB 3U44B 4TMZA 3KDSE 1I4TD 3F8TA 3VR2A 3CWQA 2FV8A 3MWLA 2GCPA 2DFNA 1F5NA 4PSAA 2QP3A 2XEXA 1Y63A 1GSIA 4W9MC 3GEIA 1Z07A 3EASA 1WRBA 3DL0A 1ZMXA 1YR9A 1HEIA 3FVQA 3TIFA 3NBXX 4Q4HA 1JNYA 4A8JB 1WXQA 4GMXA 2GXAA 1XXHE 3D6TB 3QBVA 3IEUA 1TEXA 2XXAB 2V6IA 3PUVA 5FTJA 2RGXA 2C9YA 4FINA 2HLDA 1E4YA 1NVXQ 4JLOA 1MV5A 1OKKD 2P6UA 1ZM7A 4LHYA 4Q66C 4DT1B 3U3OA 2IF2A 2J9RA 2HEIA 3QENA 4OJQA 3RRNA 3CNLA 3V4RA 2QM7A 2OAQ1 3B7GA 3A1SA 3Q9LA 1F60A 1LVGA 4DXAA 2C95A 1ZJ6A 5JCPA 1KJWA 4CDGA 3RRZA 2OO7A 2ZYUX 4MGYR 1Z2CA 2QTVB 4NBSA 2R44A 4IFEA 2V55B 4AYXA 4I1VA 5BQ5A 1KI1A 3U61B 4TYPA 4DSTA 1W48A 5H70A 4IXMA 3FOZA 1T4GA 3SU8A 4BZPA 1ZUIA 2WIAA 4XSGA 4DLTA 2XZOA 3SNHA 3OZXA 2G0NA 4PSVA 1HH4A 2IX3A 2W6ID 2C77A 5JS8A 1AS0A 3K0AB 4IOMA 3TLXA 2BBOA 3IQXA 4Q48A 4KODA 3AVTA 3B9PA 4RD0A 3FHTA 1Z28A 2VBCA 4M4SA 4JL6A 1SVIA 4NYJR 4P4TA 4ESVA 3RSLA 4CEHA 2RAPA 3QPWA 1UKYA 5FUVA 3ZZTA 1A2KC 4OHWA 4TT3D 5FI1B 4MRPA 3PVSA 3O8DA 5FTKA 3FHOA 3ZZ0A 4M9QA 4D25A 4E07A 4B33A 5HCNA 2ZYTX 3N5CA 4QFMA 4LC1A 1FPMA 2J0UA 4ZDJA 4KYUA 3A4NA 4QM6A 2IYQA 4JLPA 1VYVA 1S8FA 5EP4A 2EQBA 1OIWA 2RGDA 1OXXK 3Q7PA 5HKKD 1P7CA 3KQNA 2FPMA 4O2RA 4B32A 3U5ZB 2CNWA 3NH6A 1N6NA 1BKDR 1U90A 1KY3A 4LYAA 2G9NA 4MGKR 2IYYA 2DHRA 2OCAA 4NL4H 2HXSA 3MFYA 4HAXA 4OKSA 4LI0A 1L7VC 2NZ8A 2RGEA 3MRSA 1E96A 2CE7A 1YZUA 2FU5C 2QI9C 4A6PA 4POAA 3TH5A 3GCGA 3ZVLA 4OHVA 5C4MA 2FSHA 3RS4A 1I2DA 1XTQA 2ZJZA 1CR0A 4C7OB 1O3YA 2JLWA 2GDJA 1W4BA 2QGZA 2CVHA 2WWHA 2FZLA 4QG7A 4YMTA 2O8BB 3K09C 1KNQA 1XJQA 5C1BA 5FOSA 4EPVA 3W8NA 1F2UA 2A9KA 2EFDB 4YMUA 3LDAA 4DZZA 1XCGB 2NO7A 2O8DA 1VCMA 4V03A 3CF6R 4BRUA 2O8CB 1GILA 4LHZA 5DGXA 1R0ZA 2AR7A 1NVUQ 5DYGA 4F93B 2ZJ2A 4AIIA 5DH9A 3GJ6A 3PFIA 3CKLA 3I5XA 1CJVC 1J90A 1KK3A 4N3NA 4DC9A 2NPIA 4M0LA 4TLBA 4NONA 5AUPB 1T0JB 2GKSA 1W0KD 4AI6A 3QKSB 4RFVA 4Z1MA 1WMSA 2WJHA 3UK6A 4OQFA 2QG6A 1MO5A 2ZREA 4Q5IA 4JYCA 2ZJYA 4C0KA 1XD2B 2VIIA 4OQLA 2QAGC 2VPPA 2A5GA 2Z83A 4TZ6A 2GJKA 4RCYA 2W2VA 1XPOA 4QHTA 4QHYA 3WXMA 1R5NA 1KI6B 3SDZA 2YNMA 3T1VA 2OESA 1Q20A 1L2TA 4JBXA 1GP2A 1CR4A 1S1CA 3TUJC 4DCUA 3IHWA 4NH0A 1AGPA 3RYTC 1ZRHA 1E99A 4LY6A 3QNUA 3ZVNA 1QF9A 1ZM9A 1M7HA 1VHLA 1X3SA 4P3YA 3TVDA 3LW7A 2J87A 3BB4A 1P61B 1EFUA 5KSZA 3BIFA 2JLZA 2JJ2A 2WICA 4B3DA 1W46A 3I61A 1XMVA 3EG5A 1GWNA 2I1VB 4C30A 2NZJA 1JAHA 5CYPA 4JYBA 1DOAA 4B2PA 2Q0HA 1J8MF 4TYWA 4LJAA 3K70C 2BDTA 4A4DA 1E2MA 4C0HA 2CL6X 1QZXA 2ZRCA 3FKQA 2OXCA 1Q22A 5CB6A 2IS2A 1E2QA 3GLGA 1DO2A 3NEJA 4HZUB 3TSOA 2W58A 2IBMA 5AR1A 3HYRA 4II7A 4Q9JA 1GKYA 5DN6D 1P2SA 3ND9A 1SKYE 4UXHA 3SJCA 1KSGA 1D9XA 1P73A 3VKWA 3ZH9B 3R9XA 1KIMA 3LBHA 4QJ4A 5HPYB 1NL3A 3K0CA 3CRW1 2WOJA 1Q0UA 2OM2A 3D8BA 4GT1A 4C0SA 3EZFA 5FPKA 5FOVA 5GJVC 3FMIA 5EP1A 4R98A 3SYLA 4DEYA 4C0AC 1OV4A 2BCJQ 2QGNA 3VHXA 3HU2A 3WNCA 1E0AA 1DE0A 3MJHA 4FCWA 2HDNB 3AV0B 2J0SA 1NIJA 2IYSA 2BEKA 2Z43A 2H16A 4RFSB 4HDCA 3PEYA 4P31A 4TLCA 4XTCS 2CCKA 4M9SA 3U7HB 2R6CA 3ZDQA 1TPZA 4UKDA 1XFAA 1ZUNB 1RYFA 4EPTA 1VCIA 3WMFA 3DEFA 4GP7A 4DUGD 1RVDA 4WIAA 3B2EA 4XIGS 4FMCB 3SN6A 4G3XA 2BVNA 4H1VA 3UATA 1EFRD 5DNYB 2OLKA 4TQUS 2GEDA 2WWXA 1YQTA 1VTKA 3DM5A 3ZIAA 2VSOA 1XRJA 3CX7A 4WZ6A 4Q9LA 3B5JA 2WSMA 4URYR 1IJEA 2YZ2A 2IWHA 3TK1A 5IK2D 1G17A 3FFBA 2BMFA 4I1OA 4A92A 3GFPA 1SXJE 1KMHA 1KHTA 4M1WA 3TQFA 2FFBA 3FB4A 4PAMA 3IO3A 1SXJA 1KI7A 5JWOA 4JLDA 1R5BA 4RZUA 4GP6A 1RIFA 2ZSEA 1F6BA 4MRSA 3BWDD 5ANRB 1EGAA 4B3XA 1E32A 4TL8A 1HUQA 2XOKD 2DB3A 4MQBA 3W6NA 3KFVA 2KJQA 5FL3A 4ZDKA 1G8GA 1Z83A 2W0SA 4WZBE 4D4LA 5FBLB 1U0HC 4DDUA 4I81A 1J8YF 2K5UA 4I1SA 2PMDA 2OHFA 3KKPA 1Z3IX 4EJSC 4NKRA 3OIWA 3RS5A 3MJRA 4BLSA 3IIMA 2ZQ5A 4C0LA 3EW9A 1MRNA 2ZI3A 5JWHA 4EUNA 4QJ3A 2IYUA 2ZI5A 5CK5A 4PC3A 3C5CA 4DSUA 1OIVA 1VG0B 3CX6A 3Q5EA 4URVR 1GKIA 5LD2C 1W4AA 1XMJA 2XNDA 2VP5A 2RGNA 4WVFA 1B23P 2ONKA 2J45A 2WSSA 2QZ4A 3K53A 1D6JA 1KI9A 2YKGA 1N6PA 3FWYA 3VMFA 2KWIA 1RE0A 2Y8EA 3MMPA 3P4XA 4D4MA 4ERNA 1M1YE 3A1WA 3E2IA 4B3FX 3W9YA 3C41J 2A5JA 4RKFA 2O8FA 4RVCA 1EFTA 4KLNA 4YDHB 1OH5A 1NVWQ 3BORA 2FPKA 2PLRA 3I8XA 4HAYA 1NY6A 4Z8YA 3QY0A 4P4UA 2PMKA 1GOTA 1S9DA 3CW2A 3IBYA 4FCVA 2F1IA 4A36A 3BC1A 1ZC4A 3SHWA 3EWAA 1CRPA 2ZRIA 1NJFA 2ZE7A 2D74A 4TMKA 5DI3A 2XB2A 1XZPA 4TWZA 1KYIA 4JSTA 2NIPA 1G8FA 2VHJA 4ZIRA 4BGDA 1KDPA 2WWIA 521PA 1KAOA 2R2AA 1UEIA 3K1JA 1Z6TA 1OH7A 1OSNA 2C9CA 1Z29A 3BRWD 5L3VA 1QHYA 4DIDA 1RPZA 2IXFA 1AA9A 3WBJA 2C98A 1OB5A 3L0SA 1TF5A 3H1TA 3Q7QA 4TLAA 3V00A 1NNEA 3VHLB 2OV2A 2WWGA 1OKKA 2BCGY 2ZS9A 3FKSA 2AWNA 4N1AA 1UKVY 2HCJB 4N0DA 2W0MA 2IUSA 3LXXA 2X77A 2Z6VA 1S9HA 3L0OA 1G7CA 3LFUA 4IVPA 4RD3A 3VR4A 4DCTA 4DLWA 2P5SA 1E2IA 1TU4A 1ZNZA 3B6EA 4FCTA 4PFSA 4M9ZA 5J5CA 2V1UA 4FIDA 3RS2A 2HV8A 1VIAA 4EPYA 3IO5A 2J46A 3CB4A 3FMFA 5LB2A 2J59A 4KVGA 3A8TA 2ANCA 4DKXA 3PUZA 5J4VA 4YC7A 1D8TA 1E2HA 1JXOA 1GFIA 1ZIOA 2C2HA 3C5HA 3KB2A 3OEEA 4A1FA 3SC3A 1JEDA 1FTSA 2QY9A 2J0VA 3DOFA 1KDRA 4UNPA 3KZ1E 1CRQA 1N2CE 4ZCIA 1P3JA 3KKQA 2GA8A 3CRQA 1T3SA 3SQXA 3TUZC 3NDPA 3THXA 1XF9A 1R4AA 1SQ5A 4BFYA 5EE3A 3AVXA 3PUWA 3EPJA 1DG3A 4F92B 1OT3A 5F9HA 3U6KA 2XGJA 3OE7A 4QGGA 2IYXA 4G1UC 1CLUA 1UDXA 4FMDB 2XTZA 3TQCA 2W6JA 2C04A 1NSTA 3GJ3A 4EDHA 3KKMA 2XITA 1E9EA 2GZDA 5DIFA 2PEZA 3THWA 4LJ6A 4XH9B 4BUJA 1WF3A 1ZNXA 4YQFA 5LD2B 1KSFX 1OFTA 4MYHA 1Q1ZA 3CONA 1KAGA 3NC1C 4MYTA 4ZDWA 3UG6A 3T5DA 1CXZA 2JIZA 3BFXA 4C9BA 1TU3A 4DEXA 4B73A 1XTJA 2EU8A 2EYUA 2HYDA 3UG7A 4XJXA 1XPUA 4TTPA 4LWZA 3B1WA 2ERXA 1WA5A 1YZKA 1ZM3A 2R6GA 2ZITA 1FZQA 1HURA 2PZGA 4RD1A 4JMPA 4U7DA 3AVVA 4R2IA 2RH5A 4Q01A 1I4DD 1NVVQ 3A1VA 4ARZB 5J4KA 1GNQA 1D2EA 2ASEA 2YC4C 3CF2A 1S2MA 5GVRA 5AJYA 5FPTA 4P33A 2VHCA 4KSCA 2H18A 2ZAMA 1YRBA 2OAP1 3KQLA 2ONJA 2HXYA 2WWWA 3BGWA 4DLUA 4W7SA 5DO9A 3JVUA 3ZD7A 3C15C 5C18A 2W2TA 2WJVA 2QU8A 3AVQA 3BB3A 3R20A 4BQSA 1COWA 1T8TA 4OK3A 1KK0A 1UEJA 1JJ7A 4F91B 3THYB 2QAJA 5FUYA 3FPAA 2ZM5A 2F43B 1IQPA 1XTSA 4DDVA 2IYWA 1NY5A 1JBKA 3QF4A 1VG1A 5JBQA 4URWR 3ETLA 2RGBA 3QUSA 2PBRA 2C03A 4Q4JA 3K0FA 4LJ8A 5FOWA 2AX4A 2QRNA 1E0SA 5JEEA 1NG1A 2F55A 5IT5A 5K8IA 2P6NA 2B8TA 2QMUA 2WAYA 1AJEA 3K8YA 3F5FA 5JZVA 1SKYB 5JJLA 3PENA 5G3ZA 2JIZD 2DYKA 4W5JA 3QXHA 3SZRA 4F4IA 5FTLA 1G7SA 1G8YA 1T5LA 2CDNA 2W00A 4JLJA 4C2UA 4UXJA 1MABA 2KI5A 3UKDA 3ZGXA 4W5HA 1G7RA 1P2TA 4C3ZA 2FN4A 2VHTA 1GKUB 3LX5A 3KUCA 3K0EA 2ZSBA 1R8QA 4JSYA 3KJIA 1AS3A 3IILA 4DVGA 1P2UA 1P6XA 3RVBA 3KQHA 3AVPA 4TSFA 4DIEA 2WWYA 4EPRA 3AVOA 1XZQA 1SGWA 2QE7D 2WWFA 221PA 3QI2A 4NPHA 1XX6A 4MKHA 3EXAA 4M1MA 3TAHA 1OFIA 2REXB 4K81B 4KFSA 4NCHA 3PXGA 5AJXA 3B60A 3VR6A 1H8EA 2ZJ5A 4RCZA 4B35A 4KFUA 2VP0A 1JECA 5TMPA 4IDOA 2ZUBA 1CKEA 4JVNA 4Q03A 1DARA 2JGNA 3RS0A 1NMYA 1DAKA 4BLPA 4DLSA 1E2DA 4HB3A 2MSEB 3AKDA 3U7EB 1LTQA 1II8B 3BS4A 4L16A 2VSXA 4OHXA 5HZKA 2FSGA 1D9ZA 4LV6A 2BBTA 1FX0A 2ZRPA 3D7MA 1R0WA 3HPQA 1U0LA 2ZI9A 3QSYA 4AK9A 4CGZA 4DJTA 2J0QA 4AURA 1N6HA 1YE8A 3H0KA 4LRWA 5B2ZA 1J2JA 4D82A 5DN6A 4ARZA 2H92A 3U7GA 2NPFA 2DPXA 2E1RA 2BV3A 2ZRJA 4F7WA 1UBGA 1VIYA 2ZR0A 5K8TA 1IM2A 2CEAA 3I1FA 2NTYC 2R6FA 1ZD8A 5KU1A 2ZUCA 1G3RA 1OIXA 2ZVQX 2WJGA 1XJCA 4IHQA 4LYHA 1II0A 4HAWA 1P60A 4JVSB 2O8EB 4MKGA 3B1VA 2Q6TA 3T1OA 1V5WA 3WP1B 4BFZA 2HT1A 2IC5A 3IDQA 3QKUA 1KK1A 5KHOC 4B74A 4XD7D 3Q85A 4BFXA 1M7GA 1S0UA 1KO1A 4D2IA 2O8BA 3L2OB 5CDFA 1G64A 1GAJA 1TF2A 1J70A 4BFUA 1RRFA 1FW6A 1UF9A 3AEZA 2EWWA 3SE0A 5A4JA 5KPJA 2IA5A 3GEHA 3S1AB 1N6OA 3OEHA 1JAIA 4WZAE 3CX8A 2G6BA 4PC1A 1JR3E 2NO6A 1KSJA 3QJYA 3NHBA 4M1KA 4PHHA 3IHLA 5L3QB 1HTWA 1Q3HA 3R9IA 2EW1A 1UJ2A 3SBEA 2VEDA 1LV7A 1IY2A 3A36A 1BYUA 4URUR 5JWRA 3P4YA 2FF7A 4KJZA 5BN4A 1G6HA 3SJBA 1BOFA 1XNJA 3DKPA 4QNRA 5G53C 3E5HA 1DEKA 1Z08A 4JLKA 1ESMA 3M1IA 3NHAA 1SVOA 2D06A 1DBSA 3GJXC 3RWOA 1FUUA 1RYHA 1VKJA 1W5SA 3WBKA 3AVUA 4IDQA 4FD2A 1JPJA 2WHXA 3KKNA 2H5EA 1ZC3A 2OBMA 1ZP6A 4MGIR 5EE0A 2V7QA 2TMKA 2ZPTX 3TUIC 4AKIA 4GFDA 5AUQA 2EVWX 4NDZA 2VA8A 1N6LA 1KI4A 4PPNA 1NN5A 2AXPA 3FHCB 3CIOA 4FMCF 2C99A 4JIMA 3V4FA 3L0PA 4DBLC 4LHXA 3AKYA 3B1XA 5DI9A 3H2YA 1GTVA 1P4SA 3K0AA 1LNZA 4RD2A 1MOZA 1E2NA 4ITRC 1ZU4A 4TQ9A 4D4JA 4EQ6A 4V0LA 1IBRA 1N6IA 1AQUA 4XVRA 3OEHD 2WPDD 3UMRA 1FX0B 1H8HA 3EIQA 3HWSA 4LBWA 4CZ2A 4CEHB 5FBVB 2V1XA 3MWYW 1AZTA 2J7PD 4R9UC 2WKQA 2V4ZA 4M1YA 3BFKA 2J5XA 4LPSA 3R7WB 3TR5A 4BECA 3TJZA 3EPLA 3NVAA 5JI3E 1EK0A 3VFDA 2GESA 3U3RA 1ZUHA 1YZQA 4U5XA 3SYKA 5JS7A 8OHMA 1GIAA 1XD9A 5FTMA 3AH8A 4J0QA 1UKEA 4L8GA 3B78A 1NN0A 1QBKC 2ZI7A 1K5GA 3I73A 4A0RA 1F3OA 2R62A 2O8EA 4ON9A 3UANA 5C46F 2D2EA 1QG4A 4HAZA 2V8OA 4ZCMA 2R65A 3GLIA 4DHEA 5ELXA 2OCYC 4MA4A 4TT3A 4QBFA 2JDIA 4C0JA 4FXPA 4RD6A 2B7BA 2V7QD 3CH4B 4MRRA 4KBGA 3VR3A 1Y3AA 2GWHA 4RZXA 4A0HA 4AKEA 5K8UA 2ORWA 1EX7A 2GZHA 3ZVRA 4RD4A 4Q9HA 4HDOB 1OXVA 1YZLA 5F98A 4OHYA 1K5DA 1W0JA 5C2JB 5FL7A 4JS0A 3H4MA 2JAQA 2GK7A 2N1BA 2ORIA 4KXFB 4XVQA 2MMGA 3P1JA 2ODNA 2YWHA 1NN1A 1GRQA 1DG1G 4QBIA 1D2NA 2C8VA 1UDWA 2GXSA 2O0KA 4PQFA 1SVWA 2G1KA 2O8DB 1JJVA 3GEEA 3EX7C 1H8HD 1KO4A 1KDOA 1ZVQA 2OBLA 2WMNB 3I62A 3RNLA 2ZE5A 1S3SA 3OHMA 4URXR 5KDDA 4BASA 3X1YA 4B6EA 4QM7A 3QKRB 3W34A 3KJHA 2ZJAA 2W2XA 2CVFA 4V0KA 1G3MA 3AF3A 4PSKA 1E1QD 4TL9A 4P0TA 2N42A 1CIPA 2ZYVX 1BMFD 1V43A 3CR8A 3K09A 5D3MA 1W49A 2IYTA 5IDVA 4B47A 1VECA 3OIVA 1ZYUA 4OQMA 4KFTA 1SXJB 4LC0A 4X8HA 5AWFC 1H65A 2F7SA 2P67A 1UADA 2ATXA 2UZIR 2H8KA 1LY1A 4HUQA 1E94E 1BS1A 4Q1CA 2GF0A 1EFCA 3T12A 5FOTA 4PZYA 1W5TA 1YRAA 1U99A 2ECKA 4Q02A 1NI3A 5FUXA 4D26A 3SFZA 1S3GA 4X8OA 3RWMB 4LK2A 1XEFA 2DFTA 3QG5A 4CT4B 2VP2A 1FP6A 5FR1A 5FBWB 3SFVA 3U4QA 2FOLA 3N2IA 3ZLJA 1WBDA 4F38A 4JKIA 3EZ6A 3OE7D 2Q3MA 1AK2A 1LF0A 4E22A 4ASUA 2FWRA 4BZQA 3ICQB 3LXRA 4Q1EA 2XJ9A 4OYHA 3T5GA 1K6MA 4GL2A 4NCJA 4M8NE 1DAGA 1Q1BA 3O8BA 4Y0AA 3MSXA 1AKEA 3ZQJA 4UXIA 3H86A 1KJYA 5KPDA 2DWQA 1ODFA 2G77B 1W0KA 5EE9A 4DLZA 1SULA 2YOFA 1GNRA 2GVDC 3GLHA 3OFND 4LHVA 1J7KA 1NN3A 1QVRA 5EE5B 4CEJA 1N0WA 1T3LA 2VF8A 1GL6A 4PX9A 2PZEA 4XVUA 2QMEA 2MSDB 3VX3A 1G9XA 4NCNA 1E2EA 5HR5A 1E79A 1W36C 3C14C 4ILEA 4LBYA 3VKHA 3T15A 2VO1A 4MRVA 2HJVA 3GLIE 4IVRA 4PHFA 2RMKA 4YMWA 1VCOA 2A2ZA 1HA3A 2GJ9A 4AKGA 2R8RA 3AKCA 2VH5R 1EESA 2E9SA 2QM8A 4B3GA 1QG2A 2PZFA 1Z0FA 2UKDA 3FFAA 4R7ZA 1FOEB 5TB5A 3B9QA 3QEOA 4NYIQ 3RAPR 2ZSFA 3BH7A 5EJEA 5JI2E 3U6BA 1Q44A 3ICEA 3AP3A 1Q57A 1DVRA 5JECA 4CEIA 4M9XA 4IEIA 1X1SA 1NMZA 3ECCA 4BRWA 2B92A 4MKFA 4DLXA 3CZPA 5AUNB 1QVAA 1KOFA 5JSZB 4LV5B 1M34E 1XCPA 1HQCA 1HE1C 4HLDA 4QL3A 5D3MB 2FX3A 4B3BA 1WCV1 3MUFA 2GK6A 3SQWA 5FR2A 2H1LA 3VX4A 3EZ9A 1DAHA 4L5BA 1Z0DA 2CBZA 2BM1A 3LAWA 4GZMA 4HB0A 2F1HA 1G7TA 2ZJOA 4KVAA 4W5WA 3HR8A 3VAAA 1E9RA 1ZD1A 5J4LA 4TMTA 5HE8A 3KQKA 3K9NA 1E2GA 1GL9B 3G5UA 1IJFA 1R0YA 2Q21A 1SVSA 4QKQA 1OFHA 4IEEA 5KSPA 2QRZA 1KMQA 1YZNA 2NGRA 3ZIAD 5CITA 2ZRGA 3UXMA 2VRWA 1U8AA 2A30A 3PUXA 1GRNA 3AVWA 4HEJA 2QMOA 3MWJA 1RRGA 2RGCA 4PQYA 3QBTA 1X6VA 3ZYCA 4EIWA 1NKSA 4BZXA 1CEEA 2RB4A 5EXTA 1E3MA 1AQYA 3RRYA 4IJMA 1U9IA 4NYIR 5EUMA 3WRYC 2BMEA 1R10A 3LA6A 2ODBA 3A4LA 3NBYC 3U3JA 2CCJA 1ZD9A 3GJ8A 2RGNC 3REGA 1N3BA 4UNQA 4RSGA 2F1JA 4CW7A 3VNVA 3M4YA 3EPHA 1VG8A 5GJWC 3K70D 4CEJB 1U9IC 2CL7X 1ZNWA 1CTQA 1QRAA 2FMXA 1GZSA 2VHQA 4IXNA 3CUEF 2CL0X 1BO6A 4GI7A 1T91A 2O0JA 1Q3TA 4BFWA 5JRZA 2F9MA 2VP9A 4LHWA 4EFLA 1IXSB 3Q3JB 4A0GA 3TW8B 3T61A 1TADA 4DLYA 1UPTA 2EFEB 4KHZA 1E1RA 2ZU0C 4YXWD 2GXQA 2AFIE 3GLFE 3BE4A 1AS2A 3PITA 1TF7A 2NQ2C 1SHZA 1OHHA 3KL4A 4TTRA 3T35A 4ZDIA 2GTPA 2NO1A 1M74A 4Q1DA 1AN0A 4MDFA 3AQ4A 4BFTA 2JLYA 1XWIA 4HSEA 4LGMA 4A2WA 2ANBA 5DI3B 1N0VC 3EZ7A 4CEIB 4IW3B 1A82A 1AM4D 4TSFD 2D7DA 2F43A 3OAAA 4FWTA 3VNUA 3TNFA 4ZI3A 1NMXA 3NH9A 2P5TB 5J40A 4CVNA 1P9RA 1XMIA 1NVVR 1WP9A 2QP9X 3IUYA 3PCRB 3QEJA 4I1UA 2AK3A 4Q4JB 5E95A 1U8YA 3E70C 1QHHA 3MAAC 1T0HB 4OK5A 4Q4AA 3QG1A 2XXAA 2QORA 2D3WA 2IW3A 2ZIAA 3C7KA 5E4FA 3LNCA 2ODEA 5FPSA 4MUAA 2W6IA 4V0OA 2ZEJA 2DR3A 2BEJA 1MRSA 1XEWY 4WAUA 5B57C 2JJ1A 2AK2A 3MG9A 1VYUA 3SEAA 4QGFA 2E87A 2OUKA 4HLCA 3ZZUA 1A5TA 2P0EA 1VMAA 4B2IA 3PJRA 1E1RD 2OCBA 2YINC 1LF5A 1DTSA 3LV8A 3ADCA 1XTKA 3D3QA 1OB2A 2RHMA 1OHHD 1JB1A 1SXJD 4QJ5A 1JALA 5E7IA 2L0XA 4OI0A 3FKSD 2IXEA 4ZKDA 5CDFE 2FGJA 3I92A 2JLSA 4DT1A 1JI0A 1NBME 3P20A 4JLAA 3ADBA 1M7BA 3TRFA 5L8VA 3GLHE 1ZCAA 2CNWD 3R9WA 3AKEA 4KITB 1U98A 1U8ZA 3HR7A 3X2SA 4FWIB 2BM0A 2XSZD 3TKLA 4GMDA 1QDEA 2IUTA 4OI4A 2CCGA 4H1UA 3EIHA 2QBYB 2AL7A 4OL0A 2O5VA 2JJ8A 3IPXA 3A1UA 3MCAA 3MWKA 4S35A 1DELA 3IPYA 1ZM4A 4US2R 1NLZA 2BJWA 4TMWA 5H8WA 1E69A 2IYLD 3QKTA 3U3MA 3CRMA 3LH5A 5FPHA 4PQRA 2BHRA 3BFVA 2PCJA 1YZTA 3U3KA 1N0UA 4GZLA 4A82A 4RKEA 3WMGA 4HZIA 1HYQA 1XBTA 2F3TA 2F1RA 5BN5A 1JR3D 2D7CA 3AGPA 1G3IA 2JJ1D 3FMPB 3KKOA 4JJKA 2RGAA 3L0IB 2G1JA 2I4IA 2FE4A 3CBQA 2OFOA 1CS4C 4JLMA 3TSZA 1A7JA 5GVSA 3QXSA 1QHNA 4YDSA 1NLFA 4X8LA 3RHFA 1KO8A 1TMKA 2BC9A 2GEUA 1RFLA 2OSBA 2CJWB 4Z1MD 2IWRA 1F48A 4Q7JB 1GDDA 1MR3F 2J0UB 2OXRA 4C7OA 1P9WA 2PL3A 2DCUA 2WAXA 4C0BA 3T1TA 1QHHB 2XZLA 2WTUA 2QUZA 1XPRA 4D81A 2XNSA 3QF4B 1XB2A 2CXXA 3ADKA 5JMTA 2ZANA 1ELOA 4O0MA 1SZPA 5KNDA 2ZSAA 3F0TA 2ZXUA 2YWEA 1F2TB 4NP6A 1CJTC 2GVZC 2IF0A 4GSYA 4NCIA 4ZO4A 5FPYA 3LD9A 3QF7A 1XTIA 2V3CC 1N5LA 4OI2A 2LKCA 2QROA 4WXPA 1R6BX 2IS6A 4UJ3A 2FEMA 1UBCA 4LJ9A 1G3UA 4Q9KA 3QKSA 3GLGE 1G5RA 4TYQA 4A8JC 2ZRAA 3RSOA 3EA5A 1XMSA 3A58B 1XD2A 4B43A 2ZRNA 3EARA 3BJIC 1F2UB 2FFHA 2Z4SA 3X1XA 4DWJA 4HI0E 4QHSA 1W47A 1YKSA 4URZR 2O8CA 2V54A 5B64A 3KX2A 3U7FB 3BD9A 4TYYA 1E9SA 1G16A 1ZNYA 1KKLA 4QBHA 1XD8A 3PV0A 1X8JA 3NG1A 5DSZA 5EZ5A 4EQ6B 3M6AA 2FJUA 1MH1A 5IF9A 3CNNA 2UZ3A 2PX3A 3AP1A 2PT7A 2AFHE 5CYOA 1YVDA 4TMVA 1XEXA 2O0HA 4RZ2A 1W4RA 1FQKA 1XDBA 1T8UA 1GVNB 1MT0A 4TMXA 3HPRA 2A5DA 2IT1A 2ZAOA 4IOJA 2IYVA 4PC7A 5EXPA 4C0QC 1N5IA 1KI6A 4BLQA 2Z5FA 3AUYA 4P4SA 1NIPA 3C16C 2Q9BA 2OEPA 2ZRMA 1NJGA 3EIEA 4MH0R 3VR5A 2G83A 4EJSB 2LKDA 3AP2A 3L8YA 4JLVA 1RC8A 4HAUA 3DZDA 2CLSA 1P72A 5AJVB 1DO0A 2EFCB 1S96A 1IN5A 1E1QA 1US8B 3W8RA 5J47A 3UPUA 4DDTA 2JJ2D 4DCNA 1A2BA 3SS8A 1M8PA 3ADDA 1CJUC 1E6CA 1UAAA 2AD5A 1G21E 4BEBA 5K8LA 2ZE8A 1KTVA 3IKJA 5AK0A 5M04A 2BMDA 4GOJA 5FOUA 3GLGB 2REBA 4U00A 2ZI4A 4KI0A 3S1AA 3WRXC 5SZIA 3RDPA 2AD1A 2QE7A 4FN5A 3BBPA 1RRCA 421PA 1EWRA 2FFQA 1Z47A 2BBSA 4IOKA 2GBLA 2QT0A 3CZQA 2JA1A 1NBMD 4A15A 4YONB 2AHOA 1PLJA 2R9VA 1LS1A 1SVMA 1RKBA 3SR0A 1W4CA 4TLDA 4LZZA 1G5TA 3KTAB 4DSOA 5J4HA 1TQ6A 5KYKA 2ZRHA 1L8QA 3R8FA 2JCSA 4UNRA 1OYYA 1ZU5A 3DKVA 2ZRDA 3QXCA 4L9WA 5H68A 1UM8A 1OJLA 1ZW6A 2ZR7A 1FNNA 2DFKB 5IK2A 4PO9A 4RFSA 3WP0A 2XTMA 3JZAA 5KO2A 3JVVA 1KMHB 1WB9A 3GLFB 2REOA 4HUQB 3N2EA 3BH0A 2PH1A 3LWNA 2PJRA 1GUAA 5J4YA 4JL5A 4OQNA 4DUGA 1G4UR 2HLDD 1XEXB 1U94A 4OI1A 3ND8A 1PUIA 1OXUA 1O87A 4LDJA 3NBZC 4EPWA 3ZVMA 1NG9A 3C8UA 2GF9A 2WKPA 3AF4A 2QAGB 4HLUA 4XSHA 5GJCA 5JCZA 2YHSA 4M1OA 2C9OA 4B71A 1L4UA 5JHHB 1FQJA 2BKUA 1P62B 2GJ8A 3DDCA 4EKDA 4E5UA 3SJAA 3W5IA 4Q21A 1E2LA 2GXUA 4PR0A 1N25A 2MMCA 3O8RA 3WNDA 2F9LA 1Z5ZA 3ZS9A 3Q72A 2SHKA 1FTNA 3NBFA 1NBMA 1KI2A 4L9SA 2WVJA 4EJSA 1R5OA 3GJ5A 2Z0MA 3K9HA 3TAUA 4LBZA 3EA0A 3GQBA 3FE2A 5LB4A 4B2LA 1OLOA 4GOKA 3FDIA 4NYMQ 2VHUA 4DDWA 3AVYA 2KE5A 1US8A 2PT5A 5EUQB 4LOAA 3LX8A 4D6PA 1I4LD 1AZSC 3OIUA 4C4PA 1A1VA 3GLHB 2IEZA 4WXRA 3T06B 4M1TA 1IN8A 1G4AE 3K70B 2HF8A 2IS1A 2IL1A 2QTHA 2W83A 2WJIA 4PPGA 4WA7A 1HT2E 1ZAKA 5L3SB 2GRJA 4NHOA 3KXLA 3DZ8A 4JBWA 3TMKA 4UJ5A 4IDHA 1G19A 1OXSC 4D0NA 2O8FB 5CM9C 1E4VA 4MKIA 1FUKA 4TQAA 2LWIA 2I1QA 3QVVA 3TW4A 1DAFA 3N70A 1ONBA 5KDLA 1WDTA 4GDFA 3LW8A 2OBNA 1TAGA 2XOKA 4Q7MB 4OQXA 4G5SA 1Z06A 2VQSA 5GJBA 4LJ7A 4B76A 4TL6A 2X2EA 5F9FA 3KTAA 4YMSA 1YJ5A 2OCPA 2CK3D 2VF7A 2A5YB 1XJ0A 2PX0A 3W6OA 5A5GA 3ZD6A 5E7MA 2G0TA 4AD8A 4AYTA 1CULC 1D2MA 1C9KA 1JQJC 5KNBA 4AG5A 4WW0A 4LCBA 4O25A 5HCIA 3SYNA 2DY1A 2BJVA 2BBWA 5KSYA 4KAXA 5HTKA 2FPLA 2OG2A 5EZ6B 4JLBA 4TN1A 3GLFA 2BOVA 2BWJA 1CJMA 1E98A 3U44A 1JXMA 4A0FA 2D2FA 1HV8A 3K9LA 3T34A 3SBDA 1B0UA 4RZ3A 2QPOA 4BFVA 4LYJA 1CP2A 5FTNA 2V9PA 3SI7A 1YR8A 2QSZA 3EAQA 3LVQE 5CLQA 4IRUB 3HU1A 3LQRA 1TUIA 4IDNA 2JEOA 1KZGB 4Q4HB 4DLVA 1RJ9A 4HB2A 4F4CA 3HP1A 1UBEA 4NCKA 1IAQA 4Q00A 1U81A 2QNRA 3PG5A 3A1TA 1P9NA 5SZHB 4PC6A 3LQQA 1SVLA 1OH8A 1DAMA 1T5IA 4MYUA 2QMHA 2WM9B 1Q1QA 4G5GA 2WMOB 4XOIA 3C4JA 3G0HA 3LBIA 1DADA 4QXAA 5BN3A 2CK3A 4EFMA 3I32A 5FBRB 1DPFA 3DOEA 2F3RA 1E2FA 5JHGB 4Q9IA 1W7AA 3KXKA 1R2QA 1KSHA 2ZJBA 3BB1A 3MGCA 4JJZA 3MLEA 1A4RA 1WQ1R 3FGNA 2GCNA 5BWMA 1MO4A 3KJGA 1RRPA 2Q3HA 3QIAA 4LJYA 2G88A 5CIQA 1WBBA 3ZS8A 3UWKA 5AUOB 4HDQB 1BMFA 2CHQA 2CHVA 2ZR9A 3GFOA 5JFGA 2CHGA 1SKQA 4JLNA 2GILA 4PTLA 1KI8A 4PANA 4KO8A 4K8OA 1TL7C 1LS6A 5HKKA 3CPEA 2YYZA 3H84A 4H9GA 4GPTA 5KOYA 1NKTA 2FDCA 1E9BA 2QPAA 3CNOA 2W6JD 1HE8B 4B6FA 1SVKA 5CIWA 5FI0B 2GZAA 3GPLA 5FOXA 5TY0A 2JDID 1G3QA 1YR7A 3A37A 2QPTA 2YC2C 2A3RA 3QXXA 2PEYA 2EYQA 4MITA 1TQ4A 1E0KA 721PA 4CYMA 2QQ0A 2J7KA 4DCSA 3THYA 4RJLA 1QHSA 4JL8A 2JLVA 4ABYA 4JT2A 3TSWA 4Q4AB 3PUYA 4LYFA 5JSZA 4DB4A 3VU9B 4I99A 4TL7A 3O47A 5TVKA 4Q7KA 3I4LA 1G20E 1NSFA 5EQTA 4N0EA 1ZBDA 2ZU6A 2ZVPX 5DLQC 5GADl 1PUJA 2ZYWX 1TX4B 4C2TA 2ZETA 3LLUA 1CF4A 2FEOA 3W3AA 4DRZA 1DAEA 1GL7A 2AXNA 1G1MA 1Z0IA 5TXGA 1COWD 5CB8A 1R7RA 4WBSA 2ZRBA 1GG2A 1RJ9B 5EP2A 3QPVA 3B8HA 2IHBA 3THOA 4AWXA 4LJ5A 5AJWA 5A0FA 1U2RA 3B1YA 2GJSA 2FZ4A 4M1SA 3KUDA 3PQCA 1KO5A 3GJ0A 4JBYA 4NYJQ 3WYFA 4PO8A 4ACBA 1Z0KA 1OPXA 5F3WB 2LCFA 1AGRA 1M2OB 5JJIA 1VCNA 5B30A 1PVOA 2J1LA 4HUTA 2JLRA 3OIYA 2NG1A 3CF0A 1IHUA 1PZNA 4PC2A 1G5PA 4U02A 1S4QA 4KV9A 1E9AA 4V0NA 2OILA 4HLQB 4L15A 4OK6A 2H7VA 4LPKA 2HCBA 3I3SR 2PLFA 2GAAA 2P2LA 3NWJA 1GM5A 2P6RA 5CJPA 4Q1BA 1Q1EA 4O2LA 2HF9A 4Y0VA 3TVTA 3WHLA 2FSIA 1MABB 4X8MA 1K8RA 5G3YA 1E9CA 2ZS8A 3IIKA 1P75A 5DISB 3WMEA 2YOHA 5JRJA 1KNXA 1II8A 4GOXA 2XAUA 1JQLB 3U2QA 3O8CA 1JEEA 4TTQA 2XB4A 3FTQA 1PLLA 1ZINA 4EAQA 2XX3A 1FL9A 2ZTSA 2QA5A 3Q8XB 4NYMR 4D4KA 3BERA 4PHTA 4F4JA 3CPJB 2AKYA 3DM9B 3B82A 3WYAA 4B34A 4BLTA 1GRRA 5EE1A 4EPXA 2GHIA 2KBFA 2UVQA 3NC0C 4Q7LA 5DHFA 1H8ED 3VTKA 4V02A 3LRPA 1CR2A 4MUBA 5KSOA 2ATVA 1D5CA 1VHTA 4NU0A 5IRCD 4IFBA 4HAVA 2CJWA 1E0JA 2VP6A 3QVUA 4HB4A 4ZPXA 4QGHA 3CPHA 4ZV4A 2XNDD 3RC3A 2KSQA 4E03A 4LJ4A 2CLCX 4MGZR 4NZYA 4S2EA 3K0SA 2HYIC 1Z0JA 3KB1A 1CU1A 2GAOA 4G0NA 3KJEA 5UKDA 6Q21A 2PCLA 4B48A 4XTRA 1Z0AA 4Q4LA 2I3BA 1F2TA 3KFXA 2YOGA 4QOSA 2B8WA 3TE6A 4GRAA 2F6RA 3OF5A 4A9AA 4XWOA 5L3QA 4MYCA 2A78A 5IHPA 2GEVA 1MKYA 1PJRA 2J3EA 2NO9A 3VKGA 4AG6A 1QHIA 1Q12A 4DB2A 1OYWA 2ODWA 3FYHA 4XD7A 5TDHA 3V9PA 1G6OA 1W2GA 4M22A 4D0LB 2WBLC 3SJZA 1FNMA 4R2HA 1P5ZB 4IOLA 2IHYA 1TUEA 4BPBA 2IS4A 1QHXA 2WJYA 2GETA 3TGPA 3PEUA 1IN4A 4HYYA 1XXHA 3HYTA 2HT6A 1OFUX 1C1YA 3X1WA 1BYIA 2ZI6A 4LX0A 5KNCA 3U60B 2FFAA 2J41A 1C4OA 4RY2A 3VQTA 3NKVA 1NF3A 2IEYA 4B44A 1EFHA 4UNNA 1XU4A 2ZUDA 1Z6YA 4G5QA 2B7CA 1E2JA 4ZCLA 1AKYA 2RCNA 1J99A 1VG9B 1W1WA 1YZGA 4BWYA 2OT3B 4JZKA 2RGGA 4US1R 1X86B 3CWZA 3X1DA 3HJNA 5TARA 3REFA 1FMLA 2QBYA 2C78A 4Q18A 2HJGA 4PAOA 5DYIA 5H1YA 4L4UA 4HLUC 1CBUA 3T1QA 1X8LA 3IGFA 4M21A 2QQEA 2ZSDA 4PZLA 2WJJA 2YVUA 3IEVA 2R6DA 3WY9A 4JKYA 2CE2X 4LUCA 1S1MA 1G8PA 4EFNA 2DWOA 2WKRA 1XEWX 2XSZA 3A4MA 1T9HA 5FUWA 3Q5DA 2VP4A 5LPNA 2AKAB 3NIBA 1KGDA 2JLQA 5C4GB 1E2KA 1Z63A 2X8AA 3GJ7A 5CJ2A 5G41A 2QL6A 5FFMA 2AWOA 1ESNA 2B21A 1E9FA 1ETUA 3TR0A 2OZEA 2OE2A 3AGQA 2FSFA 2Q3FA 4HATA 3QE0A 4D80A 1NLYA 3CR7A 2J7PA 3P32A 2GJAA 3R7WA 1W36D 4GBMA 2IYRA 3PR1A 1HY3A 3P26A 1IOZA 1XCMA 5P21A 2JATA 3W3ZB 1T3HA 3LLMA 2D62A 4M2LA 2OLJA 3D31A 3DMNA 3AF0A 2WIBA 1W0JD 3AF1A 1YHNA 2OFWA 1JR3A 3AF2A 2FGKA 5FH9A 4HZUA 2QP4A 4OBEA 4OJKA 1PV4A 1EG7A 2IUUA 3EWSA 2D4HA 1MO6A 3G82C 4KLZA 3WYGA 4E09A 2XZPA 4YLGA 3RRMA 2QN6A 4NTZA 5EP3A 2A5FA 3E1SA 2WPDA 1II9A 3IQWA 3B13B 3K9GA 3GLIB 1EXMA 1Z6AA 4PPQA 3CM0A 1LW7A 1N5JA 3BXZA 3UWOA 3K0CC 4LBVA 4PXAA 2IYZA 1HQYE 4IKEA 4Z51A 1XXHB 4IDPA 4ZKEA 5G40A 4A2PA 1U0JA 4WOPA 1VDZA 2ZE6A 2R6AA 3HDTA 4DCVA 1MO3A 1GNPA 4Q19A 1JR6A 4AYWA 5FL7D 2VTKA 1FFHA 1KK2A 3DMDA 4NMMA 1W2HA 3I72A 5SZJA 3TBKA 4MDEA 4K46A 3R8CA 2YWGA 3DO6A 1I2MA 1SHKA 4G5RA 4A2QA 3AUXA 3DPUA 3DVLA 3GMTA 2IK8A 5JEDA 1N6RA 3SOPA 2WZQA 3LVRE 1GITA 2QAGA 1XTRA 4KBFA 3EZ2A 3RLFA 3QPUA 3QKRA 2AN9A 3AM1A 2P3SA 2BIFA 1G291 1IN6A 3B1ZA 1PLKA 4QNMA 4Q1AA 4PHGA 1OXTA 2NMVA 2C5LA 1E9DA 2B6HA 5KUTA 5EXXA 3F3YA 1TQ2A 2WOOA 4AY2A 4P32A 4XWAA 2Q9AA 4BLOA 1KO7A 2EFGA 4QBGB 1E79D 4P4SB 1KZ7B 4JVLA 5B58C 2OFXA 4NE2A 1UFQA 3CO5A 4DLRA 3RABA 3ASYA 3RS3A 2RKOA 1Q21A 3NTUA 5BYJA 4AC9A 4R71A 3OESA 1ZIPA 3LY5A 3ZJYA 5LBIA 2ZRFA 2A7QA 1KJZA 2FNAA 5L3SA 2JLUA 2KB0A 2ZRLA 2ZS7A 4Q47A 5E3HA 1EWQA 3FMOB 5AJZA 3GJ4A 1LB1B 2Q9CA 2CMKA 2BKEA 3I5YA 2G3YA 3BH6A 4PO1A 3QQ5A 4US0R 2X19A 3U4QB 5CLLA 3THXB 3L8ZA 5KDOA 3GD7A 5DE3A 2GNOA 2V6JA 1UKZA 2BMJA 2DWPA 2X2FA 3QXJA 3RC8A 1KY2A 1Z22A 1EFRA 1CJKC 1R0XA 2JLXA 4ASUD 5BXQC 5JLJA 821PA 1NP6A 2PJZA 2YWFA 3SHFA 3KXIA 4CT5A 3PEVA 1P2VA 4UNSA 2KBEA 1N6KA 3NEYA 5KTYA 5D3QA 1HT1E 2FA9A 2QSYA 2QTFA 4B75A 1OE0A 2GBLC 1W44A 2MSCB 2ORVA 2YJTD 3BK7A 4UQOA 4Z8XA 621PA 4XWKA 5BYKA 2IXGA 1TTTA 2CLDX 4B3CA 2WV9A 5BW8A 2ZROA 1JPNA 1G8HA 1CR1A 4M53A 3BAFA 4BFSA 1E2PA 3LBNA 4FMBB 2Z4RA 1Z6XA 3LO5A 4A6XA 5LDDC 2H57A 4CF7A 1XP8A 2GCOB 5E7JA 3DHWC 3GP8A 3UMFA 3RS7A 1X1RA 1YU9A 1ANKA 2VL7A 4ACAA 5CK4A 3ONWA 1Z6GA 4FW9A 4G01B 1N5KA 1TEVA 4DSNA 1G41A 1Z8FA 1M6NA 4IVQA 2X1VA 4BEJA 3PEWA 3VR1A 1QHGA 1IXRC 1FP7A 1IY1A 3EPKA 4JVMA 2XJ4A 2FH5B 4Q1FA 4QGAA 3OFNA 4KSBA 3M0EA 3CRRA 3PIRA 5FBQB 1WE2A 2JASA 4YMVA 1VYTA 4ZIRB 4PZZA 3HU3A 3W90A 1DAIA 2O52A 1VPLA 1IN7A 1OW3B 2HUPA 1TNDA 4BE7B 5JJKA 1UBFA 1SXJC 2P65A 1TQDA 1G18A 4LSGA 5EXSA 1OH6A 1T6NA 5F2EA 3K0FB 2DBYA 2VLIA 4PPFA 3A6PC 1OF1A 3IBGA 3RANA 1BH2A 3UIEA 2ERYA 2QENA 3EC1A 4A8JA 4D0GA 4BLRA 3B85A 1IONA 1ZCBA 1KKMA 2NOAA 4TLEA 3EC2A 2VYFA 5TV2A 4V0MA 4FMDF 1Z2AA 3W5JA 2N46A 4G5OA 4ESHA 5L3RA 4CRWB 4AKHA 2QT1A 4PAQA 4QC2A 3QOFA 4O3MA 2EWVA 5CM8B 4Z54A 3KQUA 2ZRKA 3L82B 3OAAD 2XTNA 4ZI2A 3GFTA 2QEQA 2RHDA 3W6PA 2DFLA 3BOSA 1YR6A 3CRVA 1IY0A 3UMSA 5HE9A 3CH5A 4FI3C 2EFHB 3NDBB 2NO0A 1L4YA 4I4LA 3L43A 4KU4A
chains in the Genus database with same CATH superfamily
1ZZEA 4KYIB 3I8SA 5C1DA 2YV5A 3W04A 3AF5A 4ZTZB 2LCQA 5FWYA 1ZM2A 3PQ4A 2WFLB 3E3LA 1V48A 4MGEA 3X1ZA 3L7IA 2P1DA 3IIJA 4TZ0A 1QV9A 4XPIB 1Q74A 1V3QE 3IAHA 3CLVA 5AI0A 4ZHQF 3F47A 3DNFA 4U5QA 2WSSD 1UK7A 4MLCA 1V11B 3HA7A 3ZWQA 5EJ7A 1DS6A 1TYBE 3HYLA 1KDTA 2F90A 1TC1A 2VSFA 3LT2A 5J2TB 3GRYA 2RG1A 1IWOA 2ST1A 3OPXA 4J6FA 3V1TC 2GCOA 3AB3A 1KI3A 1DQPA 5TSDA 3G2MA 1C1XB 5HILA 4QAQA 3OEED 1KAMA 2Z58A 2FWIA 1B1AA 3HHEA 3MWDA 2I6QA 4R9SA 1VLZA 4GC9A 3TTTA 3ZQ6A 4K6GA 4EHJA 1E1CA 1GD1O 2J4FA 2RK3A 3ASZA 3DD5A 4V0ME 2ZYAA 3AEYA 1MDFA 2JKVA 2VG8A 3MD0A 4C6TA 2O3UA 4YJGB 3IUNA 4AL4A 5DNUA 3KDSE 3NEPX 1TZ2A 1NURA 1P0MA 4MHOA 3PFNA 4H6XA 1ZICA 1FNCA 1GAQA 2GCPA 3E9RA 3F1LA 4RAQA 4EYGA 3LPCA 4CF5A 2QP3A 3AEUA 4KOAA 2VJCA 3HKCA 4HWKA 5EQFA 3DDUA 4WLVA 4ZVOA 2R8ZA 3NASA 4OKNA 1Z07A 3EASA 1WRBA 3F9RA 2QVLA 1H0RA 4ZARA 1UJNA 3PT9A 1Y6JA 5B7NA 1AHIA 1WXQA 1FFYA 5DBOA 3A10A 4F5WA 3GELA 1NQVA 4K40A 4KQFA 4OBWA 4G8BA 2RGXA 1SIWA 2V59A 4J76A 2CWDA 2P2DA 4GMKA 4FINA 4ZALA 1NVXQ 1W29A 1MV5A 1R4ZA 3SAJA 4I9UA 1NNUA 4Q66C 4DT1B 3J81A 3X1JA 1NRWA 4BNIA 5KOJB 3S27A 4PZEA 5I7AA 3WB1A 2HEIA 1SCIA 2VI5A 4PAGA 5BMVA 2YJ4A 2ZBGA 3GRFA 1NVEA 2OAQ1 5CHEA 3A1SA 5LBUA 3Q9LA 2CBGA 4KWCA 1CQXA 1L4NA 1Y6QA 3OE5A 2ACEA 1LVGA 1WPXA 2R86A 3D8SA 3OBIA 3RW9A 3RAJA 1YB4A 1YRQA 3TINA 4BVLA 4DXAA 1ZQ9A 2C54A 4E6PA 2OO7A 1UCFA 2ZYUX 2GWRA 2DECA 2BKXA 4GQBA 3ZD9A 3HYSA 5L3ZA 2P9EA 2V55B 3HNOA 4I1VA 1Y9JA 5BQ5A 1WXHA 4LVOA 2BEWA 1OZ0A 3AZOA 2CD9A 3FOZA 1T4GA 4BZPA 1PTKA 1UMCB 3ED5A 3OZXA 4IIJB 2DUUA 4PSVA 1HDYA 3H5WA 5JSUA 3H16A 1YOVB 4MW1A 4FEYA 1QE3A 4IH9A 4IOMA 3N75A 3NT2A 3HVHA 3LC7O 4Q48A 3B9PA 4WNAB 3FHTA 1M6EX 4EI2A 4M4SA 2PE5A 5AP9A 4OAOA 1PHRA 5J5AA 1SVIA 3ESAA 3GXOA 4ES6A 1HSZA 2E18A 3INGA 2ZT7A 5A9RA 2RAPA 5IPFA 5FUVA 2ID4A 4LY0A 5D7NA 3ZZTA 1FVXA 5TIIA 2CLKB 3FHOA 3ZZ0A 4M9QA 1I30A 1N7IA 1ZBQA 1NJ2A 4E07A 4B33A 3V2GA 4YRIA 1H2BA 3RIXA 4CKXA 4IXWA 4K1XA 4P6VF 3UJBA 2B99A 2I2XB 4B6JA 2P9BA 3A4NA 3QU5A 1THMA 2HUNA 4LZJA 2PWYA 2EF1A 5LZ8A 1SURA 3COYA 3H13A 2EQBA 2QTLA 1OIWA 3C48A 4ZOLB 5D51S 5EP4A 4ND7A 1P7CA 4ZCSA 1L5HA 3KQNA 4O2RA 4X1OA 2FMUA 2OV1A 1JJFA 2CNWA 4FX5A 3D0OA 3DF9A 3NH6A 1BKDR 2H3HA 3L1HA 4K87A 3MFYA 3AFNA 2BR4A 4RX1A 3WYEA 3FTNA 1XNRB 3WXBA 1XYVA 4HV4A 2XYGA 1EB8A 4MJ3A 1WY7A 2DTDA 2GD2A 2CE7A 1YD7A 2WD7A 2YRXA 4K2HA 4A6PA 3R9XB 3W9BA 4ZVRA 4B4OA 3LOPA 2JVJA 4WY8A 2FSHA 1LBEA 4DILA 5ELMA 1F2DA 2BHTA 3P2EA 1D2HA 3OKAA 1JHUA 1I3OA 5DWQA 1QUEA 1EG2A 1GUFA 1W4BA 2C59A 4HLNA 4B8ZA 2DWUA 2IKQA 2X8BA 1JLHA 2WWHA 4GZ6A 3EC7A 4DA9A 4YMTA 1WTCA 1XJQA 1XR3A 2B4TO 3OWOA 4KN8A 4FU0A 5F5NA 3IVMA 2G0AA 3RE1A 2PM8A 4CG1A 1F2UA 2A9KA 2EFDB 1BHJA 1GT91 3AJ8A 1TA4A 3LDAA 4CLEA 1FDUA 4YMUA 2X42A 2Q1TA 5AXAA 2YV2A 3QUCA 4Q15A 3O9ZA 1S2GA 2QN7A 4BRUA 4DV1B 4LHZA 5DGXA 2VYNA 5J58A 1NVUQ 1NQTA 4HN9A 5DYGA 4O59O 3ZY4A 4GKJB 2HJWA 2NYRA 3CISA 3CKLA 3SM9A 1LLUA 2FUEA 3HCNA 4N3NA 4DC9A 5FNZA 1AZLA 1T0JB 1L4MA 1GPNA 5GP1A 4MI6A 4KMOA 3RFCA 3UAZA 3UV3A 3A6JA 2IV7A 3ZTYA 2XF2A 4BEVA 4PNEA 2WJHA 3TVYA 1T0UA 3QVGB 4OQFA 1RM0A 2JGLA 5MN5A 4C0KA 1E3WB 3GY0A 4DCGA 2VIIA 4L8VA 2BGKA 1CUZA 2O59A 2ICAA 2BGTA 3JQ7A 3FFWA 2R79A 4G1FA 4QULA 1PFKA 1FXSA 4KQJA 3WXMA 4A8TA 4JXXA 3IODA 2OESA 4ABTA 4KQKA 3UYKA 2QTWB 1W36D 4NS4A 1LW6E 3ZHBA 4DCUA 3IHWA 2XKAA 4REQB 2FP4B 2A1TR 5DMHA 5H83A 1TYAE 3H2KA 2EAUA 1E99A 2GNAA 2LCIA 3KYBA 1GN9A 3MYRA 5GV8A 4KI7A 4ZCPA 3UW3A 4AG3A 4QOEA 1VSVA 1XKTA 3IMEA 4M37A 2J87A 1UJBA 3BB4A 1P61B 5ENDA 3BWEA 2YVQA 3KB8A 1E2BA 2QUHA 1O4VA 4HG2A 4N0MA 1U04A 3NTQA 4FYHA 4TS3A 3KAJA 2C92A 2IYNA 2NZJA 1JAHA 1SVNA 3N53A 5EXDA 4B2PA 5BSEA 3DBLA 4RTJA 4TYWA 4LJAA 3D4OA 1TMOA 2G4VA 2XGMA 3G2QA 1YQWA 1NOJA 2CL6X 3QKIA 4V38A 4ZVKA 5G0SA 5M2QA 1XHFA 4KWTA 3IUMA 1BROA 2OXCA 4HR7A 1JKMA 5E38A 1AUOA 4Y2RA 4YDQA 2IS2A 1E2QA 3GLGA 3QUAA 3DYVA 1DO2A 3EFBA 4INPA 1PVVA 3NDIA 3TSOA 4D4IA 5ALEA 2IBMA 3DDZX 3HYRA 1KMCA 1GKYA 1NW9B 1UQRA 2W11A 1GN8A 5DN6D 1P2SA 5C5DA 3DOHA 3ND9A 1RKQA 2Y2VA 2NO5A 1KSGA 4N9WA 3MJCA 2YWDA 4QXPA 1WMFA 3ZDFA 4YCCA 3ZH9B 4MS3A 1ADCA 3FROA 1KARA 1PS9A 1CQJA 1PSWA 1PFVA 1U1FA 2POQX 4YJHA 5HPYB 3FOFC 1T2EA 2VUHB 3NOQA 2R0QC 2PKYX 4KZPA 1HETA 3ZK7A 2H9IA 5FOVA 2PZBA 2ZKLA 3HB5X 1Q0PA 5K05A 4H7DA 4NAUA 1XZHA 2HM7A 4DEYA 3E7WA 4LOJA 1DKQA 1Q16A 3GEMA 4IIVA 2BCJQ 4ZT6A 2QRHA 3HU2A 3MT0A 3MJHA 5EA2A 2QQFA 1FDOA 2BEKA 1E9VA 2IOHA 2H16A 3BWYA 4PBTA 2YFYA 3GH1A 1XK7A 4TLCA 3R7FA 1XUOA 2CXQA 3DNPA 5FLEX 2R6CA 1SOVA 3ZDQA 1ZUNB 2XVMA 2GN4A 1VMKA 3RCBA 3ZE0B 3QMMA 4I8IA 5DLYA 4EG6A 4O4IB 2EX4A 3ANLA 4R2LA 5ICCA 2Q2NA 4WJZA 1ULBA 4XIGS 1N2OA 5ALYA 2FW6A 4WECA 4YUZA 2BVNA 5BSFA 5DNYB 1LDBA 3PQ3A 2X7XA 3KOUA 5K45A 2BFMA 1ZGCA 3E5NA 4F8YA 4B6QA 3CX7A 4ZEXA 3AY7A 4Q9LA 5C9ZA 3B5JA 3V97A 4URYR 2YZ2A 5EIOA 1SC9A 4I1OA 4A92A 3CUUA 3H6HA 1SXJE 1XQWA 4C21A 3A7EA 2D5CA 1QGOA 1GUBA 1O94C 1VE6A 3HFSA 3IO3A 1XCOA 1RPJA 3UAVA 1HDZA 1N9GB 2HK7A 3EXHA 1SXJA 5JWOA 1L1EA 2JG3A 4BPRA 1K0UA 3NIFB 2ZSEA 1YCFA 1F6BA 3C39A 4MRSA 3HFJA 1E32A 4TL8A 4OFZA 4AZSA 1HUQA 4D8YA 1CC1S 3LPLA 4MQBA 5JY1A 2UXDB 8ADHA 1JEYB 3UPDA 3R4VA 4R41A 2YL2A 3JAKA 5FL3A 2FHSA 4RPCA 2ZJ4A 4RS4A 3N5KA 1Y8CA 3W6ZA 4EZEA 2VZ0A 3L6EA 1KP9A 3GIDA 2G17A 4WZBE 3DMRA 2CGEA 1DKRA 1BAPA 2P2GA 5JYEA 1AKTA 4LJSA 1ZUD1 2WNHA 4WZAB 1J8YF 2Q1SA 2XW6A 5AKEA 4AS3A 4X66B 4J1NA 1JAXA 2PMDA 3L0YA 4IY1A 3ZCPA 2OHFA 1BXGB 1MTZA 3JZIA 2NSJA 1GNVA 2OHIA 1Z3IX 2XECA 3KVOA 3QLUC 2UYOA 4M0DA 4N18A 3L41A 3G79A 2QG9A 2PLWA 4I4TF 1NU8A 4Y2PA 2ZAGA 4EUNA 3QPBA 4LZOA 2I4LA 3KPVA 1BD4A 1NUSA 1ORWA 3TNDA 4PG5A 1Y42X 2EXXA 2X3FA 1PFQA 4URVR 1VG0B 2H07A 3GVCA 5EZSA 1GKIA 2A59A 4EJ2A 5LD2C 1XMJA 3UM9A 2FW8A 4NZMA 4WVFA 5BV8A 1B23P 2ONKA 3PDIB 5JXIA 1N5OX 1YWGO 1KJ8A 2J45A 2WSSA 4FLEA 4FR5A 4OY3A 5TF0A 4D79A 1KI9A 1P4GA 2D7JA 5DOZA 5F1OA 4ZC8A 5M29A 1KC3A 4PX3A 1K6JA 2W8BB 4F6CA 5ALSA 1RWKA 1N6PA 1NW3A 3ZHOA 4U4AA 1Y7HA 2J9YB 1Q15A 1T2NA 2D3TA 3QA9A 5COBA 1NVBA 1G6KA 5A6SA 2XUIA 5AOBA 1SU6A 4LGVA 2OBBA 3VC7A 1X7ZA 2GT1A 2IHUA 3W9YA 3C41J 2G7MC 4YUAA 5KYXA 1E6MA 3KQVA 5KQLA 2O8FA 4MW9A 3LDHA 1Z2OX 2QZPA 1U0GA 4WSOA 2P11A 1TO1E 3KR0A 1GVHA 1V35A 1XXLA 2B0CA 2FPKA 4K03A 3I8XA 2Y93A 3A9TA 4HAYA 4Z8YA 4F97A 3P9XA 3GGPA 1GOTA 1S9DA 4FPXA 3GA7A 2VHEA 3HSKA 4YUWA 5L7TA 5SYAA 1TE2A 1PT9A 2QE6A 5DI3A 3QEAZ 1VE3A 1KPHA 2OBFA 3RTEA 4CKEA 2BFOA 3WOVA 4CCSA 2FQ1A 1U7XA 4AAYA 4WFJA 1BWRA 2P3OA 4HGQA 2HU2A 1BJKA 1KDPA 5CVVA 4MVWA 1UEIA 1AXGA 3IUSA 2O3SA 3N6RA 1JEQB 3FGOA 5DZSA 1OSNA 2FLWA 5J1TB 4IHKA 1A98A 5EHQA 5I7UA 4MZXA 3PPXA 5ITWA 2D1QA 2BE7A 1ENPA 3FBTA 4LAFA 1AA9A 3O0DA 3PTZA 4X41A 1M2EA 2RIRA 3WBJA 3V00A 4ZK6A 3JQAA 3PC6A 4CR6A 2Y3IA 2Y1FA 1Z75A 2GFIA 3VHLB 2OV2A 2WWGA 1D1QA 4PRZA 2HMUA 1NWHA 2I8CA 1AB6A 3FKSA 1UKVY 2P77A 3GLSA 1G5HA 3NFRA 4N0DA 2W0MA 4KNVA 2YYYA 2IZ5A 3LC2O 1S9HA 3ZU2A 1ZXBA 1WUHS 1KQPA 2P5SA 1P1BA 1UOQA 1MJHA 2FEXA 2VAXA 4UPVA 3RUEA 1W4ZA 4E31A 5CVTA 4B4DA 2HV8A 1O6ZA 3CLTC 2C4HA 3ANYB 1OLXB 3AHDA 4KTTE 1XKLA 3BF7A 1JA9A 4CHGA 1RBYA 3A8TA 2ANCA 2JFPA 3PUZA 2Z2YA 4FSXA 2X0DA 4E5YA 1I51A 2RKBA 3K8ZA 4Y2SA 1MZPA 3C5HA 1GFIA 1ZIOA 1ID1A 2ZIVB 2I29A 4RXTA 4TS1A 5JYDA 5LDHA 1D4OA 1H6DA 3CN7A 4QO7A 3SC3A 2OWDA 2PYDA 2QY9A 5HKAA 2J0VA 4HNAB 3DOFA 2MSLA 4JB0A 4AUMA 1N2CE 3ABQB 4KE8A 3GAMA 3MW8A 3PRJA 1H5QA 1I14A 2YN0A 1P3JA 4YJ3B 4JEIA 5CNKA 3F6EX 1X1BA 4R4JA 1NMSA 2E3JA 2GHRA 1SQ5A 3LZDA 4HXEB 3MBIA 2SICE 4FM9A 4DR6B 2YQZA 5DGDA 2XCTB 3O1IC 4EKYA 1QIGA 4EHDA 2XHEA 4HDMA 3FY4A 4FCCA 2Q4RA 3VI4B 4F92B 1GPLA 2F1KA 3U6KA 3DL7A 3OE7A 3VPDA 2IYXA 4G1UC 2FP3A 5BY2A 2R6JA 5JAIA 1GUDA 1CDDA 4DARA 1CRLA 4IWYA 4KZKA 4EW2A 2V45A 4AMBA 1NSTA 3GJ3A 1PL6A 4UPDA 5E8RA 2G25A 3E8XA 4S1VA 1STOA 1L5NA 4EDHA 1JHPA 3NI2A 2PEZA 5CCEA 1AQLA 2FR8C 4J4TA 3VYVA 4R8SA 4CMBA 3S99A 1MC5A 1RAHA 4RY0A 1ZNXA 2DUNA 1Q1ZA 3CONA 1GU7A 3CCBA 4L2IA 4MYTA 4DEXA 3QVLA 1CXZA 2JIZA 4LE0A 2I76A 3ZWYA 3N86A 2HYDA 4EKNB 3AR5A 4ZDKA 4I3FA 4LWZA 4TTPA 1QM5A 1C9NA 2JFYA 4HCJA 2EFYA 2R6GA 1ZM3A 3AI2A 4JWKA 4JX9A 5DNDA 1FZQA 2CMHA 4RD1A 3DFIA 4JMPA 5HKOA 2WM3A 2WI8A 1HO3A 3HU5A 4Q01A 1U7DA 1N2CA 2BJHA 2PD4A 2ZATA 4ZU3A 5J4KA 3B3QA 2ACVA 3I9LA 4E4RA 2ASEA 2ID9A 4R1LA 1MB9A 4E1BA 1W6RA 4L4RA 4KSCA 4ER6A 3CC8A 2ZAMA 5DW3A 4EHKA 2VT6A 1USGA 1AN9A 3F8WA 2HXYA 3HKCB 3BGWA 2H11A 1SOUA 4DLUA 5CNIA 4YFVA 3JVUA 1MFPA 3ACCA 3CIFA 5HX7A 3A6EA 2XBMA 4YUVA 5C18A 2D00A 2QU8A 3KKKA 3IQIX 4RVOA 4BQSA 3FWKA 4JOBA 3NUQA 2GAIA 2QAJA 4RL4A 2ZM5A 2PLAA 3IRVA 4Q37A 2W9XA 3T9BA 4OMUA 3LVBA 3AR6A 3RHTA 4DDVA 1USWA 2XKBA 5JAOA 2H5JA 2X6QA 2ZTVA 3OA0A 3QVOA 2QJTA 1HDRA 5CT4A 3QUSA 2QRQA 3EDRA 4NARA 1U3GA 1KORA 2AJTA 1N2ZA 4IILA 4LJ8A 1KEVA 3R3SA 5FOWA 3RIGA 2AX4A 5H3LA 1XG5A 5IT5A 5K8IA 2C2XA 2GAFA 4LGYA 4R3WA 2F55A 2QMUA 2ZCVA 2W6ZA 3F5FA 3KOYA 1RM4A 2CNDA 2R7AA 1FF9A 3PENA 2W2KB 3FG9A 2F3SA 3QXHA 2N3ZA 4PG4A 3SZRA 3JQPA 3R3HA 6ADHA 4YRMA 3ZGLA 3AG5A 4N49A 5G0TA 4DZTA 5I9BA 4CL8A 4W5HA 4ZOAA 2PIAA 5TMBA 2CXOA 3C1UA 2Q3DA 4UEQA 4IDDA 1HORA 1UOEA 4M3NA 5AIBA 3CSUA 4DVGA 5KTRA 5LXTA 1V6AA 2GZ1A 1P6XA 2C3MA 1ZWLA 3ZI4A 4DIEA 1KFKB 4EPRA 3G6KA 2E4VA 2WWYA 3GFBA 2P41A 5EJMA 4BP1A 3AVOA 3TXYA 1SGWA 1H2ZA 221PA 2Q5IA 3A6KA 1PSZA 2WDPA 3K4PA 1R00A 1Y3BE 4NPHA 4XGIA 3TAHA 5ITSA 4WNAA 4QOHA 1FJGB 3WL3A 2REXB 3U1BA 2B4RO 3LBAA 2AQKA 1ABEA 5AJXA 4GXNA 1H8EA 3ORQA 2ZJ5A 5KB3A 2ARKA 3GJZA 3Q8WA 1VSBA 3DONA 4G0OA 4KFUA 5CT5A 1CKEA 1DARA 2JGNA 3F6CA 3OLYA 1VYHA 4PGGA 3VPHA 3LKVA 4DLSA 3LCVB 1N2IA 1OFGA 4YT2A 1X0VA 1N32B 1LTQA 4KXQA 2GO1A 2VSXA 5CB4A 3D3WA 3WOHA 1HFEL 2JH9A 5LMZA 3D7MA 4ZEOA 3U39A 1OZFA 3IP6A 2PR2A 3HPQA 4MPPA 3QSYA 4CGZA 2Q50A 3KQSA 4HFJA 1QDUA 1F9AA 1JW9B 4BGIA 1YE8A 4BX2A 2DX7A 3I9V1 2C00A 5DN6A 3DT9A 1ACMA 1BMTA 4RULA 2X76A 1JLLA 2I7TA 3D6JA 3WWOA 4MUJA 4ZO8A 1QTNA 4F7WA 1V6SA 5HF8A 1AKVA 3I1FA 1Q1GA 5I4KA 3KHTA 1A96A 3OEWA 3ELYA 4P54A 4ZXPA 2WJGA 1NM5C 3BIWA 1YVUA 4LYHA 4M89A 1II0A 5GIOE 2B4AA 1P60A 2O8EB 1GGEA 1Z7WA 2EV9A 3B1VA 3F6YA 1DRUA 1LBTA 2G9RA 3KHSA 3QKUA 4JCCA 3DHVA 3NWPA 3LU1A 4UZEA 2QNIA 4AZWA 2EFJA 4J29A 1Q0SA 4PYQA 1FYDA 2RK4A 4DNQA 1VGRA 3AEZA 2BT4A 3T3GA 4RJTA 4L4ZA 1XDDA 1X2EA 1NQOA 1ZVKA 1IOLA 2D0PB 3CX3A 4WZAE 1KU0A 2G6BA 2X8JB 3GROA 5TC4A 4CCYA 4HY3A 3CNEA 3SMQA 1KSJA 2EQ5A 3QJYA 3NHBA 5K03A 4YJFB 5DVZA 1Q3HA 4KE7A 3HGTA 4JA2A 1UJ2A 1YZVA 1ST3A 2VEDA 4IMJB 3RK4A 2AFIA 4FC7A 4BWGA 4TM7A 3OY7A 5LN1A 2FN9A 2R68A 4PCVA 5AW2A 1EMDA 3WJ7A 2XXJA 1G6HA 3RFTA 4ZCTA 2LDXA 2HPZA 1XNJA 3DKPA 3MB5A 4JITA 4HJRA 1QFSA 3TNJA 2V3WA 1SZDA 4XUGB 2YY7A 1UWCA 5G53C 3V9AA 2O1XA 2RHOA 1Y80A 1ZGHA 4JLKA 2RBEA 5CW2A 5EFOA 4AJPA 3M1IA 1SVOA 2D06A 1PJ3A 3FDJA 3GJXC 4N47A 1FUUA 2FG7C 4QPCA 2WP8J 3PFBA 3RAEC 3RJZA 4OGWA 4XGKA 2I0FA 2X58A 1DUSA 2N0SA 1BVRA 4G5YA 2FMHA 1G0OA 3PFKA 2Z3ZA 1H05A 2R4QA 4S1PA 5HUQA 3FSEA 4C06A 4NBUA 4MW6A 4EY7A 4WK4B 3KEOA 5KVVA 7ADHA 1LA2A 5HFNA 1YUMA 5K3CA 1VE5A 5AUQA 4G0QA 2EVWX 1ZG3A 1B74A 2HT1A 1JXQA 1KI4A 5AKKA 3CIOA 1A5ZA 2C99A 3S8MA 3V4FA 4M0KA 3AKYA 4KRGA 3PYMA 1E7RA 3I23A 4BV3A 1ZJ4A 2PQ0A 3H2YA 4NK4A 5KNLA 1SCNE 4MW5A 2QJWA 2MR5A 5LZ9A 2AW5A 4N03A 4TQ9A 1GYQA 2PFKA 4DSAA 1NAHA 2RC5A 2H7CA 1E6KA 1AC5A 4FN4A 3UMJA 4FGWA 3TN7A 3VYSB 3WFJA 5H4HA 4R9UC 1I3KA 4J1TA 3MVEA 4M1YA 3R7WB 3DLIA 3TR5A 4CIVA 1HEUA 4BECA 1RXUA 2C0QA 1M1XB 4MR7B 5JI3E 5EKXA 2PS9A 1YJ8A 2HJRA 4U5XA 4RENA 3SYKA 1WAMA 4ITVA 1N33B 4QD3A 2DQSA 4R6WA 5FTMA 1CZHA 3AH8A 4J0QA 5BUZA 1KU6A 1QBKC 2H4XA 1B4DA 2WZCA 3C97A 2VTDA 3CKKA 5E6SB 3A9UA 4EUHA 1V8PA 4IXTA 1OX4A 5REQA 3HR4A 3P9ZA 1F3OA 4AO8A 3ZE2B 1Q0TA 2HF7A 1T9AA 3DBRA 1YJCA 2FN8A 1BWQA 2JZCA 3ROXA 5GAJA 3L4JA 5B6IA 3GV0A 1O97D 4M8IA 3PXAA 2NP7A 4L5JA 1GQ2A 4K9LA 2R65A 4PYIA 4ZI7F 4XEHA 3WKDA 5ELXA 1T4BA 1WD7A 4TT3A 1E4EA 3MRTA 4QBFA 3X2FA 4C0JA 4ZYVA 3DSRA 3SX2A 2DMRA 4DMHA 2B7BA 2ZYDA 1OX5A 1IB0A 4DAOA 4RZXA 3NQ41 1U2EA 4I19A 4NG5A 5EHXA 1E20A 4HGPA 3VDXA 5KYYB 2GZHA 3ZVRA 4KXWA 4HDOB 1U65A 1NJ1A 3AB7A 3SZUA 4F1WA 3G0DA 3GRRA 1M2HA 1M2VB 2LIVA 4XYBA 3T5AA 4J6EA 4UE2A 4EJFA 1GR1A 3HXKA 2UYGA 2GK7A 4KXFB 5KKCA 1ZK2A 3NM6B 4PZCA 1ORRA 4XVQA 2NU6B 1VLLA 2ODNA 2JEZA 4QBIA 4Q9AA 1XQ1A 2O0KA 2SKDA 3BQ9A 4OG2A 1JJVA 2AUMA 2EKZA 2WVHA 4P2GA 1ZWKA 2OBLA 2WMNB 3CEMA 1J2EA 2OORC 3RNLA 3U3XA 5IAOA 1G8MA 4OLBA 5KDDA 3X1YA 3W34A 3I2KA 2ZJAA 2W2XA 3CRZA 1U80A 4TS9A 3HBFA 5EFZA 1JDTA 1BA2A 4QFBA 5I3CA 3IHTA 3A0RB 5BYBA 1GQQA 3VVBA 1QWSA 1RQ7A 1DCMA 1RQXA 1T5TA 1GPWB 1Z62A 2ZTHA 3IP8A 3KU4A 3PNSA 1V5GA 2N42A 5KTTA 1BMFD 3K09A 1DXQA 3HSSA 4B47A 4DV2B 2IYTA 2WF6A 1VECA 4G5HA 4OQMA 1SXJB 4X8HA 3IAUA 2P8SA 3JAWB 1YAHA 2IIPA 3JQ9C 4YAWA 5LMNB 3AUSA 5AKJA 4E7OA 4UVGA 2OHOA 2I67A 4FYPA 1H65A 4G07A 2P9YA 4MGHA 1CDZA 2ATXA 2VF5X 5E0OA 5IAEA 2UUAB 2PMFA 4O4HA 2QUBA 4N12A 4LNHA 3ABSB 3URMA 3F7NA 1I01A 4BDTA 4Q1CA 2GF0A 2F8LA 2NP6A 4OYYA 5EJIA 3ZCUA 1FDWA 4O4IF 3LIIA 2FZVA 4EA6A 4EM6A 3SQOA 4PZYA 3SIWA 1L5YA 1YRAA 1S3FA 1UPCA 1NOIA 1PL8A 3VZDA 5B4VA 1XU9A 3Q3CA 4L5AA 3MHPA 1S3GA 2F3UA 1YAJA 4I46A 4V3BA 4LK2A 4ZQBA 1XEFA 4EEZA 3FI0A 3EVBA 3QLUA 5IJWA 4ZT4A 3GDOA 1SB8A 1GPYA 3I6YA 1DC5A 1TZCA 1WZEA 5EEGA 2Z6AA 1P6UA 2MWMA 4C76A 3N2IA 3B3FA 4Q0MA 4F1JA 5B1EA 9LDTA 3GEPA 5J2UF 3DVSX 4JKIA 4C78A 1WQ4A 1WCXA 3OE7D 1AK2A 4U7JA 5JARA 4E22A 4ASUA 3CT6A 3O91A 1Y3HA 1KMMA 1LJUA 3CT4A 3LXRA 5B53A 4AQYB 3RVSA 3GVPA 1SEPA 2XJ9A 4HBZA 1K6MA 1OXMA 3EFHA 2WG0A 1SHUX 3O8BA 1U8TA 4Y0AA 2VBGA 1AKEA 3D2LA 3ROEA 5F1PA 3V4PB 4F12A 2PKCA 5BSUA 3ZZ1A 3GLTA 5L9AA 5K1ZA 3QWHA 3LRXA 4DLZA 1Q6YA 3OFND 1J7KA 1TM7E 2BFEB 1X7ZB 4QJBA 1QVRA 5KYXB 3H0EA 4A26A 5A4DA 4P98A 4JASB 3DNMA 1U6KA 3DD1A 3EEQA 4L51A 2PZEA 3A14A 2XYRA 1SG6A 4PX9A 3VX3A 3ORHA 1ISGA 2PZJA 5BNTA 5HR5A 1XZMA 1QK3A 2UZ4A 4ETNA 1R6UA 4HF7A 4M0CA 3VNQA 5LZ2A 5JH7F 3MLAA 4IVRA 3BXFA 3K94A 4ZV9A 2ZP1A 4BNZA 2RMKA 4YMWA 5EPOA 4P81A 3ZYZA 4Z4CA 4GECA 4JJ4A 3QNWA 4HXYA 5LQMA 1TUBA 2QYTA 1PV2A 2C82A 4O63O 2C2KA 4H77A 1SXQA 2PZFA 1OLUA 1T3GA 4FJ2A 2UKDA 4R7ZA 5EL0A 2EX1A 4GI1A 3B20A 4NV3A 4XARA 5HSGA 5JI2E 5EJEA 2G5GX 3U6BA 1ZRMA 3IQEA 5G1NA 4ZMSA 1M2KA 1Q57A 5TRTA 3QV1A 5JECA 4M9XA 1MB2A 2X3UA 4V24A 1X1SA 4BJ3A 1NMZA 1RE1A 1WUIS 3ZWDA 4TRNA 5C32A 1WKBA 2Y4OA 3OZEA 1M34E 2EKQA 1NQUA 2O7NA 5D3MB 4RM2A 2AJLI 3WDSA 5G1PA 4B3BA 3OICA 4C20A 5FR2A 1SHTX 3EZ9A 1K88A 1J0DA 3NTRA 3OZBA 2VDWA 3A9CA 3LAWA 3LGSA 4GZMA 3LJKA 3OE1A 4I5IA 5TF4A 1E7YA 5HE8A 2R7KA 1ESEA 5DX0A 4KN5A 3K9NA 1WBJB 1QLHA 5DXJA 4W1SA 2PUEA 2OYSA 3K4HA 4AX8A 1WL8A 4BN0A 2GLTA 1KWGA 3BEDA 2RGRA 1UZMA 2Q1UA 1EHYA 2GCGA 2QGFA 3P9KA 3RR2A 1SVSA 2XLCA 3IE2A 1B41A 1HDIA 3A1FA 1V7ZA 1L6RA 1X0XA 1XALA 3COWA 4PZDA 5TQ0B 3ZU6A 5CDGA 4LFAB 3GF4A 1G21A 1XVUA 3ZIAD 4CKBB 2ZKIA 3GNSA 2ZIWB 4WKNA 2OO5A 5B1YA 2NT3A 1G0NA 2JAXA 2VNKA 4B45A 2VRWA 1QJ4A 3M4NA 3HTXA 1Z34A 2C5EA 3GH3A 1Y6ZA 3KCQA 4QXMA 3CJTA 3I2IA 4PQYA 1RRGA 3LO8A 1V25A 3TQSA 1A8PA 2WC1A 3PJEA 1UBLS 2R7LA 1GGHA 3N28A 4HFNA 4ODIA 3RAGA 3RFXA 1RP1A 1DBIA 3Q6IA 1P17A 4ARCA 2YJNA 4IJMA 1HFWA 4U6QA 4AJEA 1X1EA 5KX5F 4NNOA 3LM8A 5EUMA 1S8OA 2J9XB 2H1OA 2BMEA 4FZ5A 3FPSA 3LA6A 4Q7EA 1D0SA 4B7XA 3U3JA 1ACLA 1NUQA 1ZD9A 4L2IB 3GJ8A 2JI9A 1Y1LA 1USKA 1ZONA 2F1JA 2ZTLA 3TGWA 4CW7A 3U4CA 1QYVA 5GJWC 3U7QA 4Y2UA 4OU5A 1ZNWA 3PXXA 3WLOA 4JWTA 1JSZA 4F56A 2DG2A 4GI7A 1T91A 5JRZA 4BFWA 2E4WA 1E8NA 4ONEA 2BZ1A 1CIJA 2I6FA 2R84A 2G4LA 4W5QA 1MZVA 4C7MA 2P69A 4LEIA 2YMPA 3D3KA 1UPTA 1CUWA 2CLFB 2EFEB 1WB5A 5B1HA 3T3HA 4AZVA 4ZVLA 1S4MA 3ESBA 3QFHA 1TKRA 5A71A 1T3TA 1AS2A 3PITA 1TF7A 1CZLA 4XEUA 3DAOA 3O8NA 3Q7TA 4TTRA 1GAWA 5CA0B 2NO1A 4MCIA 4G36A 1B00A 4PO3X 4Q1DA 4WN9B 4JI3B 1RXYA 2RD2A 4RTSA 3EGWA 4LGMA 4A2WA 1EK5A 3PC8C 4XWWA 2XOXA 3CO0S 2C9MA 3SQLA 5FJJA 4BWFB 2RFLA 3TI9A 4CEIB 1I0LA 5K8TA 3JU3A 3AHGA 2TS1A 2VPZA 1BDHA 1S2IA 1PEYA 4ZAVA 2O3RA 3TNFA 1GGVA 4F3CA 5ICSA 5J2TA 4FWTA 1P0CA 3NH9A 5AKYA 4D0SA 3O7WA 3QEBZ 1OZGA 4JI0B 3KJFA 1D09A 1C1XA 2QP9X 1R0CA 3B48A 2Q5LA 2AK3A 4U6SA 1IZ0A 1SNYA 5KTPA 4CPDA 5B7GA 4B3MB 3G17A 4POOA 2HDHA 4WNIA 1QV6A 4KN6A 5JMWA 1U7HA 1D07A 1IBKB 2DPMA 2Q2VA 2Y99A 3KKLA 3N2ZB 1XVAA 2CSUA 1GCOA 3EIWA 3T0FA 5E4FA 4HBGA 2OCDA 4B81A 5IVIA 4C6TB 3N39C 3TLCA 1LC0A 5U4XA 4PVCA 2BKLA 4NC9A 1L4EA 4LRXA 1Z5PA 4FHEA 2I7CA 4V0OA 3PDHA 2ZEJA 1M73E 3RTCA 3X43A 1RWXA 3U49A 3LLSA 1EIWA 4CE6A 2PWAA 4L74A 4QGFA 4RHFA 1H9AA 2OUKA 4HLCA 2JGIA 2IGTA 3OTWA 1DTEA 1FRVA 3DTVB 5AW9A 5B4UA 1A5TA 1MD9A 1EPUA 1VMAA 4JC0A 4C7KA 4H16A 2YINC 4EG1A 3OOWA 4N7MA 3IERA 1OB2A 3ENNA 3M9XA 4BUCA 1T0IA 1JB1A 3IAS1 3KK0A 5FI3A 1P39A 3TO5A 4UTNA 3PNOA 2X0EA 5H9WA 4OI0A 1UBTS 3K8QA 3GRPA 4JSRA 4AN4A 3D4BA 2FGJA 1BEZA 1M5UA 3QUBA 4YAEA 3O1HB 4E46A 2JLSA 4DT1A 3DF7A 5K9ZA 4XVCA 2KX7A 2X8LA 1SQGA 2CNWD 3AM3A 4LDQA 3AKEA 5BMVB 3R9WA 1GLNA 1YO6A 2HFKA 2NADA 3HVKA 3IPCA 4FWIB 3TKLA 1URPA 1QDEA 3ZJ5A 5KMGB 2F8TA 3A4IA 4IIXA 2ATEA 3SSAA 3L46A 3IT2A 1K2WA 2IXBA 1NAIA 2CCGA 4H1UA 3EIHA 1F8GA 1WW2A 4BRZA 2Q4OA 2VNHA 1JHRA 3QV2A 4OL0A 5BNIA 5E1BA 1SBYA 3UJ6A 2HTEA 3MCAA 2EDAA 2WYWA 4QUAA 3P0FA 3V2HA 1Y4UA 4MVJE 4LSMA 3BYZA 2DHEA 1E69A 3U3MA 3Q8KA 3CUYA 1ISIA 5BP7A 4FOSA 1MIOB 4L0MA 2NUTA 1UXKA 2B1GA 4NFYA 3ILYA 2CFIA 3O0TA 1E8DA 4O29A 3H5LA 2P8JA 3WMGA 5I7OA 3D6FA 4MQUA 1NFQA 4UZFA 3T7KA 1YOVA 1TZBA 2F1RA 1JR3D 1E61A 2D7CA 1SY7A 2JJ1D 3ANMA 3D3EA 3G5TA 2PL9A 1YBAA 1LQTA 4HMPA 2Z2XA 4QDKA 3CBQA 3GBSA 1CS4C 1JT2A 1XTUA 2HBZA 2VAPA 1NTRA 3H3XA 5K6RA 3M6IA 4WV3A 5GVSA 1YR1A 5E6RB 3EPPA 3EXG1 1E0AA 3FUUA 4LECA 4YDSA 4ZN6A 4D9BA 4ZREA 2AYZA 2JI8A 1K08A 1QYRA 4M54A 3QE2A 2CJWB 3FMGA 2IWRA 4O2AF 1ISSA 1V9CA 2C7PA 2EZ8A 4ZOCA 2OXRA 5TGTA 1P9WA 2G9VA 1FFBA 3HVJA 3ROQA 2WAXA 3LCMA 3PNLA 3TTXA 1CQWA 3RNOA 4C2AA 1P1JA 2QUZA 1F51E 2CFOA 4P80A 4JNKA 5LWQA 2XNSA 4V0SA 2JFNA 2AFIB 4S3MA 2NACA 1UBRS 3ESQA 3AY0A 3PR2B 5E4JA 4Z0HO 3WDKA 4COOA 2ZANA 1ELOA 2GRUA 4NG4A 2HCRA 2ZSAA 4BLVA 4EGQA 3NKLA 1XZJA 2OPBA 1VSQA 3ZCSA 4GSYA 4X6XA 1OI2A