1WRBA

Crystal structure of the n-terminal reca-like domain of djvlgb, a pranarian vasa-like rna helicase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
238
structure length
232
Chain Sequence
b'KYDSIPVSVTGPDYSATNVIENFDELKLDPTIRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIINHLVCQDLKTAYPKCLILAPTRELAIQILSESQKFSLNTPLRSCVVYGGADTHSQIREVQMGCHLLVATPGRLVDFIEKNKISLEFCKYIVLDEADRMLDMGFEPQIRKIIEESNMPSGINRQTLMFSATFPKEIQKLAADFLYNYIFMTVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DjVLGB
publication title Crystal structure of the N-terminal RecA-like domain of a DEAD-box RNA helicase, the Dugesia japonica vasa-like gene B protein
pubmed doi rcsb
source organism Dugesia japonica
molecule tags Hydrolase
total genus 71
structure length 232
sequence length 238
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1wrbA00
1NY6A 3PFIA 5JHHB 4OI0A 2VHTA 4W5JA 2GETA 3SDZA 2AFIE 3RABA 3ONWA 4I99A 4KJZA 3UKDA 3G82C 4JBXA 1JAHA 1N6OA 1JALA 1NL3A 1IM2A 2QBYA 1C4OA 4RD1A 1OFTA 2CLSA 3HPRA 4HLUC 2VPPA 1SGWA 1ZVQA 1Q1QA 2A2ZA 3PXGA 1E9AA 5GADl 3IEVA 4IXMA 2ZSAA 3A1VA 3H0KA 5BN4A 2DWQA 4A8JA 2O8BA 4NCIA 1UPTA 3T12A 1GM5A 1B23P 5JWRA 5HKKA 1NBME 3QBTA 1OXSC 2ZANA 3MJRA 4N3NA 5BYJA 1KSJA 1EESA 4MA4A 5IK2D 3PITA 5DI3B 2F3RA 4DBLC 3SC3A 2QTHA 1NN0A 5J40A 3A8TA 3LRPA 4PANA 2H16A 3GLIA 1W36B 4L5BA 1TU3A 1NIPA 4TMKA 3KQLA 1WE2A 2BKEA 1QG2A 2GEVA 5EE0A 3F0TA 4CEHA 2ZRFA 4YLGA 3P1JA 4Q4AA 3SN6A 2FE4A 5CM8B 3NC1C 5FI1B 3KKMA 1RRFA 2QP9X 1R8QA 2ZYTX 2OUKA 4GOKA 1OW3B 2CEAA 1DAGA 4IXNA 4AYWA 2ZE6A 4JSTA 3MSXA 3CNNA 5GJVC 1KI3A 2JLVA 2RGBA 3GEIA 4IFBA 3ND9A 4LOAA 4ILEA 1HQCA 3LY5A 4PQYA 2L0XA 2QQ0A 1T3SA 5EJEA 3KDSE 4FMDB 4LYAA 2VP5A 3TUJC 3ZVLA 5LD2C 4YMVA 5F3WB 2NIPA 1XEFA 2OXCA 1SVOA 2Q0HA 4Q19A 2JCSA 2RGGA 1Z0FA 4FI3C 4Z8XA 4QJ5A 3ZIAA 2FGKA 1ZAKA 3U3RA 3AP3A 2YV5A 3HP1A 1II8A 4PZLA 5TV2A 4DCUA 4MQBA 5KDLA 1BYUA 1RYHA 3BWDD 3KXKA 5FBQB 3W90A 1VYTA 5KDOA 5JI2E 1KJZA 4DLRA 5FPKA 1EFUA 2P5SA 1J99A 4P3YA 1CR2A 2XZLA 3NEYA 4PC1A 1Z28A 2XTMA 1XJ0A 3QXCA 2JEOA 3I32A 5ELXA 3R9WA 3K0FA 3EPJA 1YQTA 1YHNA 2FEMA 2GK6A 2H18A 2J7KA 4Q5IA 2JLYA 2XB4A 1SXJB 2RAPA 4JLBA 4DWJA 2QSZA 1BMFA 1KDPA 1F3OA 1MRSA 3B1XA 5JHGB 1R2QA 2VP9A 4QJ4A 3RVBA 5J4YA 2IYVA 4FWTA 2GKSA 1XRJA 4K46A 2DWPA 4DXAA 4B2IA 2IUSA 2JLSA 4FN5A 4JBWA 1XDBA 2GCPA 2NTYC 3KXLA 1YR8A 2ZJAA 4O25A 2ODWA 1E2HA 3WMGA 4PFSA 1CP2A 3EIEA 2V9PA 3P20A 1OIWA 5FTJA 2IS1A 1IN4A 3EA5A 1FP7A 4PHGA 2V6JA 1J8MF 3AP1A 1ZMXA 2ZREA 4LJYA 4MYCA 4LPSA 2ERYA 5JECA 3RS5A 4HSEA 4JLMA 2OCPA 2K5UA 3Q9LA 3BS4A 5FTNA 2FJUA 2C9CA 4X8MA 3GJ3A 4HUTA 4YQFA 4MH0R 1Y3AA 1E0KA 1H65A 3EXAA 2BDTA 1ODFA 2Z4RA 2R62A 4GI7A 3ZS8A 5CB6A 4TTQA 3VX3A 1E2JA 3GLGA 3K0CC 1D8TA 1HUQA 3JZMA 4OBEA 2GF0A 4S2EA 1XTRA 4V02A 3FKQA 1R8SA 1Q1BA 2VHCA 3AVYA 1VHLA 2VP2A 2QQEA 1LNZA 2C9OA 3X2SA 3GD7A 2GDJA 5J47A 1FMLA 5A0FA 2BVNA 3EZ7A 1XJCA 2JJ2A 4MGZR 2GA8A 2W2VA 3R7WA 3TAHA 4I1SA 2F3TA 1P73A 3VHLB 3IPYA 2G6BA 1RJ9A 2KE5A 4HAYA 5HR5A 1WRBA 1Z29A 4ZCMA 3ICQB 2EYQA 1D6JA 2J0VA 3HU1A 3EIHA 2J0QA 2ZU6A 4OQNA 1GL7A 4OJQA 4XWOA 1R0YA 3P27A 4I81A 1QHYA 2ZPTX 1GNPA 3FMFA 2ODEA 2QGZA 4Q4JA 3CPHA 4HB0A 1JPJA 2OO7A 4HZUB 3VQTA 2IX3A 1NVUQ 2AWOA 4Z1MA 3AVOA 3TSWA 3EC2A 4LJAA 3RANA 2GILA 4TMVA 1G18A 4UQOA 1JR3A 1R5NA 2J59A 1PVOA 5FL3A 3NC0C 1U8ZA 1U8YA 1JXMA 4F4IA 1Q3TA 3B1ZA 1FNNA 1YZNA 4HAVA 1NKSA 5J5CA 4M8NE 2B8WA 2WPDD 1DPFA 3B60A 4M1YA 1BO6A 2AN9A 2KI5A 3PIRA 2HJGA 4BEBA 1N6PA 2XNDD 4LSGA 4WXRA 2REXB 5CM9C 4WA7A 3THYA 3GJ5A 4DB2A 2O8DB 4ZKEA 2BM0A 4LY6A 4AK9A 3EWSA 2MSCB 3OHMA 1J8YF 2IS4A 5DYGA 5AJYA 4B43A 2J0UA 4MRRA 4IDOA 4NYMR 3B13B 3H1TA 1XTQA 3P32A 1NLFA 3KFVA 4ITRC 2G1KA 1IXRC 3BB4A 3D8BA 4MKGA 4E07A 4Y0AA 5KUTA 4LWZA 3BB3A 4TT3D 2O0JA 2QP4A 2W6ID 3NH6A 4KLZA 3QF4B 2W2XA 5HCIA 1JPNA 3VKGA 1G9XA 5TB5A 1ZJ6A 4C0KA 2GESA 3R9XA 4BRWA 2H17A 1OYWA 421PA 1AJEA 3T5GA 2VEDA 4P32A 2ZM5A 1I2MA 2NG1A 3CNOA 1P9RA 3OEED 2DFNA 2J45A 4NP6A 2GZAA 2V3CC 1QHHB 1AGPA 1VTKA 1W1WA 2J87A 3DVLA 3TAUA 1R6BX 2IHBA 5LBIA 3RYTC 2ZRCA 4YXWA 2FMXA 2GBLC 4C0BA 1KZ7B 3THWB 2IS6A 3RS4A 3AVUA 1E98A 3W5IA 4IVRA 4JLPA 1E2DA 1GAJA 5BYKA 2QL6A 3GLFA 4KHZA 1UKVY 1XEXA 1JEDA 2D3WA 2JGNA 2Z83A 3MD0A 4HLCA 4JLNA 1T3HA 4P4SA 4PC7A 2ZS8A 4EPWA 3CPEA 1SVKA 3I72A 5JMTA 3CRQA 4C3ZA 4TQUS 1BYIA 4MKHA 2DBYA 3QE0A 1P3JA 3I8SA 3W3ZB 1QBKC 1UEIA 3MJHA 5JRJA 4EDHA 1HV8A 4QM6A 2BBOA 4BFUA 5KNCA 1KI9A 3V4FA 1II9A 3X1ZA 1A2KC 4TTPA 1U9IC 3FWYA 4W9MC 5HTKA 2R9VA 2HT1A 4A2PA 1E1RD 1KKLA 1N2CE 4H1UA 1OV4A 4LJ6A 4LV5B 4XTRA 4PPQA 3WMFA 4A2QA 3KX2A 2A9KA 2YOFA 3KJHA 1AIPA 3W6OA 3X1YA 1AS0A 1ELOA 2IYYA 1UBGA 2UZIR 2W6JA 1YJ5A 4C7OA 1KGDA 4JIMA 3RRZA 3KTAA 2IYQA 1ZD1A 2WKRA 2F1RA 4AYXA 1CKEA 5BWMA 3ZDQA 1KYIA 1FP6A 1ONBA 3ETLA 3MWKA 5CIQA 2ATVA 1CJUC 2AK2A 2ZSDA 2H1LA 4KITB 2BMFA 2IYLD 2HT6A 2WOJA 4EFNA 1EGAA 3NEJA 3RSOA 1O87A 3AUXA 3C15C 3TBKA 3U7HB 5KSZA 5FTKA 5LD2B 3I8XA 621PA 4ASUD 2O8FB 4IOKA 4P33A 1U81A 2NGRA 4I1UA 1N6NA 4NZYA 1Z07A 3WYAA 2WSMA 2REBA 4DJTA 5EP2A 4X8LA 4KU4A 4JL8A 2I1VB 2G83A 2IYUA 2WMNB 2OCBA 3KFXA 4B3XA 4DLUA 4B33A 3NBYC 4TL8A 2O0KA 1KI6A 1NNEA 3VNUA 4KV9A 1XD8A 4Q1AA 3JVVA 4CEJB 1SKYB 1Q20A 2QMHA 4PAMA 1G8PA 1TUIA 1ZU5A 4CEIB 2OM2A 2PLFA 1R5OA 3I61A 1TEXA 3GFPA 1ZD8A 1KIMA 1X8KA 2ZETA 1F2UA 2ZITA 1N3BA 1XMJA 4H9GA 2REOA 4V0LA 4C9BA 3QVVA 4B47A 2XITA 3OE7D 2RCNA 1KI8A 1E1QA 1W44A 1ZM4A 3I73A 4JL6A 1G64A 1ZM2A 4D4KA 2KBEA 4A0GA 1OFHA 1WP9A 3RNLA 3EZ2A 4BUJA 3TVTA 4L15A 2QPOA 3BAFA 2F9MA 4OQFA 5FBLB 1TQ2A 1M7HA 1Z0AA 1G7CA 3EASA 3QXSA 4M9QA 1G41A 1A7JA 1IAQA 4MGYR 3B6EA 2YYZA 1IY2A 2D2FA 3NH9A 1LY1A 2A5YB 721PA 3EA0A 3IILA 2JDID 2PLRA 3A37A 4CYMA 3SHWA 3CX8A 4NYIQ 3A36A 1MV5A 3PQCA 4PO1A 1XF9A 5TMPA 5TXGA 3IIJA 1VG9B 5C2JB 1VECA 2GTPA 2VF8A 4Q9HA 2IYWA 1NSFA 3DPUA 1II0A 4EJSA 3KL4A 3GLGE 4O2LA 4JKYA 3O8CA 4B71A 4DUGD 4YC7A 2FV8A 3W3AA 1AQUA 2XSZA 1FL9A 1SXJA 1I2DA 1LTQA 3KKPA 3U3KA 3BFKA 3OEHD 3EIQA 4PTLA 3I92A 3K0SA 2ZI3A 1M74A 2WWYA 2IK8A 1U98A 2V7QA 1I4LD 2ZJYA 1TUEA 3NBXX 1Y63A 5KTYA 3TE6A 2VHUA 1Q22A 2VRWA 4DEXA 2ZRKA 4M1SA 4PR0A 4IEIA 1ZCAA 3U7GA 3GEEA 3EX7C 1RW4A 2Q9CA 3X1XA 1KNXA 2ZUCA 4NCKA 3WYFA 4XSGA 4URZR 1XEWX 1NVVQ 1YZLA 2D06A 1G6HA 3OAAD 4JLJA 1ZNWA 3UK6A 3VU9B 3WBKA 1KAGA 1X1SA 4JYCA 2HDNB 3A4MA 4KODA 1DG3A 2ZSBA 4PO9A 2RKOA 3LVRE 4D4MA 2F6RA 1OPXA 2PX0A 3LW8A 4F92B 5L3VA 2GXSA 2YNMA 4LV8B 4PAOA 4G3XA 4JMPA 4Q21A 4URYR 3WXMA 1G6OA 3CUEF 1XXHB 3MUFA 1YRAA 3FB4A 4TYWA 4JZKA 4EQ6B 1E79A 1S3GA 4FD2A 4JS0A 2QMOA 3AVQA 2CE7A 1E99A 2CMKA 1AK2A 2QT0A 5EE3A 1KJWA 2KBFA 4BLPA 3OF5A 3TR0A 3G5UA 1UEJA 2VTKA 4DLYA 1KSHA 1QZXA 2VIIA 5P21A 3AM1A 3GP8A 2PZFA 2F9LA 5FBVB 4LJ9A 3KXIA 5E7MA 2CL6X 2ZS9A 1YE8A 5SZHB 2EW1A 5HZKA 5AJVB 4A2WA 2HLDA 1QRAA 4ESVA 4LJ5A 5F98A 5G40A 1NLZA 2R6AA 4B6FA 4JKIA 4NL4H 1LV7A 2MSDB 3CH4B 1OYYA 2R6CA 3NKVA 4HZUA 2ZAOA 2VQSA 3FE2A 5FPSA 3SHFA 1XZQA 2GXQA 3H86A 2WKPA 1VMAA 2QPAA 2I3BA 5DIFA 3WY9A 2BHRA 1P2UA 3OZXA 1RFLA 3VKWA 3IKJA 3QI2A 1C9KA 4OQXA 3T15A 4BFZA 1S1CA 4HLQB 3AVTA 3UMRA 3VR1A 3AGQA 4HAUA 3TMKA 3LLUA 1YZKA 3SJBA 2O8CB 3M0EA 2NPFA 3RS3A 1ZUIA 2VBCA 4V03A 5HZHA 2LKDA 4KBFA 5FBWB 2WVJA 5IT5A 2O8DA 2OBNA 3UMSA 5JS7A 4KSCA 1G7RA 1DARA 2J0SA 4TQAA 5KYKA 4LHXA 2ANBA 3S1AA 1FNMA 3U60B 1SVLA 4XVUA 3ADDA 2HUPA 1W4AA 2VP4A 1Z0JA 3BH6A 2W58A 1NLYA 1N6HA 4RFVA 5KPJA 4OK5A 4GT1A 4TSFA 5L8VA 1E2FA 4F7WA 2P65A 4Q4HB 4QHTA 4PQFA 5TDHA 4B6EA 1NVWQ 1R10A 3HYTA 1O3YA 1TQ6A 3NBZC 4GOJA 2RGXA 1T4GA 2UKDA 4M4SA 4QBFA 3SJAA 2BCJQ 4ZDIA 2QE7D 3UANA 4GOXA 1D2EA 3CO5A 3EZ6A 4M1WA 4DCVA 1Z63A 2OAP1 4YONB 1X1RA 1CRQA 2CHVA 1ZU4A 4DT1B 3QG5A 1ZBDA 3O8BA 2IXFA 3R9IA 2XX3A 1Q12A 4AIIA 2XXAB 2BM1A 2JIZA 1S3SA 1E4VA 3N2EA 2CHQA 5CLQA 2KJQA 4TN1A 4J0QA 1Z83A 3W9YA 3V4RA 2MMCA 1JEEA 1E9CA 1XD2B 1KZGB 1UFQA 1W5TA 3CRVA 1SVSA 4QL3A 4B2PA 1W0KD 2EVWX 2OSBA 1E0SA 4A4DA 5JJLA 1F6BA 2CNWD 1T8TA 3CZQA 2RGDA 1CRPA 1DAMA 2BMEA 2VO1A 1FFHA 1COWA 1TQ4A 1FUUA 2C04A 4A82A 3U3OA 2RGNA 5E7JA 3AKDA 3VTKA 5FPYA 2QT1A 1EFCA 5JJIA 3QKSA 1E2QA 4HAWA 2W0MA 3FMOB 1XTIA 4HDCA 4CIDA 2GAAA 5A5GA 2XZPA 3FHCB 3B1WA 4PSAA 4UXJA 1JBKA 4EPRA 5JZVA 1N5IA 1QHXA 4TZ0A 2PMDA 3L8YA 2W83A 4WIAA 2EYUA 5DN6A 4TYQA 1D2MA 1XWIA 1T8UA 2JJ1D 1E9RA 3IHLA 2C77A 3M4YA 5FOSA 4RD0A 4PHTA 4AG5A 1WBDA 2D2EA 1AZSC 4N0EA 1GITA 4C0QC 2CCJA 1WXQA 2Q3FA 4M2LA 3UXMA 1M7BA 3NDPA 4XH9B 1EX7A 3ZD6A 2FFQA 4AWXA 5LPNA 2AKAB 2P0EA 2SHKA 1OH5A 4KFUA 3VAAA 5L3RA 2HCJB 4GL2A 1EG7A 3EC1A 4IOMA 3ZJYA 1W47A 4G0NA 4GP7A 1NVXQ 1Z08A 1H8HD 3I5XA 3M1IA 2Q3MA 2Q3HA 3Q5DA 3FMIA 4UNRA 3IO5A 2GHIA 4AKHA 1XD9A 2RGAA 4C0HA 1WCV1 4KBGA 1AKEA 1JECA 1WQ1R 2G88A 5FOWA 4JLAA 4DSTA 3REGA 2R65A 4DIEA 3MGCA 1KY3A 4XD7D 3OESA 4IDNA 5EP4A 4QXAA 2J9RA 2YZ2A 5FUVA 3EW9A 4LBYA 4MUBA 4KCGA 4OK6A 5EXSA 2R8RA 4IFEA 1AS2A 1NJFA 3KUDA 2ZR7A 4M1TA 2OFXA 2V1UA 1NKTA 3IQWA 4BGDA 1KO1A 2EQBA 4V0MA 3LAWA 1IN7A 4DZZA 5DNYB 1RIFA 2FFAA 3AF4A 4PAQA 4CEIA 4DLWA 5M04A 4NBSA 4IOLA 5GJCA 3LA6A 4D81A 1OJLA 3RRYA 1SXJE 4DC9A 1UJ2A 4B3FX 4PSVA 1RKBA 1P72A 2E9SA 2NPIA 1QHIA 4LRWA 3RDPA 4O2RA 3VR4A 1NP6A 2I4IA 5CK4A 1Z2AA 1RE0A 4PZZA 3CB4A 1T3LA 1TMKA 1OFIA 5FUYA 3Q7QA 4DDUA 5GVSA 4IVPA 2CLDX 4A8JC 3ZVRA 1SZPA 4K81B 4QHSA 1KO4A 1G20E 1XNJA 4N0DA 4DLSA 1A5TA 5J4VA 3T34A 1NMZA 2PMKA 2R6GA 4TMZA 3RS7A 4NHOA 3QEJA 3THOA 1CULC 4K8OA 5LB2A 2ZR9A 2ZSFA 4LV6A 2X2EA 3SE0A 4BE7B 2Z43A 4Q01A 4TZ6A 4PO8A 1VCNA 4ZCIA 4R2HA 1XU4A 3CPJB 4A92A 3PCRB 2H5EA 2C96A 3P26A 1VG1A 1RRGA 1KDRA 1JQJC 2HF9A 2I1QA 1KDTA 4NMMA 1YR6A 2J46A 2ZJ8A 1ZRHA 2OFWA 5JSZA 3TH5A 2J41A 2WJYA 2WAXA 3RWMB 2V55B 2AWNA 2LKCA 2X2FA 3SFZA 3UWOA 4BPBA 1KY2A 3AF1A 3KJIA 4ZIRB 4A6PA 2OHFA 3SI7A 1N6LA 4RZ3A 4MYUA 2O0HA 5AJWA 3KB1A 1YRBA 1PV4A 4NU0A 3HDTA 1OKKD 3FYHA 4P0TA 5H1YA 1W2GA 221PA 1KI1A 5HCNA 3NG1A 3W5JA 3ECCA 1N25A 3RWOA 5HE8A 3QKRB 2ASEA 4AYTA 1WMSA 2ZI7A 1WA5A 3VMFA 3K9GA 1Q1EA 3AUYA 5JFGA 3F3YA 5K8IA 4BWYA 3B9QA 2FSGA 1AQYA 1OHHA 2ZRDA 2CLCX 4M53A 1W4BA 3KKNA 4UNNA 4D0NA 1G8GA 1KK0A 2BEJA 1TF2A 3BXZA 1FTNA 1XB2A 1Q44A 1Z2CA 5AR1A 4FXPA 2PL3A 2HF8A 1R4AA 4ZCLA 5C46F 3WHKA 3HWSA 4II7A 1EFRA 2WJIA 1E1QD 3MMPA 3LLMA 4GRAA 1PZNA 3B8HA 2FU5C 4E5UA 3TLXA 5K8UA 1VG8A 3U61B 1XPRA 1JJ7A 4AKGA 1NBMD 3LXXA 1SVMA 2O5VA 5FR1A 4V0OA 1CIPA 1QVRA 4R98A 4ZPXA 4MUAA 4A9AA 2C9YA 1S4QA 2ZRNA 1KHTA 4A0FA 1PUIA 4C0AC 4DKXA 1K5DA 2QTFA 4B3BA 2X77A 2OESA 1ESMA 1VKJA 2PH1A 3UPUA 3D31A 3QVUA 5KNBA 4OHZA 1LF0A 3I5YA 3UMFA 4WVFA 1IONA 1IY1A 2OCYC 5EUMA 1OIVA 2P5TB 3DHWC 3LBNA 5H70A 2CVHA 3CW2A 3BORA 2D4HA 3CKLA 4X8HA 3FPAA 4Z54A 4MKFA 2QSYA 1MRNA 1P61B 1WDTA 2XOKA 3QEOA 2R6FA 2XTNA 3FOZA 3AVWA 2WJGA 4JLOA 3ZVMA 1QHSA 2B7BA 2GNOA 1XMVA 2EFCB 4Q4LA 3MLEA 1OLOA 3KQKA 3FMPB 4JSYA 4BASA 3THXB 4QHYA 3PUZA 2Z6VA 1XPUA 2V7QD 2WV9A 2EFGA 2C03A 2GCNA 5B57C 3IPXA 1N0WA 2W2TA 5EQTA 1GL6A 2IUTA 2VL7A 2ZVQX 2IWRA 5AUQA 3PENA 4A1FA 4LYFA 2MMGA 1Z3IX 2GBLA 4RFSB 1TAGA 1SULA 1YU9A 2GCOB 3CM0A 4XIGS 1KI4A 2CXXA 3QPUA 2RB4A 3QG1A 4Q47A 1NG1A 4X8OA 3RC8A 1UBFA 3LBIA 2KB0A 2ZS7A 2CL7X 2ZRMA 3LD9A 3U4QB 1YKSA 2QN6A 2YJTD 5CLLA 1G3RA 3IDQA 3T06B 1CJVC 4ARZB 2YOHA 3LWNA 4KVGA 4QGFA 2FWRA 3L43A 1W0JD 2E1RA 1XMIA 2OE2A 5DE3A 4M1OA 4NCNA 5KSPA 3IO3A 4JLVA 4TYPA 3KQHA 3GQBA 3K0AA 3QXHA 4MDEA 3K70C 4Q4HA 1J70A 2VH5R 3REFA 4W5WA 5SZKB 1G5RA 4F91B 1KSFX 4LHYA 1A82A 2QPTA 1GRRA 4RVCA 2RHMA 4MYTA 1J7KA 2BMJA 2AXNA 2CJWA 1MOZA 2GZHA 3L8ZA 4FMBB 4NE2A 4R2IA 3G0HA 3B7GA 4B32A 2HXSA 2NO7A 1Q57A 1RRCA 3KKQA 1GOTA 1OF1A 2ZQ5A 1U99A 2A5GA 3AB3A 2QZ4A 2XXAA 3BFVA 4PPNA 2WHXA 3NWJA 3U44B 3WMEA 4EPVA 4S35A 5EZ6B 5IK2A 5KDDA 4HZIA 4PXAA 3LX5A 3QQ5A 1G17A 1S2MA 4Q7KA 4YDHB 4NYJQ 1UAAA 3LNCA 2WWWA 5KOYA 4B3CA 1X6VA 3EWAA 4GDFA 5E95A 5C4GB 1E0AA 1Z22A 3A1TA 4CT5A 4US2R 1T0JB 5CB8A 5J4HA 5EUQB 1IBRA 3Q85A 4Q1CA 3VKHA 3V00A 1E32A 3WNCA 1MR3F 1KMHB 1PLKA 4QKQA 3FTQA 3X1WA 2IF2A 2ZRJA 3N5CA 3X1DA 4BFWA 2JLQA 121PA 3L2OB 4TWZA 3T35A 4URWR 4GP6A 2XAUA 5CIWA 4FW9A 4PSKA 1DG1G 5AK0A 4ACAA 4WBSA 3NHBA 2QY9A 1BIFA 2DR3A 1CBUA 1IOZA 4DLVA 1VYVA 2XB2A 2ORVA 3N70A 3CWQA 1UDWA 4BZXA 3EARA 4Z51A 4ZO4A 4NDZA 1AGRA 3AF0A 1ZYUA 4OYHA 3K9HA 4MYHA 4TYNA 1N5LA 3WRYC 5FL7D 1SKYE 1BKDR 1T0HB 1HQYE 1YZTA 4V0ME 2IUUA 1DAEA 1KTVA 2EFHB 1H8ED 3AH8A 3A1UA 2RGCA 3FKSD 3PEUA 2OAQ1 5JEEA 4GZLA 4AC9A 1ZCBA 2DY1A 1E9SA 4RD4A 1P7CA 1CS4C 1BH2A 2N42A 4RCZA 2ANCA 3LW7A 2A7QA 4IDPA 3SYLA 1CR4A 1E9EA 4BLTA 3C8UA 2G1JA 2Z4SA 2DCUA 3FFBA 5E4FA 4D26A 3AF3A 4IEEA 4A8JB 2O8BB 4ERNA 4BFVA 5CK5A 1PJRA 1S9DA 3TW4A 2JIZD 1OH8A 4UJ5A 1UKEA 2QMEA 1D9ZA 2GJAA 1UKYA 5DI3A 1U2RA 4LBVA 3BFXA 4OI1A 2QEQA 1ZW6A 4JLDA 1GZSA 3LDAA 3PEWA 1GWNA 3GLIB 3BC1A 4TL7A 5DGXA 3C4JA 4HUQB 2EFEB 1YZQA 1OXTA 2A3RA 2WM9B 1G291 2RH5A 4DSNA 4CEHB 1Z5ZA 4NYIR 1MO5A 2WSSD 4Q4AB 4DDTA 3SQXA 1QDEA 4C0SA 3P4XA 4BZPA 2FNAA 2PEYA 2QORA 2PZEA 3TQCA 4LHWA 1TU4A 1ZINA 2XTZA 4A15A 3GJ6A 2ZJZA 3R20A 3W8RA 1SHZA 4LHVA 1OFUX 5FH9A 3A4LA 2OLJA 4QNMA 2BEKA 2ZI5A 4LHZA 4Q9LA 3GJ8A 5FOTA 3QPVA 1SQ5A 5AUOB 2IWHA 2ZE5A 2ZI6A 5DN6D 3TVDA 1ZC3A 2ZYUX 2CK3A 5AJXA 3NHAA 4F4JA 2J7PA 4BLSA 1GVNB 1HYQA 4AKIA 1II8B 1E9BA 2VYFA 4EUNA 4D4LA 4HATA 2AD5A 4I1OA 3ADBA 1SHKA 4FMCB 1E2EA 5F2EA 3BRWD 1BS1A 4BFTA 1EK0A 2MSEB 4LX0A 1LW7A 2W0SA 4OJKA 3FVQA 5IRCD 3GJXC 1VG0B 3EZ9A 1G1MA 1Q1ZA 2FSFA 1P2VA 3MWYW 3MG9A 3T5DA 2O8EB 4BFXA 3K0FB 4WXPA 3W8NA 2QP3A 1W36C 4C0JA 5G53C 1K8RA 2FFHA 5CYPA 5HKKD 3DMDA 5JWOA 4R9UC 2GRJA 4A0HA 3ADCA 2ZRBA 5AUNB 4RKEA 2IHYA 3HPQA 1G5PA 4JL5A 1R7RA 1OH6A 4KYUA 3I3SR 4LBZA 4DB4A 5DH9A 3A58B 2XGJA 2JLXA 1AZTA 1G5TA 1Z6TA 3PVSA 4B3DA 2OILA 3NDBB 4AI6A 1KK1A 1NY5A 3DM9B 3CNLA 3K09A 2JATA 1P60A 1J90A 3MRSA 3OIUA 1A1VA 3H84A 3WHLA 3DDCA 5JBQA 2GJSA 4TMTA 4KAXA 4FCVA 4D80A 4OKSA 2XNDA 1OSNA 1XPOA 1W7AA 5EP1A 5SZIA 3GJ0A 1P75A 4IRUB 4LBWA 3H2YA 4C30A 1QVAA 2IYRA 2FPKA 4JJZA 1E2KA 4G1UC 4PPGA 3PR1A 2OFOA 3AVXA 4EJSC 3ZIAD 2NZ8A 4TYYA 1TPZA 3IIKA 2JJ8A 1G8YA 3ZH9B 1L7VC 3L82B 4RZUA 5AUPB 3EAQA 2RHDA 5L3SB 3R7WB 4QBHA 1KNQA 3KQNA 2BBTA 2ZI9A 2NQ2C 3AV0B 1NI3A 1P2SA 3LV8A 4FCTA 1RJ9B 3O8RA 1AA9A 1OIXA 2BC9A 1TF5A 2DFLA 2IYZA 3CR7A 2ZE7A 5CJ2A 5D3QA 4N1AA 4Z8YA 4LDJA 4PPFA 4MDFA 4QGAA 3BERA 3U5ZB 1OXVA 3KQUA 3OEEA 3CF2A 4IHQA 2B7CA 3K53A 4GMXA 1BMFD 1RYFA 1TF7A 1JNYA 2PJZA 2Y8EA 3FHOA 3TQFA 1VCIA 3ND8A 5E3HA 4HB2A 4FMDF 1FW6A 1DELA 1ZUHA 2XJ4A 1X86B 4PC2A 2WJHA 3OFNA 3QJYA 5EE9A 5D3MB 5IHPA 1MABB 1HT1E 4RKFA 1HH4A 4NONA 3U3MA 4LC1A 3DMNA 5FOVA 3LQRA 4YMSA 4D2IA 1JJVA 1U90A 3K70B 2WIBA 4AD8A 3DL0A 2AX4A 1G3MA 4YMTA 1L4YA 1NIJA 1L8QA 1XP8A 1M34E 1Z0DA 2HYIC 1KJYA 4MRSA 1IN5A 2FZ4A 1M1YE 1Z8FA 2ZUBA 2G77B 1YR7A 3Q3JB 4HB4A 3B5JA 3QSYA 1GRNA 1KO8A 2H57A 3RHFA 1X8LA 1W48A 2CHGA 1NN5A 4LGMA 5H68A 2FN4A 4PZYA 1E1RA 1NN1A 5DI9A 4BQSA 2E87A 1T91A 1D9XA 4M9ZA 2OV2A 1VCMA 3TK1A 2ZRIA 1QF9A 3WYGA 1EFTA 1E94E 2CL0X 1W49A 2IC5A 2DWOA 2IXGA 4Q7JB 4QGGA 4AY2A 2JJ2D 3JZAA 1FQJA 1VHTA 3QF4A 4IOJA 2HEIA 1UDXA 5IDVA 3A1SA 3M6AA 5JJKA 2OLKA 1Z6YA 3ZS9A 1HE1C 2HJVA 4D6PA 1UADA 3B78A 1N0UA 1XCPA 1D5CA 1DAFA 2HCBA 1T9HA 2FFBA 1RC8A 1OT3A 2YWGA 4HAZA 4TLDA 3CX7A 1TNDA 1QHHA 1E2NA 1JAIA 3WNDA 1NMXA 4LK2A 3Q72A 4BLRA 1UKZA 2NO9A 3FGNA 1EWQA 2IYTA 1IJEA 2PCJA 4JVNA 3THWA 2ZTSA 3HYRA 3N2IA 3GLHB 5FR2A 1CJKC 1XFAA 4QRHA 3CONA 4XWAA 2YHSA 4R7ZA 1N6RA 4AG6A 4Z1MD 1NMYA 3GLFB 2H8KA 2G0TA 2ATXA 1ZM7A 4YMUA 3E1SA 2D74A 5B58C 2DPXA 1JR3D 1KO5A 1MO6A 1ZM3A 3DZ8A 3K70D 1RZ3A 2D62A 2Q9AA 2XOKD 3SOPA 1HE8B 4P4SB 4LYHA 1VIAA 4CW7A 1ZNXA 4HLUA 3SBEA 2WKQA 1E9FA 2AXPA 4UNQA 3BJIC 1ZC4A 2NZJA 4HDOB 1G16A 4UJ3A 1G4AE 5FTMA 4QNRA 2ZE8A 1Q0UA 3C14C 3TKLA 2WMOB 1T5IA 4LYJA 1B0UA 2CBZA 1GKYA 2D7CA 2VSFA 1W2HA 2EWWA 4OHWA 2ZRPA 3FHTA 1RVDA 2BJWA 1GUAA 3Q8XB 1KI7A 1C1YA 2F1IA 3AKCA 3CH5A 1GIAA 2YVUA 3IUYA 4CT4B 3OE7A 1TTTA 3AKYA 2GK7A 1IQPA 3DKVA 4CGZA 2A78A 4BFSA 1Q3HA 3VR2A 4UKDA 4C7OB 1U0HC 3QXJA 3IHWA 3QKTA 3OIWA 3QF7A 3CR8A 3KTAB 4LC0A 4DIDA 1IN6A 4US0R 1E2IA 1Z06A 4TL6A 1VPLA 3QIAA 4Q48A 2N46A 3L0IB 2JDIA 3AKEA 1MKYA 3CWZA 2QAGC 4JVLA 2BJVA 2UZ3A 1U94A 1DE0A 4HEJA 2IEYA 4YXWD 3DOEA 3I4LA 4B74A 3TUZC 2RGNC 1JQLB 2J3EA 4FCWA 3GJ4A 3QKUA 2ZJ5A 3PV0A 3UG6A 3WRXC 4NCJA 5CJPA 2IXEA 2PCLA 4URXR 2O8FA 1XCMA 3UWKA 2GJ9A 3L0PA 4GZMA 3GCGA 3BK7A 2FG5A 3ZQJA 1LFDB 1GRQA 3IIMA 1G4UR 2IBMA 3U2QA 4DUGA 1XMSA 1U0JA 2BOVA 3VNVA 1KK2A 1Z6GA 2EWVA 1E2MA 1JB1A 4PC3A 1KI6B 2IT1A 5FOUA 2GXUA 3T1QA 3GFOA 1DAIA 4L8GA 4WZBE 4L16A 1LB1B 4KSBA 4G5QA 4CEJA 3MCAA 3WP0A 1DO0A 3GMTA 3OEHA 4CVNA 1JR6A 2D7DA 1N0VC 4HYYA 2PT7A 4M1KA 3TRFA 4M1MA 3I62A 4TMWA 4NH0A 1KMQA 2P2LA 3DKPA 1G3QA 1F2UB 2ZSEA 4XVRA 2C95A 4EAQA 4HUQA 4JJKA 4MGIR 3UIEA 1KOFA 3LXRA 2WWGA 3SS8A 3AEZA 4EPXA 4B48A 1CR0A 4URUR 2YWHA 4P4UA 4CZ2A 2OXRA 3C41J 2FSIA 4PC6A 3OAAA 1X8JA 2ODBA 2V1XA 2BV3A 1MO4A 2W6JD 4ZV4A 4WOPA 2BWJA 1SVWA 2WWFA 5FFMA 4OHVA 2ZYWX 4DLTA 2QG6A 2ONKA 1XTKA 3C16C 2GEDA 1GP2A 1TADA 1AN0A 4BLQA 2ZROA 4QJ3A 5F9HA 4MRVA 3V9PA 2YC4C 3ZYCA 1YZUA 2CVFA 4R71A 2LWIA 2HV8A 1KK3A 1P5ZB 2ZYVX 1XX6A 4DLXA 1L4UA 3HU2A 3K0CA 5CYOA 1N5JA 2B21A 2KWIA 4GFDA 4ON9A 4G5GA 2IYSA 3L0SA 4TLAA 4V0KA 4EJSB 2BBSA 4OQMA 1US8B 5FUWA 3SBDA 2O8EA 2OG2A 1HURA 2BCGY 4Q00A 4WZ6A 4XJXA 1OB2A 3F5FA 1V43A 3DZDA 5SZJA 1DS6A 2VSXA 3PG5A 1EX6A 4Q03A 1G7SA 3GPLA 3TUIC 4GPTA 3TSZA 1T5LA 2NO1A 5J4KA 4EFMA 3K8YA 4QFMA 4IDHA 1CF4A 2H92A 4B3GA 1W36D 1XBTA 1GTVA 5CITA 1PLJA 2ECKA 1QHGA 2GEUA 3EPLA 2QRNA 2DHRA 4KO8A 4L4UA 3K0EA 4DRZA 2OEPA 1DO2A 3NXSA 3BGWA 1Z0IA 3BH0A 1F60A 521PA 3AF2A 2WTUA 3EPKA 4E03A 2QRZA 4Q18A 3K9NA 3MWJA 4ZKDA 1YVDA 3VU9A 3B82A 4LPKA 4YDSA 1E2GA 2R6DA 2YWFA 2Z5FA 2WAYA 2XJ9A 4P31A 2QGNA 2X19A 1E9DA 2QM8A 3CRRA 2F55A 3PUWA 5G3ZA 3SJZA 4U7DA 4XOIA 3QENA 3D6TB 3K1JA 3SFVA 1KAOA 2BKUA 2UVQA 2IS2A 1CU1A 4E22A 1LS1A 1XXHA 2CK3D 4FWIB 4KLNA 1CR1A 4U02A 4YMWA 2J7PD 2A5FA 4EQ6A 5HE9A 3HR7A 1Z6XA 2DYKA 4LJ4A 1TL7C 4EIWA 3BOSA 3RLFA 1VIYA 1ZNZA 2FPLA 3IGFA 4RD6A 5FOXA 4B75A 1T6NA 5GJWC 5L3SA 3EZFA 2FX3A 4MITA 4UXHA 4O3MA 1ANKA 2GF9A 4QC2A 3RS0A 2QE7A 2ONJA 6Q21A 2C5LA 3PUYA 1HT2E 1LF5A 4ZDWA 3UATA 5FUXA 3SEAA 1FOEB 1F2TB 4RCYA 5G3YA 2XSZD 2QENA 3MFYA 1SXJD 1MH1A 1ZM9A 2WWXA 2G9NA 3FDIA 4G5OA 1CEEA 3HU3A 1FZQA 3B1YA 1WF3A 3SZRA 1RRPA 1OB5A 2A5JA 2R44A 2JLRA 1SVIA 2XNSA 4JVSB 5D3MA 1W0KA 1MABA 2B92A 2CNWA 4UXIA 3BB1A 4M9SA 1E96A 2WIAA 1D2NA 2ORIA 1SKQA 4E09A 2LCFA 3MWLA 4FMCF 3VX4A 2TMKA 2FGJA 2GZDA 4EFLA 3QY0A 2O8CA 2IW3A 5DHAA 5UKDA 3VR3A 1XJQA 2P6UA 4TQ9A 2VF7A 1DADA 4HDQB 3IBYA 2JA1A 3O47A 2J1LA 1E4YA 2Q6TA 1P6XA 4BECA 3S1AB 4BZQA 1LS6A 3AGPA 5FPTA 2CCGA 1HTWA 3W34A 3D3QA 1U8AA 4Q1EA 2F43B 1WBBA 1W4RA 1Z0KA 2GAOA 3PJRA 3LH5A 4PX9A 2CDNA 2JJ1A 2ZAMA 1M2OB 3LQQA 4NYJR 1E79D 3ZZ0A 4D0LB 3AVVA 1U9IA 1GNQA 4ESHA 5B2ZA 2O52A 3E2IA 1KKMA 2AKYA 5KHOC 3DO6A 1W5SA 2ZRGA 3NVAA 5EXPA 3ASYA 1M8PA 3KB2A 3CZPA 1EFHA 5KSOA 2FF7A 5CDFA 4DSOA 3B1VA 4MRNA 4LCBA 4DT1A 2VA8A 4W5HA 2FSHA 4LI0A 4US1R 1FX0B 3C5CA 1H8HA 2HLDD 2QM7A 3QBVA 2RMKA 2IF0A 5IF9A 1IN8A 2VP6A 4ZI3A 2ZXUA 1CLUA 2HYDA 2VSOA 4NYMQ 4POAA 2WOOA 4LZZA 5DSZA 2P6RA 1RPZA 4I1VA 3TW8B 2C2HA 3GLHA 1XD2A 3OFND 4D4JA 4Q9KA 4MRPA 5EZ5A 4OI4A 4KVAA 1E0JA 3GJ7A 4XD7A 2ZU0C 2W00A 4Q1DA 2PJRA 3KJEA 2QAGB 1VCOA 1F5NA 3CF0A 3BD9A 4ZDKA 1GKUB 2NO0A 2VHQA 3U7EB 4Q9IA 2F1HA 1S9HA 4QM7A 3PEYA 3HR8A 2JLWA 4D0GA 4QGHA 4EPYA 1HEIA 2OZEA 2PX3A 2ZIAA 2YC2C 2QMUA 3QKSB 3TGPA 2DFKB 5DO9A 5L3QB 1NN3A 1IJFA 2BIFA 4ABYA 1HY3A 1BOFA 2QA5A 3ZLJA 2ZVPX 2VP0A 3SYNA 3KZ1E 5JS8A 1FQKA 8OHMA 4RD2A 2Z0MA 1Z47A 1R5BA 2V54A 5GJBA 4TL9A 1M7GA 3GEHA 2AK3A 1V5WA 1GDDA 5DLQC 4F38A 5EP3A 4V0NA 4LJ8A 4BLOA 2Q9BA 4LJ7A 4B2LA 4Q66C 1XCGB 4TSFD 3D7MA 3GLIE 2QBYB 1DOAA 1EXMA 3VR5A 5LB4A 4IVQA 1JI0A 2ZUDA 2OBLA 1DAHA 4DVGA 3SNHA 2NMVA 3ASZA 4ZI2A 1P9WA 2C8VA 3C7KA 1PUJA 2RGEA 1ZP6A 3QUSA 4MGKR 1G21E 1QHNA 2ZEJA 4TLEA 3B9PA 3VR6A 2V4ZA 3R8FA 2QI9C 3IBGA 3RS2A 2QTVB 3E70C 4NCHA 1NF3A 4RZXA 2C78A 1CXZA 1TX4B 2DFTA 2FH5B 3RRMA 3A6PC 1M6NA 3K9LA 2IA5A 3H4MA 1IHUA 4B34A 4Q02A 2FDCA 4JLKA 1OXUA 2ODNA 4KFSA 2F1JA 1DTSA 2QROA 3B85A 3RAPR 1IXSB 1AM4D 1CJTC 1S0UA 2WWIA 4DCTA 3UG7A 4A36A 2A30A 2ORWA 2AHOA 3ZZTA 4QG7A 5E7IA 1COWD 4B35A 4JYBA 4DCSA 1OH7A 4PHHA 2WJJA 1OKKA 4Q7LA 4I4LA 1GKIA 1A4RA 4LUCA 5FTLA 3T1TA 1G19A 1MO3A 4F4CA 5C1BA 2NO6A 4RY2A 5BXQC 5KNDA 4BEJA 1FMJA 4F93B 1EWRA 3QNUA 5TVKA 4Y0VA 1JXOA 2JAQA 1S8FA 4OI2A 3QXXA 2CCKA 4L9WA 1UF9A 3BH7A 3CIOA 3J81k 2NOAA 3RSLA 1GSIA 1ETUA 1P2TA 3SR0A 2YKGA 1NRJB 1XTSA 1R0ZA 3AQ4A 3ZQ6A 4B76A 3SU8A 4MKIA 2XEXA 5B64A 4IDQA 4TLCA 3IQXA 1XTJA 3ZGXA 2DB3A 1I4TD 5FPHA 1N6IA 4IW3B 1ZNYA 1OXXK 2ZRHA 4TMXA 1Q21A 3SQWA 2ZRAA 1NBMA 1E2PA 4CDGA 1LVGA 3SJCA 3ZVNA 5G41A 4C0LA 4A6XA 1NSTA 4GMDA 1W4CA 2CE2X 3P4YA 4L9SA 1DVRA 1U0LA 2AR7A 2EFDB 2QNRA 2FEOA 3U6BA 3BE4A 4CRWB 1MT0A 1NVVR 2EU8A 5BW8A 4EKDA 3LO5A 1WB9A 3I1FA 3CF6R 4JVMA 4M22A 5J4LA 4GSYA 2C99A 4A0RA 4C2TA 1G3UA 5JRZA 2B6HA 1K5GA 2PEZA 2ZRLA 3RC3A 4Q7MB 3U7FB 4G5RA 5JSZB 3BIFA 1DBSA 3TR5A 4WW0A 1ZIPA 2B8TA 2X8AA 4DEYA 3OIVA 1KI2A 4U00A 1FTSA 1E69A 4M21A 4UNPA 4EPTA 1FPMA 4RZ2A 4ZIRA 3HJNA 4BRUA 2PBRA 1US8A 1XXHE 4KXFB 5K8LA 4RJLA 3KKOA 4QBIA 2IEZA 3JVUA 4ACBA 4AURA 1S1MA 5C4MA 3TSOA 3DEFA 5TARA 2PZGA 1NG9A 4CF7A 5EE5B 3QOFA 2WPDA 1GILA 3TNFA 3QKRA 4HAXA 3TIFA 4JT4A 3LX8A 1P9NA 3B2EA 2XZOA 3MAAC 3T1VA 4AKEA 1AS3A 3LBHA 5HPYB 3EG5A 1QG4A 5KO2A 5ANRB 5DYIA 2QU8A 3GLGB 4HB3A 3DOFA 5EE1A 1PLLA 4WAUA 4URVR 1N5KA 3LVQE 3BBPA 4TT3A 2PT5A 2V8OA 2W6IA 5DISB 3TJZA 5JWHA 4M9XA 1SXJC 2IYXA 1GL9B 4NPHA 4W7SA 4B73A 5H8WA 2YWEA 2ZJOA 3KJGA 4TLBA 1JR3E 1GFIA 1VYUA 2WJVA 4JT2A 1KO7A 4KFRA 3IEUA 2OT3B 1W0JA 4IJMA 2WZQA 3LFUA 2GJKA 4Q1BA 1W46A 1G7TA 2QAJA 4H1VA 3Q5EA 3VHXA 2JLUA 3CRW1 2JLZA 5FBRB 2VHJA 1KSGA 4G5SA 4C2UA 3K09C 2F7SA 2ZJ2A 4Q4JB 4C4PA 3OIYA 1S96A 2IL1A 3U6KA 5GVRA 2J5XA 1Z6AA 1IXZA 1X3SA 4ZDJA 2P3SA 4HLDA 3ICEA 1F2TA 4FINA 2GXAA 1YZGA 3EPHA 4KI0A 1E6CA 5AWFC 3NBFA 2ZJBA 1A2BA 2OCAA 2AFHE 1I4DD 4PHFA 3CX6A 2ZI4A 1TEVA 3THXA 2ZR0A 1AKYA 5BN5A 3PEVA 4JBYA 2GVDC 1N6KA 2FA9A 5CDFE 3THYB 2AD1A 5B30A 4D25A 1OHHD 4O0MA 4Q1FA 2G3YA 1KDOA 4P4TA 4U5XA 2QUZA 1UM8A 4BFYA 3RRNA 1OE0A 2J0UB 1IY0A 2WBLC 2GVZC 2HXYA 3AVPA 4RFSA 4WZAE 1EFRD 4DHEA 2GCOA 1CTQA 2N1BA 5FI0B 3O8DA 4RSGA 5LDDC 1G8FA 3PUVA 1HA3A 3GLHE 5F9FA 1E2LA 1FUKA 5KPDA 3FFAA 821PA 1NJGA 3GLFE 2A5DA 2GWHA 5JCPA 3U4QA 2GJ8A 3WP1B 3CLVA 2YINC 3CBQA 3DM5A 4NTZA 4QBGB 4QOSA 4ARZA 3WBJA 5A4JA 4OQLA 3R8CA 4XWKA 1UBCA 4XVQA 1XEWY 4M0LA 3T1OA 4DCNA 2F43A 5FL7A 4XTCS 1YR9A 3CRMA 1P62B 4RD3A 4B44A 1E3MA 3W6NA 2BBWA 1H8EA 2FZLA 3K0AB 5K8TA 3FKSA 4GBMA 4IKEA 1K6MA 4KFTA 2JASA 4OL0A 2X1VA 2G0NA 4ASUA 5EXXA 5BQ5A 4OHYA 4TTRA 4NKRA 1ZUNB 2C98A 3A1WA 5DHFA 1F48A 5JCZA 2CJWB 5KU1A 4UNSA 2BMDA 5JI3E 1P4SA 1XEXB 1VDZA 4Q9JA 4OHXA 5JEDA 5C18A 1GG2A 1FX0A 4OK3A 1XZPA 2FPMA 1ESNA 4G01B 3VFDA 1J2JA 3U44A 3F8TA 4KYIB 5AJZA 1DEKA 3PUXA 2R2AA 5KSYA 4XSHA 4DDVA 1ZD9A 2Q21A 1R0XA 4FIDA 1G3IA 1UBEA 3ZD7A 3ZZUA 1TQDA 1R0WA 2P67A 2QAGA 1CJMA 2P6NA 3ADKA 5EXTA 3NTUA 2YOGA 1KMHA 4GNKA 3KUCA 4DDWA 2WSSA 4PQRA 3AP2A 3L0OA 2VLIA 2WWHA 3GFTA 3WNBA 1DAKA 2AL7A 4D82A 3T61A 3W6PA 3NIBA 3SYKA 2FOLA 2H7VA 4DSUA 5JLJA 5TY0A 3E5HA 5BN3A 2OBMA 1GNRA 2WICA 2V6IA 2ERXA 3Q7PA 2KSQA 4DLZA 5L3QA 3U3JA 3A4NA 3C5HA 3QPWA 1G8HA 1ZIOA 4HI0E 1L2TA
chains in the Genus database with same CATH superfamily
3S70A 3THRA 2VHTA 3FNRA 4Y6RA 2VQDA 4TKUB 2X3FA 1N4DA 5KVAA 3ORSA 4Y1RB 4D79A 4B6JA 3OKPA 1Z5WA 4HVLA 3ONWA 4XI9A 4WCDA 3UKDA 4QTYA 4B4DA 3HCOA 1L5VA 1JAHA 5FLXA 1N6OA 5DWQA 5E2AA 3RBZA 1JALA 3NHSA 1PKXA 2HL6A 2Z9BA 2YJ3A 2QBYA 1OFTA 2CF6A 4XQCA 5CXXA 4UBNA 1QMPA 4W9NC 1UBOS 1S3IA 3BL8A 3M49A 3EMVA 1IRIA 1DLJA 1SGWA 4HLUC 5JNSA 1USKA 3N3BC 2HK7A 2J9FB 2C2OA 1DWOA 3OP4A 4EYQA 1X14A 3UUWA 3CCFA 4UHEA 1Y6ZA 2RI1A 3LX6A 2YWRA 1JIKA 1SCUA 1SWWA 4NCIA 3T12A 1O96A 4F1WA 5KKAA 5JWRA 4MUJA 1NBME 3G17A 1TZMA 2Y1WA 4MWCA 1OXSC 5BYJA 1RMYA 1SOVA 3JD2A 4YFVA 5IK2D 1VM6A 2PX8A 1KQPA 2F3RA 4G67A 4JUFA 1CRZA 1Q91A 1ZMRA 2FN8A 2W2KB 2VWGA 5J40A 6CHYA 3F2VA 1P1BA 3GLIA 3AFNA 3BCHA 1Q77A 3E3AA 4MR9A 3A6ZA 2ES4A 1TU3A 4L5BA 1A27A 1RI5A 4B83A 4EHFA 5C81A 3QNMA 2R8XA 3KQLA 1WE2A 3NJ4A 1QG2A 4HPJB 3GLQA 3E7DA 1GCIA 3F0TA 1RM4A 3H4TA 2ZRFA 2H2IA 3L4BA 4ZYVA 3SN6A 1JILA 2VK4A 3NC1C 5C4MA 3KKMA 1RRFA 2QP9X 4M60A 4Q1VA 1OW3B 3L7JA 4LQCA 3DLIA 2WHEA 3SSOA 2F90A 4QE3A 3PRKE 3EC7A 2QN7A 3G2KA 5TPZD 5DP1A 4LOAA 4MUHA 2IBSA 3EFOA 3C3WA 4ILEA 3WWEA 4ZJUA 4KK3A 4PQYA 5DT9A 3JQEA 2H7CA 1W8IA 3KDSE 4YMGA 1ZRSA 2PH3A 2QLBA 4LMPA 1P3Y1 2VP5A 3PYMA 4OY3A 4RJTA 2IITA 4Z4CA 4YJ2A 5F3WB 2DTDA 2WD8A 4RANA 2JBAB 4E1AA 5JAIA 1XEFA 2HADA 2VKTA 2OXCA 2XXJA 3F7MA 3UAOA 2B4AA 2HHHB 5JW6A 1PR5A 3T0IA 2JCSA 4GR5A 1M3SA 4Z8XA 4MAFA 5FP0A 1BS2A 3U31A 3BTUA 4CI9A 4P53A 3X1KA 2QIPA 3DMGA 3C70A 1ZAKA 4IILA 1TM7E 3DHVA 1GUBA 1OC4A 2WYIA 5F12A 3BZBA 3WGLA 3WLJA 3CWCA 3KQWA 2GN8A 4MARA 1VYTA 3KR9A 4HFJA 3W90A 5JFTA 2P9YA 4Q37A 2W6CX 3E22A 3G5AA 5FPKA 1RQNA 3NZEA 3OJXA 3OOSA 4XUDA 3HRIA 1CR2A 4P3YA 4ZVRA 4X66B 3HVKA 3A05A 4IHJA 2XZLA 4YPVA 1CZRA 1TZCA 3OT5A 4ZT7A 2XTMA 1XJ0A 2CXTA 4KFCA 2FRDC 1NC1A 2JLBA 3LX4A 4FDLA 3EPJA 1ECGA 5AW3A 2HIMA 1YHNA 3R0QA 2J7KA 1WUTA 2RHCA 4Q5IA 2JLYA 2XB4A 1BX3A 1SXJB 2RAPA 1ZNQO 4JLBA 3NHLA 5KYUA 3TNDA 1MNAA 1HMYA 1BMFA 1KDPA 2PKEA 1L5HA 3R0XA 4GEKA 1DRJA 4PLTA 4RLFA 3RV3A 3LYLA 4AKTA 3RVBA 1YBMA 3TQOA 1GY8A 2GKSA 2DC1A 5DWDA 4UM7A 4NIMA 3CH6A 4FB5A 4Y2UA 1QIEA 2QMYA 1Z35A 3L5KA 4H08A 5FBZA 1PR2A 3CKKA 1QGUA 4BJ6A 1DCMA 3ISVA 1I4EB 1TKCA 1XDBA 2GCPA 3P9SA 2ZJAA 4JBWA 4M0FA 3OTHA 4O25A 2C7QA 4NCXA 3BTOA 1NVMB 3TIVA 4RXTA 4F9GA 1CP2A 4N01A 4TXHA 2PRSA 1MIOA 2GS9A 5FTJA 1IN4A 2IS1A 4PHGA 1UMCA 1RTTA 2P9ZA 3V42A 2PHZA 5FAXA 3SX0A 4MV9A 3SCZA 4ND7A 1ZRNA 1C9MA 4MYCA 4G97A 4LPSA 1U0SY 2Y1CA 3CF4A 5CA1F 3U7QA 2R6JA 1GSOA 1W76A 1AUVA 2GM9A 4RMIA 2PFKA 4HF7A 3VYSB 2GK4A 1DAOA 2K5UA 2NXJA 3VO9A 1QC5B 2C9CA 5JMPA 4HUTA 1X1EA 1E0KA 1Y3AA 4Z9BA 5E1BA 1MAVA 2H1VA 2JJMA 3LKVA 2P1RA 3FVVA 2ZYIA 1ODFA 3G2HA 4E5NA 2XRFA 3FTPA 1SBCA 4GI7A 1TVKA 1N5MA 2YV3A 4MZDA 5CW1A 1XA4A 4EH1A 3HXKA 3DMPA 4V02A 3IEMA 1USVA 4PNZA 5D5PA 2GDJA 2IHVA 2V7BA 5J47A 3EZ7A 4QTXA 4D97A 3B6MA 4WNAA 4QRIA 3NRBA 4Q82A 2GA8A 5DP2A 3BF8A 2XW6A 2ASVA 3I76A 4I1SA 5KJEA 3Q98A 2G6BA 2KE5A 4HAYA 3U4DA 4C4XA 1XNHA 3HCEA 1D6JA 2J0VA 1HTTA 3GAMA 2GN1A 3HU1A 3NQ41 4K1LA 4BN5A 2PUWA 1E7RA 1A5BB 4YCLA 2K7ZA 4OJQA 4OQNA 4XWOA 1XDSA 3ER6A 5IXSA 1A97A 1R0YA 1SEPA 2ZIFA 3MVEA 4K2HA 4Q24A 3EVFA 5DT2A 2I7CA 4OFZA 2ZPTX 3KSMA 2JIMA 5AK6A 5IDYA 3IDFA 1D6NA 2JVIA 2ODEA 4X41A 2R00C 2X4DA 4Q4JA 4E5VA 3VI4B 1E8MA 4HZUB 4TVKA 1PF7E 3DBIA 2AWOA 1ADFA 4WN3A 4CM8A 4JNKA 1PVVA 1XALA 1A88A 1OWLA 3DB2A 2H4FA 2V7VA 4G8DA 4KXQA 4R1QA 5FPQA 3RANA 4DNPA 4Y1EA 5FL3A 2JFOA 3A25A 3NC0C 3L49A 4MWTA 1E2BA 4KRXA 4F4IA 1Q3TA 1HZZC 3H5WA 3F49S 4Y1GA 3QHAA 1LVUA 3W2TA 1NKSA 2ZUVA 1KY5A 1K9SA 5C7IO 1DU4A 3DQQA 2OXFA 3OLZA 3NHUA 3OPVA 1F6DA 5DOVA 4J3NA 4XJSA 2L82A 3PIRA 4IJWA 4C1NA 4BEBA 1OAAA 2VTDA 2CT8A 2CXUA 2YN4A 3FZEA 3QE3A 3THYA 2PZ8A 4ZKEA 2O8DB 4XWWA 2BM0A 1MB9A 1SHUX 4YMLA 1SC4A 1DBQA 3OHMA 2COEA 5DYGA 1J22A 3AI1A 5DK4A 4TKZA 5AJYA 2AOUA 5BUQA 3ETGA 3AR8A 3G9XA 2QRKA 4NRDA 1K7XB 3H1TA 4NYMR 3P32A 4OU5A 1NLFA 3A6DA 3RVRA 4ZO7A 3PHCA 5BT9A 4HQ6A 3D8BA 3VV2A 2VJPA 1Z88A 3GZNB 1OMOA 1R4NB 1HLGA 3BB3A 4DWWA 2O0JA 3NH6A 1PCXA 2VXCA 3II6X 1JSXA 5AHRA 4TZKA 1JPNA 5IBRA 1UK8A 2PSSA 3VKGA 3Q4GA 4GIBA 5JDIA 3QHQA 5TB5A 4OHUA 1GEEA 2XYPA 3WGTA 2GESA 2ZXUA 4BRWA 3VXKA 5DTIA 4ZQBA 5IVHA 3COJA 2ZM5A 1O89A 1QG0A 1OASA 2NG1A 3DBLB 1J23A 3O3CA 1DDOA 4GYYA 1DC8A 3OEED 3V9AA 2V3CC 1I6LA 4BO9A 2BUBA 2C4NA 4MP6A 4PN7A 2UU9B 4JP1A 2HUNA 4X7RA 3TAUA 1R6BX 3KLMX 5LBIA 2H48A 3I2IA 2CFOA 2ZRCA 3DMHA 5EUBA 3W2GA 3VKFA 3IV9A 1J0XO 2OFFA 3RS4A 1QO7A 1E98A 4UPEA 5DZSA 3HKDA 1T4DA 1UMDB 1GAJA 4JLPA 5BYKA 1KJ9A 2QL6A 4BNHA 2QLLA 1KBQA 3EODA 4Z3DA 2C7GA 1RJEA 1RU3A 2AOTB 1V45E 2G08A 3K1AB 1XEXA 3PE4A 4FHDA 4MVJH 3MD0A 1E7SA 4NE7A 4X54A 5KNDH 2ZWIA 1UZLA 4FGUA 4U6SA 5D2CA 1FX1A 2DFPA 3FPFA 4P3NA 4P22A 3UN1A 1URPA 3QSGA 1J6UA 1UMBA 1P77A 1DRVA 4C76A 1KPGA 1UEIA 2OBYA 4OSEA 2BP7B 3LOQA 1JGTA 3SC6A 2BBOA 1NAIA 1JSZA 3CLUC 1U9ZA 3HN7A 3PGLA 2P7IA 5F35A 4BATA 2Q4BA 9ATCA 1I0IA 3LCJA 5J1TB 3V4FA 1Q7EA 3G3EA 1A2KC 2PX6A 4FE7A 4HDRB 4TTPA 3ZDFA 5JAPA 2DUMA 1ZITA 5JNRA 4LWOA 5HTKA 1T2UA 2R9VA 3N05A 3DBHA 1WLSA 3WJAA 4HJRA 3LRTA 5F5XA 4JA2A 3H2HA 4H1UA 3X1MA 5KWJA 1T2AA 1CZUA 4S1PA 2PIAA 2I6FA 3I0ZA 4Y6LA 1NVTA 4PPQA 3VDNB 1OZ0A 3KG2A 4QSHA 3COZA 3QYFA 3KX2A 5JVDB 1JZTA 3MBOA 4G8BA 1MF7A 5KCZA 2IYYA 2W6JA 2QW8A 2GLTA 4E2ZA 1KGDA 4P36A 3KTAA 2QYSA 5AVYA 1ULSA 4IUBS 1CKEA 4FKZA 5E3IA 1JDUA 3CLRD 3I2JA 3N28A 4W1QA 1FP6A 4UEKA 4DJTA 2G04A 4ZYTA 3MWKA 1E1CB 3MS7A 1KQGA 3OJWA 3ROPA 1S2DA 2WNSA 2QF7A 3IOBA 3JATA 5H59A 1SNYA 3S99A 1VPDA 4FNAA 1W87A 2J67A 4R81A 4FGSA 2IVZA 3MFQA 3TBKA 3U7HB 5AKKA 1V25A 4I55F 4FC6A 5FTKA 5LD2B 1BXZA 1Z6QA 2JFQA 2QRVA 3CY6A 2FYTA 4UAUA 4ASUD 5CCXA 1AD2A 1EFVA 1NSYA 2EBUA 2OOSA 1JIQA 4J0HA 2FPUA 1PD1A 1U81A 4LEIA 3RTGA 3WWZA 2QZPA 3GMDA 3KVVA 1N8NA 2REBA 1V3VA 3JYHA 5F78A 5AVKA 2G9VA 3VPBA 1C8VB 3AOEC 5LQSA 3T99A 1QPZA 4J0DA 5F1KA 3F4KA 4HVTA 4MKXA 4ZMBA 5EEHA 2WMNB 2G83A 4L4RA 2OCBA 3CGWA 3AF5A 4F45A 1IZ0A 4TL8A 4PYQA 4LDQA 4TTAA 3BAZA 1ENOA 2IBTA 1JWAB 4XLLA 2LNDA 1XD8A 2IY7A 2P3OA 2JFYA 1SKYB 2YS7A 1W88A 3GGJA 1Q20A 3JQPA 4NBVA 5AI5A 1N1MA 2DBVO 2G70A 2IP4A 4RLQA 4YI5A 1K2WA 1GQ2A 1G8PA 4AIRA 4BV9A 1KH2A 4I3GA 4IDCA 4P6VF 2QVZX 3I61A 4F3TA 1FMFA 3GFPA 3MMXA 4PLPA 2RG1A 2ZITA 1E5QA 3DPIA 3ELYA 3GD5A 1L5GB 1BCSA 2REOA 4CN9A 3IAHA 2QR2A 3CZCA 4MJ7A 2V3VA 3WGQA 1O8BA 2CHEA 4CUKA 1YUNA 4XPIA 1DRWA 2XITA 2W2LA 3EVTA 1H4VB 1JN0A 1XLVA 2PZAA 4A0GA 1QH0A 3KV1A 1OFHA 4IWYA 1WSBA 5D86A 3TJRA 1P7VA 3HDHA 3MS4A 4UUMA 3VR2D 4RC9A 4WLOA 5CFQA 1G8MA 1ZGCA 5JALA 4EMTA 1TK9A 3K1ZA 4OQFA 2ZAYA 5FBLB 1DX9A 1L9KA 1KZ1A 1G7CA 1EVEA 3EASA 4AT1A 5K3OA 3O74A 2BUAA 1IAQA 3V8EA 2JRCA 1DC4A 4NAVA 5T3UA 2XTAA 2MSWA 2D2FA 3BWXA 1FYWA 1QDUA 3DE6X 721PA 2PV0A 3F5SA 3H2GA 3IILA 3EHDA 2YRWA 4NENA 4KGZA 4EBBA 3R3ZA 2GVNA 3CX8A 1F06A 3WYEA 1XKTA 2A1TR 3A36A 1H3FA 1XF9A 1Y3HA 2COUA 5K51A 1YFZA 3OURA 1R64A 4HEHA 2EJCA 4CKXA 2GTPA 3FPJA 4B7CA 1NSFA 1Z74A 4IYRA 3D4NA 3HR4A 4EJSA 4WJKB 4I4CA 3P0HA 4JKYA 5AM5A 3AZQA 4BB5A 2Q4TA 1I7LA 2BE9A 3RRFA 3H7AA 5T6MA 3E3LA 4C6HA 1B6GA 4ZU1X 5JCOA 3UHOA 3W3AA 3LP8A 4BMCA 1FL9A 2PLAA 4INZA 2I71A 3EXEB 3KKPA 4M8IA 4PS1A 4RSHA 3T3GA 3U3KA 4D1YA 3UJAA 4PXYA 1MAWA 3JQGB 3OM0A 9LDTA 3OEHD 3E82A 4PTLA 9MHTA 5CFMA 1P0MA 3KHUA 5DTQA 5JCJA 3ZGLA 4QOIA 1T4CB 1CETA 1ECCA 1I8TA 2XQJA 4HEA6 4Z4FA 1I4LD 2FOIA 3GH3A 4D4GA 4W5RA 1QQBA 3SDSA 5JJ5A 3EQ8A 3I0NA 4O4JA 1S6YA 4M1SA 4QDZA 1QIGA 3B1KA 2OTCA 3AVUA 2WLTA 2Q9CA 1EK6A 3CKMA 3EGOA 3KVNA 4ZJPA 3WYFA 1P4AA 3TSAA 3W5DA 5LOVF 3S2UA 1JR4A 4YAWA 5E6RA 5ALTA 4G41A 2CVPA 2P75A 5TNXA 1XZKA 2WU3A 1YZLA 3RSCA 3E05A 3WICA 1BQEA 2OR3A 5AXAA 5DM2A 2G9UA 3L93A 3WLAA 4LCEA 1GVHA 1KAGA 2HHLA 1NQAO 1NU8A 4CIAA 2AXEA 3BULA 2SCUA 3VZSA 1X42A 3IODA 3MINB 3PF9A 2RG7A 3DNFA 1C2YA 2EJWA 2ZSBA 3LVRE 4L6IA 3USES 3W7AA 1OPXA 3GRFA 2Y27A 1K3FA 4XYGA 4F92B 4MVJF 3IR5A 3M4NA 3E5MA 3UMMA 1UPXA 3EVNA 3E03A 2JH8A 3TOZA 2ETVA 1TM5E 2YXPX 3FB4A 4S1WA 4KXYA 1E79A 5ECDA 5F7ZA 1QFSA 1V1JA 2F8LA 1V4NA 3BICA 4PO3X 4WLNA 3TI9A 5I7RA 3WQBA 5E3JA 5FJJA 1GUZA 5J2TB 4HAOA 5EE3A 1KJWA 3HJBA 5A02A 3MCWA 4I9GA 1MCZA 2D0DA 2QL7A 4R68A 3G5UA 2BTEA 1T35A 3OWXA 4FLFA 5LYYA 3BGVA 1QFYA 3E1KA 4DLYA 1QZXA 1T29A 2VIIA 5P21A 5E8JA 2CLIB 3EH1A 2PZFA 5JZSA 1ODCA 2XWBF 3VUEA 1GQYA 3KXIA 3FTDA 4FYKA 1DBVO 2C97A 2EW1A 3PEEA 4JBHA 4EABA 1IJKA 1GZ5A 5K09A 4LJ5A 4EL5A 5A2QA 1WWKA 2N0SA 5G40A 1YGPA 3AIMA 2NNWB 2XUAA 2ZB2A 4QT4A 4JKIA 4ZALA 1HEUA 1V37A 2MSDB 4K6CA 3MUNA 3JD0A 1Q7BA 2P5UA 2ZAOA 2BEVB 2B4KA 2P3LA 2VYVA 4CNQA 4UVIA 1SAYA 4E2YA 4WNYA 2Q7XA 1VLLA 1L4NA 1VMAA 2QPAA 2BHRA 1P2UA 3TSWA 5GINE 2P0AA 2Y66A 1ML3A 5HMMA 1SIBE 5JNVA 1NUAA 2ZB8A 3PX7A 3OQJA 1PRYA 5AJHA 5CGZA 1A8PA 1NBHA 3NGMA 1PEAA 1P17A 3SY8A 4WOCA 3K9WA 3O84A 2A8YA 1QU2A 4L0MA 1YZKA 4N5LA 4P7GA 1Q6ZA 3M0EA 4BO5A 2X6TA 2CUZA 4KBFA 3C3DA 4N3GA 1VKZA 1YDFA 4OM8A 1QCZA 2BZSA 1F7UA 1QLWA 3SC2A 1JHUA 2OBNA 3UMSA 2NYVA 4KSCA 4Q12A 4Q3LA 5KQRA 1OZAA 1V8ZA 5DSXA 3T9DA 2J0SA 4LHXA 2O2CA 3ZWVA 3ADDA 3QITA 4BNVA 4PZCA 3ZR4B 5A05A 1QIKA 3DTNA 1ZN7A 2D7JA 2W58A 1I2AA 3C3MA 2YIDA 3GNTA 2QD4A 1N6HA 3OOWA 4W8OA 3HYSA 4JI2B 3R3UA 1YJBA 4P81A 3FMVA 3GPDG 3HL0A 5ADWA 2I4TA 2LBPA 4RZIA 2YMPA 2MINB 4NATA 4YHBA 2O2ZA 1BKYA 2HF2A 3GCDA 3NBZC 4M9RA 1ZAYA 4BXOB 3PD7A 1I4WA 1T4GA 2VJQA 4QBFA 4KSYA 3UANA 3SNKA 1D2EA 3GJSA 3VJMA 4TV9B 2H4ZA 1NWHA 1ZFNA 4YONB 4DNXA 1HM5A 3K3PA 2ZB7A 4JIGA 2BR3A 2NLOA 2Z8ZA 4BKUA 3O8BA 4R5HA 3R9IA 4XYBA 4EUSA 5EQJB 2XZDA 3A14A 5KYYB 1E4VA 4N8EA 2FKAA 2CHQA 3PZRA 5CLQA 4BO6A 3HMKA 2IEGA 3ZHXA 2HY7A 1F2VA 2MMCA 3C1AA 1JEEA 3DFFA 1XTPA 2SKEA 1SCKA 3ROMA 1W5TA 3CRVA 2BF4A 5HS4A 1PSWA 1XKXA 2BGGA 4P7FA 2QT9A 2OSBA 1E0SA 2C9MA 4XR4A 5JJLA 1F6BA 2IDJA 1CK4A 5TT1A 1T8TA 3EFBA 5ALVA 1EAYA 2HJHA 2RGDA 3P2YA 4ER6A 2BMEA 1JUDA 5TEVA 1FFHA 2FMTA 4IY1A 2P1DA 2C04A 1AT1A 3PGKA 2Z2IA 4FBMA 3U3OA 4N48A 5AVWA 3OSZA 3WRXA 3GFVA 5E7JA 3AKDA 2XE8A 3VTKA 4L5IA 5FPYA 4ZVUA 1CQIB 1V2HE 2LW7A 4QDUA 5DHUA 2Z2XA 1N3YA 1YDHA 1DXQA 2QTTA 4FZVA 4JSRA 4RQUA 1AKMA 3HHEA 3E3MA 4QJIA 3T9CA 3VR3D 2A0WA 2W0MA 3FMOB 3IPCA 1XZAA 1RCTE 2GAAA 4HDCA 4QYWA 1ZS9A 3B1WA 1Y34E 4KYTA 4CIDA 4PSAA 3CNHA 2IQIA 5BPFA 1GLGA 1LPAB 2AQIA 1B8UA 1JBKA 1N5IA 1KQFA 1IG0A 2JZCA 3EBLA 3VR4H 2Z6QA 2FR1A 1P18A 3CXUA 4I66A 3TIIA 2EYUA 5D6OA 3C5EA 4REQA 4TYQA 4MPJA 2ZBFA 1D2MA 1XWIA 1HYEA 1ITZA 3O92A 4PIMA 1W96A 3LMKA 1E9RA 4WKPA 4WOBA 3IHLA 5JQGB 3GP5A 2QDKA 1F0PA 1UINA 4RD0A 3EVBA 3E15A 3A3PA 4N0EA 3KOOA 1BEZA 3DD1A 1DJNA 2CCJA 3EPPA 3KAKA 2HU5A 1L9XA 1TEHA 3VDMA 1W35A 5BNWA 2R1TA 4AWXA 2YX1A 2P0EA 1N2GA 1Y0BA 5ALOA 5IKEA 2HCJB 3ZJYA 1M83A 2VI5A 3A9UA 4G0NA 3VHQA 3I9KA 3JALA 1EP2B 4ZA2A 1BMDA 3JXEA 4MWGA 3M1IA 2Q3MA 2JC3A 1PHPA 3C43A 1PGNA 3U1TA 1QANA 2FDRA 3FMIA 1YOBA 1SK8A 2GHIA 3ITKA 1AKEA 1CRLA 1JECA 3MJFA 4HS9A 2AG8A 5THKA 1RWOA 3TRJA 3UENA 1LI7A 1ODTC 2YMMA 2D0OB 3HCNA 1JXAA 4K6MA 5LN1A 4XD7D 3OESA 1Y82A 2J9RA 2YZ2A 3V4LA 3EW9A 5CBPB 4ARUA 4HV4A 4KCGA 5BQPA 3PWZA 3LUFA 4UVHA 5EXSA 4PGMA 3PSHA 2SECE 4EW3A 5ABPA 5IXJA 4MVJI 3GXBA 5KVSA 4IZIA 4XIYA 5B7QA 1VMIA 4U2DA 4BO1A 4M1TA 1M1NA 4ZEWA 4MIOA 3JQ8B 4RSRA 1KO1A 1PFYA 4XVHA 3UCFA 1V16A 3M1AA 3GEBA 2OV6A 4K03A 4CQLB 3NHRA 4UBLA 3FY4A 2NUPA 4NBSA 1PBNA 1EXDA 1QKKA 2F64A 3Q2IA 5LXTB 3LA6A 3HZHA 3QWIA 4QU8A 1RQ2A 1PJ2A 1LI5A 4X6LA 1MRZA 4O5OA 3HRKA 3GUVA 2D2VA 1YAJA 4MMXB 3OZFA 4IJKA 5GOTA 2YZMA 4B3FX 1RR6A 1NM5A 1JDPA 2R48A 5BVGA 1Z5OA 1PZXA 1NP6A 2B1QA 3I3OA 1KYWA 1T36A 1Z2AA 4EGSA 4PZZA 4FR2A 3D5QA 2V8BA 1H3EA 1JFFA 5FUYA 5K8JB 2ZCVA 2V3WA 4A8JC 4X95A 3ZVRA 3HY4A 4WZBB 1CJSA 2EERA 5C8XA 3TCXB 4K26A 4V0SA 1G20E 2D00A 4YRLA 4IDFA 4N0DA 1QK3A 3IP3A 4R2XA 5J4VA 1NMZA 1E4EA 2ARKA 5ELMA 1UDRA 2CV2A 4BJ1A 3V1NA 1CULC 4K8OA 4Y6OA 5LB2A 2B5WA 4HGZA 3UJ8A 2X2EA 4TZ6A 3N8IA 4NZMA 1YGYA 3VR6D 1XLTC 3I4CA 4RYLA 4U0JA 4B82A 3G13A 5L3QA 3QLVC 2PTHA 4QUDA 2R8OA 3K71B 1EVJA 4JOBA 1KDTA 3AYXB 4HJXA 4NMMA 1YR6A 1EU1A 2Q28A 3HBAA 2FLKA 3GV0A 7YASA 1M5RA 3WLRA 3B9BA 5JSZA 4MULA 1TLTA 2VQ6A 1D0VA 2XNCA 4H35A 5DLPA 2WG0A 3GZTB 1L7PA 2WAXA 4AUKA 1X7YB 5CIYA 2X2FA 4BPBA 5EIWA 2WVGA 3KJIA 2ID9A 4A6PA 1KXJA 3IE2A 4X7MA 5TQ2B 3IL2A 2ZZMA 1NVGA 2PBZA 4GOMD 2O0HA 3EVGA 5AJWA 1AQNA 4FFMA 5TLSA 3A32A 1KL7A 1K3UB 1RAIA 2NT4A 3FYHA 3HDTA 3NAQA 1W2GA 2FPGA 4L7QA 2GBCA 2UYOA 4QYTA 3UGKA 5HCNA 1EUQA 2FEAA 5SYMA 3ZU5A 4BS9A 3O73A 4K6GA 1C3OB 4NBLA 1O58A 4JI6B 4K9LA 5HE8A 3U17A 1DMSA 4AYTA 1JIXA 1WA5A 4LJKA 3G2JA 5DSTA 1Q1EA 3AUYA 3HSKA 4PRYA 3SBXA 4EA7A 4OJYA 1SCAA 3B9QA 2FSGA 3CT4A 2B82A 4UNNA 1A9ZA 3ZZMA 4EZBA 3ZQUA 1G8GA 1KK0A 1XZJA 1ZVKA 3DOIA 1XB2A 3MN1A 1Q44A 2IPNA 2GZ1A 3IQEA 3Q9SA 5AR1A 4YUZA 3LIIA 4LS3A 4O5AA 4RKQA 1ZVVA 4ZCLA 1RC1A 1OR8A 4II7A 1FMTA 1UKBA 3MMPA 4GRAA 1PZNA 4CDMA 3EQ7A 4J7UA 1TCCA 2OZKA 3T3MB 1AN9A 1V4VA 2OV3A 2AE2A 3EUFA 4JP2A 3S6JA 1BD3A 2NUBA 4IGFA 4AKGA 2H5LA 3PR3A 5JANA 2QRJA 1OI2A 2XHZA 4V0OA 1S2LA 1RWQA 1CIPA 3OZVA 5K8VA 5LZ2A 2XT9A 2ZAGA 4MUAA 3ZHRA 1G8SA 3IELA 3B6ZA 5ER9A 1RRKA 1YI8A 2V0CA 2ZRNA 2Q7DA 4JNCA 3HDYA 1KZ4A 1GCOA 1L7RA 5AESA 4O0LA 1GNSA 1FE8A 2PH1A 1U0BB 2I8LA 2LDXA 2PFSA 3LUDA 3RYCA 1N2JA 5ELXA 3L46A 3N2NA 1BWRA 1ORWA 2CW5A 4OHZA 4ARBA 1EXNA 5T4BA 1GXSA 4P7BA 1DDIA 5AM2A 4IIUA 2PD6A 1ORIA 3EAGA 2EKBA 4OHFA 1WL8A 2WC1A 3LBNA 3CW2A 4HSGA 3LVBA 1EE9A 1X3LA 3LNTA 2D4HA 4LXYA 5CPFA 2IOQA 2PUDA 1C2TA 3FPAA 3ZOZA 4Z1OA 1A96A 4DREA 1G5FA 3JD4A 5D51S 4MA5A 4PRLA 1DFGA 1LBTA 2QSYA 3IKVA 1P61B 4ZT6A 4ZJYA 4GMGA 1GGEA 3OM9A 4BBJA 1C1XB 2WJGA 1IB6A 5KNCH 4ENRA 2EFCB 5EYPB 3NM6B 3WV4A 3GJRA 4ZI7F 1VLHA 2P9TA 3V55A 3THXB 3VSBA 4L0QA 3TGLA 3PNPA 3WC4A 1XPUA 2GCNA 2W2TA 4X7PA 2BEUA 3T54A 4YT8A 5CDHA 1C3XA 1GL6A 4I1IA 5DGCA 2XQFA 1TM1E 4YDQA 3W5CA 3PENA 3FLMA 4IS3A 2YMLA 4LYFA 3JS5A 4BO0A 1BKSB 1AY0A 3AETB 3CM0A 5JXWA 3EZGA 4XIGS 3H2KA 3QPUA 4FEYA 4X20A 3ESCA 3QG1A 4Q7QA 2CLKB 2R97A 1NG1A 3OTQA 5E8RA 1NOJA 4EA8A 3DR5A 4RMHA 2WZCA 1KFKB 3BTSA 4X93A 3LD9A 1T3TA 1AGNA 3ILVA 3C6BA 4G84A 4MNTA 4YWJA 1GTSA 1E3WA 3BCUA 3TZKA 1QQ6A 5HGJA 3BK1A 1DJMA 4E13A 1I2CA 1D7OA 3IDQA 4ZOLB 1CJVC 1FUEA 3EMDA 4CG0A 3GYGA 2H2GA 3O4FA 1BVRA 1ZVMA 4MV0A 3BA6A 3S2ZA 3ZDDA 4MUIA 1V5GA 4PGHA 2IUYA 2XYRA 3VKUA 1U3VA 2F3UA 2KX7A 2OE2A 5DE3A 4ZI5A 4M1OA 2RCYA 1V8PA 4RCVA 4TYPA 1NR5A 4MXDA 2FLWA 3BE8A 1QP4A 2XIQA 2OCKA 1QR2A 3TGWA 3RU3A 4F91B 1REQB 1CQWA 4FYVA 4LHYA 4RF2A 2QPTA 3ZJTA 2OHHA 2YWDA 3NUZA 1FU7A 3HNRA 3ZCVA 4FMBB 3QFTA 3E7XA 2NTJA 4F3YA 1OWMA 2HXSA 4CGYA 1K88A 1WNTA 4XX0A 1GOTA 5GV8A 4YA6A 5BO5A 1AE1A 1NVKA 4JENA 2BI8A 1PK7A 2HJRA 2QZ4A 5LZ7A 2CDCA 4EI2A 2XXAA 3OPNA 3N59A 4GW3A 3DL2A 3DYVA 3LKBA 3L40A 4RELA 4S35A 5IFLA 1JF8A 4PXAA 4EECA 5C7YA 3LX5A 1CS0A 3MGAA 4M9CA 5AVUA 2EZTA 4YDHB 3L4KA 1EUYA 1S01A 2BHSA 4MVJG 2WWWA 3FHLA 1X6VA 3EWAA 5E95A 2A3NA 2FWBA 2JHFA 2PL9A 3AFMA 3WX0A 3A1TA 4MS3B 1CZLA 4YACA 1T0JB 3ELDA 3FWKA 5CUQA 5EUQB 2CF5A 5BUZA 2ZWAA 4YCJA 5J4HA 3VKHA 2CLOB 2RBEA 1MR3F 2P2CA 2PRJA 2X7JA 1PLKA 1LPSA 1PAUA 1IDN1 3ZJ4A 2ZTMA 3EVCA 2IF2A 2DHDA 4D57A 2OUIA 1RHQA 1V47A 3MPUA 2O2IA 4L75A 4ND5A 4MWSA 2VZLA 1UQUA 3MCVA 2XAUA 1DG1G 1RWKA 3K16A 4DA6A 1DC3A 1RHRA 1YFJA 2CLLB 2VHWA 1F4PA 1P39A 1F0YA 2WWTA 3NHBA 4L8WB 5FULA 3MJDA 2H4HA 4A6EA 2XWJI 2V58A 3KYDB 2ZYHA 2XB2A 5DNEA 3N70A 2DM6A 1UDWA 1LRLA 1T3GA 3CWQA 3EG9A 4KO2S 4PS0A 4BZXA 3A26A 4DLLA 4MJLA 3W9SA 3UXYA 3PP8A 3LF1A 3FNGA 5HJ5A 1VKHA 1ZYUA 4JFAA 8AT1A 3UGJA 1BKDR 1EMDA 1HQYE 3GP3A 4CI0B 1D2GA 1DAEA 1YJCA 1TGYA 5FWNA 3ZEIA 2XKBA 1JA0A 1C0LA 1DQZA 1H8ED 1KZYC 2YDXA 3A1UA 1K6JA 2RGCA 2WNHA 3AUUA 4MV4A 4RLSA 4UEOA 4GX2A 3V1KA 4AICA 5B3JC 3BJZA 4DR1B 1ZDMA 4GZLA 4AC9A 1ZCBA 2J8ZA 4C4OA 1QFMA 1YO6A 1L7BA 3LYUA 4IDBA 4NX2A 1OAOC 4XGKA 4RCZA 3FUCA 3NMUF 2IGBA 3ZW7A 3LW7A 4EHKA 2CD7A 4IDPA 3SYLA 1MG5A 1CR4A 1E9EA 4CR8A 2QPLA 1VJDA 2G1JA 3QEBZ 4N5MA 1VSQA 3JPWA 3R77A 1UJ5A 1SCUB 1CY0A 2EP5A 3IA2A 4J1TA 5CK5A 4RE5A 3TW4A 5LSAA 5KKNB 2NWQA 5KINB 4J6EA 1UKEA 1M2VA 3LS2A 4YCMA 1B8VA 1UKYA 3K72B 3GO4A 1UPBA 1B14A 1NAHA 3BFXA 1ZW6A 2WIFA 3A1NA 3LWBA 4JLDA 1GZSA 3DL4A 3V8MA 5KYXA 4I4TA 3ORYA 3GLIB 3W4KA 3ND6A 1OU0A 4HR7A 5DGXA 4J90A 4P4GA 3TLKA 5JXHA 2PKRA 2P9FA 4N40A 1CEYA 2A3RA 1FDRA 2MU1A 1TTQB 1XMPA 3TZBA 1ID8A 1IXKA 4MW9A 1Z5ZA 2FETA 1XVUA 4NYIR 1MO5A 3JU3A 3TQIA 5BSKA 3M5PA 7MDHA 2IXBA 4OQYA 3DZHA 4MYSA 3VISA 2Y1OA 1YZHA 1QDEA 3R1IA 4LDZA 4A8HA 1KEEA 4MZXA 1KETA 1A76A 1OX6A 2WI8A 1T9BA 3CLHA 4W8GA 1UKAA 3G0DA 3AC0A 2CJPA 2AS0A 3EFOB 2PEYA 2R6ZA 3EXFB 4L73A 4DCCA 4C08A 4C7VA 4NABA 4XX1A 1ZINA 1E92A 2Q9UA 4NEQA 1FJHA 4EITA 3ZV5A 3FJOA 5CB0A 5FH9A 3EDMA 3SF8A 5KYTA 4NXNB 4KMSA 3D7LA 4YJ2B 3GJ8A 1FF9A 3M3DA 5AUOB 5DN6D 4P93A 3TVDA 3AMVA 2CK3A 2NYUA 3NHAA 5AJXA 1JDBC 2E5FA 2I1LA 1N1DA 2GUWA 1E9BA 4Z53A 1HX7A 3FZGA 3FUVA 4M7OA 4I1OA 4FMCB 1E2EA 2PU7A 2PYZA 1YS7A 3BDVA 5C5IA 3RC7A 4LX0A 4Z9FA 2W0SA 4MPTA 4OIFA 4BJ3A 3FVQA 5TQVA 2FVXA 3EZ9A 1Q1ZA 2WILA 2FSFA 1OU4A 3RC9A 1KOJA 1MFZA 4RJ2A 3MG9A 5CXSA 1EAMA 1JKJA 4UHHA 4W1RA 1XXLA 3R8XA 2C0QA 4OL9A 1SXPA 1FYFA 1S89A 2XE7A 3CFYA 3KAPA 1K8RA 1SOAA 4ZVOA 5G53C 3WXBA 1ISHA 1N5RA 5CYPA 3JCZA 3ZOKA 4ZZ1A 1E1KA 1JTVA 3NDJA 1L5HB 5HKKD 4H3KB 2GRJA 1NDUA 2WSIA 1Y89A 1EQ2A 4LVOA 1DDGA 1SUBA 4RGYA 1QBGA 3ZU6A 4LKRA 3HPQA 4L4ZA 3SS7X 3L8EA 4XIFA 4ADSG 4DYDA 1JLRA 1OFGA 2LP4Y 4GQAA 4JL5A 4DARA 4DDMA 3I3SR 3EVEA 3KJNA 1QGUB 1QAMA 1U8FO 4UTNA 2ZBUA 4L5CA 1Z8HA 1AZTA 1S7GA 1H0SA 1Z6TA 1PR9A 3QFRA 1MC4A 2F48A 4WXHA 5K7SA 3MZ0A 1G20A 1RLIA 5E38A 2FRXA 1CIVA 1PVDA 1V41E 3KB8A 3K09A 2Q2QA 4J9UE 1XQ1A 3IKTA 3KETA 3H2BA 1RD4A 5SICE 1SY7A 3ETHA 2PGJA 2PKQO 3EGXA 3EOBI 3EBOA 1PYGA 3NHFA 4QTTB 4DM3A 5KS2A 4GDMA 1ACLA 1H9AA 2XLCA 2ZIZA 3GNQA 4FCVA 3U7QB 3W1VA 5KIAA 1NTOA 3LVFO 4OKSA 4RTSA 5EP1A 5SZIA 4H6XA 5ARDA 6REQA 2CFIA 4IRUB 4RHCA 3NGLA 4EHNA 3H2YA 2PRKA 3I6MA 3LUPA 3NHYA 1IMOA 3PFFA 4KQ6A 1GCAA 4IVNA 4JJZA 1IK4A 1VC2A 4R9SA 4F97A 5ICGA 1TVKB 3PR1A 3C7DB 3WL4A 3AVX