1WRBA

Crystal structure of the n-terminal reca-like domain of djvlgb, a pranarian vasa-like rna helicase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
238
structure length
232
Chain Sequence
KYDSIPVSVTGPDYSATNVIENFDELKLDPTIRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIINHLVCQDLKTAYPKCLILAPTRELAIQILSESQKFSLNTPLRSCVVYGGADTHSQIREVQMGCHLLVATPGRLVDFIEKNKISLEFCKYIVLDEADRMLDMGFEPQIRKIIEESNMPSGINRQTLMFSATFPKEIQKLAADFLYNYIFMTVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the N-terminal RecA-like domain of a DEAD-box RNA helicase, the Dugesia japonica vasa-like gene B protein
pubmed doi rcsb
source organism Dugesia japonica
molecule tags Hydrolase
molecule keywords DjVLGB
total genus 71
structure length 232
sequence length 238
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1wrbA00
3AV0B 4NYJQ 1UEIA 4G0NA 4Q4LA 1SZPA 2XXAA 1K5GA 2ZJ5A 4JLVA 4AIIA 3SFVA 4XSHA 3SNHA 3QPUA 5TY0A 5IK2A 2CLSA 5CITA 2BEJA 2UKDA 2ZJ2A 3EZ7A 1KK2A 3TQFA 4QXAA 3UANA 2IHBA 3LA6A 2F3TA 5LD2B 1CR1A 4YLGA 4PQFA 3TJZA 3B1XA 2QEQA 4DZZA 1MO4A 1KYIA 1YQTA 1NVVR 2VSFA 3A8TA 1L8QA 3LVQE 3LY5A 1XWIA 3B60A 4JL6A 2GILA 3NC1C 3QJYA 1UKVY 5HCIA 3U4QA 2G0TA 2YNMA 4TMZA 2FJUA 2QA5A 2ZSDA 4RFSB 2V7QD 2JDIA 2JJ2D 3KXIA 4TMTA 3PJRA 4Q00A 5M04A 2YOFA 1Z0KA 1YRAA 4DSNA 5KSOA 3THXA 3K1JA 2F1HA 4IFBA 2FPKA 2IYYA 4MRSA 2GWHA 3SR0A 2EU8A 4X8OA 3D31A 1W0KA 1IN7A 2ORVA 4IHQA 2ONKA 2F1RA 1CR0A 3BGWA 1RW4A 2KE5A 2IYZA 3ADKA 4NCNA 2A30A 2HT6A 1T9HA 2RGXA 2P67A 4BRWA 5G53C 3UATA 3WBKA 4CEIA 1FP7A 2Z5FA 1Q22A 2QM8A 2A5YB 2ZRBA 3X2SA 3GFTA 3CF6R 4WAUA 3NWJA 4KI0A 2RKOA 3FMPB 4L4UA 3MCAA 1C4OA 2V9PA 4U00A 1W2GA 5BN4A 1E1QD 2ODBA 5HZHA 2OAP1 2WWWA 4RCZA 2D4HA 1FNNA 3DO6A 2XB2A 2B21A 4KFUA 2RGEA 5CB8A 3LQRA 1NP6A 5HPYB 1TF2A 4YMTA 1PLJA 4NDZA 1X8KA 2GCPA 1JJ7A 4LUCA 2BBTA 3RNLA 2ODWA 2ZSBA 4E07A 1HQYE 4L16A 1NSFA 1P9NA 1KI6A 1QG2A 4IW3B 4TL9A 1OYWA 4Z8YA 1WA5A 3AGPA 4RZ2A 5JWOA 2H92A 3IDQA 5AJVB 1RYHA 4M4SA 1OH5A 3RS3A 2BM0A 3QXSA 2HT1A 2IYLD 1WXQA 2PCLA 3K0CA 3PEWA 3Q5DA 4AYXA 2ZEJA 2VSXA 3R8FA 3ECCA 2XXAB 1BS1A 5D3MB 2AK2A 1E0JA 2D7DA 4C0JA 2ZE5A 3VNUA 3AUXA 2VP9A 2ANCA 1Z2AA 5FL3A 4JL8A 1JJVA 1R8SA 4RSGA 3L0OA 3VR4A 1GIAA 2OZEA 3A1TA 1G21E 1IN5A 3ZJYA 1HV8A 4PC7A 2FPLA 1JI0A 3CNNA 1RZ3A 3K09A 1KKLA 3OEHD 1RPZA 4HEJA 1IY2A 2LWIA 1SHKA 5KUTA 3RABA 5JJLA 1XTRA 2WHXA 4M1YA 2IK8A 5J4HA 3EASA 4RFSA 2J87A 4B3CA 4OJKA 4PPQA 4TMVA 1WE2A 4Q1FA 2JLVA 1KNQA 2IUTA 4BE7B 1AQYA 2DB3A 1Z8FA 2P5TB 2VHCA 4P4TA 2FGJA 2JJ8A 4MH0R 5J40A 1NG1A 2B8TA 3U3JA 2YKGA 3V4RA 4NYJR 3GLIA 1E9SA 3FKSD 3A4LA 1Z28A 4TYPA 5FPYA 4NCKA 2OFOA 521PA 4GSYA 1FX0A 3QEOA 1S8FA 2D74A 1G7TA 3AP1A 2W00A 3MSXA 3K9NA 4FMDF 4LYAA 3P27A 1E0AA 1TUEA 3NC0C 6Q21A 2PZGA 4Q48A 3QKRB 3EIHA 4TTQA 1E99A 2BOVA 3ZVMA 3ICEA 1NN3A 1KHTA 4OQXA 3ETLA 3PV0A 3ZZTA 5AUOB 2OXRA 5EE3A 3HYTA 2JJ1D 2VRWA 4ZCMA 3PEVA 4PZYA 4F4JA 3FOZA 4JJZA 3LW8A 2REOA 2JIZA 2ZRDA 1A4RA 2JLYA 3ZS8A 2ZRLA 1XCPA 2PLFA 2YOGA 1G17A 2V7QA 2OILA 4WW0A 3GD7A 2F9MA 2ODNA 2V6IA 2VP5A 4EQ6A 3R9WA 2GCNA 4HDOB 1RFLA 3LWNA 4ITRC 2DBYA 3U44A 1N6HA 5L3RA 4F4CA 3KXLA 4URZR 3TR0A 3WXMA 3C14C 1Z2CA 2JLZA 5FOWA 1OXTA 1D8TA 5DI3A 2IXFA 1T4GA 5FPSA 4NMMA 4B35A 1OH6A 3ICQB 4PX9A 1E9RA 3NHAA 3KKQA 1ZVQA 3WNBA 2BDTA 3SJZA 4M53A 2RMKA 5KSPA 1BYUA 5TB5A 2WJJA 1NN0A 2QPOA 1V43A 5JSZB 1E9BA 1N5KA 1OKKD 4JLKA 1M2OB 1G291 3AB3A 1GRRA 2A9KA 4PHTA 1T3SA 3W6OA 3SFZA 2GEUA 1OIWA 3PIRA 1GAJA 4EPTA 1VG9B 3SQXA 2QSZA 1VHLA 1AGRA 2V4ZA 1T5IA 1DO0A 4A0GA 4B2IA 1QBKC 3A36A 3TAUA 2H57A 1IHUA 1GL6A 3X1ZA 5IRCD 4AKGA 4GMDA 2HF8A 3QY0A 1W1WA 2R44A 2R6DA 4UXIA 5AUNB 3UPUA 2JEOA 3I3SR 4JLMA 5J4YA 2CK3D 3U60B 1SKQA 5K8UA 4ERNA 4TWZA 1NBME 2NO6A 1KNXA 2ZJAA 2XTMA 4XSGA 1YR8A 4PTLA 1D9ZA 5FOVA 4ESHA 4BLOA 3E5HA 1JR6A 1YZQA 3EPLA 1UADA 1ZNYA 2HYDA 4O25A 5F3WB 2Z4SA 1X3SA 3GLFE 2B8WA 1OW3B 5F2EA 1L7VC 3ADBA 3KJHA 5JJIA 4HDQB 1KI7A 2R6AA 1DOAA 4KAXA 4KFTA 1G6OA 1TQDA 4S35A 3AP2A 3DM9B 1XJQA 5G41A 2XOKA 4IDQA 3IQWA 5CB6A 1S3SA 4IDPA 2WJHA 1B0UA 2MMGA 3P1JA 1Q57A 3P20A 4C0KA 4M9QA 4OQMA 1A2BA 1MABA 3H86A 2VEDA 4UXHA 4W5HA 1R8QA 1JPJA 4C30A 3RWOA 3ZDQA 4QM7A 3QIAA 3GQBA 3IO3A 3VHXA 4AKEA 4V0OA 1IJEA 1DARA 4B74A 1CRQA 2GESA 3KB1A 2W6IA 3LRPA 3KUCA 1KI2A 1HQCA 4D82A 5FPKA 1U9IC 2V55B 2H18A 1FW6A 5C18A 3HU1A 3AF0A 4OI1A 5FFMA 5JFGA 2XJ9A 3X1XA 5L3SB 1XD2B 1Q1QA 2OESA 4DUGA 4DSTA 1G8YA 5KTYA 2O8DA 3IIJA 3O8DA 3QOFA 1KKMA 1JR3E 3OFNA 1DE0A 3CIOA 3OE7A 2F9LA 5JI2E 4ZCIA 5L3SA 3H4MA 4GBMA 1UBFA 1GKYA 2BHRA 2QQ0A 2XTZA 3I72A 1EGAA 4RKFA 3SJBA 4O2RA 1NI3A 1S1MA 1DAFA 3L8ZA 4NCIA 4OKSA 4AWXA 1G8PA 2GAAA 4WZ6A 1NF3A 2OO7A 3GLIB 1A1VA 4H1VA 2O8DB 3ND9A 1OF1A 4TLEA 2R8RA 3DDCA 1VMAA 5DHAA 3IIKA 4CEJB 1Q20A 2GJAA 1UAAA 3VKHA 2A78A 2CHQA 4DT1B 1R2QA 4JL5A 4ON9A 4ABYA 5EE1A 2NPIA 5JWRA 5EXXA 1E2PA 2UZ3A 2W6JA 3BD9A 3AVTA 3AVXA 4Q9KA 1G3QA 2J7KA 4TYYA 3L0PA 4A15A 5KDLA 1YR6A 3SJCA 2FZ4A 2H5EA 2KBFA 4KFSA 4PC3A 1XF9A 2JLQA 2VH5R 4DEYA 2AR7A 4FWTA 5HKKD 1I4DD 4IKEA 1T0JB 5C46F 4NTZA 2GZDA 4DLYA 3KJIA 2WKQA 2GXSA 2CDNA 3K9LA 2GAOA 2YINC 3QVUA 3D3QA 4MRRA 4JVLA 3CR8A 4OHWA 3RRNA 3THOA 5EUQB 5BN3A 3UIEA 2ZROA 1R0XA 1Z6YA 1NY5A 4IEEA 3U5ZB 2H16A 1W36D 3REFA 3V9PA 3U61B 1ZYUA 3CX6A 4ACBA 3VR1A 4IDHA 4YONB 4AC9A 1DAIA 1Q1ZA 3QKSB 4D4MA 1LY1A 3HU3A 5FUYA 3SQWA 3IGFA 3ADCA 3IBGA 4JLNA 2R6CA 5A5GA 1Z07A 1FQJA 1MO3A 1VG1A 3FKQA 5FOXA 3CNLA 4O0MA 3AP3A 5EP1A 2CBZA 2EFGA 1JQJC 1AS2A 3AEZA 4GZLA 5DGXA 4HZUB 4F91B 3QPWA 2QPTA 4N0DA 5DHFA 2GJKA 1GTVA 1OXXK 4M2LA 4PQRA 5AUPB 2FMXA 3CBQA 5DI9A 4QJ3A 2IUUA 1ZP6A 3T15A 3A4NA 3MWKA 2FFAA 1RC8A 5JI3E 2GEDA 1OJLA 3FKSA 3PEUA 1SXJE 1UJ2A 2Y8EA 4XVRA 1MH1A 1W4BA 3U44B 4JT2A 2J41A 2VPPA 3BORA 3G82C 3IILA 4JT4A 5JSZA 2IWHA 5C2JB 4PO8A 1WRBA 3QEJA 4I81A 1GFIA 1E79A 4WOPA 1U0JA 5DYIA 1UDWA 2NG1A 3AUYA 1DELA 2F3RA 1GRQA 1N25A 1TF7A 3SOPA 4XD7A 1KJYA 5B30A 1GSIA 1XZPA 1NN5A 3VR5A 4EJSC 3TMKA 2BMJA 2HXYA 3BC1A 4DIEA 1E2JA 1G6HA 1M6NA 5C1BA 3PCRB 3KQUA 1LFDB 4XWKA 5E3HA 2FFHA 2ZI7A 3CRVA 1G64A 4A9AA 1SXJD 2DR3A 3VKGA 3U6KA 3CX8A 4BECA 1E9CA 3E1SA 2P6UA 2X1VA 1XTSA 1XPRA 1DO2A 1G4UR 1FNMA 3SS8A 2J9RA 3GFOA 4BZQA 3I5YA 2HEIA 1IXRC 1NMYA 3QBVA 4NH0A 5FBRB 4XWAA 2OT3B 1U0HC 1G5TA 2QBYB 1EXMA 2ZVPX 3TR5A 4M1SA 1TNDA 3CONA 4HZIA 1C9KA 2C78A 4G5SA 1U90A 1NJFA 2FU5C 2ERXA 3EC2A 1OV4A 2AD1A 3GLHE 4FMBB 4Q18A 1Z3IX 4BFWA 3NHBA 1RRCA 2R2AA 2H17A 4Q4HA 1D9XA 1HURA 2ZIAA 2ZS8A 2Z0MA 2W0SA 4U7DA 2KB0A 4CDGA 3VMFA 1Z0DA 2GJ9A 4MYHA 3IUYA 4IXNA 4P0TA 5CLLA 5FI0B 2EYUA 3N5CA 2PJZA 3B1YA 1S9HA 4C7OA 1Z29A 4RVCA 3ZZ0A 1N6LA 2QT1A 2ZR0A 3BAFA 2DWQA 3NBZC 4W5JA 1TU3A 1HE8B 3JZAA 3PUYA 3TKLA 1TADA 3B1ZA 3W9YA 3N2IA 3PITA 4Q01A 2ZXUA 1XDBA 3TBKA 5K8TA 1G16A 3OIYA 2YWGA 3GJ6A 3UK6A 4RCYA 1WF3A 3PQCA 1SVWA 1XEFA 1JPNA 2DFNA 3PUXA 5FUXA 2XGJA 1GKIA 3FMIA 3KTAA 3EZ2A 4IVPA 3I1FA 1AK2A 3BWDD 3EC1A 3K0AA 4MYUA 3RDPA 4I1UA 4OI4A 2W2TA 1KI6B 5KSYA 1KSGA 4KLZA 2F43A 2WAXA 3BH0A 3QXJA 4QFMA 1GL9B 4JZKA 4L5BA 2W2XA 4U02A 2WIBA 4O2LA 3R20A 1X86B 2OV2A 2JJ1A 1ZM2A 2HCJB 5JHHB 2Z4RA 4DT1A 1V5WA 1VTKA 2PJRA 4HAVA 1CJKC 3UG7A 1WBDA 3QBTA 4BFZA 1JAHA 2A2ZA 2XSZD 3AF4A 2QBYA 3DOFA 1XD2A 3BFVA 2VHQA 2ONJA 2E9SA 4A6XA 1GP2A 1KSFX 5TDHA 4B44A 1R0ZA 2VP4A 4AD8A 2QROA 3THWB 2OLKA 1OPXA 2GKSA 4DKXA 4G5QA 4QBGB 4JBXA 4KITB 1OFHA 3LO5A 2KSQA 1ESNA 4X8LA 4B34A 4MGYR 3BRWD 4DLVA 1DAEA 1SQ5A 4NZYA 2QGNA 4CF7A 5HE8A 2QORA 5AK0A 3CR7A 4DUGD 1QVRA 5GJBA 4W5WA 2VP6A 3TIFA 4DCNA 1MT0A 1S4QA 2EFHB 2VYFA 4AYWA 4EPXA 5KDOA 2F6RA 2XTNA 5KPJA 1FL9A 3THYB 1Z0JA 4Q7JB 5FTNA 1W0JD 1FOEB 1JALA 2ZYUX 5LB2A 3KQNA 2C03A 1EFRD 3QQ5A 4BFSA 1J2JA 4CEIB 3TRFA 3LX5A 1R5OA 1A2KC 5TV2A 2NTYC 4A2PA 3F8TA 3HYRA 1SKYE 4QOSA 1OH7A 1KSHA 4BQSA 1Q12A 1N3BA 1W0JA 1ZUHA 3ADDA 4Q4AB 2ZI9A 5L3VA 1PLLA 5DNYB 1FUKA 3FPAA 1QZXA 3VR3A 2X77A 3GJ3A 4LC1A 1XB2A 5JHGB 1UDXA 1PUJA 1Q0UA 1W49A 2ORWA 3AF3A 4V0KA 1PVOA 3K70C 2VL7A 3AVUA 1AS3A 4OK5A 2GVDC 5A4JA 1UKYA 1P75A 3VR2A 5C4MA 1NNEA 1HUQA 1JR3A 3KFXA 5J4LA 5HZKA 5FBQB 1BMFA 2GXQA 2QAGB 4HUQB 3VU9B 3HDTA 1VHTA 2X19A 4KBFA 4TTPA 4XTRA 2IEZA 3QKSA 3UMSA 2GXUA 1IOZA 2XX3A 1P2UA 3T1OA 5BXQC 2IS6A 1W46A 1PJRA 3LXRA 4MKGA 4Q5IA 3WYFA 2OFXA 4DCUA 2JJ2A 2PT7A 3K53A 1AA9A 2DPXA 3SYKA 4NPHA 1UBCA 2R65A 2OUKA 1NLZA 4LYHA 2A3RA 5EQTA 5GJVC 1NIJA 1EWQA 3RS0A 3U3KA 4PFSA 3SI7A 1XU4A 3EA5A 4A8JA 4LBZA 3LVRE 1X8LA 4Q9HA 3AM1A 2ZR9A 2W6ID 2HJGA 4GFDA 1II8B 1VCMA 3SBDA 4FD2A 1RYFA 3EZ9A 2NQ2C 1W44A 2BIFA 1E2KA 1KI8A 1OFIA 1NKTA 2QMOA 4NYIQ 4P32A 2OSBA 5DI3B 3OHMA 4A2QA 1W47A 5EXPA 4QNMA 2WJIA 2GRJA 1M7BA 2QQEA 4KVAA 5KPDA 3O8RA 3RYTC 2B92A 1L4YA 4ACAA 1Z6XA 3LDAA 4FI3C 1W36C 2XOKD 3R7WA 1SXJC 3BB4A 2PL3A 1E2LA 4UJ5A 4DEXA 2BBWA 4XD7D 4X8HA 5KOYA 1IY0A 3EXAA 2IBMA 421PA 2REXB 1ZUIA 4FCTA 3U3MA 1Z0FA 1FTSA 1P62B 1Q1EA 3OAAA 1FMJA 3ZYCA 5AJYA 1DAMA 4KYUA 2O8BB 1TQ6A 4NE2A 3PEYA 2CXXA 4EPYA 3AVPA 4G5GA 4Q02A 2YWEA 5AJXA 2WBLC 4MGZR 2O0JA 3ZGXA 3EW9A 2QAGC 3QF4A 2DHRA 1Q21A 2OEPA 4ZIRA 5JEEA 2J5XA 4ZV4A 1CP2A 4GZMA 1M74A 1KIMA 3H1TA 1M7GA 3WMGA 3DZDA 1H8HA 3ZH9B 4BUJA 3T1TA 1OB2A 2HDNB 3SE0A 1CTQA 4C4PA 1ZD9A 4B3XA 4URVR 3AKCA 4KSBA 2VHTA 2GBLC 2IYTA 5CDFE 3LBHA 1HE1C 2JLSA 1N6RA 3HPRA 3EWSA 3Q7PA 4OK6A 1T3LA 4A1FA 2IT1A 1BKDR 2D7CA 4JLDA 1G7RA 1X1RA 3OIWA 1G3RA 2KBEA 2WMNB 4BEBA 1UM8A 4TT3D 3C16C 3TVTA 3I62A 4XVQA 3NEYA 2QRZA 1ZM4A 5SZIA 5DIFA 3B13B 2HJVA 2EFDB 2FSFA 2YC2C 3CX7A 3KJGA 4MITA 2WWYA 4LBWA 1N0WA 1XCMA 4MA4A 4IXMA 1CLUA 2C8VA 3I4LA 5FH9A 1HEIA 4KODA 3Q9LA 1JBKA 4HAZA 1H8ED 2HF9A 1HT1E 1AQUA 1KMHA 1G3IA 3FFAA 2RGGA 2Q3FA 2VLIA 4RZUA 3U3OA 2ZU0C 1JR3D 2DCUA 5EUMA 4LY6A 3TUJC 1UF9A 3KUDA 2BJWA 2WWHA 3W5IA 1AZSC 3VKWA 2CLDX 2ATXA 3L82B 4H9GA 3FDIA 4DLRA 4DDWA 5BYKA 3K0EA 1KAGA 1E2HA 1E6CA 1VG0B 5DISB 5DYGA 5KYKA 4QBIA 5TARA 3W6NA 2BVNA 2IYXA 3A1UA 4JSTA 4P31A 2MSDB 4BASA 1MOZA 5DSZA 1IN8A 2H8KA 1U9IA 2ASEA 5G3YA 2AX4A 2MMCA 1RE0A 3CF0A 4ASUA 2XZLA 1GVNB 2J7PD 1DAHA 2BMDA 4JVNA 1E4VA 1DAGA 1SKYB 3DKPA 5FUWA 1U98A 2ZI3A 4JKIA 1UPTA 4ASUD 4ZCLA 1DADA 3RS5A 2QG6A 3X1YA 2EVWX 4US0R 1EFHA 1VYTA 2QNRA 1T5LA 2Q21A 4JKYA 1SVLA 1KDRA 2EFEB 1IM2A 2FV8A 3AF2A 2G77B 3DM5A 1XPUA 221PA 4QGFA 3IO5A 4N3NA 2OBMA 4CT5A 2FPMA 4JVSB 1JAIA 4URWR 3WMFA 4Q21A 4QJ5A 2WM9B 4RFVA 1UEJA 4D0GA 4C9BA 1NLFA 1LF5A 2RGDA 4LHYA 5EE5B 4TYNA 3R9XA 3MJRA 4HYYA 4QHTA 2RGBA 4YMVA 5EP3A 4Y0VA 2WTUA 3AVVA 1Z63A 3GLHA 1VCNA 2IA5A 3Q8XB 1YZGA 2ZYWX 1EWRA 4LV5B 4IFEA 4PO9A 3TUIC 4IOLA 3FFBA 4IOKA 2WSSD 3TSOA 5JS7A 4L15A 1OKKA 4C0BA 4QKQA 1ZM3A 2EWWA 2OG2A 4QRHA 3RAPR 1E2GA 4JLJA 1IY1A 1NG9A 2CJWB 2IC5A 3K0AB 4LX0A 1YR9A 2BV3A 621PA 4D26A 2CNWA 5FPTA 1T3HA 1AGPA 5CDFA 1M7HA 2ZI4A 4YDSA 4D2IA 4EFNA 1CJTC 5LD2C 3BH6A 3KQKA 1S0UA 3PG5A 3PUWA 3DMDA 121PA 1GNQA 2QUZA 3VX3A 5SZHB 2PH1A 4WVFA 4W9MC 1SHZA 4QBFA 1T6NA 2GCOA 4Q4JA 2FH5B 4F7WA 1XMIA 4I4LA 1YR7A 2GNOA 4OYHA 2MSEB 3A4MA 4OL0A 4TMXA 3RSOA 4NHOA 3DL0A 2B7BA 4MUAA 4MDEA 1YKSA 1D6JA 4C2UA 1QHSA 4DB4A 1XEXA 4LHXA 2ZPTX 5FBLB 1KGDA 3NH9A 3DZ8A 2NPFA 5J47A 3K70D 3AKDA 4DB2A 3OIUA 4V0ME 4A6PA 2YVUA 5UKDA 2AXPA 2G1JA 2TMKA 4FW9A 2J46A 3BBPA 4FMDB 1ZJ6A 4IOJA 5EE0A 821PA 4UQOA 4KJZA 4BLSA 1GM5A 4GRAA 1CR4A 3EZFA 4W7SA 2I4IA 2FEMA 2IS4A 1Q1BA 3RS2A 4HUTA 2ZS9A 1CR2A 4EJSB 4LSGA 1CXZA 4DBLC 2LCFA 4Q9JA 2PBRA 1NY6A 4PXAA 1K5DA 5LB4A 5CM8B 4PHHA 4TLAA 5H1YA 1E94E 2R6GA 4XIGS 4LJ4A 1SVMA 3ZIAD 4DWJA 4A0FA 4DLUA 2G6BA 4PPNA 3HWSA 1CBUA 1E32A 2VQSA 4OI2A 2O8CB 2BCJQ 5FR1A 4Z1MD 5JECA 1FQKA 3B6EA 3R7WB 1HTWA 3FYHA 3PFIA 1NRJB 1VPLA 4CYMA 2Q3MA 3UWKA 4NL4H 3W3AA 4B76A 2J0SA 1QHGA 2O8EA 1WBBA 1UKEA 3CNOA 4V02A 3QENA 4GT1A 1S1CA 4DLTA 4MYCA 4IDOA 2VIIA 2XZOA 3LLUA 3A37A 3NDPA 1MKYA 4PC6A 3U6BA 4AKHA 4R98A 3QXHA 2CLCX 2X8AA 2AKYA 4OHVA 2ZITA 2N46A 5KSZA 4P4SB 1MR3F 1QHHA 3LAWA 3MUFA 4D80A 3MFYA 4CRWB 1NLYA 2Q3HA 2C99A 3U7FB 2VHJA 1ETUA 4JYBA 4BFXA 1XPOA 1CRPA 1KI1A 3GLIE 3I32A 1KO5A 2R9VA 4Q19A 1I2DA 2GA8A 3U4QB 5A0FA 4LOAA 2ECKA 1R5NA 1VDZA 5IHPA 1VECA 4HDCA 4TMKA 2OAQ1 1EFRA 5GVSA 3Q7QA 2D62A 3V00A 1BYIA 1R6BX 2XNDA 4A2WA 2WZQA 5JS8A 4Q03A 4URXR 1ESMA 1RRFA 2BKUA 2ZU6A 4JLAA 5CIWA 4LRWA 2IS2A 4M1OA 5CK5A 3VTKA 2QPAA 1WMSA 3W8NA 3KQLA 3OEEA 3IIMA 3TK1A 2BM1A 1BMFD 5CIQA 3TAHA 4TL8A 3I5XA 5TXGA 2J0UB 4PAQA 1SULA 2IX3A 4LJ9A 4D6PA 4JBWA 1P2SA 2J7PA 4KFRA 4A36A 3HJNA 4PPFA 2BMEA 2O8FB 1KK0A 3KQHA 1N5IA 2I1QA 2BEKA 4KU4A 2IWRA 1AIPA 2GDJA 4TLCA 3RC3A 1W0KD 3FE2A 1A7JA 2JAQA 1KDPA 5FR2A 2JLXA 1J8YF 1NMXA 3RS7A 1ZW6A 4I1OA 5FI1B 3IEVA 4HB2A 4RD1A 2DFLA 3M6AA 4WXPA 5EXSA 3AVWA 2Q0HA 3JVUA 3LW7A 5HE9A 1IXZA 4ZI2A 3BK7A 3QNUA 1XXHA 1S96A 5EP4A 2C98A 4E22A 3NEJA 1KI9A 2WKPA 2WWFA 2IYWA 2EYQA 1EFCA 2RHDA 3A58B 1ZU4A 1HY3A 2A5GA 1PV4A 4QGAA 2B7CA 2FX3A 3TSWA 4AKIA 2DYKA 2OM2A 3GEHA 4G01B 3UMFA 2QM7A 2JASA 3R9IA 3QG5A 5CYPA 1GITA 1FUUA 1OT3A 2VO1A 3I73A 1AZTA 1GNRA 2BMFA 3OESA 4JLBA 1N6NA 4UXJA 2OXCA 1QHIA 4QHYA 4B32A 1OH8A 1VIAA 2HUPA 2ZRNA 3AKEA 3I8SA 4LJ5A 3TNFA 4DCTA 2WJGA 1K6MA 4CVNA 4CGZA 2GZHA 3W34A 1G8HA 1U81A 4HB0A 3QE0A 4Q9IA 2O8FA 5FL7D 1FFHA 1KTVA 1TQ2A 1RKBA 3FVQA 2FSIA 5GADl 3CW2A 4A0RA 1O87A 3CZQA 3B9PA 3ZVLA 3GLFB 1FX0B 1LNZA 2ZRFA 4DLWA 4EIWA 3IKJA 1OHHA 3DPUA 3L0SA 2RGCA 3L2OB 4TSFA 1E2IA 5JLJA 5P21A 1E1QA 4LGMA 3WRYC 1ONBA 4WIAA 2FOLA 4JLPA 1E9FA 1VYVA 2J59A 1Z06A 3BH7A 5JCZA 3GJ7A 3KKOA 1KZGB 4JS0A 3B5JA 1LV7A 4PAOA 4TT3A 3WBJA 5B57C 5TMPA 5ELXA 3PENA 3IPXA 5D3MA 2O5VA 2IYQA 4Y0AA 5AWFC 4GNKA 4D25A 3I61A 1W5SA 1NMZA 3B8HA 3MAAC 1IBRA 3WRXC 3ND8A 2WAYA 3ZVRA 3I92A 2IW3A 1OXVA 4GPTA 4EDHA 2XSZA 4GMXA 3OIVA 4NONA 4KCGA 3EIEA 1J90A 1LS1A 2W0MA 2CL6X 2DFTA 2XNSA 2WICA 3M1IA 4WXRA 3SEAA 2RGNC 2P5SA 2DFKB 4LYJA 2R62A 3RC8A 3EARA 3RS4A 5J4VA 4NCJA 2FSHA 5JWHA 4Q66C 1KAOA 3GLHB 1P73A 3IQXA 5EE9A 4TLBA 4KO8A 3V4FA 2O8EB 3ASYA 2NMVA 1YRBA 3WP0A 4CEJA 1E2QA 3D8BA 4UNPA 4OQLA 3WNCA 4HLCA 3CWZA 2IUSA 2YYZA 2OE2A 2QENA 1YZKA 1W48A 4B3GA 3CB4A 4G1UC 5B58C 1DVRA 2G3YA 3EG5A 4BLTA 5FTKA 3BFKA 2G88A 1W2HA 3I8XA 3VFDA 1GNPA 1X6VA 2O0HA 2I1VB 1JEEA 1P7CA 1LVGA 2WJYA 4R71A 1TPZA 2C95A 5FBVB 5E7MA 2GJSA 4V0LA 3CPEA 5KDDA 2F7SA 2JLRA 2VF7A 3ZIAA 4XH9B 1Q44A 1HT2E 3THXB 4DIDA 3B9QA 1CS4C 3MWLA 4CEHA 1OYYA 2GF9A 1WCV1 4M1MA 2FDCA 1XX6A 4NBSA 2BCGY 1E2NA 1S9DA 1MRSA 3BB3A 3HR7A 1COWD 2A7QA 4PSKA 4POAA 1G8GA 3O8BA 4LJ7A 4MRVA 3EPJA 1NBMD 1W4AA 4YXWD 4AY2A 2AK3A 2V6JA 4RD0A 3AVYA 4PSVA 4M1KA 1ELOA 2WV9A 2ZE6A 1N6PA 2JIZD 4WZBE 4C0HA 1KY3A 1IN4A 1IN6A 2QAJA 4EQ6B 5H8WA 2J0QA 2XITA 4BGDA 4P4UA 1G7SA 2GF0A 3Q72A 1F5NA 3QKRA 3W3ZB 2KJQA 3UKDA 4RZ3A 3F5FA 3SHFA 4PZLA 1F60A 1FZQA 5E4FA 1OB5A 2WIAA 2ZRHA 1J70A 4ZDKA 3ZD6A 2P65A 4UNSA 2GEVA 3GMTA 3VU9A 4BZPA 4JMPA 2XZPA 1G5PA 3M4YA 2WSSA 1KO7A 3CH5A 2QE7A 4HAWA 3SYNA 1P61B 2QGZA 4Q1AA 4HSEA 1KDOA 3QUSA 4TQAA 3CLVA 2QMUA 4M1WA 1ZMXA 3BERA 3SU8A 1AJEA 3RRZA 4DSOA 4MKIA 5FOTA 3T06B 1KK1A 1Z08A 4F38A 4Z54A 3EPHA 4B3FX 5EJEA 2WPDA 5SZJA 3C15C 5KNDA 1A5TA 1E1RD 4J0QA 2NIPA 1QDEA 1ZNWA 3HPQA 2CL0X 4URYR 1I2MA 3QKUA 2FEOA 3QXXA 1HYQA 3IHLA 3Q3JB 2P0EA 1NJGA 2CHVA 4TQ9A 4JJKA 1TX4B 1P3JA 4ZIRB 3EWAA 2IS1A 2Q9AA 2QTVB 1QVAA 2AFHE 2DY1A 1DAKA 1J7KA 2J3EA 3FB4A 2V1UA 5EZ6B 2G9NA 1XTQA 3G5UA 4II7A 4LV8B 4M22A 3JZMA 4QGGA 1OIVA 1IONA 4FCVA 2ZI6A 2O0KA 3U2QA 3CH4B 4DDUA 2F55A 4L8GA 4PC1A 3T5GA 2CE2X 5K8LA 1CKEA 1W5TA 4EUNA 4KSCA 1F2TB 2QMEA 1TUIA 2NO9A 4OJQA 5F9HA 4B73A 2YWFA 3EZ6A 3BE4A 3K0FA 4ARZA 3W6PA 3U7GA 2R6FA 3TQCA 3EIQA 2QT0A 3BIFA 4FIDA 3THWA 2XB4A 1OHHD 3U3RA 2RH5A 3ZD7A 1F2TA 1Y63A 3A6PC 4M9XA 5E7IA 2IHYA 4GP7A 2O8BA 1N5LA 4ZKEA 1XMJA 2CE7A 3SZRA 5H70A 1W4CA 2P6NA 2OLJA 3LQQA 5BWMA 3FHCB 3T5DA 5IF9A 4M0LA 4MGKR 5GJCA 1VCOA 2ZE8A 4Z51A 5KO2A 1FTNA 2ZUDA 4M9SA 4BFTA 4TL7A 4ARZB 5JRJA 1ZC4A 2QU8A 2VTKA 1RRPA 2WJVA 1M34E 3FMFA 4B43A 3GLGE 1LW7A 4DDVA 1RIFA 2QP9X 2ANBA 1TEVA 1EK0A 2EW1A 4NYMR 4DLSA 1SVSA 5B64A 4F92B 1U8AA 4IEIA 3ZQJA 1QG4A 8OHMA 2GTPA 3OE7D 5AJWA 2FFQA 3M0EA 2W6JD 3D7MA 3NTUA 4LZZA 2F1IA 4KXFB 4MUBA 2VP0A 1W4RA 2W2VA 1G20E 2B6HA 2ZRGA 2AXNA 1NVVQ 1G18A 2X2EA 4QM6A 5H68A 5B2ZA 1J99A 4DLXA 4C7OB 1CJUC 4DHEA 4HZUA 1DS6A 3WYAA 3T34A 3C5HA 3VR6A 3KZ1E 4LJYA 5BYJA 5DN6A 1NVWQ 4UKDA 1R5BA 2RGNA 4NCHA 3H0KA 4AYTA 1E2DA 1GOTA 2GBLA 2ZR7A 3GLFA 5E95A 4Q4JB 4UNQA 1E3MA 4PANA 4Q1BA 1SVIA 2OFWA 2P3SA 3LXXA 3CM0A 4ESVA 2HYIC 3E70C 4HAYA 1XCGB 1SXJB 2CCGA 4FMCF 4QJ4A 4YQFA 2G1KA 5L3QB 5JCPA 1DPFA 4MKFA 2CJWA 1PZNA 1VYUA 2DWOA 5AR1A 4EPVA 2D2FA 3OZXA 2QAGA 2AN9A 4AG6A 2C5LA 1KO4A 2ZI5A 3QG1A 4X8MA 5BQ5A 4EPRA 3ZS9A 3RLFA 1DTSA 4OHYA 4KHZA 1COWA 1LTQA 3K09C 1KO8A 4PHFA 5BW8A 2ZRAA 1CF4A 2K5UA 3F0TA 2EFCB 3AVOA 4JBYA 2WVJA 3RANA 3PXGA 3GLGA 1NBMA 4YXWA 2C9CA 5DE3A 4DRZA 1P9WA 3K0CC 3T1VA 2REBA 2HLDD 4C3ZA 1F6BA 1R4AA 4RD2A 1N0UA 2FWRA 4ZDIA 4IVRA 3FHTA 5KNCA 1WP9A 2PMDA 2FSGA 1XMSA 1P4SA 1WQ1R 2VSOA 1QHHB 2ZREA 1Q3HA 3ASZA 3ZLJA 1IQPA 4PPGA 1EG7A 4HI0E 1NVUQ 2IYVA 3QVVA 4PAMA 3A1SA 2CL7X 1E79D 3NXSA 5CK4A 2BBSA 2ZJ8A 4HLDA 5C4GB 4RZXA 5FTLA 4A92A 1B23P 4NU0A 5DLQC 1RRGA 4A8JC 1T8UA 3L43A 2QN6A 2QZ4A 2WWGA 2E87A 2HCBA 1VKJA 3KKNA 1LS6A 3PUZA 5KNBA 2BJVA 2CNWD 1QHXA 4DVGA 5L3QA 3GLGB 1CU1A 2ZRKA 5CJ2A 1M1YE 1Z47A 1G41A 1EESA 2BWJA 1RJ9A 1TTTA 4LHWA 3LFUA 2O8CA 1JQLB 2WOOA 1T0HB 5HTKA 1NVXQ 4FWIB 2JCSA 1M8PA 1D2EA 2JLUA 3P4XA 3X1WA 1TAGA 4L9WA 1GWNA 3K0FB 4OHXA 2O52A 3CZPA 5JMTA 2AWOA 2AWNA 2QTHA 3FGNA 4MRPA 4S2EA 4BLQA 1TF5A 2IXEA 2ZETA 1J8MF 3D6TB 3KTAB 4BFUA 4LJAA 4CT4B 1DBSA 3CF2A 2Z6VA 4HAUA 4OI0A 3GJ8A 2N1BA 3OAAD 4LPSA 3W8RA 1DG1G 3OEHA 1ZCBA 4K46A 4MRNA 4Q7KA 3RRYA 4E03A 1XP8A 4QG7A 4BLPA 1AS0A 3J81k 4NYMQ 3RHFA 4HLUA 5FTMA 1MO6A 1AKEA 1YJ5A 4PC2A 4CW7A 4MYTA 1QRAA 3BOSA 4KBGA 1WB9A 3IBYA 4YDHB 4WZAE 4Q4AA 1N6OA 1QHNA 3IHWA 4K8OA 3P32A 1KK3A 4IJMA 2DWPA 2V1XA 2RAPA 4Q4HB 5FTJA 1GL7A 1KMQA 3K70B 3L8YA 2G83A 2ZRCA 1N2CE 2J45A 4NKRA 1AKYA 1T8TA 3B78A 1U94A 3AKYA 4BZXA 3CPJB 3WHKA 2WPDD 5E7JA 1U99A 4B2PA 1BIFA 3TH5A 4HATA 1RVDA 1U8ZA 1Z0AA 1E0KA 1KDTA 1IJFA 2ZYTX 3GCGA 3GP8A 2HXSA 3MMPA 4TN1A 3UG6A 4DLZA 721PA 1P6XA 3TSZA 2AFIE 1ANKA 2L0XA 2FN4A 1R10A 1QF9A 1G1MA 4LC0A 2AKAB 3BFXA 1HA3A 4H1UA 5SZKB 2UZIR 4B48A 1KZ7B 1XMVA 3R8CA 1Z22A 1KOFA 4LBVA 4EPWA 4EKDA 1ZU5A 3AF1A 2C96A 5AUQA 2ZS7A 4B33A 2C04A 1JB1A 3NG1A 1OIXA 4LJ8A 1U0LA 4G5RA 5CJPA 1H8EA 4QBHA 4QNRA 3QSYA 4FCWA 1II9A 1I4TD 1XZQA 1YHNA 4Q1EA 3T1QA 1CULC 2FGKA 3TLXA 2FG5A 1VCIA 4K81B 4BPBA 1P2TA 3LV8A 2V8OA 4XJXA 2RCNA 3W90A 1KI3A 1ZRHA 3GEIA 3HP1A 2MSCB 1EX6A 4ZDWA 3OFND 2AD5A 5D3QA 4EFMA 2QI9C 3LNCA 3K8YA 1BOFA 1XNJA 1SVOA 3GJ0A 4N1AA 3O8CA 4Q7MB 1QHYA 2ZQ5A 4GDFA 3KB2A 1E2EA 1LF0A 1ZUNB 1UBGA 5HR5A 2I3BA 4A8JB 1MO5A 4LHVA 4B2LA 2IF0A 3P26A 3N2EA 3DHWC 4B75A 1OSNA 1ZCAA 5ANRB 3MJHA 1SVKA 1NSTA 1YZTA 4QGHA 5JJKA 1E69A 2VA8A 1XD9A 3A1VA 2OCPA 3TVDA 1E9DA 3Q5EA 4CIDA 1JXOA 3ZZUA 2XEXA 4HAXA 5KU1A 2AL7A 2BKEA 4D0LB 2G0NA 2NO0A 1KJWA 3MLEA 2W58A 5IK2D 2ORIA 2VHUA 1EFTA 4TZ6A 1N6KA 4BFVA 3NBFA 4EAQA 4LCBA 1BO6A 1F3OA 2A5DA 2FE4A 3FWYA 4CZ2A 4RD4A 3DVLA 1GG2A 2GJ8A 2YOHA 4QL3A 4V03A 4GL2A 1XFAA 1TU4A 1ODFA 3ZVNA 2HV8A 2IL1A 3HR8A 4M1TA 4XVUA 2ZAOA 4Z8XA 2ZM5A 3VNVA 4PSAA 4Q1DA 3GPLA 4Q7LA 2ZSAA 4ZI3A 5EXTA 2ZUBA 2CHGA 2BC9A 2JA1A 4MDFA 2JDID 3PUVA 2HLDA 4JLOA 4A0HA 5DN6D 4US2R 1NKSA 3KKPA 4EFLA 2NZ8A 1CJMA 4DCSA 2OCYC 3RWMB 1O3YA 2OHFA 4AK9A 2LKDA 2WOJA 4YMUA 2J1LA 1P2VA 3C5CA 1GUAA 1Z6AA 1E1RA 3B82A 2ERYA 4PQYA 5LDDC 2JLWA 3QXCA 2QE7D 3OF5A 3NIBA 3B7GA 3DMNA 3TW4A 2YC4C 1E2FA 2VP2A 3GJ4A 1XXHE 2XAUA 4LYFA 4L9SA 3TE6A 2GK7A 4MGIR 3AQ4A 3MWJA 3MG9A 2OCAA 2ZTSA 3LBIA 1ZM9A 3VHLB 1N5JA 2YZ2A 4I1SA 2P6RA 5FOUA 3VX4A 3G0HA 2Q9BA 4BWYA 4P4SA 2PLRA 1E9EA 4ZKDA 4QHSA 4IDNA 3T61A 3EAQA 1U8YA 5JRZA 3CKLA 5LBIA 4CEHB 3FTQA 1G5RA 4FMCB 4O3MA 3GJXC 3T35A 2H1LA 5BN5A 3DOEA 1FMLA 4M9ZA 4B6FA 3UWOA 2PMKA 4B3BA 2CVHA 2J0VA 5FL7A 2SHKA 4R2IA 1UKZA 3RSLA 3NKVA 2WKRA 5FUVA 2QP3A 4DXAA 4Q47A 4KYIB 1MRNA 2RHMA 1S3GA 2P2LA 3B1VA 2QL6A 1H65A 1C1YA 3K9GA 3SJAA 2RB4A 5EP2A 2BBOA 4TYQA 3WMEA 2WWIA 2RGAA 3QKTA 1ZIOA 2QP4A 5L8VA 4F93B 5TVKA 1KY2A 4UNNA 3TUZC 4GI7A 1GDDA 3U7HB 1F2UB 2GHIA 1FP6A 3GJ5A 3EA0A 3NVAA 4PHGA 1D5CA 4MQBA 2WWXA 1KO1A 4C0SA 1CIPA 2YJTD 2YV5A 5GJWC 5IDVA 1ZD8A 4OHZA 4LPKA 1P9RA 3SDZA 3DKVA 2ZJYA 5G40A 1WDTA 1DEKA 2IEYA 2YHSA 2XJ4A 3E2IA 1KI4A 1VG8A 3C4JA 4RJLA 4KV9A 3C7KA 2PX0A 2QRNA 3AGQA 1Z5ZA 1US8A 2F43B 2W83A 4D4JA 4TL6A 1G3UA 1L2TA 4D0NA 5F9FA 4YMWA 1PUIA 5FPHA 4E09A 2ODEA 1P60A 3JVVA 3ZQ6A 3EX7C 2GVZC 1XXHB 4WA7A 3K0SA 1D2NA 1XEWY 4XTCS 4TZ0A 1YVDA 4DJTA 1EX7A 3OEED 4A4DA 1MABB 4DC9A 2V3CC 4TYWA 4LI0A 4YC7A 1S2MA 3P4YA 4R7ZA 3PVSA 2C77A 1K8RA 1YZNA 1JNYA 4HUQA 1G7CA 3BXZA 1OFTA 1Z83A 2FF7A 3B2EA 1ZC3A 2CVFA 3WYGA 4JSYA 3MRSA 1RJ9B 1ZINA 2J0UA 5HKKA 1KMHB 4BEJA 2PEZA 3WP1B 3FMOB 2IYSA 2WSMA 4URUR 4V0NA 4Q9LA 2QTFA 1IAQA 1A82A 4GOXA 1GILA 4LDJA 4LK2A 2OBLA 4OBEA 1Q3TA 4PO1A 4OK3A 1XRJA 4Z1MA 4C0AC 3DEFA 3GFPA 4RD3A 4YMSA 4C0QC 5K8IA 4C2TA 5J5CA 2ZRIA 2Z83A 4IRUB 1NL3A 2D2EA 2FZLA 2ZRMA 4KVGA 3H84A 2IXGA 5G3ZA 4KLNA 4LJ6A 4TLDA 1ZIPA 1UBEA 3KXKA 3B1WA 5CLQA 4OQNA 3X1DA 1AN0A 4TTRA 4FXPA 3NDBB 1JECA 3KKMA 1II0A 3B85A 4D81A 3GEEA 3CUEF 1R7RA 2ZYVX 1ZBDA 3FHOA 4IVQA 1OE0A 2ZAMA 4DCVA 1P72A 1AM4D 2ZANA 4Q1CA 5JEDA 1YU9A 3RVBA 5FOSA 1P5ZB 1G3MA 4U5XA 3S1AA 1NN1A 1XTIA 3L0IB 1GZSA 4V0MA 2NO7A 1JEDA 1ZM7A 4PZZA 4G3XA 2KI5A 1Z0IA 4BFYA 2NOAA 2VBCA 1YZUA 3K9HA 3THYA 3C8UA 2KWIA 4I1VA 3Q85A 2EQBA 5GVRA 4I99A 1SXJA 2AHOA 4RKEA 4LHZA 4TSFD 1R0YA 4LBYA 2GZAA 4PR0A 4UJ3A 4QC2A 2CEAA 1KJZA 1L4UA 3KL4A 4JVMA 2OCBA 3HU2A 1JXMA 3SYLA 4D4KA 2ZSFA 2H7VA 2A5JA 4WBSA 3NBXX 3N70A 4HLUC 1XD8A 2Q9CA 2V54A 3TW8B 1LB1B 1HH4A 2NO1A 2Z43A 4IOMA 2PT5A 4F4IA 1W7AA 4TQUS 1W36B 5CYOA 2FFBA 4JIMA 1CEEA 1SGWA 4EJSA 2ZVQX 3CPHA 4FN5A 4TMWA 2ZRPA 2ZSEA 1XJ0A 4C0LA 2ZJBA 1Y3AA 4P33A 5KHOC 1MV5A 1G4AE 2ZE7A 5JZVA 1BH2A 3IEUA 4ILEA 1N0VC 2PZFA 4R9UC 5F98A 2CCJA 4AURA 4N0EA 1ZD1A 1OFUX 4B71A 2QY9A 3H2YA 1II8A 2D3WA 3KX2A 4M21A 4XOIA 3SBEA 1G8FA 3AVQA 3WNDA 2C2HA 3W5JA 3VAAA 1E2MA 3A1WA 1FPMA 1H8HD 4AI6A 4E5UA 1U2RA 2ZJZA 4ZDJA 1US8B 3MD0A 3EPKA 4LV6A 1IXSB 4ZPXA 2OBNA 3CWQA 3QF4B 4XWOA 2QSYA 1GRNA 2F1JA 3SHWA 2GXAA 2PX3A 2N42A 3BS4A 4OQFA 5JBQA 4US1R 1XTKA 3IPYA 1PLKA 3CRMA 3LBNA 4NYIR 3QI2A 4NP6A 3SC3A 2GCOB 1Z6GA 5LPNA 1TEXA 3LLMA 2D06A 5AJZA 1G19A 2PCJA 5EZ5A 2C9YA 3CRW1 2NZJA 3PR1A 4RY2A 2CCKA 1N6IA 3VQTA 3LH5A 1E4YA 1X1SA 1ZNXA 1F2UA 4GP6A 4ZO4A 2IYUA 1TQ4A 2GETA 4DSUA 2GK6A 1E96A 3WHLA 2NGRA 1R0WA 2LKCA 3KFVA 2VF8A 4B3DA 3MWYW 3CRRA 3BB1A 4DDTA 1GKUB 2CMKA 2IYRA 3UXMA 2EWVA 3C41J 1VIYA 3ONWA 1XBTA 1XJCA 2PEYA 1KSJA 2ATVA 3O47A 1XTJA 2ZUCA 1Z6TA 3NBYC 4HB4A 2ZJOA 3SN6A 1OXSC 2E1RA 4FINA 3KDSE 1F48A 1E9AA 3CRQA 2X2FA 3LX8A 2JATA 1CJVC 4A82A 4JYCA 1D2MA 4P3YA 1OLOA 3AH8A 4HLQB 1XEXB 3REGA 1TMKA 2FNAA 1E98A 2QMHA 3UMRA 4BLRA 2WMOB 3QF7A 1T91A 4B47A 4B6EA 4D4LA 4RD6A 4GOJA 3MGCA 1TL7C 3QPVA 5HCNA 3TGPA 2YWHA 1OXUA 4M8NE 3WY9A 4R2HA 5FBWB 2PZEA 2IF2A 4UNRA 4BRUA 2C9OA 1ZNZA 2A5FA 3KJEA 3S1AB 3RRMA 2ZRJA 1E0SA 5DO9A 1DG3A 5DH9A 1I4LD 5CM9C 1UFQA 1X8JA 4LWZA 5IT5A 5J4KA 1G9XA 4G5OA 3NH6A 3BJIC 2Q6TA 1EFUA 2XNDD 2JGNA 1XEWX 3CO5A 2CK3A 3F3YA 4GOKA 4HB3A 3T12A 3U7EB 2FA9A 4MKHA 1YZLA 1YE8A 1ZAKA 2UVQA 1NIPA 4AG5A 3LD9A
chains in the Genus database with same CATH superfamily
4RY0A 1UEIA 4CTMA 3N3AC 1DOHA 3R7DA 2VDVE 3PF9A 4PWYA 2ZJ5A 5K0JA 4HWOA 1AXEA 4XSHA 5DLPA 1CT9A 2ZZNA 2PT9A 2O2CA 5AKYA 1ISIA 3UANA 2IHBA 3BXFA 2F3TA 5LD2B 4PQFA 3TJZA 3B1XA 2DT8A 1BGVA 2QEQA 3FNRA 3QFFA 4KN5A 1PR4A 5FYDA 1QLHA 3ET5A 3LY5A 3ID6C 3VC2A 1SQ6A 1NF9A 3BIJA 5AW4A 3HJUA 5HCIA 5TC4A 5F1KA 1TJPB 2G0TA 2VRCA 2YNMA 4WKBA 3U4QA 4DJ5X 2QA5A 1S2OA 4IIXA 2JJ2D 5J9FA 4AJ1A 5BSTA 2JW5A 4HTAA 4EI7A 4Q00A 1T8SA 2YOFA 2ZW9A 2DJ5A 4FDVA 4GL4A 1EFDN 2WHPA 1R1DA 3HP4A 3UO8B 2C7OA 4N48A 4HWTA 2F1HA 3KT8A 3Q1LA 3M4XA 1ULBA 2IYYA 1FP1D 2GWHA 2NU9A 3ZWWA 5LIRA 3DLHA 4RJKA 3D31A 4EQZA 1Y34E 1M2KA 5J2TB 1GYQA 1VHDA 1W0KA 1IN7A 1W73A 3HB4X 4U9HS 3KIPA 4HVTA 4IHQA 2XWQA 4RH3A 2F1RA 3T5TA 1IH8A 3JD0A 3RI3A 3PEEA 3UF0A 3W7AA 3NS7A 2ZM6B 1RADA 2FEKA 5F77A 2ORYA 3TLJA 1T9HA 2P67A 1XZMA 2D1FA 4FXOA 2FKAA 3HEMA 5G53C 3ZDXB 4OIMA 5IKMA 3UATA 1EP3B 3WBKA 4XUCA 3V1YA 3S5JA 3H11B 2ZRBA 4EM6A 4FDTA 4KI0A 4WINA 1Q91A 4OMUA 4XCVA 5E9JA 1OU0A 2GK3A 1AG9A 4N12A 4RMIA 1J23A 1USKA 5TGTA 3U13A 3VH4A 3TIIA 4ARSA 2IDKA 5BN4A 3N0XA 1IEQA 2XKJE 2P91A 2H2FA 4LXTA 4KFCA 4BO4A 4RCZA 5L7WA 2G9ZA 5CB8A 5HPYB 5LWQA 4KKXB 4UTRA 4EW6A 2FLKA 4D1YA 1TKCA 1PLJA 4PG8A 3E7XA 5JCOA 3VYTB 4BOYA 3ZWPA 5KTNA 3OURA 2E4XA 3IKVA 4ZAGA 3H5TA 3UHPA 1CUWA 1NFQA 4L16A 5C8YF 1P9NA 4Y1EA 1JEYB 1OX6A 5K0CA 1QU3A 1VJCA 1JFLA 2WYHA 4TL9A 4HNAA 2AG8A 1OYWA 1MPXA 2XCLA 2IXDA 3L40A 2DVMA 4GYKA 4HDNA 3IDQA 3N86A 1EZZA 3DGFC 5AJVB 3DLAA 1VIVA 2BM0A 3IAM1 3QXSA 4IHAA 2Y1FA 1HDEA 4ZCSA 1M6HA 1QG6A 3GZTB 3K0CA 1HMPA 4HWSA 4ND7A 3TYXA 5AOAA 1BW9B 2ZXEA 4KQ1A 1TT5B 2ZEJA 1TIBA 2VZ0A 5EJAA 4AYXA 1ID1A 3C74A 3R8FA 2XXAB 3UGTA 3RREA 3UAVA 1UODA 5D3MB 1NJ2A 3AFHA 1E0JA 2IUYA 1Y1KE 3DF9A 5DULA 2ZE5A 2OCLA 3AUXA 3CLTC 3FIJA 4NQRA 5CTAA 3VZDA 2JEYA 4GBGA 1R8SA 3VR4A 4QT0A 3EQ8A 2IHJA 5C1PA 5F7OA 2V5VA 4DIFA 1G21E 3HM9A 2VYND 1EB9A 5T64A 3ZJYA 1ONOA 1HV8A 1RI1A 1KVUA 3OVMA 4PC7A 4F96A 2DC1A 2IEIA 3CNNA 4G9EA 1M1YB 2GBFA 1VI6A 2IZ7A 3JQRA 4QUJA 4E46A 2LWIA 2PT6A 2VNHA 4MVJI 5CB4F 1SHKA 5BOVA 5IAJA 3RABA 4CWAA 4HNTA 5ISMA 4BCBA 4CUZA 5JJLA 3T4EA 4PG5A 3W2HA 3BCUA 3RRFA 4CHTA 1NXXA 4B3CA 4WHMA 5EJ4A 3U9SA 2JLVA 2IUTA 3NCTA 4P4TA 4YBRA 1EQUA 2Y2UA 3JPYA 4CF4A 3NV9A 3MUOA 5JSYA 2O57A 3RBXA 3V4RA 4DM7A 3GBVA 4QBKA 1XKTA 3GLIA 1N77A 1B93A 4OAOA 3AJRA 2XUOA 4I9NA 2LRHA 4TYPA 5FPYA 3CVUA 2OFOA 4ZA2A 3AJDA 4GEGA 2E4ZA 3DCYA 4IIBA 2Z8YA 1FX0A 2EQAA 2P1DA 4TKVB 4TM7A 2CFOA 1QRUA 4P8RA 1LTHR 3AP1A 3ISTA 3K9NA 4P54A 1I10A 4PFJA 6Q21A 3HCAA 4LYEA 5ILQA 4Z0TA 4Q48A 5HFAA 5LJIA 2W11A 1GU0A 1QRTA 3GUHA 1E99A 3EGDA 4C89A 4N01A 3ICEA 1YRQA 1U7DA 3EQ2A 2RGUA 2XA9A 4HDNB 4H4DA 4LTMA 3PV0A 4LZAA 5AOBA 5F5LA 3UHJA 3ZZTA 4CM5A 2XQFA 1MB2A 1XZBA 2JJ1D 3QFTA 1LUAA 1N2JA 2JNWA 5G0VA 4AG3A 4OHRA 5KX5F 3GBPA 4RXUA 1SY7A 1M2NA 5JZOA 3DE0X 3IDOA 3JQEA 1RHQA 3B7PA 1P5FA 3PDJA 4NNJA 1RZRA 3IOYA 3PNMA 1MP0A 2NT3A 1U4SA 1VPEA 2GBCA 3HYCA 4W8HA 3P0HA 5IBPA 4D9MA 1O89A 3GT4A 2A1TR 4L9AA 4PZ9A 3Q40A 1NBHA 1A9YA 4DC1A 3D6UA 2I66A 4HDOB 3LDFA 5HS4A 1JT2A 1L5HB 3KXLA 3RUCA 4F4CA 3QELA 1H9BA 2ZYAA 3WXMA 3AUFA 3C14C 1G21B 2EL7A 1V5FA 1I13A 1ZR2A 5HEKA 3F6CA 1AKUA 3GCDA 2AYXA 2JANA 1IOLA 3BWEA 3N0TA 1OH6A 4PX9A 4RK1A 2OK8A 3NHAA 3KKQA 1WB6A 1ZVQA 3SM3A 4ZQCB 3SJZA 4M53A 1JU3A 4EO4A 1P2DA 2LCIA 3ZE1B 2BM9A 1UFOA 3JRNA 1X13A 4FDMA 5KSPA 4W6ZA 4OPMA 4PGHA 3BDIA 5TB5A 2WJJA 1NN0A 1H6AA 1C1DB 1V43A 3GR6A 3LIPA 4MB6A 4DLBA 3UJ7A 4CLXA 1KVTA 1EUDB 4RIHA 4C7VA 1VRWA 1GRRA 4P83A 5LNK1 4RW0A 1U0NA 3EVTA 3DS8A 3F7OA 4FC6A 4PHTA 3WGOA 4EG6A 2G6TA 1YZVA 2GEUA 3ROEA 4D8UA 4TV8A 1GAJA 5JFOA 2NWQA 2QQFA 1M73E 2I55A 2QK4A 3P9KA 1R5JA 1V71A 1JEOA 1VHLA 3JYNA 1RYYA 3NP9A 3R3YA 5TPZA 4EGAA 1D0IA 2C3OA 2GTIA 2HPVA 1I01A 3NIGB 1QBKC 3O1IC 3TAUA 4B2IA 5AM3A 3T5PA 3T41A 1GUBA 1NF2A 2LE0A 3N2LA 1KWKA 2FWMX 5EJ6A 1E89A 2FJPA 1M2JA 1POXA 2CLMB 4JLMA 1MJGM 1JE1A 1XQ1A 3DO5A 4GLJA 4J43A 4HNQA 5J4YA 1CQPA 2F1KA 2EARA 2IUEA 2R6R1 1AGNA 3IDAA 3NHKA 3QVWA 4TWZA 2BEUA 1VC2A 1KNXA 2QD5A 2PM8A 1WB5A 2HREA 2ZJAA 1AU9A 3H2JA 1YR8A 3NALA 4IXWA 1Y7LA 1CY7A 4JJFA 4ESHA 5AW2A 4BLOA 3K9WA 3RU2A 4LJKA 3H0EA 3PK0A 2FXVA 1UADA 3NZEA 1ZNYA 2TYSB 4Z0HO 3FDZB 5TGDA 4C7JA 5INTA 1GA6A 4D0RA 1AUXA 1OW3B 2NQ8A 2DHQA 4BNFA 5BRNA 3KJHA 1KDVA 3OX3A 5HRCA 4YH1A 2IZ6A 3PWTA 1MC4A 2VKTA 1J0XO 1VE9A 4NAUA 1XJQA 1K97A 2CBXA 2XZDA 3OBBA 4RHCA 5DBGA 4IDQA 5G41A 3WGHA 4RJ2A 4L50A 1RRKA 4KH0A 4QULA 5CB6A 4S2UA 1CHNA 4OQ4A 1IUKA 2MMGA 5I6DA 1C7FA 2NAPA 4OQMA 3USZA 4FHCA 5KTSA 3SJUA 3T9EA 2DP4E 2QI9F 2AEEA 4C30A 3HSKA 3OD1A 3RWOA 4YLEA 4Z0PA 4QM7A 4CUKA 1PT9A 4AKEA 5EIBC 3GROA 1HBJA 5LZ5A 3KB1A 2W6IA 1E6LA 5CLHA 4LKOA 5IARA 1XDZA 4EJ2A 3DOIA 1Z68A 1I3KA 2V55B 3H5NA 2H18A 1ENPA 2R751 4BJ1A 5C18A 2F59A 4I6GA 2O8DB 2VJPA 3KC2A 5FFMA 3STTA 1X7GA 4ENTA 1U2TA 1DIOB 4PLGA 4LJRA 2OESA 3JZIA 5AW5A 1LSUA 4U6NA 5LC1A 1AK9A 2EZ9A 3BXPA 4S1PA 3RTGA 4DSTA 2YVKA 2GHRA 3K1ZA 4DUGA 3ZU5A 4RPLA 4KDRA 1UBOS 5DFAA 2APJA 3IIJA 3QOFA 4WJZA 2O8DA 1TFUA 3FX2A 1SRQA 2XUAA 3OFNA 3EGXA 3BE6A 5A4AA 3H4MA 4GBMA 1JHPA 2K2QB 2P77A 2BHRA 1VKHA 3I72A 3UY4A 4DC0A 2QX9A 1GAQA 3WB0A 3TLAA 5H16A 3L8ZA 1XK7A 2WFLB 1Q0ZA 1XVAA 2G4LA 3IULA 3OHSX 1N8SA 4NCIA 2C4UA 2GAAA 3CHYA 3NTRA 2AG6A 3FRJA 1TW2A 4ZODA 3EIWA 1A1VA 1QP4A 4OLBA 2D2IA 3DDCA 4Q9NA 3RT7A 2GD0A 3H8JA 2A1TS 4CEJB 1Q20A 1XWFA 2YWRA 4PLHA 2FDRA 3DDWA 5JC1A 4ON9A 4KR3A 3TTUA 1R6VA 3WGGA 3PQ2A 5JWRA 1TK3A 4LTDA 1FUYB 1NA5A 1O94C 5CD1A 2OHHA 1G3QA 3S8MA 4KIUA 2V6BA 4EUEA 1H2ZA 2EW2A 4UCXA 2XKKA 5KDLA 2LXNA 2QLLA 4A2CA 4PC3A 1IZZA 1NT4A 1XF9A 3INGA 1FNDA 4Y1GA 1HE3A 2CLHB 3QOWA 4HBGA 4J8PA 4WCVA 3MF4A 3ZGVA 2PSHA 1T0JB 4BGEA 4DLYA 1UOOA 2Y76A 5E4YA 2GN0A 2G76A 2WKQA 1PJ8A 5T3YA 1U2QA 2P2YA 4R7TA 3UA4A 1P8JA 2WY2D 4FKBA 4D4GA 2WD7A 4X90A 1CUSA 1ZEMA 4OSEA 3ZNOA 3QVUA 3WFJA 3D3QA 3REQA 3OI7A 4JVLA 3RRNA 4BNDA 4B9EA 3UIEA 3LY9A 2ZROA 1NY5A 1U2SA 1K3FA 1W36D 1MXHA 1S89A 1ZJ5A 3U61B 2B1GA 2ONYA 3JQAA 4MRMB 3ZY4A 5BR1A 4O0LA 4ACBA 4HV4A 3D9QX 5IWCA 5IZ4A 1Z2OX 4MI1A 4G0XA 4D4MA 4UU1A 4MKZA 5FUYA 5LQAA 4Z4FA 4EG3A 2XQIA 3ADCA 4PEVA 2PMBA 4YT2A 3DUFA 4G0QA 3D8TA 4JUCA 3LVBA 2WJWA 1MO3A 3AG6A 3P0JA 3Q15C 2JLCA 2HBYA 4D97A 4OTZA 3AP3A 3F1LA 3N53A 4F91B 3HJAA 5FNVB 4GM0A 3TDMA 4N0DA 5LFAA 4RTRA 1DCTA 1DEAA 1DFGA 1R00A 1ZXLA 2GJKA 2PTHA 2QNIA 1OXXK 2WILA 3P52A 1CF2O 3O0DA 2YJ5A 4M2LA 4ND8B 4WBXC 3GX1A 4QJ3A 1EJBA 4BO1A 1ZI6A 4Z7NB 3OJOA 2HPAA 5I7WA 1O95D 2NSJA 2XDWA 2XUKA 4G2TA 4HMQA 4L85A 3ZN2A 1Y4DE 2FFAA 1GPLA 1LDYA 1ZLYA 4MV8A 3DLCA 1SXJE 3KT3A 1KBZA 4XVRA 1W4BA 2IOQA 1E7WA 5ENDA 4KIFA 2J41A 1YB4A 4F11A 5JUWA 1UBTS 2QN1A 3G82C 3HACA 3IILA 1J5PA 2R8EA 3IOBA 4JT4A 3PC8C 4UAUA 4KXYA 1Z88A 4PO8A 3WV5A 3JAWA 1CEYA 5DV9A 3E6AA 3E9MA 2Y77A 1YBAA 4FJ0A 4ME6A 1SM4A 4RWZA 4WOPA 3U81A 2G8NA 1ZN7A 4H08A 3AUJB 1UDWA 5GGYA 3T3MB 1DELA 1J7JA 1GRQA 2I2XB 2OTCA 1BZYA 2B36A 3DTYA 1GSIA 2C7GA 3VVBA 1B1CA 4FNMA 4RJJA 5HHTA 4E12A 3FDJA 5ADHA 4N0MA 1AMNA 2BMJA 3IAM6 4R7GA 1M6NA 3DT6A 5C1BA 1G0NA 5A0VA 2PGJA 3EVNA 1RI4A 4FBLA 4Z0NA 5E3HA 3KHUA 2FFHA 5GZ6A 2ZDQA 4EHKA 3KVYA 2QX7A 2FPGB 3CRVA 4DIMA 4OF4A 4PIMA 3AV3A 4HTFB 3CLSC 3VKGA 1THTA 4C3VA 1YDEA 1X15A 2JIMA 1HLGA 1TYEB 1NW3A 4EW1A 5B2EA 1X7WA 4BZQA 1X70A 2ILVA 1TCVA 1NMYA 1JQDA 1NYTA 2FZEA 3QBVA 4QTZA 5C37A 1ST2A 2HJHA 4NBNA 1M6YA 3JVEA 3HMKA 5EXDA 3CGWA 4M1SA 4ZN6A 4HZIA 5KKNB 1Z15A 3E18A 3KB8A 3EUEA 2PV7A 2FRVA 3ZNNA 2C78A 3O03A 4G5SA 3M9LA 1KKUA 1ESDA 4NV1A 3O4FA 1NJFA 3VNBA 1KPHA 3P9QA 1YNOA 3E7PA 3I6YA 3HDVA 5A2GA 3EMDA 3KQMA 3EC2A 4FYJA 2AD1A 4FMBB 3PC2A 4IIJA 2JI9A 3PWKA 3U17A 2R2AA 4O08A 4ZVOA 2PGXA 1UKBA 3V42A 2ZS8A 1ZL2A 3U3ZA 5CLFA 1THZA 2FR8A 4ZJYA 4ETNA 5AVXA 1Z0DA 1KERA 2GJ9A 2YASA 4P0TA 5CLLA 4KB5A 5EIFA 5K6AC 2EYUA 4DMCA 3S1SA 1B7GO 3ZDCA 1GLGA 3PHHA 3QEMB 2C07A 1Z29A 4O4HB 8ADHA 3ZZ0A 1GNTA 2H51A 3TD9A 2RG7A 3FVRA 3BAFA 2DWQA 4QO8A 1YJ8A 3TKLA 1HE8B 3X1XA 2OHGA 2O54A 1TADA 3PITA 1ODSA 4FQ5A 1F17A 3FBTA 3MW8A 4ISCA 3TBKA 3HY3A 2PGNA 2I99A 4PNHA 2YWGA 1SOVA 4Q37A 2OMKA 1YL6A 4J0FA 3UK6A 5EY5B 5BQFA 1IK4A 1Z75A 4L3OA 4RCYA 1Z74A 1WF3A 3QEMA 3R0QA 4I5GA 2CZCA 3PQCA 4RH0A 5CX1B 4AU1A 4BV3A 4I8XA 1IFXA 3R6DA 1HK7A 4R5HA 3KTAA 3L7CA 2Q0QA 2CMDA 1AK2A 3EC1A 4IGFA 3GPDG 2WMYA 4C20A 3KQWA 1E5LA 1K6JA 2W2TA 1KJNA 1FS4A 4YJ2F 2C2OA 4JZKA 2CZGA 2NZ2A 3MC1A 4G1VA 4L5BA 4F9TA 2W2XA 4U02A 3R20A 4QDZA 4HL6A 4Q3LA 1CUJA 3ZCRA 2ZBEA 2F3PA 1CUHA 1N57A 1G2OA 2PUJA 3WLIA 2Y1XA 1IQ0A 4PV7A 2NTVA 2YDYA 4LVOA 1GXSA 4WKOA 2DT5A 4DA6A 3KO8A 3KP1A 2J07A 4BYGA 1AMOA 2XIQA 4BFZA 2YY5A 2XSZD 3NFYA 4RDIA 4C4AA 3ZBTA 2P75A 2OHIA 4RESA 4DSZA 5EJ2A 1B16A 5JY1A 2Y0EA 1PL0A 3AR9A 4M0CA 1WIWA 2WIJA 3NAMA 3L8EA 3MM4A 1KSFX 2BFNA 1E6MA 4WQMA 3THWB 4IM7A 2GKSA 4DKXA 1D6SA 1EVIA 2DTXA 4Z6KA 4XSVA 4QBGB 4Y2XA 1RLUA 2Q4DA 1PYDA 4Q3KA 2KSQA 2BEVB 3AJ8A 1CUBA 1T1RA 2D5LA 3BRWD 1DAEA 3GELA 3I04M 4N8DA 4NZYA 4QVKA 3SF8A 4C78A 4DARA 5LQJA 2CV0A 5ESWA 1PV1A 5KIAA 4X7MA 2HADA 4ZICA 5MGBA 2FKNA 4KBYA 3RTCA 3ETJA 3NUGA 3WA7A 2EFHB 3K1AA 1D4ZA 2HJRA 1RRMA 4CV2A 3QU7A 5KPJA 1BDHA 3HSSA 1T2UA 4O4JB 1W0JD 3LSYA 4Q7JB 1FOEB 1U0EA 1QCDA 3G1UA 5TS3A 2C03A 4PBSA 3ELUA 4JOQA 3G3EA 1WD7A 5DNEA 5TQJA 3ZD8A 1KEZA 5LOVA 4U7PB 5L6LB 4A2PA 2JI7A 3BK1A 1WXDA 4M38A 4PINA 4DA9A 1P0MA 1N3BA 1ZUHA 3ZX4A 1RM5A 2QV0A 4L5YA 5KJEA 2C4TA 2G5CA 1PLLA 4MB2A 5DNYB 3GJ3A 3VC7A 1H2FA 1WU8A 1RXEA 3SY8A 4K9LA 5JHGB 1RAEA 1UDXA 4G5XA 1W49A 3ROMA 3BE5A 1K5HA 3GDFA 4UVGA 4DREA 4KNYA 5E0KB 3WLSA 3LE8A 3VDQA 3OU7A 1LQ2A 5AVKA 4JXZA 3AINA 4FYYA 3AVUA 1CZOA 4NE7A 2C7QA 4OK5A 4GX1A 1UKYA 5FDFA 1AGYA 3EY4A 3CLUD 1GPKA 2A0FA 2FPPA 2HFJA 4FFVA 1KQGA 1W4LA 3GCWA 1LW6E 8GPBA 3NT5A 2DZDA 2XH8A 2L82A 2RKWA 3PXAA 2OPHA 5FBQB 2NXEA 1F6WA 1I4WA 4ZK6A 4JC8A 1SXHA 3DNMA 2QAGB 4FR2A 3C70A 3GRAA 1DC5A 4RA9B 5JADA 2BGJA 3JR3A 3ECAA 5BXQC 3UMSA 3T1OA 1P2UA 1YQQA 2FPPB 4M0DA 1W46A 1MTZA 1DBPA 3LXRA 2GOYA 4R2MA 4Z49A 1K7YA 1VGVA 4R3UC 5J63A 3DGEC 3NONA 4BO8A 1S02A 2JJ2A 1AA9A 1YJAA 4MUXA 2EQ5A 2MOKA 4LDQA 2O2EA 4NPHA 4LYHA 1UT5A 1UP4A 3ICWA 3DAGA 4EG7A 2FUNB 1EWQA 3GUZA 2J67A 1RCTE 5HIAA 2VOEA 4F45A 1YF3A 4O1HA 4BQIA 1FSZA 4FP9A 1QGOA 1P0QA 1XU4A 2O6LA 3EA5A 3SI7A 1KMIY 1YMQA 4LBZA 4KTTE 2PY6A 5JAZA 4FSDA 4Q9HA 3ZX5A 2AW5A 4GFDA 2XUJA 5JAHA 1VCMA 4HVCA 4OLJA 5EHNA 4C03A 1PJQA 1ARZA 1Z8HA 3EZ9A 4FMPA 2P9FA 1O6FA 3VSEA 3GYBA 1W44A 5JU6A 1PFVA 5EIAA 3ZCUA 4YT8A 1CZLA 4N9WA 1CQJB 2UU9B 1DEOA 4ZOEA 4WX2B 1OFIA 1IOVA 1NKTA 1QFZA 2EERA 3BUSA 3PFWO 3O8QB 4IEFB 2P4UA 2OSBA 1XELA 2O3JA 4P32A 4GC9A 2GERA 1AX9A 2ZAYA 1W47A 4BMVA 1KRWA 5DXJA 3L1VA 1Y8AA 2R25B 3ZJ5A 2GRJA 4H1TA 3D6VA 3W9SA 1S5PA 4NY1A 3RYTC 4BX2A 4RF2A 4V38A 2B92A 3A2MA 4FI3C 4NJMB 2YS6A 3E4CA 2ZB3A 1SXJC 2R4UA 2V5UA 3GIDA 4KNVA 4DDHA 3GEDA 3ZTTA 4UJ5A 3PXCX 3OLQA 4XYEA 1L4NA 1O0BA 1KR5A 5CFMA 1M8JA 4DBZA 4JQYA 2FRDA 2IBMA 3GEPA 4W8GA 3SYTA 4OBXA 5K09A 3GDGA 4J0HA 1ZCZA 1WDMA 2B78A 2VDOB 2QLMA 4MUMA 3ZYCA 4IZOA 4WGGA 1V11A 3P2YA 3PEYA 2Z2IA 4BWVA 3GJZA 3H04A 1V25A 4GYWA 4L72A 2V03A 3R0IA 2R1TB 1C1XA 4MW4A 4X3OA 4MGZR 1WW8A 4Q16A 4CHGA 4Z9BA 2PD4A 3ZGXA 1YKFA 1C7IA 1NFRA 1YB1A 3B3GA 2DHRA 1Q21A 1Q7RA 1YSCA 2OEPA 2YV4A 4LJSA 5ALMA 1KOGA 4MIEA 1A9TA 2O2DA 1HX7A 4GZMA 4YRQA 2GAJA 4IJ5A 3VJLA 5JBIA 5DTQA 3WMGA 4ZAWA 4RYLA 3T9DA 1QH8B 3D4NA 2B82A 2IKQA 1RIIA 1MPTA 5DB4A 5A7HA 3SE0A 4B3XA 1ECFA 2FX2A 2C8LA 3RYCA 4NXNB 4KSBA 4QYWA 2VHTA 1U8TA 2GBLC 4REMA 4A1FA 1G8KA 3ZXIA 5K3FA 1Y0BA 2ZUTA 1M2FA 3GOHA 2DLNA 1G42A 3BF7A 2O2JA 2JFYA 3HYNA 2V8BA 4P08A 2HRQA 2KBEA 1H85A 3C1UA 3DXXA 1UM8A 2VAVA 1U5BB 3C16C 3MTQA 1KF0A 4KX5A 4TT3D 3QNWA 3TVTA 2BFFB 1IC6A 3GCXA 4A03A 4DYHA 3UV7A 1VBKA 2J3KA 1L4EA 2NZYA 1GUDA 1A8PA 3ILVA 1ID8A 5DIFA 2HJVA 3C8HA 2CY0A 4N82A 5FWXA 1VHWA 3O90A 4LBWA 4X93A 4R8VA 3OTOB 2OQRA 4FUQA 4OA5A 5FPQA 3O5AA 1VE7A 3HN6A 4QPDA 3KDAA 5FH9A 2Q45A 1L5OA 5CYGA 1U3CA 1YE3A 3PWSA 4P93A 4Y9DA 4DY4A 1JBKA 2GPYA 2QD2A 4FOOA 5DOZA 4M89A 3CWCA 4GPBA 5DTRA 1TD9A 1ECGA 2VLIA 3QLEA 1VLLA 2OSVA 4KWHA 1QSGA 1YVRA 2ZU0C 1JR3D 4JSRA 4H6XA 4MWGA 4OQYA 4EY8A 4JI0B 5KNCH 2WB4A 1L7AA 3FNBA 3KUDA 4N5HX 3W5IA 5I4BA 4GXQA 1AZSC 1KPIA 1K06A 2B99A 2UZ0A 4LQLA 2OO5A 1C30A 4H9GA 2CNBA 2GN9A 2H7YA 2NO5A 1E6CA 1KZYC 3BJRA 5DISB 5DYGA 1M6EX 3IKLA 1IBLB 3I64A 1I3LA 5BWLA 4R9VA 3A1UA 1GA4A 1RZRD 3ELYA 4TWRA 1BD4A 2JJYA 2ETXA 2RHOA 2ZVDA 1VJRA 5LCXA 1IN8A 4FLMA 3PTZA 4CKZA 3GAMA 3RV3A 3QVLA 2ZFUA 2CNKA 4ASUA 1PK9A 3MT7A 1GVNB 1N5OX 2PD3A 1Q0RA 3KSDO 2QVGA 3SZGA 1E4VA 1EM8B 1NPDA 3E82A 1OVMA 4A16A 1G21A 2M6KA 4UARA 2HKIA 3PI7A 2NU9B 1NFFA 3K5PA 5GQSA 3RIXA 2BUAA 1EK2A 1R4MA 4ZGWA 1XNRB 3RS5A 4QQKA 2CVOA 1REQA 4AS2A 1IQRA 1Y6ZA 1ZQ9A 4OOFA 5C1IA 4DTIA 2EVWX 4PLCA 5IEBA 1VYTA 2BGNA 2QZ9A 1YIDA 5CDTA 1L7RA 4I4TF 3SHQA 2XXJA 4JGGA 1PW5A 2AN4A 2EFEB 4PONA 4WY8A 4QATA 5LOVB 2G77B 2I78A 1X42A 3MA0A 4LOJA 221PA 1ZG3A 2AR0A 3KZKA 3QX9A 5GMOA 3SR4A 3MUNA 2HY7A 4JVSB 1JAIA 2VUSA 5CPFA 2XBMA 5FBKA 1JG3A 3O2QB 2IHZA 5JW6A 3CUYA 3N39C 3LWZA 1NXQA 3UMCA 3V7UA 4ZK2A 2GPNA 4UBOA 2O06A 2RGBA 4L27A 4A5SA 2WTUA 2EAUA 2R47A 5AH0A 3DFUA 4K8RB 4HADA 4MROA 2BGWA 2IIVA 1NQXA 2ZYWX 4DUYB 3GZ4A 4F46A 4IOKA 2WSSD 3I45A 1P7YA 4L15A 4C0BA 4QKQA 3ZDRA 9LDTA 2I6SA 2Z08A 3DEZA 3DVAA 1RMTA 1IY1A 4FTWA 4WCDA 3GY0A 3K0AB 2CNWA 1VIDA 1T3HA 1PIWA 3B6ZA 2RC5A 5FPTA 2ZI4A 4HMOA 5CDFA 1CJTC 4MP6A 1W96A 1S0UA 3V3KA 2FXIA 1BVRA 4A10A 4KRGA 2V6GA 3DH0A 2JI8A 3RYCB 4JEUA 1NULA 4I3GA 1Z4MA 2FH5B 3O1HB 3DLTA 3VNAA 4I4LA 2GN2A 4GU5A 4UFNA 3VH3A 3PC3A 4XD2A 1ZD4A 3OSUA 5L51A 4NHOA 3WADA 2HLPA 4KWCA 2OY0A 1P45A 3QH4A 3DL0A 2UUBB 2W70A 4MDEA 2YXPX 1J8QA 2CNLA 1ORDA 3EJ6A 2Y1EA 2WD7B 3AUSA 5CW2A 2G63A 5KTRA 3LS2A 2G9QA 5EMNA 4C2UA 1QHSA 4JP8A 4YRIA 2GCGA 4RULA 1KZ1A 1JA1A 1D6NA 1JDTA 3NH9A 4U7FA 4BB9A 5J47A 2EHJA 1BRTA 2D1TA 1P2BA 1YA8A 3AKDA 1I36A 1OI2A 1AKWA 1IRIA 3KPJA 4YQZA 3OOSA 1BX0A 2VDRB 2NVBA 5IFKA 2B61A 1WUKS 1R0CA 3S7ZA 4OH1A 4R0MA 4IDFA 1HFKA 4AULA 4RC9A 5K1ZA 5EE0A 5EPEA 1TYCA 3SIRA 1GM5A 1EFKA 4UQOA 4CN9A 1DKOA 3WGVA 1CR4A 1ZMRA 1U8CB 1G8MA 2FEMA 3EZFA 3RVNA 5MN6A 5CDGA 2BKXA 4GGMX 1CR2A 4LSGA 5F33A 2E37A 4X7PA 2HLHA 7MHTA 4KUGA 4G86A 5HX7A 1T3GA 2D1RA 2GEKA 2EKBA 5CM8B 2O1XA 2AFRA 3EYAA 3L7BA 4NZZA 2I33A 2I2WA 3ZKAA 1SJ9A 1J22A 1AY0A 2O2ZA 4LJ4A 4U7WA 4DWJA 4DLUA 2CV2A 5DGHA 3JQ8A 3IPRA 4M8IA 4UVHA 2WFLA 4GX5A 1E32A 1COZA 3OJLA 4Z1MD 3GZNB 3B6EA 3NEAA 1GZHB 1HTWA 3FYHA 1N7GA 2HA4A 3FUTA 3OO0A 3DDUA 4N03A 3ORQA 4ZT4A 1BXZA 5K0FA 3MIIA 3IMGA 4MDYA 4RPGA 4INPA 4NL4H 5E1MA 1QHGA 5CVDA 1VLMA 2O8EA 2C61A 4LGYA 4FD3A 1XZNA 1Z56C 3DMYA 4YACA 4CE6A 1QQBA 5H0IA 1NWCA 2JGDA 1JP7A 3MELA 2VIIA 2G06A 3QPAA 3LDGA 4C6TB 1X9HA 4FOPA 3KETA 4PC6A 4FCCA 1O8BA 4J1NA 2OOSA 1RM3A 3FD8A 3KR1A 4S1OA 3H1AA 3WJ2A 2X8AA 4CPDA 3H2GA 4OHVA 1C9JA 5G4KA 5TPWB 2IXBA 1UXHA 4J3NA 4P4SB 1WNTA 5D8DA 5JDCC 3W5SA 1DT3A 3R6LA 5H9WA 1Y4AE 4L73A 4LE0A 3TOXA 2PBFA 1NLYA 1Y5LA 4PWZA 1A8QA 1UBUS 2VSYA 1MMFB 4LECA 3ZDZB 3NDRA 2C0PA 1WXGA 3SHVA 1A7KA 4JUFA 4X97A 1BN6A 4FFMA 4ATNA 4X61A 1P0PA 2JI6A 3PE3A 4JQSA 3PFHA 1VL8A 4LFBB 4HXFB 1I24A 3DZHA 3I32A 1KO5A 4IJVA 4JBIA 5EYPB 3ZIDA 1W85A 1W5FA 2JC3A 5JVDB 2BF4A 2JGIA 3DXZA 2WM3A 3GDWA 2JGFA 3F4BA 5B1SA 4LOAA 3KQYA 4ND1A 2OAQ1 1ZN9A 4L8FA 2XGOA 2CLLB 1C3LA 1CEQA 1NVDA 3D7KA 3I9OA 4MS3B 1TCUA 5A06A 3L18A 1R6BX 4C0XA 2KM1A 3BXEA 2EWMA 2Q46A 2WZQA 3BZUA 3NQ41 3LKBA 4ILKA 4XIYA 5K05A 4C1NA 2BKUA 2ZU6A 2JGJA 3HADA 4LRWA 1UQUA 4OHFA 3OT5A 3DTNA 4RKYA 3VTKA 1CJSA 2QPAA 2BM8A 2F17A 1WMSA 3C5VA 1N1MA 1V7PC 1YDMA 2EZ8A 2I2CA 3BICA 3MJSA 4OAPA 5A9SA 5JR3A 1P31A 1FX1A 1BGXT 1RI5A 5JZSA 3CXRA 1DC7A 1Y5MA 1Z73A 2VNSA 5TXGA 3KJZA 3UJDA 2J0UB 3GWGA 3P2OA 1J4AA 2NADA 4MDHA 3W2FA 2IX3A 5D5HA 3KOZA 1B6RA 2H29A 3EXG2 4AP9A 3LUCA 4KFRA 3HJNA 4PPFA 2BMEA 5C8ZA 1TCAA 3BPSA 5C32A 2AEJA 3GJTA 4KU4A 2VG8A 5AXAA 2IWRA 2GDJA 4HUJA 1KQPA 2FEPA 3C3KA 1W0KD 3KZOA 1A7JA 4FW8A 5FR2A 4R54A 3MBKA 5BMVF 1SBNE 5JXWA 5KC9A 4I1OA 3WGIA 1JTEA 2PYDA 2DFLA 4WXPA 5THXA 5EXSA 4YJDA 5K3OA 3EXEB 3OKFA 2Q0HA 2XGSA 4JYPA 4D56A 4DKJA 2HA7A 3FR7A 1BCRB 4KPFC 3BK7A 2L42A 4UHKA 3F3KA 2CXTA 3SC4A 4FM9A 2C98A 1P6QA 3NEJA 3IAAA 1M2VA 3AHHA 1INLA 1P4HA 4M36A 2WWFA 4IQ8A 2EYQA 4QQNA 2ZQYA 4J6EA 3A05A 4YO7A 1Q6ZA 1UMCB 5CNIA 2B7CA 4QREA 3LPCA 1JB9A 3PYXA 1NJ8A 3QYAA 4PSUA 2VN8A 2G25A 1SWWA 3F71A 2Z5LA 2QM7A 3R4CA 1E64A 2Q3JA 4GDMA 4PGAA 4QPCA 1PNVA 2VJYA 5ALSA 3KOWA 3A9SA 4ER0A 1AZTA 1LRLA 1UP6A 1DKRA 2VTVA 2ZJ6A 4R1TA 2FG7C 3D0QA 2BMFA 2BW0A 1NAHA 1N6NA 1ZH2A 2FK8A 2PL9A 3OESA 1ZJJA 4JLBA 4UXJA 1VI2A 4HOYA 5DLYA 4BQFA 4KR0A 2ZIGA 4EA8A 1JEAA 3RC1A 4IS3A 2PX6A 4DCTA 1MOQA 4M0EA 3DE3X 4LJ5A 2V7UA 5ENZA 2WJGA 1RRCA 3OT1A 3A0UA 3L4EA 4PQEA 3IDZA 5SY6A 4RAOA 1G8HA 1U81A 3D0KA 4G1EB 4Q9IA 2O8FA 5FL7D 3QBEA 4BNGA 4WL0A 4NMWA 1KTVA 2AI1A 1JE0A 1HR0B 4G37A 4YRNA 4GYJA 5GADl 3FNEA 3TQOA 1JILA 2CWWA 1IWOA 1P77A 1O87A 1EHIA 3KT0A 4HEHA 4NCBA 2E21A 2IHKA 4W4TA 3DZBA 1E61A 3ZVLA 1MRZA 1FX0B 2VH1A 4KH1A 2OV3A 5AM0A 1HZZA 2RHCA 3ZIUA 1JHQA 1W35A 3GRYA 1OHHA 1Z33A 1V1RA 2O4UX 3RC7A 3KPYA 4Q3NA 2XHZA 1JHMA 1Y1TA 4GOLD 4S1TA 3UC5A 2Z58A 5E3JA 3UCXA 2X0RA 4AJKA 1PGJA 1ZBQA 1FJHA 3EIFA 5DYYA 2QR5A 1QDLB 1SCDA 1VA4A 2V59A 1CY2A 1PT7A 1PR1A 3LL4A 2DLDA 5H3LA 3BTOA 4E21A 6REQA 4P34A 4I50B 2BI4A 1EXNA 5ELXA 5KOHA 2SCUA 3IPXA 3VU1A 3PVZA 4I08A 1TPYA 1F9EA 2O5VA 1P7VA 5GIPE 4LZPA 4GNKA 5DTJA 2FI1A 5LJLA 1M10A 1W5SA 2XOXA 5JDCA 3D2AA 3P7MA 3IDSA 4YREA 1RBQA 2WAYA 4S04A 2JFFA 4JHLA 3ZVRA 4AMVA 1OXVA 3DZKA 3HXPA 2HMWA 3H2BA 4NONA 3EIEA 1J90A 3ROQA 2CL6X 1DEHA 2XNSA 3JYHA 4TRRA 4EEKA 4WUTA 2P5SA 5KTTA 4YO8A 3KV3O 3FRIA 1YB5A 4IWYA 4NZMA 4YBZA 4OU5A 4ETMA 3RS4A 3RC8A 1DMRA 4OUKX 3S70A 4BVEA 2WG1A 4Q39A 5JWHA 4NU8X 4CIAA 2NTJA 4Q66C 4KP7A 1KAOA 3SXJA 4F2HA 1V1JA 3DO8A 2BKAA 3GVHA 4FZ5A 4OIFA 2WRZA 1CPYA 3CLRD 2XV1A 1P73A 3MTDA 1PYOA 3PDHA 2HSDA 2WTMA 3RF6A 5IKEA