2E85A

Crystal structure of the hydrogenase 3 maturation protease
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
156
structure length
156
Chain Sequence
ASAVTDVLLCVGNSMMGDDGAGPLLAEKCAAAPKGNWVVIDGGSAPENDIVAIRELRPTRLLIVDATDMGLNPGEIRIIDPDDIAEMFMMTTHNMPLNYLIDQLKEDIGEVIFLGIQPDIVGFYYPMTQPIKDAVETVYQRLEGWEGNGGFAQLAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydrogenase 3 maturation protease
publication title Crystal structure of hydrogenase maturating endopeptidase HycI from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 39
structure length 156
sequence length 156
chains with identical sequence B
ec nomenclature ec 3.4.23.51: HycI peptidase.
pdb deposition date 2007-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01750 HycI Hydrogenase maturation protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HybD-like 2e85A00
3PU6A 1CFZA 1C8BA 2E85A 2I8LA 5IJAA 2KMLA
chains in the Genus database with same CATH superfamily
4AXXA 1SZCA 2IGBA 3ISVA 1NUUA 1VYTA 4JJIA 4N7MA 3L04A 4RTLA 4GVXA 3HKCA 1HM5A 1VBNA 2OHOA 4IUBS 2H6EA 4RJJA 3LY5A 1JV2B 3U3DA 3ZHSA 3ZCVA 3BB3A 1L2TA 3AFIA 3PD1A 1X80A 4GOLD 3ZE0B 4DMMA 4NMLA 4LF7B 1NQWA 2BV3A 2Y1GA 2B78A 4RVGA 3N2YA 2NTJA 1T6ZA 3G5AA 4ENVA 1W87A 3RS0A 3WHKA 4WOPA 4Q9HA 5IFLA 3HRHA 1KI9A 1GGHA 1Z0JA 4R9RA 4NULA 4FB5A 1DKMA 1FFGA 1T9GS 2IU3A 1VOTA 2OD2A 3L0PA 3IT1A 1QC5A 1BHQ1 4L16A 1Q22A 1OYWA 1PFYA 2IHBA 2VYVA 3VR1A 1DAHA 2W90A 3AOGA 1ZOPA 1HOXA 2B3TA 2EDCA 4TLDA 4S2EA 4BNYA 4ZZ1A 4B6SA 4YAIA 5ADUS 4F93B 2PJDA 4N49A 3O8QA 1JIUA 3SGLA 4FW8A 4H6XA 2IH4A 5HJ2A 3AESB 1Q77A 1QMGA 1ZNQO 3BFJA 4K9KA 2RIRA 2J5XA 2BEVA 5IDXA 1P91A 4UBLA 1RLUA 2G63A 2WABA 4IMRA 4BQIA 1T8PA 1CZLA 1ZH0A 1GU1A 3R7WB 4V0OA 3ELDA 1IUOA 2DH6A 1E20A 1U9JA 2FMIA 4NLLA 5EXTA 4ABTA 3P96A 3WZ2A 5FULA 4LF8B 3SEZA 2WG2A 3RDPA 3IP3A 3W8RA 3O3OB 2V7WA 1Z4JA 2PWAA 1HE4A 4FOSA 4PYJA 1W2WB 5H7XA 2XNDD 5AH0A 1MB2A 3EAFA 4IXTA 1E1DA 2J07A 2RCYA 1SVIA 4GW3A 3SLGA 3V2HA 3X1XA 5JY6A 1BW9A 4TMXA 4FT4A 3WBBA 4YXWD 1XJCA 3DT9A 1N6KA 2WU1A 4YLYA 1OC4A 4YMWA 3M89A 3K0CA 2VQFB 3MF4A 1ZD5A 2ZYHA 3DCJA 4LHXA 3FVVA 3KLOA 1J8FA 2IYRA 5FORA 4C05A 1G41A 2FPPA 3ZDRA 1KVQA 3WL5A 2E4ZA 1HYEA 5JLAA 1NY6A 1DTEA 1LK0A 1TLLA 2WHXA 1YTLA 3L7CA 3LQRA 4CMAA 1B93A 4HQNA 4MVXA 3SS9X 2YICA 1NPYA 4JJZA 2O2YA 5KOJB 4DGQA 1RXEA 2V7EA 2G9UA 3LBFA 3NEJA 4BNVA 1VLLA 4WDRA 1P7CA 2OV2A 5K0FA 2WC1A 2Z6UA 3X1YA 4JLWA 4F1WA 3CNHA 3HVHA 5ALHA 2C78A 1TPZA 4CMEA 4ZQFA 4D8VA 1LB1B 4XWGA 2BD0A 1AQ6A 1YZHA 2VP9A 1APBA 1SUWA 3IFSA 4LSGA 2EEPA 3QKUA 3VKHA 1J70A 2IHUA 2A58A 1KJWA 3TCXB 3PDIB 4CBVA 3KSAC 4I8IA 3WO0A 1CY8A 1G8MA 1S8AA 5HE8A 3W4IA 2GPJA 3LQKA 1WXFA 3GLHE 4Q4HA 4P0TA 3MMSA 4G97A 5AP9A 3GQBB 3L7JA 4LHWA 3Q9SA 1G60A 3RAFC 1I4DD 2QUAA 2R8RA 4LWZA 4B3TB 4CXMA 4MV6A 3DE5X 4WFKA 3BE8A 3B2QA 4TTIA 4WGGA 1RAGA 1E9RA 2V54A 2RMKA 2EHDA 1CQPA 2Z1DA 3HVKA 1AA6A 1HOTA 1O97C 1RMTA 2G08A 2GBPA 2Y92A 2VF2A 1Y1QA 1G19A 4LW8A 4I5DA 1N0HA 1WQ1R 1H8EA 1E1QA 3CINA 5H59A 4CKWB 5LKRA 3EH1A 1UEXC 2R5FA 4Q4AA 3ZXXA 2TMDA 2AFVA 3O8OA 4MQEA 5ECYA 1X14A 2B3DA 5GJVC 4IIEA 3HYSA 4NENB 2OR3A 1YMQA 2X3YA 2RHGB 1PR3A 1PU2A 3NOQA 3Q3EA 4RSMA 1SXJD 3LCMA 1YR8A 3OP4A 3BTUA 1X7YB 2VXOA 5E9JA 1ZJWA 5C2JB 5JH7B 1E0SA 1E5QA 5AHXA 2E2WA 1Y6GA 1PR9A 1T3ZA 3QELB 3CTMA 1BMQA 1CQIA 1XZNA 4QG3A 4W4TA 1ESEA 1BC5A 1KXZA 2VWHA 3MMZA 2ECOA 4QFCA 4RPIA 1GCUA 4B8ZA 1GVNB 4MMYB 1C4WA 2WP0A 5JT1A 2FJPA 4JBXA 4PLGA 3WLAA 1WUHS 4KLZA 1ULSA 4KQHA 5BXQC 1JVSA 3ICEA 1PT8A 1VLVA 3ESQA 1E1CB 1HG1A 3VR4D 4NCBA 5DE3A 1KOFA 2HX1A 5FIUA 1N9ZA 5HIMA 1WBDA 2Q27A 3CF4A 2OQRA 1GSAA 3HKEA 3PSHA 4MP8A 4WLNA 3QE0A 2PUAA 5EZ6B 4GLFA 2WTMA 1SEVA 2F43A 1SFRA 2H63A 2WHEA 4D4JA 3ANNA 5C80A 3LY8A 2AC2A 4HS4A 1I4LD 1KS2A 3FB4A 2HAEA 4YV7A 2AS0A 4HPJB 3SKYA 2A3NA 2JFPA 3GLHB 4UARA 2B20A 4I4CA 4OSOA 4AJ9A 5LWHA 2HRRA 2P40A 3I9NA 4AMVA 4DUGD 3HE3A 5I7FA 4NIMA 3T9EA 4F85A 4IGAA 5EEGA 1EP2B 3NHRA 2QYOA 3IRVA 3I4FA 1TW3A 2XWBF 2VT7A 2AMLA 1NKVA 2VJLA 4R0VA 4C0AC 2V4ZA 4XWYA 4KZPA 1A7JA 2IUEA 3GRKA 4RQTA 4GUAA 1S02A 1NJ6A 1T3TA 2OHIA 5D84A 1ZK4A 2PZEA 2Z4SA 3BMOA 4RBNA 4OB7A 4HX2A 4PYNA 3IV6A 1Z37A 3IQHX 1MRZA 4NE7A 1FDRA 4M0DA 4CLHA 1T6NA 4PINA 2G1PA 3SC6A 4TWBA 5COBA 1J49A 2ZREA 2OHJA 1PS9A 3ANTA 1EX6A 4CN9A 2ISSD 2OWEA 4DSTA 4G0NA 1VBKA 1I1QB 1Q14A 1E6CA 2Q9UA 3EYWA 3HO8A 2WPDD 2YZ2A 4F4JA 1SH7A 2IU0A 4FOPA 3LT4A 3EH2A 4R3NA 4FYXA 5DI9A 2ZRDA 4DDTA 2VJMA 1J09A 3X1JA 2AIRA 3U9LA 4AYXA 1L7RA 1EK1A 4KQEA 5HS4A 3QBJA 1P80A 2P4EA 1FE8A 3H1GA 4LHVA 1SKYE 2OFOA 4FE7A 5D3QA 5JNWA 2YQ4A 1BMTA 1ZH6A 3CA8A 3MK31 1SIOA 3OPXA 4I6EA 3RIMA 5JQWA 1Z9BA 3BUSA 4MWGA 3FY4A 5ITVA 4ZQBA 3STUA 4BN5A 3OEWA 2HNAA 1LLQA 3QQ5A 3VYRB 1GOTA 2HK8A 3VDRA 2QW0X 4UNIA 1GFZA 5DYTA 4A5OA 4KN6A 4D43A 3C1UA 1DIOB 5HTOA 4QYXA 4MVYA 3OHSX 3AZQA 3I83A 1SXPA 1YONA 1D6SA 1VE7A 4L9WA 2Y4OA 3A1FA 4RY8A 3GB9A 4X5OA 4KPEC 1KPIA 3MLAA 3THYA 3UMVA 4X7RA 1S6YA 4OCZA 4QRDA 5C5DA 1KYWA 2GK7A 3IBCA 1U5CA 1PK8A 1D03A 4X0EA 1VI2A 3I05A 3KDPA 4URHA 4D92A 3IUPA 1BRMA 2E82A 2VHWA 2D7DA 4MS4A 3ZE6A 3NBQA 5EIHA 3U3MA 3D7MA 1P4RA 2GVNA 3S2ZA 3UK7A 3DOUA 2OK8A 5ILOA 1JHDA 3EXEB 1KYIA 5A3VA 1E5XA 1AURA 1KEZA 2PX5A 4NCIA 3SHVA 3DO6A 5H81A 1JHAA 2CC2A 4F04A 3EF0A 5IYZA 4QLOA 5HFJA 3SLKA 5KDOA 1IJKA 4IFEA 4CODB 2GRAA 1Q92A 1QWOA 3A9WA 3K72B 3GLRA 4REQB 1SKYB 3V00A 5BPHA 1A9RA 3CGWA 1CQJA 3TMKA 2JJQA 1W0CA 1WHTB 2W2NA 3JQ6A 1EUDB 5SY9A 3ZW7A 4ZDWA 3FSEA 1B8OA 1XCLA 1RHRA 1ZK1A 2C2BA 3KPJA 9GPBA 3S3TA 2XXAB 3HI6A 3PGA1 2VIIA 4IJUA 4IL5A 1LI5A 2QQ5A 4ZREA 3T3NA 1JJFA 1KMMA 5JAUA 4CR6A 1U1EA 3C8HA 5B1IA 3W3AA 1M72A 1ZKDA 3MTDA 4ACBA 1HURA 4HP8A 1UOQA 1CDZA 1FLDA 2RH4A 4KH0A 1CY0A 4JJAA 1Y33E 1YNSA 3WGUA 2J87A 2HYDA 4XR4A 4YJFB 1T2UA 4MVJA 4NU5A 1NNEA 4HRXA 2RHDA 4M9SA 2AEFA 4HJRA 1XKTA 4MMZB 1PZMA 4QJ5A 4BU1A 1NQOA 2OOSA 1P1HA 3P0HA 4N3GA 5TSDA 4AO7A 2AJCA 5JHHB 5KMGB 2ZIUB 1Z4MA 4GPBA 4JSYA 3JYNA 2DQZA 4MV9A 2PMCA 1Y81A 2CW5A 4DB2A 1SVMA 4KQWA 4R2HA 5B6JA 4ZGGA 4X7MA 4I7EA 5JZ9A 2FPIB 2Q21A 2OCGA 4NHEA 1AUQA 2ODWA 1I32A 3H65A 3L4BC 5FR1A 3HCFA 3ZLJA 2NV0A 3LDUA 2FZLA 3F2IA 3SVZA 2FWRA 2V1XA 3BZUA 3OOWA 1I2AA 3LC7O 4LIPD 5EHGA 4BLRA 5H4GA 3SFZA 4BV2A 4PFKA 2GF2A 3QX8A 5MDHA 2QSYA 4WX2B 1NZFA 4HNQA 1WZEA 3HJHA 3RK4A 4EB8A 3GWGA 5HQJA 1EVIA 2P65A 5TNXA 5ALMA 3WAGA 1KQ3A 1JYFA 2X6RA 3RM3A 4JSRA 3OLZA 1UXJA 1OIWA 4K46A 3ZCSA 2WQ7A 4HX9A 4QU8A 3PXXA 2W93A 3NHFA 5DT9A 1JR3E 1GR0A 4XIJA 1NE7A 3BMXA 4CIXA 2EBWA 1QUFA 3L93A 3O3MB 4ID3A 1AJEA 1K4YA 1N2HA 1H1LA 3LC0A 3QUQA 3UMFA 3ZZNA 5AUNB 1A95A 1GPDG 3O95A 2CVPA 5IJWA 4TYYA 4H31A 3D8HA 3QGMA 4LK3A 1QYCA 4ZVMA 2OV1A 1R4NA 5BR4A 1FP7A 3HVIA 1JX6A 3KQKA 2GCIA 3I01A 5D51S 1KC3A 1OQAA 3L5OA 1U1GA 2PRKA 3ZCUA 2ZTSA 1SKUA 3G9QA 5U9CA 2A9FA 1KMNA 1Z7YA 4GLBA 1VFNA 4QYSA 2CKMA 3GIDA 1P2TA 1P1FA 3E5HA 3HA5A 1NVUQ 1GCOA 4B81A 1X9GA 4B6RA 5CYPA 3PE6A 4EQZA 3DVSX 4I66A 5ESWA 1HYGA 5ITZB 1N32B 1WKBA 3HCWA 1I5EA 3ILHA 4RESA 4OXIA 1CVLA 4DIUA 3K0AA 4MR7A 4DG8A 3WFJA 2FSFA 3HA7A 2HF9A 5FI1B 4F86A 2OAP1 1YMUA 3WDKA 1MNQA 5BPFA 3BXHA 3TBFA 3NEAA 2J0SA 1SUEA 3LPAA 1FA9A 2FR8C 3E61A 4H1WA 1RKQA 2YQZA 4KTVE 1QG2A 1KAHA 2R11A 4EK9A 2AEMA 2XLCA 2VRBA 5DHTA 3EMDA 5DN9A 3JD1A 3K0FA 4KX3A 4Y0VA 5HKKA 3TNFA 2X8BA 4KMRA 5J1TB 5LP6B 1R12A 1A8UA 2H1VA 3GGSA 2V3VA 3TQSA 4QFMA 1UWVA 2PSSA 2APJA 1NYLA 4I1YA 1J1IA 5G41A 2ZJOA 5ARBA 2PH5A 1EINA 4KMSA 4R2IA 1AA9A 3O94A 3REQB 2BH2A 2X3UA 3O2JA 2IXAA 4Y9SA 3EIUA 4J2HA 4AC9A 1RAAA 2JFGA 2BEUA 3L0OA 2DWPA 3UCEA 3HJNA 4GOXA 5TQ0B 4DXAA 2H4ZA 2N47A 1LX7A 1FX0A 1GADO 1NRXA 3C5EA 1V0JA 4U7GA 4QBFA 2NZ8A 1E2EA 1PNOA 1IZ8A 4UNSA 3AG6A 3BZWA 2GKSA 3CJTA 1OFIA 2F1OA 3HZHA 2OP1A 3PYLA 5TJ9A 4N8EA 3CVUA 1E3MA 5TF0A 3IGFA 3BEOA 5K7SA 2IX3A 4IV8A 2JATA 3W5UA 4Z9XA 4E88A 4JJFA 4FI3F 3OM9A 5LMNB 1B42A 4ZO8A 5A9RA 3UGQA 4FI3C 1DWUA 1SPXA 2JDID 3B5EA 1QKKA 3F4BA 3K9NA 4OOEA 4ZK6A 2RGAA 3U5TA 4XYEA 5KYWA 4MV0A 1AE1A 1OCEA 1TFUA 1BQ4A 4F3CA 3ESYA 3BDIA 3S28A 5TE9A 1DLJA 4YDSA 3RRYA 1MHPA 3TGPA 1MH9A 3WJAA 4BGEA 2XUQA 1TD1A 3QVXA 1FS4A 1XLUA 4IDGA 3GVPA 1WMEA 4V0NA 3VTZA 3TF5A 3VDQA 4KVAA 1V9LA 1F4LA 4NBTA 3FF1A 2PMEA 4QJ4A 4G63A 1JPJA 2IHNA 3O4FA 2D3TA 3M3PA 1H2EA 3WKBA 1EXMA 2PX3A 3J7AC 1FP2A 3S5UA 2O20A 1U0EA 3C0KA 2PNJA 4TVOA 2OQIA 1LSSA 1Y8AA 2CE7A 3T41A 2Y93A 5L3VA 3K0CC 3W5HA 4QOGA 1BXGA 3VPSA 2Q1UA 1NXPA 5TARA 4B6OA 1A2KC 4M1WA 1QGUA 1YO6A 1ODKA 2G7MC 5IAJA 1ACJA 2ZBUA 3FWYA 3H5OA 4J91A 1FZQA 1RBZA 1XEXA 5BV1A 5IULC 3GRVA 2BY4A 3HYNA 4IBOA 1OLXA 5F3WB 3K4PA 5D3MB 2HZBA 3OLCX 1JW9B 1XKQA 1X8XA 2WJWA 3A70A 4BQSA 1XZMA 5IT0A 4I55A 2O8BA 1QFSA 1T3LA 3BB1A 3OOYA 1TJYA 3GEHA 3F9RA 4M9ZA 3VHXB 3GCWA 1I7PA 4KYTA 3VI4B 4DBVO 2JJ2A 4RZSA 5JDCC 4G9GA 4CMEC 1JIKA 2A33A 5C8XA 3OQBA 1H9BA 5DX0A 2AOWA 3NOOA 5AVJA 2XSZD 3HJUA 3A0RB 1S4QA 3CUKA 1H0HA 3GUUA 3PFHA 4OD0A 2P78A 1HNZB 2VQSA 4E2FA 3RCBA 1E1NA 1G5HA 1RQXA 1R3DA 1ZCAA 4JX9A 4US1R 3QSGA 2BFMA 2ECQA 3IP7A 1LQUA 1V16A 4JLSA 3E81A 3ZJ4A 1D7OA 4AMYA 2G06A 3H16A 1C3JA 1I6LA 1VIMA 4OQFA 3UCXA 1DFHA 4RJIA 3AW9A 2YW2A 3BVPA 3HYRA 1HE3A 3QLUC 4KUGA 2A8YA 2WHPA 4DABA 1SC1A 4X1IB 3ENZA 4F4HA 4Y2HA 2IYYA 3IKLA 2BTOA 2VH5R 5FUBA 1G291 1KKLA 2KM1A 3I4LA 1BYUA 1HDOA 2VPIA 2QAGA 2Z9CA 4JLOA 4LXUA 2IH2A 5I9LA 2GCNA 4L4SA 3VUFA 3COPA 4IDDA 1SEPA 3KJNA 3OMWA 3ONNA 3QPUA 4JL5A 5DO9A 4CKCB 3CVVA 2UVPB 4CMGA 3H6KA 3PTLA 5H1YA 4UUQA 3VPHA 1JTFA 1V39A 4LXIA 4BV8A 4F84A 3U4QB 1ADYA 3GGCA 3IVAA 1R8YA 3PDJA 4J90A 3HKBB 2C92A 3K2BA 3WGVA 1UQRA 4B3XA 5HTKA 3UUGA 2C96A 3DCNA 4EDHA 2YYSA 5AVZA 1RZRA 2HY7A 3DZGA 4F3TA 1DFGA 1OB2A 3IDOA 3LX5A 3RVQA 3BXFA 2XUGA 1ZNWA 4OVKA 3TLMA 3FPSA 1R9JA 1YKGA 1QLWA 2PX6A 2YWBA 2IELA 3IBGA 3NLLA 2IDJA 3NP9A 4UQPA 4MRPA 2BSQA 2WEKA 2Z08A 4DR6B 1TIKA 3BTOA 3ZGOA 3ZUGA 3QY9A 5LMUB 1X1BA 3S40A 3WKEA 1MAHA 4CIVA 4V1CB 2RIPA 4ZC8A 2DFDA 3L1UA 1KI8A 1XDBA 4HWOA 1ODLA 4BVBA 2Y99A 1KFJB 1K7SN 1LC0A 1YAJA 1YHYA 3QKTA 4GG1A 4P22A 3ADCA 4A0FA 2RI6A 1ODTC 5JJCA 4CTOA 1H8HD 3PEFA 1SM4A 3QXXA 4HKTA 3TQTA 3PQCA 3D2AA 4MWEA 1Q3KA 2IIBA 4BFUA 2BZSA 5AKXA 4BFXA 1P2FA 4R81A 1J9ZA 2I3BA 2OP0A 3H04A 1P4JA 4DA6A 2ZBDA 2C5BA 3HBMA 4GPEA 3ZTWA 4G5YA 1N9GB 3V3TA 4Q1VA 4RXTA 4YRCA 5ERGB 3T9CA 4U0KA 3TKYA 1XEWX 1X1DA 2F9MA 2A9JA 1N6HA 4KIFA 4C0WA 4CF6A 1UKVY 1VXRA 4EDFA 1N2OA 2QW8A 1ULTA 1KMCA 4MJXA 4Y1RB 1K0FA 2JZOA 3A28A 2XA1A 4DGSA 3K0BA 3EG9B 2W42A 4RELA 2O5EA 3RS3A 1CIJA 4PZEA 4EH1A 4P92A 4PPFA 1AK2A 4N5LA 5K5EA 1QCDA 2XMGA 3KJEA 3KSMA 1Z63A 1QDEA 2YHAA 2Z9DA 3ORSA 2PUEA 1I7NA 1S8NA 3A6ZA 2PUDA 4ENTA 4QM7A 2H7XA 2QTCA 5IK2D 2IIQA 3LE8A 1HDRA 2FEWB 5LBIA 5KSWB 4B3SB 5E6RA 3IIEA 2BM1A 1RHUA 1TM5E 4F6LA 1DQYA 2K5UA 1SMKA 1GXSB 4QASA 4YDRA 3S8MA 2YXNA 3FRIA 2CWDA 1PV2A 3KQPA 4P4GA 1EQUA 3SJBA 4CE6A 2NAFA 3LZ6A 2F3QA 4C4AA 1UAAA 3DFMA 4PRLA 5K6TA 3UJCA 2W2LA 3MWEB 2A67A 3G17A 1LWNA 5B12A 1L4HA 3M2PA 3M9WA 4Y2TA 4DLNA 4DLTA 1MPXA 2VDVE 4RS4A 1L5NA 1ADJA 5SZIA 4P7KA 2IODA 1H0KA 2P1ZA 4JUIA 2ZE7A 2WOJA 1SHUX 5JJ5A 5H70A 1XL1A 2NU9A 4HAOA 4HEA1 4PPQA 4B8WA 1TF7A 1Z08A 5DWQA 3P0JA 2ZYVX 4M89A 4GPZA 2I6TA 1SHKA 3ANSA 2I1VB 4DNOA 1PLKA 1DAGA 2JGDA 2WF8A 2Y0EA 1J8QA 3EZLA 4TLLB 5LJIA 3RHTA 4H4CA 5C18A 2CKDA 3KL4A 3B82A 4LECA 4GZMA 3SQWA 2IEDA 2A84A 4MGKR 5CIQA 3FHLA 4Q48A 4TV9F 5ALEA 3N2GA 1WOYA 1MG5A 4DJTA 4F72A 3U4MA 2C4TA 5IMBA 1HTBA 2AFIB 4RLFA 1YE8A 4Z4EA 3NTXA 2XGJA 2RGXA 1C1DA 1PKXA 2D5CA 4KXLA 2G8NA 2RC5A 5LU8A 3VTFA 1ENOA 3BQ9A 3L1KA 1NU6A 1V5WA 2C0QA 2VFAA 4DREA 3D0KA 1TK3A 4PIPA 2FN4A 2GAIA 3H6HA 1P1BA 3WNBA 1UBCA 1F6DA 3AK4A 3UA3A 4AZ3B 4PICA 2FMUA 3C5VA 3KKLA 4F0JA 1WDKA 5I9MA 4O3FA 2ZVDA 3QW4B 2ID8A 3I04M 4Z1OA 2X8LA 5ICGA 2WA1A 3D3WB 4Y8VA 3ZCRA 3A1WA 3V6MA 2OCDA 3FM9A 1MF7A 1VC2A 1WMBA 4F4CA 1XEWY 4M53A 1L8XA 1JJ7A 2QN3A 3CCCA 4PFSA 4HMPA 4ZVKA 4HDKA 3T8YA 1HEUA 3M4YA 5DLDA 3UATA 4E5YA 4RF3A 4C03A 2CHFA 1D6JA 1CUSA 3EGOA 3DEAA 2VSQA 3AO0B 3PQFA 3AU8A 4F91B 1RHKA 5HZGA 1WW2A 2A0XA 3WWYA 2IU4A 4DJAA 1VI6A 1CY6A 1VP3A 4F45A 3THRA 5KQPA 4H17A 5TGZA 3L1JA 2LR0A 4H3SA 2YY5A 2ZK7A 4JLJA 1MDBA 3KD3A 2VCHA 2FZVA 2HIAA 4KG7A 4AG6A 1EFCA 1VCMA 4URZR 4UTRA 1AB6A 5EUMA 1XZLA 2D5AA 3OKPA 4PLWA 4WLFA 1CZKA 2OYSA 1UK9A 1CUXA 1G9TA 1E98A 4M0UA 1Q7GA 2PO7A 1JLLB 2KPOA 3AZOA 1F2TA 1XL0A 1X70A 4KBGA 1V6AA 5IC6A 1B3RA 2YZNA 4TV9B 3V8QA 4ARCA 4KREA 1R4MA 1V1MA 1U2SA 5HZMA 1W1IA 3PFKA 5DNWA 2XNKA 3A27A 5A7HA 2WNIA 1W7AA 1O97D 2BFBA 3OCCA 2ZYUX 4M7OA 2YXLA 4WZZA 1FQWA 4UM8B 4NCHA 1B76A 3BH7A 1I51A 4B3IA 4IXMA 4B2IA 4LKRA 3VPDA 5C81A 2HWXA 3UKDA 1AUXA 2OHGA 5C3MA 4KNVA 2A0UA 4Q21A 3SS7X 1Q0PA 2QPOA 3DEIA 1PEDA 5BWBA 4U6NA 1GA4A 3EPRA 5KIAA 1GAXA 4C78A 3O91A 3DC7A 1YRYE 1GPJA 1EZZA 3K9HA 3SXUB 4MVJG 5K0CA 1MN6A 1RU3A 2Y3IA 3GA5A 5FADA 2HLPA 1Q74A 3K09A 2VK4A 1IC6A 3ZU2A 4BE4A 5E2IA 2MCFA 3EWSA 3UMSA 1LDYA 3M82A 1N6RA 5HW0A 2L69A 4GR9A 4PQRA 3OQIA 4HC4A 4DLZA 1M8KA 4LXYA 4B73A 3G2HA 2YJTD 1BX3A 2D2EA 1O9BA 1GL3A 3EXHA 2YOHA 1UADA 3PL1A 1TF2A 4YASA 3WJ7A 4AS3A 3MQ2A 4ASUD 3UBTA 2A92A 4LC1A 4BKOA 3CEJA 1QQAA 4LY9A 3UXEA 1Z7GA 1UH5A 4YCCA 5IVKA 1TU3A 2JHAA 5F35A 3TGWA 5KZMB 2JI8A 3IMFA 3QE2A 3JQ9A 1GTMA 3C43A 4UEWA 4PCVA 4UU1A 2JI6A 3W2EA 2ZBQA 3EE6A 1DTWB 3V7NA 4BEJA 1RQ2A 2ZT8A 1L7XA 1L5SA 4L73A 4BZXA 1XAJA 3ABRB 3BAFA 1BH6A 1LJ8A 2R6AA 3DBHA 3E8MA 3GJXC 1IOLA 4GKAA 4F3NA 1VL8A 3EFEA 2Q6TA 3GPIA 1PUIA 4KAXA 3ZZ0A 2GPSA 1SVSA 3ZXSA 2AJTA 2HPHA 4JDPA 4K6KA 4YA6A 2SKDA 1SC3A 4I8XA 3BHMA 2C7BA 2Z98A 3RSSA 3H2KA 1J06A 3PNVA 3UJDA 4EG7A 1MXFA 2BR4A 3QFTA 5KNBH 2K4MA 3VYWA 1Z8FA 2CLFB 4GP6A 3UVEA 2VUSA 1ETHA 1WDWB 2GEVA 4HXGA 1EX9A 4R41A 4BO6A 3OKAA 2Q7DA 5L3SA 4AAYA 1QRRA 3ICWA 2PWBA 5KYKA 1U8EA 2OGZA 2PZAA 2XVAA 3GJRA 1XN1A 5IF3A 1N9KA 1UWLA 3O2SB 2W2KA 8ATCA 2O8VA 3HZOA 1URPA 3DR5A 1NI3A 2E0IA 2G77B 1VSQA 2VXYA 2JBWA 3KYIB 4E2YA 5IKPA 5JSHA 4H35A 4KDFA 1PV4A 4PSDA 1Q1AA 2BIFA 3F7MA 4H7IA 2OV6A 1U8CB 3TW4A 2EZTA 4YRDA 1AGXA 1OI2A 2GA8A 3KU1A 4B43A 3W78A 2XE4A 3PNLA 4ND3A 3P2KA 2FFHA 4ZCRA 3JVEA 1R50A 3WGHA 4L95C 1D1TA 1H3NA 1UANA 3R0ZA 1PAUA 1ZHHA 2QD5A 3FDIA 3PPIA 4OYHA 4UD2A 5JRZA 5A5EA 1I3LA 5KVSA 1V8PA 2YJ3A 3BHIA 4M9CA 4RF4A 1M5UA 3G7NA 5CM8B 1FNDA 1NURA 3PRHA 4TTVA 4ZQGA 4CT4B 5HS6A 5DHUA 4PSVA 4DM4A 4WIAA 2AN9A 3WGYA 3T5MA 5F7XA 5BYKA 4P4NA 3SX0A 1UDWA 2FUKA 2I1WA 2VCYA 2PXAA 4OY3A 4LHEA 4QYIA 1A8PA 1D4AA 3WX0A 4NY1A 1DRJA 2HWUA 1N3BA 1CR2A 4Y2QA 1LPSA 1NUQA 2VHEA 1V3VA 2C5GA 3QFSA 2WV9A 2X7XA 1T13A 4LNUB 4B80A 1KNQA 1Q20A 3HBNA 1N8KA 1DUIA 1P74A 2EJCA 1R0WA 5CK4A 2IPNA 4LJKA 4JROA 1YHZA 4QFDA 4D2IA 3VR6H 4DAOA 4N1AA 3OM0A 4EB3A 4Q05A 3M0EA 4MI1A 3GZ4A 1DLIA 2W6IA 2XMBA 3KYDB 2P69A 4YRZA 5CT9A 1O96A 2YN4A 1J7KA 3B51X 3PWZA 3PVCA 2PTGA 1OOEA 1W73A 4WXMA 2L19A 3FF4A 3R3UA 1H6BA 1G7RA 4M99A 3WFZA 2DYKA 4JZKA 3UIEA 1PZGA 2QJOA 1QH8A 4I19A 1GD1O 3VH3A 3U2QA 1VM6A 5EJFA 3TZQA 1ABFA 4QXMA 4HDRA 3NBAA 1AN9A 2M9MA 4P83A 1R0RE 2CJWA 3QE4A 2JLYA 2L17A 4GC5A 1SBYA 4JV5B 3QNUA 5K8IA 4GEGA 3DMDA 5IFKA 2Y1WA 1ZMXA 4ZK2A 4NNPA 1OI7A 5JXJA 4XD2A 3UENA 4WD3A 3PDIA 4IIJA 4H6PA 4RYLA 3T7KA 2HLDA 5CLIA 3X0DA 3KAJA 4R9NA 3EQ8A 3EIFA 1E96A 4I3FA 4RD6A 3CLKA 3VR5H 5J23A 2IWRA 3L84A 4JLBA 1ECGA 1YZVA 4BNDA 1DDOA 1E6UA 1T34A 2G83A 5KYNA 4ABYA 3K9FC 3DAYA 2XYRA 2CB0A 4HH1A 4NAHA 3FCAA 3CUVA 3OX4A 3QNWA 5AOCA 4MRMA 1ZO8A 5EIBC 3WL8A 1UBJS 4HDNB 1V3QE 3WYBA 1ATIA 1ZK2A 1JILA 2BDTA 4JKYA 3IEMA 1D0VA 4AURA 1HFJA 3TM5A 3AI3A 3VR3A 1UMCB 2LV8A 1H42A 5BWMA 1U8AA 5FF9A 3WK6A 4BMYA 3LRXA 3N5KA 4YRSA 1I13A 3PFWO 4G65A 1YUMA 1PG0A 1M1YE 1AKWA 3OH8A 4NXNB 4C4OA 1WZUA 3VSCA 2M6SA 3FYHA 4OMCA 3RVPA 3H17A 2SICE 4QTZA 3NHAA 4DXHA 5JH7A 3LSYA 1V26A 4WXHA 3QELA 3UPTA 3GFBA 2O8CB 1JG2A 4PQGA 1R64A 3FW1A 2C0CA 4A3SA 4OQNA 4YP6A 2BC9A 5B36A 1Z25A 2GO1A 3IODA 1FLNA 3E18A 1TZJA 2WMOB 3TIIA 3GNSA 3X1ZA 2WIFA 4UHDA 4FYMA 4RL4A 2EL9A 1DKLA 2DMRA 3LBYA 2ODPA 2B4KA 4E5VA 5GADl 2CBZA 2IS2A 2WKSA 5F64A 1RHQA 3FSRA 4RADA 1EGHA 2DP4E 3O8DA 4G89A 4C0JA 5TV2A 2DR2A 4WZBE 4PHHA 4J4TA 4ESHA 2IYFA 3N6XA 2M6LA 4ZVQA 4JC4A 2W83A 3ZN2A 5AO9A 3HXQA 2IV3A 3D2LA 4KODA 4WERA 3FHJA 1TRKA 5DNEA 3RC2A 4A0QA 5JYBA 1Z13A 3U6KA 4NR0A 1P73A 4BNUA 3U44A 3LX6A 2VXBA 3TLGA 2EATA 1Z33A 2JJYA 3FNHA 4FGKA 2C97A 4RNDB 1TCVA 1UPUA 4A73A 4C9BA 4B40A 4ROTA 3EVEA 3F74A 1XG5A 3OF3A 4QOJA 4C6RA 1DBPA 3H1FA 4EENA 1R15A 4FYPA 2HRCA 9LDTA 4FR0A 4C4SA 1NW8A 1M1YB 4AZ0A 4AFNA 4L72A 4YJ2F 3EWNA 4ZU3A 2G17A 3ZDBA 3FWKA 3FNEA 3QLVA 1PVDA 1AZTA 3H84A 3I9FA 3PUYA 4WBSA 1B6GA 2ZPAA 3QFHA 1MKYA 2AE1A 4MUEA 3S1AA 1OWNA 4RIEA 4B6JA 4CFYA 3EGVA 3IPYA 1MAWA 5J5CA 4D9MA 4EWLA 1I10A 2F3PA 3C3AA 4XDHA 1U63A 3BHNA 1QQBA 3WRXA 4CLDA 1AVTA 5EWMA 5CITA 3T1OA 2CT8A 3W05A 2GEJA 4GPTA 1GTRA 4G0WA 1JHYA 2OFXA 4HYEA 4IKOA 5FI3A 4JGGA 3URKA 3ZU6A 1ZKMA 2JHGA 5CMLA 2MSKA 3DLTA 3UNXA 3NT4A 1L8QA 3HNRA 4C0HA 1ZSVA 3HK2A 1PL6A 2PMBA 4Q66C 4V3CA 2PJUA 4WZBB 3ZHXA 2PAAA 4GRDA 1QM5A 3RSCA 4G0QA 1X7DA 2XRZA 2JFXA 2O50A 4DSUA 3WBJA 5KQGA 1RYMA 2QQFA 1JMKC 2ZSKA 3BXPA 1U3VA 4X45A 4QXAA 1WY5A 3RG8A 2IYUA 3RTBA 3GNLA 1ZZEA 2HSZA 3LW7A 3Q2OA 4WT7A 5J2TF 3S0JA 3KZKA 4G4IA 1G4UR 3TBKA 1NHWA 1ZMBA 4NPCA 1I80A 3C3CA 1TT7A 2VNKA 2BF7A 4MLDA 3C7AA 1EVLA 3AEYA 4MGYR 1YBAA 2B4QA 2HGZA 3EISA 3FPLA 3OF2A 5HILA 3TUJC 2R6JA 4UZSA 3ZVRA 4P93A 3INTA 3NDPA 1NP6A 2HXSA 3CMMA 3BULA 2ENUA 4RFSB 2QIPA 1B8PA 5EESA 4MZDA 2ZSFA 4P34A 4OL0A 2YS6A 1VDMA 4N7JA 1TO2E 4RCVA 5FYDA 3GN2A 2NX2A 1NVVQ 2BEWA 4RYDA 4ZT5A 5BN1A 1SBQA 2J6IA 2AOXA 2FK8A 2WFLB 2PGIA 3LNTA 1RIFA 3M49A 1F38A 1PL7A 4CCSA 4PRZA 3MJHA 2Q1YA 3FPBA 4IEFB 4CHGA 4Y6PA 1E1KA 4HGOA 3MJFA 5L3RA 4RORA 1G8YA 3GI1A 1IJEA 5TEWA 4U7TB 4XWOA 4K1LA 2Q0XA 3IBYA 4OHMA 2C7RA 4NBUA 3EEIA 4Q9IA 2QZSA 3TLXA 1R8SA 4REQA 3V6LA 2C2ZA 1ELOA 1YIAA 2LCFA 2ZJ4A 2FP4A 2H0QA 3KTOA 4J6EA 4N6OA 4YJHB 1YC2A 2BF4A 3DCYA 2PQ2A 1KOGA 4D57A 2MWMA 4YAKA 3CX4A 4IILA 1FDTA 2X8JB 3E27A 4OXQA 3WJ1A 1MQAA 4JHXA 3VA7A 1KPGA 4QE3A 1XV5A 1UKEA 2DBZA 3H1EA 5AKIA 4RA6A 5JMWA 2E7ZA 1KEWA 4WEOA 3LNCA 1OD6A 2GXAA 1IRIA 2J5QA 1T9CA 2TMGA 1NJ5A 4ZHQF 2FN9A 2FQ1A 1I0LA 3IRUA 4CM8A 5KJ6A 3BDVA 1NWHA 3ZLUA 2F8LA 2X23A 3NRBA 1FVOA 4YCMA 1JHOA 1RM5A 2OZLB 2R7LA 3NANA 4I14A 5J2TB 2XUDA 3CLSC 5B1SA 5A9TA 4K9PA 3R77A 5KMGA 4KMOA 1RQ7A 1M73E 1P8AA 2N42A 4M76B 5DPMA 1HRDA 3F7NA 4LN1A 4BECA 4ZT3A 5BUZA 1GU0A 3RNLA 3PJFA 1JKJA 3DXFA 1XAGA 3TL6A 4R9VA 3MD9A 1U3UA 3SYMA 4QQNA 1K06A 2NUTB 5FRDA 5K3BA 1W8DA 4BOYA 3TEMA 2DUWA 2AUMA 1VKJA 2I55A 3TG2A 2JNWA 5T4EA 4JELA 2YYZA 4ND4A 2GJ9A 1E1MA 3AHCA 1UBKS 3DNPA 3E3MA 5B64A 4C7KA 3WK7A 2CMGA 1Z28A 1CR1A 4TMFA 4KNYA 1UXKA 3JW8A 3VFDA 2R1ZA 1H8ED 1E1QD 2Q28A 1Y5IA 3DC2A 2DG2A 3IPXA 3N8KA 1O3YA 2ZSIA 4UUAA 2HBRA 2LE0A 4GSLA 1PK7A 3I23A 1M6YA 2P62A 4YXFA 3AERB 3LHFA 3Q0IA 4GWGA 2YX1A 3N2EA 4XM0A 4J0EA 3QPAA 1XLTA 4P81A 5AVSA 4BBZA 4K86A 1L3BA 1TZMA 3URMA 3G8DA 4JOBA 1JHQA 1EFVA 1F6WA 1XVIA 3ZD8A 3B1FA 4HDMB 5KTYA 5LN1A 1DO2A 2FWBA 1U7UA 4M22A 4ZI3A 5JQGB 2N1BA 2WT9A 3Q8WA 4HO1X 3IPLA 3WSTA 2X4DA 1JIXA 421PA 3HB5X 5B37A 2FEAA 2J3QA 4M7RA 3FMFA 4ND7A 3EXHC 5LUAA 1BVRA 4D5EA 2OV3A 4EEXA 5DEOA 4ZHQB 4G1EB 3F9IA 1PEKE 3QEOA 4EFDA 5JS1A 1QS0A 5CNKA 4A16A 4U2KA 2JKYA 4CZ2A 2B1JA 2Y6VA 2GZ2A 1EJBA 3EXAA 4MI3A 4MDFA 1EMDA 2HL6A 2WYVA 3QM1A 4BFLA 4CCYA 2Q8NA 2IYVA 1PW5A 4BFCA 2NTNA 2ST1A 3AG5A 3PICA 5ALZA 2IVZA 3VXKA 3JQ9C 2XMDA 3UO8B 4DOMA 1Z5OA 2X3FA 3KIPA 3JALB 4HCJA 4RSHA 4D96A 4UM5A 5FWNA 4RAOA 2ZVQX 1E4EB 4C5AA 1HL7A 5AW3A 1XTBA 3E7PA 4RTMA 3AI1A 1GFIA 4DQVA 1RW4A 2B6HA 4DDWA 1PE0A 2LVBA 3CKKA 3E9ZA 3ROFA 3AF4A 4IOMA 3LGSA 3B52X 4E13A 1Z56C 3F3SA 5KYXB 4OMUA 3RYHA 3QPCA 2I6XA 3UZUA 1KYTA 3RK0A 1JR3A 1SOUA 2G88A 3CZ5A 4ZZIA 5LD2C 1LBEA 4KQMA 1JKIA 4X24A 4ZCPA 4TMTA 1JIVA 2R2GA 3GJ5A 2I4RA 2UV8A 3KZXA 1VYVA 4F2GA 1TJPB 1EVZA 1WMSA 4Z4CA 1L5GB 3AVTA 4R83A 4M1SA 1RCTE 4LF6B 3ADPA 2PG3A 3O26A 2JPDA 3PQ8A 5LQJA 3ZNQA 3E4CA 5BOSA 5FI5A 2PD3A 2J6HA 2AUTA 2VZ8A 1CG6A 3OFVA 3FAKA 4I3HA 5BQFA 2JAWA 1E18A 4YALA 5HRCA 1TM7E 2D4HA 2ZR9A 4FUQA 1DG3A 2J09A 4LV6A 4R1TA 4RO0A 3A9RA 3B70A 1W1WA 3IPRA 4KACA 3FYUC 3VMMA 4EJFA 3C87A 1PQUA 3TCKA 4LHSA 4CV0A 1E64A 2VVTA 1QE3A 4NJMB 1CUZA 4MYDA 3TQIA 5FEUA 1FP4A 4L9AA 4L4ZA 3ABQB 5JD5A 5JCOC 1E77A 1KAQA 1ULZA 4ZPJA 3DA8A 4FFOA 1M7BA 1A9YA 4P4SB 4B3MB 2M6RA 5IBRA 5TT0A 3AJEA 3OBIA 4N5HX 1UOEA 4XVHA 5L3QB 2JIBA 1BWRA 4HN9A 4TN5A 4MHOA 5H4HA 4LRXA 3HMKA 4BNLA 1K89A 2O4CA 5FT9A 2PMDA 1U9IC 4OL9A 1WPQA 2WIDA 4R2KA 4CKBB 1IBMB 1UJBA 1IXRC 3IV7A 5DGIA 1MTZA 2HBZA 5EPUA 1BKYA 4DSOA 4BFTA 4C3OB 1NBME 2QVZX 2ZBGA 2IXFA 2FEMA 3C48A 4MARA 1Z4KA 1C1XB 4NU6A 1VIAA 4XRGA 3PIIA 4EYKA 5LD2B 1MOQA 2DQYA 2UZIR 1GQFA 4ZYLA 1IN6A 1GZVA 3G7SA 3UAZA 1SG0A 1Y82A 3ODGA 1IZYA 3WK4A 1GUZA 4HVLA 5A4FS 3EFHA 2B37A 1KFEB 1MIOB 1N7IA 3GMTA 3E1KA 4IH9A 4M1ZA 3V9AA 1YVPA 4HWSA 1Z74A 4CMHA 4LF4B 4W82A 5ABPA 1K2WA 4FCTA 1CV2A 1HQYE 3V42A 5I4CA 4DY4A 3BERA 3E3OA 2GASA 3OC6A 3WZMA 1W5SA 3K7EA 5K4AA 2GWHA 4I99A 4AULA 3CZ4A 3WZLA 1QKJA 3UHAA 1ZNXA 3D3QA 1JECA 4GOJA 1DMRA 4UVDA 2BAGA 3PFFA 1U0GA 4F9TA 1OPRA 3CT6A 3WLJA 2QLTA 1NRJB 1VMIA 3R76A 2B7LA 3NDBB 1DCMA 3MFYA 4PC2A 3WLSA 1QH0A 2VYND 2P9GA 3FCOA 3FYUB 5C5CA 2YDXA 3EPPA 4TXNA 4RC9A 1N2XA 2V0CA 1L7AA 2FEOA 4H6WA 1ZM3A 1HDEA 3T4PA 2A1TS 2W37A 1JF8A 1MU0A 3CRNA 3Q88A 4B44A 2R5NA 4BX0A 4DT1B 4JD5A 2ZM6B 1DCKA 1VJTA 3TL2A 1ZHOA 2R00A 4HLCA 2E1RA 4WUTA 2X0JA 3LXXA 1XALA 3IS3A 2XQKA 4P38A 4KHZA 4ZAWA 3X1WA 4GH5A 2OCBA 3OCZA 1G17A 4UEKA 1G1AA 3ZY4A 4Z51A 4OHYA 4CTNA 1DE0A 1S2IA 1CR6A 2BGNA 5B4VA 1TYCA 3ASVA 1BOFA 1NYQA 4OH1A 4DCPA 1SQGA 3Q6NA 4G1BA 3ZIAA 5BRJA 4E3WA 1JVBA 2HHCA 4R1SA 2YNMA 6ADHA 3S1SA 3UHJA 3CX8A 4CDGA 2DFNA 1ZD4A 3GLQA 2WVAA 2JIQA 3QVTA 4F7WA 3UC5A 3KUKA 4KE8A 5BSMA 2ZB3A 2OBYA 3TH5A 1Y4SA 4OATA 3I9MA 2X7JA 1SQ5A 1OT3A 5CM2Z 1U4OA 3LT1A 3LDHA 2G9VA 1J90A 3K9WA 1OX4A 4PBTA 2ZQYA 5IBPA 3TS1A 1OYVA 3IQIX 5FTMA 4BATA 6LDHA 3BGSA 3N59A 5JVDF 1C9MA 2P91A 1K5HA 3L82B 4JQYA 4OAOA 4DLLA 1QQ6A 2ZQ5A 1SUAA 1QSGA 4O4IF 4O5OA 3U0BA 3VDMA 1Q44A 3DTVD 3W77A 1OX5A 4HB3A 1Z38A 2Z3ZA 3PQ7A 1N8SA 1P7WA 1EWYA 3OFND 4EKNB 2HOQA 3ZZMA 1BSVA 5ERYA 1ACMA 2ACEA 3OY7A 4R2JA 1N3YA 2Z09A 5REQB 5IN5A 5AW9A 4FZ3A 3W6NA 4W8GA 1XO1A 5HF9A 4R68A 3SEFA 1LBIA 1WSAA 3TPFA 4ES6A 4HWKA 1PJQA 3TAXA 1P2GA 3E7WA 2XI4A 1VYUA 2BONA 1O6FA 2H5LA 1NXWA 3QI7A 3H87A 4Z8YA 2C4NA 1QTQA 3WL4A 3MUFA 5F1PA 3EPHA 4R69A 2X0EA 4PGGA 3IAM6 4TWAA 2O5VA 1OWPA 3WR5A 1M0WA 3SZGA 3WYAA 4GOND 4KRGA 2LXNA 4OQDA 4FR2A 3NKFA 5LOVA 2MSCB 4P53A 1HKHA 4BBAA 4ARVA 4H0FA 2GDJA 3GCGA 3BOSA 4ZARA 2YIJA 5FBVB 4QUDA 1A5BB 1KIAA 2ZXEA 4Z0HO 5H3LA 5CAEB 3K05A 4ZRMA 4HQRA 4TWRA 1GARA 2FKAA 2ZETA 4DLRA 1SD2A 3GDWA 3GY0A 5E4JA 1XVAA 2J08A 1OFUX 1G8AA 1TPYA 2O3RA 3NFYA 3OM1A 4LXGA 3RAGA 3TXAA 3ESZA 3SC3A 1I7SB 2P5YA 2K7FA 1ISJA 1QDUA 1F2VA 1CETA 2I65A 1CF2O 1K5GA 1WTAA 2J5KA 1NXTA 2Q3JA 2QTWB 2QN1A 1G55A 3P0RA 5AJYA 3WRXC 4F9GA 3V46A 3TXYA 5HQTA 1ZRSA 3CLTC 2Q49A 5ENZA 4CI0B 2C88A 2XQVA 2A9KA 3Q3CA 5HKKD 4K9LA 1MOSA 1T6BY 4GVPA 1JEJA 5D7BA 2PVSA 2R2AA 1DJNA 1ZVQA 2NO7A 3F46A 4HDSA 4RIHA 5D01A 3T5TA 4B82A 3K71B 5JVDB 1T9DA 1PJRA 2WM2A 2EFYA 3VYTB 4JI8B 1QU2A 1ONOA 4ICIA 4K6OA 4EY7A 3GJTA 4IV0A 2R65A 1T2EA 4Y18A 1LY1A 3FTDA 1KMHA 1V7CA 1CDEA 3TCNA 2O8FA 4QOEA 5B1YA 1J9GA 3GLTA 1NDQA 1R6VA 4ZVSA 4CM3A 1ZQ9A 5DHQA 1EFKA 1NVDA 4XJVA 5LMCA 3V48A 5AVRA 2XNJA 1J1ZA 1K5PA 3A2LA 3AT1A 3N0XA 4AMZA 4CR7A 1BDHA 1VE5A 1FRZA 2XVMA 1B15A 4R2WA 5JYCA 3OIFA 3RABA 4Z53A 4ZCTA 1I36A 4ER3A 2CWWA 1L5FA 1QNFA 3AFOA 1RKVA 3PHBE 4KE7A 1S0UA 3BFPA 4UJ3A 5HIAA 4Y9RA 3DSRA 3OU2A 1NY5A 5KDDA 3L7KA 1KFKB 3QFCA 3SBEA 2RI0A 4DLUA 1VGVA 2GCOA 3K9CA 3L1IA 3OCJA 1RWQA 3QK7A 3EY9A 3RSGA 2GXQA 4P7BA 3B1WA 3BE6A 3UWMA 3FNIA 3ZQJA 2DBYA 3MUNA 4EA8A 4U9UA 5KUTA 4OK5A 2XUFA 2OXCA 1FUKA 3V1NA 1L3IA 1XTUA 5I3CA 4BLTA 5I7RA 1GO2A 2GO7A 5B2ZA 1P4AA 2JCGA 3G9ZA 1YULA 4YAJA 3L7YA 3TQHA 4E09A 1N2CE 2ZI5A 5CR9A 3H0CA 3HA3A 2DLNA 3LKDA 3UTDA 2QRVB 2ZQZA 5A6VA 4EMUA 5AQEA 5IKOA 1DBQA 4EMSA 4DV5B 1YJXA 3K0EA 4UREA 1LJLA 5TMDA 4F4DA 2EQ5A 2CXQA 4HGNA 4Y7DA 1OC2A 3SQNA 4FK8A 1Y1KE 4J0QA 4X60A 4ERNA 3P26A 3EX7C 1XZIA 1Z6AA 3DCIA 3DE0X 1BWSA 5T4BA 1CUBA 1JDBC 3OEEA 4F2WA 3DHWC 3DG9A 4BRSA 4HNTA 4H15A 1EU1A 3UKJA 3QBEA 1LBSA 4JVLA 3VC1A 4ALKA 4YAUA 1EUCB 1YMVA 3AF6A 3IUJA 4A4DA 3R5SA 3SF8A 3I9LA 5DP1A 3RG2A 4CLRB 3NBUA 4KP7A 2QLJA 1FS6A 2L18A 5IUKC 4CU5A 2D0DA 1ZBQA 1SWWA 3IO3A 3PNKA 1RRFA 4KAAA 2PL3A 1IN4A 5LXTF 2GEBA 1JFFA 2PZGA 2WT8A 4D5GA 1X1QA 1ODFA 1KRHA 4DJDC 1A1VA 1WCYA 2NLOA 4Q5IA 4MX8A 5EY5B 5TF4A 3ND7A 1C9NA 2JJ2D 2XWSA 1FTGA 1P17A 3U4GA 2ANCA 4QUIA 5FPHA 3GLKA 3OZRA 5ALTA 4AF7A 3HGTA 2JI7A 5C8VA 3U16A 3RRFA 4FGUA 3DDCA 2J1LA 3PHIA 2ZBFA 1JIQA 1NVTA 1UXOA 1D04A 2NXEA 3EEFA 3QU7A 4MMXB 4O29A 4NABA 3QUCA 1YRAA 4V0QA 4CCWA 3DBRA 2FPGA 1S2OA 1SU4A 5EE1A 2RAVA 4MGEA 4O2AF 3CCBA 4DEYA 1VHWA 4ZVUA 3SHWA 3DFZA 2ZUTA 4FPXA 2BGTA 5FCDA 2VAWA 2F1KA 2PA0A 5LZ8A 1KK2A 4LDAA 4EI8A 1YC5A 4Y2SA 3F98A 1U3TA 2V6FA 2BJWA 4X00A 1Q0RA 4D42A 1YVEI 4QOIA 2QRHA 5C4MA 5IRCD 2CZGA 3AEQA 4KWIA 1Q1ZA 4ZVOA 2OLKA 3S6JA 1C9JA 4IGKA 1ZH2A 5DN6A 2JGJA 4M46A 4W5RA 5FX2A 2XYPA 3Q1KA 1RNLA 4CM7A 1Q0SA 1DC8A 4OA5A 1XZFA 2BGMA 1TK9A 1N5RA 1OFVA 4RVNA 4EYGA 1H3EA 4HNRA 1IQ0A 2Q3MA 3EIXA 4RXUA 1NNUA 1GZ6A 3GL9A 5FJJA 1JR6A 4ZIRB 1J1UA 1QIGA 1NG1A 2I4LA 3LC1O 4OHUA 3FPJA 4UQLA 4GUDA 1XGKA 1GCAA 3CRW1 1XOIA 2QRZA 2X9NA 1NMXA 3GNQA 3VVBA 1UIMA 5L6LB 5CBPB 2MYTA 1C41A 5HNKA 1ZUNA 2WM8A 3C39A 5GZ6A 3AC0A 2NP7A 4BGUA 1JA0A 3H4MA 1NI4A 5A6SB 5BN3B 4OQLA 1R88A 1VSUA 3IAUA 4HBZA 1JQBA 3MW8A 5LXTB 4JA0A 3P27A 1FFXB 3LA6A 5C7LO 1JR4A 3WL7A 4FDTA 4Q1DA 5KTRA 4MRSA 4TMKA 5TXGA 3OE7A 5BNZA 2X5JO 1NAIA 3ETJA 3SZMA 3HTXA 2AB0A 1K97A 2ZITA 5DYWA 5IVPA 3AI7A 4CNBA 4FYWA 3A3KA 5ICEA 5J3JA 4MUHA 3MT9A 4PLHA 3RIHA 4GSYA 5DHAA 5FTWA 1XZCA 2G40A 1F3LA 1Y80A 16PKA 2IHVA 3KC2A 5AT1A 2H2AA 4KQXA 3T15A 3G23A 2PUCA 1JXQA 1UPXA 3DYBA 3LT0A 3MTGA 4QDKA 5FUXA 1SIWA 3LO8A 3A8TA 4O2AB 3DH0A 1XZKA 2NYRA 1NVXQ 4IOKA 1JG6A 3HV0A 5HCIA 3B8EA 1EFAA 2V6BA 2YRWA 3A4MA 3EUEA 1BA2A 3AHHA 3P9CA 3HRKA 3UWDA 4MICA 4BP1A 4DTCA 3I1YA 3P0IA 3KR9A 2W6PA 3HEBA 3TIFA 4DMUB 3NYIA 3RVKA 1JI0A 1NNLA 5F7OA 5AW6A 5LDDC 3ER6A 3CEHA 1O0SA 5JNSA 2J0UA 1ORHA 3IMKA 3R5TA 2O14A 3H2ZA 1T10A 4WPGA 3RD5A 4XUGB 1Z6GA 3PX3A 2Y1FA 3UW1A 2Q29A 4D26A 4NARA 3I8SA 5CJJA 3BJZA 1DC4A 3EXIA 5ANRB 1ZJ5A 4CEJB 2W58A 2HMYB 4AKIA 1XLWA 5F9HA 1IULA 3GAAA 3JSAA 4JUCA 4PLVA 4NNJA 1Y1TA 4YP7A 4R6WA 5F78A 2VT2A 3ND9A 5JU6A 4WTOA 3W34A 3FFWA 4Y6GB 4O0MA 3AJ8A 2J32A 3INYA 4L3VA 1UP6A 3ZD9A 1AUVA 3RJTA 2A4MA 5B4UA 1QG6A 2CFTA 4X20A 2QPAA 3F1KA 4PF1A 4D46A 2PH1A 3I6MA 4E31A 4E4TA 3TDMA 2C5AA 2IXTA 4G0PA 4H18A 4LYFA 3WGNA 2ZCUA 1RRCA 4O3MA 3JQFA 3W6UA 1P8JA 2DT5A 4WACA 2FG6C 2YBDA 1RJWA 1GL6A 1JQ5A 1MFPA 1F2DA 3KXPA 1QORA 3HP1A 4ZQEA 3GXOA 1RTTA 1LQ2A 3FVTA 1Z5PA 2VDQB 3QVMA 2EDAA 1TYEB 4BX3A 2WWTA 5BVHA 2PL5A 4ONEA 4TLBA 4WZAA 1M0EA 4M83A 2AEJA 3C3YA 3G5TA 4DAEA 1R3UA 2CGEA 5KJEA 3DVAB 1PR0A 2IF0A 3IVGA 2ZR8A 1QLJA 3IVCA 2W4QA 3CZQA 2BFFA 3QF4B 1Y3AA 4MW1A 1XMJA 3GUCA 2ODBA 1S96A 2Y0CA 3QI2A 4CVNA 1L5VA 2WAXA 3QKWA 4TL9A 4CGYA 5IUJC 3KT0A 5TS3A 4LJSA 4L27A 5HJ7A 2AR7A 4D4MA 1K6XA 2HYIC 2QX6A 4MK4A 3E7FA 2UZ3A 1SXHA 4D7AA 5BT9A 2CHVA 2B8EA 3PGXA 4PZZA 2JA2A 3KSDO 4EUEA 3IJRA 3W90A 5C32A 3U60B 2WP8J 1THTA 3FHTA 4WMLA 5AW0A 5LWQA 3GARA 4WBNF 4B7AA 4TUYA 1MX3A 3MWGA 4HRYA 4EY4A 3LKZA 3RS4A 4G5OA 3ZE1B 1G18A 4QTXA 4N7BA 5IU6A 1H2YA 3DOFA 3EG5A 4IRUB 4E30A 5C1PA 5KVVA 1EFUA 3NBFA 5ALJA 3DULA 2G28A 3M5PA 5C0OE 3VX3A 1R8JA 1JWLA 4EPRA 3LPNA 1HNXB 1T0IA 2I4MA 1P0MA 1E1RA 1CQXA 1G20A 5JTTA 5FWXB 2FFRA 3HHPA 5LM3A 2JGIA 3K6JA 2ZIAA 5ADVA 3JXEA 2R5WA 2H1WA 2V74B 3N75A 3M3HA 2EZUA 3T5GA 1AO3A 1EPUA 5JD4A 3PF8A 3FZYA 4E2XA 1FYVA 3DOHA 1V3TA 2V6MA 3SCZA 2OPHA 4M1YA 3LT2A 1NLFA 3C97A 2QYHA 1NONA 2QE6A 2X0IA 1EHIA 3TYXA 3ZHTA 2H9IA 1NMSA 1I0ZA 2WWFA 5I51A 2LIVA 4CEIA 3CJRA 4O0LA 3OIVA 4FFMA 3SSAA 4KHPB 2BMWA 3IA2A 3MWDB 3QMWA 1UT5A 2FF7A 1P3JA 2GLUA 5KNCA 1ZMTA 3G0HA 3JD0A 1OTYA 1SIUA 2VK8A 3TOSA 2R00C 3VYUB 2FQYA 4DHWA 5JBQA 3H3XA 4WXYB 4P5EA 5KVQA 3ECCA 2E6UX 3O9ZA 1KR5A 1UM8A 4C6SA 4DZZA 3GLGA 2VN8A 3H4VA 2I7DA 3EIWA 1ZWKA 2Z5LA 2VQEB 5ALGA 1JKXA 4N41A 1HT0A 2FZEA 4CM1A 3GFFA 1B2RA 4YPFA 4OLBA 2NVUB 3TZLA 3NNSA 3RAEC 2YNMC 4TQUS 2ZBRA 3P4XA 1RM0A 2XTNA 3C6QA 1GQQA 1RVV1 2Y9MB 3FAZA 3PT5A 4JP2A 4X9XA 3TFWA 3VM6A 3SEAA 5AYVA 1MLDA 3B60A 4R6XA 4N0PA 1LI7A 1VJ0A 5B7NA 1DX9A 1QHHB 1NR1A 4WBNB 2ORWA 1FC0A 4OV6B 3W5IA 4D3YA 3AB3A 5KTKA 2GFIA 2HDOA 4ON9A 4EB6A 3H2YA 1IHOA 2P9HA 5JROA 4NXMB 1L4MA 5L51A 2I2DA 2I2FA 3R0XA 4L5IA 2XCRB 2W4IA 3LY7A 3TBHA 3AF2A 4L0DA 1QCYA 5A1TA 4FXOA 1WB5A 2XB6A 2R7NA 3ACCA 3R6LA 1KPHA 2OT3B 3FHCB 1W76A 2BMDA 3KOOA 4IDFA 4TTSA 3SI7A 2DCMA 3WNZA 1DBSA 4KAJA 1LS1A 3BTVA 4GAEA 4Z4IA 4DLBA 3AUJB 4ECEA 2I4TA 5ALRA 3UYLA 5L6MB 1RSZA 2XUAA 1ZINA 9ATCA 5FO0A 5HX7A 3ZK9A 4MWBA 4F71A 5A0VA 3MD0A 1OFGA 1N25A 3A1CA 3TLEA 3VOBA 2OBMA 5K0LA 3PJDA 3OQNA 2AN4A 1RI5A 4IJKA 1ND5A 4J76A 2DBVO 4EUHA 3SN6A 1CK4A 5KKCA 2W0SA 1E6MA 1LSUA 3HEMA 4KTTE 5E6UA 2D5LA 4R0MA 4H6VA 4PO1A 2P9CA 2ORED 4DL9A 1EH5A 4JFAA 2BGIA 4FNOA 4U9IS 2A9RA 3A3YA 4M3NA 2BUCA 3ELUA 4YROA 2X9VA 3F4KA 2YC4C 5KWSA 3O8LA 5FL7A 2H2WA 3C5WP 4PIVA 4CF7A 2AXQA 2FMHA 2PEYA 1GGMA 3N76A 1TU4A 2ZLBA 4TSFD 3ZHQA 5KYVA 5IJ9B 1TUGA 2CY0A 2ZUSA 4RFLA 1TQ2A 3J7TA 3WMEA 1FTQA 4Z7QB 1US8A 2W2XA 4LRWA 1H1DA 1GV1A 4WFQA 1PX2A 1O94C 3RFFA 4C08A 4MW6A 3EXG2 3HVUA 3JAKB 1QHFA 1P5FA 4ZJYA 1KZ1A 1ZOIA 2H48A 3FVWA 2G67A 1NJ8A 3WYGA 1R9NA 2H5EA 4CL0A 4B4WA 2NADA 4N0DA 1UPFA 5K45A 4Z4GA 4LZAA 3DZDA 2P0EA 3M4JA 3N8HA 4MW5A 4PX2A 2FKNA 3HDYA 3KX2A 3AETB 3V8MA 3HXOA 1MJGM 1Q19A 1H1TA 4WA8A 1MH1A 5HF5A 1T2NA 2XCUA 1OXSC 1CUYA 1GPNA 4C4XA 1SHTX 4ETMA 3ETEA 4KXFB 3K1JA 4OLFA 1SVNA 3UQYS 3CW8X 1CP3A 2PS1A 5C1OA 4BJ1A 1LF5A 4HATA 2WU0A 3LI2A 1DADA 3FOAA 4IP0A 3VU0A 1TA0A 1YTUA 5FA5A 2YTZA 1A69A 1T2FA 4OGFA 3WGGA 5ICMA 1WW3A 1N1EA 2CLOB 2ZW9A 4GKKB 1U5BA 1YDGA 1CEQA 2OKCA 3FN4A 3PQDA 221PA 2WT4A 5FUVA 1E9SA 4AWXA 1DG9A 4F60A 2F6RA 5AOVA 5A4MS 3KVRA 4AM8A 1WPRA 1KQPA 2V59A 2ZULA 4R1NA 4IJ6A 3CZAA 4NG5A 4DPKA 1ZJ4A 2ZYRA 1Y3HA 4EG8A 4LNHA 3F7OA 1DRWA 1FNCA 4RFSA 3OIDA 1QP7A 4N0QA 4YQZA 3RUFA 1Z0ZA 4BLVA 4GFDA 4RVFA 1ZJYA 3T5DA 3H5LA 2LKCA 3KSBC 3IKMB 1OB5A 1D2NA 2AXPA 3K5IA 5BR7A 1PG5A 3N6VA 1Q84A 3U7IA 4NYMQ 2Y1XA 3H5AA 5EOVA 2PUTA 1SN7A 3PR3A 7MDHA 4Q1BA 5LL6P 3U4AA 1VKHA 4PQYA 1OU0A 1RYZA 3EZGA 4RD0A 3KZVA 5K3FB 1W47A 3AIOA 4FEYA 4TKZA 3OQHA 4CNQA 1KI6B 1XCPA 3LP6A 3QVWA 4PX3A 2PRSA 2VSFA 2BOVA 3R3YA 4ZV9A 1OFUA 1NL3A 4DA0A 4RY0A 1YFZA 2RHWA 3SR4A 4BNIA 4EG5A 3FWZA 4RNCA 4QOHA 5FNZA 4A2WA 2RJOA 2QR5A 2V45A 3ZBQA 3GEEA 3HDTA 3Q9LA 1CR4A 1JWBB 4NSNA 4XZ3A 4YUAA 3LUHA 5DSTA 5EQJB 3CNOA 4PPNA 4ZVNA 4ZAZA 2W6ID 2X58A 4YCLA 2PLRA 3S2SA 2WTAA 2WWHA 1ISGA 2Q1XA 3DBIA 4PNPA 2RBEA 3ZYCA 4HSGA 2WI8A 3CRVA 4BXOB 2AR9A 2BM8A 3JPWA 4S1WA 2ZAOA 5FR2A 5B58C 5THKA 4DC0A 5FWYA 2EKDA 3RRJA 3RUCA 1HXHA 1R6TA 5A9SB 4RD1A 5FBHA 3LDGA 2B36A 3SJAA 3CT4A 3RYIA 2B8TA 4BY9E 4MAAA 1JPUA 2FK7A 2G25A 2QIOA 2UUOA 1RI3A 4MYHA 2CSXA 4Y2JA 5EJ6A 1SKQA 4G2NA 2Z8YM 2H1FA 1SUDA 1SUIA 4BP8A 1YQXA 2J3IA 2BBOA 3LPMA 2GVZC 1IATA 3KWJA 3L8ZA 4NYIR 4Q18A 3D2CA 3S2YA 4OX9Y 4LFBB 7ADHA 2A5YB 1IBRA 2A1UB 1OH6A 1W94A 1C3OB 1SELA 2BZGA 1OAAA 2COEA 5LUBA 2VZ0A 3ADBA 4E22A 1T5DX 2Q9CA 3A36A 4BV3A 5AK4A 1MB9A 2SCUA 4CDNA 2GSWA 4OJNA 3KO8A 4I6GA 4B4VA 3N0TA 4GYKA 1ZW1A 3ORHA 4JLAA 4UU8A 5FPPA 4AJ1A 4A92A 5KC9A 1O6BA 3NVDA 3GC6A 3ZY2A 2ZI9A 2WKWA 4YJGA 5DNDA 3R9IA 4I1PA 2A94A 1QYRA 3BAZA 3VR3D 1WCIB 2C04A 1G9XA 1KVUA 5K3SA 5CK5A 3K73O 2IK8A 3CQ9A 1HV8A 1RJ9A 2VBFA 2A5FA 3F8SA 1EP3B 1FRQA 3AFHA 1ZGZA 3NYQA 5CCDA 3WE7A 2YVUA 4GPIB 4C2AA 3SIRA 1XD2B 2XA9A 1Y7HA 5F9FA 1JDJA 2NYVA 4LRSB 3ASYA 5EHNA 4YMUA 3SM3A 4XW2A 1KIMA 1LJUA 4NL4H 5DWVA 5FPQA 2UZ1B 3T4UA 1JPVA 3A1SA 3MOIA 5PGMA 4JXZA 2ODNA 5JZBA 4CLEA 5DLEA 4LJ8A 1Z4OA 2ZUDA 3WLHA 2EP5A 2XKAA 1XZJA 2XVYA 4RZ2A 3DL2A 1CYDA 1NRIA 5EHIA 3SZ3A 3TZCA 5BVGA 3H7AA 2FCRA 2ZPUA 4DM7A 3PQEA 1CR0A 4JC5A 2P35A 2GK6A 4EI2A 3I09A 5KYYB 2HSGA 4E08A 3RYCB 1NF2A 1F17A 4IICA 1HC7A 1YZLA 3NIBA 2CMFA 3U1VA 1O77A 4F9EA 1CDDA 1HTTA 2FF5A 2JJ1D 4ZFNA 1WY7A 3BCSA 3LY9A 2P9BA 2V0GA 3LHSA 3L4JA 1Z68A 5G2OA 4BJ6A 1J0BA 3QEJA 2WLSA 4HAXA 3GRAA 5I4IA 3UKOA 1LCIA 3I39X 2DEUA 2ZUFA 3IOCA 2QU8A 2X76A 3C8MA 2OCIA 3FIJA 4DLVA 5EWJA 4WKOA 4QU0A 2DY0A 3KQLA 5SZKB 1Z29A 5FUQA 1FMFA 2B1IA 1FSGA 1FW8A 4X3OA 4FWTA 1EQAA 3BYZA 3WLOA 2L82A 5CURA 2IHJA 4EL0A 5JJLA 3PJGA 1LXCA 1GP2A 5I8ZA 2PV7A 3CRMA 2NSLA 2WMYA 5F33A 4Z2YA 4H08A 1WA5A 1P72A 1XU9A 2B1RA 2VL7A 2X1HA 3UHFA 3OT4A 3WS7A 4HNVA 1I4WA 1ZMRA 3ET5A 1Z4PX 2XZTA 2DZDA 4WESA 4ZO4A 2BJHA 4MQFB 3U7RA 4UNQA 2IC5A 2QGZA 1VHJA 3ZV3A 2C7VA 2G1UA 1PV1A 2V7QA 3ELWA 4L22A 1ZJJA 2CD9A 2QN2A 3DKVA 3HWRA 4IWNA 5EJ9A 3ABSB 4A8JC 4M9UA 1AHNA 1GYQA 3OZTA 3RKRA 5F1YA 3U3KA 4F5YA 2QTNA 1AS0A 4NTZA 4KQGA 4NF2A 3TEFA 2FMXA 2RHHA 1K6IA 3A6JA 3PXCX 4P4TA 1KAMA 1LK5A 5C35A 3FLMA 4JNKA 3LXMA 3L6CA 3QYPA 4UCFA 1FQOA 1H23A 1K9SA 1P2SA 2W43A 3SFTA 4MLZA 2ZU0C 4BIIA 5BRAA 1QF7A 3TZ6A 5I7HA 3MHTA 2RHOA 2IP4A 3BK7A 2DPHA 5HKLA 1JN0A 1Z0AA 2EGHA 2W2QA 4GI1A 3VH2A 5DTEA 4PTLA 2X1VA 1UM9B 2XD4A 5T4HA 1NF3A 3AUTA 5JCZA 1OX6A 3TL3A 1F8XA 2VJAA 2JANA 5BNWA 2FZGA 2ISQA 3K0KA 2QR3A 2IGTA 4A5SA 5CA0A 4CLOB 1DAOA 5IWAB 3A2KA 3V7WA 3M6AA 4S1OA 4AJPA 5TGDA 4ZI5A 1M1XB 3TZKA 2RD2A 1GEEA 2AMVA 2DKOA 2JD1A 3EOBI 3OX2A 4Q1FA 4Z49A 1AU9A 1X0VA 4IW3B 3V80A 4BP9A 1PS8A 1QR6A 2J3LA 1IL0A 2X9LA 4G67A 4Q7KA 3TQQA 1J8DA 4JKIA 4YACA 1I7LA 3Q0EA 2QRUA 1I8TA 2XYGA 3RREA 3R6WA 4L50A 4PG6A 1LRKA 4AY4A 2YQ5A 4F5WA 2I62A 3KKKA 2C29D 4C1BA 4IO1A 2JFFA 3ABOB 3EAQA 2G5TA 3A2MA 1T1SA 1ZEJA 1ZRMA 3M3DA 3KAKA 2ZIEA 2V58A 2ZB8A 4E5PA 1BHJA 2JEOA 2WJ6A 3B1ZA 1WVMA 1MQSA 2AQIA 4I1UA 3L8DA 1D2CA 3UG7A 3PXAA 2ZS9A 4X8HA 2UAGA 4EFMA 3HDQA 2ORVA 1W5TA 3OPQA 3TJRA 3TX6A 4UVHA 4DMKA 5M34A 4OHCA 1JEOA 2FPOA 2FWMX 2HDNB 2JGEA 2W0MA 2HF2A 3G9TA 4MUKA 1IIRA 1NQAO 4U4AA 4CYMA 4YT8A 2KMLA 4LV8B 4P2BA 4QPJC 4A8JB 2L2QA 5JSZB 1YA6A 5FPYA 2BTQB 1HDIA 1WXWA 2XKKA 1C3LA 2H2GA 4XJXA 2WSSD 4C5BA 3P9IA 4N6GA 3TB6A 1RYYA 4B2YA 3U44B 1ADGA 1G21A 1E0JA 3C74A 3VJKA 1ZK0A 4Q7MB 1XEAA 2D1QA 1R6XA 1NV9A 3PQ3A 3BN3A 2XT0A 5T64A 2F90A 1SCIA 1A9XB 5BSTA 1VJRA 3T7RA 2WVGA 2UZ0A 2IF2A 1AF7A 3IIJA 4HQKA 1AUPA 3L5KA 3BWMA 5DW3A 3RBVA 3GUHA 4EJSA 2J3EA 4V0SA 5G02A 4K6HA 1LW7A 4E7PA 3IJEB 4FDAA 1W4LA 4PM4A 1CP2A 2NZWA 4ZPXA 3ZBTA 4AUKA 5I9NA 2IV7A 1PS0A 5KTSA 1KAGA 2Q5IA 3NU1A 3TI7A 5GQSA 5FOUA 1DKUA 2OK7A 1CJUC 3TSAA 3KJGA 3H0KA 4UASA 3WWPA 4BGVA 4E5NA 2IS1A 3N0VA 1NBMA 1U8ZA 5JJKA 1FXSA 4MV1A 4LDQA 3UV7A 3FX2A 1LRLA 1S3FA 2A0KA 1SJ9A 4R3WA 2EBFX 4DNQA 2K2WA 5AM2A 3ELBA 1ML4A 2GM3A 3OIWA 3TINA 4B87A 1L7VC 5AJHA 5TMBA 1R5BA 5BR8B 1KL7A 3KD2A 4JB0A 1U98A 5ERXA 4U00A 5FWAA 1QG0A 1RAHA 4KQ2A 3KZMA 5TB5A 4CMIB 5DBHX 3EIHA 1U0TA 1PVOA 4BGDA 1G5FA 5DTMA 4GGOA 3KCNA 5IJ0A 4US2R 2I1LA 3D7RA 5IKMA 3NIGB 4JJ6A 1W0JA 5TGTA 3ZUPA 3EZ7A 3M6MD 1F8UA 3SZUA 1O08A 1CUFA 1RYNA 1WCV1 1V25A 2GEUA 1ILEA 1SK8A 4BO0A 1L8LA 4DDKA 1M8PA 3RBXA 1QO0D 4NBRA 1ESCA 1ECPA 1WDTA 4QVKA 4PSCA 1IVSA 5CNIA 1YVRA 2HXGA 2DH5A 2FX5A 4CF3A 4I9FA 1U7OA 3MNFA 1V47A 3IPAA 3MIZA 4WLEA 2CL6X 2QMOA 3Q5EA 4YHBA 3VZPA 1OR8A 1KKUA 4BN4A 2F1JA 4C07A 4RD3A 4Q9KA 1Z0FA 2BI4A 1G3MA 1E2UA 2B99A 2HCRA 2YV3A 2ZJAA 3CH6A 4RMIA 1AKTA 1NBAA 2R1TB 4BQPA 1TJ4A 2QI9F 3PC4A 2R48A 4E1BA 3FI9A 3EFOB 1ZVMA 2QI9C 2JIOA 4DV2B 4DJFC 4DLXA 4DZRA 1BG6A 1CLEA 5B7GA 1EK0A 1P44A 2K87A 5BUSA 4LX8A 2HNBA 4KPUA 4YJKA 1Z0SA 1C5KA 1UC9A 1TEZA 1XRRA 1TK2A 2F3TA 3DT8A 5E1DA 4UBNA 2ASEA 2WHYA 4K05A 4AIIA 5JMTA 1TCCA 4UAVA 1KS9A 2RJNA 1JI3A 4LDPA 4QATA 1TUIA 4EPVA 4IX9A 4XX0B 4E2ZA 5A7FA 3AP3A 4GMGA 3DV0A 4IIGA 4W1RA 3VAZA 1IU9A 1WKCA 4FHGA 4X1KA 5C8YA 2NUPB 4JI3B 4OG2A 3K2EA 3JAWA 4FP9A 4GR4A 5K6RA 1DWOA 4G5HA 2FZWA 3EZ6A 1HNWB 3G0DA 3DTTA 3Q11A 4U39A 4XH9B 3G2KA 5B3LA 2BR3A 4OXYA 1PDOA 3K8OE 1DVRA 2JZCA 1BIFA 3KKZA 3EZNA 2CXSA 4IVQA 1YL7A 2DPYA 4ND8B 1TEVA 3RAJA 3SYTA 5IT4A 5KOYA 1ZS9A 3CVWA 2NP6A 1JR3D 4XDGA 1E79D 4AJJA 1ODJA 4QTUB 2ZZNA 1CZOA 1E5TA 7GPBA 2G9ZA 3AWDA 1QANA 1E3WB 2ZEJA 2C8JA 5DIZA 1JLMA 4B6QA 4CQLB 1PR2A 4Y2RA 1QYVA 3AXTA 8GPBA 1G3QA 1E61A 1Z4IA 1N33B 2IBMA 5HDQA 4RLQA 1F0YA 2PLAA 5HM6A 4B9AA 5TQVA 3QX3A 1H69A 1HGXA 2Q5OA 4ER5A 2B98A 1ACLA 1L9XA 1Q7BA 2QXUA 1JZQA 2I91A 3KOUA 4ZOAA 1OH7A 1M2VB 1MFZA 4Y2PA 1AGYA 2NV2B 5DTIA 3RO7A 4RJTA 2AF4C 5B3KA 4GYJA 2VJDA 4J0CA 1RRPA 4ZVTA 5L45A 4G3XA 1D6NA 2FN8A 2FPRA 1HEIA 2WSMA 3RBAA 5JECA 5EIXA 2ZI6A 2W2VA 2M1XA 1R16A 3KOMA 1IPFA 2ZIXB 3AR7A 2O8EA 2C2XA 1MCZA 1ZN2A 3VI3B 1M34E 1QTNA 5B55A 5BW8A 3PIDA 4EPYA 3BIJA 2IVFA 3P52A 4TTAA 5H80A 4JMPA 4OFZA 4HXEB 3C7KA 1C7JA 2H11A 4YR9A 4OGWA 2OECA 1YGYA 3I62A 1Q0LA 2J4CA 3ZDCA 4BMPB 1HK7A 3FZNA 2Q2NA 3OSUA 3ZU4A 5DM2A 1TD9A 3ANMA 1M2HA 3EGEA 4IHJF 3UAWA 4OPMA 2FZKA 3CCFA 2F00A 1RR6A 3HB7A 4U2EA 1W36B 2CEAA 5EJ2A 1Z5WA 2VJOA 4BVLA 4U02A 5CLQA 5KQLA 4Y98A 2QMZA 2FR1A 2VTBA 1EBUA 4RVHA 2I71A 4BVHA 1PT7A 1GYPA 3BK2A 2P9JA 3LFHA 3KB2A 3G2JA 3PDWA 4CQMA 4Q4CA 3KB1A 1GGEA 1Z17A 2A14A 3OZ7A 3Q9UA 4A2PA 4CMBA 2OXIA 3BQNB 4QEKA 1P4GA 1UF9A 5K2MA 1O5OA 3VUEA 2XZDA 4QNMA 2V1UA 4YXWA 1M54A 1UDAA 3MJSA 4YUVA 4CLRA 4UPVA 1JLHA 2YC2C 1ADFA 5KTNA 4OI2A 1S2DA 3M5DA 1NLZA 2BP7B 4Z5XA 1WUTA 1T4CA 3JQAB 3KT6A 5K3CA 1DEKA 5CJ2A 5CCXA 1F5SA 1W52X 1ECCA 2H06A 4GX2A 1X38A 5AHWA 5FB3A 3WLTA 1GDTA 2QTVA 2OILA 3W79A 3CH7A 1J5PA 4DMHA 4KO1S 4AKHA 1TO6A 2EXXA 1UMBA 2FPKA 3E2PA 4ENQA 1Z12A 4H3KB 2V8OA 1IPEA 1U0RA 2H08A 2Y76A 3IR6A 4OLJA 4XKJA 3THWB 1ZR2A 1USKA 1ZD9A 2RB4A 1K3FA 1X7WA 2JRLA 5GONB 2XKBA 2JKZA 4QIHA 3N9IA 5DM60 4Z4HA 3D59A 4LXTA 5K8LA 4UE6A 1VLZA 4RK6A 1Z5ZA 2EP7A 5LQUA 4BL5A 3ZHOA 1DXQA 4BEBA 3KKMA 2V3CC 5BNTA 5TRTA 2GWRA 1T9BA 3P32A 1PJ4A 1YZQA 1N2CA 2PYZA 3LRPA 3MC1A 3WLQA 2XB9A 4ER6A 2WD7B 5EIAA 4DPLA 3L8EA 2C9BA 5H8WA 2I5PO 4W63A 4GZLA 2EV9A 2FUG6 3COWA 2ZWIA 1IOVA 3D5TA 4P3PA 1LU9A 1UJCA 3B7WA 1U7XA 1DDIA 1E2MA 1UMDB 2JIRA 2SHKA 2I7TA 2ZROA 3ESRA 3KK0A 2XITA 5ARCA 5LQAA 2BMAA 5GINE 4UHJA 2R85A 3MPUA 2RSLA 1M67A 5AFSA 3GF4A 3MQFA 4IJ5A 4IRMA 4O4JF 3AUXA 3DHEA 2H00A 4PHTA 3ZIAD 2BT4A 3L8CA 3OZFA 4TS3A 4DQXA 2H2IA 1FS5A 2GK4A 4U3JB 4I3GA 2YNMD 5JYEA 4DN6A 2JK1A 2XKJE 4MRVA 2DPXA 4TLCA 5MGNA 2XAUA 2O3JA 2Y1CA 3VOSA 4FJ1A 1I1NA 1RE0A 1KH2A 1J23A 1SXJA 3O83A 6PFKA 1HZZC 2V3WA 4NNOA 4X91A 3TMYA 2AOTB 2YHIB 3X2SA 4MR9B 3C6ZA 4HAYA 1KEEA 2REOA 4NYMR 3EGXB 3ZWMA 2ZTHA 3LH5A 5CM9C 4UOQA 3U49A 4MULA 4C6TA 5KYTA 3EWAA 3OAAA 3BGDA 1YKFA 3MGKA 4NESA 1ARZA 1K7CA 1P6XA 1OV4A 2H85A 1XWIA 1XE3A 3E53A 3WXMA 4E4YA 3VR4A 2O5CA 3WSVA 3MB8A 1KYQA 2B1QA 4L57A 1YFLA 4DEXA 4HUQB 4RMHA 4Y1GA 1NX9A 3CS3A 5DULA 4IYJA 4IAOA 5CDGA 4RTPA 3ON5A 1EE2A 2QTHA 5C34B 3H9BA 4NG4A 2Y0PA 1YACA 3I3OA 4LOHA 4Z1MD 2CEKA 1UZNA 2DHRA 1Z6XA 1M6WA 3HSSA 4B48A 3CZMA 5EKXA 4DUGA 3LPCA 5IH7A 2O8DB 1J24A 3FNFA 4BO9A 1LBHA 2XA2A 2AHOA 2I99A 3PENA 2IXGA 3LKVA 4WCFA 3NTOA 2XECA 5DEIA 4BFZA 2QTBA 3KS9A 1PDWA 2PD4A 4UBKA 1E3DA 2JGRA 3RVJA 1PR6A 1UBGA 1EFDN 3FCUB 2F7SA 3P20A 4O4JB 4W5WA 3ROPA 2D59A 3R7BA 2CF5A 3DAOA 3RQIA 1C30B 4JEIA 4WFIA 4EJMA 4DUYB 4F06A 3LFTA 2BFNA 1EVKA 2Y8EA 3VOTA 4YO7A 3N86A 1YJQA 3I8OA 1YZGA 3BRWA 4UEQA 2H5IA 3DZFA 1HLGA 4E7OA 2A7QA 5BSVA 4IJQA 2HA6A 4XOUA 2DUUA 4XUEA 3OEHD 3NW9A 4Q3OA 4EG1A 4KWTA 3QY0A 4Q4JB 4UDOA 3QEMB 4G5GA 2MINA 4DNPA 4I2NA 1KDPA 3H5TA 4D41A 4FUTA 5KTTA 1VG0B 1JNYA 3CG4A 1YB2A 3NC1C 4KQ9A 2HIHA 4NDAA 5KJ1A 3D4LA 3RJ9A 5M7EA 1MX1A 1KI3A 3ZQ4A 4LVUA 1EHCA 1GILA 3H5VA 4QQKA 1QP4A 3ESCA 1VE1A 1T9KA 3OPYB 1GPH1 3RKUA 3FDZA 3FETA 1KI7A 3RRXA 3TX2A 1ZD3A 4KFCA 3FZGA 1U5AA 1LUAA 1DKRA 1W35A 2HU8A 4TMWA 2B5WA 4AY3A 4I08A 1UC4B 2NVOA 4KNWA 1A5ZA 5BMVF 1VG8A 3FI0A 3A14A 1A5TA 1ZHFA 1T3GA 1YGPA 2I8LA 4ZJZA 3N2IA 4FHZA 3WP0A 1DRUA 1ORTA 2HA7A 3C45A 2JLAA 4F6RB 2VP0A 3PPWA 3COYA 4CN8A 3TPZA 2R4QA 1J0AA 1IVNA 3DZHA 1GNPA 1ZJ6A 5EA2A 1MVOA 1QHYA 2HD4A 5TPWA 3KJQA 2WAAA 3P9ZA 4L6IA 2QMQA 4WFJA 5CDHA 2P2YA 1CRPA 4LS3A 3ZDFA 2J85A 4AJIA 1B3BA 4ARBA 1P6UA 2I76A 4R0NA 5C51B 2O7NA 5TLSA 3NAQA 5IVIA 1OH8A 4WK6A 2WSBA 1IN1A 3K8QA 5DXFA 3MCZA 1HG0A 1XROA 4W9RA 3EVGA 4FFSA 5B58T 3V1LA 1TW2A 1L7OA 3OHMA 4CRWB 1BRTA 1QHXA 4FE3A 4HNUA 4AX4A 1YBHA 1QGZA 4QG7A 1QRDA 3MBIA 5EUBA 1U65A 2V6JA 3GCZA 3M5CA 4I1VA 1SG6A 3O4JA 1C7QA 3TQCA 1VA5A 4CIDA 4L2IA 5F3DA 5FTKA 4AX8A 2H16A 1JXAA 1PZFA 4JT2A 3WOVA 3OEED 3H86A 2PO5A 3F3KA 3K70B 4GXQA 1KR2A 1FEZA 2SKCA 2ZWPA 2J5RA 4OHPA 3K8ZA 4X85A 2VPWA 1CDOA 3ABIA 4H7PA 4JUBA 3NBKA 4PG5A 1DL5A 3E1GA 5GZ1A 3KJFA 1UOOA 1E3IA 3GUVA 3LUJA 4MTLA 4WJZA 4W9NC 2V7TA 3CSDA 4DCMA 1E3EA 5J63A 4D4KA 4EJSC 4J43A 4UKDA 4N5DA 3MGBA 3F5FA 2JLQA 2HRBA 3TPCA 3IUYA 5JC1A 1QAQA 5IJXA 1W48A 3SYKA 3PKZA 3BS4A 3AJRA 2QKYA 4JXJA 3RUEA 1UDBA 5BMVB 3SZRA 3ZD7A 3PV0A 4IZ6A 1Z15A 2Z58A 3EXG1 3RFVA 2FZ4A 1WZNA 2WJHA 2GK3A 1W4BA 2XCSB 1UXIA 1SCBA 3A9CA 3K1ZA 4ML3A 1JH8A 4U2BA 5TIIA 4U7WA 2RHCA 1W25A 3M70A 2X5NA 4LHZA 3T3DA 5JARA 3JWPA 2VKTA 2JG3A 4I9UA 1ODCA 4CTKA 4FW9A 3UMGA 4ZMBA 1GDHA 5GWXA 4HQOA 3MUEA 1MEEA 2HT1A 4UC0A 5DX1A 4IINA 5AVUA 1V5GA 2LUOA<