2E85A

Crystal structure of the hydrogenase 3 maturation protease
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
156
structure length
156
Chain Sequence
ASAVTDVLLCVGNSMMGDDGAGPLLAEKCAAAPKGNWVVIDGGSAPENDIVAIRELRPTRLLIVDATDMGLNPGEIRIIDPDDIAEMFMMTTHNMPLNYLIDQLKEDIGEVIFLGIQPDIVGFYYPMTQPIKDAVETVYQRLEGWEGNGGFAQLAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hydrogenase maturating endopeptidase HycI from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Hydrogenase 3 maturation protease
total genus 39
structure length 156
sequence length 156
chains with identical sequence B
ec nomenclature ec 3.4.23.51: HycI peptidase.
pdb deposition date 2007-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01750 HycI Hydrogenase maturation protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HybD-like 2e85A00
5IJAA 3PU6A 1CFZA 2I8LA 1C8BA 2E85A 2KMLA
chains in the Genus database with same CATH superfamily
4XQGA 4S0XA 1Q95A 1XAJA 2OTCA 3JQCA 1DEOA 1QFXA 2YC2C 3B48A 4U02A 3VNBA 4E2YA 5IHXA 1AZSC 1P0PA 4J3JA 5AVZA 5KYGA 1NR1A 1P5ZB 3DLHA 4G1CA 4U2KA 2PIDA 4X7RA 2ZI9A 4IQFA 5BRJA 5JU6A 1JR4A 3NHSA 4RL6A 2QTWB 3W8EA 4YV2A 1Z6GA 1EVYA 1VPEA 3O2NA 4FOPA 4GOKA 2X0JA 3C7KA 1HNXB 5EHGA 3JVDA 3C3XA 3K4HA 2BFPA 3NORA 1V6AA 1GPAA 3FOWA 5K6AA 4RZXA 3U7HB 1H1TA 4JJ4A 4RA6A 1Y9ZA 4O1IA 2ES4A 2EW8A 2CE2X 1JALA 3I1JA 3WZLA 1QNLA 5IAAA 3KT0A 4D6XA 3TNFA 4K3UA 4J90A 1DPGA 4MQUA 3OCUA 2M1XA 1V45E 3EZFA 3Q3GE 4UFOA 1IB6A 1C3EA 1D6MA 4BNDA 2HC9A 3OOYA 5KYNA 4B3HA 3P5SA 1NQAO 1BW9B 4MVWA 2ZSDA 5EMKA 1H2FA 3N2YA 5DNVA 5CA0A 4TS3A 4ZVPA 2R8YA 2ZUUA 2Y9MB 3KX2A 4QREA 4JI0B 3EC7A 2D1QA 2VJLA 2IVFA 2YR0A 3RUHA 5H7XA 4WFIA 4CF7A 4N0QA 3RC1A 3ZXUB 1E0JA 2BUBA 3A6KA 5A6SA 1RXUA 3DCYA 3E3OA 4J9VA 5H80A 1PQYA 4KBFA 1Q3HA 2FV8A 1YQWA 3UJAA 1GSOA 5I9NA 5IUKC 2RAVA 2PU5A 5KINB 4F92B 2J7PA 1KEEB 4BC0A 5KTRA 3T1TA 3RSZA 3K5WA 2C4HA 2FSSA 3CUYA 4KKXB 3GNTA 4P1ZA 2QRQA 1U9JA 4HS9A 1G7TA 3MB5A 3MRXA 4AW9A 1IEWA 2DJ5A 4W1RA 1F0YA 4UNPA 4CM8B 5KNBD 1FNSA 3HJNA 3KVOA 2QUAA 1P1BA 3PUZA 3YASA 1IAVA 3DMHA 1LI4A 2DAPA 4FFVA 1M0TA 4LY3A 3U3ZA 4JIGA 3RRZA 3Q4GA 4YR7A 3BXEA 2C2WA 3D3NA 3DE4X 4WCFA 5EERA 3VZPA 3RREA 2FN9A 1ORHA 2HU8A 2MINB 3AF0A 2BFDA 1BU8A 1W4LA 3EXHB 1CNFA 2V7QA 5H83A 3AY0A 4G0MA 2WJHA 5ALWA 1Y63A 5H59A 4ZQFA 3SLGA 4ZEXA 2NIPA 1XUOA 3F46A 3I73A 1RVDA 2OD9A 2DYKA 2QZ9A 3M0EA 3M6XA 1KDTA 4BC1A 3NHYA 5ENDA 2J9YB 3H9BA 3OOEA 3ESBA 4RPCA 2OK7A 3RT1A 2CNDA 2VNJA 1QP0A 4TV9B 2GDJA 1E60A 4KQMA 3PICA 4UM5A 4CL8A 1P4SA 1QIEA 4KFCA 1T34A 3WRXC 3L0CA 4YN3A 4ZEMA 3MTDA 1OXSC 5KSZA 4INPA 3QSGA 3BTOA 2XR1A 4M3NA 4N76A 4FMPA 3I09A 2X9VA 1E3WA 2XVYA 2FW7A 2ZYRA 3GLKA 4UNQA 3SYLA 3KQLA 1WDLA 1XEAA 2WRZA 4UHJA 3AONB 1TMKA 1XWIA 3IP3A 3X1ZA 3TVDA 1E7WA 2XEXA 1EU1A 3ZWNA 3IDAA 4WCFC 5JI3E 2ZI7A 4HDMA 3QJ5A 5CURA 3OZEA 4FHCA 3CQ9A 4LF8B 3HDQA 2GDZA 2Q27A 2RG1A 5EXXA 1AK1A 5FJIA 1HDOA 2NZYA 3CB4A 3WGLA 4DDKA 3VFDA 3NT2A 1XXHA 4UPEA 1RBYA 1YBHA 1S3IA 4TKMA 1Y1LA 1Z5PA 1C9YA 2AVDA 3DYBA 5E8JA 1SVWA 2X13A 3GHHA 5C3UA 1NZDA 1P5JA 3DZCA 3EIWA 4KPFC 3RTAA 5B4UA 3OZVA 3HUUA 4YV0A 3OSUA 3ULKA 2G71A 3I9JA 1UOQA 4ASUA 3FYDA 1TKCA 4HFRA 1F2TA 2VP0A 3QNWA 2HLPA 5HBGA 3QZUA 1UZUA 4V0MA 2WM8A 3VNAA 3IXQA 3K94A 4D3DA 3JAMA 1V5EA 4NARA 3QVUA 4I3FA 1SB9A 1UZNA 3QOFA 1ZGCA 3GBSA 1S3GA 4MP3A 2YIJA 1I9CA 4P54A 1T9AA 1UBKS 1XR3A 4E5DA 4D8YA 2J33A 1GPWB 2OD2A 4L78A 5AVJA 1V16A 4OBXA 3ICOA 4QSHA 5FPTA 3W5AA 3B60A 1EX6A 1IVSA 1GTMA 1HZZA 1U2QA 2BE7A 2QD2A 3L2OB 4NDNE 4W5RA 4O33A 1Q44A 2C9OA 4H0NA 3AR3A 5TMEA 1M1ZA 2QY9A 2HBZA 2XSZA 5H0IA 3Q98A 2FQXA 2G4CA 2XMZA 4H7EA 3SQMA 3BTUA 2E4VA 4JLVA 4QUHA 1L3CA 2G08A 1YSCA 2P7HA 5FI0B 4YREA 4Z3DA 4BO5A 4YH1A 3BMXA 4K40A 2CFSA 1EWKA 1CY8A 3O0DA 1M1NA 3ZN2A 1EFDN 1JLHA 2XBUA 4L3WA 3ZCPA 3UY4A 4WAUA 5KJFA 4ARBA 4IDHA 2CDRA 3IBFA 5ED4A 1GSHA 4GZ3A 2OXEA 4PGHA 3T7DA 2X4DA 1QAOA 2FWNA 2Z4SA 4MUHA 2E4WA 2CV0A 5DHUA 4HQ0A 5LWQA 4XGIA 1PCXA 1OFUA 4EJFA 3CW9A 3G17A 3K2IA 4PXYA 4EG8A 4GWGA 2Q3LA 3Q9NA 5I01A 1PU2A 1F9AA 3KPJA 3QY0A 4JL6A 5T57A 3RS5A 1VIMA 3W5SA 4V2UA 1EZ4A 2BKLA 3D8TA 4Y6SA 4ZVTA 3T7CA 1KDRA 3LDUA 4WBNA 3K9CA 3FSRA 1XZMA 2I6TA 3O8QB 3QVXA 1J49A 2X19A 2XI4A 4FDAA 3HZZA 3IDQA 4I19A 1NUTA 2P1DA 2IZ0A 1KVSA 2H0RA 2VYFA 2IX3A 2C4VA 4YLYA 2LXNA 4NENA 4DLVA 4GXNA 1EYZA 4I7EA 1ZK2A 3DSRA 1MC5A 2X8LA 3IAUA 2WP8J 3KYJB 2G9NA 3PGA1 4BBJA 4EL0A 2GSDA 2Q5OA 3L4KA 4GYJA 3F4BA 3VU9A 4CR7A 2ZZMA 5AW6A 1V8FA 1GLGA 2D06A 2CMKA 2JCYA 4WACA 1NQWA 1SUAA 3KQWA 1UKZA 2YS6A 1E1LA 3PX2A 1OLUA 3VR4D 2D3TA 1DBVO 2ZRKA 3RQSA 1DKNA 3N74A 3JQGA 4GH5A 3EXIB 5HUQA 3RHZA 2HJGA 3BD9A 3PF9A 3A36A 1EGMB 5ILGA 3ML1A 1T8SA 2WHYA 4ZOCA 1GZ3A 3H4VA 1KH3A 4BFSA 1V41E 5FTNA 1E9EA 4MW0A 4INZA 3EH2A 3AVYA 1IUPA 5TPZA 3H86A 3WGQA 2C4WA 1XD8A 2BFCA 3EG9B 3OM8A 5LP1A 1Z34A 1KFKB 1A5BB 4CUZA 1JHDA 2GWRA 1G5HA 1BHO1 2WSBA 2WWRA 1ZUHA 2YTZA 4B33A 2IYEA 5A4DA 1HT1E 4CM9D 4PW0A 5HJ5A 3O9MA 1WL8A 4HLUC 3O92A 4HX2A 3EG5A 4O5AA 4MRPA 3L6UA 3WV4A 4WTOA 5CHEA 4IX9A 5KNDD 4HQFA 1KU0A 4Q9KA 2C8JA 2ZJ4A 2DM6A 1M2KA 3FFBA 3KC2A 1KK0A 2AUTA 1NUSA 1SURA 1GPDG 1W0KD 4E14A 5D2CA 2OO7A 3UPTA 3RUFA 4ZZ0A 3AF6A 4BHTA 5M5BA 3LI2A 1WMSA 1CZOA 2WJWA 3JD2A 4C43A 3Q7PA 5BUCA 2G6TA 5CA0F 2G28A 1EKXA 2O7QA 2INGX 2YWCA 3C6KA 4A1OA 1XTSA 1Y5IA 4UEWA 3QVGB 2QLTA 1KY5A 1L7AA 1E2QA 1F9EA 2Y77A 3EVDA 5AJWA 1F14A 2VDQB 3PZRA 3EX7C 1F4LA 2ECFA 1VA5A 1Z6XA 1NUAA 3D31A 3HY6A 5CGQB 2Q5FA 4WNAB 1JF8A 3WQBA 4DE5A 3ZKAA 1G20A 2FZEA 5H5JA 1JS1X 1GGHA 1OFHA 4YNBA 3UA3A 1UT8A 2FSFA 3ND8A 1UK6A 2I4MA 2JLAA 2VZ9A 4DNFA 4NNJA 1GPLA 2AOUA 1HE8B 2RKWA 1FRNA 1CYEA 1F1JA 1DC7A 1ZYUA 2FN4A 1HFEL 1NXOA 1ODIA 3DBRB 4P3XA 4Q37A 4QYMA 5E38A 2Z8XA 3DZ8A 3KWFA 3T9DA 4CV0A 4F4UA 1JDSA 3TMYA 3I37X 5JFOA 4O0LA 1LA2A 1NA5A 2G1AA 1V0JA 2X4GA 4TVKA 5HIAA 4HAZA 2V97A 3EB9A 4ZTBA 5BT9A 3RS7A 3T3MB 5CCEA 4DLKA 4I36A 1GY8A 1KI6B 4HNHA 4M38A 4UMVA 1B1CA 3UMFA 4DNXA 1DIOB 1YZYA 2ZSEA 1O9HA 2WV9A 3OA2A 3O74A 2Q3EA 2ZJ0A 3TI9A 1L3BA 4UE2A 3A05A 3TTTA 1XG5A 3C1AA 3L7MA 3CRVA 2AE1A 4YWJA 1OZ0A 3QELA 2P9FA 4D99A 1R5JA 1UOPA 3SYNA 2GKGA 4EZIA 4O4JB 1QKJA 4JP2A 3RJ9A 1MO4A 3WR5A 3GQBB 4LZWA 4FXOA 3K09C 3V1LA 1ZOPA 3QXCA 4JXXA 4EZEA 1ORWA 4LUCA 4W6QA 4BMZA 5HGXA 4AF6A 2B9EA 4NAHA 1R0LA 3ESYA 2XXJA 2WMDA 1KF0A 3EMDA 1Y4UA 2VHUA 1G3RA 2PQMA 4ARIA 4PRZA 1L7VC 2OCGA 2AD5A 1HORA 1OX4A 4MVJE 4URWR 4JVMA 3V1KA 2JFUA 4AJOA 2I9PA 2O1SA 4J6FA 2H85A 2L82A 3LHIA 3SQDA 3AKEA 5DX8A 2IYYA 1XPRA 1FNCA 1BWQA 1JVBA 4GVLA 3ADBA 1XB2A 1JRLA 3EGXA 1MH1A 3RYHB 3IUQA 2KLHA 4CIWA 2ZAYA 1W5EA 2B3TA 3DEAA 1RQXA 3OM0A 1S2MA 1NX6A 2XZLA 1RQRA 1DL5A 1ISMA 1T5TA 3ECSA 3WNQA 1TF7A 6AT1A 1R0CA 4G4GA 2HCFA 4Q39A 3ZDRA 3WGVA 4NE2A 1PLJA 1X0XA 4JEMA 4LA4A 2Z3VA 1CUDA 3R5SA 5G41A 5H1YA 3W2IA 3PI6A 3G8DA 1TVEA 1QX3A 1E8NA 2QN1A 5FP0A 4BVKA 3I0ZA 4CKCA 2C54A 5F1PA 1T9GR 3ZIUA 4NP6A 3CLRC 3FYUA 3ENWA 3IHTA 1FFXA 4HQ6A 5E0KB 1BD3A 1RI2A 3BQNB 3IAHA 3SSOA 3ZZUA 1TYZA 1OREA 5EWJB 4UVDA 3R5FA 2V54A 1XDDA 2IYWA 2ZTHA 2ZBDA 2QTAA 4WBXC 1F4VA 4DLUA 5ALOA 1ZXBA 4ARZA 4C4OA 1QYVA 4D8TA 4KV7A 2TMDA 5CX1B 5DBGA 3M6WA 3UAOA 1JFLA 3T35A 1Y1QA 5TGZA 1MVNA 4B09A 2FH5B 4JBIA 2LBPA 1H4VB 4WY2A 3M4YA 3QRWA 2Y2VA 1KBZA 4YRCA 1J0XO 2AV6A 3PDUA 4CBVA 5EKSA 2GF0A 4HH4A 4MGIR 3TKLA 4B74A 1E62A 1M1YE 2HCTA 3I2JA 4G0ZA 3S70A 2YVQA 3FRHA 2YWEA 4NXMB 1LBTA 4CIDA 2YZNA 3D6MA 5CYFA 5ELMA 3VMFA 4EUNA 4KQ9A 2C2XA 4IDAA 2QZJA 5L4NA 1F12A 4XJSA 1OV4A 1ZVJA 2AN9A 4IX1A 1H66A 3ANTA 2PAAA 2X2EA 3AMVA 3N5CA 5AKIA 3TLXA 1HDEA 1HLPA 3PI7A 2JFWA 3ETEA 1NC1A 3OMWA 1GU0A 1AHHA 2WJGA 4UM8B 1TLTA 2ZR7A 2QQ5A 3HGMA 3RK4A 1VCMA 4S0ZA 5KU1A 5LUBA 1I2MA 3O4FA 1S1CA 4UBJA 2GO7A 2QGNA 2ZS9A 3PEEA 1U98A 1PWHA 3JSXA 5CITA 5C53B 1IXKA 2VAPA 1MQAA 4IGKA 1RWMA 3GVPA 5F5NA 2XT9A 3CN9A 4CKCB 1I94B 1YBMA 2E5FA 5CD9A 1WXHA 3DDOA 4MW6A 3B6JA 1GNLA 3OOJA 1KKMA 4HVCA 1GT91 1U0JA 3Q1KA 1MB0A 3H19A 4XX0B 2C7BA 2XQKA 4AZSA 4ZDIA 3ZCRA 1RYZA 1O87A 3CPSA 5ICCA 4PC1A 4NU8X 5ALMA 2Y1XA 1Y7HA 1Y8QB 3EPRA 1AG9A 2OO5C 4QU5A 4D8WA 2H5EA 2JJ2D 5T3YA 4CKZA 5JALA 5TIIA 1PVOA 2ECOA 4DWWA 1JR6A 1JECA 4CLRB 2XV1A 4I8XA 4C4RA 4DAOA 1QPZA 3D6TB 1T4BA 3RYHA 1MC1A 3RYFA 2A30A 4E07A 2Y1GA 4YJ2A 5KDLA 1SUEA 4RWZA 4AB1A 3TFOA 1NQOA 4QYIB 3QVJA 2IBMA 1P31A 4HQNA 1YU9A 3PQEA 4IQ8A 2GK3A 1VRVA 4DM4A 1T5SA 3INGA 4RCZA 1Z4MA 4QZVA 4ML3A 3M1YA 1JDBB 2JZNA 2JFVA 4PHGA 4RGYA 5L6MB 5FORA 4M8LA 1AZTA 4XIFA 5CT8A 1INLA 2VPIA 4YFYA 1GRVA 4FFBA 1EFCA 4KRXA 5FI3A 5LC1A 4PY2A 1DPFA 4Z1MD 2OB2A 5A62A 1DXHA 1EEHA 3H99A 1CJBA 4KH1A 1AIPA 3B9PA 2A0XA 3D6NB 4MVXA 4MWBA 4R31A 3WKAA 1V95A 3AI3A 1EI9A 4BVLA 1JFFB 4IHAA 2WJAA 2BEVA 3OE5A 3BD7A 3DF7A 4REOA 1RPJA 2AZXA 3ZY5A 1PK8A 1FNMA 3RFTA 1IG3A 3VDQA 4NFSA 2H9IA 4DCNA 1B00A 1KI3A 1WSWA 2CLOB 3CMMA 4JP5A 1Z22A 4KO1S 1FVOA 4UDXX 4CGYA 1UJ2A 2BYTA 3RODA 2ON6A 2PA0A 1LSUA 4D2IA 4UUQA 1DBIA 3EEYA 5AO9A 4U5QA 3JU3A 4URHA 1S3SA 3KQVA 1UP6A 2A5FA 4ZXPA 1PV1A 4TTVA 2J0VA 3CURA 1EDDA 2VJOA 2OO3A 3AZPA 3WZMA 3LSTA 4A27A 5JCOA 4CLOB 1FJXA 3UJHA 5BNZA 2R6AA 1M5UA 4G4IA 2C1EA 3DPIA 2B4TO 1A2BA 1F0KA 4PLWA 2W9XA 1R6XA 1YKFA 2EGUA 2HPVA 3FD8A 5DP2A 5DNAA 4K6KA 5FJJA 2BJHA 3HY4A 5CYGA 2QTTA 3GDHA 4XSGA 5DHSA 1II8B 3CINA 4HDSA 3ZX4A 1TQ4A 3N75A 4GFDA 5DTQA 1YF3A 2IHYA 3SZ3A 2WVJA 3DMYA 3THWB 3H9CA 1UM9A 3DCIA 5CM9C 3HL4A 3D5EA 4Y18A 5EWLB 5DW3A 2GEVA 3BJMA 4RV4A 3B7GA 3PQ3A 3GOHA 2WZCA 5C81A 1XWFA 5AKLA 3BOSA 5G3ZA 1ISGA 4GKAA 2O5EA 3C3CA 2QB5A 1EPUA 3LK7A 2YBEA 3IXMA 2FX2A 4CMIA 3D7LA 5ED0A 2AEMA 4TV9F 1J9GA 2B6NA 3HUTA 3IPXA 4AQ7A 2J32A 1A97A 4KR7A 3ZWVA 1ZUNB 1GQFA 2HX1A 1N8KA 2JFHA 3TBFA 2FMUA 3T3IA 4C21A 1G5PA 1T13A 4D5EA 3RUEA 2XE8A 3CBQA 2WF8A 4P35A 1PR4A 4AJIA 2PMEA 4EHKA 2GZRA 4YROA 3KB6A 1S0UA 4CRWB 3V7UA 3RTBA 4IGEA 1Y6GA 3IUSA 2AI3A 3D7NA 3PDHA 4OHCA 2TECE 2D1YA 5CT9A 1DX6A 1LSSA 1RWVA 1U8EA 3OZDA 5LQRA 2F9MA 5EE9A 2FETA 4M9ZA 2Q2WA 5KTSA 3QLUC 1LDNA 1E2DA 1OFVA 1K4YA 1WETA 1ORIA 1XAIA 4IIHA 3ZCUA 5JADA 4B4WA 1R6BX 2VC2B 2XDQA 2EP8A 2E9SA 3DAGA 3MGGA 2Z9CA 3JQGB 3PX3A 1MO3A 7MHTA 1Z47A 3CVJA 1LTQA 4G5HA 3VTZA 3JQAA 4HZGA 1ATZA 1GQ2A 3REGA 1G42A 3KSZO 1UXGA 3BEDA 3GMIA 2YNMC 2FVYA 4L1KA 4RFSA 3X1YA 2ZZNA 2IPLA 3A9VA 2BV3A 2CFTA 5B6JA 4Y9RA 3HKEA 1NATA 1B1AA 3T7SA 1LBHA 1RLJA 3HCRA 4GUDA 4DAEA 3OP4A 4MJLA 5J63A 2LUOA 3U1BA 3WZ2A 4H7IA 4M7RA 1NR5A 3CKKA 5BXQC 1MEJA 1NXTA 1AKEA 2V1XA 1M2VB 1XO1A 4HGNA 5IF3A 3C7DB 2IXBA 3OT1B 2ZSJA 2GHTA 3O8QA 4IYRA 5GZ6A 1YUBA 2GAIA 7ADHA 4DUGA 1XTPA 5H3CA 3N76A 1QRDA 2C82A 5J47A 1RWQA 1HOXA 1LY1A 3TBKA 1A7AA 2YJNA 4JLJA 3ZLBA 1N1MA 3EWSA 4I9NA 1LRKA 2VJDA 5TGTA 4JZKA 2EEZA 3C3AA 2OLEA 2Q3JA 1QGUB 1AU9A 1L4HA 1RNLA 3QYJA 3R09A 4CR6A 4DCPA 1KETA 4ROSA 3DMRA 1OXBB 2OFPA 4OQEA 3UHFA 1OXXK 3I64A 4NCHA 5GONA 4BOYA 2IEGA 4P3KA 1PWYE 4BKOA 4YAGA 2B4KA 3BDAA 3VU1A 2IKSA 3PR1A 2EHJA 4GXTA 1G291 3WVNA 1Z36A 4IWYA 4M9QA 3EDMA 5ALPA 2WOOA 1KR5A 1EFPA 5FA6A 1W5BA 2CNWD 2WSSA 1FXWA 1ZUWA 2QRGA 4W7IA 5D3QA 2PUBA 2MMCA 2F9FA 1XLTC 1SHLA 2OCYC 4M83A 2JCXA 3UTDA 4P33A 4TT3A 4FYYA 3OE1A 1U31A 2J3MA 3AR4A 4U2EA 3H7AA 1KO4A 4G37A 3R7SA 2G0AA 2IYTA 3EXFA 1JXMA 3AHIA 1VB5A 1CPYA 1Y3FE 1XK7A 4AP6A 2JAOA 1IN6A 4FHZA 4XTCS 3WNCA 3SXJA 2BZ1A 4BO0A 3KOUA 4ZT7A 3UJ7A 1ESNA 3GPBA 4P5EA 3VO2A 3WICA 4F2PA 1JQJC 3ET4A 4IMRA 4ZQIA 5JQGF 2ZM6B 3L7IA 4L3OA 1QE3A 4R9NA 4P38A 1E69A 2B5OA 3K4PA 1OLXB 1JIXA 3DZKA 4TN1A 3VYVA 4LZJA 1XHFA 3NBFA 2CJFA 1T6YA 2QAJA 4NI5A 3FVWA 3NKLA 4HB3A 4S1VA 2R62A 3GVHA 3H1PA 4Q3OA 3RGWS 4FX5A 1Q77A 4AXXA 4WZAA 2CD7A 4R8VA 1E7RA 3S2UA 1B6RA 1AXRA 2YIVX 3H0EA 1P9WA 5T4EA 2XPCA 3PEUA 4KQIA 4XPIA 5U4QA 3ZWQA 5CM8B 3K8ZA 2WUEA 3E22B 4TGLA 5HJ2A 4BZXA 3W1VA 4LF9B 1JHRA 2Q6KA 2IKQA 2JBHA 2QTLA 4NSNA 2VQFB 3EIEA 1SAYA 1W75A 3B5EA 4WLOA 3ROEA 1TPZA 1UFOA 2C97A 1B26A 4RPKA 1MFZA 4MROA 4TVOA 3FYSA 5KX5A 4HDMB 3W4IA 3E7DA 3L9XA 3GCDA 3T5TA 5BPHA 2W6MA 2IIQA 2ZWOA 3DW3X 4UFNA 5EUMA 2VTEA 2GBPA 2ALJA 1MN6A 3GVXA 4G97A 2AOTA 4BFXA 6NULA 3REOA 2R1TA 4REQB 1P9OA 3ZXXA 1TVCA 2GRUA 3LC1O 1LJLA 2DQKA 2GTPA 4B76A 4A0GA 2CJWB 2D1RA 2JNWA 2GJ8A 4PBSA 2Z6UA 1AQYA 3VDXA 1AK2A 3GLHB 4DV4B 3DD5A 3KTDA 1PKEA 6LDHA 5K6RA 4JI2B 3GUHA 1DBSA 5CEFA 4IG9A 2I33A 4O2AB 4D8UA 2FUG6 2FTKE 4Q7MB 1GKKA 3GG2A 3A6ZA 1Z45A 2I66A 2CMFA 5KVQA 1EG7A 2PNFA 3F4KA 2XECA 3HFRA 1NZJA 5FBHA 2HMAA 4C7MA 5IBCA 1VPDA 4IUYA 4JQZA 2P4HX 4KPUB 1XVAA 4WK6A 1X38A 1S9HA 4LY0A 4N7RA 5E6UA 3R7FA 1DOHA 4ER5A 4PAMA 4ZV7A 2YHBA 3IPLA 4YP0A 4IIEA 1NMYA 2XYRA 3TM4A 4YC7A 1I4WA 3FDJA 5B3JA 1FTNA 4G85A 3T1OA 4LDNA 1H5UA 3P45A 1IM8A 1A2KC 4GOLD 4F85A 1T5DX 2C4UA 1T8RA 3QK7A 4M99A 3VR5H 3D9QX 3L7YA 4AY6A 1K5HA 2HN9A 5AW4A 1XELA 2XOXA 4NQZA 4Y2RA 5A02A 1P6UA 4AWAA 1NASA 1NN5A 4DOMA 1QCYA 3K70D 5ALHA 3FTNA 3OZGA 4AKGA 5FFFA 1E6MA 2GPTA 2GAAA 5J4LA 2UXCB 2ZKLA 2KJQA 4BX2A 2KM1A 3OF2A 4CM8A 3OJ0A 4CFZA 1ELOA 1SVKA 2O0MA 3PWTA 4BWVA 5FL7D 4HDQB 4JLUA 1E2NA 1ZXXA 3R5HA 4MPJA 4PC6A 2ZJ6A 3RG8A 4I8DA 4EYOA 2QJWA 1QBGA 5JPIA 4IJUA 4AJHA 5I7OA 1AKNA 3C3EA 3EC1A 2PUCA 4JLMA 4C9BA 4MV5A 4NCJA 5I47A 1MB4A 1WUYA 4RGQA 5TEWA 4V0KA 3O84A 5TEVA 4XWKA 3ADDA 2X5XA 3Q3EA 3C85A 3M6MD 1KAGA 3I52A 2PYDA 3UJ6A 5LNK6 4JFRA 2PRYA 3P0HA 3KQKA 1R4NB 5JYCA 1OU4A 7REQA 4B32A 4EVIA 3JYQA 2FLWA 3OLXA 3ME5A 1Q7EA 4IDCA 1IOVA 3OTIA 4DRXB 3G0CA 4P6VF 4U00A 4UUNA 3TR0A 4B1FA 4BNMA 4BNDB 3JXEA 3HCNA 1XD9A 3PGMA 1W93A 3DFMA 5TT1A 3ABQB 1JPNA 1QUEA 2BDTA 3OCZA 4LOJA 5TC4A 4DBZA 5I9LA 4Z9YA 1M7HA 5I7FA 3MINA 3EN0A 1DRUA 1ADFA 1UBSB 3FUTA 3WNBA 1QBKC 1UQUA 4IJWA 4Y1RA 1VSUA 5ARCA 5KMGB 2M2IA 2NQTA 1D4FA 2AC2A 2D1FA 2JVIA 4CV1A 4F12A 2HLDD 5FULA 2A4MA 4ZVLA 1PZEA 2XCUA 3LPNA 3IC5A 4LJYA 2WTNA 3MN1A 4ZC1A 2YZ2A 3UAVA 1FXWF 3WLSA 1XI2A 2HA5A 1Y7IA 3DZDA 4UDNA 4O2AA 1JKIA 3K5IA 2XMPA 4Q12A 1V5FA 5F2EA 3R3JA 1FTYA 3KOOA 2H57A 1ZRMA 2ID8A 4FDTA 1GZUA 2XDAA 3A9RA 3MEQA 4MX8A 4BJHB 1ID8A 2FX3A 1U4OA 5BOVA 3R75A 3ZWPA 4EYQA 1QMGA 4Z3KA 1UKCA 2YS7A 3KE8A 5J5CA 3F74A 4D9IA 1C7EA 5JDIC 2GPAA 4REQA 5EMMA 3PJGA 4URVR 3HXQA 2AOTB 1U0GA 1LZKA 3I5MA 2OHJA 2RGNC 4Q4AB 1L6IA 1ZCBA 3MD0A 4EITA 2QSUA 4JVSB 3CH6A 1PQWA 3I83A 1AHIA 2J6HA 2XB8A 3UJCA 3N7TA 1E5VA 3I2IA 1C1DB 4F4JA 1JT9A 2R60A 2GVZC 2C4MA 1FYEA 3FH0A 3ZD7A 4XYBA 4TQUS 1C0LA 2RMKA 3CW8X 3RWMB 3VR5D 3ZJUA 1H1LA 3AM1A 3BYZA 3TWOA 3PA8A 2AQ8A 5ALDA 4D43A 2E4ZA 1PKXA 2R79A 1Y3AA 2NSLA 2YQZA 4N40A 1F7UA 1NVVR 4Q9IA 1NM5C 4TSFA 1UBJS 5FTLA 5AJVB 2WG0A 1JSXA 1D7AA 3AJEA 1YDEA 3FDIA 3HZHA 1TF5A 3N8NA 4IGIA 4TQAA 4UM7A 4HEHA 3E7XA 2GZ3A 1IOZA 4W5OA 1QK3A 2VA8A 5J58A 1D6JA 4B3RB 1CRLA 2WTXA 3NTRA 2VNKA 3EGWA 4NK5A 5GJCA 3BWEA 1KO5A 3TQSA 5G0SA 1WJGA 3VZBA 4ZMBA 5KBYA 4GGPA 1X86B 3FCYA 2FEKA 5I7RA 4QYTA 4ESOA 1T9CA 1G9XA 7GPBA 5KQPA 4G3XA 2ENWA 4W1QA 5JG7A 1YVDA 2A35A 4F8YA 4PC3A 4GXRA 5HKAA 3DD1A 3FJYA 3SDBA 1RJ9A 4GPD1 1OT5A 3N0TA 4DUZB 4UKDA 3PJEA 1L5ZA 1GZVA 3WIUA 4AUEA 3QUSA 1XJQA 1Y98A 1TK2A 4Z4QA 1J5EB 5EY5B 1G5IA 2A1TS 4V0LA 3GMTA 1NXXA 5IM5A 4KUHA 4N3GA 4N5HX 5LBTA 5C7OO 1P9RA 3K6SA 4PZPA 1GCUA 2YUIA 2JBWA 3QVMA 4LVUA 1IG0A 4GXQA 3NIDB 3G13A 3U3MA 3I3OA 3CLKA 1P3JA 1ZRNA 1NLMA 4ZI7F 4GMFA 4QPPA 2FHSA 1QGUA 4LGMA 2G7MC 4TYQA 1X87A 2QW0X 2PMCA 3SS8A 4B48A 5BY2A 2N3ZA 4QXAA 3BD6A 1VJDA 2MIIA 1RYFA 2J5BA 2PXXA 4X84A 2G06A 4DJTA 4UVHA 1YWGO 4AIIA 1QVAA 1Y80A 5JJCA 5C46F 3MIZA 3SZOA 2Z2KA 1TCUA 1ZVQA 3QYFA 3KEOA 1PL7A 4ON9A 4RFLA 3CZCA 5C9ZA 5K3FB 4B6RA 4PN7A 1C5KA 5D00A 2C7VA 2Y27A 5DV9A 1KMNA 4P7FA 1MABA 4N0DA 1M2VA 4PEVA 4MIYA 3P9PA 5I45A 3IIIA 1RCFA 1QG2A 2ZR9A 2P4UA 5JT1A 1NG9A 2PPLA 2ZAGA 2FUNB 4MQFA 3L0ZA 2BZGA 1I33A 1G20E 4K6GA 4EKYA 3D2LA 3TLBA 5JATA 3BHNA 1VHWA 5E3IA 4P0QB 2DOKA 2ZQYA 3NH6A 2DJIA 3G5LA 1U3FA 4HNGA 1LDYA 2R4UA 3WGMA 2O1WA 4RMHA 5DGCA 5JW6A 1QJCA 2VAXA 5DU2A 5F3DA 1ECBA 3HB4X 3NCHA 3IEIA 5HE9A 2V3CC 1ZI6A 1EK5A 2Q3DA 1T91A 5J2UA 2WHQA 3KWLA 1I1OA 4IDPA 4TKZA 3WKBA 4CQJA 3A27A 3AIIA 4EGJA 2GRAA 2JCBA 1EAYA 5CVEA 4A7PA 3CF4A 3G1TA 4FE4A 4UEKA 4ENRA 3KR0A 2OPHA 4KH0A 3LFTA 1AMOA 1P1IA 3DJFA 4G5FA 4J7XA 3KR1A 4MKGA 4XD7D 3U37A 2CEKA 3A4IA 1O6BA 3LXXA 3C5EA 4JLPA 3B7PA 1YQDA 3CF6R 3G49A 1UDCA 3TO5A 1E3SA 4DRZA 1ARZA 2RE8A 5DM2A 1VFPA 3GJZA 3QV2A 1IZ0A 4CFYA 1I0IA 1TLFA 5EE3A 1LWNA 3I9KA 2WU1A 4ZZIA 4JDPA 5K0LA 1YCGA 1EE9A 4FW8A 1OBCA 3HA3A 4LTDA 1M6NA 1FTGA 1ZH4A 4RHCA 5GADl 2W2LA 1I2BA 3U3JA 4XGQA 5JZSA 1PR0A 4EGSA 4QOJA 1U3WA 1ZQ9A 1O6CA 2J46A 3DUFB 1J0AA 4C5CA 2O6LA 1UPAA 2PJRA 2C99A 1ZLXA 2FPGA 1C3OA 3FVTA 4XCQA 4B45A 1MB9A 2JGAA 1KXZA 2JIOA 2HV8A 1EHYA 3JX9A 3L79A 1SH7A 2X6RA 3ZWAA 2VQ6A 4O08A 1JBQA 1KI7A 3R3VA 1B8OA 1PR2A 4YRQA 4EA6A 5CHYA 3U4MA 2VJAA 2OM6A 5CDFA 3RVDA 4QUBA 3ZWWA 1JKJB 2GN0A 4NNOA 4QC2A 5LU9A 3WIEA 5E7IA 1ZH8A 3SVLA 2GK7A 2Z2XA 2H4FA 1F0PA 5F7XA 4AFNA 4MUMA 3RVOA 3U6KA 5DCUA 2ZKIA 1YZFA 4ZYYA 2F3PA 4MDYA 2B5WA 2CXRA 5JWOA 5KWJA 3OX1A 1CS4C 1X1BA 1SRQA 2WKQA 5IG2A 2H29A 3QLUA 5TVGA 3PJRA 2H08A 1L8LA 4NZPA 2Q07A 3UV6A 1T8YA 1IHXA 3ZE0B 3BUSA 4NCAA 3NKFA 2IQ5A 1P7WA 3PFWO 4ZAWA 4B7AA 3TZKA 1U2DC 1KY4A 4RJKA 4YI5A 4EB6B 4UATA 2QEQA 1TO1E 1YZHA 1U0SY 4XW2A 1X8XA 3WK5A 3RJTA 3ZD9A 1F51E 1G19A 4AQDA 4ZZ2A 2G9ZA 2I6SA 3S1AA 3VGPA 3GJ3A 2XTJA 1I7LA 4OJQA 2X3UA 4Y0VA 3G2PA 2E21A 2GN4A 4DIDA 1NV8A 3LYLA 1C0IA 1U9YA 4HH3C 4IEEA 3TR5A 4A8JB 4DKJA 4ACBA 4TWIA 4QLOA 1QQTA 1GN9A 1N0UA 2JGKA 4A8TA 1LPAB 5ALIA 4L50A 4D98A 1WTCA 3UWOA 4NBWA 4PYNA 4Q1FA 5K09A 3CZ5A 2CDNA 3D59A 4FFBB 2JFFA 4MPTA 4O63O 4QAQA 1DMRA 2WEKA 3SVTA 4XM0A 2G3YA 5TY0A 1CKEA 1SC4A 2PZFA 1NC3A 2QAIA 3E1SA 5CXXA 3S44A 3LQYA 3WMFA 3UT5A 5FAXA 2J30A 5T4HA 1G21A 1EFRD 4QDTA 4DR6B 2GZDA 3VYTB 4Z4GA 3DCJA 8LDHA 5LP6B 1X7GA 4D3YA 1VLLA 3TG2A 2VHVA 3CZ9A 3H1BA 3VR3A 4QUAA 4H1VA 2K87A 3UKJA 5HRCA 2DH5A 5K05A 3QKRB 3GRCA 3QLTA 3HFGA 4F93B 4G0QA 4FGJA 4C2BA 3VSDA 1CYDA 3CEPB 4IOJA 3ER8A 4CLRA 1ODLA 3EGCA 5FPYA 5TQ0A 4OHOA 5BW8A 1C4OA 1IY0A 2OLKA 2V7QD 3LBNA 1EQ2A 1X94A 1C1DA 4UOEA 3L7JA 3N8DA 4HB0A 2ZVJA 1E4EB 1Z33A 1E79A 4HFMA 4LCJA 5CNIA 1J2YA 2LWIA 3WOVA 1ZRSA 3TI7A 1LFDB 4ENTA 3O03A 5ANRB 2Q41A 2YFKA 3BAZA 3C7AA 5F35A 3QLJA 4DLBA 4PSUA 1DJQA 4D9HA 4Q9DA 2IH4A 3CT4A 3DT9A 1WY7A 4FIZA 3CH4B 1QS0A 4N0PA 5FTJA 2XNKA 3QU4A 3T5DA 2DHRA 5KIAA 1E1RA 1QIGA 4IMJB 4Q05A 4MEBA 2D4AA 4F04A 5KJ1A 4LOLA 4X1KA 2HWXA 1VYTA 4BPBA 2J48A 4B6EA 2FG6C 1U11A 3BORA 2WSIA 3B1WA 3M5WA 3CTMA 3EGDB 3O2JA 1QDEA 4N8EA 5JVDA 3O8OB 1ZUD1 3CTPA 3EY4A 2D13A 3A6LA 3OE7D 3VOSA 2CXTA 1U8CB 4AJ2A 5A2QA 4YPOA 1EZ1A 2RHHA 5KDOA 1WCXA 1NJ8A 5JTUA 1JFSA 5TXGA 4W8HA 3PYMA 4H3VA 1M1XB 3ELBA 5SZIA 1ZEJA 5F12A 1PR9A 1Z07A 4Y1RB 5G0WA 4CN9A 4RF2A 2O3RA 3VZSA 1T9HA 5IT5A 1WDMA 2WUFA 1A04A 5AKKA 1VB3A 3STXA 1L2TA 3SAJA 3QE4A 3GRRA 4PCLA 3ZDXB 5DNCA 5REQA 4BZWA 4I4TB 3HMQA 1TTTA 2DPHA 3Q7IA 3L5OA 1XTRA 1QYDA 1QGOA 3IRUA 2CY0A 3IOEA 3LX8A 1XAHA 3NHWA 4QATA 1JW9B 1ONPA 1V1JA 1X2EA 2FP3A 2WM3A 5BSEA 1WXGA 7REQB 1M2HA 4DLZA 1HNWB 3TTUA 4ARZB 2UYCA 4FQ5A 3QLVC 3CFYA 3L7AA 3SZUA 5BN4B 5G1OA 2DP4E 1L7NA 1AURA 3GP3A 4MTCA 2CW5A 3GT0A 4FXPA 3TQFA 4GHWA 1KIMA 5M04A 1ATIA 1EG2A 4BUZA 3QXJA 1FFXB 1G8KA 1DJLA 1ZWKA 2NU6B 3NXSA 4FPXA 1OBHA 3FYUB 4HWPA 4XEHA 4J1SA 4G0NA 4MUFA 5JSQA 4Z7NB 1L7EA 4ZRMA 4ISCA 1L5OA 5COBA 2RSLA 4BU1A 3USES 1O2DA 3P9NA 3NW9A 2ZT6A 2HLNA 3P9RA 4UCXA 4IO1A 5CFRA 4ZZ1A 1IE3A 3PQ7A 2GKOA 3ZHVA 2JEYA 4W5HA 5IULC 1PJSA 2GPSA 1I6WA 3EBPA 1GEEA 4K46A 3BFJA 3K1ZA 4OIMA 4A3SA 5A9TA 1W5TA 1PJLA 2CHEA 5IUNC 4MR7B 5CDFE 3U44B 3EFEA 1UPUA 5TJ9A 3UUGA 1OWNA 4WZBA 4FR5A 4X92A 4C6HA 1YCFA 4PQRA 1ZONA 4HDNA 4Y6QA 3RGGA 2BFMA 4LE0A 4WZZA 4DEXA 4LVCA 1T24A 1XRRA 3C8HA 4YRKA 4J16C 4WPGA 4G67A 2YXNA 3HM2A 3K70B 4NICA 1R9MA 3QKSB 4M46A 4X93A 5BN5B 3HEMA 3MGAA 2VK4A 5IAKA 2X15A 2E5WA 3FNRA 1XJ0A 2GFIA 3F7MA 4KLAA 3SN6A 5AD1A 3D3KA 2NU7A 3QPWA 4RK1A 4CMEA 3MCAA 2CCGA 2LD4A 4KE8A 2ZRGA 4FWIB 3FNEA 2A92A 1O8BA 4RULA 4GWKA 1AVTA 5BUQA 1KARA 3SXUA 1UMBA 3VSBA 2QG9A 4A03A 4OI4A 1JPUA 4TKVA 3NDRA 2FZ5A 1PJQA 3K2BA 4WLNA 3EDQA 1BGXT 1U3CA 4BP1A 3R9WA 1T10A 2I4LA 4BX0A 4K9LA 3ILXA 5K3SA 2YY5A 1EH5A 1Y6RA 1MO2A 4R40A 3QM1A 3PTZA 4HD8A 4Q3CA 4I50A 1NRWA 3NV7A 3E8MA 3BQ9A 3WAKA 5KZMB 2B34A 2ZTUA 1GKLA 3P9KA 1QZ3A 5E1DA 4CIXA 4MS3B 2W6JA 2A6PA 4Q3BA 4UE3S 4MITA 1MHTA 3AXSA 5C8XA 1RAIA 2O2ZA 4AZTA 2OT3B 4LIPD 4UPDA 4JC4A 3NETA 1JG2A 3KWMA 3QW2A 3BHMA 4JBXA 3D2AA 4MV7A 1KI6A 1SG0A 3LXMA 4BMXA 1JH9A 2NTVA 2WIBA 1PEAA 1V11A 4V3BA 4RHTA 3ZNQA 4N0EA 4Q47A 4Y1GA 2QM7A 3TEFA 3FLAA 3WL4A 3PCTA 4E70A 1A9XA 3GLIB 1EWQA 1U90A 2SKEA 5TPWB 5JS6A 1ACLA 3B3GA 2HU2A 2XZPA 1DXQA 3F97A 1ETHA 2IYOA 1QKIA 3AU9A 3M9WA 5EQTA 4REMA 4FW9A 1TM2A 4MLZA 4TVSA 1Z7BA 2O4CA 4HB4A 1U81A 1O4WA 4JITA 4YAEA 4B4KA 4Z7JA 1SG6A 1H2HA 2K4MA 2WOJA 2BBTA 4U2FA 4H35A 5CXSA 1TEXA 3A37A 4XLLA 2RC6A 1G20B 3C41J 5T5QA 5A05A 2PZ8A 1GPYA 1YR6A 4H9GA 5K2MA 1MJGM 1GPMA 4EW2A 3MBOA 4TYPA 2FXVA 3SBDA 3A4TA 3GWZA 4UNSA 1D03A 1JEQB 2ZUVA 3OF3A 3QVGA 4YP1A 4KE6A 1GNRA 2IU4A 4MV3A 1U9CA 1PHRA 1UBOS 1IRXA 4MDHA 2Y2UA 2HO4A 1E79D 1JG6A 2XSZD 3H8SA 2GBLA 4BFZA 3UKOA 5B6PA 5EXPA 5JAIA 2IBTA 4BBZA 2WIKA 4RABA 2PCLA 1ZM4A 2OZEA 2Q0XA 1GN8A 3I4CA 5IYZF 1C7QA 1EFPB 4WASA 3CB2A 4NH4A 2V7PA 2ZRCA 1ENOA 4Y2VA 1IHPA 5D3MB 1FRVA 2I29A 2DFNA 3HO1A 3AERA 1YS1X 1F17A 3VYWA 2EJUA 1B74A 1AQ6A 1XVIA 4K9MA 1EIWA 3UJBA 1S3FA 3BMNA 4BP3A 1TOAA 1PJCA 1Y82A 4EPYA 2RK3A 3R0VA 4EK9A 4L07A 3HP7A 3TQRA 2HJWA 2V65A 1E0SA 3GEHA 2VQEB 1FSPA 3DOIA 4QXRA 2C96A 4MYRA 3RU7A 4DJAA 3H6HA 4TS4A 4Y6LA 5KVVA 3FOZA 5J43A 3WLOA 1E6CA 3D1VA 3EAGA 1L4LA 3FSEA 4NOKA 3X2SA 1N6OA 4X62B 4AN1A 3KYCA 3FWZA 4AKTA 2ZS8A 4WKCA 4XYGA 5AK4A 1J8FA 1MJGA 1XQ6A 3F1KA 2CVFA 2O5RA 2P4QA 3A25A 2C3UA 4C7JA 3QU2A 4X5OA 3GP8A 1L1RA 2Q21A 3GXBA 2XH8A 3O4VA 1TZJA 1YJBA 4EEZA 3IAM1 5DM4A 3V34A 1PF7E 2J9XB 1W8DA 4WN9A 5KQMA 2YUTA 3HKEB 3V3KA 4GI3A 1FSFA 2H7CA 1ZD9A 2Y4OA 2G07A 2QJRA 3E3NA 4HADA 5F1OA 1NPYA 5ITVA 2A4KA 3PR3A 4YP5A 5IJ9A 5L3ZA 1W4BA 3H0CA 3SF0A 1P61B 2R1UA 3LFUA 2V5AA 5ESRA 2EZ8A 4BBAA 4K9KA 2DMRA 1GDHA 5F2NA 2AA3A 2EGGA 4HLNA 3WGNA 3V4PB 1HI9A 2F3RA 1P9NA 1OGIA 2JW5A 4G1FA 5C31A 4EO7A 4YCJA 2HB6A 2WB4A 1WKCA 1E7SA 1E2LA 4BVAA 2DTDA 3G0OA 2BGJA 3I45A 1CQJB 1GXSA 1V7CA 1HV8A 3PD0A 2Y1OA 4LRSB 1Z0SA 4Y6RA 2AG0A 2X6TA 2XTMA 3ZGVA 4ENVA 1H8HA 1LW6E 1RADA 1RU3A 1VECA 2OXRA 2NV6A 2V6IA 3BMNB 3H2KA 4RELA 1VI5A 2QMYA 2XWQA 3SM3A 3I9MA 4OOFA 1CDDA 2XGSA 4EHJA 2AYXA 1ZVKA 5CA1F 4EO9A 3AERB 4Z5XA 3O5AA 2VHWA 1O5OA 2I2XB 2GH1A 4R2HA 2BEJA 4RAOA 4ZVUA 2ZYUX 3MTIA 1SUPA 4OMFG 3H2YA 4A26A 4I2VA 1JDVA 4P3NA 4A8JC 1TJPB 3PRKE 3VX4A 5IJ0B 3ZV6A 4D46A 4R9UC 1T3GA 1W2GA 2AJTA 2JKVA 2BI8A 3AUSA 3MJHA 1AMUA 3GOQA 1DT3A 1O94D 2FW9A 2VUSA 1N5JA 4FLEA 5F51A 5GP1A 3HG7A 4P36A 4KLCA 4ZXFA 4KR9A 4DR3B 3DM5A 2PFGA 4YDSA 2XCOA 5IC5A 2NMVA 4RK6A 5BQ5A 4Q3AA 1L4KA 1TM4E 2GD1O 3DW1X 3OU6A 4FHGA 2Q1UA 2NLOA 4I50F 5ALXA 3JZAA 2B4YA 1U2EA 1II8A 2Y6VA 4YDRA 4EMBA 2HO5A 2VP5A 3I9NA 2I2AA 2LNDA 2XTNA 2J0EA 1JR3A 5DYGA 2Y0DA 3LUKA 2XNHA 2XUPA 4WDQA 1MZPA 2D2FA 2I34A 2PBRA 5TSDA 2PO5A 1EBBA 4GM4A 4LSMA 1T2AA 4LSGA 5HKOA 4MWEA 3ZVMA 4BJ3A 1E9CA 2VK1A 1A9XB 4I5IA 4P5PA 4PZDA 1MX9A 2JAQA 1PSWA 3N70A 1PDWA 1I4TD 1Z6YA 1S8NA 2H1SA 4F5YA 3FTCA 1EK6A 2BGKA 1CIPA 4MHOA 1JNYA 4Q7KA 4BIIA 1HXHA 2O2XA 3A06A 4E03A 2AF3C 2ANBA 3BE6A 4QVKA 1PLLA 1DRWA 2G17A 3JR7A 4JUIA 4TV8A 1U9IC 2BC9A 3E84A 3MLBA 3ZHSA 2FN8A 1ZR2A 2Q62A 4FD3A 3RSCA 2PEZA 4WOJA 3QPDA 1ESMA 3UFBA 1M10A 2JJMA 2QUJA 3PHHA 4V1CI 4PIPA 3U9SA 4CIVA 2CL5A 3KYIB 2L19A 1E3WB 4JLNA 5E9AA 4FBMA 1XJWA 3WO0A 3M5PA 4ZO4A 4KOEC 4O4IA 2W6IA 1CZNA 3RFXA 3NT5A 5FOQA 4A82A 3Q8LA 2FGKA 2GVDC 1MB2A 4BP8A 3A11A 2AEEA 5IJXA 1B7GO 2ZJAA 2V3VA 4L27A 3FBWA 3GD7A 3BCSA 1F20A 1ISSA 4YVFA 2DLDA 1Q7BA 2YVKA 1OI3A 1P73A 4NJMA 4UCQA 4EJMA 1TT7A 4R2LA 1SR8A 2O3QA 5BSVA 1PFWA 2CLMB 1RM5A 2FUCA 2WJPA 1QR2A 5FQOA 5JXIA 4DWOA 1T1IA 3RHTA 2MSLA 2RIPA 4B3SB 3HBJA 2G25A 2WK1A 3TS1A 1Z28A 3MQ4A 4YJ2B 3B1XA 1JU3A 3TEMA 2O3UA 2JIBA 3NT4A 4UUBA 1ODCA 2DCUA 2EU8A 2J3KA 4XQEA 3EZXA 3KJFA 3AV0B 4YJFB 5CBPB 1NLFA 1KJIA 3B2EA 2Y9PB 4QDJA 2EX4A 3ZY2A 4RPGA 1I3MA 2OD7A 5FO1A 2ZIUB 2RONA 3E82A 3KV1A 4XX0A 2XGOA 5BXYA 5FLYA 1JHMA 4OQXA 1TYDE 1JXAA 2QZ4A 4MQMA 1ADBA 4R2WA 4WMLA 1J9EA 4X60A 1QJ4A 1X3LA 2QUKA 3A1EA 5EZYF 4LISA 3LZ6A 4ZJYA 3DTVA 2V7WA 2EQ5A 3F47A 5BQXA 2VF2A 3HJFA 3RDPA 4RTKA 4KP7A 1HG0A 4MEJA 2BEWB 1GZ4A 1XVUA 1AY0A 2IYNA 4ZDWA 1OLOA 4WEOA 1OCEA 3NASA 4FE7A 1TTQB 4XDYA 3LXRA 1U5BB 4JBNA 1KGDA 2PO7A 5DOZA 1PS9A 4KVZA 5A6SB 2CYAA 2UYYA 3PC2A 2QQGA 3PCRB 1H9CA 1C1HA 4F4DA 3WAGA 4QUKA 3R8FA 1NLUA 1VP9A 5ERYA 2NGRA 4FFWA 6CHYA 1RRCA 4MB2A 3F6BX 4MKFA 3DG9A 3N07A 4HO1X 1K3TA 4OXNA 3UA4A 3IO5A 4DA7A 2DSNA 3MWDA 2IITA 2GQ0A 3UYKA 3UCXA 2OQIA 3H2ZA 1XZCA 1YQXA 2Q99A 1E6UA 1GU7A 2IZ7A 2OWEA 4MYDA 4WECA 2HK9A 4BX9A 3W5DA 4I66A 2SHKA 3HB7A 4B6FA 2F4NA 5KNCH 3EH1A 2VYNA 2G5CA 5IEJA 2ARKA 2BR3A 4WFJA 5AKGA 1CQZA 2G72A 5F2KA 2Y0BA 3WRWA 2LR0A 3BXOA 3FKSD 2AGVA 2I2WA 5IKOA 5HDBB 3UMCA 1GFIA 2IX9A 4XOIA 3KKLA 3U6BA 5HTKA 4BV3A 2ZE6A 4Y2QA 1E20A 3PWKA 5AK5A 3CNNA 3ZY6A 5AVVA 2RGDA 2H6EA 3AI1A 4MJ7A 4B80A 4L7VA 3WDLA 3ESRA 2J6CA 4HN9A 5L40A 1MQSA 2ZI5A 3DHVA 4LVNA 1RDFA 3IEKA 3KSBC 4I3GA 4OMUA 3O91A 1PGQA 4L95C 2NYVA 2AD1A 4DGSA 3AJRA 4POAA 2YJ3A 1HKHA 1SXHA 2HLDA 5DLEA 4CCSA 4P80A 5K3EA 4RVUA 4RADA 1C9NA 3T99A 1QRUA 3SYMA 3UT0A 4CHTA 3AY7A 1UBNA 3W5VA 2C5FA 1ZKMA 3KYDB 2AXEA 2JFXA 3UOWA 1QPBA 3TSCA 1IEQA 1U2PA 4NCNA 3DH0A 3FGZA 1CQIB 2AFHB 3VKVA 4BMDA 1GCGA 1A9OA 2I2FA 4EKIA 3G02A 2VR1A 2J45A 1ZI9A 3IMEA 3NBXX 4N5NA 5MN6A 1ZISA 3C24A 4JCOA 5TQ0B 2ZIXA 2ZAMA 1AC5A 1WVMA 3AR7A 5F21A 1S2LA 2BI4A 1IBKB 1U3DA 7YASA 1UJBA 1LI5A 5F52A 2A0UA 4GOND 1IQPA 3IFSA 1CW2B 5JNVA 4O8CA 1JR3D 1S8OA 4ND4A 1JU4A 1GVNB 5IVDA 3STTA 2CE7A 1G7RA 4PR0A 2WHEA 2GXAA 1KFJB 3KOMA 4GP6A 4PZCA 1ZD1A 4DFDA 4K86A 1R9NA 2J59A 4N8SA 2BZ0A 1DWUA 1H2XA 1HFJA 1BG6A 1XJ5A 1ZSVA 4O4LA 3D6HA 1JT2A 4HFNA 1TADA 1OGJA 4CEJA 3QY9A 2FSHA 1MORA 4Y7DA 3VHXA 4EI9A 4HC4A 2XADA 4RA9B 3WYGA 4DYDA 4EKGA 1TB4A 1GZ6A 4R01A 2AN5A 5ALVA 1YBFA 1VE1A 2IDZA 1GG8A 4X0EA 1H3NA 3G2QA 1YA6A 5A4MS 1I3NA 1FUIA 3Q40A 3GEBA 4KXWA 5CT6A 3UHOA 1KC1A 2P9GA 4WOCA 2VXCA 3KOZA 2ZUBA 2ZITA 1Y1TA 3L4BA 2MDTA 3K6RA 3L04A 3W2GA 1BMTA 1H2YA 2PD4A 2PBFA 1L4MA 3LP8A 3MK31 4G0OA 4LNHA 4BFCA 5HK9A 4WUVA 3GLGE 2JLWA 3TE6A 3NOXA 1VE3A 2A5JA 4DG9A 3BTSA 3HWSA 4WVFA 1HR0B 1WLYA 3TPZA 2AW5A 1XZEA 2J31A 2ZRAA 3GJ0A 3AW8A 2A9JA 1IWPB 3QBTA 4JU8A 4YRBA 5FNVB 3FR7A 4KX5A 2DPXA 1XZPA 5C1OA 2CLEB 3ZNOA 4B8WA 4JA2A 4KMOA 1GV0A 1Q0SA 4MK4A 1UANA 2JDIA 1E2KA 2FDXA 5JRZA 3DBRA 4Y1FA 5J2TA 3V7NA 4IOMA 2XUOA 5HUJA 5CDGA 4BB9A 1U7DA 4RS4A 2PMWB 2FE1A 3C5CA 1ZSNA 1N1GA 3PD1A 4BVHA 4ES6A 2OBXA 2R85A 3O1LA 3T0IA 3VYRB 1VLMA 3CUSA 4B5KA 1NN3A 4C08A 1NSTA 4XYLA 1X7YB 3PPWA 4AZ3B 2PZMA 3C7TA 4X95A 3VH3A 3WL3A 2PZKA 1D07A 1VSVA 3ICVA 1T6XA 1OAOA 3SQOA 4F11A 1K63A 4LNUA 4F4FA 1W36B 4BB0A 4NS4A 1NVWQ 4MXDA 4RIEA 4UUMA 2ZVDA 4G5SA 3DKVA 1V5IA 3KQNA 1EZZA 3I1YA 1B15A 4ND3A 2J87A 3KD2A 2VCEA 4TPKA 1PEKE 5F7JA 3RVSA 3FZQA 4F7WA 2E3JA 1UKYA 4YHBA 1OC4A 1T3TA 3KSUA 4K81B 3FMOB 4EB3A 1E4OA 2WLSA 2OP1A 1GTZA 1JZTA 4WESB 3HJAA 2XYQA 2II6A 3OOWA 1VE7A 2HRZA 5DGDA 5LKRA 2COUA 3C8ZA 4X61A 4OX9Y 1QH8B 1R5NA 2BDEA 4FTWA 4LQCA 3V1YA 1KSGA 2W8ZA 4IDOA 4LBWA 5IAGA 5LVAA 3KLMX 1TVMA 1XTIA 4EOGA 2UYQA 3CPEA 1DQZA 1KJJA 4CR8A 3H87A 5LYJB 2P0YA 3F5QA 4EJSA 4DDTA 3KPUA 1G60A 3L6OO 1SD5A 4NYJR 3N86A 5LL6P 1A98A 1Z15A 4TTJA 2DFLA 1MX3A 4HZIA 5AI8A 1YJAA 3ZD6A 5H4HA 1W0CA 2EV9A 5D87A 3UMMA 2XQGA 1DAFA 2XQVA 5HCUA 1J33A 2IOYA 3OQVA 3VR0A 3AVWA 3ABIA 1SK8A 1V8ZA 4O4HF 4ZT2A 1M8PA 1P44A 4CL2A 2IZ1A 4KMMA 4XE5A 3WLHA 3ZR4B 3QQ5A 1IBLB 3Q8MA 2YW2A 3J7AC 1F8UA 1L5SA 4RENA 3HYLA 3ZI4A 4MSUA 5JRDS 1VLVA 4MJ3A 4URYR 5DHRA 1UPCA 2X1LA 1AGXA 1A77A 2VDLB 2ZOSA 1BHSA 4I1RA 2NTJA 4BNNA 2YN2A 1UFVA 4CETA 4N5DA 2JD0A 1JEJA 1YMQA 2QN7A 4K6FA 4WL0A 4NENB 3L1UA 4ACAA 5E1MA 4PFQA 4KIFA 5KSOA 1ECCA 3ZDAA 4RCYA 1PT5A 2VDWB 1TKAA 3ADKA 2EAUA 1XQVA 4WBNB 1UDWA 4I14A 3OFKA 2XLCA 5DYWA 4QXQA 3P96A 3EEQA 4KL8S 1HWYA 2O3TA 2F7SA 4KXNA 2V03A 4L5YA 4QECA 2X0EA 2QX7A 1Q6ZA 1YVRA 3HCBA 5B7PA 4BQPA 2H63A 4RKYA 4YAKA 2V9CA 1T3HA 1P74A 2QD1A 3WNZA 5DB4A 1GG9A 1EX9A 3MGBA 3ENZA 4KSCA 4CM4B 5BSKA 2POQX 4EY5A 4BRUA 1ULSA 1WABA 1IBCA 5DIZA 3HZOA 4MR8A 1RRPA 1JEYB 1KDOA 3G9UA 3HCWA 1E3TA 3QLVA 4LHZA 3T12A 1QTQA 4U39A 5C7LO 2JGFA 1XLWA 2EFHB 1RSZA 4WT7A 4BGIA 2VOEA 4E2XA 3RYCB 1XEWX 3KOYA 3M3PA 1ZOOA 4UVEA 1O94A 1G6OA 4DDUA 1BA2A 3SY8A 3L3BA 4QU0A 3PUHA 2JH8A 5TMPA 5FIUA 1L1QA 1TECE 2GBLC 1L4EA 1R5BA 3N39C 4FR0A 2YZGA 2AMYA 2Z2JA 4FCTA 2XXBA 2B7BA 4NATA 4PC2A 2OG1A 1LGYA 2ECPA 4ZVRA 1JEEA 3BMOB 3EQ9A 1JHQA 3ONEA 4R7ZA 1LDMA 3KK0A 1RJFA 3GT4A 3LRPA 3Q9LA 4LVOA 1OX6A 3IKJA 2QD3A 3OFSA 4KXXA 5SV2A 3WLLA 4KQGA 4HP8A 1HUQA 3K35A 1Z7YA 1T8PA 3LT5A 1V8DA 3EVGA 4G2TA 4RANA 4TM7A 3ZHBA 5THXA 2DTEA 1J56A 1FFHA 4BTEA 3H3JA 3MWEA 3P5BA 4L0DA 4X8HA 3PTLA 1QQ7A 1J97A 2DQYA 2VJPA 3E6AA 3GLQA 3O3CA 3PXUA 4RK5A 4RZ2A 4TMXA 4WFQA 2NU8B 3JATA 4NG4A 4YAWA 1RT9A 4HY3A 2RHJA 2YWGA 1P0CA 2WTUA 3BMCA 2GYWA 3D3WA 3FVRA 4N82A 3EUFA 4A4DA 3UHAA 2WB2A 1WDWB 4G63A 3FDXA 4E32A 4E7PA 4DQUA 5IKMA 3NTVA 4TTPA 2VSQA 5B4TA 5AXDA 1XRJA 5DNYB 4JYMA 1N3LA 3AG5A 1X70A 3P4XA 3W6NA 4AKSA 4BZPA 4RTRA 4QRIA 1EK0A 3VR3D 3VXKA 4L8WB 5JY6A 3KS9A 3E9EA 3MCTA 1ZNXA 3H16A 1Z5GA 1N92A 3FDZB 4QU8A 16PKA 3L6DA 1J0DA 3NC1C 4EPWA 3FTFA 1H69A 2JIDA 2XGMA 1T4CB 2E0IA 2BP7A 3PU6A 3WWPA 1C81A 5DYYA 2F1OA 5EFZA 5F5XA 4KQCA 1G5QA 4MVJF 4FR2A 3KPYA 5H8WA 1V37A 4LOHA 3AP1A 1GU1A 2ZRNA 1DBPA 2G9UA 2IQIA 2WVHA 3KSMA 1AXEA 2PKEA 1EVIA 4MHTA 4MIOA 3FNQA 3PNSA 2YZMA 5CLGA 4Q1CA 4MPRA 3MOSA 2VF8A 3M4JA 1BCSA 3FB1A 1E3EA 3NHBA 4QQ8A 4GM0A 5AXAA 3TTXA 2ZSUA 3SR3A 3UFXB 4BASA 1PNOA 2E4XA 2RARA 1SWVA 3MJCA 1S4MA 1XTQA 3ZJ4A 3EQ8A 4OXKA 4XGNA 4EPTA 3VA7A 5L7TA 1Z74A 2JLUA 3QBVA 4JODA 1WQ4A 1Y7PA 1GFZA 8MHTA 1XP8A 4WXPA 1JN0A 2BFDB 3FTQA 5L8VA 2YJ5A 3RU2A 3IEVA 3GGDA 2HWUA 1BKDR 3LGAA 3GC6A 3Q8XB 4NXNB 1N4DA 4HB2A 3WYCA 4Z54A 3FCSB 5KO2A 4RVNA 5KS2A 4EDHA 1YRHA 5KQLA 1J0EA 2Q1TA 4OOEA 4QPCA 3X2FA 3VBCA 1W94A 2QQFA 1W0JA 2H7XA 4O25A 1BN6A 3C70A 3EW7A 2H92A 3L7LA 3E2IA 5CVJA 3SJZA 1IY9A 1ODSA 2EP5A 1IDN1 4PZ0A 1R8SA 1I0LA 5EFOA 5BSHA 2HJ9A 2GEJA 4NFHA 1TPYA 4Q5IA 4LJ6A 4MVJD 1JBKA 1LEHA 1IZYA 1UM8A 1YJXA 3EDOA 3WGHA 4DDMA 3S2IA 4EB8A 1GFSA 2Q3BA 3LCCA 4L08A 1KEEA 3X1MA 4CM1A 4C7XA 3IA7A 3CA8A 3DLTA 3AF1A 3OCCA 1Z6PA 1FS4A 5TT0A 1CUAA 4ZAGA 2ZIEA 5B36A 1P80A 3IL2A 4P3PA 3K6KA 4YALA 3ZOZA 1LF0A 2C83A 2NZWA 3FDZA 3QQPA 5FUWA 4LI0A 3O0TA 4Z7QB 2FUEA 3ESQA 4XASA 3VSCA 4PLYA 1AQUA 5EJGA 1W48A 5JD6A 1I1QB 2P3OA 1EXWA 1OILA 2DFKB 3GLTA 4HHEA 4KLRA 1T6NA 3NIBA 1BROA 1AUQA 2BRUA 4FLFA 3OZWA 1BW9A 1SCUA 2QPOA 2X0KA 2V5VA 2Y1DA 3BA6A 4ICIA 5D6NA 3UWDA 4ZKEA 4RMJA 5IKEA 3EW9A 3KU1A 3SX0A 1ESCA 3FNIA 4L4YA 4MCHA 4ZOLB 1FS5A 3OFND 5CDTA 3ZHUA 2OZPA 4LOAA 1GA6A 2CLFB 2X22A 3BMCB 5FWXB 4Q9JA 4IILA 3K9LA 4M22A 1E94E 3JATB 5JJ5A 3B1ZA 1XL1A 3VVMA 3FOFC 1CF4A 1XU4A 1X74A 2CXHA 3EQ7A 1DAKA 1VL1A 2IU6A 2Q5EA 1IPFA 3D8UA 4L9WA 5IEBA 3ZDFA 2AFVA 4J07A 2MJLA 4B8YA 2DQ4A 4YQFA 1Q7TA 2Q9AA 5C34B 2F8MA 1IJEA 1JAIA 2B61A 3HC7A 4CU5A 3IR6A 3FVQA 4FD2A 4IXTA 1G8SA 4HDKB 3GDOA 5EIBD 4HZUA 4C5AA 4FMBB 2IUUA 1R15A 1Y4AE 3KLPX 4R0VA 2FPMA 1CUGA 4PC7A 2PR2A 1RMQA 1SZDA 3GN1A 3DTTA 2VNAA 3IJRA 1N2CE 1UAGA 2QN6A 1SQ0A 2BVNA 1SBZA 3QE0A 5BQFA 4FOTA 1P2FA 1N57A 3HUEA 4J91A 1KHHA 2D1TA 2Q5HA 4M1TA 1W87A 3LE8A 5P8WA 4YT2A 1VM6A 5CJJA 4XWGA 5FL3A 3WMEA 5AP9A 3JWEA 2A5DA 2AMFA 2FPIA 3OLVA 4QULA 4JZYA 3V32A 1RWNA 2I7XA 2HSJA 2Q1XA 3RSHA 3ESXA 2CNKA 4DMGA 4DR1B 2Y6UA 1DJMA 2UZ1A 4IHJB 4HNVA 4DTIA 1TQHA 2JASA 4JGGA 2HEIA 4D0GA 4YQZA 3S1LA 4BNLA 2P62A 2HBQA 2FPXA 2UYHA 1BXRA 3AF2A 3V8NA 1CLUA 4DC1A 5FBVB 1IMOA 4UU8A 2H4HA 2W4IA 1WEKA 2BOVA 3IOYA 2XX3A 2GPNA 3A3PA 2AZTA 4IFEA 2W4QA 4N65A 5KNLA 4Z3OA 2PBLA 2QYOA 4FC6A 1XTKA 1O3YA 3IP5A 3RI3A 3Q0EA 5CAEA 4Y2PA 4MRMA 3CR7A 2QVZX 4IPTA 5H3LA 4YQYA 3SZMA 3SYTA 6REQA 1CEQA 1TJ5A 1KAOA 2W6ZA 4NNPA 4X1OA 1UBRS 1V3UA 2DUMA 4JNKA 4NABA 4QELA 4AJKA 3W7AA 1NHGA 8ATCA 2NN3C 2A1UB 1HTTA 3LPMA 4GSLA 1P7YA 1FSSA 5G1PA 2CFRA 1P9LA 4UBLA 1TF2A 3RFFA 3QNMA 4B7XA 2A9RA 5GVRA 1YJ8A 2HPAA 1E6WA 4W9NC 4BNGA 2ZRFA 5T41A 1E32A 2EZUA 2JFZA 5LD2B 3V33A 3FNGA 2AI1A 4KI7A 1L5QA 1PNQA 3BH6A 1H85A 3P97A 3UIEA 3B2NA 3S8MA 1T25A 1U8FO 2QTHA 1IJBA 1FW8A 2ADFA 2OQVA 2MSNA 4BRWA 3V8MA 2QSZA 3CGGA 2B2CA 2ZQ5A 3ZHYA 1Y3IA 5F64A 1I2DA 2UUCB 4GICA 1M7GA 3COYA 1IUOA 1LWOA 1V3TA 2W2OA 4N12A 4UXHA 5GONB 1Z5ZA 4MQEA 5EUBA 1IYZA 3A6GA 1TD9A 4JOQA 4KN9S 3LHKA 3BKWA 1ZSYA 1DB3A 5JCJA 3GL9A 4YEDA 1M34A 1U94A 2XUGA 3PX7A 1IN5A 3OIYA 3OEWA 1FPQA 1MXHA 1WRBA 3I6BA 4RQUA 5DFAA 2Q45A 1U8YA 1SQSA 4L4ZA 1L4UA 2P9YA 3GAAA 1JB9A 1JDZA 2IYSA 1NVUQ 3R6TA 4O3MA 4HEQA 5HFJA 4L8VA 3AP2A 1LJ8A 3K9BA 1D8TA 3OO0A 4E09A 3JCZA 4HSGA 1PV4A 1DUIA 2OV2A 1HG1A 2C0PA 2QLFA 2XUAA 3GGJA 3MRTA 4FFLA 4QYXA 3U3RA 3V1TC 1FP4A 2I6FA 5K0FA 3CUWA 1G8YA 3PNQA 3DHYA 2BGLA 2D62A 4FX2A 4RFSB 1ID1A 4B43A 2ZIZA 4QGBA 5HP4A 2R1ZA 4LNUB 1BDIA 3EYAA 1FA9A 4NC9A 4C0HA 2FGJA 1Y6QA 5JXGA 4XDGA 1Z12A 1UDBA 1QOQB 1PJTA 3B53X 3ZK7A 4BMSA 4KR6A 1L7MA 3V2GA 1K5PA 1ZESA 2O7RA 4OI1A 5JANA 4IWNA 4F4CA 5IC6A 2IPNA 4ZCSA 2NYUA 3R40A 5EC8A 3RFVA 3WLJA 5C35A 1CV2A 1J25A 3FOBA 5A3SA 4PWZA 2G9VA 3VH1A 4EI7A 4QOFA 5HNKA 1CVRA 4UOQA 3AUFA 2QRJA 4A0SA 4L15A 1L9XA 3EXEA 1EFHA 5AJTA 5PGMA 5IZCA 1B3BA 1FUUA 2WY2D 1A76A 4UEQA 1MC8A 2QR5A 3F6RA 4R1UA 5LJLA 4YAFA 4HR7A 2SKDA 2YWXA 5B1HA 5EIXA 3OQNA 1ISIA 2IUYA 3AR5A 2OQRA 3T38A 3VBEA 3C1TA 1U7HA 4CLOA 1T2NA 2IHTA 2OHOA 4IHQA 1U2ZA 3COZA 3SKVA 1ZUNA 3HXTA 4ETNA 4OPMA 4FZRA 4J03A 3BRWD 3ZE6A 3H2GA 2DTXA 4PZAA 3THRA 2AEFA 3R24A 3DO8A 2ZIGA 3TEJA 3R0QA 4CMIB 4NESA 1QTNA 1XCPA 4FYMA 2WD9A 3USZA 2Q5IA 3WYDA 1GQSA 4XJTA 1XMIA 3ZZ1A 2QJFA 2CSUA 3F98A 3UF0A 4C4SA 4S35A 1VYUA 2BRUC 3FCXA 2OBLA 3M70A 1RKQA 3FPFA 1BTOA 2Q2VA 1Y8RB 4ZQBA 4TRRA 2OCBA 1UAYA 3EUAA 5DI3A 2VJYA 2VRNA 3L8HA 4DSUA 3O9ZA 1ADYA 1E5LA 2QL7A 3P9CA 2WJ4A 4O2RA 2QYTA 3RIMA 1W88A 3UB2A 2HDOA 2O8FA 4X1IB 4JVLA 4IUDS 1QIKA 5BNTA 4RK0A 3ROKA 1K92A 2Q2NA 4RIFA 1BVHA 3LDHA 4L2IB 2QXTA 1NVDA 2AKAB 2DT8A 4BRSA 1VKJA 4LECA 1SC6A 3P9SA 1AGPA 1YC5A 5E9WA 1AN9A 2RH5A 2WHRA 2Q5JA 3OKCA 3AM3A 1CDOA 4K9SA 2FWPA 1FBTA 4ZU6X 3I58A 3QBDA 4QOIA 4DR5B 1B0PA 2Z8ZA 5C8DA 1VSBA 2GFQA 5LN1A 2HA7A 2F3TA 2PL9A 4NMMA 5JNSA 1WBDA 5F7ZA 1SBIA 2IYXA 4RLHA 1QV9A 1QE0A 4IYJA 1UPBA 1Z7GA 1VDZA 2I1LA 3U9LA 5D5QA 1YJQA 4D80A 5ADWA 2SBTA 3A6JA 3GFBA 1YZVA 1KERA 4GE0A 4IFTA 3OAAD 5DBFA 3KYDA 1BX0A 2P27A 2AEJA 1ZOIA 3I9V1 4ETMA 3KJQA 3ANLA 3LO5A 4Q4JB 3MMNA 4PLVA 1M2GA 4G8CA 4D82A 2VAWA 4DPMA 4Z1MA 3LTEA 4YRPA 5K5EA 3KB1A 3GP5A 1UQTA 3QVTA 4WI1A 1SWWA 1GCOA 4UEOA 3T4UA 1HETA 2BJWA 2Z6AA 1NVEA 2HMVA 3RADC 2OHXA 1GT6A 4P7GA 3DL4A 2G6BA 1NMXA 3HCAA 1FDTA 3GZNA 3IB6A 3MT8A 1TAGA 4QEDA 1DQYA 4ZP1A 1JQ5A 1MU0A 2GZSA 4US2R 2IGTA 2Y1LA 1BCRB 3FF1A 2O7SA 3LDGA 2HADA 3S28A 4GVXA 2TYSB 2PSEA 2QM8A 2L42A 4I4LA 3IE0A 4AKEA 4CG3A 3MB8A 3BWYA 1CB0A 4RMNA 1LLUA 1OTXA 2VPZA 1VMIA 2VYQA 4HRYA 4OTZA 1N78A 4U4AA 1EFKA 2OPBA 3M6VA 2XVMA 4PS0A 3RYFB 1Q92A 1Y1SA 2Y1KA 2KYRA 3BB1A 1P72A 2QE7D 5BQPA 5JJKA 2A3NA 4PN3A 4G0YA 1G9TA 1NYRA 2Q46A 2G4LA 1NKVA 2E4UA 3EDYA 4PX3A 3EF1A 4Z99A 3S0JA 1QH1B 2C2KA 3IAFA 1GP2A 4OQLA 5IT9A 5LIPA 2RGYA 4F1KA 5EKTA 1F5NA 2AHOA 1NY6A 2B1RA 2I3DA 3FUCA 3JZMA 4MICA 1E1QA 2C07A 2B35A 2WWVD 4WIAA 3ZCQA 4EF5A 4ER3A 1TD1A 1FNDA 1MTOA 2YJ4A 2QLNA 4N9QA 4XIYA 1YL6A 2IF0A 2OGUA 3UATA 4YAIA 3RS9A 4DIFA 1US8A 1XQWA 4B40A 5IM4A 2Z83A 4BE7B 3WI7A 4ZT4A 3KHTA 3VMMA 3ZBUA 1PL0A 2I65A 1HDCA 3EVZA 4CM5A 2GS9A 2XWPA 3HWX1 1ZH6A 3O31A 2Q3MA 5I8ZA 3R0IA 3DEZA 1Y3CE 4FKMA 1MHPA 1NBWB 2DR0A 3UKDA 4P4UA 1NU6A 3ABRB 3DTVB 1XRSB 3FGPA 2AJDA 3I12A 4MKZA 4QDUA 4YT5A 3KKMA 4EAAA 4JI1B 1G98A 1K7YA 4ND7A 1US8B 2OHVA 3GFOA 3KZVA 4TTRA 1NXVA 2XMRA 2OUIA 3DE3X 3JQEA 1ZD8A 1O6ZA 1P33A 5FOWA 4NBSA 2ACKA 3ASUA 1EJBA 3HH8A 4IIJF 4CKYA 3U0BA 4UQLA 2J4FA 4AJPA 3OKFA 4Y6GB 4PTZA 5CBPA 2R5WA 2VL7A 1KYVA 3AUAA 5SZJA 1SD1A 4JLWA 2VEOA 3HV2A 5AVXA 1E6KA 2PH1A 1YE5A 3LUJA 4BAZA 1OJ7A 2C8VA 1B3RA 1XZHA 3PFGA 4RESA 4AUKA 1QIFA 1RZRA 4DNQA 3UVEA 1O94C 4HAYA 1W4AA 5T67A 1QZUA 4C5BA 2ZJZA 2E89A 4OKNA 2B7CA 4QGHA 2D00A 2D5LA 3TRKA 4ARVA 4DMKA 3HS3A 4YHHB 1A4UA 1V3VA 3D6UA 1OYWA 3RH0A 3KEGA 10MHA 1A2OA 3M2PA 3MJDA 4DQ0A 4CT5A 3HBMA 4Q0MA 4WSOA 4IO0A 2R00A 2R6GA 3GUCA 4LY9A 3MVEA 5H9VA 1XD2A 4MLCA 3TIGA 3ORRA 1SCNE 1BNCA 2MR5A 4PV7A 4DR4B 4L5CA 1J09A 3DR5A 3QTLA 4IUBS 4DVGA 1O9BA 2BGIA 4IH1A 1CWUA 2H17A 4G9BA 1P0FA 5JJBA 2YWBA 3AQ4A 4FSHA 1PQUA 4RDIA 5BRNA 1L7RA 2GB4A 3N1UA 1H4QA 4O4IB 5HBRA 2X40A 1DC8A 2ZBFA 1PV2A 5DK6A 1X1CA 1V8BA 1JQEA 1KZGB 3S7ZA 3E5RA 5E2AA 1JYSA 5IANA 3VR6A 2YWRA 4L8FA 4ZHQB 1ZH0A 3BHJA 4HYEA 5KB3A 3UMSA 3QVLA 1A96A 4LMRA 5AUQA 2QBYB 5I7UA 4EBBA 1DKQA 4O3FA 5DEOA 3E81A 4DMFA 1KVQA 1AH2A 3F3MA 3REQA 1ZC4A 2QMEA 5DX0A 4JI5B 1J8MF 3WQQA 3E5MA 1WAMA 3C6MA 4C7KA 4QBIA 1DKUA 2YOHA 4WGFA 3TNYA 2GEKA 3B85A 5J4HA 4QODA 3TJRA 2IT1A 2PZJA 1WXQA 3Q11A 1FW6A 1KSHA 4ND5A 4YCLA 5LOVA 3F67A 1DKOA 2XCQA 3GEMA 4D8XA 1IK4A 3AQIA 1LBQA 4JHLA 3FJ1A 5JBQA 1ZHOA 4MS1B 2C98A 4KW7A 5TGDA 4HLCA 5EZQA 3UB3A 1RM3A 2R11A 4P2BA 3WJ1A 2W2TA 2Z4RA 4EGAA 5ABPA 5AUOB 1K68A 4LJ7A 3GFPA 1QYIA 3GQVA 4RKRA 2XODA 4ZQHA 1GWNA 3JQFC 1USUA 4CM7A 1KRHA 5D1HA 2Y68A 4X1IA 2V7VA 3OHPA 1P2BA 5JISA 4TL9A 3AEKA 4NBTA 2W6QA 5DI3B 3AZQA 4K8OA 1E2EA 5FI5A 2F8TA 2NTNA 1TFUA 4FFNA 4XJXA 1JI0A 2AG1A 5JXHA 2Z5GA 4LFAB 4XWWA 2HNBA 4MOWA 1HF3A 3CC8A 4O4JA 2E5LB 1Q0ZA 2EFJA 2G36A 2HA2A 3DNMA 3LCRA 3EQ6A 4PYKA 2IA5A 4DZZA 1M6YA 3D43A 5LD2C 3QKWA 4N8DA 4AMUA 5JD4A 4IEFB 1BX3A 5FOVA 3NHLA 4HTFB 3MT0A 2QQEA 2JAPA 3TLGA 2PAFA 3FZEA 4QYSA 4BATA 5IFKA 3N2NA 4KLNA 1JHUA 2W2LD 4Y7CA 2XQIA 5SYMA 4QNRA 1XE3A 1MCZA 3ZH2A 4DLNA 1WVIA 1X7HA 3NEYA 3TCKA 1COWA 4IBOA 1BMDA 2PBZA 2X58A 2A0FA 1KL7A 2Q3FA 3DPUA 1DCMA 1OU0A 4DLWA 2VKTA 2IYZA 5E6SA 3SJAA 4O2LA 3ZC3A 5KU7A 5LZ4A 2NSHA 5IZCC 5L4LA 2FDCA 4FOOA 2D8MA 3AG6A 4UUAA 1J06A 2PWPA 2YV4A 4KZKA 4NK4A 3PQ4A 5CMLA 5E8RA 1D1QA 1Z0UA 3KOWA 2VYVA 1Q83A 1A27A 4R2MA 4OI0A 2VJMB 5JYBA 1YE3A 2DKOA 3HKBB 4JY7A 4L0MA 4V0NA 3V4LA 3IAS1 1O97C 3EE6A 5F9FA 4X6UA 3TLMA 3WGOA 1DWPA 1PQ4A 2YMLA 4EX7A 2CUZA 3MJRA 4RSGA 4S3MA 5LIRA 4WERA 4JUCA 5C3MA 1HNZB 3MD9A 2R7LA 4DCTA 4KGDA 1PTKA 5EHQA 5KNDH 1OZGA 1XTUA 3OIGA 1NUQA 1B2RA 2IPXA 4GLOA 4GMGA 2B1QA 3AVOA 5FTKA 3VC1A 1H8ED 5AJXA 1W1UA 4JT4A 2O9JA 5F1KA 4ZCMA 5KX5F 1FP4B 5E1BA 3NAQA 1Y7TA 1OI7A 1IMJA 1M8GA 2F3UA 2YDXA 3ICPA 4LHSA 4PAOA 4CG2A 4EKDA 3FHTA 4IH4A 1NWCA 4PXSA 3J80A 4PG5A 3PNPA 2WT9A 1KE2A 2H65A 3NOQA 1YCDA 1Z8DA 3ADOA 3Q72A 4ZOEA 1K75A 2DCMA 4KRFA 4P58A 4U6QA 5E6RA 3DPSA 4R4JA 1JIJA 4DHEA 4A2QA 3L4JA 2DZDA 4E4TA 2ZCUA 4Z4HA 5AKEA 2P77A 4A2CA 5EEHA 5KDDA 5LNK1 4LYHA 4JJFA 1YNSA 3UBTA 1OFUX 1IZZA 1DIHA 2IC5A 2RHCA 4ZYZA 2QU8A 2DUUA 1IB0A 1ZC3A 2HXYA 1Q2UA 3BCUA 3CZMA 2YIDA 4Q1BA 5EMJA 4BY9E 3EG9A 3RC7A 4XD2A 2Q29A 1IUKA 1V8PA 1XQXA 1BVYF 2A0WA 2BSXA 3G2LA 3PKZA 4FKBA 3PF8A 1P2GA 3ZPXA 3JQ9A 3PHLA 4RDHA 2OXFA 1DCFA 4NKRA 4G84A 1EBUA 4OSPA 5LDDC 3KCNA 4L7QA 3AVQA 1YR7A 3CVXA 4BJ1A 4EHDA 1F5SA 4ENWA 2PGDA 4N48A 2AWOA 2E1PA 3F3YA 3Q3CA 3SOZA 3RLFA 4RJTA 4JS0A 5LFAA 1E2FA 1UJMA 3LQQA 3W0LB 3OFJA 3QKTA 1U6KA 3LT0A 4BMOB 4EABA 4KPGA 4K9RA 4C4TA 2OYCA 1H2ZA 1R0XA 5B2ZA 4A2PA 3KB2A 3AF3A 4IHJF 3DE1X 1JEQA 1SQ5A 3LP6A 2AZDA 3NYIA 1LVUA 2AYZA 4TMZA 4U2GA 1X1TA 4HYYA 4QJ5A 4XARA 3U16A 4J1QA 1CY7A 4ZMSA 2UXBB 2QV7A 3FUXA 4B82A 3RABA 3NPAA 2AR9A 3KL2A 3FUWA 5FD8A 3EPLA 4F4IA 4AI6A 3T5AA 3PLNA 4E6PA 3LIIA 1N33B 3X43A 4QFBA 4BGDA 2FPWA 3D2BA 2O0KA 1AO0A 3C87A 5LB2A 1NUUA 2H2FA 2HK7A 3H42B 4YP9A 3TW8A 1R8YA 3G9TA 4CKEB 2X8AA 4L22A 5F73A 4BNYA 2CVPA 4EW3A 3E05A 2EFDB 4UUPA 3EYWA 2TMYA 1OI4A 4ZV4A 4H59A 5I4CA 1ESZA 2YWFA 1KQNA 5B12A 3GLIA 1BXRB 2P5YA 1EFUA 3CCBA 3AFNA 2TMGA 4F56A 3FE2A 1RHMA 1W35A 3FTPA 1J00A 3O2SB 4AG3A 3R6WA 1GM5A 2VHTA 3Q6IA 5EPUA 2ONZA 2XDYA 2IH5A 1Y3DE 2QRNA 2VPTA 3C3DA 3UV7A 1YZ3A 1DUSA 4MRSA 3U0VA 3CLRD 3TLGB 3HA5A 1RYDA 2EOAA 4HTFA 3BE4A 1GLVA 1C7FA 1L4BA 3DLIA 2FUKA 5ECYA 3AM5A 2MYUA 1HO3A 4CMKA 2JBAB 2B1JA 2PZGA 3PC7A 2C61A 1JI3A 3NI2A 3SSNA 4CE6A 1ANKA 2PJUA 4G0WA 3D64A 2P0EA 1AKYA 3ENQA 3QF4B 4YACA 3A6HA 3PUYA 2Z3ZA 2PIAA 2K2WA 2Q7XA 4YRGA 5I4KA 4NULA 1LC3A 1EA7A 3MMSA 5EL0A 1CTQA 5IXYA 4KR3A 4TKVB 1KK2A 2FJPA 2JGLA 5F77A 3FYHA 5CG2A 4Q3EA 2RAPA 2VUTA 2X7HA 2ZB4A 4OUDA 2FPRA 4I9FA 3A3OA 3WLMA 1MA3A 3IKMB 4MGEA 5FPQA 2QNBA 4PAQA 1CP3A 1LV8A 4PFKA 4OYHA 2ZYTX 3AJ8A 3QX3A 4L28A 5KCMA 1OC2A 2DU8A 3H0KA 1G3IA 1MV5A 2AYYA 2NO5A 1SVIA 1E9VA 5BN5A 1HT2E 3IQDB 2LGJA 4JYZA 1JJ7A 1PJ4A 4Y2UA 2JHFA 4A0HA 2GNOA 2JFBA 3FMIA 1H2RS 3KT6A 1NURA 5JH7A 1K6JA 2WJVA 3QYAA 4KQHA 4ZOLA 4W1SA 1XXHB 3OZBA 3TL6A 3UT6A 2CVHA 3JQ8B 5KYKA 2YJ6A 3I1FA 2FP4B 2CC2A 2VP2A 3D8BA 1DV2A 1UP7A 4JNCA 2JKZA 4H7DA 4Z2YA 3EPPA 3EWAA 4B9EA 1FFCA 4BX3A 4NIMA 3G2KA 3TAXA 1PZXA 3MAJA 3KIPA 4GMXA 2C8KA 3OUZA 1UJNA 4Q1VA 5AT1A 3SG0A 4F9GA 1ESEA 3BS4A 2VDVE 5EIAA 2AKEA 1KJYA 3R0XA 3AVVA 5LQKA 5IJAA 1ZK3A 2WQZA 4O2BF 1OXTA 3PQ6A 5G0VA 4LRXA