2E85A

Crystal structure of the hydrogenase 3 maturation protease
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
156
structure length
156
Chain Sequence
ASAVTDVLLCVGNSMMGDDGAGPLLAEKCAAAPKGNWVVIDGGSAPENDIVAIRELRPTRLLIVDATDMGLNPGEIRIIDPDDIAEMFMMTTHNMPLNYLIDQLKEDIGEVIFLGIQPDIVGFYYPMTQPIKDAVETVYQRLEGWEGNGGFAQLAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Hydrogenase 3 maturation protease
publication title Crystal structure of hydrogenase maturating endopeptidase HycI from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
total genus 39
structure length 156
sequence length 156
chains with identical sequence B
ec nomenclature ec 3.4.23.51: HycI peptidase.
pdb deposition date 2007-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01750 HycI Hydrogenase maturation protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HybD-like 2e85A00
3PU6A 5IJAA 1C8BA 2I8LA 1CFZA 2KMLA 2E85A
chains in the Genus database with same CATH superfamily
2DHRA 1P6QA 3OLCX 4UQLA 1EJ6A 4LBVA 1EVJA 5CB4A 3CLRD 4IMJB 2QMHA 3M9XA 1LWOA 1LDBA 3UHAA 4X62B 3GEMA 1KEEB 3EHEA 1S3IA 4ZZ3A 4NENA 3TGPA 1E77A 2VDWA 2ZT6A 3FKQA 4MO9A 3SMQA 1X7ZB 1ZRHA 2J3HA 4AMZA 5C5CA 2FSVC 4OAPA 3OE4A 1T6BY 2CZGA 4QRHA 3AL2A 3UANA 3R5JA 3SZ3A 3QUCA 4IJUA 1ESEA 3IV9A 1TVMA 1ZC3A 1U7TA 1C3OA 2JAOA 3DOEA 3RUHA 3K6SB 3E5NA 1R8SA 1SQ0A 2EF0A 1OHHD 2Q1SA 3MWDA 5I9BA 3SMVA 3BMCB 3U7QB 1O9GA 3EEIA 4OHBA 1SG6A 4FOSA 1ECJA 3QKRA 2H2IA 4Q39A 2VT6A 2JLRA 2DLDA 4RPKA 4KBGA 4MV0A 3RYCB 2AS0A 1CVIA 2JGLA 2HO5A 3HKBB 1YHYA 1ID1A 2H1RA 2ZBEA 3IQHX 4PNPA 4YJHB 3LU1A 1B3BA 1ZJJA 2ETXA 2OPBA 3NHSA 4WCFB 2QYHA 3HGMA 4BGEA 2I54A 2NP7A 4OPMA 1KS2A 1L8AA 2AN4A 5FWXA 3ZY2A 2IHZA 2GSDA 1VB5A 4ND7A 3WGQA 3ZZMA 1H2BA 2O14A 3PHJA 4OFXA 5ALFA 3LLUA 2I6UA 2JGDA 2WKRA 3OSZA 2OO5A 3QXCA 4C03A 3BIOA 4Y9DA 2XCQA 3GJ5A 4TQ9A 3QBTA 4TUYF 2YYAA 4WUVA 3FDFA 2VZ9A 3CF2A 1F8YA 4DRXA 1QIDA 4UZEA 1MABA 2XMSA 1AVTA 1C0PA 1JB9A 1WZUA 2HJHA 1MORA 3ILXA 4IIJB 3ZHVA 4BOYA 4YR9A 1T6XA 2OO3A 1QTRA 2CXPA 2QX4A 2VH5R 3HJTA 4LS3A 5DCWA 3URMA 1U7WA 3AKZA 1M5UA 4RULA 5JAOA 3UGJA 3J7AC 4TOIA 2QLMA 3RUCA 5IM4A 3OQIB 2Q8QA 4FHFA 3QX8A 3T3EA 3HH8A 4NATA 3NYQA 1BD3A 4JJZA 1W8IA 4MB2A 4MKZA 4KOAA 2NO1A 4Y2XA 4KPYA 1UDBA 2J67A 2JAWA 4JB0A 3EG5A 3FPEA 5D5HA 1RFLA 2EL9A 2JJ2D 2YH2A 2K6GA 3UT6A 3CX7A 1QH0A 2OLEA 2VHCA 4E4TA 4U2GA 2ZRBA 1PS9A 2W48A 3S2UA 1JF8A 3CPEA 1JQ5A 4B75A 2PFGA 4TTVA 5IKPA 2ECPA 3DKPA 3HTXA 3CC8A 3H7AA 4XCQA 2JFXA 4MDYA 2JFQA 2XE6A 4FDMA 4PW0A 4QLBA 5BUSA 1LXCA 2VSQA 4ZT7A 3P2KA 2PMEA 3GUYA 3OKCA 1E6LA 1G8GA 3AT1A 3GI1A 4JGBA 3TNLA 5IC6A 3W9YA 3ZY3A 5BN1A 1MAVA 4QYIA 3K2EA 2R8RA 2XEDA 1O1YA 4LHWA 1H2AS 1YMVA 1P2VA 2ZBGA 3PICA 5COQA 1C3JA 2Q6LA 3UIEA 5BMVF 1T1EA 3JQAA 4TWAA 3WAGA 1NP6A 3O9MA 4PX5A 4AG6A 5KMGA 1GU0A 2X58A 3THYB 4BNHA 2W6IA 1RCTE 1NQOA 5I6DA 3E9ZA 3MWFA 4L0CA 1MX1A 1HL7A 4AN4A 4KO3S 3R6DA 3AEXA 4EDFA 3N2GA 3L9XA 3ESDA 3IBCA 4OCZA 2FKNA 3ECSA 3U4DA 2GXQA 4XIIA 2R1UA 3KQTA 1M6EX 5B5SA 1UC5B 5K01A 1KQFA 1NMYA 2H1CA 4I6JA 3JU3A 4N5HX 5BR4A 1PHRA 2GEBA 2AXEA 1BVUA 1QRSA 2PU7A 4FFBA 5IHPA 4Q19A 1MOZA 1SD2A 4KAAA 1MB0A 4QOSA 2PWAA 1RXCA 3R5SA 4NZYA 1QR6A 1FP6A 3THOA 3TEJA 4CCSA 3VRHA 1T8WA 4CLOB 3DLIA 5KJFA 1NVKA 2ZI9A 4L5IA 1DB3A 4C7XA 1L7PA 4ZYYA 2X9LA 1FSPA 2XB9A 3ZHZA 2V4ZA 3I61A 2RHBA 1S2NA 3RUAA 4DA9A 3WL4A 1JA0A 1ZK0A 3SVLA 3W3ZB 2PIAA 1MO2A 1JVBA 5DGHA 5E8RA 4BLVA 4D97A 3TJZA 5AW1A 1NW6A 1NR7A 2PUGA 3SM3A 1ZH8A 4G36A 4WBNF 3U44A 1GP2A 1KI3A 2FCAA 1EVQA 3BXOA 2G1KA 1T2DA 1P2TA 3Q6MA 4Y7CA 3B7GA 3QVLA 5DM2A 3V8BA 4A8TA 2I4LA 3KV3O 4ZAZA 4EHLA 3C6YA 1Z47A 1NBMD 2C3UA 1D9XA 1M33A 3KKMA 3LDFA 3QU9A 4C5BA 3W1EA 2X0EA 3WK9A 3GHHA 4ERXA 3RC2A 5CG2A 3R0ZA 3PT9A 4FMBB 4WX2B 3ZCSA 1VXRA 1FF9A 1QIGA 2CMHA 2HPHA 4Z9FA 1E7MA 3BRCA 4BASA 2R7NA 1KU0A 4IVRA 5K6TA 4ZICA 3FTEA 2NMVA 5KINB 1QYRA 4DHEA 2VPZA 1X7WA 1FCJA 3UGTA 4E32A 1DAPA 2E82A 5IJXA 1JMYA 1M1YA 1N1EA 4G07A 4LXIA 3TZ6A 4Y1EA 4E4YA 2H1OA 2ZUEA 3BD8A 2R00A 3AF3A 1RRKA 3OG9A 2ATXA 1QHNA 2I1VB 3PLAE 4KYTA 2QMEA 4BO9A 3C98A 2QMOA 4HWPA 1SUFA 1WU8A 4HUQA 3KTAA 4DLTA 3PTLA 5KSPA 1TQ4A 4Q9AA 2ATVA 3ZHOA 4D8YA 3DAPA 3VU1A 4P35A 2JIOA 1ZA2A 4N39A 4HH0A 4EY7A 4DSNA 1JJBA 1ULBA 2GCIA 3ENNA 3SSMA 2C7GA 3PUYA 3LWZA 4GLFA 4JZKA 4FINA 1HX7A 2A3NA 3FMVA 2R6ZA 1P1HA 2BM8A 2QRJA 3TD2A 3FAZA 2HZ7A 5EP2A 3L7DA 2OPHA 3HP1A 2FPOA 3NRJA 4DABA 3MB8A 3NBQA 4HLQB 4I6EA 5F76A 2LXNA 2VRNA 3DO6A 4G84A 4IMRA 4DCOA 3O2JA 4OXXA 4YNBA 5A9SB 5EHXA 1HDGO 2ZZKA 3BFPA 3IR5A 2OFWA 5JCOA 2PDAA 1DRKA 3A11A 3WVNA 3I76A 5FPYA 3GJQA 4EABA 4DV3B 5JZVA 1VHJA 3CZ9A 2J5BA 2OESA 1M76A 3NH9A 2YMQA 4HYTA 3QNMA 1Y8CA 3QVUA 5HSGA 4LF5B 1UMCB 3GDWA 4HH3C 4M38A 4QDKA 3FTFA 3A2MA 3VNQA 2XZTA 2C5HA 4UCQA 1PTJC 2HUNA 3QEAZ 3RAEC 3FZGA 2EKQA 2YICA 1OI4A 2QSUA 4I1RA 2VAPA 3CF6R 1TI7A 1U81A 1D2NA 3LNCA 4Z53A 4K6FA 2AFHE 1TAGA 4LRQA 5FP0A 5JIBA 3C1AA 4F2DA 3K70B 1SVOA 2TECE 1L9KA 3QI2A 4GP6A 3AIIA 3TNDA 3UJNA 2Z6AA 2L42A 3IAM6 4OXYA 4LF6B 2GKOA 4CM8A 2CF6A 2XTNA 3WHKA 1DZ3A 2M9MA 3O74A 2C5EA 3UAOA 1AZTA 5CP8A 4DCVA 3EIEA 3IR6A 4II3A 6AT1A 3VMMA 1YE3A 2GVNA 3AC0A 1Q0LA 1YI0A 2QN7A 3K0HA 4LHZA 4EYEA 5I7FA 2XVZA 1KPGA 4LVOA 4QASA 4HK4A 3DWFA 4LXHA 3WSVA 4DLAA 2W2XA 2UZIR 1I1OA 2VTEA 3BXXA 3PDIA 3ZGLA 3VPCA 1JEEA 1WE2A 1X7HA 4D4HA 4EQZA 1FFXB 2N75A 4BJHB 2FQYA 3TS1A 1R0ZA 1CTQA 1T3HA 1E92A 2DHCA 3G9QA 2VJQA 3M5CA 5E6UA 1HQCA 2PH5A 2XECA 5IHXA 4CQJA 5EMKA 3M2PA 1MKYA 1XUOA 4GBED 1RXWA 1LLDA 2CXSA 2D2IA 1RADA 3BS4A 3W04A 2OHVA 3TE6A 4CV2A 1K9SA 5EWLA 1CIVA 3JVVA 4AZ3A 3SKYA 4YRFA 1SXJE 5T64A 4E51A 1E1LA 5KQPA 4Z0TA 3UMJA 1PGPA 2FEPA 3ADPA 3EBLA 2WSBA 3ICWA 4ZU1X 3ET5A 5E9WA 3KQNA 2YWBA 3N05A 5DRYA 1RHJA 3QLEA 1BFKA 4U6QA 3TIXB 5CDUA 4NDNE 3Q9NA 1OXVA 1J8VA 1NNSA 1W2HA 2FRDA 3GFGA 4HTFB 5CCEA 1LH0A 1FW8A 2GNAA 1AS0A 2Z98A 4QELA 2ILVA 4K8OA 4P86A 1PJCA 4RC9A 2IIPA 1ITZA 1T9AA 3M6XA 5ERYA 2XT0A 3U13A 3GLIA 1JEYB 1T5TA 3RUEA 2E4UA 2XKJE 4IIGA 4BEJA 1COWA 3QITA 4PZCA 4WSOA 3H3FA 1KDYA 4ZCRA 1AKUA 3WYAA 4TMYA 3KQKA 2AMJA 4FB5A 2HUPA 5KSOA 1UFVA 4NU0A 2D62A 2GLXA 3T9EA 1O94D 1G9TA 1P0CA 2L82A 2A35A 4R1PA 3DMPA 2IZ1A 1RTTA 4S2EA 3CTMA 4HAWA 4Y2TA 1AQ6A 1QTIA 2BL4A 2UYHA 2OCAA 3D1LA 1RPTA 4Y2YA 3WGJA 4BCCA 1B2RA 3PKZA 2WF7A 3OZTA 4NBRA 2R47A 4TMWA 4WZZA 2OXIA 1U0GA 2IU6A 5C7YA 4NNOA 4EECA 4B47A 2ZCJA 2O7VA 1YCHA 2BFNA 2P1DA 2PPLA 4BB6A 3AXTA 5A04A 2AZTA 2EZ4A 3BSSA 1PQYA 1DRJA 3QVXA 4F5DA 2CVHA 3BOSA 1JLHA 1NDQA 5AXAA 5KDOA 1ZD4A 1DWUA 1C29B 2CLLB 1OTXA 1GAWA 1UAYA 1V5FA 1IN1A 4DZZA 1KMCA 2DFKB 4QDXA 5BO5A 4DANA 4NJEB 3F90A 1O96B 2HA3A 3DEKA 3DL2A 4TTJA 1HTBA 1E18A 1QC5B 3J7TA 2J07A 4O2LA 5J3JA 2FOXA 5LMUB 1G4HA 3QOYA 3WKBA 3T3OA 1S1CA 1XAIA 3F4KA 3OBBA 5CIWA 1IWOA 1PT8A 1OLXA 1XVAA 2IHUA 1VE7A 4ENQA 1N2GA 4R01A 1NW4A 4H15A 5AJWA 4A2PA 3HRHA 3IT2A 2Z56A 2VNHA 3L6EA 2Y1KA 2FWIA 1BEEA 2ZRJA 4JLVA 5T6MA 3JS5A 1WVMA 2IX9A 3I58A 3VPFA 1N7IA 2IHBA 5EUQB 4E5DA 3AUSA 5FA5A 4Q3EA 3B3AA 1W8DA 3EULA 4YRKA 5C7IO 1W59A 1FFCA 2O2DA 2VAWA 2G9UA 1GAEO 4LXXA 5HEKA 2HIMA 1Y3HA 2G08A 2G1UA 3JAKB 4R8KA 5EP3A 2MTBA 4AD8A 2WV9A 4Q3BA 3OPXA 1BWPA 2ATEA 3MCUA 4AKHA 1GCIA 2C97A 1UMBA 1U7OA 2G67A 3OLWA 4ZWNA 2GASA 3FYUC 5HIIA 4O2BA 1GG9A 4F6RB 2FEWB 2DFLA 4JELA 1B76A 5U9CA 4ZCTA 4F3CA 4RQBA 4RGVA 3H04A 4CIYA 4TYMA 2Z2XA 1N4AA 2RGCA 1D07A 3LBYA 1TRKA 4TLLB 3EXIA 4ZKDA 2IXFA 1LPOA 1XRSB 2YN4A 5FTKA 2ADOA 2PJDA 2HJGA 3DBHB 2Q4BA 3LUCA 1JWBB 1RQ2A 3QBDA 4ZHSA 1E8DA 5K0NA 3N0VA 3VR1A 3K9WA 1C3LA 5ECWA 5FBRB 4ZXPA 5K8LA 1SUEA 1RHQA 4AKGA 1I94B 9LDTA 3WQBA 1CJSA 2RHGB 3ER8A 1HC7A 1O6CA 3FNFA 4LOJA 4Z99A 5IT9A 2I6GA 1N0HA 5GTDA 4AWXA 1E2PA 2AXPA 3D4LA 4NAVA 3WP0A 3L0CA 3DKVA 1VSQA 1NV8A 1Y80A 5PNTA 4PFJA 1RWMA 1J1IA 2FP4B 3RWBA 5ABPA 1M34A 4G1MB 1Y98A 1ZKMA 2VIIA 2AN1A 3GROA 3QIAA 1KFEB 2NZJA 4BV8A 4EPWA 5CA1A 2VQDA 4IQ0A 2DCMA 3A4MA 1JHQA 3K4PA 1XRPA 1WSWA 1H85A 1QH8A 1CR6A 1X7GA 4PCVA 4K3VA 4MIOA 2TMDA 3C97A 3S28A 4EZBA 1I3LA 1I10A 2WHEA 3W7AA 3MT7A 4D7AA 3GLKA 2RH9B 3H16A 3GPDG 1D2CA 2BD0A 4M46A 1K5DA 3T1NA 1IBLB 3QLUC 5KTRA 2BBTA 5M7EA 3QLVA 2OE2A 4M9CA 3Q3JB 3KUKA 2XI4A 1UKZA 4BNWA 5KBYA 1Z4MA 1W0JA 1OIVA 2WOOA 2WJYA 3MEQA 3R3YA 5IT4A 3RTDA 1TC1A 1TM5E 3SKVA 5CR9A 1PE0A 1KETA 3GVHA 1JAYA 1NVEA 1U8XX 5AI5A 4P0TA 3JARB 3GJXC 3QKSB 4LNUA 4GRDA 3FTDA 5ITZA 1BXKA 1KZHA 4BJ5A 3OT1A 3KBOA 3QOXA 2DETA 3LC2O 4E11A 1ADGA 3KUCA 1FMLA 4V0SA 1F6DA 2X8JA 3L8DA 3IE1A 3P9RA 4Q4JB 1F7UA 3WB0A 4K5QA 4C05A 3FI0A 2JJQA 3VA7A 4MR9A 3K35A 2OEPA 2J3LA 1ECBA 1HYHA 5K3DA 2P3SA 4WOJA 4M0KA 3LKZA 1LX7A 3AVOA 3JRXA 5HKAA 3KLNA 5AVTA 4MV5A 4MQBA 4ND5A 3C3BA 5DN6A 4H7EA 1UJ5A 5JYCA 3SJUA 1TO1E 1ZD1A 3O8LA 4NV3A 2BRUC 1FX1A 2IYLD 5EPEA 5LXTB 4C7OB 4D9BA 4XWWA 1BDBA 1IQPA 1Y5LA 2GSWA 2VRCD 4QO7A 4DT1B 1YGPA 3RO7A 3H2YA 4Q3OA 2GUGA 2H0AA 1YHZA 4B34A 3R23A 3VPGA 1PZFA 3L82B 3ZBTA 2Z09A 4AP5A 4WNCA 4WZBE 1GZDA 3M6MD 2BGWA 4CFSA 3FBWA 4IFTA 2ZRQA 3KEFA 1Q0SA 1QM5A 2AR0A 2QF7A 1JP7A 4U63A 4CR7A 4KJXA 5K3CA 5L95A 2D74A 3C3CA 4RDIA 2CMGA 2R68A 5JE8A 1T13A 2BZSA 2B0CA 5CBPB 4DXAA 1E1YA 3I30X 1T8YA 3L8ZA 4AJIA 1L5OA 1NW3A 3KT8A 1YRYE 1EBUA 1YB1A 1N33B 3GFTA 3DFZA 4GKKB 1IBCA 1QTNA 3LYAA 4FU0A 3MPUA 4UNQA 2Z4SA 4RELA 5DMHA 4BQFA 2HPZA 2PH1A 3I9OA 4F21A 1T3LA 2VBFA 4RD0A 2B4YA 3BXFA 5MHTA 4M99A 1HOXA 1E58A 5KYXB 4LPSA 2WJ4A 3UA3A 3WMRA 2JZNA 1FYXA 3LMKA 1VL6A 4IDDA 4K9NA 3DFIA 2WF8A 3TL6A 3WA6A 4B2YA 1Y33E 3F6BX 1G66A 3PXGA 2ORED 3LQKA 5JWHA 1QRTA 5JJLA 4N8SA 1MMFB 1L5RA 4UHJA 4DMMA 1L8QA 2Z8ZA 3DDCA 1LDNA 1OX6A 1XU9A 5AVUA 1WMBA 1NXTA 1UEJA 2WD9A 3NRCA 3E9DA 2XRMA 3HDGA 3LS2A 1N8KA 3DMFA 3ILYA 1LZLA 3QUQA 4MUNA 5AW4A 1XEWX 4UXHA 3NTXA 1AKVA 1WULS 2D0PB 4NSNA 1L4FA 3V8EA 4EA8A 3HBAA 1PL7A 2L19A 2Z43A 3GLVA 3IOBA 1M2GA 2B8WA 3HCWA 3NASA 3PKJA 4QUEA 1ANKA 3WBJA 5IZCA 4M8SA 3WZMA 5LMCA 2Q4TA 2J32A 4EQ6A 1TZBA 3ZDDA 3DXXA 3C5VA 3ETGA 4KHZA 2NOAA 4MUEA 3Q7SA 5CU7A 1EMDA 3A70A 3SHQA 4KDFA 3ROTA 3UJ6A 5JI2E 1N6HA 2Q6KA 1H69A 2Q1TA 2GJ8A 4RWZA 2IHJA 5C1DA 1H5NA 2V7BA 3ND5A 5BVHB 5KNDA 1SQGA 3HYNA 2FPGB 5CH3A 1T4CB 1TYDE 2X0KA 4RTLA 4WZ6A 4P7FA 1AMOA 2VPTA 2FPMA 4C0HA 1SBNE 2BFCB 1ECFA 2D0IA 2GN8A 4WERA 1RM3A 2NQTA 2TYSB 4B6OA 4ZODA 4HWGA 3LDUA 4NWIA 1PJLA 4JQZA 1LNSA 1KJWA 3MLEA 5A4JA 4QUHA 3GOQA 3ZKWB 2EQAA 3G8YA 4G26A 3TXXA 2QP9X 1B41A 4F38A 2F3SA 2WM8A 1RHUA 4MAAA 3BIXA 3ZE9A 4BJ6A 5JJIA 1G2IA 1YCDA 4HEA1 2V5VA 4UQOA 4D9JA 2NQ2C 1U2SA 2H08A 2Q2NA 4M1KA 2QW0X 1ZG3A 4GBJA 3COJA 2FZVA 3O3MB 1CPYA 4FBGA 4UDXX 1PLJA 5ELMA 5FWYB 3EXG1 3EFOA 3JR3A 2OK8A 3FIUA 3KVRA 1K8RA 4Q15A 1RBQA 1GWNA 4WINA 4DYVA 3EDMA 1U65A 4I4IA 4TSKA 4C0AC 7MHTA 1USWA 3DJYA 4HRYA 3HDYA 5ALKA 1GPAA 5ILGA 2D00A 3EZ2A 5C52B 2F1HA 2XWJI 3OTGA 3J80A 5JMPA 4HQLA 2HJ9A 3ZK7A 4CT5A 2YX1A 3R6GA 4G1CA 1PFVA 2GTPA 4LGVA 4PBTA 4DBLE 5IJ0A 1X70A 1J2JA 4JEHA 2NV2B 4R9VA 5I4CA 1Q20A 4HVAA 4YJ3A 2NSJA 2RAPA 4R2IA 5CFPA 5TT0A 3NANA 2ZRNA 1MC1A 1R10A 2QD1A 4M1OA 1PDVA 3VU8A 3WLPA 3TKLA 2XUDA 4NP6A 3VHQA 4YXFA 1FQOA 1QE0A 2ZGVA 2E7ZA 3R3UA 3DSRA 2C2YA 3SZLA 4DS3A 1RI1A 2UVQA 2CJPA 1AF4A 3KPWA 3R76A 3RD5A 2HMUA 1I5OA 5B58C 3VYUB 1IEVA 1GO2A 3I9NA 3KXIA 5BW8A 1VYVA 3MMXA 5L4SA 1TXGA 3RU7A 4FD3A 3VNAA 4EKYA 4LECA 1XJWA 3IQEA 5IAKA 3RVBA 2JKVA 2BLNA 2BLLA 4Q4DA 3AESA 1HDEA 4M7OA 4XOIA 3X1WA 5CDSA 5MN6A 4ZFNA 4Q7QA 1Q6YA 1Z4QA 2G72A 4N0MA 4O4HB 2PV7A 2VDNB 4MW7A 2J0QA 1WUJS 2Q9BA 2FUNB 1YS4A 5DMXA 1KSGA 5I7EA 1D0IA 1OZFA 4V0QA 1W87A 3C8UA 4A8PA 3CVXA 3Q8KA 4BNVA 4UDOA 3CNNA 3HS3A 2BFOA 3I62A 1U11A 3UM9A 3RI3A 4CKBA 1LPBB 2J8ZA 1J0AA 3W5UA 2W43A 4HLUA 3M6IA 2VPWA 2GEVA 4ANFA 2QZSA 5C34B 2IDJA 5HOQA 2ZAGA 1RZ3A 2CKDA 3CNHA 3EZYA 4RADA 1D0VA 1OAAA 1VE1A 3N2LA 3EVEA 2Y1CA 5FH9A 4INAA 5ALDA 2O8CB 3B1VA 4OV6B 5M2QA 2PS1A 4MV4A 4CGYA 4A92A 1V71A 1YIDA 1XDWA 2FSPA 1LBIA 1YL7A 4MVJI 3TD6A 3W6OA 3AR5A 2EFHB 2AT1A 3HEMA 2V65A 3JQ9A 2LPMA 2GBFA 1WV1A 3H9EO 1JFFA 4NXNB 1X87A 5KYKA 3QYJA 4WGFA 3U1BA 1RZVA 3PHHA 1Z0IA 2HA4A 2C5AA 4RQUA 2WW8A 3GGJA 3F6CA 2RGEA 4BLOA 2WRZA 1ENYA 4MWTA 2QJOA 2FMUA 1ZUNA 4KUGA 1A5SB 1M1YE 3P4YA 2WWRA 5L7WA 4X84A 3F6SA 3SI7A 5CNKA 5AM3A 1QZUA 3SOZA 2ZRPA 5DHFA 3DDHA 2X2EA 4CIBA 2RGDA 4ZHQA 2F1JA 3IR7A 4NBTA 1CR1A 4DIMA 1EP1B 4KL8S 1GTZA 1UKAA 4LZOA 1E7WA 5C80A 1TA0A 4BMVA 2REQA 4PLHA 3E9YA 3TE7A 2FSSA 2H1LA 2Q5EA 3EVBA 4DCCA 3QGMA 1EZZA 4AQYB 4RK4A 4XM1A 2OCLA 5CT6A 1H1TA 3MINA 4PXAA 1TF2A 4IJMA 4LCJA 1YKFA 1POXA 1SELA 3RC7A 4B3TB 3R3JA 5BORA 4QPDA 4WN9B 2TMKA 2QT1A 3QBEA 4K46A 4WK6A 5BV8A 4KMOA 5FBVB 3KDPA 5AH0A 1L7NA 3DM5A 3Q8MA 3LA6A 3HFRA 5KREA 5KYWB 3L84A 4E31A 1UXKA 4XGQA 1K4KA 3RB8A 3VM6A 3FPBA 5D8DA 1LBQA 1A71A 1SBHA 4C4PA 1LVGA 1E4YA 1X1TA 4H3SA 3JW8A 1U94A 5G0TA 3FWHA 1DHRA 2B2CA 4IO1A 4YJDA 3DYVA 1ORHA 1SUCA 2XYVA 4TTPA 4L74A 4CM4B 2M32A 5DYYA 4CUZA 3ZNQA 4HX9A 3BKWA 1GKYA 4ONEA 2FMHA 4CKEA 2W98A 3W3AD 3FYCA 4WQMA 4YAEA 1UKVY 2CJFA 3P9PA 5NLLA 5TNXA 5T3YA 2ZJ8A 3V3KA 3ZOKA 5KYGA 1F1JA 3K9HA 4XLTA 4FR5A 3R3WA 2UKDA 2ZTSA 1P2GA 2P2ZA 1YXMA 1E2IA 5MN4A 1P0FA 4IKOA 3T4UA 4IY1A 1O4VA 1U04A 1EPUA 4C89A 4US2R 4BB9A 2E49A 3HCCA 1YQ9A 4BMXA 4TVSA 2Z1MA 1RKXA 3R9KA 1Y1SA 2DTXA 2DPLA 5HWSA 3VGJA 1NNUA 4KN6A 4QPCA 3IX7A 2JHGA 4R9RA 2FZEA 3K2BA 4JR2A 3T5DA 5K0TA 3UBTA 2JK1A 1M66A 3PEYA 4TSFD 2XDWA 3I32A 3HPQA 3LPMA 4JOCA 3PWTA 4D92A 1CZNA 2H1VA 1UWLA 2PWYA 3DMDA 1SU8A 4FQ5A 3DNMA 4RL4A 2C4MA 4LX8A 5ADUS 2AJCA 1BA2A 1CUAA 1PFWA 1YZQA 3E03A 3QU2A 4BP1A 1J1UA 2QTBA 2IF0A 2O3QA 3SIXA 4ZAWA 3S2FA 1P2DA 2Y1GA 1F06A 2HF2A 2YMPA 3HDTA 3MOGA 4UZFA 4XFKA 2E4WA 2O3UA 3BJMA 5LQAA 3DXYA 1CSEE 3D64A 4ARZB 3O7MA 3E3MA 4HAVA 1VJCA 4AYWA 1S02A 4G56A 1BSVA 3D6AA 4OUKX 4QRIA 5AKLA 4DIFA 4HDAA 1QZ3A 1AGXA 5K8UA 3SIWA 1LFAA 2GFQA 3FYDA 4Q05A 2F62A 2WHXA 2YWFA 4P84A 4KFRA 4PZUA 5K4GA 2NUPA 1KI8A 1NI4A 2YJ6A 4Q6BA 4J3JA 4S2UA 1G41A 3QBVA 2ZJAA 2Y0PA 2RSLA 3AVQA 3BE4A 2C9CA 5IC4A 4S1PA 4QD3A 4J7UA 2XDAA 4V1CI 3LHIA 1KDPA 1EP9A 3O8CA 5J2UA 2W5UA 5SZJA 3GLIE 3QE4A 2YWEA 1ND6A 1AHIA 2YL2A 2BMDA 3F98A 4CJXA 4UVHA 2UZ0A 3JTMA 3U9TA 5TQ0B 1ZJWA 3DUFB 3F78A 2OFPA 5K7SA 3T0IA 3DTVA 1GD1O 3HB1A 3LWDA 5F3WB 2GD0A 2ZETA 1M6VB 2CEAA 1R7RA 3BXGA 3JVIA 1Z6GA 4PAWA 1JHDA 4BNIA 3MBIA 3ESAA 1QV6A 2NZWA 2RIPA 2OCXA 2YMMA 3F0TA 3KXKA 2UYYA 4F3NA 4DNXA 4I36A 4F45A 4QU0A 1E1DA 3LY7A 4EYQA 4Y2QA 2BR4A 2XNKA 4L5BA 2ZI6A 3KTDA 4TV9A 4X91A 1SG9A 1HK7A 1JI0A 1GTG1 3BBPA 2DWUA 1MNAA 3JPYA 4RFVA 5DNVA 3TUIC 1T2VA 3PX3A 1WCV1 5FT9A 2Y66A 3I9V6 2ORIA 2RGNC 4FT2A 1CX9B 2GHRA 1PAUA 4URUR 3V5NA 4E7PA 3O73A 2ZUSA 4IVNA 5DB4A 1NKVA 2H1FA 3UWSA 3HM9A 4QXQA 5I01A 1I80A 4QPJC 5ESXA 1FXSA 2O7QA 2IP1A 4Y9TA 3DVAA 2FWPA 3SX2A 4DAOA 4LDJA 4ZN6A 1AO3A 1NIPA 2C1ZA 2QTMA 3PZRA 4L2IA 3ROPA 3PTAA 3SS8A 2RGYA 4QKQA 4XX1A 1UJ2A 2ACEA 3M81A 1KPIA 3FUCA 4N3AA 2OWEA 3H2IA 1J2RA 1FBNA 2G88A 5CXXA 3FWPA 1I7PA 2WILA 3TUJC 3VDRA 3AF6A 1GV1A 4AN1A 3O2QB 4L9SA 2VTBB 1CDOA 1THTA 2C2XA 3AIMA 3P0EA 3WYGA 2PMDA 2W8BB 2WU0A 5JMWA 1WBBA 2B1IA 3BSWA 2C9ZA 5HUJA 5C18A 5G0VA 2I91A 3EMBA 5JBNA 5B1YA 4I19A 2M2IA 1EVYA 1QK3A 1SU7A 3EQ2A 3I3SR 4Q12A 1RR6A 2MSWA 3C3WA 1Y7TA 2V7GA 3V2IA 3GEIA 1YBVA 1KNQA 3UV3A 1ZM3A 2IZOA 1SEPA 1T1GA 3PGA1 4GE0A 4IWNA 2XADA 1EX1A 2AXNA 1U3UA 1VRCA 2JFZA 1C4KA 4BVLA 5BSWA 2BEKA 1Z5NA 3RABA 1I6KA 3WP1B 1NUUA 4D99A 4ZTZB 3FHCB 4IHJF 3NWOA 4GGOA 1DELA 1GZHB 5EPUA 4GM4A 1QIMA 2G1AA 3PGJA 4PLYA 4CHGA 1Z7WA 3O8OA 3TTTA 1EDZA 1Z3CA 3HN6A 1E99A 1YR3A 2Q1UA 3NXKA 1ZRNA 1RLOA 1MEEA 1U99A 1SR8A 2HK8A 2O1WA 3DOCA 1R5BA 2GBCA 4LZAA 4QNNA 4U7HA 1MT3A 5AW0A 3UEOA 3AZQA 5K4AA 4A0FA 4M7PA 3DLTA 3UAXA 2AX3A 1TYZA 2AUNA 2PMKA 2ZE6A 3CU5A 2OD9A 2FMKA 2XE4A 3O8RA 4BU0A 3AERB 5ITWA 2FMTA 4MCJA 4JFAA 1XG5A 3QU4A 1O3YA 2QRLA 4DMRA 4J90A 2G09A 1E3DA 1NU8A 3MYRA 5FNVF 3WL6A 2HO4A 3OCWA 4XPZA 3TCXB 3W2IA 1GTL1 1M8KA 1Y1RA 2P9JA 2KI5A 3AV0B 1PLKA 1LW6E 3R4CA 3C43A 3ORYA 4OHMA 1UP6A 4QTZA 3PNSA 5FI1B 5JPIA 4BUZA 1RP1A 4D8UA 3PQ5A 1UFOA 3CE6A 1TZCA 3SK0A 5EJ8A 5JW6A 3UA4A 1PD1A 3PXEA 1XZIA 4EHKA 5JUWA 4Q3CA 3FPSA 1RM0A 2PANA 1E9FA 4PHCA 3GT3A 3DZGA 2PD3A 1EGAA 1XU7A 2NXCA 1P4HA 3GDOA 4NCHA 2FW6A 3S2SA 3JQGA 4ZMSA 5EYPB 5BN3B 7MDHA 1F9AA 3K30A 4Z51A 1OU4A 3GJ6A 1DQNA 1KTVA 3WL7A 4J0JA 1UPTA 1RXYA 1WSBA 2SICE 1T34A 1U8AA 2Z9BA 2GBGA 3OURA 3R5FA 3T41A 1A9PA 5C81A 1F4LA 1J8FA 1NX9A 1UZMA 2FXVA 2RGBA 5LZ8A 5HPYB 2O7SA 3QK7A 1FDOA 2PQMA 3TW6A 2WWYA 1RT9A 4FMCF 1TIPA 2ZRMA 1T0JB 4R6XA 5FXMA 4AQ7A 2IBTA 5A3VA 3CY6A 5FUWA 5TDHA 5J58A 1FEZA 2NZ8A 4NBVA 4H4EA 3UJAA 5H8WA 4I5EA 5FPQA 3TJMA 3ZI4A 2BISA 4L8GA 1Z68A 4F8EA 3NWPA 1M0EA 2X2FA 3FI9A 5TB5A 4GUDA 4Q7KA 1PD0A 2ZTMA 3FTPA 3LV8A 3RGWS 2XX3A 3QYFA 4FWIB 4PZAA 3U3DA 10MHA 3F7MA 3CW8X 1DXHA 5NULA 1MA0A 1OBVA 1R8QA 4D0RA 2Q9CA 2P79A 2O7RA 4CDRA 1GTVA 3RYCA 3FCYA 1A2BA 1AB5A 5TQ2B 2AR9A 6Q21A 3WL5A 4XGKA 2BKUA 1LK5A 4CKWB 4G5GA 1V6CA 1IXRC 2NTYC 2I67A 4ZALA 3K7EA 4D9KA 1G7TA 4MGEA 5E3IA 1E2BA 3H9CA 1XXLA 5G2OA 1U1EA 4CG3A 2ZM6B 4IXMA 1WD7A 2BAGA 1MGPA 4EG5A 1CP3A 2DKNA 4DMCA 3AUAA 2Q6IA 1KYWA 4TLAA 1NQVA 3SJAA 4RIIA 3W8NA 5A5EA 3GJZA 5J5AA 2ZR7A 1G1AA 1FZQA 1H6CA 1LJLA 2XHEA 3CF0A 3KQSA 5CLQA 5AI6A 5G4KB 3TZHA 5K0FA 4RPCA 5T8KA 3AHJA 1L4HA 4MRMA 4E0BA 1MV5A 1RS0A 1TF7A 1K98A 2FH5B 2I78A 2B30A 3C3AA 1ZOPA 4O29A 5HYVA 1PJ4A 5FWDA 3SHTA 1P8JA 3LPCA 1K68A 3FNQA 4NLLA 4JKYA 4RK1A 3R7SA 1LSSA 2WNHA 2INGX 2XCLA 1CERA 3OQIA 4KYVA 4U7FA 5J4LA 3P2OA 1GCUA 3V4PB 1ZD8A 2EP8A 4FX5A 2PZFA 2XQFA 4LYYA 2I6FA 2IS6A 2Q6TA 3GJ3A 4ZANA 2GJAA 2O5VA 3LPDA 1GNPA 4CODB 4TLEA 1YB2A 1JFTA 3EGXB 3SXUB 1MC4A 4DUGA 2GXUA 2WBLC 3ISVA 4AJEA 1U9IA 1Q92A 1X14A 1ZC4A 1MOQA 2ZYGA 3B2NA 4MKGA 2CWWA 5EWJB 3FB1A 2HU7A 3WIVA 3ZDQA 3NBZC 4WJKB 2JGJA 3PFBA 5JAIA 1VJ1A 4ZJUA 4RQAA 2A7XA 1KP3A 3SFTA 5K6AA 3WJ2A 2QNBA 1E1MA 4MUXA 5I4BA 3FDJA 2ZPAA 2P8SA 2PSEA 4KDCA 1QDLB 4ZJPA 3ZE0B 1AV6A 4UKDA 3V46A 3GT0A 4IH9A 3F5FA 3AFOA 3IAS6 1OY1A 4G0UA 2NYUA 2BE9A 3LUFA 4R68A 4B8YA 3CJTA 2WWTA 3WIUA 4LF8B 5K3SA 3R5KA 5JBQA 1OVGA 3SYMA 4BP9A 1Z39A 3HO1A 3B8HA 3H2GA 3Q0EA 2PE5A 2AQHA 3BK1A 4B9AA 3AM3A 1II8B 4L16A 1U2QA 1CFZA 2QD2A 2A9PA 2GK6A 2RGRA 1NVMB 4AY5A 5KVAA 2N0SA 1I01A 4HB0A 3BERA 3ONNA 4FC7A 2CHFA 2GD6A 2BM9A 3KDAA 3T7IA 2AN3A 2O3RA 2PTHA 3CWCA 3DA8A 4G0WA 1PO7A 5C1BA 1ZUHA 5CNJA 2QPOA 5EZYA 1ENOA 2VBGA 1UF9A 4L1KA 1X7XA 3R7WA 1CJKC 4MYTA 1T5SA 3KHSA 4QGGA 4B33A 4B87A 2QVCA 4BLRA 2NZYA 1WTAA 5LP6A 2ZUVA 5C5DA 1BDIA 5IH7A 1UDCA 4X1IB 1U2GC 4PBRA 3OFND 1GQFA 4QJBA 4AAYA 1A2KC 4MVWA 3SG0A 4MS1B 1CUWA 1N0IA 1YUMA 2ZXUA 4ZIRB 2A67A 3RIXA 1NJSA 2RCYA 1QP4A 1E2JA 1FP2A 1Y1QA 1R66A 4FZ3A 4N40A 2V7VA 2R87A 5GMOA 1SVMA 1OAKA 5JNWA 1M2KA 4GVLA 5BW4A 2YIDA 8ADHA 2JAPA 4TKUB 4JAVC 1J0EA 2WSSA 3CCCA 4AG5A 2YN2A 5JH7B 1FFEA 1P17A 3F5QA 4BDSA 1URPA 3W3AH 4BZWA 2WZQA 3DR5A 2PGIA 1J0BA 3L6OO 4NQRA 4G5FA 3C39A 2EFDB 1J70A 2PFSA 4EH1A 4YMHA 4F4CA 1CEXA 5KTNA 1W1WA 4EGAA 4C4TA 2WI8A 5CA0A 5A4MS 1H9CA 1KI7A 1US8B 1SCUA 1X13A 3BQNB 4GO1A 3GJ4A 3FPJA 3DV9A 5FF9A 1J5XA 2A4KA 2GB4A 2JZOA 5I9MA 3GFOA 4QYMA 1UP4A 1C50A 2BGRA 3VJKA 3KB1A 4KBFA 4N5DA 5HS6A 4IGFA 3A6PC 2G9ZA 2HIGA 1ILEA 5HQ3B 2E48A 2JANA 4IOMA 1SBIA 2W71A 4FYJA 4JC0A 4LDZA 3W4KA 3X1XA 4DB4A 1RXEA 1ZU4A 3FF4A 4HN4B 4AUKA 1S2MA 1RJWA 4BP3A 2MYUA 4CCAA 4DQVA 1U3GA 1LUAA 1AZSC 1ZNXA 2DUMA 2PZ8A 1M2VB 4CETA 1UL1X 2SCUA 1AURA 5EJ2A 4WZAB 3KOXA 3KYBA 3VDNB 1ZVJA 3QX9A 3ADCA 2WDZA 4MVXA 1WUIS 4CMGA 4MGYR 3TOSA 2QE7D 1IU9A 3RKSA 3K8ZA 1OH5A 3RC1A 3ADDA 3U3ZA 4DIUA 4CKXA 1HEIA 2DP4E 5IWAB 2R79A 1VIMA 2M1ZA 3I6ZA 4RVFA 3RE1A 3AP3A 4ZVPA 3W4IA 2D1TA 2B94A 2NP6A 1VSUA 1JFLA 3UWOA 3H9QA 2JKYA 3LTNC 4MUKA 1PKEA 2X4LA 4Y98A 2V0NA 3SZGA 5CDHA 5J4YA 3GLSA 3I4FA 5I7SA 2QZ9A 1BXRB 4LQDA 3LLMA 2ID8A 4ZDJA 1M0SA 5DTMA 2JEYA 3FRHA 2AD1A 3P32A 2VDJA 2W2LA 4YDHB 4L75A 3VKVA 5A7HA 4URVR 3IAHA 3MRXA 4ZC1A 3V7WA 5IYZA 1PQ4A 1SK9A 1ZOIA 4R7ZA 2FEXA 1UBFA 3JD3A 3SJCA 2H92A 2ICAA 5CVEA 2HQ1A 2WG2A 3LX5A 5H82A 1P39A 4HWSA 5A6SB 2LWIA 3RU3A 2PX8A 3G5TA 1K89A 2GVDC 4KE8A 2YHAA 4BUCA 5IAAA 1AHPA 3ANMA 3MAJA 3OE7D 3P7MA 2H65A 2JIDA 3IUEA 1P60A 4I2VA 5ANRB 2XR1A 4F85A 4OTZA 1IB6A 3H11B 2GCGA 3M5PA 3B38A 1XA4A 2QUZA 3FPHA 1NW9B 2H2AA 1CR4A 3R3SA 4JZYA 1NLUA 3JASB 3S2YA 4MVJD 3SVZA 2IELA 3RIEA 3KQUA 4K40A 1KY4A 4HAUA 1S7CA 3CNQS 3DZHA 1T9ZA 1G3QA 3K9GA 3LG2A 1UM8A 2EV9A 2QAGB 3D0OA 1XPJA 1U6KA 4C0JA 3RAGA 4CN9A 3A9CA 1ORVA 2E4XA 3E1KA 1OSNA 4I08A 2BKAA 4KXNA 3ASVA 4N5LA 4PR3A 5ARBA 3HWWA 4V0RA 2VXYA 4M9SA 4AJKA 2GTIA 3A6GA 1CRZA 1TF5A 3A2NA 1VCNA 5SY9A 1IOWA 4MTCA 4WUTA 4EA7A 4KI7A 1HYEA 4Y6QA 4R1TA 3G9UA 3DFFA 5AKYA 5BYKA 1PI3A 4DQUA 2WKSA 5DRTA 3VH2A 1N2CA 2EIHA 2QJRA 4OK6A 4UJ3A 4RMJA 5MFPA 5EIOA 2WVJA 2QN9A 2Q6VA 1H4VB 2WSLA 1YBHA 2X3YA 3K92A 4QYXA 3UMRA 3U4MA 1ISSA 1UBKS 5H80A 1MNQA 1IY0A 4GDFA 3AIKA 4PPFA 4D44A 4FZJA 1BS1A 1DT5A 3FE2A 1YJBA 3EH2A 1T10A 2R6AA 3DG9A 3IKVA 4JEUA 3LY8A 1Q1NA 3I9MA 4Z4HA 3AHGA 1D5CA 4HTFA 4PSAA 3S7TA 2VPPA 3KBBA 1HG1A 3WR5A 1ATZA 4O33A 5JHHB 1HEUA 2NV0A 4M0LA 2QX7A 2W2QA 1QHHA 2Q99A 3LCMA 3ZD8A 1CLUA 5COAA 1G59A 3T3NA 5EKSA 1FZTA 4BNYA 2H7XA 4PYNA 1QU2A 4YJKA 2Z5LA 2ODTX 4JWTA 4LBYA 5L45A 2J87A 3EY4A 1ND5A 1J9EA 1QQTA 3VC1A 4GXQA 2WWVD 3E2PA 4A4DA 3V1MA 2YJ3A 5LLTA 3ZNOA 3UUEA 1NDHA 1QAMA 1VE5A 3O47A 2H16A 3L0YA 1JIQA 4M0PA 5JXJA 2F59A 2AKYA 2Z4RA 4UE6A 1FJ2A 2C4UA 1P5RA 5L3SB 1B6GA 1JXQA 2O2YA 1S1MA 3MRVA 1NF3A 1SWVA 1A5TA 3OPNA 4QEKA 3ONEA 1JH8A 4DCTA 2O2IA 3A2LA 4P4GA 1IYZA 1NN0A 3QXXA 2XAUA 3R9WA 4BBJA 1DFIA 1HL3A 2KBFA 1BGWA 1O96A 1U5BA 1MRZA 3LUHA 4GSKA 4MO2A 4L22A 2CV2A 4KNYA 3GFPA 3HWSA 4MUBA 4FYXA 1IQRA 5J23A 5F52A 3GLHB 2P4QA 1VP3A 4D6YA 2DBYA 4L85A 4KFCA 1Z7YA 2GO7A 1YONA 3L1VA 1EIWA 4CKZA 3ZWPA 2RH4A 3NHYA 3MW8A 3Q11A 2OBNA 2VWQA 4R81A 4PPQA 5IT0A 1GQ2A 3K8OE 1K2WA 3KKZA 3LUDA 3MGAA 4AXXA 1LD3A 1X2BA 4R54A 3V8NA 3OJEA 1ZAYA 4Z2AA 3W90A 2P4EA 4FPXA 1AKQA 2DQYA 3ZVLA 5B57C 1NF9A 1DLIA 1JNYA 4Z2YA 3CUUA 4E03A 1ODCA 4EJSB 2KB0A 2C8LA 2FMFA 2G4VA 3Q8LA 3TJRA 4IS2A 4RK7A 4RL6A 5L3VA 1E9BA 1V8BA 2WE7A 3H18A 4DSZA 1XZCA 1Y3AA 2PG3A 3B1WA 3QPVA 1ZGJA 3MYYA 4TUYA 1H0KA 3HDVA 4QQFA 1VXOA 5EIBD 4DWOA 3HVIA 4DLRA 1XYYA 3QMVA 2AMYA 2VQ3A 4FYMA 5CIQA 2GBIA 5IAGA 2LCQA 3LQ4A 2WZDA 4OKNA 1N0WA 4F5WA 2LV8A 4XWAA 1WZCA 2P0EA 3EHDA 2X9VA 2OKCA 2A92A 4M98A 4PAOA 5C5IA 3HRKA 2VT7A 3HXOA 3TPFA 2YHIB 4YJ2B 4XUEA 2NU6B 4KAJA 3R0VA 5KU7A 5EFOA 2IW1A 4GECA 4R2WA 3DFKA 4XGRA 4C7KA 1V47A 3R6TA 3ICVA 4UAJA 1AKMA 5I7AA 4B7CA 4ZJZA 1Y3CE 4ZQEA 2DXIA 4YI3A 5BYBA 2PNFA 4R4JA 5HM8A 2FPPA 2KBEA 2RB5A 3TL2A 4PRLA 4BFWA 3H2JA 3LOPA 2WU4A 5EIBC 3RSOA 4A27A 5BWCA 3LY9A 4MIKA 2FUG1 3ZS9A 4HNQA 5EE1A 4ZZ2A 2ZFUA 1DRVA 1NOIA 2K7ZA 3HFGA 2DBRA 3HA7A 3RGGA 1BW9A 5CPFA 1N2SA 4PG4A 1JDBB 2IV7A 4RTRA 4M6WB 5B2ZA 3PPVA 3FCAA 2ODPA 2X6RA 3G3EA 1KKMA 1XB2A 3A3YA 4OHFA 4D9MA 3ITNA 1UK6A 4F4DA 4KQ9A 4G0VA 4EY6A 2XGJA 4M53A 3AVTA 3DWGA 4LY3A 1JDNA 1R27A 1P1IA 1OXXK 2GT1A 2HM7A 3DBLB 4KYIB 3OI7A 5D6OA 2BGGA 3JWIA 3OUZA 3OF2A 2TMYA 3DYBA 4DNOA 4MPJA 5FO1A 1M83A 5SYNA 5JCJD 4N18A 3ROFA 5E0KB 1TO2E 2CLMB 4IZOA 2AI3A 4BTEA 1SCBA 2CXHA 5KNBA 4N76A 1YQQA 2P3OA 3BXHA 5C5EA 1XVLA 1Y37A 1FRQA 4BKQA 2O7NA 4D8WA 5BMVA 1EESA 4F4HA 5TMBA 5MF6A 4X3PA 4IDBA 1T91A 4J94A 2NO9A 3WC4A 3QKSA 3P8ZA 3ZV3A 2IS1A 4MP3A 2LP4Y 1XN1A 2FR8A 3QE3A 3UOWA 3X1DA 4BLUA 3IV7A 3NW9A 4N3NA 3PFIA 3QH4A 5TMDA 1QBKC 3AY6A 2HU5A 3LRXA 1CUZA 4N6GA 2FLVA 3D4BA 3SJZA 3U3XA 5LYJF 1K7FB 1KTIA 5JARA 2W2NA 1F17A 1EFPA 5AM4A 4R5HA 1DPGA 2GPTA 3E1SA 4NJMA 1JQDA 1N92A 1OBCA 1W7AA 2DTDA 1EJ0A 1G7SA 4MKFA 3S27A 4CLHA 3H4TA 2YZ2A 3P97A 2XCTB 2UVPB 3PI7A 1DKMA 1KEKA 2FW8A 4E5NA 2FLKA 1RP7A 3C41J 4UUAA 2XUAA 2P11A 2Q4RA 2XCOA 3ZCUA 2QN3A 1A9OA 2E1RA 3D6MA 3E05A 4KPUA 4LCBA 4LKRA 4RM3A 4C7OA 4M1YA 3OIDA 5E9AA 1RYYA 3EVDA 3RSZA 1NMQA 1C4WA 4CLXA 2ZYRA 3A1VA 1DEOA 2OKGA 4EOGA 1PJ8A 1COZA 2I4MA 1P3JA 5HE9A 1QLWA 4O59O 3T5GA 4GM0A 4AO6A 3N3AC 4ZVQA 2GRUA 2YMLA 3SVTA 5LKRA 3KKLA 4R05A 2FEKA 3IO3A 4BRUA 16PKA 2GUWA 1K27A 5HXAA 4RPJA 5CXSA 3ANTA 1RI3A 1VI5A 4G8DA 1QCCA 2FYTA 5CMLA 5CBPA 1I5RA 1VHQA 1EGHA 1OIXA 3UCXA 3AKYA 1ZLXA 5K4HA 4AJLA 4JEIA 3KQHA 2GCEA 1WKCA 2D2FA 1W25A 5TF0A 4C4SA 3GLGB 3K71B 1R0LA 3QG1A 1Z4LA 5A4IS 4BX8A 2NPFA 2BMVA 1DXYA 1JTVA 1NZJA 4IGAA 1OREA 4GOJA 2CXXA 4LK2A 1USVA 3DAHA 2JEZA 4B35A 4CIVA 5EMNA 5FUXA 5KU1A 1GQRA 4E7OA 1YR8A 4EF5A 2VEDA 2ZM5A 1PR1A 1RQRA 3CSDA 2GWHA 3H17A 4R8SA 3RH0A 3H5TA 3VPSA 1C2YA 4KXYA 3JR7A 4J0IA 2O19A 3V9PA 1E96A 3LZCA 4WT7A 1GA4A 2AFIA 2IY7A 4FMDF 3STTA 2O2HA 5FHQA 4C3ZA 4F7WA 1RXUA 2PKQP 2BF4A 4A26A 3DBRA 4BAUA 2QJFA 4COOA 4UC0A 2G40A 1N1MA 2QTCA 1OLSB 1CZHA 4D98A 1NN5A 1QXSA 3DTYA 4UHCA 1QAOA 3V97A 3GUZA 3OLQA 4FKMA 1JLKA 1LLUA 4UM9D 1GL6A 4HGYA 1R3UA 1T0UA 2RAVA 2CN1A 2DULA 1PT6A 1Z37A 2OCPA 3NHZA 4J0GA 4RACA 1EG7A 4CMEA 4R69A 4AFNA 1TO6A 4EW3A 4JJEA 4DQKA 2VUIB 1OJLA 1MW8X 2AOXA 3NFYA 1U2RA 1YH3A 1QB7A 2H31A 1W36D 1XHLA 1O9HA 2C5GA 3D6JA 1BO6A 2WJHA 1BRTA 2AG6A 1GRRA 3GZNA 2ZB2A 4QO8A 5ALZA 3WGKA 8LDHA 3L4EA 5A0TA 3DP9A 4KVFA 4D96A 4MQUA 1QDUA 3ZWCA 4WNAA 3C7DB 1L1FA 3I64A 4M89A 4ESEA 2QNIA 3A27A 1NXSA 1U8YA 1FVFA 1JQKA 2I55A 3BVPA 5F98A 3L0OA 4HWRA 1WO8A 5FEMA 3W9BA 4BUJA 4ID3A 2YY7A 1YZNA 5DYTA 4PQYA 3ETCA 3RT1A 3AONB 1Z6YA 1J97A 1HT0A 4WNYA 3LKVA 5FWYA 3O93A 2C2ZA 3QW4B 4NMMA 2CNWA 4DV7B 2Y2VA 1M3SA 3IKTA 3FHTA 2GHIA 1MPXA 2VSNA 3M33A 5HIMA 3HVHA 2XUQA 4BE7B 1KYZA 3WOHA 1N2HA 2ZK7A 4NMHA 4HI0E 3A3PA 4V0NA 4BNDB 1CQJB 4GQAA 2HSJA 2PL5A 3HACA 1BHJA 1GU1A 3ASUA 4KPEC 2UUBB 4CG2A 1T9BA 2EG9A 4GR9A 5T6BA 4E2YA 5CBKA 4C4ZA 3T95A 3EXHC 9ABPA 5JTUA 2GBPA 2TSYB 2WG0A 3KRTA 4D4LA 1TVKB 2IYXA 3BMOB 1SO8A 5CLIA 2DQ4A 2OVBA 1NI3A 5T57A 4GOOD 1FJGB 1ZD9A 2C9OA 4B31A 4URZR 2GF0A 3GGCA 1EFRD 1X8KA 4XYGA 2VTDA 3INYA 1MCZA 2W0MA 2C2GA 1SCDA 3QUAA 4Q9LA 4FYHA 3R6WA 1YTUA 5K0EA 5GZ6A 4EUNA 3MMSA 1XKQA 1GVHA 2O2SA 4MULA 4JHXA 4YPOA 2ZEJA 3OESA 4HDCA 2FWJA 5JMOA 2BDEA 5CK4A 3LQRA 1CUBA 5ESRA 3UXHA 3ZHRA 4MVJH 2BGNA 2RHCA 1LI7A 2WIBA 1ZM2A 3PUVA 4UAVA 5GONB 1EDDA 3SJBA 3UJBA 1RHRA 1YZFA 1QZXA 2C94A 1BX0A 1H2XA 1VIAA 2YZNA 1HURA 3F3YA 3I1IA 3IQIX 3L0BA 4XZ3A 5FFNA 4TZ0A 4TT3D 4MW2A 5DHRA 1XDBA 2EEZA 4CM9A 2WJ6A 4RVGA 4MA5A 1DC5A 4UNNA 1XK7A 1F48A 1KEWA 1KVTA 1QFXA 1YIAA 1NKSA 2Y1WA 2XIQA 4K0KB 4MSUA 4ZGGA 5LQJA 3DAOA 5FTWA 1XCMA 2KM1A 5BSHA 2CVQA 3ONVA 3PFKA 3CM0A 4F9GA 5AXDA 5JBIA 4Y9UA 13PKA 1AH2A 4RTNA 4TZ6A 3BMQA 2TS1A 2O3TA 3G6KA 1EVLA 1MA3A 3MXOA 1L5SA 2F48A 1UAGA 2O50A 3KUDA 5CH8A 4NK5A 2COKA 3PCXA 2KQUA 4UVIA 3ZXXA 4B7ZA 3E9NA 5JVDF 3NNNA 2ECKA 1E7YA 5GOZA 1QYVA 3HZRA 3KOZA 4QXAA 4FE4A 1G7CA 3G0GA 4NIMA 2HWYA 4BX0A 3N2KB 1UIMA 2IEDA 5L40A 5DTJA 1Z4OA 1BMQA 3CYFA 3IBTA 1XVIA 4HO1X 3K9LA 3V7UA 1FIUA 4YRSA 3C8MA 4JUIA 1O6FA 3IBYA 4GE3A 4P5EA 4ZQCB 4OAQA 5FI5A 1WPRA 3IL2A 1HYBA 1W85B 3DLBA 5AKKA 1T3TA 1CJTC 2L0XA 5ALSA 3VVLA 3AVYA 1JZTA 1X42A 2AI1A 5T3UA 5TPZD 2IGBA 1YZVA 2WYUA 1ZUD1 2B6NA 2IEIA 3P0FA 4KR7A 2FJPA 2C0QA 1BX3A 4DV2B 5KX5F 2A7QA 1BTOA 3ISTA 1IRIA 1U5CA 2YZ7A 4IRXA 5ER6A 3T15A 1VDMA 2ZBVA 5T7BA 2J5RA 3WRYA 2P6PA 4JGIA 3NHBA 3CCBA 3UFBA 1T25A 3GH1A 3B12A 4GBGA 3PFWO 3R40A 4UUMA 1QO0D 3OUTA 5AHRA 1P29A 4G4IA 4BLSA 1VLHA 3RVQA 1CHDA 2IYOA 2VTBA 2Z4TA 1QBGA 2WM9B 3IPXA 4H1UA 4DCJA 4Z6KA 3KEQA 1FLAA 2NYRA 4KI0A 4RCVA 4G01B 1V1RB 4M8NE 1I4WA 2QTGA 2WY2D 2EF1A 3IHLA 1JLLA 5TVKA 4JWKA 4MV9A 3UTDA 3AI7A 3UHFA 2CFCA 3B85A 2I4TA 1TZKA 2JD1A 3IYLW 4K9QA 3OLVA 2J0UB 5JD3A 4PHTA 4E94A 1N2ZA 4J07A 1QQ7A 3P0HA 4U2BA 5T4BA 3HG7A 3WFIA 5FBKA 4O4LB 5JSZB 3PE4A 2PVCA 4S1OA 1MIOA 4MGKR 4CF5A 2JLXA 2ADMA 4OQFA 2JF0A 4UTPA 1SOUA 1OFTA 1AU9A 2WIGA 1QQAA 1EUCB 1V1JA 3IPLA 4RGBA 5U1PA 5A3RA 4ZOBA 3KYJB 1RE1A 2W6CX 3H1BA 4F12A 1XALA 3HKDA 2P9YA 3K5WA 4IFIA 4IDQA 1BXGB 2VL7A 5DEOA 4DMUB 4ZK2A 5FUQA 4MW0A 3DE7X 1QDEA 2WHPA 3BFXA 1NVDA 2EJCA 3JD1A 2JFNA 2VTKA 4KR6A 4DSTA 3NHKA 3DKRA 3M4NA 3RAPR 4EB8A 1P4SA 4AMYA 3B3QA 3ZN2A 3CKKA 3AP1A 4ECAA 2A9FA 1E61A 2OG1A 3C74A 1CY0A 3GNTA 3X1YA 1FSSA 3RFXA 2EQBA 3CF4A 1CQPA 1I1NA 4DZRA 1X1EA 1S3SA 3A4LA 4BATA 1JE0A 2X4GA 3DMTA 1KAMA 2G25A 3M6UA 4OVKA 4JI5B 5B2FA 1NPDA 1UC8A 4J8PA 2ZDGA 4HEQA 1QTQA 2N47A 1N2CE 5HMMA 4AYTA 2WUEA 4D3ZA 4Z7JA 2YVAA 4QFBA 3T34A 3RUPA 1O2DA 3H87A 5KYUB 4X7BA 5JD6A 1J5PA 4JC5A 2F55A 3M4JA 5JAPA 4WOPA 4MKHA 1ZCFA 4RY2A 4YO7A 4BFLA 5HRAA 4O1HA 1UOPA 1T2AA 1THZA 2JJ1A 3L7AA 4P3KA 1UODA 3SWWA 2AUTA 5G3ZA 4NJOA 4FHEA 5DNUA 5B6JA 2QTHA 3W6PA 1D1TA 1LK7A 4O8ZA 5F1YA 1JLSA 2OLKA 2ZAIA 2ZATA 3HZZA 2QM3A 4NQZA 4Y6SA 1XTJA 2I9PA 3A3OA 4CQLA 1GPDG 3QEOA 2PGJA 2X22A 4P1ZA 2VDLB 2HGZA 4ZEOA 5GVSA 1Q15A 4QOGA 5F1OA 1IRXA 1QO9A 5AESA 2C3YA 5TQ0A 1T8UA 2QTVB 3DUFA 1ZIPA 3DZIA 4DUPA 1Y8ZA 5A3SA 2DOKA 4JCOA 3D2AA 4G0OA 4KQJA 3MJFA 3DDSA 5B6PA 2GXAA 2PCJA 3D81A 3KSUA 4F3RA 2AL7A 4HEA6 4WJZA 5CRIA 1NYLA 4QEDA 3KO8A 4XX0A 5DCUA 1MAWA 2B4TO 3FVTA 2DQSA 1GZ5A 2ZVQX 3VC3A 4KE6A 1G9XA 1E4OA 1P6XA 3M89A 2ACWA 3NONA 4NOMA 4RCYA 5CFMA 2DH5A 3ZDCA 3DUWA 3MCAA 3PQ8A 1E2QA 1U8CB 2FGKA 3I9KA 2BZ0A 2H4ZA 2P78A 3IE2A 3PNVA 3K5PA 4OM8A 4OQYA 1IOVA 1W5TA 3LQ1A 1FDRA 2CZCA 3HLYA 4ZCPA 2XE7A 3HR4A 2CC2A 1HEYA 3RROA 4OATA 2C58A 3LYUA 4KR9A 4D74A 5EGNA 3M8KA 5MN5A 3KM0A 1C7RA 5BRNA 1U8ZA 4JT9A 4G23A 5IDWA 1Z2EA 3TDMA 1E2GA 1OPXA 1IJKA 4QTYA 2OGTA 5F2EA 2Y0CA 3R74A 1Q2UA 4MROA 4ZGBA 2LTAA 1K6EA 4IKPA 4WMLA 2HLDA 3L8FA 2JJYA 4DOMA 1KY3A 1M54A 2QJWA 3AETA 1IZ9A 4RVSA 3FYUB 3WIBA 3AGQA 4ZYXA 2XNDA 3NHAA 1ZX1A 3SAJA 2XSZD 3WWCA 4ARAA 1GA6A 5KTYA 2QENA 2ETVA 2AW3A 2VJMA 3DV2A 4AROA 4GHWA 1NRXA 5FBHA 3MTQA 4C87A 2YV5A 3LW8A 2ONKA 1S89A 1JALA 2BC9A 2QOEA 4MR7B 4N7JA 4M1MA 4V2IA 4Y0VA 4FGLA 2YN0A 4BV3A 2PJUA 5LA6B 3H1GA 1H93A 4N49A 3TEFA 1WW2A 1PV1A 2H2HA 4J1SA 4NONA 4ZMBA 4DILA 1T2NA 1EZ1A 1IQUA 2YDXA 4YMUA 1K2VN 1ZGAA 4YRGA 1H2YA 5JNUA 2EC5A 2KW5A 1O5TA 1XDSA 1ZJ4A 3L8YA 4KGZA 4OIFA 3TRDA 3GD5A 2C2OA 4MQ6A 1OAOA 3WMFA 3NALA 2OHFA 2WYIA 2ZUTA 4YUWA 2VF4X 1YD7A 4FDTA 2C7BA 3ACBA 4MWZA 3GD7A 4FS3A 3B78A 3H6HA 1XWWA 4M9XA 4RVCA 4ZI7F 2E85A 2O5EA 5C46F 3LZDA 2XV1A 2XA9A 3HCAA 1L4MA 2D5CA 1RFGE 4R16A 5JDCC 3TCKA 1JQLB 5A1TA 1EX9A 3D7LA 2LKCA 1M7HA 4TROA 1DBRA 4R2KA 5U4QA 3LD9A 1TAQA 5EHQA 2VSOA 3PBKA 2R8PA 4WL0A 5JS1A 3CWZA 2CLKB 1K8YB 3ED1A 3ZUGA 2C4HA 2X6TA 3A4TA 1KGDA 3NBKA 1MP0A 1Z13A 2WA2A 3D59A 4P2GA 3PF8A 5IDYA 4C04A 4ZA2A 5FPSA 4CT4B 5C1PA 3WHLA 5K99A 2UUAB 3JQBC 1NHGA 1Y4AE 2R1VA 1GPYA 5FJJA 5HUHA 1DLJA 2ZROA 3CX6A 4XWTA 3D3EA 1JNXX 4IMIB 2D3TA 3PB3A 1L4KA 4QJIA 1B14A 1LPNA 1RLTA 2P41A 2XOXA 1X38A 3TL3A 4E07A 4MW5A 4F86A 1V1MA 3FPAA 3CEHA 3EQZA 3FUTA 3GO4A 5EEHA 1I2AA 2WMDA 3AUTA 5EMLA 1QZZA 5SZKB 2G8LA 3DHNA 4FN4A 2CY0A 4M21A 3ZD7A 4BO0A 2DFTA 2JFBA 2M6LA 3OMWA 1GT91 4LE2A 2WF9A 4QSMA 5F2KA 4FCCA 1L3BA 4LYDA 1QHEA 3O26A 4WCVA 5CM9C 4EB0A 1OUMA 3NVAA 2ID4A 5CH5A 4EIWA 3FR8A 4N48A 1BMFA 1ODSA 5P21A 2AJBA 3CMMA 3A3NA 3KJEA 2GX6A 4TWRA 1RC0A 3SM9A 4C2BA 1JQJC 3E1GA 1TW2A 2UU9B 1YAJA 2FDXA 1ZN8A 1G8AA 3PWKA 5CYOA 5D2CA 1IJBA 2CGEA 1JG1A 4X44A 4D3YA 4D4MA 1SXJD 2W2TA 1Q5PA 2C8JA 3GRPA 3V8PA 3GQBB 2WLSA 1YZUA 3UUGA 4BFZA 5CJ2A 4Q4HA 3UJ8A 2W2PA 1U8EA 4FW8A 1CWUA 4EX6A 3OM9A 4NNJA 5EXEA 2JFGA 3IVCA 2HHHB 2QUHA 1YFZA 5ADWA 1ORDA 5HK9A 1Y7HA 5KVCA 5H0IA 3ZGNA 5REQB 3ZY6A 4CN8A 3G2OA 4L5AA 3IA7A 4KQKA 4EATA 2K7FA 2FJ0A 1LV7A 4FFPA 1NR1A 3E35A 2B37A 1ZMXA 1YBMA 2P75A 4R2LA 5EESA 3ZBQA 4NCAA 4D4KA 5C2JB 4WXYB 1PJAA 1QGAA 1JHXA 4ND3A 3KYCB 4KX3A 4UMDA 4WV3A 1SXJC 4Z3KA 5TQ2A 2CDBA 3EPKA 2PLWA 4UVDA 3IVAA 3RM3A 4MX8A 1QGYA 3DZFA 4YCDA 2CFIA 1FU4A 2MR6A 4AZWA 4EY3A 4UEJA 4EI7A 2QBYB 2XB6A 3JAWB 2GPYA 4RHUA 4X9XA 4PCUA 4FBLA 4UU7A 4GKVA 8ATCA 5JOQA 2J7PD 1W48A 3QFCA 4HPJB 3KPUA 5J5VA 3V34A 4EHJA 1KK1A 5AXCA 3BD9A 1ZCJA 1W1IA 5GIOE 1SVIA 1QNLA 2YYZA 4Z9BA 1KSFX 1C5KA 3SIRA 1EM8B 2WUVA 5DM1A 3USCS 3T5PA 1LQTA 3AY3A 5CEJA 3IULA 1OA0A 3H2HA 5G4KA 3NVMB 3AVUA 1W30A 2VATA 1UXOA 2JA2A 3WYCA 4M9ZA 4NKRA 4LRYA 5KOJA 2NO5A 3KKKA 1UBLS 3G5AA 5DCLA 2ODNA 5DLYA 3C6XA 5CB4F 1WPXA 3FFWA 1I7LA 2OORC 4OMDA 1NTRA 4R6WA 3ZV6A 3QEBZ 3OZSA 3V48A 2FXIA 5FV4A 2EW2A 5JQWA 3DHEA 2XNJA 5BNFA 2GH1A 3GRVA 1JBQA 4BWYA 4J16C 5JDIC 1N9KA 4AZVA 2AFIE 5JS7A 4EEXA 5E4JA 1GG2A 2UZ1A 3CBGA 3MA0A 3QNUA 3LE8A 2QVBA 4PICA 3VSBA 1NUQA 4CMKA 2YNMD 3SXUA 4DIKA 4UBMA 2SNIE 1C7IA 4HYQA 4OAOA 2V59A 4CNBA 1QU3A 2PMFA 2HW8A 2JLCA 4I46A 3FYHA 3AF4A 3RSLA 5CW1A 3AFGA 1QP8A 2B9EA 3AR8A 3NOOA 1B8VA 3MOSA 3ODPA 4UXJA 4EO9A 4CEHB 1MXFA 1Q77A 1JEOA 2QUIA 3LZ6A 4XPIB 2NLOA 3O8BA 2ONJA 1EYZA 1FRNA 1ZAKA 5B3JA 1IZYA 2FQWA 3TTXA 4AS2A 4YV2A 1Y63A 4FYKA 1SOVA 4GI3A 3GGDA 4I4TF 4BKRA 2WU8A 4I6GA 1DAGA 4MWOA 2CD7A 2GI4A 1WXDA 3EGDB 4GI5A 3IKJA 4DYDA 1P0MA 5CLLA 2YNMC 4EUKA 2VP5A 3KJIA 1II8A 4YRDA 4ZPXA 1CB0A 4E2ZA 5CX1B 1JXAA 2I7DA 2LRHA 5DGIA 1RAHA 4D9GA 4PG8A 3NIDB 4BYGA 2FUEA 3BK2A 2QN6A 3QOWA 4ME6A 4MICA 3T4XA 2ZT8A 1THMA 1XYGA 4QFMA 3DCYA 4Y1RB 1E79A 2B1QA 4H0FA 4A0HA 4BNXA 2BDTA 2OBBA 4IFEA 4WI1A 4JT4A 1XZEA 1JSCA 1HKUA 2A58A 3EDRA 3Q88A 4K9SA 1K88A 5I9SA 3LXUX 1NOJA 3S99A 3PFNA 1KARA 1EXMA 1WCIA 2H2WA 3KE9A 4FOTA 1IXYA 3BMNA 4DIOA 3B3JA 5EUMA 5AUNB 5IM4F 1OB2A 3ECCA 2D2VA 4IGIA 2G77B 3JWEA 2RKOA 3PYXA 4AJ2A 4CQNA 3OIGA 3ZGOA 1Q7GA 2O1EA 1D4ZA 3AOEC 3BIWA 3OWHA 3ZLTA 4CV3A 4IDNA 2CJYA 2AJDA 3DXFA 2LCFA 2PQ6A 3BIFA 3V6LA 4D6PA 2HCFA 4EKNB 4JI6B 2W4MA 4PN7A 4G1EB 4W9NA 1TEZA 1V8OA 4M54A 1FVHA 4NFYA 3EDOA 2E4YA 3DONA 3IIJA 1G0OA 3NV9A 2Z6VA 3HCDA 4TKUA 4ALLA 1PSWA 1VBMA 1UPBA 2BEVA 2OXFA 4RV5A 4DF3A 4EGJA 1DT3A 2XUJA 3VSDA 1MF7A 2FK8A 2QTZA 4OHZA 5JRZA 1HNZB 1DJOA 1QONA 3IOMA 4M88A 4QVKA 4US0R 4Z9YA 4JLKA 3WDLA 4YRAA 5EIXA 4ER6A 3ZNPA 1OD6A 1HLDA 1NC3A 3EZNA 1SNYA 3LBNA 4HDRB 4MEJA 2O52A 1JZSA 1I6LA 3DE4X 4Q1CA 2Q7XA 2B78A 2IYYA 3KB2A 5SICE 1L6RA 3CZCA 4KSYA 4DJAA 1QIIA 3HSSA 1PEYA 4QWWA 4ZYVA 4NCNA 3GVIA 4M1SA 1TK3A 5D5QA 3G02A 3AL0C 2VJCA 3VR4D 3WKCA 1LTHR 2PX0A 4M3NA 5HQ3A 1USKA 1JEDA 4JXJA 5I3CA 1TU0A 1JAZA 4LJ9A 4Q48A 3D0QA 3DVQX 5L3QA 4BIMA 4IWXA 2A9VA 2DBQA 2ENWA 2YXLA 1RRFA 2RC6A 3Q3CA 1JA9A 2IP4A 5TS2A 1N7HA 1AKNA 5ALXA 1XQ6A 1X80B 2I0FA 1OC4A 2I2FA 4RK0A 3CRRA 4BKPA 2GGSA 1GQYA 1V7CA 2OHGA 5EJ7A 1RZRD 5K0ZA 1J22A 3FKJA 4JBWA 4QGBA 4UU0A 4XARA 5LL6P 5LLSA 3CINA 1W0KD 4XIFA 3FB4A 2Q3FA 4OFWA 5F4BA 4G0YA 1K3UB 1W34A 3MSCA 3NX4A 3LPNA 2HEGA 3HUFA 1TCUA 3P96A 4EW2A 1BD4A 3THRA 4UNSA 4Z8YA 1M72A 4MHTA 4B4DA 4U7PB 1LDYA 2OVFA 1G291 4KIWA 1JEAA 4NULA 5BSFA 1ENPA 2OAEA 3QWIA 3VX4A 5BWNA 5JRJA 2QROA 1MXHA 2XRZA 1ZO8A 4YONB 1R4NA 1WB4A 3RW9A 1ZIXA 4PRKA 3ACCA 4ZZ0A 1KVRA 1BXRA 2BEJA 3DEHA 4GXTA 4P4LA 3IVXA 5A5GA 4I2NA 4B32A 1ZIYA 1NXOA 3JVDA 2ZSHA 3KWMA 3SZMA 4M36A 1DKRA 3HUEA 1OZHA 3NT4A 1YS9A 2W6JA 4HZGA 5GAJA 3NZEA 4Z5XA 1PZXA 3D6NB 1NY6A 3ZIAA 1QYCA 3MUFA 2Q5FA 3VU9A 3E9RA 2PO5A 1GPMA 3W5AA 4G5RA 4BLTA 4ALMA 3GJSA 3S81A 1ZGZA 1AQJA 4RLQA 5ALYA 2DPGA 4CI9A 1LQ2A 1EEXB 2G3YA 3P5BA 2E6KA 1SWWA 4EFKA 1KQNA 4F71A 3SLKA 3GCXA 3H11A 4EI8A 4TTTS 1R64A 1M6NA 3L8CA 3VH3A 2HSDA 3S44A 1YZLA 2GEKA 4AO8A 3KS9A 5D87A 1RE0A 4UNPA 4GF5A 3P26A 2VP2A 3RHSA 1RU3A 1V45E 2VQFB 2ZDHA 1RQXA 5DSTA 1Y5RA 4EUSA 2QAGA 5AVKA 3FWNA 2CXTA 4XB1A 1JGTA 3VBEA 3UHPA 4B2PA 2FUCA 1J56A 1JIJA 4C0BA 4KPFC 3WZ2A 2GM4A 5CB6A 1F5NA 4KXLA 4AS3A 1RXIA 2AIRA 2JFFA 3CVJA 3PRKE 3N0RA 4LN1A 2RHMA 4YWJA 2CLIB 3REGA 1DP4A 4PPYA 4NS1A 3MTAA 1WA5A 2QQ0A 3SC3A 1NSTA 3U4IA 4MWBA 3OO0A 1MJGM 4NYIQ 3D0KA 4R84A 4HEHA 2O8DB 2HADA 3LGAA 5B1HA 4KQ6A 2VAMA 2BSAA 1M1ZA 1KORA 1U2ZA 1WY5A 2CHVA 3C70A 3JXEA 5BQFA 4H31A 4S35A 3ZHYA 4D9IA 1BA3A 3C3KA 4JSTA 4XM0A 4ESHA 1ZK3A 2BBWA 3R3HA 1EFTA 5AMXA 1B7GO 1TQ8A 2FW0A 3H19A 1J24A 3K6RA 3PUHA 2R11A 3IDAA 2KPOA 3U7GA 3GLFB 3BB3A 2C98A 2R97A 3EISA 4OGWA 1U0FA 4E3WA 5K0BA 4N41A 2P67A 2QTFA 1NUHA 1BU5A 2OO5C 4KVAA 4PC6A 2D4AA 3UWMA 4TZTA 5ESDA 1V7ZA 4M37A 2C2WA 3WIEA 1QG2A 3GP8A 4YK7A 1RBMA 2P0YA 3BFVA 4BAZA 5HX7A 1J25A 2J59A 1WF6A 4N12A 1E2HA 4K81B 4OBEA 2C7VA 3F6RA 4G41A 2HK6A 2F6RA 2HH9A 4JODA 5B3LA 4HFMA 2W2KB 2ADFA 1W4ZA 4UHFA 1HDRA 2QRHA 2CSUA 5HIAA 2OSBA 1N77A 3ZXYA 1CP2A 2P3LA 2MDTA 1PNRA 4R9NA 2BGTA 3O2SB 1DAKA 4RK6A 3WYEA 2O8BB 1L7QA 3WWPA 4PZZA 1YL5A 3AKDA 3DE2X 2XNHA 4B6QA 3KWFA 1V9SA 1XEXA 1LCIA 2PSDA 3RSQA 4OLBA 2P2CA 3N2EA 1E1CB 3F4BA 3ICCA 3EIQA 5IAEA 5JG7A 3PE6A 4DSOA 5FUMA 4GPZA 2QLNA 3D8UA 3R7AA 1SVKA 3SYKA 1F2DA 3LUPA 1G20A 5CXQA 5LLDA 3JQAD 4B3CA 4TKLA 4PAGA 2YQZA 4PQFA 1E5VA 1N3YA 1N3BA 4LJ7A 1KOJA 1UDXA 3BE6A 4REOA 2RHHA 2EDCA 1VE3A 4YMWA 1AQYA 3HYSA 3VV3A 1NV9A 1ZONA 4PR0A 2B3TA 3HJHA 4KYUA 1IEQA 1KZ7B 1SBCA 3GRAA 3P9KA 4YX9A 2QIPA 1N7JA 4DBLC 4LYGA 3RS2A 2H57A 3FVQA 1XFAA 2HQOA 4IIXA 3DGEC 1ZU5A 1LS1A 2VWGA 2YS7A 4D2IA 3M49A 5BSEA 2R48A 2WKQA 4IDHA 1I8TA 1XRRA 1ODLA 3AG6A 1KIAA 3N53A 4B79A 3A3KA 1SHZA 1A5AB 1ZA1A 4LSWA 1XGKA 1WB6A 2Z58A 1EKXA 2IF2A 3AOGA 5JLJA 2XCRB 1GUZA 4AQDA 4O4IB 3KG2A 2IA5A 4V38A 4Y2SA 1L5ZA 3SNHA 3ITEA 1FFDA 1ZR4A 1BGXT 4MQEA 4M87A 1TM4E 4J75A 4I55F 2PL9A 2VNJA 4JA2A 3QF4A 4H18A 1N57A 3FOFC 2E89A 1ACLA 4P93A 4BWVA 3BZUA 1ZNYA 1SHTX 3DPIA 1E3WB 1OGYA 4TXNA 1YR7A 4Q4LA 2O23A 4UVEA 1KJ8A 2Q9UA 4MW4A 3M1LA 5JYBA 3FA2A 1E63A 3IP7A 3STHA 4HUJA 1JSZA 1WRBA 3VUEA 3ZTYA 3BL8A 5BW5A 2DPMA 1E7SA 3HCBA 1HO3A 2OYCA 4UPEA 4YYZA 5AOAA 2ZXEA 5FUBA 3WLMA 1DARA 3TG8A 3QVGA 4CEJA 4OREX 4YJ2A 1BOOA 1E60A 3GA7A 3HZHA 5LPNA 1M5RA 4RBNA 2BH9A 2ORWA 5KSZA 5G0UA 3WKEA 3ZH9B 3ENKA 3OCZA 1ZYUA 1K5HA 2BFFB 2BSXA 4FOPA 4HPXB 4E21A 1V43A 3IP1A 5IABA 1YRWA 1NXQA 1PFUA 3OQ1A 4XSGA 4ED9A 4EG6A 2HIAA 3R41A 2NM0A 5I5GA 5K0SA 1KERA 4OH1A 4UARA 2QR5A 2DWQA 2RG7A 1BGVA 1N6OA 4NPCA 2H3EA 5GQSA 4INPA 1OV4A 1N8TA 2CB0A 2WSYB 1HF3A 4O6VA 3VBCA 3D0RA 2OHHA 1I1HA 2BHNA 2XMRA 3DQPA 4GVXA 4JUFA 4LAFA 3L2OB 4R9UC 4EVIA 4KVZA 4UU1A 5F7JA 2B34A 2MYTA 2V03A 4YCLA 2O2CA 3CNBA 3B2QA 4P4TA 4PF1A 3D6TB 4LOIA 2Q1WA 2C2BA 5IS2A 2H59A 4INOA 1BKDR 1ZGHA 2CHUA 4W1QA 1WABA 3LY5A 1MU0A 2YRXA 1CUCA 2EGUA 1M2OA 2R00C 2YTZA 4RAQA 1O77A 4UMFA 5F23A 1E3JA 3RKRA 2X5XA 1MTOA 1I32A 3ZJVA 1FFHA 3DZDA 1ZH2A 1TT7A 4KE7A 1G55A 3HUDA 1GPJA 3LX4A 5CT4A 4UMEA 4O2BF 4YAJA 1K06A 2X42A 3ZWWA 1OX4B 1X9HA 4HXEB 3NC1C 4E15A 4JI2B 2QM0A 3T5AA 1JXOA 3AU9A 1AMNA 5SZHB 1BFDA 3DZJA 1DOHA 3T7KA 1GOTA 3F4LA 5AJUA 5CVVA 1VPLA 2R5NA 1OROA 1XLUA 1DTSA 3B6EA 4AB1A 5FFMA 2G5TA 3B6JA 2EJWA 3OTQA 3WLRA 3OQMA 3S5UA 1R6BX 5JCOC 2EFEB 5LB4A 4YALA 4FD2A 1OBOA 1Q21A 4ITUA 3A9UA 3MLAA 3L8GA 4OY3A 3TNJA 3THXB 2DY1A 3F71A 3ICPA 5TVGA 2ZTHA 5KJ1A 3K9FC 2G76A 1OI2A 4BVFA 3G8CA 4KAFA 4C9BA 4DJ5X 2IQIA 2UVPA 3LT4A 3PFCA 2BFBB 1UEXC 3O2NA 4PCAA 4YWHA 4P3YA 4YT5A 3HVJA 2X0IA 5EIEA 2AA3A 4M1TA 1LK0A 2J6BA 1NATA 1P74A 3LF1A 4O4JA 1MZVA 3RIHA 1ENZA 1C1DA 3OPYI 5HBRA 5CA1F 1QIEA 1KYTA 2YV2A 1N5RA 3K09C 1UH5A 3ZTTA 5KOIA 5JO9A 1B0AA 3LBFA 1JR3A 2X23A 1D4FA 3BQ9A 1C8VB 2Q0XA 2GN1A 1G38A 2EG5A 3RBAA 3B6IA 3I28A 4GR5A 4ND1A 4YCAA 3QXGA 5DLPA 4Y0AA 3T61A 4PO9A 3J81A 3LSYA 4JV5B 3EOBI 3OPMA 4B6GA 4A15A 3UZUA 1XTPA 5BQPA 2C77A 1JAXA 3DM9B 4KWCA 3WYBA 3OJ0A 4XIJA 4P6VF 3SC2B 1GRCA 3GLGA 2ZUUA 1ZNWA 2ZBFA 4BAGA 2YWCA 4B46A 2ZCVA 4TRRA 4BO6A 3FIJA 1T15A 4X3CA 1MQ9A 1T0PA 1S8OA 3ORHA 4HNGA 4IYJA 4D41A 4MWCA 1J0DA 4I8IA 4BMPB 4IFBA 4ZYTA 4QVIA 4LTMA 2PLNA 2VHTA 4YUXA 4JFRA 5E7IA 3QUTA 4J3NA 5C8DA 5LNK1 1TFUA 2C92A 4NEQA 4ISCA 4W8GA 2BMAA 1OHHA 4QDUA 3RT7A 1UWCA 3MGGA 4CF6A 5H68A 5JJ5A 1C8BA 1O58A 5K2OA 2RHTA 4RY9A 1PG5A 1UBNA 2W2VA 3I83A 5EXXA 4TN1A 5EJAA 3UMSA 3VQTA 4EHHA 1F2VA 4B71A 4BQRA 3JZMA 4HQKA 3FBGA 4EUHA 5JSFA 2I71A 1N25A 4OMCA 1T9CA 4QYSA 3ZWNA 3VX3A 1DJQA 4DIDA 3WSWA 5KJEA 2ERYA 2FRDC 3QM1A 1U9YA 3VYWA 5AW6A 2P3QA 2O8EB 2ZBQA 5AVVA 4LFAB 3DFUA 4CIXA 1DNPA 1Q0ZA 1T9HA 3AK4A 2NT4A 5HCNA 5A2GA 1U8FO 5EFZA 2ZWIA 4XA8A 4POAA 2K5UA 2Y1DA 3HFSA 3HN7A 4BBZA 3W05A 4EGFA 4LHVA 3GCDA 4X6UA 1F20A 2XBUA 2ZJ5A 3EAFA 1W2WB 3FUWA 3HB7A 2PSFA 3TDNA 3FMFA 3UFXB 4UDYX 1RQPA 4BLWA 5LD2C 3OEHA 3R7DA 1RAGA 5IRCD 1FP1D 2J9FA 1G2PA 3E3OA 4EMUA 1Z75A 5IJAA 2ZRIA 4HY3A 2Q07A 2MYPA 4IICA 1MEOA 3P2YA 4LWZA 4MPDA 1W46A 3WXMA 4AZTA 5KOHA 1SULA 2QZZA 2ZBPA 2AOTB 4LGCA 3PFFA 1VL2A 5FTJA 5JQGB 1SHUX 3MQ4A 1JDPA 3L7OA 4EWLA 4JOQA 4OB8A 1H8EA 1H6BA 2CZQA 2Q29A 1ZM7A 2JA1A 3CRW1 2CFTA 1BWSA 1H2ZA 3EVFA 2WA1A 2H18A 3OX2A 4YACA 3EN0A 5HF8A 3VNRA 2PUCA 1U4NA 3FSJX 1VA5A 3CRZA 2EEPA 1A7JA 2GD2A 4IHJB 5EZQA 5DTQA 3D3QA 3FDXA 4UCXA 4D0LB 2BGJA 5LZ2A 3LP5A 3R24A 4C6TB 4MGHA 2ZJYA 1Q2XA 4EDHA 3DE0X 3AEKB 4W8OA 3TLMA 3U3KA 4TKVB 2R6GA 3GP3A 3UJ9A 1O6GA 5BOVA 4IW3B 1FX0B 3C6ZA 1I2DA 2FOLA 3IO5A 5FULA 3COVA 3EIXA 4ZAVA 3VNUA 3ZQJA 1QWSA 2AZMA 1Z28A 2WHRA 3JRNA 2F3PA 4XIYA 4Q4AA 3CONA 3STVA 3A1EA 2R86A 3BMOA 9LDBA 3UJHA 4MZDA 5LQRA 4Q9NA 4Y2GA 4WADA 4JJ7A 3ZWOA 1H65A 3ROZA 3E8MA 4IXTA 3JQ7B 1CV2A 5DW0A 1C2TA 1V5GA 4IUBS 3T12A 1SBYA 3H3XA 4ZCMA 4TTAA 1L1RA 1ISHA 3HBNA 3R3ZA 4K0RA 1G8JA 1A77A 1Z0KA 2VJPA 4QEZA 4WLUA 4J0QA 5FNVB 1VSVA 3AM5A 4G5SA 5BUCA 2UYQA 3UOAB 4XFJA 1CY1A 2AMVA 3KXDA 4KCGA 2VA8A 4CLEA 4F4JA 2ZAOA 3ROGA 4OQXA 3WICA 3D8HA 3VAAA 1BROA 3EVGA 1REQA 3B1XA 1ADBA 4GPAA 2OSVA 3VR6D 2Q5IA 4YMTA 3KZOA 3QQPA 4E33A 4BMDA 1CUVA 3LGXA 5IUJC 4FI3C 1Q0PA 1SUBA 5EE3A 3AB8A 1G3RA 4CPDA 3LIPA 5AKZA 4KMMA 4JROA 2WTXA 5D6NA 3EZGA 2J45A 5DO9A 4GOXA 5A5FA 1XEWY 1GT6A 1N1DA 3KVNA 4N3GA 4DWWA 1JEJA 1Q1QA 4AYXA 4X41A 1P75A 1Q83A 2Z95A 2ZI4A 4IG9A 3BN3A 5LD