5ILOA

Crystal structure of photoreceptor dehydrogenase from drosophila melanogaster
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
265
structure length
256
Chain Sequence
HHVGTSFRGKNAVVTGGAGGIGLQVSKQLLAAGAAKVAIIDLQDNLEEFVKLRAAHPTQSVMIIKMDVANKKGVEATYEEIAKTFGNIDIVVNVAGIFNDKDVQRTLLVNLGGIINSTLSALPYMGKDNGGKGGIVVNMSSVVGLDPMFIIPVYGATKAGIINFTRCLANEKYYQRSGIKFVTVCPGATMTDMFTNFTEKIIFPETSLNKQSAADVSRCILNVLEKDKNGAVYVIEGKRVYPLEIKPQWTGKEQAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoreceptor dehydrogenase, isoform C
publication title Structural Insights into the Drosophila melanogaster Retinol Dehydrogenase, a Member of the Short-Chain Dehydrogenase/Reductase Family.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Oxidoreductase
total genus 86
structure length 256
sequence length 265
chains with identical sequence B
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2016-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5iloA00
4MIEA 3NDRA 4AVYA 1ZK3A 2PGLA 3F1LA 1ZK4A 3PRJA 2Y1OA 5JCJA 3AM3A 2HJSA 4IY1A 2PD6A 2ZB4A 4FJ1A 5MDHA 3ZHXA 1ISHA 5BQFA 4J1TA 8LDHA 2QYTA 3E9MA 3ROKA 3A1NA 3GDFA 4B7XA 1I2BA 2GGSA 2AQ8A 3COSA 3H6KA 1ENOA 5T64A 3MOIA 1V9LA 1YS4A 4BNVA 1E7RA 3FRJA 5KIAA 1TT5B 2ZTMA 4BNXA 1IPFA 2GRAA 1H94A 2XXJA 4I9UA 3WICA 1NWCA 1QRRA 1ARZA 1JKIA 1YKFA 4YRAA 4E2WA 1C1DB 5AYVA 3U9LA 1H2HA 4LSWA 2J3HA 3BMCA 5ILOA 2AQKA 1IY8A 3EZLA 4RDHA 1R4MA 1M6HA 1H9AA 2I9PA 2YV2A 2RH8A 2HO5A 2X8LA 4Y67A 4XIYA 4L4XA 2X23A 4E13A 1DC6A 1NTOA 1PGNA 1NVMB 1BVUA 3WQRA 5TQVA 2FR1A 4BS9A 3ZNNA 1PQWA 4I5FA 3EGOA 4ND5A 3RD5A 4BMSA 5BSEA 2ZQYA 3PEFA 3UCXA 3EY4A 3TZHA 3GOHA 3NYWA 3N7UA 3ITKA 1GUYA 5AXBA 2Y1FA 1D8AA 1JKJA 5JDCA 2Y0DA 3GK3A 3PP8A 4PG4A 4OIMA 4G65A 2NQTA 4J6FA 5U1PA 4IQGA 3F47A 2ZCUA 3DWFA 1NX6A 3H9JA 3JQ8A 2ZB8A 1V8BA 2BF7A 4BNNA 5JSFA 3AFMA 3JQFC 2VHVA 1ISIA 4DIBA 3EK2A 5KVSA 1VLLA 4OJNA 5F1OA 4JP2A 5A9TA 3PTZA 3PGJA 3L77A 3BXXA 1RM5A 3QWFA 4INAA 3ZWXA 4RQUA 1XGKA 4ALIA 3NGLA 3PJDA 5TF4A 5HM8A 1UDCA 3GR6A 3KYDB 3ZWBA 4IBOA 3GVHA 1UXGA 3TOXA 3B1JA 3KZVA 3PK0A 1V6AA 1I2ZA 2J3IA 1DFIA 3KO8A 2HK9A 4YTEA 1FMCA 1U5CA 4MO2A 3W4IA 4BNHA 3EMKA 2BI8A 5KJEA 2X9VA 3N74A 4EI2A 3CXRA 5U4QA 3DBLA 1LXCA 3GZNB 1R66A 4MVJG 1P74A 3E9QA 4EEXA 4AJLA 5H82A 5AQ1A 4CLXA 1BMDA 3A4VA 1DXYA 4DC1A 4IIUA 1GQQA 4MVJM 4YJFB 2HCTA 3O38A 5ER9A 5A4DA 3CH6A 3VZQA 5I7VA 4KZPA 1GZ6A 2HUNA 4W7IA 4FJ0A 2P4HX 3WYCA 3JSAA 1C0IA 4FJ2A 4NFYA 4QQRA 2PGJA 5L3ZA 3WGHA 5KJ6A 5HS4A 2GZ1A 3WTBA 2GF2A 1EBUA 1NBOA 2VT3A 1YL6A 2PZKA 4CODB 5L45A 4YJGA 2A92A 2HKIA 1ZCJA 2Y05A 4Z6KA 1I32A 3JD1A 4JBHA 1YOVB 3GQVA 3FSRA 3IS3A 4II2A 2VYNA 1HLPA 3ZWYA 2ZKLA 2WYWA 1DOHA 1IE3A 4FC6A 4DQXA 4LRTB 5A9SB 1LLDA 5LC1A 5ENDA 3JYOA 2HJRA 3L4SO 3QVTA 1LRLA 1LDEA 1JVSA 4HFJA 4GMGA 1U3WA 3VPSA 1J49A 5U9CA 2BFMA 1NAHA 4B7CA 1DHTA 3UXYA 4GLLA 1BSVA 3T4XA 3VZPA 1LEHA 4M1QA 4PLCA 2EKQA 3WXBA 1P1HA 9LDTA 5L4SA 3E5RA 2ZB7A 4L8VA 2C29D 3KYCB 1YGYA 4NZ9A 3EHEA 2D5CA 4J4TA 4RPLA 2B4RO 1KIFA 4LCJA 4BUCA 2X1HA 3PPIA 2YQ4A 3OA2A 3STHA 4J1SA 1NR7A 1JKFA 3HFGA 3OP4A 4UEOA 4U7WA 4EJMA 1ENPA 4NR0A 5B37A 3ZNPA 4RPHA 4OAQA 3KRTA 2P4QA 3ONEA 3V8BA 1U3VA 3V2HA 1CETA 1XDWA 4I5EA 2I99A 4EUEA 3ZWVA 4LMPA 2NU8A 2VQ3A 4BNFA 4DC0A 4WEQA 4Q3AA 1YXMA 2FY8A 3I1JA 2R2GA 3F5QA 1I3KA 1HF3A 2FR0A 1WNTA 4YT4A 2P9GA 4YJDA 5GZ6A 4BNGA 4DBZA 3ZI0A 2GSDA 3O03A 1TB4A 3DBRA 4YACA 5BNFA 2O3TA 1Y1PA 2HRZA 4CQMA 1EQUA 1K0UA 4LMRA 4E5YA 3CKYA 3FWNA 1FK8A 4D42A 5A1TA 1PGPA 2DC1A 2C82A 2HDHA 1B14A 3KOUA 1MV8A 4AJJA 4XQCA 1LRKA 2VYVA 5DCYA 5T8KA 4PG8A 1ENYA 1XR3A 3DFZA 1H5QA 3NT4A 4CLDA 4ZD6A 5BT9A 1Q0QA 2AXQA 1T4DA 2GZ3A 3GN1A 3PVZA 4MJLA 3VDRA 4TSKA 3BIOA 4BNIA 1C3VA 2V6FA 1EDZA 2VOEA 3DZKA 3JQEA 4QECA 4BNTA 1T2DA 5A03A 1IB6A 3I6IA 3ORFA 5JCXA 3C7DB 2RIRA 4ZQFA 4LVUA 4W9NA 1MUUA 3MWEB 3FR7A 4OO3A 1IHXA 4LISA 2Q99A 1YB4A 1YONA 3BA1A 4NJMB 5L4NA 4ZU3A 2FN7A 4I08A 5L53A 1OC4A 2VHXA 4MVJF 3EVNA 1WMAA 4GX1A 3U4DA 3GAZA 4PVDA 1QR6A 3TFQA 2PKQP 1B8VA 4O63O 1ZMOA 4FFPA 5L7TA 2Q2WA 4BO4A 3WS7A 1ZFNA 4WLFA 5JCJD 4GL4A 2G1UA 3E82A 3QSGA 4S3MA 1F12A 4WECA 1BW9B 2HMVA 1HE5A 2HMTA 2AEMA 2NU6A 1DLJA 1BTOA 2YDXA 3ZWCA 2WYUA 2JD2A 2C20A 2YZ7A 3GN2A 4OYRA 2HMWA 1ISJA 1PJTA 2PD3A 4C4OA 5CDSA 1D1SA 5T57A 2Y0CA 1RM3A 4YAGA 1EFKA 4K26A 1BXGB 2J3JA 3GFBA 5HTOA 1X1EA 4LN1A 1GQ2A 3Q3CA 3E8XA 4IDFA 2DFVA 2Y1CA 5DCUA 1OMOA 4D0RA 1GCOA 3VH3A 4NHEA 2Q1WA 3JYQA 3GG2A 4E4YA 3OQ6A 1R4NA 4RVDA 3UCEA 3P19A 3ASUA 4O0LA 2W2LA 3OFSA 2O4UX 3UW3A 4U8GA 4GBJA 4FGSA 4UVDA 1DAPA 1Y81A 3M6IA 1EVJA 4XEHA 4JJGA 3EDMA 3NJ4A 3KETA 2UAGA 4PLVA 4YB8A 1Z6ZA 2C7VA 4NPCA 1SPXA 1P1JA 2WD7A 4NFSA 3NKLA 4W99A 3IKTA 3S8MA 1UZMA 3AFNA 3U5TA 4GAEA 1B8UA 4B4VA 3F46A 1BDMA 1Z82A 2X0IA 3QWIA 1OC2A 4FFOA 3ETDA 4QO7A 1G6KA 4FSHA 4Z3KA 1IOLA 5CAEA 3K9QO 4QFCA 1NQ5A 1NASA 3KSUA 1LQUA 3F3SA 4L4RA 3TL2A 2FPPA 5LDGA 5DDIP 3DZHA 1B0AA 4Z0HO 5JDIC 3MCVA 3DBHB 3VPFA 4YQZA 4MVJP 1IZ0A 3I4FA 2C5AA 1DPGA 1CJCA 3JD3A 3PDUA 3C7CB 3INRA 4EGFA 1E3WB 3MJVA 1LDNA 3T7EA 1W0CA 2YW9A 4R54A 1NQOA 2DUWA 2NWQA 1E3SA 3DZBA 2E82A 1MA0A 4KMSA 5I7SA 3TZQA 2RH4A 1D4FA 3ULKA 4JLWA 4YT2A 1RM4A 3O8QB 3QY9A 3DAFA 2GCGA 2PNFA 2WM3A 2Y68A 3VPHA 5CG2A 2B35A 4DGSA 2X0NA 3BMNB 4YR9A 1YBAA 3D1LA 3WOHA 3WYBA 2G17A 3E18A 4GH5A 5EL0A 4CR7A 1GV1A 1VJ1A 2LDBA 1H6DA 3UAGA 1F0YA 2I3AA 3UICA 1BHSA 1LDBA 3HNPA 5HBRA 4D45A 3TJRA 3AK4A 2GD1O 2DKNA 2QG4A 4HUJA 4A7PA 1GY8A 2O7SA 3QP9A 2BGMA 2VYND 3H8VA 3H2ZA 1JN0A 4FFLA 3U49A 1NNUA 1CIVA 4HY3A 4BGEA 3G17A 3VTZA 2Z5LA 4M8SA 4B8ZA 1XQ6A 1SCUA 4UUMA 4ND2A 3PHLA 4KWHA 1LBEA 1PL7A 4J4BA 4UVGA 1YJ8A 4HNGA 4MVJA 4Y6RA 4Z9XA 2H6EA 3I9NA 3D64A 3K96A 1ZZEA 3PJFA 5DP2A 2I67A 1N7GA 1WDMA 3WBFA 3RI3A 4BB6A 4XQEA 3C1TA 1HSOA 1E3IA 5C7OO 3ZGYA 4BNLA 4PLGA 3OECA 4GVXA 1V3UA 3FHLA 4RCVA 4DLLA 1XHLA 3AM5A 1ZUD1 4DQUA 3WBBA 3U4IA 4TWRA 3GVXA 5IZCA 1WMBA 2A35A 1DC5A 2OUIA 1TA4A 2JHFA 5ITWA 1C1XB 3FI9A 3DZGA 4Z0TA 3PHIA 3DFUA 4GSLA 1RYEA 5T8KC 3O4RA 1DHRA 2FRDA 4ZN6A 3B1KA 1U3UA 3ZDFA 1GU7A 4CMEA 5JO0A 2OFPA 4ALMA 5GZ3A 4XYLA 1P0FA 2VWGA 3I9JA 4W6ZA 3BZUA 3S2GA 4DA9A 4CMCA 1GR0A 4XR4A 1Z7EA 5G0TA 2D1YA 4O6VA 4BKOA 1HKUA 3GF4A 4N7RA 4CJXA 5C7IO 1BXZA 2AQIA 4RO0A 3ZV5A 2I76A 2CSUA 3AUTA 1I5RA 4RJTA 4R16A 1VSVA 5AVOA 3RCBA 2VYVD 4BGUA 3EYWA 3WIDA 3WSVA 1K3TA 3CINA 3MTGA 2EJWA 1MXFA 4ID9A 3QE3A 1Z75A 4R68A 3RC7A 2X86A 2RBEA 2O4CA 2NUAA 3JD0A 4CUJA 1NR1A 1GZ3A 4JJIA 1H6CA 3RUEA 2GLXA 4UUNA 4GGOA 1VM6A 4BO9A 4WGGA 2JHGA 4E30A 4FQ8A 5L95A 1N1EA 4A26A 1H6AA 3ZW8A 3WNVA 4WK6A 5CDYA 1QXSA 2PZLA 4BKPA 4BMVA 5JBIA 4PZDA 4LSMA 3GGPA 3EZYA 3KEQA 1VKNA 2B4QA 1OFGA 1EQ2A 2E6UX 3GUCA 4I5GA 3RKRA 1P3DA 5TT1A 1GZ4A 1PJLA 1N92A 3WGYA 3ITDA 4DLAA 1CF2O 1WDLA 3PIDA 4N5NA 1BWSA 2A9FA 3BMQB 3JQGA 4XYGA 2H63A 1W8DA 2QZZA 4OM8A 4RF4A 1SB9A 2R00C 4CMHA 1ZSNA 1GFSA 1RWBA 4A03A 5A9RA 4BO2A 5TGDA 5DCWA 4I1IA 1I10A 1R12A 2NNLD 3VC7A 4E3ZA 4CMJA 1S6YA 1ZSYA 2I3GA 3HDQA 3LK7A 8ADHA 1N5DA 1DC4A 2VN8A 4IUYA 1UP6A 1DRVA 1W4ZA 2DFDA 3HN7A 2AEFA 3OF2A 4IXWA 4DREA 4XQ9A 1WAMA 1OBFO 5DOVA 2DPHA 5CPBA 5EIOA 1SMKA 3W1VA 1QV7A 1ZK0A 3PYXA 4PLYA 4Q3EA 4XWYA 4E2ZA 4A0SA 2EP5A 4WCFC 2NVUB 2NLOA 2CVOA 3LLSA 3M2TA 1AE1A 2FR8A 3ONDA 3X2FA 4OQYA 1XG5A 3TPCA 2GN8A 4ZHSA 3ZNOA 1VSUA 1YQGA 4YQYA 3UF0A 3RUCA 5JNLA 4Q3NA 2X9NA 4B7UA 2VZ8A 2Q46A 3ETEA 4BOYA 4BNJA 1IHYA 3NDJA 2W2LD 1KEUA 5AOVA 3ZWPA 4AJ2A 3MJSA 4OHUA 2AEJA 1I2CA 4CM8B 2VHYA 5IDYA 4IQ0A 4BNKA 2Q49A 2VTEA 4J90A 1ULSA 3BMOB 1O89A 3GNQA 5FI3A 5MGBA 4ZA2A 4CV2A 4E6PA 2YFHA 4RF2A 1QORA 3GA0A 3KTDA 4RL6A 2BMAA 2BKAA 2RAFA 2IZZA 2X9GA 3BTOA 5A02A 5TIIA 2WE8A 4XKJA 5KTKA 1I24A 3OHSX 1BVRA 4DL9A 4NU6A 5ILGA 3VAZA 2IRWA 2PFGA 3I23A 5IFLA 2ZQZA 4E32A 4JNKA 4CMGA 3B70A 3RUDA 1JAYA 4YEDA 4E2YA 2I5PO 1HDGO 4FFMA 4KTVE 1Y5MA 2FOIA 4J2HA 2Q45A 1DSSG 4YVFA 4JJFA 4PZEA 1YVEI 2JD1A 4XYEA 3RC9A 1KOLA 2JJYA 2G82A 5ITVA 3WWYA 3AUSA 3WMXA 1XLTA 3PDJA 1XCBA 3K2BA 3KLMX 4TROA 3R3SA 5G2OA 2PGDA 3ZN2A 3ZCXA 5K0ZA 5L4LA 3GG9A 4RVHA 3L4BA 3DZFA 5T5QA 1FDUA 3Q1LA 1SC6A 4XGKA 1PZFA 3NTRA 1B15A 4JK3A 4EDFA 2IODA 4FGWA 2D59A 2NTJA 1Y8RB 5IDXA 5JE8A 5G0VA 4EUFA 2DT5A 3GC6A 1VKOA 4CM3A 4NQZA 4XIJA 3ZV4A 2CF5A 2XXBA 4PIVA 1UP4A 1WWKA 1UUFA 5TX7A 4WLVA 4E33A 5JXWA 2CNBA 4LW8A 3OICA 1X7GA 4ILKA 4N5LA 5JFOA 3H9QA 2W2KA 2P91A 3EC7A 4BO8A 5JC1A 3U62A 1L1FA 2CDBA 1VJTA 2V7PA 4WOKA 3RVDA 1IZ9A 3IMFA 4Z9FA 1HE3A 4OKIA 4DPMA 2E49A 1N9GA 4WNCA 4W7HA 1E77A 4ZQGA 4KDEA 5IZCC 2OBNA 3MTJA 4PN3A 3WGQA 3NGXA 5B1YA 3H9UA 5ES3A 2Y67A 5ADHA 3G1UA 4MVJD 1PL8A 2ZYGA 4CUZA 4CMEC 4Y8VA 3WG9A 5GY7A 2UYYA 3PWKA 4WLUA 5COQA 1I30A 4D44A 1R0KA 3Q2KA 2O3JA 4IJKA 4MVJH 3OQ1A 4H7PA 1O94A 4BO7A 1MLDA 2Y1EA 3BTSA 3GPIA 3H7AA 4GKBA 4P22A 4EZBA 2Z95A 4OOEA 1SEVA 2PTGA 3B20A 4BVAA 2Y99A 1P9LA 3MWDB 4N54A 1T1RA 3WFJA 2D3TA 3WJAA 1G0OA 4Y9DA 2BH9A 2BELA 3RC2A 4R51A 3H5NA 1WZEA 1MXHA 4UUOA 2EV9A 3JQBC 1J6UA 4S1VA 3AU8A 5L40A 5IDQA 3VZSA 5JAZA 3KUXA 2YV3A 3K8ZA 3VPGA 4RQTA 5TRTA 3QVXA 5FI5A 1DIRA 3CZMA 1UAYA 2BRUA 4GQAA 3QW2A 1WW8A 2C2YA 3LDHA 1DFGA 1VC2A 4FPXA 3QJ5A 4D3DA 4YBZA 1KC3A 2D5AA 3VH4A 1O95A 1QP8A 2VNSA 1ULUA 4MKRA 3JQAA 1RPNA 1WVGA 3Q2IA 1RKXA 3RWBA 1MG5A 2B4TO 4D79A 1JW9B 2CMDA 2J5QA 3PYLA 1HRDA 3QVSA 2IZ0A 3A14A 4YJHA 4IZIA 3Q0EA 3DOJA 4A73A 1HDCA 4GMFA 4NJOA 4WCFB 5IJZA 4JN6B 5T6BA 1WPQA 2VWPA 4TRNA 1PJSA 3AUAA 3FBGA 3NDIA 3WLEA 4XB1A 5B12A 1ISGA 2AMFA 2I6TA 2VWQA 3NTQA 5G4LA 1EDOA 5JAIA 4CQLB 2H9IA 3TZ6A 3U09A 4II3A 3H9GA 4WLEA 2XAAA 3HFSA 3RFVA 4R3WA 4DLBA 1U4OA 1YE3A 2WYVA 4IPTA 1GCUA 3QRWA 1GTMA 3EAGA 4IZHA 2B36A 4YA6A 4GGPA 4R5HA 4IM7A 4AJPA 1OAAA 3BYZA 4XRRA 4CM4A 2IZ1A 5JY6A 1E1NA 4H3VA 2IXBA 1QMGA 4YWJA 1Y8QB 2VWHA 4LCEA 5J23A 1ADCA 2NV6A 3AI2A 4YAEA 4P8RA 3ZZNA 2OO5A 1NFRA 4K28A 3PLRA 4CLEA 5HWSA 3GVPA 3HG7A 2X6TA 3RKUA 3I5MA 5F21A 3C24A 1AHHA 4AJEA 1P1RA 3TZCA 3HADA 1KC1A 1LDYA 2RCYA 2BGLA 4Q39A 2X4GA 3K92A 1LQTA 3NRCA 5F1PA 4CM6A 1Y6JA 4NU5A 2BD0A 3A9WA 3ZHBA 4PFJA 5G0WA 4J49A 2X5OA 4E5KA 1O5IA 1F17A 1NQAO 3D5QA 1A5ZA 3P5SA 1H93A 2GDZA 3GDOA 1KBZA 1K6IA 4UUPA 4FC7A 1NAIA 5CFZA 1LLUA 2AG5A 5KKCA 3PJEA 2C07A 1X7HA 4HX5A 6LDHA 5EESA 2JD0A 3HDJA 1C14A 4CR8A 3WX0A 4Y98A 1K2WA 4ZQBA 4RGBA 1MC5A 2NU7A 3DL2A 2FWMX 3GNSA 4HXYA 1H6BA 5EMHA 1E3EA 5G0SA 4OSOA 4CMIB 5COBA 3L9WA 1MP0A 4YT8A 1E1KA 1LSJA 1IULA 4UEJA 2B69A 3VOSA 1TT5A 5TT0A 1PJ3A 3M1LA 4ZICA 1XELA 3PFWO 3L4BC 3Q6IA 5COAA 3DMYA 4AJ4A 2TMDA 3LF1A 3CIFA 3L07A 5I9MA 1C1DA 4OQZA 1HDRA 3A06A 5C7LO 4C7JA 3L9XA 4NK4A 1LI4A 2YV1A 3BHJA 4LK3A 2AA3A 3MZ0A 3LVFO 4FN4A 4FFRA 1U2GA 4AJIA 4C7KA 4CLOA 1PZGA 4RPKA 1LDGA 4HBGA 4I8XA 4BMNA 4TQGA 2GYYA 4W82A 4RVUA 2HLPA 1SBYA 4CM9A 3KB6A 3ZNQA 1UXJA 5DT9A 2UV8A 1U4SA 1FJHA 4D3SA 1MFPA 5ER6A 1VL0A 3BHMA 2O2YA 4DMMA 4XRGA 2XF8A 4FBGA 4CMBA 3MJEA 5AXAA 1DC3A 2WSBA 5JLAA 1ONPA 3TZKA 1ZEJA 2NVBA 2Q2VA 3GRPA 4AICA 2OGUA 5DOZA 2JCXA 3PGXA 4JGBA 1I33A 1ZXLA 3V1YA 3QA9A 4BO5A 2C54A 4TMFA 1J0XO 2YHIB 3IAHA 5KJCA 1NHWA 3UN1A 3JQ7B 4PG7A 1SOVA 2HU2A 4G5HA 5DBGA 4TZKA 2DBRA 5JDCC 3UHAA 2PA3A 2Y1GA 3AM4A 3JQ9A 2VT2A 3KBOA 3KYDA 4JBIA 1QYWA 3K5PA 4FFNA 1Q0LA 3EVTA 2AE1A 2JFFA 3JTMA 1ORRA 1BRMA 1EK6A 5B4TA 4RVGA 3SVTA 1X1TA 1VPDA 3CPSA 1MB4A 2FPIA 2W8ZA 2VUSA 5FFFA 4WKGA 1MC4A 4K9DA 3GZNA 4WNIA 2B37A 4J0FA 3GEMA 1D7OA 1KS9A 4GX2A 1UAGA 3TL3A 2VZ9A 1RYDA 4E0BA 2V6GA 5TJHA 1KEWA 1U28A 3BTVA 3S2EA 4BO6A 1P33A 4BNUA 1UXIA 1KVRA 1I3NA 2EERA 1GYQA 4YJFA 1QKIA 1T2CA 3KVOA 3OMLA 1KEVA 4CLRB 4J2OA 4BO0A 2OHXA 5L7WA 4FW8A 4ROSA 1QLJA 1Q7BA 2EJVA 2FPGA 3DHYA 2Q1UA 3LSYA 4IQ8A 4IS3A 4JIGA 5AXDA 2NTNA 1DAOA 3LC2O 4DPKA 1CQIA 4BB5A 2QW8A 4BKUA 5K6AA 2O3UA 4NIMA 1FXSA 4R1TA 1JVBA 4E31A 4MIYA 2CVZA 3I6QA 4O59O 2O3RA 2P68A 3D3WB 3PWSA 2JAHA 4CV3A 5A9SA 1E7WA 4DIOA 4RZIA 4BHTA 5G4KB 3PQFA 3OJLA 2Y93A 5F3RA 1OI7A 3AI3A 2DTXA 3JYNA 4QFDA 3ROMA 1T1SA 1NFFA 1E7YA 5IXYA 1AXEA 4R4JA 2QRKA 2CUKA 5F5LA 1LTHR 1B3BA 5I7FA 3CZRA 3DB2A 2YFQA 3RUIA 1YB5A 2UVDA 4FS3A 1ZEMA 4J16A 5CPFA 3DHNA 1NPYA 3KYCA 4FOOA 4QO8A 4YPOA 1DIAA 4IXTA 9LDBA 3PXXA 3B1FA 1QYVA 1WXDA 3DTYA 3I9LA 3GEDA 3C8MA 4UREA 4D3FA 3JQAD 1GUZA 3UVEA 1P0CA 2AQHA 1ZXBA 5EPOA 1A27A 2FHSA 4NNJA 1TI7A 3DMTA 4YDRA 4BL5A 2ZTUA 1HXHA 3E5MA 5C5IA 2NSDA 2CVQA 3GT0A 5JAMA 3L6DA 4OMUA 2Y1DA 1ZSVA 4G2NA 3GGGA 4XCVA 5H81A 4DUPA 3W4KA 1I8TA 2EKLA 4QSMA 2EG9A 3UFXA 4BQPA 1NVTA 4N18A 1JAXA 4U0KA 3W6UA 2Z1NA 2ZJ0A 3CMCO 2O3SA 3QLJA 4BV9A 1RM0A 3D4OA 3IQDB 1PJQA 4P4NA 3HJAA 1P1IA 1UXHA 2DBVO 1HT0A 1B8PA 1E92A 1JQBA 3GAFA 3O26A 1E6WA 3GDGA 1GPJA 4KQXA 3P7MA 4ALLA 1FDSA 3PHJA 4XJSA 2DLDA 1E7SA 4RDIA 1LX6A 3U4HA 5TJ9A 1D3AA 1JWAB 2RHRA 3WSWA 4AG3A 4FB5A 1EUCA 1SB8A 4AL4A 4J1QA 3FPLA 3ZH2A 3WMWA 4OGWA 4BKQA 2DBQA 1YRLA 3W4JA 4PLTA 2BFPA 3WJ7A 1ZW1A 3BTUA 4ALNA 1R6DA 2VNAA 1ZKMA 3FN4A 1F8GA 2NU9A 3R1IA 4FDAA 4BV8A 4PLZA 1VJ0A 4IMRA 1F14A 1NHGA 4NJMA 4Q3CA 4NK5A 3D5TA 3OBBA 4ZJUA 4U6SA 5IF3A 4CQMD 2WDZA 3WB9A 3BMCB 3INTA 3ZWAA 4AJKA 4NBRA 1VE9A 3PHGA 1R4MB 2IXAA 4M89A 4W9NC 3K73O 1EVYA 1YBMA 3SBOA 4CL3A 4J7UA 4O5OA 3HN2A 1PGOA 2QRJA 2I65A 1HE2A 3ABIA 4U5QA 1SAYA 2EEZA 2VTDA 4Z9YA 1UDBA 2B0JA 1N1GA 1PJ2A 3TNLA 1BW9A 1LDMA 5DBIA 1ML3A 1DFHA 4JP3A 4TRRA 1E0DA 4N5MA 2DTEA 1PJ4A 2EHDA 3NAQA 3RIHA 3DXFA 1O9BA 5CEJA 2AG8A 2G0TA 3C1OA 1B16A 1NWHA 1HYHA 1XYGA 4QEDA 1BXGA 4XA8A 4ESOA 3QV1A 2W4QA 1PU2A 1LRJA 2ZJ1A 4CMKA 3JQ8B 5C37A 1YWGO 4FD3A 1B2LA 1M2WA 1Y9EA 5T67A 3PQDA 2GZ2A 2DU8A 2W90A 3I52A 3FWZA 4J43A 5KVQA 3ANLA 3LLVA 4BNWA 4DPLA 3V1TC 4FCCA 1CWUA 5EJ2A 3I9OA 1Q1NA 2C59A 4WASA 2OBYA 3NX4A 3D3EA 1BDBA 1ZBQA 2DAPA 1AUPA 4CM9D 4UVIA 3K2EA 1YL7A 1O6ZA 3DBLB 5KCZA 3PIIA 2WWRA 2P9EA 1ZMTA 3OH8A 1ZVMA 2A94A 1VI2A 1IUKA 2O3QA 4J7CA 1VL8A 4H15A 1I01A 3G0OA 3S1LA 2F1KA 3GMSA 3QWHA 4PRLA 4QXMA 5JY1A 1UJMA 2HSDA 4J4HA 2X5JO 4ZQEA 3SLGA 3WDSA 1UXKA 4ND4A 4PCVA 1E3LA 4YRDA 3ZW9A 1R15A 2DQ4A 1R37A 4MVJI 4AFNA 4F46A 1DO8A 2VRCA 3HWRA 3V2UA 2E37A 1GADO 4H16A 2PH5A 3OIGA 4MP6A 1TEHA 2EIHA 1HZJA 2YUTA 4OKNA 1ISMA 4Q3BA 3R6DA 2NQ8A 1K89A 3OEYA 4MINA 1KY5A 3GEGA 5DN9A 4Y6SA 3OJ0A 3DBHA 2YY7A 1PJCA 4YJHB 4GX0A 2H1SA 2GR9A 2XOXA 4HFNA 3MJTA 3LT4A 2BFOA 4YJGB 4IGFA 2VCYA 1E3WA 4MP8A 5L7YA 1M67A 3GUYA 1E5QA 3GY0A 5K6AC 1MFZA 2W98A 3AY3A 3D7LA 2ET6A 3HZZA 3VVCA 2FZEA 4M86A 3IKVA 5AXCA 1XKQA 1ZK2A 3O8QA 4NBUA 1U3TA 2A4KA 2J3KA 4E5PA 5JYEA 1V35A 5FWNA 3EW7A 4MOWA 2HMUA 5A04A 5I9NA 1EVZA 1KYQA 4GI2A 2VHZA 1PS8A 2OP0A 3DHEA 3OIDA 2HRBA 3OA0A 4PLFA 4XYBA 3DZIA 2PKRA 1YDEA 3C3XA 3BMNA 3NTOA 3O9ZA 2DBZA 4P38A 5KOIA 2BI7A 3LT1A 4MVJE 5JO9A 3CEAA 1X14A 1XU7A 2Z1MA 1PQUA 4LVCA 4E5NA 1QV6A 1ADGA 1UH5A 4CM7A 4CV0A 4I5DA 4UAGA 4IIVA 1LC0A 1N7HA 3RFXA 1QG6A 5HS6A 1V3VA 4EJ6A 3HB4X 1G1AA 2UUOA 1NQTA 5F5NA 5GMOA 3V1UA 3WNQA 4WPGA 1E5LA 1Q0HA 1PZHA 3T7CA 1LJ8A 1X13A 1A7AA 3KXDA 1I3LA 3FNHA 3ONFA 5KNLA 5KVVA 1WZIA 3HQ4O 3H5AA 3PHHA 3E48A 3DMTC 1ENZA 1RJWA 4XYMA 3FF4A 4XQGA 3HHPA 5THKA 2CF6A 2JKVA 3QVWA 5G0UA 5KWEA 3DBVO 3DBRB 4EEZA 3C85A 1I0ZA 1V3TA 1B7GO 3QVOA 4CQMB 2D4AA 2NM0A 2Q3EA 1C0PA 1ADBA 2EGGA 1OZAA 3KHUA 2ZK7A 3IP1A 4B3HA 4YRBA 5DF1A 4IDEA 4BQRA 2NVWA 1KVQA 4GPD1 3VPXA 2WMDA 3OM9A 1X15A 4ONEA 1FDVA 1NXQA 3ADOA 1LNQA 2PZMA 4IDBA 1CRWG 1JA9A 4NMHA 1BXKA 1DIHA 4J9UE 3C7AA 4PG5A 4F3YA 1NYTA 4NFHA 3DC2A 1U1IA 1C1XA 4JQCA 5DBFA 1MG0A 1GYRA 4BIIA 2WEKA 5DULA 3VKVA 5HRUA 3GHYA 1PR3A 4A2CA 5BSHA 1EUZA 2PLAA 2JL1A 2G5CA 2CD9A 2Y66A 1J4AA 3ENNA 5H83A 1P77A 3QWAA 3JCZA 3BHIA 1A7KA 4PLHA 4J91A 4WOJA 1UDAA 4U0JA 4BGVA 3RUHA 3WR5A 4M49A 2EWMA 3WLFA 2PR2A 5CG1A 4IINA 1HETA 2GN4A 1XQ1A 1U5AA 1ZO8A 3GVCA 4OOFA 4PRKA 3PZBA 3FCOA 1J5PA 4QTZA 3LC1O 1NPDA 5KVCA 2WTBA 4HWKA 4NBTA 4R1NA 5TC4A 3SJUA 3HB5X 4CLOB 4DYDA 3KSDO 1A9YA 3LC7O 3AUUA 4I9HA 3HE3A 2I66A 4TVBA 3MEQA 3VVBA 5I8WA 1XEAA 4DTIA 3GVIA 5IG2A 2BGKA 1GDHA 3D4NA 1AN9A 5IAAA 2GASA 1ZJZA 1JDJA 2GNAA 4R01A 5LDHA 1PSDA 1LSSA 3W8EA 1BG6A 1PTJA 2C0CA 3F6YA 3KYBA 1C0KA 4A27A 5A5FA 1HDZA 1E1LA 4HFMA 4ND1A 3P2OA 2RHCA 4DWVA 4AJ1A 4D43A 5TLSA 1SZJG 4ALKA 1GPDG 3QIVA 3QWBA 2EW8A 4F6CA 4TRMA 3H9EO 4BO3A 4J7XA 4XGIA 1A72A 4BGIA 4YYZA 3ZWNA 5ICMA 3ZV6A 1KEPA 4P4LA 5EQFA 4DBVO 2PV7A 1DB3A 2WJPA 3IC5A 1Z73A 1B3RA 4CM1A 1H9BA 4PZCA 3WIEA 4KUHA 3OQBA 4RF5A 4D0SA 3BMQA 2ZB3A 2ZCVA 5TS3A 3ETGA 4EBFA 5KJ1A 1P44A 1HDXA 1R4NB 1F06A 3TRIA 3MOGA 4BNMA 2CY0A 5C3MA 3WQQA 1IPEA 3FNEA 1IYZA 5THQA 3NEPX 4DYVA 4KTTE 3H3FA 4TZTA 1ID1A 3PWZA 3LF2A 3WGIA 4L4SA 1A71A 1X0XA 1CYDA 2GO1A 1T2AA 3CUKA 4L0QA 5DNAA 4QUKA 2WD7B 1M66A 4DXHA 4QT0A 3SC6A 1XWFA 1NFQA 4B4OA 4D41A 2X58A 2PH3A 3INGA 5JDIA 1NPTO 3IJPA 2O50A 1GL3A 1FDWA 4DQVA 3I9KA 3QHAA 2NVUA 3M2PA 4URFA 4KOAA 1HDOA 4EITA 3VTFA 2Q2QA 1EZ4A 3R0IA 1Z7BA 4O1MA 1XIVA 1DIGA 1K6XA 1U8FO 1EUDA 3RJ9A 3G3EA 4RPGA 1SEPA 3JYPA 4WLNA 1HDYA 3ON5A 3S55A 4BKRA 2DPGA 1SOWA 3JYLA 1PGJA 1CQJA 4HP8A 1KVTA 4OXNA 4CM8A 4B79A 4G81A 4YCAA 3TF5A 1OOEA 3BMOA 4NH4A 1I36A 2ZYDA 3ASVA 5CEFA 3RUAA 2D8AA 3TQHA 4RLSA 5FEUA 2ILTA 3GH3A 1E7QA 4OL9A 2WD8A 3WYEA 1NVGA 3FR8A 3KLPX 4LRSB 4ND3A 4UVHA 3GNTA 3RU9A 4J9VA 5DZSA 1FDTA 2D2IA 4ZRMA 5JS6A 2J8ZA 4L9RA 2O2SA 5HA5A 3DZJA 3W8DA 3FTPA 4YT5A 2YYYA 1GQYA 4MKXA 4ALJA 4NBVA 2VRCD 1QLHA 3L0DA 3PLNA 2J5KA 5CDUA 4XX0A 4R9SA 4K1LA 3ROQA 2D0IA 3S2FA 5GZ1A 1E1MA 2POQX 3F4LA 3PJGA 5EQDA 3PFFA 1PR9A 4YAIA 2HMSA 1JTVA 4UEKA 3U3XA 3UCFA 5LCXA 2B83A 4E5MA 3LT0A 3ZHYA 3ANMA 4IS2A 3FNGA 4JCOA 4Y6PA 1HL3A 1Q2XA 3RROA 3AWDA 4WUVA 4XDYA 1HYGA 5BNTA 2HK7A 1NM5A 3LYLA 1LLQA 1YL5A 2Q50A 1ZJYA 4EUHA 3AOEA 1YBVA 1T2EA 1Y8RA 2Q4EA 3L6EA 5BSGA 3JQCA 3FBTA 3K6JA 1ONNA 3RAJA 4NBWA 2HAEA 4IDAA 2FMUA 3F1KA 3B6ZA 2EXXA 2VUTA 2GPTA 4KWIA 3HDYA 5I7EA 1QYXA 4R5MA 2P5YA 5TSDA 1U7HA 3G1TA 1DIBA 2QYSA 3E6AA 3AJRA 3RBZA 4R1SA 3SX2A 3AOGA 4UULA 5K9ZA 2CDCA 1B26A 3DQPA 2X0RA 2IE0A 4M87A 1PZEA 3LU1A 1M76A 1E7MA 2Y0EA 4IDDA 1DRWA 2GERA 2BFAA 2JCVA 4OSPA 4PG6A 4XJTA 4YAKA 1BGVA 4P4GA 4EW6A 4NDNE 1EE2A 4M55A 3IDSA 5F1KA 3LT2A 4KP7A 3WWZA 3X2EA 3CSDA 3WGOA 1UZNA 3KM0A 3WFIA 2UDPA 1KERA 3WGTA 4XD2A 3R3JA 1PS0A 4L73A 4RV9A 4CV1A 2AE2A 3JD2A 2B5WA 4A5OA 1ZNQO 2IYPA 2WE7A 4KQWA 5IN4A 2CZCA 3RQSA 4EJ0A 1KVUA 4FIZA 3ZV3A 4FOSA 4Q3DA 4X54A 1DRUA 4ZGWA 5ICSA 2V65A 4B4UA 3F4BA 5CEEA 1HWYA 1KETA 4J3FA 2OZPA 2O23A 1C0LA 4KUGA 1VL6A 2DM6A 3IP3A 2IEBA 4KUEA 3DAPA 4PVCA 3RBVA 3TOZA 3DONA 3TFOA 4IGEA 1NP3A 1LU9A 2P9CA 3I3OA 4R3NA 4OXKA 1T2FA 3UOGA 1H2BA 4F45A 3ANNA 1WLYA 3OEWA 1PS9A 2R00A 3HSKA 1N2SA 3SLKA 4IMPA 4U6QA 2UUPA 1Y9AA 2J5RA 3ADPA 1DDOA 4DRYA 3OJOA 2O7QA 2P5UA 4Z3DA 1XA0A 4YXFA 2CFCA 4L74A 1EE9A 4ZVVA 3GGOA 3A28A 2R6JA 2OL4A 1R16A 3JQGB 2BLLA 1FF9A 1G0NA 2DTDA 1PWXA 3FD8A 1DLIA 4BNYA 2PKQO 3QQPA 4GWKA 3JQ6A 1O0SA 1X7DA 4K6FA 2NACA 1N8KA 2IEDA 2TMGA 3G79A 3NJ8A 4J1NA 3DAGA 5KKAA 2OXIA 1A4UA 4WCFA 2OP1A 3DOCA 3ZWWA 4E2XA 5BR7A 1K5HA 1YOVA 4XGNA 1KY4A 5L9AA 1HYEA 2Q1TA 3AY7A 4Q9NA 2GUGA 4CQLA 3RJ5A 5A06A 4TRJA 1ZIDA 5FYDA 3CMMA 4GKVA 3GMDA 3OJEA 3SXPA 2Q4BA 2QHXA 1GUFA 1P1KA 2X5KO 4PLPA 3VKUA 3ROPA 5A3VA 1U7TA 2GN6A 4B4WA 4E12A 5IZ4A 1YB1A 1X0VA 3TWOA 4WJZA 3RU7A 1AHIA 1EK5A 3ICPA 2FP4A 3GLQA 1SNYA 1JU9A 3ZU4A 1Y8QA 2PWZA 3AU9A 1O8CA 4GVLA 4MP3A 1YH3A 5BSFA 3SJ7A 5KJFA 4M54A 5A3JA 5ENVA 3VZRA 3H5RA 1Z74A 1T4BA 5A05A 2IYOA 1QYDA 4K6CA 1YQXA 2G76A 4GLOA 3E9NA 1U2DA 5A5EA 2OMEA 1R0LA 1CEQA 1MGOA 4Z0PA 1GYPA 3P2YA 1PJBA 3U4CA 1I3MA 4RPJA 2FZWA 1TVEA 2QRLA 3UUWA 2YHUA 2J6IA 3ENKA 3SC4A 2P2SA 1LSOA 1AXGA 3LQFA 2ZATA 1UZLA 4AJNA 2C7GA 2OOSA 3VH2A 4KDFA 7MDHA 4MDHA 3OJFA 1Q7CA 4OH1A 4CPDA 2VOJA 5JMPA 7ADHA 2ZTVA 3FPCA 5IN5A 1LUAA 3SEFA 3DEYX 4XB2A 3V2GA 4B8WA 5CP8A 1YJQA 1U9JA 3Q9UA 4CLHA 2VRBA 1TLTA 1ADFA 1EVIA 4J0EA 5I8ZA 4WE3A 2AW5A 2DVMA 3VDQA 3GZ4A 3EUWA 5CDGA 2JCYA 2EGHA 3MJCA 4IJWA 1CERA 4YAJA 4RORA 5JPIA 3E03A 3S2IA 4CL8A 1QYCA 1HZZA 4HADA 2FSVA 3JD4A 2B5VA 3G49A 1GEGA 4CMIA 5JW6A 1UP7A 4QX6A 4EYEA 3TSCA 2QIOA 1HEUA 1VRWA 3F9IA 5B4VA 4UVEA 2F00A 5JYDA 1ZK1A 1GAEO 1W73A 1DJNA 5JAQA 5JMWA 3MJ4A 3IL2A 3CTMA 2GN9A 4NI5A 4WCDA 3T4EA 2YDYA 4GWGA 3UH1A 3ST7A 2JFHA 3AOEC 4IDGA 3UKOA 4HKTA 5CDTA 5L51A 3FTNA 4CR6A 1T24A 3TN7A 3Q9NA 3IOYA 1MX3A 1EFLA 2X7HA 2V6MA 5EERA 3IUSA 4RVFA 4WEOA 3HUDA 3KV3O 3ZU2A 2ZYAA 5B4UA 3NUGA 3ZHZA 2W2KB 3N58A 2QX7A 3FNFA 3WTCA 1YO6A 2E4AA 3GPDG 1V0JA 3IIEA 3NT2A 3OETA 4WLOA 1N9GB 3H2SA 1HTBA 4IJUA 2NADA 2O48X 3L6OO 3JQFA 4ZRNA 5DP1A 3H3JA 1P31A 2H5LA 3PYMA 5IXSA 1YDWA 1LA2A 2EP7A 2V6BA 3F5SA 4R69A 3GHHA 3RASA 4DVJA 1Y5RA 1PGQA 2EKPA 4A10A 2YHIA 3JQ7A 1F8FA 4JX8A 1E3JA 3DO5A 3IUPA 4LGVA 3JQDA 3RC1A 3WGZA 3ZWMA 1H0KA 5IDWA 3IJRA 1WDKA 2PK3A 2PZJA 4F6LA 1D1TA 3JQBA 1P45A 3H65A 3K31A 1Z45A 1WP4A 1IL0A 1SO8A 2ZIZA 2C5EA 4OXYA 1T26A 1YQDA 1HLDA 2VUUA 1UR5A 5I9LA 1M6WA 3LZ6A 4B3JA 4HV4A 3PQEA 4I9NA 1T25A 4XZ3A 1PL6A 4RLHA 1PEDA 2ZTLA 4B3IA 3Q11A 3AI1A 1XSEA 4DIFA 3JQ9C 1EEHA 4BO1A 3I83A 3HDHA 4D7AA 1W6UA 2LDXA 1EBFA 4JBGA 3GFGA 3RSHA 3VH1A 3K30A 3U0BA 3NT5A 3CE6A 3W8FA 2EW2A 3ZU3A 3C1AA 4MKZA 1JWBB 2OORA 2CDAA 2EF1A 2PD4A 1HSZA 2Q1SA 1ISFA 4HFRA 4E21A 4BNZA 4CLRA 4ITUA 2YQ5A 3V5NA 1L7EA 2X22A 1PX0A 4JROA 1M75A 2E48A 4GX5A 5FF9A 4PLWA 2SCUA 1XU9A 2PY6A 2NTVA 2XPCA 3UGKA 1LSUA 3PZRA 3ICCA 3JQAB 1EMDA 3ZWOA 3NV9A 3GRKA 3AY6A 4D46A 4R9RA 3RFTA 1A4IA 5EINA 1DJQA 3H4VA 2AHRA 3I4CA 1TXGA 4PGFA 4R41A 5TNXA 1U8XX 3OSUA 2HK8A 3I9MA 3D3WA 1P1FA 3KSZO 4XDZA 1PQPA 5JC8A 1S7CA 1AGNA 4HNHA 5EN4A 5G4KA 3D4PA 3JV7A 1HE4A 3BAZA 3DR3A 2QZ9A 4R1UA 3D0OA 1L7DA 4CUKA 2YJZA 1DEHA 2X0JA 4ZQHA 3M1AA 3E1KA 4L76A 1R0SA 1E6EA 1A9ZA 1Q7GA 2JFGA 3TDKA 3W6ZA 3VHRA 1LC3A 2FSSA 2VZ0A 1ONOA 5BNIA 4TKMA 4CMAA 4AJHA 3ZU5A 2BHLA 5CHEA 4CM4B 4L75A 4NG5A 4TVOA 1K6JA 1CDOA 1GEEA 3RUFA 4AJOA 2VHWA 1QSGA 3DOOA 3PI7A 4IJVA 4DMLA 2DUUA 1GV0A 1KVSA 3AW9A 4IDCA 2QQ5A 1JLLA 1DBVO 4GSKA 4JXKA 3WQSB 4RVSA 2C2XA 1PIWA 2JAPA 4RF3A 4FR5A 1PWZA 6ADHA 3KEOA 4RZHA 1TT7A 1Y7TA 4XR9A 3WGGA 4MPDA 3RBXA 4W4TA 4MIOA 1LLCA 4TKLA 4CM5A 3OIFA 3DDNA 3DTTA 1E6UA 2IDZA 1GD1O 2HQ1A 1ZH8A
chains in the Genus database with same CATH superfamily
3L04A 2FSHA 3MNFA 1P8JA 4V2IA 2C83A 4UCFA 4AVYA 1U5BB 1NYQA 3GJ7A 1PDVA 1NG1A 3COWA 4P2BA 3PRJA 3ERCA 1W59A 3ZQ6A 2JKYA 3MWLA 2JFQA 1JIQA 1UPFA 1MJHA 4FJ1A 4R7GA 5D5PA 1B6SA 3TRHA 5HQJA 5MDHA 3ZHXA 1EESA 1ISHA 3FOZA 1PUJA 5BQFA 3IDZA 4J1TA 8LDHA 3ROKA 4REQA 3A1NA 1MH1A 2F3UA 3GDFA 4OREX 4B7XA 3GLUA 5IEJA 2R65A 3HBLA 4K1XA 4KVAA 2DOKA 5PNTA 3H6KA 1EVLA 2XITA 4N9QA 4OQEA 1L5KA 3MOIA 1KI1A 4QULA 3D43A 1E7RA 1QQ6A 1LZKA 3ZCVA 1TT5B 4JEHA 5CXXA 3Q8WA 4BNXA 1A1VA 1HZZC 4I6JA 1H94A 1V8ZA 3GUZA 3WICA 3W3AA 3IBSA 4M21A 3GW8A 3IQXA 4KN9S 4O4IB 1THZA 4PHTA 4UOQA 2BFWA 1RAEA 3J80A 1JKIA 5FOUA 4PRYA 4E2WA 1C1DB 1G41A 3OZDA 5AYVA 5AM1A 3UJCA 3W2GA 4QT4A 3GLIA 1VIDA 2J46A 2QL6A 4US2R 2J3HA 2P6RA 3BMCA 2AQKA 3EZLA 3AMVA 4K9OA 2CEKA 2ZYHA 1UBKS 2W7TA 4JFRA 4RVNA 4YDSA 4AO8A 2WUGA 2X8LA 2ZS9A 3WGUA 3RYCA 2ZOSA 2CLLB 5LP6A 4JYCA 5JLJA 3NBZC 5FNVB 5GJVC 4M0KA 2BFNA 4X6UA 3R3XA 1UKVY 3LPMA 3WKBA 1E89A 4YDHB 4RHYA 2ZKIA 4P83A 5C1BA 2KWIA 2PGIA 4HWTA 4KRXA 3PEFA 5AM4A 1G9XA 1JR3D 4HN4B 1FYWA 4R40A 5ALJA 3GOHA 3G1WA 1RE0A 2RHTA 4YONB 1JKJA 5K0JA 1RHRA 3GUUA 3NWOA 3DLBA 2X8JA 1L7XA 3K2IA 3AETB 1ZMXA 3L46A 4G65A 2NQTA 2YY5A 4H0FA 3LIPA 3UATA 1G2IA 4J6FA 5AT1A 4BX2A 2ZI6A 2QDXA 2JJ1A 4MCAA 4YRIA 2DR0A 3DWFA 3H9JA 4M9ZA 3B2NA 5AUOB 1P29A 5JSFA 4DR2B 4BNNA 1RYNA 1OB5A 1USWA 1ISIA 2VHVA 1GGVA 3HI6A 1T9HA 4A2WA 4KDRA 4R2HA 5I3CA 3QXXA 2XBUA 4G8CA 4JP2A 4P7GA 5A9TA 3AB7A 2MYPA 1RM5A 4YGYA 3C45A 3ZQJA 2IEIA 1DKQA 2ZI7A 2WINI 3M4JA 1CUSA 3QWFA 4KN8A 4YFVA 4OLFA 3TKLA 5CB6A 4LDQA 1BYUA 1W5AA 2DT8A 3L43A 3NGLA 4LQ4A 4MEJA 1OZHA 1OU4A 4K9MA 4U7PB 1DZ3A 4W5HA 2HA5A 1C41A 4N49A 2OUKA 2MSLA 2XCOA 1OH8A 3ZWBA 1UXGA 4I5IA 2YN0A 2VSOA 1BE8A 1XPJA 3ONWA 5E1BA 4A2QA 3K3PA 2YFYA 4M0FA 2JIZA 3HCAA 3KO8A 3FGOA 1FMCA 2OSBA 2JFBA 4MO2A 1QGOA 2BI8A 3EMKA 5KJEA 3LZCA 1UJ2A 3N74A 4KXMA 3F5FA 5U4QA 3VX4A 3HKBB 1WQ1R 4FMCF 1DOZA 3GFSA 2YJGA 5CIQA 4M1KA 4EHJA 2P2DA 3RHFA 4ZJYA 4HF7A 4MVJG 1I2MA 3KDSE 4TMTA 3IVAA 1CUVA 1P74A 1GLVA 1GP2A 2VFAA 3E9QA 5H82A 5K8JB 4CLXA 3AM1A 4TTTS 2JLSA 5BURA 4D4MA 2VDNB 4MVJM 4YJFB 4MR7A 2RC5A 1PHRA 3EXG1 4KIFA 1P7WA 3VKGA 3DMPA 5I7VA 1JTEA 4XFKA 5KNDD 5C31A 1HFWA 2GEDA 2OORC 3DCNA 4XFDA 4OD0A 3WYCA 2WWGA 5LOVF 3CLVA 1Z4MA 3R7SA 1FNCA 3WGHA 4QDXA 1MD9A 4ZOLB 1UBTS 2GF2A 3IE2A 1NBOA 1G2OA 2VT3A 3H7IA 5F73A 5TXGA 2VQFB 4GEKA 4C5AA 2BHSA 1YL6A 3BF8A 3EWNA 1ECGA 3FAKA 5JVDB 2A92A 3CVJA 3HEBA 4INJA 3ASYA 2GK6A 4R84A 1I32A 3CZQA 4JBHA 4DCUA 4Z6KA 2XDWA 2FJPA 3FSRA 3IS3A 5CK4A 5C35A 2PVSA 1PR1A 2R8OA 3SZUA 1BKDR 4J03A 4PPYA 2QNRA 3TW4A 1JSRA 1B42A 2C03A 2ZBFA 1RBMA 3UK6A 1IWBB 4V39A 1OSNA 3AF2A 4W5OA 1P2GA 1LDEA 1JVSA 3MFYA 1LB1B 4ZYTA 2HUPA 4ACBA 4QWWA 3B5JA 1CUZA 3NORA 5B1SA 2B78A 3IHWA 1AG9A 3MOSA 1AV7A 5G1OA 5JT1A 2Z3VA 3E4DA 3HCFA 3O73A 4NEHB 1LEHA 2EKQA 1FIUA 4R2LA 9LDTA 1UMCB 2H2IA 4GGMX 1X39A 3CF2A 1G7CA 2C29D 3TTWA 1IXSB 4Q47A 4NZ9A 3EHEA 3UAXA 5K3FA 2PZ8A 4GYJA 3LX6A 4MR8A 1TK9A 1ZD5A 3V1LA 2VBIA 1EA5A 4BUCA 4D3YA 4OBXA 3V4PB 4CRWB 3OA2A 1L5VA 5AICA 4J1SA 3TIXB 1NR7A 3AG5A 4EJMA 3OP4A 4HWGA 1II8B 3FWPA 5E4JA 1ENPA 1O9GA 2EBHX 3ED5A 1UBUS 2XKAA 3OFVA 2WQZA 4JJ6A 3ZNPA 2NZJA 2CE2X 3EZ6A 3KRTA 4NYMQ 4WWHA 3ZKAA 1E4VA 1XDWA 4ZWNA 4I5EA 1MQAA 2SICE 4ZMSA 1J99A 3BJRA 4MYCA 3WIUA 4DZTA 1YXMA 2M6SA 2WTUA 1T35A 2EJCA 2FY8A 3DAHA 4QXAA 5T4EA 3MUNA 1Z5PA 4FGLA 1I3KA 1HF3A 2FR0A 1WNTA 2HJGA 4G09A 1DWOA 1SU8A 4G85A 3PE6A 2QWXA 4DBZA 3T3DA 4UBIA 3B6KA 3O03A 3HWSA 1T4GA 4MWGA 5MN6A 1JDUA 3BE4A 1EQUA 3MILA 4FMBB 3MQFA 2DHDA 3P9QA 1GR1A 1IQRA 1FK8A 5A1TA 2NYRA 1MIOB 2E6KA 2DC1A 2C82A 1SCBA 4CF6A 1V9CA 1ZUWA 3WLTA 3ZIAA 2IIQA 5CJ2A 2HDHA 3RTBA 5JNSA 3SIRA 3U44B 1MV8A 1KDOA 4O4LB 4ABYA 1KK0A 1P81A 1GU0A 5M34A 2ETVA 3QTLA 2VK4A 5DCYA 4BJ3A 1U94A 1AIPA 1NI3A 1ENYA 3M8KA 4X6YA 5D6OA 4CLDA 2QKYA 4DMGA 3IOEA 5BT9A 1QTQA 4GLFA 1XCLA 1AOXA 4UTVA 1FX0A 3QU4A 1FS4A 4K6GA 2FPXA 3GN1A 3PVZA 4US1R 4F85A 3LHDA 3LCVB 3REQA 2V6FA 1ZHOA 1G8PA 4QECA 5IVPA 4C6TA 3R9WA 4ARSA 2SNIE 3HO8A 3CR8A 2Q5HA 2O2ZA 2G8NA 5DNEA 4B71A 2F1IA 4ZOQI 3KQUA 3ORFA 1MC8A 2XDYA 1T5LA 4I55F 2WP8J 4QC2A 3FMFA 4GWLA 2DKFA 4W9NA 2VH1A 3B6MA 1JG3A 3MWEB 1X38A 3NEYA 3FR7A 3UAOA 4OO3A 3ZH9B 5IS2A 5CNJA 4F5ZA 1ODJA 3N8IA 3E58A 4IQFA 3TQFA 1BKSB 1YONA 3BA1A 4NJMB 3THRA 5L4NA 4ZU3A 3P8ZA 4DC1A 4AP6A 1VCIA 2NXNA 4QDTA 1KZ4A 5B7QA 1ZMRA 1BVHA 1IU9A 4GX1A 3GAZA 3SEAA 3U4DA 2XZPA 1FQWA 2AFHB 1EZ1A 1QR6A 1USKA 1V25A 2PKQP 3TFQA 1K1EA 4U8HA 4FFPA 4CYMA 1VI5A 1FRQA 4BO4A 1ZFNA 1I1HA 3TXAA 3NHWA 2SBTA 4IHKA 2A0XA 2OXEA 4HX2A 1F12A 2FUG1 3L18A 4QPNA 1U0EA 1HE5A 2HMTA 3TB6A 4N4AA 4LZJA 3VC2A 3CR7A 1W87A 2WAOA 1PSZA 2YZ7A 4YMGA 4Y7DA 3AHJA 2NT4A 3Q85A 1EAMA 2CK3D 1ISJA 2PD3A 3DA8A 3WSTA 4C4OA 4RTPA 1M3SA 4EENA 1J33A 2VSFA 5BV8A 2R8XA 5FXMA 1RM3A 1V4VA 4M99A 5M3BA 4YAGA 2R6AA 1E66A 2J3JA 2J7KA 1AKNA 3W3AD 1DKOA 1PTJC 1Q91A 1YJCA 4TYWA 1GQ2A 5GVSA 3Q3CA 1R3DA 3SOPA 3GLVA 2A9PA 4IDFA 1SQFA 3WDKA 5DNDA 2IYUA 2OWDA 4N47A 3TB4A 4EAAA 1AN0A 1YVUA 3EMBA 1YFLA 5TVGA 1CVIA 1WXXA 4XH9B 3AVVA 4PAMA 2XUPA 3F8SA 4PHGA 1ES9A 5FA5A 3R7AA 1OMOA 3AXSA 3L3BA 4QM6A 4NLLA 3VH3A 4X66B 1Q6ZA 3A6FA 3GZJA 3GG2A 4E4YA 4ZVSA 3CT4A 4XUGB 4RVDA 4FKZA 4K9NA 3ASUA 4WVLA 1WB4A 4LF5B 1H4QA 3UW3A 1PFYA 1RP1A 4U8GA 4Y2VA 4G1MB 4S2UA 1LLFA 3MBKA 3A3PA 3WL5A 4EW2A 4XEHA 3DSRA 2A5DA 3EDMA 2ZT5A 1JA1A 1NF9A 3KETA 4PLVA 1WZCA 1M5TA 4EJFA 1SPXA 1SUEA 3CNHA 2HU5A 3NKLA 1JEQB 5K8IA 1AM4D 1R8SA 2WU1A 4OEHA 1NI5A 3AIIA 3AFNA 2MSEB 3RSZA 2O8EB 4HWOA 3CH5A 3KNZA 4HQNA 3I2KA 2X0IA 4AQDA 1FP7A 3IXMA 1MZVA 3ZX4A 4QO7A 4XAQA 3HUFA 4H7KA 2OGZA 4YLGA 3K9QO 4G41A 1R9JA 4BFVA 1NASA 4G2TA 4MMZB 4PX3A 1DKMA 3N0WA 4RPCA 4CL0A 3KSUA 2DY1A 1XRLA 1LQUA 4L4RA 4OXIA 5FOWA 3LQQA 4HPJB 1NRXA 1WEHA 4I14A 1FVHA 4QUDA 1RC8A 2FPPA 2IYNA 1LPBB 1WUTA 5LDGA 1BDIA 1IXZA 1B0AA 4MRAA 4TTJA 4FIDA 4Z0HO 4C4TA 1NKVA 2FW9A 4D4IA 2MWMA 3NU1A 1DAGA 4C0AC 2ORVA 1JFFB 3DBHB 5JAHA 4RW0A 1FPQA 4PZLA 4C3VA 1PDOA 2A58A 1IZ0A 3I4FA 2CKDA 1DPGA 1NIPA 3JD3A 3PDUA 4M0MA 3UWMA 1XD8A 2JIZD 2HIMA 4GEGA 4PZAA 3B52X 2QF7A 3MJVA 4RU1A 5LA6B 5H3CA 3UWOA 5FUMA 4KI0A 1K7FB 4R54A 3ZQ4A 4EFLA 2HGSA 2BSQA 1E3SA 4QGBA 2E82A 1MA0A 1QQBA 1I80A 1JQJC 5ALWA 2ZQ5A 3TZQA 1D4FA 5EJAA 4JLWA 4IYRA 4YT2A 1DE0A 1E79A 1RM4A 2R86A 2XNSA 3BD6A 3O8QB 5FIUA 2CLMB 1GAWA 3DAFA 1NVXQ 1P75A 1R64A 2YL2A 3L8DA 1ZKDA 4QXPA 2FFJA 1TGYA 2E5WA 4M9QA 4O2AF 3TD2A 2X0NA 1AKUA 2BM9A 2YWCA 5EXSA 3T5BA 4WXPA 3L0ZA 2XNJA 4RE5A 5CCDA 2A14A 1Y6QA 1GG5A 3SXUA 2CJWB 3E18A 1U6KA 3K0AB 2XW6A 3F6CA 2D1FA 5EL0A 1GV1A 3GT4A 4BASA 1H6DA 3LWBA 2XUJA 5MHTA 2GHTA 3UICA 5HBRA 3WNCA 4LZOA 1ODFA 4G8DA 1ZJ6A 4AIRA 2ZJFA 3F5MA 4A7PA 3UA4A 4CKBB 3AUXA 1YA8A 3MAJA 2YVAA 3MVEA 2XUOA 3QP9A 3IRVA 4EB3A 2B4AA 1TYZA 2G5GX 1QP4A 5JECA 4FFLA 1S4MA 1U65A 3LUJA 4HY3A 4KPUB 3G17A 4AZ0B 5F2KA 2Z5LA 2J3LA 4M8SA 1HY3A 3RLFA 1J09A 2XWQA 4FINA 4CIDA 4GKJB 3DFKA 3PHLA 1BS2A 4KWHA 4F4JA 1H2RS 3L8ZA 3P2IA 2JK0A 1XUOA 2G9ZA 1XTZA 3C6XA 3MC1A 5ESWA 3TW0A 4MVJA 4Y6RA 3I9NA 1HLGA 1QZTA 2OV2A 3G8YA 3DD1A 3K96A 1ZZEA 5EP4A 3C6YA 2XWSA 5DP2A 3K71B 1SVMA 1N7GA 3UH0A 3WBFA 1Z0AA 5C80A 3QJYA 2Q6KA 4MARA 1COWA 4AY3A 1HSOA 4YJ2A 3FMIA 3LCUA 4C5BA 4XOIA 4H4CA 2OPHA 4DUZB 2P4EA 3BGDA 4GVXA 5ETJA 4OUKX 2VTBA 4FZ3A 2Z5GA 1DDGA 4MZDA 1GZSA 5TMEA 4B09A 2H4JA 2D62A 3GVXA 2FLKA 2BKVA 1TA4A 3UMJA 4D9IA 1C1XB 2UVQA 3FI9A 3ADDA 5LN1A 1XPUA 3HK2A 3PHIA 2Z09A 4GSLA 5CXSA 3IULA 1UL1X 4FDVA 4B5KA 5IEBA 3R44A 3EIWA 4BE7B 1R7RA 2HNAA 5B3KA 1U8AA 3I39X 3S7ZA 5AO9A 1JKMA 2WNSA 4WJKB 2OHHA 1C2TA 2WYHA 1E2NA 4LJLA 1WM1A 3E3AA 1RKBA 2YN2A 4ZO9A 5GZ3A 1PFKA 3LGXA 1SXGA 3UG6A 1GAJA 2WHYA 2ZI3A 4OGKA 4DA9A 2RGYA 3RT7A 4DG5A 4D5EA 4AURA 2A9JA 5AKKA 4BKOA 3O2SB 4N48A 3GF4A 3KEGA 4E5UA 1N1DA 1SC1A 1W85B 2P69A 3L02A 2ECKA 2IQIA 4A5SA 3A1UA 4RO0A 3G7SA 4HZUB 1G6HA 2CSUA 2I76A 2PLFA 3BJEA 4JYZA 4MYUA 2PUEA 2N1MA 2YC4C 1NE7A 1F4PA 1SGWA 3CINA 1NN1A 2AN3A 2EJWA 3MJHA 1MXFA 4ID9A 3H8SA 3P4UA 4V1CA 2PMEA 1ORHA 4ZEVA 1Z75A 3BGOS 3TUJC 4HDCA 3RC7A 2RBEA 5E9WA 2NUAA 4DQ0A 3R3WA 3GRFA 4YR7A 4CUJA 2QUJA 4MKFA 1I9GA 1SXJC 1DEXA 1PUIA 2BOVA 1GZ3A 4O4HF 5K3SA 3RUEA 3E8MA 2OD9A 2EGUA 2XB6A 4WGGA 3T06B 1NU8A 1PE0A 4TLEA 3KJNA 4FQ8A 5DSXA 5L95A 4A26A 1H6AA 4FGJA 4O8ZA 3WNVA 1FZTA 2RGUA 4WK6A 1QXSA 3H99A 5E8RA 2FEPA 4KRGA 5JBIA 3RC3A 2JZNA 3SM3A 1Q7EA 1H65A 4K9QA 2BVNA 3UPDA 5IANA 3GRRA 4UNQA 1OFGA 4RV5A 3TNJA 2GN2A 2I7VA 1EQ2A 2E6UX 1GNPA 2SKCA 2ZDGA 4I5GA 5ALLA 2BDEA 1E1RD 1GZ4A 1RC0A 1VMEA 2QR2A 1N92A 1UMDA 3WGYA 5FUQA 1YR9A 3ITDA 3C3AA 1L4FA 2FI1A 1CF2O 3ZIUA 1WDLA 1ZGGA 5TQ2B 4N5NA 5KOJA 1YZTA 5JPCA 2FZKA 3FRIA 1A9QA 3JPWA 4N0QA 3VR6D 4XYGA 4UBOA 4LHSA 3F98A 3QFFA 1W8DA 3CU5A 4WERA 1H4VB 5FNZA 4CMHA 1I3CA 2C77A 3OCCA 4AUMA 1GFSA 3ZGNA 1UBEA 5BVHA 2YRXA 3G8DA 3LQKA 3RF6A 5E7QA 3FYDA 2C4TA 4I1IA 1I10A 1Q19A 5LZ7A 3VYVA 1Z06A 3CO0S 4WY5A 5EZSA 5BN5A 2HV8A 3H9CA 3V34A 3BMXA 1ZSYA 2I3GA 3EQ9A 1NI4A 3LK7A 4FGKA 4MNTA 1N5DA 4MUHA 5GM1A 5B7GA 1M9NA 1WD5A 4IUYA 5ALEA 2D7CA 5D3KA 3Q8MA 2HHAA 4IH1A 2DLCX 1N2JA 3OF2A 2WG2A 1VJCA 5JJBA 4JDUA 5DOVA 3U3OA 2YY6A 3VR3A 2WSMA 3VHXB 4EG8A 2Z43A 3EY9A 3HKDA 2B34A 3PKJA 2Z9DA 3IOBA 3RRNA 1HQKA 1QV7A 3UC5A 3FZGA 2H7CA 5F64A 2C57A 4P54A 4YQEA 5DGTA 4A0SA 4C05A 1QFZA 5HM6A 3H5WA 4UUAA 2NLOA 3FUWA 3M2TA 4B6FA 4GRIA 1E0SA 1POWA 4OQYA 1QBGA 1XG5A 4YRJA 2GN8A 3D3QA 5JNTA 3HUUA 2WJIA 4R3UC 1NJSA 1VSUA 1CE8B 4JXJA 4YQYA 2EJTA 2ZULA 4MEAA 2J0UA 3ETEA 4IMIB 4Q9LA 1EVEA 3CVVA 1NN3A 4MLZA 2C42A 4BNJA 5HCNA 2OEPA 4DANA 1KWKA 4FWIB 4AJ2A 3FA2A 2PUWA 4CM8B 4R8KA 5IDYA 5E6RA 5M7EA 3ZZTA 3JATA 3GNQA 5FI3A 2QD1A 5D7BA 4U7FA 4ZA2A 4ZCPA 1GGHA 4CV2A 4CVNA 4RL6A 2BMAA 3K7EA 1YCGA 3SBDA 3HC7A 3NC4A 5ALVA 2BKAA 3ZDZB 4NZPA 5BNZA 2F6RA 1JZSA 2WE8A 4XKJA 3Q10A 1KPIA 1FFSA 2BDTA 1B2RA 2BONA 2PEZA 1N5RA 1BVRA 5KTKA 4NU6A 1OBOA 3CS3A 2F64A 1OBCA 1PD0A 2IRWA 3I23A 2DQSA 2ZQZA 3BORA 3IMGA 3PFIA 4MWCA 1V6CA 3DCYA 1JX6A 5E4TA 3B70A 4BP3A 4CMGA 5JJ5A 1JR3E 3OOHA 1JAYA 3KB1A 4E2YA 4C7BA 5AK6A 4PYMA 1Y5MA 4F3RA 5B57C 2Q45A 1Z2PX 1DSSG 2UVPA 4ISCA 3BXEA 1Z83A 4HWSA 3LXXA 3U1VA 4QVGA 3F7NA 3F6EX 3T52A 5HXAA 1YVEI 3FKSA 2MIIA 1ZGBA 1A8IA 1SXHA 2LWIA 1A5SB 1IHOA 4JC5A 4KHZA 4UQOA 3RC9A 5CLLA 4YRKA 4TSRA 2WQ6A 1JS1X 1ECBA 4MQEB 3NXSA 4OJMX 3QMWA 1Z4LA 1L5HA 3VNBA 3KL2A 2YQZA 1FEZA 3PDJA 4UU1A 3IJ5A 3TTXA 4PNPA 1T15A 3R3SA 4UXHA 1QS0B 1QV9A 1L7MA 2CFIA 1L3BA 3ZBUA 3KKZA 3ZN2A 5AFSA 5AVYA 1RC1A 5K0ZA 4UZEA 5L4LA 4JZKA 3ZY5A 4KR7A 4OI0A 7REQB 1FDUA 4NS4A 4XGKA 5ARBA 1ILWA 3STWA 1E5TA 2AFHE 1B15A 3TQTA 3WAKA 3HKCB 1UADA 2VT7A 1GVHA 2WVGA 2XA2A 3NVMB 4Q48A 3TZBA 5CIYA 4FGWA 2D59A 1E79D 1QIHA 2WWHA 1F3OA 1BHJA 3I45A 4DAOA 4ZK2A 5BWCA 3WKDA 4GPTA 3WFZA 4EGJA 5G0VA 3GBSA 1KDPA 4JLJA 2GD0A 2UUBB 3G5TA 2FMXA 2IDKA 4JL8A 1HNWB 5HDQA 2N1BA 1YTLA 4P33A 4JOBA 3ZV4A 3SYTA 3F7MA 4ZEXA 2CF5A 4HOYA 3QX9A 3GLSA 1SELA 5AK4A 5LXTF 4BX0A 1Z07A 3K05A 3K0EA 2JBHA 2VBFA 4WLNA 5JXWA 5EP3A 5JQWA 3DTNA 4ARVA 1X7GA 4NU0A 2Z4TA 4ILKA 2HLDD 4N5LA 3WNZA 1H3NA 1GAXA 4O2BA 2OHFA 2CDBA 1VJTA 2V7PA 2VK2A 3KUDA 4HLUC 4IIEA 4PX9A 4HVCA 2Z9BA 2QAIA 1W4AA 2GK3A 1UJCA 3IMFA 2JFUA 4Z9FA 4GXRA 5ALDA 1IN1A 2QVCA 5JANA 3GEPA 1T10A 1N9GA 2E49A 4WNCA 4TOIA 2GQ0A 4AUKA 3DW1X 1E77A 1GFIA 2FX3A 5IJXA 4DLZA 5IZCC 1XJCA 2OBNA 2OOKA 1NBIA 3MTJA 1CHNA 3OBIA 2A0YA 3H9UA 2J9FB 4WKPA 3TLGB 3U37A 4LX8A 2Y67A 2OWEA 3QE9Y 3G1UA 4MVJD 3PEYA 4GPBA 3BHNA 4QDZA 1GT6A 1T9CA 2VJCA 3ANTA 1PAUA 3PUKA 4RE6A 1SA0A 2F4NA 1AKMA 4OP1A 1R0KA 3WBKA 3WWOA 4TS3A 2ONYA 2O3JA 5A2GA 4NX2A 3CKMA 1T0IA 1GNRA 3L6RA 4H7PA 2JGDB 1NXXA 1OTYA 4MW9A 1I94B 1DVRA 1MLDA 4UPDA 1X9IA 3L8GA 3B51X 1FOEB 3DZ8A 3LKVA 5JALA 4BE9A 2MTBA 2BGTA 2PTGA 3DCJA 3B20A 1E4OA 1N5KA 3O4IA 3SQDA 3TO5A 5DX1A 1RQGA 4N54A 5HRUA 5H0IA 2R1UA 1Z6TA 2D3TA 2WJGA 4NEQA 1G0OA 2PGOA 4P08A 5AIAA 5DNCA 1DP4A 2YJ4A 1MABB 5FNVF 2B8NA 4DT1B 4R51A 2A5GA 3H5NA 4MQBA 1MXHA 2OCGA 4QOSA 4HN9A 3O92A 1PK8A 5NLLA 5MGNA 1AF4A 4KAXA 2O19A 3BSWA 1ZLYA 2QLMA 5IDQA 2FDXA 2I4LA 4CU5A 1X92A 3PFNA 4C4XA 4ECEA 2C5FA 4INZA 2CEAA 3VPGA 2H17A 4TGLA 1DIRA 1GRNA 1SWWA 4A1FA 1U0SY 1O97D 1THMA 4B7ZA 1U8UA 2FN4A 2XGGA 3RFFA 1P2TA 1TK3A 1TF7A 4UKDA 4L8LA 1GQOA 2FEXA 2PSEA 2MSWA 1KAQA 4V0QA 5JSZA 3R9XA 1NJFA 4FVTA 3VM6A 2IHZA 4YBZA 1IHPA 1L4KA 2Q6VA 4QU8A 1YDHA 1BOFA 2XHZA 1O95A 1QP8A 1NSFA 5BUCA 3UK0A 1CRZA 1ULUA 1XZEA 1MQ9A 4MKRA 4D92A 2WHRA 3FUTA 4Q05A 1RKXA 5JSUA 1MG5A 1XXHB 1E9CA 4ZOAA 2G1JA 4Z99A 4U7JA 3SM9A 1RAGA 1S5PA 2Q3CA 2Y1KA 3FZNA 2J5QA 2CMDA 2PL1A 2AOXA 2LUOA 1HRDA 1CXZA 2P62A 3QVSA 4G1BA 1G8YA 1Y8CA 1EKXA 3Q0EA 3RG2A 4HD8A 1KI6B 3KTAA 3BE5A 3B1WA 3P4XA 4YJKA 4RWEA 2DPYA 3TTTA 4XGRA 4BRUA 4EYOA 2UKDA 1Z18A 4LUCA 3RFUA 3ZKWB 1GL6A 4TV9F 3FFBA 2QD5A 1DG9A 1JXOA 1JIVA 1KY2A 1ZOPA 3QBJA 1DJMA 2AMFA 5G4LA 1R6UA 3VX3A 4GE0A 4RVOA 4CQLB 2H9IA 2QRVA 3F74A 5FTNA 4UEQA 4JENA 1W9MA 4NOKA 2X77A 1U4OA 2WKRA 4X60A 1GCUA 3E7FA 1GTMA 2GM3A 1BXRA 2B36A 2PMWB 4YA6A 2EFYA 1EWTA 3G0IA 3V42A 1ZP6A 4DF3A 2XB4A 1IBCA 2Q8NA 3RJTA 5I51A 1FU7A 1T6XA 1DQPA 2O20A 2FP4B 4V24A 1QMGA 3CNEA 3FDJA 2IPAB 1Y8QB 2VWHA 4LCEA 4TLCA 5CDFE 3N2YA 5GV8A 4YAEA 5EKTA 3ZXUB 2OAQ1 4RANA 3ZZNA 4CTMA 5IH7A 1M1XB 2OO5A 3DT6A 1FX1A 3EW9A 4Q16A 5J2UB 2PRKA 4IVRA 1WPXA 2P6NA 4KQFA 4KODA 4OHVA 4CLEA 5HWSA 2JS7A 3DLIA 1EG7A 1EAYA 2X6TA 1KR5A 2QTWB 3EIXA 1HI9A 2B1GA 5ESDA 3VR4A 1DADA 3IXLA 5B7NA 2FE1A 2XMDA 1NDHA 4H7IA 4AYWA 2SECE 5AD1A 2GTPA 3RV4A 2IYEA 1P1RA 2IFTA 2J59A 3TZCA 1KC1A 1LDYA 2C9YA 4H18A 4KYTA 3N6VA 1LQTA 1T8TA 4BE4A 4JEIA 4NU5A 3VR3D 4AP9A 2AZ4A 4CM6A 1C4XA 2VO1A 3IP6A 3A9WA 3BXOA 5HMMA 1UZAA 4L1KA 3K5WA 1GCAA 1ESZA 2GILA 3NCTA 3SXUB 2RKOA 5A5GA 3AFIA 1H93A 2PNJA 3JAKA 1XP5A 1KBZA 2YASA 3FPFA 1Q3KA 1K6IA 1YQEA 4FC7A 2MJLA 1NAIA 2AG5A 2AG6A 5KKCA 2J30A 3DVQX 3KUKA 1DL5A 4KH1A 4HX5A 3VYRB 6LDHA 5EESA 3NXKA 3LUKA 4CKWA 3HDJA 3QELA 3DE5X 1NMSA 1E1QA 4CR8A 1JJIA 3WX0A 3TSAA 3PF8A 1XU4A 4Y98A 3VV3A 4ZQBA 2PAAA 5BXYA 2NU7A 1U0FA 4HXYA 4X6LA 1SCAA 5DEOA 3R9KA 1D2HA 4KIJA 2K5UA 1HQYE 1TGVA 3EOBI 2O6HA 1WXQA 4DM7A 3VR1A 3IEKA 4L7VA 1MP0A 3CUUA 4MGHA 5P21A 4DKXA 3PJRA 3GLRA 2W6MA 5FX2A 2VQDA 2XYVA 3VOSA 4KAJA 1AH2A 4HNSA 5TT0A 1PJ3A 2JH8A 5LB4A 3G0DA 1UPTA 1XELA 2QN3A 2GS9A 2V7TA 3L7YA 5COAA 1J39A 1L7RA 1L4LA 2QK4A 1G5PA 3LF1A 1T9AA 1M8FA 1L4GA 4J1TC 3B38A 3EF3A 4DR1B 5I9MA 4LKRA 1HPLA 1KSFX 1KRXA 5C7LO 1HDRA 1NVKA 3IPAA 1PFWA 1ONSA 2RIPA 4KJZA 2VH5R 2O8BB 2CL7X 4AIIA 1N7JA 4AG5A 1YB2A 3FKSD 1V9SA 2IHKA 3RBAA 1NXTA 1SIBE 4RPKA 2WB2A 2ZROA 3I92A 1M2NA 4I8XA 3L05A 3PC6A 4JJZA 1V5GA 4W82A 3VBCA 5JQGA 3PG5A 1G8GA 4HHEA 5KO2A 5HEKA 2ISQA 2RD2A 1AKRA 4ZGBA 3L8EA 3K15A 1XQYA 5IYZB 1MNAA 1U4SA 2ECFA 2JI7A 4NPHA 1PO7A 4TLLB 2Q7DA 4OAOA 4ZCRA 3A27A 3OE4A 4AYXA 4XRGA 2ZRDA 4ZPXA 1YDMA 2I1VB 4X41A 4ZAZA 5LP6C 1WMDA 3TLBA 2Z6UA 4KK4A 1BQ3A 1QQTA 3CWCA 1LPAB 3EMDA 4ZDWA 3TZKA 3DPUA 5H59A 4BLTA 2W6NA 4AICA 3LL7A 1YDFA 4AN0A 2BMEA 4LXHA 5F7ZA 3NI2A 3ZHUA 2JLYA 1A8QA 3U48A 5IFKA 1Y1RA 4C88A 1JYEA 2C54A 4TMFA 2R1TB 8AT1A 3IAHA 2W2OA 1VJRA 2CYBA 2W6OA 4FHDA 1Y1QA 4IGAA 1NC3A 5DBGA 4G5HA 3RIXA 3TI7A 4ZZ0A 2DBRA 3V4RA 4NENB 2CV2A 3AM4A 2QVZX 3RAPR 1KRWA 4N1AA 5HK8A 5A6VA 2FN8A 4LNHA 2JGNA 3K09A 4JBIA 2AJDA 3K5PA 1GRQA 3PUZA 1V8PA 1OR8A 2NUAB 3WTBA 3L06A 1G291 3EUFA 3E0QA 3QHPA 4RSRA 3JTMA 4UD6A 4PBTA 3FWKA 2WAMA 3UJ9A 4FKBA 2QROA 1BRMA 1EK6A 3CW8X 3S70A 3D3NA 3NO4A 3SVTA 2QM0A 1L1RA 2OG2A 2ZI9A 1JG6A 2ZW9A 3KL4A 5EZYB 1I1QB 3UT0A 1YQ9A 1RR6A 1TLFA 1E63A 1GNQA 1NMEA 4MYDA 1ZVJA 5FFFA 5GGXA 4JGIA 2WU3A 4K9DA 4WNIA 3AXTA 2J7PA 3GEMA 2I6GA 4DSOA 1UAGA 3DXXA 1KWGA 2VZ9A 2NXEA 3QNUA 3EQ6A 4RABA 1K75A 2IXTA 4G1VA 3S2EA 4BNUA 2DR3A 5DTMA 3ZE0B 1UXIA 1KVRA 1I3NA 1GYQA 1UMDB 1X8LA 4EL0A 4CKCB 3B82A 2XF2A 2V0NA 1LQ2A 4CLRB 2Q2OA 3JARA 1KHTA 4J2OA 4BO0A 4ROSA 2EJVA 1Q7BA 2B4KA 3DHYA 3UOAB 1FUYB 4HDRA 4AMGA 4C78A 2E55A 2BRUC 2ZXUA 4KNVA 3W78A 3QXSA 3KD2A 3NHAA 3AV0B 2JLQA 4Q1DA 1E9FA 4PYKA 3NCHA 2IUFA 1CQIA 3R6LA 3ZCUA 4BB5A 3C87A 4DPKA 5JTUA 3IA7A 2NSLA 3FUXA 3QBEA 5DM60 1JVBA 5AH0A 1Q50A 4P82A 2FSFA 2CVZA 3D0QA 4IQ4A 4DCMA 2Y4OA 1C0EA 4B48A 4G56A 4D6YA 4F5WA 2PO5A 2JAHA 2C7OA 3O8NA 3A6KA 4YO7A 5FEMA 4Z54A 2C4WA 5G4KB 1KO1A 1Z28A 4INPA 2Y93A 1Y1KE 1Y7PA 3PF9A 4OYLA 3AI3A 4HQFA 2B2NA 2WJZB 5AKHA 2XTJA 2YOFA 2DTXA 5DWVA 4OQQA 5HUJA 1BKYA 2YC2C 4IRUB 4L3WA 4IAOA 5HZKA 1NFFA 1E7YA 1V7CA 3NC0C 4R4JA 4OBWA 2Q3DA 4BP9A 3T34A 4CEHB 1V2HE 3PXCX 3OCVA 4TM7A 2YFQA 1FSFA 5CPFA 3WLPA 5IKPA 3KYCA 1GPH1 4YPOA 3A58B 3HYTA 1SC9A 4QO8A 3OC0A 1RBZA 1O95D 1WXDA 5ADWA 4D3FA 2ZPUA 3P0JA 2ZXFA 4EG0A 4RK4A 3AF4A 2AG0A 4LTMA 4AUEA 1O87A 4C5CA 4EB6B 2CXHA 4CTNA 1T8SA 2FHSA 2XADA 3DMTA 3G85A 4NNJA 1KBOA 4YDRA 4BL5A 3EXFA 2GNPA 4I46A 1VE3A 4MR9B 5FLYA 5INTA 3E5MA 5H4GA 2OLJA 5I7WA 2CVQA 1NU6A 2D2VA 1GPKA 2ZRPA 3P2MA 4LCBA 4UDXX 5DTEA 5B1HA 3VDNB 5JAMA 1B8OA 4PFQA 1N0WA 1ZSVA 5H81A 3GA7A 5LA6F 5LMUB 4RTQA 1G21A 2EKLA 4MQUA 4ZQIA 3ENVA 4RTJA 3UY4A 4FYIA 1U8TA 4BLUA 4F8YA 2FSGA 3MGAA 4X8LA 5THXA 3RREA 3W5JA 2CUZA 3SZGA 3EPKA 2Z1NA 3OO1A 1INLA 5D7NA 1Q14A 5ICEA 4RMNA 2A7XA 1LFDB 4AX8A 3D4OA 2FN3A 2CCGA 4JKOA 3T3NA 1N0IA 3R4CA 1JDBB 5AW1A 1GA6A 4LXUA 2J9YB 3CKLA 2GA8A 3HJAA 3KQOA 1UK6A 2W4IA 2BJWA 2YZ2A 3KXPA 4ERXA 5HYVA 1E92A 3GAFA 4GKAA 3TPZA 2I0FA 3L8FA 1S2GA 1M2EA 1UPXA 3U6BA 3EEOA 2G80A 1XDZA 3FLMA 3QENA 3P7MA 2G9UA 1Z4IA 2UUAB 2V7WA 3OZSA 4CFYA 1ZVKA 1J00A 1M7BA 3LFUA 4XJSA 4H35A 1BFKA 3HL0A 3U7QB 3V9PA 3ZLVA 2X6QA 4RDIA 5DBOA 4D74A 3SQOA 3ESZA 1FP4A 1YFZA 1V11A 1DARA 4IIHA 4GHWA 4L0CA 4MWTA 2VT6A 2HC9A 2PKYX 4WZBA 3WSWA 1EUCA 5DEIA 4RGQA 5A7GA 3FPLA 1RMQA 1DRJA 1JILA 4MJ7A 3VR4D 1X7ZB 3IT2A 4OGWA 4BLQA 4YMUA 2WKWA 2PO7A 3O4FA 1SM4A 2RJNA 2IVFA 4PLTA 3DTVA 2OKGA 1GPMA 1ZGJA 1ZW1A 5BR1A 2WZBA 2J31A 1V43A 1N36B 3K0FB 2P9QA 4MLPA 1R6DA 4ALNA 4WUTA 1Q0RA 1CULC 3D59A 3ZJ5A 3SHOA 2EJUA 3P9CA 2BL4A 4PEVA 3H05A 4KO2S 4JL6A 4X5OA 2BGUA 2IC5A 3MWYW 1VJ0A 2Y71A 1F14A 3QEMA 4IMRA 4RD3A 1ZIOA 3PHCA 1FP2A 2JHAA 3CRQA 2NG1A 1KMMA 3K4QA 3NONA 4RZXA 4U6SA 1RXEA 4CQMD 1HYBA 2DH5A 1VLJA 4AJKA 4NBRA 1VE9A 2GHQA 2GFQA 2KQUA 2VL7A 4W9NC 5AHKA 1YBMA 1SQSA 1ULZA 3H18A 4IKOA 4JWTA 2DSNA 3HM2A 2C1EA 2IXEA 2WKSA 1RIIA 2QRJA 2GJSA 3ACCA 2AF4C 4K3VA 3AJEA 3ABIA 2V4UA 1ELOA 1UJ5A 1UDBA 1KO5A 2I22A 2ACEA 4ZP1A 3TNLA 3WRWA 2Z2YA 2AVNA 3WYAA 3RSGA 4TRRA 2AOTB 1E0DA 2L18A 2WUVA 3DXFA 5CEJA 3O4GA 2YFKA 2G0TA 3C1OA 1F7VA 1B16A 3UPUA 1GQRA 4Q4HB 1TAGA 3NBMA 4RZUA 1HYHA 1XYGA 3IV6A 1GFWA 1TW2A 3ELDA 4J0HA 5JD5A 2H0RA 2W4QA 4PONA 1BGWA 1LRJA 3PD0A 3JQ8B 1L3CA 5C37A 2GAIA 1YWGO 2PX6A 4FD3A 5ERGB 1Y9EA 1QIFA 3A05A 1PNRA 4KREA 5I3ZA 4FX2A 4TMYA 2W90A 3A1DA 3FWZA 4NF2A 5DMXA 4ZYVA 4HQKA 2Q6OA 5TVKA 3ANLA 2QGZA 4YRLA 4AZTA 1GCIA 1PKXA 1Y0BA 4KWTA 2QPOA 3C6ZA 2QORA 1XEWX 4AC9A 3G2JA 4ZJPA 4JBWA 3RRMA 2NPOA 4E11A 1WSBA 4MWDA 3INYA 1Q1NA 2C59A 5G1PA 4BFCA 2DAPA 2X4IA 3A0UA 1AUPA 3ED1A 2ZUBA 1QUEA 3K2EA 3WWDA 1YL7A 4LG1A 2N3ZA 2WRZA 4KK3A 5BOSA 4LOJA 1DWQA 3PIIA 2ERXA 3TOSA 3V4FA 3BICA 2J41A 3N0RA 3ZBTA 1Z63A 1RFLA 1I01A 4RHXA 3RVKA 2VP6A 3G0OA 4CF7A 1G63A 1CKEA 3F5DA 3T7DA 4RLFA 1UKCA 2AFVA 3F6RA 3ZW9A 1E3LA 1RIFA 4BMOB 1R15A 1QTNA 1Z56C 1XZ8A 1IWPB 2JJ8A 3I2GA 4LOIA 2EBWA 2E37A 2QS9A 3VJLA 1YVPA 4NCBA 3OX2A 4MP6A 1TEHA 3UC9A 3DW3X 5K5EA 2PH7A 4OKNA 1X1QA 4WOPA 4Q4AB 1UBRS 5J2TB 1YI1A 1QH1B 2EOAA