5ILOA

Crystal structure of photoreceptor dehydrogenase from drosophila melanogaster
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
265
structure length
256
Chain Sequence
HHVGTSFRGKNAVVTGGAGGIGLQVSKQLLAAGAAKVAIIDLQDNLEEFVKLRAAHPTQSVMIIKMDVANKKGVEATYEEIAKTFGNIDIVVNVAGIFNDKDVQRTLLVNLGGIINSTLSALPYMGKDNGGKGGIVVNMSSVVGLDPMFIIPVYGATKAGIINFTRCLANEKYYQRSGIKFVTVCPGATMTDMFTNFTEKIIFPETSLNKQSAADVSRCILNVLEKDKNGAVYVIEGKRVYPLEIKPQWTGKEQAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Drosophila melanogaster Retinol Dehydrogenase, a Member of the Short-Chain Dehydrogenase/Reductase Family.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Oxidoreductase
molecule keywords Photoreceptor dehydrogenase, isoform C
total genus 86
structure length 256
sequence length 265
chains with identical sequence B
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2016-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5iloA00
4ZJUA 4IJWA 4S1VA 2VWHA 3DDNA 2R2GA 2EG9A 5G0VA 4R51A 3GEDA 4NFHA 2UDPA 3WLEA 4AJEA 1O5IA 2WSBA 3K6JA 1P44A 1NXQA 1YGYA 2I66A 3OECA 3QHAA 1CETA 3KUXA 1U3WA 5DN9A 4YAJA 5IZCC 2NUAA 4QXMA 2OO5A 1GEGA 3WGZA 1CYDA 1YL7A 1ISGA 4OOFA 3I4CA 5ILGA 2C0CA 4P4NA 3PWZA 4BNJA 3TZ6A 3JQBA 3LSYA 5BNTA 3RVDA 3KOUA 5F21A 1KC3A 4EW6A 3D3WB 1SNYA 1V6AA 3RSHA 3VZSA 4BNKA 1GQYA 1EBFA 1WP4A 3RCBA 3OP4A 4BB5A 3LF2A 3UCXA 3DAPA 3H3FA 1YBMA 1EVIA 4BO6A 5FF9A 1WZIA 3NX4A 5BT9A 1UDAA 3E9QA 1C0LA 4D42A 3AOEC 3K2EA 4LSWA 1E7RA 4E2YA 2QRKA 4AJPA 4ESOA 1NPTO 2HMUA 4CR8A 4WCDA 4EUHA 5GZ1A 4N18A 2Q2WA 3AK4A 1YOVB 3PHGA 3TF5A 3Q11A 1EBUA 3LT2A 1LDBA 4FOSA 3PQEA 5JE8A 5TNXA 3OA2A 4XRRA 3D4PA 1VM6A 3PPIA 3P5SA 5C5IA 3CMMA 2Q4EA 1Z73A 2AE2A 4Z6KA 1VC2A 2PA3A 1U2DA 4NQZA 2AG5A 3GEGA 2BFPA 4JN6B 4J0EA 4DPKA 4RF2A 3WFJA 3INRA 2YDXA 4HV4A 2V6FA 4UULA 4IMPA 4KMSA 4LGVA 4BNZA 5JAIA 1H2HA 4K26A 1K2WA 3TSCA 1T1SA 5DBGA 4KP7A 3OEWA 2GRAA 4NG5A 4MVJD 5FFFA 1NWCA 2W98A 2JHGA 1UXJA 2QX7A 4PLVA 3KSZO 3VOSA 1IZ0A 3SVTA 1KOLA 1EVZA 4OH1A 3KXDA 4AVYA 3BZUA 3ZWXA 1C1XB 1W6UA 3PHJA 1U5CA 4LCJA 4BO4A 4ZQBA 2GZ3A 4GMGA 2JJYA 3TFQA 4FN4A 2SCUA 3BTVA 5KJEA 2Q1TA 3JQ7B 4Z9YA 2GASA 2I76A 4YJHA 2I6TA 1XCBA 2Q46A 4LW8A 1JQBA 4FFRA 5COBA 1X1TA 1DLJA 4MOWA 1Y5MA 3OJ0A 4BQPA 4CPDA 4QQRA 4YR9A 1SEPA 1YB1A 1HT0A 1CF2O 2IZ0A 3IQDB 2HK9A 1I24A 1OAAA 1SEVA 3G49A 4BNVA 4MVJP 1NNUA 3GUYA 3CZRA 2RCYA 3PYXA 3DTYA 1Y8RB 4OGWA 1PJ3A 3QVTA 1EK5A 1E7WA 4DPLA 4GLLA 5BSHA 3OJEA 4BNUA 1X7DA 2XXBA 3ZZNA 2X0NA 4XX0A 2BFOA 2O2SA 2NV6A 1T4DA 3GRPA 4TSKA 3VC7A 3GC6A 5C37A 5ILOA 4WCFB 2X5OA 4WLNA 1N92A 3QVSA 4E0BA 5JY6A 4NBRA 2FP4A 1C0PA 2HRZA 2GZ2A 1C0IA 4CM7A 3KLPX 5G0WA 4Y98A 2IZZA 3U3XA 3S1LA 3BHIA 1ADCA 2ZTLA 3W1VA 4ALNA 4BVAA 5I7EA 5T57A 1T2CA 3IP1A 1RJWA 3PLNA 3D4NA 2PD3A 2FRDA 3A28A 4MKZA 5JFOA 1H6CA 1X0VA 1NPYA 6LDHA 3EMKA 1LTHR 2OHXA 5JCJD 2VUTA 1LDGA 3WDSA 3I9MA 3GG2A 4XYBA 3V5NA 4P4GA 4U7WA 1YL6A 4PIVA 2QRJA 2ZB7A 3D3EA 1NVGA 1ISFA 1K6JA 2EGHA 2B69A 4XGIA 3S2EA 5JC8A 4J7UA 3JTMA 4U5QA 3WGGA 3PYMA 4BNLA 2BKAA 3LT4A 4UEJA 4FJ2A 3AI2A 3FWNA 5TGDA 3HDJA 1ZKMA 3C24A 4XDYA 3TL3A 1PR3A 1LRLA 4OO3A 3PFWO 1V8BA 5DNAA 4CMEA 4CM8A 2VOEA 3C7DB 3PIIA 5LDGA 1HZZA 3BMQA 3I9LA 3E03A 3KYDA 3PEFA 1YS4A 2IYPA 2NADA 4R16A 1JTVA 4CMEC 1M76A 3PVZA 4PRKA 4OYRA 1LQTA 5TX7A 4CR6A 5I9LA 3GZ4A 1KC1A 1PQPA 1QMGA 4B3HA 1H9AA 3JQ8A 3GF4A 1JKFA 2EP5A 5G0TA 5AXCA 4CMKA 4D46A 2BFMA 1FF9A 1U3UA 1QKIA 1R4MA 1V3VA 4GLOA 4BO3A 4FDAA 3BAZA 2XXJA 3JD2A 3E5MA 3BMCB 1NP3A 4IDEA 2VT2A 2JL1A 5C3MA 4QFDA 1DBVO 2PWZA 2HO5A 3R3SA 2GUGA 4J49A 3S2GA 1DIRA 4WK6A 1UDBA 3ONEA 1I3MA 2G76A 3EK2A 4KZPA 1NQ5A 3Q3CA 3ADPA 3ZGYA 1ENZA 4TKMA 3HUDA 4U0KA 5C7IO 1BW9B 5TF4A 1HDCA 4ND2A 4TRRA 4NH4A 3A1NA 3C1TA 3WS7A 2HLPA 5T64A 3WQSB 1UP4A 4FQ8A 4PCVA 5ADHA 2JD1A 3KO8A 2QZ9A 4Z0PA 3U49A 4RPKA 2YY7A 1D3AA 2LDBA 5CFZA 3D7LA 3PP8A 3B70A 1PGPA 2PGLA 2C20A 2Z1NA 4MKXA 3ZDFA 3JYNA 4NBVA 1XKQA 3VZPA 3D0OA 2IODA 1KEWA 1UUFA 3LVFO 4HFNA 3P2YA 5JLAA 5JAMA 3RKUA 3IOYA 3QQPA 4BNIA 4Y67A 1EFLA 1EMDA 4Q3CA 4YTEA 3VPHA 4BGVA 3NTRA 5AYVA 1DO8A 4IXWA 2PKQP 3GHYA 2B5VA 1H94A 2ZYAA 4NFYA 3MTGA 3T7EA 3LC2O 4FBGA 2NU8A 4IMRA 3PJGA 4C7KA 4RF3A 1B3RA 2F1KA 2X8LA 2JFHA 1MXFA 3GDFA 1N9GB 3AI3A 2RH8A 5ICMA 4FJ1A 1CWUA 1EDZA 5DBIA 2VUUA 4MVJE 3I3OA 4LVCA 1IZ9A 3HFSA 2ZB4A 3ZWAA 1I32A 1NFQA 3RD5A 2Y0EA 5THKA 1E3IA 3LYLA 3ITDA 4J7CA 4DC0A 3L77A 4BNGA 1LLDA 2W4QA 2E48A 5H83A 2CD9A 5JAZA 1A5ZA 2EKLA 4B7XA 1CEQA 1XDWA 1M66A 4Q39A 2HJRA 4D3DA 3RBZA 3K73O 1E1LA 1MC4A 3U4DA 2J5RA 2C5EA 2TMGA 3GZNB 1Y8RA 2I5PO 1ZUD1 1GTMA 4HFRA 4RCVA 3GVCA 4TQGA 3SEFA 2Y1OA 5CEFA 2CF5A 4F6CA 3TZHA 5LDHA 2B83A 1PQWA 2JCVA 1EE2A 2PK3A 4DREA 1VE9A 4AFNA 4B79A 2GD1O 1FDUA 3EYWA 1B26A 1DSSG 2Q49A 4WJZA 3SLKA 4MJLA 1HSOA 1KEVA 4WPGA 1CIVA 1P33A 1QYDA 4R5HA 5EJ2A 1O89A 3RJ9A 4E21A 5L40A 4AJ2A 1U2GA 5DT9A 5KIAA 4J1QA 4D41A 1IPFA 3EC7A 3GAFA 4FFOA 4GL4A 1JKJA 5I8ZA 2W2KA 4PRLA 1H9BA 3KSUA 4DQXA 1M6WA 4TRNA 1L1FA 3T4EA 3U4HA 2YQ4A 3UF0A 2CVOA 1YH3A 2W2KB 1ENPA 3DTTA 1PJBA 5A9RA 4LVUA 3GLQA 5A3JA 4PG5A 5KWEA 3IAHA 1I33A 1HWYA 4JIGA 3ZV4A 5U4QA 2UUPA 4QFCA 1R12A 2CSUA 2P9EA 1QSGA 3JQAA 2VRBA 3RUEA 4CLDA 3BMNB 3ZHZA 4YT4A 2PR2A 4FD3A 1ONNA 1SBYA 3GY0A 4GH5A 4JJIA 2FZWA 4GPD1 1QYXA 3EW7A 2X5KO 1LRKA 2Y1CA 1HXHA 1ML3A 5DP1A 2YHIB 3E5RA 4NR0A 1K5HA 5JDCC 2CVQA 5CDSA 3WWZA 2WYVA 2AHRA 1FK8A 5DZSA 5DCUA 1SAYA 4YYZA 3OH8A 4II3A 4C7JA 1HE5A 3BYZA 3WJ7A 2ZJ0A 4ZN6A 1QRRA 4EEZA 4YAGA 1QV6A 4IQ8A 1SZJG 5IDWA 4E2WA 3PJEA 2NTNA 5A03A 4EEXA 1R37A 2GPTA 3F46A 5KVVA 1C0KA 4RQUA 3S55A 5ER9A 3ZU2A 1GADO 4NU6A 4UUPA 1SPXA 1D1SA 5JCJA 4QX6A 4F46A 3QRWA 4XDZA 1ZH8A 4FSHA 1GZ3A 3MOIA 2QYSA 5L4SA 4BNTA 3M2PA 3PZBA 4BMNA 1NQAO 3M1LA 4TRJA 3KB6A 3TN7A 2ET6A 3O26A 3JQAB 4GX0A 4A5OA 3PDUA 3EVNA 1NR7A 4AJ1A 4CMIB 4KOAA 4OXKA 3W8FA 2GYYA 4YRBA 5JW6A 2E4AA 2OGUA 3G79A 3JD3A 4RZIA 1TEHA 4R41A 1GUYA 1ZO8A 4W99A 1NQTA 4FFNA 4RQTA 2D5AA 4FFPA 4E6PA 1U4OA 3L6OO 4Y9DA 1ZJZA 4E4YA 5CG2A 1B8VA 3GG9A 3DOOA 3OICA 2ZK7A 3HWRA 4Z3DA 4BO9A 3K9QO 1SB9A 3N58A 1SCUA 4GMFA 1VL0A 2UV8A 2DTXA 3GPIA 4G65A 4YJGA 4J9VA 1E7QA 5JPIA 1P1FA 1R16A 2YJZA 3ZV6A 3B20A 1N5DA 4MVJH 4QO7A 4EYEA 3ASUA 2RHCA 4I9NA 4E5KA 1T2DA 1F06A 5L51A 3W6UA 2NSDA 3RQSA 4OSPA 4LRSB 2G5CA 2GR9A 4L76A 2O4CA 4IZHA 1BDMA 3OIFA 5IN5A 3RC7A 2YV1A 2D5CA 1DRWA 3ASVA 4IGFA 4WASA 1KVTA 5F5LA 3WQQA 3NDRA 1ADGA 1Z6ZA 3OQBA 2D0IA 3NRCA 3H2SA 3RFTA 3WMWA 3ZHBA 3TPCA 1A7AA 1OZAA 2Y67A 4IIVA 4ZRNA 4L75A 3DZKA 1A7KA 2IE0A 3MZ0A 2VT3A 4XB1A 3K8ZA 3W6ZA 4CUKA 3ENNA 5EINA 4D0SA 5KJ1A 3RC9A 2YW9A 1E77A 4NBWA 4HY3A 2OOSA 2ZTMA 1RPNA 4I8XA 4BGIA 3IP3A 4M49A 4FGWA 1T2FA 4WNCA 3ICPA 1MGOA 1E3EA 1Y1PA 3PWSA 2VZ9A 3TZKA 4O5OA 4R4JA 3TZCA 3UAGA 3OJOA 3UHAA 1PZHA 4M55A 4DLAA 9LDBA 1WDKA 4UUOA 1C1DB 2J3JA 5TIIA 2FZEA 1EFKA 4E12A 3P7MA 2O3UA 3CINA 3F5QA 2Q1UA 1F17A 1R0KA 3KTDA 4ZQHA 3EUWA 1NFRA 1IL0A 2DPGA 1EVJA 5EQFA 3WYEA 2D59A 3JQFC 3AOEA 4X54A 5L95A 1I3NA 4B4OA 2I3GA 3S2IA 4YQYA 1XA0A 2EHDA 1RM4A 2P9GA 4MP3A 4WCFA 1XELA 1N7HA 4PZDA 4N5MA 1H2BA 2QW8A 3KETA 1CJCA 2NU7A 1F8FA 3OHSX 2DAPA 4KDEA 4EJ6A 2WM3A 1PL7A 4FCCA 4D3SA 4RZHA 2XF8A 1ORRA 3HDQA 3DAFA 4KUGA 1TT5B 3QA9A 3OIGA 4J4BA 5ITVA 1U8XX 5HS4A 4AJHA 3Q1LA 4OJNA 4ZU3A 5AXBA 3Q2KA 3DZHA 4PVDA 3EGOA 1Q0QA 4NJOA 3GVPA 3HG7A 2HKIA 1DIBA 3OSUA 4K6FA 5JSFA 5DP2A 5A4DA 1ISJA 4AG3A 1HF3A 3JQ7A 4R5MA 4ZHSA 4IQ0A 1B3BA 2A94A 3GVHA 4CMJA 1BMDA 3E9NA 5KVSA 4ZQEA 4W9NC 5IG2A 4CODB 3WIEA 5A5EA 2IZ1A 1A72A 4PLYA 1BTOA 2BHLA 2X9GA 1GZ6A 1HDZA 1TT5A 5BSFA 3RASA 1YDEA 1NR1A 4F6LA 1XU9A 1EQ2A 3F5SA 1E92A 5HWSA 4CLXA 1B14A 3AJRA 4CQMA 2PZMA 3EZLA 3HQ4O 4GSLA 4ZGWA 4NU5A 3AFMA 4DGSA 5IDQA 3CE6A 3NAQA 1XU7A 3RUIA 3KLMX 2WYWA 5TT1A 1NVTA 1UZNA 2CDBA 2Q1SA 4G81A 3KZVA 1O9BA 5EMHA 3RROA 1KY4A 3INTA 3PFFA 3KYDB 1BGVA 3G1UA 1H5QA 4UVHA 3DMTC 5EQDA 1X13A 1P1HA 2E37A 4XGKA 3H65A 1A4IA 1JAXA 4HUJA 4Z9FA 1T24A 3NTQA 3U4CA 4H15A 4YBZA 5KTKA 4OXYA 3WG9A 1LJ8A 1GDHA 2VYVD 3SX2A 4ZQFA 1GYPA 4J2OA 3W4KA 1LDEA 4M86A 1HE2A 4BNMA 2QHXA 2Y1FA 4YEDA 4FC6A 1GYRA 5JCXA 4PN3A 1UXIA 1IOLA 1T25A 1ULSA 3B6ZA 4KUHA 3PRJA 4ZA2A 1I8TA 4NNJA 2O2YA 5GZ3A 1Q7GA 4HBGA 3O38A 1PJLA 2ZJ1A 1HL3A 3BMNA 5IDYA 4BNXA 3GVXA 2P9CA 4WEOA 3RIHA 5K6AA 2H1SA 2W8ZA 3V1UA 2X7HA 4BNYA 5CDGA 4HFMA 1GY8A 1D7OA 1CERA 4QUKA 3H3JA 4QSMA 1JKIA 3CZMA 4MO2A 1DHRA 3ENKA 2BLLA 2XAAA 2H9IA 2WTBA 3AY6A 4L4RA 4IJVA 4HADA 4CQLB 1JA9A 1ONPA 3E1KA 3JYQA 3W4IA 1Q7CA 5F5NA 3HE3A 4WUVA 1EE9A 4HX5A 3QVXA 1MC5A 1KVQA 3VVCA 4EI2A 1CQIA 4E3ZA 4I5GA 2I67A 3PIDA 4CL8A 1GUZA 4TKLA 5CPBA 5DBFA 1Z7BA 3B1FA 1IULA 1QR6A 3DZGA 3ICCA 3HN2A 2P2SA 4CMCA 2JCXA 1DFGA 2AA3A 4GGPA 3PJFA 5G4KB 3VKUA 4B7CA 1JDJA 1W4ZA 1QYVA 3IIEA 2Q2QA 3M1AA 4U8GA 1E3WB 4YWJA 4GAEA 1M75A 1E0DA 1ENYA 2WE7A 2B35A 4PLHA 2CDCA 5IFLA 1E3JA 3LQFA 1JLLA 1DJNA 3IUSA 3W8EA 3DBVO 5AQ1A 2FHSA 5DDIP 3ANMA 1AE1A 5KKAA 4NJMB 1GUFA 3DO5A 5FI3A 3WBFA 5DCWA 1IHYA 2AMFA 2DTEA 4R54A 2C59A 2PH5A 2J6IA 1ZK2A 5AXDA 2X86A 4Z0HO 1NVMB 4GVLA 2ZIZA 3VPFA 4R3WA 1BVUA 1S6YA 1MG5A 4BKPA 1KIFA 2OL4A 1RWBA 4PLPA 4DQUA 4BV8A 2AEFA 4FGSA 3WXBA 5EIOA 2D3TA 4OXNA 2PFGA 2YV2A 1RKXA 4DRYA 4P8RA 1I01A 4G5HA 4NDNE 4TWRA 5JXWA 2R00A 1LLQA 4IS2A 1V3TA 4L9RA 1U9JA 2BF7A 4J91A 1LUAA 2POQX 3I5MA 3F6YA 5C7OO 3KYCB 3DBHA 3RUFA 3HB5X 3SJUA 4J3FA 3JQGA 4JJGA 3O4RA 4DWVA 4HKTA 2QYTA 2EXXA 2EEZA 3NJ8A 3NDIA 3QW2A 1QG6A 2FPIA 3KHUA 1XYGA 5CPFA 3WB9A 4DUPA 1GPJA 4UUMA 4UEOA 2OP0A 3AWDA 3ROKA 4BO2A 5IF3A 3SC6A 4Y6PA 4YXFA 3WGTA 4EJ0A 3GQVA 1O8CA 2I3AA 2H63A 5CEEA 5FWNA 1AHIA 4W7IA 3VTZA 3PQFA 2Q50A 2YUTA 4JGBA 3JD1A 4U6SA 3U4IA 1NASA 3L6EA 2IYOA 5KNLA 1W73A 1FDVA 3H8VA 4KDFA 1IE3A 3Q0EA 4ND3A 5F3RA 2GZ1A 4XEHA 2EJVA 3AM3A 4GWGA 1PZEA 2O50A 5JYDA 3DQPA 4OL9A 3DAGA 4S3MA 1U1IA 1Z7EA 1NYTA 3ZWYA 3IJPA 5A9TA 4FPXA 1SMKA 2HDHA 4D3FA 2WD8A 4BKOA 4CMHA 3FNGA 2DBQA 4JXKA 2I65A 1G1AA 3MWEB 1A4UA 4CLRA 1VKOA 1UJMA 3GGOA 2X58A 4OKNA 4E31A 3DBHB 4MVJF 1N7GA 3DZBA 1AXEA 4J4TA 1NHGA 3PDJA 2WJPA 1TA4A 1UH5A 1ZEJA 1E6WA 5B12A 3B1KA 4CLHA 1HYHA 3DHNA 3VPSA 3NT4A 5EERA 2EJWA 5L7TA 4QECA 4XJSA 4XB2A 1Z74A 3GN2A 3GDGA 3VH1A 3WOHA 1ZMTA 1I36A 3JQGB 3LDHA 5JY1A 1XQ6A 2AXQA 1OC4A 2VHZA 5TSDA 1FDSA 4AJ4A 3FD8A 3KBOA 1IB6A 4NK4A 3U62A 1PGNA 2OUIA 2PGDA 2C7GA 1U7TA 3V1YA 4PGFA 2NTVA 5A9SB 4B7UA 1MB4A 1Y8QB 1HETA 3UH1A 3WMXA 4A03A 4FB5A 4JP2A 4R01A 3ROQA 4E5NA 2ZQYA 2AG8A 3PWKA 4NMHA 2J5QA 5DULA 1XGKA 4XWYA 1WW8A 1QYWA 2AQKA 3ANLA 2JAPA 1G6KA 1WDMA 3AFNA 5LC1A 1ADBA 1ZK1A 4BL5A 1SOWA 1J0XO 5COQA 2O23A 4KQXA 4UVGA 1WMBA 4PZCA 1L7EA 2CUKA 4J1SA 4N7RA 4UVDA 5HM8A 4ALIA 4XZ3A 4PLWA 3SC4A 1XR3A 1G0OA 3GNTA 3FR8A 2RIRA 3R3JA 3P19A 4M87A 5LCXA 4Z3KA 4YT5A 4DLLA 1WPQA 2HMVA 2VZ0A 4IXTA 3PI7A 4L0QA 1DFHA 3EDMA 4RPGA 1CQJA 1I0ZA 2BELA 1E6EA 2VTDA 2IXAA 4BB6A 4DYVA 3P2OA 3M2TA 1HDOA 4XQEA 2GO1A 1E1KA 4PLTA 3W8DA 1KVSA 1KS9A 1B0AA 2UYYA 2YHUA 2A35A 1P1JA 4B8ZA 2YHIA 1GR0A 3HFGA 4BS9A 2DQ4A 3WNQA 1BXZA 1ZXBA 2HU2A 2EERA 2VQ3A 2RHRA 3ZHYA 2BI7A 2WMDA 4J16A 4C4OA 2BI8A 4CV2A 3PYLA 4YA6A 2P5UA 2JD2A 2GLXA 4I5DA 4PFJA 4WGGA 3WQRA 2VUSA 1NM5A 2Y1DA 5CEJA 2VRCD 2Z5LA 1ID1A 1FJHA 4ZICA 3PHIA 5IDXA 4YAKA 1K6XA 3OETA 1NWHA 5DOZA 4KTTE 1NHWA 4U6QA 4DVJA 4D7AA 5JDIA 1W0CA 1XHLA 1GV1A 3E8XA 2HK8A 1ULUA 1E1NA 3UW3A 1F8GA 1YQDA 3TQHA 3G17A 2P4HX 1D8AA 4YT2A 1HDRA 5CDTA 4CR7A 4PG7A 3ZNPA 1OI7A 4DTIA 2FN7A 2HMWA 4MP6A 1H0KA 5ENVA 4HNGA 1MV8A 4OQYA 1BDBA 1Z45A 2CFCA 3A14A 3OQ1A 3JQ6A 1CDOA 2ZTUA 1PL8A 2NQ8A 4D45A 4DIFA 2Y1GA 3V1TC 4PG8A 2C7VA 1YB4A 2GN6A 1WWKA 1FDTA 2O48X 1GD1O 4JROA 1DDOA 3ETDA 4B4VA 4GGOA 3I6IA 2Y68A 1SC6A 4OIMA 2C07A 4XGNA 1GPDG 5L4LA 3JYPA 2QQ5A 4CM5A 2VWGA 1ZNQO 4WCFC 5COAA 2GDZA 1KBZA 1UXKA 5TS3A 3KYBA 3TOXA 5FI5A 4JNKA 4L4XA 2PNFA 2C5AA 5L7WA 3FHLA 3KV3O 2B37A 4FW8A 3ONDA 4E5PA 5K0ZA 3TL2A 2YYYA 2YDYA 2Q1WA 3H9JA 4BKRA 1VSVA 3U0BA 2PD6A 5BSGA 4HWKA 4XYLA 2UAGA 1ONOA 1E1MA 3HNPA 4A26A 4J1NA 2O3TA 1U28A 1X7GA 1EDOA 2QIOA 3R6DA 1DPGA 1DLIA 3I9JA 3OFSA 4RVHA 4BGEA 4WLOA 4GKVA 2A92A 2PKQO 2D4AA 1BW9A 1YWGO 1O95A 2VCYA 3CTMA 3TDKA 3RWBA 3ABIA 4O6VA 3VZQA 1R4NA 2NNLD 2DC1A 3FN4A 3O9ZA 1QLJA 2PGJA 5A05A 2ZTVA 4WNIA 1Y7TA 3FNFA 4YB8A 1N8KA 4QTZA 3X2FA 2VTEA 3W4JA 2B4TO 3PHLA 2OBNA 1MXHA 2GGSA 3DWFA 4RGBA 4BHTA 3H9UA 3WGQA 4TZKA 4CM9A 1HLDA 1CRWG 4JQCA 3GOHA 3AUUA 3PGXA 2DBVO 2VHXA 3MTJA 1PJ4A 4AJIA 4AJJA 4DBZA 4DIOA 1KY5A 1LRJA 1ZK3A 3JQAD 4TVBA 3H5RA 2ZKLA 3PJDA 2HJSA 5A06A 4BV9A 3INGA 5ER6A 2CZCA 4ND1A 2Y66A 5G0SA 2PD4A 3IDSA 1JW9B 4RF4A 3PLRA 3C8MA 4IJUA 3U09A 1ZSVA 4MINA 1DRVA 4P22A 1VSUA 3SJ7A 4B3IA 5CG1A 3KEOA 2VYVA 1YONA 1F14A 5EN4A 2RH4A 1LX6A 3DMTA 3C7CB 4TRMA 3GGPA 2GNAA 2A9FA 3E9MA 3V2UA 4CQLA 5HTOA 3FNEA 1JN0A 2AW5A 1LU9A 2B0JA 1ZK4A 2FY8A 2XPCA 3JD4A 3PZRA 2VYND 3Q6IA 5AVOA 2ZQZA 8ADHA 1PR9A 3ZWBA 1QYCA 3F1LA 2J8ZA 3I9KA 4FOOA 1LA2A 3QWFA 2DUUA 3RUAA 3D5TA 3I23A 2YFQA 3FCOA 4FS3A 1JAYA 3U9LA 3QIVA 3HSKA 5JYEA 3L9XA 4CQMD 1D1TA 2AEJA 3GFBA 1YDWA 2NLOA 4AJNA 2JD0A 4YAIA 1NAHA 1PEDA 2WWRA 4RVDA 2GERA 4HNHA 1YOVA 1AN9A 1I2ZA 3NEPX 4YRDA 3ANNA 2Y99A 1LNQA 2CVZA 4UAGA 4DMLA 1O0SA 3K2BA 3RC1A 1U3VA 1YQXA 4I5FA 4NPCA 2FMUA 1NBOA 4MVJA 4R9SA 5TLSA 2AQIA 3DC2A 4G2NA 5JNLA 3D1LA 3H9QA 1VJTA 3NJ4A 3DR3A 4H3VA 1O6ZA 2WDZA 4XYEA 1GCOA 2DT5A 3KM0A 1Y5RA 4IDCA 3UCEA 4W4TA 2OZPA 3CMCO 1C1XA 1P31A 1EZ4A 3JYOA 3LF1A 3H5AA 4RDHA 5CHEA 1UXHA 2IXBA 3GMDA 1R0LA 3ZW9A 4L8VA 4MVJG 3F9IA 4WE3A 3Q2IA 1JVSA 2DUWA 4J0FA 4E2ZA 4L74A 2FPPA 2X0RA 3I83A 1QLHA 3VH4A 4E30A 4OHUA 2HRBA 4ND5A 5TRTA 1WZEA 4ALKA 3VHRA 2C2YA 5IN4A 3NGXA 1GV0A 1WVGA 5TT0A 1G0NA 1ZSNA 2NVUB 1JU9A 4YCAA 3H4VA 3VH2A 4DIBA 5ITWA 1TI7A 3WYCA 1X1EA 5I9MA 1ADFA 1DIGA 3DOJA 5JMWA 4E2XA 2PKRA 3DZFA 3JYLA 3WGIA 3FTPA 4QEDA 1HSZA 1YE3A 3V8BA 2R6JA 4IUYA 4ALMA 4IBOA 2Z1MA 3QE3A 3IL2A 1Q0LA 4YDRA 1Y81A 5B4TA 3GFGA 1VI2A 3WSWA 4FIZA 5I7SA 3I52A 4H16A 3ST7A 2F00A 1A27A 4Z0TA 1LI4A 4FFLA 4IPTA 4LCEA 3K30A 2V6GA 1A71A 3R1IA 3BMOB 4KQWA 2ZATA 4GBJA 3U5TA 4IGEA 1DAPA 5KKCA 1UR5A 5GZ6A 1PJCA 2BGLA 1PSDA 4GI2A 4RLSA 1QORA 3I9OA 1I3LA 4ND4A 1T1RA 2VZ8A 2JCYA 4UREA 1R6DA 1KEPA 4RL6A 2A4KA 2AQHA 1YJ8A 3AY7A 4IM7A 4CLRB 4BO8A 4GX1A 4I9HA 1T2AA 3FTNA 4CMBA 1HLPA 2PTGA 1I10A 5KJ6A 4HXYA 4GQAA 5I7VA 3QP9A 1M2WA 4GWKA 3S2FA 2FR0A 2X4GA 1R15A 2X9NA 3JQBC 3DHEA 2EW8A 3IKTA 3BMCA 3ZWNA 3E82A 3I4FA 4YRAA 1NX6A 3ZWOA 5THQA 3DZJA 4PLCA 3NDJA 4KWIA 5TJHA 4H7PA 1ZSYA 3NUGA 1BXGB 1OMOA 1SB8A 4TVOA 1P45A 3K92A 1LSSA 3RU9A 1Y9AA 3WTBA 3VPGA 2B4QA 3GT0A 3ROPA 1I2BA 1Q7BA 4NIMA 5G2OA 1ZVMA 4E5MA 4R3NA 4DMMA 3L0DA 1PJSA 4W82A 5U1PA 3VDRA 4PLGA 1HEUA 4ZQGA 1VRWA 3VPXA 4INAA 3O03A 1ZFNA 3QLJA 1Y8QA 1GQ2A 2VHYA 2OMEA 1H6DA 3D5QA 3TFOA 2CMDA 2OXIA 2GCGA 3VH3A 1IY8A 2B36A 4PLZA 1W8DA 1YB5A 2DPHA 4XR4A 3PK0A 2CNBA 3S8MA 2B4RO 4DA9A 3L9WA 4I5EA 3A9WA 3JQCA 4L4SA 3F4BA 4U0JA 3F3SA 4R69A 2O3JA 5L3ZA 1QP8A 3SLGA 3RI3A 5AXAA 1PZFA 4DXHA 3STHA 3ZH2A 3V2GA 3CUKA 1VLLA 4CV1A 1YBVA 3H9EO 3N7UA 4OM8A 4NFSA 3ZW8A 1DEHA 3OEYA 1H6AA 1QXSA 2UVDA 2JFGA 3MJCA 1MFPA 3WSVA 5IJZA 4UVEA 1ISIA 1N1GA 3LZ6A 4YJFB 5MDHA 3KYCA 1P1IA 8LDHA 2HUNA 1P1KA 3D64A 1Z75A 4PG6A 1DIAA 4KUEA 4EUFA 4CMIA 4CUJA 3ZHXA 4R1TA 5EPOA 2VN8A 3FR7A 2NACA 5KVQA 4Q3DA 1XG5A 1D4FA 2DVMA 3IUPA 4W9NA 3JQ9A 1TXGA 3EAGA 5TC4A 2Q3EA 3VDQA 5BNIA 4A7PA 2FWMX 1DRUA 3GEMA 3AI1A 4OSOA 3TWOA 2VHVA 1PJQA 2PLAA 3X2EA 3ON5A 1RYEA 4RLHA 1U7HA 2HK7A 2X6TA 3NYWA 4KWHA 3I1JA 3V2HA 1YXMA 5JO9A 5JC1A 2V65A 2W2LD 3GH3A 3ZV3A 4CM4A 5K9ZA 3ZNNA 4NBTA 2WD7B 1TT7A 1ZBQA 3ROMA 3ETGA 4EDFA 3C7AA 1HDXA 3QWHA 3UCFA 3ULKA 3ZWWA 1TVEA 3TJRA 1A9ZA 4J7XA 2XOXA 1N9GA 4JBIA 7ADHA 1ZIDA 5HA5A 1H93A 1P9LA 2JFFA 1QV7A 1K89A 1PGQA 3F4LA 3HN7A 2EIHA 5GMOA 2QZZA 4LMRA 3WLFA 3GUCA 4XYMA 3T4XA 1XIVA 3JQFA 2IRWA 1P0FA 1I2CA 4RVGA 4LMPA 3B1JA 4EZBA 5DF1A 1DFIA 1C14A 4B3JA 4B8WA 4B4WA 1V9LA 2Q45A 4A0SA 1YL5A 4F3YA 4F45A 2BMAA 1LSOA 2H6EA 4ROSA 3D3WA 2FOIA 7MDHA 2DBZA 4RVSA 1PTJA 1X15A 2D8AA 1KVUA 4FFMA 1A9YA 4K28A 1J5PA 4WLUA 1OBFO 1R0SA 1YO6A 2RBEA 4TZTA 1MG0A 3UUWA 2HCTA 3GMSA 4JCOA 5H82A 2DTDA 1RM5A 3ZU5A 3LC1O 2Y0CA 3GK3A 4HP8A 3OJFA 3ITKA 5JMPA 2FSSA 2NWQA 3AUAA 3DOCA 3MCVA 5FYDA 2R00C 1WAMA 3E48A 3DBRB 4OOEA 4ZRMA 3T7CA 1NQOA 3ZN2A 2H5LA 4XKJA 4CM3A 1PS8A 2NQTA 1NFFA 3NKLA 3GNQA 1B15A 4P38A 5JO0A 2FR1A 3QSGA 3DBRA 3WBBA 4M54A 2RAFA 3IC5A 4N5NA 4WOKA 3FF4A 4XYGA 4CQMB 1PU2A 3BMQB 3QY9A 4I08A 2V6MA 3IJRA 2GN8A 2HMSA 4CL3A 3VVBA 3FWZA 3PXXA 2X9VA 3G3EA 4GSKA 1GCUA 3R0IA 2FPGA 4O1MA 5DOVA 4MVJI 1PWXA 1I30A 2DM6A 3JQ8B 1V0JA 3BHMA 1ISMA 1NTOA 2NTJA 3QWIA 4MIOA 5H81A 2BD0A 1VL8A 3BIOA 3TZQA 1MA0A 3ZV5A 4RJTA 4WECA 3RUDA 4FJ0A 5CAEA 2ZB8A 3RAJA 1AUPA 2PZLA 3WGYA 4RV9A 3AM4A 2PY6A 1ZCJA 4MIEA 1P3DA 5B1YA 4GVXA 1IPEA 4E13A 4CJXA 5K6AC 4XQCA 4AL4A 4JK3A 1TLTA 3BTSA 1OC2A 1EUZA 4M1QA 5JDIC 3NT2A 1HYEA 1LSUA 3FRJA 2ZCUA 3L4SO 4J1TA 1DXYA 1KERA 3KEQA 4ONEA 3BTUA 1TB4A 4Q3NA 3WFIA 4XA8A 2D2IA 4WLFA 3WYBA 2QRLA 4Y6SA 1PS0A 4M89A 2ZYGA 5A3VA 5A1TA 1RM3A 3AUSA 3I9NA 4N54A 1DC5A 4FR5A 1JWBB 3QVOA 3WR5A 4BNFA 1XWFA 3UOGA 2IEDA 1Q0HA 3C85A 3CKYA 5BNFA 1LLUA 3TNLA 1E3SA 1N2SA 3O8QB 1BRMA 5HS6A 4E33A 2O3SA 3F1KA 1GEEA 4UEKA 3HDHA 1ZK0A 1EVYA 2YFHA 2EF1A 5ENDA 3L07A 1HDYA 1Z82A 2VNAA 2WYUA 3FPLA 4ZD6A 3H5NA 3DEYX 4DBVO 4O0LA 1SO8A 4D0RA 4DC1A 3FI9A 1BSVA 1UDCA 3RU7A 3A4VA 3UVEA 5KVCA 1WLYA 3PGJA 1NAIA 4EGFA 4OQZA 1LDMA 3FSRA 3AM5A 1PGOA 3WTCA 1U8FO 2I9PA 4A73A 3DBLA 2WE8A 1EUDA 4BO5A 5ES3A 1DC3A 5BSEA 2O3QA 4EJMA 1WNTA 4NI5A 5CDYA 1IHXA 4QO8A 4B4UA 4DL9A 3JV7A 1B16A 4P4LA 2E82A 3CSDA 3WX0A 3JD0A 1P0CA 3GDOA 1X7HA 3JQDA 4ALLA 3LT1A 2OBYA 2DBRA 4D44A 3C1AA 3GNSA 1PL6A 3LU1A 1BVRA 3IKVA 1GYQA 1R4NB 2YQ5A 1HDGO 3MJVA 1BXKA 1BWSA 2Z95A 5L9AA 3EVTA 2EWMA 2VHWA 2O3RA 4OMUA 4E32A 3H6KA 3TOZA 4OKIA 5I9NA 1B2LA 1VJ0A 2OP1A 1DAOA 3AU8A 1F12A 2PZJA 5JAQA 5B4VA 3OJLA 3GAZA 1R66A 4J9UE 1K3TA 3Q9NA 1WMAA 3ZWVA 3N74A 4RVUA 4Y6RA 1MFZA 2FSVA 3HZZA 4YACA 5JDCA 2ZYDA 1BG6A 4ITUA 2PV7A 5EESA 4A10A 2G82A 4II2A 3NGLA 4DPMA 5IAAA 1KETA 1LDNA 1Q2XA 1UZMA 3AUTA 4BO0A 5IXYA 3AOGA 1DB3A 4UVIA 1ENOA 1Y6JA 3RFVA 4CV0A 3IMFA 3PTZA 2X0JA 1HZJA 4ALJA 3GGGA 1PX0A 4CLOB 2X0IA 3TRIA 4BGUA 2I99A 5BR7A 4JX8A 4RVFA 2GN4A 1XLTA 4AICA 3DMYA 4CMGA 2P68A 4D43A 3DXFA 4YJGB 4PG4A 4Z9XA 4DYDA 4WLEA 3MJ4A 1UP6A 4RPHA 3ZNQA 4BMVA 4CV3A 3RC2A 2VWQA 3E6AA 1P1RA 3QV1A 1LQUA 2BFAA 2VYNA 4JP3A 1LBEA 4CM1A 1I3KA 3LT0A 2IEBA 3UKOA 3WGOA 5F1KA 3DZIA 3RFXA 5ICSA 4WKGA 4Q3EA 1M6HA 4CMAA 4CM8B 3ZNOA 1GQQA 1ZZEA 2LDXA 1HTBA 4CLOA 3FBTA 2JAHA 4J90A 4JLWA 1LXCA 1PQUA 2BGMA 1ARZA 1HYGA 1LSJA 1E7SA 2NM0A 3GPDG 4LISA 1AXGA 4PZEA 1E5QA 3K96A 3CPSA 3OM9A 1S7CA 3H2ZA 4R1NA 4XRGA 3M6IA 4CUZA 1GL3A 3RKRA 1B7GO 1R4MB 3AW9A 3E18A 1C3VA 3OBBA 2WD7A 1MLDA 3HJAA 1M67A 3RJ5A 5IXSA 1YJQA 4RO0A 4OAQA 1DJQA 4YT8A 3WIDA 4PVCA 1GAEO 2AEMA 2OFPA 4IDGA 1BHSA 3RUHA 3CH6A 3DFZA 4Q3AA 1J4AA 2EKQA 3Q9UA 4Q3BA 3LLSA 4XD2A 5G0UA 1U4SA 3DONA 1Y9EA 3WWYA 4BNNA 2EW2A 2G1UA 2GSDA 2D1YA 4R1SA 3CEAA 5A02A 5CDUA 4K1LA 1U3TA 2BGKA 1F0YA 4BOYA 3HB4X 2AE1A 2EV9A 1ZEMA 3HDYA 4TROA 3HHPA 3C1OA 3K31A 2X5JO 1AHHA 2J3IA 3MOGA 2DFVA 4W7HA 3FBGA 4E5YA 1ZW1A 9LDTA 1OFGA 1PJ2A 2O7QA 5I8WA 1JWAB 4YVFA 3OF2A 5KCZA 2WEKA 4L73A 2VRCA 4N5LA 5FEUA 4R68A 2OORA 4J2HA 4BO1A 4EITA 5L53A 1X14A 5KJCA 4QT0A 4JBHA 3RUCA 4AJOA 2NU6A 4IY1A 3VZRA 4BNWA 2HQ1A 2VNSA 2ZB3A 1J6UA 4ILKA 4IZIA 5A04A 1OOEA 4NJMA 2JHFA 2UUOA 3L6DA 5KJFA 3NTOA 3UICA 1RYDA 2TMDA 5AOVA 1IUKA 3KSDO 1DIHA 5U9CA 1DOHA 3LK7A 5B4UA 3K5PA 4CM9D 1YQGA 2C82A 2JKVA 2Y05A 1VL6A 3VTFA 4MVJM 4R9RA 4MIYA 4RPLA 4K9DA 2G17A 1UXGA 1GFSA 1GU7A 3AU9A 3MJSA 1UAGA 3OQ6A 3PHHA 4RF5A 4URFA 2CDAA 5MGBA 5L45A 3EHEA 3JQ9C 4NHEA 3QWBA 1UP7A 2EKPA 2DLDA 2YZ7A 4I1IA 5TJ9A 3SXPA 1DC6A 4GX2A 3ETEA 1PS9A 3SBOA 3OA0A 5F1PA 4IS3A 3BA1A 3MJTA 1SOVA 4IDAA 1DC4A 4WLVA 2Q2VA 4XIYA 1ZJYA 2C54A 2O7SA 2B5WA 4O59O 4EUEA 3ZU3A 1Q1NA 2FR8A 2V7PA 4CLEA 1O94A 4IDFA 3RBVA 1K0UA 3H9GA 2BRUA 4MPDA 2E49A 3NV9A 3UN1A 2NVUA 4NK5A 3GR6A 1ZXLA 1WDLA 5IZ4A 3KVOA 3DL2A 1EUCA 4LRTB 4BUCA 3GA0A 1EK6A 4MKRA 2C29D 1FMCA 2PZKA 3H7AA 4Q9NA 1PIWA 1LDYA 1V3UA 1E5LA 3DFUA 1BXGA 1FDWA 4WEQA 4UUNA 3DHYA 2QG4A 3CIFA 1LC3A 1L7DA 4DLBA 2ZCVA 4JJFA 4YQZA 1MP0A 1KEUA 1VPDA 3G1TA 1U5AA 3ORFA 1YKFA 1P74A 4J6FA 3GHHA 5CP8A 3DB2A 4BIIA 4GX5A 1N1EA 3JSAA 2J5KA 5T8KC 1HE3A 3KRTA 5JS6A 2EGGA 3BMOA 4IJKA 3I6QA 5HRUA 4NBUA 4RDIA 4XQ9A 1MX3A 2J3HA 2P5YA 4BNHA 3JCZA 5C7LO 3MEQA 3QWAA 2P4QA 4A27A 4Y8VA 2NVBA 3COSA 1LLCA 1EQUA 4J43A 3D4OA 5T8KA 4YPOA 3VKVA 5L4NA 4M8SA 3OIDA 1B8PA 3LC7O 1T4BA 4HFJA 3GN1A 3QJ5A 1HKUA 2NU9A 1FXSA 3AY3A 1GZ4A 3ADOA 3ZWPA 4XCVA 4XQGA 3VAZA 3BTOA 5G4KA 5HBRA 5L7YA 4CM4B 3ZCXA 4O63O 5A5FA 2AQ8A 2DU8A 1HE4A 2W2LA 5J23A 1LEHA 1E7YA 1H6BA 4RPJA 4K6CA 2HSDA 4LN1A 4MP8A 4BKUA 3ZWCA 4TMFA 5IZCA 3G0OA 4IQGA 4A2CA 4DQVA 1V35A 3L4BC 3FNHA 2E6UX 3C3XA 5KOIA 1KVRA 1AGNA 1DHTA 5B37A 3EZYA 1XSEA 1VKNA 3EY4A 2GF2A 2X1HA 1C1DA 2GN9A 5T67A 1JVBA 2O4UX 4R1UA 5G4LA 4XR9A 3UFXA 4YJFA 3WNVA 2Y93A 5I7FA 2Q4BA 3WJAA 5F1OA 3LLVA 2VOJA 3F47A 3GZNA 5EL0A 4MDHA 3ZI0A 1ISHA 3ZWMA 5TQVA 3MWDB 1T26A 1K6IA 2PH3A 5T6BA 1B8UA 1WXDA 1XQ1A 3DBLB 2ILTA 1RM0A 4WOJA 4LSMA 2HMTA 3L4BA 4D79A 2G0TA 4GKBA 4YAEA 1KYQA 1E7MA 2V6BA 4XJTA 3HADA 4YJDA 4EBFA 4KTVE 4BO7A 4IDBA 1E3LA 2DKNA 1PGJA 4W6ZA 3RBXA 4RORA 3WGHA 4IINA 5JBIA 5BQFA 2X22A 4XIJA 2NVWA 2C2XA 2CY0A 2EP7A 5T5QA 3PQDA 3MJEA 4J4HA 2DFDA 1J49A 3IS3A 5GY7A 2J3KA 1YBAA 4AJLA 4BMSA 1PJTA 1I5RA 3BHJA 5A9SA 2BH9A 2YV3A 2P91A 3ONFA 1LC0A 4I9UA 1ZMOA 2W90A 3GRKA 4YJHB 1T2EA 3GVIA 3FPCA 1E6UA 2Y1EA 4LK3A 1VJ1A 3UXYA 3BXXA 3WICA 6ADHA 3OMLA 1MUUA 1UZLA 3CXRA 3A06A 4ZVVA 1E3WA 5DCYA 2Q99A 4FC7A 4IDDA 3NT5A 4PLFA 3JQEA 4BQRA 1YRLA 2X23A 2Y0DA 1IYZA 4CM6A 4BKQA 1X0XA 3O8QA 1EEHA 1NPDA 1PWZA 1P77A 4NZ9A 1XEAA 4IIUA 1HRDA 3QVWA 3ZU4A 4AJKA 4ID9A 2CF6A 2HAEA 4JBGA 2IDZA 3UGKA 2VWPA 1YVEI 1PZGA 1UAYA
chains in the Genus database with same CATH superfamily
1S9DA 1ZMRA 4IJWA 4AIRA 4HEA6 1GL7A 3DT8A 2Y4OA 4I8IA 3P9IA 1PQYA 4YFVA 3MHPA 2OE2A 2WHEA 3H3XA 1X42A 4Y2QA 3ZZ1A 4C0AC 3UUFA 1CQJB 3WLEA 4HDMB 3QNUA 2IT1A 3A9TA 2AG1A 2Z8ZA 2YUIA 4TV9F 5B55A 1B42A 3NIWA 1NL3A 2FPRA 1ZI9A 3QHAA 3WLHA 5JO0A 3KUXA 1RXIA 2Q6TA 3U16A 4PAWA 3SS8A 5IZCC 4QXMA 2FUCA 3ADBA 1UEXC 2OO5A 1GEGA 2C9YA 3DE0X 5K0LA 1ISGA 4EF6A 1EP1B 1EX9A 3OLWA 2YBDA 1QCCA 1Y1QA 4AKIA 3P9YA 4UD2A 2OV4A 3T6KA 3I34X 3AVVA 4EJFA 3O93A 3FUUA 5E0KB 1T9AA 3UJ9A 1PHRA 1ILEA 2ZRHA 4RK0A 1EHYA 1W75A 3L5KA 1V6AA 4IOJA 3RSHA 3VZSA 4JYCA 4H4EA 4BNKA 1WP4A 1E79D 2IYXA 2E4UA 3CLSD 3IIKA 4UATA 1E9CA 1J8VA 2X1MA 1J07A 5LA6B 3VR3A 4YMVA 4OHOA 5CDFA 3DE7X 1YBMA 5FF9A 1WD7A 4F91B 4MDEA 4RY2A 3NX4A 2GHTA 5B58C 2IUTA 3E9QA 4TGLA 3CRNA 3DOHA 2FJ0A 2GJSA 2AJDA 1AHNA 3BD8A 2FAXA 1U5BA 2PX2A 2SHKA 4E2YA 3N6VA 1PQ4A 2QRKA 2YXDA 2Z8YA 4L2IA 2HMUA 4O4JB 2ERXA 2RSLA 4EUHA 3GFTA 4G1UC 4QC2A 3DEZA 1AD2A 1BRTA 4WQMA 5FP0A 2RGCA 3Q11A 5LVAA 1KTVA 4H1TA 5GTDA 3HJGA 1Z37A 1V3QE 3H5OA 5JE8A 5HRCA 3Q8MA 4XRRA 2R4QA 1N5KA 1VM6A 3ZLUA 4JCCA 1P4RA 3BXGA 4X0EA 1KKMA 4MUHA 5C5IA 4B9AA 4G01B 2A67A 2Q4EA 1B00A 5DHQA 5DX1A 2IWRA 2AR7A 3ESQA 3B5EA 4JI7B 4NQZA 3RAFC 2EKDA 2AG5A 1DPFA 4QDJA 5AKZA 2VJLA 1K1EA 4NZOA 4U7TB 5FBVB 4DPKA 3FPKA 3WFJA 3N8IA 3ZGXA 3V8PA 2YDXA 4YCSA 3I1FA 4LGVA 1X1CA 3EIEA 1W36D 1H2HA 4K26A 5FADA 1H3EA 2QUJA 1FFXA 4DNQA 4B48A 4EUNA 4ERXA 5LD2B 4NG5A 2HF8A 4MVJD 4NYJR 3TRHA 5BMVF 2V8OA 5FFFA 5TGZA 1NWCA 2W98A 1EP9A 3HJCA 3NHPA 4PEVA 3TVYA 4E1BA 3ESZA 5EJ9A 2QX7A 3E2IA 3VOSA 4YUXA 3U0VA 6AT1A 2GD0A 2P75A 3KXDA 3N2KA 3IFSA 4DDMA 3ZCTA 3CHYA 5DBHX 1W6UA 2PUWA 3PHJA 2B4YA 4KBYA 2GZ3A 2WNHA 4LMAA 4LXXA 5FFNA 3KPUA 1XZKA 4H17A 4L6IA 2ICAA 4M88A 2QYOA 4QOEA 4RX1A 1GPLA 5DEOA 2Q1TA 4EFKA 1Q50A 5CLQA 3NOQA 3EGXA 2I76A 4YJHA 4EGQA 1BCRA 1G5QA 2J9RA 3DZ8A 4LW8A 2I6GA 4IV8A 2WSMA 1T0JB 2BFDB 5COBA 1ECJA 2PGAA 5EGSA 1M8JA 1DLJA 2J4FA 5F1OA 1ZIPA 5E1DA 3AVUA 3C6KA 1Y5MA 4BQPA 4CPDA 5I5GA 1UADA 1SEPA 1JJVA 3M1YA 4ZVTA 3RVRA 3TUJC 1FQOA 3AFHA 4EYGA 4OHMA 1OAAA 4PS0A 3G49A 4B85A 4BNVA 2R9VA 2XSZD 1NNUA 1VCNA 3NH6A 3RT7A 2QAJA 3W1EA 5BQ3A 2RCYA 3AKDA 5I6DA 5AKLA 4LJ6A 4BE7B 1EK5A 1Z13A 2WFLB 5C5CA 1OVMA 1T2UA 2XQKA 3AHCA 3STTA 2FA9A 2WR8A 2OZLB 4ZCIA 3TLXA 4WXRA 4HN4B 3UJAA 5FBKA 1YAJA 4G8JA 4POOA 4P0TA 1XU4A 2O2SA 3GC6A 3VHQA 3RW9A 2CMFA 1NLFA 2QUAA 4F5EA 3AYZB 5ILOA 3F74A 1JV2B 4WLNA 3M83A 1OIWA 5JY6A 2OORC 2XNKA 1T6YA 2FP4A 3AVOA 3FTDA 4NBRA 4QHTA 5GONB 1ITZA 4C0KA 3ZY5A 2HRZA 4PHFA 4YQFA 5TQJA 1QYIA 2XYGA 2RH9B 4K1XA 2IVZA 2A9JA 1XP5A 2IZZA 5HF5A 3S1LA 3DOFA 1ADCA 3W1VA 3SIWA 3VR2A 4ZDIA 2AR0A 4HAZA 2ZBFA 3D4NA 3VGPA 2FRDA 1Z8DA 4FEEA 4MKZA 1H6CA 1RYYA 5ESXA 4BZQA 4XW2A 1LTHR 3IDAA 3GW8A 1N25A 1KSFX 3HK2A 5DCLA 3I9MA 1A2OA 1GO2A 5D7BA 1M2NA 4D8VA 2XTJA 4IIYA 2V6JA 5DGCA 1EGQA 2ETXA 2FW0A 1JDBC 2NYAA 2QRJA 2YZ2A 1NVGA 2EGHA 2YWBA 3TVDA 8GPBA 3S81A 1V39A 1YBFA 1ACMA 3AF4A 4A91A 4HZUA 1I94B 4NCAA 2XUAA 3BUSA 2WG0A 4MS4B 2XUZA 4X6XA 5TY0A 4EPYA 1AMUA 1PL0A 5TGDA 3NAMA 1XMSA 1Z62A 1ZKMA 1FFHA 4PAQA 1FJ2A 3IV6A 4PSDA 1CRPA 5KTSA 4M1KA 3VNVA 4FZVA 4OO3A 4RSHA 5FORA 4CM8A 2VOEA 2FF5A 4CFZA 2APJA 3BMQA 4JC5A 2XNCA 1E0KA 4F9GA 1U0RA 1V1MB 2DH5A 2IXFA 2IYPA 1JTVA 1QFSA 1M76A 2ZOSA 3LP8A 3MRVA 3NIGB 3FSGA 4G36A 4MUNA 4CMEC 4P86A 4JL8A 3ANXA 4CR6A 5I9LA 4M98A 3KQKA 1YVDA 5EWLA 4A5SA 1PQPA 1QMGA 3LLCA 4XWGA 3SZRA 4V1CI 3LGSA 1RJDA 3NEJA 3UHJA 3BILA 3O84A 1DKNA 1RE1A 4HRAA 4OK6A 5FTLA 4BPBA 1DQRA 2H9YA 4WBNB 3BFPA 1XRPA 4B84A 1YR3A 2MOKA 4OHZA 3OCJA 4D46A 4BLWA 5HYVA 4LVOA 2PZBA 2QMEA 1BE1A 1V3VA 1R4MA 3KTAB 4GLOA 5LP6C 3WB1A 3JD2A 5E8JA 3EGVA 3E5MA 5B1SA 2XCLA 2Q3BA 4J2TA 4DNXA 5DHAA 1I4EB 3CNEA 2XE6A 3B5JA 4FHCA 5F12A 1KP9A 1D2AA 2F43A 3ZJ5A 2GUGA 2OD9A 2Z9CA 3GJ7A 4RH3A 4B6PA 5HCUA 2IHJA 1ONSA 1JEEA 5AK3A 3ONEA 1A3CA 1I3MA 1MJFA 1YS9A 4KZPA 5BV8A 2Z6VA 3R5SA 4ZXPA 1NQ5A 2J87A 5B64A 3K8QA 2IUUA 4JLPA 2W22A 3CVWA 1U2PA 1ZUHA 1GZ7A 1WD5A 1JPNA 1ENZA 1BHO1 2Q41A 4TKMA 2ROQA 4Y6GB 3I28A 5C7IO 3T5BA 1BW9B 4PNHA 5FL7A 3TLGB 1JPUA 4S04A 5EAIA 1TKCA 2OV1A 1DKQA 3C1TA 3EVBA 4FS8A 3GP8A 2QRNA 2QZ9A 4Z0PA 1L0BA 4CCYA 3PB3A 4FMBB 2YY7A 4HGQA 3M49A 2OZKA 3PP8A 1XZHA 3KOXA 4KIFA 1YI1A 1ZJ4A 2B4AA 4JZYA 1JIJA 2PGLA 3HPQA 4MR7A 4R98A 3L18A 1J22A 2AJ8A 2BMVA 1W0JD 2G4CA 4F3RA 4NBVA 4LFCB 3K05A 3L5OA 3LQRA 3MTBA 1XZDA 1OAKA 3D0OA 2A9OA 1KEWA 3IOCA 4OHXA 1OTYA 4U5XA 5BN4A 5JAMA 4HFNA 2ADFA 3I73A 3EPKA 3IOYA 4JEHA 2IEAA 4Y67A 4Q3CA 1EMDA 3R5JA 2VHQA 3T1QA 3U9TA 1I9GA 3DVQX 4MWCA 4YTEA 1RYFA 3KU1A 2VJOA 3O4GA 1OT3A 4RY9A 3GJRA 4GC9A 3GHYA 5IABA 4TYNA 4EVIA 2ZYAA 3RFFA 4MRAA 4JUAA 3UWPA 2G77B 3MTGA 4G0YA 5EYPB 5IH3A 3SE7A 3T7EA 5FO0A 5D01A 4DWWA 5LQAA 2HSGA 3IT3A 1ZOOA 2F1KA 1N2XA 1UL1X 1I4OA 2FZ4A 4PINA 2X8LA 1MXFA 4C0HA 1N9GB 1IHPA 1L5ZA 4WOCA 2IW1A 2YXPX 3KZKA 2D4HA 3TBKA 4WBNA 1F3LA 3ZWKA 1CWUA 1N75A 3OZVA 5DX0A 1UBOS 4XWOA 2VUUA 3MINB 3I45A 4H60A 3UBMA 4AUMA 1I7DA 4LVCA 5C8YF 3HKEA 1V8DA 3STUA 2YV5A 2C42A 1A9RA 3AJAA 4Q9IA 1RKBA 1I32A 1W19A 1XB2A 3EIXA 3NWBA 2Q4OA 1E3IA 3OLZA 3UYKA 1GG8A 2ZDQA 2XQIA 4BX3A 1G5IA 3I04A 1HG1A 4DC0A 1HFJA 3HYCA 5J4YA 3AF6A 3CS3A 3CLRC 2G07A 1VBNA 2K5UA 4FGKA 4XWAA 1IM5A 5L6LB 3I8SA 1DVRA 1ZGBA 2B0CA 2CD9A 2IYSA 1EM8A 3NBKA 4PPNA 4FT2A 3QXHA 3TQQA 5K3AA 5J4VA 1SCIA 5FUYA 2I4OA 3VOBA 2HJRA 4D3DA 4MTLA 3WYAA 4DV1B 3Q7PA 1H2XA 1XZEA 3HRIA 1MC4A 3IELA 2J5RA 3U4DA 4AMBA 1YJXA 1H8HD 2TMGA 3QE9Y 1Y8RA 3PDWA 1ZUD1 2BFCB 2EBFX 2G9ZA 3TEJA 2ZBQA 3T9CA 5F98A 2G1JA 3GB9A 4E2FA 2Z43A 3T38A 2XR1A 2C4TA 2BKLA 2JLBA 3VPCA 3A9RA 4MRPA 2B83A 4IMIB 2ABWA 5DSTA 3UKJA 5KZMB 3DKRA 1QAMA 3D8RA 3V6MA 4AFNA 4B79A 4M8IA 1KPGA 4QUGA 1B26A 1H0HA 4F72A 2FE1A 2JZNA 2IL1A 4WJZA 4ZCQA 4EY8A 1EK2A 3K3PA 1QYDA 1O89A 1FMFA 3MD9A 2XAUA 2CJXA 3QMVA 4OLFA 5BXQC 2ZUFA 3O8BA 1IPFA 3EC7A 2NXCA 3I32A 4UNIA 4C3OB 4ZAZA 4RMIA 3HKDA 2R4TA 2OHGA 3I72A 2Z4TA 3REQA 2Z98A 3Q6MA 1H9BA 3S1AB 3KUDA 4E5SA 1IMJA 2C5FA 1NI3A 3PT5A 4X90A 3SXUB 5E3HA 3U4HA 2ZM6B 1KI9A 3MLEA 2CVOA 3NANA 2W6ZA 4YJ2F 3DYIA 3RC3A 2XYHA 3ED5A 2I55A 4Z0NA 1JTFA 2WJIA 4LVUA 3GLQA 2ACVA 4TS3A 5KB3A 2MCFA 4G4IA 3UGTA 1I33A 3EWAA 3MN1A 4L2IB 4PV7A 3V3TA 4Z7JA 2GFHA 1AUQA 4FZJA 4JDUA 4NATA 1BEUB 1QBKC 4OFZA 3NKFA 2J41A 5JAUA 2P2CA 5JT1A 4DCPA 1CJMA 3KX2A 2NZVG 4FD2A 2Z6AA 1IDOA 2FGJA 2Q29A 4JL6A 2PR2A 5ALYA 1TMKA 1R8JA 1I80A 4N8SA 4F8JA 4GH5A 4QU8A 1Z8FA 3WYGA 4FYHA 4LY0A 4GPD1 1L5MA 3NU1A 1HXHA 2IYAA 2Y1CA 3LUBA 3E5RA 2CXSA 4FHZA 4NR0A 4ZT5A 1SBCA 4QQFA 4R81A 3OCCA 2MIIA 3G2KA 5CDSA 4FYKA 2WYVA 2BZGA 3OUUA 4X8HA 1OBVA 3U4AA 4JL5A 1P91A 2Z9DA 5DZSA 5KYUB 4RTOA 1R8SA 1SAYA 1NLUA 1E1QA 3ENVA 3SZMA 4C7JA 1RPJA 4CEHB 2ZJ0A 3WMRA 1JWLA 3LXRA 5BSRA 1T8YA 4EEZA 4YAGA 3PLAE 2ZS8A 1U0FA 4QPPA 1YR7A 3G7SA 2PYDA 1MX5A 1USUA 1UWCA 4KR3A 3CIOA 2CCJA 3DW3X 3DEJA 3GWGA 4XFJA 3TB6A 1OU0A 1ST2A 3P32A 3WLRA 5AVQA 3DLIA 3GLIA 3RV4A 5A4JA 3RRBA 5KVVA 2JLXA 3O2SB 1D0IA 2HGSA 5ULLA 5LM3A 4L5IA 4Y2SA 5DHPA 1U9IA 3LNTA 4TWIA 1YJAA 4NU6A 4WN9B 4XUEA 4YI5A 3ZKAA 4UUPA 2IZ7A 2GN0A 4QX6A 5EXSA 4F46A 2ATEA 3TXXA 4XVRA 2IVFA 4M36A 2QYSA 5L4SA 2C3OA 4F5ZA 3G0IA 2JGEA 1YHZA 4YJ2B 5BOSA 5BURA 1VYUA 2RKWA 2G9UA 2YWEA 3IMEA 3UNXA 4KBGA 2Q4TA 4BP9A 3TMYA 1G8KA 1KGSA 2NU7B 3D6FA 3C6YA 2ZLBA 3EBOA 4OQXA 5BRAA 1X3LA 3CPJB 3FPSA 4A5OA 3EVNA 2DUJA 4OXKA 4M9UA 5I9BA 3AESA 3V33A 5JW6A 1PE0A 4EPWA 2AZTA 4HD8A 4HQLA 5G1NA 3TQCA 5ARBA 3VDNB 3NHBA 4RZIA 2V4UA 1F7VA 2BP7A 1NRWA 4GU5A 1GUYA 2JB9A 3L8CA 1ZO8A 5DO9A 1DXOA 1VQ1A 4W99A 1YB6A 3L7AA 1WSWA 4N8EA 3ZXYA 2WVJA 4FINA 2YCLA 4RY8A 5J59A 2ZRAA 1U4OA 5LR6A 1GWNA 2QLBA 4Y9DA 6ABPA 2R1VA 3D31A 3VTKA 3U7RA 4BUJA 5AP9A 3EVFA 2H07A 3CWQA 3DMHA 3HCAA 3EQ9A 1V8OA 4X8LA 1DRJA 1DQSA 4TN5A 4U4AA 1XTIA 4QYMA 1URPA 4QDZA 4B3TB 4BECA 1VL0A 3ZK9A 4C4YA 1U7UA 1NW6A 1D0SA 2QX9A 4RVCA 4WESB 3MMXA 2XRFA 1P1FA 1R16A 2H5IA 5DB4A 3AHGA 3B20A 3CURA 2A59A 4DJDC 3R7BA 2RHCA 4E5KA 1OFTA 1CR0A 2ZIGA 5AIAA 4C29A 5L51A 1RAAA 3W6UA 3NP9A 5JXHA 4QLAA 4GRDA 2ZBDA 2DPXA 3ETLA 3K0CC 1VHWA 2F67A 4D9MA 2XJ4A 3CLTC 1QVVA 4TYYA 2JA1A 4W8HA 2C57A 5IN5A 1QVWA 5KNBH 1SZPA 1ZMXA 1DRWA 3BRSA 5F5LA 3BJZA 4K3VA 4DNOA 4KRGA 4L8FA 2C3UA 2BEUB 4P2BA 3SBEA 1L7MA 1TJPB 3NS7A 2R86A 3JU3A 3AVPA 5D84A 3C3DA 3HL4A 4BP8A 2WWVD 3TPCA 5A5GA 2QD1A 5I7OA 1W4BA 2Y67A 3K1JA 3H9CA 1V5FA 4MW6A 4ZMSA 4XB1A 3K8ZA 1YDHA 4V0NA 1T36B 1GRCA 4BFYA 4L5JA 3SKVA 3DPIA 2O8BB 1TNDA 2YW9A 2GTHA 2FJUA 3WI7A 2QY9A 3D54D 2PZFA 2QD4A 2WAMA 3FB4A 3OUTA 4BGIA 4D74A 4ECEA 121PA 4NBNA 1PUJA 1T2FA 4WNCA 3G7NA 3ICPA 2AD5A 4HDRB 4N49A 5BQOA 3WAGA 5JJIA 3TZKA 3OC0A 1XZAA 3ZXSA 2C94A 4R4JA 3TZCA 3UAGA 1QQ6A 4B43A 3UHAA 4EYKA 4NEQA 4M55A 4DLAA 3R20A 2AUNA 5TIIA 4RWZA 1EFKA 3DLCA 2EP8A 5H4HA 5GPBA 1F1BA 1ZUIA 3DJFA 1B4DA 3QPWA 2CHEA 2Q1UA 5JV5A 1KE2A 4ZQHA 1XVLA 3Q41A 3EUWA 4EP1A 1UKCA 2DPGA 2OG2A 3ESCA 1G8MA 3JQFC 5KQPA 1I3NA 3G7UA 1SUWA 4MA5A 3HGMA 2NIPA 2WKWA 3X1DA 4HRXA 2ZUCA 3THWB 3VO1A 2QJRA 2P9GA 3BFVA 4JUFA 3U44B 4MP3A 4ODIA 1OI3A 2O0HA 4ETWA 3T3OA 3BWDD 4DCVA 4A0RA 1N4AA 3K15A 1K8QA 4HYYA 1RLMA 3UG7A 3EBPA 4ZKDA 2E1RA 4ZCMA 3DYVA 4LYDA 4EJ6A 4O2LA 1Z7YA 2O8EB 2E18A 3QHPA 1DEXA 4KNVA 1FLNA 2Q3DA 2XF8A 3BGOS 2IQ5A 1ORRA 1EWVA 3DAFA 1J0EA 2BCGY 3I3SR 1H4QA 2P40A 1OPXA 1KQOA 2IU3A 2O2IA 4R40A 1MORA 1L1RA 2HMAA 2SKDA 4TXMA 5KC8A 5AXBA 4OJNA 1P18A 4EGJA 4BLOA 3W5SA 3LQQA 2PSDA 1REQB 2X9LA 4CG0A 3AHJA 4B75A 3GVPA 3RU3A 1SXGA 1ZN7A 3HMQA 3R3XA 4OX9B 2N42A 1DIBA 3OSUA 5C4MA 1ISJA 2QTCA 4I9FA 1KNQA 1Z5UA 3HFJA 4QAQA 4R5MA 3VI4B 3R6LA 3TLJA 3SC2B 1YS2X 2D7CA 4BNDB 4CMJA 1SCDA 1WPRA 2A94A 2K7ZA 2YC4C 2PXAA 3DR5A 4FXPA 5HFAA 5JD3A 3DOUA 1HC7A 4BJ5A 3F6CA 3RJMA 2I6QA 4W9NC 5CNJA 2ON6A 3LHKA 1X8XA 1L4YA 4OHWA 1YJCA 3V9AA 5KU1A 4WL0A 4QATA 1BTOA 1JT9A 4LE0A 4DCSA 3EVAA 1XNRB 4HH3C 2BHLA 3Q85A 5KUTA 1TGYA 3GRZA 3OZWA 5LOVB 1VECA 4MPRA 2H9AA 3IIMA 3G9TA 4PRZA 1X1AA 1XAJA 3AF0A 3T99A 1NVKA 1XU9A 2RJNA 2ZWMA 3F5SA 1R5JA 4UMVA 3C98A 3DL7A 4MQ6A 2AXNA 3AJRA 2IV3A 3RRMA 3SS7X 4EO7A 1HMPA 3EZLA 4JT4A 3ZLVA 4PX9A 1ANKA 3CLUC 1NURA 5D6NA 4RIHA 5IDQA 1JJIA 2YXBA 3CE6A 3K35A 3NAQA 1XU7A 3QA3E 4MYCA 4U8HA 2IEIA 3ECAA 5TT1A 3RUIA 1YC5A 4EHJA 1TM3E 2B1JA 2VK1A 2TYSB 4IZOA 4G81A 1X9IA 3VMMA 4DQLA 2QL6A 1J24A 3KZVA 3AG6A 1TF7A 3LLUA 4BZWA 2V74B 3KUUA 1VG1A 2AG6A 4HQKA 3U39A 3KYDB 1BGVA 2GM9A 3G1UA 1FFXB 3BD7A 3IP6A 2V3WA 1TO2E 2VQDA 3KPVA 4UVHA 3IQFA 1V37A 2W37A 2XMBA 4XGKA 3H65A 5D3KA 2XJ9A 1JAXA 2HV8A 4WDRA 3NTQA 4ZEXA 1A8PA 4AW9A 5BWMA 4HTAA 4HNAA 4YBZA 1M2FA 4DA4A 3WG9A 3W34A 2RE8A 1LJ8A 1GDHA 3FB1A 1R4ZA 2JJMA 2YVAA 3NNSA 2AWNA 1KFEB 4J2OA 1QGOA 6REQB 3R74A 4QRIA 2Y1FA 3EG9B 4HQ6A 2YIDA 5ALXA 1X1RA 3CUTA 3P9XA 3UJ6A 3GPLA 5JZSA 4ILEA 1ULSA 1EYZA 2Q5EA 1GPAA 3W7VA 1I8TA 2HEIA 3V7WA 2H0QA 2QNBA 1GKKA 2VJMB 2DF8A 2YJGA 2ZAIA 2F17A 5ALQA 5LZ4A 4QBGB 5IT9A 3N53A 2P7IA 3MK31 5DXJA 4DIDA 5BXYA 3HKBA 4WEOA 5TQ2A 5AKHA 5K6AA 3M3PA 2WFZA 1F7UA 2X1LA 5KDLA 2X7HA 4K2AA 4BNYA 1GY8A 1D7OA 3PX2A 2K87A 4KQCA 1NXOA 3NHZA 3THRA 1CERA 1K7EB 3H3JA 2OCDA 3CNHA 3DCNA 1RMQA 4RA9B 3RHTA 3U80A 3ENKA 5DISB 4RS3A 4DANA 4UXHA 2R85A 4B83A 3Q3EA 3P9ZA 2ERYA 3LC0A 2D5LA 4V1CA 2DULA 1CFZA 4IJVA 4L4RA 4ARUA 2B94A 2OXEA 4CQLB 2V03A 1ABBA 4NAHA 4G5YA 1YB7A 2ZJOA 1Q7CA 4GG1A 2AOUB 1KAGA 4HCJA 5EZQA 1XTRA 4WUVA 4BIMA 3TD9A 3ZQUA 2LZ0A 3BGVA 4HX5A 3B78A 2LCFA 4JLKA 3VQTA 4YUZA 3FMFA 2C84A 3EQ6A 5JTTA 2X15A 2WJZB 4C1BA 4LRYA 4ZYZA 1CUYA 4CKBB 4JI4B 4I99A 3KOYA 2ASVA 3MVEA 3QKWA 5A0TA 1IULA 3DZGA 4HN2A 2OESA 3I2IA 1YZKA 3IP7A 4HAXA 3H8WA 4KVGA 4CMCA 2JCXA 4HNUA 1V71A 2I22A 1J25A 2AA3A 3FIJA 5ISMA 5BWBA 2FSGA 2BOVA 5JEDA 2O1SA 1S96A 3PVCA 1J23A 2ACEA 4EI8A 1HYBA 4CI0B 1JDJA 3KEMA 2W2QA 3TI7A 3BRCA 4NOJA 3MB5A 2BUBA 3PNMA 4BWGA 3M1AA 1P7VA 3QG5A 2CNLA 3HB1A 1E63A 4DN6A 1G6HA 1Y5LA 2RGBA 3AL2A 5AR1A 5LQKA 4H7HA 2YJ6A 4H0CA 1L7OA 1W5EA 5LXTF 3SR3A 4OYYA 2G9QA 1DJNA 1L7BA 2IYYA 3O92A 4HDNB 5K05A 2AYZA 2HHHB 2HXGA 4A92A 4KXVA 3WV5A 5BV1A 3FHCB 3ANMA 4ITRC 4DQKA 4OXIA 2F9MA 4Q6BA 1MJHA 3K1YA 5KKAA 3D0QA 5FI3A 1XWIA 1O9HA 2AMFA 2DTEA 5E7IA 1E3MA 2C59A 1YDFA 4PAOA 1UKAA 2A3RA 4YLGA 1M34E 2X86A 5EOVA 2ATIA 1NVMB 3K2IA 4Z0HO 5AXDA 3SZUA 4PZAA 3FKSD 1H69A 1KKUA 1EWQA 1YZFA 1JB1A 2JJQA 4C22A 1KSJA 4HVLA 4EFLA 2QN7A 2ZSJA 2F1JA 1TECE 3LVQE 1QHFA 1SC9A 2GBIA 3GRFA 3OFNA 1UFKA 4PLPA 4RA9A 4RSMA 4B3BA 4DQUA 1TADA 4FYJA 4D9JA 1UKZA 3WXBA 2CL5A 3F96A 2QRPA 3OTQA 2Y2UA 2R751 2D3TA 2V5UA 4OXNA 2PFGA 2B6NA 4BXOB 2RMKA 3GQBA 1ZPDA 3WIUA 4P8RA 4QZVA 4G5HA 4P31A 4TWRA 1OREA 3O94A 3QEBZ 2VR1A 3FLMA 3CX3A 2BMJA 3B38A 5LXTA 4DT1B 1LUAA 1LW6E 2ZWOA 3RUFA 3NNNA 1LBSA 2IHUA 4G8CA 2AOTA 5A2QA 3OF3A 3O4RA 4HKTA 2DH6A 4HNSA 3NDIA 4XD7D 3L05A 3L7BA 5TMDA 1ORVA 1XYGA 3CBGA 2R6AA 4NOLA 2PGOA 3MRXA 4MXDA 3ROKA 2IS6A 4MRMA 3SC6A 1A8SA 4N48A 1FYEA 3WGTA 5JS1A 1O8CA 2IF2A 3HXKA 1PYGA 3P1JA 3CTPA 3RIEA 4W7IA 2FZGA 3IULA 3KAKA 1NASA 5D5PA 3UTCA 3H2IA 2H59A 2CBXA 4JB3A 4I55A 5KNLA 1FDVA 5AJHA 4N7BA 1IE3A 3WLNA 4GDFA 1HY3A 1I1HA 1KI4A 1QDLB 4E51A 4JEIA 1SIOA 4EFDA 1HT1E 1KOFA 3KOMA 1SD1A 3ZJUA 3L8DA 2DKOA 1U7DA 1UF9A 1YGPA 3BJEA 3D1JA 3P0HA 4LRUA 1U1IA 1Z7EA 1NYTA 4OGLA 4TWZA 4ZOCA 3A26A 1NBWB 3HA7A 2JVKA 3IJPA 5A9TA 4FPXA 1JHZA 1JF8A 1JHQA 5AVWA 3WJAA 1GQRA 4UAJA 3ZE1B 3CRQA 4BMXA 3GQBB 3BQMB 1G8PA 2J6HA 3ZCSA 2YVKA 5KOHB 1GIAA 1GRVA 3V80A 4EJ2A 1G1AA 1HT2E 1PT9A 3ADKA 3MWEB 1DJLA 4UPDA 5FNVB 1AUVA 3KFVA 1JIIA 3H97A 5ESDA 3G02A 4UUQA 3CUVA 2VBCA 1EG7A 1G6Q1 1ZC4A 4V0SA 4J4TA 5J2UB 1G66A 4NYMQ 5JOQA 2V3VA 3SBXA 2ZWPA 1EFVA 4M1TA 3F6PA 1S02A 4P7KA 4UBKA 3P94A 5D5QA 1E6WA 1Z6TA 3H7IA 3T3NA 3RLIA 4CLHA 3HXLA 2GQ0A 1NQVA 2NN3C 1DUVG 3P8ZA 3TQIA 4DJJA 4I81A 5EERA 4Q7KA 2MWMA 4BFXA 2R1UA 3FKSA 3IT0A 4XB2A 1WETA 4P4SB 4O2AB 1I36A 2ACKA 1NQXA 3JQGB 5CT5A 4EA9A 2J6BA 3VHXB 4UEWA 1QAOA 3I04M 4ZT2A 5TSDA 7REQB 2QLJA 3CNNA 4JB0A 3V8VA 4DMRA 4RK7A 4TLCA 2V98A 5ECDA 3R4VA 1RWVA 4NK4A 3TZEA 4B6JA 4DV2B 4P92A 4N65A 3DBOB 1PGNA 4RK1A 4TUYB 3T52A 2OUIA 2YNMA 1KJNA 4DUGA 3LWBA 3PA8A 1U7TA 4XUCA 3LY9A 4PGFA 3IB6A 3V1YA 4EO9A 2X2OA 5A9SB 2BM0A 2C9DA 1MB4A 1Y8QB 3AR4A 4IUBS 4TTPA 1H5UA 1CZUA 5ALVA 4A03A 2RD2A 1SVMA 4JP2A 4R01A 1MC8A 2XGOA 3DVAA 1CKEA 3ROQA 1ACJA 1XEXA 2ZKIA 1J2UA 2B82A 4NMHA 2LV8A 4K9OA 5FPTA 4ZDWA 1AB5A 3HCCA 2J4DA 2QN6A 1MABA 3UJ8A 1PN3A 1TZ2A 3WZMA 4RTLA 3Q15C 2JEYA 4UTZA 5K0EA 2AQKA 1YI0A 1QS0B 5A0VA 4L9SA 4BL5A 5LC1A 1ADBA 1NSTA 3IIIA 1SOWA 5COQA 5EHZA 1P2FA 4AJ9A 4R83A 2GPYA 1PDOA 2JA2A 3EVGA 4LYGA 3B12A 4HJRA 3V7YA 2WZDA 4ALIA 3HO8A 4G3XA 1OHHD 2PA0A 3GA5A 4MPTA 3L1HA 1Y63A 3B2QA 4PLWA 1G0OA 2EAUA 2JAUA 3GNTA 4H3HB 2RIRA 4H6XA 4Q6WA 4WXEA 3ZVRA 3P19A 4BX8A 3IA7A 1EXMA 2BY4A 2H65A 2NZYA 4KEAA 2ZXFA 3UK0A 5ALZA 2HRQA 4RD3A 1SBHA 2HMVA 2VZ0A 5IKMA 1NW4A 3BF8A 3PI7A 3TTSA 4Y1EA 2PX5A 3PS9A 3QUTA 2DHQA 2J31A 2HA2A 5HKAA 2UZIR 4G63A 1E6EA 1IN4A 1J8MF 1P9WA 2IXAA 3BFXA 3QIAA 1R88A 1CUSA 3MOSA 4MKFA 1E32A 4XQEA 3RHZA 3W8DA 3NVAA 2P2DA 4KFTA 4HXGA 1SN7A 4W9RA 5AW8A 4JUBA 2MSEB 3VUFA 1LBTA 5M34A 1GNLA 1R8QA 4QICA 3BXHA 3OOYA 3QKTA 5C8YB 1NBME 2WT4A 2PVCA 3LPNA 5DFAA 2M1ZA 4KQJA 1BO6A 5EXPA 1G8GA 1Q0RA 2XH8A 4I5DA 1TRKA 3FZQA 4KFRA 4MJXA 4UHEA 5DW0A 3L01A 5B1DA 1L5LA 3WQRA 2VG8A 4IGAA 2EZ8A 3FDXA 1AKYA 1V47A 4NFLA 4Y9RA 4YHBA 3UO8B 5BR4A 3EMBA 4CEJA 1FJHA 2C7BA 2BEWA 5IDXA 1AGXA 4IVNA 1HR0B 1YR9A 5T3YA 2ECKA 2PM8A 3BCHA 1R0BA 5ETJA 4KTTE 2MYTA 1W2GA 3IEIA 4D7AA 3KYIB 2B6HA 3EARA 3FJOA 1ZD1A 3E8XA 2FKAA 4NARA 1WCYA 4M0FA 1QP7A 3R7DA 1GQSA 3Q8LA 2PUAA 2ZI6A 4BQRA 2VXOA 4RHUA 2NXJA 2KI5A 1IRXA 5B3AA 1UJ5A 5CDTA 5IW8A 3T35A 4PPFA 4P0QB 3S7ZA 4PG7A 1QHNA 2Y0PA 2FN7A 1JEJA 3NOXA 4G09A 1PF7E 3AFIA 2HMWA 5ENVA 3V8MA 3Q87B 1QQ5A 4QBFA 1QV9A 4R05A 5C3UA 4Y1RA 1Z2EA 1IM8A 1GOTA 3A14A 3OQ1A 2A0UA 1NDHA 4R0NA 4XCQA 4ZEWA 2NO0A 1QQTA 2NQ8A 3VC3A 1VCMA 1UJCA 4KLCA 4N03A 4XDHA 4DXDA 1K86A 4B71A 4LQDA 1SHJA 2ORVA 4M37A 5LQSA 1PR2A 1SIUA 2O48X 1CNMA 1FSSA 2C99A 3ETDA 3LKBA 3GT4A 4FDVA 4UU1A 1NKTA 3VDXA 2AN1A 4XGNA 3DVRX 1GPDG 5L4LA 1JL3A 1IN5A 3I9V1 3L46A 3FCXA 3FDZA 1Z6AA 3HB7A 5COAA 5CW2A 1KBZA 2G88A 1NKVA 2ZPAA 3DHVA 3IPCA 3BWXA 3UPTA 5KAMA 2VT7A 4WBSA 2PNFA 4H6WA 4LJKA 2C5AA 1KF0A 1Y33E 2FWRA 2D74A 2M1XA 5C32A 3N8GA 2C8VA 2DSNA 4JVNA 5K20A 2C1ZA 4NBKA 2O20A 2FUKA 4PO8A 4XLTA 5DHSA 2IPXA 5LYJF 3CW8X 3PBKA 3QNMA 1S8AA 3MT7A 3LTNC 2AZ4A 2PD6A 3ZLJA 4MRNA 2WHPB 5BSGA 3K70D 1J9ZA 4KVAA 4DV0B 4LX0A 3MTEA 4ZVUA 2O3TA 5F78A 4W5NA 2QP9X 1E59A 1EDOA 2QIOA 2W9XA 5EIBC 3TIXB 1DLIA 2P3OA 3I9JA 4W5JA 4XIGS 3WQBA 1VPEA 4L22A 3VSBA 2BGGA 2R11A 4WLOA 4HAYA 8ABPA 2CFOA 1Q3TA 1XYVA 5THXA 4EYQA 1BW9A 3HEMA 3AI7A 2VCYA 3NBZC 3RT1A 2B25A 4OLAA 1IOVA 3ABIA 3OQIB 4HDSA 5L3SB 4LJSA 5L3QB 4L50A 5BSKA 5DTJA 5DLPA 2CV0A 4N5HX 4RHCA 4E5PA 1SOUA 2AKEA 4D3YA 1CIPA 2VUHB 4WNIA 1Y7TA 4YB8A 3ZBQA 5CIYA 2PUDA 2NP7A 1TL7C 3X2FA 2BWJA 2IDJA 1AKMA 1KYXA 1T8RA 1TEVA 2WKPA 4X95A 5CR9A 3T3PB 3H2HA 4L16A 3ZI7A 4YAUA 2OBNA 3E9DA 1MXHA 5BV0A 6YASA 3DWFA 4BHTA 2JGFA 3NBUA 2E7ZA 3WGQA 3ZE2B 5EIXA 1CRWG 3FDZB 3F7OA 4I1VA 4JQCA 2DBVO 3EXHB 4S35A 4AMVA 4HDOB 1R64A 3ROFA 5K0JA 2GYWA 4DBZA 1LQ2A 1ZK3A 1KY5A 4ACBA 1V8FA 1Z0JA 4YMUA 3EH1A 1LPAB 5HIJA 4BDSA 4ZK6A 1YJBA 3EBLA 2QN2A 4CKWB 5EMLA 4KXQA 3Q8XB 3WB2A 2VXBA 4GICA 1W2WB 1U1DA 3FMPB 3JY6A 4B3XA 1OZGA 3LCRA 4ZAFA 5A06A 3ER6A 3TD6A 3DEFA 2CZCA 3TM5A 1C9EA 2DGDA 2P4UA 3T1OA 2D2FA 3IDSA 1V1MA 4LFAB 2XF2A 4XVQA 3FGNA 2YJ4A 5FLEX 5GONF 2WIKA 4IJUA 1E69A 5TS2A 3HU5A 3U09A 1QR2A 1ZSVA 2EDAA 4OMCA 4CF7A 2YWRA 2FG6C 1NBMA 3SJ7A 3E7WA 3KEOA 1Z83A 4KGXA 1SU6A 1P9OA 2ZE5A 4EM6A 5AW7A 3EZ6A 1LX6A 5MN6A 2WU1A 1F5NA 3VUEA 2EQBA 3DMTA 3HXPA 1T3GA 4YYEA 4DJTA 2C9CA 4QQNA 1AMNA 1FS4A 3TSZA 2EU8A 3V2UA 3ZKWB 4P5DA 3T0GA 1L7NA 5L3SA 1EX6A 2WKRA 2B0JA 4N3GA 2Q3MA 3JAMA 4BLUA 2VYND 3TTXA 1MC1A 2HIAA 5AVOA 2ZQZA 3WIVA 5IX8A 1PR9A 3HVUA 2IXDA 2J8ZA 3CCBA 3T94A 1NXPA 2PL3A 2GXUA 3ANSA 4Q5IA 3BX1A 3QWFA 4BCDA 4FFSA 2F62A 3D5TA 4IHJB 1IPHA 2YL2A 1SA0A 1E99A 3N86A 3SG0A 3ZIAA 1KSGA 5KQMA 1BNCA 4QFMA 2JJ8A 5J1TB 4RHXA 3U9LA 3LOPA 3ISVA 4CQMD 2RB5A 1VOTA 2AEJA 1YDWA 2Y1LA 2WWRA 4LAFA 3CVUA 1B0UA 3LPLA 1GL9B 1R6XA 1YOVA 2XA1A 1ODCA 2H00A 2WMOB 3IAM6 3NEPX 4P5EA 4QJIA 5DWDA 3VSEA 2JH8A 3KEGA 3U3ZA 4DOMA 1ECPA 2GUWA 2G9NA 3UOAB 2YNMD 4DUGD 1O0SA 1KI1A 2EZUA 1J5XA 1FP4A 2GCOB 2OCGA 1HNWB 3MPUA 5C4GB 2QPAA 2AQIA 4AN4A 5M2QA 5AVKA 1DARA 1SUPA 3D1LA 3COYA 1M6VA 4L08A 1MHTA 1L5OA 4QELA 3X1JA 4OXRA 2HB6A 4HT3B 3FETA 4CE6A 4XYEA 5I01A 4YP1A 1Y6GA 1Z4NA 3TO5A 4HDQB 1FX0A 1QX4A 2OZPA 2N3ZA 2VF7A 4NOKA 1C1XA 4QBHA 4TV9B 2V7XA 2GKGA 3IDFA 1YZ3A 1NF9A 2Z2XA 3BREA 1VGRA 2C8JA 3L6BA 3LF1A 3H5AA 3C5HA 3ED1A 2HFJA 2PRSA 2PZ8A 3UUEA 2X77A 2RK4A 1WZ2A 2CXHA 2IXBA 2YRWA 1EB8A 3THXA 2QM3A 4FBMA 4MR8A 3F9IA 2MSDB 2MHCA 4RQBA 4IJ5A 4J0FA 4E2ZA 4UM5A 3D3NA 1TVKA 5B7QA 2CLLB 3I83A 2X0RA 4OHUA 2QM7A 5AW9A 1VBMA 4ND5A 2A1IA 2HF7A 5L3RA 1N2CB 4R2HA 1S1CA 5TRTA 4X1IA 10MHA 3WY9A 3SHVA 1Y7HA 2C2YA 3COVA 3R3VA 2ZYHA 5DM2A 5TT0A 1O03A 3LNCA 3MCTA 1JU9A 4YCAA 3H4VA 3CZ4A 5KTRA 1G38A 3RS5A 3M3HA 4JT8A 4LWOA 4KYUA 5I9MA 3KXIA 4PHCA 1KMHB 2YS7A 3LO5A 2Q8NA 5H02A 4AWXA 2QAGC 1P8AA 5IT0A 1QH1B 5AIBA 3JQPA 5I3ZA 1C7QA 3W8RA 4BEJA 4QT4A 4IUYA 1CHDA 4ALMA 4GPBA 5ECGC 1XCOA 1WVMA 2ANBA 4RD1A 3QE3A 3PNKA 5DXAA 4DY6A 3OOSA 4F2PA 3IL2A 5FJJA 4RIEA 4PSKA 4WERA 1VI2A 3PD0A