5ILOA

Crystal structure of photoreceptor dehydrogenase from drosophila melanogaster
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
265
structure length
256
Chain Sequence
HHVGTSFRGKNAVVTGGAGGIGLQVSKQLLAAGAAKVAIIDLQDNLEEFVKLRAAHPTQSVMIIKMDVANKKGVEATYEEIAKTFGNIDIVVNVAGIFNDKDVQRTLLVNLGGIINSTLSALPYMGKDNGGKGGIVVNMSSVVGLDPMFIIPVYGATKAGIINFTRCLANEKYYQRSGIKFVTVCPGATMTDMFTNFTEKIIFPETSLNKQSAADVSRCILNVLEKDKNGAVYVIEGKRVYPLEIKPQWTGKEQAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Photoreceptor dehydrogenase, isoform C
publication title Structural Insights into the Drosophila melanogaster Retinol Dehydrogenase, a Member of the Short-Chain Dehydrogenase/Reductase Family.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 86
structure length 256
sequence length 265
chains with identical sequence B
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2016-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5iloA00
4XIYA 2O2SA 2O3RA 2CVZA 3PQDA 1Q7BA 4ZQBA 5U1PA 1MC5A 4A2CA 1H5QA 4K28A 3G79A 4AJLA 4IPTA 1PWZA 2BH9A 2DBZA 2HMSA 2JD2A 1ENZA 2CUKA 3K9QO 4Z0PA 1DC6A 3PPIA 2WD8A 2NQ8A 3RU9A 4CUKA 2XXBA 4U8GA 1P0FA 2LDBA 2POQX 3D4OA 1I3NA 2ZQYA 4JBGA 4DC1A 1G0NA 1NQ5A 3WBFA 4NMHA 4CR7A 2XPCA 5KVSA 3RUAA 3K92A 3JSAA 2FHSA 2FPIA 4OGWA 4R68A 4BKPA 2IEBA 2EJVA 1IPFA 4LCJA 4NIMA 3HADA 1BXGB 1NASA 5L95A 3TDKA 1K2WA 2PK3A 3GDGA 3WMXA 4DXHA 1T2FA 2ZCUA 3GRKA 5IJZA 2BI7A 1KVTA 1MGOA 2Y0EA 1RJWA 2AG8A 3GVPA 5BR7A 4LW8A 1XA0A 2I3GA 4YBZA 5G0SA 4P22A 1BVRA 3PHGA 3Q6IA 4FC6A 5I9NA 3OECA 3WGOA 2OP1A 3GHYA 4II3A 1J6UA 1PZHA 4GLLA 3NJ8A 4J7UA 2VRCA 4G2NA 3MOGA 4UEOA 5G4KB 3JQ9A 4YRAA 4YR9A 4RV9A 1W4ZA 4ALNA 4BO8A 1NVGA 2Y66A 5EN4A 8LDHA 1FDSA 1L1FA 1QG6A 4ZQGA 3AI3A 1RPNA 1U5AA 3B1KA 3W4JA 1YE3A 5JAMA 1PEDA 1YS4A 3H9GA 3DZKA 3JQEA 4IDGA 4KDFA 5B4VA 4YDRA 1Z45A 2EW8A 3ZV6A 5EINA 4BO3A 4FD3A 1PJ4A 5GZ1A 4RF4A 2I5PO 2Z5LA 5F5NA 1E3EA 3JYQA 1DIRA 4HKTA 5KJEA 4QECA 4PZDA 1UUFA 1EUCA 2X58A 1TT7A 1NR1A 3AY3A 2ZTLA 3ZWVA 3BTSA 5DCUA 4CQMB 2B5VA 3SLKA 5C7OO 2OGUA 5KNLA 1PU2A 4GMGA 3I5MA 4Z3KA 3IKTA 1EK6A 4FN4A 3IDSA 4E4YA 5FI3A 1EE9A 2X9NA 3W8FA 3WIDA 4IDDA 3BZUA 3PTZA 3PJDA 1PR3A 4NFSA 1HDZA 2J3HA 1UZLA 3KHUA 2NWQA 1CQJA 3DBLA 4X54A 1ENOA 4MVJH 1YB1A 4MP6A 5IDWA 1YBAA 1O0SA 2WDZA 3IMFA 3W6UA 2I9PA 1MUUA 4IQGA 4H16A 1I3MA 4N18A 4C7KA 3D64A 4BV9A 2W2KA 4BNYA 1EBFA 1E7YA 1T2AA 3DC2A 4OO3A 2H5LA 1RYEA 4R16A 3VZQA 3GA0A 3JYPA 4CV3A 1NHWA 4IJWA 5F5LA 4MP3A 4J2OA 1NX6A 4CL8A 3KBOA 4KQWA 1CJCA 4MKZA 1YBVA 5LDHA 1EK5A 4FC7A 1ADCA 3RROA 4CQLA 4LRSB 5JAZA 1PZEA 1PL8A 2NNLD 2Q46A 2QRJA 5KJFA 4IQ0A 2PY6A 3LLSA 1P77A 2QG4A 3WGIA 1F0YA 3DZGA 1YL5A 1E5LA 3CH6A 4IDBA 1YDWA 2QIOA 4XB1A 1DLJA 1NBOA 4WOKA 3I9JA 1O89A 1LQTA 1R12A 3U9LA 3DZHA 4OQYA 1DOHA 4Z6KA 4Z3DA 1E7MA 3K5PA 2WMDA 1U4SA 5DT9A 4I9UA 1CQIA 4KTVE 1X7HA 3TRIA 4U0KA 4CM8B 4I9HA 4Z0HO 3GVHA 4WEOA 4XYEA 1GCOA 3VPXA 1P1KA 2VUSA 3WJAA 2X7HA 4B3HA 4J9UE 5MGBA 1PL6A 5TJ9A 1LC0A 3TWOA 5ITVA 1V3VA 3MJ4A 4J1TA 3VZPA 2JHGA 3B70A 4UVGA 3VPFA 1PJBA 1GZ3A 4RF5A 1IL0A 2IDZA 4NQZA 3WQQA 2WWRA 1UXJA 4KDEA 5JDIC 4IZHA 4CMIB 2XAAA 2AEJA 4R1TA 2GGSA 2X6TA 4ESOA 5G4LA 3ICPA 2PD3A 4S3MA 2PD4A 1Z7BA 1DAPA 5ADHA 3JQDA 3MJSA 5T57A 4YT8A 3ONDA 3PJFA 1T25A 4RQTA 4EI2A 4WLNA 4YYZA 3BTUA 1Q7CA 4EUHA 4PG4A 3I23A 1AN9A 1NYTA 1VL8A 3GFGA 3MWDB 4J0FA 3Q9UA 1HDGO 4BB6A 5ICSA 2NU7A 1X0VA 4JX8A 1E92A 1N7HA 3CUKA 3TZHA 3EVNA 3SBOA 4B3JA 2VHVA 5T64A 3UF0A 1B26A 2DVMA 4YQYA 3VKVA 1EE2A 2HRBA 1N8KA 4R4JA 1PSDA 4CR8A 1WZEA 4TVBA 3JQ8A 2NV6A 3D3EA 4GX5A 3WGHA 3GPIA 3JQGA 1QKIA 1Q1NA 4WLFA 4MOWA 3OJ0A 5KJCA 4WLVA 1LJ8A 4IUYA 1LDBA 1Q0QA 3GDOA 4LSMA 4BNJA 4F6LA 1E1LA 4YJGB 4ND2A 1LI4A 1VM6A 3QIVA 4XDYA 4O63O 5TT0A 4UVDA 5JY6A 2WD7B 4TSKA 2RH4A 4CV0A 4DVJA 4J4HA 3C24A 4ZQEA 3NTRA 3DZFA 4YWJA 1Q0LA 5CPFA 4XYLA 5ES3A 3WR5A 4BV8A 1QYVA 3RC1A 1ZVMA 2C2XA 4ALLA 4E31A 4URFA 5B4TA 4WLUA 3FBGA 2GPTA 4BNUA 5IFLA 3OIDA 3V1YA 2ILTA 2EXXA 4IY1A 3D7LA 4UUPA 4D43A 4DIOA 1QYWA 1R4MA 4TZKA 1SAYA 3IJRA 4LMRA 4NBRA 2HDHA 2VZ0A 1T2DA 2O4UX 3AU8A 4CLOA 4FFPA 2C59A 1JKFA 4FFLA 2AE1A 4E5MA 1E3WA 1WMAA 1J0XO 1OZAA 1T4BA 4RVSA 1U2DA 2GDZA 1SC6A 1H94A 4MVJF 1XDWA 4PZEA 1C1DB 4NDNE 3KEOA 2VHWA 1R37A 3GEMA 4AJKA 1ULUA 3R3JA 5U9CA 3O9ZA 3VVCA 1E3SA 3KYCA 4AJNA 4LSWA 1A7KA 1I10A 2BLLA 1X1EA 2CDCA 4YAEA 3RCBA 5A4DA 1OAAA 1ZK1A 2PKQO 1SOWA 1YQGA 3VTZA 1VE9A 4RF2A 1NP3A 1LLQA 1BG6A 1LDMA 3LU1A 2B4QA 2HCTA 4NZ9A 2B4RO 4D0RA 2NU8A 3RQSA 5I9LA 2XOXA 5GZ3A 5B12A 1VSVA 1A5ZA 4OQZA 3AW9A 2ZCVA 3H9QA 1PIWA 2YDXA 5C7LO 3B20A 4DREA 1EMDA 4C4OA 4BS9A 3OSUA 4PLZA 3RUCA 2D3TA 5JAQA 2C82A 5C7IO 4FCCA 3AFMA 2J3JA 1JKIA 4RZIA 1VI2A 3Q1LA 1XR3A 3IJPA 4RLSA 1IB6A 5ENVA 3PWZA 4HFJA 4E3ZA 3R3SA 3OMLA 2YHUA 4ND5A 1EVZA 3FWNA 3TFOA 1RM5A 3OIFA 1B15A 1XKQA 3FN4A 4K6CA 2W2LA 2RBEA 2VCYA 2JHFA 4PLWA 4R9SA 3K73O 3L9WA 1OI7A 1I3KA 5BNFA 1OFGA 4IGFA 3SEFA 3WLEA 4BKQA 1KC3A 1Z6ZA 4OOFA 5T8KC 4BNKA 2E82A 4OMUA 1PR9A 4MKXA 2OORA 3H3FA 4W9NC 2B83A 1FXSA 1HXHA 2VZ9A 2B0JA 5J23A 3QA9A 3HG7A 1WXDA 1FJHA 3PJEA 2EHDA 4QT0A 1GEGA 1RKXA 2GN4A 3PJGA 1RM4A 2PD6A 3PP8A 3UGKA 5JCJD 3UXYA 1DDOA 3SJUA 3ZNOA 3V1TC 2EERA 1A9ZA 1J49A 3LT0A 4R51A 2R00C 1ENPA 3DOOA 3A06A 4GX2A 3BXXA 1ISMA 3SXPA 5L7WA 3C7DB 4CM4A 3QQPA 2Y1DA 3ZHXA 3JQBC 4PZCA 1Q7GA 1O8CA 3H9EO 4G81A 1BWSA 4R5MA 3TJRA 1UZNA 3D3WA 3LZ6A 4YACA 3UOGA 1NQOA 1BXZA 1JAYA 3VVBA 3ORFA 1P33A 4WLEA 4KUEA 1U7HA 3ZGYA 2TMDA 3F4BA 2EP5A 3DDNA 4OAQA 3ZZNA 1QSGA 5BT9A 2Y0CA 4Y9DA 2Y1OA 1YRLA 4Z9YA 3WQSB 4BNXA 2B37A 2NACA 4P4NA 4CLRB 2O2YA 4IIVA 1KBZA 3H5RA 3OIGA 2VOEA 4J16A 5JDCC 4NJMA 2NSDA 3WJ7A 3IKVA 4K1LA 4RQUA 4ZGWA 4R69A 3SLGA 3JQ7A 4A73A 3U5TA 3E82A 2FY8A 1E7QA 4HADA 1LC3A 1PGJA 2P68A 3DBLB 1K6XA 4A0SA 2IZZA 3G1TA 4E32A 5CDTA 1JTVA 2ZATA 4Y6PA 4J43A 1T2EA 2X22A 3FI9A 3L0DA 4GGPA 4DLLA 5A3VA 3T4EA 1FDWA 3L6DA 4KMSA 1NAIA 2BHLA 2FPPA 3IUSA 2YQ4A 5F3RA 4WECA 4TVOA 5A02A 1KEWA 1GDHA 1KVQA 2UVDA 2Q2VA 2W2KB 3AOEC 3BMQA 5TSDA 4M8SA 2HUNA 3DAFA 4E5NA 3Q3CA 4J49A 1WMBA 3CZMA 5KJ6A 3WLFA 4GSKA 1IZ9A 2Y05A 2ET6A 1BW9A 3GMSA 3O4RA 4A7PA 4CQLB 3LC7O 5JSFA 4WLOA 3CMMA 4DGSA 4YJFB 4TRRA 3U4DA 1LA2A 4YRBA 3ZNPA 4NU5A 4R3WA 3ROQA 2V7PA 4A26A 4U5QA 4AJ1A 4DPLA 4GBJA 2J3IA 1K6JA 1HTBA 5A9SA 2WTBA 3F3SA 1KVUA 3E48A 3GZNA 1V0JA 3S8MA 2NADA 4D42A 3RUDA 4Q3AA 3H8VA 3RU7A 2X5JO 5JYEA 4R3NA 2JCYA 1EDZA 5CHEA 4D3SA 4JQCA 3UH1A 3PQEA 2HK8A 2VWHA 1ISIA 2EV9A 4RPHA 3ZNQA 1F8GA 1P1FA 1C1XA 3JYOA 4XYMA 3WNQA 2PH3A 2Y1CA 1VKNA 2AQKA 3JD2A 1NM5A 4FGSA 4AJHA 3HDQA 4J4TA 2P9GA 4LVUA 2C20A 1P1JA 4BKRA 3GN2A 1HDOA 3ZWNA 4XQCA 1PS9A 3PFFA 1ZK0A 4RVGA 4DQVA 1LLUA 4PRLA 3UUWA 4FW8A 1NPDA 1EDOA 2CNBA 2TMGA 4KOAA 4P8RA 4YAKA 1H0KA 4BO6A 3MWEB 1GADO 5KVQA 4ZHSA 4RPGA 3JQAD 4BGVA 3U09A 4JROA 2P9EA 1WDKA 2OMEA 3OA0A 2JL1A 2I6TA 2H9IA 5KKCA 1YWGO 7ADHA 3IOYA 2BGKA 4BO4A 2CFCA 4HFMA 1A71A 1GR0A 4P4GA 4RPKA 5CEEA 4B4WA 4E2YA 4IS3A 2GCGA 1HSZA 4W99A 5G0WA 4EDFA 3NDIA 1LDGA 3DAPA 3EW7A 4DBZA 4QEDA 3KLPX 3RJ9A 5DBFA 5G0VA 4QO7A 3KB6A 2WYVA 4CMEA 3SX2A 3ZV3A 3GC6A 1ZBQA 5JAIA 3QLJA 1KIFA 5CFZA 3VH3A 1JAXA 1Y8QA 2FZEA 3GVXA 3GH3A 3WX0A 4XX0A 3QY9A 3WDSA 4JXKA 3JQ8B 1A7AA 4MDHA 2G1UA 3JQGB 3RC2A 1DJQA 4J7CA 5JFOA 3C8MA 1I3LA 4EITA 4FFMA 9LDBA 2WM3A 3H5NA 1DIAA 3PHLA 5K9ZA 3JD3A 3GNQA 5G0UA 1HYHA 1H9AA 1AE1A 3F5SA 4TKLA 1ISJA 2HMVA 4ZICA 1QYDA 4XIJA 2NTNA 5IZCA 5L3ZA 4IS2A 1PQPA 3FNEA 4XB2A 3S55A 5C3MA 2NQTA 2I3AA 2IXAA 3I83A 1MXFA 3OQ1A 1B2LA 1X0XA 3UCEA 2VHZA 1R0SA 4FFOA 3AUTA 3H5AA 2QYSA 4NBWA 4WUVA 1KOLA 5I7EA 3OJOA 2AQIA 4DLBA 2CSUA 4ND4A 2FRDA 1MC4A 2NUAA 2QHXA 1TLTA 2O23A 2GERA 1LSOA 4LK3A 1E3IA 2HQ1A 3ENKA 4BO0A 3OQBA 4RDIA 1AXEA 3SJ7A 1R4MB 1DO8A 3PLRA 4MJLA 5HWSA 3GOHA 3STHA 4CLOB 4CM9A 4RJTA 5FEUA 1RYDA 4QQRA 1UDAA 1I5RA 4J9VA 1E3WB 1C14A 4B8ZA 3QWFA 2JCXA 1P45A 3VH1A 5A5EA 3INRA 1BTOA 1D4FA 1HWYA 4GAEA 2ZTVA 2A4KA 3NYWA 2RAFA 3SC4A 1UXHA 4BNTA 3PYXA 4ZQFA 5CAEA 4QSMA 1SEVA 5KVCA 1KS9A 1EVYA 1CERA 2OHXA 2YZ7A 4YT2A 1NAHA 1F12A 2Z1NA 1VJ0A 1HEUA 2SCUA 3I4FA 1CF2O 4M87A 1EFLA 1BHSA 1T4DA 1QV7A 4UREA 1ADFA 2IZ1A 1S6YA 3G0OA 4HFRA 5TLSA 1OC2A 4ZD6A 3RBXA 2G5CA 4J91A 5C37A 3N58A 3RJ5A 4IJVA 1F17A 2HLPA 3EY4A 4MPDA 4F3YA 1EQ2A 1N9GA 3WS7A 3C3XA 2CF5A 4R9RA 4WGGA 3LDHA 4TMFA 5A5FA 4LRTB 2ZYGA 2HJSA 3ZU4A 2VOJA 4I5FA 4DA9A 1GD1O 1KYQA 3DO5A 4K6FA 3F6YA 4CLEA 2OBYA 2Q1TA 1GQQA 3PHJA 3ZHBA 4GKBA 1OOEA 1R66A 5K6AA 2VNSA 1R15A 3RKRA 1YQDA 2EJWA 3M1AA 4GVLA 2Q50A 2BRUA 5BSFA 1E6UA 1O94A 1QLHA 3OJLA 4NBUA 3KSZO 2GR9A 4XZ3A 5AOVA 2VHYA 5CDSA 5CEJA 5COQA 1W6UA 4QFCA 4YRDA 3B1JA 4KWIA 4Q3DA 3DTTA 3VH2A 2FR8A 2YFHA 4XQGA 5I7SA 3JQAA 1CEQA 1SEPA 1WDMA 2I65A 4HUJA 5HTOA 2Q99A 3WB9A 3KSDO 2H1SA 3C7AA 1UAGA 4YVFA 1PS0A 5CDGA 3ZDFA 2P5UA 4DMMA 4P4LA 4OJNA 5G2OA 3EGOA 3BIOA 5JE8A 2G76A 1O95A 3GZ4A 2X5KO 3AK4A 2W98A 3GMDA 1LDYA 1MB4A 3C1OA 3QVXA 5CEFA 4WNIA 2J5RA 4D79A 4DQXA 3TF5A 4FJ0A 5H83A 1FK8A 4CM4B 5JW6A 1JKJA 2UV8A 2HKIA 3I9MA 3GNTA 1FF9A 3GGPA 1PJTA 3D3WB 3ZWMA 3PZBA 4IINA 3DAGA 3LT4A 3E5MA 3L9XA 4B7XA 3I4CA 3K30A 4HNGA 1WZIA 4B4UA 3D5TA 4ZN6A 1A72A 1B7GO 5JY1A 3GT0A 3JQFA 3WWZA 3QJ5A 1M6WA 3G17A 3RI3A 3JQ9C 1LXCA 5TQVA 3B6ZA 5L4LA 5G0TA 3NDRA 2BF7A 2WE8A 4TROA 2Q1SA 4BNMA 4YEDA 1SOVA 3I9NA 4IM7A 2UYYA 2VT2A 1LRLA 1KY4A 4NJOA 1LX6A 4TQGA 1CIVA 3JQ7B 2NU9A 3KEQA 3L6EA 4ROSA 4E5PA 5KOIA 3HFSA 5L51A 1NWHA 4EEZA 4MINA 3HDYA 4RGBA 3BMOA 5C5IA 3T4XA 4RPLA 4E5KA 3MZ0A 4TRMA 4Q3CA 2FN7A 2GLXA 4AVYA 4CMHA 2J5QA 3OH8A 1PJLA 1LTHR 3Q0EA 2ZK7A 2OO5A 3IQDB 2GASA 1EBUA 3DHNA 1D8AA 3GEGA 3HZZA 3KZVA 3MJCA 1YXMA 4GX1A 3W6ZA 2QX7A 3BMQB 1XWFA 4N7RA 4E12A 2YQ5A 5THKA 4I5GA 5IZ4A 3WMWA 2IODA 3CKYA 4NBTA 1BVUA 2H63A 2OXIA 3UKOA 1QYCA 1BMDA 5JCXA 3KV3O 3RC7A 3DBRA 2OP0A 3F46A 2O3QA 1BW9B 3L07A 2DBQA 3QP9A 2JKVA 1NPYA 3U49A 5JLAA 3KYDA 2I99A 3A9WA 2P91A 3ONFA 3OJEA 4XKJA 3DFZA 3RFTA 1YONA 1LBEA 1U3UA 2OZPA 4WCFA 2DBVO 3HQ4O 1DRUA 4TRJA 2YV2A 1A9YA 2W2LD 3L77A 4WOJA 1LLDA 4CM7A 5BNTA 4UVIA 2E37A 2JD0A 2PV7A 3O03A 5A9SB 4XQ9A 4BHTA 3DOCA 3GZNB 2PKRA 5L7TA 3CEAA 3R1IA 6ADHA 3HN7A 4CM5A 5DCYA 4ZRNA 2ZB7A 4XD2A 2GZ2A 1GV0A 3WICA 1ZMTA 3LK7A 4R1UA 3OJFA 5TGDA 2B69A 3UICA 3VZSA 2EWMA 4UVHA 1C1XB 3TNLA 3ADPA 4PCVA 3AI2A 3PZRA 1YQXA 2X0NA 1WAMA 2FOIA 5BSGA 1FDVA 3K2EA 3FCOA 2Y0DA 4H7PA 4K9DA 3S2IA 1ZK4A 3C85A 4OKNA 1RM0A 3I52A 1I0ZA 4D0SA 1ONOA 4RZHA 3WQRA 3W8EA 3U62A 3ZWAA 3QRWA 4E30A 3HDJA 4A03A 2AQ8A 4FOOA 5L4SA 1A27A 3BMNA 2VWGA 4GX0A 2X1HA 2AEFA 4ND3A 1NFRA 3ZU2A 4CLHA 3DFUA 2Y1EA 4GI2A 3KSUA 5HS6A 4U0JA 4I5EA 1M76A 4FFNA 5FI5A 4JP3A 4JCOA 1SB9A 3JD1A 2EGGA 9LDTA 3F47A 5IN4A 1NXQA 4UUNA 1U3TA 3OEWA 1X1TA 4FIZA 4UVEA 1M6HA 2YHIA 2EP7A 2Z95A 1I8TA 2JD1A 3TL2A 1O9BA 4YJHA 1QR6A 2NM0A 1Y8QB 5JYDA 1MLDA 3BYZA 1UXKA 3L6OO 4QX6A 4M89A 2ZKLA 4RDHA 3P7MA 3AY7A 3QWHA 1LDEA 1NVMB 3NV9A 4GSLA 4BKOA 3K8ZA 5DOZA 3FTPA 1X7GA 1ZSVA 3ITDA 8ADHA 4IJKA 2I76A 4B79A 1L7EA 4M55A 4U6QA 1ZH8A 1HDCA 2JFGA 1SB8A 4GQAA 1LSJA 3OM9A 3E9NA 3RUEA 4A27A 3CTMA 1RM3A 3NKLA 4N5NA 4XCVA 4BVAA 2IEDA 4BNIA 2NU6A 4GKVA 2Q1WA 1NVTA 4M86A 3WFJA 1PQWA 2VHXA 5LC1A 3N74A 1N5DA 2C5AA 2GRAA 3DHEA 3EUWA 3U3XA 3I9KA 4NI5A 2HK9A 1NWCA 1QLJA 1U2GA 2QRLA 2DPGA 3CINA 4WK6A 1DC5A 3FRJA 2F1KA 1LU9A 1TI7A 4NNJA 2CDBA 3VPSA 3ANLA 3ETEA 3DHYA 1E7WA 1PJ3A 5I8WA 3RBZA 3LF2A 3DTYA 3QHAA 4AFNA 4HY3A 3D4PA 3K31A 3WNVA 4ZQHA 1U1IA 3VH4A 1DHRA 2PNFA 4XRGA 4EUFA 1J4AA 3IIEA 1SNYA 2PTGA 4BGIA 3QWIA 1B8VA 4IJUA 4TZTA 2AE2A 4U7WA 1WLYA 3T7EA 1V9LA 2ZTMA 2B36A 3GEDA 4O0LA 3WYEA 4BO2A 3JQCA 1ID1A 2V6BA 1U7TA 2C2YA 2Y68A 1DFHA 4PIVA 2VUTA 2EIHA 4Q3EA 4FBGA 1C0PA 4FDAA 5KWEA 6LDHA 2VUUA 1JA9A 3NGXA 1U4OA 3FTNA 2HO5A 5L7YA 5JS6A 3ZHZA 4U6SA 3DOJA 2C54A 2IE0A 1IHYA 2NTJA 4YA6A 4YAGA 3I1JA 1P1IA 1ZCJA 2PGJA 5JMWA 2QZ9A 4I8XA 5JMPA 1GYPA 4GWGA 4XJTA 2C29D 1IHXA 4HNHA 1ZXLA 3ZWXA 1XU7A 1XU9A 1N9GB 3BTVA 4BL5A 3DBHA 4MO2A 5DP1A 2JAPA 5EQFA 1QP8A 2D2IA 4WCDA 3TZCA 1I2CA 2BI8A 5DP2A 2C07A 4DPKA 4HV4A 2OOSA 4ONEA 2HMUA 5T5QA 4D44A 2O4CA 5I8ZA 4GWKA 1U9JA 1JDJA 4I08A 4PLPA 4RLHA 4ALMA 1DBVO 1I30A 1UZMA 2Q4BA 4YPOA 3GLQA 3HDHA 4A5OA 4HFNA 4Q39A 4CJXA 3GVIA 3BTOA 1P9LA 3UCFA 2X9GA 4PLCA 3M2TA 1YB5A 2P5YA 1HE5A 3AUAA 3RAJA 3RASA 3PGXA 4RPJA 3JQAB 4L76A 5L9AA 3VDRA 1M66A 5JDCA 1GTMA 3IS3A 4L4RA 5EESA 1UP4A 3Q11A 2FSVA 3FNHA 4YT5A 4D7AA 3DONA 2Z1MA 3MJTA 3ONEA 5KCZA 3Q2KA 1PTJA 4M1QA 1LDNA 1MP0A 3RFVA 3E9MA 3PK0A 2PGDA 2VQ3A 3DQPA 1V3UA 2PGLA 3HFGA 3TOXA 1XSEA 2FWMX 1Y8RA 3WYCA 1LRJA 1K5HA 1GV1A 2W4QA 4LN1A 2R2GA 4QO8A 5A05A 3ZWPA 4EW6A 4AICA 4XYBA 2ZYAA 4ITUA 3AOEA 3QVWA 4QTZA 4J3FA 4JLWA 4Q3NA 3D1LA 4II2A 1H93A 3RVDA 4JIGA 3IL2A 1HDXA 1YJQA 4N5MA 4Y98A 4FR5A 3ZU3A 4CV2A 2IRWA 3WTCA 3QWBA 3EAGA 1DEHA 3O8QA 3W1VA 3ZW8A 5DULA 4D45A 4CM9D 1Y81A 4M54A 1E6WA 3WWYA 1GPJA 2HSDA 4LVCA 1PJSA 4EUEA 2DU8A 3WXBA 1E5QA 2X0JA 1EVJA 1D1TA 4B4VA 1QORA 4PLVA 3A28A 3O26A 1ZSNA 1QXSA 2RCYA 1BDBA 1B8UA 1DLIA 1GYRA 4R5HA 3U4CA 2ZTUA 2D0IA 4WNCA 4H3VA 4E13A 2VYVD 4XR4A 4XGKA 1PGNA 4IIUA 4CUZA 4CR6A 3ITKA 5T67A 3PXXA 3BA1A 1V8BA 4XYGA 5AXBA 3S2GA 2YJZA 1DRWA 3RUFA 4XR9A 3ZWWA 5K0ZA 1LUAA 1Z7EA 3BMOB 3MCVA 3ETGA 3ZWOA 4MIOA 5TF4A 4PG8A 3G3EA 4AJIA 3INTA 3U4HA 1XCBA 3TN7A 2DAPA 2VTEA 3X2FA 4DBVO 4DIBA 3G1UA 2AMFA 3TZ6A 2RH8A 5TRTA 5CDUA 5CDYA 4IDAA 5B37A 2DBRA 3TFQA 1PX0A 1ZEJA 3IUPA 1NQAO 2VZ8A 4WE3A 2D59A 4D46A 5IAAA 1YDEA 1CDOA 1MG5A 3K2BA 3DBRB 4E0BA 1DC3A 3V2GA 2GO1A 3HE3A 3VDQA 4CPDA 1VLLA 2OBNA 3KYDB 3L4BA 3OQ6A 4O1MA 4CM3A 1G0OA 1YH3A 1C0KA 4IMRA 4PLYA 4BO5A 1KY5A 4HX5A 1ADGA 4WCFB 5I7VA 1GY8A 2HRZA 1O5IA 1MA0A 5CG1A 3ZW9A 4DUPA 5DBGA 3WGZA 2C7VA 3VPGA 4DYDA 4PG5A 4OXKA 2O50A 3DMYA 2Q45A 3GG9A 4TKMA 4OXNA 1W8DA 2YDYA 3LC2O 5KKAA 1ONPA 1DPGA 3GRPA 1JVSA 4TWRA 3E9QA 3IP3A 4BGUA 1R0LA 2EKPA 3ZV5A 1L7DA 2GN9A 4AJEA 2I66A 1H2BA 4Z9FA 5IDXA 3KYBA 2X4GA 1ZSYA 1IY8A 3ZWYA 4Z0TA 4PFJA 2VT3A 2HMWA 1ISGA 3E8XA 3OICA 1TEHA 3RD5A 3WTBA 5DOVA 1TT5A 2DKNA 4NBVA 1YKFA 4GPD1 1DIHA 3HUDA 5ILGA 4Q3BA 4FJ2A 1Y1PA 3KLMX 4W7IA 3EZYA 2RHRA 3BMNB 4QFDA 1LRKA 3GN1A 1HSOA 5BSHA 4WJZA 3WSVA 1SO8A 1N7GA 1PZFA 2PKQP 1C0LA 5EMHA 1E1NA 4OYRA 4ZRMA 4XGNA 3GGOA 3KVOA 3KXDA 2O3TA 3PVZA 5FFFA 1CWUA 1UJMA 3FWZA 4DC0A 3SVTA 4ALIA 1B8PA 1W73A 2J6IA 3UW3A 1KVRA 3E6AA 4BMSA 4LMPA 1WPQA 1I2ZA 5TX7A 3CXRA 4F46A 2BFPA 1DFIA 2YHIB 3ASVA 4EZBA 3WGTA 1K3TA 1O6ZA 1UXIA 4TRNA 2GYYA 4YJHB 1NFFA 4HBGA 4CM6A 2PZKA 1R4NA 3TQHA 2DLDA 4JBHA 1VJTA 2RIRA 3DMTC 3JCZA 4J4BA 3ROMA 4W6ZA 3ENNA 4MP8A 4MVJG 3NTQA 4IQ8A 4B3IA 2R6JA 5JO9A 3H3JA 1MV8A 5ICMA 1KETA 1P0CA 3DB2A 4R1SA 4QUKA 3BHMA 2CVQA 3UHAA 4D3DA 1U8XX 4FQ8A 3JD4A 5COBA 1E7RA 3WGYA 4ILKA 3UFXA 4DRYA 4E2ZA 1X15A 1ZW1A 3W4KA 1KC1A 2G0TA 3ZN2A 3C1TA 1X7DA 2A94A 4INAA 3DEYX 2VTDA 1PZGA 1AUPA 1ZKMA 2O7QA 1ADBA 2VYVA 3HB5X 2BKAA 2E4AA 4MIYA 3OF2A 1NFQA 5A06A 2EEZA 1U28A 3KYCB 3RIHA 1AXGA 3BMCA 4BNWA 1XIVA 4XA8A 1CYDA 2D5CA 1WP4A 1DHTA 4PLFA 3S2FA 4PGFA 3VAZA 2DM6A 4FS3A 3G49A 4BNHA 1DB3A 2DTEA 4IDEA 1VKOA 2BFOA 2ZIZA 1KVSA 4OHUA 3H7AA 1HE2A 1DC4A 1ZO8A 3F4LA 4BNNA 1ONNA 1SCUA 2DT5A 3PIDA 5BSEA 2YW9A 3MTJA 1IULA 2Q3EA 3CMCO 2DFDA 3ZU5A 3I6QA 2CF6A 2GF2A 4M49A 1QYXA 5FWNA 2X9VA 3N7UA 4ALJA 1I24A 4Z9XA 2ZB4A 5GZ6A 1HRDA 3WSWA 2BELA 2IXBA 3GR6A 1P74A 4R1NA 1DIGA 1HLDA 4J1QA 5A03A 5IDYA 5ER6A 1HL3A 1ZJZA 1D7OA 2BD0A 2X0IA 3GG2A 1V35A 5I7FA 3DBHB 5EPOA 3R0IA 4CM1A 2BFAA 1GCUA 1K89A 2FMUA 4OXYA 2ZYDA 3QVSA 3VPHA 1WWKA 1OMOA 3FPCA 3AM3A 3AOGA 2Q2QA 1DXYA 4NH4A 3WYBA 2AA3A 5EJ2A 4DMLA 3Q9NA 1NHGA 5AXAA 1QV6A 3AUSA 2ZB8A 1FDUA 3IC5A 5CP8A 1J5PA 2V65A 1E3JA 1H6DA 4BO9A 4PN3A 4OSOA 2FR0A 2PWZA 3QE3A 2W8ZA 4GL4A 3WFIA 4IDFA 4C7JA 2OL4A 3PLNA 4XQEA 1GQ2A 2IYPA 3DBVO 3V1UA 5H81A 3LSYA 3RKUA 4FSHA 3JYLA 2A35A 3JD0A 2AG5A 2CDAA 3GUCA 3LC1O 3S2EA 3NAQA 4I9NA 3H65A 5K6AC 4UULA 3DZIA 4L0QA 2EGHA 1MFPA 4CV1A 4P38A 3LF1A 3ROPA 1ENYA 3VHRA 1C3VA 2BGLA 4J7XA 4FOSA 4MKRA 5TS3A 2QRKA 3C7CB 4CL3A 2NLOA 5L4NA 3WIEA 4E6PA 4JK3A 5AQ1A 4RORA 3V2HA 3X2EA 5KVVA 5EL0A 4PVDA 1NR7A 3HHPA 4YQZA 4F45A 2EW2A 1FMCA 4GGOA 3EK2A 1WW8A 1HETA 4WKGA 3PI7A 1Y8RB 3IP1A 5KJ1A 1TXGA 1T1RA 1E1KA 4CLRA 2P4HX 1U3WA 2DUUA 2WE7A 1LEHA 1MFZA 4KUHA 3HWRA 1I01A 2YY7A 1T24A 4NJMB 2GSDA 2VWPA 1H6AA 4J0EA 5EERA 3P19A 1TA4A 1ZMOA 3GPDG 5ER9A 1VL0A 2CD9A 3KM0A 1N1EA 3OBBA 4XWYA 1BDMA 3GQVA 4RVHA 3V2UA 2GUGA 3O8QB 4PLHA 2AHRA 4YAIA 1EUZA 1B14A 3A14A 3LT1A 4O6VA 4CMBA 3PWSA 3ZCXA 3KRTA 3V8BA 3H6KA 5CPBA 1F8FA 4B7UA 5H82A 1HZJA 2O3UA 1SZJG 3VOSA 2Y1GA 1ZIDA 1HE3A 4AJ2A 1GZ4A 3KUXA 1E6EA 4UEJA 5IDQA 5F1OA 2NVBA 4OKIA 4LCEA 4AL4A 1GYQA 5JDIA 4MVJE 1B0AA 3UAGA 1E77A 4N54A 4DPMA 2DUWA 1E7SA 1P31A 3FR7A 1E1MA 3R6DA 3PDJA 1QRRA 4YJFA 3JQFC 3PHIA 1Z82A 4L75A 2D1YA 5LCXA 5LDGA 1GUFA 1VSUA 5U4QA 3NT4A 1SBYA 4AJOA 1IPEA 1TVEA 4JGBA 3FPLA 1M2WA 2OUIA 2AW5A 3H4VA 2NVUA 1AHHA 2V6FA 2D4AA 2J5KA 1PWXA 1PQUA 1NTOA 4HWKA 5IG2A 2G17A 1QMGA 4L9RA 1KERA 1P44A 4PLGA 3EHEA 1Z74A 4YJDA 4KZPA 3NDJA 2X8LA 4DIFA 4YB8A 1ULSA 3E1KA 2PZLA 4XRRA 4MVJM 1G1AA 3L4SO 2EKLA 2V6MA 4ZJUA 2O7SA 2FSSA 4Q9NA 4DQUA 3RC9A 5TIIA 1JW9B 2X0RA 4UUOA 4BMVA 1ZK2A 2V6GA 1T1SA 1HLPA 2P4QA 5JC1A 1UR5A 5DCWA 5B1YA 4DWVA 5IF3A 2CVOA 2ZJ0A 1P3DA 5TNXA 3ZNNA 4B7CA 1B16A 4RF3A 3ABIA 1H2HA 3A1NA 3B1FA 4FPXA 4PVCA 1DSSG 1VL6A 1XYGA 2X86A 1GUYA 4Y8VA 2DC1A 3NRCA 5AYVA 3A4VA 3F9IA 5DNAA 4AJPA 4L4SA 4HP8A 1NNUA 3KTDA 4WCFC 2VNAA 4IBOA 1WNTA 4UAGA 5BNIA 1JQBA 1Y9AA 1YO6A 3E18A 3AM5A 2X23A 5TT1A 3QWAA 2WJPA 2A9FA 2EG9A 1TT5B 4CQMD 3RWBA 4AJJA 4NFYA 3P5SA 2LDXA 3HJAA 2WYWA 3E03A 4BUCA 3JYNA 4BO7A 4J1SA 1MXHA 1H9BA 4BB5A 5DF1A 1F06A 3PIIA 4EJMA 3U0BA 1EZ4A 4Y6SA 1JN0A 1ARZA 2UDPA 3GY0A 5IN5A 1S7CA 3TSCA 5AVOA 2A92A 1UP7A 1V6AA 3HSKA 1VJ1A 1XQ6A 5A3JA 1U5CA 5F1PA 2JFFA 2O48X 4O5OA 1TB4A 1LSSA 1W0CA 1MG0A 4IDCA 3UCXA 3P2OA 3JV7A 2CMDA 1JLLA 3M2PA 4R01A 3EVTA 3RSHA 2PR2A 4ID9A 1GL3A 1R4NB 2W90A 3PHHA 3D4NA 3PRJA 4PLTA 1N1GA 2UUPA 3W4IA 3S1LA 2OFPA 3QVOA 3H9JA 4R41A 4W7HA 2YFQA 1UDBA 1YOVA 3PEFA 4JBIA 3ANNA 5HM8A 2J3KA 1GUZA 2PZMA 1XGKA 2YYYA 2VWQA 4LISA 4WPGA 2C7GA 5HBRA 3T7CA 2GZ3A 1ORRA 3KO8A 5JC8A 4WEQA 4J2HA 4F6CA 4JN6B 4W82A 3SC6A 4MIEA 3K96A 3RUIA 4BIIA 2JAHA 1YL7A 2GD1O 4YT4A 3WOHA 2B35A 2GN8A 4EBFA 1EUDA 1XHLA 5KIAA 2B5WA 5JNLA 3I6IA 4RVUA 1B3RA 5I9MA 2VRBA 3WBBA 3BAZA 3HN2A 3NGLA 1I36A 1WDLA 1ISFA 4CLDA 4O59O 3FNGA 4BNZA 1JWAB 3NX4A 1I33A 1K0UA 2DTXA 2I67A 4PG6A 2XXJA 5A1TA 1GEEA 5T8KA 1PJ2A 1XQ1A 3UVEA 3UN1A 2JJYA 3HB4X 2WYUA 3BMCB 1ZZEA 4W9NA 5B4UA 1IOLA 2VYND 3VKUA 3AI1A 4L4XA 3F1KA 3GAZA 3MJVA 3AWDA 3ZI0A 1HZZA 3NT2A 4I1IA 4Y67A 4MVJD 3TZQA 3PYLA 4J6FA 4ZVVA 1EVIA 1B3BA 1YVEI 1ZEMA 4J1NA 1DIBA 1PGPA 4FGWA 1BXGA 1DFGA 4A10A 1ZJYA 1PJQA 4B8WA 4FB5A 4BGEA 5DZSA 2R00A 2G82A 1HYGA 5ILOA 2C0CA 3EYWA 4LGVA 2XF8A 5HRUA 1HYEA 2Q49A 4ZU3A 1GAEO 2AQHA 2UUOA 2P2SA 2Y93A 2GNAA 5A9RA 3JQBA 5JXWA 1ISHA 4BNFA 1CRWG 1MX3A 3NUGA 1JU9A 1XEAA 4L8VA 2FPGA 1E0DA 3ADOA 5KTKA 3OP4A 3DZJA 4MVJI 1ZFNA 2Y99A 3HNPA 3U4IA 2EKQA 3FNFA 1D3AA 1M75A 1HKUA 1NQTA 2E48A 2E6UX 3GFBA 2PZJA 3JTMA 5G4KA 4NK4A 4J90A 4BNLA 1GU7A 5FYDA 4KP7A 1WVGA 5L45A 3I3OA 4EYEA 1YJ8A 3GUYA 3RFXA 4DL9A 4BNGA 4ALKA 2C5EA 3EMKA 2EF1A 4JNKA 1RWBA 2UAGA 1Y5MA 2H6EA 3PGJA 4RVFA 1VRWA 2Y1FA 5DBIA 4DTIA 4DLAA 1VPDA 1ML3A 3TZKA 2QZZA 3M6IA 3AJRA 3GHHA 4NFHA 4B4OA 4EGFA 1Z75A 2ZB3A 3C1AA 4AJ4A 1DRVA 3OEYA 3ZV4A 1V3TA 2HU2A 3LQFA 4JJGA 1EQUA 3EZLA 1EEHA 1GPDG 1I2BA 4CQMA 1PGOA 1FDTA 2D8AA 4XDZA 3NEPX 5IXYA 4RO0A 1SMKA 1R6DA 4QXMA 3MEQA 4PG7A 4OIMA 3OETA 2JFHA 1UDCA 4E2XA 3GF4A 2RHCA 4YCAA 4BQRA 1YGYA 1U3VA 3F1LA 4OSPA 5JO0A 3EC7A 2CZCA 2HK7A 3GK3A 1XG5A 1XLTA 1I32A 1P1HA 4KQXA 1BGVA 2F00A 3P2YA 1OBFO 3ETDA 2YV1A 3QW2A 5L53A 5HA5A 3CE6A 4I5DA 5GY7A 4IMPA 5CG2A 2BFMA 4CMCA 3ROKA 5AXCA 3NJ4A 4YTEA 3H2ZA 2QQ5A 3AUUA 3ULKA 4YXFA 2QYTA 3AM4A 3FSRA 1KEUA 4G65A 4BQPA 3QSGA 1H6BA 1LNQA 2PA3A 4BOYA 1C0IA 1HF3A 3BHJA 4NR0A 1BXKA 3QV1A 4S1VA 1KEPA 2FR1A 2DQ4A 3JQ6A 1YL6A 4JP2A 3BHIA 2PH5A 4EEXA 4FFRA 1F14A 2GZ1A 3DR3A 3FD8A 4CODB 1AGNA 1ZXBA 5A04A 2GN6A 3DL2A 3TPCA 1N92A 1Y5RA 2YV3A 4WASA 5IXSA 4G5HA 4XEHA 3CIFA 1PL7A 4E21A 4UUMA 4CM8A 5A9TA 4BO1A 1HE4A 2D5AA 5T6BA 4GMFA 2FZWA 3H9UA 5BQFA 4IGEA 1UXGA 1T2CA 3ZWCA 4GH5A 5F21A 5GMOA 3NT5A 2ZQZA 1HT0A 1CETA 1R0KA 4L73A 1Q0HA 2FP4A 2QW8A 4DYVA 4HXYA 2VYNA 3PFWO 2NVUB 3K6JA 2IYOA 5F1KA 2YUTA 4CMKA 1A4UA 2DPHA 4Y6RA 3COSA 4NPCA 3AFNA 4MVJA 3AU9A 3GAFA 5DDIP 5DN9A 4CMIA 1X14A 4W4TA 5HS4A 1IZ0A 2P9CA 4L74A 5JPIA 2PLAA 3MTGA 1N2SA 3LT2A 1LLCA 4NG5A 1PJCA 3NTOA 3H2SA 5COAA 1UAYA 4RVDA 4XGIA 1Y9EA 4CUJA 4OL9A 5AXDA 3Q2IA 2JCVA 3CSDA 3ZH2A 3KOUA 4KTTE 4XJSA 4RL6A 1ZK3A 2Q2WA 4GLOA 1AHIA 2VRCD 1U8FO 2AEMA 4CMGA 1IE3A 3GNSA 1LSUA 2WSBA 2O3SA 1LQUA 2AXQA 4ZA2A 1E3LA 2HAEA 4MVJP 2B4TO 4EJ6A 1ZNQO 5THQA 1YBMA 2BGMA 1X13A 1UH5A 4UEKA 4JJFA 4D41A 3DWFA 1JWBB 3VC7A 3DMTA 3MOIA 3W8DA 3QVTA 1HDRA 2ZJ1A 3L4BC 1SPXA 1IYZA 3LVFO 4OH1A 5JBIA 3DZBA 4YAJA 2X5OA 2IZ0A 2O3JA 3FR8A 3GGGA 5EIOA 3LYLA 3CPSA 1XELA 3VZRA 1GFSA 3WGQA 4CMJA 1H6CA 4OOEA 1A4IA 5FF9A 1D1SA 1PGQA 4YJGA 3TOZA 4BKUA 4OM8A 2Q4EA 2NVWA 2DTDA 4CLXA 2WD7A 5JCJA 4JJIA 2PFGA 3I9OA 2J8ZA 4IXTA 3PQFA 4EJ0A 1P1RA 1VC2A 3PYMA 4KWHA 1EFKA 3E5RA 3M1LA 4R54A 5ITWA 4FJ1A 3ICCA 4D3FA 1DAOA 3AY6A 3O38A 3OHSX 4NK5A 1G6KA 4E2WA 1Y7TA 3ON5A 3CZRA 4IXWA 3INGA 2VN8A 3DXFA 3FF4A 1OC4A 2BMAA 3WG9A 2HJRA 3V5NA 4BMNA 2HMTA 4IZIA 1Y6JA 3GDFA 5L40A 1KEVA 3RBVA 3EDMA 3IAHA 4KUGA 3ZWBA 4H15A 3VTFA 3F5QA 3TL3A 2NTVA 4CMEC 3ANMA 5ENDA 3PDUA 4K26A 5EQDA 1NPTO 4AG3A 5MDHA 1GZ6A 2Y67A 1T26A 3FBTA 4PRKA 1PS8A 2WEKA 4ND1A 1C1DA 4NHEA 4BNVA 3OFSA 1YOVB 2E49A 3KETA 4E5YA 2Q1UA 4GVXA 1DJNA 3WGGA 1K6IA 1BSVA 7MDHA 3OA2A 5TC4A 1BRMA 3FHLA 1Z73A 3ST7A 1IUKA 1GQYA 5TJHA 3LLVA 4N5LA 5IZCC 1UP6A 3MJEA 1M67A 4NU6A 2DFVA 3GVCA 1YB4A 4RCVA 3RUHA 4E33A 1R16A 3D5QA 1HDYA 4CMAA 1Q2XA 3ASUA 1ZUD1 3I9LA 3PWKA 3ZHYA 2CY0A 3D0OA 1JVBA
chains in the Genus database with same CATH superfamily
4XIYA 4IMJB 2O2SA 3QX3A 3O74A 4OMCA 1RYYA 4CIDA 4WZZA 2WV7A 1CB7A 2MTBA 4C7OB 1OFTA 1TECE 4H7EA 2B0CA 3I45A 4PHFA 1U3DA 1R3DA 2OD9A 4IPTA 1PWZA 2FRDC 2BH9A 2A9KA 2HMSA 1E9CA 2JD2A 4R2IA 3R8CA 5SV2A 1UFRA 2YKGA 1JG4A 3D31A 3UC9A 3VU3A 4URXR 2NQ8A 3DQZA 4TLBA 3RU9A 4DNXA 4YAFA 3PNKA 2LDBA 2RBKA 1TLFA 2J0UB 3D4OA 4C0LA 4CKWA 1I3NA 1PLKA 5DLEA 5AVRA 5JEEA 3MTBA 3IE0A 1T0JB 4S0XA 4C30A 3QU5A 2EAUA 2ZQYA 2GBGA 4RQAA 5HCNA 3OUUA 1NQ5A 3WBFA 4GEKA 3H5LA 3DLAA 4ZTBA 4WKCA 1H0RA 3R40A 1NULA 3K92A 3RUAA 4DTCA 5EIBC 1JJBA 1DRJA 4JI8B 3QUAA 3RF7A 1IPFA 5GGYA 4LCJA 3P9KA 1ZI9A 1K66A 1L7MA 3OCWA 4KGZA 4OJMX 4P92A 1NASA 3TDKA 5ALVA 1K2WA 3GDGA 3WMXA 1NSTA 4UOQA 3GRKA 1JNYA 4M2LA 5IJZA 2BI7A 1RC0A 2I4LA 4GMXA 1EFVA 2WF8A 4LNHA 1MGOA 1RHUA 2Y0EA 1X9GA 3PQ2A 5DX8A 1RJWA 5K8IA 3GVPA 5BR7A 1P4SA 5TVKA 3MT8A 3EFHA 4LW8A 1NU8A 4NZZA 2QMEA 5DSTA 5LYJF 3ZLVA 5BWNA 3SZLA 4C22A 2FPGB 2XD4A 4LFAB 4FC6A 4R2KA 1FBTA 4B31A 1S4QA 3WGOA 4BB0A 2OP1A 4DWOA 5DNWA 3EVBA 1FQOA 3KKZA 3GHYA 4II3A 1J6UA 1PZHA 1SVSA 5BV8A 3PKIA 3JVUA 3HFJA 3CEHA 3VR4A 1CHNA 1NMQA 2LE0A 4UEOA 5G4KB 1E59A 5EUMA 4YRAA 3C98A 3WGNA 4BO8A 4YR9A 4ALNA 3NLLA 4NXNB 3CRZA 1YCFA 3NANA 2D5IA 3J81k 2J5BA 4JYZA 1VG9B 4L4UA 3MGCA 4ZQGA 4GYJA 2GVDC 4A9AA 1RPNA 1DBPA 4BBAA 1YS4A 4PICA 4X0EA 1VKHA 5CYGA 5B4VA 4YDRA 1Z0JA 2EW8A 5EWJA 1GA6A 2VPIA 3E1GA 4WUTA 5CH5A 3V55A 3AL3A 3TB4A 4BO3A 3HBAA 3DMRA 2FMIA 4O4JA 2E4YA 2Q3CA 3OKFA 1YFJA 5LQNA 1E9RA 3P4XA 5L8VA 4RTNA 1BYIA 3T4UA 5BQPA 2R66A 5KJEA 1QZTA 4LYJA 1FP7A 2PE5A 4CQMB 1NR1A 1C4KA 2P8SA 1AK1A 2ZFUA 2ZTLA 1DBQA 3A9RA 1ZUNA 3AY3A 1ZIXA 4DCSA 5EIWA 4M1EA 4GMGA 4EL5A 2FR8C 4Z3KA 1DAMA 3I9V6 4MRPA 3GRRA 1EK6A 4PY2A 1CY6A 3E05A 4HDAA 3EXFB 3R0ZA 2E6KA 4K03A 2ZRPA 3PJDA 4NFSA 1HDZA 3S29A 4XDGA 3SM9A 4F4IA 4YUXA 4Z86A 1J90A 5FPKA 2HTFA 2NWQA 4V2UA 1NJ8A 4X54A 3OX2A 4JI0B 1XRRA 4EJSA 1YB1A 3IR6A 2QB5A 4JT8A 3C41J 3ESDA 4I6JA 5KHAA 5IDWA 5JECA 4ZYLA 3RTBA 4KK3A 3GPLA 1W5SA 3ER9A 1WETA 1Z06A 4H16A 4N18A 4X8MA 1D6NA 1JL3A 4C7KA 4EMSA 1E6CA 5EHNA 3PLAE 5AKLA 2O7VA 4BNYA 1E7YA 4ZOEA 1N5RA 4Z8YA 2H5LA 1RYEA 3D6NB 3EDYA 3O75A 3CY6A 1T1EA 4G8CA 4CV3A 1SC4A 1VHLA 1XDSA 3AI7A 3HGTA 4J2OA 4BU1A 2XWQA 4CL8A 3WZ2A 4Y2HA 4KQWA 4DMHA 4C7BA 2YZKA 2FEPA 4X5OA 4F9FA 1BD4A 2C4MA 4AU1A 1RLIA 1YR7A 3C8ZA 1EK5A 1YI0A 2GXUA 4NJEB 3RROA 4AMBA 3SHOA 1X1AA 3KQPA 1EA5A 3M5WA 2WZDA 2ZIAA 2VQSA 3VMFA 1PZEA 3OQIA 2NNLD 2FFHA 2PV0A 4KJXA 4LZAA 2Q46A 3NONA 4DLZA 5JNUA 2A9JA 1PZXA 5BURA 4A0HA 2IA5A 5KJFA 2PY6A 4ISBA 1E1QA 4GZLA 1P77A 4F5ZA 4DLUA 1F0YA 2XY4A 5C4IA 4YQEA 1SKAA 1Y9DA 1DCTA 5JS1A 1E5LA 1RJEA 3PQ6A 4IDBA 3SDZA 5CA0F 3FXAA 1Y6GA 1DLJA 2QXUA 3AF6A 1EINA 3KQYA 4OQYA 4IZOA 1JU4A 3FOCA 4JQOA 1Y8ZA 3K5PA 1U4SA 4ZYYA 3OHMA 1CQIA 4KTVE 4MUXA 4U0KA 4CM8B 4Y1EA 4HXFB 3GVHA 3BSSA 3C6YA 4WEOA 4XYEA 2ZOSA 1SUIA 2KS6A 1EE1A 2ZXEA 3KOXA 1R18A 1BS1A 2PUVA 5EFOA 3ZG6A 1VHQA 4B3HA 3DVAA 5KDOA 5MGBA 4EO4A 5TJ9A 4RGYA 1TUBA 4YAOA 4J1TA 3MJ4A 4TTQA 1Z16A 2QX6A 3LP8A 2JHGA 4TQAA 5PNTA 1KYXA 5BSWA 2YUIA 4XE5A 2FN4A 1IL0A 2C4NA 2HL6A 4PS1A 4QEZA 2O8NA 3DOEA 5DK4A 4BCBA 2WWRA 1Z17A 5EP1A 1EB8A 2Y0PA 4JUFA 4MWDA 4A0QA 3HPQA 4KDEA 5JDIC 2P27A 3NJRA 2I6UA 4RUKA 1WZUA 2QG6A 3FVWA 4B83A 1O96A 2VLBA 3ZVMA 3BB4A 4R1TA 1AA9A 5E9WA 4ESOA 4YRPA 5JANA 4QLAA 4GLJA 4ZVPA 1OBVA 1G7RA 2PD3A 3GT7A 3LO8A 1H42A 1Z7GA 4ZOCA 4IAOA 3WWEA 2G6TA 1CR2A 2QUIA 2P2DA 4PNEA 3OFND 3MT0A 2PUHA 3EFOA 4FYHA 3QFCA 4IDPA 4YP6A 3P9SA 3GUUA 4KAJA 1SVKA 4ZYXA 1NMXA 3HVHA 2R79A 4EI2A 1C7EA 3IHKA 3T54A 4EUHA 3GEEA 4PG4A 3K0EA 1DARA 3I6YA 3I23A 1NYTA 5E6RA 3GLIA 3GFGA 1WDTA 1VMEA 1WXWA 1YRBA 5A6VA 1JPUA 1I7QB 1M1NA 5ICSA 3GFSA 2NU7A 1MRNA 3STTA 1DQPA 2O0LA 1E92A 3CUKA 4HJXA 4MKHA 1AQJA 3EVNA 4B3JA 2VHVA 3AUXA 2ISCA 2XGJA 4R98A 3BCHA 1EE2A 1PT7A 3SE0A 1PSDA 2NTYC 2OE2A 1RI1A 1L1EA 4G4JA 3FSEA 2YOHA 3OFJA 4TLEA 4CFZA 1Y8AA 2O20A 3WGHA 4GI7A 4BX0A 4MS1A 3DNFA 4L0DA 2EKZA 1FYVA 2AF4C 4MOWA 4CWAA 1AMOA 1DAHA 2AG6A 5KOHB 2OZKA 4Q9AA 5JHGB 2BFNA 4TLLB 4QBKA 2YJ6A 1XA4A 4KRFA 4IX9A 4HD8A 1MNAA 1VOTA 4LI3X 4D9NA 1LDBA 3GDOA 3D7MA 4LSMA 1E1LA 3EWSA 4X20A 3INNA 5AHRA 2O2EA 3FETA 2FEKA 5J59A 1JSRA 2ZE6A 5TT0A 1RJDA 3VPDA 4QM7A 1E2HA 3NO4A 1CEEA 1IFXA 3ND8A 3ZQ4A 3FYHA 5AJHA 4DVJA 4U7TB 1A2KC 1YAJA 2QROA 4J4HA 5IAEA 3RT1A 5JQWA 2AN1A 4ZQEA 2PVPA 3NTRA 4IVPA 1ORVA 4B35A 5K01A 3IGFA 1Q0LA 5AKHA 3EZ7A 2RAUA 2NGRA 2GAOA 2GETA 1QYVA 2VDRB 1VA4A 2AS0A 3QUQA 2C2XA 2MYPA 4PFKA 2XUDA 4RX1A 2WHXA 3F4KA 3L82B 2GPTA 4LZNA 4WLUA 4CEIA 2W93A 2XF2A 4HXEB 1AKTA 1O97C 2EXXA 2ILTA 3FCCA 4UUPA 2IC5A 3WDKA 1MDFA 1HR0B 2FGKA 3STYA 4B7AA 4AMYA 1Q7EA 1V95A 3D8BA 3G85A 3IJRA 4TZKA 5FOWA 3NOQA 3RRYA 1JBEA 2E4WA 1YE5A 4CLOA 3EG9A 2O4UX 3EBOA 4MKIA 4M9XA 2OYSA 4FFLA 2AE1A 2Q7XA 3WK8A 2IUTA 1KZYC 5AVQA 4QPNA 4RVSA 5LPNA 3J80A 4G3XA 1KOFA 1T1GA 2H4HA 4FWIB 2VDWB 4MVJF 1QHNA 4PZEA 1L7RA 1Z4NA 3PUIA 5FTNA 1GOTA 4NDNE 1BVHA 2PFKA 3KEOA 4H18A 4AJKA 4DSUA 5FCDA 2BMDA 1NC1A 4WA8A 1T4GA 1Y3CE 1KI4A 3LHFA 1E9EA 1VYUA 1JQLB 3D43A 1FVFA 3LZDA 5CBPB 3EIWA 2D13A 1E3SA 1YQ9A 2Y6UA 4LSWA 1A7KA 1I10A 2JCSA 4FHDA 4OD0A 1T9GR 2CDCA 1IZ7A 2FOLA 3KKLA 3GXBA 4YAEA 5HILA 2BI4A 5JROA 2XNSA 3EEOA 2G25A 3NOVA 1SOWA 721PA 1YQGA 3IAS6 4GIBA 3VTZA 4RF2A 5LQRA 2G77B 1BG6A 1LDMA 2YYZA 3FDZA 3T7RA 3UJBA 4QD3A 1QFMA 4OHZA 4NZ9A 1NG1A 4J7AA 4DZRA 1C80A 4JC8A 5IUNC 5I9LA 5J2UA 3FOFC 4ETIA 3W8NA 1HLFA 2OZLB 2G7ZA 4OQZA 3WLOA 2ZCVA 3T9EA 3H86A 1PKEA 3QPCA 1VKJA 4X1IA 4CDRA 3E3MA 3TI9A 1MA3A 2BCJQ 2AL7A 5IJXA 1X7WA 3SHVA 3OSUA 4PLZA 3GEPA 1MO4A 2F3PA 3QBEA 4PAWA 2ZRAA 3IHLA 5B53A 1FTSA 4WT7A 1FSPA 4CU2A 5C7IO 4FCCA 5KOJA 3LNTA 2IU4A 3V4SA 1Q84A 4E3ZA 2XKBA 4CKCA 1W9MA 1D2RA 2B4AA 3NP9A 1S3IA 1RM5A 3H2GA 3OIFA 3PDCA 4C3UA 2D5LA 1PZNA 3FN4A 3LM8A 4W8HA 3CT4A 1NMZA 1JHYA 5EJ8A 2PSSA 4PLWA 4R9SA 2E87A 3RPEA 3ZH9B 5BW4A 5K99A 3EZ6A 4L2IA 1ODIA 3V8RA 2CVPA 1J2RA 1OFGA 1UC8A 3SEFA 3T7SA 4C88A 3WLEA 2OM2A 4BKQA 4CG1A 2Q2OA 4K88A 2UVPA 1Z6ZA 1QIGA 1G7SA 1GT91 5FTKA 4OMUA 4OK6A 4V0MA 4BMDA 3G9TA 1E2UA 3ZHOA 2OORA 1PJ8A 2BMEA 2P2CA 3GAAA 3H3FA 4DCOA 4L50A 4QLOA 1DG3A 1H1TA 1KRHA 2V7TA 1Z7WA 1HXHA 4DLVA 3LUCA 4UU8A 5BW8A 5C8YF 2WT4A 3OF5A 1MQ8B 1WXDA 3HG7A 2IU6A 2PS9A 2FFQA 1FXUA 3OFNA 1H0HA 3HLTA 2PD6A 3X2SA 2Q62A 5JCJD 4A8HA 3AHCA 1EP3B 3RS8A 4YCLA 2XOKD 1DX6A 5DEIA 2LWIA 4GWLA 2AB0A 2JEYA 2W00A 1Z4OA 5DHTA 3WRYC 5HGXA 1J07A 1J49A 3LT0A 3N28A 4F3NA 3QOWA 4KBFA 1VIVA 1MOPA 4A36A 2QF7A 1CXZA 4GX2A 5KMGB 1W0JD 1ISMA 1GO2A 3BXXA 3M9LA 3OZVA 4PXYA 5CXXA 1IBSA 2Y1DA 1DO0A 2O2XA 2XT6A 3JQBC 2QUKA 3AT1A 3AZOA 3PITA 3EVDA 1BWSA 4GC5A 1UZNA 3D3WA 4YACA 1IG3A 1ZNZA 5JG7A 4ZC1A 1CX9B 1YC2A 3DYBA 4LWPA 5H3HA 3V2IA 3CG4A 3VVBA 2EARA 4S1PA 3LP5A 4C6SA 4BJ6A 4PHTA 2C9CA 3ZCSA 1P3Y1 3JRWA 4Y6OA 3NFRA 1DDGA 4H3HB 2M6KA 3ZGYA 4PZZA 2OD7A 4NVRA 3NKVA 2OKGA 3DDNA 5LQDA 1PN3A 1E2LA 1RHRA 1W76A 1YB7A 2VI5A 2Y0CA 1ZPDA 2Y1OA 2YIJA 2VHUA 3EOBI 4MI1A 4E09A 3K5IA 2LUOA 3MYRA 4IEFB 5CVVA 2FWAA 1V5EA 4Z9YA 2OILA 3OZXA 4BNXA 2JRCA 1PG5A 4I2VA 4P4NA 1EGMB 3IUEA 2O2YA 4PV7A 5I9TA 1I6LA 1YQEA 2W4MA 3B3AA 3HMQA 1M6NA 4J16A 2H1HA 3EF3A 3TQTA 3NYRA 1USUA 2PS1A 1T6ZA 3TO5A 1MAVA 3E81A 3L0CA 2XRZA 5DRYA 1J0CA 1QGED 3JATB 4DJFC 6REQA 1GLNA 3DBLB 1K6XA 2BC9A 4E32A 3DKIA 5CDTA 1JTVA 1GTSA 2Q9BA 3NNDA 1T2EA 4Y6PA 1V25A 4DLLA 2BM9A 4KFRA 3T4EA 2UZ0A 3Q6MA 5BR8B 2YVKA 3EGWA 4KMSA 1NAIA 4FE7A 4H3SA 1VHDA 3IBTA 4JB2A 4TVOA 4KVZA 5CX1A 3QBDA 1U0JA 3MGAA 4DIKA 1KVQA 2UVDA 3LMKA 1V8FA 1GG5A 2W2KB 5KINB 2P8JA 4Z7NB 3AOEC 3VR0A 5TSDA 4CETA 1SULA 3DAFA 3LPDA 2JFVA 1WTCA 2CNLA 4RS4A 4UATA 3H17A 3IBSA 3HCDA 1Q6YA 4JBYA 4Z1MA 4D98A 2ZJYA 4EDHA 3DKKA 2WBLC 3Q3CA 4MK4A 4YR7A 4V1CA 5KJ6A 3WLFA 3THYA 2WWFA 2Z6AA 1R8QA 3QLUA 2AFHE 1MR3F 2HPVA 2PBRA 1QH1A 5DWQA 1ZJJA 1WPXA 1N0UA 2GK4A 3HCFA 1K7SN 2HWWA 3FPFA 3LC7O 4MRVA 4DADA 3C2QA 5C35A 3CVXA 2WU4A 4YJFB 3B53X 1D03A 3TOSA 3IRUA 1YVRA 2VF5X 1W47A 2FFJA 2RI0A 2YN0A 3TR5A 3ZNPA 1SVLA 5GV8A 3ZCUA 3TS1A 2ZZMA 4UZEA 3P9XA 4F06A 1ECPA 2V7PA 1P29A 4BVJA 4OGKA 1M2GA 1WSAA 3QEBZ 2NUPB 1K6JA 2R85A 1VPLA 1NBMA 2R4TA 3STVA 1F4PA 4CNQA 4LUCA 2J5XA 4WSOA 4UOEA 2R6ZA 2HDNB 3CRQA 1LTQA 3MINB 4G1BA 3H8VA 3FTCA 3RU7A 1GPYA 1GTJ1 2X5JO 2ZWPA 3MERA 1GU0A 4RSMA 4Q66C 4YRMA 4P3YA 4R3NA 4LNUB 1R5OA 5JYEA 5CHEA 4AXBA 3UH1A 2OFWA 3EFBA 2VWHA 1ISIA 3GJ7A 3N0VA 3RS2A 3GROA 3R3UA 4Y7CA 2LR0A 3OTIA 3ZIUA 4C76A 4F92B 2UZIR 1S4MA 5M04A 2ZE5A 4JEIA 3NTLA 2QIPA 3WHPA 4YRSA 3FJYA 4AJHA 1DADA 3HDQA 3KHKA 4HEJA 4UQLA 1IONA 2VK8A 3OWXA 3TLBA 3HVIA 3GN2A 2CLDX 3SVLA 3ZWNA 3BKWA 2C1XA 3PFFA 4DW8A 4J0HA 2WT9A 4RVGA 1KZ6A 3FMOB 4QATA 4XFJA 3UUWA 1GQSA 4P8RA 1CRPA 4LZWA 3MWEB 3BX1A 1S2MA 4ZCLA 5JCZA 3JQAD 4LC0A 4NAVA 4BGVA 1T8YA 5M5BA 4GNRA 2XZLA 2JIPA 3NYQA 1DXOA 2OMEA 1PR0A 1YK1A 3OA0A 4L0CA 4REOA 4UHBA 1SY7A 2PWAA 2VXYA 1PV4A 4BLOA 1ZVJA 1RHMA 2I6TA 2V74B 3QPVA 3IEMA 3BGOS 2C4TA 2B92A 1A5SB 4F4DA 1CQXA 2CFCA 3AF3A 5EJFA 5CDFA 3GUHA 1JFVA 5ALUA 4E2YA 1JE1A 1VI6A 3ZHVA 2QI9C 3FCAA 3JAMA 5AVXA 4EDFA 5IUJC 1LDGA 1Z68A 2GLTA 1WJGA 3SR0A 3EW7A 4DRXA 3QNUA 2JI7A 5TS2A 3UO8B 4DBZA 3KLPX 4URHA 2VRWA 3W3AD 2ZAMA 1NJSA 3KB6A 4QOEA 5EPUA 2PZEA 2Y1LA 2HJGA 4S35A 4E1BA 2IX3A 4WKOA 2QJRA 5BP7A 2PRZA 4MUYA 2MMCA 3M9XA 4NE2A 5EWLA 1L5GB 2O8EB 2FZEA 1L5OA 1IB0A 3BXHA 3WDSA 5EJ4A 3SQNA 2L17A 3JQ8B 4EGSA 1U04A 4MDHA 1UKAA 3JQGB 3UGQA 1W0JA 4HEHA 2DY0A 4J7CA 3C8MA 4BRZA 2WJIA 4U63A 2QKYA 3F5SA 13PKA 1ISJA 2HMVA 2OZEA 3SHWA 4AIIA 4BMCA 2CNOA 2VNJA 5LNK6 3OM1A 3HA5A 2NTNA 2CL0X 4OI2A 4KRGA 5L3ZA 4XB2A 4NXMB 1X80B 3ZXSA 4KXFB 1BCSB 4WN3A 4F2DA 3NW9A 3AEKB 1YGPA 2IXAA 3I83A 3OQ1A 1CZLA 1PSZA 4JASB 3TOVA 3G2NA 3ZJVA 2AWOA 2QDKA 2ZSAA 3EGEA 4R81A 5JQGB 3KNZA 2QYSA 2FFBA 4QUEA 2WG1A 3P5BA 1W87A 4WL0A 1KOLA 2W4IA 1L1QA 1NVFA 2ACKA 3N0TA 2X6QA 3TNFA 1B4DA 3S3TA 4ND4A 3LGAA 1MC4A 5TPWA 5F5XA 3T4PA 4WINA 4DR5B 1TLTA 4RK1A 3RB8A 3SICE 2GERA 5IT5A 3PEWA 3DXXA 3BJZA 1G20B 4LQLA 4AP5A 3ENKA 4EABA 2BEVA 1GXSA 4IRXA 4JC4A 4KW7A 4BO0A 4GRDA 3DV0A 1DQRA 1TZBA 4R2XA 4RDIA 4GOJA 5TMEA 4LRYA 3SX0A 1DO8A 4ZI2A 4E88A 4MJLA 2GZDA 4LHXA 4FSXA 3EGIA 3RANA 5HWSA 4UHJA 5EY5B 4PSVA 1EVEA 3GOHA 4HS9A 3W6NA 2WD9A 3UAWA 2V3CC 1NJ2A 1I5RA 2AYYA 5DYWA 1SHUX 5EP2A 3ND6A 3TRDA 2P41A 4AZVA 2D1FA 1B0PA 1KSGA 3VH1A 5DMXA 4QGFA 1HWYA 4K9PA 2A67A 5DBHX 1YTUA 1AKNA 2A4KA 4XCQA 1CR1A 2NP6A 3HKEA 8ATCA 4LJ4A 2BFEA 1UXHA 4BNTA 1R8JA 3KXKA 3PYXA 2IYZA 5TVGA 1A8PA 1CVIA 1SEVA 2BMWA 3W3ZB 1XCMA 2RD2A 1KS9A 3AFGA 5K3FB 3OTWA 4FD2A 4FS8A 4PSKA 2PX4A 2J3MA 3ZPXA 3EUEA 2AFVA 3EQ7A 4LZZA 4M87A 3I4FA 4MCAA 5EJIA 1EFLA 4B0OA 2BGUA 1BHSA 1T4DA 3BXEA 4UREA 3DV2A 4Q7QA 3CRRA 5K8TA 1ADFA 4QGBA 2VK4A 1L5NA 3G0OA 1ZMRA 1GRNA 1FFXB 1E79D 3UHOA 4J91A 2HN9A 4OP1A 1OX4A 4O2AB 4KIWA 1F17A 4WH0A 4EHAA 3A1FA 1Q21A 2QN6A 1N0VC 1U81A 1QG0A 3E2MA 2C95A 2ACEA 3H2HA 1U2EA 4PWYA 1A9SA 3QPWA 1YIAA 4R9RA 3W77A 5KTKA 3LDHA 1JXOA 2HJSA 1T6YA 4K86A 2VOJA 3ZU4A 2PIAA 1USIA 2BEJA 1GD1O 1KYQA 1Z0FA 2CXSA 2LNDA 3QITA 3A6FA 5GM2A 4EPTA 1E64A 2YX1A 3Q40A 3VU9A 1SQFA 2OBYA 2Q1TA 3OT5A 1R66A 2GA8A 1FUEA 4LHVA 4Q7MB 4EF6A 2EJWA 3QNWA 4GVLA 5DXFA 3EPPA 1HYQA 3RRFA 2BRUA 2X77A 5DM1A 1QLHA 1VJRA 5BSFA 1FTYA 1RLJA 3VKWA 1XMOB 4MR7B 2ZJOA 3GZJA 2JK0A 5FPTA 4IO0A 5AOVA 3IVAA 4FGKA 2CDNA 5AUPB 3R3WA 3QFFA 5COQA 4C0QC 3ADKA 4QFCA 4TV8B 4GMHA 3UMRA 3DTTA 4QG7A 4YCNA 4JR1A 5DX0A 4XQGA 3TTVA 1LVUA 3DZ8A 3JQAA 1B2RA 5HTOA 1XTQA 1OQAA 3WFZA 5EKSA 2V98A 3KJGA 3O0TA 1ECGA 2H1SA 3VNBA 4IFIA 1A97A 3ZDFA 3UHFA 2IPXA 5JE8A 5G2OA 4CCYB 2A33A 3GDWA 1L5FA 4NYMQ 4H08A 2A0KA 4ZEVA 3TAHA 4OYLA 5K09A 1K4KA 1YDHA 4I55F 2XOEA 1HTTA 3HCEA 3GMDA 3GJ0A 1CY1A 3Q15C 2ZRHA 1JLKA 3AHJA 1QKJA 2IEYA 1UBJS 3DHWC 1JSLA 3ILHA 4H6VA 5IJ0A 1X1RA 4F9EA 4KV7A 1NYLA 3W3AA 4ZVSA 4YUZA 4JI1B 5IX8A 4XM1A 3RC3A 2F8LA 2PQ2A 3LUBA 3PX3A 5H83A 3UMGA 3TEMA 2Q6TA 2UV8A 4C04A 3EF0A 2AN3A 1IBCA 1EFUA 2ZJ3A 3BREA 4JJKA 2XUAA 1E94E 1CF9A 1CUUA 4IINA 2YVQA 1Q0SA 3L6UA 3SFVA 1KRXA 4M8IA 3GPBA 3GJTA 3QEMA 3I4CA 4QOFA 4J07A 1W36C 2C4VA 5D3MA 5G53C 3FAZA 4P5DA 3S2YA 1QRTA 1MW9X 3HFRA 3G0HA 1IMOA 4M8LA 1KAEA 5IHXA 1E1DA 1R64A 3K0FB 3A26A 3II6X 4HQKA 5BYKA 2RHJA 1ZN7A 4NPAA 2Q3MA 1AF4A 3ZCRA 1LD3A 3E61A 1PVDA 4M0LA 3N70A 4FBMA 1YS6A 3EQ2A 2CYAA 4NNPA 4Q4JA 3RKSA 1KQPA 3R3XA 5G0TA 3X44A 5FBQB 2WE8A 4B84A 3FRIA 3GGDA 3L6BA 2K4MA 1SOVA 2JFZA 3EW9A 3WLHA 4IM7A 5JH7F 2UYYA 1XPRA 1KEKA 1AO0A 4B81A 4HBZA 4ZK6A 1LRLA 1OX5A 1SIOA 1KY4A 1TW3A 4NJOA 4Q15A 1DEAA 5KX5F 1CIVA 3AFHA 4HN2A 1O6GA 2QBYB 2ZXUA 1K86A 5KOIA 2FMTA 5L51A 1VHJA 4X60A 1MAWA 2B1GA 4RGBA 2HCJB 3BMOA 3ZJUA 4TZ0A 3MLAA 5HK9A 4M0UA 2VP5A 1OILA 2XSZA 1JDSA 2WF9A 4Q3CA 3UUFA 2IWRA 4DCCA 1Y5LA 2WICA 3V4RA 1H4TA 1Q17A 2V4ZA 3WGLA 4CMHA 1NL3A 1IBKB 4OHWA 3BGVA 1LTHR 4BLRA 4MR8B 2NX2A 1EBUA 1D8AA 3HKBB 4BFSA 2ZPTX 4IOMA 1YJCA 1XWFA 4E12A 1CUZA 1UEIA 1ZCZA 1IN6A 2BTQA 1KTVA 3PQ3A 3WMWA 5SYAA 1J70A 1GRCA 1TAHA 1NVWQ 2OXIA 2QEQA 2H63A 1SHJA 4EUKA 3FYCA 1OASA 3M6XA 3TIVA 1L5WA 4P08A 4BVLA 5KDLA 1NKSA 2I4NA 2O2HA 3NHKA 4OM7A 5C46F 1BW9B 2AI3A 3L07A 3QP9A 2C9MA 4NWIA 1NPYA 2EFYA 2ZS7A 2C4WA 3KYDA 4EJSC 4E15A 4KODA 3KQWA 5DLQC 2K2WA 1QH9A 3QYJA 4XKJA 3OO1A 4FI3C 4ZZ0A 1FMJA 1L8XA 4DSNA 3KT0A 2QM3A 4WCFA 5ALWA 3WNZA 5BSVA 1DRUA 2YV2A 1CJMA 3FDFA 3OZBA 1AV7A 1Y4DE 2VDPB 4I50F 4WK2B 3I2HA 2Q8PA 5BNTA 4LFBB 1N78A 1E6LA 1V9SA 2E37A 3HB0A 3DAOA 2JD0A 1TK3A 2BHNA 2P78A 4NECA 5BVHA 5HOQA 5A9SB 1U0OC 4XQ9A 3MLBA 5FNVF 1E79A 2JEZA 4I1UA 1NG9A 4YJ2B 4BRSA 2QPTA 3A6KA 3HN7A 1U7OA 3ZZ1A 4Y2YA 3U48A 1L7AA 2E5LB 2F8MA 2GVZC 5BUCA 3ICOA 4L78A 4AY3A 1ZMTA 2EZTA 1ZD5A 2HJHA 3LUFA 5BNZA 3CNLA 2B69A 1M5TA 3LQQA 3LVQE 4WESA 3VZSA 5I3ZA 3ZDYB 1ZH4A 3OC6A 4UVHA 4DLRA 1UMKA 4AS1A 1C1XB 5M3BA 3ADPA 3TDNA 4H6WA 3ODGA 4O25A 2JFNA 3LFHA 1VPWA 3K2EA 1D5CA 4EAQA 2QY9A 4GI5A 4YASA 1Z2EA 3ZLJA 1NUTA 3S2IA 5IKPA 4HDKB 8AT1A 2EQBA 2CLCX 1XEXA 4FEGA 2VH2A 1XROA 2PR7A 3DVLA 4OKNA 4LG1A 3L0IB 3ENVA 5IM5A 5A6SB 4DMKA 3FFWA 2JJ1A 5ADUS 1J9ZA 4GICA 1IHPA 5BMVF 4WQMA 4BEJA 2O1WA 3BWDD 3BQ9A 1A27A 1UOPA 3A10A 4HPXB 1TAGA 3LPCA 4M8NE 3SZMA 1T8UA 1G41A 2AEFA 1TYEB 3FCSB 3ZU2A 2DWOA 2OEPA 3DJYA 3VZDA 4CLHA 3KS9A 4KXQA 3KSUA 3EPKA 5CGZA 1J2TA 1HTWA 1M76A 3JARA 4QU9A 2P9YA 4BNDA 2QN9A 4GVPA 4KYIB 1XHEA 2UYHA 1LK7A 1SB9A 3AVXA 4V02A 4JY7A 4X7PA 3F47A 3SJZA 1NUQA 4JJ6A 1U3TA 2IDJA 5EUBA 4EG6A 1F3OA 2A1UB 4UARA 3T0FA 4KQMA 2YVUA 1X1TA 2GZRA 1G66A 1M6HA 3RK4A 3HV0A 5KNCH 3KEGA 5A5VA 1YASA 1N0WA 4JGGA 4YRIA 4PQEA 4ZGGA 1FFEA 4AQ7A 2KE5A 2YY6A 1Y8QB 5JFGA 1MLDA 3BYZA 1OCEA 3KXIA 3EHDA 4XX0B 3L6OO 5EZQA 2JGJA 4QX6A 2PMEA 1DJPA 2PBZA 3WHLA 4GDFA 4RDHA 1NRIA 4LFCB 1ZJ5A 3H3XA 3REGA 3TRHA 3V4VB 4B6OA 4BQQA 5LIPA 1UMBA 4R8MA 2G5PA 4MRMA 2XEDA 1DWUA 2GJAA 3NV9A 1PI3A 2A0WA 2HWYA 5AJTA 4ZV4A 5AK6A 1JLMA 1PT5A 4IDHA 3HVRA 3OM8A 1TA0A 1MT0A 5DTJA 4UFOA 5HZKA 3QV2A 3W8RA 5C4GB 8ADHA 4MEAA 1J8DA 3CW8X 2O6LA 4NS4A 4U6QA 3T3PB 1MCZA 3U16A 2WFLA 3EIEA 1KP2A 1SB8A 3RG2A 1HE1C 3OM9A 3VR5D 4DJ5X 4EGAA 1I5OA 1KY3A 1OZHA 3RUEA 2ZIXA 4NHOA 3HDTA 5I8PA 2CE7A 1Q95A 3OAAA 4BVAA 3OZUA 1JHDA 4LZLA 4TVKA 3ZXXA 5JALA 2NU6A 2QN7A 3HCPA 4F2GA 1D2MA 2O2ZA 1NVTA 1SC9A 4GFDA 3BC1A 5T4HA 1PQWA 3WFJA 4CG3A 3GDHA 4IIDA 5E2BA 4ZJZA 5KNDH 2VTBB 2QD5A 1AZLA 4DUZB 3RYCA 5IJWA 2GRAA 5EJAA 1T0PA 1GGFA 4ZC8A 3NHLA 3I9KA 4NI5A 4QE3A 1XVIA 4PYOA 1C3XA 3CINA 4A2WA 2WHEA 3HXOA 2AFIE 1TI7A 1LU9A 2CDBA 3H11B 1FFCA 1MH9A 1CULC 3RYTC 1QIJA 1QS0A 2O5VA 3ANLA 4DIEA 3C39A 4BQSA 5I5EA 4X1OA 4DCNA 3I5YA 2AI1A 3CRVA 3LF2A 3QVLA 1HFWA 1T3TA 2RBGA 4O4LA 2H06A 5INTA 2ZCJA 4IHJA 3U7RA 2PNFA 3CX3A 1J4AA 2BCGY 1SNYA 3M3DA 4PGAA 1EFHA 3QGMA 1B8VA 4IJUA 1NUHA 4S1NA 1V9LA 3FA2A 4F4HA 5KYTA 1IC6A 1A8SA 2FB9A 4BO2A 3LVBA 2P0AA 2XADA 4U2GA 3C3MA 1XVLA 3U6KA 3U80A 1T1IA 2ZJ5A 2W48A 2EIHA 3O2QB 2VK1A 3S4YA 2QVZX 3EWNA 3TLYA 4QWWA 2RKWA 5K3DA 5DCLA 4MULA 1XMPA 3NGXA 1Z2OX 4DV1B 3W3AH 3ZHZA 5C1BA 2BSXA 2C54A 4LJ9A 4M99A 4HAXA 2X7XA 4YAGA 4WXEA 2XI4A 4EM6A 3U4MA 1T0HB 4D26A 3WL4A 3C3AA 1ZXLA 1GPWB 2SECE 1O1YA 2WSYB 4MUGA 5D5HA 3DBHA 2MYTA 2MOKA 1RP7A 2AEEA 4NAUA 1FYEA 1NQUA 5EQFA 4X61A 1QP8A 2D2IA 1M2JA 4REQA 1I2CA 2A58A 4DPKA 1BE8A 1EFVB 1WL8A 5F33A 1BDIA 3LUJA 1NX9A 2OOSA 1M1YB 3LHIA 1CQZA 4W63A 4D44A 2O1EA 5EHXA 1RQPA 3FFXA 1DPFA 1N2GA 2VQEB 4PX2A 4PLPA 3TMKA 2P9QA 2QVXX 4RLHA 5FT9A 1Y1QA 1UZMA 2Q4BA 1ZIPA 2JFOA 4RKQA 3HDHA 2BBSA 5TEVA 3ER8A 4E07A 3WAJA 3ANYB 3GVIA 1CUWA 3Q3HA 221PA 4KHZA 1J9GA 4Y2TA 4HWRA 5CA0A 4PLCA 1OJLA 2WA1A 3T9AA 4A16A 4GC9A 4NONA 2P5YA 1HE5A 4N0MA 3VOBA 4PE5B 2Z6QA 1SCKA 1L5HB 1RYFA 2PWBA 4ITRC 4L76A 1PJAA 521PA 4DLWA 1M66A 2AMYA 4N01A 3B9RA 4YMGA 5JDCA 1J1UA 2M98A 3QVGA 4HRXA 1GPUA 1VYVA 4DE5A 3D54D 1CE8A 4L15A 5BVGA 2HPHA 2Z9BA 1Y4UA 4ZAYA 3ONEA 4D97A 4V0SA 1PYOA 3H1FA 4TTTS 1BS9A 4FXPA 5KCZA 2IHBA 1KEEB 4FCTA 2DFNA 3E9MA 2BP7A 4X93A 3PK0A 1JI0A 2OA0A 4EFKA 3R3VA 1JF8A 4PRYA 4RLFA 2VQ3A 4P36A 4TT8A 1K8YB 2B30A 2PGLA 3HFGA 3WYCA 1Y8RA 4OQEA 1LRJA 2ZPUA 4YCMA 5BORA 1EWKA 3L8YA 1ADYA 1K9SA 3COWA 4YO7A 5ED0A 2XDQA 2H5IA 4TLCA 1ZGGA 2D1QA 3H13A 3MCWA 4N48A 1PT6A 2OORC 2G1AA 3FRHA 4O4IB 1GTL1 3GCGA 4OREX 5F35A 3QZUA 4JIGA 1HDXA 1YJQA 3UJHA 3FH0A 1U1GA 3FHCB 5BWCA 3VDMA 4QICA 4CV2A 2B1QA 2R5FA 3RFFA 1TYZA 4DLPA 2XMDA 4HWTA 4CKXA 3O8QA 5K6TA 1T9AA 2IPMA 2YZ2A 3W1VA 1FVOA 2WF6A 4GE3A 3V3KA 3G23A 3JVEA 4IRUB 1B0ZA 1GPJA 4KXYA 1ONSA 4EUEA 1EVJA 1D1TA 4G1VA 2DY1A 2WABA 3V46A 1P0IA 2IIPA 3EXG1 3FNQA 1Z7YA 1GYRA 5DYIA 3RIGA 2GZAA 4GUDA 5JMTA 3H2IA 4XR4A 3L8FA 2VNKA 1PGNA 3JWIA 3M4NA 5F9FA 2BMJA 1LGYA 5K4HA 1BFDA 1G17A 2XQIA 5HMMA 4BJ3A 4CR6A 1KOJA 5AUOB 1QK5A 2NU9B 3AINA 1V8BA 5I4KA 4QGHA 2AV6A 2YJZA 3HKDA 2OV3A 4XR9A 2PA0A 4HEA6 1V47A 2Y71A 4YONB 5TF0A 1LUAA 2PZGA 3DCYA 3ZWOA 3LTNC 2XITA 1A5BB 3GAMA 1U65A 1PFKA 5T41A 4MIOA 2VYCA 5LOVB 3KQVA 3G3EA 4AJIA 4O0MA 2QK4A 1DS6A 3KOYA 3TN7A 2DAPA 5FUBA 5EIEA 4X6UA 2BIFA 4DIBA 2FETA 1HA3A 2AMFA 1EZZA 2NO4A 3BHNA 3TZ6A 4B3MB 5CA1F 4RETA 1P1BA 1UJBA 2JA1A 2XRYA 4IDAA 4LBZA 5EIXA 1DNPA 4U2FA 1PUIA 2EZ4A 2FVYA 2XUKA 4JVSB 2VZ8A 4WE3A 1E2QA 2WHYA 4P7BA 3I28A 5U4XA 1MG5A 1CQIB 1C2TA 3ZQKA 4E0BA 1DC3A 4KACA 4V0QA 3V2GA 2GYWA 1REQA 1IJFA 3IP8A 5ALPA 3VDQA 1POWA 3RVBA 3HUUA 1US8B 1SHLA 4KO8A 4O1MA 5T6MA 4DRZA 4IMRA 1XPJA 4FYMA 2JLUA 4PLYA 1EHYA 1O58A 5I7VA 3ROTA 1C9EA 4Q3KA 4P0TA 3MWJA 4K6MA 1CS0A 5A2GA 1KBOA 2AI2A 2IHKA 3OY7A 4CW7A 1RAGA 5B7QA 3MG9A 3RNOA 5DBGA 2KX7A 1RWOA 3L8ZA 1FEZA 1JSCA 3PGA1 5D01A 4ZWNA 1SBZA 3HRKA 4C03A 4EKIA 3TTYA 1H1LA 1E9AA 4EYOA 1YS2X 3CVJA 3R20A 5DLYA 4B75A 3P71T 2H0QA 3QLUC 4IILA 2JIRA 2YDYA 4RFSB 4A2PA 4EHBA 5HBGA 4U9HS 1ACJA 2QPLA 1HNZB 1JVSA 4TWRA 1GAWA 3E9QA 3ZV5A 2PT9A 3AEZA 4WERA 3DD1A 2EP8A 3DE6X 4C20A 2GN9A 1R0BA 1QQAA 2HSJA 1RWKA 3K0AA 5IDXA 3EFOB 2HA2A 4BQFA 1K7YA 3WZLA 1YF3A 1IY8A 1GDDA 2JDID 4PFJA 3IBYA 3EPLA 2HMWA 3EBPA 1ISGA 2M6RA 3KHTA 4M0CA 4PO1A 3UVEA 1SXPA 3GLIB 1E8MA 1TT5A 2H3HA 3CZ9A 3CTPA 2A59A 2QMUA 3JPWA 3OWOA 4NBVA 1YIOA 1TD9A 3SGLA 1RYMA 3ZS9A 5B5SA 5TY0A 3NBYC 3HUDA 2R8RA 4AIRA 4LPKA 1Y1PA 2JFWA 2NZ8A 3KLMX 4W7IA 3TVYA 1UZUA 1ZC4A 4B0PA 3VO9A 3HU2A 1QAOA 3BMNB 2Q3FA 3GN1A 1HSOA 4KLAA 4XLLA 4XARA 1NVUQ 1AGYA 1SO8A 2HREA 3MIIA 3MK31 4NESA 1QHYA 4D80A 3PB3A 5EMHA 1C0LA 3NIBA 2PCLA 1E1NA 2DR0A 4UNPA 3KVOA 2BPOA 2PXXA 3KXDA 3PVZA 4KE9A 3FWZA 4M1WA 4PCLA 2JJ2D 3NCTA 4WDRA 3V6MA