4CM4B

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQKSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
total genus 90
structure length 251
sequence length 267
chains with identical sequence C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cm4B00
2VWPA 4RPLA 4TZTA 3AK4A 1LDMA 5IZCC 5TJ9A 2YV2A 3I4FA 4OAQA 1DSSG 4BNXA 5DCWA 1H6BA 3U5TA 3L6EA 1RWBA 2EG9A 3DHNA 3VPFA 2Y1CA 4ZA2A 2B83A 4NU6A 3RAJA 1C0IA 1X13A 2AW5A 4DPMA 1IL0A 1QKIA 2B5VA 4YJHB 5JY1A 3RBVA 1U3UA 3VVCA 4HUJA 5JFOA 4DPKA 5B4UA 4E12A 5G2OA 3PPIA 2VTEA 2YQ5A 3RKRA 1PQUA 4BQRA 2HK9A 4D44A 1X7GA 3R1IA 5EL0A 5JYDA 2DBZA 2O3QA 1Y1PA 5HM8A 5JO9A 4P38A 1PZGA 5FF9A 4CR6A 1J5PA 5THQA 3IDSA 4BMVA 3WG9A 3OMLA 1UXJA 4YRBA 3LC1O 4II2A 5IJZA 1PIWA 3AOEC 1D1TA 2GZ1A 4E32A 4DMLA 2PH5A 3P7MA 1YWGO 4EJMA 3RC2A 3WSWA 2HMTA 1YBMA 3DR3A 2IEDA 1X1TA 1P74A 1I3NA 5F1OA 2VTDA 1NR1A 1GYRA 1Z82A 3VPSA 4PN3A 4KQWA 3PQDA 5ES3A 1EVIA 4E5NA 3PJFA 3RKUA 1H6CA 4IS2A 5I7SA 5JAZA 1SBYA 4W9NC 3U4DA 1GU7A 1VE9A 2ZK7A 4OKNA 4YJHA 4WOKA 2ZB3A 4EBFA 4CM8A 3QVSA 4DLBA 4QQRA 4GWKA 3HHPA 3S2FA 4BO6A 1Y8RB 1MV8A 4RVDA 3UHAA 3W8EA 5JS6A 2VCYA 1N1GA 1DC3A 3ZCXA 3ZWMA 5A9SA 1G0OA 2QG4A 2WDZA 3DOCA 4WASA 1LU9A 3AW9A 5DF1A 4DMMA 2WSBA 2CUKA 3AY6A 2FWMX 1D1SA 1D7OA 1LDNA 3M1LA 1Y5MA 1CYDA 3INTA 3QVOA 4XRGA 3E9NA 1QYDA 4FFPA 3FPCA 4OXYA 4IQGA 4Y67A 4Z3DA 1KVUA 5G4LA 4D45A 3ONDA 5GY7A 4CL8A 2AEFA 4LCJA 2X9VA 1R37A 1GL3A 3BTVA 2ZJ1A 3K30A 3OH8A 3HB5X 3K6JA 2PZLA 4Q3DA 3GT0A 4R69A 1LQUA 3PHJA 3OFSA 5DZSA 4GPD1 2YHIA 3WYBA 3NX4A 3L4SO 3PK0A 5B1YA 3Q9UA 1DXYA 3ZU2A 4LVUA 3GNSA 2ZATA 2WD8A 1DAPA 4F3YA 3ROKA 5I9MA 1J49A 3JYOA 4CQMB 3WICA 4RPGA 4J6FA 1E3IA 2ET6A 4JNKA 4BL5A 1E92A 2H5LA 2I3GA 3D5TA 3LSYA 1Y7TA 1GD1O 4FPXA 2BFPA 2CF5A 3ABIA 2Y1EA 1DAOA 2C0CA 4IBOA 2YV3A 4E5MA 1TVEA 1DDOA 5JC8A 3NGXA 4YRDA 3W4IA 3W6UA 4BO1A 1EK5A 3WIDA 2H6EA 4ALMA 3Q11A 5DN9A 1H2BA 4Q3CA 5AXCA 1ENZA 3BMCA 5TC4A 3W4KA 3HDJA 3OECA 3ZDFA 3VDRA 4WK6A 3SVTA 1ULUA 4DQUA 2PGLA 1DOHA 1C1XB 1CDOA 4J2OA 3JYPA 3PXXA 4YJFB 4OJNA 5T6BA 5TNXA 3RROA 3TL2A 1M6HA 5G0TA 3STHA 3MJ4A 4J1SA 3AY7A 3GN2A 3KEOA 4OOFA 5TS3A 4KOAA 5L7TA 2Z5LA 4FFLA 2B35A 4YAKA 4CLRA 4K6CA 4MJLA 1KEWA 3AOGA 3PHLA 1U7TA 3D3WA 4XYEA 1PEDA 3ZV5A 3P2OA 3WYCA 2EGHA 4G5HA 3CXRA 1B8VA 5TF4A 3WDSA 3H9JA 4LN1A 5TX7A 5DP1A 1ZXBA 4A03A 3BMNB 1I01A 2NVUB 2V65A 4NJMB 3JQGB 5BSGA 3RBXA 1ZSNA 3JD1A 3NAQA 3JQCA 2YFQA 4GGPA 5H81A 1R0KA 4BNVA 5F5NA 1R4MA 2PGDA 5KWEA 1IULA 4E21A 3CTMA 1QORA 3VHRA 1E6EA 3FWNA 2VT3A 5KIAA 3H2ZA 4IJWA 4RCVA 4FW8A 1F8FA 2Y68A 1GPDG 1T1SA 2HO5A 2ZYGA 1VKOA 5F1KA 1BXGB 2VYVD 3KBOA 4XD2A 3UOGA 1BW9B 1WZIA 3IKTA 2D5AA 3O8QB 5ILGA 4MVJE 4IM7A 5EIOA 4HFJA 4N5MA 1Z74A 3KSZO 4CLRB 4CMAA 4DC0A 3RUCA 3KO8A 4ALNA 1PJBA 4BNKA 3NEPX 1GY8A 2PD6A 4BNUA 5JDIA 1LSOA 5KJFA 3GMSA 2X58A 3X2FA 3GLQA 1YOVB 4GVXA 2BFMA 4R54A 1ADCA 1LTHR 3LQFA 4WCFB 3QIVA 4EDFA 4TKLA 4IZHA 3LLVA 4ALIA 3FR8A 2C5AA 1E3EA 2CVZA 3AU9A 2VWQA 1XLTA 1NASA 1TEHA 3L07A 1HE4A 2I65A 1NHWA 2Q45A 3PJEA 4PRLA 4XIYA 1VPDA 2OORA 1YRLA 5JCXA 1P44A 3GY0A 5CDUA 2BGKA 2X0JA 1E1MA 1QLHA 4R3NA 4DYVA 5HRUA 2GR9A 2GERA 1HDCA 3HB4X 3HN7A 3U4CA 1ONOA 1ZJZA 1NAIA 3QW2A 3RD5A 3HJAA 1SMKA 1ADGA 3DBRA 2CNBA 3SXPA 3ZHBA 3I9LA 4ID9A 3BHIA 2GRAA 4GSKA 4R68A 1XHLA 1P1IA 4NDNE 4PLWA 1E3LA 3ZHXA 5DBIA 1NPYA 3OA0A 3VH3A 2BI8A 3GGGA 1QYVA 4J4TA 4U6SA 2VWGA 5ITVA 1QSGA 3ROQA 2D1YA 4IY1A 2I76A 3BTSA 4PG6A 4XKJA 3FTPA 3T7EA 1NX6A 3WNVA 1E5QA 4XGKA 3DTTA 1LDEA 3Q2KA 3ZWAA 3AUTA 1NVGA 3GZNA 4KWHA 5DCUA 1OFGA 1HE2A 1F14A 3QSGA 1U1IA 3S2GA 4YAEA 4M49A 2PK3A 3AFMA 1FJHA 2OMEA 3TL3A 1UUFA 3WGQA 2DC1A 5T8KC 3NTQA 4J16A 3B1JA 1HKUA 4CMEC 5KNLA 1LDYA 4ZVVA 2DLDA 4EYEA 5TRTA 3JQ7A 5G0VA 4XQEA 4TWRA 4EJ0A 2B36A 4IDAA 3DAFA 1A27A 1T1RA 4J9VA 3K2EA 4WCFC 2PKQO 1E5LA 2EJWA 3BXXA 5GZ6A 3ANLA 4UUPA 4ND4A 4AJEA 4E30A 2B4QA 2GGSA 4TRJA 5BT9A 3GG2A 4CLDA 5CDYA 2A9FA 4BNHA 4CV3A 5B4VA 3H5AA 3JD2A 2X4GA 3FNHA 1MFZA 3MJSA 3QA9A 3JQAD 3KSUA 1ZFNA 4N18A 5CEFA 4Y6RA 1DLIA 2QHXA 2Y0CA 1WPQA 1EVJA 2D8AA 1T25A 3GNTA 4PG4A 2C2YA 1IPFA 1YKFA 1LLDA 2WM3A 3JQDA 2C59A 3M1AA 5KJCA 3K92A 1FDSA 1KY5A 4JBHA 4ZQBA 7ADHA 1BXZA 5L9AA 4XQGA 3E03A 5TGDA 3MJTA 4RF5A 2O4CA 1UP4A 1EUDA 2EKQA 4ZD6A 5F5LA 2J8ZA 3WBFA 5FYDA 4EEZA 5JCJD 4L8VA 3EHEA 3IUPA 4CLEA 3LDHA 4J0EA 4L9RA 3TSCA 1CWUA 2JD0A 4FFRA 3IQDB 4KDEA 3N74A 1EVZA 3GMDA 1I10A 2GF2A 5ER6A 3FCOA 3QWBA 3U3XA 5JO0A 4YQYA 4ZQGA 1XU9A 4I5DA 4E6PA 2HUNA 3D4NA 2GSDA 1TXGA 2AHRA 1T26A 1VJ0A 3C1OA 5KJ1A 5L7YA 3F6YA 3OA2A 2FR1A 1PJSA 3SLKA 5K0ZA 4OGWA 5L95A 1YQDA 2ZCUA 4A0SA 4A7PA 1PGOA 2F1KA 1BRMA 3A4VA 3ZZNA 3JYLA 4R16A 4GQAA 4IDCA 3VH2A 1K89A 4ND2A 2O3SA 4Q3EA 2X22A 1LSSA 3VTZA 3Q6IA 1P77A 3TOXA 4F46A 1LSUA 2R6JA 3E5MA 3OQ1A 4D43A 4EITA 3MOIA 1OZAA 4GH5A 1IOLA 2FMUA 4W6ZA 1C1DB 5A3JA 4MIEA 2IYOA 3X2EA 2P9GA 3NJ4A 4NPCA 1FDVA 3GEDA 1ZK1A 2PGJA 2YZ7A 2QQ5A 1YGYA 4JJFA 3ZNPA 3TF5A 1V0JA 4PLYA 4AJPA 2VYVA 4FOSA 3E18A 2E6UX 3E1KA 1TLTA 1C0LA 3GNQA 2E48A 1PS0A 4MVJD 3C85A 3TN7A 5CG2A 1PJ3A 4RQTA 3E8XA 2HDHA 3GGOA 2NVWA 2PD4A 1XYGA 2FHSA 3GRKA 5FWNA 3WQSB 2EKLA 4BUCA 1ZBQA 2GUGA 3G17A 1LRLA 4HWKA 1ARZA 2HMVA 3IC5A 2Q4EA 2Q2WA 4LRTB 2EW8A 4O6VA 5C3MA 2GO1A 4E5KA 3IJPA 2X86A 3H65A 5AOVA 1T4BA 3TPCA 4ALKA 3VPHA 2DKNA 2NSDA 4XYMA 3KRTA 4M8SA 2ZB4A 1ONPA 4XA8A 1O0SA 2IDZA 1QYCA 1C1DA 2WMDA 3UUWA 4E2YA 5EPOA 1PGNA 3ADOA 4YJFA 4I1IA 3QHAA 1KVTA 4IJKA 4YQZA 4I5EA 1ISJA 1SAYA 3DEYX 2EKPA 4NFHA 1N9GB 1HE5A 3GUYA 5COQA 3ONEA 1CETA 1GV0A 2EIHA 1R0SA 2B5WA 3JYNA 4J2HA 4JX8A 4CMBA 5KKAA 1BTOA 1U4SA 3CUKA 4HKTA 3K5PA 2UAGA 1E3WB 3ZV4A 4JK3A 5K6AA 2VRCD 1I3KA 5AXAA 1R12A 2Y1OA 1ZSYA 3WTCA 4D46A 3DBLA 4MOWA 5L7WA 3QRWA 4BNWA 2RAFA 3U09A 4YJGB 5BR7A 4Z9XA 4AJHA 2Y0DA 3EVNA 2GN4A 2GZ3A 1LUAA 2O3RA 1Q0QA 3DMTC 4B79A 3WGZA 2RBEA 2BH9A 4QFDA 2W2LD 2O3TA 4D0SA 3DFUA 3NT4A 3LT1A 5C7OO 1U8FO 1IUKA 3SBOA 2EJVA 4L74A 1IZ9A 1K6IA 1HZJA 4PGFA 4CV1A 4HX5A 3KZVA 1RPNA 1WMAA 3O8QA 3HUDA 5I7VA 3TZCA 2NVBA 4BO7A 2HK8A 3P19A 4C7KA 4IMRA 3LT0A 4H7PA 1HZZA 1QP8A 4J49A 4NBWA 1VRWA 5TQVA 4DPLA 4Z0TA 3TZQA 2AE2A 1LDGA 4C4OA 2HU2A 1U4OA 4YWJA 4LSMA 1AHHA 3PZBA 3E6AA 4BIIA 2DAPA 3ZWWA 2YYYA 5HS6A 2X8LA 3L4BC 3Q0EA 4BNFA 4Z6KA 2I99A 2O4UX 3HE3A 4QEDA 2NTJA 4P22A 1ZO8A 1UXHA 3V5NA 4BO3A 2YY7A 4AL4A 1JKIA 1NR7A 3S55A 9LDTA 1DC6A 1NFRA 3M2PA 2RH4A 4QFCA 5L53A 4D79A 3MWEB 3KSDO 3ZN2A 4BV9A 3G1TA 3LT2A 3G79A 4CM7A 1UXGA 3I5MA 5JCJA 5T64A 4D3DA 2G0TA 2F00A 4O0LA 4PLVA 3COSA 1R15A 4FFNA 2BRUA 5I9LA 1PTJA 3E9QA 3GPIA 4GL4A 1ZJYA 5CHEA 3U4IA 4KDFA 1B15A 1ULSA 2EGGA 2Q49A 2PNFA 2NTNA 1X15A 5C7IO 3AUSA 3PHGA 3W1VA 1WXDA 2R00A 1EDZA 4YPOA 1RM5A 1E7SA 2FY8A 3IAHA 3OEYA 3U9LA 1KVSA 2ZTVA 1GR0A 2Z1NA 3SJ7A 5ICMA 2QRLA 1LEHA 1AHIA 4RF3A 2J5RA 4GLOA 4ND1A 5I7FA 1EUCA 4R1TA 3ZU3A 2XF8A 2B4RO 5J23A 3R6DA 4CLHA 5JLAA 3JQFA 1P1JA 2PR2A 1JWAB 1QLJA 3PWSA 2P68A 5GMOA 1V6AA 3RUHA 4GX5A 4BO9A 1UP6A 4GMFA 2AG8A 3UAGA 4L75A 9LDBA 5T8KA 3IOYA 1AN9A 2R00C 3BMOB 4IJUA 1F0YA 4J1TA 3WLFA 1P33A 1Q0HA 3RQSA 3FRJA 4F6LA 2DM6A 4IMPA 4CPDA 2I67A 1DC5A 3UGKA 1VSVA 1LJ8A 3ZHZA 1GADO 2CD9A 4JBIA 1X14A 4XRRA 1HLPA 1IPEA 1N2SA 1UAGA 3OIDA 4TKMA 4Y9DA 4GAEA 3GH3A 1SEPA 1R6DA 3CMMA 4TMFA 4BNZA 1PJLA 4PZCA 3IP1A 1B3BA 3DOJA 3JYQA 4XR9A 1L7DA 4E13A 2J3HA 4GGOA 1U3WA 4MP6A 2WTBA 4PFJA 3ZW8A 3EW7A 2XXBA 3B6ZA 4IQ0A 3KTDA 4NBUA 1LNQA 4UVHA 1DIRA 4RQUA 4X54A 2LDBA 2HJRA 2BFOA 4WLOA 3ZWYA 1N5DA 5ENDA 3IJRA 2RHCA 1JKJA 2AEJA 4IXTA 3RUDA 1WLYA 5JAQA 5G0SA 2OUIA 4IINA 4DTIA 1JVBA 4DVJA 1HDRA 3DMTA 2NNLD 3HDHA 2WWRA 5ENVA 4ONEA 4W82A 2AQ8A 1U2GA 4IDBA 1GUZA 1N7HA 3GVPA 1T2AA 3FF4A 1WMBA 3OSUA 4W9NA 5U4QA 1U3TA 4OMUA 3U49A 1QG6A 3G1UA 5JE8A 4RVUA 3PIDA 4DA9A 5C37A 3RI3A 1VSUA 3WFJA 1RKXA 3NT5A 4GMGA 3HG7A 4IJVA 3RBZA 5IZ4A 2XAAA 1FF9A 4CM4B 1HL3A 2AMFA 3K96A 1S7CA 1VJ1A 3ZV3A 1Z45A 4DXHA 1N7GA 2JCXA 1NFQA 1P1FA 4YRAA 1TT5B 3F4LA 1EMDA 3DBHB 1H93A 3I3OA 3RFTA 1GUYA 1HDGO 4EUFA 1Y8QB 1SZJG 3CPSA 3ETDA 3JQBA 2A4KA 3ZWXA 5JNLA 1E7YA 3ANNA 3MJEA 7MDHA 2P9EA 2VT2A 3EAGA 1NVTA 3DWFA 1YB4A 2X5JO 4J7UA 4U8GA 3UCEA 4EEXA 5ICSA 1Z7EA 1P45A 4CUKA 4D7AA 3ASUA 1GV1A 2VHYA 5EESA 5G4KB 1YBVA 1CF2O 1N8KA 3Q3CA 3TNLA 3UVEA 4TVBA 3KOUA 4N5LA 1X1EA 1L1FA 3ASVA 1SNYA 5HS4A 5HTOA 3GHHA 2HLPA 2XOXA 3JQFC 1KEPA 4FSHA 3C24A 3DZBA 5T67A 4J9UE 4AJKA 4MVJM 3WWZA 3TZ6A 2EHDA 3H7AA 3Q1LA 2WE8A 3QVWA 4RZHA 2CDCA 4FOOA 4R41A 2ZTLA 3JQGA 3I52A 4Y8VA 3OIGA 2VHXA 5THKA 3W4JA 1ZKMA 4BVAA 3D3EA 2FSSA 2ZKLA 1FK8A 5I7EA 2EEZA 4ZU3A 1E3JA 1PWXA 1PJ4A 4K28A 5H83A 1ISMA 3JQ6A 4YXFA 3JD4A 3W8DA 4XGIA 4JBGA 3CMCO 5A9TA 4DQVA 3WSVA 1ID1A 3VC7A 4MPDA 4MIYA 3JQ9C 4XB2A 3HQ4O 1EBFA 3ZU5A 3WMXA 4CMGA 4WLVA 4BO4A 3VH1A 1IZ0A 1ZXLA 2OHXA 3KB6A 1O89A 2W90A 4O63O 2HMWA 1V35A 4J91A 2RHRA 4WOJA 3LLSA 1VJTA 3CEAA 4XJSA 4LK3A 4LRSB 4IGFA 3GZNB 4WNIA 3Q9NA 1MLDA 3H3JA 3C3XA 4J0FA 4MVJG 3RC9A 4PLFA 4XDYA 1EBUA 4RLHA 4WCFA 1T2FA 1FXSA 2E37A 2JHGA 1PQWA 3C7DB 3IS3A 1SOVA 2Q1UA 2J3KA 4L76A 4AFNA 3RU9A 5L4NA 4PLTA 3HDQA 3NT2A 2W8ZA 5U1PA 2P5UA 4YVFA 1MA0A 1DHRA 3SX2A 5IF3A 3CINA 3K73O 2ZQZA 3A06A 1UZNA 4NBVA 1YVEI 4Q3BA 4BGVA 3DL2A 4MP3A 1Z75A 2OBYA 4OSPA 4W7IA 1HETA 5AYVA 3EZYA 3LK7A 2UV8A 4OXKA 3VPXA 1HYEA 1JTVA 3E5RA 4CMCA 1GZ3A 2PZMA 4TROA 2H9IA 4BNTA 2CVOA 2NACA 3OBBA 1Q7BA 1BMDA 1W73A 3V2HA 1AE1A 4EUHA 1P1HA 1F06A 1WDMA 1ISGA 4OKIA 4FBGA 4PLHA 1KOLA 1JU9A 3FBTA 4YAJA 1H9BA 4DWVA 4OHUA 3H5NA 1DO8A 5L4LA 4FS3A 3DO5A 1X7DA 3EK2A 2YUTA 4WKGA 4B4VA 3UKOA 1O8CA 1YS4A 4UUNA 4QX6A 4AJ1A 1MC5A 1I36A 4GWGA 2J3JA 1KC1A 1E7WA 2DUWA 5L3ZA 1ORRA 3JQEA 2GZ2A 3BAZA 5I9NA 4RO0A 3N58A 3DAPA 1DFGA 4K1LA 1GCOA 3WR5A 2HK7A 1QRRA 1DEHA 1Y81A 4QXMA 3B70A 1KVRA 5AXBA 3GVCA 4IS3A 3V2GA 1D4FA 1ZK3A 2CFCA 3CSDA 2IE0A 3EYWA 1PZEA 4M55A 1V3TA 2JL1A 2Q50A 2XXJA 3KYDB 2VN8A 3O9ZA 4MVJP 1RYEA 1MP0A 4PCVA 1RM3A 2D2IA 2DT5A 1BHSA 4DRYA 5FI5A 1A4IA 3HN2A 3KLMX 4KP7A 3E9MA 3F1LA 2AA3A 3AUAA 4GX1A 2P4QA 4H15A 3WB9A 1ENOA 4PZEA 4BS9A 3BZUA 3AI3A 4B4UA 2QW8A 1MUUA 3MZ0A 5L51A 4DIFA 2AXQA 3DHEA 2HAEA 4TVOA 1QXSA 3ZNOA 1ZZEA 4MINA 3K31A 4ESOA 1WWKA 4CM5A 3JQ9A 1E7MA 2JD1A 3JQBC 4XDZA 4BGEA 4MP8A 2JHFA 4ZGWA 5L45A 1E1LA 1I3MA 5IN4A 2PKRA 1C14A 1PJ2A 3HSKA 4JGBA 3TFQA 3FN4A 2WD7B 4Q3NA 3I9MA 2IXBA 2J6IA 5MGBA 4I9NA 1B3RA 3ZWOA 3F46A 3ORFA 1ZVMA 3BHMA 4BB6A 1PGQA 1ISHA 1U7HA 1EQUA 3QVXA 4NIMA 1B8PA 1DRWA 5KVVA 1GAEO 3JQAB 1CERA 1HTBA 1K2WA 1YO6A 3DZHA 5DP2A 1XEAA 3I23A 4CMHA 3GDFA 3G0OA 4M89A 1I5RA 4UVGA 2I66A 4DUPA 1NQTA 3F9IA 4EI2A 1Q0LA 4YEDA 1WDKA 3ZHYA 1HDZA 2JFFA 6LDHA 4D0RA 4M1QA 4GBJA 4RDHA 3FR7A 5JAIA 3KHUA 3M6IA 2X6TA 2AQIA 1UDAA 3KYCA 3DBHA 2PTGA 2PA3A 3K8ZA 1GEGA 2EXXA 2HKIA 5KVCA 1QV6A 4YCAA 4FJ0A 2NU8A 4URFA 5JAMA 4JROA 4FCCA 1U28A 1B14A 3WFIA 3V1TC 1ISFA 4XB1A 1KIFA 1T24A 1K0UA 3WGYA 2C07A 5LDHA 3INRA 3DZGA 1MGOA 4JJGA 1KEUA 2FSVA 2GDZA 3GAZA 1JQBA 3JQAA 4CMKA 4CQLA 1KVQA 3ITDA 1PZFA 4Q39A 2ILTA 4KWIA 1G0NA 1P0CA 1PWZA 4TRNA 1BG6A 1E0DA 1ZMTA 1GQ2A 3H5RA 3G3EA 4PIVA 3DONA 2JKVA 3H9GA 1U3VA 2E82A 2Q4BA 1MXHA 3K2BA 3BMQB 4PG7A 1O6ZA 1NFFA 1BXGA 4Q3AA 3V2UA 1DIHA 4BNNA 1SO8A 4L4SA 5JBIA 1BXKA 2ZB7A 2ZYAA 2VUUA 3F5QA 1AXGA 3ROMA 3RJ5A 1ZEJA 1H5QA 3F1KA 3I9OA 4BO8A 3D5QA 4RVGA 2J5QA 2NUAA 4OH1A 1JW9B 1R4NA 1G1AA 2X0NA 4BNYA 5TSDA 3VDQA 4FDAA 2WJPA 4XCVA 1DRUA 5HWSA 3TRIA 5A9RA 1XG5A 3MTJA 2Q2QA 2PH3A 4WUVA 4YT5A 4UAGA 3WQRA 2ZYDA 5IFLA 5H82A 1B16A 1P31A 3AOEA 4HXYA 1J6UA 1PJQA 4YACA 2LDXA 5IXYA 3CZMA 3TOZA 2OFPA 2QYTA 3I9JA 4FFMA 3B1FA 3NDJA 3H3FA 2FN7A 4WEOA 2WE7A 3TQHA 1GDHA 3RU7A 1B2LA 3KV3O 3HFGA 2QZZA 1LRJA 1Q1NA 2DVMA 3PVZA 2W4QA 4R1UA 4Z9YA 1A4UA 2QRJA 3OJLA 3SJUA 2C7VA 4K6FA 3SLGA 4J4BA 5IDWA 3LC2O 4B3HA 1PX0A 1R4MB 3OJOA 4MVJI 5CPFA 2VRBA 4A73A 5BNFA 2VWHA 2YHUA 4RF2A 1MG0A 2UYYA 3DMYA 2Q1TA 2VNSA 4LW8A 4L4RA 1NYTA 1LRKA 2FP4A 1NNUA 1WP4A 2JFGA 3ETEA 1UXIA 1I24A 2YDXA 3OHSX 4ZJUA 1WAMA 5CEJA 2QIOA 1DIGA 1M6WA 1U5CA 3DQPA 3FNEA 3KEQA 2CDBA 5IN5A 4OOEA 4ILKA 1W4ZA 3QWFA 4J43A 3VZPA 3V1YA 1H6AA 4WGGA 4N7RA 2BFAA 3PDJA 4RVHA 3RIHA 5JXWA 5A04A 2DU8A 3ENNA 3Q2IA 1YE3A 3DBVO 3ST7A 2B4TO 3A1NA 5CG1A 3ZWBA 4CM1A 1ENYA 3PLNA 2IEBA 4WLEA 1D3AA 1PGJA 1S6YA 4BKRA 4M54A 4CM9D 5G0UA 3WJ7A 2CY0A 4GX0A 1LSJA 3G49A 2X0RA 1T2EA 3VVBA 3PWZA 5A5FA 1DBVO 2AQHA 1Q2XA 4JP2A 4NFYA 2X5KO 3K9QO 2DQ4A 5GZ3A 1OAAA 3RC1A 3PYXA 4OQYA 1I2ZA 1KS9A 4IDDA 1LBEA 3TDKA 3UXYA 2JAHA 3GEGA 1ISIA 2AQKA 3PWKA 4R1NA 3U4HA 1HSOA 4ZRNA 1K6XA 1YJQA 3NKLA 4K9DA 1C3VA 1PQPA 4R1SA 4GX2A 1JAXA 2YDYA 3SEFA 3WJAA 5A06A 3NDRA 5IDQA 4OO3A 3PZRA 2X0IA 1E6UA 3EUWA 3PYMA 4B8WA 1T2CA 4CM3A 1EEHA 3SC4A 5AVOA 1AXEA 2DTEA 3DZKA 4UUMA 4Y6SA 5ER9A 2GD1O 2VHWA 2GNAA 4B7UA 2AE1A 4TZKA 4IUYA 3NGLA 3BYZA 4IIVA 1Y9AA 3GC6A 2EF1A 1W0CA 2FZWA 2CDAA 2G76A 4E4YA 3MJVA 2B37A 5CPBA 1ADBA 3DZJA 3DZFA 4MKRA 1Z6ZA 3P5SA 4NU5A 3RUIA 4EZBA 4DIBA 1HDOA 4CR8A 1EE2A 3H6KA 3CIFA 2HCTA 1XCBA 1D8AA 2OL4A 4J1NA 4Z9FA 3V8BA 4U5QA 2X7HA 2VZ8A 5A02A 5K6AC 2CF6A 2VHVA 2C82A 3KLPX 2FRDA 2Q99A 1E7QA 1NWHA 4BKPA 5BQFA 1PZHA 1LXCA 3EY4A 1E7RA 3LVFO 2B0JA 4IXWA 5EINA 4QO7A 3V1UA 4NH4A 1U5AA 3L77A 4NJOA 4JLWA 5C7LO 3P2YA 2NWQA 3WOHA 3OP4A 2FZEA 1L7EA 4FFOA 1OBFO 1GCUA 1ML3A 4CM8B 1YL6A 3ROPA 3OJFA 4YJDA 4MKZA 4XQ9A 5T5QA 1A9ZA 1R66A 1Z73A 5C5IA 3TJRA 4BNGA 3PJGA 1NXQA 2OP1A 3DDNA 3ICPA 4YT4A 3FHLA 2WYUA 4LGVA 4AG3A 3KM0A 2DBRA 3FNFA 3I6QA 1F12A 2QX7A 4UVDA 3NUGA 2TMDA 4OSOA 1YONA 1HYGA 2C54A 1I2BA 4A27A 3BTOA 1H2HA 3QLJA 4GSLA 3A28A 1UXKA 3FD8A 4E2ZA 1EDOA 1BDBA 4A5OA 4ALLA 1SB9A 2EP5A 3UCFA 1RYDA 2O23A 1T2DA 2JFHA 3PHIA 4L73A 4AJ4A 4BMNA 4RVFA 1V9LA 4CODB 1UZMA 2ZCVA 3ZWNA 1PSDA 1ZUD1 4NHEA 3L0DA 5TT0A 1RM4A 3BMQA 1PS8A 4OIMA 1EVYA 1LLCA 1LLQA 4NFSA 4R5HA 3VKUA 5FEUA 4CQMA 1UJMA 4JXKA 1YQGA 2FR8A 1BDMA 4W7HA 1UDCA 3VH4A 2NM0A 3F4BA 1OMOA 4KTTE 1DC4A 1WW8A 5DOZA 5A3VA 3ZU4A 5KTKA 1KC3A 3C7AA 4O1MA 2CMDA 4W99A 4NQZA 1DRVA 1MG5A 1LA2A 5KOIA 1BW9A 3DTYA 3GN1A 3TZHA 1O95A 5HBRA 1YL5A 3FWZA 3NJ8A 1YDWA 1JLLA 3RJ9A 1K5HA 1P0FA 1LC0A 4ZQFA 1YQXA 5DDIP 3LF2A 1FDTA 1SB8A 5BSHA 1NBOA 2G17A 4RPKA 4J1QA 2EWMA 4BKQA 1P9LA 3AWDA 4OYRA 2HRZA 4OM8A 8LDHA 4MVJF 1O9BA 2J3IA 4O59O 3OJEA 3PEFA 1HEUA 1B8UA 2E49A 3JQ8B 2P4HX 5ILOA 3HFSA 3OICA 1PR9A 1C0PA 1NQAO 3UICA 2VYND 4A26A 3AM3A 2NTVA 3ZWPA 2PY6A 1Z7BA 3C8MA 3OM9A 1RM0A 4CM6A 5B4TA 1NPDA 5ITWA 4PLZA 3QP9A 2WEKA 4HY3A 1NAHA 5AXDA 4UEOA 4HADA 3QWAA 2NU6A 3WTBA 1P1KA 2PLAA 2B69A 3RUFA 4CLOB 4ZICA 1XWFA 1YJ8A 2OZPA 3PDUA 1EK6A 2TMGA 3PLRA 4NMHA 3VPGA 1LX6A 3LZ6A 2W2KA 2P5YA 1ZIDA 3GRPA 3RUEA 3PGXA 4NR0A 3AI2A 2JJYA 5IDYA 3GZ4A 4PG5A 4R01A 4UULA 5AQ1A 4R51A 2ZIZA 2OXIA 1VKNA 2DUUA 3OQBA 3NTRA 4Z3KA 3I9NA 3EC7A 4XQCA 3PFFA 4RV9A 3GDGA 2PD3A 2CVQA 2X5OA 4RF4A 3JTMA 3GVHA 5CDSA 3JQ8A 1ZNQO 1XSEA 3WGGA 5IDXA 2V6GA 3UCXA 4YAGA 4MDHA 3WMWA 4R3WA 3AFNA 5HA5A 1RJWA 3AM5A 2Y05A 1VM6A 2V6MA 5TJHA 3ZWCA 5EQFA 3RASA 1AGNA 5DOVA 5K9ZA 4BHTA 2JCYA 2J5KA 5T57A 1SOWA 2VZ9A 4MO2A 4B7XA 4J4HA 2A94A 1JDJA 4DL9A 3JD0A 3F3SA 1VC2A 4XYBA 2DPHA 4Z0PA 4Z0HO 1A5ZA 2YV1A 4QT0A 3ADPA 3ZW9A 1YL7A 5JSFA 4CMIA 3MJCA 1MXFA 3VZSA 1CIVA 4CMJA 4E5PA 1PGPA 2EW2A 5JDCC 4YAIA 1EQ2A 4QUKA 1NP3A 2UUPA 4GKVA 1GTMA 1X0XA 2Y1GA 3S2EA 3ON5A 3EVTA 4LSWA 2V7PA 2CSUA 1R16A 4AJNA 2BF7A 4UEJA 3IIEA 3S1LA 4WECA 1H94A 3RFVA 1N92A 5CP8A 3IL2A 2Y93A 5B37A 4AJ2A 2NQ8A 1CQIA 3ICCA 3WGHA 3RWBA 4D41A 4I8XA 2Q1SA 4E3ZA 3D4PA 2X9NA 3U0BA 3L4BA 5DBGA 3QWIA 1E77A 1HLDA 1U8XX 5CEEA 3VZRA 3PP8A 4WCDA 1YH3A 3IP3A 4LMRA 4A10A 4P4GA 2IYPA 1LLUA 1Q7GA 4IDGA 1PJCA 2DTXA 1DHTA 2Q46A 4UVIA 2HMUA 1F17A 3TFOA 5KKCA 3CE6A 1AUPA 1OI7A 3H9QA 5CDTA 4RPHA 1XR3A 1BSVA 4E5YA 2FPGA 4AICA 4GKBA 5BSEA 3F5SA 4NBRA 2RIRA 4NZ9A 3H9EO 1B26A 2IRWA 3PFWO 4FQ8A 1TA4A 2O7SA 4ALJA 4OL9A 2GLXA 3BMOA 4IDEA 2C2XA 1ENPA 4YT8A 1A72A 2UVDA 3VAZA 5DT9A 4CV2A 1ONNA 3JQ7B 1ZW1A 2GCGA 4YT2A 2D4AA 2QYSA 4ZQEA 1CQJA 1ZSVA 3DOOA 1UDBA 1HF3A 3IKVA 4O5OA 5U9CA 2FR0A 5FI3A 1I33A 2YW9A 3EGOA 2DTDA 3KVOA 3R0IA 4AJIA 1X0VA 3GAFA 4RLSA 3I83A 4PVCA 4U6QA 5A1TA 2P9CA 3AY3A 4JN6B 5LC1A 1PS9A 2PZKA 3D7LA 1CJCA 2NADA 4M87A 1H6DA 2EP7A 3F47A 1A9YA 3PI7A 1DIBA 3ZI0A 3JCZA 3CKYA 3D4OA 4Y98A 5COBA 2Y1DA 4NI5A 5JMWA 6ADHA 4BB5A 4N5NA 4HNHA 1WZEA 3PHHA 4DREA 2Y0EA 4UUOA 3WIEA 2GN9A 5A5EA 3GOHA 2G5CA 3KYDA 1BVUA 3UFXA 4GI2A 1VL8A 4AJOA 2VHZA 3GK3A 3GG9A 3LU1A 3RUAA 4BNJA 4CR7A 5CFZA 3WS7A 3M2TA 3DC2A 4XYGA 1M75A 1FMCA 3EZLA 4BO0A 4J90A 4OQZA 1U9JA 3BMCB 1M2WA 3DXFA 3H8VA 3T4EA 4BQPA 2BGLA 2GYYA 1ZMOA 5A9SB 3OETA 3ZWVA 1W8DA 1C1XA 4KTVE 4QTZA 4W4TA 1G6KA 3BIOA 3N7UA 2D59A 1GQYA 4D42A 4U7WA 1ADFA 4CJXA 1OOEA 5ADHA 5F1PA 1HDYA 2Y67A 4G2NA 2IODA 3I1JA 3W6ZA 4G81A 2VYNA 1XIVA 3ANMA 3GQVA 3GUCA 3L9XA 1EZ4A 2SCUA 3C1AA 4P8RA 2YJZA 3H4VA 5BNIA 4HBGA 2X1HA 4RL6A 3DZIA 4I5GA 4S3MA 2A35A 4RVSA 1QR6A 1NQOA 5EERA 1PJTA 2OGUA 4EUEA 3IUSA 4LVCA 1KBZA 4IZIA 4IGEA 5IZCA 4MIOA 4ZRMA 1CRWG 3RFXA 5DBFA 1NM5A 3UW3A 4LMPA 4XR4A 4BOYA 2IZ1A 1IY8A 2BGMA 4WLNA 3PTZA 3HZZA 3OQ6A 2BHLA 1FDUA 2I9PA 2JCVA 4DIOA 5A4DA 4CLXA 3GHYA 4NK5A 3S2IA 5JYEA 2PKQP 1U2DA 3U62A 2AEMA 1TT7A 5F21A 3D64A 3OJ0A 4XYLA 2R2GA 1VL0A 4D3FA 1NWCA 1J4AA 2ZTUA 5CAEA 1YB5A 2ZTMA 2POQX 4ITUA 4BNMA 3WWYA 1UH5A 1DIAA 4PLGA 2PFGA 4PZDA 3UN1A 1XA0A 4DC1A 2D5CA 1V8BA 2GPTA 4TRRA 2FPPA 3H9UA 4MVJH 1ZH8A 2IZ0A 4C7JA 3LT4A 3KETA 3UF0A 5G0WA 2BELA 3FTNA 3L6DA 1X7HA 4YA6A 4B4WA 1JN0A 2FPIA 4BO5A 5DNAA 2P2SA 4TSKA 3WQQA 3GGPA 4PVDA 3HNPA 1KYQA 5L40A 2BI7A 5L4SA 4Q9NA 1O5IA 4INAA 4KUHA 1YBAA 3UH1A 3E48A 4BNLA 3LYLA 4J7CA 1CEQA 5LDGA 3CZRA 4R9SA 4DGSA 3FI9A 3ONFA 4XWYA 1Y6JA 1R4NB 4K26A 3L6OO 3NTOA 3D3WB 4B8ZA 4CQLB 1SC6A 4I9UA 3B1KA 2AG5A 2ZQYA 5JC1A 3SC6A 1IE3A 4WLUA 3R3SA 1HSZA 5G4KA 1I3LA 3BMNA 3INGA 2RCYA 4NK4A 4BKOA 1GZ6A 5JDIC 1SEVA 3PIIA 2QZ9A 3KUXA 4RZIA 1DJQA 1E3SA 1P3DA 3PQEA 1J0XO 4FJ2A 1LC3A 2HJSA 3S8MA 1XQ6A 1MFPA 1K6JA 3PQFA 3WNQA 4FC6A 2Q1WA 4CV0A 4YR9A 1F8GA 3WXBA 4FN4A 1I30A 5COAA 1UP7A 3QQPA 4KUEA 3QV1A 1HT0A 2Y1FA 5LCXA 2E4AA 2O3UA 1WNTA 4HNGA 1ZCJA 2O2YA 1E1NA 3RVDA 1EE9A 1GEEA 4FIZA 4L4XA 2X23A 5KJ6A 4XJTA 1OC2A 1B0AA 1P1RA 1HXHA 4FC7A 1XELA 2FOIA 4JP3A 4KUGA 2X9GA 4E2WA 2CZCA 1ZK2A 3I4CA 4BKUA 1PL8A 1GYQA 3GR6A 1R0LA 2V6FA 1XKQA 3MOGA 1MC4A 4HFNA 3OF2A 3CH6A 3VZQA 3PRJA 5JPIA 4DQXA 2GASA 5EN4A 4EGFA 4RJTA 1LDBA 2O2SA 1A7AA 2VUTA 4CMEA 5CDGA 4YTEA 5TT1A 2D0IA 4KMSA 3AI1A 1Q7CA 4FD3A 4TQGA 1GPJA 4BMSA 1JAYA 1GQQA 4OXNA 1PL6A 2YQ4A 4J3FA 1EUZA 4BV8A 3BTUA 1T4DA 4UREA 1I0ZA 3TZKA 1W6UA 1K3TA 2VOEA 3ZH2A 4IPTA 1MB4A 3VOSA 3GA0A 4DLAA 4R9RA 1HE3A 4R5MA 4JIGA 1FDWA 4WLFA 4GLLA 4WJZA 4YYZA 4DYDA 3I9KA 8ADHA 4ZQHA 2QRKA 1WDLA 4U0KA 1LI4A 3GFGA 4BO2A 1Y8RA 5KVQA 3QY9A 3MTGA 2IXAA 4E31A 2VZ0A 1DFHA 1HWYA 1JWBB 2C29D 2NU7A 3ZNQA 5IAAA 1MX3A 4CUZA 1IB6A 4MVJA 2NU9A 4QSMA 4HFMA 1HDXA 4F45A 4FB5A 3L9WA 4KQXA 1VLLA 2I3AA 2C7GA 4QO8A 4ROSA 3D1LA 4FGWA 2HMSA 1NTOA 4HP8A 4RPJA 1PL7A 2EERA 4H3VA 3GEMA 3HWRA 4DBVO 1TB4A 3BA1A 4J7XA 1M67A 3DFZA 2RH8A 4DBZA 4TRMA 2OP0A 4D3SA 1UZLA 2YFHA 3MEQA 5B12A 5MDHA 4F6CA 2YHIB 4PRKA 3GDOA 4QECA 4E2XA 1M66A 2H63A 4P4NA 4PLPA 1KERA 3JSAA 4XZ3A 3LF1A 1YDEA 3AM4A 1DLJA 5EMHA 4PLCA 3O4RA 1V3UA 3GPDG 1NVMB 1XQ1A 1GFSA 3RC7A 3ZV6A 4RORA 4WPGA 4B7CA 5KCZA 3DAGA 3I6IA 3QWHA 1KETA 4YDRA 2Z1MA 4JJIA 3WYEA 5FFFA 4I5FA 2Y99A 1JKFA 3NDIA 2VRCA 2I5PO 1EFLA 1SCUA 3HDYA 1HYHA 4XIJA 1OC4A 5EJ2A 4RDIA 1QMGA 2O7QA 3ITKA 4Y6PA 3LC7O 2V6BA 4CM4A 4CM9A 4PG8A 3AJRA 5I8WA 4AVYA 4R4JA 1H0KA 3BHJA 1ZEMA 1PR3A 1TT5A 3GFBA 1BGVA 2XPCA 3TWOA 2O48X 4BGUA 4IIUA 4ZN6A 4FJ1A 2HSDA 2W2LA 1A71A 2WD7A 3QVTA 4B4OA 5KVSA 2WYVA 3MWDB 1DFIA 1EFKA 4WNCA 3ETGA 1A7KA 1H9AA 4FGSA 2BLLA 3OEWA 2JAPA 3A9WA 2UUOA 2Q2VA 5DULA 2NVUA 3EDMA 2OBNA 2P91A 3ZGYA 3GF4A 2PWZA 3KYBA 4CL3A 2IZZA 5JW6A 5TIIA 3T4XA 1E3WA 3AU8A 1O94A 2JD2A 4E0BA 3PYLA 4BGIA 3GVXA 3VTFA 1KY4A 3JV7A 4S1VA 3QJ5A 4YBZA 1QYXA 4ND3A 2D3TA 1ZK4A 3GVIA 2C5EA 3RSHA 1XGKA 4M86A 2W2KB 4WE3A 4LISA 3WLEA 1QV7A 2O3JA 2DBQA 4RGBA 5I8ZA 1NHGA 4H16A 4NNJA 4B3JA 3NYWA 3WGTA 1Y9EA 3KYCB 3ULKA 1ZK0A 4E33A 2BD0A 3RCBA 3W8FA 1N9GA 1NPTO 2Y66A 3ENKA 4XEHA 3E82A 1I8TA 2DBVO 3FBGA 4P4LA 4EJ6A 2BMAA 3NRCA 3R3JA 1YOVA 5KJEA 1UAYA 2ZJ0A 1HRDA 5A05A 5JY6A 4DLLA 4ZHSA 2WYWA 5F3RA 1TI7A 3WGOA 2VUSA 1VI2A 3O26A 3QE3A 4B3IA 5IG2A 2G82A 1WVGA 4YB8A 5A03A 4YJGA 1Y8QA 1YXMA 2O50A 3IMFA 3D0OA 4NBTA 2I6TA 3WGIA 4WEQA 2GN8A 5EQDA 4FR5A 5BNTA 2DFVA 3ZNNA 5GZ1A 3DHYA 5IXSA 3EMKA 1NQ5A 3C1TA 2NLOA 4I08A 4IDFA 1I32A 4EW6A 2A92A 2C20A 4MKXA 4GVLA 3HADA 4NJMA 2BKAA 3O38A 4UVEA 2NV6A 1UR5A 1B7GO 4HV4A 3O03A 3DBRB 1IYZA 1GZ4A 2GN6A 1DJNA 2NQTA 4G65A 4L0QA 4N54A 4II3A 1GUFA 3DB2A 2DFDA 5BSFA 1N1EA 2VNAA 4CMIB 3A14A 1QYWA 1XU7A 4A2CA 4CLOA 3H2SA 4AJJA 4NG5A 2PZJA 4HFRA 4AJLA 4JQCA 1BWSA 3KXDA 1IHYA 3C7CB 2ZB8A 5DCYA 2VQ3A 3PGJA 2EV9A 3OIFA 1GYPA 4XX0A 2OO5A 3WBBA 4I9HA 3FNGA 3NV9A 1SPXA 2HRBA 4U0JA 2HQ1A 2PV7A 2W98A 3FSRA 1I2CA 3FPLA 3MCVA 1BVRA 1M76A 2UDPA 5TLSA 1IHXA 1Y5RA 2Q3EA 2DPGA 1YB1A 2OOSA 4XGNA 4ND5A 4CQMD 4KZPA 3VKVA 2H1SA 1JVSA 1V3VA 5JMPA 1KEVA 2Z95A 1LQTA 3WX0A 4BNIA 1VL6A 2G1UA 3JD3A 1JA9A 2VOJA 3B20A 1E6WA 3DBLB 4JCOA 3PJDA 1C0KA 4UEKA 1PU2A 1DPGA 3AUUA 3T7CA 4IQ8A 5JDCA 4LCEA 1DB3A 1XDWA 1E1KA 4CUJA
chains in the Genus database with same CATH superfamily
1FFAA 2FJ0A 2VWPA 3AB3A 2H51A 3C3CA 2OA0A 1QIKA 4L8FA 3RSGA 1QE5A 2BZSA 1J06A 3DKVA 1DSSG 1SHTX 4L3WA 1Z2PX 2GYWA 4D97A 2BM0A 1T6XA 1IC6A 1Z5OA 3JQQA 4NNOA 3ZIAA 4PPGA 1MOSA 3KSBC 4AS3A 3DHNA 5I3CA 3VPFA 4EHFA 4QYTA 2E21A 1C1HA 2EDAA 1ESNA 5UKDA 3Q3VA 4YUVA 3AVPA 4OL0A 3VVCA 5EHZA 3LBHA 3KEMA 5JFOA 1VCIA 4Q7MB 3REGA 3ZDEA 3ZOKA 1EBBA 3U4AA 3M5DA 1YR2A 3PPIA 4ZVPA 4UPVA 3E05A 5HM8A 1Y1PA 3CUTA 3IE0A 2HUPA 4A6XA 2BGTA 3H83A 1JTEA 2JLUA 1UXJA 1XMSA 2NTEA 1UJNA 4EY3A 3LC1O 2WHYA 5DLDA 4M98A 4QBHA 3AOEC 1P8JA 1JG7A 2GBPA 1VMDA 3QZUA 2JG3A 4ZT4A 3E7PA 4KVZA 3OWXA 1ZD9A 3TZEA 4NXNB 1Z0KA 3ONVA 1DARA 4KRXA 3D8SA 4M1ZA 1GCAA 1CP3A 3WK4A 4EJMA 2HEIA 3WSWA 2ZS9A 3HKCB 2DH6A 3CZ5A 1YBMA 3AUXA 1AKNA 4TV9B 1P74A 3IDAA 3CZ9A 5AW2A 4G0QA 1RYZA 2YXBA 5F1OA 2VTDA 3A1UA 1RDFA 1NR1A 1GYRA 3DMNA 5PGMA 3VDNB 3CTPA 2QRUA 2E55A 2KQUA 3PQDA 3F8TA 1EVIA 1TRHA 1OI4A 3PJFA 5FOWA 1YTLA 1JNXX 1SBYA 1FVHA 2J48A 4W9NC 3U4DA 1VE9A 1MH9A 3CLSD 2JFPA 3D7SA 2Q28A 1NRIA 1ORDA 3GLIB 4IFEA 1OLXB 1ACMA 5HHTA 4EFLA 4GWKA 3S2FA 1S8FA 4BO6A 1MV8A 4BV3A 5T4FA 3UG7A 4BN0A 4DCCA 4P0PB 1HC7A 5F76A 1K8QA 5H1YA 1YC2A 1RP1A 4PYOA 1RI2A 1LU9A 1AZSC 2GVNA 3Q10A 2PYIA 2FWMX 1TYAE 3M1LA 5DPMA 2ZDGA 3KQWA 2I8AA 2PM8A 4ND6A 4QRDA 4XSGA 4D9FA 5CXQA 4UASA 4Y67A 4LC1A 4CL8A 3U80A 2X9VA 1GL3A 5HDBB 1B74A 2GAIA 1KZGB 3KE9A 1QGYA 3F3YA 3OH8A 3SIRA 3B9RA 4Q3DA 3VJRA 4L0MA 3H5WA 1KO7A 1QR2A 1LNZA 2VF2A 1Y80A 1R5NA 2YHIA 1U0SY 4FLMA 4GPD1 4M8LA 3PK0A 4ON9A 4E94A 4LYEA 2XYGA 5JS8A 3FDZB 2JBAA 3N2NA 1Y4DE 1DXYA 2ZATA 1TKBA 1YR9A 3ETCA 2ZZKA 5IK2D 1SCDA 4KLAA 4KO3S 2NMVA 2B61A 3LUAA 1GTRA 5DHUA 2CDNA 3C8ZA 1GR1A 2Z6QA 5F2EA 1ZPDA 4DDWA 5T4EA 3M5CA 5LD2B 4O2AB 1KI7A 1T3GA 4HJRA 4REMA 2KMLA 2ZT6A 4WXYB 5LMNB 3C4VA 1Z4KA 5AKGA 3TAUA 3WE7A 5FWYB 3MN1A 2CF5A 4L8YA 2Y1EA 1OLOA 5DX1A 4WXHA 4EH1A 2P5SA 1HLGA 5AUOB 2KWIA 1N32B 3K0EA 3HH8A 1DDOA 3QE4A 4FCVA 2VJBA 3NRBA 1VHTA 1ODLA 3TNFA 3W6UA 1BHO1 5C7YA 2MSCB 1Z35A 1IN4A 5DN9A 4Q4AA 5AKKA 3VKHA 1ECCA 4KB5A 3OECA 4EG1A 3UKDA 4EQZA 4WK6A 1ZRHA 2C4KA 5CXXA 1NT2A 3AVWA 3QKTA 1XDGA 3NANA 5CA0B 3VDMA 5KO2A 4CTNA 5T6BA 1SBNE 3KPYA 4OJNA 1IG3A 5TNXA 3RROA 3VXKA 3FNBA 1W5EA 3TL2A 1M6HA 1TM1E 3PUWA 1F6BA 2ZIVB 3ZGNA 3AY7A 5BRAA 4K9KA 4N3BA 3SBXA 5GPBA 4YCDA 4KOAA 4H17A 2IEAA 1F8YA 1OBCA 4MRPA 2ZUBA 3G7UA 2Z9DA 2SCUB 3PHLA 4JUCA 4LHVA 3A70A 3IUMA 3SAJA 3BDAA 3P2OA 2GEBA 2BP7B 2CXUA 2P2LA 2P2GA 1DKPA 3WJ2A 5ICCA 1WO8A 2IHVA 1FTNA 3M6UA 5DK4A 3RYCA 3BJZA 1UMDA 5TX7A 3ZI7A 1ZXBA 3SQMA 1H42A 4PZ9A 2ZTSA 4QVGA 3UBMA 4IXDA 4L4ZA 4IHJA 2V65A 4O0MA 7REQA 5CBKA 5BSKA 2WJGA 1KPHA 2I6FA 4RSMA 3RBXA 4F8YA 2E6KA 1F0NA 3NAQA 3QIAA 1AKEA 4J0CA 4B4DA 3K9BA 2NTYC 1E0JA 4MJXA 4D3ZA 4GGPA 3W5IA 1VA5A 1XN1A 3OZVA 4MQFA 2NIPA 5F2KA 4PS0A 2YL2A 3FLAA 5E7IA 1YQTA 1TZKA 5IPFA 1RMQA 1VBFA 3IQGX 4B9EA 2AD1A 2GAFA 1ID8A 2NZ2A 5E0KB 3BWEA 4RCVA 4DMRA 4FW8A 4BLUA 1KMHB 2H92A 2QP9X 2Y68A 5CNIA 1T1SA 1SD2A 2ZYGA 3OZDA 1ILEA 5LZ7A 1BXGB 2G9QA 3X43A 1XZIA 4G9EA 4N7BA 3UJDA 4KR9A 2BMWA 2XA2A 2Y9MB 2YWJA 3QLTA 1QH1B 4D6YA 4Y2TA 5BW5A 3HRKA 1T8SA 3UXMA 1OTHA 2D5AA 3O8QB 2JFYA 1H2YA 5EIBC 5H9VA 5ILGA 3UAZA 3W2HA 2G0AA 4FFDA 1AKTA 1Z74A 2C2BA 3KSZO 4CLRB 1J7JA 1CC1S 2XAUA 3D31A 2UYGA 3FETA 3FMVA 3IMKA 3PQ6A 4L9SA 3RUCA 1F2VA 4BFZA 3DDUA 3CV3A 1E9CA 3GMSA 3GLQA 1YOVB 1D2EA 3VR6D 1BDHA 3RNLA 1JEAA 1NZFA 4MCIA 2YRXA 3TLGB 3Q15C 1AURA 2YWXA 4IYRA 1TDJA 1WX1A 3FR8A 3K5HA 4ALIA 2JZOA 2NUPB 5MHTA 3CXUA 3OFKA 4B81A 1CG6A 4O4HA 5LOVF 4XJVA 3L07A 1IIBA 3PJEA 3IBGA 3O73A 3I73A 1DDIA 5H4GA 1MRZA 3QI7A 3Q3HA 1WCV1 3L7IA 2DXIA 4HVCA 3JU3A 1KTIA 5DKFA 1E1MA 1QLHA 4KVGA 5BN4B 1TFUA 1KMMA 3MJFA 3QFHA 3DEKA 3HN7A 4DYVA 5CD9A 2C9YA 4FKMA 1NAIA 2BCJQ 3HDVA 3QUQA 4ZEWA 4U1RA 1GTSA 3DBRA 2CNBA 4PY2A 5LJLA 1ZIOA 4C6HA 3UHJA 3OLQA 3IV9A 3W6PA 4GSKA 1UM9B 4LX0A 5DGDA 2G5TA 3WGJA 2IXDA 3QUBA 4PLWA 2YXEA 3MWGA 1OHHA 3DE7X 1VE6A 5DBIA 1W0JA 1WCIA 1PYGA 2JEYA 3CLVA 4OP2A 2F1HA 3ZE8A 1YQEA 1EFDN 1GUAA 1QYVA 1SY7A 1BQEA 1UJ6A 4WZBB 5C52B 4ZQCB 1L7BA 4J4TA 4M9ZA 1R9MA 3HJUA 4YLYA 1S8AA 2VK8A 3D3KA 5ITVA 3KT3A 1T43A 3A6HA 4P53A 3IPAA 2PZBA 1ZS9A 4B34A 5DM0A 1JQ5A 2KBEA 3I1YA 4ZP1A 2FFAA 4LRQA 3IR7A 4Z2AA 3T7EA 1NJSA 3N70A 1LDEA 3Q2KA 1OGYA 5HZHA 3DE5X 5FFNA 4I1YA 1XMQB 1DWUA 1NVGA 2YXLA 3JVIA 2R9VA 4HXFB 2ZSHA 3F73A 2JLRA 4IXMA 5FNVB 4CWAA 4JXZA 4PWYA 3ZDCA 1O94C 4HAXA 4GYWA 4D6PA 4KVAA 4MZXA 2QD2A 2BISA 4L4UA 2QYOA 2FSHA 2REQB 2C7QA 1E2BA 4J16A 2FEAA 2H11A 1HKUA 3ZLTA 2P7IA 2QN3A 4CMEC 3ILSA 1QAQA 5KNLA 4YUZA 1LDYA 5IEJA 5DTRA 2DLDA 2D0DA 5TRTA 4C9BA 1CJKC 2B36A 3D6NB 2PYZA 4A0GA 3Q72A 3DAFA 2ZPUA 1T1RA 2AJCA 5K0TA 4WCFC 3BXXA 2HF9A 5DGCA 3IXMA 4DRZA 3ANLA 4DG9A 1V9CA 4UUPA 5LWQA 1BWRA 2B4QA 2GGSA 4IVPA 5JAPA 4MWDA 5IAEA 5LXTB 4YHHB 3ZPXA 5HOEA 1B76A 2FN9A 4Q48A 1JXAA 2WBLC 3ZZ0A 1BO6A 2PANA 1CRZA 1R4ZA 2NYRA 1E1RA 1MFZA 1WXGA 2X4GA 1FP1D 3HEAA 3MJSA 5TB5A 1ZFNA 3NVKI 4MPPA 5CEFA 1AUOA 1FLVA 4Y6RA 2C3MA 2X76A 1DLIA 4IRMA 5KNCH 2QHXA 2WIBA 2Y0CA 4YRLA 3LXXA 1T25A 2FETA 2IYZA 3GNTA 4PG4A 4R1MA 1YKFA 4X61A 5HE9A 4KZKA 3JQDA 1AOXA 1S8OA 3S6JA 3ORQA 4J0GA 2BEUA 2R86A 1M0EA 1FXWA 5LPNA 4LZAA 1I9GA 3NP9A 5GGYA 3UUGA 1BXZA 5C1BA 5L9AA 3QPWA 4RV4A 1NP6A 3E03A 2QPAA 4KW7A 5IKMA 3BGSA 5B1DA 4Z4EA 1UP4A 2EKQA 3KJQA 1MZVA 3TI7A 5F5LA 2GBLC 3WBFA 2X41A 3T06B 1Z38A 4EEZA 4QPZA 5JCJD 4L8VA 1Q3KA 6AT1A 3VPCA 4FQ7A 1MH1A 1SK9A 3EHDA 3IUPA 3ZV7A 4L9RA 4ZCPA 2CFTA 1CWUA 1G64A 2V5VA 1WMDA 2YZGA 4B3MB 2Q3HA 3FZEA 3U3KA 2WWHA 1EU1A 2C4TA 2NXNA 3HB1A 4H3HB 2WHPB 3AEUA 5HEKA 1ULBA 1XEWY 2VRNA 3FCOA 5JO0A 4JASB 4UNNA 2DR0A 4ZQGA 3S5JA 3G0HA 1KAQA 2HUNA 4WNAB 3CB4A 5KTOA 3OFND 3RSSA 1T26A 5DW3A 5MN5A 3JAWB 3IRUA 3LQYA 4KQJA 3C1OA 3R40A 5KJ1A 3F6YA 4N0PA 4GBMA 1O7JA 3R0XA 1XJQA 4M7RA 3SLKA 5L95A 2I55A 1FFXA 2YWBA 2VHCA 4IDOA 4P4UA 4RZQA 1FL9A 5H59A 1BRMA 3BPSA 3PC8C 1GUDA 5E9JA 4RMNA 4I6GA 5GJCA 3ZZNA 4B76A 3JYLA 4GQAA 1BRTA 3ET5A 4YXWD 3AH8A 1G60A 3O8NA 1CSEE 5CW1A 2HA0A 1P4GA 2X22A 1C30B 4OGFA 2EFJA 5CLQA 3VTZA 5KYVA 3WLHA 2ODBA 3GV0A 4D0NA 1ZN7A 5LZ5A 4I2VA 1RIIA 1WMEA 3HBLA 3QG1A 4YJ2B 2AFIA 5M5BA 4LDJA 4GH5A 1FMLA 3DM9B 3DVLA 1SR8A 3NYQA 1ML4A 3REQA 4JVSB 4G2TA 2QTAA 3X2EA 3NJ4A 4NPCA 1JFLA 2HXSA 4P9NA 3UHOA 4EQ6B 3RYCB 4UQOA 3EIOA 3R5TA 2WF8A 2PGJA 1W94A 3HXTA 2YZ7A 4D4KA 1JECA 5F35A 1JT9A 2DUJA 1KHHA 2FLKA 1V0JA 2ZULA 4PLYA 2VYVA 1CE8A 4FOSA 1QP7A 3V4OA 2RKBA 4OFWA 2AIRA 1X1BA 2ZBPA 4RK4A 5FLEX 5CG2A 1RYHA 1YS9A 2GPSA 3PUVA 4HG2A 2DQSA 4JBLA 4RQTA 2R8EA 2HDHA 5CDFA 3W5HA 3GGOA 5H80A 5ISMA 2IEIA 4L0CA 2IW1A 1YSCA 1H0HA 3PRHA 4PZLA 4QYWA 1XYGA 5DXAA 3SNKA 3VX4A 2FHSA 3P0FA 1H4QA 1R5OA 2EKLA 5A3SA 3MT9A 1ZBQA 4UNPA 5HRAA 5DGTA 1YTUA 1GQRA 4JEHA 2ETXA 4PXYA 1CUEA 1JSLA 5K6RA 4NCJA 4OK5A 5SY9A 3HUTA 5CDFE 2GO1A 3PXBA 3QEKA 1UOOA 2IBMA 3DOIA 4DSUA 2CLLB 2PJDA 2SKCA 1WL8A 2VDNB 1PG5A 4MEJA 3DZCA 3FUUA 1T4BA 5AOVA 2ZPAA 3AESA 1W29A 4Q4AB 4I1UA 3EMBA 5F73A 3KEGA 4LVNA 3VC1A 3ZXIA 3KRTA 1ZQ1A 3HYTA 1QYCA 5CFPA 1Q95A 3T9AA 1NW8A 2WMDA 3AX6A 5E7JA 2QTVB 2AZTA 1IB0A 2AJBA 5EEGA 4XIIA 1AXRA 1CZUA 3ZLJA 2VJPA 3ZJTA 2EZTA 3QHAA 1KVTA 4IJKA 4YQZA 5DHPA 3T1OA 1T2VA 1X74A 3R3YA 5LZ4A 1SAYA 4PQYA 2Z6AA 3DEYX 2QU7A 3SMQA 5COQA 5CA0F 2M6RA 1GV0A 1FVXA 2MJLA 3ONEA 4QXPA 3U3MA 2B5WA 3H5IA 4JX8A 4MWZA 4ASUA 4PQRA 1KF0A 3AM1A 1E3WB 3VHQA 2H2FA 1M0TA 5F7JA 2GK7A 1SUCA 1XNGA 2VRCD 2J85A 2Z2KA 5K6AA 4BVEA 2GM4A 3ZD6A 1TTQB 1C9YA 4C5BA 5L7WA 1FRNA 3GFSA 3D6TB 3TX6A 3U09A 3ZIUA 2JI8A 3O3OB 1KOGA 3A6PC 2XTNA 1TD1A 4G97A 4A16A 5BR7A 2CFRA 4I14A 4Z9XA 4AJHA 1FZTA 1PAUA 3LPMA 3MBKA 2XCQA 3E7WA 4Q3OA 1LUAA 2VIIA 2DPXA 2O3RA 1Q0QA 2OQVA 2PKXA 1T0BA 5C8YB 1OXUA 2XIJA 2IYTA 4KPYA 1XCPA 5JCOA 4PFKA 1UM8A 1TEXA 5A7GA 3HB7A 3ZDDA 4C0JA 3W2IA 4RIHA 3NT4A 1GWNA 4TUYF 5I9SA 3LT1A 3FYUB 2WKPA 3PRKE 3G9TA 3UK2A 1L8LA 4LY9A 4KO2S 5KKNB 3DF7A 3ZHCA 1IZ9A 3B6IA 3GROA 1HZJA 4GYKA 3HGQA 4IV5A 4PGFA 5U4XA 3CGGA 3ZD9A 1XLUA 1QO7A 3ZE2B 4XM0A 3WAKA 4Q4LA 1G21B 2OG2A 3O8QA 3WL8A 5BUSA 1QRSA 3CNBA 4LHXA 4QGFA 1N7IA 4TKZA 5ICEA 4MUXA 3I72A 3P9RA 4M37A 2O5EA 3RODA 1PNQA 4OA8A 2Y77A 5FHQA 4WRRA 4BRWA 2HK8A 4G8DA 2HPAA 2XR1A 4C7KA 4AMZA 5LLSA 1M33A 5IVHA 4JZYA 4QU9A 3LHSA 3NNNA 1WXIA 1V5WA 1A9PA 1WABA 2D74A 2OE2A 4O2BB 1IVSA 3MMNA 3RG2A 1XMOB 1DGQA 4OYLA 2C4UA 4UU0A 1PEKE 5GQSA 2D8MA 4Z0TA 4MS3B 1G2OA 1QFJA 1U2PA 5TLSA 5BUCA 4GS5A 4KQMA 2AE2A 3EW9A 3WDLA 3DA8A 3N2IA 4LSMA 5EZ5A 2PT5A 1XTIA 3BZWA 3OM8A 1VP9A 1Q0UA 1V25A 2X2FA 3L4EA 3P4XA 2O8CB 4QUIA 2X8LA 3GFRA 4M0UA 1UEIA 5HS6A 4Z6KA 5KZMB 1TYCA 1G1MA 1QQTA 3GFVA 4AZ3A 1PLLA 2DR3A 1TU4A 1XTUA 1N3LA 3LX8A 1IWOA 2WKWA 2JBWA 4MVCA 4AECA 1JKIA 9LDTA 4BP9A 1WXFA 1BX3A 1UDWA 1BROA 4HVAA 5K3EA 3KYJB 4OXRA 2QTBA 1ZD8A 4I55B 4LCBA 1JDNA 4EVIA 2G80A 3ZN2A 4BV9A 3AGPA 2FZLA 4IGKA 1N6HA 2QEQA 5BWMA 4ENWA 1EG2A 1WCIB 1T35A 1TIBA 2YYZA 3BCRA 4DMKA 1EWVA 4D3DA 4JC8A 2XCSB 1OJLA 3SOZA 3IE2A 3WWDA 5DIFA 3T34A 2BRUA 1YJBA 3B6EA 3COZA 2H4XA 4P80A 1PTJA 4TLMB 2ABWA 2AVNA 4PM4A 4M4SA 2Q5CA 3GPIA 4GL4A 2WU0A 3U4IA 3IBFA 2JVKA 1Y37A 1JHMA 4KDFA 3FMIA 2PNFA 4MYTA 1X15A 4OHWA 5BSWA 5ADVA 5C7IO 3CGWA 1WY5A 2PRYA 3F2VA 4P0TA 3E5HA 4NYIQ 1XRMA 2IOFA 1E9BA 1E5TA 3AWIA 1K98A 1VPLA 2G9UA 3U7GA 4Y2VA 1RM5A 4IIJB 3UHPA 1RI1A 3IURA 3U9LA 5EEHA 3OO1A 2CMHA 2QTLA 2JFWA 4EL5A 1WULS 1BKYA 2OO3A 2ZWPA 2QRLA 2WUEA 3ESCA 5BRNA 3SEQA 4DJ5X 2P6OA 4MRVA 2A1TR 4UUQA 3WY9A 2Z58A 4C1BA 1D5WA 1EM6A 1ZKDA 1KI9A 3AGQA 5J23A 3D6MA 1LNSA 2FW9A 2OGZA 4CLHA 1BVHA 1P1JA 4BVBA 1QP4A 4RKYA 2H3EA 4S04A 5HJ2A 3NW9A 1V6AA 1Z37A 3RUHA 4GX5A 2H4YA 2PQMA 2ZW9A 4BO9A 2ISQA 2R8OA 4YMWA 2XUQA 5A7HA 3B1VA 3UAGA 2DQYA 4K1XA 9LDBA 5T8KA 2WUWE 3AERB 5KMGA 2W0SA 4E5UA 2R00C 5B2EA 5KTYA 5TEWA 1P33A 1Q0HA 3JATA 1JX6A 1JPJA 2GWRA 2HTEA 3AJ9A 5G1NA 1XT6A 2DM6A 3CS3A 3L7KA 1UJ5A 1FFEA 1DC5A 2FUEA 5FORA 1Z0AA 1LJ8A 4LRXA 2XWBF 5CVUA 2CD9A 3DW3X 3F8SA 1X14A 4FNMA 4XRRA 1HLPA 1M1YB 3T7SA 1EUQA 3QVKA 1RLTA 2C3OA 1PO7A 2DSNA 1H8EA 3QVGA 1CUVA 4NECA 1K63A 3CMMA 4TMFA 4MR8A 3FVVA 4EQ6A 3IP1A 4UU8A 3RYHB 3DOJA 1OQAA 1CV2A 1L7XA 3MXTA 1GPWB 1N2JA 1US8A 3BL8A 2J3HA 1VE3A 3HVUA 4J76A 3PC8A 2OORC 3BOSA 1TK3A 2QRZA 4DVGA 2WTBA 5KS2A 3TOCA 1QHHB 3EW7A 1GILA 3HP4A 4KH1A 1E2DA 5K51A 3KTDA 3OAAD 4NBUA 4UVHA 1ZVJA 2QRNA 5C8ZA 1DIRA 1QK4A 4XPIB 4WLOA 4ECAA 2BFOA 3TAXA 4EHBA 5HIAA 4AO8A 2YHSA 1N5DA 1UWVA 1IY0A 2E4ZA 3R09A 3UOAB 1FMFA 2F9FA 1T8YA 2KE5A 2BSXA 3GXOA 4ZGGA 1TJNA 1OV6A 4TKVB 8AT1A 5G0SA 2PUEA 3HZHA 2VHEA 2WHQA 2IDMA 2PUJA 3MTQA 1SQ0A 1HDRA 4LZNA 3X1MA 4DVJA 4YQFA 4M1YA 4J2TA 1OVGA 2Q3DA 2WWRA 3W6OA 1ORTA 2DRIA 2E2WA 2JATA 1KDPA 4TTSA 4O5AA 3RRJA 3Q9SA 1KJYA 1U2GA 4EENA 4Q4CA 5JSQA 5KYKA 2YY6A 2HBRA 3JS5A 4W9NA 3OSUA 1G7SA 2ZKIA 4EI8A 5IJXA 2I0FA 2YNMC 3BB4A 4RVUA 3PIDA 4IIFA 2J5XA 1VSUA 3NT5A 1Y42X 4G5OA 4YRCA 4GMGA 3HG7A 3ZS9A 3THWB 2XAAA 1FF9A 2ZAIA 2B30A 3UK0A 1HL3A 2QRVB 4IZ6A 3IVXA 1O58A 1Z45A 1N7GA 5FLKA 4UMVA 2VJMB 1ZRMA 1IXSB 4NCIA 3C6BA 4JVMA 2QJFA 2BJHA 4YRAA 3PNPA 1EMDA 1G8PA 2KM1A 2PKWA 3DBHB 3QXSA 3RFTA 2HF2A 2A3RA 2B8JA 2JAWA 1LV7A 1VMIA 3NHLA 3OSZA 4PO8A 5CXSA 1W25A 2O57A 2QRMA 1Y8QB 3AV3A 3ZUPA 5FWXA 5JNLA 1NUQA 3O95A 3HSSA 2YZNA 4HR7A 5BORA 2P9EA 2WV7A 2FJUA 1TMYA 2XEXA 4H35A 1ESZA 4U8GA 3UCEA 5I5EA 4G0UA 5ABPA 1P45A 3ASUA 1GV1A 1QZUA 1T6YA 3OU6A 4K87A 4PGGA 1YBVA 3G8DA 4OMDA 3PFBA 5EESA 3RIEA 1N8KA 1U9CA 2M1ZA 4X85A 5BVHB 4N5LA 1X1EA 1BAPA 2EX1A 3NYIA 3QMWA 1EESA 4YO7A 2GZAA 5CITA 1EGQA 2Q41A 1TPZA 1UL1X 3H0KA 4GPBA 2HLPA 4Z1MD 3T3PB 4ZK2A 1KEPA 4X0EA 1D9XA 2HZBA 1J0CA 2NSHA 3DZBA 3M34A 4FX5A 4X6XA 3QELA 3AP1A 4ZAXA 1A76A 4NULA 2BTQB 1DAKA 3GLVA 1DCKA 2WE8A 3Q1LA 3BSSA 3D6FA 3QVWA 1GRCA 4NATA 4LXUA 1FFSA 1SBIA 2ZTLA 1XN4A 3OJXA 3I52A 4GPTA 4Y8VA 1NUPA 1ZKMA 4KPUB 3UT0A 4L2IB 3DDHA 5GWXA 3ZZTA 5AIAA 2OSBA 3BICA 1E2KA 3QPCA 2R4UA 3RGWS 5I7EA 1CBUA 4KYTA 3UGTA 4UQPA 3HVRA 1PWXA 1PJ4A 3FOFC 4K28A 4QQKA 4UJ5A 1ISMA 5H83A 4UEQA 3TNYA 1UJCA 2NSYA 2GBCA 2RGUA 2LZ0A 1X38A 2PIAA 3JQ6A 3NETA 4KCGA 3MQ4A 1XL0A 2FFQA 1E9AA 2YS7A 4PCUA 3TMKA 5K8JB 3Q40A 2R96A 2XZPA 2ARKA 2VEOA 3A1SA 2VDRB 3R75A 5ADUS 2VF5X 2W00A 3Q85A 3PT9A 3FDIA 4G4IA 3S2YA 4D1YA 5LMZA 5KINB 5AHOA 1RZRD 1VXOA 1KI6A 4YP9A 3F3KA 3OTOB 1NI5A 3VH1A 5KWJA 1IZ0A 3U81A 4BP8A 3T5AA 1O89A 2W90A 2WWTA 4O63O 1WKBA 4BU1A 1QWOA 4IR7A 2RHRA 4QHYA 3LLSA 2EDCA 1B1AA 1VJTA 4XJSA 1P2BA 4LRSB 3SHTA 2OILA 4V39A 4WNIA 2D7JA 1MLDA 4WBSA 1C8LA 2PYDA 2RKOA 2WZQA 3KTAA 4J0FA 1XRPA 3RC9A 3WOVA 4DIMA 1N3YA 4WCFA 4C6TB 4JBYA 1DTWB 1FXSA 2M9MA 3ENQA 3KCQA 4QULA 1R0XA 5E7QA 1PQWA 5BMVF 2VAXA 3DL0A 3ND5A 1W5SA 2H1LA 3ESXA 4KXQA 2HM7A 2ZUDA 3RU9A 5L4NA 3ZDBA 2P5UA 3NOQA 3IEUA 721PA 2CNKA 3ZCRA 3IAEA 1L5LA 2C42A 1T0PA 2WILA 2Q8PA 4PE5B 2ZQZA 1CYEA 2BAGA 4KYUA 2O5RA 3BBLA 4BFYA 2VXBA 3DL2A 2ZRPA 4MP3A 1Z75A 4OX9Y 4OSPA 3GLSA 4LDPA 5EP4A 3EZYA 3UG6A 1QO9A 2UV8A 2MMGA 1J21A 1JTVA 2IP1A 4CMCA 4FYVA 2H9IA 3IYLW 2ZR9A 2NACA 2O05A 4N8SA 4RABA 1U6IA 2NU9B 3HU3A 4DE5A 2WYOA 4BBZA 1F06A 1ISGA 2X1LA 4N76A 3VU0A 5LDDC 4H7IA 3L1VA 1BMFA 2CJPA 2FX3A 4Q9JA 4Z99A 5LBTA 1YIAA 2XVXA 4IOKA 3RS3A 4JJ8A 3UMBA 4YAJA 3LKZA 4K8OA 4OHUA 5L4LA 5I7HA 4AD8A 2ODPA 3CJQA 2NNWB 1B00A 4PHFA 4Y2PA 3U3JA 2IY9A 1YS4A 4G63A 3GRVA 4UUNA 1XMIA 1MRSA 2WTXA 3KOOA 1XEXA 1MC5A 2XBUA 5L3ZA 3N07A 3JQEA 4GOMD 2GZ2A 1H22A 2W6NA 1WZNA 2DUMA 1I1QB 3K09A 2GXAA 2J46A 2W9XA 4LQDA 2FEOA 3RPEA 2HK7A 1QRRA 1QS0B 2YVQA 1FU8A 1KVRA 4OB8A 1FUKA 2B1JA 5DRYA 3WLQA 3CCFA 2FEPA 5CR9A 4EJ2A 4IS3A 2OYRA 4ZT6A 1D4FA 1HG0A 2HU5A 1R8SA 2AF4C 4JLNA 1JZTA 2R48A 3EYWA 4RD2A 5KU1A 2JI6A 3ZD8A 5M7EA 3ITNA 4M38A 3HB9A 3KYDB 4V0QA 3SP1A 2VN8A 4DLRA 4Q6BA 3PC4A 3ANTA 4XIFA 2D2IA 2PPVA 4DOMA 5CIQA 5FI5A 3PNQA 3ZE7A 1AMNA 2ADMA 4LF9B 1IFXA 1OX4A 3W6NA 1B0PA 2H54A 2WU8A 4MICA 1EVLA 2PQ2A 2O0KA 3A4MA 2XZOA 4QBGB 1XRQA 4MEAA 3QE9Y 4P6VF 3MZ0A 3WWPA 4KE9A 4ZYTA 3EPJA 2GHTA 4KJZA 3DHEA 4WOPA 2HAEA 2P3QA 2WC1A 3SEAA 1VHWA 2BFBB 1QXSA 2Q21A 1FMJA 1UDXA 4G0MA 5J59A 4BJ6A 4C0WA 2ASVA 4R2WA 3TK1A 4ZEVA 2PJUA 4CM5A 1CR0A 1E7MA 4IVRA 1H2XA 2ZCJA 4F2WA 3AR9A 3BF7A 2PL5A 3EPHA 2JD1A 4ZGWA 3PGLA 3JX9A 4G5RA 2WF9A 2V7XA 4KE6A 3GJ4A 3SZRA 3LLMA 3M6AA 3WK8A 3ED5A 3HSKA 5K3CA 3TFQA 1MQSA 1LVUA 4X1YB 5K2OA 1SXJC 3U4MA 3WYDA 1P62B 5DM2A 3HNOA 5EKXA 3KOYA 3HKCA 4OHXA 1T13A 3HR4A 1MCZA 3LECA 2B25A 3ORFA 1ZVMA 3BHMA 3EWIA 4K7JA 3KKPA 1U7HA 5KX5F 3TG8A 1KZ1A 2JIMA 3CM0A 5FBVB 3JQAB 3DZHA 4R2LA 2O2EA 3F97A 3KQTA 5DP2A 1OU4A 3UPUA 1S3FA 2H5IA 4M89A 3BERA 5E6RA 4GOXA 1I5RA 4M6WB 4DA0A 2I66A 1NQTA 2Z1DA 3RARA 3V7NA 2C9CA 2P62A 4NPHA 5HIIA 1Q0LA 2Q29A 2G88A 3EF0A 1CTQA 5CYGA 5FAKA 2AOVA 1WDKA 3LHDA 4KWCA 4GI7A 5AP9A 4N7MA 1G8GA 4JH0A 1T2NA 2FGJA 2RJ3A 4M1QA 4GBJA 3ANSA 2QRVA 4HZGA 4RDHA 2G8NA 4YMGA 2J6HA 2AQIA 3DFFA 3K9LA 2GBGA 2RG7A 3KELA 5CT9A 5ERYA 4OHOA 1XRJA 1II8A 2EJCA 3DBHA 3QI2A 4TTQA 1TTHA 5TE9A 3I2FA 2JAOA 3RFUA 1SZCA 4EB6B 5KHLB 3LTNC 1ZCAA 5JNWA 1P4HA 1J0BA 1FP4A 1Z6QA 2IHBA 3D1VA 4YCAA 5AUQA 4ZCLA 2NU8A 5FWXB 4FHEA 5JAMA 2RKWA 3AXTA 3BIJA 1B14A 1PR4A 4MGYR 4UBIA 1G7CA 3V1TC 1DPFA 2AOWA 2UZ0A 2YNMA 1KIFA 1CVLA 2NP6A 1UMDB 4V3CA 1I6LA 4QHTA 1T24A 1FB5A 1UKEA 1K0UA 3I45A 2C07A 4DRXB 2I87A 1KZ9A 3UMGA 4J94A 4EVQA 5EIEA 2FSVA 4TTTS 2WFLB 3NBFA 3N8IA 4R7ZA 2NO9A 2B4AA 4BZPA 4JI7B 5ANRB 1KO1A 1TEVA 2R6ZA 4EDHA 3IPYA 4XPIA 5C5CA 1CFZA 1PZFA 1JUDA 4N5IX 5LBIA 3OX4A 2V9PA 3WKCA 5EIBD 2GM9A 1GQ2A 1NOKA 1JDUA 3IULA 3OEHD 3DONA 3OT5A 5LKAA 1K8ZB 3H9GA 1U3VA 2FPOA 2D5IA 3EQ7A 4GZLA 4IZOA 4V0RA 1FW6A 3BMQB 1O6ZA 1NFFA 3C6MA 5DYGA 4HWPA 1BXGA 3QV2A 1QH8B 1GL6A 2F6RA 4IWYA 3V2UA 3WMRA 4BZZA 3N6RA 2XCIA 4ZALA 5JJIA 2G71A 1TF2A 4RS3A 2ZYAA 3AFGA 1YASA 4B09A 1NW4A 4B9AA 1AXGA 2QTFA 2HCRA 3EH2A 3N0VA 3RJ5A 1THZA 1GU0A 1JDVA 4RETA 5IM4A 1R50A 2DH5A 4ABTA 2KX7A 2AW3A 1XZMA 2X0NA 4TMYA 5HBGA 1ESDA 1AO0A 4QXAA 5TSDA 3CVJA 3LWDA 3OOYA 3ROTA 3TRIA 3WGKA 4OLAA 3A6FA 5A9RA 2F8SA 2SKEA 4TT3D 2PH3A 6GPBA 2YWHA 3L8MA 1F2UA 3K6KA 4XUGB 3C3DA 2QYHA 4UAGA 4AP5A 2JIZD 3L0IB 4HXYA 5AVJA 1J6UA 4DB2A 4HYTA 5BN1A 4DR5B 3VSEA 3J81k 4EHNA 2AJLI 2QM8A 3GFFA 1JDSA 1OH8A 3TOZA 3O3CA 2QMYA 3OQPA 3X3HA 2EYQA 5KNCA 2HRDA 1H8HA 3I9JA 1FFYA 5IBPA 3KJIA 3H3FA 4L5CA 2G3YA 1EAMA 2ZE7A 1O95D 1QGAA 3K4PA 3MMSA 1BJRE 4FEEA 5K05A 5EFZA 3RU7A 4XB1A 2OZEA 3KV3O 1LRJA 2BM8A 2QZZA 2X6RA 3PVZA 2W4QA 4KKVA 4R1UA 4Z9YA 2OXTA 1XCOA 5IAAA 3SLGA 1QCYA 3D2LA 5FFMA 3IPRA 4AY5A 3LC2O 5FWDA 4GNKA 2JZNA 3CVOA 2Z9CA 5I9BA 4PYQA 2D7DA 3GELA 1PSWA 3QXHA 2JRLA 4XWTA 4H6XA 5FUQA 2I2AA 3VNQA 4MZDA 2UYYA 2V96A 3EXHB 3DMYA 2Q1TA 1YIOA 4JT2A 3TIFA 3TXXA 1JILA 3I32A 3BT7A 2B82A 1NYTA 1LRKA 3GJZA 2JJ8A 3SOPA 5CX1A 2D3WA 1XRLA 3OHSX 4URYR 2ZDQA 1NIJA 2XMPA 4KQIA 1VGQA 4KMRA 5DEIA 4ZJUA 1M6WA 3LA8A 1RJFA 4TMXA 5IAJA 1U5CA 1I1HA 4DLNA 5JCZA 4PYLA 2WG0A 5IN5A 4WVFA 5GIOE 2CL5A 4JBXA 1W4LA 4ILKA 5CXUA 4Z7QB 5LM3A 5JSKA 1HFEL 3QOXA 4DDVA 2LIPA 2Q5FA 4N7RA 2A9QA 2DBYA 3BDIA 2EIXA 3PDJA 2L19A 1VI6A 3S8YA 2ZIUB 1QVZA 1XPUA 4N6GA 1JQLB 2B4TO 3TLGA 5FA5A 2PS3A 2Z43A 4H1TA 3RO7A 3LWZA 1D0SA 4M2LA 3TVDA 4ROTA 4IL5A 4AF7A 3PLNA 3REOA 3UJPA 1IIRA 2XMSA 4FI3C 1PGJA 2QLJA 4P3OA 1RACA 2Z6UA 2PS0A 4M54A 4B3XA 1JJAA 2ZVPX 4D0LB 1Q50A 4UTZA 1KZYC 1T8PA 1WQ1R 2AR0A 3MIZA 2C5LA 2H0AA 4V0MA 1DTWA 4AKIA 1CY6A 1FRZA 1OFHA 4XQ0A 3DO8A 2QXYA 3EMDA 3CU5A 4AKEA 4ARCA 3K9QO 3F5FA 5H3CA 3HFRA 3AKDA 3PYXA 4LZWA 1U7UA 3EUAA 1XBTA 4IDDA 1LBEA 3S7ZA 1WOYA 3TDKA 4RZ2A 4G0WA 4M0CA 3W3ZB 1Q6YA 3OM1A 2X5XA 3C16C 2FFRA 1FC0A 1PUXA 4MRSA 1C3VA 1E6LA 3ESRA 3GCXA 3G2KA 3ND7A 4GX2A 4F4JA 2CNNA 5A06A 4ZWNA 4LYHA 4BP3A 1KMCA 2LGJA 4MULA 1B6RA 1E6UA 2ZDHA 1V2HE 3PYMA 4FMDF 4ZU6X 3A05A 1EEHA 3ZJUA 2CMKA 3WHPA 5D00A 3DZKA 3CZPA 2VAMA 3FLEA 1YA8A 5ER9A 5REQB 2VHWA 2FEKA 2Q3LA 3HR7A 4MB0A 4RXMA 3QVUA 1O94D 1CQIB 1P29A 3GJQA 3NBMA 1LBQA 2EF1A 5EXPA 3LOQA 5FWAA 4PX9A 2O7NA 3IIIA 4YUYA 2FZWA 2PZ8A 2FMFA 5BYJA 1XZDA 2B37A 3NKFA 5BQPA 3DZJA 4EFMA 2FUNB 2EW1A 1QPZA 3OZRA 4XDGA 3K0AA 4BEWA 3SC2A 3EOBI 3FSGA 4EZBA 1L1RA 4DIBA 1E2UA 5AVSA 1QPGA 4HDQB 4CR8A 3FYDA 4RESA 5LU8A 4ZIRA 3E23A 4DWOA 1G38A 1WDWB 3LJKA 4DXAA 2HCTA 4NENA 3H6GA 1U9YA 1FEZA 2E4YA 2RI0A 1XCBA 2FLVA 1D8AA 4J1NA 5CGZA 3SU8A 3VYVA 2Y1WA 1IEXA 1QG2A 1X1CA 1CS0A 2CF6A 3EMVA 4MMYB 4X44A 3O0TA 5K3FA 3AVVA 3IVGA 1XYVA 1JKMA 4P2GA 1E7QA 1KJQA 4BKPA 2E5LB 5JQGF 1N8NA 5CT4A 4LAFA 1U81A 5EINA 2B0JA 4IXWA 3MQ2A 3AQIA 3L77A 4LF6B 1KEZA 5C7LO 2YFKA 2NWQA 3R7WA 2IVFA 1L7EA 2NXEA 2C97A 1AQUA 3LE8A 4AX4A 2BUCA 2ZIXA 3GA5A 4I81A 2IYNA 3GJ8A 2ODTX 5NULA 3IQEA 1RQLA 4L7QA 5ELXA 2AJDA 4JI0B 1GGEA 5C5IA 1ZGZA 4C0AC 2AFIB 4FNGA 4RQAA 5E6UB 4BNGA 3PJGA 2ALJA 4GECA 1I2MA 3THXB 2BFBA 2FZVA 4I36A 5HMLA 3DDNA 5LNK6 4IIJF 5E95A 4E70A 1JBKA 3FHLA 1JJ7A 2P9TA 4TWAA 4KLZA 5AVWA 3FNFA 1GHTA 3S44A 2ZR8A 1CF9A 1F12A 1EIZA 2QX7A 3OUUA 3NUGA 5FJJA 3ZY4A 1DO2A 1OGJA 5T3UA 1YONA 5CGQB 1HYGA 2C54A 1SHUX 3BTOA 4Q02A 3ER9A 4FK8A 3FD8A 3MCUA 1ULTA 2B9VA 1YJCA 3KAJA 1KOJA 4X1YA 4TYYA 3PNMA 1QCDA 1SB9A 1GTZA 2XCLA 2XUFA 4PQFA 1HK7A 2PUVA 5DHAA 4F5EA 2EKZA 1YUNA 5CCXA 2VPWA 1TJYA 3TZLA 5BOSA 3B3JA 1T9GS 4S1OA 1IXYA 2YTZA 1UFKA 4CODB 1UZMA 3BHNA 4AY4A 3GFQA 4AZVA 2QZSA 1ZUD1 4R40A 3BMQA 4U7PB 1HDIA 2PS1A 2XUDA 3GGSA 4N9QA 1DEAA 1SBZA 1PS8A 3PEVA 3MUNA 1LLCA 1VI5A 2CVFA 3N0RA 2JK1A 4FEGA 2G28A 4KXYA 3SHQA 3C48A 3AVOA 3U16A 3VNVA 1FTQA 2XUGA 5C1PA 4XTCS 3IHTA