4CM4B

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQKSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
total genus 90
structure length 251
sequence length 267
chains with identical sequence C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cm4B00
5IZCC 1I36A 4XR4A 3WTCA 3FR8A 1ADCA 3DHNA 2EXXA 1V6AA 2DKNA 3QVXA 4DBZA 3AI1A 4TRMA 1O9BA 2Y99A 4TKMA 3M1LA 3MCVA 4I08A 3KEQA 1YB1A 3M2PA 5JO9A 1NHWA 3HNPA 4XD2A 3PLNA 1LDBA 2BHLA 4K28A 4W99A 3NEPX 4ZD6A 4PG7A 2R00C 1X1EA 3RKRA 1IPEA 3H5AA 4MO2A 4IGEA 4HV4A 5TIIA 4WUVA 4IXWA 2EG9A 1NQOA 2B4RO 3NJ8A 4RVDA 3ZWXA 3PHLA 2HKIA 4IGFA 2EHDA 4GWKA 4JJIA 1C14A 1ZSYA 3H3FA 3JQGA 2PK3A 2UAGA 3AM5A 2OP1A 5DOZA 1R16A 3FF4A 1Z74A 4FGWA 4IIUA 4F3YA 1BXGB 1LLDA 2CF6A 2P5UA 2V6GA 4XWYA 3WGTA 2IXBA 2BELA 2Q99A 1LBEA 4G2NA 4CODB 3H9JA 4DREA 1Y6JA 5H83A 3JQFC 3BMQA 5JXWA 3ZHBA 1T2AA 5J23A 1CQIA 3W4KA 3V2UA 5JSFA 4FCCA 1EQ2A 1V3UA 4BMNA 1BTOA 3DHEA 3G3EA 4FFPA 1E7MA 3ENNA 3SLGA 1HDRA 4E2XA 1M6HA 5I8WA 4CV2A 1YL5A 9LDTA 3W6UA 1BW9A 3OJFA 2B5WA 1MC4A 1GZ4A 1W6UA 2VZ9A 3KXDA 3JQ7B 4CMKA 1EMDA 1LRLA 3H5NA 3CPSA 4MOWA 1FDUA 4GMFA 5F21A 1PJQA 4GBJA 3EGOA 1RWBA 3N58A 2I99A 4YT2A 1P31A 3ROPA 4BNLA 2OMEA 4BS9A 1GD1O 3WBBA 2GSDA 7MDHA 1YQXA 1QYXA 4FC7A 4U5QA 3VKVA 2BGMA 4PVDA 2W90A 4R3NA 4WEOA 1KBZA 5B4VA 1UJMA 4KWHA 2P2SA 3OIGA 3I9KA 2WD7A 2ZTMA 3C85A 5JY6A 4WCFC 4IQ0A 4ALKA 2OOSA 4FC6A 1GEGA 2AG5A 1YBMA 5F3RA 3AM3A 3B1KA 2NVUA 2PZMA 3LT0A 3C1AA 4WPGA 4NBUA 5CEFA 3DAGA 2BI7A 5I7FA 5KOIA 2YHUA 2AQKA 3GR6A 4D42A 4ZGWA 4IDCA 3GVXA 3DXFA 3M6IA 2RAFA 1JVSA 1R15A 1UZMA 3PDUA 1ZK3A 4YYZA 1LU9A 5G2OA 3HDYA 1PL8A 4JK3A 2I3AA 2NVBA 1Y5RA 3W1VA 5G4KA 5KWEA 1KEPA 4R1UA 3WGGA 4ZU3A 4N5MA 4CUKA 3UCFA 3B70A 3QIVA 1X7GA 3WQQA 1YGYA 2Y1DA 1L7DA 2PKRA 3WSWA 4BNGA 3F9IA 4CQLB 3AY7A 3TPCA 2FR8A 4B4OA 4FGSA 1X14A 1LUAA 2YJZA 3MTJA 1V8BA 2VOEA 4PIVA 4E5KA 4HUJA 1ZW1A 3F3SA 1XIVA 1SB8A 2AE1A 1EE2A 4BO8A 5CG1A 2YUTA 2NU6A 2LDXA 5IN4A 2HMUA 2WE8A 1RM0A 3RWBA 5DCYA 4BHTA 3G0OA 1HLDA 4YT8A 2X6TA 2JCXA 4OXNA 1H9BA 4JXKA 2PR2A 4P38A 2Q2WA 3A06A 2OORA 4N54A 3SLKA 1F12A 1RM5A 5FFFA 3PWZA 4IS2A 4MPDA 5HTOA 2BKAA 4E21A 3PYLA 1LRJA 1XA0A 2C2XA 1EQUA 2CDCA 3LLVA 5KVVA 1BMDA 5L7TA 2DBRA 4BMSA 4BOYA 4MIOA 3D4PA 1X13A 4HWKA 2FY8A 1JTVA 3DOJA 1LRKA 5EPOA 4EUHA 2IZ1A 4LRSB 2OP0A 5DCWA 4S1VA 3VZSA 1HZZA 2HQ1A 2I67A 3G49A 1F06A 3JYNA 3DBHA 3TSCA 4BO3A 4D79A 2FPPA 4ND4A 1N7HA 1DC4A 1Y9EA 2CY0A 5L4SA 1NQAO 2JAHA 2CD9A 5C7LO 3F1KA 3MJEA 4ND2A 3UVEA 3D5QA 2ZQZA 1C1DB 5DBIA 2I5PO 4GAEA 2FP4A 4ID9A 4TQGA 3NTRA 1BSVA 3DBRA 3AUSA 4LVCA 3SEFA 3ZU5A 4GWGA 1WPQA 3WLFA 4IM7A 4M86A 5K6AA 3WIDA 3DTYA 1IB6A 4ZQHA 3DOCA 1JQBA 2CNBA 5TJ9A 4NZ9A 4GL4A 3BMNB 3ITKA 1NBOA 3N7UA 3PYXA 5COQA 1LLCA 1Y7TA 1CDOA 2GERA 4ZRMA 3RFVA 4DMLA 4TKLA 4R54A 1LDYA 4PVCA 1NPYA 5A9RA 1H93A 1FDWA 3HWRA 1ENOA 2EF1A 4BNVA 4RLSA 4XIYA 3R3SA 1X7HA 1WZEA 1IULA 1ZSNA 2EERA 5LCXA 5JS6A 5JBIA 3K2EA 4NG5A 5EL0A 1MG5A 4B3IA 2VHZA 3ON5A 4CLOB 1H94A 9LDBA 5JC8A 2H6EA 2FSVA 2ET6A 3Q0EA 3RBVA 2YHIA 5IDQA 3QWFA 3GQVA 3WJ7A 3HADA 3VH2A 3QWIA 1FJHA 3L6OO 1PQPA 4RLHA 5JAZA 2X4GA 1ENZA 2JJYA 2JFGA 4MKRA 3PGJA 4ALNA 2VUSA 1ZSVA 4IPTA 4BO5A 2V6MA 3FPLA 3OJLA 1H6DA 4M54A 1K2WA 5F1OA 5KCZA 1B8VA 4Y6RA 2DTEA 4L73A 4OQZA 1UXKA 4AJJA 4J4BA 3TDKA 1MX3A 5A03A 3GVCA 4YWJA 1T1SA 1ARZA 4DQXA 5I7SA 5I7VA 3CKYA 3HQ4O 3MJTA 4UUNA 3NRCA 4YJGB 5HS6A 1U9JA 1ULUA 5C7IO 1NM5A 4L75A 5IN5A 2HUNA 2OL4A 3BMOB 3WG9A 3IOYA 1IY8A 4DPMA 1VC2A 4FJ0A 1DHRA 3NDRA 3PDJA 4D46A 5BSEA 3PZBA 3I52A 4UREA 4OMUA 1WW8A 2J5QA 2VYVA 3VPXA 1ZUD1 2IYOA 3GN2A 4JBIA 5CPBA 2DFDA 5DBFA 3WQRA 5HS4A 1W8DA 1LSJA 2RHRA 2Y68A 4FBGA 4S3MA 2BD0A 1E77A 2RH4A 3W8EA 2JD1A 1FMCA 3PYMA 3ICCA 2Q3EA 3GNTA 1KY4A 4EJ0A 3AU9A 2GF2A 4Z3KA 1VL0A 5FEUA 3S2EA 1R37A 2GGSA 3D7LA 3QVOA 3V5NA 4YCAA 4II2A 1HTBA 4LMPA 2BMAA 2J6IA 1YL6A 3ZW8A 1UAGA 2Y66A 1A7AA 1PIWA 2VHXA 4PG6A 3HUDA 3FR7A 4XYEA 3AI2A 2WEKA 3E5RA 1IZ0A 4CM4A 5KJ6A 3LZ6A 3OQBA 3CIFA 3GNSA 4I9NA 1EFLA 4IQ8A 1NPTO 1PGNA 4B3HA 4FB5A 1G1AA 4N18A 1M75A 1XYGA 1CF2O 4YPOA 1LC0A 4GI2A 4BGVA 3FNFA 5AXDA 4XRGA 1JDJA 1BDBA 3E1KA 4OXKA 3VTZA 3QLJA 5A1TA 2FPIA 2GCGA 2D0IA 3TZ6A 2NU7A 1WP4A 4AJPA 1JU9A 1JAXA 4ALIA 4Y98A 3RCBA 4KUHA 4C7KA 4EUEA 3NUGA 4B7XA 2C07A 5CDYA 4BNIA 2NM0A 3WMWA 1V3VA 5DF1A 2GR9A 2AHRA 3E82A 1Z7BA 4WE3A 1ENPA 1QXSA 4AL4A 1CWUA 3IQDB 1BXKA 3ZNNA 4WLEA 4BO2A 2NVWA 5T64A 1A9YA 4YA6A 5IZCA 1VL6A 1BXGA 3JQ6A 5TT0A 4DQVA 3GMDA 4M1QA 4L0QA 4WECA 2AEMA 3HE3A 2O3TA 3VKUA 3PQDA 1K5HA 3ZU4A 4BUCA 4DYDA 1E7SA 1O0SA 1C1DA 1I0ZA 2BRUA 1R0KA 3OQ1A 1VKOA 4UAGA 3JSAA 3ZDFA 3JCZA 4PGFA 3ZNOA 1EK5A 5KTKA 3ONDA 1E1NA 4CJXA 3ABIA 1BW9B 3HN2A 1NX6A 1XU9A 5FWNA 1YVEI 4FW8A 2JD2A 3OMLA 3WXBA 1EVYA 1NWHA 2X5KO 4A2CA 1PJLA 3AWDA 1I30A 4RF3A 3RUEA 3EC7A 1DOHA 1NVGA 1MG0A 4E2WA 3LLSA 4G65A 5JDIA 4QUKA 1ZMOA 1PX0A 3O8QA 3PWSA 1ZZEA 3WGIA 1I2ZA 3KTDA 2IE0A 2I3GA 1W0CA 5TRTA 1XQ6A 2EWMA 3C1TA 3WYCA 4ZHSA 3L6DA 3BMCA 4UEOA 4ALMA 4OKNA 2HK8A 1VJTA 1LTHR 4HKTA 1I5RA 2ZYDA 3GDGA 5G0VA 3NKLA 3PGXA 1P1HA 1DDOA 4J9VA 3ZWAA 2HK9A 4L74A 5G0TA 2ZCVA 2P68A 2PZLA 3H2SA 3TRIA 4AFNA 1NVMB 2CUKA 2FSSA 5JC1A 3RROA 4MP8A 4XYGA 3GGOA 2IRWA 1MV8A 3I83A 3F4LA 2QW8A 5JCJA 3RKUA 3NT5A 4H16A 2FHSA 4BQRA 2ZQYA 3CINA 4CV1A 2Y93A 2G1UA 1YO6A 4QTZA 2J3HA 5AXAA 1W73A 3PLRA 5CDSA 4PLZA 4RPKA 1FDVA 3PEFA 4LCJA 3ONFA 1B8PA 4FR5A 1ISJA 3EDMA 1R0SA 3KETA 3EAGA 2Y1GA 4KTVE 1TI7A 1A9ZA 3EUWA 4UUMA 4Q3CA 3DBRB 1P77A 3AY3A 3PFFA 4FFLA 4K1LA 1VSUA 2CMDA 4GX1A 5BQFA 3ZU2A 4E5NA 3HG7A 1Y8QA 3RUHA 3UAGA 4E5YA 1IOLA 2WMDA 1YS4A 3ONEA 4CR7A 1KVUA 1DRUA 1R12A 4MVJP 2DAPA 1O8CA 4DVJA 5JCXA 1EBUA 1PS8A 4Q3AA 5B12A 1UXJA 3VPHA 1EVJA 3WWYA 3L4BA 4XYLA 2PGJA 1HE5A 2O2YA 3IDSA 4XCVA 2I76A 2V7PA 4BL5A 4YRAA 1YXMA 5THQA 3K92A 4YTEA 5GMOA 3KYCA 4XGNA 3WB9A 2FR0A 1E3JA 3VZQA 4J7CA 2HRZA 4YAIA 3GFGA 2VWHA 2D2IA 4MVJA 3VPSA 1XEAA 3EZLA 4R01A 2QRJA 3VHRA 1R4NA 1YJQA 4ZICA 4CMEA 5A5FA 1ONPA 3OICA 4H3VA 3DMTA 3X2EA 5IDXA 1PGQA 3IJRA 3GEDA 4YJHB 4CL3A 1Q0QA 4BNWA 3W4JA 1MFZA 5TGDA 4A73A 4PZCA 2A92A 2NADA 4UEKA 2GZ1A 4X54A 3UICA 1XR3A 4DL9A 2EKQA 3V2GA 5KIAA 2V6BA 3GG9A 2VRBA 1LDMA 3F4BA 3D3WB 3OF2A 3JQBC 4KP7A 1ISHA 3VAZA 3MTGA 1L1FA 5KJ1A 3D1LA 2G0TA 1GQQA 2Y1CA 2QIOA 4B79A 3JYLA 3QY9A 4M55A 1ZKMA 4NBVA 3GVIA 3MEQA 3U4HA 2C5EA 4RPHA 5DDIP 1LSUA 3MZ0A 3AM4A 1IL0A 2EKPA 3L0DA 1TT7A 1PJ2A 5GZ1A 1F17A 4D43A 4GKBA 5A5EA 2PLAA 4BO9A 4L8VA 2F00A 3OH8A 4Z9FA 1EUZA 4K26A 1PWZA 4CUZA 4DTIA 1NR1A 3D3EA 3WIEA 1A4IA 3WMXA 4YRBA 4I1IA 1EZ4A 3GNQA 1AE1A 1RM3A 1LDEA 1DBVO 1U5AA 4IXTA 2RCYA 2VYND 1K89A 1EUCA 1E3WA 4FFNA 4J0EA 2VTDA 5CDTA 2X5OA 1U4SA 1FK8A 4CMGA 4I5GA 4CQLA 1X15A 4YJGA 1MUUA 4NHEA 2AMFA 3IAHA 3QE3A 4BV9A 2DC1A 3DMTC 1JW9B 3BMOA 3QWAA 4II3A 1EK6A 5G0UA 4IDGA 1B0AA 1XKQA 3RJ9A 2J3KA 2FMUA 3VDRA 2G76A 3PHIA 4FN4A 3EVTA 3WICA 4IBOA 1A72A 5CEJA 3MJCA 2J8ZA 4E12A 4F6CA 2DUUA 3RI3A 4EZBA 1KEVA 4DQUA 4JX8A 5A06A 3IMFA 2O7SA 3HFGA 3NGLA 3Q2IA 2C5AA 3T4XA 5C7OO 3DMYA 4OO3A 4PLYA 3PIIA 1N92A 3HFSA 3RBZA 4D3SA 3RUAA 2GD1O 1C0LA 3RQSA 1YE3A 3ETEA 3GVHA 4Z6KA 4K9DA 1SOWA 1L7EA 1BVRA 1VM6A 3I9OA 3VZRA 2QYSA 2UVDA 4MP3A 2WSBA 1EDOA 3OECA 4R69A 3ZHZA 1SAYA 3I5MA 1UXHA 4CMBA 3OETA 3R3JA 4CQMD 1PTJA 3PQEA 4Z9YA 5A3JA 1QV6A 3L9XA 5TQVA 5F5LA 1ZK0A 3ZWNA 2SCUA 2VZ8A 4PLWA 4IZIA 1NPDA 2O4CA 3NJ4A 4GLOA 2D3TA 3DZHA 1U8FO 3W6ZA 2Q1SA 1WNTA 1MA0A 1NR7A 4XEHA 1U3WA 4TRRA 3AJRA 3OP4A 3KEOA 1PS0A 2J3IA 1TVEA 1Y5MA 3CTMA 2AW5A 2P4HX 4BNTA 5ILGA 2WWRA 1S6YA 3D0OA 1X0VA 4QFCA 4R1NA 3ICPA 1WVGA 1BRMA 3JQGB 5JAQA 1Q7BA 2CDBA 3LT2A 4JBGA 3NYWA 3SXPA 3KYCB 3DBVO 3PXXA 3R6DA 1NHGA 4GGPA 4GKVA 1C1XB 4NDNE 3KM0A 3F5QA 4L9RA 4B4WA 3BMQB 2IZZA 3P2OA 4NBWA 2VRCD 5ES3A 3LT4A 2I66A 5IZ4A 5JAIA 8ADHA 4NFSA 3E03A 4J4TA 1C1XA 1ZK4A 1OMOA 3GHYA 4RQUA 1U5CA 1B14A 1DHTA 1JN0A 3QWBA 4XQCA 5T8KA 2A4KA 1TT5A 1V35A 3OJ0A 1YQGA 4E5MA 4W6ZA 5G4LA 4ONEA 4QFDA 3O38A 2V6FA 4BNNA 3JYQA 5FYDA 1D1SA 3O8QB 4B8WA 3L4BC 4OIMA 1ISGA 3C3XA 5ADHA 4ZQGA 2NSDA 4N5LA 1GAEO 1LA2A 1YDWA 1I3LA 1HDCA 4XYMA 2FOIA 4JGBA 5JYDA 4RV9A 1P3DA 1AXEA 5ILOA 3DDNA 1E3WB 1Z6ZA 2Q4BA 5B37A 1YONA 1MFPA 3ORFA 2E37A 3PJFA 3AK4A 4YEDA 3TZCA 5CDUA 3A9WA 5A4DA 2EGGA 3TFQA 1B3RA 3OEYA 1ZBQA 2ZIZA 1TA4A 3INRA 5JE8A 1KS9A 1YDEA 1GUFA 4AICA 4E2YA 5L7YA 3UFXA 4Z0PA 5COBA 3OBBA 4TRJA 4HXYA 4RVFA 4BO7A 2B36A 5JLAA 2B4TO 2OBNA 2I65A 3CH6A 3GF4A 1KOLA 2VQ3A 3IKTA 2ZK7A 4DRYA 5F1PA 3BMCB 1NWCA 4B8ZA 4QQRA 1VE9A 3ITDA 4E4YA 3VVBA 4BO1A 4J43A 2Y0CA 3C24A 3TQHA 4PG5A 1T26A 3HHPA 4ZN6A 2Y0DA 5C37A 4TMFA 3WBFA 1A7KA 1A27A 4CM5A 2PA3A 1KETA 2ZJ1A 3A14A 4YACA 1Z7EA 2GPTA 1P74A 3JQ9A 3FCOA 3ZWCA 1HLPA 1HKUA 1B26A 1U3VA 4N5NA 3C1OA 1C0IA 3LK7A 3BHMA 1G0NA 5HWSA 5HRUA 3I1JA 2H5LA 3O03A 2YFQA 3LDHA 2XAAA 2YQ5A 3QQPA 4AJHA 1U2DA 2V65A 4MVJE 1NFFA 1PJSA 2VT3A 5DN9A 1E1LA 3ZH2A 3F6YA 1T2DA 2P5YA 4D45A 3UH1A 5G0SA 3RUCA 1NYTA 1PWXA 4GX2A 3TFOA 1S7CA 4AJOA 1HYHA 3ETGA 2WTBA 4CQMA 2YYYA 4G5HA 1J49A 1HWYA 1LQUA 1PL6A 3QP9A 2PD4A 5CPFA 1IE3A 1MXHA 4AJKA 4PG4A 5CG2A 1OAAA 2VHVA 5JMWA 1SMKA 5EIOA 4GX0A 3GAZA 3VH1A 1K3TA 1SO8A 4YJHA 3ZCXA 1ZEJA 4E6PA 4UVIA 1BXZA 4IIVA 4ALJA 4DBVO 4J1TA 2RIRA 2DLDA 3O9ZA 4QO8A 4MVJH 2O50A 3ZI0A 1Y1PA 3RBXA 3GH3A 4GSKA 2O23A 2GLXA 2EJVA 2OFPA 1FF9A 2QQ5A 1WMAA 4MVJD 1G0OA 1T1RA 3NT2A 4PLVA 3FTPA 3RU9A 1R66A 3D5TA 5L3ZA 4CMEC 1Y8QB 4QSMA 1E5LA 1BGVA 1P9LA 1O94A 4R3WA 4INAA 2NV6A 5MDHA 2UUOA 2JAPA 5EMHA 3S8MA 1H9AA 2PZKA 4IDBA 5THKA 4J9UE 3NTQA 3L6EA 1HE2A 2EW8A 3GAFA 3H9GA 4RORA 1TB4A 2DVMA 4FSHA 1LXCA 1U8XX 1RKXA 1DFGA 2NNLD 3GVPA 2VYNA 4QXMA 5ENVA 3BTVA 4O63O 4U0KA 3VPFA 3I9NA 1WAMA 5EINA 4D7AA 5BSHA 5C3MA 3E8XA 1X1TA 3MWEB 3P7MA 3QW2A 3ZV6A 3AOGA 1GADO 5EJ2A 2BFOA 2GN8A 4DWVA 3ENKA 3HJAA 1ISFA 1J4AA 1PGJA 1SPXA 2UUPA 3DOOA 4KTTE 4L4RA 4WGGA 4YJFB 3Q1LA 2EW2A 2H63A 3WQSB 4OGWA 1MB4A 4KQXA 4W82A 5ER6A 2QX7A 3GLQA 2AQHA 3VC7A 2X1HA 3FNGA 4JLWA 3ZGYA 3E18A 6ADHA 4JBHA 5H81A 1HDGO 4BNUA 2DBQA 1DC6A 2C29D 3TNLA 4IS3A 5I7EA 4HY3A 5IXYA 3QA9A 2BGKA 4Z9XA 3VDQA 3HB4X 4LCEA 4I5EA 4D3DA 4HBGA 4DPLA 1TT5B 3GEMA 1P1JA 1GQ2A 4JN6B 4RDIA 5LDGA 2UDPA 4CMAA 3TL3A 2E48A 1Q0LA 5IAAA 4TZTA 4J7XA 1WXDA 4DMMA 1VLLA 4ZVVA 3H7AA 1LQTA 2YV2A 3GDOA 3JQAD 5AYVA 3WJAA 4EI2A 3E48A 3K73O 4RL6A 2Y1FA 2WE7A 1UZNA 1SNYA 5A02A 2VTEA 3BXXA 2GN4A 3DHYA 2ZTUA 1C0KA 1GEEA 2NTNA 1PS9A 4BNZA 4CM6A 3I23A 4KWIA 3JQ9C 5TF4A 4UEJA 4CMCA 4RPGA 3JD4A 1NNUA 4XGKA 3S1LA 4P4NA 5GY7A 3DEYX 5KVCA 4XKJA 3FWZA 4IMPA 3V1YA 4P8RA 3MJVA 1DFHA 1VPDA 1EE9A 2BGLA 4ZQFA 3OA2A 1LC3A 4CM9A 4D0RA 2ZTLA 3H2ZA 4B4UA 2ZYAA 5TS3A 2GASA 4MJLA 2IXAA 4HADA 1ML3A 4I5DA 5IDWA 1AHIA 5I8ZA 1XG5A 3STHA 4RF4A 4NJOA 2AG8A 4IUYA 4O1MA 2YV1A 5G0WA 5EERA 1QLJA 4JJGA 1I01A 1I33A 5ICMA 1I10A 3ANMA 4UVDA 1ADBA 2NU8A 1GFSA 1Q2XA 3LF1A 4OSPA 3ZV4A 5AXCA 1XLTA 1ZJYA 5JFOA 4XDZA 3OA0A 4BO6A 3IC5A 3K2BA 4R1TA 3COSA 3ZHYA 3BTSA 5FI5A 5FI3A 5JDIC 3MJ4A 1VL8A 5T5QA 3L9WA 1I24A 3I4FA 5KNLA 4Q3NA 4EYEA 1F8FA 4H15A 4FPXA 1HEUA 2JKVA 2C2YA 1XSEA 2DTDA 4FFOA 2WYVA 2BH9A 1KEUA 2EKLA 3JD3A 2ZATA 4J90A 2VT2A 3OIDA 5ER9A 4IDDA 1HDOA 3RC1A 2Z1MA 1U28A 3K5PA 4TRNA 1DRVA 3KSDO 3A1NA 1U2GA 2UYYA 3FRJA 3FTNA 5DCUA 3VZPA 5GZ3A 3UF0A 1N5DA 2GO1A 4YT4A 1U7TA 4L76A 1UH5A 5CP8A 1NASA 2HJSA 2ZYGA 2P4QA 4Z3DA 4DA9A 4HX5A 3WNVA 3KLMX 4PLPA 3B20A 3FHLA 4NU6A 2VRCA 3JQBA 3OJEA 5T8KC 3DQPA 1ADFA 1PJ3A 2JFHA 3EZYA 3GRKA 4W7HA 4RVGA 2B83A 4RCVA 1K0UA 1OZAA 5K9ZA 4RQTA 4PN3A 4RVUA 4E30A 1DC3A 2PNFA 2R2GA 1G6KA 2AA3A 4K6FA 4P22A 5BR7A 1ZO8A 2C59A 4PLHA 3AFMA 3GZNB 3ZV3A 4MINA 4JIGA 4Y67A 2O3RA 4F46A 4CL8A 4TVOA 1N2SA 1NP3A 2ZKLA 1Z75A 4L4XA 2IZ0A 2YQ4A 4ILKA 4LMRA 4NH4A 3SJUA 2OGUA 1QMGA 4J3FA 1LLUA 3NAQA 2DQ4A 3MJSA 1DIHA 3ZWVA 2BFPA 2XXBA 3GZNA 2BF7A 3DZIA 3EY4A 4ND1A 1B7GO 3ETDA 1P0FA 1X7DA 4BGEA 2XF8A 2NLOA 4H7PA 1ISIA 5A9SB 1UUFA 4NFYA 1OI7A 1M2WA 3H65A 1Q0HA 1T24A 1E3LA 4ALLA 4CV3A 1UDAA 2CSUA 4AJ1A 5L51A 1ENYA 4PLFA 1VI2A 1WDKA 1D3AA 3IIEA 1P1KA 5L95A 1ZK2A 1UP6A 3BHJA 2QZZA 5DBGA 3K9QO 4NMHA 5JO0A 2NQTA 3WGQA 1RYEA 5ENDA 3B1JA 3OFSA 1QYCA 1XELA 4FD3A 4PCVA 1X0XA 1Y9AA 1M76A 2YZ7A 1H6AA 1CIVA 3PWKA 4NBTA 3WLEA 3BTUA 3GUCA 3F1LA 4FS3A 2WD7B 3IP3A 1P1FA 2OXIA 1VRWA 2P9CA 4AJIA 5BNIA 1TEHA 1UP7A 3WS7A 3AW9A 1P1IA 1SC6A 4CMHA 1BHSA 2HCTA 4TWRA 2IEDA 3LF2A 1CQJA 4E32A 3PQFA 2NTJA 4KDEA 3UW3A 5B4TA 1GR0A 4XJSA 5TC4A 1WMBA 5T67A 4J16A 5A3VA 5MGBA 2DFVA 2E4AA 1N1GA 3DBLB 2ZB4A 3DONA 3ADOA 4OKIA 4D0SA 2G17A 5BNFA 3TJRA 1NTOA 3DFZA 2OUIA 2O3UA 4RJTA 5BSGA 3PHGA 1YOVB 4PRLA 2ZB8A 2F1KA 2PWZA 2W2KB 4BNKA 1YL7A 2B35A 2W2LD 3DZJA 3I6QA 4CM9D 4YAKA 4MVJI 5KJCA 2CVZA 2Y1OA 2PV7A 5DOVA 1XQ1A 3FI9A 3ZWOA 5AQ1A 4CMIB 2Q50A 4IJUA 1GZ3A 2XOXA 2H9IA 3GFBA 4IDFA 4NK4A 4EDFA 2AEJA 3JQ8B 1DFIA 1VJ0A 3PHJA 2J5RA 1E1MA 3BAZA 1H6CA 2QRLA 2PH5A 1A71A 1AN9A 3JYOA 1AHHA 4WLOA 2VOJA 1PR9A 3ZNQA 2EJWA 4EGFA 5CEEA 1R4MB 1IUKA 1KY5A 5L53A 1E3IA 4WJZA 3VOSA 1V0JA 3NTOA 4WOKA 3CMMA 1GZ6A 1RYDA 4D41A 3PJGA 2JHFA 1XU7A 1I2BA 1NAIA 3CSDA 4NBRA 3KB6A 5CAEA 2ZTVA 4XA8A 4LGVA 5IFLA 4DC0A 2PFGA 4JP3A 2NTVA 1E7RA 1ULSA 4P4LA 3ANNA 4IY1A 1LSOA 4DUPA 3NX4A 2HU2A 2JFFA 4CUJA 3MOGA 1FDTA 1Y8RA 1E5QA 3BA1A 3DZKA 4LK3A 4PLTA 5AVOA 4B3JA 1DAPA 3TZQA 3K31A 1Z82A 1CETA 3E5MA 1HF3A 1H6BA 1ZK1A 1F0YA 3RUIA 3SBOA 3GHHA 2Q1WA 3ZZNA 3JD0A 3RD5A 2G82A 3K8ZA 4GH5A 3RFTA 4JCOA 1BG6A 1KERA 1KVQA 3GUYA 1ZFNA 4HNGA 4U7WA 1R0LA 1V3TA 4IDEA 4M87A 5A05A 1O5IA 4BMVA 5B1YA 2O48X 2PH3A 1JKJA 2EP5A 3CE6A 3UOGA 1PJCA 4CR8A 1YKFA 1I3KA 3E9MA 4OM8A 4WLFA 1YJ8A 5ITVA 4WCFA 3INTA 1O89A 2NWQA 4KDFA 1DAOA 2C82A 3BTOA 3KSZO 1DIAA 4R68A 3Q2KA 4A5OA 1QLHA 3I3OA 1WZIA 3RFXA 4DIFA 2EP7A 3LQFA 3KO8A 2DPHA 2X9GA 4YRDA 1XCBA 2CZCA 3K96A 4AJ2A 5JCJD 5JMPA 4HFMA 2O2SA 2GDZA 4EEZA 3RIHA 3JQDA 2Q45A 5KJFA 3HDQA 5KVQA 1UXGA 3JQFA 2YHIB 1NQ5A 3RSHA 2NVUB 4NPCA 1M67A 4BNXA 4MIYA 2WYUA 4FQ8A 3FPCA 4XYBA 1HETA 3PTZA 3KV3O 4Y8VA 2D4AA 3GG2A 5C5IA 1YH3A 3HN7A 1JKIA 1KVSA 1PR3A 1CERA 1HL3A 3NT4A 4BNJA 4DIOA 2YY7A 5IJZA 4W7IA 4NJMB 1IHYA 4XIJA 7ADHA 2PTGA 4R16A 1ZXBA 2Q2VA 1PQWA 1K6XA 3V2HA 4A26A 5U9CA 4LVUA 1AGNA 5B4UA 8LDHA 5L40A 3DTTA 1D4FA 5DP2A 1MXFA 3D64A 3JQ8A 4YDRA 2EEZA 4NJMA 4CPDA 4UULA 2HO5A 3CEAA 4CM7A 1RPNA 3I9MA 1ZMTA 4BB6A 4CM8A 4UUOA 3H8VA 4BO0A 1M6WA 1NQTA 2W2KA 3ASUA 2X23A 4EEXA 1U4OA 1YRLA 3KBOA 4IMRA 5DT9A 5CFZA 4R9RA 4WEQA 3KZVA 4BNFA 1OC2A 1I3MA 2P91A 4AVYA 1MLDA 3ADPA 2FN7A 2FRDA 4FJ1A 3OEWA 2XXJA 4OAQA 4ND5A 4C4OA 1SBYA 3DC2A 1PZEA 4YB8A 3H4VA 3V1UA 3UCEA 3ZWBA 2AE2A 1DPGA 3RC9A 3TOZA 1CRWG 1DLIA 1ID1A 1H0KA 3I9LA 3KVOA 4XDYA 4YQYA 3U62A 1HRDA 3KUXA 3AFNA 4WOJA 1ZNQO 4RF5A 1QSGA 2Y67A 2QG4A 3CXRA 3K30A 3WSVA 2WDZA 4FOSA 4B7CA 5AXBA 1E7YA 1DLJA 2X0JA 5FF9A 3B6ZA 1VKNA 3DBHB 4R5HA 3AY6A 3FD8A 1QG6A 4PG8A 4R9SA 3U0BA 2VCYA 1YBAA 4XB2A 4Z0TA 3W8DA 1B16A 4DLAA 2VHYA 3ZWMA 5U4QA 1M66A 4UVEA 4J49A 2D5AA 4KMSA 1F14A 2DT5A 3TOXA 2X9VA 2WJPA 3VH4A 4NR0A 4J7UA 1BDMA 4RGBA 2RHCA 4OXYA 3SC4A 4BKRA 3UXYA 1UZLA 1WDMA 4FJ2A 3ASVA 1ZVMA 3PZRA 1QKIA 2JL1A 1DIBA 4NU5A 3ZW9A 4BNYA 3RJ5A 3M1AA 4RVHA 2W98A 2Z95A 1ZJZA 2B4QA 3IL2A 1GCUA 4KZPA 4RPJA 4DGSA 4U0JA 3LVFO 3RUFA 3M2TA 5A9TA 3PIDA 1N8KA 3O4RA 3JD1A 4MKZA 1GCOA 4BB5A 1VSVA 4EW6A 2QZ9A 1Y8RB 3ULKA 1ADGA 3WGHA 5LDHA 4R5MA 5A9SA 1T25A 4E5PA 1UAYA 4BKOA 1HSZA 4GSLA 5L9AA 1PU2A 3U49A 3BIOA 4R4JA 4XZ3A 3ST7A 4BIIA 2C0CA 2VUUA 2GN6A 1Q1NA 3EW7A 4OSOA 2HMTA 3EMKA 3JQCA 2HDHA 4N7RA 3MOIA 3IKVA 1HYGA 2W2LA 5HM8A 4KQWA 4BVAA 2Q1UA 3H5RA 4NFHA 1ISMA 4D3FA 3GK3A 3X2FA 3PJDA 3TL2A 2CVOA 1PEDA 1F8GA 4E2ZA 2PKQP 3LSYA 3N74A 4MVJG 4OH1A 3G79A 1P0CA 2GYYA 3LT1A 1O6ZA 2OHXA 4G81A 4CMIA 1ORRA 4YVFA 5DP1A 1T2FA 4XJTA 3DO5A 3GOHA 3DL2A 1E6EA 4ND3A 1Z45A 3BHIA 2D8AA 4HFNA 3V8BA 2DBZA 4CLOA 4RO0A 4JQCA 4CV0A 1NFQA 4I5FA 4LW8A 2ZB7A 1QYVA 2VN8A 2OBYA 3SX2A 1B8UA 4CQMB 2X8LA 4XB1A 5ICSA 1GPJA 4OOFA 3SVTA 2X0NA 3GDFA 2W8ZA 3GMSA 4TSKA 1HE4A 2WD8A 2YW9A 3QVWA 3INGA 4Q9NA 2HK7A 3V1TC 4AJLA 4TVBA 3ANLA 3GPDG 2VHWA 2Q46A 5LC1A 4WCDA 2YDYA 1D7OA 5AOVA 4DC1A 1DSSG 2GN9A 1C0PA 3DBLA 3KRTA 4A7PA 3DAPA 5L4NA 5HBRA 3U4CA 3GA0A 5JPIA 5L7WA 1H2BA 1KC1A 4RDHA 1RJWA 1GV0A 3L4SO 5BSFA 5F1KA 5TSDA 4IINA 1LI4A 2HRBA 3E6AA 3RAJA 1IYZA 4J0FA 4CM4B 1EUDA 4GGOA 3RC2A 1AUPA 2HLPA 2I9PA 3A4VA 1E3SA 1VJ1A 1HSOA 4HNHA 1PGPA 2HMSA 2NQ8A 3DFUA 3P5SA 5TJHA 2C20A 4W9NC 1GQYA 1K6JA 3ZHXA 1UR5A 3FWNA 4Q3BA 3WGYA 1EFKA 1EBFA 2X7HA 2X0RA 3QV1A 1E7QA 4J1SA 5K0ZA 4OYRA 1DIGA 3AI3A 4UUPA 4O0LA 1JAYA 3BYZA 1LEHA 4E33A 1QYWA 4JNKA 2VWGA 2VUTA 1PJ4A 4OHUA 5K6AC 1ONOA 5I9LA 2O3QA 4DXHA 1SZJG 4YJFA 5JDCA 2Q4EA 1KVRA 2XPCA 1D1TA 3WGOA 4MVJM 1QORA 4WNIA 3U5TA 4YQZA 1JWAB 4BQPA 5DZSA 2DBVO 3JQ7A 1SEPA 3OHSX 2HAEA 4E0BA 4PZEA 1B15A 4XQEA 2X58A 4FFMA 4CLRA 1I3NA 2FZWA 3S55A 1JWBB 1D8AA 3RU7A 1KC3A 2PY6A 2RH8A 3GC6A 4PLCA 5COAA 4DLLA 4BKQA 3ZN2A 4CLHA 3I4CA 1CYDA 1ZEMA 1SCUA 2ZB3A 4JROA 2CVQA 3JTMA 5CHEA 4YBZA 2TMDA 3ZWWA 1J0XO 5IXSA 4QO7A 2X22A 5JY1A 2BFAA 4IJWA 3D3WA 2PKQO 3OJOA 4OJNA 4URFA 5BT9A 4WKGA 3PHHA 2GNAA 1PZGA 4HFRA 4DPKA 2P9GA 2X0IA 4YJDA 4PFJA 1HXHA 1TLTA 4B4VA 5L4LA 1DIRA 1OFGA 3GGPA 3DZBA 2BLLA 4RF2A 1XGKA 3K6JA 3KSUA 1P45A 3IUPA 4GQAA 4A03A 1E0DA 3G1UA 4WASA 2R6JA 3C7AA 1J5PA 3HDJA 3WDSA 1PGOA 3JV7A 3WTBA 3QVSA 1C3VA 3WNQA 1E92A 3GGGA 3QHAA 1Z73A 3R0IA 5JNLA 1QYDA 1WDLA 3KLPX 4LSMA 4QEDA 4IJVA 2E49A 1GU7A 4I8XA 1GY8A 5JAMA 4XQ9A 4FFRA 4Q3EA 5JYEA 4YR9A 5EQDA 2IEBA 3TN7A 3JD2A 3H6KA 3HZZA 2O7QA 5I9MA 3QVTA 1LX6A 3SJ7A 1CJCA 1MC5A 1DXYA 4CM8B 3LC1O 3AOEA 3EK2A 2PD6A 2HMVA 4KUEA 1FDSA 2Q1TA 1T4BA 3C7DB 4I9HA 4LRTB 3U4IA 3CUKA 2B5VA 3A28A 1IZ9A 3DZFA 4IDAA 4O6VA 1HYEA 5TX7A 4PRKA 3OSUA 2FWMX 3BZUA 3LC2O 3R1IA 4BO4A 1UDCA 1ZCJA 2ZCUA 4YAEA 3GEGA 5L45A 2B37A 2JCVA 1JKFA 1PSDA 3NGXA 4LISA 4FOOA 3OM9A 3RUDA 3P2YA 4ITUA 3FBGA 3OIFA 1GUZA 4NQZA 3F46A 3U3XA 1Q7GA 1P33A 1GYRA 3QRWA 1E1KA 4XRRA 1QR6A 4GMGA 4CLXA 2VZ0A 2A35A 3Q9UA 4BKPA 4BNMA 1P44A 1SEVA 1EVIA 2FZEA 3TZKA 1HE3A 4EJMA 1EEHA 2AXQA 3UKOA 4Q3DA 3U9LA 4ZA2A 4GX5A 4LSWA 3KOUA 1IHXA 2POQX 3QWHA 4WNCA 3U4DA 4R1SA 4NIMA 2OO5A 4XR9A 3P19A 4W4TA 4CLRB 4PZDA 2DPGA 2E6UX 3I9JA 1R6DA 1N1EA 4BNHA 2O4UX 3Q3CA 1LNQA 1GUYA 1DC5A 2OZPA 3L07A 2HSDA 1LDNA 1QP8A 2JD0A 3DWFA 2DTXA 3VH3A 4F45A 2IDZA 4Q39A 2O3JA 2PGDA 4FDAA 3JYPA 2GZ3A 1DJNA 1K6IA 2YV3A 2PD3A 1T2EA 2HJRA 3IUSA 4AJNA 5ITWA 3DB2A 3FNEA 1T4DA 1NXQA 4HFJA 1BVUA 2UV8A 1YQDA 3CZMA 1JA9A 4E13A 1LJ8A 4Y6SA 4D44A 3JQAA 2VNSA 4WCFB 3Q11A 4RZIA 1SOVA 4GVLA 5DNAA 1GV1A 3NV9A 3W4IA 1UDBA 1YWGO 5TT1A 4AG3A 1DEHA 1PQUA 2EGHA 3JQAB 1U1IA 4ZRNA 3CMCO 4UVHA 3KYDB 4I9UA 5DULA 1MGOA 3WGZA 3UN1A 2B69A 3H9EO 1KEWA 4M49A 4C7JA 2D5CA 3WFJA 4B7UA 2R00A 2NU9A 1JLLA 1QRRA 3F47A 4ZQEA 4CLDA 1SB9A 2EIHA 1E7WA 4J91A 3ZWPA 5CDGA 3WFIA 4PLGA 3SC6A 2E82A 4O59O 4Y9DA 3C7CB 4L4SA 4EUFA 2BI8A 2C7GA 5JDCC 4MDHA 3WOHA 2C7VA 4RZHA 3PPIA 5A04A 2WM3A 3PRJA 1N7GA 2Q49A 3TZHA 3E9QA 5H82A 4J1QA 2D1YA 1GTMA 4YAGA 3IP1A 2G5CA 5EQFA 3VPGA 4FIZA 1E3EA 3PI7A 5EESA 5HA5A 3L77A 2NACA 3UCXA 3ZNPA 3TWOA 5U1PA 1ZH8A 3FSRA 4DYVA 2C54A 4ESOA 3GY0A 3C8MA 4BV8A 3I6IA 3QJ5A 3UUWA 3D4OA 2GUGA 1A4UA 1PJBA 3HDHA 2J3JA 4OOEA 3G17A 2GRAA 2JCYA 2X9NA 1YB4A 4CMJA 2GZ2A 2Z5LA 4U8GA 1J6UA 5F5NA 2YFHA 3KHUA 4YXFA 4EITA 3O26A 3T4EA 4NNJA 2P9EA 2RBEA 3NDIA 1LLQA 2AQ8A 1B2LA 3B1FA 3AOEC 1W4ZA 3NDJA 2CFCA 3IJPA 3TF5A 1GDHA 3RASA 1GYQA 3FBTA 3UHAA 2HMWA 1PZHA 6LDHA 2X86A 4XGIA 4DIBA 3CZRA 3LC7O 4OQYA 3PJEA 2QRKA 3EVNA 4OL9A 3IS3A 1YBVA 1DJQA 1JVBA 1HDZA 2PZJA 2X5JO 3GZ4A 1I2CA 1NVTA 4Z0HO 1HDYA 5G4KB 2I6TA 2CF5A 5TNXA 2LDBA 1DRWA 1OC4A 3ROMA 4AJEA 1A5ZA 5IF3A 4O5OA 3QSGA 4MIEA 4U6QA 2JHGA 1N9GA 4WLUA 2BFMA 4J2OA 1R4MA 3JQEA 4QX6A 1UP4A 3WX0A 5T6BA 3PVZA 4CLEA 1UXIA 1LSSA 5IG2A 1H2HA 2WYWA 4GVXA 3WWZA 3FNHA 3HSKA 1EVZA 2W4QA 3AU8A 3HB5X 3Q9NA 1KIFA 4R41A 3WYEA 5KKCA 1I32A 1NFRA 4P4GA 3E9NA 4GPD1 1BWSA 2Y1EA 3MWDB 3FN4A 2VNAA 4WK6A 1GL3A 4IZHA 1MP0A 4WLVA 1OOEA 2VWQA 3RVDA 4BGUA 5EN4A 4TZKA 4YAJA 1PL7A 1T2CA 3WR5A 3PFWO 4NI5A 1V9LA 5GZ6A 1GPDG 2ZJ0A 3LU1A 1RM4A 4IJKA 3ZWYA 4F6LA 1HT0A 4K6CA 2DU8A 4E3ZA 2AQIA 3T7CA 2FR1A 4A27A 4CM1A 1PJTA 4WLNA 4CR6A 3GRPA 1R4NB 1FXSA 1O95A 3EHEA 2VWPA 1TXGA 1E6UA 3KYDA 2O3SA 4EJ6A 3H3JA 4DLBA 1H5QA 1XWFA 2Q2QA 3ZV5A 2B0JA 3G1TA 4J2HA 2TMGA 2IODA 3GPIA 5KVSA 2Y05A 1ZXLA 1E6WA 3GN1A 2DM6A 2FPGA 3LYLA 2J5KA 4GLLA 3AUAA 4MVJF 4TROA 3PP8A 4W9NA 4ZJUA 3U09A 5T57A 1I8TA 4KUGA 4YT5A 2YDXA 4J1NA 3DR3A 4J4HA 4JP2A 3ROQA 4RVSA 2A94A 2IYPA 1U3UA 1Q7CA 3EYWA 4HP8A 4AJ4A 2DUWA 2ILTA 2Z1NA 4QT0A 1DB3A 1HDXA 3GT0A 4QECA 1YB5A 3H9QA 1DO8A 4E31A 1EDZA 4JJFA 3F5SA 1U7HA 1ZIDA 4ZQBA 3VTFA 3PK0A 5KKAA 1GYPA 1KVTA 1ONNA 3ZU3A 3T7EA 1WLYA 1PZFA 1WWKA 3D4NA 3AUUA 3BMNA 1YOVA 3S2FA 1NAHA 5TLSA 1IPFA 3Q6IA 1HZJA 2CDAA 5JW6A 5KJEA 4CM3A 3DAFA 3VVCA 1OBFO 4A10A 1QV7A 4MKXA 3UGKA 2Y0EA 4M8SA 4LN1A 3S2GA 4XX0A 3DZGA 5BNTA 4MP6A 1XHLA 2EV9A 1KYQA 4J6FA 4BKUA 3AUTA 4XQGA 5I9NA 3W8FA 4M89A 2QHXA 2PGLA 3RC7A 1P1RA 2H1SA 4RPLA 1LDGA 4U6SA 1AXGA 2A9FA 3KYBA 3H9UA 4KOAA 4ROSA 5IDYA 4Y6PA 1XDWA 4A0SA 4R51A 2VYVD 4NK5A 1B3BA 4EBFA 1Y81A 3ROKA 2D59A 4IQGA 3WYBA 1CEQA 1N9GB 4UVGA 3S2IA 2QYTA 2NUAA 3OQ6A 4BGIA 1U3TA 2AEFA
chains in the Genus database with same CATH superfamily
1ZC4A 3FPGA 4ZCTA 4HDKB 5AOCA 2IS2A 1XJCA 3FR8A 2GVZC 3LLCA 2WRZA 4Q7MB 4U7TB 1PEAA 2O14A 4AQDA 3AHEA 1HQYE 5H0IA 2P2DA 3IPXA 3LDGA 3QVXA 2GCNA 3AI1A 5KX5A 2CZGA 5BV7A 5BN4B 1O9BA 1XMSA 5JSZB 2J41A 5CH5A 2LCQA 3L8CA 3M1LA 2QD5A 4G84A 2CCJA 1R5NA 1W4CA 1YB1A 4HQRA 4I08A 5JO9A 4IKOA 2IYUA 4XD2A 2BHLA 3VHXA 1RI5A 2FI1A 2PSEA 5CH8A 2XQIA 4WSOA 3DMDA 4RK6A 2R00C 1CZLA 2I8AA 3Q3HA 5D6OA 1K75A 2OVBA 2F59A 4MO2A 2J4CA 1KDRA 1D4OA 1JTEA 1VI6A 4HV4A 2CEKA 5IC4A 3A58B 1Z7WA 1NQOA 4YRRA 2WJ6A 2QVGA 3NJ8A 2O2JA 3ESZA 3NHAA 4GICA 1T4CB 5DLYA 2A5YB 1WMFA 3EIOA 4UHHA 4IGFA 3T7DA 3HGMA 4JJIA 4DG8A 1M0EA 1FIUA 2LRHA 3SEZA 4PS0A 3ZHQA 3JQGA 2FSHA 3H2IA 4QDTA 3ZGOA 4D9FA 1F2UB 4LDPA 1AS0A 4IIUA 1E4YA 2WHXA 2TECE 4FGWA 4QUHA 4F3YA 4S05A 5CNIA 1XRMA 2QVBA 3WGTA 2IXBA 1VBFA 4D4JA 3TGLA 2VPZA 5FI1B 1LBEA 3QBVA 4G2NA 1JEQB 4TS3A 3H9JA 1Y6JA 2IHVA 3JQFC 3K09A 3KR9A 5I4KA 1T2AA 4FYIA 5ALNA 1SXJA 3CW8X 1RLIA 2X4LA 3UWDA 4NEGA 1EFTA 3CTPA 1NOKA 3EQ7A 1H4TA 1CR0A 1DAFA 1V3UA 2AVDA 3CX6A 4G63A 4EKEA 3PEEA 1X19A 5JYBA 3G3EA 4OB6A 4LDAA 4X41A 2BGJA 2HNKA 3QPUA 1C4OA 1P7PA 4X8HA 3D4BA 4QBFA 3ZWQA 3GT3A 1HDRA 1M6EX 2D5IA 5CLQA 3KJHA 5I8WA 2NP7A 3M8KA 3ZY5A 1Y7PA 4ZVUA 4WXYB 3PI6A 3OJFA 5K0FA 2AXPA 4RZSA 4AKEA 4GLFA 1N5LA 2WTMA 4AKSA 1QWSA 5BY2A 5IYZB 2ATCA 3ZBQA 3IEMA 2HDOA 3H5NA 1ZESA 1R9MA 1ZLYA 1FDUA 4GMFA 3M70A 5JMOA 3BIJA 3FHTA 5L6LB 1H3NA 3BE4A 2J0VA 3TD6A 4I1VA 1Q1GA 2C57A 3W6PA 4C0QC 4BS9A 2NV2B 4ZMRA 5ELXA 2JEOA 1XKLA 1YQXA 3FOCA 4IEEA 3KS9A 4MV8A 2YY5A 2W90A 3R7DA 5HF6A 4J0KA 3K35A 4JQYA 4R2XA 5FTJA 3C85A 1JDBC 3PFNA 3VRHA 3A4LA 1L9KA 4HRAA 1WS6A 3HNOA 3NTVA 1E2HA 3L3BA 4FC6A 1EHCA 3AF3A 4NJEA 4V0KA 2ZIVB 4UD2A 4TLCA 4G36A 3OD5A 5J3JA 3B1KA 4F12A 2PZMA 4L85A 5KTNA 1RP1A 2XTZA 4MQLA 4NBUA 1NRXA 5KOIA 3HUFA 3O8OB 4QGAA 1JEJA 1PHRA 5DM60 3T9EA 3TSWA 4HAXA 4MUXA 4IQFA 1UZMA 2B20A 3A1WA 3FJOA 2IQ5A 4WN9A 2QJOA 3CO0S 3P0EA 2I2XB 3ZIDA 2I3AA 1CIJA 2F48A 4KO4S 5DNDA 5G4KA 5KWEA 4ZU3A 4X9XA 1A8UA 2JIRA 4WRRA 5IF9A 1II0A 2N0SA 2ZXEA 1X7GA 3D2AA 4PSUA 4EBBA 2KS6A 1VA4A 4BNGA 5FBKA 2P9HA 3QNMA 2H0QA 5AJVB 5HJ5A 2FR8A 4YV0A 1PNRA 3LPMA 4B4OA 1SXPA 1S0UA 4Q7JB 5AHRA 4JI1B 4CGYA 1CUSA 1LUAA 1QCYA 4PIVA 2LV8A 2GFIA 2FH5B 4YO7A 1SBHA 2OFOA 3F3SA 2H16A 1V8DA 2O8DB 1AZSC 1X7WB 2R3SA 1BXRB 5KHOC 8MHTA 4ZOEA 2GKSA 1IONA 3CUSA 3T4UA 2YUTA 4G1MB 2PSHA 4QDZA 4EB6A 4Z3OA 4DMFA 3PXBA 4HUTA 2G09A 1NONA 3GQBB 1ZM3A 2XB9A 1WBJB 3KJGA 1TQDA 4BHTA 4U9HS 3G0OA 5JS2A 2IYQA 4G5QA 2VZLA 2X6TA 4B9EA 3G6WA 1JBKA 2TMKA 4PZLA 2Q2WA 2W6QA 1NBME 1WEKA 3ENQA 3P1JA 4M9ZA 5FFFA 4MPDA 4BTLA 1FQWA 1U0EA 2BKAA 3AF5A 2QMQA 5FTNA 2C2XA 3GCWA 4QDKA 1R0RE 4YUZA 1PG2A 2DBRA 1AURA 4YI5A 4MUNA 1CLUA 4HH1A 4MIOA 4G4GA 2BHRA 4WBXC 3BXGA 3N76A 4L2IB 2XMBA 3CISA 4EUHA 2HSEA 4RK1A 1Z33A 3F67A 1NF2A 1RWOA 3EIUA 3EG9A 4BBPA 5DCWA 1V6SA 4XVCA 1CF4A 3NWJA 1R74A 5LIPA 3V4VB 1GA1A 4WADA 2W2QA 3BWVA 1NC1A 3WWCA 4OQXA 1Y6GA 1YCGA 4DNXA 3TSCA 4Q01A 4BO3A 2JGLA 4E94A 3FAZA 2JI9A 5AKLA 3HTXA 4OREX 2CY0A 3DMHA 3RT1A 2PQ6A 3O75A 4C29A 1XCLA 2XY4A 2ZRPA 4NBLA 2CD9A 3G85A 3F1KA 4UE3S 2WFAA 2R4QA 2CVFA 3R7AA 1XALA 4XIIA 1H66A 1GGNA 3BRCA 3UEOA 5IHXA 1GITA 4GAEA 3FUUA 1YIOA 3CPEA 4FZ5A 3PITA 3NTRA 5E2AA 1BSVA 1FP1D 3AUSA 3LECA 1WETA 3KB2A 5LD2B 3MGBA 5CR9A 1TYZA 1EU1A 2HTEA 4JS0A 1NA5A 4IM7A 4M86A 1IFXA 4GRIA 4IG9A 5K6AA 5KB3A 1X94A 1IOZA 3WIDA 4DJFC 4EG1A 1IB6A 3SQWA 3H1EA 5TJ9A 3WMFA 4ZOQI 1PNQA 4ENSA 4CEIA 4FNOA 5I5EA 3ITKA 1M6VB 1ZIPA 2MSLA 1V39A 1G19A 2PO5A 2Q6OA 3K5IA 2P90A 1PF7E 4GLBA 4TKLA 2BEWA 1N4DA 4KYUA 3KUDA 1VHDA 4R54A 1LDYA 5DRYA 1H69A 4LMBA 4P80A 1IQRA 2JA1A 4PVCA 3LBFA 2I4MA 4K8OA 1PZNA 5D85A 5FULA 3HWRA 3TPZA 1ENOA 4OFXA 2QMEA 4ARZB 3ER8A 1W5EA 5ECGC 5CLGA 4RLSA 5JNVA 1QGYA 2G40A 3R3SA 1X7HA 3HP7A 3OOEA 1IULA 3D8SA 5HM6A 3G9UA 5JS6A 4AN0A 4NG5A 3VO8A 1MG5A 3O84A 5HK8A 1CUDA 4KMRA 2REQB 2YYSA 4B3IA 1EVEA 2AOXA 9LDBA 1PD0A 2BE7A 1T5IA 2AWOA 2ET6A 2H6EA 2YZKA 3BF8A 3KBBA 4PGHA 4FILA 3SQOA 2XWQA 3WMEA 3C3WA 3HBMA 3QWFA 3K32A 3GQVA 3U4QB 3HADA 3TW6A 4QZVA 1TUBB 2FVXA 1VGVA 1W75A 2ZSKA 4ZVPA 2ZT7A 1T13A 1W2GA 2X4GA 5JAZA 2JJYA 4KC0A 4QT4A 2XTAA 4W5OA 1W1IA 1G3UA 4MKRA 3ZHOA 4ALNA 1MB3A 3UXHA 1ZSVA 1RYHA 2C2BA 2V6MA 4LX8A 3RSOA 3QYAA 1H6DA 3FYUB 2NP6A 1JVNA 1QOPB 1K2WA 3R5TA 4M54A 3GFQA 1IRXA 3ZIAA 3SFTA 1SA0A 3VC1A 4KXLA 1WEHA 1AA6A 2NSHA 3KQYA 5F52A 1KY2A 1P5FA 1ZGBA 2LNDA 2QQ0A 1N6RA 3FCYA 4ILEA 1OXXK 4QATA 2HPVA 3RM3A 3AP3A 1SVIA 4YWJA 1IWBB 2LR0A 3CKYA 2P79A 4GS5A 1KZ7B 1RQ2A 3MHPA 2H08A 2W37A 2ZSUA 3PC8C 1U9JA 1ULUA 3H42B 5HS6A 2FPOA 5G3ZA 3R8CA 3BMOB 2JARA 3Q1KA 3VGJA 2BUBA 3ZE2B 3UMYA 1NZDA 1FLNA 4QDXA 1QB8A 1GPLA 2HHCA 2EFEB 3P9RA 5LZ2A 5KVAA 2XXAB 4R0MA 4OMUA 4FHFA 1LPPA 2SNIE 2MT9A 3T6KA 1ZUD1 4NBNA 5TMPA 4DDMA 3H4IA 1VPTA 2VNJA 4BVGA 3ETCA 4BZPA 1W1WA 4HVCA 2ATIA 2QOEA 1UMBA 4JEMA 1PUIA 2EW1A 3T1OA 1OYYA 2GAAA 4H3SA 4WFKA 1PFKA 3LGSA 1E77A 1Y6FA 5CCEA 3K0EA 3A0UA 5E4YA 1JB9A 1QGZA 5FR1A 5TQJA 3I61A 2XNHA 1YRQA 3ICCA 3F6BX 1YZHA 5ALRA 5KS2A 1BGXT 1UM9A 3T35A 1XDBA 2GGSA 4YCAA 1U94A 1RI1A 2EFJA 4KR2A 1IEXA 4II2A 1L5HA 2EAUA 1NTRA 2CJFA 1YL6A 2D74A 3NBKA 4XD7A 4TVSA 3Q6MA 1UAGA 2LIPA 1PIWA 3LL7A 4LRXA 4WXHA 1NX9A 3FR7A 5DYYA 3WYGA 1IBRA 2WEKA 4XM1A 3IAUA 2CNDA 1SU7A 1SVOA 2JI4A 3LZ6A 2FK8A 4P0TA 4BN5A 4Q5IA 4LQCA 4KSCA 2G36A 4YUXA 1QHHA 2OG2A 3CIFA 1EFLA 3GNSA 2V7WA 4IQ8A 1SCNE 5E1BA 5E95A 1VHWA 4H4EA 2HT6A 5BO5A 4EG7A 3NKFA 4W5QA 1O7JA 3WRXC 1C8VB 2PMWB 1TM5E 3HO8A 3WK7A 1KGDA 5A2GA 3W5HA 1NUPA 3FNIA 2WAXA 2G6BA 3FNFA 1Y48E 2PKCA 5AXDA 1JDJA 1J8YF 5AKYA 2AHOA 5F7ZA 3X1DA 3HJUA 4AP6A 4KJXA 4L5IA 4MHTA 1HE1C 3UK6A 2IYSA 5TQ0A 2GCGA 1QM5A 2D0IA 2GZDA 5B1DA 4M8NE 1WP4A 1H42A 2C9ZA 4G0OA 4AJPA 5EJ6A 4Y98A 3MNFA 2P69A 1TF5A 3CNEA 3N9IA 4ARVA 2R60A 2P9FA 5IKPA 4AIIA 2JH9A 1BFKA 1NBEA 2FYTA 5F2KA 3CRW1 1N8TA 1V3VA 3G7NA 1M2EA 4IIJF 3R9XA 1YHYA 1F9AA 2AHRA 4AZWA 2CGEA 3T0IA 2QPLA 2QQFA 5KOHA 2C2GA 1E1CA 4MLZA 3BCHA 2CK3A 2KX7A 2LKDA 2QXUA 3SHFA 4AL4A 2JLQA 3B48A 4C22A 3RO7A 3OCUA 4RJKA 3UAZA 3VO1A 4XPZA 2NVWA 2G71A 1RMTA 2K6GA 5T64A 5FV7A 5DI3A 3TEFA 4BFWA 1BXGA 3I01A 4DDKA 3GMDA 4L7QA 4GT1A 4M1QA 4L0QA 1G17A 4JBWA 3A6GA 2H57A 2O3TA 4KFRA 1YVUA 2QAIA 3N2GB 1ULBA 2XVZA 5K8CA 2XZDA 2G77B 1OBCA 4TXHA 4F11A 1U0RA 2Q4RA 3DUWA 1GPBA 1NMXA 5M7EA 3W5BA 1H4VB 5JISA 1FYEA 2QV7A 1R5JA 2HJVA 2QT0A 3D6FA 1C1DA 1I0ZA 1CZRA 3RANA 4B40A 2KB0A 5EHXA 2R1VA 2ZXFA 3FSJX 4A8JC 4TKUA 1U2RA 1EWKA 2EIXA 4PQFA 3HS3A 4RDXA 5KTKA 2CXNA 3PKJA 4II7A 5FA8A 1V47A 3P9XA 1XD8A 1BW9B 3AF0A 1XU9A 2HRDA 2HO4A 3QFHA 3LP5A 1E0SA 1KJJA 4H6PA 3U7GA 3ZDDA 1EVYA 1NWHA 3CH4B 4FBLA 2X5KO 4GBGA 2H52A 4W9RA 4OJQA 2R11A 2ZSBA 2AI2A 1I30A 1N2OA 2WKPA 3CF4A 3L7JA 4N8DA 1RAFA 4D8VA 1NVGA 5F7OA 4E2WA 4Y2SA 3B5EA 4U6NA 4EB6B 1GKLA 4Z4FA 4EYQA 1JQ5A 1REQA 1NJ1A 4XOUA 4PX2A 2IE0A 5C31A 4G1FA 4AF7A 1IH8A 5E6UA 3GL9A 3TI9A 2HDNB 1YK0A 5EFOA 2BTQB 1N5RA 1I3OA 3IT1A 4MW4A 4TT3A 3TXYA 3WYCA 3G0HA 3OIWA 3PDCA 4KNWA 5BQ3A 1BS9A 4EGCB 3I34X 2AC7A 3BEOA 3PUJA 2XA9A 3N8KA 4G67A 3TBFA 1CDZA 5HX7A 1N0WA 1V25A 4Q15A 2FOXA 3IUNA 4UHEA 5G0VA 4TTSA 3D6AA 1FRNA 2QYOA 3NKLA 3PGXA 4QM7A 1DDOA 4J9VA 5DHRA 3MERA 2HK9A 1JHPA 3RVRA 4DLKA 3CKMA 1AK9A 2PLFA 3IAS6 4L74A 2P68A 1CP2A 5BOVA 3E23A 2HADA 4UPVA 2II6A 3R5FA 3HYCA 2FSSA 2RC5A 3ZZUA 2K2QB 4DCPA 1RQXA 3D54D 3RROA 4DDWA 1NE7A 4MP8A 3CBGA 3GGOA 3KTOA 4MCAA 2QUHA 4WDQA 1MV8A 3I83A 2PUTA 3P96A 4P5DA 4IUBS 2CT8A 5JCJA 3RKUA 3OT4A 4M88A 2WAAA 4M7PA 3NT5A 2HF2A 3AR8A 4RVCA 1C8BA 1ZD5A 1C9NA 2FHSA 5GONF 4BQRA 1FLAA 2ACWA 2XWBF 1AKUA 3L6BA 4CV1A 5BRJA 4R8LA 1EGQA 1NW3A 1YO6A 2CKMA 3D8UA 4K5QA 3EDOA 3CUEF 1WHSB 2J3MA 4HH4A 5HTKA 2X3FA 3H0EA 2WR8A 4PLZA 1Y4ZA 3PEFA 4YAFA 3AEQB 4ZCMA 5KNDD 1K7YA 5BURA 4JB3A 4R1MA 4BIMA 4P58A 4BLRA 4N6NA 1DRKA 1NMZA 1N6OA 5FPPA 6REQA 4CIWA 5A0VA 3Q6NA 2WT9A 4QYXA 2DPMA 1SCJA 4FFLA 2Y27A 1TA0A 3R2JA 1VSUA 2B98A 1SHZA 3QELB 2I2WA 3ZU2A 3ZV7A 1F4LA 2J4DA 4XUDA 1Y8QA 4FYYA 2O8CB 3JVIA 3UAGA 4DLRA 4IG4A 4RKQA 5ITZB 2WMDA 5EXXA 5LBIA 3IRVA 4F4HA 2GEJA 1RPJA 1DRUA 1OIWA 1R12A 4CEIB 4MVJP 2QLMA 1OWNA 2CUNA 4NCKA 1VLJA 1JEDA 1W9MA 2C1EA 5ALZA 4NE9A 4TV8F 4RWEA 4UZEA 3L4BA 3V8QA 4JEHA 6AT1A 3O2NA 3KKEA 3T94A 1CUFA 3BFJA 3IDSA 3KTAB 2AN3A 2V7PA 3IXLA 2FDRA 1YXMA 4XCVA 1Y5LA 3K92A 2FFQA 4C2AA 3I0ZA 4NZPA 4DIEA 3WAJA 5BW4A 3IUYA 1AX9A 3MS2A 1BMTA 1ZIOA 2FMHA 2VWHA 3GFGA 3EF1A 3NW9A 4ZOAA 2OYCA 2R6HA 3HBFA 5HW0A 3CRZA 1XEAA 2GN2A 2PT5A 4RYDA 1IOWA 1T8RA 3EZLA 1N6NA 3I45A 3K0HA 1NRWA 1QIEA 4KDRA 3VHRA 5JTUA 4PGAA 3TLBA 4O2BA 5FPQA 3KDAA 4LYGA 5REQB 4ZEMA 4OTZA 5BQ5A 3V1KA 2XADA 3X2EA 1WOYA 3GEDA 1I0IA 1RT9A 3BIWA 4REQA 3EW9A 2XB6A 2KLHA 3NM4A 4MW7A 4PX9A 2YBDA 3COWA 1IN7A 4U1RA 4B6EA 2A92A 2NADA 3NS7A 4UEKA 4NU0A 4EM6A 4AZSA 3UICA 1XR3A 2C96A 2EHJA 2FUNB 3ORYA 1BHO1 1W19A 1E89A 4I7EA 4R2LA 1QZ3A 4JYCA 2VP5A 4W1PA 1U90A 3D3WB 4KI0A 3KL2A 3T41A 2HMYB 1CW2B 2XYVA 3JQBC 3K1AA 1ISHA 1VYHA 2CL6X 3G68A 1PW5A 4UBMA 3NKVA 4DS3A 3E27A 5IU6A 4GPEA 1HNWB 3AQIA 1TMYA 4IGAA 2QIOA 1IXSB 2ZR9A 1SPBS 3SSOA 3JYLA 2HHJA 2F3PA 2JI6A 2YL2A 3L7AA 4OLHA 1ZKMA 5JNUA 1WUHS 4X65B 4L57A 4AB1A 1AQNA 1WZCA 6GPBA 4NPHA 4ZANA 4QHYA 1WMSA 5DM1A 3MAJA 2BAGA 2CDNA 1LSUA 3MZ0A 3AM4A 4EW1A 2EKPA 3L0DA 5TMDA 1TT7A 1JP7A 2C95A 3O3CA 3C5EA 4B09A 3O31A 1Q2UA 4RYLA 3REOA 1E2JA 2WBLC 1VRCA 4RADA 3LCVB 3LJKA 5B2ZA 4J1TC 1KJWA 1MBZA 4DKJA 3NRBA 4OBBA 4C7OB 1T43A 2BWJA 1DP4A 3KPYA 1B8OA 4L8VA 2GPNA 4NC9A 3W2IA 4BO9A 4K3UA 2ZDGA 4YAOA 4LY3A 3RUPA 1YVDA 3L1KA 3QLEA 2J9RA 4I1IA 1SA0B 4UOQA 1Q17A 1RM3A 2Q6IA 2L69A 5EUMA 1GSAA 2D06A 5FWXA 3UKDA 5T3UA 1Z37A 3SFZA 3FOFC 1WP9A 2FN9A 2JK0A 4B3GA 1AV6A 2SKEA 4M0PA 4UW9A 3STTA 5CXQA 3M7IA 2XMGA 4H9GA 2IPNA 4JJAA 2P8SA 3ZK9A 4NQRA 3S8EA 3Q9LA 1I4DD 3D4LA 2AXNA 5F98A 1MUUA 4NHEA 1Q1EA 5K4GA 4CVNA 2AMFA 5KYXB 2HHLA 3UK2A 1TUEA 2XRMA 3QWAA 4DLWA 2GJ8A 3BMOA 3OLZA 1EK6A 2HPAA 3G2LA 3UOAB 1B0AA 3RJ9A 2J3KA 4IIDA 3PHIA 1ZGCA 2V45A 3WICA 1WUKS 2PUJA 1SXJC 3ELWA 1UOEA 2J8ZA 5HJ2A 4S12A 2UVPA 1RQ7A 2B1IA 2O7SA 2GEBA 1RAIA 3Q2IA 3GV0A 2C5AA 3BSFA 5C7OO 1WQ1R 1X86B 1N92A 4D3SA 2D2XA 2RB4A 1NVKA 4UUQA 1E69A 1YE3A 3M9WA 2H29A 3ESRA 4Q6BA 5CX1B 1SOWA 1L7EA 3VZRA 1G16A 1JSCA 3I9OA 4JQSA 5BVGA 2WSBA 4FTWA 5JASA 1EDOA 4R69A 3PS9A 3QXXA 3CUWA 3C4QA 1OX5A 2WI8A 2I6XA 1UXHA 2I4OA 1SHLA 3I5MA 3OETA 1OLUB 3PQEA 2VXBA 4JZYA 4F9EA 5A3JA 4IXDA 1USWA 2D0OB 1ZQ9A 3F6PA 4LOJA 5F5LA 4MUKA 2VDWA 3Q3GE 1HR0B 4EG0A 2D6FA 4IFTA 1E18A 3B7PA 4IZIA 1NPDA 1SCAA 4GLOA 5K20A 1GILA 2D3TA 3U3KA 1FYWA 5CGZA 4UDNA 4EGQA 3BL6A 1ABBA 2Q1SA 1X1AA 4JJZA 3H6HA 2UYCA 4J7AA 1ZS9A 4EJFA 4Y2YA 1V4NA 3SYLA 1U3WA 3WL6A 3PA8A 2VPQA 4TRRA 1U02A 4OXQA 3UQYS 4CKCA 5KOJA 1PS0A 4GPZA 3I9V1 1D2GA 2P4HX 1YA6A 1QGAA 3PU6A 3KSAC 1US8B 3U7QB 4OQFA 2WWRA 2VPYA 3T9AA 1X0VA 2FN3A 2VAXA 2O52A 3IFSA 4N5IX 1WVGA 3FFXA 2ICAA 3U7JA 2PYDA 2WZQA 1TGVA 3W1WA 1Q7BA 3FOZA 1EWQA 3T95A 4FW9A 3EG9B 4TQAA 3OCCA 3SXPA 3KKNA 4J6EA 1BWPA 1RXYA 4GKVA 1C1XB 4NDNE 3TBKA 4ZMSA 3RYIB 1KDTA 2UKDA 4L9RA 3PTAA 3AQ4A 3NWEA 2V9CA 2BFFB 3WIOA 2BFDB 2O1WA 2Y6UA 1QZUA 4LGCA 3K0CA 3QXSA 3LC0A 3B1ZA 3LO8A 5JAIA 3O8CA 1KSHA 4UHJA 4NFSA 1QNFA 2N46A 2OC9A 1C1XA 1ZK4A 2YTZA 3E03A 3EFBA 4RQUA 4X91A 1TQHA 3PRYA 3M1IA 3QWBA 1YVRA 1XROA 2A4KA 2DQZA 4KE7A 2B8NA 1TAUA 3PNLA 4A0GA 4L4ZA 3VJMA 3NIFB 3C3KA 3OJ0A 1YQGA 3R23A 1P6QA 1J42A 4TN1A 1BDIA 5G4LA 2ODNA 3EBLA 4C08A 2IS4A 1XA4A 1EDEA 4EB8A 1XKTA 5KREA 3O38A 3TVTA 3VDMA 1D1SA 3L4BC 3W2EA 4NY1A 3ZX4A 3GOQA 2X5NA 4D4LA 3ZZ1A 4CG0A 2NSDA 1JLLB 1KQ3A 5KYNA 1GAEO 5HR5A 4LXUA 1JZTA 4LXTA 1PVVA 2Q5IA 3Q72A 5E4FA 3ILXA 3S99A 4EDHA 1U3CA 5JYDA 2IYYA 3MILA 3HA7A 3K53A 4LJRA 4L22A 5HGJA 4W5RA 5LXTA 2JGAA 2G4LA 2WVAA 5K8VA 5GJCA 1JEYA 5B37A 5T4EA 1V96A 1TJNA 5H5JA 3V55A 2BMWA 1FRVA 2C99A 5JZOA 2E37A 2GF9A 3AK4A 3D31A 3PJFA 3UA4A 3TZCA 2R2AA 2YNMC 1NL3A 2ONYA 1JQJC 1AA9A 2HBZA 1XQWA 3DO8A 1WZNA 3FFTA 1B3RA 3K4PA 3OEYA 5BR8B 2ZIZA 1TA4A 1YDEA 3HJHA 1ONBA 4IR7A 4AICA 4HZIA 2ISSD 3UFXA 5DX8A 4F38A 3SSAA 1KMMA 3CUUA 5LIRA 1U0LA 5KPJA 1GARA 1SURA 2JS7A 1QFYA 1EG2A 3D43A 4XJXA 3COJA 2VQ3A 4HHEA 1WV1A 1Z4PX 2C61A 2ZK7A 3CZ9A 1XZGA 2EZUA 2IW1A 1PW7A 1EFRA 1GGVA 1Y4DE 2Z5FA 4PAGA 5ELMA 4QQRA 5HBGA 1GN9A 2FLVA 4C6TA 3GLIB 2GBIA 2X4DA 4E4YA 1TVCA 4J43A 4Y1GA 4CHGA 4W63A 5AKHA 2H4ZA 4PG5A 3W5CA 2BMFA 2WD9A 1NXSA 3KIPA 3HHPA 4UMDA 1MF7A 3MWFA 3TQSA 2V7GA 4DHWA 2JIBA 4O2AB 1CHNA 1AZWA 1R00A 2BGUA 1DO2A 2P40A 1COWD 4YACA 1CG6A 3FMOB 4KQ2A 5FP0A 2PX8A 3SXJA 3VYRB 3K70D 2HD4A 2FNAA 1HKUA 2WG0A 1U3VA 3UMJA 3ZWCA 2BM8A 2FG5A 4N5NA 1JIKA 2I8CA 1FYVA 4M7WA 2UZIR 2FWRA 4NF2A 5KMGA 1FQKA 3W5DA 2I4NA 2H5LA 1Y1SA 1F51E 5JZ9A 3SZ3A 4XWWA 3O03A 2Z09A 5JU6A 3LDHA 4Y1RA 5FOSA 1SKMA 2ZYWX 3IVCA 2QV0A 1OZGA 1OXBB 4EG3A 1N5KA 4AJHA 3FCCA 5HEKA 4J03A 1NFFA 2IU3A 2Q5FA 2VT3A 5EJGA 1ODIA 8OHMA 4YXWD 3F6YA 5BOSB 4MLPA 4KXFB 5A1JA 1G8PA 1UKCA 1S2NA 3HGQA 1UEIA 3TFOA 3PUHA 3U40A 1FYFA 2HUPA 2ZULA 1U0SY 1JLMA 2ZPUA 2N1BA 3OTOB 1TAQA 1FE8A 4DM7A 1DJMA 3WYFA 5J59A 5K0JA 3UUEA 1WBDA 5CG2A 5KC9A 3IB6A 1OAAA 1GLGA 2P41A 1XFDA 5KCMA 1Z4LA 4BBZA 2W6CX 1K3TA 3LCMA 2CXPA 3R09A 4K05A 5AJXA 5A6VA 1AF7A 4U00A 4A8HA 3SHQA 2IKSA 2C0QA 4JSYA 4QG7A 3LFHA 4ZARA 2BFCA 3TUJC 2ANCA 1NJ2A 4KGVA 1EP9A 2HTFA 3EZ2A 1I4OA 5E7QA 2Y1KA 1RVDA 3IOEA 2WJAA 3EGIA 2HBQA 1I94B 5B7QA 4MVJH 4ZO4A 3E70C 3FTDA 4NS4A 1MOQA 3DQZA 3NJRA 3H18A 1JEAA 2L19A 3A36A 1IU9A 3VU8A 4DMHA 2CKDA 5B58C 1WMAA 1RRMA 1OSNA 1RAEA 2NZYA 1FX0A 1G0OA 3NT2A 2VT7A 4PLVA 2ON6A 4KLCA 1Z35A 3D5TA 4MUGA 5EYPA 3WLJA 1JSLA 1P61B 3WWPA 5LQAA 2AYYA 1E5LA 2H92A 2DGDA 3IXQA 3ER9A 4JJ4A 3RH0A 1YMQA 2FW1A 2YJ3A 3PQ5A 5DSTA 4JLNA 5DIFA 5MDHA 5BRAA 4P54A 5EMKA 3WDKA 2ZUEA 1H9AA 2PZKA 2QAGA 3G9QA 3HACA 1D6JA 4MB2A 3NTQA 3COPA 3UAVA 3IQZA 1HE2A 1SZDA 2EW8A 2G5TA 2XDYA 3C6QA 4TXJA 3TR6A 4AULA 2DVMA 4EPXA 1YOBA 4FSHA 4ZOBA 3UMFA 1RKXA 3F3YA 3GA5A 3GVPA 4HQNA 2MR5A 4O63O 2WV9A 2ZBEA 3I9NA 1WAMA 5EINA 3U26A 5BSHA 3E8XA 3MWEB 3P7MA 1TDJA 3QW2A 2C4KA 2J9FA 5C52B 1EUQA 3MWGA 3E1GA 1EFAA 2LE0A 3ECCA 1U6JA 3PT9A 4JQZA 3WISA 4G01B 2CCKA 3BWBA 2BFOA 2ID9A 1L8QA 4QA9A 3HJAA 4OI4A 3GT7A 2RKOA 3C39A 4L5CA 1A8SA 1SKYE 2IV2X 4RHTA 3AEYA 5ALDA 3EYAA 3I05A 4IOLA 5BPHA 3ANTA 2C97A 2QX7A 3GLQA 3QNUA 3V8VA 1ZJWA 2X1HA 4NABA 3NXSA 4Y7DA 3ZGYA 2XDQB 3KOOA 4JBHA 1L7AA 5H81A 5DH9A 3DOUA 4HDAA 4OVKA 3QEMA 3TR0A 2OCPA 1K98A 4LJLA 1SVKA 3CNNA 3PXDA 2VNHA 4IS3A 4TWZA 1DAGA 4B74A 1T0BA 4J76A 4LHXA 1WW2A 4HBGA 1J1IA 1P1JA 1GQ2A 4MMZB 4GU5A 4ZK2A 4A0HA 1WV0A 3VR6D 4CMAA 5DN6D 1ZDMA 4LUCA 1OT3A 2AFHE 3AVXA 1BFDA 4GM1A 2XXAA 3B6MA 3UANA 3HV0A 1L1QA 2OBFA 1P2SA 2VJBA 3JQAD 4ZVVA 3GDOA 4RM3A 3O74A 5AYVA 5JAHA 3RYCB 3BPSA 4RL6A 4JMPA 1X2BA 1MD9A 3ZLJA 1F5SA 2QTBA 1NE2A 1PSZA 2WE7A 2FWIA 2C42A 2OAP1 3QLVA 1JBEA 1SUCA 4UCXA 1GNSA 2GN4A 4MRRA 1JDZA 1JPVA 2Z58A 2WIFA 1GCIA 1KXZA 1KF0A 3DCYA 3L7KA 3P45A 4BNZA 1IBCA 2A0YA 2CHUA 3DA8A 3I23A 2SKDA 3H13A 4QBGB 1SUDA 4DUGD 2I78A 1USIA 3CB2A 1CJBA 2PS0A 3UAWA 5JECA 3OJCA 4Z0NA 2JAOA 1D04A 4CXMA 4EKYA 4DA8A 1XWIA 4AKGA 1P2DA 2FCAA 1EFCA 4ZRDA 1YUMA 4OCZA 1XXHA 2XT9A 2PSFA 4XKJA 4QPNA 4DNQA 2ILVA 4EO7A 5JYCA 2J48A 3A3NA 1Y63A 2J6HA 3L8YA 1VPDA 2BGLA 1LC3A 4CM9A 1TM3E 2ZTLA 4B4UA 1T8SA 3GZJA 2GASA 1U7WA 2QTCA 4XWGA 4MJLA 3DLAA 1ML3A 1QVZA 4RHYA 4HNAB 1VI5A 2Q4TA 3PC6A 13PKA 2CCGA 4QUEA 4RF4A 4FEAA 3DAYA 5AK4A 1QHNA 4O1MA 5HE9A 5EERA 2C2ZA 1CRLA 4WZBE 4KAFA 5ICMA 2YN4A 4GNKA 1U0NA 1PHPA 3BK7A 4X6UA 1GFSA 5H70A 2EYQA 4X62B 1XLTA 1ZJYA 4MJ7A 1MEEA 4RHXA 1W87A 3OI7A 1Z17A 4U02A 2HL6A 4H4DA 4MCJA 3IC5A 2ZBQA 4TM8A 1RC1A 3KWFA 4NMXB 4EHLA 3COSA 1JZSA 2VDMB 4CETA 3BH7A 1OWLA 4N4AA 3SKYA 4DMRA 1T3GA 4R71A 3OX3A 4M37A 5JDIC 4TWAA 2GD2A 5IYZA 3DT9A 1KH3A 2OBXA 3I4FA 1QQAA 2KJQA 4EMUA 4A6EA 1F8FA 1QG4A 1Y3DE 3B51X 3F97A 3RG8A 2XF2A 4MRMB 4EZIA 4J3JA 2DTDA 1YJ5A 1CNMA 1KEUA 2EKLA 3JD3A 1K8QA 1V2HE 1YCDA 1A2QA 4QELA 1W34A 1HDOA 1OXTA 2QN9A 3RC1A 4RD1A 2Z1MA 1A3CA 2OO5C 3L0BA 4TTTS 4V02A 4DV0B 3HVKA 3KSDO 3DTNA 1HNZB 3WRWA 3BDVA 5DCUA 5FFMA 3VZPA 4C14A 4NVRA 1APBA 5DI3B 4L50A 2PGIA 3IR5A 4F93B 1AUOA 5CP8A 3TQFA 1UBCA 2FU5C 4HSGA 1HGXA 1NASA 3AESB 5FL7A 4DSZA 4Z3DA 4B87A 3LYUA 4HX5A 1T36B 3AVPA 2HDWA 4NU6A 3KXIA 4GZ3A 1X1SA 3H1FA 3JQBA 5D3MB 4DMGA 5JH7F 2QJWA 1PJ3A 4D6YA 1KI1A 4E1VA 3JASB 3G2KA 2B83A 2P6UA 2QE6A 1XTBA 1OE0A 4Q9DA 4RCVA 1L7NA 4RQTA 1Y37A 1DC3A 2R2GA 3L8EA 1G6KA 2AA3A 1QG2A 2Y76A 3IPYA 4JA2A 1ZO8A 1KSFX 2C59A 3C6XA 1RTTA 4MV3A 3A32A 1DG9A 4JU9A 3ZV3A 2YWCA 1UBJS 4JIGA 2INGX 2OHIA 4Q82A 4CL8A 2NO5A 3A9RA 4L4XA 4BAGA 2IZ0A 4P31A 1ZJ6A 2YINC 4IHKA 5EIBC 5EP3A 3KCQA 1U8YA 4BYGA 4A1OA 1ZD3A 3G0BA 5DM70 1FL9A 1EDDA 1ACMA 1DIHA 2QLLA 3A0RB 4PYQA 5AQEA 1RIIA 1RXCA 1CUWA 1E6LA 1V3QE 1B7GO 3ETDA 3L0IB 1HG1A 2V03A 2IYEA 4BGEA 1FRQA 1MTOA 4EABA 4AS2A 1N9ZA 4ZVOA 1O9HA 1UUFA 1X80B 3O2JA 4L9SA 1QVAA 3SD7A 1XEWX 2ENWA 3GEIA 4CV3A 4IVNA 4XFKA 1UDAA 1XZBA 1V9CA 5E6UB 2AKAB 3PPVA 3TZQA 2LD4A 1Y82A 2XUDA 3FZQA 4YRMA 2PUDA 5L95A 1P1KA 2ZPTX 2XJ9A 2WWHA 2PGOA 3K9QO 2OESA 5TXGA 3EVBA 3UMVA 4YFYA 4HQ0A 1INLA 3R7WB 5KYYA 3OFSA 4DY4A 5HILA 5ALSA 1EA7A 1TM2A 2DJIA 3JAKA 821PA 4WZ6A 1X0XA 5KYUB 1XNJA 1Y9AA 2CLEB 2YZ7A 4MR8B 2J09A 3E3MA 4XX1A 2AD5A 1P1FA 4TMZA 5EG5A 1K8ZB 1MIHA 1VRWA 2QJFA 4IV5A 4LDNA 2HIAA 2REQA 1Y9ZA 4N0PA 1LBSA 1TYAE 2JNWA 4M8KA 5DEIA 1TEHA 1QVRA 3JQPA 1PEYA 4G6ZA 4U63A 3UWMA 4JUIA 4JFRA 4LJYA 3AW9A 4L28A 5CA0A 5ITSA 4OHMA 3FFWA 4TWRA 3KKQA 4W9MC 3VBEA 3FVWA 4E32A 5LJIA 2NTJA 2JIMA 4KDEA 1P2GA 3VPCA 4GMHA 4XJSA 2QVZX 2H4JA 3V4PB 1E1YA 5F77A 3TQIA 2VP0A 2OK7A 4B8YA 2X5XA 5BORA 5FTKA 2GWRA 3AF2A 5A3VA 1M33A 1ZU4A 4WFQA 1CS0A 3WGLA 4JI3B 4N39A 3RS3A 1N1GA 3DBLB 3SICE 2CB0A 1Z4NA 3QU2A 1JBQA 3TJRA 3ZY4A 4OGFA 2P4EA 1F8UA 4RJTA 4RFVA 4LZLA 1NXPA 2WZBA 3ZGVA 1ORTA 1YOVB 3S6JA 2WKSA 1PLLA 5M34A 2F1KA 2W2KB 2PWZA 2ZB8A 3U81A 2CLOB 4C0WA 1Y4UA 1YL7A 2B35A 2ZRHA 4X1KB 4CM9D 1Z18A 4YAKA 3W5SA 5A3QA 1HMPA 3LH5A 1YRBA 2CVZA 1CJTC 3H4TA 2DHDA 1V41E 3H0KA 3ZWOA 5H4GA 1EJ6A 3A6HA 2C92A 1EP1B 1BMQA 4JVSB 1CUXA 2XOXA 4GECA 3SGLA 1SU6A 2CBXA 2CXSA 2AEJA 1HBJA 2ZI9A 1DFIA 3LCRA 4LA4A 4UCWA 1GU1A 3PHJA 5LWQA 1YFLA 2PRSA 4I99A 4YRTA 2W58A 2Z9DA 3GP5A 1W48A 2QRLA 5EWMA 1JI0A 1AN9A 2NXEA 2A5FA 3JYOA 3KJIA 4QVGA 4WLOA 3G5TA 5FBWB 5BWLA 4DCVA 2EJWA 2GCPA 4NMWA 3HH8A 4LXQA 1KY5A 4IUCS 4RHFA 2R96A 1YS7A 3JPYA 4HNSA 1L1RA 1T0PA 3GU3A 4NYMR 2ZSAA 1FQOA 1ICEA 4URWR 4WK0B 3G02A 2HLNA 5L3VA 2ERYA 4DSTA 2JVKA 1GZ6A 3I1YA 4M53A 2PUHA 1DL5A 4PX5A 3PJGA 3FPSA 2XKJE 2EVWX 1OFTA 4WAUA 1QMPA 2A9OA 5AMXA 2A1TR 1JMVA 3CSDA 4GXTA 4XA8A 1XD2B 1FFEA 4LGVA 3BVPA 4Q66C 3PD0A 1JQDA 1L4EA 5E6RA 4D9JA 1ULSA 1XZPA 1WULS 1LSOA 3A6DA 3NX4A 2HU2A 1RADA 2QU7A 3FZEA 3HXKA 4DCJA 2JGFA 1FDTA 5A5VA 1LJUA 4N7MA 3IAAA 1FFYA 4TWIA 5ICFA 1NVUQ 2WWGA 2AZDA 4RDCA 4ZQIA 1MTZA 3DZKA 4JBLA 2ZUVA 1G2OA 4IW3B 4LK3A 4U3JB 5AVOA 3S28A 1CF9A 3E5MA 1WDTA 4G4IA 4PC3A 1ZK1A 4HGPA 3DVAA 3GHHA 1PJ8A 3VQTA 1G20E 3A1UA 3NOVA 4C6SA 2G82A 2PMCA 1I7SB 3V4RA 1XMQB 5HF5A 1D2RA 4U3JA 1VXRA 2PX2A 3G2MA 3F3MA 4FYWA 5BQPA 3T3DA 2ZIXB 3FIJA 4ARSA 1ZFNA 4HO1X 1R0LA 5A05A 4D6PA 4MV9A 5HDQA 3UJ8A 4BMVA 4KK4A 3LUGA 2PH3A 1RCTE 2IHKA 3OZVA 4TT3D 3B2QA 2M1ZA 4QYTA 5FBRB 3II6X 4F96A 2CFRA 3CE6A 2RGUA 3SC2A 1HRKA 4CR8A 3ZVKA 1AU9A 1OFIA 2YS7A 4O4HA 2IV7A 2X1VA 2WJ3A