4CM4B

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQKSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE 1
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 90
structure length 251
sequence length 267
chains with identical sequence C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cm4B00
2EGHA 1E6WA 1PJ2A 1KY5A 1U7TA 4GI2A 3Q9NA 4E30A 2X9GA 1ORRA 3CINA 2PKQP 5EJ2A 4EGFA 5JAMA 4WE3A 2EERA 4DLLA 4DRYA 1J4AA 5JDCA 3LLVA 1X7HA 4J49A 1Y9AA 1U5CA 1V9LA 4N5LA 3DBLB 5BR7A 3JQBC 1DIAA 3JYQA 1EUZA 3P19A 3LT1A 4NFHA 4CJXA 4OH1A 3WGHA 3LQFA 3RUAA 2IE0A 3ZHXA 1CEQA 1LTHR 2V6BA 5G4LA 3VDRA 1DBVO 2P9EA 3GRPA 1NQAO 3LC7O 1H6BA 3IAHA 5B37A 4DMLA 4NBWA 4AJLA 4FFNA 4KTVE 3AI3A 2E37A 2V6MA 4BHTA 2W2KB 5THQA 3JQDA 4YCAA 1SEVA 1J6UA 1P33A 3PHJA 4UEKA 4YJGA 2BRUA 3OF2A 1F17A 1U2DA 5A04A 5IAAA 4XZ3A 4I5FA 1E0DA 3W8DA 1E7SA 1A5ZA 3P7MA 5JAQA 1S6YA 2BI8A 3ZWOA 4E12A 1DSSG 1KEWA 3VH2A 1SOWA 3I3OA 2B35A 2H9IA 3B6ZA 4N5NA 4A26A 2PZMA 3KO8A 4FCCA 1VPDA 4M8SA 1XR3A 4O59O 2H1SA 1CQJA 1DC6A 4RVDA 3DB2A 1O89A 2O48X 2O2SA 2DQ4A 2ZTLA 4A5OA 3ABIA 1T2AA 3E03A 3NAQA 3MEQA 4HFJA 1ZUD1 1NQTA 1AGNA 1JTVA 4M1QA 2YDXA 1A4UA 2B36A 4IQGA 3GUCA 3PJGA 2EXXA 4AJEA 4HY3A 2FWMX 3MCVA 4RORA 3OHSX 4B4OA 1R4NA 4ESOA 4PLTA 1E3LA 1KBZA 1YVEI 1HYEA 5F1PA 3WXBA 1I3LA 2JFFA 5C37A 3VPSA 4YVFA 2XXBA 5I7SA 2Y93A 1T4DA 3JQFC 2EW8A 4YAEA 4W99A 3HDYA 1YGYA 2VZ0A 3B1JA 1ZSNA 3HWRA 4IIVA 4XCVA 1UXGA 3BA1A 4OIMA 2Y66A 3S2GA 1MUUA 2P5YA 2X58A 2VHYA 4YBZA 5B12A 3T7EA 4BVAA 4CM5A 1DEHA 2EV9A 4MDHA 4LVUA 4MKRA 3OQ6A 3AY3A 4QEDA 1DAPA 1NVTA 5C7IO 4PLZA 5G0UA 3ZNNA 1IZ9A 3D3EA 2BHLA 1R12A 4PRLA 4CM7A 1ZXBA 5JMPA 5COQA 4ZD6A 3UAGA 4G5HA 5GZ6A 4K6FA 4R9RA 3JYPA 4C7JA 1B14A 3DZIA 1UDBA 1A4IA 1O95A 4MVJE 3HFGA 5EN4A 3VPHA 4CM1A 4ITUA 3AW9A 1B15A 3ETEA 1YE3A 2ZTVA 3AFMA 5C7LO 4MKZA 2NLOA 2NU9A 3GVPA 1ONOA 5EINA 4CV1A 5IZ4A 5DP2A 4QUKA 3D7LA 1Y6JA 1OFGA 3D3WB 1J0XO 5B4VA 3G0OA 4XJTA 3GN2A 7ADHA 1ARZA 5FFFA 3OSUA 3BMNA 3UN1A 3TN7A 5IDQA 5TLSA 3HADA 2D59A 3E9NA 2EWMA 4PZDA 3F5SA 4E5MA 4NQZA 4ZQGA 5KJFA 4H3VA 3X2FA 2YUTA 1UUFA 1ZKMA 1DC4A 1GUYA 4TZKA 1EQ2A 3G1UA 2X8LA 5A9TA 1E6UA 1TEHA 3E48A 1PS8A 1ZK1A 2OL4A 2OORA 2HMWA 2GRAA 4HFMA 4AG3A 1UP4A 3FNGA 3D4PA 1ZBQA 4II3A 2P2SA 3FF4A 4RO0A 5H81A 2A9FA 4BO3A 1C1XA 3ANNA 1GCUA 3EHEA 1XSEA 1JKIA 3K5PA 4KQXA 2IYPA 4OOEA 1WDLA 3TL3A 4RLHA 2NTJA 3PYLA 2YV2A 4R16A 5TGDA 5DULA 2IDZA 4EEZA 2AEFA 1I3NA 2ZB3A 2Q50A 3ZHYA 3JQ9C 4FQ8A 1LXCA 1PZGA 3NKLA 4R5MA 2JAPA 1EDOA 3I9LA 3V1YA 1VM6A 3O4RA 4AL4A 4DIOA 3OJ0A 1HSZA 3ZI0A 2GO1A 2P91A 3UW3A 6LDHA 1M75A 5T67A 3VAZA 4PLGA 4NBUA 3PVZA 2BMAA 3IC5A 2VZ8A 2GPTA 4O0LA 2EP5A 3K2EA 1IPFA 3E1KA 5C3MA 5IDXA 1D8AA 2EP7A 4U0JA 3PTZA 3ZDFA 3BAZA 3GNTA 4GSKA 1RM0A 1BVRA 3BMCA 4ND2A 1Y8RB 4YRDA 4XRGA 3DDNA 2NWQA 5EQFA 4L4SA 3BTUA 3MJ4A 1Q0HA 4IMRA 3WIEA 4D46A 2GERA 2DFDA 3UXYA 3CH6A 4WLFA 2X0NA 5T8KC 1FDVA 1UZLA 5HWSA 4YR9A 4OQYA 3WGGA 4J16A 1BG6A 2DUWA 2VRCD 3AWDA 2AXQA 4D41A 5L4SA 5JDIC 4BNNA 4B8ZA 1M67A 3RC7A 4YQYA 1DFIA 1DC5A 1QG6A 1Y5MA 4J7XA 3H5NA 1QR6A 1ENOA 3H2ZA 3P2YA 2WM3A 4WNIA 4HNGA 1UH5A 3HB5X 3ZU2A 4BO2A 2GCGA 3GFGA 3K2BA 3GNQA 1J49A 2HMVA 2RBEA 4YJFB 3RFTA 4RVSA 2VQ3A 3IJRA 4W7IA 4FIZA 2PV7A 5L95A 4D45A 4CMCA 5DCWA 2OXIA 2IEDA 1VLLA 3PP8A 4BO6A 3A28A 1VRWA 2AQKA 4EI2A 3DFUA 4MIOA 4K26A 1PJQA 1MG0A 4P38A 3JQ9A 4ZGWA 2VNAA 1CDOA 5AQ1A 4WKGA 1NP3A 2Y0EA 2I3GA 2HSDA 1Q7GA 1GADO 3ZWYA 2YW9A 1LRJA 1E5LA 4GH5A 2ZB7A 1H94A 2J3JA 4PVDA 4OOFA 4CLOA 2P9CA 4D42A 4KQWA 4H7PA 1P77A 1Q1NA 3QWAA 4RF2A 2EW2A 2GN6A 3K92A 2JFHA 3QW2A 2D8AA 4GBJA 1DIRA 1A7KA 2AG8A 4XQCA 5IXSA 3C8MA 2Q49A 3L4BC 4WUVA 3NT5A 1Y5RA 3RC2A 1WLYA 3LVFO 4S1VA 2DM6A 2VRCA 5K6AC 5JYDA 3S2EA 3QVWA 2FZEA 4K6CA 5ES3A 2F1KA 1IOLA 4BNYA 4UULA 4B7UA 1L1FA 3RQSA 3O38A 5FWNA 5ICSA 1GAEO 1I33A 4J6FA 3M1LA 4BNLA 3K8ZA 3AOEA 4RGBA 4BNZA 2VOEA 3VH4A 3AUUA 1QSGA 1D3AA 1GYQA 1CIVA 5IN4A 2GR9A 3F9IA 3I23A 1T25A 1B8PA 1QYDA 5FI5A 4BO9A 4N7RA 4EJMA 2QRLA 2O3QA 1DJNA 1R0KA 3C7CB 3DC2A 2CMDA 3INGA 1CYDA 5DBGA 1PZHA 1ID1A 3INTA 5TJ9A 2Y99A 1TA4A 1Q0QA 4MOWA 2FR0A 1I36A 3RUFA 5CG2A 5GZ3A 2X23A 4Z3DA 3AY7A 1ISJA 4YJHB 3WR5A 2HDHA 1A7AA 1Q7BA 4MVJF 5CPBA 3G79A 1DIBA 1KEUA 2C7VA 3DHYA 3S1LA 4P4GA 1DIGA 1F14A 4BNHA 2PGJA 3KSDO 3RUEA 3K31A 1IL0A 1ADBA 2QYSA 5L51A 3BIOA 3RIHA 3HDHA 4HADA 4CV2A 3GOHA 3EY4A 3PHLA 4J1NA 1K6XA 1Z73A 3JYOA 3UFXA 1GV0A 3GQVA 1QMGA 4XJSA 5I9LA 3DEYX 5L9AA 3NDRA 3B1FA 1NVGA 1TT5A 2R00A 4PLPA 1V3VA 4AJOA 3RBVA 1MFPA 5JS6A 4MP3A 2HJRA 3CMCO 1IULA 4P22A 1SO8A 2X9NA 3KLPX 3PLNA 3ETGA 3JQGB 5EL0A 1PQWA 4DIBA 4OQZA 4DMMA 5F1KA 1VJ0A 1P0FA 2WWRA 1HLPA 4QX6A 5A5EA 5A3VA 3TWOA 5ILOA 1GDHA 2GSDA 3JQCA 2NQTA 3D0OA 4RLSA 5KVVA 5T6BA 5GMOA 4BNGA 3VHRA 5B1YA 4II2A 1FF9A 1YL7A 4C7KA 3NX4A 1VKOA 1H2HA 1GTMA 1QYVA 4OXNA 2FPGA 1U4OA 2C2XA 2YQ5A 3GPIA 4ZHSA 5AXDA 5A06A 2NUAA 3GRKA 1DJQA 1FXSA 2DTEA 3AU8A 4ND5A 1DHRA 4LSWA 2O23A 4BMNA 5IJZA 4WEQA 2C2YA 1QV7A 2JAHA 4IS3A 3RVDA 4NIMA 4ZRNA 1LDBA 1JA9A 4W9NC 2QRKA 2HCTA 2QHXA 4AJ2A 3QVTA 3UKOA 2Z1MA 1X1TA 1M6HA 4EYEA 1KY4A 1GYPA 2AE2A 2C7GA 1NPTO 1SMKA 3FBTA 4KUGA 2C20A 3H5RA 1I5RA 2IRWA 2NSDA 1P74A 2O3SA 4CM8A 1PJSA 4FPXA 3ZHBA 5KIAA 4ALNA 4GSLA 1C14A 4BV8A 2O7SA 3PRJA 4K1LA 3INRA 1MG5A 2GF2A 1E77A 1T1RA 2GYYA 3GGOA 2PZJA 3PGXA 4BNUA 3BXXA 3TNLA 4CM9D 8ADHA 4TRMA 1XLTA 3DBHA 1CWUA 4KUEA 4ZQFA 1PQUA 1O9BA 1KERA 5ENDA 1X7GA 3FCOA 5JBIA 3PHHA 1PJ3A 4JP2A 2FN7A 5LC1A 1GY8A 2P4HX 3V1TC 2AQIA 2GASA 3ASVA 1EBUA 2PK3A 4CR7A 3R6DA 1DO8A 1HDCA 5AYVA 4U7WA 3MWDB 2J8ZA 1UDAA 1Z6ZA 4J1SA 3DMTA 2I66A 1YO6A 3NT2A 5DOVA 3U0BA 3H3JA 1HRDA 3TFOA 1P1JA 1IHXA 3E18A 1MXHA 3DO5A 4UREA 4YRAA 4NJMB 4CMAA 4B3IA 5MDHA 2OZPA 4HNHA 2G76A 1T2CA 1N9GA 1R16A 5DF1A 1T2EA 4PG5A 4W9NA 1U3TA 1E3WB 5I8WA 4MVJI 4KDEA 2YFHA 4CL8A 1RYDA 4IDEA 3VC7A 2VHWA 4LCJA 1ISMA 1VL6A 1BDBA 4B3JA 1UP7A 3GEDA 2VT3A 5IF3A 2VHZA 3PIDA 4GVXA 2NACA 4GAEA 4MIYA 3FNHA 1HXHA 2OBYA 3ZWCA 4FGSA 4GKVA 4DVJA 4XYLA 3WGZA 3NGXA 4ALIA 4BGIA 3PWKA 2F00A 5TF4A 1NPDA 2VZ9A 1ZNQO 2X5KO 4WNCA 4I8XA 3X2EA 1YQGA 2Q4EA 1LSSA 3KYDB 4YAIA 2QG4A 5CP8A 2VYND 2OFPA 2H5LA 4A10A 1DLIA 4OYRA 1F8FA 3QRWA 1LA2A 3EYWA 3JQ8B 1LUAA 2EJWA 3GEGA 3CKYA 4O6VA 2NU6A 2BFPA 3IKVA 1PGQA 2HQ1A 2QQ5A 3GR6A 3OFSA 3VPXA 3VKUA 3OH8A 1H2BA 3GGGA 1D7OA 2RHRA 3JD4A 4LK3A 5IDYA 4Z9FA 5C5IA 1F0YA 3ZWXA 4Q9NA 4UVDA 1X15A 2HLPA 4D44A 4PLWA 4I9HA 4YQZA 4TRJA 4CUZA 1I30A 3WNVA 2WD7B 2OGUA 3EGOA 4L9RA 1I3KA 2VRBA 3V5NA 3H9UA 4J9VA 3NGLA 5U4QA 4RQUA 3GNSA 3WX0A 1O5IA 3WTCA 1O94A 1ZXLA 4IBOA 1I10A 1YS4A 1EDZA 4Q3CA 1SZJG 1PU2A 1U8FO 2UAGA 3ICCA 1T2FA 4U5QA 1EFLA 4J2HA 4DLAA 3KYCB 4I5EA 4JGBA 2X0IA 3GHHA 4J7UA 2FSVA 4O63O 1D4FA 3FD8A 3I6IA 3TRIA 1E7YA 1ONNA 3GHYA 1P9LA 2LDXA 1YB5A 2Q1UA 2TMDA 2ZJ0A 3DBVO 3KRTA 4ZQHA 5TS3A 2B5WA 1P1RA 4ZQBA 4CMIB 1Z45A 3CIFA 3L07A 1X1EA 3C85A 5JPIA 4BNWA 1UXJA 3CTMA 5TNXA 2NQ8A 2I76A 1HSOA 4TRNA 1E7WA 1I0ZA 4E21A 1YL6A 1WW8A 4INAA 2CDCA 4DPKA 4RZHA 1E1NA 4FFOA 2G5CA 1ULUA 2NTVA 4JK3A 4BNXA 1WZIA 2JFGA 3ITDA 5L7WA 1J5PA 1MXFA 4XRRA 1PS0A 5CDSA 1ZZEA 1Y8QB 3PQEA 4NDNE 4Q39A 1XWFA 2J5QA 5DN9A 5TIIA 2NNLD 4CL3A 3PJFA 2YHIB 4A0SA 3K9QO 4YYZA 3NJ4A 1MA0A 1WPQA 3JQAA 5L7YA 2J3HA 4PLCA 4MIEA 1UXKA 1E7MA 2ZYDA 3BTSA 3FWNA 4QECA 4Y9DA 3RD5A 4URFA 5I9MA 3U4CA 4IDDA 4F6CA 3IP3A 3WOHA 4D0RA 3B20A 3MJEA 3PPIA 1U9JA 3HFSA 4XWYA 2Q4BA 4MO2A 1XGKA 3GG2A 4DBZA 2DTXA 4E2XA 4BNKA 1AHIA 4IZHA 3RUIA 4P4NA 3H6KA 3NT4A 3B70A 1OAAA 2HRZA 4FB5A 4TKLA 3BTOA 4I5GA 1XA0A 2HU2A 1WVGA 2W90A 4OHUA 4Z9YA 3RUDA 3PFWO 4GLOA 3D3WA 4YAGA 3E5RA 3JQ7B 2VNSA 1PGPA 2C54A 2E49A 3EMKA 3FNEA 3LK7A 3LT4A 4I9UA 2QX7A 5GZ1A 1IB6A 1B2LA 1H6AA 1KYQA 1SEPA 2HO5A 2PY6A 3DBRB 1NM5A 4DA9A 1B16A 5IZCA 4EITA 1LLDA 4Z0TA 5EPOA 1YONA 3D4OA 2CF5A 5DT9A 5HRUA 3HG7A 1YOVB 5CAEA 3KETA 3L6DA 4J0FA 4LCEA 3N74A 1SB8A 4I1IA 4JBGA 4DGSA 5L53A 2J3KA 4Y8VA 4CM4B 3ANMA 4WLNA 2D1YA 3GMDA 4D3DA 2JKVA 3AU9A 3DZBA 4MVJM 1I2BA 4JP3A 3GFBA 4TQGA 3GDFA 4CV0A 2ZTUA 4OKIA 3RBZA 2OOSA 1KC1A 1UR5A 4BKOA 3S2IA 4H16A 2FRDA 4I5DA 4EUEA 1C3VA 1JQBA 1PJBA 1AXGA 3U3XA 5KCZA 4PVCA 4FN4A 1HYHA 4HWKA 4KP7A 3WBFA 2Q1TA 1GV1A 3SVTA 3A4VA 1TI7A 4QFDA 3JD0A 1G1AA 1HDYA 4BL5A 1BW9B 1LRLA 3R1IA 1E3JA 4FFPA 2EG9A 1G0OA 3AUAA 2BFAA 2O7QA 3HN7A 5DOZA 4FJ2A 4Z0HO 1HDZA 2XXJA 3BZUA 5G0VA 4O1MA 5DCYA 3ZHZA 4WCFB 1JU9A 4OMUA 1PL7A 2DLDA 5ADHA 2GZ2A 3AOGA 4L8VA 2WMDA 3UUWA 1TXGA 4NG5A 3GVXA 3GPDG 4R1UA 3ROPA 3PWSA 5FF9A 4AJPA 4CQLA 5G0WA 3L6EA 4CMBA 1GQ2A 3CUKA 1FDUA 3NDJA 4XD2A 3GVCA 3WGYA 4E13A 3U09A 1AE1A 3FSRA 1N8KA 1NNUA 5CFZA 5JC1A 4PRKA 2OUIA 5A9RA 4YXFA 2DFVA 3UICA 2YV3A 4UVHA 3OP4A 3QHAA 3SXPA 7MDHA 2EF1A 4Z0PA 3ZH2A 2ET6A 1D1TA 5I7VA 3QA9A 3E9MA 4NBVA 3UCXA 3GC6A 3BMQA 3M6IA 3WBBA 3T4XA 2Y1FA 1N2SA 4WOJA 3PJDA 2Y0CA 3KOUA 1I32A 3DZJA 4XEHA 2ZB4A 1X13A 2O4UX 4CLDA 9LDBA 1LU9A 1HKUA 4M86A 2OMEA 2WJPA 3L9WA 2IYOA 3LC2O 4YJFA 4NFSA 5DNAA 3PI7A 3GMSA 3NJ8A 3RASA 1ZIDA 4JJIA 3DOJA 4QSMA 3SLKA 3WSWA 3ZU4A 1EUDA 4UEOA 5F3RA 3EDMA 4PLVA 3TZKA 1N7HA 3F47A 1G0NA 3OA2A 2NVUB 3WNQA 1V35A 3D64A 2C59A 1SCUA 1E6EA 3RJ5A 3RU9A 1Y1PA 4N54A 2JL1A 4BNTA 2NU8A 3T7CA 4UEJA 2YHUA 3CEAA 3WGIA 1XIVA 1YB1A 3V8BA 3NEPX 1EBFA 4MVJG 1BGVA 4QQRA 4M55A 3UH1A 3SJUA 3VTZA 2OHXA 2YDYA 1NQ5A 4XIYA 1D1SA 5JO9A 3SJ7A 4IQ8A 4HP8A 5KKAA 2GN9A 3DAFA 1JVBA 5L3ZA 1VSUA 3ZW8A 2BGMA 1KETA 1OI7A 1YL5A 4R41A 5CDYA 1WZEA 1DB3A 2Q3EA 2AQ8A 4GGOA 3IOYA 2VTEA 1Q0LA 2RHCA 4IIUA 4L74A 5T64A 1MP0A 2IXBA 4FS3A 4Y98A 5A05A 4D3FA 3PDUA 4JN6B 3H3FA 3GK3A 1T26A 2BFMA 3WQSB 4OXKA 3VDQA 1W6UA 4OAQA 3BHMA 3HB4X 2JHFA 1U3UA 1P31A 2AEMA 5COBA 4BKQA 4R1NA 1QYWA 1R4NB 2QRJA 3HJAA 1DRUA 3IJPA 4ZICA 2YY7A 1YH3A 5B4TA 1ADGA 4E3ZA 1HYGA 4EUHA 5FYDA 4B4WA 3VPFA 1P45A 2WYVA 2ZCUA 3AM5A 1H93A 3ZWMA 3PXXA 3ZV3A 4BMVA 1U28A 2A4KA 4ZN6A 5F1OA 4F6LA 5L4NA 1LEHA 1Z82A 5L4LA 2JCYA 2NV6A 3IUPA 2G0TA 4E2YA 1BSVA 1CETA 1LC0A 3OEWA 1PL6A 1UDCA 2NADA 4IJUA 5AOVA 3LDHA 1EK6A 1GEEA 2XPCA 2CD9A 1BXGB 3AOEC 4UVIA 4PCVA 1ML3A 1QYXA 4HBGA 1GR0A 1S7CA 2DTDA 1ULSA 4L0QA 1VKNA 1WMAA 3TF5A 3DHEA 3KEQA 4IDGA 3S8MA 4OSOA 4K9DA 5IXYA 4IJKA 1JKJA 3EAGA 1U1IA 1R6DA 2PGDA 4NJOA 2BI7A 5JXWA 5L45A 2R6JA 3QWIA 2EGGA 3QVXA 3H7AA 1C1DA 1EVYA 1HETA 2IZ1A 3C1AA 4E4YA 3ZV4A 2BF7A 2ZB8A 2ILTA 3CXRA 4GL4A 3F1KA 3F3SA 4AJ4A 1PZFA 3DZGA 3L77A 3GEMA 3BTVA 4MP6A 2JD2A 5EMHA 3OICA 4Q3NA 3P5SA 4J1TA 4GGPA 5DZSA 4E2ZA 4GMGA 2BFOA 4FDAA 1O0SA 5U1PA 1ISIA 3ADOA 3HHPA 5CEFA 2CDBA 4WK6A 2PLAA 3EZYA 1IZ0A 1OOEA 4IUYA 2V6FA 1I24A 2RH4A 4CQMA 3FRJA 5J23A 2PZLA 5TSDA 3VH3A 4ALLA 1T1SA 1A9YA 1CF2O 4PLYA 1NWCA 1PJLA 4YAJA 3KUXA 2R00C 3QJ5A 2XAAA 3I52A 4J91A 4BNMA 3WJ7A 3WTBA 4RPJA 4IJVA 3OQBA 1XCBA 4FC6A 3QSGA 2OBNA 4H15A 2HJSA 4R3WA 1NAIA 2YV1A 4XQGA 2X0JA 3WLEA 3D5TA 3WYCA 1M2WA 1C1XB 4OXYA 4OKNA 1NFRA 2Y68A 5JE8A 4HV4A 4XB2A 3OJOA 3TL2A 2EKLA 1TB4A 1RJWA 1H9AA 1HZZA 2B4QA 2CY0A 1JW9B 3MJSA 2G1UA 2W98A 3E9QA 3KB6A 4HFRA 3FN4A 1E3EA 3DTTA 1IY8A 1KVUA 4NFYA 5TRTA 2HK8A 4E5PA 5JFOA 2V6GA 4R51A 3SX2A 4G81A 2PA3A 1KIFA 2GLXA 3LSYA 4ALJA 1SB9A 1DRVA 1XDWA 3EVNA 5BNIA 4W82A 4DQVA 3O8QB 3PQFA 4HXYA 3IDSA 5IN5A 3ZWBA 5T57A 3GZNB 1LDEA 2AW5A 3GVIA 1H9BA 2X5OA 4OM8A 3Q9UA 5JAZA 3ORFA 2FR8A 3I1JA 1FMCA 4P8RA 3OQ1A 3S2FA 1JVSA 1TVEA 2Y1OA 4J4BA 5TC4A 1CERA 2D5CA 2G82A 2C0CA 4JNKA 2C07A 2HK9A 3BMCB 5JMWA 3Q2IA 4R1TA 2ZK7A 3MJCA 3C1TA 5CDTA 1DOHA 2CF6A 1R4MB 1WNTA 3ETDA 1T24A 4D0SA 1QYCA 4M54A 1JWAB 1LDNA 4LW8A 4MVJP 2WD8A 5G4KB 2VWPA 3KXDA 3WWYA 1YQDA 1BRMA 4LSMA 4Q3AA 4DWVA 5JO0A 4DXHA 1W4ZA 2Z1NA 4CMJA 1IPEA 1WXDA 2DPHA 2VWHA 3K96A 1XU7A 2UVDA 3IIEA 3ZN2A 4ZJUA 1YXMA 2VUTA 3WQQA 3HNPA 1V3TA 2X6TA 5JYEA 1PZEA 2JHGA 2ZCVA 3K73O 3AY6A 2QIOA 4NJMA 1HE2A 3F6YA 1ZEJA 4KZPA 4XDYA 4YB8A 3AI1A 3R3SA 1E7RA 4M49A 4GMFA 3SBOA 5KVCA 1C0KA 3JYNA 1A72A 2C5AA 4QXMA 3NTQA 3GG9A 3VZSA 1PS9A 4ND4A 4Q3BA 1M66A 3D4NA 1Q2XA 3DMTC 1BHSA 1NX6A 4BGEA 4CM3A 2DC1A 4XYBA 1YRLA 2DAPA 1EE2A 2FSSA 3CPSA 3JQEA 3KV3O 4RPKA 1IUKA 1U4SA 2WEKA 5CDGA 4AJJA 4CMEA 2GZ1A 4NMHA 4L76A 3E8XA 4CLOB 3U49A 3DAGA 3PZBA 1U8XX 3LLSA 4IY1A 1ZJYA 3BMOA 3CMMA 3KM0A 4J43A 4CV3A 4LISA 4CLRA 1YKFA 2Y1DA 1QORA 1WDMA 2CZCA 1F8GA 2ZQYA 2Q1WA 4QO7A 2QZ9A 1SC6A 2FPIA 5DBIA 5K0ZA 3RSHA 4XGKA 1JLLA 2EIHA 3ENNA 3GAZA 4XR9A 4ILKA 3WGOA 3JQ8A 5KJCA 3O26A 1CQIA 4PG6A 4D3SA 1VC2A 1H6DA 3I9KA 3DL2A 1Z74A 1H6CA 4XYGA 5HTOA 2PZKA 2EKQA 5BSEA 4ND1A 1B8UA 5TT0A 2EKPA 3E82A 4PLFA 4CR6A 2PKQO 2D2IA 1NQOA 1TLTA 3IKTA 3W1VA 1VL8A 2VN8A 2UDPA 1NASA 3TFQA 1AXEA 1E1KA 4RVFA 4WEOA 1KVQA 5CHEA 1HDRA 4IZIA 3B1KA 4MVJA 4EEXA 1SOVA 4R54A 4ND3A 3ZNQA 5AXCA 1LDGA 4Y67A 4WGGA 3HDQA 3GF4A 5HM8A 1C0IA 5AXBA 2JD0A 4MKXA 3JD1A 1U2GA 4A03A 2I3AA 2DVMA 4LRSB 4OJNA 1HDGO 2BELA 4A73A 3I5MA 3KYCA 3Q2KA 4KDFA 5F21A 4PZEA 2AE1A 4WCDA 1O6ZA 1L7EA 3JD3A 3W4IA 3OJEA 1AUPA 2DT5A 1CRWG 4DBVO 1NFFA 3PGJA 4RVUA 1A27A 2HMTA 3DOOA 4BKPA 4MPDA 4NI5A 1JDJA 4FFMA 5BT9A 5EQDA 5BSHA 5I7FA 3D1LA 4JBHA 3I9JA 3JCZA 4M87A 1EFKA 3WGTA 1XKQA 1FJHA 2DBVO 1HDXA 1IHYA 3HDJA 1LRKA 2GN4A 4IDCA 1BWSA 4Z9XA 1T2DA 4ZU3A 1MC5A 4WASA 8LDHA 1BVUA 2D5AA 2I6TA 2ZYAA 4J7CA 3DFZA 4U0KA 1P1FA 1RM5A 4IDAA 4YT8A 4A2CA 4UUPA 2W2LA 3VZPA 3KSZO 3U4IA 4B4UA 4FJ0A 4B7XA 2IZ0A 2ZYGA 2DPGA 4FD3A 5IDWA 3DBLA 3GDOA 3AUTA 3Q0EA 3U4HA 2YJZA 5BSFA 4MJLA 2J6IA 4GKBA 3ST7A 2RAFA 3C7AA 3QIVA 3DHNA 3COSA 3WGQA 3H9EO 4CR8A 3Q11A 3V1UA 3TJRA 3RU7A 2E6UX 2V7PA 4M89A 4IDFA 5A5FA 4RF3A 4DREA 2TMGA 3KZVA 2DBZA 4GWGA 1BTOA 1K0UA 3F5QA 3BHIA 3OJFA 3FPCA 4GVLA 1F06A 2Q2QA 2W2KA 1U3WA 2X9VA 4NR0A 4RJTA 1GQYA 5KTKA 3ONDA 4IGEA 2PD4A 4DPMA 2W4QA 1HLDA 5HBRA 2PD6A 1R0LA 3JQ7A 3RKRA 1HE3A 4J1QA 3VVCA 1KVTA 3DBRA 4CM8B 3GLQA 1ADCA 3JQAD 4U8GA 4BB6A 4IXTA 3TZHA 4CODB 3OM9A 4MINA 4XB1A 1ZEMA 1EEHA 3E6AA 4JROA 2VYVA 3RC9A 3UCFA 4AFNA 1EE9A 4YT2A 4ALMA 5DCUA 2WDZA 3U5TA 1LDMA 1UJMA 3ZZNA 4ZVVA 3GVHA 2P9GA 2YQ4A 1SBYA 1MV8A 3OIFA 4KWHA 4DYVA 4CM4A 4JIGA 1A9ZA 3DBHB 1ISHA 1E5QA 1E92A 2PNFA 3KBOA 5EIOA 4NZ9A 4X54A 4FJ1A 4WOKA 4CLHA 1PQPA 4G2NA 3MOIA 1N1GA 3CZMA 1R15A 4IJWA 1DAOA 3W4JA 4JJGA 5IZCC 4BO8A 4DIFA 3O03A 1LSOA 1QRRA 1YBMA 4R5HA 3ZW9A 5B4UA 4BO0A 1ISFA 3JD2A 4CLXA 3WS7A 3NTOA 5THKA 5IG2A 3WQRA 2FPPA 4WPGA 1NVMB 2Y1GA 2Q2WA 3PQDA 4GPD1 4IDBA 4L75A 4LVCA 1BW9A 4BGUA 1EVJA 3QV1A 1FDTA 4BO5A 4L4XA 3ICPA 3RI3A 3RWBA 5U9CA 5A9SB 1YQXA 2G17A 1P1HA 4R01A 5FEUA 4WCFA 3GAFA 3UGKA 1ZMTA 4J4TA 1AN9A 4FGWA 1HWYA 3F4LA 4YTEA 2UUOA 3VZQA 5JC8A 1PR9A 1ZFNA 2HMUA 4BNFA 3PHGA 1GEGA 3WYEA 2YYYA 2EHDA 3EUWA 5ILGA 2IODA 2JCVA 3DTYA 2B4RO 3AJRA 3TOXA 3AM4A 3LT2A 5HA5A 4KMSA 4D7AA 1PTJA 3LT0A 3A06A 2E4AA 3W6UA 4LMPA 2Q99A 5JNLA 1RYEA 2POQX 5KKCA 1YJ8A 3Q1LA 3WFIA 3ON5A 2I99A 1QP8A 1E1LA 3W4KA 3NDIA 3DZHA 2BGKA 4BIIA 2WYWA 2Y1EA 1ZJZA 1NBOA 4YRBA 3I9NA 1Z7EA 2Y1CA 5ENVA 3R0IA 3VPGA 1KEPA 4HX5A 1KOLA 3EW7A 1YWGO 2X22A 4XIJA 2GGSA 4EJ0A 2PTGA 5JCJA 3TOZA 2HMSA 1LBEA 1ZSVA 4AICA 3VH1A 4UVGA 1IE3A 1YDEA 4E6PA 2Q1SA 1VL0A 2LDBA 3IQDB 4YJDA 5ER6A 3PK0A 1OZAA 4F46A 5IFLA 2NVUA 1LNQA 4U6SA 4XGNA 1I8TA 1ENYA 3ENKA 1XHLA 5BQFA 2OO5A 3IMFA 2VWQA 1JN0A 4XA8A 4XQ9A 3DXFA 3F46A 1ZMOA 4LN1A 3ZV5A 3PYMA 4CMKA 1H5QA 3NTRA 1Z75A 3FPLA 4BMSA 1ENZA 4ZRMA 1I3MA 3LF2A 1RWBA 2VHVA 3EVTA 3QQPA 4DPLA 1K3TA 2XF8A 3VVBA 4ONEA 1WMBA 3ROKA 2A35A 4R3NA 2X86A 2SCUA 2VUUA 3DZFA 2I5PO 2BGLA 1NYTA 1PEDA 1I2CA 1DC3A 3JTMA 1K5HA 2Q46A 1W8DA 2CSUA 4PGFA 3ZWVA 4BUCA 3IL2A 4EBFA 1GZ4A 5KVQA 4RVGA 3OBBA 3V2UA 5DDIP 1M6WA 3GGPA 4BNVA 2OP1A 3LU1A 3TZ6A 1GD1O 3SLGA 4IS2A 4DUPA 2B69A 3JQBA 4PFJA 1YBAA 1ZSYA 2AMFA 1KEVA 1RPNA 5AXAA 4Z6KA 2J3IA 2W8ZA 3IS3A 3W8FA 4RQTA 3ZWWA 1NTOA 3JQ6A 4OL9A 4U6QA 3ZU5A 1Y8RA 3M1AA 2E48A 5KVSA 1YBVA 3TQHA 4FR5A 5JCXA 1UAGA 1NAHA 5EESA 1P0CA 2D3TA 2RIRA 4MVJH 2WTBA 2PKRA 1HDOA 2CDAA 3R3JA 3HZZA 1V0JA 2UV8A 4EJ6A 1JAYA 4ZQEA 1BXGA 3EZLA 1MGOA 1EQUA 3PWZA 2V65A 3FI9A 4GX5A 4PG8A 4AJHA 3JQAB 3T4EA 3U4DA 3GH3A 2X4GA 3QE3A 1M76A 3OIDA 1JKFA 1K89A 1X7DA 1LLCA 4W4TA 3WLFA 1P1IA 4R9SA 3RCBA 5JW6A 4AVYA 1PR3A 1GUZA 4P4LA 2JJYA 1MX3A 3AFNA 4DYDA 1QLJA 4NH4A 4RV9A 2A92A 1AHHA 3IUSA 3GA0A 4O5OA 1Z7BA 1NPYA 1GCOA 2GDZA 3N58A 2ZIZA 4YWJA 1HE5A 2ZKLA 1ZK4A 4YJGB 4E32A 2GNAA 4IGFA 1R37A 1EUCA 1G6KA 1K6IA 2CVZA 4FFLA 5COAA 4B8WA 5TT1A 1IYZA 1WWKA 3QWFA 1EVZA 5T5QA 5CDUA 4Y6SA 1BDMA 4OGWA 4YAKA 1Y7TA 1DPGA 3RROA 4JLWA 3DONA 4IQ0A 4IXWA 3TSCA 3PEFA 2HUNA 4EZBA 5A4DA 5L40A 1XQ1A 4UUNA 5A3JA 1BMDA 1OC4A 1Q7CA 1V6AA 1ENPA 4R4JA 2DBQA 2H63A 2B37A 4J4HA 3JQFA 4RF5A 3A9WA 3ZV6A 4FSHA 2DU8A 4CM6A 2DKNA 2VT2A 1A71A 3RC1A 4UUMA 2FP4A 1ZK0A 3G49A 4R1SA 3STHA 1ZK2A 2HAEA 4RDHA 5DP1A 4QO8A 4DLBA 3OA0A 2X0RA 4J0EA 1VJTA 4JQCA 1HEUA 4PZCA 2O4CA 2BH9A 3ZGYA 4B7CA 1UAYA 1UXIA 2B83A 1LLQA 2BLLA 2CNBA 4PN3A 4UUOA 1I01A 4E5KA 1PSDA 1T4BA 3JSAA 1UP6A 3ZNOA 5I9NA 4CQMD 4NNJA 1QV6A 1NFQA 3DOCA 3FR7A 2NVBA 3DWFA 3LC1O 1KC3A 3S55A 1ZW1A 3O8QA 2R2GA 3WB9A 5CG1A 3GZNA 2NU7A 3FHLA 1R0SA 1ZCJA 3GN1A 2B4TO 3ROMA 3PFFA 2VTDA 1O8CA 2FHSA 1V3UA 1DLJA 4MP8A 3KTDA 4YJHA 5G2OA 1ZK3A 3L4SO 4RZIA 1GZ6A 2O3UA 4FFRA 4RPGA 4CQLB 4KWIA 3V2HA 4E0BA 1LC3A 2C82A 2X5JO 2D0IA 4WLEA 3ZWAA 3QLJA 5KNLA 2AA3A 1Y9EA 4BNIA 1R4MA 1GL3A 2VHXA 4DC0A 2IEBA 4XYEA 4BQPA 4TMFA 1EVIA 1E3IA 1WDKA 3H9JA 3MZ0A 4KUHA 3M2TA 5G0TA 5BSGA 3L0DA 5G4KA 1DFGA 2QW8A 2Z5LA 5ITWA 3OIGA 1LDYA 3VTFA 3PLRA 2HRBA 5FI3A 5A1TA 3BMQB 4DL9A 4RPLA 4NBRA 3AK4A 1B0AA 2P4QA 4NBTA 3RAJA 4A7PA 3E5MA 4TVOA 1GPJA 3H2SA 1OC2A 3JQGA 4WLVA 1N7GA 3RFXA 1R66A 1LQUA 2BD0A 3RBXA 1P3DA 5KJ6A 1ADFA 1DXYA 4FBGA 1UXHA 4D43A 4UAGA 1BXKA 3W8EA 2JD1A 3MWEB 4YPOA 3BMNB 2QYTA 1QKIA 3UF0A 5KOIA 1DFHA 1RM4A 3DQPA 2O3TA 3JV7A 2FY8A 1YDWA 4BS9A 1PGOA 4DQUA 3HQ4O 3OECA 1HTBA 4IMPA 4TSKA 3H4VA 1C0LA 1XQ6A 2H6EA 1UZMA 5TX7A 1KVRA 4ID9A 4NK4A 3FTPA 4HFNA 4XX0A 2Z95A 3JYLA 3WMXA 5CEJA 4PG4A 1X0VA 3C24A 5CPFA 4BQRA 4ALKA 1PJCA 4AJIA 2ZJ1A 4XYMA 5MGBA 4TVBA 1PIWA 4AJ1A 5F5LA 1N5DA 3SC6A 4JBIA 1LX6A 2VWGA 2AHRA 2HK7A 1HZJA 4K28A 2PR2A 3OETA 2CVOA 5G0SA 4BOYA 3Q3CA 1B26A 2WSBA 1YB4A 3KLMX 2DBRA 3A1NA 5T8KA 1PWXA 3H9QA 4R69A 2NM0A 4Q3EA 4GLLA 2XOXA 3ONFA 1KVSA 3F4BA 2PH5A 1FK8A 4FOSA 4CMEC 1LLUA 5JDIA 4E31A 5ER9A 4DC1A 4J3FA 3PZRA 3O9ZA 5JY6A 1PJTA 5HS6A 3WG9A 4EUFA 1P44A 2PWZA 3PDJA 1W0CA 2CVQA 3MTJA 1GFSA 2WE7A 4I9NA 3ZU3A 3L6OO 4R68A 2YZ7A 3TDKA 1WAMA 2Q45A 3TZCA 2C5EA 1QLHA 4QFCA 3ZCXA 3FBGA 2AEJA 2I65A 3ULKA 2B5VA 3PJEA 4KTTE 1GU7A 3MTGA 2UUPA 3HUDA 3MJTA 1N92A 3KSUA 4G65A 4ZA2A 4JCOA 4N5MA 3G17A 2A94A 3WJAA 4YT5A 1XELA 4Y6PA 1MB4A 3LF1A 4GQAA 3NYWA 5EERA 1LSUA 3I4FA 3GY0A 4PLHA 3KYBA 3QY9A 3H65A 1N1EA 2P5UA 3K6JA 1GYRA 3CE6A 4RVHA 4W6ZA 3TPCA 1PJ4A 4WLOA 3UCEA 4RF4A 3F1LA 4S3MA 3WICA 1U7HA 1VE9A 4JJFA 4Z3KA 1NWHA 2ZATA 3PHIA 4BNJA 1FDSA 3A14A 4GX0A 5CEEA 1C1DB 5F5NA 4W7HA 3H9GA 3QWBA 5AVOA 1YJQA 1I2ZA 1E3WA 3FNFA 3G1TA 1ONPA 5KJ1A 3AM3A 4MVJD 3KVOA 3L4BA 5ICMA 1SAYA 2E82A 3RKUA 4YA6A 2YFQA 2ZTMA 5K6AA 5JY1A 1TT7A 3I6QA 3NUGA 1LQTA 1U5AA 4NHEA 3NV9A 4XKJA 4TRRA 4AJNA 1HT0A 1OBFO 4AJKA 1F12A 1RM3A 3GDGA 1B8VA 3FWZA 4BO1A 2QZZA 3ASUA 4JXKA 1VJ1A 5K9ZA 4CQMB 2Y67A 1EZ4A 2CUKA 3KEOA 3AI2A 2JCXA 1GPDG 3KYDA 4LGVA 3WWZA 4HKTA 3QP9A 2NTNA 2X1HA 4OO3A 5H83A 3I83A 4B4VA 4XR4A 3I4CA 3L9XA 4RL6A 4CMHA 2RH8A 3D5QA 3EC7A 3GZ4A 3ROQA 4E5YA 1C0PA 1X0XA 2FOIA 4FW8A 2FR1A 2PFGA 2Q2VA 2CFCA 2WE8A 3AUSA 1GZ3A 2UYYA 1K2WA 3WIDA 1NHGA 3P2OA 5BNFA 5JLAA 4F3YA 4BB5A 2Y0DA 3TZQA 1DRWA 1DDOA 4UVEA 2WD7A 4BGVA 2PGLA 3SC4A 2W2LD 4CUKA 4FC7A 1GQQA 3DZKA 4Q3DA 5LCXA 4CPDA 1XG5A 1KS9A 3CSDA 3C1OA 3U62A 1GUFA 3BHJA 1DIHA 3ANLA 4WJZA 1ZO8A 2I67A 3I9OA 4GX1A 4DQXA 2GZ3A 3ZWPA 2C29D 3H8VA 2O50A 4CMGA 1WP4A 3GT0A 3DMYA 1OMOA 4LMRA 5I8ZA 3WMWA 3CZRA 3HN2A 2Y05A 3RJ9A 1U3VA 5GY7A 4N18A 3N7UA 4BO7A 2AQHA 4B3HA 1B7GO 5JAIA 2IXAA 4CMIA 2B0JA 2GD1O 3QVOA 4B79A 1H0KA 4NU5A 1QXSA 3HE3A 3WSVA 5L7TA 2PH3A 4TROA 4EDFA 1TT5B 4BKRA 4OSPA 3FR8A 4TZTA 3ADPA 3M2PA 4PG7A 1VSVA 4YEDA 3ITKA 2VYVD 4HUJA 5A9SA 4XDZA 1EK5A 1LI4A 3VKVA 1JWBB 4NK5A 3QVSA 4TKMA 4E5NA 1HF3A 2EEZA 4TWRA 2FZWA 3V2GA 1Y8QA 3C3XA 2J5RA 2WYUA 5A02A 3Q6IA 2O3JA 2YHIA 9LDTA 3WFJA 3VOSA 4E33A 2AG5A 4Y6RA 4IINA 4PIVA 2VCYA 2NVWA 5KWEA 1L7DA 2RCYA 4JX8A 3HSKA 1B3RA 2FMUA 2BKAA 3C7DB 3MJVA 4CM9A 4CUJA 4IPTA 4WCFC 4A27A 4EW6A 5BNTA 6ADHA 4KOAA 5TQVA 2O3RA 3BMOB 4CLRB 5ITVA 1PX0A 4YACA 1RKXA 5LDGA 1K6JA 5TJHA 3OMLA 1B3BA 4NPCA 4XQEA 2O2YA 1JAXA 4BV9A 1MC4A 5JSFA 4RDIA 2D4AA 3MOGA 2X7HA 2GN8A 2OP0A 3W6ZA 1SPXA 2GUGA 5H82A 4I08A 1PL8A 3G3EA 5JDCC 4L4RA 4XGIA 1XU9A 1YOVA 3OEYA 3H5AA 4E2WA 1HE4A 1HL3A 4J9UE 4WLUA 4D79A 4F45A 4LRTB 4L73A 2VOJA 1NR7A 2I9PA 1MFZA 3DR3A 3I9MA 4IM7A 4QT0A 5DBFA 1XYGA 3DAPA 3UHAA 5HS4A 2EJVA 4J90A 5A03A 3OJLA 1X14A 1W73A 4BO4A 4GX2A 1CJCA 3LYLA 2J5KA 1PWZA 2DUUA 1DHTA 5KJEA 1ZVMA 3ONEA 4NU6A 3U9LA 1P1KA 1Y81A 3UVEA 2PD3A 4FOOA 3NRCA 3SEFA 5LDHA 3IP1A 2IZZA 1MLDA 2HKIA 4DTIA 4RPHA 1UZNA 3GUYA 3RFVA 1PGJA 5I7EA 1E3SA 5JCJD 4QTZA 3K30A 4YT4A 1SNYA 1E7QA 1PGNA 3KHUA 3VZRA 1EMDA 1V8BA 2ZQZA 4GWKA 1FDWA 3PYXA 3ZNPA 1NR1A 2VYNA 4YDRA 3BYZA 3RUCA 1NHWA 1NXQA 4C4OA 3LZ6A 1LJ8A 3RUHA 3ZWNA 4BKUA 1ZH8A 1BXZA 2P68A 4J2OA 1N9GB 4CLEA 3PIIA 5C7OO 1E1MA 3FTNA 3WYBA 3WDSA 4RCVA 1ISGA 3UOGA 1LSJA 1VI2A 4WECA 3QWHA 2VUSA 4ROSA 1XEAA 3EK2A
chains in the Genus database with same CATH superfamily
1XE3A 2RGUA 3D2CA 1WO8A 3PT9A 1Z63A 2XQFA 3LH5A 1JLSA 4ZK2A 2ATIA 3PC8C 5CRIA 1U7TA 4GI2A 3GD7A 3Q9NA 1XQXA 2Z83A 3GJZA 5KSYA 2X9GA 2AJTA 4G5XA 1QG2A 1DAKA 2B4AA 2OT3B 2PKQP 1TMYA 3AETA 4I1PA 4WE3A 4DRYA 3GUUA 3AESA 5KYVA 4ZVRA 3GT4A 4L50A 3X1MA 4C2BA 1ST2A 4HDCA 4XWKA 4EF5A 2GCOA 5FV4A 2CV2A 4FZ5A 1Y9AA 1U5CA 1KZ6A 1RFLA 5EUBA 1FP6A 4MUXA 5K0EA 1DIAA 1OBOA 5KU1A 3I5UA 3VSAA 3LT1A 1KYTA 4NFHA 4CJXA 4ZCMA 2PAAA 3OMXA 3C5HA 4LYFA 1SCJA 2C1ZA 1Y5LA 1D0VA 5I7UA 4U7TB 1I4LD 2YQZA 1J00A 2VKTA 3FYDA 1KRWA 2WR8A 4TLCA 1V11A 3LDFA 4QXPA 3WGHA 3PR2B 1QM5A 1CEQA 3LCRA 3FDFA 1LTHR 1FJXA 2D2EA 1BDIA 1SXJD 1BROA 4IHJF 3VDRA 5IPFA 1DBVO 5KNBA 4BRUA 1Y1TA 1KMCA 1TU0A 3KJHA 3RPEA 1W48A 4LZJA 3WISA 4DR6B 5B37A 4GD3Q 3KWLA 3LKBA 4QL3A 3QOYA 4AJLA 1VPVA 3IIJA 1Z25A 3UQYS 1EX7A 2V6MA 1RVV1 4Y2TA 2GJAA 4EI9A 3IEXA 1Z34A 3UC9A 1P33A 3MK31 5DSZA 1X38A 1U7DA 3ZE1B 4UEKA 3K9WA 3BA6A 4LXUA 4OATA 3T0IA 3NHPA 1MCZA 3KUCA 1F17A 4XWOA 2TRSB 2IITA 2VJQA 5IAAA 1Q1BA 2ENWA 1BGWA 1PD1A 1N6IA 2YIMA 2IUSA 1WMDA 3K0FB 3W8DA 5JAQA 3GGSA 2RB4A 4ZAFA 3BXPA 3B3AA 3GLTA 2RCNA 4BMDA 3I2FA 1MOPA 4P32A 5TPZD 1G8JA 3VH2A 2FE1A 2WU8A 3BORA 3SZ3A 2BYTA 3B6ZA 5IT5A 2FZ4A 1MA3A 2G70A 2PZMA 3IBYA 4EW3A 2DKOA 3KO8A 5AK0A 5IUJC 3K9LA 4K6OA 4P81A 1ZCBA 4D8VA 4GNKA 2E55A 1S4MA 1XR3A 4LWZA 4EW2A 1XZAA 3IESA 3WDKA 4C43A 3TCKA 1Y4ZA 2ZTLA 5GM1A 4A5OA 3ABIA 3IP5A 4F4HA 2ZR7A 3H2JA 4F8JA 5ICGA 2QBYA 2C5LA 2GCEA 1NQTA 3N8IA 3SBXA 3SXUA 1NN1A 1VIMA 2B36A 3KD2A 3GUCA 4YHHB 4HY3A 2F67A 2GM4A 2FZCA 4JU8A 4E11A 2GCPA 2FWMX 3ABSB 2OFOA 3EZGA 3OHSX 2JJ2D 4B4OA 2RAPA 1X3SA 4PLTA 4L95C 3TUZC 5F1PA 3CVUA 3AR4A 3WXBA 3REFA 5IDVA 3D1VA 4HAYA 2HFJA 2Q3MA 2Y93A 1YHYA 2Z2XA 1C0EA 3OC0A 1GG9A 2WZQA 3JQFC 4V03A 4YAEA 4W99A 5GOZA 3CCBA 3DW1X 3B1JA 4W8HA 4OLFA 5HOQA 1G98A 3DE6X 3TGLA 1EKXA 1VHQA 5DO9A 1X7WB 3LUFA 3S2GA 3A2LA 3MWJA 5TVKA 5C8DA 3LX5A 3QBJA 3NNDA 3A58B 1GRNA 1UM9B 3AB3A 4UE2A 2GJ4A 3AEKA 2A5DA 4UHFA 4YBZA 3ADDA 3AVTA 3OI7A 3SI7A 3GGJA 4HNQA 3ZY6A 4KITB 4MDHA 2AFIB 4MWCA 4LNAA 5EI5A 3N07A 4Y7DA 2QTTA 5SYMA 4C2UA 1C7FA 3FI0A 3CZ5A 2FFHA 3L7IA 4S1TA 3W0LB 4BFYA 4ENUA 1SBZA 5G0UA 3T1OA 4Q4LA 3MF4A 4PRLA 4CM7A 2G80A 1DVRA 1XEWY 1XZKA 2A86A 2P30A 1OI2A 4X8MA 1KI2A 5FAXA 4EGJA 4ESVA 4Z1MA 2JHCA 4WMLA 4ZZ1A 3WHLA 4YAUA 1QWOA 1XTBA 3ZZUA 4C7JA 2PUGA 1GN8A 4Y0AA 1B14A 2EL9A 5FBZA 1LX7A 1SVUA 2PUEA 5IBQA 4MVJE 2J41A 2PUHA 2R8EA 1WD7A 2Z3ZA 4CM1A 3OIYA 2DLCX 3AW9A 4TT8A 5FOSA 5BQOA 4RZQA 1V96A 1PDOA 1FYEA 2RI6A 1E2QA 2NLOA 1XK6A 2Z2YA 1HOTA 3O8NA 3OPQA 1SIOA 5IZ4A 5DP2A 4DVGA 2XTMA 2YWDA 4FKMA 4TLMB 3V8RA 4UPVA 5F98A 1J0EA 2VI5A 3RK1A 1QQBA 2ECPA 1X1CA 3OPYI 4AMYA 1XHEA 5AK4A 4E4RA 2YMMA 3G0OA 3GN2A 3NHAA 5HQJA 7ADHA 1UCFA 3HJCA 5FFFA 2GXQA 4RA6A 3OSUA 3L0ZA 4OFBA 3TN7A 2R3SA 1QCZA 2XTNA 1KHHA 2EWMA 4MGKR 1ZMBA 2P9BA 4H3VA 1UK6A 4ZAZA 1T4GA 4XUGB 3LIIA 4Z7JA 4C7MA 2NMVA 2NXCA 3UJAA 2RGRA 1E6UA 2HIHA 2PBLA 1SVNA 1PS8A 2OZVA 1F3LA 3KEMA 2OL4A 4MUAA 2OORA 4P3OA 2FFQA 2HMWA 3O8OB 5E9WA 3I04M 4AG3A 2WJVA 1VPEA 4LYEA 3IHKA 2DQYA 1ZBQA 1BU5A 1MABB 4CT5A 4RO0A 2GBFA 1C1XA 3ANNA 4URHA 1G3IA 5EXPA 3RAEC 1KO5A 3OPNA 1JKIA 1ND6A 1G21A 5T4FA 4PS0A 5H16A 5KTOA 5AKEA 5E3JA 1JXAA 3DS8A 3PYLA 1XPRA 2YV2A 1Q0PA 3OTHA 2VAPA 3HA7A 2H4XA 5DULA 3KUKA 4LK2A 1B6TA 1E4YA 1AB5A 1UPTA 3JQ9C 1OTHA 4FQ8A 1PZGA 2PZ8A 1NXTA 1TM2A 3FZYA 3TNDA 1J0CA 1EDOA 3I9LA 3O4RA 3QA3E 4LIPD 1QS0A 2O8CA 1GVHA 1RCUA 1P6QA 1GTJ1 1KY2A 2L82A 3UQZA 4DIOA 3MWKA 4CVNA 5HE8A 1DAHA 1M75A 5LIRA 1H2AS 5BXYA 2RGWA 2FSGA 2ANBA 1LS1A 1ZH4A 2B7LA 2D00A 2JRLA 2W6JD 2RI1A 4GM0A 4PLGA 3ADBA 4MUHA 3FTEA 2VZ8A 3OPYB 3LS2A 5JR3A 2G1PA 5KQPA 2QL7A 3E1KA 3M81A 3NTLA 1SXJB 1AK1A 3ME5A 4G5OA 3SFTA 1EESA 4C5BA 2GJSA 3LY9A 3PTZA 3AKYA 4PPGA 3TLAA 1L1EA 1OB5A 3DV0B 3FOWA 2BE7A 4TQAA 1U11A 3P9CA 3WLSA 5GINE 1YFLA 3PPYA 3OD5A 4MAFA 3TEJA 1Y8RB 2PRIA 1RAHA 3A1TA 5BW6B 1JL3A 3E7WA 3STXA 3DDNA 1GDDA 4KPUA 4LJ4A 4JP5A 4L4SA 2ONKA 3BTUA 4DMGA 3U3KA 1Q0HA 3ZLJA 4IMRA 1CIJA 4IICA 2DFDA 1UKCA 2W71A 2XUOA 4DDTA 1NQXA 4LZZA 3BDVA 1SBIA 4WLFA 4HQ6A 4ZKDA 4B9AA 3CRVA 4KXWA 3CCCA 3KB8A 1H85A 2NPOA 4B3GA 4J16A 2P2NA 4ARVA 1AGRA 4AQDA 4D41A 4V1CA 3PV0A 3HVJA 3OM0A 5LR6A 4BNNA 3HM9A 3ISTA 4C4XA 4G84A 1J8FA 4YQYA 4MWSA 4EG6A 1YKGA 3RIGA 3R5JA 1HG1A 1Y5MA 1X8JA 3H5NA 5CXXA 3BX1A 2CFSA 4PCAA 3P2YA 5FUQA 4UDYX 3CVOA 3F71A 3MCZA 1UH5A 2IHTA 4WTOA 3ZD8A 3GFGA 3ZU2A 1G16A 4NBNA 4TXLA 3P4UA 3K6RA 4B17A 2HMVA 2NZ2A 3EY9A 1AMNA 5BWCA 1XNRB 2RJ3A 2VQ3A 5J4HA 1MTZA 3JAKB 5CBPA 5JD5A 2YNMA 1VJGA 5L95A 2EFCB 4NJEA 4CMCA 5DCWA 1NMQA 3PP8A 4KR0A 3A28A 2AQKA 2CBXA 3ZGNA 3DFUA 3H87A 3DMGA 3B12A 3DOHA 5K8LA 3Q8MA 2VNIA 1AV7A 1MG0A 4IDOA 4KSYA 4P38A 5CH5A 3B3JA 1XTPA 1L5ZA 1NVWQ 2NO7A 1BD3A 3LA6A 4F06A 1R9MA 2C9DA 1A3CA 3DYVA 5AQ1A 4WKGA 3RVNA 1MT3A 3ZOZA 4BVFA 2ZE7A 4YH1A 2Y0EA 4D74A 1S2OA 1KBOA 2I3GA 3OFKA 1Q7GA 1GOTA 2YW9A 4W9RA 1PT6A 1C7IA 3IAXA 3HM2A 4PVDA 2FW9A 3VPDA 5KHLB 1VL1A 4CLOA 4ZIRB 4R8LA 1PQ4A 4KQWA 3ESAA 4U7GA 4B0OA 1L5HB 4H7PA 1P77A 4CCWA 5LOVA 3QWAA 2HXYA 1RZRA 1Z0AA 2EW2A 2WPDD 2D8AA 1RHJA 2AG8A 4IIGA 2ISSD 4XQCA 3C8MA 3K2QA 2VTBB 3ID6C 1Y5RA 1V8ZA 3R7DA 4EG5A 5FA5A 3LVFO 2ZJ6A 1XV5A 1M6YA 1U3FA 3QVWA 4K6CA 4ZI2A 3T3GA 3DL0A 4DWWA 3JATA 3H2BA 1SUCA 3CRQA 4V0QA 2WU3A 1GT91 1WCXA 3MT8A 4TS1A 2QI9F 1MJNA 4JVMA 1NRWA 2O0MA 1GAEO 2RHOA 2X5NA 2G9QA 2LWIA 3K8ZA 3CUWA 3T7DA 1N5RA 4U9HS 5E1DA 3VH4A 3ZJ4A 3AVQA 4R0MA 3AUUA 1KQNA 1QSGA 2ST1A 1CIVA 5TMDA 2EGUA 2GR9A 3I23A 5F3WB 4CDRA 4IZOA 3OLQA 4A4DA 3C6ZA 2Q3FA 5ECWA 4HWRA 2QRLA 5B3KA 3OZ7A 3QEAZ 1M7HA 4DR3B 3O0DA 3REGA 3DC2A 4FZJA 3J7TA 2CMDA 3OZCA 4J0QA 4KXQA 1CYDA 1OLXB 1R10A 4B35A 3INTA 3QEBZ 4WESB 5TJ9A 5ETJA 1Y3DE 4JGIA 1T34A 2H4FA 1QVWA 5KWIA 2PQ2A 5K2OA 4QUBA 6Q21A 3ZGLA 1AGYA 2X23A 2CXXA 1ISJA 1A8IA 3WR5A 2C9ZA 2DQZA 3RWOA 4WOBA 4IIBA 4RH1A 4HAWA 5C5DA 1OLUB 4BPBA 2AB0A 3AW8A 4P4GA 1NXSA 2G08A 2PGJA 4PF1A 2IWHA 5JISA 4IRXA 3RUEA 1LBSA 3SPXA 2BTEA 1IL0A 2ZW9A 2QYSA 4JJ4A 3BIOA 2YY6A 1VJCA 1C8KA 1JAIA 1OHHD 3QNMA 1W36D 2E85A 4QU8A 1W46A 3QEKA 4YPFA 2AEEA 1ZI8A 2KQUA 5AJVB 4PIMA 4WY8A 3N3BC 2GDJA 1P9NA 2RHMA 4RTPA 4XJSA 1QOZA 1ZX1A 3NIWA 3GIDA 1OI3A 3N2GB 4DQ0A 5CFNA 1RRGA 1TT5A 5FIUA 2ZZNA 1V3VA 5HF5A 1ORHA 2ZJ2A 2ZJAA 1B0PA 2F90A 2RD2A 5BOSB 1SUFA 2HJRA 2PMWB 3CMCO 1EU1A 2YYAA 3PLNA 1L8AA 2VTKA 4A6EA 5JQGF 4OUDB 1PQWA 4LYDA 4DTCA 1T36A 3MERA 3NASA 3LPCA 1G55A 4S35A 2Q6IA 4QD3A 1XWIA 4K9LA 5A5EA 5ILOA 3OTOB 3LKDA 3NHKA 3JQCA 2IUTA 5KVVA 5T6BA 4IJQA 5JJKA 1UWVA 1KJJA 5B1YA 2BMFA 2ZM5A 3W05A 2QZJA 4C4TA 3NX4A 2YN2A 1P4HA 4MV7A 1H2HA 4OXNA 1JFRA 3GJ8A 4C0SA 2Q5QA 1CLEA 3MHPA 1E2NA 5FOTA 3BQ9A 5C8XA 4AKIA 4AP5A 4KN6A 2YX1A 1RRMA 4ETWA 1AT1A 3A7DA 2O7RA 3NUQA 3CX7A 4KH0A 5HEKA 5A06A 3IKJA 3UBMA 3P9KA 3UOWA 2QPAA 5D3ZA 2FA9A 1C4XA 2RGNC 3EZ6A 3KEGA 5JIBA 3AU8A 1N25A 1YHZA 5K3OA 3GARA 2A1UA 1BH6A 1DHRA 3W1WA 1YJ5A 2JLAA 4H4CA 5ED0A 3V80A 1R3UA 2VBFA 4RWZA 3FOEC 5IJZA 2C2YA 1QV7A 2BM8A 1T1GA 4C20A 4ZRNA 3HA5A 1SK9A 4KE6A 5HQTA 2UYOA 2C95A 1FRNA 3P9PA 3F98A 3ZZNA 2QHXA 1HFEL 3QVTA 1PW5A 4FP9A 1ZOSA 2Z1MA 4K5QA 3ANTA 1CYEA 2W5UA 3UAOA 3U13A 1GYPA 4C0WA 3L79A 1GFWA 2VRWA 4JBLA 5IXJA 1EAYA 1NPTO 1P0PA 2DR2A 1CVIA 4X85A 4M9UA 1RQRA 1JBKA 3H5RA 4MYDA 3F6BX 5G41A 4CM8A 4HNSA 1RLOA 4GI5A 3FFBA 3ZHBA 2HRRA 2FZVA 4I55F 4O4IA 1IBMB 2OBFA 3NXKA 4FHZA 1CJSA 1C14A 5FB3A 1UBTS 2WIDA 1JIVA 4BB9A 3DDUA 3PRJA 2VHUA 4K1LA 5CB4B 3INRA 1GAWA 3WFZA 3X1DA 5M7EA 3O4GA 1MG5A 4INOA 3VYRB 3LY8A 1T1RA 4PYRA 2GYYA 1PR0A 2FRXA 1EM8A 6YASA 3TNLA 4CM9D 2FQQA 1Z35A 5E2BA 1YRYE 3U3MA 3SF8A 2BKUA 2QMEA 1XLTA 1CWUA 1OXXK 4YQFA 1BD4A 3G0DA 3WLRA 1A1SA 2XZDA 1C4KA 1JZSA 1PQUA 2C92A 1X7ZB 3KS9A 4MDEA 2B25A 3FCOA 5LP6C 4HK4A 4HAOA 2OAEA 2C3OA 2ODTX 4JP2A 2AT1A 5KBYA 4OEHA 1FMFA 4RTNA 5EJ6A 1TVKB 3VFDA 2CL6X 3RWMB 3V1TC 5L3QA 2JC3A 2GASA 2P4SA 1JG2A 2O0HA 2QX6A 2XE7A 4QVIA 4KLNA 1EBUA 3ZIAD 1GGVA 1LK5A 2Q28A 2OWDA 4Q7LA 5KHAA 4CR7A 2PVPA 2WQ6A 2UKDA 2ZRBA 1HH4A 1UDAA 3FFAA 4DCUA 3UGJA 3A4MA 1YO6A 1F8UA 4FOLA 1T6ZA 4TT3D 5DOVA 3RVJA 2ZUVA 1PEYA 4LEIA 2I78A 3MGBA 1XWWA 3TFOA 3EPHA 2JGJA 2P6PA 3E18A 4HNUA 1MXHA 3BJIC 4RNDB 1UM8A 3RSQA 3VVMA 4YRAA 1CJBA 2J3DA 3PTAA 1YQEA 1IBRA 2GAAA 2X2OA 3DD5A 3GFFA 3SBDA 2X8AA 4CMAA 4DSOA 5IC4A 3LYUA 3TTTA 1BWQA 3MSXA 1T2CA 1TCBA 1GGJA 4KO3S 4M1YA 4PG5A 4H6VA 5KMGA 1RPZA 3GLHE 3IOEA 2GEBA 3FDZB 1OFUX 3SD7A 1E3WB 3GXBA 2PUFA 4JC0A 4G41A 4KVFA 3T9BA 1V7QA 3VI3B 2WWFA 3Q7SA 2O2IA 1QPBA 5ALJA 2GK7A 4L5BA 1Q6ZA 1NJ8A 3KJQA 4B3JA 5DYYA 5I7WA 1UPFA 3DMRA 2ZUCA 2J7PA 3N0WA 2VQDA 4XPIA 3NHWA 4C0BA 2PZAA 2WOJA 3NBZC 2IEGA 3FNHA 4GAEA 4LZWA 5CGQB 1J70A 3UIEA 1KZ4A 3A1UA 3WGZA 1H1LA 3PCXA 3GLFB 5TQ0B 2APJA 5KOHB 2J9GA 2YWGA 3UYKA 4WN9B 4TPKA 5DTIA 2FOXA 4WNCA 1X1DA 1OH7A 1YQGA 1YVUA 3QE4A 2XDWA 4FYVA 2TS1A 3R9KA 4YAIA 4HGPA 5CP8A 1LV8A 1Y6ZA 2Q5OA 3OT1B 4LUCA 3PQ7A 5T4EA 1G41A 1ZGJA 3PC2A 1DLIA 1OT5A 4OYRA 4TLDA 4MYRA 1F8FA 1MX1A 3GJXC 3CUYA 1LA2A 5BYAA 3EYWA 2CD7A 2IHYA 1E2JA 2B2NA 2EJWA 3ZE2B 2F3PA 4TUYF 2BGWA 1RKBA 1WXWA 4GR5A 3SX4A 3D6AA 1M1NB 1J24A 2VJYA 3B9PA 3DXXA 4N5IX 3OH8A 1VE6A 1D7OA 2RHRA 2XH8A 3O4IA 4LK3A 5BR4A 3VPCA 5C5IA 5AFSA 3LAWA 2GA8A 4E7PA 3KELA 5LYJA 1TZJA 4LJ7A 4OIFA 2FKNA 1DJOA 4NAVA 221PA 4TRJA 2XUGA 4LV5B 3NEJA 4AY2A 1I30A 4JJAA 5EZYA 2WD7B 2VCHA 3WNVA 1DG3A 1JBQA 2VR1A 2W6PA 3EGOA 4GMKA 5LQKA 1UQUA 4PANA 4DCVA 3C2QA 1IIBA 3FCSB 3TG2A 3OCXA 5GJVC 3LSTA 3QBDA 3WX0A 2X4LA 4G5QA 4JLAA 5ANRB 4IBOA 3G82C 5THXA 3V8NA 3G5UA 4ENTA 3X1JA 1SZJG 3WE7A 1PU2A 3BMXA 4BQNA 5EE9A 1BNCA 3DKVA 4I4NA 4D25A 4D0NA 3TVDA 3UHPA 2WINI 3OJXA 4PC7A 4DNQA 1U2ZA 1HPLA 1BEZA 1OT3A 1PUIA 3WB2A 1Y98A 2YRFA 1L5RA 3OUZA 4X3OA 5FL7D 3ZDZB 4DLNA 3I6IA 3TRIA 5KQLA 1E7YA 1KAOA 1RRVA 1IMJA 1YB5A 1JQEA 2Q1UA 2ZJ0A 4WQMA 4CTJA 4ZQBA 3QF4B 3QMVA 1Z45A 1NJSA 3EISA 3QXXA 4URZR 1JYEA 3C85A 4FIDA 4ITRC 5JPIA 1UXJA 4N8EA 4G9EA 5JSYA 1Q95A 4L2IB 2KW5A 3RGWS 3COYA 4AQ7A 5E7JA 3C3JA 3TI9A 1PYGA 4TRNA 1T1EA 1I0ZA 3K0AB 2CEAA 2WTEA 1WW8A 4ENPA 3T1NA 3X3HA 1P8AA 4RZHA 4G1VA 4WUTA 4CN8A 4EZEA 3DAHA 4FFOA 2IUYA 4BAGA 1JR2A 1U7PA 3COJA 4BNXA 5HXAA 1WZIA 2D13A 4A6PA 2WM9B 1AZWA 2FSHA 4OU5A 2IJGX 3FKQA 1QHYA 4XRRA 5JG7A 5EHZA 1KA9H 1PS0A 5CDSA 3DMHA 1YMUA 1T5LA 2BP7A 2OO3A 5C8YB 3A1EA 3KQNA 4OBXA 1MIOA 2WNIA 5JWOA 1Y8QB 3PQEA 4NDNE 3U5ZB 5DN9A 3WI7A 4EKIA 4KKXB 4V24A 2A84A 2H16A 1T4CA 4YYZA 1KFKB 4WZAB 4LDRA 2A1TS 3DOIA 2WA1A 3P0RA 3K7EA 3JQAA 5LZ2A 4PRYA 2J3HA 1T9HA 3TRHA 4C0AC 2OK8A 4ZYYA 1XCPA 2Z2KA 3MJDA 4KB5A 3HUUA 1AKMA 1XHFA 4I6JA 5I4BA 2BFDB 4OK6A 1XXHA 2UZ3A 4YJ2A 3NHBA 4HDKA 3BPSA 3WOHA 2BFCB 1FLVA 2QD2A 4XWYA 4DWOA 2N0SA 3A1FA 2X9QA 2NG1A 4EATA 4U7HA 1YCDA 4KFSA 5TV2A 4E2XA 5H4GA 1N0VC 1AHIA 5F4ZA 1EX6A 4P4NA 3E15A 3EXEB 3KCQA 2HRZA 3ZPXA 4RTJA 1H66A 4QHSA 4CGZA 5P21A 4BC1A 4TKLA 1XA0A 2JGLA 1J22A 1CR1A 3T6KA 1VOTA 4OHUA 4ND7A 2WV9A 5KYWB 4KL8S 3SS9X 2E4VA 3D3WA 5A7GA 3JQ7B 5DM1A 1PGPA 2C54A 4I9UA 1NDQA 2P9YA 3LK7A 2XXAB 1CJMA 1ITZA 3IURA 1IB6A 4M7WA 4OP2A 4YQEA 2O8VA 3R0JA 1B16A 1LLDA 1DUVG 1XZFA 3D4OA 3CGGA 4D8WA 3PFNA 5B7PA 1XZBA 3C16C 2FN9A 5JHGB 5MN6A 5HRUA 2B8JA 4A1OA 5CAEA 3SFZA 4DR1B 2KSQA 1BQ3A 3BGOS 3NCTA 3MS7A 4LCEA 3F5MA 1EVEA 3GLKA 2OVBA 3K09A 3KOMA 5FHRA 1OH6A 4CM4B 3HR8A 3AHFA 4HB3A 3NDBB 1KI7A 4BFZA 3AU9A 4G5RA 1I2BA 5A7HA 1DUSA 4K8OA 3DV9A 1DDIA 1M2GA 2QWXA 3ANYB 3E23A 1TQHA 4L5YA 4OREX 4B34A 4BJ3A 2YXPX 4CV0A 4DSUA 1X7YA 3TW4A 3SIPA 3SS8A 4I5DA 2TMKA 2D0PB 1A82A 1DBIA 1RVDA 1C3VA 3F8SA 1PJBA 2GARA 3O7WA 4N3NA 4PPFA 1FS6A 4PVCA 5TEWA 1JQJC 2L2QA 1HYHA 4RD6A 4GT1A 4ZPXA 4QPZA 3WVNA 4H1UA 4OHZA 1CUZA 3SVTA 4IVRA 3ZW7A 3IELA 1HDYA 1EHIA 5BN4A 1ZS9A 1E3JA 2OECA 2EG9A 2XSZD 3AUAA 3NYRA 4BCCA 1LI5A 3OOHA 2OORC 2RHLA 3ZDDA 3TH5A 5DCYA 2NOAA 3DT8A 4WCFB 1OE0A 2QJOA 1JU9A 3PDIA 4CFZA 1TC1A 3TLKA 2Z4TA 5ADHA 1OQAA 4RK0A 3T1YB 1K8QA 3MINA 1XZLA 1U02A 1TXGA 3Q41A 3GVXA 2QAIA 5K8JB 1DS6A 1WB4A 1RPJA 5KTPA 3EG5A 4LHWA 3MBIA 5HOEA 4CMBA 1TKBA 2FMFA 2B3DA 4WK0B 1SURA 2PRSA 3NDJA 3GVCA 1I6WA 1JIJA 3KXIA 5CLJA 4MQEA 3FSRA 1NNUA 4WFJA 1XTVA 4HXGA 4AZWA 4B3XA 5JC1A 4UNPA 2NPIA 2DFVA 4E5SA 3N8GA 4OXXA 4UVHA 3C6YA 1RWQA 3B7GA 1J1IA 3IJEB 3SXPA 4CNQA 4BZWA 1WKVA 2ET6A 3ZQ4A 1D1TA 3DPSA 3OZRA 4FHCA 2UZ1A 4G9GA 4L16A 3ZXYA 1DKMA 5AUOB 5I7VA 3E9MA 1GLGA 1MO6A 1GGFA 1M6EX 4WK4B 2AHOA 3QPCA 3I30X 4RTKA 2K6GA 2OKCA 2Z9BA 5DX0A 3WBBA 1I51A 1RXCA 5K4HA 2Y1FA 5FYQA 5AW1A 4RSMA 3UB2A 2ZZKA 3DAYA 3JZMA 3UJDA 5AW8A 4GBED 1KJ9A 4ZDWA 4YREA 4BNDA 4JOQA 4X64B 4QOJA 4KGXA 1WM1A 1AHNA 3L9WA 3LC2O 4YJFA 5AKLA 3WA6A 4CTMA 5DNAA 1P9RA 2QRNA 2WTUA 3PRHA 3DW3X 1SHJA 3RASA 3TRDA 1UC8A 3DOJA 2P4UA 4TYPA 3SLKA 1D2HA 3WSWA 2ASEA 4KNVA 4ZALA 1ZI9A 4D6YA 4WY2A 1Z4QA 1EUDA 1OW3B 5FUYA 1R8QA 4YO7A 1I94B 1YQ9A 3F47A 1G0NA 3OA2A 1NVFA 1V35A 3D64A 4EUSA 2B1JA 1GGKA 2AS0A 1BKDR 1E6EA 1GTL1 2HGSA 3RU9A 4K7JA 1Y1PA 4YJ3B 2R6GA 1NUAA 4GPBA 4UEJA 4KREA 1CHNA 5EA2A 4QDUA 3WGIA 4MVJG 1BGVA 3C1UA 3T3DA 1E8DA 1ESEA 5EE0A 2C7RA 3Q1KA 3SJUA 3AHIA 3WK9A 4DR2B 4XCXA 5K3FB 1EFRD 4E88A 4NXNB 1SD1A 2YNMC 3C74A 5LWHA 4EEKA 3O2QB 3AINA 3FHJA 3JW8A 1EH5A 1WX1A 5GM2A 4H3KB 1I9CA 3AIOA 3DAFA 5KKAA 1K75A 1SKUA 4YX9A 3AJAA 1KETA 3C3BA 3C4QA 2Q3EA 1DB3A 3D43A 2AQ8A 4GGOA 1H2EA 4H9GA 1MB2A 4HQLA 4JP8A 2J3LA 3NMUF 2OWEA 2RHCA 1FQWA 4L74A 4WT7A 5T64A 1BRTA 2IXBA 4M0LA 2POCA 4J1TC 3QX9A 3IULA 1QTQA 4D3FA 1AZSC 3GW8A 1NF8A 3O93A 3ETLA 2WT8A 4U9UA 3EGVA 3H3FA 1SXQA 4OXKA 3PG5A 3VDQA 2HF7A 1R2QA 4G5YA 2XEDA 4NOKA 5FLKA 1DEKA 4C0QC 1MH1A 4RK1A 2ZFUA 1U3UA 4QLOA 5COBA 1KH2A 3OKAA 4BKQA 4DEXA 1QYWA 4DUGD 1L5NA 3R3UA 4MTLA 5AT1A 4EM6A 1L9KA 4HTFB 4BWYA 1ADGA 1HYGA 3CX8A 4FW9A 3V1KA 1F0KA 4P5PA 3QUQA 4J2TA 4DUZB 2OFXA 2H8GA 1U28A 3ZVKA 4UOZA 1J1ZA 2G9VA 1S8AA 3LYHA 1YDMA 1D2AA 4RENA 2JCYA 3IAUA 5IM4A 2L18A 3QF7A 5BQXA 2RGEA 4POOA 4E2YA 3V8QA 1BSVA 1CETA 2QLJA 3TOCA 3OEWA 5DK4A 2NADA 2XYRA 1FRFS 3ELDA 1M5TA 3RDPA 1FC0A 1YI0A 2CD9A 2QDXA 1MTOA 3IBCA 1D0SA 1Z4LA 4DRZA 4CETA 3HH8A 4JYCA 1AQIA 3OE7D 4LE1A 1ML4A 2WJIA 3PUYA 1GR0A 3A70A 4B48A 1BFUA 1E59A 2YIDA 3T12A 4KR6A 1BCSB 3AZPA 2WSSA 1VKNA 1N5JA 1IJFA 2QVCA 3E2MA 3ICOA 4Q24A 3HJGA 5ADWA 4PE5B 2NYUA 3EAGA 5ALYA 1IBCA 4ZVOA 2YXNA 3RRXA 1N2GA 3CRNA 2QE6A 5AW6A 5JXWA 4ETMA 5JWRA 4IVNA 4WFKA 1GILA 2EGGA 4YNBA 3NFYA 3P9YA 1C1DA 1EVYA 1YQQA 1FP2A 2V4ZA 2WD9A 2ECOA 2GEVA 3N5KA 4MRMB 1YUNA 4KE9A 1YC5A 2QSJA 3FCCA 2BF7A 1X7XB 2ILTA 4NULA 2P2GA 3AP1A 3F1KA 3TQOA 4BFTA 1B00A 2ORVA 1P60A 2R8ZA 2ZSKA 3D5EA 1N2JA 3QLVC 1PZFA 3ZHVA 3JVIA 4MP6A 3GEMA 3BFKA 1WPGA 5FOVA 1H4VB 4K86A 1YSCA 4U9IS 4BWFB 2DHCA 1R0RE 3C15C 3Q2OA 5DHSA 2BFOA 2V3CC 3DB1A 4XDHA 4MKGA 4LGYA 4MQ5A 3HO1A 2E1PA 1ISIA 1DTSA 1PZMA 3ADOA 3R23A 3E3NA 3CLRD 2CDBA 1GCIA 4WK6A 2QV0A 3BZWA 3CH7A 3EZYA 4Y2XA 2V6FA 2ZJBA 5KVAA 2XADA 4WXPA 5L6MB 1KEEA 5J23A 3T7TA 3VH3A 4R1PA 3LZCA 2WG1A 2WJYA 3HCOA 3ZY5A 2WI8A 2R6AA 3EF1A 5B36A 4KO2S 1PJLA 2BFBB 2L0XA 3KUXA 4MVYA 1QNLA 3TQTA 1OFVA 4HH4A 1J99A 4BQIA 4C3UA 3O9VA 4RPJA 3L7DA 3OHPA 5IJ0B 2ZRLA 3BDIA 3L06A 4FMDF 4IJVA 5KPJA 5K8TA 4P84A 3QSGA 4EW1A 4EHJA 1P4GA 2FEPA 4O3FA 2YV1A 2IIPA 4XQGA 3SICE 4Q16A 2PXXA 1R8YA 2Q9BA 4I14A 5IK2A 3WYCA 3W5AA 2R25B 1ULAA 1BJKA 3N70A 4MW7A 4OXYA 5FOWA 1PR5A 1Z5WA 2ORWA 3FIJA 4Q3KA 2HHHB 3Q8XB 1JXMA 3TL2A 3B38A 1OILA 1V9CA 2D1TA 2XUDA 1H9AA 1HZZA 1OTXA 4KQIA 3TB4A 3U4QA 5CT6A 3E9QA 4MW4A 3TNJA 1JEOA 5CMLA 4FUTA 5EMMA 1SUSA 1UKAA 3GRYA 4NNPA 4B32A 2BDTA 3QKUA 4LBYA 4R51A 4Z8XA 1M2KA 2Y1XA 1KZYC 3KCNA 5J5VA 4ZHQF 5EUQB 2PU7A 1RBMA 3CLTC 4M7RA 4TYWA 1SB9A 3HI6A 3CR8A 2YZKA 4P98A 1DRVA 1F3OA 1YRBA 1J2EA 3DFFA 3EZ2A 5DHQA 3H42B 5FUWA 5HX7A 5JS8A 4GYKA 4RA9A 3ZWBA 5T57A 3GZNB 3OOWA 2ZVQX 1W93A 4M1ZA 3IQFA 4ES6A 1FRQA 3RIYA 3I1JA 1FMCA 2TECE 3OAAD 4P8RA 4UBJA 4E6EA 1TVEA 4MYCA 1DI0A 1XB2A 3D8SA 2II6A 4J4BA 4LHVA 4O4HF 4Y2SA 1ZGBA 2D5CA 5U4XA 3AEZA 1GARA 1ZM7A 4P7BA 4A0QA 1F0PA 3OEED 4LZAA 5CDFA 2C3PA 5AKJA 4B33A 2PIDA 3CF2A 4ZEVA 1JZQA 3KJGA 1DJLA 1CVRA 3ZDEA 2ZK7A 3MJCA 1SVIA 3OC6A 5C34B 3PX2A 1DOHA 2CF6A 2VA8A 1Q74A 3RYHB 5K0JA 3J81k 2C3MA 3DE0X 1T24A 3GEBA 3T5PA 1YJCA 4EL0A 2XAUA 4NDZA 2WAXA 2W6MA 3C8HA 3M82A 3E9ZA 3U7GA 2JLWA 3L8GA 4JEUA 1RQNA 3ICQB 2FPOA 4GEGA 4L22A 5CM9C 3R3HA 4PAQA 4Q3AA 3PCRB 1WTCA 4YMWA 1TA0A 4NPAA 1M74A 1KQPA 4BBJA 4MQFA 1Z4IA 3QH4A 4ABTA 2WMOB 4CMJA 1WXDA 4YLGA 2DPHA 1FB5A 4F5YA 1XU7A 4H7JA 1EWVA 4I1YA 5T7BA 4A16A 2WVGA 4BYMA 1AMOA 1YXMA 2IEAA 5DNYB 1V3TA 1CZHA 1W25A 3M1IA 2A5YB 3R20A 2ZCVA 3K73O 1GQFA 3L1KA 1Z28A 1XLTC 4EQZA 1UBUS 3CONA 4F97A 1H3EA 1HE2A 5D7BA 1FP7A 3VTFA 3PIRA 3VUEA 2G83A 2HSJA 5EYPA 5ECGC 4Z2AA 4YB8A 2VDQB 3R3SA 1XCGB 4P5EA 3ZDQA 1B6SA 3LLMA 1VCIA 3JYNA 4CU5A 2C5AA 4EHDA 1STOA 2ZQ5A 1AZTA 1W5BA 3B6IA 3CV3A 4ND4A 3DVQX 5EP3A 3GV0A 2AK2A 1IZZA 1MJ5A 5J4KA 4LQCA 3D4NA 2UZIR 1FU8A 5BYJA 3E9RA 3GRUA 1KEKA 1HLFA 2XTJA 3ICWA 2V7UA 5HF8A 2FKAA 1XNGA 4ZVTA 3KV3O 2NXNA 2BR4A 2WEKA 1OWMA 2EJBA 4PYOA 2XOKD 2WT4A 3EULA 3EUAA 4CMEA 1YAHA 2W0MA 2D06A 4HB2A 4MRRA 3DAGA 3RYTC 2CJXA 5JLJA 3U4MA 3PXCX 4FINA 1NKTA 3KM0A 4J43A 2PX4A 4PBSA 3T3PB 4LISA 1Y3CE 4CV3A 2FK8A 1THZA 3DYIA 2JF0A 2Q1WA 4PPQA 5EWMB 4RESA 3IVXA 3QEOA 1SC6A 2FTKE 2F3TA 4EJ2A 4XGKA 3TOSA 1T6BY 3MLBA 4S0XA 2GFHA 3WGOA 5KJCA 3O82A 2GHIA 4PICA 1FQOA 1VC2A 1X8XA 1YR7A 3I9KA 1V95A 2FF7A 1YDGA 4UC0A 2HCRA 1L8QA 3KT3A 4UUBA 1H6CA 3N86A 3ESRA 4O2BF 3RH0A 4EA6A 1EA5A 2EKQA 2PZKA 1OZGA 3B8EA 3FW1A 1A9XB 2ZI3A 4N0MA 1OYYA 1SIBE 4ND1A 5BVGB 4I0WB 1AKWA 5TT0A 2EKPA 3HKCA 5BWMA 4CQNA 4CR6A 1B4DA 4BJ1A 2OQ2A 4KIGA 1VPLA 1D0IA 1NQOA 2D2IA 3FWKA 4QEZA 1YUBA 4WA8A 1RHKA 1VJ5A 1WXQA 3PT5A 4BASA 1S2IA 5LUAA 3IKTA 1VL8A 3R5KA 3K1AA 1NASA 2IUUA 2J7KA 1AXEA 1E1KA 2VDUE 3FKSA 4LSGA 3TFQA 4FHEA 5CHEA 1HDRA 2W70A 5AI6A 5KYNA 3T0GA 1SR8A 3B1KA 1U6IA 2HFKA 2I2AA 3CSUA 4IH4A 5JTUA 3L7YA 3F3KA 4AIRA 2Y9PB 4EPWA 1E3QA 4WV3A 3F6SA 2XNDD 3GF4A 5DX8A 3CW2A 2WMNB 4MV9A 2QYOA 5DMHA 3R7WA 5C4GB 5AXBA 5JEDA 4OSEA 4MKXA 3JD1A 1U2GA 4A03A 1DEXA 1UMBA 3PVCA 4LYYA 2VP0A 3ZBPA 1S3FA 4LYHA 1C9JA 2CUNA 2OE2A 4IDHA 4PZEA 4B74A 3SR4A 4TL8A 4OHOA 4N9QA 3K6KA 1YQUA 4X1IB 1X1SA 4ZOLA 2FB9A 2Q5EA 1FCJA 4ABYA 4C0XA 2XCTB 3BCRA 3OJEA 1CTQA 1AUPA 2DT5A 2VHQA 3CBQA 4NCJA 4ZI7B 2QRQA 4Z9AA 1G63A 2P9HA 3UMGA 1E2DA 4B2LA 4MPDA 5CVTA 4OGKA 5BSHA 3T5MA 4HB4A 3D2LA 2G8NA 4KJXA 4LRQA 4AECA 1QP0A 1PQYA 2Y6VA 1SKYB 3IOCA 2OCLA 5ALGA 2HU5A 3TLGB 4DXAA 3AO0B 2AFHA 2W0SA 3I9JA 3JCZA 2PSJA 4M87A 1EFKA 1TK9A 1UBKS 1XJWA 2VPZA 3C7TA 1WEHA 1LRKA 3HDJA 2GN4A 1E79D 1YBFA 1ZN2A 4FYJA 1G21E 4Z9XA 1W1UA 4OHWA 3VO1A 4LF6B 4QGGA 3E3AA 1NLZA 4KWTA 4WASA 3V4VB 3VU8A 1BVUA 4XGRA 3IHWA 2GEKA 2IXGA 2I6TA 2ZYAA 1RKUA 3LBYA 4JC8A 3RABA 2ZR9A 1ODIA 1YUMA 2ZWVA 4I9FA 1E0AA 5DBEX 1YR9A 1YI8A 3LDAA 2W2LA 5AJZA 3VQTA 1TKRA 4B7XA 4JODA 4FD3A 4LHXA 5L8VA 5AVXA 2DR3A 2JGAA 5H9WA 3Q0EA 3U4HA 3D4BA 5LP1A 2J6IA 3Q3EA 5CA1F 3G5AA 1W76A 3TXYA 5ALQA 4MYTA 4G01B 3QVUA 4PN7A 2XVXA 4XWGA 4MB2A 3FLAA 3ZUGA 4YCMA 1CP2A 2GPJA 3FYUB 4IYRA 5CJJA 1C3EA 1EPUA 3FSGA 3TJRA 1QGYA 4K9PA 1UJCA 3IAM1 5M29A 2E6UX 4TV9B 4CW7A 4G63A 1F0NA 1G5IA 4IDFA 3JR7A 4RF3A 4AUMA 1BTOA 1JHYA 2GEFA 1K0UA 3F5QA 1AK2A 3OVMA 3IUNA 3NH9A 3BHIA 2D5LA 4JJ6A 3FPCA 4EH1A 4GVLA 3IAM6 4WNYA 1KORA 3ZKWB 1IQPA 3NHSA 2V7GA 4H3HB 1V7CA 5JSZA 2I4RA 2QZ4A 3RUPA 1Y34E 3LGSA 4G25A 2DECA 5HBRA 4YP5A 2PD6A