4CM4B

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQKSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE 1
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 90
structure length 251
sequence length 267
chains with identical sequence C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cm4B00
1BVRA 1M2WA 3CXRA 4Y6RA 3MWDB 1ZVMA 4QT0A 4MVJG 3PVZA 4IQ8A 3V2GA 3V8BA 3DQPA 2QRKA 4Z9YA 4A2CA 1KIFA 4D43A 4KUGA 3EK2A 3HSKA 3MOGA 3K31A 3ETGA 1PR3A 1B8UA 4IMRA 2Y93A 4A03A 3TL3A 3RC2A 4XRGA 4CMHA 1V6AA 4JJFA 1YOVA 1NPDA 3DBHA 2YFQA 3N58A 5A05A 3MTGA 1DC3A 3GA0A 4IBOA 4OL9A 1GPJA 3HFGA 4P4LA 3GRKA 1XELA 1TT5A 3ITDA 4JGBA 3JTMA 2ZK7A 2J3JA 3T4XA 1E7YA 2VYND 1H6AA 5ILGA 3H4VA 4I9NA 4D42A 3AY7A 3GZ4A 4DPLA 2X5KO 1PU2A 4H15A 4ND3A 5T6BA 3ZU2A 1E1LA 4CQMD 3K73O 3CMMA 2V6FA 1VLLA 2A92A 2J5RA 4XDZA 5JYDA 4EEXA 4WCFA 1LLCA 2WYVA 2WEKA 1JWAB 5GZ3A 4HUJA 3RWBA 2J3HA 4QQRA 3DBVO 3Q2KA 4BNLA 1ID1A 1UP4A 2HMVA 4CM5A 1PGJA 2QX7A 3LF2A 4G65A 4UUMA 3KUXA 4D46A 4LRSB 4UULA 3HNPA 1UDBA 1YS4A 1N9GB 4AJKA 5L4NA 5GMOA 1DFHA 4AJEA 1N5DA 1X7HA 2AHRA 4NJMA 4YJGB 4M8SA 3DZHA 1TXGA 5JLAA 4OKNA 4NJOA 1EVYA 4XIYA 3VAZA 1OI7A 3GG9A 1BMDA 5BNTA 1P1IA 5I7FA 3B6ZA 4MIYA 3D5TA 4WCDA 1EE9A 4PLCA 3FF4A 3JQGA 2NVUB 4DUPA 3L6OO 4QECA 4LK3A 3ZWWA 1JW9B 5JSFA 3HDJA 4Q3CA 3O9ZA 4OHUA 1G0NA 2D4AA 4TRJA 3S55A 3LC2O 4OJNA 3TJRA 5CG2A 5THKA 2FP4A 5CFZA 2D59A 1H94A 2I65A 2W8ZA 5K0ZA 1UXGA 1HF3A 4BV8A 3LSYA 4ZU3A 2AQ8A 2NTVA 3PQEA 5TX7A 5TT1A 1PL8A 4DQUA 4E5YA 3TN7A 2WYUA 1PSDA 3FNFA 1E7RA 3B1FA 1PWXA 3NTOA 2EXXA 5KVVA 4HFMA 1XKQA 4CLXA 8LDHA 5IG2A 2C20A 5IJZA 3H9UA 3UCEA 3C85A 5FEUA 4BGIA 2PGJA 3GVXA 3JQDA 4FFMA 4BGEA 1X0VA 1ADCA 3WGGA 1O89A 4DL9A 2NU7A 1NPTO 1XSEA 1GEGA 1T25A 1ZK4A 3C24A 3PDUA 2VHYA 3P19A 1B14A 4PIVA 1S7CA 1JQBA 1NHWA 1VM6A 2JHFA 5EL0A 3VDRA 1CETA 3O8QB 5T57A 3D0OA 1I2CA 3W6ZA 5JNLA 4RVUA 5JFOA 4PG7A 3RIHA 1PGPA 2B4QA 4H3VA 1P1KA 5I9LA 4QFDA 4MKXA 1EMDA 1D3AA 1OOEA 5EQDA 1CYDA 1EQ2A 1QXSA 3HZZA 4NQZA 3ONEA 1PZEA 3FWNA 5DBIA 4ALKA 3OA2A 2VN8A 2ZKLA 1XU7A 5COAA 4WK6A 4MPDA 1P45A 3KVOA 4W99A 1PZFA 1YQGA 3AW9A 3QJ5A 3DAPA 1BHSA 3BTSA 3KYBA 1GD1O 4WASA 5A9SB 4BIIA 1L7EA 4UUPA 1E3EA 3WGOA 2EJVA 1MFPA 4YRBA 3ZI0A 1UXHA 1N7GA 3ZDFA 1NTOA 1PQUA 1GV0A 4CQMB 5JC1A 3ONFA 3NJ4A 2O2SA 3SVTA 2V7PA 4NBRA 4IUYA 2CD9A 4ILKA 1B26A 1CQJA 4J6FA 3R1IA 4MVJA 1ZW1A 3GY0A 1DSSG 4I5GA 3ANNA 4A10A 2QZ9A 4B4OA 4BNNA 1MGOA 3TZQA 4ALIA 4RZIA 1HSOA 3E8XA 4YAIA 1DIRA 2EWMA 5JAIA 4YTEA 3ROQA 1Y9EA 4XZ3A 2J6IA 3OETA 3WG9A 4C4OA 2Q49A 3PGJA 2PR2A 3ZNQA 3ZWYA 3T4EA 4IJWA 5ADHA 3EYWA 2VT3A 3I6QA 3KM0A 4CMKA 1KVSA 1Z6ZA 3FNGA 3NYWA 2AEFA 5FI5A 2PKRA 1PR9A 5G0VA 5GY7A 1WDMA 2FPIA 3WJAA 2R00C 4RORA 4FC6A 4KTTE 2PZLA 5COQA 4DC1A 1K89A 1KERA 1NP3A 3OICA 2GO1A 4O59O 2A9FA 2O48X 4XR4A 3GZNA 1AUPA 2WMDA 4XR9A 2OMEA 1DJQA 2VWHA 1PJ2A 3K5PA 1HE2A 4MVJH 4AJ1A 3DONA 2VOEA 1LSOA 2OBYA 4KWHA 4FB5A 1VKNA 1X15A 1YVEI 3EVNA 4AJIA 1G0OA 1EK5A 4A73A 3FR8A 2Q50A 4IMPA 4BNIA 3ZV5A 4YPOA 1D1SA 5A02A 3L07A 2YHIA 4RPJA 5TJHA 2PH5A 2Q2VA 1BW9A 2ZB7A 3JQBA 2W2LA 1U3UA 1QRRA 4HKTA 4B7XA 1A27A 1PS8A 3OJ0A 5EQFA 5JDCC 3ZW9A 3NDIA 5I8WA 3OQ1A 3COSA 3PP8A 4IJKA 3E6AA 5ENDA 2Y1EA 4DA9A 3F47A 3GVCA 3AU8A 1YOVB 3RCBA 3DBHB 5IXYA 1PJLA 3AFMA 1TLTA 3BHJA 2VHZA 3ZZNA 5KJFA 2HMUA 4NDNE 3E18A 3MZ0A 5A9TA 4CM3A 4J0FA 1ISMA 2O2YA 3ASVA 2JCXA 2H9IA 1TT5B 2PK3A 4XJTA 3M6IA 2QRJA 4Q9NA 9LDTA 3BTOA 4NU6A 2P5UA 1C3VA 3AOEC 1AGNA 4CMEA 5FFFA 4FPXA 1JKJA 2PD3A 1I30A 3OIGA 4FOOA 4XGIA 4JXKA 1PZHA 4Z0HO 1MX3A 3E9MA 1OAAA 2IE0A 4JLWA 1QYVA 3LK7A 3LYLA 4WCFB 5FI3A 3IIEA 1UUFA 1P33A 4MVJD 5ES3A 1DLIA 4NBUA 3CKYA 4N5NA 5B4TA 2POQX 5K6AA 3FNHA 1GFSA 5TGDA 4L75A 4AFNA 4QO7A 4MDHA 1ENOA 1Y5RA 3PYMA 1U2GA 2IXAA 4W82A 3WWZA 1SB8A 3NAQA 3ROMA 1B16A 2F00A 1J49A 5A04A 4WNCA 3ENKA 1M75A 1P74A 3VHRA 3MJ4A 5DP1A 3UGKA 4OQYA 2PNFA 2AQIA 5CAEA 1DC5A 1RWBA 1FDWA 1SPXA 2IZ1A 4NJMB 4GH5A 1EK6A 2JFHA 1BGVA 2BGMA 1LDEA 1QLHA 3D64A 1VJ0A 3QIVA 5JPIA 4YQZA 1GL3A 1M67A 3D5QA 3WR5A 4XX0A 3DBLA 3JQGB 2QHXA 4M87A 1IHYA 2UUPA 4WUVA 3TOZA 5TC4A 4CV0A 4FN4A 2GZ3A 5JY1A 4CR7A 2P5YA 4ZQFA 4Q3NA 2EHDA 2I76A 4I08A 3H2ZA 4O0LA 4BV9A 1H2BA 3C7AA 5EESA 1NFFA 3VTFA 1XGKA 5DDIP 1A9YA 4YJDA 1DRWA 2FWMX 2W2LD 2IEDA 1A9ZA 3DZBA 4MVJI 1PS0A 5GZ6A 5G2OA 3DR3A 2W4QA 4N54A 2V6BA 3U4CA 1NBOA 4R9RA 4HY3A 4C7KA 1NWCA 1B3BA 4QSMA 1OC4A 1Y81A 1E3LA 3PJFA 5TF4A 3WYEA 3TRIA 3G1TA 4D45A 3QVWA 2GN8A 1JAXA 1A71A 2OGUA 2JFGA 3I9KA 5I8ZA 1F8FA 4XQEA 2AMFA 1SEPA 3FTPA 1EBUA 5HBRA 5LCXA 4HXYA 4FOSA 2JD0A 4QFCA 5IAAA 1NAIA 2BHLA 3WDSA 3NT5A 4W7IA 3E9NA 4U0JA 4YAEA 3TOXA 3W8DA 2Q1TA 3ZW8A 5ICSA 4ZJUA 4YAKA 3UHAA 1CIVA 4IDGA 3HADA 4NI5A 3TZHA 1E3WA 3OIFA 3WYBA 2YJZA 1BWSA 1PTJA 1YDEA 2GGSA 3O26A 4YDRA 2HK7A 3VH3A 4CL3A 5HS6A 3ZN2A 1LDBA 4BNZA 4DLBA 5DOVA 4FSHA 4ZGWA 1NM5A 1M66A 2DTXA 3ORFA 2O3UA 3OSUA 3MWEB 3RUCA 3ZWVA 3FRJA 3MJVA 4Z9XA 3CEAA 2FR0A 1V3UA 3P2OA 3ENNA 4R1SA 3WQQA 3AWDA 3JQAA 2Y05A 1HDXA 1YBVA 4IY1A 3F9IA 3W8FA 4J0EA 1LSUA 3JQ9C 1N7HA 4JK3A 4E5KA 3D4OA 3KSZO 4XWYA 1LSJA 3GMSA 4XQ9A 2I5PO 2G1UA 3IS3A 2ZTMA 3GOHA 3NEPX 4K1LA 1DAOA 2C29D 3RAJA 2R2GA 3L6DA 2X0JA 3JQCA 4GSKA 5BSFA 3RBZA 3GDOA 5J23A 4LISA 2HMSA 4ZICA 2YY7A 3QY9A 4E33A 1KEVA 4INAA 3S2EA 4MVJF 1P0FA 3NUGA 4ZVVA 3MJSA 1U2DA 5B4UA 5I7SA 5A03A 2DBVO 4OOEA 3IL2A 2B36A 4DLLA 3F4LA 1ZMOA 2WE7A 2QQ5A 4I8XA 1GAEO 4WGGA 1U3VA 3WFIA 2Y1CA 4PRLA 1DO8A 4PLZA 1I24A 3I4FA 3ANMA 1B7GO 3GLQA 1I3KA 3X2EA 4J9UE 1GCUA 3RFXA 1YO6A 4FJ2A 5HTOA 1UZNA 4R16A 2Y1GA 3STHA 2Q1UA 5BSGA 4IGFA 1UXJA 4OSOA 1YBAA 1H6BA 2PKQO 1C1DA 1M6WA 2J3KA 4BNVA 3B1KA 3OJLA 1QLJA 3NV9A 2W2KA 4Z9FA 3WYCA 3H9GA 4EJ0A 3OHSX 1QP8A 1I32A 4RDHA 5JXWA 4D41A 4DYDA 3E5MA 2NQ8A 1XR3A 3VTZA 2QG4A 1GTMA 3E48A 4UEJA 1TEHA 4GKBA 4WLEA 2W98A 2VYVA 4A0SA 2D5AA 5IDQA 2YUTA 3GZNB 1Y5MA 4GMFA 4IDAA 1EDZA 3WTBA 4CLHA 1ISFA 3SJUA 2Q2WA 4OYRA 4YAJA 4QXMA 1MP0A 5DNAA 3C8MA 4MIOA 1R15A 1J0XO 1JVSA 4N5LA 1YB1A 2OBNA 1ZJZA 4BO3A 4PG4A 3PHGA 1CJCA 1GY8A 2YFHA 4U6QA 1HYHA 3AUAA 5AOVA 2NACA 1R0LA 2O3JA 3ADPA 2J8ZA 2YHIB 4CLOA 1ISJA 1GYPA 2IDZA 3DMTA 1BW9B 3WFJA 4U6SA 1WAMA 4RDIA 2OP1A 3U3XA 5JAMA 2B4RO 3RU7A 1P44A 5B4VA 2JJYA 4N5MA 4BKUA 1A4UA 2HUNA 3SLKA 2NQTA 3EGOA 7ADHA 4UUOA 2VZ0A 1I33A 1YKFA 3JQAD 3M2PA 2I67A 4P4GA 4Q3EA 3Q9NA 2P68A 1A7AA 3Q11A 3V1YA 4BO8A 1EDOA 1GYRA 4HV4A 2PFGA 2PTGA 4E2XA 1JVBA 4D7AA 1HEUA 2JL1A 3Q0EA 3IAHA 4JQCA 1D1TA 4A26A 2J5QA 1ZK0A 1LDGA 5KKCA 1IPFA 3TDKA 4R3WA 4CM1A 2E37A 4PLYA 5C37A 1V35A 2DPHA 2A94A 1Q2XA 1Z75A 3FR7A 3DEYX 2X7HA 1I01A 1E3SA 1A4IA 3JD3A 1T2AA 1T4DA 3P5SA 3VZQA 2ET6A 4GLOA 2Q1SA 3QWIA 3WNQA 4FS3A 2HJSA 1I36A 1NVGA 4OQZA 3KETA 2YQ4A 2FSSA 2O3TA 1IHXA 3UW3A 3HQ4O 1KYQA 2AA3A 3INRA 3JQFA 3TFQA 5G0TA 4Z3DA 5JDIA 1Z7BA 3BMNA 4DQVA 3PFFA 1V3TA 1HL3A 2GF2A 3RBXA 3JQ6A 1LI4A 2E82A 1V3VA 5A4DA 4Z0PA 5AVOA 5HS4A 3VC7A 4BO7A 1XG5A 3KRTA 5KKAA 1K0UA 1NR1A 1XDWA 2A35A 2VZ8A 4GBJA 4J7XA 2ZTVA 3CPSA 3FTNA 2VRBA 2NM0A 4XGNA 2XF8A 3HUDA 3VPHA 1HE3A 2VYVD 5ITVA 1P1HA 2PWZA 1ADBA 2P9EA 2I6TA 3W1VA 3DBLB 2HRZA 1T2DA 1T2EA 3PHIA 1KETA 3LT1A 5HA5A 2VUTA 3TNLA 3L4BA 1FXSA 1XEAA 4FFPA 1X1TA 4N7RA 4S1VA 1FDSA 4BKRA 1YGYA 5KWEA 2Y66A 3ZV4A 3KB6A 2GERA 4BO0A 1E3IA 4IDFA 3W8EA 2YDYA 4YT4A 2H6EA 4CM6A 3FWZA 1OZAA 1WXDA 4E21A 5H83A 1P1FA 3IDSA 1QG6A 3CSDA 1WWKA 4FD3A 2LDBA 4GGPA 1AHHA 1NASA 4F46A 1DPGA 2UVDA 1ZBQA 2VWGA 1U28A 4YACA 3DXFA 4KUHA 5IDYA 1AXGA 4BNFA 3NDRA 1HDYA 1Q7BA 2EF1A 3JD0A 3KV3O 4RL6A 4PFJA 3OMLA 1LA2A 4PLPA 5MDHA 1SZJG 4DBVO 4Q3BA 1NNUA 1GZ3A 2FMUA 4AL4A 4BO4A 2B0JA 5EJ2A 1GQYA 2AW5A 1SMKA 3H5AA 1VKOA 4ZHSA 4JJGA 1HWYA 3DHEA 3MCVA 3WIEA 1ADFA 4KQWA 2PY6A 4BGUA 5F5NA 3ZH2A 4DMMA 4GPD1 1I8TA 3BMCA 4TVOA 1LDNA 1LLQA 1E3WB 4RO0A 1CERA 5T64A 2X22A 4IQGA 3GF4A 3E82A 4TKMA 4KTVE 2ZB4A 3JYQA 1Q0LA 2CDCA 5IN4A 3KHUA 2JD2A 1DIGA 2Z5LA 1FDVA 3UH1A 3PJEA 2NU8A 2WSBA 4EUEA 4YJFA 5C5IA 3EZYA 2P4HX 4BNYA 1HE4A 2DQ4A 2DFDA 2C7GA 4GL4A 5GZ1A 4F45A 3JQAB 1UDCA 3GT0A 1XU9A 1NX6A 2GRAA 4XB1A 1B0AA 1E7QA 2DBRA 2GCGA 4IIUA 3JD1A 1ZH8A 1SOVA 3I6IA 2X6TA 2ZTUA 1YQDA 1PJBA 3R3SA 2AG8A 3DMYA 1Z82A 2I3AA 3JSAA 5EIOA 3AM5A 2PGDA 4GVXA 3VVCA 2RH8A 3OQ6A 1IPEA 4TSKA 3NT4A 3GGPA 3O03A 4J4HA 4EZBA 4JIGA 3ZWBA 3TFOA 2UYYA 2OFPA 1CEQA 1EFKA 1Z74A 1NFRA 2NNLD 2YDXA 4D79A 1DRUA 2PD4A 5DT9A 4GWKA 3U9LA 2AQKA 4TVBA 1M6HA 1F0YA 3PGXA 3WGTA 4IS3A 1FK8A 2PGLA 5JMPA 3RSHA 1LSSA 4E31A 1F14A 3KXDA 3LT2A 3CINA 3ETDA 5G0WA 1C1DB 3OJFA 4Q3DA 1X0XA 2JHGA 3RD5A 1R16A 2GASA 3HFSA 2W2KB 4E2WA 1UAGA 3GDFA 2GR9A 1FF9A 2IZ0A 3HN2A 2LDXA 5EN4A 3RQSA 1H9AA 4D3FA 1Y1PA 1EUZA 4P22A 3H6KA 2FSVA 4BKOA 3H65A 4KUEA 1WP4A 1N92A 3O38A 3KLPX 5C7LO 1TT7A 1I2BA 1VRWA 2FPGA 2P91A 3RI3A 5BR7A 3MJCA 2VHXA 2VOJA 1ZK2A 2NVBA 2HJRA 2Y0EA 4P8RA 1GUYA 1QYCA 4NMHA 4YXFA 2H5LA 1IOLA 4LGVA 3DZKA 4AICA 5JMWA 3UAGA 3PHHA 4R1NA 1AN9A 2B4TO 3BMOA 3VZPA 4NZ9A 2BFPA 4J2HA 3D1LA 4L73A 4OGWA 2X9GA 3RU9A 3GGGA 5TRTA 1X7GA 4UVEA 4Y6PA 5T8KA 3VH2A 4W7HA 3WBBA 5LC1A 1ONPA 1AXEA 4WLNA 4CLOB 3UFXA 4WKGA 4CMGA 2EV9A 2XXJA 1BG6A 4H7PA 1U3TA 1E7MA 3AI3A 1E1KA 3LC7O 5L9AA 3RUDA 2F1KA 4MVJE 1T2FA 1ZXLA 5A06A 2VQ3A 1IE3A 3QVTA 4DXHA 3GGOA 1WPQA 4PVDA 1FJHA 3JQ8A 4B7UA 1YB4A 3PIIA 5L45A 2Q46A 2EEZA 4FGSA 3VOSA 1HZJA 3JYNA 1HDRA 4FJ0A 8ADHA 5HWSA 4NK5A 9LDBA 1YL7A 2V6GA 3DTTA 2EIHA 2C5AA 5F5LA 1HE5A 1G1AA 4JNKA 1H9BA 3TF5A 3C1TA 1NYTA 4RF3A 1P3DA 1U5CA 1O0SA 4PCVA 1X13A 1OFGA 2VUUA 4L74A 4XEHA 1LC3A 5EERA 2Q1WA 2HAEA 4BO9A 4EJ6A 1GUZA 5KJ6A 1DAPA 1E1NA 1UP7A 4F3YA 1VC2A 2HMTA 5TNXA 2XPCA 4Q39A 1BRMA 3PYLA 1DDOA 2Y0CA 4ZQEA 3W4JA 4RVSA 3DWFA 4BHTA 3INGA 4E5NA 3HDHA 4EUFA 4XKJA 3PFWO 1PJSA 5JO9A 4J43A 3AU9A 4L4RA 4W9NC 1GCOA 3VVBA 4XCVA 3NGXA 1DHRA 3PXXA 3TSCA 4BMVA 3GDGA 3GRPA 3B20A 4UREA 1BXGA 3LT0A 4IINA 1LC0A 1M76A 2EKPA 4ZQGA 1PJ3A 3Q2IA 3U4HA 1WVGA 3OFSA 3BMNB 3TZ6A 5IDWA 5BQFA 4TMFA 1LQTA 1D8AA 3CUKA 1XA0A 4ALNA 3WNVA 1H2HA 2HU2A 3FPLA 4E0BA 3U62A 2Y99A 1EZ4A 3TZCA 2BELA 3ST7A 2ZCVA 1U1IA 4MP8A 4JBHA 2B35A 4BNWA 5HRUA 3ETEA 4Z6KA 5C7OO 4CUZA 3ZHYA 3ICCA 1DXYA 4A27A 3F46A 2ZB3A 5AXDA 1Y8RA 4RGBA 3ZWAA 1MC5A 1WNTA 1K2WA 3EUWA 5A1TA 3CZRA 1DFIA 5L7TA 3JQBC 1HYEA 4FW8A 3DL2A 3K2BA 2NWQA 4NK4A 3GHHA 2EERA 4I1IA 1KY5A 3DZIA 2IXBA 3PYXA 4IQ0A 3A14A 2C59A 3QSGA 1PJQA 1BDBA 3K8ZA 2VHVA 3IKVA 3ZV3A 2RHRA 1NQ5A 1E5LA 1SB9A 1XCBA 3KSUA 3FBTA 3F3SA 3SEFA 4NPCA 1B8PA 5DBFA 5F3RA 3BA1A 5U4QA 2B37A 3JYPA 3TL2A 3UXYA 3X2FA 1Z7EA 1JAYA 2CDBA 4B3IA 1P77A 4IIVA 2D8AA 4GMGA 5DCUA 1RJWA 4CM9A 1CDOA 4AJ4A 2Q3EA 1LRLA 4CMEC 5H82A 4BVAA 4ZQHA 1NQTA 3MTJA 3C1OA 1T1SA 1I5RA 4KMSA 3OF2A 2GDZA 4IDEA 4CLRA 4QX6A 4ND2A 1K6XA 4M55A 3QWBA 3NTQA 1U9JA 4RZHA 4CODB 2NU9A 3ON5A 1UXIA 4R4JA 2NTJA 5BSEA 2IRWA 3GN1A 1DOHA 2AEJA 3BMCB 4J1QA 1SBYA 1SOWA 2ZJ1A 1ZNQO 3HWRA 4BNTA 4Y67A 5H81A 1T24A 5KOIA 4XYMA 2A4KA 4AVYA 1NQOA 2BI8A 4FFLA 2HCTA 1RPNA 1IZ0A 4WJZA 3LLSA 3UICA 1IZ9A 1O94A 3UUWA 4JBGA 1I10A 4FDAA 2ZATA 4Q3AA 3PEFA 1EBFA 3G79A 4G81A 1OC2A 4NFYA 1ML3A 1GYQA 2ZTLA 4YJFB 3AOEA 2C2YA 3PWZA 1YONA 5CP8A 2P9CA 2QYTA 3QWHA 1EUDA 1FDUA 4J1NA 2EP5A 2EG9A 2X23A 3C7CB 4JCOA 4CPDA 2NVWA 4L8VA 1PJ4A 4EUHA 3IJPA 4RPKA 1QKIA 3ZV6A 1QR6A 2NLOA 1WDLA 1E7SA 2AE2A 2DBZA 1UZMA 3ZU5A 4BNKA 3GVPA 5IFLA 3A06A 4OSPA 4UVHA 3W6UA 4PLVA 4GSLA 3A28A 3JD4A 2EJWA 4JROA 4TRRA 3FI9A 3ULKA 1E6EA 4PLWA 1CF2O 3QQPA 3GUYA 2Y1DA 3I52A 4L9RA 3AOGA 3PLRA 4LSMA 2CF6A 5IZCA 4BQRA 2R6JA 1XIVA 4J4BA 1XYGA 4J1TA 1GZ4A 1O5IA 3WWYA 3I4CA 5JC8A 4CMIA 3GEGA 1NPYA 3NRCA 4XB2A 3FNEA 3EW7A 2O4UX 1E5QA 1PJCA 3RUAA 3GVIA 3O4RA 3RUIA 4XYGA 3UCFA 2EP7A 5L7WA 1LNQA 2DAPA 2JFFA 5T5QA 1D7OA 3GFGA 5FF9A 1E77A 1IY8A 2X0IA 4DPMA 5BSHA 2O7SA 2CVZA 4M49A 3KLMX 4CM9D 1ENZA 2OHXA 4KDFA 1N1EA 3GAFA 4MKRA 3HHPA 5K9ZA 1MA0A 4Y98A 3DBRA 2GLXA 3HDYA 4I5EA 2GN9A 2PZMA 3QVOA 3AY3A 4ND4A 3SJ7A 5L4LA 2WD7A 3DO5A 4CLEA 2DTEA 3GPIA 3I3OA 1QYDA 5MGBA 3V2UA 3IUPA 1ZSNA 3BMOB 4BNGA 4DTIA 1XLTA 1PIWA 2DUUA 4DC0A 2EW8A 2O3RA 5DZSA 3BTVA 3IP3A 3WLEA 1P9LA 3JQ7A 4R51A 4RF2A 4CM8A 1GPDG 5F21A 1KVQA 2YZ7A 3ONDA 4U0KA 5U1PA 2WD8A 5L53A 1LQUA 1SNYA 4RF5A 1IYZA 1MV8A 3DOCA 1QV6A 1N2SA 3PPIA 1X1EA 2IODA 5CEFA 3QLJA 4RQTA 2CVQA 3VPSA 3G1UA 3VPFA 2ZIZA 4IM7A 3ASUA 4BO5A 3JQ8B 1HDOA 3CE6A 2OL4A 5ILOA 1T2CA 4URFA 4LN1A 1PQWA 4PLFA 1PWZA 3IJRA 3GEDA 4E2YA 1ZCJA 4IDDA 2UUOA 1B8VA 2FR8A 1MC4A 3PZRA 2C2XA 4OH1A 1KEWA 5EPOA 5KVQA 4GAEA 3HDQA 5CPFA 3TQHA 3PI7A 1U5AA 1KVRA 1JA9A 3BTUA 4HADA 4I5FA 2BD0A 2PZJA 3WGYA 2G0TA 3M2TA 1U4OA 1JKFA 1GZ6A 3ZWXA 2O4CA 1JKIA 4LMRA 5DCWA 1ARZA 1XWFA 3K6JA 3NDJA 3HG7A 5TQVA 1BXGB 3ZWCA 1T1RA 4KZPA 4PZDA 4B79A 4FFRA 3RROA 4JJIA 1L1FA 4J9VA 2HK9A 5DULA 2WE8A 3OQBA 4ND5A 4NIMA 5TJ9A 4PG5A 2X0RA 3ZWOA 1ZEMA 3VPXA 4K6FA 1I3LA 4I9UA 1ENYA 4HFNA 4XDYA 1J4AA 1KVTA 4ALJA 4BMNA 3BAZA 3BIOA 4FR5A 1C14A 4MVJM 1E1MA 1R4MA 4IJVA 3OEYA 2HKIA 1CQIA 2DBQA 1Y8RB 1WLYA 4N18A 1R4NA 4R41A 3U4IA 3LF1A 4OIMA 1I3MA 2FHSA 2X8LA 4Z3KA 4IZHA 2G5CA 4J7CA 2DM6A 3GC6A 3SBOA 2HQ1A 4BUCA 2BRUA 1U8XX 5IZ4A 3PHJA 2B5WA 5CPBA 5LDGA 2SCUA 1ONOA 2I99A 1HXHA 5L4SA 3DC2A 3M1AA 2GYYA 1YDWA 5KJCA 1W8DA 2YV3A 5IDXA 4MP6A 1O95A 3QHAA 4B3JA 1ULSA 4J1SA 3DB2A 4FIZA 2YHUA 5KCZA 5JS6A 1T26A 3GN2A 3LC1O 3UN1A 5FWNA 5AQ1A 2DUWA 1GU7A 1FMCA 3HN7A 4HP8A 6LDHA 2NU6A 2FOIA 4ESOA 4II2A 1H5QA 5T67A 4XGKA 4BKPA 2D3TA 3WSVA 4K28A 1YRLA 1DB3A 5AYVA 4BL5A 4DBZA 4AG3A 3DFZA 1LTHR 4ZRNA 4MOWA 1SEVA 3VKUA 4MIEA 4CLRB 5DOZA 4D0SA 3KZVA 2H1SA 4O1MA 7MDHA 3LQFA 5BT9A 3ROKA 1TVEA 5I7EA 4D0RA 3JCZA 1LLUA 5ICMA 3OJEA 3WQRA 3ZHZA 4ZA2A 2FPPA 1K5HA 1LRKA 3ZNPA 5JDIC 2C54A 3WQSB 3Q6IA 4RVDA 1LJ8A 2ZYGA 3JV7A 4YT8A 2DKNA 2ZQZA 2VTEA 1I2ZA 4LW8A 1G6KA 1C1XA 4YBZA 1GV1A 5KIAA 4G5HA 4Y9DA 1ZIDA 2G82A 3MOIA 1KOLA 3DTYA 1QMGA 2Y68A 1TI7A 1VI2A 3E9QA 3MJTA 4OXKA 1DJNA 4P38A 4P4NA 3TWOA 4CMJA 1Q7GA 5U9CA 1B2LA 4EITA 3WJ7A 3R3JA 1NXQA 4FCCA 3GQVA 5A9RA 2OORA 3OJOA 4R5MA 1RM5A 4J90A 4QO8A 1Z73A 1H6DA 2G17A 4TZTA 2C5EA 4WEOA 4M1QA 1K6IA 1JWBB 1ZZEA 2CVOA 4M86A 4B3HA 4NBTA 4E3ZA 3W4KA 4ROSA 2RCYA 4E6PA 1R0KA 4TRNA 4D3DA 1XQ6A 1HZZA 1DFGA 1IUKA 1ZXBA 3AUUA 4JP3A 3RUHA 3IMFA 4GGOA 3WB9A 4EBFA 5I9NA 2GZ1A 4J91A 5IN5A 2E4AA 2D0IA 2NTNA 4DRYA 3RJ9A 4FGWA 4IXTA 3RUEA 4JBIA 3KEOA 1MG0A 1YXMA 4ZQBA 3K92A 4NH4A 3FHLA 4YWJA 5EINA 1ADGA 3WOHA 3A9WA 2O23A 4LCEA 4CMIB 2HDHA 3I23A 3DAFA 1NAHA 1JLLA 2XAAA 4NG5A 4Y6SA 3WMWA 3KTDA 1C0IA 3OECA 4J3FA 3PTZA 2W90A 3OEWA 4BNXA 1OMOA 1BVUA 2ZYAA 1MUUA 2HMWA 2QRLA 2Y0DA 4QUKA 4KP7A 5JE8A 1ISIA 2Q2QA 4E2ZA 3IP1A 1GQQA 3I9NA 2D5CA 3KYDA 1SAYA 4E12A 3DDNA 2QIOA 1NHGA 2JKVA 4CUJA 3DBRB 2AQHA 3HJAA 4DYVA 3CMCO 4UEKA 4E32A 4WCFC 3S2FA 4A7PA 3TPCA 3PZBA 2IYOA 1HSZA 5G0SA 2Y1OA 2FN7A 4AJLA 3I9LA 2WD7B 3KBOA 4GVLA 4EDFA 3LT4A 1P1JA 1GADO 3W4IA 2BGLA 4DREA 1UZLA 1E92A 3VZRA 4CR6A 3C3XA 2AXQA 2DLDA 1K6JA 1RKXA 5KJ1A 1Q0HA 3VDQA 3DZGA 2BFAA 4TKLA 2DT5A 2YYYA 2CZCA 4WLVA 1AHIA 3U4DA 1P0CA 3JQ7B 4FJ1A 1PQPA 4XRRA 1PL6A 4CM8B 2NSDA 2RIRA 1CRWG 4X54A 2GNAA 3I83A 4B8WA 3ADOA 3WMXA 4XD2A 1R6DA 3QE3A 4W6ZA 3ZCXA 1JTVA 1DC4A 2RBEA 1ZUD1 2Z1NA 3GAZA 4WEQA 1K3TA 1P1RA 2CMDA 4RPGA 4CL8A 5ER9A 2DVMA 2EKLA 4CJXA 3NX4A 2OP0A 1YB5A 4YR9A 3RKUA 3E1KA 3D4PA 1QYXA 1LDMA 3KYCA 3SC4A 3QWAA 5BNIA 2X5OA 1HDZA 4CQLA 3FN4A 1ZMTA 2CNBA 3AJRA 4FFOA 2G76A 2GN4A 2GD1O 3L9XA 3BHIA 1LU9A 1UXKA 4OXNA 1ZK1A 3GH3A 4GI2A 5L40A 1UP6A 1I3NA 3SLGA 3K30A 1U4SA 1TB4A 5AXCA 2QZZA 3I5MA 1RYEA 4BNUA 4JN6B 4PG8A 3AY6A 3AI1A 5JCXA 3P7MA 3TZKA 1W73A 1KVUA 1X14A 3C1AA 4RLHA 3DOJA 2C0CA 1P31A 3P2YA 3U0BA 3DOOA 4IXWA 2BH9A 5EMHA 2Q4EA 3F5QA 2X86A 1O9BA 4YB8A 1MB4A 4LCJA 2DC1A 1Q0QA 5CDYA 2WM3A 4NNJA 4BNHA 3V2HA 3WICA 1DLJA 3MEQA 4AJHA 4YT2A 3FPCA 3ITKA 1WZEA 4LVUA 1R4MB 1WMAA 1WDKA 4UUNA 5T8KC 1YBMA 4ITUA 4UVIA 1R4NB 4YQYA 1YJ8A 3ZNNA 4G2NA 3D3WA 3HB4X 1DBVO 1UJMA 3NTRA 1O6ZA 4AJJA 4R3NA 3QVSA 1IL0A 3UOGA 3WTCA 3GNSA 1QORA 3WGQA 2HK8A 3QV1A 5LDHA 4CMCA 2YW9A 5JW6A 3EMKA 2XXBA 5TSDA 2ZYDA 4RVHA 4AJNA 3LDHA 5KVSA 2X1HA 1ZO8A 1E6UA 1H93A 2P9GA 1VL6A 3GG2A 1VJ1A 5CG1A 1R12A 2HO5A 1PJTA 2PA3A 1U7HA 3EHEA 3NT2A 3S2IA 2CF5A 1HLPA 5G4LA 1XQ1A 2BKAA 4J2OA 5F1OA 3EDMA 4ALMA 5IF3A 4F6LA 3BMQA 4B4VA 3R0IA 3AM4A 3D3EA 3ZNOA 4PZCA 4E5MA 5B12A 3KSDO 1Q1NA 4L4SA 3V1UA 2C07A 4EEZA 1MLDA 2BLLA 5DN9A 2EGGA 3IQDB 1Y8QA 4GLLA 1LBEA 2WYWA 3PRJA 3S8MA 1VL0A 2VT2A 3RC9A 4MP3A 5TLSA 1U3WA 4TROA 2DU8A 1MG5A 1EE2A 1U8FO 4R5HA 3F4BA 3WIDA 2OOSA 1A7KA 3K96A 2GN6A 5CDTA 1EUCA 1UH5A 2OUIA 5C3MA 4WE3A 5DBGA 1ONNA 3RC7A 2ZJ0A 1GR0A 4WPGA 1VE9A 2JD1A 4CM4A 2D1YA 3H7AA 4BO1A 3S2GA 3MJEA 1GUFA 3CH6A 2ZB8A 1C1XB 4BB6A 2HRBA 3IKTA 2Q45A 1PX0A 3M1LA 3PWSA 4E4YA 4Z0TA 4MO2A 4WLUA 1MXFA 4TRMA 2VZ9A 1HKUA 1I0ZA 3U09A 3PHLA 1ULUA 5L3ZA 3GEMA 1HRDA 3OIDA 3H9QA 2VHWA 2EGHA 4NBWA 4D44A 2BMAA 4PLGA 2X9NA 3WX0A 2Z1MA 2O3SA 3DHNA 5B37A 3UF0A 4LRTB 4W9NA 4RQUA 3V5NA 1V0JA 5I9MA 2WTBA 3KEQA 3UCXA 4CV1A 3WGIA 3GNQA 4II3A 1F8GA 3CIFA 3RJ5A 1KBZA 2BFOA 2GSDA 2UDPA 4OMUA 2WJPA 3EY4A 2B69A 1NWHA 4HX5A 1LXCA 1WW8A 4U5QA 3H8VA 4B7CA 4QEDA 2R00A 3K9QO 4YRAA 4UVDA 2E48A 2YQ5A 4B8ZA 3NKLA 1B15A 4RVGA 2EW2A 3WGZA 1N1GA 1E3JA 4EI2A 2J3IA 4GKVA 2OO5A 4K9DA 1WMBA 4BKQA 4YCAA 3QWFA 3GUCA 1ZK3A 3JD2A 1ORRA 1RM3A 1GDHA 4BS9A 1EVJA 4O6VA 4BMSA 4CR8A 1LRJA 4ALLA 1KEPA 3ZWNA 3KYDB 4CMAA 3R6DA 1YWGO 3RVDA 4CV3A 1KC3A 4WLFA 4J7UA 3OBBA 3AFNA 1IULA 4OKIA 5DCYA 3GFBA 3ZWMA 3F1LA 4I9HA 1H6CA 4LMPA 4DQXA 4MJLA 5K6AC 4PG6A 3G17A 2CY0A 1MFZA 2YV1A 5JDCA 3UKOA 4YJHA 4YEDA 2NADA 3LU1A 2CFCA 4J49A 3GR6A 4UEOA 1TA4A 2E49A 5G4KA 1RM0A 4BNJA 5A5EA 4U7WA 4DIFA 3KOUA 4PVCA 1KEUA 2JAPA 3PWKA 4DVJA 1PL7A 1HT0A 3RFVA 3N74A 5DF1A 3L6EA 4YT5A 4TQGA 4IDBA 3BYZA 1SCUA 2BGKA 1EVZA 2OXIA 3U49A 1A5ZA 3PQDA 4QTZA 2HSDA 4PLTA 5DP2A 1HDGO 1V8BA 1ZFNA 2VWQA 4OOFA 4WNIA 2V6MA 3AM3A 3H5NA 4XYEA 4E13A 1ZSYA 3QVXA 2NV6A 5ER6A 4EGFA 5THQA 4UAGA 4FBGA 2I3GA 5CEJA 4GX1A 4AJOA 3KYCB 4R1UA 1KY4A 4WLOA 4CV2A 5IZCC 3U5TA 4GX5A 4NU5A 3GVHA 5COBA 4CQLB 4R69A 5ITWA 2VNAA 3D4NA 4J16A 4IPTA 1E6WA 4MINA 1C0LA 3AUSA 3QA9A 3H9EO 4HFRA 3RUFA 4L76A 3NGLA 4WECA 3ZU4A 1KS9A 1YL5A 3B70A 4K6CA 1UR5A 4Y8VA 3GHYA 3PDJA 2AEMA 1EQUA 4RLSA 1RM4A 3JQEA 2VRCA 1ZSVA 1QSGA 3CTMA 5F1PA 5BNFA 4YAGA 4IZIA 1JU9A 3LVFO 2JCYA 4JX8A 2PLAA 3LZ6A 2VNSA 3H3JA 4PGFA 1YL6A 3GMDA 3CZMA 3HE3A 2JCVA 3E5RA 4F6CA 2TMGA 3Q3CA 1EVIA 2QYSA 1QYWA 3I9JA 1EFLA 3H3FA 4B4UA 4BO2A 3Q9UA 2C82A 1ZJYA 4BB5A 5F1KA 2X58A 4HFJA 2O7QA 3L4SO 1B3RA 4CM7A 3L77A 1C0KA 3F5SA 5KJEA 2IZZA 2GPTA 4LVCA 3RKRA 3N7UA 1YJQA 3RASA 4R54A 1WZIA 3ICPA 4M54A 2WWRA 3WGHA 2B5VA 1DIHA 1JN0A 3D3WB 4TWRA 3ZHXA 3B1JA 3EZLA 4NBVA 3SX2A 3IC5A 5A3VA 1PGNA 1XHLA 4PN3A 3FSRA 3PJGA 2Z95A 2JAHA 4OM8A 3I1JA 3INTA 1NQAO 4OO3A 3EVTA 1R0SA 3VKVA 1ISGA 2XOXA 4RPLA 5L7YA 1F12A 1YQXA 3C7DB 3ABIA 4O5OA 4ZRMA 3ZWPA 2B83A 4ZN6A 4XQGA 4I5DA 1BDMA 1SO8A 3H2SA 3Q1LA 4GX2A 1DC6A 1HETA 2I66A 4PRKA 4GWGA 1F06A 3VPGA 2BF7A 5C7IO 3HB5X 4WOKA 2PV7A 3BMQB 1BXKA 5JO0A 5L95A 2PZKA 1DEHA 4HWKA 4D3SA 5CEEA 2CDAA 2CSUA 3ZU3A 1PGQA 3AUTA 4ONEA 3RBVA 1AE1A 3GPDG 5ENVA 1NFQA 1N9GA 1EEHA 1VSVA 1Z45A 2ZQYA 2X0NA 1Y8QB 1DIBA 5KVCA 5G0UA 4YRDA 3AI2A 3SXPA 4YJGA 3LLVA 3ZHBA 4R1TA 5CDUA 4IJUA 4R9SA 4HNHA 4KDEA 1D4FA 1R66A 4GX0A 4IDCA 1PEDA 2Y67A 4YYZA 2DFVA 2QW8A 4L0QA 4RF4A 3RC1A 1W6UA 4OAQA 3BXXA 2TMDA 3OP4A 5B1YA 2NVUA 2Q99A 3QRWA 3FD8A 4E30A 4NFSA 4WOJA 4BGVA 5L51A 3JQ9A 5A3JA 1DIAA 2VRCD 4CM4B 4DMLA 3WLFA 4E5PA 2PH3A 1LDYA 3H9JA 3EAGA 1PS9A 3PLNA 4BOYA 1Y7TA 3WBFA 4GQAA 1F17A 3VH4A 4YA6A 4R68A 3DHYA 3D7LA 3L9WA 3GNTA 5TS3A 4ZD6A 4BO6A 2RHCA 1VPDA 1N8KA 4TZKA 1E0DA 2ZCUA 2O3QA 1UDAA 2E6UX 1U7TA 1L7DA 5JCJA 4K26A 1DHTA 1J6UA 4JP2A 4XJSA 1UAYA 3K2EA 4LSWA 3QW2A 2GZ2A 1ZKMA 4O63O 2DTDA 2UV8A 2FR1A 2CUKA 4R01A 5TIIA 2GUGA 2FRDA 3DAGA 3PK0A 3DMTC 4DPKA 5KTKA 2VTDA 3ROPA 5I7VA 3L0DA 3UVEA 1HLDA 4CUKA 1Q7CA 1GQ2A 1NVMB 4MVJP 2VWPA 2J5KA 2VCYA 2YV2A 3A1NA 2H63A 1IB6A 1OBFO 2FY8A 3O8QA 4DGSA 2V65A 2PD6A 5AXAA 5IXSA 1E7WA 3JYLA 4OXYA 4DLAA 3QP9A 4EYEA 4B4WA 1PGOA 2EKQA 4UVGA 3G3EA 4U8GA 3BHMA 3ANLA 5CHEA 1FDTA 3PJDA 4EW6A 5HM8A 1HYGA 1T4BA 5AXBA 1RYDA 1W4ZA 2X5JO 1YH3A 2IEBA 1BTOA 1ENPA 4RCVA 3DFUA 4NFHA 2VUSA 4XIJA 3OH8A 1SC6A 3AK4A 2ILTA 4KQXA 4AJ2A 4S3MA 4RV9A 4HNGA 3IUSA 4L4XA 1LEHA 3F6YA 3PIDA 2UAGA 4XYBA 5CDSA 1BXZA 2AG5A 2HLPA 2OZPA 3JYOA 1KC1A 3DZFA 4KWIA 4XQCA 4YJHB 1J5PA 4J4TA 3T7CA 3JQFC 3BZUA 1MXHA 3S1LA 4MKZA 4DIOA 5A9SA 2PKQP 1YE3A 1LX6A 1S6YA 2VYNA 4FQ8A 1JDJA 1LUAA 3FCOA 5JBIA 1BSVA 2IYPA 5G4KB 4DIBA 4KOAA 4CQMA 2D2IA 4EJMA 2AE1A 1H0KA 1HTBA 1ZEJA 2WDZA 4DWVA 4M89A 3EC7A 4PZEA 5FYDA 4RPHA 4W4TA 2FZEA 1O8CA 1CWUA 1R37A 3GK3A 3OM9A 4IGEA 3SC6A 4NHEA 2NUAA 3V1TC 2C7VA 2RH4A 2P2SA 1Y6JA 4FC7A 1HDCA 4ND1A 6ADHA 4CMBA 3IOYA 3WSWA 3G49A 4HBGA 2P4QA 3WXBA 3G0OA 2Q4BA 5CDGA 5KNLA 3L4BC 4FFNA 4ID9A 5JCJD 1NVTA 3ZGYA 4XA8A 2BI7A 1VSUA 3E03A 4BNMA 1QV7A 1C0PA 3FBGA 2RAFA 2X4GA 2X9VA 2DPGA 3NJ8A 3VH1A 3A4VA 3DZJA 4H16A 4CLDA 1A72A 4C7JA 3KO8A 2FZWA 3I9MA 1DRVA 1X7DA 5JYEA 4PLHA 3OA0A 1VJTA 4AJPA 3T7EA 3F1KA 3H5RA 4RVFA 3VZSA 1LLDA 2BFMA 3I9OA 4BQPA 1NR7A 2O50A 1ISHA 5JAQA 3RFTA 5JY6A 5JAZA 1W0CA 1V9LA 1VL8A 3WS7A 5A5FA 5TT0A 3PQFA 4IS2A 1PZGA 2Y1FA 4A5OA 4NR0A 1GEEA 4YVFA 2I9PA 4RJTA 4XYLA 1Y9AA
chains in the Genus database with same CATH superfamily
1V37A 2XCQA 3SIWA 4GG1A 3VU8A 1C7QA 1HQKA 3MWDB 3FWYA 1XTTA 1RKVA 1ZVMA 3KR1A 3QXHA 3D8RA 3KR9A 1MT0A 3NHYA 4EMTA 4G1UC 2PS3A 1LVUA 4N39A 5EHQA 3UPUA 3P9KA 1A96A 4DV7B 1KIFA 1YFKA 3MINB 4YI3A 3EK2A 4CKWB 1VXRA 5EG5A 4IQFA 3ZIUA 2RHMA 2JJ1D 5B6IA 1VIVA 1B8UA 3KZCA 4DLSA 2G9ZA 3FNQA 4KDCA 4MWDA 3SZLA 2BKUA 3EDOA 3HJHA 3FYUA 4E22A 4X1KB 5LYJA 2I7CA 3BK7A 1R7RA 2BI4A 3FAZA 3IBTA 4ETNA 3OQVA 5LJLA 1YOVA 3T7TA 3K0EA 3V4FA 3THRA 2ZPUA 1CVLA 1HT2E 3PQ4A 2JGIA 1KAOA 3IAAA 3KLBA 2FZKA 1CZRA 1QC5A 2GAJA 5JZOA 3RIXA 3GRKA 4JGBA 4X64B 1UQTA 1F8UA 2ZK7A 4EG6A 1XNGA 3UTCA 4BY9E 3SHTA 5EIAA 1DWOA 1H6AA 3WDKA 4HNUA 4MRPA 3L7CA 4Z4HA 3AY7A 3DYBA 4GEKA 3FHTA 4FGUA 2X5KO 1PU2A 4ND3A 5T6BA 1RRKA 3AF2A 4XW2A 4DPLA 5LU8A 2J48A 2V6FA 3L1KA 4DKJA 3K1JA 4MXDA 1N5IA 1HORA 1K68A 3ICVA 2VP0A 4ATNA 5L6MB 4RESA 2WYVA 5IANA 3ID6C 4HUJA 2IYLD 3RWBA 1TKRA 2FDCA 2IYFA 1QQBA 1JXAA 3ITNA 3I6BA 4FGLA 5BWMA 1ZUHA 3Q2KA 3O91A 4BNLA 1ID1A 5JAOA 1DBQA 1EG7A 2HLDA 3C4VA 2QTHA 3V7NA 1CR2A 3EMBA 3QFSA 1E2UA 4TV9B 5CNKA 2JFQA 4GMKA 2QX7A 5K0JA 2PWAA 3TECE 3LF2A 4IH1A 1TYBE 4RNCA 2AXEA 5AJVB 3EOAI 1KSFX 3IOEA 4L5YA 4YJKA 4LY9A 1GL6A 1X3LA 4ZO6A 1J7KA 5B6PA 5LP6A 3JARB 5L4NA 2J41A 4RJLA 4UBIA 3UAYA 1NG9A 1CT9A 3ADDA 1Z88A 4QGHA 4RUKA 1ZD1A 3LQKA 3LO5A 1K5PA 1PR0A 4OIFA 4AJEA 3NZEA 4C5AA 1O08A 5EIWA 3DUFA 3LW8A 5JWRA 2RE8A 4JWTA 2C1XA 3E84A 4YXWD 3QVGB 4HLCA 4M1ZA 2PXHA 3B7PA 4NJOA 4XIYA 2CJYA 3UAZA 1QQTA 1IWBB 1OI7A 2HNAA 4R2WA 1JJBA 3DZ8A 4Q1EA 2XB9A 2ZQ5A 1QGAA 2I80A 2R7NA 3FUUA 3LL4A 1GTSA 2FG6C 2GVNA 3FF4A 2PAAA 4GZ5A 3L0ZA 2XBMA 2N46A 4QECA 5FD8A 1LBSA 2A0XA 4UAUA 3H5VA 2H2HA 4X44A 2JVJA 2Y4OA 4UTPA 1G0NA 3S55A 3NIWA 3ZXIA 3LC2O 4P34A 1FTNA 1GRQA 2ZIAA 4OJNA 5DCLA 3AEKB 3TJRA 4KVAA 3RAPR 2J0EA 3QPUA 2R8PA 5THKA 5JSZA 2FP4A 1QM5A 4XOUA 3T41A 1YE8A 1UXGA 1HF3A 1U2SA 2H54A 2C77A 2H1LA 3ZS8A 1KY2A 8ATCA 4FM9A 1PL8A 1T91A 3FH0A 3NOQA 2P78A 3RJZA 2QRUA 2RIPA 4ZEWA 2VHEA 2QTVA 2ORED 3NVMB 2JI8A 5IVHA 4P0QB 4V02A 1L4UA 1QHIA 1E7RA 2VJLA 3B1FA 4TXMA 4TXNA 3ZXUB 1CRPA 1QAQA 1PWXA 1Y6FA 4DB2A 2EXXA 2XUPA 1TIBA 1E9VA 4Y7CA 1ZGAA 1H3EA 2CXOA 2C3PA 3M3PA 4JBXA 5FTNA 4MV0A 1A9QA 2XSZA 2C20A 5IAEA 3KCQA 3TZEA 5ALGA 2A5GA 3LPDA 4YYEA 2K7ZA 3JVVA 2IHKA 1WBJB 3GVXA 3OQIA 4WNAA 5F5XA 4FFMA 4JSTA 2CSXA 4DA8A 1KGSA 4QOHA 1X7YA 2QTFA 1QFMA 4UHCA 1Z4LA 3HYSA 3A2NA 2NU7A 2H16A 3GMTA 3OTGA 2WQZA 1PFGA 3C24A 1U3CA 3MXTA 3P19A 3T3OA 3VSDA 5HIJA 2JHFA 2CNKA 3FG9A 3V1NA 2Q2NA 1OZHA 3QU2A 3TSAA 1Q15A 3QKRB 5JFOA 4QVGA 4PG7A 4Q9KA 4LZJA 1A50B 1W30A 4KPGA 1IB0A 2PMBA 2HLDD 3VKFA 1YFJA 3AC0A 4MKXA 1K8RA 3OPYI 4LFBB 5EQDA 3VC2A 1C5KA 3X1JA 5GAJA 1C0EA 2IYEA 1YZTA 3M34A 1CYDA 3HZZA 2SKCA 5LN1A 1NQVA 4NOMA 1NNLA 1Z0JA 2C4MA 3NWJA 3ONEA 1PZEA 1T1GA 1UM8A 3A6EA 3OA2A 3R8CA 2AOUA 2VN8A 3QPWA 3V33A 4JP5A 1SVNA 2W7TA 2YC2C 1M6EX 3ISJA 1JNYA 3PFBA 3NEAA 4MPDA 1BS1A 3BB1A 4QDXA 5AVKA 1NN5A 3T9DA 2JJ2A 2R85A 1M72A 1RNLA 3ZHQA 3WAJA 9ATCA 1PZFA 3NBQA 4DDMA 1YS6A 5I9TA 3U3JA 1NN1A 2AYZA 4CQJA 3VO2A 2ZUCA 3CEHA 3T9CA 1GA1A 3QBJA 4FR0A 1NUHA 3PD1A 3IO3A 4WASA 5CR9A 3A6FA 5AJTA 2OPHA 5K7SA 5A9SB 4BIIA 5KHOC 4DZRA 1RC1A 2BMDA 3HH8A 1MFPA 4YRBA 1JEQA 1N7GA 1SFRA 1UXHA 3ZDFA 4AURA 1W96A 1PQUA 1ZHHA 4M46A 1PFYA 2FW8A 2J67A 1K1EA 2GEFA 3PFCA 4M0LA 3SVTA 3QTBA 1BQ3A 1GFIA 1UZUA 5F73A 2WQ6A 1B26A 3KR2A 4J6FA 2CJWB 3UEOA 1JFTA 3DG9A 3R5KA 2WFLA 3R1IA 1DSSG 4JP8A 5AO9A 4A10A 4KVGA 4ALIA 3P45A 2EWMA 4M8NE 3T35A 2VAXA 4YTEA 3O4JA 3ROQA 4N3CA 3WG9A 2J6IA 1UFRA 1SD2A 2PLNA 2ENUA 2BFCA 2P8JA 2Q49A 1JVNA 3P9NA 3PGJA 4EB8A 3ZWYA 1G291 2ZYTX 3LV8A 2IXDA 2ZKIA 3ZZUA 2CYAA 4TLEA 4DQLA 2WMOB 3BJIC 2B7BA 3A36A 3KM0A 3MGBA 4CMKA 1DG3A 1KVSA 3M6LA 3O8NA 2XMPA 4O4IA 1ORVA 5E2IA 5JRDS 1PR9A 1F8YA 1KYYA 1FSSA 2XSZD 4EY6A 4KTTE 5COQA 1K89A 1NP3A 3OICA 1LD3A 3TQTA 4WI1A 5EE1A 2A9FA 2O48X 4I7EA 3UMFA 2CJXA 1S4MA 3HUEA 5CVTA 2QQEA 1PLLA 1G8HA 1XBTA 2A57A 2RGEA 4YPFA 2PT6A 5SYAA 4MDYA 4C3UA 1KSJA 1AUPA 4QHYA 2NTEA 4Q9IA 4FMPA 2H51A 4XR9A 2OMEA 2RKOA 3KOXA 1BKYA 4R2IA 2VWHA 3DT8A 1X7ZB 4TL7A 5EXXA 4IHAA 2R751 4KR3A 1GPYA 1PT5A 1Q1ZA 3DONA 4F3NA 1HI9A 3STXA 4JL5A 1Q50A 2J5BA 4N3BA 3SS7X 4I1VA 4OP1A 1D2RA 3ZJ4A 4FB5A 2XZDA 4JLUA 1YVEI 4IIBA 1JHDA 5EP1A 2IU0A 4E6EA 4A73A 3L1UA 3H2GA 2Z5VA 5FTKA 1XALA 3FR8A 1JDZA 1G7SA 1R27A 5LOVB 4E03A 1BOFA 5D3MB 5A02A 3NGMA 2F2TA 2E0IA 1SXIA 2REBA 2NYVA 1BEZA 1SRRA 4EVRA 1N0UA 3VSAA 2W2LA 1MJGM 2WG1A 2YOFA 3AQ4A 3O5AA 4A8PA 2EBWA 2BEJA 4KAAA 1VGRA 4HKTA 4PSKA 1PKEA 3V8VA 3F8WA 1KOGA 1PS8A 2RAVA 1GWNA 4L4ZA 4P5DA 5FBKA 4MHTA 1M2KA 2BGRA 2V7QA 3ZC3A 3PP8A 5HIMA 5HTKA 3E6AA 3I2GA 1I7DA 1OIVA 3OLXA 1P7ZA 3SM9A 1XCPA 3UMCA 3HU5A 3VPCA 4EDHA 2H4JA 3AU8A 5EKDA 2JJ2D 5HUQA 3L8DA 1XPRA 1KZGB 3CLRD 4QYWA 4ER5A 5AK3A 2FDXA 2OXEA 3DLTA 5KJFA 4XM1A 4KO3S 4NDNE 4A8JC 4J0FA 1ISMA 3LQYA 4IMJB 3WLKX 5IT0A 2H9IA 4XJTA 2NX2A 4YWHA 2QRZA 3H5WA 3QX7A 3TLAA 4G25A 2P5UA 2B3DA 2PQ2A 1GLNA 3AOEC 1G8GA 1LS6A 3FDFA 3GARA 3PGKA 5CT5A 5JFTA 5MF6A 2JLYA 4FB4A 4AY6A 3QU4A 1QVZA 2ZP1A 1LI7A 2WJHA 2ZVPX 2OYSA 4AUMA 1LPBB 4AZ3A 1KI4A 1NVAA 3A6LA 2F55A 4L1KA 1QYVA 3LK7A 3GXOA 4F86A 2WU3A 5FH9A 3WK6A 2W2TA 3FIUA 5F9MA 2W70A 5ES3A 4HQOA 2RONA 2J45A 4MYDA 3TO5A 2Q5HA 3UJ7A 3BORA 1Q44A 3W5HA 2POQX 1T36B 3WWCA 2TMYA 1MW8X 4HVCA 2GYVA 4IJMA 4RK7A 3WWZA 5FNVA 3DFKA 1SB8A 1B41A 2G83A 4JU8A 1B16A 1G8MA 1T8RA 2Y2VA 3ENKA 1M75A 1KTIA 5IMSA 4XIGS 1F38A 3QPDA 3UGKA 4OQYA 2PNFA 2AQIA 4D99A 5E7IA 3JAMA 2YN4A 2XHEA 1J06A 1HGXA 1JXMA 1YDFA 3OURA 1W2HA 4IL5A 1D6MA 4OBWA 2QVGA 3I9V6 4JB2A 4D4MA 1BGVA 2BGMA 1LDEA 5JQGA 3ZGLA 2HWWA 2I03A 3ZUPA 5AUOB 4OLBA 5F9HA 3EF3A 1GL3A 1M67A 2YR0A 2O1EA 2X1VA 4YQZA 5E3JA 1I6MA 1XZHA 2YOGA 4KE8A 2MCFA 3ZK9A 2G9NA 5BWOA 1IN1A 3D3KA 1BQ4A 2XTAA 3QPAA 2J59A 4TVKA 5JZMA 3CBGA 4QSHA 1IHYA 1ZNYA 1M2GA 1K63A 3OPNA 3RSCA 4P3YA 3TOZA 2X2EA 1KBOA 4E5VA 4RMJA 3ABSB 4F06A 1WZ2A 3EQ9A 4C0HA 5KYXB 1P4SA 1OFTA 1AMUA 2CD7A 2UKDA 2HJWA 1FX0A 4BV9A 1H2BA 5EESA 1U0TA 2ZWPA 5T4BA 4G0ZA 4EQ6B 2IPLA 2VK1A 3WGMA 1J1UA 2BHTA 3I64A 4YJDA 2CW5A 2FWMX 2W2LD 3A27A 1USWA 1A9ZA 2NUTA 3O47A 5SY9A 4KXFB 1VB3A 5HILA 4LHSA 3WJ1A 2V6BA 5IKOA 5IAJA 1WD7A 1A82A 3HM2A 3P0IA 2V7QD 1E9RA 4HY3A 4R8LA 4KPFC 1X39A 1XMOB 1OC4A 1V39A 2JK0A 3BH6A 1FUKA 2BV3A 3C3YA 1VGVA 2VNIA 3PJFA 3TRIA 3G1TA 2X9LA 3O3MB 3QVWA 2VDRB 1OFUA 2IHVA 1L5QA 1XLUA 3DMHA 5C1PA 1XEXB 2VHCA 3U26A 2P2LA 2RD2A 2MYNA 4U7GA 5LCXA 4FOSA 2JASA 3PE6A 4F4HA 5IAAA 2ADMA 4XH9B 5BURA 5IT4A 2FVXA 1M8JA 2GPJA 2BHLA 1WQ1R 2AD5A 3BXZA 3JXEA 5FIUA 4DWWA 2ZIGA 3K9BA 3E9NA 1XXHB 3KKKA 4U0JA 1L5RA 4YJ2F 3W8DA 1U9CA 3KOOA 3EZNA 4JAVC 1RE0A 4L2IA 3ZW8A 4EZEA 3SHOA 4B6OA 3UHAA 3B13B 3OE7A 4HH1A 2I3DA 4YJ2B 3HMQA 1OASA 1UBKS 2CEAA 1YDEA 2YJZA 4YDRA 2WIGA 5KAPA 2BP7B 2HK7A 1E20A 5K3DA 3VH3A 4HDQB 2G9UA 3GLTA 4PZYA 2HC9A 3BM5A 3STTA 2B99A 1VMEA 2GKSA 4X8HA 3U60B 1V5GA 2GDJA 3VGPA 4O8ZA 4FSHA 5AJUA 1W4BA 4ZGWA 1M66A 1NDHA 1J39A 2DTXA 3ORFA 5DSXA 4JI0B 2O3UA 2P0EA 3OSUA 3RUCA 2HWKA 3CHYA 4DJTA 4B6GA 4Z9XA 3CEAA 4D3XA 2G08A 4AKTA 3AESA 2ZRFA 2C4NA 3P2OA 4UU0A 5DYWA 2B4AA 4O2LA 3ZG6A 4EPYA 4N41A 1D07A 5AVJA 1J0BA 3LDGA 4UU7A 1TMKA 2Y05A 1HDXA 2GK4A 4E3WA 4ZK2A 5F7OA 5IVPA 2UUAB 3F9IA 3W8FA 4J0EA 1XA4A 4HVLA 4C1BA 3D4OA 1I9GA 2GRUA 3KSZO 3T9BA 2IYVA 2QTBA 5EZ6B 4AN4A 4HUQB 2IKQA 5FR1A 4JLSA 5CD9A 4D9EA 1CHDA 2ZTMA 1G9XA 4NVRA 3NEPX 1T34A 4QUEA 3RANA 1YSCA 2WPDA 5CK4A 4ARCA 3N2ZB 1Y1RA 5BSFA 3WNZA 4ARBA 1L9XA 1C3JA 3GPCA 4NHOA 3TKAA 4INAA 2IUTA 1K86A 1LZKA 2A5YB 3FKJA 3N05A 2XE7A 4MVJF 4RYLA 421PA 3NUGA 3PUXA 1TMGE 4LRUA 3I2KA 5A03A 2H1CA 3VQTA 2B36A 1CQJB 1YFZA 4TV8A 3TDMA 2QQ5A 1GAEO 1R50A 1VRCA 2B94A 1OH6A 2VCEA 2F3RA 4WGGA 3EPHA 3QY0A 4TT3A 2C83A 2XNCA 3G2MA 3I4FA 3H17A 3K9CA 1PZXA 3X2EA 3ADKA 2IHBA 3INNA 1X77A 3AV0B 4TYNA 2ONKA 1IZYA 1GU1A 2PPVA 2YV4A 1R5NA 3GFFA 5BSGA 4IGFA 4EG0A 5AKGA 1YBAA 1G3UA 1YUMA 4JJKA 5BMOA 5JWHA 3AY0A 4BNVA 2V8OA 3BGVA 4Q4AB 3K71B 1QLJA 2OD7A 4Z9FA 4N03A 3EXIB 1AGYA 3H9GA 3A0UA 1M7BA 4TLDA 4JSRA 3OHSX 2FPIB 5IMBA 3QEAZ 2WSIA 4BFTA 5EZYB 4D8UA 1XR3A 1AD2A 1D0IA 2GJKA 2QG4A 4NYIR 2PQMA 2BMVA 4KFTA 3EGXB 1ZWLA 3R6LA 1JA0A 4HH3C 4TYPA 1NI3A 2JIQA 3R75A 1N2CA 3EC1A 4PR3A 1Y9JA 3S2UA 4A0SA 1Y5MA 4JXXA 1YI0A 2R8YA 1XCMA 5KMGA 5CB8A 1RQ2A 3LFTA 4KXUA 1Y7LA 4IIHA 4J3JA 3SJUA 4UCWA 3WTBA 3ASYA 3B6MA 3F6EX 2AFHE 4LI0A 3S68A 3KYIB 3K0CA 3TG8A 1L7PA 2Y1WA 1ESMA 1JYFA 2O1XA 3CNOA 2MSWA 2VLBA 1DTWB 2XODA 2ZUWA 1R1DA 2ONZA 3OE7D 3D7RA 3TOSA 2HQRA 4BO3A 1RI1A 4PG4A 1GG2A 3PHGA 2PL9A 4UTRA 1MEOA 3SGLA 5CT4A 4NYJR 2AN4A 3W2GA 1LZLA 3AUAA 1PT6A 3R3YA 4F21A 5KQPA 2EQAA 4LJ4A 3ADPA 2J8ZA 2QENA 4G0QA 1IXSB 2VXOA 1YCFA 3OZTA 4YC7A 1BW9B 3WFJA 1J1IA 4WVFA 4U6SA 4PS1A 2BEWA 2A7QA 2WWYA 4GPAA 3ANSA 3KHKA 1YNOA 4I36A 3U3XA 1Z68A 1GPWB 2QZJA 2PYZA 3DC7A 4OGKA 4ZMRA 1RADA 2W37A 1ECPA 1GKIA 1SCJA 2WU0A 1A4UA 2HUNA 2PJDA 4LTNA 3SLKA 1GG5A 1N3LA 1RQXA 2G8NA 3OZRA 4PZ9A 1EGHA 2WMYA 2XDWA 5AI9A 4EHKA 4C0KA 3M2PA 5HGJA 2O7VA 2GI4A 3OSZA 4P4GA 3Q9NA 1SXGA 3NBUA 2AEEA 2P6OA 3DYVA 4HB3A 4N0PA 1XD2B 3CUUA 1JWLA 2AF4C 5K0BA 3BRCA 1NLYA 2BR3A 3KLOA 1NRXA 3IOCA 2PTGA 3ND5A 4U2DA 4E2XA 1JQ5A 5KNDH 2ACWA 5E7MA 3WMEA 2IS1A 3Q0EA 3AVOA 4A26A 5LQMA 1D1TA 2WPDD 1ZK0A 4JLNA 1ORTA 3M6MD 4WL0A 4AULA 5KKCA 1S2DA 5H9VA 1CYEA 4LPKA 5KQGA 5C7YA 3MERA 3EULA 3WL6A 2E37A 4N7JA 4LVOA 4PLYA 3P9XA 4EWLA 1V35A 5C37A 1RXUA 1ZCFA 3LUPA 3DE2X 1X74A 1YJXA 2CMFA 3GQBB 2X7HA 4MV4A 2FPMA 2FGKA 3PVCA 1RFLA 4X8OA 1E3SA 2E4WA 1XRLA 3F90A 1T2AA 2WUEA 3T5PA 1FS5A 3P5SA 4QYMA 4TT3D 2ET6A 3AEYA 1PV1A 2FDRA 4GLOA 3VZQA 3ZEAA 4EY3A 1ZM2A 2Q21A 3BKXA 4FS3A 2HJSA 4Y0NA 1N1DA 1E4EA 2Q4DA 4OQZA 5BRNA 1N25A 2YQ4A 3UW3A 5D3QA 3HJNA 4Q48A 4Q9HA 3FPHA 2IPAB 1PCXA 3INRA 4L5IA 4ND7A 4PPYA 5G0TA 3TFQA 4AZ0B 5EUMA 4IV0A 4KACA 1A9PA 2NPOA 1ECLA 1RIFA 1V3TA 2WWXA 4DQVA 5FJIA 2E82A 3V7FA 2XMBA 3WHIA 3W5DA 4BO7A 1XG5A 3CLKA 1Q7RA 4E21A 1LGYA 3NS7A 4RZ2A 5ALNA 3S8EA 4J7XA 1XTKA 5AWFC 4HAUA 3V55A 2WTUA 3CPSA 3GLGE 1NXOA 2Q07A 3HS3A 1BA2A 2NM0A 4TTRA 4CETA 3N07A 3JAWA 1U31A 4S1PA 1QZZA 2I6TA 1Y4AE 4IIXA 1T2EA 3BXGA 3PHIA 2IH2A 1DP4A 1KETA 3FCAA 1K5GA 2IK8A 3LT1A 3OPYA 1BHO1 2PLWA 2GF0A 1FXSA 1XEAA 4N7RA 1X1TA 1RFGE 2VH2A 1J5XA 3CKKA 4C20A 4BKRA 1TEZA 3HA3A 1TK2A 2Y66A 3ZV4A 3FYSA 4ARZB 4J3NA 1VPEA 3HZHA 3KB6A 2GERA 3RSZA 5J2TA 3A6GA 3GJ6A 3PQCA 4JC5A 2ZBDA 1BVYF 2H17A 3EDRA 4IDFA 4PX5A 1ORWA 4CM6A 1W1IA 1WXDA 3FWZA 4MS3A 4Q24A 1AA9A 3NUQA 1P1FA 4N9QA 2CLDX 5GOZA 5B58T 1VP3A 1WWKA 4Q5IA 4FYVA 2J6BA 2XUGA 1EVKA 1MNAA 3VR5D 3RYHB 4RGYA 3RLFA 2N75A 1GRRA 1UBTS 1G8YA 2ERCA 3OJXA 1O87A 3GFOA 3PR3A 4D0LB 1NASA 3AHFA 4L78A 3EB9A 3RHSA 2UVDA 3VUFA 1L7BA 2VWGA 4QYSA 1U28A 4YACA 4KUHA 1R8SA 1AXGA 4DQ0A 2OYRA 4YFVA 3KV3O 1EFVB 2FKAA 4REMA 4QBKA 4RKWA 3OMLA 5E2AA 1DCKA 4MR8B 1PG5A 2I22A 2FG7C 4PGMA 4HSEA 3COVA 3N8IA 3PUJA 5C4IA 2YHBA 4WV3A 1NNUA 1GZ3A 3CSSA 4AL4A 3RRMA 3IALA 3L04A 4LOIA 1GQYA 4RLQA 4V0LA 2RI0A 2GAAA 3S81A 4QBFA 4URUR 3MTDA 1AK1A 3K70B 2PT9A 1KI1A 1LW7A 1NYQA 1NOJA 3EUFA 3FWPA 1WSDA 4Q6WA 4UQPA 4BVHA 4YHBA 2CLMB 4P4SB 4TVOA 1N57A 1E3WB 3ADCA 2CFOA 3I2FA 5FLKA 2PUAA 3BCUA 3AB8A 4NYJQ 3TW4A 4C0BA 4TKMA 2JIDA 3A4LA 1UPAA 1QOPB 1Q0LA 1Y6ZA 221PA 1VBMA 5H68A 2NSYA 2OQVA 1DIGA 2D5LA 3HWWA 3R0QA 5WRFA 1MH1A 1KSHA 1JDTA 1V8OA 2I2FA 2JS7A 4P3NA 4WXEA 3U40A 3UH1A 4JI7B 4LF9B 2WSBA 3U31A 4O3FA 2BLNA 5C5IA 1ONBA 3LPMA 1QGUA 2B20A 5EJEA 3T52A 2OFWA 2FSPA 3EZFA 1OZFA 3N2YA 4LJYA 5GZ1A 3U6BA 3BWYA 1HURA 3HCBA 3JQAB 3QEMA 5IKXA 3GT0A 3ZQJA 1YBFA 4MRVA 1XMSA 2GRAA 2YMPA 4UJ5A 3EF1A 1VBNA 3CIOA 1B0AA 3U1TA 4D74A 3CVUA 5J9FA 3AO0B 1HT1E 3TGLA 4KHZA 2B30A 3JD1A 2QMEA 4F60A 4CUJA 3DVAA 1SIWA 1QR2A 1NIJA 1XJ5A 2WINI 2FEAA 2W2PA 3RRBA 5CB0A 1VHQA 3DMYA 2FX3A 3QEJA 3T7AA 1Z82A 3LUFA 1Y1QA 5A7HA 3HABA 5EIOA 3WMGA 4ZEMA 5KO2A 4EMBA 1WCXA 3ZHTA 4E46A 4G84A 1P3JA 4MKIA 3GGPA 1E2PA 3GIDA 1E8NA 3X1XA 1XPJA 3D0KA 4WSOA 4EZBA 1T3HA 4CKBA 4QATA 3UJNA 1EFKA 1NGSA 1NFRA 1Z74A 2BUCA 3FPJA 1TZMA 1Q7TA 5K3FB 1HMYA 2ID9A 1DRUA 5FBHA 2DR0A 1QRUA 3ZLTA 1SELA 3WL5A 4GWKA 5IK2A 5KC9A 2CCKA 3OHMA 1M6HA 2V7TA 2GEJA 1MH9A 5AK5A 5FPPA 3WGTA 4DLXA 3WLRA 2PGLA 3RSHA 3UQZA 1QH0A 3OP1A 4S04A 4U00A 1LSSA 4PNEA 5LD2B 3VAAA 1IATA 1OTXA 1M6VA 4U9IS 1C1DB 2QPLA 3OJFA 4Z49A 5JWOA 3RD5A 2Q29A 1NJSA 2W2KB 1FFDA 2DR3A 4ER3A 4HDSA 2GR9A 1FF9A 1QP0A 5K45A 1JAHA 2IZ0A 2WTNA 4RFVA 3WY9A 1KFEB 1YRYE 1H9AA 3M9LA 2JAQA 2IYXA 3NHRA 4MHOA 4B2PA 3H65A 2CMHA 1Y80A 2XUHA 4KUEA 3BQMB 3O38A 4CBVA 5C7LO 1V41E 1N8SA 1VYTA 2GJ9A 2JEZA 2DMRA 1QTQA 1JTFA 3RI3A 5BR7A 3W2IA 5LU9A 3ZD7A 1E6CA 1NSTA 2NVBA 2HJRA 2QVBA 4P8RA 4EB6A 1PRYA 3BD8A 1S4QA 4FYIA 3SICE 4DLKA 2UUBB 4YXFA 1ILEA 4O2RA 1T4CB 4Y2GA 2QW0X 4LGVA 3K6KA 3PXUA 1E69A 4WAUA 3UAGA 4GDFA 4R1NA 2VJCA 4LYAA 2B4TO 1Z35A 1ZJ4A 2HDOA 5REQB 5C1OA 2BFPA 1DAKA 3UK1A 2X9GA 2KE5A 2VJYA 3KPWA 4R2JA 1GA6A 4B87A 1E2KA 3CNBA 4M2LA 5IXJA 4FP9A 4R7TA 2H4ZA 5D3KA 3M9WA 4WLNA 5J2UA 4WKGA 2EV9A 3RIEA 1BG6A 1MRSA 1U3TA 3KQKA 5EWMB 2WHRA 1RXIA 3N5KA 3IOMA 1Z62A 3AI3A 1Z4KA 5E1DA 5HBGA 2F1KA 1CW2B 4ZTUB 3HB1A 1NJ6A 4P6VF 2FSFA 3U44B 1L4MA 1X2BA 2VQ3A 3LHSA 5D7BA 1Y3AA 5K3AA 4N8EA 5FPQA 3GGOA 3LLUA 1RW4A 5B1IA 3SC2B 4PVDA 4JVLA 4IR7A 1FJHA 1NXWA 3KBBA 1YZHA 3MJFA 3HVRA 2VAWA 2J85A 4Y2HA 2EEZA 1QCCA 2H18A 4BBPA 1OI2A 3ILVA 4GNKA 2HLNA 1O96A 3A1TA 1TLFA 1W5SA 3N7AA 2IYRA 2CYBA 4IIGA 3KK0A 4U3JA 4BRUA 4YUXA 2ZYSA 1KH2A 3UQYS 1LV7A 4K2AA 1HE5A 5DYYA 4GYWA 5KINB 2H85A 4Z86A 3F98A 1NDQA 1H9BA 3KFLA 3C1TA 1U8YA 4RF3A 1K9SA 1OFGA 4R2HA 1E0JA 3KKEA 2E4YA 3CURA 4MUBA 1UKEA 5AHKA 4FYWA 1VI6A 1IU9A 2Q1WA 1TX4B 1WM1A 4ND8B 3OE5A 1DAPA 4YO7A 1D4OA 1UP7A 3F9RA 1VLZA 3N3AC 4OU5A 4H4CA 2HMTA 4EK9A 5IM4A 4KRFA 2QE7A 1DDOA 5L3SA 1E59A 4Q18A 2GK3A 3QE2A 4RVSA 3QUAA 5EXDA 4K9NA 4G5XA 4KXYA 1AB6A 4KNYA 3RW9A 3PFWO 3QEKA 1PJSA 3U4QB 4J43A 2QVYX 2WSSA 3AU9A 4L4RA 1GCOA 3SF8A 4XCVA 5EWLA 2Y0BA 1DHRA 3CVOA 3PXXA 5BP7A 1XB2A 2G0NA 1Q12A 4EH1A 5IK2D 3AQIA 4EYOA 4UREA 1HX7A 1EHIA 1OPXA 1N9KA 3LT0A 3C8ZA 1I13A 4L9AA 1H22A 1PJ3A 4BLUA 4C22A 4CN8A 1QTRA 3NM6B 5KYGA 2XZOA 3ZJTA 3BMNB 3TZ6A 1YZKA 5BQFA 3DE1X 4OJQA 5HKOA 1BE0A 1SPBS 2PUCA 2HI0A 1D8AA 1OH8A 3CUKA 3DEAA 4WADA 1XA0A 1G21E 4Q47A 1GFWA 3FPLA 2QTAA 3QM1A 3U62A 1VJDA 2ZVJA 4DUGA 3TZCA 4UOZA 4DY4A 1XFDA 3FUVA 3ST7A 2ZCVA 1JPNA 1NURA 2QP3A 4H9GA 4MP8A 4JBHA 2XNKA 2OAGA 3OKFA 1GAXA 2FCAA 4R8VA 3ZHYA 1DXYA 3LKZA 4A27A 1T0IA 2CFIA 2FYTA 2OV1A 3FIJA 4RGBA 2P65A 1WNTA 2OUKA 5C8DA 4WXMA 4JELA 3HP7A 1K7FB 4MJ7A 4EZIA 2BFWA 1K2WA 121PA 4DANA 1U8EA 1YMUA 3CZRA 3NOXA 3GRRA 1HYEA 1UDXA 3HVKA 4FW8A 5LQDA 1ZH0A 2EERA 4I1IA 1KY5A 3UMJA 5BOSA 3IAM1 3NM5A 4Z1MA 3IKVA 1P7YA 4K6GA 2B34A 1R5BA 2WVGA 3EG9B 3HB7A 1NQ5A 1SB9A 3KSUA 3F3SA 1J07A 1Z8NA 5JEEA 2OGWA 2FSUA 4OSEA 3W5VA 5U4QA 2B37A 3W9UA 4FHDA 3TB6A 4HDNA 4S2UA 3SQDA 1IIRA 2FEPA 4HNTA 1R9NA 5DGTA 3O1JC 2CVHA 3QEOA 4IIVA 1Q6ZA 2C8JA 5AIAA 4A5SA 3THSA 3NC1C 5I9IA 4CM9A 1CDOA 4CMEC 4PPFA 5H82A 1IDN1 3R3WA 3T1HB 1KNQA 3MCAA 4M4SA 3ZDAA 3VOAA 4C5BA 4X1OA 3UT5B 1QGOA 4L5JA 4RKQA 2GDZA 1GGKA 2W2XA 1PBNA 1GTJ1 3DLHA 1NKSA 4MUGA 1UBSB 1I0LA 3HKEB 4CODB 2NU9A 3TJMA 3A1UA 2FSGA 5DHPA 3LOPA 5DIFA 4R4JA 5BSEA 1ZU4A 1WD5A 5AW8A 1L7AA 2OT3B 1DXOA 2QE7D 2PMKA 3BMCB 3SE7A 3WWEA 4C43A 4KR7A 4ESEA 1P1CA 1ZNQO 2RCNA 3PC7A 4JD5A 2YICA 1DQRA 4KMRA 4Y67A 3UW1A 1T24A 4BGDA 3MUOA 2BFDB 1YR6A 3VHXA 1DXQA 4ZIRA 2WSSD 5C1DA 1NQOA 3EGIA 4WJZA 4P4TA 1RPNA 3UICA 1CZLA 3UUWA 4DXDA 2IX3A 2BKEA 3EGDB 3L3BA 1V6CA 4FDAA 1J8MF 4MEAA 5B2ZA 2G40A 4A8JA 2GPAA 3QF7A 5M5BA 3ZE1B 2VJKA 4TTJA 1EBFA 4F96A 1XJ0A 4Q7EA 5J5AA 5BYAA 4CIYA 3C1UA 3LWNA 5D00A 4WJLA 2NU8B 4PC7A 3JPWA 3QE9Y 3AOEA 2CLCX 1YONA 4LDPA 4UTOA 4YMUA 2WZCA 5JXJA 1T43A 5BQOA 1XA3A 4HQ0A 3ER6A 3BMXA 2OCBA 3EUEA 4ZU1X 3ZI7A 1ND5A 1P6XA 3C7CB 1SXQA 5GWXA 1DARA 2V7WA 3LLCA 4CPDA 4DUGD 1PJ4A 4EUHA 5DK6A 2PMCA 4ZCSA 2QI9C 4RKRA 1CY1A 4LVNA 1QVWA 4KN6A 2NLOA 3AR4A 4TUYF 4Z99A 4GM1A 4RK5A 4D9GA 9ABPA 4F3TA 2Y27A 4YMWA 3CV3A 4P36A 1Z6TA 2ECFA 1H3NA 3QXJA 1FLDA 3UHPA 3W5CA 1GZUA 1TUGA 4OSPA 1F3OA 2FETA 1QV9A 1XYYA 2IDMA 2ZI4A 1WF6A 3JD4A 4DY6A 2E21A 3IEKA 4TRRA 3JASA 1E6EA 3GFPA 3EAFA 5CYOA 1RHJA 3OFKA 3GUYA 4F7DA 1BDIA 2Y1DA 3OZEA 4BFUA 1AY0A 4L9RA 1LPNA 4FU0A 1QHSA 4JLAA 2R6JA 4J4BA 5JH7F 1B6GA 2C78A 1ADYA 2SKDA 4NZNA 2BGJA 3TS1A 4Z1MD 5KQSA 3OCXA 2WIAA 3P52A 3ZE2B 4CMIA 5BPFA 5IHPA 2YINC 2Z98A 1XZDA 2CK3A 2AJTA 1TPZA 1SN7A 2ID8A 4FUQA 5JH7B 1F5SA 4XB2A 4BZXA 4DLWA 3FNEA 2ZWMA 3WKAA 2KX7A 4REQA 4S1TA 3RUAA 3M82A 4QYTA 4IWNA 5HXAA 4XYGA 2P79A 1BJRE 1TM7E 5T5QA 2F3PA 1D7OA 3X1KA 2X0IA 2OCIA 2O7SA 3PR1A 4Y30A 2NV0A 2G4LA 5BN4B 4CM9D 1U8CB 1N1EA 4RSMA 2WU8A 1IWPB 2MINA 3HHPA 1F3LA 4M3NA 1LJLA 4RKYA 4BFSA 3UHOA 1XLVA 5DHUA 3HDYA 1JR3A 2QTCA 4M38A 4B0OA 3GRYA 4I5EA 5JSQA 2WJJA 1MEEA 2QLMA 3O4GA 3ODPA 3HCFA 5TGTA 2VYCA 3A9VA 4V24A 1ACMA 1UFVA 3QIAA 5B3LA 3X1YA 4WJKB 5FBRB 1Y5NA 2DTEA 3WKEA 1PVOA 2B82A 5LSAA 4KN9S 4P1ZA 2OENG 5T3YA 3RGGA 4L15A 4U9HS 5JG7A 4YQFA 1SKUA 1M7GA 5AW6A 2O7RA 4BNGA 4C76A 4WERA 5DXFA 2CEKA 3L7NA 2DUUA 2QN2A 1I4EB 2VDLB 3IP8A 5H59A 3V8RA 2QX6A 2WTXA 3NAGA 1CHNA 2IYZA 1GARA 2CHQA 3K0AB 3R9KA 2PUDA 4F97A 4QU8A 1XNJA 3UFXB 4BVGA 4CM8A 3AM1A 1GPDG 1RMQA 4QOSA 4U0KA 4KQFA 1FB5A 1LQUA 4JEUA 4O2AF 4W8HA 1QV6A 1SC9A 2P9FA 1YC2A 1X1EA 3L4EA 3PPIA 4KGVA 1NW3A 2N3ZA 5EP3A 2B8JA 2ZJBA 4CEHB 2W6NA 1UJ6A 2Q4TA 4QTUB 3WNBA 1JQLB 4O2AB 2JRLA 4IM7A 4UE2A 1KSGA 4LECA 1I3OA 3EZXA 3ASUA 2V5AA 3JQ8B 1RBZA 4HWSA 2RGUA 3IP6A 3RE1A 2OL4A 3RYIA 3PEEA 5KTTA 1H2XA 3ROFA 1CS0A 1DWPA 4F5ZA 4PEVA 4I9FA 3LAWA 1TJ5A 2R4TA 4BQFA 2WM2A 3N8DA 2FJPA 4IDDA 2R8EA 4QIHA 2YX1A 5C35A 2OCPA 2UUOA 1BMTA 2ZRAA 1KFCB 4D9IA 1JQDA 4TQUS 4UM9D 3U7GA 3WA7A 4IVQA 5KVQA 1WABA 3PEUA 4QUJA 3HDQA 3MS4A 4UTNA 3TQHA 2WLSA 4NYMQ 1N2CE 4RU1A 4RW0A 3HKDA 3H0CA 2NXJA 1JA9A 4OQ4A 1E0AA 4I5FA 2FZVA 1OAOC 2EJBA 3GUHA 3JVEA 5HFAA 3PSAA 4LJ8A 3VSBA 5ALIA 5ECYA 1YQ9A 5AKIA 4EI8A 4BMZA 5EGNA 3ZWXA 3ZIDA 2CK3D 2V7XA 2O4CA 3N2IA 4LMRA 4GICA 1ARZA 5DCWA 4H1VA 2X3YA 2NZ8A 3GT7A 4FI3C 2BFEA 4DIKA 5MHTA 5A3SA 3D54D 1BXGB 3ZWCA 5EJ7A 3LQ2A 1T1RA 3R4VA 2GAFA 3KWMA 1CP3A 3L0CA 2Q5CA 4ZT2A 1BU8A 3FHOA 4E51A 3T9EA 1L1FA 3I8OA 2N42A 1UQUA 1VE3A 2HK9A 1ZM9A 4NIMA 4DMCA 4LFAB 3DXZA 1E79A 3VPXA 1CXZA 1T9HA 1VCNA 3R8XA 1PEAA 4AO8A 5JJKA 2AKAB 3TDNA 1J4AA 1KVTA 3TE7A 3D0QA 2C99A 2X1MA 1L5YA 3DMGA 1JR3D 3VU3A 1ZONA 3MHTA 4LV8B 4FR5A 5AK6A 1RAHA 1C14A 1TE2A 2XUFA 4MVJM 3LA8A 2QRPA 3QFRA 4RQBA 3EX7C 1QCDA 4IJVA 2UVPB 1Z5WA 3CX7A 3NUZA 3OZBA 2DBQA 2FEOA 1WLYA 2Q8PA 4I55A 1QQ7A 1R2QA 5BN3A 1D4AA 2A0WA 1QQ5A 4TMTA 4ZVMA 3TLZA 3DP9A 4Z3KA 3E8MA 2G5CA 1FZQA 4P33A 2DM6A 2NZWA 2C3UA 4YO8A 2A3NA 2D7JA 3QLEA 1GCAA 1EWTA 1Z37A 2NP7A 1A4XA 3J7TA 3NHJA 1ONOA 3L92A 5LPNA 3I2IA 1M2VB 1ODLA 4G4JA 4ZFNA 1W8DA 4Q4JA 1X38A 2YV3A 1YTLA 3SSMA 2QXTA 3UGQA 3VX4A 1U2QA 1O95A 4M76B 1QLWA 1VQ1A 4F38A 3RVRA 3OT5A 1ULSA 5G1PA 5GVSA 3AH8A 3E22A 2YHUA 4BLQA 4CIVA 5JS6A 5FL7A 5FKJA 1NV8A 2FWRA 3GN2A 3UN1A 5LUBA 4CCYB 1EGMB 1W5EA 2DUWA 3AF5A 4B45A 3DD5A 4EAAA 3PD7A 2MHCA 1FMCA 1ZS9A 2QR2A 1T5LA 4G9EA 2NP6A 2R3SA 1KRHA 5DH9A 4II2A 3WJ2A 1F2VA 1XMVA 5T67A 4XGKA 4XVUA 2AZXA 2JIBA 4KR0A 1YRLA 2ZROA 1DB3A 5AYVA 4LE0A 3GGDA 1NC1A 5GJVC 1KK3A 1LTHR 4MOWA 4ZRNA 4D8YA 4IMIB 4MIEA 5I4IA 1OH7A 1FTSA 1QF7A 4D0SA 2II6A 2RJ3A