4CM4B

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQKSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
total genus 90
structure length 251
sequence length 267
chains with identical sequence C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cm4B00
1KETA 2B4RO 1R12A 1OI7A 1RM0A 4NMHA 4PVCA 4MINA 1LEHA 5I7EA 3L6DA 4NI5A 4I5EA 3RFVA 2EV9A 4IDFA 1HT0A 1LA2A 5A9TA 3H9GA 4N5LA 3D3EA 2GYYA 4FSHA 3UVEA 1PU2A 3H9UA 4BV8A 5CG2A 4FFOA 2PKQP 3TZ6A 1LQTA 5GZ6A 3JD0A 4PRKA 5CFZA 1XKQA 3GNTA 4PLHA 4A73A 1DHTA 4LW8A 3D0OA 3DL2A 5U9CA 4HFMA 1EVYA 4RPHA 2XXJA 3UN1A 3ONEA 1NFRA 3TFQA 3FWNA 4WGGA 4IY1A 2WYUA 4QO8A 3JQDA 1I2ZA 3PJGA 1H9BA 2ZCVA 4J4TA 4P4LA 1AGNA 3QVSA 4BKPA 4MDHA 5BSEA 4IDDA 5CDUA 4OOFA 4EUEA 1V0JA 1K3TA 1NQ5A 3QV1A 5ILOA 5JLAA 4IM7A 3AOEC 4L8VA 5MDHA 1QYDA 1IL0A 3ADOA 2PD6A 4W82A 3GT0A 5A05A 4R4JA 3EMKA 1VSUA 3AUTA 1XEAA 4RDIA 4UAGA 3FR7A 1NVGA 3EHEA 4L75A 4B79A 2X5OA 2H63A 1O9BA 1I5RA 4QXMA 2G1UA 1PJ4A 1XGKA 2GZ2A 3GZNB 4E3ZA 5KJEA 4A7PA 1X1TA 3D64A 2EP7A 4FFNA 2BI8A 1ZIDA 4NR0A 5ER9A 1ZSNA 2VN8A 2P2SA 1MV8A 2BGKA 1AHIA 2EGHA 2D5AA 1QG6A 2YW9A 4DIOA 4B3JA 3KVOA 3FBGA 2J8ZA 4PLPA 2Q4BA 2BLLA 1DIBA 2H6EA 3T7CA 4E6PA 3MJEA 2ZATA 3DBRB 2BELA 5BSGA 4G2NA 4GSLA 4AJLA 3PI7A 4MKRA 3RQSA 4CV1A 3PZBA 3GG2A 4GGOA 3ITKA 1R0LA 1PTJA 4HNHA 3HDQA 4WKGA 3VH4A 3W1VA 1CDOA 3NYWA 4AICA 1H6BA 1XU9A 3HG7A 2I99A 1ZK0A 1VL6A 4INAA 1YXMA 1XDWA 5EL0A 4J1TA 5ENVA 5TJ9A 4MIOA 3ADPA 4YJHA 2J3HA 4DQXA 3ZV3A 4QEDA 3EZYA 1RM3A 1PL8A 3DOCA 4TKLA 4BHTA 1HLPA 1Q7GA 2EHDA 3QWBA 4WNCA 3VKVA 4CQMB 4WNIA 4IMRA 1ORRA 1EFLA 5JAQA 3GLQA 5T8KA 2HRBA 1EUCA 1PGNA 1GTMA 2OUIA 3DMYA 4YRDA 5G4KA 3RC7A 3FRJA 4CLHA 3AUUA 1E7RA 1VRWA 2IYPA 2E4AA 2UAGA 3KYDA 3A14A 2AQ8A 2Q1WA 3WJAA 1NTOA 4F46A 1HSOA 4XWYA 5HS4A 1HYEA 5JXWA 4MVJH 1EMDA 1H93A 1UP7A 1ADFA 1WP4A 1WNTA 1N9GA 4UEJA 3MOIA 4R9SA 2X8LA 3A06A 5T5QA 1TVEA 2HAEA 4RF5A 3CXRA 3PHIA 3FF4A 1B8PA 1UH5A 1VLLA 2X6TA 2X0NA 1P33A 4R51A 5K6AA 2C7GA 3G3EA 3LYLA 3OECA 3KUXA 3PHLA 3IP1A 3QE3A 2FMUA 4L76A 2JCVA 5DOVA 3TOZA 1UDAA 4B4WA 4CLDA 3OJLA 4NU6A 4GX1A 3UCXA 3LQFA 2G76A 3DBLA 3KRTA 1LJ8A 2AEFA 3GDFA 3LVFO 4WLEA 4JXKA 4D0RA 1EQ2A 2QHXA 1RKXA 1CQJA 4BO9A 3RBVA 1I0ZA 1P1HA 4GQAA 4OL9A 3TJRA 2EXXA 2FWMX 3ZHBA 3M1LA 1E7QA 5CEFA 5GZ3A 1ZSYA 2B37A 5KJFA 1C14A 5DT9A 3TQHA 1CWUA 3KYCA 1VPDA 3WGYA 4E33A 2QRLA 1T2AA 1LSSA 3ZI0A 1M76A 1FDVA 3NDIA 1DC5A 1M75A 2WD8A 1HDRA 2DTDA 3MTJA 4AFNA 1W0CA 1XIVA 1JAYA 1UDBA 1OC2A 2NTJA 3IMFA 4RORA 1LDGA 2FZEA 3ZCXA 2AEMA 4RF3A 1JKIA 3K31A 4PG8A 5I9LA 3W8DA 3CKYA 5KTKA 5C37A 4MVJI 4XDZA 2PR2A 3NV9A 1U7TA 3INGA 3SX2A 1B7GO 4NFYA 3TRIA 4HNGA 2HMWA 4WK6A 2BD0A 3DWFA 2PGLA 3GN2A 1KC3A 3LLVA 3BYZA 4IXWA 2W2LD 3BMQA 3G1UA 2J5QA 3H2ZA 5U1PA 3EVTA 1KS9A 5IN4A 4EJ0A 5HA5A 1KEWA 4YA6A 3BTOA 3GRKA 5FWNA 1E1LA 2ZJ0A 4CQLB 1XYGA 4ALJA 5CHEA 5I7FA 2GO1A 1BDBA 3DZHA 4GWKA 9LDTA 3BXXA 1K6JA 4WASA 5JYEA 1HYGA 2QRKA 4A27A 3FCOA 4FBGA 5KJ6A 3W4IA 4O63O 2F00A 4NDNE 3P2YA 3LT2A 4TKMA 1S6YA 4IBOA 1GQQA 3VTFA 1YBMA 3OH8A 2IZ1A 4N18A 4D3FA 2DBVO 2X0RA 4OSPA 4RV9A 1G6KA 4XGKA 2V65A 3UHAA 4D42A 2EJVA 3JQBA 1DOHA 1L7EA 3WGZA 1ZUD1 3OJOA 1LC3A 2JFFA 1AXGA 3JQ8A 4J1QA 1IUKA 3O9ZA 3C1TA 1EDZA 4IGFA 5KKCA 3BMCB 1GQYA 1UDCA 4YRAA 4HKTA 2UUPA 4KTTE 1H6DA 1V3TA 3RI3A 3JQEA 1EZ4A 2D8AA 4FJ2A 4B4UA 3KETA 5L45A 4GSKA 4E21A 4E32A 5DN9A 4CM4A 4OH1A 5JPIA 2O23A 3U9LA 4EGFA 1PS9A 2PZKA 1GUYA 1MC5A 2FN7A 5F3RA 4L0QA 2LDXA 3MEQA 2DVMA 4LSMA 3FI9A 2HSDA 4YAGA 3Q11A 2A35A 3CIFA 2FPGA 4B8WA 1LSUA 4ND4A 3HWRA 1ISJA 3DHEA 3JQ9A 1C0IA 1ZXLA 2DC1A 4FC7A 3ZV6A 4JJGA 1DRVA 4D44A 3NTOA 1E7WA 5A5FA 3DZKA 1DIGA 3SEFA 3VVCA 4RGBA 4BGIA 1EE2A 4YT4A 4PZCA 2HDHA 2W90A 4ZJUA 4FGWA 4OJNA 3ON5A 4Q3BA 2RBEA 2WM3A 4YT2A 3ZWWA 4R5HA 2CUKA 3PEFA 1V9LA 4UVHA 4GKBA 4NBRA 3WSVA 3VDRA 1GZ4A 3ZNNA 3A4VA 1PX0A 3QQPA 2HLPA 4LGVA 1DSSG 4AJEA 3VAZA 1I3MA 4AJIA 3GVCA 3VPSA 1N5DA 1ENOA 1U5CA 1V35A 2VYVD 3GNSA 5IJZA 2GERA 2C7VA 3LLSA 5JFOA 1C1XB 2A4KA 3WGQA 5G0SA 3U09A 3AM4A 4IPTA 4XQCA 1SNYA 3R6DA 1BXKA 3RVDA 4CMIA 3WDSA 2C0CA 5CDSA 2VYND 3OEYA 3SJ7A 4PN3A 1G1AA 2DFDA 3GQVA 2RCYA 3GR6A 3NTRA 4LCEA 4I1IA 1HF3A 4AJNA 3DAGA 4DL9A 1JDJA 1ONNA 2P9GA 3HB5X 3FNHA 4FFLA 2GN8A 1GY8A 4FJ1A 3PJEA 3WWYA 2VHYA 2IDZA 3M1AA 3QIVA 1E7YA 4R1NA 2IODA 3BTUA 1EE9A 1U2GA 1NYTA 1C0KA 4EDFA 3FTPA 3RC2A 1H94A 3DBRA 1T2EA 1Z6ZA 2B35A 2Y99A 3WG9A 3B70A 4IS2A 5TS3A 3V1UA 4BQPA 1NM5A 9LDBA 1JKJA 1NP3A 1YQGA 5AYVA 3F4BA 2WD7B 3WYBA 1NFQA 1U3WA 1WW8A 1XCBA 4KTVE 4EUHA 4O6VA 5KVVA 3QW2A 4DUPA 2OP0A 1FDTA 5IZCA 2NU8A 1P3DA 1QR6A 1SBYA 4EJMA 1U7HA 1GPJA 3KLPX 1L7DA 1LC0A 4LRSB 4KQXA 1V3UA 3HN7A 4FS3A 2JCXA 1GR0A 1DC4A 5JO9A 4YJFB 2DUWA 1IZ0A 2O4UX 5IDQA 2Z1NA 1UR5A 1KEVA 3DB2A 1GADO 1NQAO 3I9LA 4XYEA 4ALNA 4Z3DA 3PYXA 2D3TA 4W99A 4JLWA 3C7AA 4CM3A 4J1NA 2I76A 4CLOA 3S8MA 1B3BA 3IUPA 3D1LA 2JAPA 2O2SA 5IF3A 1XG5A 1PJ2A 5F1OA 3ABIA 4DC1A 2BFAA 3NGLA 2ZTVA 1R16A 4K26A 2Y05A 2YUTA 4OXYA 1E6UA 3HB4X 5ER6A 2ILTA 4DC0A 3LZ6A 5CPBA 2A9FA 2G5CA 2AQHA 1P1KA 4JBIA 3F47A 1T4DA 2EEZA 2IZZA 2VHZA 1T24A 5EESA 1M6HA 2JHFA 3NT2A 3PFWO 1IB6A 2YV2A 1YB5A 3VZQA 1X7DA 3E8XA 5BSHA 3I9OA 3PWKA 1TT7A 3JQ7A 4CLXA 4BNWA 1OFGA 5CDTA 1RM4A 1ZJYA 2FP4A 3JYNA 4JJIA 2PKRA 1KY4A 4CV0A 3HDYA 2BGMA 1FDUA 4KDFA 1BXGB 3HDJA 3WFJA 3ZNOA 1I10A 3KSDO 1ZH8A 1OBFO 3I4CA 3VHRA 3S1LA 1QXSA 4BO7A 4XD2A 1U8XX 4Q39A 3Q2IA 1FJHA 1DFHA 2J6IA 3C1AA 3E5MA 5DCUA 4HBGA 2VZ0A 5I8ZA 5FI5A 3V8BA 2DU8A 1VJ0A 4CMKA 1SPXA 4BO5A 1LSOA 3PHGA 1LLCA 1BG6A 1YJQA 1E3IA 4Y6RA 3ZWCA 2VQ3A 2CMDA 2ZYGA 4PZEA 3Q1LA 1VSVA 3F9IA 4YTEA 3AFMA 2RIRA 1ZNQO 2EKLA 1WMAA 5TX7A 4UUOA 3K8ZA 3R1IA 3FWZA 1E5QA 4D45A 2FSSA 4NBVA 4D43A 1ISMA 2OOSA 4Q3AA 2DAPA 2X86A 5L51A 2EJWA 4H7PA 1E3WA 2NWQA 4BGUA 5DDIP 4PLTA 3M6IA 1ULSA 4N54A 4CR8A 3RU7A 4QSMA 3TZHA 2NQTA 3QY9A 2NVUB 3RROA 5GY7A 3K92A 1CYDA 3BMNA 4GX0A 4IGEA 1WPQA 4ITUA 2NU6A 4OQZA 4M55A 1HYHA 4CJXA 4M1QA 3X2FA 1NQOA 1VC2A 4ZVVA 1YKFA 4TRNA 4ILKA 1NPTO 1TA4A 5T6BA 5ADHA 2VTDA 3UGKA 4WEQA 3BHJA 2PWZA 2VT2A 1W6UA 2J3JA 2EIHA 5TRTA 4BO8A 2POQX 3ZWOA 1DIHA 2HK8A 4R1TA 3QRWA 1BVUA 5EMHA 4D41A 4CMCA 1EVJA 1BW9B 1E77A 3FNEA 4CMGA 3I9NA 5LDHA 1HEUA 2HMVA 1ID1A 1Y8QA 4J7CA 1LXCA 1QSGA 2Q3EA 2YDYA 5L7YA 4Y6PA 3GG9A 1UXJA 3ZW9A 3NDJA 3WMWA 1PGOA 3KEQA 1D1SA 1HSZA 2NQ8A 4CQMD 3VKUA 4BNYA 1O94A 1O89A 3L07A 3MJVA 1EVZA 1UAYA 4HFNA 5IN5A 1AXEA 4XRRA 4DBZA 3QWFA 2NADA 1VJTA 4MP6A 4NHEA 4MVJE 4XYMA 5AXAA 3MJCA 1HXHA 2DTXA 3E9QA 4TMFA 2JAHA 3UCEA 2JL1A 3DZIA 4OSOA 5EQFA 3PHHA 4XQ9A 2EKQA 1ZSVA 1D8AA 1SB8A 4OOEA 5JDCA 5I7SA 4YACA 1NQTA 3CMCO 4JROA 3F1KA 3WYEA 1JVBA 4NG5A 4BNIA 5IDWA 1ZO8A 3RJ5A 3DHNA 1HZZA 2VUUA 2ZK7A 4DA9A 4PLGA 3VZSA 2CVOA 4NIMA 2CZCA 3LDHA 2YQ4A 2NV6A 4CUJA 4HV4A 5GZ1A 3ROKA 3GEGA 4ND5A 1LDMA 3VH1A 4XQEA 4B8ZA 3DBHB 1AE1A 4BNZA 1Y8RA 4BO0A 1QORA 4W4TA 1R4NB 3O26A 1WWKA 4TROA 4UEKA 1H0KA 4J91A 3N7UA 4IIUA 3WNVA 1TT5B 2D5CA 4DQUA 4DLLA 3JYLA 4YQZA 2NTNA 5CDYA 1ZFNA 3VPHA 2WTBA 4FJ0A 1C1DB 3A1NA 3EDMA 5H81A 1I3KA 2WYVA 4RQUA 1ZK2A 4Z9FA 4AJPA 4J7XA 5K0ZA 3R3JA 3DZJA 4QQRA 2Q49A 1UZNA 3DZFA 3GUCA 4OXNA 1GYPA 5ICSA 1F8GA 2WDZA 2RH8A 4OGWA 5AXBA 4L9RA 3DTTA 1PQUA 3H5NA 3CZRA 1PL6A 3FBTA 5CAEA 2OHXA 2GUGA 1R4MB 3TOXA 4URFA 1HE5A 5C5IA 1B26A 1YBVA 2VZ9A 4BGEA 3JQAB 1H6AA 1DIAA 4CMEA 2YZ7A 1X7GA 1YWGO 1PGPA 1X0VA 1ZKMA 4GPD1 1DXYA 1HDZA 1JU9A 4DLBA 1UZLA 5A9SB 3H9EO 5JY1A 3PHJA 4ZA2A 3OP4A 3JD2A 1VE9A 2AQIA 4E12A 4CV2A 3TFOA 2QZZA 1JN0A 1HETA 3CH6A 4D3SA 1Q7CA 2IEDA 4XIYA 2VOJA 2GZ1A 4ALIA 1H2HA 1YL6A 3O38A 5B1YA 3FPLA 4RVDA 2ZB7A 4YRBA 4BV9A 5AVOA 2HJSA 2NM0A 2JFGA 4L73A 5A9RA 5I9MA 4GMFA 2YFQA 3RUFA 4ID9A 4OXKA 3ZNPA 4JBHA 3E03A 2W2LA 4R69A 1D7OA 3ITDA 1UUFA 1YQDA 2VNAA 3JD4A 2Y66A 1BGVA 3SC6A 4D7AA 4OKIA 3TF5A 5L4NA 4W9NA 1WDMA 2P5UA 1PEDA 2C29D 3WMXA 1MG5A 3JQFA 3F5QA 3FHLA 1JQBA 1ISHA 2VUTA 3A9WA 3DOOA 4JBGA 3D3WA 4NJMB 2HMUA 2BKAA 1HKUA 1I8TA 2BMAA 1R15A 3BHIA 2W2KB 3I9MA 3G79A 5THQA 1U5AA 1YRLA 5F1PA 5EINA 2Y0DA 1YB1A 1Y9EA 3G49A 2FHSA 3ROMA 2OBYA 2NVBA 4CLEA 4E2XA 3QVWA 1CQIA 4M89A 3WBBA 4QX6A 3U3XA 4EW6A 3PLRA 1T2DA 3RKUA 2NACA 3ZHXA 4KOAA 4E5NA 3AUAA 1PR9A 4IINA 2B0JA 3D5TA 4AJ1A 3KEOA 2C2YA 1E0DA 1GAEO 4IZIA 4Z9YA 5L3ZA 2WE8A 4KQWA 4XA8A 1YOVA 2X1HA 1T26A 2UYYA 5JDIC 3K73O 3ZWPA 1ADGA 3FNFA 4PLWA 5JAZA 2I9PA 1LQUA 1WMBA 4N5MA 4XYGA 4O59O 2GF2A 4A10A 1BDMA 2FZWA 4HFJA 3GHHA 3F1LA 1E7MA 4PRLA 1O5IA 2NU7A 2YQ5A 2X22A 3KO8A 3ANMA 2V6MA 1PJBA 1ADBA 3EC7A 3ONFA 3QWIA 3C3XA 4HXYA 5TF4A 5C7OO 1E7SA 1SEPA 3JQ6A 3Q0EA 1PZEA 3H65A 4DPKA 4ND2A 4CM1A 1EFKA 2C54A 1QYVA 5EQDA 3B1JA 3LC7O 3NDRA 1ZEMA 4CL8A 3W6UA 3DFZA 4HFRA 4NFSA 4JIGA 1P74A 4E0BA 4LMRA 1U8FO 5L9AA 2SCUA 4F45A 4CM8B 4DQVA 3OM9A 4IJVA 1CEQA 4BB5A 1GQ2A 4BQRA 2Y1EA 4MIEA 3WOHA 3PIIA 2R00A 4KWHA 1M67A 1Y5RA 1B0AA 4ZRNA 4RPLA 1E6WA 3K2EA 4MVJM 2BFOA 1QYCA 1QP8A 4PLCA 5IDYA 1HL3A 4J9VA 5AQ1A 5BNIA 1GV0A 5L53A 3C24A 5EJ2A 3WR5A 4K6CA 3IJPA 5G0VA 4JK3A 1E92A 1IULA 3AFNA 4RQTA 3KB6A 4H16A 3WX0A 2EW2A 5L95A 4DWVA 1ZMOA 4TRRA 4ZD6A 1P1JA 1T1SA 3OBBA 3WFIA 5BSFA 1DRUA 4E4YA 1HDOA 2AA3A 3NUGA 2O50A 4BMVA 1WDLA 5DBFA 4EEZA 3GH3A 4GMGA 3GOHA 3S2EA 1A9ZA 3N58A 3WS7A 4K28A 4NU5A 3VZPA 1ISIA 3WBFA 1MFPA 5BNFA 3GDGA 1XQ6A 5JCJD 3IOYA 3E48A 2ZTLA 2RHRA 3I9KA 3IC5A 1IHXA 3QVXA 1RYDA 1BVRA 3MOGA 3OIFA 4QUKA 8ADHA 2X0JA 1IZ9A 2PH3A 3UICA 3AI2A 3OQ1A 3TDKA 1BW9A 3GAZA 1E3SA 5DZSA 3VH2A 2HUNA 5KVSA 2HMSA 3JD1A 1KYQA 3H2SA 1UXIA 3AU8A 8LDHA 3AW9A 1NBOA 5COBA 3TZKA 3JCZA 1O0SA 4NH4A 2JJYA 4RPJA 1U3VA 1KVRA 4DVJA 2HK7A 3U4IA 2FY8A 3ZGYA 3CE6A 3U5TA 3M2TA 4IZHA 5KKAA 3RUHA 4FGSA 3H5RA 4BOYA 1JVSA 2Y93A 5BQFA 2O7QA 3CMMA 3EUWA 3BMOA 1OOEA 1T25A 2FPPA 2IRWA 3O8QB 4DLAA 4N7RA 5FEUA 1WZEA 1DC6A 2EP5A 3U4CA 4JP3A 1GEGA 4CLRB 1KEPA 2ZTUA 2PKQO 4FFRA 4FOOA 4BNKA 4E2ZA 1UAGA 2AEJA 1Z7EA 1O8CA 2V7PA 1PL7A 3Q6IA 2DPGA 4ND1A 4YT5A 4NBWA 3KM0A 1I01A 5I7VA 1B2LA 4WLNA 1IPFA 3JD3A 3R3SA 2VNSA 2X0IA 4XCVA 3CZMA 5JAIA 2BI7A 2O3QA 3PK0A 1NWCA 1ZK1A 1YL7A 2OZPA 4MVJG 3ANLA 1DHRA 2Y1OA 4MVJF 5KCZA 1R4NA 5B37A 2G17A 4Y98A 1OC4A 2HO5A 3OA2A 5KJCA 4FW8A 3U4DA 1ZCJA 2P4HX 4GI2A 3C1OA 1PSDA 3L6OO 3L9XA 2QZ9A 3O4RA 3RFTA 4KWIA 1TI7A 2HU2A 3GK3A 3X2EA 4XGNA 1VM6A 1YE3A 1C1DA 4ALKA 4BNTA 1P1FA 1P77A 4Z0TA 1PWZA 2H9IA 2GPTA 1JWBB 3PTZA 1Z75A 2NVWA 3H3FA 1LBEA 1SEVA 3IUSA 3LT0A 1Q2XA 4YJGB 3BA1A 3QP9A 3MJSA 4WCFC 1ZBQA 3AI3A 3EVNA 1A27A 1H9AA 4WLFA 2TMGA 2A92A 1EBFA 1P44A 4J7UA 3I6QA 5JSFA 1UXHA 5TLSA 3KZVA 3GFBA 4FOSA 1PZHA 1SOVA 3GGPA 4BKUA 4CPDA 1ZEJA 4BB6A 4UVIA 2CVQA 2E6UX 2A94A 5CPFA 3OHSX 3ZWAA 3T7EA 2I6TA 1PJCA 1LDEA 1SCUA 1XA0A 1PJSA 3DHYA 2Z5LA 1I3LA 2XAAA 3K6JA 3I1JA 4J43A 1GZ3A 1Y7TA 2NTVA 3OF2A 4K1LA 4Z3KA 1B8UA 3WGTA 1E1MA 3FD8A 1TB4A 1HE2A 1VL0A 2Z95A 4BL5A 5CEJA 4B3HA 5IAAA 2BFPA 3GEDA 1LLQA 4H3VA 4YXFA 4WCFB 4G5HA 3S2GA 1KY5A 1R66A 2PGJA 4DTIA 3KOUA 2QYTA 3GC6A 1PJQA 3TN7A 3WQQA 2VUSA 4YAKA 5BR7A 1F12A 4ND3A 3JQGB 4GX2A 1MFZA 2WMDA 3CPSA 4J2OA 4II3A 2P9CA 1PQWA 2HRZA 4GVLA 3GZNA 1VKOA 4DYDA 2JFHA 4EUFA 1LRJA 4PLVA 3Q2KA 1SMKA 4YT8A 3ZHZA 2PNFA 1DEHA 1H5QA 5DBGA 3RC1A 1P9LA 3ETDA 4BMNA 4K9DA 5JMPA 4HWKA 3S2IA 5L4LA 4R1SA 3KSUA 1C3VA 2W4QA 3WSWA 4J49A 2OO5A 4XX0A 3GF4A 4RVGA 2DFVA 3V2UA 2YHIB 3NRCA 5L40A 2UUOA 2PK3A 3OICA 4WLOA 2YYYA 2YFHA 2AE1A 3P2OA 1YS4A 5JAMA 4Y9DA 2V6BA 4II2A 3KYBA 4S3MA 3AOEA 3GUYA 2WWRA 4D3DA 1VI2A 3I23A 4N5NA 3PQFA 3GEMA 3DMTC 4FN4A 2O3SA 3COSA 1G0NA 4WUVA 4MVJA 1U3UA 4LN1A 3ANNA 3TZCA 4JGBA 4AJOA 4IQGA 4F3YA 2XOXA 1NR7A 1XQ1A 1FDSA 2Y68A 4J0EA 3INRA 1J6UA 3LC2O 1LRKA 2HQ1A 4R5MA 1IPEA 3WQRA 3OFSA 5T57A 1IY8A 3V2GA 4CQMA 2GGSA 3GY0A 1UJMA 3F3SA 3WQSB 4YR9A 2AG8A 2C59A 3HSKA 1J49A 2DLDA 3WJ7A 2ZB4A 3D4PA 3CEAA 3DZBA 5I9NA 4W7IA 4QT0A 2FR0A 1NAHA 4I08A 4CM9D 3ETEA 5JBIA 1VJ1A 3E1KA 1X15A 2E48A 1DDOA 1A7KA 1DAPA 4NZ9A 4PGFA 4R68A 3VPXA 1DIRA 2GDZA 1AHHA 1ENPA 1LSJA 3RUAA 2GCGA 1GV1A 3PFFA 4J3FA 1RYEA 1RJWA 1S7CA 2R2GA 3LF1A 4KDEA 2P9EA 1UP4A 4J2HA 4D46A 3FNGA 3NJ4A 4R41A 4BNGA 1M66A 3EGOA 2Y1FA 3O03A 4PLFA 3F46A 4M8SA 5T8KC 4IMPA 1PJ3A 3AK4A 5T64A 1MB4A 5TSDA 3ZWXA 1PS0A 4QFDA 4R9RA 3SJUA 4BKQA 5KWEA 1R0KA 2HCTA 2I5PO 1A72A 5JDIA 2Q1SA 3ZU4A 4BNNA 1BHSA 3FR8A 4MKZA 4ZN6A 4LSWA 2G0TA 4AJ2A 1B14A 2X9NA 5A5EA 1GD1O 4MVJP 4DPLA 5AOVA 5JNLA 4EZBA 3UFXA 4BIIA 3BZUA 1Q0LA 5LDGA 2VWPA 4FR5A 1DJQA 3VH3A 1HE3A 1HDXA 3KTDA 5LCXA 4BO6A 5IG2A 4LRTB 3PWSA 2CDCA 3H6KA 4RPGA 3JQAD 1DRWA 1NHWA 3RU9A 3WNQA 4YJHB 1NHGA 1PZFA 2FPIA 5K6AC 1I30A 3HFGA 1B8VA 3E82A 4NBUA 1DB3A 4NJOA 3H9JA 4PLZA 2JD2A 4RVUA 3MJTA 1W8DA 5G2OA 4D79A 1SOWA 2J3IA 4E30A 1LDBA 2DUUA 2YV1A 1YB4A 4PCVA 5G4KB 3I83A 3ICCA 3PPIA 5JE8A 1BWSA 2J3KA 4CV3A 1J0XO 1DC3A 4E2WA 1GYQA 1I33A 2EG9A 4YCAA 3KYDB 3OMLA 1BMDA 1HWYA 3BTSA 3PQDA 3DQPA 4OIMA 4MJLA 4R3NA 3QJ5A 1P0CA 3MTGA 4W7HA 1D4FA 4HP8A 3GVPA 2QYSA 3FSRA 3WICA 4U0JA 7MDHA 1SB9A 5ITWA 4I5GA 1U1IA 3NX4A 2JCYA 3WGIA 1JW9B 1HDCA 1K6XA 1N9GB 4IDEA 4ZHSA 5KNLA 1JWAB 3E9NA 2GZ3A 2QX7A 3K2BA 1MXHA 2C82A 3UCFA 1Q0HA 2C07A 5LC1A 3INTA 3W6ZA 3D4NA 3ULKA 4BNVA 2X5JO 2HJRA 4YDRA 1DFGA 4CQLA 3NTQA 4WPGA 4Q9NA 2GD1O 2Y1CA 4LVUA 2Y0EA 3JQCA 2CVZA 2EF1A 1YGYA 5DNAA 2RH4A 5FFFA 4DRYA 1X14A 1X0XA 3U62A 2DKNA 1KVUA 1Y6JA 3DBLB 1CJCA 1K5HA 1W4ZA 2Q2QA 3I5MA 4BNXA 1O95A 3L4SO 2C2XA 3P19A 1XELA 2XF8A 5AXCA 4RL6A 4BGVA 2B4QA 1YONA 1GEEA 5DCYA 1Z74A 3IDSA 1E3LA 2DPHA 2PD4A 4ZQGA 4XB2A 2QQ5A 1I32A 1Z45A 1ONPA 3K96A 4OAQA 3ICPA 3K30A 3TSCA 2QIOA 3GZ4A 3BMCA 3WTBA 5HBRA 3MZ0A 3D5QA 4J4BA 3GFGA 4ALMA 3B6ZA 4QECA 1EK6A 4XQGA 3JYPA 1QYXA 2FSVA 1SZJG 1ZJZA 3HE3A 1E1KA 4U6SA 2YHUA 1FMCA 4TQGA 2GRAA 3VDQA 4YPOA 3JTMA 3GMSA 3HQ4O 4I5FA 1YH3A 4CM7A 3EAGA 1H6CA 3JQBC 2GN4A 2IEBA 4B7XA 3GA0A 4CUKA 2AXQA 4P22A 6LDHA 1WAMA 3H4VA 4C7JA 3BMQB 3AY3A 2QRJA 2VCYA 2ZB8A 5TQVA 2X7HA 2CDAA 3ORFA 3UH1A 1A7AA 5EERA 3IJRA 2I66A 4UVEA 2B83A 3H9QA 5EPOA 3WIDA 2RHCA 2E49A 2VWHA 2V6GA 1NVMB 5DCWA 3OIDA 4KMSA 4IUYA 3V1TC 4BO1A 3W4JA 3I6IA 4AJHA 4YJDA 3EW7A 3OJEA 3L4BC 4GLLA 1MC4A 2J5KA 3PZRA 5IFLA 4CMAA 3DAPA 4G65A 2X23A 3NKLA 4JP2A 4Y8VA 4IDCA 1DLIA 4CMBA 3UOGA 4EEXA 2BRUA 2O3JA 1IE3A 1SAYA 3AWDA 4ESOA 3ZV5A 1ZK3A 2NUAA 5KVQA 3GGGA 3NT5A 1B3RA 2P5YA 3JQ9C 3JQ8B 4EBFA 1SC6A 3H5AA 5C7IO 3JSAA 2TMDA 1V8BA 1HE4A 1T1RA 1HRDA 3IIEA 5CDGA 5CEEA 4L74A 2PLAA 1C1XA 3KLMX 2AW5A 4FFPA 4GKVA 5L4SA 5TC4A 5TJHA 3TPCA 2I3GA 2O7SA 4XIJA 5DULA 1OMOA 3DFUA 1GUZA 1LU9A 1HDGO 2CDBA 3TNLA 3ROPA 2O48X 3OEWA 4AG3A 4F6CA 4FIZA 2EWMA 3E18A 4X54A 2O3UA 3JV7A 4CM4B 3WTCA 1DBVO 3P5SA 2CD9A 2HKIA 3R0IA 5A02A 4GL4A 4A2CA 2Q4EA 3S2FA 2YHIA 2OBNA 1MUUA 3CUKA 1P1RA 1YDWA 5ES3A 3RC9A 4JQCA 5JO0A 2VRCD 4U7WA 3LU1A 4NFHA 4A0SA 3QVTA 4BO3A 5JCJA 5MGBA 1V6AA 3F6YA 4J6FA 4UUNA 3ZU3A 2Q1TA 2WD7A 4O1MA 4GGPA 4BNUA 2PFGA 5J23A 4GAEA 1LDYA 2V6FA 3E9MA 3GVXA 4KUHA 3JYOA 3QSGA 5B4VA 7ADHA 4XYLA 2NNLD 2B36A 3HZZA 4DMLA 1NASA 1N8KA 3HUDA 3N74A 4AJJA 1PGQA 4P38A 3H3JA 3UXYA 2VWGA 4YJFA 2C5EA 2B69A 3GMDA 1PGJA 4ZQEA 1C0LA 2P91A 4IDAA 3W4KA 4R1UA 1CIVA 3EK2A 3F5SA 1XHLA 5C7LO 2ZQZA 2NU9A 1GCUA 4LK3A 3RIHA 2C20A 5IZCC 4MO2A 1I24A 2X58A 1X1EA 4R54A 5IDXA 4CUZA 4KZPA 4CMIB 2QW8A 2OFPA 2IXAA 3NGXA 3PYLA 4H15A 1Y5MA 4A03A 3ENNA 3DMTA 4I9UA 1GU7A 1E1NA 5THKA 2Y0CA 4RO0A 1K6IA 4GX5A 4I9HA 2DQ4A 2IYOA 4IIVA 4WECA 4YAEA 2O3RA 1WXDA 4YAJA 4RCVA 1KEUA 4M86A 3U49A 1LRLA 1HZJA 1NVTA 3FTNA 4OM8A 4XR4A 3ZV4A 1KVQA 1Y81A 3RFXA 4XJTA 5JYDA 3BTVA 1YVEI 4FFMA 4AVYA 1GCOA 2O4CA 2VWQA 4JNKA 3SLGA 1BXGA 2GNAA 3MWEB 3T4EA 4AL4A 3NJ8A 1MP0A 1M2WA 1MA0A 3F4LA 3VVBA 2PD3A 5B4UA 3H7AA 1KVTA 3RWBA 5JY6A 1QV6A 4J4HA 3UUWA 4FB5A 4EJ6A 1B15A 2EGGA 1WDKA 3ENKA 1K2WA 4LVCA 1BRMA 5HWSA 5TNXA 2O3TA 5DOZA 5IZ4A 4P4GA 5I8WA 1Z7BA 4BO4A 3LC1O 2X9GA 3IKVA 3VTZA 2GR9A 1K0UA 2GLXA 4RDHA 5B12A 4EITA 2OMEA 2ET6A 3DR3A 3PDJA 5DP2A 4C7KA 3HNPA 3QHAA 4PFJA 1AUPA 3V2HA 3OJFA 1WVGA 4CLOB 1ZK4A 4UVGA 1WZIA 3HN2A 4CMJA 4JJFA 5G0UA 1T2FA 4HY3A 5G0WA 1JLLA 1NFFA 5COQA 3ZDFA 5FI3A 3LSYA 2NVUA 3W8EA 2JKVA 3ZU5A 3D4OA 4TWRA 5JW6A 2JD1A 4L4RA 1EK5A 4PLYA 4WLVA 3HADA 1ADCA 3DONA 1LI4A 4E31A 1XR3A 1V3VA 1PR3A 2H1SA 5KVCA 1I2BA 2P4QA 1EDOA 3VPFA 3JQ7B 5EN4A 1H2BA 1ML3A 2CF5A 4O5OA 3AY6A 4DMMA 2YY7A 2IXBA 4XRGA 4PG6A 2Q99A 2VYVA 3KBOA 1W73A 4RVFA 2FR1A 1QYWA 4WOJA 4GWGA 4F6LA 4IJKA 3UAGA 3RBZA 3I52A 1U4SA 4RZIA 2VHWA 3C85A 4TVOA 4MIYA 1BTOA 2AE2A 2VYNA 2DBRA 4ZRMA 4E13A 5A3JA 3EYWA 3SXPA 2J5RA 1N1GA 1UZMA 3VZRA 2ZTMA 1K89A 3FN4A 4Z0HO 1LLDA 4CM5A 1E5LA 2B5VA 2Z1MA 5DF1A 5TGDA 3V1YA 3WLFA 3GDOA 4HADA 4J9UE 3ZN2A 1U28A 1DLJA 4JN6B 2PTGA 3A28A 5A06A 4YBZA 3OJ0A 4M87A 3PVZA 1KERA 5HTOA 3E5RA 3NAQA 1CRWG 4G81A 3PP8A 4NK4A 1RWBA 5T67A 1IOLA 1P0FA 2UVDA 3IP3A 3QVOA 1GUFA 4A26A 3IQDB 4L4XA 3PGJA 1DAOA 4FDAA 4Z0PA 3PJDA 5A1TA 1E3WB 1NPYA 1OAAA 1L1FA 2BFMA 2I3AA 4YEDA 4YAIA 2Q50A 1GPDG 2PZLA 1TLTA 4ZQHA 2HMTA 4OQYA 3ZZNA 1KBZA 2WE7A 5COAA 3Q9UA 3BMNB 2OXIA 1JAXA 1T4BA 3ZWVA 5KJ1A 3DAFA 5B4TA 2YJZA 4UREA 1EUDA 1N7GA 4P4NA 3OQBA 3RJ9A 4U5QA 2EW8A 2VHVA 3ZWMA 5JS6A 2BF7A 1IYZA 2FRDA 4XDYA 4FD3A 4Q3DA 3WWZA 2Y1DA 1EEHA 2AHRA 4CM9A 2Q1UA 4BO2A 1Z73A 3SC4A 3DBHA 2FOIA 4U8GA 3GPIA 1NX6A 2WJPA 3C7CB 4PG5A 4NNJA 2GSDA 3JYQA 3QLJA 4DYVA 1KOLA 4E5YA 1PJTA 1U4OA 1TT5A 3PIDA 4CODB 5TT0A 2Y67A 1LTHR 3K9QO 4UVDA 1J4AA 4Q3NA 3GVIA 5JDCC 3RKRA 3T4XA 4OHUA 2RAFA 3ZW8A 1KC1A 3U4HA 3MJ4A 4J1SA 4YYZA 4CM6A 4W6ZA 5A04A 2CFCA 4UUMA 3TWOA 5H83A 4DIFA 1NXQA 4ROSA 1NR1A 1X13A 1Y8QB 2AG5A 5A3VA 2B5WA 3PDUA 4QFCA 5JCXA 1JTVA 1E6EA 1BSVA 5IXSA 3WGGA 3WGOA 5H82A 2NLOA 2X5KO 5TT1A 1ZZEA 1D1TA 1X7HA 4QO7A 1Z82A 4ZQBA 3GAFA 2Q46A 4FCCA 2W98A 4TRMA 1R4MA 2VHXA 3DXFA 3KV3O 5ICMA 3OA0A 4PG7A 1D3AA 3L4BA 1QV7A 2XPCA 3JQAA 1BXZA 2JHGA 3IS3A 3DEYX 3IL2A 4RLSA 5BT9A 4RVHA 3BHMA 2IZ0A 4E5PA 4RPKA 3RUIA 4B4OA 5C3MA 3RBXA 5A9SA 1YBAA 3SLKA 3UF0A 2ZYDA 5A4DA 3PGXA 1FXSA 1ENZA 3AY7A 3GNQA 4Q3EA 1XSEA 4XKJA 1B16A 1FF9A 2ZQYA 2WEKA 4GVXA 1Y8RB 4YB8A 4O0LA 1RM5A 1GFSA 1XWFA 1UXGA 5F5NA 2DBZA 1MGOA 1HDYA 4CMEC 4UUPA 4IDGA 2I67A 4I5DA 4WOKA 3GN1A 4XZ3A 5L7TA 2D2IA 3ZH2A 1VKNA 5DP1A 1N92A 2O2YA 3AJRA 3KHUA 5G4LA 3DOJA 4P8RA 3GRPA 1ARZA 4MP8A 3ZHYA 2WSBA 3AUSA 2B4TO 4CMHA 4RVSA 3HJAA 1R6DA 3SBOA 4NJMA 4OYRA 4PIVA 4Y67A 3V5NA 3STHA 1MLDA 4BKOA 1J5PA 1PWXA 2W2KA 1OZAA 1CETA 4GBJA 1EVIA 3DTYA 3RSHA 2DBQA 1A5ZA 4J90A 1M6WA 3RD5A 5F1KA 3ASVA 3B1FA 4Q3CA 3HFSA 2IE0A 4D0SA 3PYMA 3UW3A 2D59A 2C5AA 1FDWA 4WJZA 1QLJA 1E3JA 4XGIA 2PV7A 1DJNA 3AM5A 4WEOA 3ASUA 1HTBA 1SO8A 4R3WA 4W9NC 2ZJ1A 4XEHA 4IJWA 4NPCA 1ULUA 1Y9AA 2P68A 3JQFC 3L9WA 2ZCUA 3C7DB 3WLEA 4EYEA 4L4SA 3ETGA 4MOWA 4PZDA 3QA9A 1QRRA 2QG4A 2GASA 4I9NA 4K6FA 3CTMA 1DFIA 1FK8A 1PIWA 4FQ8A 3WIEA 2VTEA 3ZWYA 4DPMA 3I4FA 2LDBA 3QWAA 1ZW1A 4J0FA 4GH5A 4LMPA 5U4QA 1QKIA 3B20A 4TRJA 4TVBA 1XU7A 4B7UA 1TXGA 4YQYA 3ROQA 2Y1GA 3EZLA 1YL5A 2BHLA 3Q9NA 2OORA 3IAHA 1Q7BA 2DM6A 4XYBA 3GVHA 3TL3A 4TZKA 3AOGA 1MX3A 1U9JA 3LT4A 4C4OA 3LF2A 2DTEA 3G17A 4MP3A 4BS9A 1EQUA 1JA9A 1F0YA 3DO5A 3AI1A 1C0PA 1XLTA 2CNBA 4IS3A 3OQ6A 3KXDA 4CM8A 1CERA 5KIAA 1JKFA 3KSZO 2PZJA 2PY6A 3FPCA 2ZKLA 1NNUA 1LNQA 4ALLA 3D3WB 5GMOA 4WCDA 4LCJA 4IXTA 2OGUA 1YO6A 2PGDA 4RF2A 4AJKA 4ZGWA 5K9ZA 5JC8A 3OSUA 4MPDA 1LDNA 1YDEA 2D0IA 2G82A 2VT3A 5A03A 2YV3A 1GDHA 3G1TA 3GHYA 3QWHA 2YDXA 4RJTA 2CF6A 1A4UA 2NSDA 4OMUA 4NBTA 2JD0A 2Q45A 2DT5A 1F06A 5IXYA 4I8XA 3ZU2A 1PS8A 2PA3A 1F17A 1KVSA 2Q2WA 5G0TA 2HK9A 3RASA 1T2CA 5ENDA 5ILGA 3Q3CA 3DBVO 2VOEA 2D1YA 4DXHA 1I36A 3RUEA 1TEHA 2R00C 3WXBA 2WYWA 3RAJA 3S55A 4LISA 3TL2A 1YOVB 2E82A 5FF9A 1AN9A 1PQPA 1LLUA 3CINA 5AXDA 4DREA 1N1EA 3HDHA 4UEOA 1A4IA 3ONDA 4FC6A 1ISGA 4E5MA 4BNMA 3ZWNA 1R0SA 3VC7A 3L6EA 2I65A 4ZQFA 2EKPA 2X9VA 4TZTA 4U6QA 4B7CA 5CG1A 3WGHA 4B3IA 2GN6A 4TSKA 3DDNA 1YJ8A 4J16A 4RF4A 4BUCA 4CL3A 2XXBA 2VRCA 3I9JA 3DC2A 5HM8A 4HUJA 3BIOA 4IDBA 2PH5A 2CY0A 4XB1A 4CR7A 4NK5A 1U2DA 4DGSA 1LX6A 3LK7A 1NPDA 4BKRA 4DBVO 1QMGA 4KUEA 3WYCA 2D4AA 1G0OA 5KOIA 3K5PA 3RCBA 3RUDA 4BMSA 1DO8A 2UDPA 1EBUA 3O8QA 1R37A 2H5LA 1IHYA 3PLNA 1A9YA 3AU9A 3LT1A 3DZGA 4JX8A 4CLRA 3ZNQA 4YVFA 3H8VA 3E6AA 3PRJA 2Q2VA 1O6ZA 1YQXA 1CF2O 3RUCA 2X4GA 1E3EA 4PG4A 2CSUA 5FYDA 1VL8A 4YWJA 3VPGA 4EI2A 3OETA 4HX5A 2ZB3A 1NWHA 1ZVMA 1QLHA 1ISFA 2ZIZA 3KYCB 6ADHA 1ZMTA 2ZYAA 4FPXA 4IQ8A 5DBIA 4S1VA 5HRUA 4PVDA 2W8ZA 3NT4A 1I2CA 3BAZA 3U0BA 1P1IA 4RZHA 3P7MA 1N7HA 3GPDG 2EERA 1HLDA 1KIFA 4M54A 4MKXA 1UP6A 1F8FA 5F21A 4E2YA 1GZ6A 4OKNA 3CSDA 4CR6A 4UULA 5JMWA 3IKTA 5CP8A 1Q0QA 1ZXBA 4MVJD 1A71A 1EUZA 3EY4A 1GL3A 3I3OA 5ITVA 3WB9A 4AJ4A 1LUAA 2F1KA 2VRBA 2BGLA 4R01A 5EIOA 3UKOA 4ZICA 4NQZA 5HS6A 1U3TA 4YJGA 1RPNA 4ONEA 1UXKA 4BNHA 4WE3A 1Y1PA 3MCVA 4R16A 1Q1NA 4RLHA 1DPGA 2OP1A 3W8FA 3ST7A 3C8MA 1ONOA 3PJFA 3L77A 4BNJA 4Y6SA 3B1KA 4A5OA 2VZ8A 1P31A 1I3NA 4OO3A 4XR9A 4E5KA 5JC1A 4BNLA 1PJLA 2OL4A 3BMOB 4DIBA 5L7WA 3M2PA 2FR8A 2BH9A 3PXXA 2GN9A 4IJUA 2AMFA 3PQEA 3VOSA 3G0OA 3GGOA 3D7LA 2R6JA 1NAIA 3MWDB 1WLYA 4GLOA 3ZWBA 1P45A 4BNFA 3HHPA 4B4VA 2AQKA 1F14A 3AM3A 2UV8A 4IQ0A 4WLUA 1MXFA 3TZQA 1N2SA 1GYRA 3SVTA 4KUGA 4U0KA 5F5LA 5TIIA 2PZMA 4WCFA 4BVAA 4M49A 3PWZA 4JCOA 4KP7A 4QTZA 4XJSA 3JQGA 4ZU3A 3NEPX 1MG0A 4Z6KA 1PZGA 2E37A 3OIGA 5BNTA 1ENYA 3L0DA 4Z9XA
chains in the Genus database with same CATH superfamily
4L4YA 1OTXA 3K0AB 1G8AA 4NZOA 1OI7A 2I3BA 4ZI3A 4PVCA 4OB6A 4MINA 5I7EA 4LYJA 3L6DA 5K01A 4JWKA 3HL4A 3NPAA 4RA6A 3F5DA 2QUJA 3THSA 1IY2A 3HEMA 3P9PA 5KTSA 3GJ0A 2OXCA 4I5EA 1SCNE 3WYAA 2I1QA 4IDFA 1HT0A 2YXNA 4U00A 1RWKA 3A0UA 4ZV4A 3D3EA 3UVEA 1J21A 1ZICA 4FFOA 3LHDA 1GFZA 3F78A 5JI3E 1IZZA 4HGRA 1NP6A 3VX4A 5KOJB 3ME5A 3GNTA 4XFDA 3T3IA 1ABBA 4PLHA 1V1MA 3D31A 1DHTA 3N2KA 4A8JB 2F4NA 1RKVA 3DL2A 2A88A 5JG7A 5KQPA 5FUWA 1EVYA 1RE0A 4RPHA 2AKAB 1PEKE 2D7CA 4KXQA 5IP5A 4DV1B 1R64A 1U99A 4XLLA 2RHTA 3FWNA 5FAKA 4TYNA 1WW3A 4C3UA 1ECFA 3KTAB 1RPTA 4QO8A 1YHZA 1QHXA 3DKRA 2XCQA 4OQMA 2IYSA 1FFWA 1F6WA 3C0KA 2ZCVA 3HXTA 4HNSA 2E85A 1BWQA 1BS1A 1AGNA 4IH9A 4J4TA 4F71A 1Z4KA 1L0BA 4MDHA 5EI5A 2H2WA 2BIFA 1XCOA 3RR2A 1V0JA 2QMQA 4YY3B 1FX1A 4G0QA 2G04A 1ODCA 2G9ZA 5B58T 3AVXA 1KE1A 2EQ5A 1NXPA 5AUQA 3U3KA 1WDTA 2FXIA 4JU9A 4IXMA 1MO2A 3ADOA 3G7UA 4QUIA 4RKYA 1S2MA 5CFPA 2B2CA 4R4JA 1FZTA 3ESRA 2QY9A 3AUTA 2L18A 4RDIA 4YAFA 4UAGA 4L75A 5C46F 1LQ2A 1Q22A 1GGKA 2EWWA 1QUFA 4KKVA 5EP4A 1F0KA 5CDUA 1OLSA 3KJIA 3RNOA 3U13A 2VPWA 1PJ4A 3PC8C 1Z5OA 5EHQA 3RVMA 1VMIA 1Y8AA 4RVNA 4P82A 5KJEA 5IJWA 1X1TA 4X71A 4ZGBA 3TXYA 3D64A 1GAXA 4FZRA 1IN7A 3IP7A 3E35A 1ZIDA 2AOVA 5BV7A 1TYDE 4X7MA 4Y2UA 1B6RA 3M5PA 4KLRA 5J2UB 3M4XA 3TPZA 4B7AA 5GINE 3M4NA 1VHJA 3O7WA 4OUDA 1YV9A 4KNVA 1L4KA 1PDOA 2EGHA 4IOJA 3RYTC 2E5LB 4O29A 1E64A 2J59A 1E58A 1FYFA 1U0EA 3FHOA 1T3TA 4EG7A 4DCTA 5DNUA 3HYRA 3KVOA 1ZAYA 1N5KA 3FBGA 3F6RA 4HH0A 1IWPB 4MCHA 3QEOA 1DIBA 1MHPA 2ZATA 2UVPB 1MT0A 1N8TA 4ZAVA 4C0LA 3HCNA 1C4OA 4DLZA 5KYWB 4ZVSA 1VG1A 4JUAA 3PI7A 1PV2A 5A7FA 4MKRA 4TTIA 1TLFA 3GG2A 1E0KA 2JFPA 2AD5A 2QPAA 2YJ5A 1ZCBA 1XMPA 1TTPB 5AK6A 3NYWA 4BC1A 4B2PA 2PYIA 4NICA 1H6BA 3BMXA 1E6LA 3OURA 1ZK0A 1G1MA 2VP2A 1XDWA 3H8JA 1NL3A 2BFCB 4J1TA 2YBDA 4LHEA 3C3MA 3M6WA 3GLKA 1KJNA 4MIOA 2HL6A 4X3PA 3ADPA 1FBTA 2I6UA 3QNWA 4BN0A 2J3HA 1OASA 3NB0A 1L8XA 3ZDCA 4QEDA 4TQ9A 1T43A 2G3YA 1NGSA 2OBFA 1AKQA 4F4IA 4F93B 2FFAA 5DBOA 3TGWA 1DTSA 4RK6A 3USES 4I50F 4IMRA 4E5DA 4XWTA 3W9UA 1FSPA 4ENTA 2VC2B 1EFLA 1EFPA 3OKCA 2FJ0A 3GLQA 2R65A 1QCYA 4TKZA 5T8KA 3DMYA 1FC0A 2VJQA 5JSZB 2BGGA 2VXYA 2PUFA 4IKOA 1VIDA 1WE2A 2ZU6A 3FRJA 3NV7A 4J07A 2L19A 3K0HA 4XGRA 2UVQA 3AUUA 4CLHA 4X45A 2G25A 3AR4A 4EL0A 4CEJA 2YVKA 5B1HA 2UAGA 2FE1A 4HYQA 4HXEB 3RWMB 3WJAA 2B8NA 4F46A 2EBFX 1YHYA 3V3TA 2AN9A 1E2GA 5HS4A 2RI6A 2CLIB 1IM5A 4MUIA 1IRIA 5SZIA 4DMCA 1EMDA 1H93A 1GZ7A 1UP7A 5HR5A 1ADFA 4H3SA 1WP4A 4HPJB 3ZE1B 4JUIA 3QVVA 5KSZA 2IL1A 3MOIA 2J41A 2BEKA 4RCYA 4ENVA 3H2BA 3S4YA 2HAEA 2JFNA 3V4SA 4NCJA 2JKYA 4MR8B 1B8PA 1UH5A 2GSWA 2VQSA 3LWNA 3EAFA 4G85A 5EIEA 1CUXA 2X0NA 1P33A 1LS6A 3HHEA 3K6KA 2C7GA 3KJZA 4DFDA 1WU8A 4FIDA 4L7QA 4L76A 1RAEA 2FMUA 2JCVA 5DOVA 3TOZA 4L07A 3ESXA 2IY7A 4PSAA 3OJLA 3PEYA 1U5BA 3HJUA 3UCXA 2DERA 4GKKB 3QE9Y 2IP2A 2Z5FA 1OIWA 1V48A 4EGQA 1QMPA 3KRTA 4EJ2A 5AHRA 4CRWB 4E5UA 2DOKA 2NOAA 3BVPA 3PCRB 3OEHA 3ZG6A 5J2TB 1RKXA 1Z5VA 1QRTA 4PO8A 3IMKA 5AFSA 4PSKA 2XADA 4OL9A 3TJRA 3THYA 2Z2XA 3JU3A 1O97C 1SCIA 1W25A 2EXXA 2FWMX 4G5XA 2Y3IA 3BILA 3M1LA 1E7QA 1FY2A 4R0VA 4AP9A 2PRYA 4E4RA 4HAXA 1Y98A 3TQHA 1FW6A 3RBAA 1X1DA 2I7TA 3KQMA 3LGSA 3KQSA 3NHPA 3SSOA 3AUFA 4E33A 3I6YA 1U7OA 2J0UA 1ESDA 5ARCA 1LSSA 1M76A 1FDVA 3NDIA 4HF7A 1M75A 4DMFA 4LY9A 2GPYA 3FTEA 2SBTA 1W0CA 2XHZA 3KSBC 1IY1A 2QP9X 2VQEB 4HLQB 2ZRJA 2VJPA 1YNSA 4RD2A 3K31A 5LDDC 3O47A 2W7TA 1LFAA 3X1YA 2IUFA 2X77A 3A1TA 5C37A 3B3FA 3GUUA 3CX7A 3FYUB 2QE7A 4W8GA 3OZRA 2PR2A 3TINA 3LH5A 4JUCA 4NFLA 2VJMA 3UWSA 1IVSA 3VYWA 3JASB 1B7GO 2YXBA 4GZ3A 3TRIA 1F7VA 1L5NA 1RAGA 4C78A 2HMWA 3ABOB 4WK6A 2CC2A 1NJ8A 5KNCH 2APJA 3TI9A 4IXWA 1WSBA 2W2LD 1TUGA 3B36A 3DOHA 3Q8WA 1TU0A 2ZUEA 3EVTA 1B42A 3IDFA 1YMQA 4NMXB 5IJXA 3TE6A 2ZTSA 3QLVC 4EJ0A 3DE7X 1U9YA 5FWNA 1E1LA 4PX9A 5C5DA 1C7RA 1Z2AA 1ZW6A 1CUJA 4ZWNA 4C22A 1XYGA 2H4FA 2GOYA 3LFTA 4FFSA 4W8HA 2WF9A 2J0QA 2GF9A 3DZHA 1AZWA 1G5TA 4KV7A 1GR1A 1DADA 3M33A 1G18A 4KYUA 4F9EA 5JYEA 2XMQA 1YC2A 4A27A 3JATB 5CURA 3P0JA 3PNYA 5IM5A 5DM1A 2VSNA 1TYZA 2F00A 2FH5B 2Z8ZA 4O63O 3P2YA 3SSAA 3VU9A 1OHHA 1NVXQ 1WZUA 3CLVA 1S6YA 4TKMA 3UK1A 4D80A 4MI6A 3SIPA 3VTFA 1UBSB 3C3YA 4WINA 5F64A 1L6RA 5FOWA 4F04A 2YWFA 2HN9A 4N49A 5HKLA 4N9QA 4OSPA 1OYOA 1S4QA 3ZOKA 1T9CA 3H6GA 2P6MA 4XGKA 4XJVA 1RKQA 5SICE 5F3DA 3V55A 4F3TA 3IAEA 3VU3A 4V2UA 2HRQA 5DNEA 3T7IA 4B73A 2R60A 3UWDA 4KLNA 2HQRA 1OYWA 3N0RA 1FS6A 2I4LA 3M6XA 5DRYA 2Q3CA 5ICCA 3JQ8A 1D2CA 1I1QB 4UXHA 2HHLA 3C1TA 2JC3A 1QFYA 2D74A 3V4FA 4AZ0A 2X9LA 3L4KA 1W4LA 1I4LD 2YMPA 2EFDB 4N03A 4YRAA 4N5IX 2PSHA 1YK1A 2UUPA 3A36A 3EF1A 1S9DA 3NBMA 3LVBA 2Y2VA 3B1WA 4W7SA 1Q2UA 5FADA 4C2UA 4G37A 4FBLA 4JSRA 4MWTA 1E3QA 4Q16A 2XCTB 3AF4A 4FJ2A 3OTHA 4JQZA 5P21A 2IYQA 5L45A 5CNKA 4ZDKA 1JDSA 4E32A 5CA0A 1RWQA 1FSFA 1QHNA 1N2ZA 1U2SA 1XZIA 3VI3B 1QDEA 3EXHC 4EGFA 4G0NA 2GAJA 2ORIA 3LWZA 1IN6A 4NY1A 2FN7A 3LT5A 4C6HA 4C21A 1P91A 1CS4C 4YJ3A 2GZDA 2Y76A 2DVMA 2JGFA 1AKRA 4LSMA 4QQ8A 4YAGA 3HXLA 1TF2A 5FLYA 4TYQA 2HV9A 4B8WA 3K53A 4ND4A 1CU1A 4TGLA 4PZZA 1ISJA 2ROQA 5IK2A 2BY4A 3JQ9A 4KN9S 3UPDA 3DV0A 5JCPA 4LTMA 3CRRA 3IOBA 3CR3C 5FAXA 5LZ7A 1KAEA 1G9XA 3BWYA 3KBBA 1RPJA 3SDSA 3NTOA 1WMFA 1E7WA 3KVNA 3RTGA 2H4HA 5AKYA 3AEQB 3GMTA 1NUSA 3KTAA 5J47A 3DCNA 4YP9A 1QP4A 3VVCA 4RGBA 5KDLA 1QHIA 1TZ2A 3S1AA 4LF7B 2C3PA 2O2XA 4GBGA 3HWSA 4OJNA 3RARA 2RBEA 3RS2A 1FXWF 1TD9A 2QXTA 3WRYA 1RYYA 3ZWWA 2XVYA 4GICA 4R8VA 3RSGA 2QRMA 3PEFA 1Q6ZA 3ZJYA 3M1YA 4IZ6A 1IZYA 1R50A 3O95A 3ETNA 3N6VA 3QVMA 4Q1VA 3ZLVA 4GYWA 4AK9A 5KYYA 2JBAB 1KH3A 1L5SA 4LGVA 4NS1A 4IFEA 1DSSG 3AQ4A 3KC2A 3VAZA 2ODEA 1PVVA 4AJEA 1XE3A 1YS7A 1EGHA 4AJIA 1N5DA 4RZXA 4CKXA 5EE5B 2VSFA 2GERA 5IJZA 4KH1A 4Q1AA 1A8HA 3OC6A 1TC2A 5TXGA 1NVWQ 4A0GA 4DCSA 3WKCA 3HK2A 3E84A 4R2LA 1NVFA 1RLUA 4CMIA 3R5TA 4K9RA 3RRXA 3WDSA 1L5VA 3HBJA 5EJ7A 4IIDA 3LTNC 2ENUA 5F9MA 5JJKA 4G1FA 3OEYA 3SJ7A 4YCNA 3GAMA 2QDXA 4UNQA 4LZWA 5K1ZA 3KVVA 3WRXC 4LCEA 4I1IA 1GAJA 4CKBB 3DAGA 4DL9A 4EO4A 5GPBA 1TEXA 2GN8A 1GY8A 4FFLA 4HATA 3B5IA 1NXTA 4M21A 2IDZA 4MS4A 3M1AA 4TL9A 3QIVA 4OJMX 3T0FA 1E7YA 1E98A 1FNSA 5IYZA 5DIFA 1I4DD 4O5AA 2IODA 4X6LA 1EE9A 4JLJA 3VBEA 3ZI4A 2QM0A 4A0QA 4OIFA 4O33A 3M6MD 4KFCA 2VPQA 4Y3UA 1M2JA 2F9LA 3PGVA 1Z4NA 3FOEC 3ET4A 4IS2A 8ABPA 2HU7A 3K09A 1H66A 1V96A 3JWIA 1W44A 1NP3A 1QWOA 2XUGA 1TVCA 4HR7A 3GO4A 5F7ZA 1CVRA 1NFQA 3HI6A 4YLEA 4KTVE 3PDIA 3QW2A 4Q1FA 3MG9A 1KXJA 4FILA 1OXXK 4AT1A 5IZCA 3Q8KA 3AFGA 1P3DA 4OFXA 1RDFA 2BFCA 4RDXA 4EJMA 4IJ5A 3JALA 1I5OA 4LPSA 3KLPX 1FU8A 1RJDA 3UAOA 1SU6A 3NQ41 1E99A 3KZCA 4KHPB 1HLGA 2N46A 2RAVA 3N9IA 2XRZA 3UMBA 2DUWA 1HFJA 1V43A 3BJIC 4HWRA 4QJ5A 4ARUA 4W5QA 4GP6A 3MINA 4KGZA 4WBNB 1OBVA 2DHQA 3BBLA 4ALNA 3AGPA 3CXUA 3PYXA 1VPVA 4LS3A 2C2KA 5ESRA 2W0MA 5FBQB 4W99A 5NLLA 2DXIA 1S8NA 1U0BB 3RK4A 3AEKB 4J1NA 2F90A 4CLOA 3IUPA 3V33A 3G8DA 1FTWA 4YN3A 2DFPA 1O96A 4BQOA 1H65A 1NNEA 2BSXA 3FWYA 3NGLA 3IBFA 1YNOA 5EP3A 4Y2JA 3VVMA 2YUTA 1TW2A 3A6DA 3B1YA 1E6UA 5F7XA 4U1RA 2J3DA 1EJ6A 3OPYI 1GPAA 1WKVA 2WSLA 4ZT5A 3LZ6A 3RRBA 2ATCA 3ZW7A 1ZOSA 4B80A 2A9FA 2AQHA 5AJWA 4TXLA 2WTUA 4PR3A 3HKCB 3F47A 4R1PA 5JBQA 5JNVA 5KQSA 3DPSA 3G23A 2IZZA 1X92A 2BCJQ 1CUUA 1M6HA 2QJRA 2JHFA 4B74A 4MR8A 4U7FA 1RLOA 1RHQA 3EE6A 4W9MC 3VZQA 1GDTA 1ZGHA 4W8OA 2IYNA 5BSHA 1TT7A 3K6SA 2V9ZA 4C06A 1OFGA 1OKKD 1ZJYA 4JJIA 3JYNA 4AQDA 1N9ZA 4CV0A 1M5UA 1ZH4A 2QSYA 4CIYA 1FDUA 3ZVNA 1YMVA 5EWJB 1H8EA 1DZIA 2GD6A 2R8PA 3KSDO 1ZH8A 2HCBA 3I4CA 4L57A 5DEIA 4I3HA 2H7CA 5CXQA 1JHDA 4IX1A 3S1LA 3VHRA 1U8XX 1UT5A 4GOOD 1AX9A 2DF8A 4PGHA 3ZV7A 1RRKA 1DFHA 2W5UA 3G9ZA 1J0AA 5DCUA 3DD1A 3ED5A 4RFVA 4HBGA 4F91B 4F8YA 2XEDA 2QSUA 2WPDA 4FOPA 5FI5A 1ORHA 3V8BA 1BCSA 3FGZA 1X6VA 3BWMA 4H60A 3PHGA 2M6RA 5EKDA 4F85A 1FVHA 3D7SA 2DFNA 2G1AA 1A95A 1NXOA 4FWIB 3AR3A 5HKBA 5CFRA 2ZI7A 1YCFA 1BWPA 2FOXA 1QO0A 4ZVPA 4BGDA 1BJTA 2NUPA 4F2WA 4HLCA 3W9SA 2WYIA 2ZRFA 5HOQA 1PUXA 5CJPA 3VNRA 1AZSC 1WMAA 5TX7A 2QN2A 5DN6A 2W83A 2XT9A 5BNZA 2C3YA 1XOIA 4PPFA 5DGXA 1DEAA 3FWZA 2C4VA 3A6FA 1UFVA 5FJIA 4YPFA 4EWLA 2ERYA 4NYIQ 2GNOA 1ISMA 1M54A 4TLBA 4BJ1A 4D43A 2O6HA 2BUBA 4EY6A 3BIJA 2EJWA 3R4VA 1ACLA 3FUWA 5KQRA 3OQNA 1E3WA 3HWWA 2WSYB 1DXOA 3I73A 2OB2A 3KSRA 2NWQA 4S1TA 1XTQA 1ZOIA 2P2CA 1LNZA 1E79A 2FW0A 4KHZA 3PD0A 3JASA 4PLTA 2CXRA 2W6PA 4LGYA 1XRSB 1JG4A 2ZWVA 3C70A 4H6WA 1A8IA 1A5TA 3RU7A 4ARZA 3TZHA 5ALSA 5HMMA 3R5HA 1PD1A 5JS1A 3UHFA 4B84A 5GY7A 1F5SA 4FCVA 3FMVA 4GX0A 3UGQA 4DR7B 2A1UA 2IPNA 1W4AA 3H19A 3BCHA 1RKUA 2NU6A 5HUQA 2C3OA 5ITZA 5DGCA 2ODBA 3QEAZ 2XDQB 4X1IB 4HMPA 4OXXA 2WA2A 3LQRA 1QX4A 4ZVVA 5AVUA 2W6OA 3C6KA 2ZSFA 4TRNA 3O3MB 1NPTO 1TA4A 1ZWLA 3U1TA 2QL6A 1SIWA 5CVUA 4BUZA 3B6EA 4MV7A 4A0HA 2O8FB 4O2AB 4Z51A 5JSHA 2H0RA 2ANBA 5LQRA 2DE0X 3ZJ5A 4FFBB 5HKKA 2EIHA 5TRTA 3KVYA 4OI4A 4BO8A 1JDTA 3QV2A 2R1TA 3SXJA 2ZSUA 3L46A 1ECPA 2XE4A 4MV1A 1KSHA 4BAUA 1GQSA 1JRLA 4MJ7A 1VA5A 4AMUA 4IJ6A 1U02A 4DM4A 3DAOA 5HQTA 1ORTA 2H7XA 3IQXA 1F48A 1BCRB 1Z0FA 4ETWA 1E77A 1DJPA 3ICWA 3BXFA 3G9XA 2WP0A 5LDHA 2NVOA 1HEUA 1IQRA 1Y80A 1LBIA 2RGBA 3I9V1 2P0YA 4DCCA 5C1DA 3NHJA 1QSGA 1U1GA 3QG1A 4EJSA 3ZW9A 2XA2A 4Q4CA 3GG9A 1UXJA 5JI2E 4DUGD 1NC3A 1SHTX 4NPAA 3OT5A 4WOCA 4JGIA 3EA0A 2ZUDA 1AF4A 3QYPA 5E9AA 3SCZA 1G2IA 2I8LA 3KSMA 3VKUA 4BNYA 1KS2A 1O94A 3H75A 3LM8A 4NYIR 1UAYA 2OHIA 5IN5A 4XVCA 4XRRA 4DBZA 1EWVA 2FP3A 4QQNA 1YVRA 4MUGA 4DJFC 2AI2A 1QRDA 3GLFE 3V1MA 2KBEA 4XYMA 1X7XA 2HJHA 3QLUC 4M0KA 5D3ZA 4RTOA 2ID7A 2G71A 3E9QA 4BU0A 1OXKB 3C3BA 1PYDA 2HF2A 1M0EA 2CVHA 3O3NB 3ZDDA 1QQTA 3PFIA 1YAJA 4XQ9A 2ZGVA 3A05A 3AP3A 4OOEA 2WQ7A 4CI0B 3BE8A 1ISPA 1COZA 3ZOZA 4HNTA 3HO1A 1HGXA 2P78A 3F1KA 4AZVA 1DTWB 3IERA 4BNIA 1H2RS 5IDWA 4DTCA 4QDKA 3SFVA 1ZO8A 3RJ5A 3P2KA 2F8SA 1LLFA 2WAOA 4CQNA 4PLGA 1MV5A 2W6ID 2ZBFA 2PXXA 3AMVA 4FOTA 2NV6A 2ZRQA 4NIMA 3VZSA 4BNDB 3FDXA 3OI7A 4YJ2B 3ROKA 2PS9A 5JMOA 5C52B 1NDQA 1U80A 1G9TA 1C8BA 1AE1A 4BNZA 1UDXA 2IYTA 3ROGA 2VLIA 5B2ZA 4E1BA 1L5LA 2OC4A 3TD2A 3TIFA 1H0KA 3TQOA 4IIUA 2A30A 2Z43A 5C1BA 2D5CA 1X39A 2Z98A 3VNSA 3JYLA 4GG1A 4YQZA 1EEXB 3FOCA 4DR6B 4POOA 1Q20A 2P75A 4ML3A 3PIRA 1AQLA 4G89A 2GPAA 1LI5A 3E70C 5H81A 3WL8A 4ZI7B 4RH1A 4PN7A 3LKDA 4Z9FA 4AJPA 4IG4A 4FINA 4AMVA 5K0ZA 3SKYA 1WCIA 4NAHA 5CB8A 5D7NA 2Y2UA 1U63A 1JA1A 1XTRA 1UZNA 5LPNA 2JLSA 2Q6OA 4R6XA 3WADA 1T1GA 1GYPA 1Y8CA 3ZYZA 4C87A 2WDZA 5AXBA 4EUSA 1Z07A 4WXHA 3KUUA 4M83A 5JLJA 1H1TA 3BQNB 4U5XA 4X1KB 1H2FA 5DLQC 3U7QB 1RRMA 2ZCJA 4EOGA 3FBTA 5CAEA 1QP0A 2ECPA 5B1EA 1OFTA 2GUGA 2Q62A 3O21A 1Y4UA 1CDZA 3BD9A 4C14A 3IVGA 1N6NA 3ANTA 4LNUB 3PDCA 4TWIA 1Q91A 2X5XA 1H6AA 4B3MB 2ZAIA 2FGJA 3MXTA 1Z18A 4KXFB 1YWGO 4D9HA 3KE9A 1SCUB 3R7SA 2JA1A 2R4TA 4V1CB 3IPAA 3UPTA 1DXYA 3DNPA 3R5XA 2VNIA 1P9WA 4YDHB 5SY9A 1JU9A 4FYXA 3ZGXA 1AGXA 4DLBA 3H9EO 3N8HA 8ATCA 4HH1A 2RE8A 2H11A 4ZA2A 4URVR 4XWOA 2JGJA 1PFGA 2OCXA 3DD5A 2C31A 1H2AS 2AQIA 2ORYA 4E12A 1XFDA 3H1GA 3PS9A 4EY3A 1BDHA 2VPYA 4MITA 2AFIB 5BXQC 2G80A 2QZZA 2VPPA 1CFZA 4G4JA 5CNJA 4RS4A 5DSZA 5JZ9A 5KYTA 3TQQA 2I87A 4QJIA 3SVZA 3DZCA 3KAQA 1VKHA 2VOJA 3EDYA 3H2IA 1H2HA 4X63A 4XIYA 1CRQA 5M2QA 4JOCA 2A59A 4H1TA 2XQFA 3HDVA 4Q48A 2HH9A 2BH2A 4TZ0A 3DZDA 2HJSA 1RAIA 2JFGA 2ID4A 2WNIA 5A9RA 3DT8A 5I9MA 5LXTB 4GMFA 4MUXA 4DCPA 1A9QA 2WJWA 1Z38A 3EFBA 1HFEL 3L41A 2OD9A 1NJ2A 2QTVA 1SCJA 3F98A 3LP8A 5MN6A 2YJ4A 4HTFB 1EFUA 3VYVA 1RJ9A 3CW9A 2Y66A 4BMXA 1ZX1A 3VI4B 2CK3A 3T5DA 4D7AA 3FNIA 1M34E 2WKSA 5ELMA 1PEDA 1MG5A 4CTOA 1JQBA 3AEKA 1M10A 1ISHA 4UZSA 4AURA 4REMA 1RYHA 1XT6A 2C94A 3DOOA 4P35A 3D3WA 1G7CA 4ER5A 4FFDA 2R85A 3EQ9A 1U0SY 3U7HB 1A8UA 1ZD9A 1ZVJA 1HKUA 1CQXA 3I9MA 4C76A 2OY0A 2XBUA 3KKMA 3LE8A 5THQA 1P72A 1BOOA 4KWCA 4WD3A 4BRSA 4KE6A 5GJBA 1F3LA 1WD7A 3ACBA 4TMTA 4WOBA 2ATXA 2BI4A 1Z3IX 1V95A 4D8TA 4EJFA 4ZYLA 1OB5A 1VHLA 4EG4A 3D7NA 4DG8A 1P7CA 1UKBA 2OBYA 1QCZA 4CLEA 4OHWA 1RXWA 3WBBA 4QX6A 2ZT5A 2C2ZA 3U3XA 4EW6A 1JHRA 3PLRA 2QMHA 4M9QA 2NACA 1KHHA 1TVKB 3B51X 5EA2A 3FUXA 3K9LA 4JYZA 3OE7D 2B0JA 3D5TA 3ODGA 4AJ1A 2QBYA 1NW3A 2RGCA 1NMSA 2PZGA 1GGVA 1HTWA 2YS7A 4MV4A 4LDZA 4B3BA 3U3MA 1C7JA 2UYYA 5JDIC 3K73O 4L2IB 3ZWPA 4PLWA 5IJ0A 3SIWA 5JAZA 1WMBA 5A5GA 3ILXA 4QRHA 2FZWA 1FP7A 2O52A 4HFJA 3BORA 2WVAA 1N2CE 4CEHB 1EDBA 1WXIA 1EK0A 4PXAA 4XM1A 3ACDA 4A4DA 1GGFA 3PTLA 2V6MA 3ORHA 2IQIA 4IHJA 4B2IA 3ONFA 3C3XA 3AZPA 4K0KB 4F9GA 1E7SA 1SEPA 2HWUA 2WSSD 1PZEA 3Q0EA 4NL4H 4Y1FA 3IKMB 5CLGA 3T9EA 4OMCA 2C54A 3NHBA 1QYVA 3WXMA 1WZ2A 4A36A 5EQDA 2GXSA 4ZEOA 2D1QA 2GKGA 4GLJA 5LKAA 1PDWA 1O4WA 1U3FA 4YCDA 5ALKA 1VJGA 3O94A 1WXHA 3W2GA 3W6UA 5B30A 1XL1A 3DFZA 3MWYW 4X8MA 1HT2E 1P74A 2JAQA 4NJEA 1TYBE 5TV2A 4E0BA 3JZAA 4YJKA 6ABPA 2XYRA 3OM9A 1CEQA 4BASA 4BQRA 3D1JA 2Y1EA 1R4AA 2WVGA 5A1JA 5JISA 5T3YA 4KWHA 1E9BA 1VB3A 3PXDA 1T2UA 3CUYA 4MMYB 2OCIA 4KXVA 1M67A 3SM9A 3UAYA 5T7BA 2CL7X 5AI9A 4MVJM 3K2EA 4ASUA 5LIRA 1QYCA 3B2QA 3LCVB 3UJ8A 4D9NA 4ZYXA 1WKCA 2IUEA 2JI9A 3FMGA 3IQGX 5AQ1A 5BNIA 3SE7A 3C24A 2B1QA 2ZS9A 3DL0A 4G86A 3PU6A 1QIMA 1T4GA 2VRWA 5G0VA 5CBPB 3EPHA 3EN0A 2JIBA 2HSEA 1RJGA 4UOQA 3WX0A 1OD6A 3IJEB 1CJKC 1P5ZB 2XDQA 2VCEA 4M6WB 1G3IA 5L95A 2Q2OA 2O19A 4QQFA 2ZRIA 2IBTA 3WFIA 3FYDA 1SXHA 3OBBA 1DRUA 4MA0A 4OU4A 1EGMB 1AMUA 4E4YA 4JU8A 1HDOA 1ADJA 2R25B 4BMVA 1WDLA 1YUBA 5JQGB 4EBBA 4KPEC 4AF6A 3L8CA 1AV6A 1ZS9A 4QHTA 2O8FA 1CLEA 4O2AA 4NU5A 3VZPA 3OZXA 1JEOA 2AUTA 4BWYA 1T9ZA 4OP1A 4ESEA 4RELA 2PKWA 3TBFA 1LW7A 5JXJA 4KR6A 4WIAA 3T1QA 2O5VA 2VF5X 3QVXA 1IHPA 4Q4JA 4IIJB 3OIFA 3HM9A 1HYQA 3L43A 8ADHA 2YVAA 1DCMA 3DWEX 3WL4A 1CNMA 3B78A 1QQ5A 2CMGA 3AI2A 1KZ9A 1P2GA 4CIDA 1KRHA 1BCRA 2QTBA 4WFIA 5DT2A 3VH2A 3H42B 5MHTA 4EQ6B 5KVSA 3JD1A 1S8AA 2AL7A 1KDTA 2Q7XA 4XPIB 5JS7A 2ISSD 3NP7A 3U3OA 3ZIAD 3SZUA 2JG3A 1DKPA 3M5CA 3OY2A 1T3SA 3VV3A 1O0SA 3LXXA 3FCEA 4O1HA 2JJYA 4RPJA 4HLNA 3CBQA 1SCQA 1AM4D 2HK7A 3KZNA 5JNWA 4H1WA 3IRVA 1KGSA 4R8SA 3P9RA 3BRCA 5DKFA 5C81A 3CE6A 4QATA 4V2IA 2OV3A 1QDUA 5GP1A 5KKAA 5C7YA 2FGKA 1H4VB 3RUHA 4FGSA 3H5RA 4BOYA 2V7UA 3EA5A 5J2UF 2P27A 3I61A 3GJYA 3CMMA 1BXRB 3EUWA 4AKIA 1UZUA 1EM8B 1UXOA 3JAWA 4PIMA 4N7RA 3SHWA 2V97A 4JSYA 5FEUA 1LD3A 4QYTA 2WIJA 4JP3A 1Q1GA 1O87A 4EVQA 2PKQO 5AVJA 2XT0A 3DVAA 4ZIRA 3MWDA 2AEJA 2TYSB 4YX9A 4H7IA 5BSTA 5DI3A 2WB2A 2BGRA 4WKOA 4ZVQA 1CZUA 3D59A 1XROA 1CP2A 1ODTC 4YT5A 4N7JA 1JFSA 3TVTA 5I7VA 1Q1ZA 2A84A 1V71A 1E2HA 2VNSA 1W30A 4BNDA 3W04A 4XASA 2V96A 1EGQA 2BI7A 2O3QA 3CLRD 3SHTA 1NWCA 3JY6A 1R0XA 2NT3A 3B8HA 5ADVA 1ZU4A 5KMGA 2BC9A 3N87A 2XITA 4MVJG 1SKYE 4OYHA 3TRHA 1DHRA 1E2NA 4MVJF 1KHTA 4C4PA 5B37A 5KCZA 3EG5A 4XFKA 2RMKA 2XLCA 4F4UA 5KJCA 3TTXA 3U4DA 2P4HX 4IXNA 2XB8A 3DR5A 3VHQA 2WHPB 5E1OA 4K88A 5LUBA 3T7DA 2QZ9A 4AKEA 3UMVA 4ZZ1A 1GNVA 4KWIA 4A2WA 4EK9A 4BQFA 1L1EA 5LMZA 1R74A 2HU2A 2P1RA 4CYMA 1ZKDA 3HLTA 2QI9C 1YE3A 3O5AA 3OPNA 1PT5A 4MWBA 5LIPA 3IOEA 4BNTA 4Z0TA 1HE8B 3RJTA 4A16A 4ZI7A 5FUQA 5LZ2A 3INNA 2EWVA 1F6DA 1QQ7A 1CEYA 2Z2IA 1LBEA 1RQ2A 4YJGB 4ZKDA 2JW5A 3EPJA 2JGDB 5E2AA 1ZI6A 1G8GA 5TQ0A 1EK1A 3EVNA 3LUDA 2H1RA 2ZIXA 1LCIA 1W0JA 3HR7A 3RS5A 4WLFA 4BECA 2TMGA 2XOKD 3KAKA 3LQQA 1P44A 3IIJA 3H86A 3I6QA 4J7UA 4JLAA 4MI1A 4TN5A 4ZREA 1BS9A 1QHFA 2C9MA 3A3YA 3GT3A 3ZCPA 4D9JA 3AVWA 5LP6A 4FNGA 1JQLB 1XCJA 4BKUA 1N6OA 2RHJA 3ZDAA 4WESA 3K0KA 4UVIA 4QDTA 4OUKX 3SX4A 1M2FA 1PCXA 4PICA 1P39A 1NE2A 2I6TA 2QMYA 2RC5A 3T7EA 4C0HA 1SCUA 3NMUF 1RWVA 4WN3A 2JLXA 4N0DA 1IIBA 4J43A 3T52A 3OF2A 4Z3KA 1B8UA 3WGTA 2CFIA 2J3LA 3QXCA 1CP3A 2P9YA 1TD1A 1VL0A 1N1MA 2Z95A 4AULA 1Z2OX 1U0HC 5CU7A 3RS0A 1NXSA 3I0MA 4E3WA 5IAAA 2WG1A 1AUOA 1OQAA 2BT4A 2PZAA 2RAPA 3JYHA 3P9XA 4BYMA 1FVFA 1QE0A 2XOEA 1RMQA 2D8MA 2YRWA 3R5KA 4NSNA 5CGZA 5FPPA 1XJQA 5J2TF 1D09A 2J5BA 3VR2A 1PNOA 4BTLA 3SVLA 2D6FA 3ECCA 4CFZA 1KKMA 1RNLA 4TM8A 3WQQA 3ZR4B 3VJLA 4BZZA 1GOTA 1Y3FE 4ND3A 4YAKA 3PC6A 1NDUA 3GDHA 3UB4A 4NC9A 4E88A 4OP3A 2VSYA 3I12A 3NU1A 4J2OA 3T7SA 2GO7A 2HIGA 2HRZA 2R8RA 1VKOA 4EUFA 2JFHA 1KQ3A 1LRJA 3RW9A 3N8IA 3CGWA 3EGWA 2QMZA 2OZLA 1ZOPA 4ZT4A 3VJMA 2PBZA 2PNFA 3T5MA 4KRFA 1P9LA 2ZOSA 1H0HA 3ETDA 4HDSA 1Y3AA 2B4YA 3SQMA 3NI2A 2FN8A 4DUYB 4AS1A 1JHPA 1C3VA 1C3JA 2W4QA 4ZVKA 2VR1A 4JENA 4N8SA 3NYQA 1Y89A 4ZKEA 1HKHA 3V2UA 2I62A 3WLKX 5MFZA 4DIDA 1QIGA 3AR7A 2UUOA 1N3YA 5AUOB 2YFHA 3P2OA 4EAAA 1WS6A 1YS4A 3LTEA 1U98A 4LOJA 1HA3A 3FCUB 4II2A 4WZAE 4Q1CA 1H4TA 2WWRA 4D3DA 2GRJA 5JWOA 5D8DA 4N5NA 4O3MA 1SKAA 4CETA 2WMNB 1P4AA 1Z8FA 4LRWA 4RW0A 4LYHA 3MGCA 2YC4C 3UGTA 3LCUA 1JMYA 2NTYC 5BN4A 3CA8A 1P2FA 1R8QA 3BQ9A 3PT9A 2O3SA 4FN4A 3COSA 4I81A 2EX4A 4I2NA 4L16A 1WUJS 1XYVA 2FUNB 3DXZA 1N0HA 3TK1A 3DQQA 3D9QX 3K0CA 4LDAA 4U63A 2XOXA 1NR7A 1XQ1A 2PUBA 1ZNXA 5EUQB 1UBTS 3INRA 2XRFA 3LC2O 1LRKA 4HAZA 1J07A 5EC8A 1IPEA 1Y82A 2ZPAA 4YFVA 1A5BB 3GPBA 4HPWA 3V8MA 1DRKA 1MNQA 2WWFA 2CHFA 3R20A 4X41A 4CQMA 1FP1D 2P77A 2GGSA 4G8DA 1UJMA 2B1JA 2AG8A 2QAGC 2H0QA 4Q5IA 1J49A 1JR4A 3AHEA 4NZZA 3L18A 4QNMA 1PTJC 3W7BA 4BQEA 1BD3A 1EJ2A 2GK4A 2HWKA 2KB0A 1EA7A 3ETEA 3RS3A 2DH6A 3QF4B 2PBFA 3LHIA 3TMYA 1FJGB 1MEOA 1DDOA 1N75A 1A7KA 1FP4B 2HDNB 2VTVA 4PGFA 4R2JA 3BJZA 4MKIA 1KJWA 1DIRA 1AG9A 4RHFA 3PFNA 3I9V6 4YRLA 3E9YA 1OH7A 4G1UC 2GCGA 1GV1A 1HK7A 4DKJA 2IUYA 1DT5A 3KXIA 3RYCB 3N53A 1RJWA 4KDEA 3P0IA 1VOTA 3EXG1 4J2HA 4QULA 4Y2TA 2XB2A 5HXAA 2FPXA 2G5GX 3BL5A 1EINA 2UZ1A 3LGAA 4HUQA 4KJZA 4FTWA 3EGOA 4ZALA 4YREA 2PGXA 3EGXB 2QSZA 4PLFA 4F84A 1ONBA 4UNPA 3UG6A 4IMPA 1T9GR 4B71A 1WTAA 3EG9A 2NO1A 3I6MA 2GJSA 5E4TA 1H2WA 3HJCA 2XY4A 1R0KA 5EGNA 4PTLA 1A72A 1C30B 2AB0A 3FR8A 4QBGB 4LSWA 3RF6A 1JG2A 5IKEA 3UT5B 2B1GA 2CNLA 3LKBA 1GPMA 3UWPA 2GF0A 2WMYA 1GD1O 1YKSA 2KE5A 3LQ4A 5JNLA 3UFXA 1D6SA 2BFFB 2CB0A 3MRVA 3UW1A 1C9YA 1RQ7A 4OL0A 1UBRS 4HDCA 4EG0A 3PWSA 3RRJA 5IC4A 3I09A 1XFAA 3W5BA 1ZRNA 2A7QA 3QGMA 1M8GA 4HQNA 3CF4G 4KQMA 2FSGA 4UTXA 4NE7A 3SS8A 1H3NA 1NHGA 5KPJA 1I30A 3N75A 1B8VA 4IIGA 3IUBA 4N01A 1DB3A 2WUWE 4PLZA 3R8FA 1SN7A 4LJ4A 4RVUA 1W8DA 3HYNA 2PCLA 2J3IA 2PQ2A 1LDBA 2DUUA 4R0MA 5BQ3A 2D2XA 4PCVA 1K97A 1JR3E 1KK3A 2QG6A 3IQFA 1QFJA 5G4KB 3PR1A 2C9OA 5JE8A 1BWSA 4C5CA 2JGMA 1J0XO 1DC3A 1HQYE 4Q7EA 5K09A 4US0R 3KYDB 3O74A 1BMDA 1G3UA 2FQXA 2J4CA 2GPNA 3MTGA 4UUBA 1E1CA 4W7HA 1D4FA 3X0DA 4F56A 4I6GA 4XPIA 4EPYA 3C3WA 2WU1A 1OGJA 5ITWA 1U1IA 2AZ4A 2C8VA 1N9GB 4MDEA 2ZIWB 2J33A 2Q8PA 3HKEA 1G5RA 2EOAA 1JJIA 1UWLA 3E9NA 5FL7D 3MT8A 1PFYA 1PT6A 5I48A 3INTA 1N6IA 4G5YA 1Q1EA 2XMGA 2ZULA 3O83A 4C7VA 3QUTA 4QBFA 4UARA 3UMFA 3ZX4A 4IR7A 3PFCA 1KZHA 2CVZA 4LDJA 1BXRA 1YGYA 4QPCA 1KH2A 2HA2A 5INTA 3OF3A 3BF8A 2RH4A 1WUIS 4Y9RA 5CM8B 3L0YA 5CHYA 3U62A 2DKNA 3E81A 4KX3A 3WC4A 3PR2B 1TX4B 1UKZA 1UM8A 1YZUA 1Y6JA 2JIZA 3EBLA 3TQSA 3JWPA 3TL3A 4HQOA 2BEWA 3C3EA 3P4UA 4NG4A 1W4RA 1CJCA 4QTYA 1VA4A 2Q5QA 4X44A 4V0ME 3K1JA 4ND6A 1O95A 2HC9A 3OPXA 1Y63A 1OLUB 2W2MA 4UHFA 4G0OA 4TMVA 5FIUA 5DCYA 3R0JA 2ZITA 1E3LA 1VJRA 2DPHA 3ZDBA 1J1UA 1A82A 3R3XA 4ZQGA 4XB2A 3EGDA 1SVMA 2OCKA 2QQ5A 3C16C 3NHSA 4QBIA 4WZZA 1Z45A 3R7WA 1XNRB 4OAQA 3D4LA 1RYNA 4RY2A 1L5MA 2PZ8A 3GZ4A 3A2KA 3BMCA 3EA4A 5FR1A 3WTBA 4J4BA 2I1LA 1KF0A 3B6ZA 3PUIA 1JKXA 3B6JA 4Q24A 2OKCA 3ZHOA 1DARA 3Q5EA 2WHPA 3RSFA 2P2LA 2FSVA 1ZJZA 2INGX 2X42A 4IF6A 1E1KA 1JLRA 2A9QA 1IBRA 2YVLA 5AHWA 2Y71A 3KDPA 3CCCA 3VDQA 3RADC 1Q0TA 1V1RB 2O5EA