3OF5A

Crystal structure of a dethiobiotin synthetase from francisella tularensis subsp. tularensis schu s4
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
222
structure length
222
Chain Sequence
SNAMKKFFIIGTDTEVGKTYISTKLIEVCEHQNIKSLCLKPVASGQSQFSELCEDVESILNAYKHKFTAAEINLISFNQAVAPHIIAAKTKVDISIENLKQFIEDKYNQDLDILFIEGAGGLLTPYSDHTTQLDLIKALQIPVLLVSAIKVGCINHTLLTINELNRHNIKLAGWIANCNDSNIKYIDEQINTIEELSGYKCSAKISRNADYLDFIDLSKILI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dethiobiotin synthetase
publication title Crystal Structure of a Dethiobiotin Synthetase from Francisella tularensis subsp. tularensis SCHU S4
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Ligase
total genus 72
structure length 222
sequence length 222
chains with identical sequence B
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 2010-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13500 AAA_26 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3of5A00
2V1XA 5AJYA 1AQUA 4MYUA 4S2EA 5FUYA 1IN7A 2AK2A 2BIFA 4ZDIA 1TQDA 3LVRE 1E1RD 4C0SA 2N1BA 4W5JA 1G3MA 5UKDA 4HUTA 4OHYA 2DWOA 4F92B 4DCSA 2V3CC 3PR1A 1F5NA 3P4XA 1ZW6A 2G6BA 1QF9A 4PPFA 5DSZA 5G3YA 1IN6A 1FX0A 4RD3A 1JR6A 3MWKA 4HI0E 1GRRA 2HJGA 2EFDB 4CEIB 1BH2A 1E9EA 2Z43A 4G5SA 4JVNA 3GQBA 5AUNB 2PT5A 3HPQA 2OBNA 2WIAA 3W3AA 1SULA 3DOFA 4P32A 1Z08A 4UNNA 1VYUA 3IHLA 4AG5A 5C46F 4KITB 1RRCA 4DCVA 2CHGA 2ZANA 4V0KA 3UWOA 3VNVA 4O2RA 2ZI6A 4Q48A 1JR3E 1P73A 2IYUA 4EDHA 4L9SA 4DDTA 4JBWA 3GCGA 2UVQA 1E99A 2XOKA 1FMLA 4GMDA 1TQ4A 1ZUHA 3UMRA 1ZUIA 1DAHA 5AWFC 1R8QA 4OQXA 1NSFA 2OEPA 4F4IA 4RZXA 5J4HA 1E1QD 3A1UA 1HT1E 2GK7A 4US1R 3SZRA 2EFGA 3DZDA 1JQJC 2YC4C 3NDBB 2C9CA 3BC1A 1L7VC 2AXNA 5A4JA 3K70C 1J99A 1R7RA 2BJVA 1U8YA 1M2OB 1X3SA 3ETLA 3AH8A 1UKZA 3L0OA 2WSSA 4CEIA 2A5JA 3HYRA 5GJBA 2GJ9A 1QHGA 1QVRA 2P6NA 2H7VA 4XVQA 3GD7A 1BMFD 4CYMA 1OH8A 3S1AB 2JAQA 2ZITA 4W5HA 1KSGA 2AN9A 5JEDA 1NMYA 2ANCA 2EU8A 4NDZA 4PHGA 2FFBA 1OXSC 2DCUA 1P60A 2DFNA 2ANBA 3THYA 3IIKA 5EJEA 2WAYA 2ZUDA 1AK2A 4PFSA 4MYHA 3EZ9A 4Q1DA 4Q66C 2QAJA 3ADKA 3AF0A 2CVHA 2BCJQ 1T9HA 1GITA 2O0HA 2WJGA 1Z0DA 4Z54A 3KFXA 1VG9B 2QTHA 2V6IA 3SJAA 1M74A 2CNWD 4LHVA 4B3XA 3N5CA 1RYHA 4HYYA 3ZGXA 1HA3A 3EW9A 3SFVA 4H9GA 4NCIA 3WY9A 4CIDA 4KJZA 1QHIA 3DKPA 3GLGB 2D06A 3GLIA 2V55B 3KQKA 2BEKA 2DYKA 4A4DA 4BLTA 3KQNA 1KHTA 1MABB 1G16A 4W7SA 4X8MA 1FOEB 4ZO4A 2F7SA 1OIVA 5J4YA 3GEIA 1OV4A 4A0FA 5FTKA 2OESA 4NH0A 4L8GA 1KI8A 2PCLA 3AB3A 5IRCD 1W48A 3M1IA 1KI6B 1OKKD 2QPTA 3QIAA 1KI4A 1NLFA 2BDTA 2WWXA 4FMDF 3BD9A 4V0OA 5E3HA 2IL1A 2IXGA 2WWWA 3IEUA 4PO8A 2IHBA 3PEUA 4LV6A 1A7JA 3D7MA 3C5HA 4H1UA 4B3BA 3HJNA 4NYJQ 2ATXA 1R8SA 3CRRA 3LNCA 1EX6A 4LJ8A 4DB2A 1CRQA 2IYRA 1ZD9A 3CNOA 5KYKA 1N6KA 2Q3FA 4IDPA 1RKBA 4OQMA 3G5UA 4U7DA 1ZNWA 4ITRC 2FEOA 4ZDJA 3I62A 3U5ZB 2CE7A 1MABA 1ZUNB 2F1JA 2W6JA 4R7ZA 4LV5B 1E2MA 1NBME 3AF2A 1QRAA 1CU1A 3PUXA 4TMVA 1O3YA 1CJMA 3B8HA 3O8RA 1KGDA 4KLZA 1G21E 1E2HA 2GETA 3OIVA 2XTMA 3B9PA 3KXKA 1XTSA 3AP2A 3EXAA 4GRAA 4M2LA 5DHAA 5JBQA 3CRQA 2FSHA 1P62B 1A82A 4BFTA 2D7DA 1R10A 1G17A 1CF4A 5CDFA 1JAHA 1XXHE 4D0NA 2WKRA 4QG7A 3X1ZA 4A0GA 4L15A 4CGZA 2FPMA 3EA0A 1ZCBA 1SHZA 1KTVA 3BB4A 1LVGA 2FE4A 2O0JA 3GEHA 4FIDA 4HDQB 4NCKA 3VFDA 2J87A 2Q3HA 4B33A 5KSZA 1H8EA 1FUKA 1CTQA 3GLFB 4JSTA 2AWNA 3QKSB 5JWHA 1E2GA 1IAQA 2WM9B 1E9FA 4GNKA 4KVAA 1KJZA 4LPSA 3U61B 1NJGA 1KKMA 1N6LA 1G5TA 4MRRA 4MRVA 1EGAA 2XOKD 5HR5A 2OM2A 2ZYVX 2WWFA 4LHWA 1VIAA 2PBRA 2YWEA 1GNRA 1K5GA 5DIFA 4I1UA 5J4KA 2QP4A 2YWGA 4F38A 5KNCA 1DG1G 2DY1A 2ZJZA 4G3XA 3A4MA 1N5LA 1K5DA 2C9YA 3K53A 2QSYA 1F2TA 2GVDC 3NBFA 2Q0HA 4MA4A 4JBXA 4TTRA 1W4RA 2EWVA 3SE0A 2VA8A 4DWJA 2ZSEA 1XF9A 4JT4A 5FTNA 4CT4B 4A8JB 1J8YF 1OXTA 2CHVA 3GLFA 3ND9A 1HY3A 3QKSA 5LPNA 1AIPA 2XITA 4ILEA 1Z22A 1YRAA 2FZ4A 2HYDA 4BFYA 2WPDA 4TYYA 5TARA 2VP5A 3PEYA 1FNNA 4R2IA 1GL6A 2ZR0A 3WP0A 4Z51A 3EIHA 3BFXA 4D4LA 4TZ6A 4CVNA 3H2YA 4BRUA 4R9UC 2ZAMA 4PQYA 2QRNA 4GFDA 4M9SA 3K8YA 1M1YE 3ZIAD 1L2TA 1XTQA 1HUQA 3K09A 4B35A 4LHXA 5L3QB 1T0HB 5B64A 3SN6A 5CJPA 3BJIC 3SBDA 1XFAA 1S96A 1XRJA 2XTNA 2JEOA 1CR2A 4ZI3A 1UDXA 4A8JA 4EFNA 4BLQA 1VECA 2C95A 2ZR7A 2XZOA 2BWJA 3U7EB 1I4LD 2OV2A 4NCJA 4C7OB 1E2KA 1E2JA 1NN1A 2JLUA 4PO1A 2WV9A 4JLJA 4WZ6A 3GJ3A 5AJXA 4LY6A 1RJ9B 2RGBA 4RD2A 3NTUA 1WQ1R 4KFTA 4AYWA 4DSUA 2GXAA 4PZZA 4GZMA 4Q4AB 1OLOA 1NI3A 1U99A 4TLCA 1FUUA 1KK0A 3WBJA 1Z2AA 4MUAA 2BC9A 1XCMA 2F1HA 2ZQ5A 3THOA 4IOMA 3VKGA 2QPAA 1GNQA 1GKIA 3QBVA 3AVWA 3E5HA 1KO5A 2R65A 1SVWA 1MRSA 3BXZA 5L3QA 3DKVA 1AM4D 3FFBA 5FBVB 3LBNA 4Q4LA 3GJXC 1JAIA 2ODWA 3WMEA 5DE3A 1E3MA 1JQLB 4L16A 6Q21A 2OBMA 1IQPA 3TUJC 3WXMA 1RIFA 4IOKA 1UBCA 1FP6A 3TLXA 4C7OA 2C77A 4A0HA 1E2LA 2V1UA 4TZ0A 3NIBA 2IX3A 5D3MB 4LJ9A 1E0SA 1RJ9A 3OZXA 5HTKA 2A3RA 2C98A 3SU8A 2NGRA 3CF2A 1N6OA 1U8ZA 1PJRA 2ZI7A 2ZVPX 3DMDA 1RPZA 5TB5A 4JLDA 5HCNA 2BBTA 2XTZA 2F43B 4JS0A 3DMNA 4JIMA 4MUBA 5FUXA 3LLUA 1W1WA 5JI2E 3M0EA 1Q1EA 3THWB 1S1CA 3LDAA 4B44A 2EW1A 4JL5A 1T8UA 2WTUA 3BGWA 2O8DB 1BOFA 3E70C 3I5XA 3OIYA 4C0LA 1KAOA 1S2MA 4M53A 4MKFA 2IK8A 2FSIA 2F1IA 4BUJA 1XJQA 4D80A 3AVPA 3CWQA 4FCTA 2QQEA 2LKCA 3GP8A 1PUJA 1HT2E 2B7CA 2BBSA 3GMTA 3RABA 4EQ6B 3X1XA 4ESVA 5D3MA 5JWRA 4KYUA 5H70A 3MFYA 3GLHB 3B9QA 4GI7A 2GXUA 3PCRB 2J1LA 4HEJA 1Q3HA 1G3RA 2IXFA 1Y63A 2NTYC 3I92A 2AK3A 3ONWA 2QE7D 2IYVA 2WMOB 2JJ2A 1XWIA 1YZNA 1US8B 2F43A 2VEDA 3KX2A 4M21A 5L3VA 4ACBA 2ZSAA 5F9HA 3A1TA 2GTPA 4Q4HB 1G8PA 3RS2A 1YZLA 1W36B 4NP6A 3OF5A 4IFEA 2QA5A 3WYFA 1E9AA 1IY0A 4KAXA 2QROA 5FPTA 1ZU5A 1AKYA 4Z8XA 1P75A 2JLYA 4AKIA 2H18A 3EZ2A 4BQSA 4MDFA 1UJ2A 5KO2A 1G8FA 5DI3B 1KY3A 4P3YA 4QXAA 1AJEA 3LVQE 4B32A 1FW6A 2ZM5A 4EQ6A 4BE7B 4ZDWA 4LSGA 1M7GA 1EFCA 2WJJA 4W5WA 2W2TA 2YVUA 3CLVA 3GLHA 4LOAA 4TTPA 3IPYA 4QC2A 5DISB 5KU1A 1E9CA 4DZZA 1UKYA 3SJZA 2QRZA 3LWNA 3CNLA 3ADDA 2LKDA 3FHCB 2VP4A 1Z6XA 4EPVA 1US8A 3PJRA 5BW8A 1AKEA 4I81A 3SI7A 3FPAA 2G1JA 3CRVA 4Q4HA 3FFAA 1GKYA 4HAZA 5DN6A 1EFUA 2GNOA 1F48A 4OJKA 3LBHA 3GJ0A 3C7KA 4M9ZA 2F6RA 2Q9BA 2IYYA 1S3GA 3CH5A 3RVBA 5DLQC 1P9RA 2QMOA 4O3MA 1TUEA 2O8BB 2VRWA 5DI3A 2EWWA 2XEXA 3N70A 3QXSA 3BWDD 1ODFA 5FOUA 3O47A 2B92A 1Q0UA 1W4CA 3I32A 3IKJA 3VR2A 3AVQA 5DNYB 3KQHA 1D9XA 1IY1A 1LTQA 1D2NA 4US0R 2CK3D 1A2KC 2O8CB 2Z4SA 5JEEA 4RY2A 4OBEA 1GWNA 2C8VA 1N0UA 2R44A 2VP6A 1GFIA 3SC3A 1G1MA 3B78A 2WJVA 1W0KA 1KIMA 4A0RA 3CRW1 3QKRB 2BCGY 2WKPA 4HB3A 2GJ8A 4RD1A 4LBVA 1AA9A 2W00A 1Q12A 5TXGA 1NRJB 5FL3A 1KK1A 2WSMA 3QPWA 1Z29A 1ZP6A 5EP1A 5HE9A 4F91B 1PUIA 4GT1A 4HZIA 1ZNZA 1KI9A 2ZREA 2W58A 3W6PA 2O8BA 1U94A 1OIXA 2QY9A 2YNMA 3D6TB 1OHHA 2F9LA 3B85A 4MH0R 4QGAA 2IS2A 1G9XA 4UNRA 2V7QA 1VYTA 3RWOA 1XP8A 2VHUA 1HQYE 2XB4A 1T3HA 2O8CA 1T91A 3QEOA 4A92A 2GZDA 1EG7A 2OCYC 3NC1C 1R0WA 3WBKA 1DS6A 4AK9A 4PSVA 4B2PA 3IIMA 3LRPA 3QKRA 4TLAA 1N6NA 2AKYA 3L0IB 4QNRA 2KJQA 1E2IA 5SZHB 5FTMA 4ZPXA 1UFQA 2D2FA 2F1RA 4B3GA 4OI2A 2OCBA 1UKEA 1IXZA 4UXJA 5EXSA 1P9NA 3TK1A 1E0JA 1NMXA 4DKXA 3FKSA 4TMKA 1KOFA 3KZ1E 1G6HA 4XOIA 721PA 2ZRIA 5LD2B 1E2EA 2O5VA 2GXQA 3MCAA 3W3ZB 1Z6YA 3AVXA 2D62A 1IHUA 2JLXA 4TSFA 1XPUA 2KE5A 1OFIA 1QZXA 4PX9A 2VBCA 3FMFA 1R5OA 3SQWA 1IN4A 3OIWA 2JJ2D 2J9RA 2ZRFA 2GVZC 2EYUA 4UNPA 4U5XA 4JVSB 1XMVA 3R8FA 1UBFA 3Q8XB 2JJ1A 1YZKA 4Q4JB 4DDVA 4BFWA 3QUSA 4QJ5A 3U44B 4IXNA 1MV5A 1Q1BA 2FPKA 1XMIA 3FWYA 4Q9JA 1JI0A 1NP6A 2WWYA 4J0QA 4LJ6A 4GOJA 3QXXA 4HAWA 4OYHA 5AUQA 5JWOA 1CJVC 4U00A 3L0PA 5D3QA 2Q6TA 1OH5A 3T61A 3C5CA 1Z07A 3Q5EA 3QXCA 5ANRB 2JLVA 2GBLA 1R5BA 2RGNC 1ZM7A 1KJYA 2WKQA 3RRNA 4DC9A 3KJGA 2AX4A 4BLRA 2P2LA 1GSIA 5AUPB 1LS1A 1KO8A 1W2GA 1ZNXA 1D2MA 4NYJR 4WBSA 3RNLA 3AQ4A 5J4LA 4QGGA 4DLRA 1P61B 3ZS9A 1N0VC 3KXLA 1G8YA 4PHFA 4DSNA 1QHYA 1W36D 3IEVA 3VHLB 1N25A 1A5TA 1SKYE 1YJ5A 3LBIA 5SZJA 4C0JA 4Q4JA 2H17A 4JMPA 1E98A 1H65A 4WXRA 1GTVA 4IEEA 4RKFA 4AG6A 2HYIC 2IS6A 3U44A 4K46A 2WHXA 4AWXA 2PL3A 1ZCAA 4F93B 4P4SA 2O0KA 4MKGA 2WMNB 4QM7A 2QM8A 2H1LA 4L4UA 3MMPA 3TUZC 2BMEA 4MRSA 4N1AA 4KSCA 4E22A 3HR8A 4A2PA 2C5LA 1E32A 4Q9KA 3T5GA 1F60A 4V0MA 2YV5A 4HLUC 2JIZD 3LO5A 4HB2A 4G5GA 3THXA 1WDTA 1XEWX 2JJ8A 4LRWA 4JSYA 1XTRA 2GWHA 4KYIB 4EAQA 3SYLA 5F3WB 2TMKA 4M1OA 1E94E 4NMMA 5JS7A 2HT1A 8OHMA 5JRZA 1YHNA 3RS7A 3CX7A 2P6UA 1JJVA 4ABYA 2ZS8A 1NSTA 2ZRNA 2OE2A 3AGPA 3PFIA 5CM9C 5IF9A 1IN5A 1R4AA 1E2NA 4QKQA 2HCBA 1TL7C 2MMGA 3BBPA 4EFLA 3A4NA 1NG1A 1C4OA 1A4RA 2GAAA 3PUYA 1DAIA 5P21A 1F3OA 1E2QA 3L43A 2V7QD 4ZIRB 4TWZA 2ZRDA 3IBYA 2ATVA 4TQUS 3RS3A 2NG1A 1UDWA 3HU3A 2JA1A 4HAUA 5JJKA 521PA 3BE4A 1FP7A 3AM1A 4RSGA 3EPHA 3BORA 3QKTA 3QQ5A 4B75A 2V6JA 3K0CA 2ZSFA 4D6PA 2ZRHA 3RDPA 1HV8A 4TMTA 1NY5A 4LCBA 4XIGS 3J81k 1R6BX 1U0JA 4UQOA 3B60A 1CR4A 2ORIA 5E4FA 4POAA 3BFVA 3U60B 3EC2A 3T34A 1G6OA 5GJCA 4YONB 3EC1A 1TF5A 3RSOA 1HH4A 2QNRA 3HU2A 4BLSA 4LJ7A 2O52A 3CRMA 1HQCA 3ZLJA 1W47A 4ZIRA 2VO1A 1I2DA 5BYJA 2H57A 4FMBB 3RRMA 3VTKA 1E0KA 1JR3A 2ZSBA 3DO6A 2VL7A 1S9HA 2OUKA 3TVTA 3THYB 1FFHA 2ZJ5A 4RD0A 3TVDA 3UIEA 2FX3A 4GP7A 3KJIA 2E87A 2G9NA 2QUZA 1GVNB 4ON9A 3W90A 4Q47A 2JJ1D 3CF6R 4QBHA 2NO0A 5HZKA 2XB2A 2DFTA 1G291 2PCJA 1ELOA 3QKUA 4LBYA 2J0SA 2FPLA 3ZYCA 4DVGA 2J7PA 2CCKA 1XBTA 3DOEA 5FPKA 3W34A 1D2EA 1D5CA 2ODNA 4RCYA 4LWZA 1XEWY 3N2IA 1W0JA 1RZ3A 4LBWA 3GLIB 4ASUA 2XJ9A 2IYXA 1CULC 2W2VA 4Q7MB 5EXTA 1KMQA 1NMZA 1ETUA 1ZMXA 3T06B 2ZETA 1OFTA 3CPEA 2XX3A 3QXHA 1CP2A 2W0SA 1G4UR 2AKAB 4PO9A 4Q01A 4QBIA 4ZCMA 1VHLA 2WJYA 1GRNA 2F9MA 5K8TA 1OYWA 4JKYA 2AD5A 5FR2A 2CL0X 2E9SA 3ZVLA 2A9KA 1JPJA 3SHFA 3MRSA 1WRBA 1RFLA 2Z5FA 1OFHA 4D2IA 1GILA 2AR7A 3TW4A 3U3RA 2IT1A 3A8TA 1WBDA 2FJUA 1N6RA 3CW2A 3GJ8A 1NKTA 1YVDA 1Z3IX 3EX7C 2GK6A 4OK5A 3WHKA 3MWLA 4X8OA 5C4GB 4I4LA 2RGXA 5E7JA 5EXPA 1PLKA 2ZVQX 1NIJA 3BH0A 5K8LA 3VNUA 3SJCA 5C4MA 4NU0A 1MT0A 3H84A 3RS0A 3MD0A 2CCGA 4MGKR 3FTQA 2A5GA 2ZUCA 3RC8A 5FI0B 5HKKA 4IHQA 2JATA 3BERA 1KDOA 2JLRA 2YYZA 3QVUA 4HATA 3EPLA 1XXHB 2XSZA 1CR1A 4NONA 4BEJA 3PV0A 1JALA 3TSZA 1JECA 2PMKA 3VKHA 2FGKA 3OFNA 3WRYC 1G20E 5EXXA 3HU1A 4EKDA 1OYYA 4A2QA 2BOVA 4WZAE 5FOSA 1ZU4A 1E69A 4TYQA 1NBMA 3QG5A 3VKWA 3CONA 2IYLD 4WIAA 3CB4A 2OFWA 2WZQA 3F5FA 1E4YA 2OCPA 2ZROA 1JBKA 4OHXA 5TV2A 1NVXQ 4AKGA 1L8QA 2WICA 4RZ3A 1IOZA 4JT2A 3QE0A 3BFKA 1LFDB 3AVUA 1TUIA 3VQTA 1X8LA 2PT7A 3AUXA 3CR7A 2DB3A 2BBOA 3NEJA 4HB0A 5FOXA 3HP1A 1XXHA 2IC5A 5EUQB 3TKLA 3OEEA 1BYUA 1OT3A 1F2TB 4JLMA 3GLGE 4MDEA 3TGPA 3GJ7A 2LWIA 1Q57A 3IQXA 5JRJA 5JFGA 4IDNA 1XB2A 3D3QA 4Y0VA 1IONA 2A78A 2RB4A 1J8MF 4NHOA 1JNYA 2A5YB 2DPXA 1JR3D 5SZKB 4DLTA 1YR6A 4G5OA 1XCGB 4RD6A 3ZH9B 3NVAA 2AFHE 1F6BA 1AN0A 2GJKA 4DSTA 5GVSA 2ZI5A 1S4QA 3SOPA 4BECA 1IN8A 4DCNA 5CDFE 1DG3A 2QSZA 5FI1B 4B76A 3LFUA 4B47A 2D4HA 3PUZA 2C96A 4KVGA 3EZ7A 4JYBA 4JYCA 1GM5A 2J7PD 2YJTD 5EZ6B 2OSBA 1G19A 3GJ4A 4DXAA 3B6EA 3K0AB 1JJ7A 3KL4A 2DR3A 3ZZTA 1E2DA 4EJSB 1W0JD 2MSDB 2WSSD 3AF4A 1DBSA 1Q22A 4ASUD 5FH9A 4QGHA 3H1TA 4DRZA 4M8NE 4KBGA 3V4RA 3T1OA 4N3NA 2GILA 2WOOA 5L3RA 1TPZA 1PV4A 1Q3TA 4EFMA 4IW3B 3ASZA 3V4FA 1RC8A 3PITA 2X1VA 1XTJA 3VR6A 4FWTA 4PTLA 1YR9A 4U02A 4V03A 4D82A 5H68A 1CEEA 1H8HA 4FCWA 4D4MA 3KUDA 2DWPA 2BMDA 1M7BA 1E79A 2GXSA 3A58B 5EE1A 5EP3A 4Z1MA 1J70A 2NMVA 1Z0JA 1EFRA 2ZAOA 2PZGA 2QU8A 3HDTA 3HR7A 4CDGA 4CF7A 4HAXA 3K0AA 3UMFA 2PLRA 3K09C 4DDWA 4EJSA 4ZCLA 3RHFA 2ZRKA 3VR5A 2F3RA 2XNSA 4WW0A 1IXRC 1R0ZA 4LZZA 4UJ5A 621PA 2ZE5A 3QY0A 4A8JC 4BZXA 4V02A 4E03A 2P67A 2D74A 2QENA 4GOXA 4LI0A 4B48A 1R0XA 2OO7A 1NN0A 1VMAA 1U90A 3VR3A 3U4QB 4EPYA 1G64A 4QHSA 5JJIA 3MSXA 2D7CA 3TR5A 2A5DA 4LX0A 1L4UA 4G0NA 3F0TA 3TMKA 4I99A 1KO1A 2PH1A 5JSZA 4B71A 4YMVA 2GZAA 3OFND 1U8AA 2J41A 4TL7A 5BN4A 1Z6AA 4B34A 3R20A 1T4GA 4LYHA 3ZVRA 1N3BA 1SVIA 4C2TA 1HE8B 3TJZA 1C1YA 4DCTA 2K5UA 3GFTA 3UPUA 1NG9A 3QI2A 2JCSA 2ZI3A 2W6JD 1MO5A 4DLWA 1DARA 2VTKA 3CPJB 4GDFA 2QMEA 1UAAA 2MSEB 2FSGA 1E9BA 1HTWA 1FTNA 2NO7A 3CR8A 3DL0A 5JI3E 1E2PA 1XNJA 2V54A 5FBWB 3I72A 1X1SA 1QHXA 2IXEA 3QENA 2OHFA 3ZQJA 3U6KA 1UEJA 1JEEA 3IDQA 1Q44A 4DT1B 3U4QA 4URZR 1UKVY 4PPQA 3TBKA 3OEED 3AUYA 4OJQA 3I61A 4UXHA 2ONKA 1W4BA 4EPTA 1N2CE 2ZUBA 3DM9B 3SJBA 2VHQA 3TQCA 3U7GA 1GZSA 1FTSA 2IEYA 5KTYA 4D81A 2VPPA 4ZKDA 1TU4A 2G0NA 2VSXA 4H1VA 4BLOA 1UM8A 3B1VA 1H8ED 1T5IA 5JHHB 4XVUA 2VP9A 1GRQA 2G1KA 4ARZB 2IW3A 4PHTA 2REOA 1TAGA 3REFA 1MKYA 4IVPA 3TQFA 1KK2A 3AVVA 2Z83A 1TNDA 3LXRA 3TUIC 1GL9B 1QVAA 3SYNA 1YZQA 1XJCA 2B8WA 3PUVA 1P72A 3DEFA 3A1SA 1VHTA 4LV8B 4N0EA 5GVRA 5B58C 1S1MA 1AQYA 4RJLA 4NYIR 2XZLA 4DT1A 1XD2B 3SDZA 4Q1CA 2C04A 4URVR 4URXR 1SKQA 1NNEA 2FOLA 2REBA 2O8EA 4L9WA 4C3ZA 3EPKA 1X1RA 1LS6A 3IO5A 2QL6A 3X1YA 4C9BA 4OHZA 5GJVC 1X8JA 2HLDA 1ONBA 3A4LA 2GEVA 3RYTC 1XU4A 221PA 2P65A 4ARZA 1SXJB 2WPDD 2ONJA 3W8NA 4A82A 4E07A 1I4TD 2FV8A 2VSFA 3FYHA 3OESA 1G3IA 2AHOA 4RKEA 5FL7A 1G8HA 4ZV4A 4FD2A 3LX8A 1VPLA 4YQFA 4V0NA 3CPHA 1E79D 1II8B 4Z1MD 1U0HC 1XTIA 2HEIA 4YMTA 1XD2A 3FHOA 2ZIAA 3HWSA 4D26A 1ZD1A 4NBSA 1X8KA 4RFVA 2WBLC 4CT5A 3PXGA 3SQXA 1KI2A 1KSHA 1RRGA 3SEAA 2R6GA 3UK6A 2ZI4A 3ZD7A 3KTAA 1II9A 5JHGB 1W36C 4ESHA 4Q00A 4HUQB 1KI7A 2NO1A 821PA 5J40A 2CLSA 2ECKA 4OI1A 2XXAA 1DO0A 1SXJA 2HT6A 3RRYA 4P4UA 1VDZA 4YC7A 1ZIPA 2IHYA 5EE9A 2LCFA 1JXMA 2Y8EA 1QG2A 3LLMA 4X8HA 4FINA 5A0FA 3DM5A 3JVUA 2FZLA 2YOFA 4OHWA 5L3SB 2RCNA 3WMGA 4DDUA 4YMUA 1GG2A 3T1VA 2AXPA 1II8A 1HYQA 1V5WA 2VYFA 4UXIA 2PLFA 1Z0IA 2QI9C 2X2EA 3W8RA 4AIIA 4TLDA 3SYKA 1WXQA 4LJ4A 4FCVA 5DI9A 3LV8A 4CW7A 1U0LA 5L8VA 1XZQA 4Q21A 4P31A 4TYWA 1SGWA 1GUAA 2GEDA 3FKQA 1QHSA 4IXMA 4AKEA 4JLAA 4DIDA 3G82C 4MITA 1XDBA 4PAQA 4KO8A 3U2QA 2A30A 1S0UA 4DIEA 3JVVA 4HUQA 3C41J 4HDCA 3I3SR 1OF1A 2DBYA 4BASA 4OL0A 2R6CA 2IF0A 2R6AA 4ZKEA 2VHCA 2QTFA 4HAVA 2GJAA 1IM2A 3W6OA 5KPJA 2RHMA 4XH9B 1UPTA 2IYWA 4R98A 2G83A 1UBEA 1N5JA 3KB2A 5L3SA 4IDQA 1G7CA 3IHWA 1XEXA 4OQNA 3EAQA 4XTCS 3X1WA 5IT5A 1EXMA 2ZU6A 5CM8B 2GESA 2AL7A 1KNXA 1YR8A 5GJWC 3BH6A 5CB6A 3SBEA 4K81B 3EASA 5FFMA 2YZ2A 1P2VA 2VF7A 1T0JB 3BOSA 3O8BA 1TTTA 2GAOA 4M9QA 4MRNA 1EWRA 3LH5A 4JLNA 2ZRGA 4QNMA 4QOSA 4MQBA 4A1FA 4CEHB 1S3SA 4LYAA 4MRPA 1Q21A 1WF3A 1NIPA 5FBLB 4AURA 4XWKA 3RS4A 5CJ2A 3UXMA 3LA6A 2ZRJA 2QBYB 5EUMA 3NHBA 2B6HA 1II0A 3MGCA 4B6FA 4C0HA 4JLPA 3DZ8A 1E1RA 4O25A 1MRNA 1SVLA 3UATA 2ZJ2A 3A36A 2Z0MA 4M1KA 1SKYB 3TIFA 1G7TA 1XTKA 2WVJA 4Q7KA 1XMJA 4TL9A 3VR1A 4BEBA 1ZM4A 2HDNB 3UKDA 3X2SA 3SFZA 1ZIOA 2ZJYA 3KKMA 1BYIA 3M6AA 2HLDD 4B3CA 3O8CA 1G7RA 2ORWA 4JVLA 1MO6A 1WA5A 1N0WA 2HF8A 1U9IA 5FTLA 2IUTA 4CEHA 1ZNYA 3EIEA 4P4SB 1TF7A 1GDDA 2H8KA 2VIIA 4C0KA 4LJ5A 4DLYA 2EFCB 2X8AA 2RGCA 1IXSB 5FL7D 5DGXA 2IEZA 2KBFA 1TF2A 4Q9IA 4PC1A 2QBYA 2VLIA 1NLZA 2PX3A 4NTZA 5LD2C 3ZZUA 4B2LA 2FH5B 3K9GA 1P5ZB 1KY2A 3CNNA 2ZRLA 4UNQA 2Z6VA 3C4JA 4EPRA 4JLOA 4WZBE 3THXB 1NLYA 2VQSA 3QVVA 2QP9X 2YHSA 1YKSA 1NF3A 2ZRAA 3D8BA 4M4SA 2G0TA 2GF0A 2R9VA 4URWR 3BH7A 5DYIA 5DN6D 2KBEA 4TN1A 4NYIQ 2IUSA 3MJHA 3B1YA 3GEEA 3WNBA 2Q9CA 1G4AE 3L82B 2RGNA 1SXJD 3QBTA 4IFBA 1T5LA 3BS4A 5HE8A 3CBQA 1YRBA 3U7HB 4O2LA 4QJ4A 2JLZA 5CIWA 2A7QA 4LK2A 3LQRA 4II7A 3RS5A 1TEXA 3OAAA 2OLKA 2XAUA 4LDJA 4XD7A 1DPFA 1Z6GA 1BS1A 4TTQA 5FBQB 1HE1C 2REXB 5AJZA 1YQTA 1U98A 4I1OA 1YZGA 2BMJA 2J0VA 3I1FA 3KQUA 1W0KD 1GAJA 4E5UA 3FOZA 2FFHA 4B3FX 5B30A 1DVRA 3K0FA 3LD9A 1Z0FA 1UADA 2RKOA 2A5FA 5KDOA 1S8FA 4QL3A 4DLXA 2JDIA 2QPOA 4UJ3A 2RMKA 4B2IA 1P6XA 2B8TA 1J90A 1CBUA 4WAUA 1OPXA 3AVYA 4ACAA 3TSWA 3M4YA 3U6BA 4DLZA 2RH5A 4HLUA 5CIQA 4PQRA 3ZVMA 3Q3JB 1TQ6A 5AJVB 2NPFA 4DJTA 3DHWC 3NXSA 2OZEA 4FMDB 3NBXX 5KDDA 3EIQA 4V0ME 2YWFA 1OHHD 3LY5A 4GPTA 1NN3A 1XMSA 4RZ2A 1EK0A 3CH4B 4FW9A 4QRHA 4GL2A 3CF0A 5BXQC 2QAGC 3IIJA 4MKHA 5C18A 2EVWX 4ZDKA 4XSGA 2HXSA 2F3TA 3PIRA 4YDSA 1RVDA 2R6DA 3LW8A 2J0UB 3UANA 1GKUB 4PSKA 1DAGA 5DO9A 3PQCA 5FBRB 1N5IA 2ZRBA 2I4IA 1X86B 3C15C 2G77B 4JL8A 1MR3F 2PJZA 2VP2A 2ERXA 3K0CC 3R9IA 5G41A 4AYTA 3V9PA 1W5SA 4QBGB 1Z63A 1CJKC 1E9DA 3VR4A 1E9RA 1ZM2A 3K9NA 4GBMA 3U3KA 1B23P 1DADA 5E95A 1BKDR 4CEJB 3FKSD 4DBLC 2BM0A 5EE0A 1SVSA 1Z2CA 4OQLA 1OH7A 1XD9A 1KI3A 1Z6TA 4MYTA 4OHVA 4A6XA 4IEIA 4TSFD 5KSOA 2IBMA 4BFVA 3JZAA 1E96A 2UZ3A 1FNMA 3KKNA 1UEIA 1FPMA 1WP9A 2HXYA 2J45A 2WJHA 4HZUB 1OXUA 1Z06A 3W5JA 1UBGA 2P5TB 4JBYA 3EZFA 3AKEA 2NPIA 3BRWD 2IYZA 2J0UA 3K70B 1G41A 5FPSA 1V43A 3DPUA 4CZ2A 2VSOA 3NKVA 4RVCA 2WJIA 1MOZA 1FQKA 2CL7X 2DWQA 2GRJA 3FMIA 4G1UC 4KLNA 4M22A 1A2BA 5H8WA 5FOTA 3NH6A 4RD4A 4YMSA 1G7SA 4EPWA 5JECA 1EWQA 2C9OA 4BWYA 3CZPA 1HURA 1VCIA 4C4PA 3MAAC 3FB4A 3TH5A 2W6IA 3UMSA 4BRWA 4PAMA 4CEJA 2FF7A 1QHHB 4XWOA 2BVNA 5EE5B 3ICEA 5LDDC 2ZJBA 2P6RA 3U3MA 2PEYA 4LGMA 4MGZR 5KOYA 4EIWA 4JJKA 1Z5ZA 2WIBA 1DEKA 4RZUA 4LC1A 3W5IA 2JASA 4HZUA 1G5RA 4HDOB 5CITA 1AS0A 4R2HA 2G88A 2C03A 4E09A 3FHTA 2RAPA 3C14C 4TL8A 5KHOC 2FDCA 3IILA 4HSEA 1B0UA 5JS8A 2QT0A 2OBLA 1G3QA 2JLQA 1DAFA 3CKLA 1YR7A 2DHRA 3WMFA 1LF5A 4IJMA 2QN6A 3KKOA 5DYGA 1P9WA 1Z0AA 5FTJA 4A9AA 4BFXA 5AUOB 3A6PC 1OB5A 1G18A 2GJSA 1VTKA 1P2SA 1WCV1 4EUNA 3KB1A 4YXWA 5G40A 1CR0A 4D0GA 4P0TA 2RHDA 3B1XA 3VMFA 4PANA 1ZYUA 1QHHA 2FNAA 3KKPA 2D3WA 2X2FA 3OAAD 3AV0B 3F3YA 2ZE6A 1T8TA 4XD7D 3K0EA 2L0XA 3LAWA 2WOJA 3TNFA 2GEUA 4Z8YA 5LBIA 2KWIA 3WHLA 4YLGA 2KB0A 3BK7A 4X8LA 3TAUA 4PZLA 1AGPA 5BWMA 4BGDA 1Z8FA 2IYSA 3ZIAA 2BHRA 3EWSA 4NYMQ 2CE2X 1OXXK 3ZQ6A 4BFZA 3ZVNA 2PZFA 5BQ5A 2JDID 1W4AA 3IBGA 4KU4A 1R5NA 5LB4A 4EPXA 3KJHA 4TQAA 4Q9LA 3AKCA 1RYFA 1NJFA 4WA7A 1U81A 3FMPB 3NHAA 5EP4A 2ZJ8A 3GLIE 2IUUA 5KSPA 3EZ6A 4PC2A 4LJYA 4PAOA 3R9XA 3CWZA 1N6HA 3S1AA 3WP1B 4DCUA 3QEJA 1Z47A 1JPNA 1RRPA 1KDRA 4K8OA 2CXXA 1G3UA 3T15A 2ZS7A 2JLSA 3VX4A 2R2AA 5G53C 1XPOA 1Z83A 4URYR 2RGGA 4TMWA 2AD1A 5FOVA 2Q3MA 3TAHA 1VIYA 3V00A 5AJWA 2NOAA 1E6CA 5FR1A 4AKHA 1IBRA 4JLVA 2RGDA 3NBZC 1T3LA 2P0EA 4DLSA 1AS2A 1ZD8A 1M34E 4YMWA 5DHFA 1AZSC 3AVOA 3GLGA 4OI4A 2W0MA 1P2TA 1OIWA 2QGZA 3B1WA 1LB1B 1A1VA 4DHEA 1ZRHA 2ZE8A 3F8TA 4HLDA 3ND8A 2CEAA 3MUFA 2BKUA 5K8IA 4KSBA 2J0QA 4R71A 2ZRMA 4Q7JB 5FPYA 2PX0A 2OLJA 2MMCA 4IRUB 1Y3AA 2ODBA 4ZCIA 1QBKC 1KI6A 1Q20A 2B7BA 3OE7A 5KNDA 4DEXA 5CK5A 3GPLA 2QT1A 3RLFA 1HEIA 1ZM9A 2NIPA 2R8RA 2IF2A 4DLVA 2C2HA 4KCGA 3BIFA 2CLCX 3CX6A 4AC9A 3ZDQA 3E1SA 1WBBA 2QZ4A 1GL7A 3HPRA 3A1VA 2J5XA 3B82A 2ZJOA 2WWIA 1EESA 1OW3B 3SS8A 4Y0AA 1R2QA 5IDVA 5HPYB 4QBFA 3EPJA 2SHKA 2FSFA 3REGA 1E0AA 4HLQB 1VKJA 2W6ID 2GHIA 4OI0A 4Q7LA 1DAKA 2YOHA 1ZC4A 2ZYUX 1EFHA 1VG1A 3FMOB 2EFEB 2ERYA 2G3YA 5TVKA 1CJTC 5SZIA 1OXVA 1GOTA 4HLCA 3W6NA 4QJ3A 4M1MA 2BBWA 3L8ZA 2OFXA 2VHTA 3BB3A 4PSAA 5J4VA 4KODA 3B2EA 4QGFA 1W46A 3K70D 1OH6A 3K9LA 2QE7A 2JLWA 1NY6A 3I8XA 1NN5A 3UWKA 3IUYA 1MH1A 1T3SA 4GOKA 1CRPA 1YE8A 2VF8A 3NEYA 3TR0A 5EQTA 4IVRA 1FMJA 421PA 1YZTA 1X6VA 5JSZB 1Q1ZA 5CLLA 1ZBDA 4YXWD 3QJYA 4PC6A 2FMXA 3PVSA 2D2EA 2YOGA 4AD8A 4A36A 3GLFE 4TYPA 1KYIA 5IK2A 1CIPA 4EJSC 3QPUA 5J5CA 2ASEA 2NO6A 3X1DA 1XJ0A 4NL4H 1VCMA 2ZS9A 2UZIR 3A1WA 3GFOA 4LYFA 4IKEA 5EE3A 3AGQA 2HCJB 3VAAA 1U2RA 3RRZA 4DSOA 5HKKD 5B2ZA 1XCPA 4I1SA 1KSJA 1NL3A 4MKIA 4TLEA 5KSYA 2BKEA 2FU5C 2UKDA 4XSHA 2GCPA 1D9ZA 2WAXA 2YKGA 3FGNA 2XSZD 1AS3A 2KI5A 4FXPA 1VG8A 1NVWQ 1TQ2A 4PC3A 3QXJA 2B21A 3KDSE 3LQQA 1DELA 3P20A 4JVMA 4NZYA 4TT3A 3GJ5A 1ZM3A 3T5DA 5BN3A 2W2XA 2IWRA 3H86A 4RCZA 4B43A 2XGJA 1NBMD 2QQ0A 4GP6A 1P3JA 2OG2A 4D25A 4PXAA 4DUGA 4XJXA 1SQ5A 2CVFA 4I1VA 5G3ZA 5LB2A 1KDPA 2OCAA 1UF9A 4TLBA 5EP2A 3WYGA 5FPHA 4BPBA 4PQFA 3OIUA 3AF3A 4IDHA 2CK3A 121PA 1DAEA 4A6PA 2YWHA 5JMTA 4OK3A 4RFSB 2IA5A 1P4SA 2GCNA 2FFQA 5KDLA 5M04A 2XNDA 3KKQA 2OFOA 3W9YA 1K6MA 1JEDA 2V8OA 3R9WA 1MO3A 1J7KA 2I1QA 3C8UA 5TMPA 2O8EB 4P4TA 1KSFX 2FEMA 2ZJAA 5CYPA 2VH5R 5JZVA 3QPVA 3MLEA 2PMDA 4FN5A 1R0YA 3ADCA 1VCNA 1G5PA 3ZD6A 4HAYA 1Z28A 1TX4B 3L0SA 4W9MC 2J7KA 5FOWA 1KZ7B 4KHZA 4G01B 3OE7D 1P7CA 1ESMA 4Q4AA 2P3SA 2XJ4A 1J2JA 4OQFA 3U7FB 3KQLA 2OT3B 4M1YA 5C2JB 3UG7A 2Z4RA 2QORA 3NG1A 2VP0A 1GIAA 1VYVA 4RFSA 2H16A 4F4CA 4HB4A 2GF9A 3QF7A 4KFUA 4A15A 4Q1BA 1NKSA 4Q5IA 3B13B 3GFPA 4Q1AA 2GKSA 2CDNA 4C0AC 2W83A 2A2ZA 4YDHB 5TY0A 1AGRA 3CIOA 3CX8A 3P32A 3KTAB 4G5RA 3SR0A 2C99A 3C16C 1CXZA 2OXRA 3PENA 2GZHA 2HUPA 3FVQA 1EX7A 1E2FA 1OB2A 1WE2A 3EA5A 3UG6A 3CUEF 4OKSA 2XXAB 4C2UA 4NPHA 1KJWA 5JCZA 2ZE7A 2F55A 4C0QC 3ZZ0A 2DFKB 2X77A 3Q5DA 1VCOA 2CJWB 3IO3A 3EWAA 2HF9A 3KXIA 1IJEA 3PG5A 2Q9AA 2FA9A 4PPNA 1H8HD 4FMCB 5JJLA 2FGJA 1OSNA 4GMXA 3RSLA 1PLLA 3THWA 2IS1A 1TU3A 4P33A 3IQWA 1XX6A 2GCOB 2VHJA 3K9HA 2N46A 3VU9B 5J47A 2O8FB 1PZNA 1EFRD 1RRFA 1KAGA 4Q03A 4D4JA 2CHQA 1KI1A 1YZUA 2WWGA 2X19A 1PVOA 2O8DA 3EARA 3B7GA 1P2UA 2AFIE 2CLDX 5IK2D 5F9FA 3A37A 1D8TA 2OAQ1 4TQ9A 4M1TA 1TADA 4Q9HA 2QG6A 5KUTA 4KFRA 3Q85A 1E4VA 3E2IA 3IGFA 5FUVA 4B73A 2ZYTX 4PZYA 2RGAA 1BIFA 1RW4A 2YINC 5BN5A 1N5KA 3RC3A 4BZPA 1SXJC 3LW7A 4QHYA 4S35A 2ZRCA 4WVFA 3NWJA 2CJWA 3GLHE 2IS4A 5JCPA 2PZEA 3LXXA 1M8PA 4US2R 2OILA 2J46A 1Z0KA 3G0HA 4MGIR 3SHWA 4PR0A 5CYOA 1NVVR 4JL6A 2PEZA 3T1QA 1JXOA 1XEXB 2GCOA 2QMHA 3QSYA 1M7HA 4IOLA 3NH9A 4UNSA 3P26A 2OAP1 3Q7PA 1ESNA 3VU9A 1WMSA 4CRWB 2O8FA 1KNQA 1IJFA 1LNZA 1VG0B 3H4MA 4TT3D 4LJAA 3VX3A 2CMKA 4BZQA 3I4LA 4IDOA 3RWMB 4Q02A 4Q1FA 4ERNA 5HCIA 4JLBA 4LUCA 4DUGD 5KNBA 4G5QA 2QEQA 2NQ2C 1SXJE 1CKEA 1ZVQA 4FWIB 3AKYA 1W49A 2ODEA 2BV3A 4AY2A 1CLUA 4L5BA 1PLJA 4LHYA 3T12A 4XTRA 3BB1A 2JIZA 4TMZA 4UKDA 2OXCA 5ELXA 1LW7A 3TSOA 1KO7A 3OEHA 1W7AA 1COWA 3H0KA 3JZMA 4C30A 2ZI9A 1IY2A 3FDIA 2XNDD 2I3BA 1TEVA 1NVUQ 1YU9A 4Q1EA 3K0SA 2QTVB 3NC0C 3TE6A 4B74A 1SVMA 2V4ZA 5HZHA 2YC2C 1RE0A 2GA8A 3ASYA 4KXFB 2BJWA 1E9SA 3QOFA 4DEYA 4PHHA 1KDTA 4PC7A 2QM7A 1W5TA 3TRFA 2ZSDA 1SVOA 4M1SA 2MSCB 3OHMA 3AF1A 2C78A 4LYJA 2NZJA 1O87A 3MJRA 1XZPA 3AKDA 3U3JA 3WYAA 1W44A 4M9XA 1WB9A 1DO2A 3Q9LA 4XWAA 4BFSA 3QF4B 4NE2A 5F98A 4XVRA 4BLPA 3WNDA 2ORVA 3VHXA 1N6IA 1XEFA 1KKLA 3ZS8A 4Q18A 3TW8B 4KFSA 1ZINA 1G8GA 4OK6A 5B57C 5CLQA 3ECCA 2GDJA 1F2UB 4V0LA 1D6JA 4MYCA 4N0DA 4JLKA 3P4YA 3DDCA 4LC0A 4LPKA 3EG5A 1KO4A 3SNHA 4O0MA 1SZPA 2QMUA 3LX5A 4LHZA 1SHKA 1U9IC 4GZLA 1ZC3A 1DE0A 4M1WA 4TMXA 2P5SA 5C1BA 2J59A 2QGNA 3CZQA 2NZ8A 1GP2A 3MG9A 4NYMR 2CBZA 4B3DA 3QF4A 3B1ZA 1I2MA 3N2EA 4M0LA 2IYTA 2HV8A 2ZR9A 4TL6A 1XD8A 4NCNA 2BEJA 1K8RA 2GBLC 2V9PA 5GADl 3PEWA 1S9DA 2ZRPA 1CS4C 2E1RA 2ZTSA 5IHPA 4QM6A 1M6NA 1QHNA 1KZGB 3MWJA 5FUWA 1E1QA 4FMCF 1DTSA 1OJLA 3K0FB 2R6FA 1CJUC 4KI0A 2ZXUA 1F2UA 2N42A 3I73A 3L8YA 3T1TA 1QDEA 3P27A 4F4JA 4TYNA 3R8CA 3O8DA 1SVKA 3L2OB 1DOAA 5AK0A 2WWHA 4AI6A 4QHTA 1QG4A 1LF0A 5DH9A 3PUWA 5E7IA 4D4KA 3AEZA 3ICQB 2EFHB 1BMFA 4WOPA 3K1JA 4BFUA 2NO9A 1LY1A 3AP3A 5TDHA 1KMHB 2H5EA 1EFTA 3B5JA 2FFAA 3NBYC 3PEVA 4URUR 4MGYR 4AYXA 1DAMA 4DB4A 2JGNA 3I8SA 3D31A 4ZI2A 1LV7A 2ZPTX 2QP3A 3DVLA 4LBZA 1C9KA 1XPRA 4IOJA 1FL9A 4A2WA 2AWOA 1MO4A 2EQBA 2Q21A 3KUCA 3Q72A 3QG1A 5H1YA 4C0BA 1OFUX 5EZ5A 1W2HA 3FE2A 4Q19A 4DLUA 1L4YA 4JJZA 2IYQA 5KPDA 2CNWA 1ZAKA 2XZPA 1I4DD 2BM1A 2HJVA 2DFLA 2QAGB 3P1JA 2ZU0C 1N6PA 3R7WB 3Q7QA 1ZJ6A 3QNUA 1FQJA 2IWHA 3AVTA 3RAPR 3ZJYA 4B6EA 5F2EA 3U3OA 2ZEJA 3RANA 3KFVA 2KSQA 4KBFA 1ANKA 3WRXC 3OEHD 2FWRA 4IVQA 1COWD 3NDPA 1Q1QA 1KK3A 5A5GA 1KMHA 2H92A 4JKIA 2CL6X 5AR1A 2FN4A 2EYQA 4KV9A 4QFMA 3WNCA 4D0LB 3T35A 1OKKA 3I5YA 5JLJA 4F7WA 1T6NA 2I1VB 2CCJA 1JB1A 2PJRA 4FI3C 3ADBA 3CO5A 4NKRA 3CM0A 5CK4A 3HYTA 5K8UA 1FX0B 2R62A 5BYKA 4NCHA 1OE0A 4WXPA 3AP1A 2BMFA 3IPXA 1BO6A 1NVVQ 3MWYW 1GNPA 2RGEA 1FZQA 4GSYA 5CB8A 1TMKA 2QAGA 5E7MA 3R7WA 2J3EA 2ZYWX 3KJEA 2FG5A 3BAFA 1AZTA 4JZKA 3GJ6A 4PPGA
chains in the Genus database with same CATH superfamily
1TLLA 2V1XA 1AQUA 3WYBA 4WX2B 4MTLA 4ENPA 2XB9A 2BIFA 1DIHA 1O2DA 3SAJA 1OYOA 2HWXA 3LVRE 1VLJA 2N1BA 3SZGA 1VMEA 3EEYA 3G8BA 3KSRA 4L51A 4W5JA 1N0HA 2NPOA 1LDMA 4PF1A 5DYWA 1ODKA 5A1JA 1KQGA 1AT1A 1LNSA 2V3CC 1DEOA 3MUEA 4DYHA 1R0KA 1R8XA 2G6BA 2J07A 2RH4A 2YFQA 3IDFA 4ENRA 3A6ZA 5D3ZA 1IN6A 4R8MA 1C1XA 4O2AB 4IH4A 5FYDA 1FFXA 4HI0E 1PJ4A 4CEIB 4IH9A 1ZI6A 1A5AB 1E9EA 2Z43A 4G5SA 4JVNA 2A1UA 3ZWDA 1RTKA 1HFEL 3Q9UA 4O4JF 4C5AA 2P3LA 4KRFA 1RLJA 2DSTA 3KT0A 3G0BA 1MJFA 3LTEA 4IDBA 4QVGA 3AY3A 1MNQA 1TO2E 3HC7A 3QNMA 4U7JA 1U7HA 1OTYA 1V1MB 3KVOA 1VYUA 1D1SA 1VJTA 1SUWA 1X9HA 3IHLA 5LBTA 3QEMB 2CHGA 1QUFA 4COKA 1Y6JA 4D3DA 4C6RA 5IJ0A 4IIVA 4DIKA 3VNVA 2WK1A 1TZMA 2WM2A 4Q48A 1DRUA 5ALKA 4AZ3A 2IYUA 5K6AA 4DDTA 4IP0A 2C4TA 1LLCA 2XGGA 3GEDA 3DR3A 1DQYA 2OQ2A 2XOKA 4L4RA 1TRKA 2A92A 1JVNA 1TQ4A 3NONA 5FNVA 3ZCQA 3ETEA 3DDOA 4GXQA 3E84A 4RZXA 1HT1E 5GY7A 3SZRA 5JNLA 1TCVA 3DZDA 3H83A 1FRVA 3DYBA 1P4GA 3BC1A 5HF6A 2AXNA 3PQ5A 4ND8A 1TMOA 2IVFA 1R7RA 3FZGA 4KW7A 3TDKA 1X3SA 3OWHA 1VLQA 4YMLA 3AH8A 2WSSA 4LRUA 1CUWA 1LPMA 3BMCA 3HB4X 1QVRA 5IPFA 1BMFD 3I2GA 2ZITA 4O0LA 3S1AB 1YS6A 2VJAA 5E6SB 3IMKA 1HMPA 1KSGA 5JEDA 2ANCA 2GD6A 1QDUA 4XYMA 5JSQA 1OQAA 3ZV7A 2FFBA 3AG6A 2DCUA 3G02A 2OKGA 1P60A 3PKJA 4D9MA 2OO3A 3OQJA 4Y2TA 4BVAA 3S99A 2RARA 4RTLA 4IX9A 1ENYA 3EZ9A 4H4DA 4MYHA 3K71B 3M6FA 4OHUA 3UUFA 2QAJA 1ZBQA 2OV4A 3E27A 1IEXA 3ZIAD 2E4ZA 1SOVA 2CVHA 2XBLA 1JIXA 2W2NA 3PC6A 4URHA 5BV7A 2WJGA 3C5WP 4LZLA 4D9NA 4YP1A 1Z0DA 3EZNA 5ILQA 4KPEC 2FEPA 3NORA 1M74A 4BNGA 4B3XA 3EXG2 3N5CA 5CHEA 1FLVA 4OFBA 3WO0A 4UVGA 1HA3A 4CIDA 3EIXA 2VQ6A 4W4TA 4KJZA 4DJAA 1QHIA 3ET4A 3L8DA 3TD9A 3MBOA 1RE1A 4OJNA 4CM9D 4G0OA 3WB1A 4C7JA 3ROXA 3GLIA 4BLTA 5TSDA 4H60A 4J90A 3NTXA 1G16A 2W70A 4BKQA 5JBIA 8ATCA 2MSNA 3RYHB 4CM8A 4X8MA 1FOEB 2PSDA 3FCYA 5CLJA 2F7SA 3G8YA 5DMXA 3PA8A 1GN8A 3GEIA 5J4YA 2YHAA 1OV4A 4A0FA 5FTKA 1EXNA 1PWYE 1RPJA 4NH0A 1QGAA 1THMA 4L8GA 3ITEA 3DAFA 5CT6A 4MLDA 4Z0NA 4DXHA 5CFPA 4GU5A 4XGRA 3AHFA 5HQTA 1NT2A 5IRCD 1W48A 1BJTA 2I4NA 2I33A 1OKKD 2ALJA 2QPTA 4DNQA 3J80A 1LTKA 1NLFA 5TC4A 1KAEA 3VJRA 4FMDF 1G42A 2IL1A 2IXGA 3BDVA 2Q3BA 2DJ5A 3PEUA 1YZ3A 4YEDA 1NDQA 2JPDA 4X61A 2XUQA 2BR4A 4NYJQ 4JJIA 2HA3A 4L07A 1P7YA 1U2TA 1MAAA 1Q74A 3A9VA 3CRRA 4DB2A 5LMNB 3CNOA 3TSAA 3FLBA 3E22A 1N6KA 4RO0A 3N7AA 2VOEA 1ESEA 4KDEA 2OENG 5H3HA 4HD8A 3I62A 4ZDJA 3VVMA 1C41A 3AEQA 4NESA 3FDZB 4ZZ3A 2ZZNA 4FGZA 2CE7A 1MABA 5F12A 5CXQA 4ECAA 4PINA 2IXTA 2HZBA 1EXVA 5EWLB 1XLUA 5IXJA 1QP7A 1JQDA 5A3SA 2HHLA 4FEEA 2O50A 4GMKA 3DMHA 2PVSA 5JO9A 1I14A 4DMCA 5K8JB 1GLGA 3UOAB 3O8LA 1XALA 3B8HA 3DC7A 1Q5PA 4XW2A 5SYNA 1G21E 1E2HA 2GETA 4RQAA 4MUYA 5HXAA 4KXQA 2HHCA 2VZEA 4KVZA 4BO5A 2JB9A 3V4VB 5DHAA 2XCTB 1NVKA 1MBZA 2AI2A 1T1EA 1P62B 4J4BA 4PCVA 3HWX1 1P8JA 3KRTA 2XV1A 5B1DA 2VPYA 1O6GA 2BKVA 4QG7A 3VPAA 3X1ZA 3HZOA 3PRHA 2FPMA 3NJ8A 4L15A 1SAYA 1DJPA 4M83A 1IBLB 1KTVA 2FMKA 1NPDA 3GEHA 1ZK3A 2A1IA 4R6XA 4JI0B 4I4CA 1FFYA 2VNSA 1DP4A 1I7LA 3N76A 3R5JA 2O2HA 1H8EA 3LP5A 3LF1A 3KXDA 4HG2A 1T2VA 4YACA 4JSTA 4YGYA 2VYCA 3DT6A 4F4HA 2WM9B 1R18A 1YBVA 1DBIA 3OVMA 4KVAA 1CYEA 1KJZA 1FVXA 3U61B 1JG6A 4YTEA 1KKMA 4EVIA 5JH7A 1G5TA 1ESDA 5HR5A 5BMVF 4QECA 1DC6A 2WWFA 2YHUA 1ZX1A 3ZDBA 4CV0A 4FE4A 2C5SA 3H5OA 3VVBA 4CIWA 3DOOA 2P2ZA 3C3MA 5SY9A 2HFJA 2GK3A 1H3EA 3UT6A 4CLDA 3QPDA 5AVOA 1VXOA 3K53A 5ESWA 3EQZA 2ENUA 3SR3A 1F2TA 2AA3A 5BQFA 2GVDC 3UA3A 2Q0HA 2XA2A 2E1PA 2ZYRA 4TTRA 3ET5A 1W4RA 3AYXB 7REQA 2FR0A 2Z1MA 4L74A 2FZEA 1OLUA 2A6PA 4IJKA 4H35A 3OF2A 3TG2A 4DV1B 3R0XA 5FTNA 4CT4B 3FBTA 3FBWA 3UC9A 2I87A 4PYIA 1C7ZA 2OZKA 3F5QA 5H80A 1RI5A 3QKSA 4MW2A 4F60A 1GG9A 2AUMA 5BW4A 1RD4A 1YRAA 4ATNA 1HGXA 4FFOA 3ES9A 4RIIA 3PGVA 5TARA 3ANYB 5KX5B 3DTNA 3AJEA 2GGSA 3ZI0A 2QN7A 1GL6A 3OPXA 4GGMX 3EIHA 3BFXA 3LPNA 3BCHA 1AA6A 4CVNA 3ZPXA 3AHHA 3O3MB 3JWJA 2QV0A 4R9UC 3S70A 4PQYA 2R4QA 3C7CB 3QMMA 4GFDA 5FWAA 2GH1A 5F7OA 1OGIA 3UQYS 4CFYA 3K8YA 1V8PA 4LJKA 1X1TA 3KZVA 4EX6A 5CVCA 2C31A 1AK1A 2R2GA 1XTQA 1HUQA 5G1NA 1D2CA 5IWCA 4UOQA 4B35A 4Z99A 4LHXA 1KS9A 3VPSA 1RRVA 3INYA 5L3QB 3DYIA 2Z04A 4XQEA 3BZWA 2ZOSA 3OKFA 4OUDA 2B2NA 1QH1B 3DSRA 2YX1A 4C4XA 4XOUA 4FU0A 4HEQA 1BSVA 4AXBA 1X0XA 5U1PA 3X3HA 1K4YA 2DLNA 2XZOA 2AE2A 4JLUA 4YP0A 3LYAA 1K3TA 3P52A 1UCFA 1E2KA 1E2JA 2Q1YA 2VYVA 3FVTA 4PO1A 3L07A 4PZ0A 4DMUB 3C3AA 4JLJA 3W8EA 5B3LA 4L78A 4F9TA 3EBPA 3H2BA 4LY6A 1XAHA 2RGBA 3ROEA 1V1RA 2BF7A 4QREA 4RD2A 4KFTA 1CQPA 3ZDRA 4J0FA 4J0EA 4PZZA 4Q4AB 4DQXA 2B69A 1GUFA 1U99A 2CGEA 4XYEA 4K28A 1CE8A 1H1LB 1NI5A 3G89A 4WE3A 5KCZA 5BNTA 1F06A 1Z2AA 1YOVA 2BC9A 3K32A 1TM4E 4MUAA 3ZXYA 2FZVA 2NU7A 3SIWA 4IOMA 2QPAA 1GKIA 2BFNA 3GLQA 3I4CA 3D8HA 1R66A 2R65A 4ENSA 1U65A 3BXZA 3KOOA 5HWSA 2R6R1 3MK31 3OT5A 1GDHA 3C2QA 1OVMA 3CE9A 1NMSA 1JAIA 2ODWA 3GJXC 2UZ1B 5DE3A 4DCJA 2JAHA 3QLEA 2Q46A 5JROA 2ZB2A 2OBMA 3MGGA 5M34A 1PTKA 1EI9A 1MB4A 2QXUA 3GAZA 3IRVA 4TWRA 4WKGA 1CNEA 1UBCA 3HDGA 1FP6A 4MJ3A 1HLPA 4M76B 4RVGA 1JJIA 2Q27A 1E2LA 3R0VA 1G5QA 1EM8A 1L5RA 1VMKA 1W8DA 2C4MA 4B6JA 2H9YA 2VI5A 4BY9E 2ISCA 3VV3A 1HNXB 1GHTA 2RHLA 2C98A 2NGRA 2YXPX 2VWHA 5FBHA 1U8ZA 1PJRA 2ZVPX 3DMDA 1RPZA 1SK8A 3UFXB 5ITWA 4P83A 4B5LA 2SKDA 2YFYA 1E4OA 4RTNA 2XT0A 2RGWA 2Q4EA 2BBTA 5FADA 3CS3A 1WQ3A 1SCUA 2X7XA 3DAYA 4JIMA 1UWKA 3LLUA 3ZGYA 4U63A 3CTMA 5JI2E 5DX0A 1Q1EA 4I3HA 3DFIA 1S1CA 4RZSA 2OCGA 4O2BF 3K73O 4BGEA 3CLTD 1CUGA 2ZIWB 3PICA 4UHFA 3H42B 3RLIA 2WTUA 4RJ2A 2QT9A 4UNIA 3NGXA 3VPBA 4CDMA 4JP5A 1TT7A 1P74A 5I7FA 4QRDA 4YBRA 4C0LA 3LK7A 5KTPA 2XGOA 3I5XA 2C57A 1E58A 1BMTA 3EUAA 2RSLA 2IK8A 1U0RA 3O8QB 1ZNQO 1Y82A 3AVPA 3OJEA 4FCTA 1RJGA 2LKCA 2O14A 4YT5A 3TDMA 1PUJA 2BTQA 2BBSA 2QVCA 4ESVA 2WM8A 1WV1A 5D3MA 1EK1A 1M1NA 3KR9A 4RGQA 2A33A 3E6AA 1WG8A 2QZPA 1I24A 1I6MA 3DV9A 3F49S 1K6IA 3F9CA 4HDKA 1JKXA 2RIPA 3GLHB 3L6EA 4LI3X 4RE5A 2H3HA 3MRVA 3NR2A 4D0RA 4QVKA 2GXUA 3V2GA 4ER7A 3P9KA 1FCJA 1G3RA 2VDPB 2QRJA 2B0CA 2CVQA 2PGDA 3C1AA 2AK3A 3PIIA 3PNLA 3T3IA 2IYVA 2YN0A 4PYOA 1ZL0A 1PD1A 1UAYA 1XWIA 1DBQA 2VEDA 2Y92A 3LKDA 1AG9A 3MJTA 4M21A 3SXUA 5F9HA 2H0AA 7MHTA 4GYJA 1NR5A 1G8PA 4JYMA 2OBXA 3RS2A 3RYCA 1W36B 2V6BA 3NCTA 4MLZA 5B1SA 5JQGA 3VC1A 4YRKA 4HNHA 1ICEA 4UU0A 2VLBA 3OOSA 1ECLA 2EV9A 4G1VA 3EJWA 3FF1A 1GFZA 1P75A 1H5UA 1QB7A 1SN7A 4RPHA 3SD7A 2H18A 4EMTA 2JLYA 3FY4A 4ZGWA 1CETA 1JE0A 2PPVA 2D0IA 3QM1A 1UJBA 2IU0A 4E3ZA 4F12A 2B83A 3BFJA 5CFQA 1GYRA 3B3GA 4FFBB 1J0AA 1W94A 4QOGA 3SLRA 2FF5A 3F46A 4XIYA 3LVQE 1C8LA 2EGHA 3CMMA 3F1LA 1I36A 3OQVA 4D45A 1P9OA 1Z4PX 1W5EA 4ZDWA 4BE7B 4EQ6A 1M7GA 1EFCA 1L7AA 4W5WA 4WKOA 3BGDA 1T8YA 3OD1A 4AJPA 3CLVA 4LOAA 5DISB 1OAAA 1Y9EA 3G9UA 4DZZA 1UKYA 3LKZA 4JENA 2C2XA 5CW2A 8ABPA 2BAGA 3ADDA 5BRNA 3BL8A 1YT5A 1L5HA 2JGKA 3FHCB 1SUPA 4G1FA 1SY7A 4TGLA 4JFAA 1K75A 3NKLA 4AY4A 2XKBA 1M5UA 1AKEA 2WR8A 4EHIA 1UWCA 1ZAYA 4BKPA 5TNXA 3MIIA 2JGIA 1B3RA 1KYTA 3DVAB 1EFUA 4K9NA 4L5IA 4YRIA 3T38A 1J0BA 1NBWB 1P0IA 4RHXA 2F6RA 3O83A 4MW4A 3ZV6A 2QTZA 3TZHA 4V1CA 1V8DA 3RVBA 2X9GA 3FDXA 4HYEA 1EBUA 4O3MA 1TUEA 1KXJA 2TMDA 5BPFA 2XEXA 3N70A 3QXSA 4UHCA 4Y2HA 2FSVA 3OZFA 5FOUA 2JJYA 3O47A 1JIJA 2EKZA 3K5PA 4CNBA 2B92A 3VR2A 1T9BA 2AG1A 3JARA 5G0TA 2Y76A 5FPPA 2GSDA 2HJ9A 2P9BA 3IURA 2WNHA 2XYHA 2PNFA 3K94A 4ENTA 3JASA 4QSHA 4YLYA 3I05A 3TECE 1D2NA 1K7EB 3TD2A 4IAOA 2O8CB 2Z4SA 2O23A 1TM3E 4IXDA 2D2IA 3H3XA 1Y1LA 2C8VA 3JU3A 3EGVA 2DR0A 4WLEA 4ZK2A 2WJVA 5TE9A 1KIMA 1SFRA 1TYZA 1LPPA 2ZSUA 3E7PA 1MC8A 3GVPA 1WY7A 3K1ZA 3ZCSA 6PFKA 4HY3A 4LRQA 4HEA6 4LBVA 4RD1A 1ZXLA 5KNLA 2GA9A 1AY0A 2YICA 4Z4FA 1LBHA 1G55A 3GL9A 4A6DA 3C45A 4ZRNA 3SS9X 4CKCB 2W00A 5JH7F 1GPLA 1Q12A 1P2FA 4Y2UA 5CIYA 2QHXA 1NRJB 3B3JA 1BOOA 2W2LA 1JDBC 2WSMA 5F5LA 2QN3A 5KKAA 1Z29A 4F91B 5HE9A 4EB6B 3A06A 4GT1A 4ER5A 1EHIA 5ITZB 1KI9A 3NC4A 4RTJA 5E1MA 2C4NA 1F8UA 1T9AA 3NZEA 4LXXA 3RC2A 3SC4A 3UCXA 2Z8YM 3ESDA 2HNAA 3HUFA 4LMRA 5AOBA 3SHTA 2QAIA 1WCXA 5SICE 3VYUB 1QX4A 2YJ5A 3AY6A 2BFEB 4C88A 5A62A 3QITA 2IS2A 5HF9A 4MR7A 1P0QA 1FDRA 3DKRA 3GI1A 2YRFA 3IQZA 2XB4A 3L7KA 3CSDA 4U7PB 3KYBA 4I8DA 1W8IA 1XOIA 2WNSA 3JV7A 3F7NA 3IA2A 2GZDA 2Q0SA 3F9RA 1GQ2A 2H9IA 3LUKA 1V7ZA 4JQCA 1DS6A 3WBKA 2IHVA 2WRZA 4KQMA 5AQEA 3TE7A 4AY6A 4ZVLA 2C7VA 4EFKA 4NPCA 2DUNA 1GCOA 2PGOA 3LRPA 3DA8A 1DWQA 5ES3A 1N7HA 1QFMA 3A3PA 4TSKA 1EHCA 2HWWA 2KJQA 2ODPA 1CUJA 3F7TA 4QNRA 1KZYC 5FTMA 2JD1A 2F1RA 3NUZA 4XM1A 1F4PA 3MIZA 1P91A 2JI8A 3LPDA 5BR1A 2C2KA 2OSVA 1U2PA 3PNQA 4G2NA 1P9NA 1WSDA 1NMXA 3G23A 3I12A 3Q4GA 4TMKA 1KOFA 4LVUA 1EP3B 1ULZA 3TZEA 3TTWA 1VSTA 3V1MA 4H7HA 4GIBA 1T25A 5EXDA 4RGVA 4M9CA 1V6AA 4MWOA 1XPUA 1ZN8A 1USIA 2E3JA 1OFIA 1QZXA 2KE5A 2O1XA 4H7KA 4RPJA 3ZXUB 3SKYA 4NEGA 1L4FA 2HWKA 3G79A 5CB4A 3FMFA 1EFKA 3BWEA 1G63A 3HGMA 1QZ3A 2G40A 1UFKA 5J2TF 5DGTA 4YP7A 2GVZC 2GO1A 2XA9A 3OX3A 5F5XA 1WSAA 4TZKA 5GV8A 2RK6A 4CR7A 4JBIA 1IOLA 3KQVA 1EUCA 3IKMB 3O75A 1XMVA 2LPMA 2ZATA 4JVSB 4OH7A 4UNPA 1ZQ1A 3TXAA 2PKQP 4UULA 1XLTC 3HJGA 3Q8XB 3HNPA 1M10A 1NM5C 3IP8A 3H5RA 1J56A 3SOZA 5CAEA 3K15A 2CZQA 2FPKA 5E6RB 1NP6A 3G7UA 1NWCA 5GONB 1O57A 3DDHA 3HCNA 3N6XA 5HIIA 1SQ0A 3NNSA 3IQHX 4B3MB 5AUQA 5FUMA 1CJVC 5JWOA 2RKBA 3B89A 3L0PA 4PS1A 2W48A 3D8UA 1ZD2P 2Q5FA 3FMGA 1WMAA 1P1CA 3GAMA 4CMIA 3F74A 1DT3A 3R44A 2EHJA 4I4TB 3NT5A 4MO9A 3A27A 3ZW8A 3S8EA 2O3QA 2PSEA 1M1UA 3PWZA 1JMYA 1W2GA 4NARA 1D2MA 4MGHA 4Q16A 5DZSA 1ZW1A 5J4LA 4QGGA 3MPUA 2W42A 2JZNA 1LXCA 2O3TA 3ZS9A 1PDWA 1W36D 2QI9F 3VHLB 4C0JA 1A5TA 1SKYE 1YJ5A 5SZJA 5IF3A 4UAUA 5IYZF 5C1OA 2WINI 1TXGA 4HDRA 1GTVA 2IS6A 3U44A 4IYRA 1G9TA 5ETJA 5H83A 2VBFA 1Z6ZA 1IHPA 2WD7A 4J0HA 5ESDA 2YN2A 3P71T 4AWXA 1WV0A 2EARA 3NTQA 1ZCAA 1FRZA 2C3OA 2O0KA 1PFGA 3P0RA 5E2IA 2KLBA 2QM8A 3V8NA 5KNBD 3FKJA 4L4UA 3MMPA 3TR6A 4KTTE 4LY0A 3OE5A 4MRSA 4N1AA 1KQNA 4E22A 5DRYA 1TEZA 4CLRB 4BTVA 2EJBA 2XQIA 3ABRB 2C5LA 2GYVA 2I4LA 2PL9A 3I28A 2H63A 3KV1A 3MRTA 4W82A 2HW8A 3O1JC 2B36A 1XZNA 2QU7A 2YV5A 3WIDA 4DTIA 3V8RA 3AY7A 2H4FA 3EBOA 3DDNA 2IHZA 2Z95A 4WK6A 1XK7A 4RKYA 2PYZA 1B93A 4J0KA 3QKWA 4L5AA 3V2IA 8OHMA 1C4XA 5JRZA 1YHNA 1O6BA 3HA7A 1G2OA 3QLTA 3RS7A 1JJVA 1XCLA 3DJFA 1NSTA 4ZXPA 1CZRA 4GGPA 2YS7A 1RWKA 4ZVPA 4UE2A 1H5QA 1R4AA 3MJSA 4MINA 1PGQA 3QHAA 4ZXFA 5GZ1A 3LGSA 4Y18A 3UJDA 3AZPA 4QU0A 4EFLA 1J97A 4HSGA 4KIWA 2A1UB 5HKBA 4Z86A 1JYEA 1ZSYA 5ALGA 5HVNA 3OQ1A 5BSUA 1XNGA 1R3DA 4ZANA 1T5HX 2EFYA 2GZRA 1OZ0A 5I7VA 4NJEB 5DNWA 3HYNA 3PHJA 2NG1A 3HU3A 2JA1A 1J2UA 1E5VA 2R8BA 1UPCA 3DL4A 4MMXB 5FTWA 4RPCA 3GRKA 3JAKB 5E9JA 4N5MA 3RSSA 4B6SA 5FV4A 5JJKA 4GLOA 3MCUA 1VL0A 3GZTB 5AI8A 4TV8B 3EPHA 1C3VA 1ULHA 3T3DA 3QMWA 3OZDA 5TPZA 4P08A 3QQ5A 5KIAA 5FNVB 3PT5A 2ZSFA 4FLEA 1MCZA 3MW8A 1I2BA 4OJTA 5I7EA 4NBKA 4W9NA 1NAHA 3HWRA 1ISJA 3D2AA 5LLSA 1XKXA 2BW0A 3GRPA 4EBFA 2R1TA 5CA1F 2FW1A 3WLSA 5E4FA 2OCIA 2WE7A 1Y33E 1YRHA 2WU0A 1DEHA 2VSNA 4FEAA 2XQJA 1E3WA 4POOA 3F6PA 4YONB 5KVAA 3EC1A 5H9WA 1TF5A 3CW9A 5EIBD 2DEUA 1OX4B 2OAGA 1V37A 2O3SA 3DE3X 3O94A 4G4SP 4QPCA 4LJ7A 4PIPA 4EOGA 2O52A 2GWRA 5TEVA 3UK1A 1CUXA 1F0NA 1NFFA 2P9EA 2VO1A 4JHLA 4TV9A 1I2DA 5EJGA 1JT2A 1WDMA 2YL2A 3CVOA 3JD1A 2NZUG 3O7WA 5BYJA 2ZSBA 4O63O 3VZCA 1DZIA 2JGDA 1BMQA 4CM4B 1KHHA 3G1WA 2ST1A 1FFHA 3UIEA 3T1HB 3FGOA 4GP7A 3N2ZB 3X1MA 3A6DA 2QUZA 1GVNB 4QUDA 3W90A 4U2CA 3B2QA 1TVEA 1WMBA 5HZKA 2DFTA 3H11B 5ITSA 1TYEB 3KG2A 2FWPA 3CGGA 4YUWA 4RH1A 5G0WA 3DMGA 3WNVA 1P7VA 4DVGA 5JJBA 4WL0A 1HG1A 2J7PA 3VH3A 1PDOA 5AKGA 2AEMA 1H9CA 3DOEA 2JS7A 1XJWA 1R4MB 1T9GR 2F48A 4NR0A 5FPKA 1WY5A 5JLAA 1D5CA 2ODNA 4FFDA 4LWZA 1HE3A 4RCYA 4YRPA 4LBWA 3UK0A 4C22A 3GLIB 4L0CA 4D8WA 2IYXA 3FTEA 1J07A 1B6GA 5I8WA 2JFUA 3IV9A 5EXTA 3SMQA 4ALKA 2UUCB 2JD0A 3PWKA 4BO2A 3T06B 3DEJA 2Y0CA 2XA1A 4IRMA 4RH0A 3QXHA 3OSUA 4W1PA 4I5IA 3ICWA 3RRBA 3RS9A 2ZWPA 3UVEA 1RU3A 2JJMA 3B1FA 5I7HA 5KYXB 4OXIA 3WA7A 2WZBA 1K8XB 2QD4A 3I6QA 5EJ9A 1TO6A 1CUHA 3O1HB 2AD5A 2E9SA 3ZHCA 1NPYA 3ZVLA 1WRBA 1RFLA 2IQIA 2Z5FA 4O1IA 1M34B 2AR7A 3KHSA 4DWOA 5DXFA 1A0OA 2EF1A 5EERA 3MZ0A 4DMRA 1WVGA 3PYMA 13PKA 3A31A 4II2A 5HS4A 4EHJA 3LUJA 3KEGA 4H6WA 5LNK1 3CW2A 4B7CA 3STXA 3DL7A 2MR5A 5LQMA 3MWLA 3LUGA 3CEPB 2A58A 5C4GB 1C0IA 3KZCA 1RM5A 2EX4A 4I4LA 2RGXA 3JY6A 3CFYA 4OYYA 5EXPA 1NIJA 3DB2A 2AS0A 5K8LA 1ODLA 4IWYA 3DBRA 4DVJA 2XZTA 4MVJD 3RS0A 1SZJG 1YBFA 1C7QA 1CZLA 5FI0B 3JX9A 4QSMA 3UHJA 2CMGA 2JATA 2AI3A 3C8ZA 3TOVA 3C6KA 1N2OA 5ALVA 2JLRA 1TKRA 2YYZA 4F2PA 4R8LA 1HE4A 4XIJA 5J59A 1QKKA 4Z4HA 5C7OO 4BEJA 5AVJA 3PV0A 4PIMA 1UFOA 2I4RA 3TSZA 3I8OA 2PMKA 4QQRA 4P22A 2FQWA 5EESA 3HU1A 1MG0A 4GKAA 4A2QA 4WZAE 4EG3A 3G0OA 4QE3A 3U26A 5I7OA 3EMDA 4QUKA 3NYIA 2QVXX 1EK6A 5AQ1A 2C4WA 2IYLD 2O3JA 2OFWA 4PGGA 1L4KA 2UZ4A 4UHBA 4BQIA 4IINA 3QVGB 1E4YA 2BD0A 3ZEIA 2RJOA 1IIRA 2ZROA 3EMKA 3LQYA 5DF1A 3TRKA 5TV2A 1RQNA 4HWTA 3TCXB 4AKGA 3GX1A 1NDUA 4A73A 1KOLA 3QE0A 1E60A 1LBTA 4D8UA 2NADA 4KPUB 1LFDB 4BFLA 1FDOA 4H7JA 1ENOA 1BVUA 2QVBA 1A9PA 3AUXA 3AK4A 3L7LA 2BBOA 4EYQA 1JG7A 2JBAA 1OI7A 2HOQA 4I55F 4OCZA 4PYMA 2FRVA 2Q8QA 3KUKA 1Q15A 1ZGZA 4K6HA 3UICA 5ALIA 5I9TA 3TKLA 3ZY6A 3OEEA 1BYUA 3QUBA 4W99A 1OT3A 3NHPA 4DL9A 1F2TB 3EOBI 4JLMA 3PRJA 3HUUA 2X5NA 4YCJA 1UP6A 4ZYXA 2HRDA 4MEJA 5ES4B 2XE6A 5HM8A 7REQB 3JQ8A 3IQXA 1R3UA 3TFWA 3GD5A 2PAFA 1EUYA 1XB2A 4IO0A 1PFUA 1BHQ1 4MV9A 2A9VA 4FCCA 4D8XA 1WXFA 2NV6A 3NYRA 4GX2A 3FNFA 4B79A 2J6BA 3GFVA 3OTIA 4N6NA 4QTTB 3O92A 2H6EA 2UDPA 1N4AA 2YY7A 1NRXA 4M3NA 2GJKA 1SXPA 2NSDA 4FONA 4X9XA 4CMAA 4YP9A 1P1FA 1J33A 1BROA 1Y7LA 3ND7A 4DSTA 1KVUA 2ASVA 1MQ9A 1TIKA 2JAWA 2KMLA 4NS4A 5M3BA 1DG3A 2QSZA 4HXGA 1X1EA 3H5IA 4DY4A 2C96A 3R7LA 3U3XA 2QIOA 4IYJA 2B1JA 4WEOA 5C32A 5EMLA 1UC9A 1J5PA 1A95A 5EGSA 5F35A 3K0AB 3KL4A 1CB7A 3OCUA 3EXHA 4YPOA 5FYQA 3ZZTA 4OUDB 4WCVA 5HOQA 2WSSD 2WU1A 4K88A 1BWSA 5G4KA 1Q22A 4LDRA 3QVTA 2CXUA 4KBGA 2G63A 2QRVA 3NDRA 1XRRA 1ORIA 3MBKA 1RVV1 4WKPA 2Q6KA 3BSWA 1PV4A 4EFMA 3U49A 2DX7A 1SH7A 1ST2A 2HQSA 3U7RA 1RC8A 4B6PA 1CK4A 1MAWA 4DDKA 1XTJA 3BHMA 3G2IA 3VR6A 1ARZA 2PS9A 3OWOA 4FWTA 5ADHA 1Z2OX 1YR9A 3BMXA 4HZGA 4OQZA 4BMSA 3ZV4A 5FJIA 2XI4A 1CEEA 4E94A 2ZW9A 3I6IA 3BTVA 2Q4RA 3KUDA 2DWPA 5A4MS 2BMDA 4LSWA 2BE7A 2L82A 3DBLB 5EP3A 3MHTA 1YOVB 3DTYA 2H1OA 4FFWA 2I8AA 2PN1A 4F5YA 3NS7A 4JB8A 4FXOA 4B2IA 5BSWA 5GGYA 1R6AA 1Z0JA 2B1QA 1ZH2A 3PNMA 4TTSA 3HR7A 3A32A 4CDGA 3AL0C 4F96A 4PIVA 1QYIA 1ZSVA 3O73A 3RVOA 1KAMA 2ZRKA 1KMCA 5I4KA 3K3PA 5JVDF 1XU9A 4DQDA 1JVSA 3L41A 5EIFA 1SRRA 3B12A 5EL0A 1Z38A 2CLFB 1IMJA 3GG9A 2XCOA 1NUHA 2NO4A 5FO1A 3NU1A 4E03A 3CNHA 4GP9A 4MIEA 3EQ9A 4W6QA 4BVGA 5JXIA 1XGKA 2QENA 1ID8A 2XMQA 2HF2A 4IQ0A 5JMOA 4B4DA 1R0XA 1NN0A 2CLLB 1VMAA 1Z7YA 4W5OA 2VDMB 1AHPA 5K6RA 4OH1A 4NZOA 2RGUA 4R8KA 2X4DA 4LF9B 5JJIA 4QHSA 4RTSA 2WVAA 1KFJB 3MSXA 3MXOA 2QTGA 4JV5B 3CUKA 3QFTA 1P45A 2R8YA 2XWBF 3IUQA 1Y89A 2P30A 3QVWA 4G0NA 1YVUA 3TMKA 4B71A 4CJXA 5JSZA 4Z4GA 4TL7A 1U8AA 4BLVA 5BN4A 1E77A 3ZWYA 3PJEA 4C2TA 5DMHA 4E5YA 3K6KA 4S1OA 1VJGA 3GFTA 5BR4A 4AQYB 1Z2PX 1HT0A 3O0DA 5IUJC 4PSUA 1V6CA 3STWA 4A15A 3F67A 4MAMA 4LY3A 2ZUEA 2O2ZA 2Z8ZA 2B7LA 5AP9A 4WY8A 3TZLA 2XLCA 5IDWA 1UMCB 4ZVNA 2VHVA 4GX1A 2POQX 4YROA 3FHJA 5HBRA 3VSBA 1JQ5A 1A04A 1SBYA 1NHGA 2OMEA 5AM5A 2LCQA 2BFDA 2OECA 1R1DA 4O4IB 3LQ2A 3DL0A 4IF4A 1I5RA 2BTQB 3GZJA 4RS3A 1THTA 1YJBA 4IDEA 4Z2AA 3U6KA 4EGQA 3HXTA 1QP0A 1PU2A 1Q44A 3D6VA 1DFGA 3ZIUA 3DFMA 4PX5A 1U28C 1Z82A 3DJYA 1TK9A 1L5ZA 3JQPA 1E7RA 3RT7A 1SXIA 3U7GA 1FTSA 2D6FA 1MB3A 3WQBA 4F5DA 4CKZA 5KTYA 4X20A 1HF3A 3OQPA 3NTVA 4H1VA 4ZKDA 3RYCB 1PQPA 1UM8A 3DHVA 2HNKA 4ZOAA 3ZNOA 1H8ED 3L7BA 4FTWA 4MLPA 5BNWA 5C80A 1TAHA 1MVLA 3QLJA 2WJPA 1TYCA 4B7AA 1A8SA 4XVUA 2LZ0A 1GRQA 2VP9A 4LGVA 1PV2A 4PHTA 5BSEA 2VN8A 5KOJA 2REOA 1MKYA 4IVPA 3TQFA 4X64B 1KK2A 3UQZA 4ALJA 4H2DA 3DFKA 1TNDA 1J0EA 1QJ4A 2IGBA 2QMQA 3LXRA 4Y1FA 3RHZA 3ZDEA 5DXJA 5BN3A 4UHKA 1VJCA 4OMUA 1VHTA 1VKOA 1U3FA 1S5PA 2JGRA 2Q28A 1HFJA 4HRYA 4KGXA 4LV8B 4Q1VA 5BNZA 1KU0A 1E62A 4RJLA 5JY6A 4BKRA 4UAVA 4DT1A 4WRRA 4K9SA 1XD2B 4KREA 1TOAA 1HDRA 1CVLA 2J9FB 5NLLA 2EP8A 3UJAA 3MPOA 4Q1CA 2C04A 1MFPA 3UJHA 1SKQA 2C5GA 1NNEA 1WPGA 2I4OA 1W52X 3CF4G 1NX9A 4RV4A 4L9WA 4C3ZA 1IZ9A 1H85A 4MOWA 2MSKA 5JSHA 1AO0A 2OD2A 3KOZA 2C61A 2AXQA 1R0CA 4ZU6X 4OHZA 1A9ZA 2HDHA 3PWTA 2HLDA 2R4UA 2IIQA 3A4LA 3RYTC 1JP7A 4WOBA 1XU4A 3ULKA 4ZEOA 2OCXA 4ARZA 2DUWA 4LZNA 2XLBA 4A82A 4N4AA 2GZ3A 3V8PA 4AMZA 3A9TA 3LWZA 1U0SY 4K1LA 1M2EA 3FYHA 1SQFA 3QPAA 1G3IA 1ZGBA 2AHOA 4RKEA 5FL7A 3A70A 3ISVA 4ZV4A 3Q87B 1NJ2A 5ELMA 5DBOA 3WQHA 4YQFA 3CPHA 3JASB 1EH5A 3E4DA 1AX9A 5DTEA 3D2BA 4YMTA 4FDAA 1QAOA 2Z58A 2ZIAA 4OA8A 5AIBA 2Y99A 1XDZA 2Q99A 3RQIA 2FZ5A 1HC7A 2DAPA 4NBSA 4PE5B 4RFVA 5KU1A 2WBLC 4ZAGA 4IJUA 3SQMA 4QEZA 1RAAA 3SQXA 2W8BB 2OYCA 1V1JA 1KSHA 1DDGA 1P5FA 4J0GA 4MWTA 3ROGA 2FR8A 3PC3A 4ENUA 1UC4B 4EG8A 2ZI4A 3MHPA 2EKLA 2WYUA 3R3YA 5JHGB 3T7JA 2NV2B 2EJCA 3SKXA 4S24A 1KI7A 3TM5A 4RIHA 2NO1A 3GFBA 2WUVA 4OI1A 2CLSA 2JNWA 1EE2A 3G2LA 1SXJA 2HT6A 1GZHB 3HGQA 3LUFA 3W0LB 2X4LA 5EE9A 3JQ9C 2LCFA 4W5QA 3PLNA 3LLMA 4UU8A 4EYSA 4Y2XA 3TLYA 5A0FA 4L8YA 1QK4A 4MR7B 4FJ2A 3VPDA 2N47A 5JD5A 3KTOA 2ZRQA 1GG2A 2PH3A 3G8AA 5FJJA 3UMVA 3IVRA 1II8A 2VYFA 1V5WA 4QARA 5F5NA 4BO9A 2MYPA 4HPWA 4K6MA 4QYIA 1JDVA 2VNHA 3EEOA 2V0GA 4I9GA 2QI9C 2ZQZA 4AIIA 1IQRA 3G2OA 4DLLA 4TLDA 3MILA 1G2QA 1WXQA 1N7GA 5F76A 1JDSA 4AP9A 4JP2A 3DPIA 1CFZA 4TYWA 3JRWA 5CDGA 1GUAA 1LDNA 3KAQA 1LW6E 4JWTA 1XRNA 3G82C 3GV0A 3QK7A 4PAQA 3KJFA 2WF7A 4QQFA 5HG0A 1G2IA 2XUDA 1DWUA 2D5CA 2CNDA 4P4NA 1OF1A 4MQ6A 1Z7WA 4DJ5X 5IKPA 3UMYA 1AQ6A 1QQTA 2Q3DA 5I47A 2R1VB 4ZKEA 2WC1A 1U1FA 1E1KA 1WUHS 2VHCA 5BQOA 5K51A 4HAVA 3NATA 2YNMC 2GJAA 5IW8A 3W6OA 1WETA 3NHSA 2RHMA 4XH9B 3ZY5A 3IV7A 1DEXA 4R0MA 5KYGA 1UBEA 4I4IA 5L3SA 4IDQA 5AW7A 4PO3X 5IAKA 4KKVA 1G7CA 5CT8A 1KH3A 1T15A 4RDIA 1KGSA 3KPUA 1K97A 3IHWA