3OF5A

Crystal structure of a dethiobiotin synthetase from francisella tularensis subsp. tularensis schu s4
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
222
structure length
222
Chain Sequence
SNAMKKFFIIGTDTEVGKTYISTKLIEVCEHQNIKSLCLKPVASGQSQFSELCEDVESILNAYKHKFTAAEINLISFNQAVAPHIIAAKTKVDISIENLKQFIEDKYNQDLDILFIEGAGGLLTPYSDHTTQLDLIKALQIPVLLVSAIKVGCINHTLLTINELNRHNIKLAGWIANCNDSNIKYIDEQINTIEELSGYKCSAKISRNADYLDFIDLSKILI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Dethiobiotin synthetase
publication title Crystal Structure of a Dethiobiotin Synthetase from Francisella tularensis subsp. tularensis SCHU S4
rcsb
source organism Francisella tularensis subsp. tularensis
total genus 72
structure length 222
sequence length 222
chains with identical sequence B
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 2010-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13500 AAA_26 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3of5A00
3K9LA 5HKKA 1JAHA 1RFLA 2GDJA 2CBZA 1JBKA 3TAUA 1ZNXA 2WJJA 3O8DA 3ASZA 4AY2A 3CX6A 3CWQA 2HXSA 1RRGA 1OKKA 4CEIB 3Q85A 1JJ7A 3SBDA 4BLPA 1XF9A 4HAZA 3QXHA 2QNRA 3FMIA 2CVFA 1NJFA 4L8GA 5F9HA 3ADBA 4E03A 5CM9C 1ZNWA 2PH1A 3DO6A 5DIFA 2D06A 4OHXA 1VCOA 1KI4A 3AQ4A 3EZ6A 2BMJA 2NZJA 2FA9A 4MYTA 1KO4A 1U8AA 1H8HA 2QEQA 3QJYA 3WNBA 1KJZA 3EXAA 621PA 3MMPA 2ZS7A 2DB3A 1NY5A 5IHPA 2IXEA 2NZ8A 1E0AA 4LX0A 1ZNYA 4NCHA 4Q7KA 3BWDD 5FR2A 1VMAA 3PUZA 5HCNA 3U3JA 3U7FB 1R6BX 3GJ5A 1N6NA 3AVUA 5EXPA 1X86B 3LXRA 1Z0DA 2EFHB 1J2JA 2YWGA 3OHMA 4RFSB 1KI6B 1L7VC 2OXRA 2IT1A 3ICEA 3L82B 4R9UC 4XD7D 1KK0A 3QPWA 3VR5A 1SKYE 4FI3C 5BN3A 3CRVA 4NPHA 3H84A 1KMHB 1N6IA 3WYAA 1R8QA 4KFUA 4LYFA 1G3RA 1NSFA 5GJBA 1GFIA 1VCNA 4DCUA 4XVUA 4LJ6A 4TWZA 4AKEA 1P3JA 3GEHA 2ZE5A 1GM5A 3IDQA 3AVWA 1FOEB 4YMUA 3ZYCA 2CNWD 5KPDA 2DFTA 2VH5R 3FFAA 2DPXA 4G0NA 4JLDA 5L3QA 1MABB 5FOSA 5BQ5A 2X2FA 2RHDA 4Q1EA 5KPJA 3VMFA 3TLXA 4A0FA 1TQ2A 3GJ4A 4M9SA 1XTSA 3SR0A 2WMNB 2WOJA 3NHBA 4YXWD 3VHLB 4BPBA 4A2PA 1E9DA 3FB4A 2MSCB 1U8ZA 1WP9A 2RGEA 4LZZA 1N0UA 3PENA 4PHGA 1RRCA 2WSSA 3FDIA 4URYR 4X8LA 2BOVA 5FPHA 4RD1A 1YZKA 2W0MA 2H92A 1ODFA 3UANA 3RS4A 3NXSA 1E2NA 2A30A 1ZM2A 3CNLA 3KJHA 3RSOA 1Q1QA 3PCRB 1J70A 4QNMA 5FTKA 1SKYB 4DT1B 1ZD1A 4JVNA 4C0QC 4GRAA 2QQEA 4JYBA 4URUR 2FOLA 5LB2A 1XTRA 3A1WA 2ZXUA 3HYRA 3P4YA 3SJCA 3KTAB 3IGFA 3QOFA 2O8DA 1E0SA 1GL9B 4M1MA 2ORIA 3RNLA 4Q5IA 1ONBA 1TQ6A 1GRQA 4ZDKA 4DZZA 2ZR7A 5JI3E 5KDLA 4A0GA 3CNOA 1QG2A 4ZV4A 1XP8A 5SZIA 3UK6A 2WICA 1E1QA 3MWKA 2AN9A 1OSNA 3ZIAD 1SVMA 3SQWA 1NNEA 3AVYA 1V43A 4OK5A 1P2VA 4MQBA 5D3MB 1GIAA 2J0UB 2RKOA 5BW8A 3FKSA 1JI0A 3EG5A 4ZIRA 4AG6A 4W5JA 3VKHA 4QKQA 3KJEA 4WZAE 1YZGA 2X19A 1JEDA 1AQYA 3R8FA 1D6JA 2Z0MA 1L2TA 2IWHA 4YC7A 3RDPA 1W36D 3IO3A 3R8CA 5DLQC 3OFNA 2XXAA 2IHYA 3SJBA 4U7DA 5E7JA 3CUEF 3Q8XB 5AUQA 2ZJAA 2XZLA 2O0KA 4MKGA 2IL1A 5TY0A 2ZANA 4OI4A 1HT1E 2Q6TA 2C78A 5IF9A 5TMPA 4LJ4A 3EPLA 1W36B 1P2TA 3NDBB 2WBLC 2CEAA 3I72A 2O8EB 3QSYA 3X1XA 3IBYA 1EFHA 5DNYB 4QM6A 1NMYA 3B13B 4WOPA 3H2YA 3GQBA 1Z0IA 2DWPA 2ZE7A 4CGZA 4H1VA 4KLNA 3I73A 3PG5A 2VYFA 4NHOA 5BN5A 1FMJA 4RJLA 3WP0A 1QHGA 2A5JA 3I3SR 3ND8A 1LV7A 5B30A 1HTWA 1Z6GA 3L0SA 4WW0A 3KKMA 2DBYA 4PC7A 4YONB 4D0GA 3BOSA 5JZVA 4CEJB 4RCYA 1T8TA 1DEKA 1XZPA 4B73A 1WRBA 4GMDA 4OHZA 4URZR 4U02A 1XB2A 4IVRA 4CEHB 4EPRA 1ZMXA 3ZJYA 4HDQB 4DEYA 4A6PA 2IYZA 4IEIA 1S9DA 1D8TA 2XJ4A 2ZR0A 4O2LA 4V0MA 3W6PA 4CVNA 4IW3B 2OT3B 1Z22A 3KKPA 2JATA 2BCGY 2V7QD 5FTMA 4NTZA 2IUTA 3F0TA 3TRFA 1X1RA 3JZMA 3QF4A 2FZ4A 4G1UC 3LX5A 4TMXA 4DDUA 5JHGB 2WOOA 4Q7MB 1HE8B 4JBXA 2VPPA 4DLRA 5AJYA 1MO3A 5EP2A 3BD9A 2J0SA 1VIYA 4D0NA 2VEDA 2AXNA 4OQNA 2WWXA 2G1KA 2MSEB 1CR0A 4U00A 3K70D 3BJIC 3RLFA 4P33A 4YQFA 1IOZA 1MKYA 3WNCA 3EC1A 3EIQA 2FE4A 3PFIA 4HB2A 3K70B 1DELA 1G7TA 3U60B 4Z1MD 1FUUA 1R0XA 1P2SA 5CJ2A 4EPVA 1M8PA 1W2GA 3C5HA 2D7CA 5B2ZA 1D9XA 4KXFB 3UIEA 2W2TA 1II9A 3LO5A 4BWYA 1UEJA 4K46A 1RIFA 3K0FB 1OB5A 4LJAA 4P32A 5GVRA 5DHAA 1P9NA 1KGDA 2LCFA 1OFUX 4HDCA 3ZVMA 2BBWA 2VP0A 4PC1A 4B43A 3JVVA 1E2JA 3L43A 1G21E 3LWNA 5TV2A 2P65A 5JI2E 2XEXA 2R6AA 1AZTA 3RANA 4DUGA 4MH0R 1C1YA 3L8YA 4CW7A 2BC9A 3MGCA 1UKYA 3D31A 4NE2A 1OH6A 5FUWA 4MGKR 2Q0HA 4JL8A 5JJIA 2ZVPX 5G53C 3QKUA 1Z5ZA 4EQ6B 3VU9A 3B1ZA 4LHVA 1QZXA 3BRWD 4AYXA 4HLUC 4AKHA 5DYGA 2BBTA 2CK3A 3U6BA 1T5LA 2OAQ1 4C4PA 2GBLA 2PJZA 1KKMA 4TTQA 3T61A 4FWTA 2X2EA 1WQ1R 3UWOA 2C99A 3K0AA 3VTKA 3GJ8A 3PJRA 2GESA 2ZITA 1P5ZB 5DN6A 2QG6A 1M7BA 1QBKC 4LCBA 4G01B 5ELXA 3GMTA 3MWLA 4GI7A 2ZU0C 1GVNB 2A7QA 3H1TA 4QG7A 2QRNA 4US2R 5KNCA 2W6JA 3AP1A 3DOFA 4O25A 3V00A 1QHXA 3NVAA 4HZUA 1KSFX 4N1AA 3C15C 4C3ZA 3QY0A 3BS4A 1GKYA 1NJGA 4PQFA 3SYKA 5EE0A 4M9ZA 3AB3A 3W6OA 2DWQA 1NN0A 3SZRA 2W2XA 2KB0A 3CBQA 3RS7A 1W4CA 3Q7PA 2H8KA 1II0A 2P5SA 4FMDF 5FPYA 1RC8A 1RPZA 4GNKA 3M1IA 4TLEA 2BIFA 2QM8A 4A82A 4I81A 1TPZA 1E9CA 2ZRPA 2P2LA 1SVWA 2ZJ8A 3QEOA 4P0TA 4BFYA 2PJRA 1WCV1 1XRJA 4PPQA 1KSGA 1HURA 3RYTC 1Z0JA 1N5KA 3DHWC 2QE7D 4LV6A 2N46A 4XH9B 1RRFA 3R9WA 4DLYA 3AVPA 1ZC3A 3QE0A 3W3ZB 4Q4AB 4XTRA 3THOA 4QM7A 4KSCA 2XB2A 4AG5A 1G7CA 4ZDIA 2CE7A 1QHYA 4CT5A 2EFGA 3PUYA 4GDFA 2DY1A 2JJ2D 4QHYA 4X8HA 2R2AA 3IIKA 5JWHA 3ZH9B 1EX7A 1TU3A 4RVCA 2QAGB 1DTSA 1M1YE 1OFHA 4PPGA 4DKXA 4UNPA 2BCJQ 3KQHA 3Q3JB 3AUYA 2ZS9A 1NKTA 3G82C 5EXTA 1EWQA 1ZM3A 3KDSE 5FOWA 3OEED 2JJ1D 1CLUA 1KZ7B 1FX0A 1AS3A 1QRAA 2OXCA 4JBYA 2OEPA 1LY1A 4WA7A 5KNBA 2D4HA 2IA5A 4Q02A 3KXIA 4BLRA 1E0JA 4BFUA 1AJEA 3B5JA 3QPVA 3I5YA 3THXB 1G3UA 2MMGA 3GLHA 5FPTA 1DADA 1MO6A 1RVDA 2XZOA 3LLMA 4B44A 3TSOA 1ZRHA 2NGRA 1ESNA 3AF3A 2J41A 2LKCA 5FH9A 3K0EA 2Z5FA 4R98A 1NBME 5JEEA 1UAAA 3QIAA 1FQJA 2HDNB 4K81B 4IKEA 2QMEA 3I5XA 2IS1A 3CR8A 3KXKA 2OE2A 3PQCA 3D6TB 2AFIE 4KFTA 2WHXA 2RGDA 4LHZA 1Z07A 4BUJA 2JIZD 1G20E 3ECCA 4PQRA 1E2EA 1T5IA 4F38A 1XZQA 3GEIA 2XSZD 1FFHA 1AN0A 3W9YA 2JLXA 3LAWA 4QJ5A 1JNYA 1O3YA 2BV3A 3NDPA 1W46A 4Q4JB 1OE0A 1G291 2JCSA 4B2IA 5FBQB 1XX6A 3TUIC 4IDHA 1XEWX 1FZQA 3WHKA 2KI5A 1DG1G 3NEYA 3A1SA 5L3SA 1LW7A 5LD2C 3BXZA 4A6XA 2AD1A 4HDOB 4GP7A 4YDHB 3HP1A 1WA5A 4DC9A 1P2UA 4M4SA 2QI9C 4HAWA 1NLYA 5HE8A 4R7ZA 4TLCA 2O8FB 3TW4A 4HSEA 4IVPA 4MRVA 2JDIA 1UDWA 3B82A 2X77A 4BASA 4LOAA 3GFTA 2ZIAA 4ARZB 1HQCA 2ZROA 3LX8A 1KDTA 1KZGB 1A7JA 1ZJ6A 3NBFA 3TUJC 4BZPA 2NTYC 2CLDX 2PMKA 4A36A 3ADKA 3VFDA 2O5VA 2I1QA 3IBGA 1CF4A 2IYRA 4OQFA 4DJTA 4PO8A 2HYIC 1BH2A 1SXJC 2RHMA 2OUKA 3FHOA 4B2LA 2LWIA 3U7EB 3TK1A 2QBYA 2KBEA 4A8JA 4MITA 3MD0A 1UJ2A 2O0HA 1XCMA 4KV9A 1YVDA 4TMZA 4B33A 1F60A 1RYHA 4AIIA 4US1R 6Q21A 3KFVA 3AVVA 4GOXA 3DMNA 3QNUA 2O8BB 5G40A 4ZDJA 4UXJA 2D62A 1VDZA 3L0OA 2GVDC 4PZYA 1KHTA 4TLDA 1E98A 221PA 2RGNA 2W6IA 3OF5A 1CTQA 5JRJA 3QVUA 4FXPA 1T6NA 5EUQB 2AK3A 2YOHA 2Q21A 2C03A 3Q72A 2GCNA 4Z8YA 5HPYB 2VF7A 4ACBA 1RJ9B 1TF5A 1R8SA 5KSPA 4B3FX 4MGZR 1BO6A 1CS4C 4ZCMA 1ELOA 3W8NA 1N6PA 1E94E 3EARA 4OBEA 4TN1A 1Q1ZA 4PSKA 1EFRD 3GLFA 4C9BA 3RRNA 1OW3B 2P67A 2PEZA 2EFCB 3HDTA 3TNFA 4B75A 3W34A 1HEIA 1E2IA 3P4XA 1N0WA 4FN5A 1SHZA 4D81A 3QBTA 2PLRA 3K9NA 4Q1BA 1E1RD 3DPUA 4TSFD 4JIMA 1DAIA 1UFQA 1G5TA 1GUAA 3X1DA 3H4MA 1DAMA 2AWOA 3OAAA 5E95A 2H18A 4PO1A 4QFMA 1KO8A 4ASUD 1E79A 1R5OA 2GF0A 1S4QA 1QF9A 3ETLA 1Z63A 4PTLA 2GEUA 5C46F 1ZP6A 3UMSA 2VSXA 3QBVA 5KTYA 3ZQ6A 2HF8A 1NP6A 4LHYA 4W5HA 2VTKA 2GJKA 3P20A 5B58C 2VP9A 5GJWC 3KZ1E 3LVRE 1AZSC 1W5TA 3Q5DA 3DZDA 2GXAA 4UXIA 5FOUA 3IEUA 4MGYR 1E9FA 1FTNA 1GZSA 1WDTA 3GJXC 4F4IA 4PZZA 1XXHB 4K8OA 1G18A 4JS0A 4KYUA 2VBCA 1OFTA 3TQCA 3GLFE 1DBSA 1SXJD 3CPJB 3R7WA 2VHTA 4UNSA 1GRNA 4ESVA 4PAMA 4TQ9A 4JL6A 1XJQA 2IF2A 1SZPA 2A5GA 1YZLA 1L4UA 2J59A 2DYKA 3C8UA 3U7GA 1SXJB 1G4AE 2BMEA 2QENA 1GAJA 1M7GA 2QAJA 4IFEA 1FL9A 5FFMA 5A4JA 2ZYWX 2RGCA 2O0JA 1N5LA 3ZS9A 1OXTA 4XSHA 5IK2A 1G7RA 2A5FA 3VAAA 3QF7A 1IONA 2ZI4A 4RZ3A 3DOEA 3DM5A 3N70A 2KSQA 1UKEA 4PPFA 1UDXA 4DLXA 5EXXA 1MR3F 1M6NA 1ZVQA 2R6CA 2GZHA 2IYVA 3AEZA 2YINC 3P26A 1X3SA 2A3RA 4LHWA 3B1WA 1KO7A 2QROA 2PEYA 2R9VA 1XCGB 1HV8A 3EZFA 2ZVQX 1Q57A 2DWOA 3EAQA 4I99A 4EKDA 1HY3A 1CJTC 1KY2A 3UPUA 2ZUBA 1QVRA 1YZQA 5DI3B 1AA9A 4H1UA 4NYIQ 1VG0B 2WM9B 4JKYA 1EX6A 4IOKA 2JLVA 3E1SA 2GVZC 1KOFA 1TNDA 1TX4B 1ZM4A 3MLEA 3RVBA 3SN6A 4E09A 3PVSA 1G8HA 2P0EA 2OFXA 2YWEA 1WB9A 5F2EA 5FUYA 3ZZ0A 1E2PA 1KI6A 1L8QA 4XWOA 3SJZA 4R2HA 2HLDD 3IO5A 1QHSA 3D3QA 4XVQA 1CJMA 1ZU4A 3KKNA 5FBRB 1K5DA 4QGGA 3HYTA 4S35A 4DDWA 1TQ4A 1FPMA 4IXNA 3C41J 1VECA 4JT4A 3BH6A 5JEDA 2PT5A 4AKGA 4HB3A 4R2IA 4XIGS 4TLAA 3DVLA 4V0NA 1IXZA 4LC0A 3GD7A 3SYNA 3BH0A 5SZHB 4Q9IA 2WJYA 1FNMA 2QTFA 2CCKA 3RWMB 4TYPA 4QNRA 2ZRKA 2ZYTX 3UMFA 2F1HA 1LS1A 3E5HA 1T0JB 5KHOC 3QUSA 1CJKC 4PXAA 4HATA 5C4GB 4KBFA 2ZSEA 1VG9B 2YOGA 3CZQA 2IEYA 1S2MA 1JAIA 2IWRA 2A5YB 2JA1A 2UVQA 3O47A 4S2EA 3KFXA 2ZM5A 4Q03A 4RD2A 3GJ3A 1BIFA 1OFIA 3T15A 4A1FA 4NCNA 2XZPA 2CJWA 1H8ED 2MMCA 2W2VA 3THYB 4DDVA 1GILA 3DMDA 2V55B 3OEHA 3KTAA 4MDFA 1SVIA 1U9IC 1MO4A 3TW8B 2PZFA 3K0SA 1FQKA 1FW6A 3UG7A 4HB4A 3VR3A 1XPUA 1R2QA 1YZTA 2ZYVX 1UBFA 1MT0A 4HUQB 2J7PD 2ZS8A 4Q48A 4WIAA 4Q1CA 2H17A 2VP5A 3QG1A 4BLSA 4BLTA 4JBWA 1W36C 4URWR 1IN4A 2J0UA 4FMCF 1BKDR 1W0KD 1CEEA 4ZCIA 2YHSA 2ANBA 4HB0A 5DISB 1YQTA 3AP3A 1XJCA 3O8BA 3THWA 1KIMA 5TDHA 2GJ8A 4Q18A 2NO9A 4QC2A 4LJ7A 1W47A 3TVTA 3TGPA 5ANRB 2ZI6A 1TF7A 3C7KA 2FG5A 2FWRA 2GAOA 2V54A 4RCZA 1XTJA 2FFQA 3CRMA 2GZAA 5CM8B 2GXUA 2V9PA 3HWSA 4A0RA 4PZLA 2O8EA 1X1SA 2QZ4A 4NYIR 5HKKD 1LTQA 3U44A 3W5JA 1EK0A 4MGIR 3V4RA 2BM1A 3NC0C 3CO5A 3CPEA 4JVSB 1W4AA 1OKKD 2CLSA 2Z83A 4EUNA 3SBEA 2AL7A 1ZCAA 3A4LA 2O8CA 4M1SA 4QJ3A 3P32A 4EFLA 2OCBA 3HU3A 2VRWA 2YJTD 5TARA 2IBMA 3TSZA 1OPXA 2FSGA 4L5BA 1N6LA 3S1AB 1P9RA 2K5UA 3K0CC 2NIPA 4ILEA 1M7HA 3LBHA 4KO8A 5L3VA 2OCAA 3MWYW 2ZAMA 5C1BA 3LFUA 4GZMA 4BRUA 3KQNA 2QQ0A 1QHNA 3ZLJA 4KODA 5FTLA 4CEHA 2F43A 3L0IB 2WPDA 3LW7A 1H8HD 1SULA 2X1VA 4HAYA 3LXXA 5AR1A 5HZHA 1I4DD 1D5CA 3DDCA 1E96A 3RRYA 2ANCA 1FTSA 2XTNA 4C7OB 2WAXA 2AR7A 4MDEA 2D2EA 4OK6A 2A9KA 4IVQA 2HYDA 1NLFA 3GEEA 2NO7A 4EPYA 2GZDA 2FN4A 3FWYA 2EWVA 4OHVA 1A5TA 5FBWB 1Z0AA 4XJXA 1E32A 3IILA 1Y63A 3H86A 2ZQ5A 4EIWA 1XMSA 2UZIR 5AUPB 2B6HA 5BYKA 1JPJA 4MYCA 3A37A 3K70C 4TZ6A 2JLQA 2V7QA 5KSZA 1GG2A 1EESA 4LI0A 4PPNA 1P4SA 3F3YA 4RKFA 1EG7A 3T1VA 4EPWA 5DSZA 2VLIA 1LB1B 1DE0A 1W0JA 3LH5A 3RSLA 1OHHA 3ZS8A 2XOKA 3W5IA 1FUKA 1NIJA 1HUQA 4EFNA 5B64A 1N6OA 4C0BA 4BQSA 2H1LA 1QDEA 2HJVA 4OQLA 2GJSA 3A36A 3CRQA 2CDNA 4IRUB 3VR6A 3KUCA 4KLZA 5JSZA 5M04A 3LV8A 4IJMA 4JL5A 3OIWA 2IC5A 2IYYA 1KI7A 3SS8A 4ABYA 2KE5A 2ZJOA 1R5BA 5JJKA 2JEOA 3AF0A 2WSSD 3EZ7A 3UKDA 5L3QB 4DCVA 1U90A 2ZR9A 3K0FA 4QHSA 4M53A 4JJKA 2BMFA 5HR5A 5KDOA 4RD3A 4NYJQ 2ATXA 2XITA 1X8LA 2QN6A 3KX2A 4LY6A 4Z51A 1GL7A 4JJZA 1XMVA 1BYUA 1COWD 2ONKA 1AKEA 2IS6A 1AS2A 5AWFC 3AF2A 3GFOA 2ODBA 2G77B 4UJ5A 5JHHB 1HE1C 1EFUA 4QBHA 4BLOA 4BZQA 1J90A 3EA5A 1LVGA 3ADDA 4IDQA 2QA5A 1E2QA 1OIVA 4PAOA 3SOPA 2O8DB 1E2FA 2GWHA 4JLBA 4TTPA 2ZU6A 4D4MA 2ZE8A 3B1VA 5KSOA 1P73A 3QENA 4E22A 2DFLA 2I3BA 3FKSD 3J81k 3AKEA 1R5NA 4M22A 3F5FA 2EWWA 3EPJA 1Z6AA 3FYHA 4TLBA 4B2PA 2BKUA 2CXXA 1S1MA 2WVJA 4J0QA 2PX0A 2IYQA 5EP4A 4QBIA 2PL3A 5AJZA 3GLGA 5IRCD 2IX3A 1MRNA 1UADA 4I4LA 4OK3A 1L4YA 2HJGA 3K09C 1K5GA 2WWWA 3L0PA 3L8ZA 3MJHA 3WP1B 4DHEA 2C8VA 5J4HA 1S8FA 3WY9A 4QOSA 3UMRA 3U3RA 2Z43A 4V0ME 4JSYA 4O0MA 4TT3D 3IIJA 1PZNA 2IUSA 1GITA 3ZZTA 2W0SA 2GCOA 4PHFA 4F4JA 4CRWB 2A5DA 4OI0A 4YMTA 1P7CA 3A4NA 1ZNZA 2CCJA 1YU9A 2Q3FA 1LNZA 4DLTA 2CL0X 5FUXA 3VR1A 1N5JA 1I4LD 2QAGC 2W00A 2BEKA 4WVFA 5J4KA 1S3SA 4M1WA 1KSHA 3MG9A 4RD0A 2I4IA 4G3XA 5CYPA 3PEUA 3GLIA 1EGAA 3FMOB 2JLUA 1OB2A 3K8YA 4Q4HB 2E9SA 4EJSC 3OIVA 4CYMA 1Z2AA 2ONJA 1YJ5A 5K8UA 1R10A 2PZEA 1J99A 1IAQA 1I2MA 1NVUQ 4JLOA 5EE3A 4NH0A 2VP2A 2XNDA 1VCMA 3NG1A 1U0HC 3BFVA 3QKSA 2RCNA 5KO2A 1UEIA 2OHFA 3B9PA 3I92A 4DIDA 2H5EA 2GJ9A 4QGHA 2V4ZA 1PLLA 4UKDA 5FL7A 2CLCX 4CZ2A 3HU1A 5TXGA 2OLKA 4Y0AA 1A82A 1G1MA 3NH9A 2JJ2A 1W2HA 4LGMA 2KWIA 3ZZUA 2O52A 1OH7A 4QGFA 2Q3MA 1D9ZA 2IHBA 2ZPTX 4NYJR 2EYUA 4B35A 4N0EA 3NEJA 4HLUA 2ZRHA 3V9PA 2OILA 4IHQA 1GNPA 3TQFA 4NCKA 1T0HB 4L16A 2WWFA 4ZO4A 3RS2A 1KYIA 2QP9X 5E4FA 3THXA 1G8YA 1II8A 2FSIA 4B76A 1IN6A 1QHHA 2AK2A 2OLJA 4OHWA 5SZJA 4BEBA 1DS6A 121PA 3ZD7A 4DEXA 3SE0A 4BFZA 1YZUA 5G41A 3I61A 4MRNA 1TF2A 2EFEB 1NG1A 2VF8A 3IQWA 5FBVB 1TMKA 1CIPA 4E5UA 2VSFA 2Q9CA 4L4UA 4B71A 2ZRJA 3HR7A 2IYSA 1W49A 2CHVA 3UG6A 1Q44A 1P72A 1U0JA 4M8NE 5EZ5A 3CM0A 4HUTA 1ZM7A 2ZSAA 3QKRB 2PT7A 2WJGA 3EZ2A 2GRJA 1TQDA 3QEJA 4AC9A 3PUWA 4Q7JB 2R6GA 4Q9KA 3PEYA 4HLQB 1PLJA 3A8TA 4NL4H 4DUGD 3VQTA 1NRJB 1R0YA 3FE2A 3AF1A 3H0KA 4IXMA 1ZIPA 4NBSA 3BORA 3CRRA 4TQAA 3KKQA 2JIZA 4OQXA 4EFMA 2D7DA 1T91A 4GFDA 3EIHA 1V5WA 1OV4A 2RGGA 2C5LA 2KBFA 1IN7A 2VO1A 2OBNA 4KSBA 1KI3A 1GKIA 2QP3A 3OE7A 2B92A 3QXSA 2BJVA 1NY6A 2EW1A 5DI9A 2GTPA 3LRPA 4DB4A 4WAUA 2FPMA 3LNCA 4DCNA 2CK3D 4CIDA 4EJSB 1NSTA 3AKCA 2XJ9A 4AYWA 3VU9B 4NYMR 3CONA 2HUPA 1XJ0A 2FDCA 4HAVA 3BB1A 4MYUA 2IYUA 5DN6D 2Q9BA 4KJZA 3T12A 3TR5A 1T4GA 1IN8A 4ACAA 4ARZA 1N5IA 1E9RA 1VG1A 5J47A 2WV9A 4P4UA 3EIEA 5L8VA 5K8IA 1OXXK 1U98A 1XD9A 2EYQA 4PQYA 5P21A 4YLGA 3L2OB 1HH4A 3QQ5A 4W9MC 1TAGA 1OH8A 2ZUDA 2HXYA 1IXRC 4DSNA 5FI0B 5BWMA 4HZUB 1RYFA 2ZI9A 4TYQA 4FCVA 2F9MA 4ZCLA 2PBRA 3RS3A 4ZI3A 1ZW6A 1AQUA 1G16A 2FMXA 2G1JA 1P6XA 3A6PC 2ZRBA 3AP2A 2REBA 4GZLA 5JRZA 2J46A 3NBXX 4M9QA 1DAKA 1NMXA 4F93B 5BN4A 4DB2A 3BFKA 1G41A 2WJIA 2REXB 2E1RA 1GTVA 4L9SA 2ZRFA 2IF0A 5JCPA 2OAP1 3CX8A 1MRSA 4A92A 2ZRGA 3U7HB 4G5SA 1W7AA 2YC2C 4JMPA 1IJEA 2IS2A 2C9OA 4BECA 4N3NA 2BKEA 4HAUA 4LBYA 5GVSA 4LWZA 3MJRA 4IOMA 1NBMD 4DWJA 3GLHE 1Q1BA 3AKDA 3X1WA 1KDRA 2JLSA 3ND9A 3UATA 2G83A 1W48A 3EPHA 4MA4A 4QRHA 1Z06A 3VX4A 2QTVB 5K8TA 4TZ0A 1EFRA 2A2ZA 3SU8A 1XPRA 1QVAA 1GKUB 2PX3A 3U4QB 1DO2A 2ZRLA 1WE2A 4M1YA 4C2TA 2ZTSA 2FFHA 1TUEA 4D4LA 3X1YA 3BBPA 1N25A 2OSBA 2IYTA 3IHLA 5DE3A 4QBFA 2NG1A 5H70A 2QT1A 1X8KA 3KKOA 4ZDWA 1E1RA 1ZAKA 3QVVA 5FR1A 5CB6A 4OHYA 5CLQA 4B3CA 4DDTA 3WXMA 5KU1A 1F2UB 4M9XA 1JR3A 1YR7A 4KFRA 1UBCA 2PLFA 2ZI5A 3SNHA 3FHTA 3SFVA 3VKWA 4DSTA 3LD9A 4H9GA 1S96A 2FFAA 3CH4B 2A78A 3EA0A 4JLVA 2OG2A 2QPOA 1IHUA 1Q22A 2R6FA 8OHMA 3GPLA 1AGPA 2JJ8A 1XXHA 4JLAA 2NQ2C 2BDTA 3GFPA 4ESHA 1EWRA 3TSWA 4BFVA 4URVR 3PIRA 5H68A 1Z83A 1YE8A 1DOAA 1ESMA 3AF4A 1E9AA 1P61B 2ZUCA 2GKSA 1GOTA 3AVOA 1SXJA 4O3MA 3AVXA 4C0KA 3TMKA 4RKEA 1F3OA 1VYUA 2V6IA 4B3BA 4DLSA 1I4TD 1US8B 3HPRA 4DRZA 3GJ6A 1MOZA 4V0KA 5L3RA 5F3WB 1E2MA 1PUIA 3B1XA 2QMHA 4PR0A 4DSUA 2OV2A 2VQSA 4DBLC 1E99A 1T8UA 2QTHA 4MRPA 3C14C 1OT3A 4PSVA 3NHAA 1G8FA 1CULC 2SHKA 3NH6A 4JKIA 3B85A 2AFHE 1RRPA 2IW3A 4AK9A 4HYYA 4NMMA 1XEXA 4P4TA 4NDZA 5J4VA 4LBVA 3K9GA 3VNUA 2G0TA 2QPTA 5G3ZA 1XD2A 3RRMA 4QHTA 1NI3A 2BHRA 1XTIA 3GJ0A 1XPOA 1KK3A 2C04A 1JEEA 2HF9A 3EWSA 4KYIB 4OI1A 2QU8A 3EC2A 2WWIA 5GJVC 1Q0UA 1YR6A 2OFOA 3CLVA 4QJ4A 1S3GA 1ZCBA 2IXGA 4OJKA 5L3SB 1RE0A 1YHNA 4P4SA 5SZKB 3TAHA 2CVHA 2AHOA 2F3RA 2PZGA 2IXFA 2J7KA 2JDID 3FGNA 1BMFA 2G88A 4YMVA 2OBMA 2ZJ2A 4F91B 4X8MA 1OXVA 2F9LA 4PC3A 3ICQB 1CU1A 1UF9A 3LQQA 4US0R 4BFXA 5EQTA 1JR6A 1F5NA 1S9HA 4B74A 5CLLA 1Z6TA 2XTMA 4UNRA 1F2TA 3IIMA 2CCGA 1JPNA 1JQLB 3KQLA 1R7RA 1IJFA 3SEAA 5C4MA 3N2IA 4LPKA 4DXAA 2R8RA 3K1JA 5JS7A 1UBEA 3T5GA 2IK8A 2QBYB 1G4UR 4ZI2A 4Q9HA 3RC3A 2MSDB 4A8JB 3T06B 3MRSA 2NOAA 2QMOA 2H7VA 1CR4A 3BB4A 1KSJA 3MSXA 4BLQA 2W6ID 4CEIA 3QXCA 2ZRIA 4OL0A 5JFGA 4HAXA 4NP6A 2DR3A 3WYGA 1PJRA 5JJLA 3TR0A 2QGZA 4F7WA 2F1RA 2P6UA 1U81A 1BS1A 2TMKA 4KVAA 2JLZA 2GCPA 3N2EA 1U0LA 4ITRC 5CJPA 4WXPA 1AKYA 1KI1A 4PX9A 1OH5A 1HQYE 3QG5A 4ZPXA 1D2MA 3THYA 1Q21A 2WKPA 4KVGA 3GLFB 4OYHA 1KI2A 3ZDQA 1IN5A 1CXZA 2C98A 4FMDB 1J7KA 5JLJA 3OAAD 3PEVA 1VG8A 1C9KA 1E79D 2ERYA 2N1BA 4XSGA 5FOVA 4JSTA 1CRQA 1JB1A 4RFSA 1A2BA 1NVWQ 5JECA 1S0UA 1TEVA 3ADCA 3NBZC 4LYJA 5KOYA 2RAPA 4Q01A 2QUZA 1XU4A 3IPYA 3LY5A 4IDPA 4LYHA 1KMHA 1OF1A 4LJ9A 1T3SA 3GCGA 3LDAA 4UJ3A 4C2UA 3OIUA 1E2LA 3B60A 2BBOA 4V03A 4XD7A 5JWOA 2DFNA 2FEMA 3RS5A 1ZBDA 2VHUA 3HU2A 4TYWA 5D3QA 1NMZA 1KJYA 4PAQA 5FPSA 1U8YA 3FVQA 1NG9A 3BC1A 2DCUA 4L15A 1KDOA 4DCSA 4URXR 5AJVB 1G7SA 2C9YA 1MABA 5E3HA 4JLKA 5UKDA 3EASA 2ZSDA 4I1VA 2G9NA 4FINA 5CK5A 3REFA 1WF3A 2ZI7A 4RFVA 5HTKA 4DSOA 3NIBA 2CNWA 3R7WB 1ZU5A 5AJWA 1VIAA 2JASA 2UZ3A 4D82A 5H1YA 3C5CA 4AD8A 5IK2D 2JAQA 2DHRA 4KCGA 3BH7A 3TUZC 1Z0KA 4DIEA 3SQXA 1M34E 4E07A 1IY0A 2F7SA 4YXWA 3VHXA 1VHLA 2XX3A 3WYFA 2WZQA 2WJHA 3FKQA 4LBZA 4C0AC 3SI7A 1E69A 1U2RA 2CHGA 5CIQA 5JCZA 2CE2X 2I1VB 3S1AA 1T3LA 4DT1A 3U61B 4FD2A 2ODEA 2WWYA 3U6KA 1G3IA 1E2KA 5BXQC 5LPNA 1ZD9A 1RW4A 3B7GA 3ZD6A 4A2QA 4BFWA 4Q7LA 2J0VA 3U3MA 4D4JA 1CJUC 3B8HA 2BMDA 1R0WA 3I8SA 4JLJA 5AK0A 4TMVA 4C7OA 1AK2A 1UKZA 5KUTA 1G8PA 1ZM9A 2DFKB 2XGJA 1H65A 3FMFA 1KMQA 1W4BA 5D3MA 2YZ2A 4GMXA 4IDNA 1DVRA 3E70C 3IKJA 3NWJA 4D2IA 5AUNB 1SVOA 1MO5A 3IPXA 2BVNA 4A15A 3ZIAA 4IEEA 1MH1A 4W7SA 5FBLB 4LPSA 2NO0A 5TVKA 1R0ZA 4LK2A 1U9IA 4MRRA 1DARA 3SJAA 1ZUIA 2C96A 2H57A 5CIWA 4C0JA 2R65A 4AYTA 2YC4C 1OLOA 4A0HA 4POAA 4UXHA 1UBGA 3R20A 1U94A 3EZ9A 3AVQA 2OO7A 3TVDA 4TYYA 3A1VA 4MYHA 1Y3AA 2B8WA 1D2EA 4JT2A 4AWXA 2B21A 5FPKA 3A58B 2D2FA 4FIDA 4HEJA 5EE9A 4XTCS 2VA8A 3B9QA 5CITA 4N0DA 1QG4A 3VR2A 4LDJA 3KJGA 4QBGB 5HZKA 3O8CA 4GP6A 2ZREA 3AGPA 2FH5B 3T1QA 2OESA 2V6JA 4LJYA 3A1UA 2NO1A 4TTRA 5C2JB 3QXXA 1PV4A 3BAFA 4OKSA 1E9BA 2HT1A 1G6HA 1Q20A 2FZLA 1KO1A 4CEJA 3NTUA 3K53A 1OXSC 3CPHA 4Y0VA 3TBKA 1LF5A 2GILA 5B57C 3GJ7A 3W8RA 1HA3A 1I2DA 4FCWA 4D80A 2Z6VA 1N2CE 1W1WA 1P9WA 3AH8A 4EAQA 2UKDA 2VP4A 3OEHD 4XVRA 1N6HA 3OESA 2CJWB 1ZUNB 2QT0A 4NKRA 1COWA 3T1OA 4FCTA 1IQPA 3K0CA 1YRAA 4MRSA 5DGXA 5CYOA 5K8LA 1ETUA 2FPLA 2ORVA 1E6CA 5F98A 1CP2A 2F55A 2IYLD 4BFSA 2R62A 2B7BA 2VIIA 4KU4A 3GP8A 2P5TB 4JLNA 1G9XA 2WKQA 2FEOA 3PXGA 4TMTA 2V1UA 1R4AA 4D6PA 3V4FA 5EP1A 1AIPA 5FTJA 5HCIA 5H8WA 4A4DA 5DO9A 4PO9A 2IS4A 2X8AA 3FPAA 4L9WA 4RD6A 2AWNA 4V0LA 3ZVLA 4DLZA 5A0FA 3THWB 1U99A 1E9EA 2HT6A 3AGQA 4TQUS 2OCPA 3TH5A 4RZUA 3T5DA 2FSFA 2P6RA 2AXPA 1BOFA 3M6AA 2H16A 3BE4A 1GNQA 2ZE6A 5FOTA 3I62A 2ZI3A 2EFDB 3QKTA 4Z1MA 5GJCA 1CKEA 4B32A 3U44B 1VPLA 1XMIA 3PUXA 4TT3A 4TL8A 3X1ZA 4B3GA 3X2SA 2FSHA 3QI2A 3U5ZB 1KNXA 2O8CB 1N6RA 2YNMA 5IT5A 2WJVA 1E9SA 1Q3TA 4Q4HA 1Z29A 1YKSA 2WPDD 3NC1C 3T35A 2J0QA 5EP3A 1N0VC 2CHQA 2QP4A 4EQ6A 2EQBA 2QSYA 4U5XA 2QM7A 2VHJA 3SFZA 1E1QD 4NZYA 2LKDA 4WXRA 1YR8A 5EUMA 2IUUA 3LBNA 4NU0A 2F43B 2WIBA 5KSYA 4JVMA 1M74A 5IDVA 4LBWA 2G0NA 1LFDB 2L0XA 1XBTA 3REGA 1Q12A 3CNNA 4BGDA 2GETA 2J5XA 1JQJC 1OIWA 4C0SA 1FNNA 3R9XA 2GNOA 4M1OA 2VSOA 1J8YF 3OFND 4QGAA 4ZIRB 2HV8A 2BJWA 2ODNA 3RWOA 2QMUA 1NKSA 3DZ8A 4BZXA 2C95A 4R71A 1ZINA 1CBUA 3RABA 1VYTA 3AV0B 1W0JD 3JVUA 2XXAB 1B23P 2EU8A 4JZKA 2JLWA 1OHHD 2J1LA 2XOKD 2ZJZA 3B1YA 3VR4A 2OBLA 1G5PA 2XAUA 2FF7A 3EWAA 3KB2A 2FFBA 3SDZA 1NVXQ 4WZBE 3RC8A 3WHLA 1AGRA 3LQRA 3KXLA 4Q4LA 2IYXA 4PANA 4NYMQ 2IYWA 5J5CA 4GPTA 4MUBA 3ZVNA 2FPKA 2AKAB 3IHWA 4B3DA 3KQUA 5JSZB 1UM8A 1SVLA 4BE7B 3K09A 2JGNA 2WSMA 5HE9A 3B2EA 3BERA 3O8RA 5J4YA 1IY1A 2J87A 4M2LA 3I1FA 4TMKA 4TL9A 4CF7A 3QKRA 4JVLA 4P3YA 1IBRA 4Q4AA 4LV5B 4Q1AA 3MCAA 1XCPA 3CF2A 3GLGE 2QE7A 1D2NA 1VTKA 2CMKA 3U2QA 5J4LA 5JS8A 2C2HA 3AKYA 1X8JA 1XNJA 4ZKDA 1WBBA 4OQMA 2ZJYA 3BK7A 3WMGA 2VP6A 2GBLC 4MUAA 5DYIA 2QAGA 2ZRDA 2YYZA 3OZXA 1G3QA 4RZ2A 5EXSA 3W90A 5DH9A 4F4CA 2QRZA 2Z4RA 2V8OA 1SQ5A 2EVWX 4PHTA 3KJIA 2B8TA 1KO5A 4V0OA 3A1TA 4YDSA 3FOZA 2GEVA 4EJSA 3T1TA 1RZ3A 4Z8XA 3QF4B 3WBKA 2WIAA 1YRBA 1EXMA 1TTTA 3LW8A 5EJEA 1VYVA 1KJWA 1NLZA 1GSIA 4LYAA 3JZAA 2YV5A 3B6EA 2RMKA 1GWNA 2PCLA 3OEEA 2G6BA 2JJ1A 4HLCA 3GLIE 3RS0A 2NPIA 4EPXA 4BRWA 1KAGA 3CF0A 3UWKA 3R9IA 2JLRA 3TKLA 3WRXC 5CB8A 5E7IA 3F8TA 4X8OA 3GLGB 3WMEA 4C0LA 3CIOA 3VX3A 3HPQA 1AM4D 2GXQA 3MUFA 4D4KA 1Z47A 2FGKA 3AUXA 1FP7A 4DLWA 3I8XA 2CL7X 2ZAOA 1KDPA 3HR8A 1G5RA 2WKRA 2ZSBA 1PUJA 2QSZA 2NMVA 1TADA 3DKVA 2ZETA 1ZIOA 4FMCB 1DAFA 2FU5C 3BB3A 3CWZA 3FFBA 3KL4A 4WBSA 2GJAA 4D25A 1IXSB 2ECKA 2GCOB 5A5GA 4PHHA 2ORWA 2HCBA 1CR2A 3BFXA 4G5OA 3TJZA 4CDGA 4TL6A 1VHTA 4YMWA 2FJUA 2ZYUX 1KK1A 2BEJA 2VL7A 4Q4JA 4BFTA 3FTQA 4G5GA 4NONA 4YMSA 4ZKEA 1W4RA 2XSZA 5JMTA 3TE6A 4QXAA 3KUDA 4GSYA 4JLPA 1E2HA 1VKJA 2RH5A 2XNDD 5EE5B 3GLIB 2AX4A 4HLDA 3CF6R 2P6NA 3MAAC 1MV5A 1E2DA 3CRW1 1Z3IX 3NKVA 3WNDA 3B78A 1Q1EA 2FX3A 1E4VA 1NBMA 5FL7D 3RRZA 2O8FA 4AKIA 3U4QA 4DVGA 1CRPA 2FGJA 2J9RA 1G6OA 3A4MA 4ON9A 3QKSB 2Q3HA 1PLKA 2Z4SA 5JBQA 3K9HA 2V1XA 5C18A 1G64A 4GT1A 1LS6A 4B48A 2ODWA 3K0AB 2BBSA 4Q66C 2VHCA 2W6JD 3EX7C 1F2UA 3AM1A 1CR1A 1WXQA 4A2WA 4I1UA 2PCJA 4FWIB 1Z08A 1A4RA 2QL6A 1DG3A 1G19A 4KBGA 4JYCA 3LBIA 4PFSA 4UNNA 3KB1A 1XMJA 3DKPA 2RGBA 3CKLA 2ATVA 1Q3HA 4LHXA 1YZNA 3HJNA 4LC1A 3D8BA 1NVVQ 2O8BA 2J3EA 1O87A 1II8B 2ERXA 2GK6A 5LDDC 1DAHA 2WAYA 1QHHB 2ASEA 1XDBA 4LUCA 5EZ6B 3SHFA 1ZYUA 1DO0A 2FV8A 3IEVA 1EFTA 1GRRA 2V3CC 1KI8A 1N3BA 2YOFA 1PVOA 2RB4A 721PA 4GOKA 1Z8FA 1A2KC 1US8A 2ZRMA 3DL0A 5DHFA 5KNDA 1RJ9A 1SKQA 3QPUA 4EPTA 4MKIA 2ZRNA 3E2IA 1OYWA 1JECA 3MFYA 2ZSFA 1NN5A 1IY2A 2HEIA 3ZQJA 3CB4A 3EW9A 1G3MA 3WRYC 4KHZA 5E7MA 1XFAA 1KAOA 4D26A 3G0HA 2F3TA 4LJ8A 2PMDA 1SVSA 3EPKA 3OE7D 4I1OA 5FTNA 2YKGA 3Q9LA 1Z0FA 2YWHA 3BIFA 4Q19A 1WMSA 2QGNA 1XD8A 3RAPR 2HCJB 3W3AA 3SHWA 4B6EA 1W44A 3PUVA 1GNRA 3M0EA 4KFSA 4TSFA 4Q00A 1E2GA 4B6FA 4BEJA 1ZC4A 2GEDA 3CX7A 2ZJBA 3CR7A 1W5SA 4ASUA 2OZEA 4RY2A 4ERNA 2RGAA 4II7A 4I1SA 4RSGA 3M4YA 4GBMA 4A8JC 4GL2A 2F6RA 5F9FA 4M1TA 4F92B 2WTUA 4NCJA 1FX0B 3N5CA 3SC3A 4IOJA 3RHFA 2ZJ5A 5FUVA 2E87A 3DM9B 2GF9A 4XWKA 2OM2A 2XB4A 3GLHB 4A9AA 2RGNC 3U3KA 5FL3A 1OIXA 3Q7QA 1OXUA 1XEWY 521PA 5G3YA 1DPFA 1FP6A 1A1VA 4IFBA 3I32A 4B3XA 1IM2A 3VKGA 2AD5A 2FNAA 4G5QA 5LBIA 3IUYA 2XTZA 1SVKA 2BM0A 1JR3E 4Q9LA 4M21A 4B47A 2W58A 2REOA 4OI2A 1TU4A 1NF3A 3ZGXA 4DCTA 2Y8EA 1T3HA 2F1JA 4V02A 2GA8A 4W5WA 2N42A 1NN3A 4M0LA 421PA 4NCIA 1XXHE 4XWAA 1BYIA 1NVVR 5J40A 5DI3A 4LV8B 3MWJA 2P3SA 1HYQA 2WWHA 3LA6A 4KAXA 2G3YA 4MKFA 4QL3A 4EDHA 4LSGA 2NPFA 2JLYA 1UPTA 2RGXA 1SXJE 2GK7A 3LVQE 4HZIA 3SYLA 2W83A 1JR3D 4Q1DA 1P60A 5LB4A 2CL6X 4KITB 3D7MA 3NBYC 4JLMA 1RKBA 4Q9JA 1KKLA 1NIPA 3I4LA 3KQKA 1B0UA 4TYNA 1DAEA 1OYYA 1EFCA 1XTKA 4XOIA 4Z54A 821PA 5GADl 4G5RA 2HLDA 4B34A 1TL7C 2D3WA 2OCYC 1Z6YA 5LD2B 1X6VA 2Q9AA 3CH5A 4DLUA 3WMFA 4C30A 3AVTA 4RD4A 3QXJA 4C0HA 2GHIA 2AKYA 1LF0A 3Q5EA 3ONWA 4CT4B 1NN1A 2WMOB 3W6NA 4PC6A 4IOLA 1C4OA 4M1KA 1AS0A 4Q21A 3TIFA 2GAAA 3CW2A 5AUOB 1JJVA 1JXOA 4IDOA 4LRWA 3T34A 3WBJA 1P75A 1OJLA 2R44A 2R6DA 4AURA 5CDFA 3P27A 2B7CA 1F6BA 2IEZA 2ZRAA 1E0KA 3PEWA 4Q1FA 1XEFA 1JXMA 2QY9A 3LLUA 3ZVRA 5JWRA 1T9HA 1VCIA 2D74A 4GOJA 1SGWA 2ZEJA 3IQXA 2YWFA 1SHKA 4UQOA 3C4JA 4PSAA 1GL6A 4TL7A 5TB5A 1KY3A 4KI0A 1TUIA 1YR9A 3UXMA 1E3MA 5FOXA 4Q47A 5KYKA 1KNQA 1H8EA 3BGWA 1WBDA 2BWJA 2OFWA 1XEXB 5KDDA 2KJQA 2YVUA 1GDDA 1KTVA 1Z6XA 4AI6A 5EE1A 4HUQA 1M2OB 4LJ5A 2C77A 3U3OA 1P62B 1XD2B 1DAGA 1XTQA 5CK4A 1GP2A 4O2RA 1J8MF 5FI1B 5BYJA 4DLVA 3PITA 1ZD8A 1Z28A 3PV0A 1G17A 1F48A 2QPAA 1BMFD 4FW9A 4RZXA 2XNSA 2VHQA 5AJXA 2J7PA 4P4SB 1TEXA 1FMLA 3PR1A 1CJVC 4PC2A 5CDFE 1HT2E 1K8RA 2F1IA 2J45A 1K6MA 1W0KA 3CZPA 4WZ6A 4MKHA 1G8GA 4TMWA 2ZRCA 1ANKA 4FMBB 2C9CA 1ZUHA 1N6KA 2GXSA 3VNVA 2NO6A 1S1CA 3ASYA 4P31A 3C16C 1KK2A 3DEFA 3FHCB 4OJQA 4D0LB 1JALA 1F2TB 3FMPB 1QHIA 1KI9A 1E4YA 2WWGA 3P1JA 2QORA 1UKVY 4HI0E 3OIYA 1Z2CA 3G5UA 4UNQA 1NL3A 1XWIA
chains in the Genus database with same CATH superfamily
2C3PA 4K88A 3LOQA 3TPCA 5JROA 2V65A 2P0AA 4ZK6A 5ALGA 4JLUA 5F1PA 1M75A 5A02A 2GDJA 1RFLA 1PWZA 1SUSA 1JBKA 2CBZA 2WJJA 3RVPA 4GEKA 1HDOA 4NF2A 1XR3A 1T2DA 2BL4A 3CX6A 1KZHA 3WMXA 3ZIDA 1RRGA 4EW2A 4LZAA 4CEIB 3A1FA 1UOQA 4BJ5A 4BIIA 2DUWA 4BLPA 3B3AA 1NLMA 3DBRA 2QUHA 3UAOA 4A2CA 4BV2A 3QXHA 2J3HA 2R87A 3ZQ4A 4ER0A 3FMIA 5FBZA 1W4ZA 4HX9A 4DMHA 5A05A 4X6UA 2HRBA 3RTAA 1UC4B 1TKBA 4AQ7A 3UB2A 5FUQA 1KWKA 2D06A 3BKWA 2FG7C 4OHXA 2EGUA 5JNUA 5LNK6 1VCOA 1KI4A 4NECA 4XGRA 1CFZA 5FI3A 2NZXA 3AQ4A 3Q7EA 2BMJA 2FRXA 2IHUA 2NZJA 2OV1A 1KO4A 2PZKA 1U8AA 1H8HA 2A8YA 2JRCA 3FF4A 3GAMA 3EXIB 3PD1A 4LOJA 3WNBA 4K86A 2YIVX 5JTTA 3MIZA 1NY5A 4NK5A 5IHPA 1PVDA 1L7RA 1E0AA 3QU2A 1ZNYA 5AO9A 5FR2A 3U3JA 3M70A 2H1WA 2X1HA 1FNSA 1Z7GA 4MAFA 4UCQA 1EQUA 1U2DC 3PRJA 3PHJA 4GKJB 1YXMA 1VJCA 2HW8A 2IPXA 2QR2A 5BNWA 4QULA 1RWPA 1VB5A 3HZRA 3EVEA 3L82B 4R9UC 2HO5A 3ICEA 4KFCA 1KK0A 3BFJA 3LQYA 3QPWA 4QX6A 3B51X 2V59A 2QHXA 3A9TA 3NZEA 3VR5A 2Y1DA 3ZJVA 3TLEA 2GX6A 1VE7A 4RORA 3UTCA 4FB4A 3PICA 3LPAA 3L8HA 3FPHA 1R8XA 4RLFA 3C7DB 2G76A 2NXJA 1VCNA 4JU9A 4N5NA 1RLOA 3D2AA 4XIYA 4DCUA 5JXWA 4D3FA 1P3JA 1J07A 5K0CA 1E5VA 2B99A 1QRSA 3F9CA 1ZIXA 1RC1A 5KC8A 1Q0TA 2VH5R 3GRPA 4G0NA 3SXUB 1MABB 5FOSA 5BQ5A 4DNOA 3L7KA 2Y92A 3UCFA 4GUAA 4Z7NB 1EJ6A 3WZLA 2PX4A 5COQA 4A0FA 4EO7A 1OMOA 2WMNB 1TIKA 2SBTA 4BPBA 2RGEA 3T5PA 4MDHA 1JWAB 2I62A 3PENA 4PHGA 3N2LA 1RRCA 2WSSA 4DTCA 3FPLA 5F2OA 4R9SA 4X8LA 1VA5A 2BOVA 1ZSNA 1YC2A 2PUVA 2AOWA 3G2KA 4TYMA 3ZY3A 2O3QA 2F8MA 1L4HA 3HS3A 3CVXA 1ZK3A 1ODFA 2C3OA 4GI3A 3FOAA 1E2NA 2A30A 2WJ3A 4B17A 4X94A 5EPUA 1Q1QA 3RSOA 2EJVA 3KB8A 1NI4A 2KW5A 4G0OA 3LKZA 2VK8A 4C21A 3GR6A 1T4DA 1W5BA 1L1QA 1SKYB 2I6QA 2Q1UA 2Q2NA 4IF6A 4TLMB 4DT1B 4LF6B 2BEWB 2D0DA 1UBTS 4GRAA 2FOLA 1JKJB 4URUR 3OMLA 3OSZA 5LB2A 1SXHA 3OWHA 3SJCA 1Y3DE 3IGFA 4UDOA 3SXJA 4JJIA 2ORIA 1VL8A 1WXFA 4KV7A 1ONBA 2IU0A 4DABA 5C3MA 1SRRA 3IAS6 4JNKA 1XNGA 3CNOA 4GR9A 3II6X 4G0VA 1ESZA 1QG2A 1ZPDA 2YYYA 3N28A 1R6VA 5KQLA 4WEOA 5IUKC 5SZIA 2Y99A 3UK6A 4E21A 1E1QA 3VZQA 1LDBA 1GUDA 3H7IA 4YUYA 4HEHA 3HL4A 2DTEA 3N0VA 3ZIAD 4ZMRA 3YASA 3SQWA 1V43A 4MDYA 1M0SA 4R8SA 5AESA 4YRQA 3P2EA 2X5KO 2WJWA 3SC6A 2R4QA 3L7OA 1JI0A 3EG5A 5CW1A 1PSWA 5G1OA 2IPNA 3KSZO 4J7UA 3KJEA 3HBAA 3ZX4A 4WZAE 2R86A 1YZGA 3NR2A 1D6MA 1D6JA 1L2TA 2XXAA 1W36D 4DQ0A 1OWPA 2IHYA 1VJRA 1T4MA 3CUEF 5AVWA 3ZLTA 5HM8A 5C81A 1DC8A 3R3UA 4KXXA 2HU2A 4KLCA 4O4LB 1OI3A 2IL1A 4TS9A 5K5EA 5JFTA 4OI4A 2YVKA 1G38A 1JQAA 4HDMB 4RK5A 4WGFA 1P2TA 1ZFNA 2OZKA 2CEAA 3SX4A 1MXFA 2FPWA 3QW2A 4XW2A 2FN8A 5I8ZA 1G6Q1 2HNAA 4KWTA 2YWCA 4QOEA 2AEMA 1V7QA 3KPUA 1KP2A 4WOKA 1U3GA 4ID9A 3UJDA 1T0UA 5I7VA 2ST1A 3DJYA 3H2YA 4D97A 1KFBB 1UOOA 4B9AA 3CN9A 3L0YA 4XXHA 3WOVA 3BIXA 4UDYX 4KLNA 4N49A 2AC7A 1FMFA 2VYFA 1JTFA 3KYDB 3OPQA 3ODPA 1GPAA 3DVAA 1G8KA 3T3IA 1FSZA 2IITA 4J7AA 1RBMA 3I3SR 3RVJA 4EH1A 1LK5A 5B30A 2PSFA 3AB7A 5AH0A 5ED0A 5GONA 2ZYRA 3UPTA 3BOSA 3HFRA 3B12A 3WB0A 3WSTA 2DT8A 1R8JA 4N5HX 4PAWA 3O82A 1JFTA 1WRBA 4LVOA 4TS4A 1QNFA 3R6DA 1MB4A 4MQFB 3CF4G 4U02A 3OLVA 4C7VA 3OQIA 1QF6A 2O2XA 3PNPA 3FKJA 1Z39A 3ZJYA 4F3KA 3E1GA 3IP7A 3O93A 5KYTA 1D8TA 5KTSA 1QZZA 3EOBI 3LK7A 4DA7A 1LLUA 3D4IA 4Y2JA 2WHPB 1AX9A 3L41A 3LUJA 4FKMA 1GTJ1 3K5HA 2B5WA 5BSTA 4K6OA 1KYQA 1SA0B 3CGWA 4BTEA 5AW3A 2IUTA 1VL5A 3F0TA 4ZV7A 2H6EA 2FZ4A 4G1UC 1CV2A 2QVXX 1Z4IA 4G4GA 4JSRA 2C7PA 1BN6A 1U11A 3QE3A 1K7CA 1JH8A 3HJHA 2ZUSA 4LDZA 3TLAA 4HNUA 3WK4A 1V8FA 4OQEA 4A5OA 4RADA 1ZOSA 2R7MA 1TVMA 3W8FA 4IDEA 3IOEA 4HSGA 3ROGA 4B3RB 2F59A 4TWAA 1CEXA 1NE7A 2VEDA 4Y9RA 4HEA1 5THXA 3EPPA 4ZRNA 5I7OA 3VVLA 4BL5A 1O89A 3N9IA 3S7ZA 3PUIA 3H4IA 4X61A 4LQCA 5B55A 1SCIA 2P75A 1KBOA 3RTBA 3PGJA 4J43A 3ZDZB 2NTNA 2D1RA 1ITZA 4REQB 4HXFB 1E18A 3N75A 1CDOA 1MKYA 1XN4A 3ZY2A 5BVGB 1P5HA 4POOA 4FYYA 1P4JA 2G4CA 1SK8A 4RWEA 1QRUA 4GHWA 2IZZA 4RF5A 3HJGA 5DX0A 1EVLA 5FFNA 2XGMA 4Z1MD 2C4WA 4QPZA 4EG4A 4X6YA 2FQQA 1YL6A 1W2GA 1JFFB 3C5HA 2D7CA 5B2ZA 1QYRA 3H75A 4LTDA 2FW9A 1XMQB 1RP1A 3I2HA 2DLCX 4GBGA 3PIDA 7ABPA 4IIDA 1KZ4A 1UEJA 4HFMA 4X85A 1RIFA 4ALKA 2DZDA 2AH5A 2BH2A 4P32A 1E7YA 3BMNB 1P9NA 1WL8A 5TX7A 1YFJA 3R3YA 2GWRA 2YY6A 1WSBA 2D5BA 1EBBA 1K3UB 1KAEA 2A1IA 2GHRA 2Q0XA 4MWDA 4OMCA 4PC1A 2XCOA 3V2IA 1E2JA 2XCUA 3L43A 5LN1A 1FP1D 4XPZA 3FPFA 1EJBA 3H65A 1AZTA 2GH1A 3N3BC 1RJEA 4Z0HO 1XAHA 3RANA 5IABA 1P18A 1Z16A 3FCUB 4IXDA 4JC0A 4MH0R 4CW7A 4PNEA 2BC9A 3FLAA 3MGCA 3IOCA 4E5PA 2PH3A 4II2A 2SICE 1ODIA 4E6PA 4WBNB 4HBZA 4R84A 1VLZA 2AGVA 5JJIA 5HKLA 4ND3A 4Y1GA 1NXPA 3B1ZA 1T8SA 1QZXA 2R5FA 4RE5A 5LUAA 1Z34A 4J1SA 1G6KA 3DMTC 1YI8A 2VYVD 3KJFA 4L9RA 1CLEA 2CK3A 3KT3A 3UN1A 5B1SA 1JB9A 4RQAA 5KZMB 1THMA 4KK4A 5CCBA 1UXIA 1I51A 1KC1A 1XKQA 2GBLA 1YS7A 2PJZA 2D3TA 2Y66A 1CZKA 2ZQZA 4KO4S 1JLLB 1BFKA 4L4RA 3ESYA 2X14A 3NORA 4M0EA 5JZ9A 3P9IA 4CFSA 3Q3GE 2I33A 2NVUB 4C5CA 1PR3A 2O3TA 2CLHB 2A7QA 1NXVA 1OOEA 2MT9A 1JHZA 2XADA 3KOXA 2PX2A 3V7FA 4BMVA 5LL6P 3VJRA 1HLPA 2W6JA 1BC5A 1K7FB 3LQFA 5B1DA 8GPBA 1VMEA 2QYSA 3GARA 1JS1X 4C3ZA 1L5YA 3UJNA 3AW8A 4YRMA 2VCEA 3QY0A 4PQFA 3V5NA 3AB3A 2DPYA 5E6SA 1CY6A 2Y9PB 3BDVA 4Q4CA 4JB3A 1YHYA 3TNDA 3CBQA 3PHCA 3CWCA 5AVSA 3C48A 4EVRA 1AURA 5AVKA 3ITDA 3GG2A 3I5UA 4FYIA 1CQIA 2NSLA 3VR0A 4WCFC 5J5VA 4I14A 5I3ZA 5EJMA 2VQDA 2JFYA 3O84A 4GNKA 3WRXA 3EDCA 3SM3A 1G5FA 3T5MA 1E9CA 2PJRA 2P2LA 3RUIA 4P0TA 1N2GA 2A1TS 1NAIA 2AEFA 5DLPA 5HZMA 4PPQA 3H3JA 3RYTC 1Z0JA 3IIIA 1SU7A 1P2FA 4BXOB 3VISA 4BB9A 4LV6A 1QFMA 3OU6A 3KYIB 2WEKA 1K5HA 1LTKA 1JSRA 1UXKA 4UMFA 5TT1A 2JGDB 2JBAA 3MZ0A 4DLYA 4Z4CA 3PX3A 3VI4B 1ZLXA 4RVHA 5FNVF 1XAIA 3W3ZB 4Q4AB 5HIMA 1ODKA 3NDJA 4AG5A 3DEIA 3E9EA 1QHYA 3K2IA 3QLEA 2GI4A 1GCIA 2OK8A 4U0JA 4X54A 2BF7A 5KI6A 3F7NA 3UHJA 5BMVF 2CF5A 2R2AA 4WLVA 1NZJA 3ZH9B 3L7MA 4RVCA 2ZIXA 2QAGB 4L72A 4UOZA 4KE8A 1OFHA 4R1MA 3IDAA 4UNPA 2BCJQ 3BHMA 4AG3A 4RVGA 4DKXA 4ENPA 4DV7B 1GRVA 3VC7A 3AUYA 2V0NA 1NKTA 3G82C 5K05A 5JPDA 2ZK7A 3EH2A 3DL4A 2J9FB 4IAOA 3SEZA 3NM4A 5FOWA 4ZVUA 3NVKI 1W35A 3E3LA 2VAPA 4OM7A 2QDXA 3NM5A 1T6YA 2AC2A 4WL0A 3NFYA 2NUBA 4NEQA 2ZAYA 1D09A 1T34A 3L6UA 2D1FA 4JBYA 2DUMA 2OEPA 1UOEA 2B1IA 3V46A 3DWIA 3P0IA 5KNBA 1JIUA 3USES 2H2HA 2ZUWA 4Q0MA 1XVVA 5CG2A 3ZQUA 3KXIA 4HQ0A 5MN4A 4ZQEA 1MZPA 1AJEA 1OU4A 3LUCA 3MMSA 4BNDB 3I5YA 2ZBFA 4EJMA 3BQNB 1Y1SA 1HT0A 2MMGA 3R5XA 4XUEA 1ULAA 4I5DA 4QNNA 1DADA 1GADO 5FPTA 4DNPA 4KNYA 2VXYA 1RVDA 1TT5B 1ZRHA 2TMDA 1ZJZA 1KPIA 1OXMA 2H0QA 3AR7A 4GPD1 4PYQA 3DZKA 3ZDBA 4K87A 3NHZA 3K0EA 2XQIA 2ZBUA 3EDOA 1R4MA 3UUEA 4BO7A 1NBME 4HYTA 1O94A 3OOJA 4H17A 4EYGA 5CDSA 1UXHA 2HDNB 2IS1A 1K86A 5EWMB 3VR6A 7ADHA 2GYWA 4G0YA 5D7BA 4TKLA 4G2TA 1DINA 2GM9A 2ZBPA 3PHHA 3DEJA 4I8XA 5EQJB 2VNHA 2AFIE 3R5JA 3QU4A 2WHXA 3U81A 4ZVTA 4CR6A 3HWWA 5AW4A 4BUJA 3CVYA 4INOA 3LHIA 4PQRA 2EXXA 2A5LA 3GEMA 4F38A 3W9YA 2JLXA 4WCFB 4OQYA 2QN9A 3NJ8A 2FEPA 1JNYA 2WFMA 3B3GA 1O3YA 3FWPA 5B1YA 1M2WA 3JAMA 1VE1A 4LXYA 1W46A 2ZYGA 3CKMA 1OE0A 3I0ZA 1IZZA 4QAJA 3TKAA 2I65A 4HVLA 2DXIA 2JCSA 4KR3A 3BGSA 1XX6A 1X9GA 5JD5A 2A59A 1POWA 1PWEA 3HEAA 3VO8A 1KQNA 2EOAA 3UMJA 1NHWA 5PGMA 1GPJA 2PSDA 4NJMA 2FW6A 3BXZA 5JXHA 2JEZA 1LCIA 3HP1A 1LX7A 1AVTA 1WA5A 2NZWA 3WRYA 4DC9A 4DR4B 1FJXA 2CJFA 3MTGA 1X7DA 4CQLB 1TZKA 2BHLA 2C5FA 4HAWA 1DI0A 5HE8A 1E1LA 2O8FB 1FLDA 4EMTA 1UDWA 3H8VA 4UHFA 3IQIX 1HQCA 4MR7A 4QEKA 5IAGA 2XRZA 2NVOA 3IUMA 3BRQA 1ZJ6A 3GMSA 3TUJC 3V33A 4UUAA 4DQLA 1C29B 2G5PA 1CZHA 2COKA 2PMKA 4PW0A 4BQPA 4RNCA 1G20B 2J0EA 1CF4A 4R83A 4DJTA 3OTGA 1UZUA 3C85A 4PO8A 5GQSA 1UC9A 3WLFA 4BPRA 3NP9A 2OMEA 2RHMA 1EWKA 2OUKA 5HDQA 1DEXA 2LWIA 3TK1A 1PGJA 1HFEL 5JCJD 2FUNB 5CVVA 1Q7BA 4MITA 1ARZA 3VR4H 2EHJA 1YC5A 1HTBA 5HG0A 1UP6A 1EK6A 3INRA 1ZO8A 5CVEA 4KV9A 1TLTA 1CEYA 1GNVA 4TMZA 5AI5A 1F60A 1RYHA 2RJ3A 4AIIA 4B33A 4LJSA 3AESA 1FYXA 3A2LA 2AA3A 3KFVA 4PRZA 1YB7A 5GGXA 3SSAA 3I9V1 4X5OA 5G40A 5KTMA 4RTJA 1U3CA 2CNKA 5EIEA 2D62A 1CY0A 3EBLA 2LD4A 3RVQA 4PZYA 4F3TA 1JHMA 1KHTA 3O8QA 3CO0S 4TLDA 3SOZA 2IODA 4QXRA 4ALNA 1YQEA 221PA 2FFJA 2W6IA 1CTQA 2ZIFA 3HUTA 4KRGA 5BN4B 1B2LA 1SH7A 4HVCA 1E1NA 3WZMA 4MUMA 2Q0SA 1GPNA 1LH0A 2C03A 3IKTA 2VF7A 4PS1A 2W70A 5C4IA 1TF5A 5IPFA 3TW0A 1R8SA 3RH0A 3Q8MA 1Y98A 4U2DA 3ICCA 5JCOA 5J2UB 2AOUB 3W8NA 3EARA 1NUAA 4OBEA 5HUHA 1JEYA 1ZVMA 2IOFA 3G68A 2C5BA 4OAPA 3G9TA 2H51A 3OPYB 1G8MA 4QFCA 1LW6E 2EFCB 3HDTA 1UPXA 1XVUA 4N7BA 4UUOA 4B75A 3P9SA 2P90A 4G5XA 3RADC 5MN5A 4JP5A 1QOZA 2XNCA 4QDXA 3W3AD 3U0VA 1E4OA 2PLRA 2EX4A 5JSQA 1E1RD 4TSFD 4RWZA 3J7AC 2QUJA 4C20A 1G5TA 2P9EA 3GLQA 3HI6A 3ZHOA 2FMTA 2OQ2A 4L74A 4ASUD 3KVVA 1KO8A 1FEZA 1C7QA 1H9BA 5JTUA 4KQMA 1T5OA 3DP9A 3C87A 2VCYA 1GQYA 1X7ZB 2WAOA 3QA3E 4X7MA 4OMFG 5LMNB 2H1OA 4BX8A 4EMSA 4R7TA 1ZP6A 3JQRA 3UMSA 5BQFA 2A88A 2A1TR 5T4HA 2VSXA 3ZQ6A 4CHGA 1YUNA 3ENNA 4FI3F 5KVSA 2IZ6A 1ORVA 1V6CA 1Q14A 1O6ZA 2VTKA 3O95A 4EG7A 1EEXB 4G8JA 5EJ4A 2VP9A 3VH4A 1WPQA 2P4SA 3ESDA 3Q5DA 4W8HA 5FOUA 2Z2XA 1L7AA 1Z2PX 1Y81A 1FTNA 2B37A 2MHCA 3IEUA 3GJXC 4MGYR 4TS3A 4PZZA 4TTSA 1XXHB 5C35A 3H83A 1XZHA 4U39A 1I9GA 1W85A 3HVHA 4KYUA 4OHCA 5BORA 1QGED 3B1FA 4M7WA 4QU9A 4CM9D 1DBSA 2GOYA 1SXJD 4KQKA 3GLFE 4KAJA 3R7WA 2DSTA 2VHTA 1GRNA 2PKCA 4ESVA 4PAMA 1AF7A 1QZTA 3H2GA 4JCOA 1SZPA 3E81A 4N5IX 1WDKA 3G0CA 3C8UA 3GLSA 4RH1A 1H3NA 4LTNA 5FWYB 2BMEA 1M2VB 4GRDA 1EWYA 2BMWA 1KR5A 1F9AA 2O0JA 4P6VF 3P7MA 3JATB 1EP3B 4FN4A 1XSEA 1G7RA 3VAAA 4DIKA 3QF7A 1NVAA 4QYWA 2VATA 3NAZA 3NM6B 1UKEA 3MHTA 3GNTA 2Z56A 3GHHA 2PQ2A 1OX4A 2CC2A 4Q7EA 2GZHA 2IYVA 1RAFA 5HS4A 1KMMA 2YINC 3H8JA 1X3SA 3K5IA 3MMNA 3D6UA 3T3GA 5IYZB 3Q8LA 1KO7A 5KC9A 4MULA 3P9PA 2QROA 1MAWA 4ZYWA 3EZFA 2ZVQX 1Q57A 1ZJ4A 2DBZA 1GR0A 5KJ6A 2FF5A 3PX7A 2VSYA 2O8VA 1TVEA 3A11A 1KY2A 1VJDA 3GDOA 4WY2A 1LDYA 1V3QE 3H6HA 2IYAA 4MK4A 1ZVVA 4HWTA 2FVYA 2QMZA 3LYAA 4OOFA 4MVWA 2WM9B 3JQGA 3SDSA 2YFKA 4FYHA 4NAUA 4X1IB 4CKCA 5IHXA 1EA5A 2W8ZA 5F3RA 5IVIA 3RVBA 1AUPA 1E3WA 1T8WA 1WM1A 3PVSA 1G8HA 1ORRA 5K9ZA 1M34A 2V9ZA 3IP9A 4HTFA 1E2PA 1X13A 3R3ZA 4KXLA 4NICA 4XB1A 4R2HA 1U2SA 5ERYA 5EZYF 4XWOA 1SBHA 1PCXA 3EEIA 3IO5A 5ADWA 4MVJI 1HDYA 4XVQA 5MF6A 3Q88A 4MLCA 4ZP1A 3PFCA 3PPVA 4ZT2A 4ZVQA 2C0CA 3AU9A 2D8AA 4E5KA 4YJKA 2Z09A 2GR9A 2HPAA 3HYTA 4BUZA 1TQ4A 3JSXA 4CCSA 4IXNA 3GZNA 3ICPA 2QYTA 2X5NA 3MPUA 2GBFA 1UMBB 4HB3A 4R2IA 4LJKA 4XIGS 3LC2O 1IXZA 2VLBA 3NYWA 2PE5A 4DV2B 3GD7A 4MP3A 1B15A 1P17A 5K0BA 2ODAA 4GBJA 1YB1A 2CV0A 4Q9IA 5AW7A 4M9RA 1C1XA 5C52B 1C5KA 1HLGA 2GTHA 4OGFA 3Q12A 3MERA 1H0HA 4GL4A 4ENTA 2HN9A 5IKMA 3JARA 2AMYA 1P0FA 2QLMA 2HX1A 5LKRA 4YK7A 3H9CA 4HFNA 3G49A 5JSZA 3CTMA 1IXYA 2A84A 1IHPA 1TM1E 2H5LA 1NBAA 3HYNA 4KBFA 4UHJA 1VG9B 4MCHA 3SIPA 4M0PA 2IWRA 1PZEA 2YWXA 3E9RA 3MPOA 2UVQA 4IHAA 4RS4A 4D6YA 3KFXA 4EB3A 1B4DA 5AI8A 4B79A 2FX2A 4CIYA 3CLTD 5JXIA 5B1IA 1EX1A 2CZCA 1OFIA 4BKMA 5BV8A 5DTJA 4A1FA 4TWIA 4I1IA 3MIIA 2V6MA 2QF7A 5FPPA 4YRAA 1ZUNA 3GMIA 3THYB 4Y9SA 3RFCA 2FWIA 1MFZA 2BEWA 1JKJA 2VOJA 1ZDMA 3W4IA 4UVIA 2NUTB 1FMCA 4QLOA 5KTOA 2QD1A 4RSHA 1B8PA 3GV0A 3MBKA 4RHCA 1FQKA 3O4JA 3X0DA 1YZTA 1MJFA 1BD3A 3E35A 4H18A 1QVWA 3W6ZA 4WIAA 1DFGA 4UOQA 2ZBEA 1NT2A 3DNMA 2GKGA 4JBWA 2VJCA 2QR5A 3H6KA 1MTZA 1ODSA 5FTWA 4YALA 4BV3A 3HB9A 2PS9A 3QFCA 3A14A 3R0QA 2TSYB 1B3BA 2H4JA 2XQKA 2YHSA 2FLVA 2ANBA 2DG2A 2P9BA 3DLIA 1YQTA 3AP3A 3AUSA 1XLWA 3SQMA 3COZA 1N8SA 3E18A 3UFXA 5M2QA 2Q4EA 1KIMA 4S0XA 1OUMA 2H48A 3KBOA 1AQJA 2NO9A 3VU3A 3D8TA 2CUKA 4QC2A 1GKLA 3M81A 3WICA 4RV5A 1U2DA 4LY0A 1KF0A 1GZUA 1ZN9A 1W47A 4ZT7A 3T3MB 5ANRB 1QK4A 2JBWA 1XWFA 2B5OA 1UJBA 4K7JA 2B20A 2NM0A 2FFQA 3CRMA 3PQ5A 4L5IA 2GXUA 2V9PA 1S2GA 4N5MA 3DOIA 3JWHA 1GD1O 4HDNB 4HNGA 1GGHA 1QAQA 3FGOA 1YJBA 3EEYA 4D9HA 1UKBA 1BSVA 2GYUA 3AYXB 3PDUA 1EK0A 3QWFA 4H4CA 4MGIR 3W5JA 2IIPA 2W6MA 3CPEA 4JVSB 4XUCA 4DV6B 1O5OA 1R9GA 2P11A 4YLEA 5TQ0A 3X1JA 4AECA 3V1MA 4JLSA 4EUNA 5CFMA 2O8CA 4M1SA 3CMCO 3RUDA 4B4OA 2OD9A 2QU7A 3JWIA 5EJGA 1E20A 2XD9A 2VRWA 2PIDA 3HU3A 3WB2A 4DJAA 1GN9A 2B83A 2IBMA 2PKQO 1OPXA 4JI0B 4AVYA 4P5DA 2X0KA 3G79A 1KQOA 3RD5A 1RQLA 1U1EA 3K0CC 3PPXA 3ANNA 4P9NA 5B2FA 3SSMA 4KO8A 1SVNA 5L3VA 1U1FA 4CTMA 4AX8A 1QH9A 1EPUA 2ZWAA 3KQNA 1Z7WA 5MFZA 3ZLJA 3N6XA 3C39A 2JI8A 3TSYA 5FTLA 5CFPA 1YFLA 2HWUA 1H8HD 4WKPA 2X1VA 2R7LA 3LXXA 4HAYA 4R69A 3ZKWB 4LZJA 1D5CA 3ZOZA 3DL7A 3KHUA 4DNFA 3H0EA 1D1SA 1NUHA 2XTNA 1FDOA 1EFAA 4H4EA 2AR7A 1YBHA 3Q9SA 1SNYA 2ZIUB 3C6XA 5HMMA 3U1VA 2ZYIA 3LS2A 3F6YA 3I1JA 2VRCA 2X58A 4IVQA 1KA9H 4EPYA 5I7EA 5IT4A 2FN4A 2EWVA 4OHVA 1A5TA 4QUAA 2YVLA 2PANA 3IEIA 1R1DA 1E32A 3ZHTA 3A70A 2C5EA 1Z8DA 3LF1A 5AUPB 2XB6A 1BS2A 1J09A 1JPJA 2H2WA 2HMTA 5EMKA 3K70C 4TZ6A 3VR5D 3K05A 1GG2A 3GDWA 2BP7A 4P34A 4KYVA 1W8IA 4U2EA 4DAOA 3T7TA 3T1VA 3CUWA 2E4UA 1U6JA 1C4KA 1LB1B 1DE0A 1N4DA 2XPCA 5BYBA 4AAYA 2YTZA 5F9MA 3LH5A 2I7TA 5EL0A 3WWOA 4PYIA 3PXCX 1HSOA 5DM70 3H87A 2J9XB 2XOKA 1JT2A 3ABIA 3M9XA 4MV4A 4K9KA 4ZREA 4M8SA 4O33A 3NTQA 3KLMX 1NIJA 4REQA 3W5IA 4EFNA 4KR2A 3FSEA 3K6KA 5DYNA 1T5DX 3V3TA 5DBEX 1GG8A 2RJOA 4C0BA 4BQSA 2HJVA 1QDEA 3F71A 5K0SA 2RGUA 3HKBB 5K0LA 3A36A 3CRQA 4GMFA 3QK7A 3R5TA 3FPKA 3M49A 4IRUB 4P7KA 4TROA 2Q27A 1N2OA 1Y7HA 4R05A 3LV8A 5BOVA 3ZWVA 5CHYA 3ZK9A 3TVYA 1NUUA 1I30A 2VT7A 3TXXA 3L02A 5H82A 3L8CA 1L5KA 3LT0A 1V48A 2WSSD 3UKDA 5L6LB 4RPCA 1U90A 1YH3A 1XRPA 4EVSA 1NBIA 5LQCA 1CSEE 1PFVA 4QO7A 3V8BA 2I03A 3BMNA 5TPWB 3EEQA 4ZVMA 1H0SA 1KXJA 2IY9A 4JJKA 3TF5A 1QPZA 4FGKA 5HR5A 2C2ZA 2CN1A 2GN8A 1QIEA 2CXQA 3SE7A 4AO8A 5GP1A 3N0XA 4Z51A 1T2NA 4E14A 4Y6PA 4BVLA 1H4TA 1LNSA 1U3TA 4OA8A 1ABEA 1AS2A 1OROA 5JR3A 2IS6A 1DGQA 2RI1A 1EZZA 1XJWA 1LDGA 1NU6A 4NESA 5DCLA 1MX1A 5AWFC 3OIDA 4JP2A 2H3HA 4DBZA 3R0XA 4BZQA 4BLOA 4PFQA 4WZBA 3ACDA 4Y9UA 3EA5A 2WIDA 2CFOA 3TFQA 4PAOA 4NCAA 3SOPA 2XMGA 2JFGA 3VV3A 2WIKA 3FXAA 2O8DB 2IYOA 3TIGA 3BTOA 2OP1A 4XYEA 5KSOA 1P4HA 5IWAB 5FD8A 2VCHA 4MV5A 3AEQB 3JYOA 2DFLA 5JISA 5KOJA 1PFYA 3GNSA 3QVGA 2ZT5A 3BIJA 4XJVA 1Y1QA 4U2CA 1T3TA 5AKHA 4ZRDA 2ISCA 2BKUA 3MJCA 4COOA 2MINA 2WVJA 4J0QA 3U7JA 3W2GA 1HFJA 4CIAA 3AR9A 2GQ0A 2B0JA 3ANTA 2YR0A 2Q5JA 1JUDA 1JLKA 2PL3A 3ZWMA 3GLGA 1A9ZA 1MRNA 1UADA 5BT9A 1YIDA 4Z4QA 3IMFA 5TR9A 5ITVA 1TUGA 3UHOA 4FBMA 4YECA 3MM4A 1QCDA 5ER9A 5EVCA 4EA6A 2HCRA 4CG2A 1M1NA 1U2QA 2YZ7A 4JP8A 3L0PA 3L8ZA 4DBVO 5HK9A 3IUBA 3MJHA 4LOLA 5IBRA 3OURA 4OXKA 3F97A 1P7WA 1S8FA 3OO0A 4M0DA 4MW1A 2LRHA 4ATNA 3BL8A 4U1RA 4N5DA 5FADA 1D2RA 3URKA 1J21A 4FOSA 3V8PA 5EG5A 3RK1A 1CYEA 3U9TA 2P9JA 4JI1B 3V8QA 3AUJB 5CNKA 2IUSA 5FO0A 1GITA 4ZK2A 5I4KA 3CLSD 1FVXA 3GI1A 2OZVA 1QIJA 2EC5A 2EATA 4FC6A 4RMIA 3WLEA 1DQYA 1ZNZA 3G5MA 3L7AA 4D99A 4E46A 3E5RA 3W5BA 2O5EA 4RH0A 2OV3A 1ES9A 1N5JA 2KLHA 5HKAA 2BEKA 2Q1YA 2PSSA 3RRXA 4CMBA 1CPYA 3VKUA 3EVCA 4BXOA 1M2JA 1M3SA 2QDKA 2DBRA 3GK3A 3W0LB 2I4IA 5J23A 4WH0A 3LGAA 5CYPA 3U3ZA 3BF8A 1Y8ZA 2JLUA 4F2PA 3K8YA 4EJSC 5FP0A 5FKJA 1LQUA 4UCFA 1P1IA 4QGSA 4MGHA 2PKYX 1I2MA 1UR5A 4P0QB 4G9BA 2G04A 4K0RA 2VH1A 3LYLA 4TPKA 3TMYA 4AZWA 1VCMA 3C2QA 3L0DA 4LAFA 1KEUA 1VL1A 1RPAA 5FBHA 2L19A 2PZAA 5ENVA 1UEIA 2G9RA 4QUEA 3OD5A 2H5EA 2V4ZA 4HQLA 4XB6B 1PLLA 1NONA 2JI9A 3DV0A 2NZYA 2YWRA 4CZ2A 3HU1A 5HYVA 4EB6A 1M66A 1G1MA 1A82A 1DEHA 1T8PA 2ASVA 4HP8A 4LGMA 4JT9A 3WK8A 8ATCA 4WPGA 3HXLA 3U19A 1GT6A 2J9FA 3D6JA 4PCUA 4QGFA 4ZQHA 1GG9A 2X3UA 1OH7A 3H1AA 3QZUA 2IHJA 1XA3A 4H7HA 4C6TB 2ZPTX 3F1LA 4OYRA 5IX8A 2EYUA 4NCXA 3EN0A 4N0EA 4R31A 4CDMA 2ZRHA 3ZV5A 4K1XA 3B7PA 4IHQA 3DMTA 4NCKA 1UBUS 3RKUA 1T0HB 3Q2KA 1OGYA 3QVWA 1V4BA 4L16A 2WWFA 2BFDB 1SD1A 2LW7A 1IG0A 1II8A 2H7CA 1Y3FE 2FSIA 1SBIA 1SG9A 3M4NA 4DRXA 4XVCA 3MXOA 4B1FA 1ZG3A 4OHWA 5SZJA 3TG8A 1DS6A 3ZD7A 3A06A 2PV7A 3SE0A 2C4KA 3T7IA 4DQKA 3HJCA 4AZ3B 1YI0A 3UT5A 4TTVA 3UC5A 2VF8A 4A26A 5FBVB 4NR0A 3WYNA 3NBKA 2XYVA 5DGDA 3WMWA 2VSFA 5ENDA 1BJKA 4B5LA 3HR7A 1JHQA 3ZK7A 3O38A 4ZWNA 3RS9A 3F98A 3ONFA 1Q44A 3GDGA 4P1ZA 1P72A 5EZ5A 3HRIA 3Q1KA 4IZOA 4M8NE 3UICA 4HUTA 2J3JA 1ZM7A 3QKRB 4OAQA 2WNHA 3EZ2A 5GM1A 4KMSA 3WL7A 4AC9A 1WXEA 3PUWA 4Q7JB 3DZIA 4HLQB 4WCFA 1PLJA 3A8TA 4F1KA 5JAHA 3RIMA 3VQTA 3KOWA 3OBIA 3Q6NA 1NRJB 1R0YA 3F6SA 3QMMA 4QU0A 1ZIPA 2D7DA 3CRRA 4QLBA 3KKQA 1T91A 5HRUA 1BQ4A 2AT1A 3T54A 2W71A 3ZWYA 2RGGA 1N1EA 1GTZA 4JOQA 4OP2A 3RT9A 1ETHA 1KI3A 2QP3A 1E3LA 3OX3A 1AGXA 1Z7EA 2EW1A 2WT8A 3JQ9C 4HQNA 2PLAA 3EA4A 4GG1A 2XE4A 4X1YB 5ECYA 4ENWA 4WNAA 4DB4A 4EGQA 4DCNA 1NVGA 2CK3D 4Q3AA 2Q07A 3FAKA 5AXDA 1NSTA 3O1LA 4EJSB 1SBQA 1Y5RA 2C2BA 3AKCA 1D4ZA 4D92A 3CONA 2HUPA 5D84A 1XJ0A 3K6JA 1KVTA 1OAAA 4JI5B 4MYUA 2E4XA 3AUKA 1ABBA 3KSUA 3A1EA 3TR5A 4N40A 2EKLA 3AINA 5MGNA 5IUJC 4WOCA 1GEGA 3U9SA 2E7ZA 3IXQA 5KINB 2EZ8A 3LX4A 4GP9A 1I9CA 3NRJA 1OXXK 3QGMA 5P21A 4PQYA 1SR8A 1NPTO 3L2OB 4E2WA 4J6EA 3O4GA 3OPVA 1FBNA 5LQSA 5MFPA 1WQ3A 2YJ6A 1U7OA 3NNDA 4A6EA 2GBGA 4IUYA 3FDJA 4DSNA 1ZQ1A 3WLSA 4HZUB 4UBJA 1RYFA 2ZI9A 3QYJA 4YDQA 1TCVA 2CYCA 4XR9A 1ZK2A 3V42A 4CLXA 4ZI3A 3FRJA 2V7VA 2NU8B 1ZW6A 2DERA 1AQUA 2FMXA 3DE7X 2IH5A 3FCAA 2REBA 1EHIA 1NLUA 1VMKA 2W2LA 2WFLB 1P1BA 4DADA 2J46A 4OBBA 5KQPA 2VJBA 3NBXX 5CUQA 4J0IA 4F93B 5BN4A 4BC1A 5DZSA 2WJIA 4DCMA 2RKWA 1RYEA 1OLSB 1NTRA 1SWWA 2ZRFA 2IF0A 5B4UA 3QU5A 3CX8A 2A0KA 2B61A 5LU8A 2ZRGA 1WP4A 3NRCA 1W7AA 1ZX1A 2WF5A 3AIIA 3GLKA 4RA6A 3TQHA 4BQNA 2HK6A 1B8VA 4N3NA 2AOUA 1Z4NA 2BKEA 3SEFA 3ZW9A 3QPDA 4BECA 4BQRA 4PZUA 3MJRA 4IOMA 3OPXA 1Z36A 2EAUA 1R8YA 3PFKA 1Q2UA 4X90A 1FDTA 3ZE2B 3HDJA 5JDCC 4E1VA 4K6CA 3HB1A 3SVZA 4MA4A 3OY7A 2RK6A 1RXIA 3EFBA 3E27A 3IQDB 4R1QA 1LQTA 3OZEA 5K8TA 2Q2QA 4P7JA 4RETA 4RDIA 16PKA 4GGMX 4JP1A 4A27A 1XHEA 3KQPA 4UQLA 5TE9A 2NZVG 1TAHA 3K16A 4CL2A 2XBUA 4QVGA 3DE4X 1VKOA 2OSBA 4JU8A 1OQAA 5DE3A 3IMKA 4QBFA 3VTFA 2YZKA 1X8KA 1X7ZA 2Q3DA 4ZDWA 3C43A 5T3YA 1ZAKA 3SDBA 2GUWA 4EZIA 4OHYA 1H05A 4EK9A 4B3CA 4EA8A 4DDTA 1WU8A 2HQSA 4IJUA 3VOSA 3WXMA 3GRVA 1YR7A 3ADPA 3OF3A