3OF5A

Crystal structure of a dethiobiotin synthetase from francisella tularensis subsp. tularensis schu s4
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
222
structure length
222
Chain Sequence
b'SNAMKKFFIIGTDTEVGKTYISTKLIEVCEHQNIKSLCLKPVASGQSQFSELCEDVESILNAYKHKFTAAEINLISFNQAVAPHIIAAKTKVDISIENLKQFIEDKYNQDLDILFIEGAGGLLTPYSDHTTQLDLIKALQIPVLLVSAIKVGCINHTLLTINELNRHNIKLAGWIANCNDSNIKYIDEQINTIEELSGYKCSAKISRNADYLDFIDLSKILI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dethiobiotin synthetase
publication title Crystal Structure of a Dethiobiotin Synthetase from Francisella tularensis subsp. tularensis SCHU S4
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Ligase
total genus 72
structure length 222
sequence length 222
chains with identical sequence B
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 2010-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13500 AAA_26 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3of5A00
5K8UA 4JIMA 1R7RA 1YE8A 1F60A 1FFHA 4ZIRA 3NTUA 1RYFA 2F1RA 3K0AB 1OFUX 1P9NA 1AS3A 3WYFA 1GRRA 3GP8A 3RSLA 4KBFA 4M1OA 1UKZA 1G6OA 2JJ1A 3T34A 2HLDA 1YZQA 4WAUA 3EASA 1YHNA 2RHDA 3LLMA 4Q4AA 3CBQA 4DCNA 4S2EA 5SZJA 5JZVA 2XOKD 1NG9A 1NVVR 4KAXA 5G40A 2DBYA 4B3CA 2ZYVX 4UJ5A 5FPHA 4B2LA 4MYTA 5FTNA 4OI2A 3EA5A 1IXSB 2IXFA 4IRUB 2PEYA 5TY0A 2E87A 1P72A 1XMIA 4PHHA 4O2LA 3V00A 3SZRA 3TSZA 3IGFA 4W5JA 2C98A 2N46A 3TK1A 4B43A 5J4LA 3BERA 2QTVB 2IS2A 1OIVA 1PUIA 1R5NA 1YR9A 2EQBA 4WW0A 1V43A 2ZE5A 3KKNA 5BQ5A 5DN6D 1RVDA 2JLXA 5LB2A 1LVGA 4NYJR 2XITA 3T1OA 3ZYCA 2JATA 4D81A 2Q21A 3HU1A 3LD9A 4ZKDA 1MR3F 2QPAA 3P27A 3O8CA 1SXJD 3VX4A 5AUNB 4HB0A 4H1VA 1LY1A 1VCOA 1W44A 1M7HA 1G5PA 1D8TA 1U0JA 2ZR0A 3K0CA 3B8HA 4ACBA 1QHHA 3QVUA 2GCOB 2ZUBA 3NHBA 1XTIA 3CO5A 3SN6A 2RGEA 1J70A 3KKQA 4POAA 2IL1A 4NYIR 4V0KA 4TQAA 2XZOA 1VHTA 1Q20A 2DWOA 1CR1A 2PMDA 2V7QD 3EAQA 4C0KA 1MKYA 5JS7A 1X6VA 3H0KA 5L8VA 2VP0A 3CRW1 2RGDA 5KHOC 5FOSA 1YRBA 3HPQA 3VTKA 3K70D 3DZDA 1PLJA 1E1RD 1K5DA 5LDDC 3R9IA 3IEUA 1KHTA 3OIUA 4ZDIA 2CMKA 5CB6A 1Q57A 1X1RA 2G0NA 2XZLA 3U3RA 1W2GA 5D3MA 3NEJA 5CYPA 3AVQA 5CM8B 4LJ7A 5BW8A 3CF2A 3PUVA 2YZ2A 4GOKA 1Z6GA 2BWJA 2NMVA 4FCTA 3U7FB 4PPGA 1HEIA 4J0QA 4LPKA 1E3MA 2FNAA 1CTQA 2D7DA 4DT1B 4DLYA 4B73A 2GEVA 3R7WA 1KKLA 1MABB 1CRQA 2OSBA 4MITA 2H18A 3A37A 2YOFA 4ZKEA 1WF3A 1Z2AA 1KNQA 3L8ZA 4PAMA 5FTMA 1TF2A 3U3KA 4BZQA 2UKDA 1IN8A 4LHXA 1G7SA 4TL7A 2R2AA 3LQRA 2Z83A 4EJSC 4EJSB 2QP4A 2F7SA 5AJWA 3PR1A 1ZUIA 3PG5A 2OCBA 1EX7A 1KZ7B 2FH5B 4MRPA 1M2OB 5EXTA 4BRWA 2AWOA 4LZZA 4YXWD 2OUKA 4P4UA 3KQUA 1VCMA 1U0HC 3QUSA 4XSGA 5EP4A 5JSZA 1U9IA 2N1BA 1E94E 3OAAD 4XOIA 1KK1A 5J5CA 1SKYB 4CZ2A 1NBMA 3SE0A 3A4LA 2LKDA 1W0KA 4HAZA 3SJZA 2J87A 2KJQA 2ZRAA 3RS5A 4HLUA 2Q3MA 2JA1A 3A1WA 4I1VA 2W2TA 2OBLA 2ZRFA 2W2XA 4TL9A 4BEJA 3BB3A 2C9YA 3EIEA 3T1QA 5K8IA 4Z1MA 4BQSA 4KYIB 2VYFA 2H8KA 1G8FA 3GQBA 1E9EA 4RZUA 2KE5A 4NCJA 3O8BA 1XEXA 2AK2A 2QORA 3PVSA 3AP3A 2VP6A 1K8RA 4DJTA 1XDBA 4H1UA 1G5TA 4JLMA 1KOFA 1SVIA 2VRWA 3EC2A 1KZGB 4PTLA 2EWVA 2O8EB 1ZRHA 1R2QA 3ONWA 2OBMA 1SXJE 4MQBA 1OKKD 2J45A 2WMOB 1SHKA 1Q1EA 1YR8A 2BJWA 2YWFA 1TAGA 1W2HA 2FA9A 2J9RA 4V0NA 3W34A 4F4IA 4HLCA 4URWR 1NY5A 2ZREA 1XD9A 4PHTA 5DO9A 5EP1A 5TV2A 2P0EA 2P5SA 2QAGA 3OESA 2IYTA 2MSCB 1DARA 2OO7A 2JJ2A 2Q9AA 2P6RA 1YKSA 1KK2A 2HCBA 3K09A 4DLUA 3VKGA 2I1VB 3T1VA 4BFXA 2UVQA 3IILA 4KODA 1PZNA 3RS3A 2F3TA 2JEOA 1TL7C 4WVFA 3WP0A 521PA 1R8QA 3MRSA 5TB5A 4ZI2A 5E7IA 4PHFA 4Q66C 3TH5A 4NTZA 1P2SA 2ZRJA 4UNPA 3SBEA 3C4JA 3L8YA 3WYGA 4PFSA 4IVQA 2J46A 1W0JA 2VA8A 3SFVA 2BCGY 3NG1A 3AF0A 4K46A 1YR6A 4GMXA 5H70A 3TUIC 4O3MA 4D4JA 2NO9A 1RKBA 5E4FA 3THXB 4QNMA 4HDQB 1VHLA 2IW3A 1G3IA 2VHQA 1CBUA 5H8WA 2X77A 3EZ9A 2QGZA 2REOA 3FFBA 2J0QA 2F6RA 1JJVA 3K9NA 4JMPA 2ZUDA 2CDNA 2MMGA 2VP4A 1XTJA 1I2DA 2IWHA 1KK0A 1GRQA 3CNLA 4RSGA 4RFSA 4RJLA 4EQ6B 2CHQA 1W49A 2R44A 1ZJ6A 2WOOA 5EP2A 2CEAA 3AUYA 4LC1A 4DEYA 4MDFA 4DLTA 5FUVA 2FSGA 3Q7PA 3GEEA 4GMDA 3JVUA 3WBKA 1Z08A 4OHYA 4R2HA 4E22A 2NG1A 421PA 2JLZA 4E09A 1KI1A 1C4OA 3EIQA 2PZFA 2QSYA 5J40A 3WY9A 1IN4A 2ZYTX 3IEVA 1F2UB 2RHMA 4CT5A 2WKRA 3RC3A 1DPFA 3QEOA 1T3SA 4TMTA 1ZM9A 1J7KA 2GDJA 5J4KA 2WVJA 2GTPA 3ZDQA 1E96A 3TUZC 4I1SA 4I81A 2FE4A 3AF2A 3RRMA 4R71A 2CLCX 5CJPA 1E9BA 4RY2A 5ANRB 5FOTA 3K0SA 3LXXA 3PEUA 1NSFA 2DB3A 1J2JA 2G77B 2PL3A 1NY6A 5FBWB 1E32A 4HZUA 3ZJYA 3VR6A 2QSZA 1LB1B 2JLYA 2ZR7A 1KI7A 2C9CA 2FFBA 3QXJA 2QROA 4IDNA 2J1LA 1CU1A 3AVWA 4JJZA 5TVKA 3SBDA 4NYJQ 4CGZA 1KJWA 2G9NA 1E2KA 1CIPA 3AM1A 4V0LA 5BN3A 1ETUA 3W3AA 4QOSA 4C4PA 2WWIA 1QHIA 2A5YB 2Z6VA 3KKPA 1U99A 2F43A 3PUWA 2RGAA 1TQ2A 1G7TA 3K9LA 2QQEA 2ZSBA 3DOFA 4TTQA 2FU5C 2GK6A 3E2IA 3H1TA 1WXQA 1FUUA 1E2EA 1HYQA 5LPNA 2I1QA 1S1CA 4XIGS 3TSOA 2NGRA 2Y8EA 4LY6A 2V55B 1JNYA 5G3YA 3ZIAD 1H8ED 1Q3HA 5AJYA 2QT1A 2RGXA 3OEED 4D4MA 4XVUA 4WXRA 1U8AA 2XXAB 1S1MA 2YWHA 3FKSA 4HSEA 4WIAA 4ZDWA 4JKYA 4JT4A 2ODBA 5HCNA 1P2UA 3B9PA 4FW9A 4DB2A 2CL0X 1GUAA 1GFIA 3EWSA 4R7ZA 4DSNA 4JLAA 3VR4A 4G01B 1Y3AA 2VF7A 3RSOA 4F4JA 2A2ZA 1T6NA 3GJ6A 2HYIC 2C8VA 1IQPA 2VO1A 4L4UA 2PX0A 2PMKA 5BN5A 2G88A 4AI6A 3ZS8A 4B48A 1TPZA 3KUDA 4M1TA 1ZBDA 4KSCA 1OXVA 2YJTD 4GI7A 2QG6A 5FPSA 4NH0A 1WA5A 3IQWA 1LW7A 1L2TA 3RRYA 4A0RA 3B13B 4YC7A 1SULA 1E1QA 4Q00A 3GLFB 1CP2A 4P4SA 5JCZA 1I4TD 4TZ6A 1IM2A 3NBYC 2ODNA 3R8CA 1PUJA 4FI3C 2JLQA 2BMFA 4IEEA 4AYTA 2YVUA 3U6BA 4QC2A 1NKTA 4FMCB 2QRZA 4TMZA 3LA6A 1E9RA 2CHGA 4BFTA 1EK0A 3GMTA 4LI0A 2VL7A 4Q9IA 3I62A 1P6XA 3X1ZA 2O8DB 2JCSA 2QMEA 3MD0A 2ZSAA 2IYWA 1W4AA 3M4YA 3VR5A 2VPPA 3BBPA 3VHXA 1AK2A 3UWOA 1RRGA 3AKYA 4BGDA 1KY2A 1YR7A 2W58A 2ZIAA 1N6HA 3TGPA 1RIFA 3RC8A 1LTQA 3FMFA 4Q02A 2CCJA 3VKWA 3KB2A 4QG7A 3T5GA 3WMEA 2DWQA 2ZYWX 3P20A 2ZSFA 1GDDA 3U2QA 5JMTA 1RFLA 4G5SA 4DXAA 2O0JA 2JJ2D 4LJ6A 2HDNB 4UXHA 1E69A 4M9XA 3B60A 4D26A 1E2QA 4DB4A 4NBSA 4OHVA 4P0TA 1XP8A 1KK3A 3D6TB 4AWXA 1N5LA 4BFSA 2QBYB 3VR3A 1EXMA 1PJRA 2GA8A 1P7CA 3VFDA 3U7GA 2C95A 4M8NE 2A5JA 2AHOA 4NPHA 3AF3A 3TLXA 1WE2A 3C5HA 4AKGA 4KVGA 3TIFA 4DIEA 4G5GA 1D9XA 3SJCA 1ANKA 1R0YA 3LX8A 3UWKA 3THWB 5G41A 1E2PA 4ZV4A 1E9DA 1ZC4A 2AXPA 1LF0A 4IHQA 2BDTA 4TMKA 5ELXA 1XEWY 1JXMA 4HAUA 2XTZA 1JPJA 2DYKA 2J0UB 4K81B 4I99A 3A1SA 3I72A 2IT1A 1NVXQ 1R0ZA 1EWQA 3WNBA 3ZVNA 2W0SA 2GKSA 4ZDJA 3DM9B 2JAQA 4RD3A 2IF0A 3ZD6A 3AVYA 1GL6A 3B9QA 1OSNA 3B5JA 2VTKA 3KKOA 3UXMA 2FFAA 2AXNA 1KO5A 1XJ0A 2Q9BA 4LBZA 3AVOA 2E1RA 3PJRA 3ZH9B 2D74A 1ZU4A 4HUTA 1E4YA 1XCMA 3PIRA 4TLAA 1YZLA 3MJRA 4LCBA 3QSYA 2ZS9A 1XMJA 2ZJ8A 4BUJA 4ASUD 3B1ZA 3ND8A 4RKEA 5KDLA 1BIFA 2RMKA 4JSTA 3I5XA 1OB2A 2D62A 1HY3A 4OJQA 3P4XA 4PC7A 5DN6A 4JL5A 2Q3FA 4TMWA 5C2JB 1NRJB 1S0UA 2Z4SA 1TQDA 2REXB 1D2MA 3KZ1E 4TWZA 2ZRIA 5FI0B 5KPDA 4N0DA 1V5WA 4A9AA 1SXJA 2NZ8A 2P67A 4OJKA 4O0MA 4TYNA 2HV8A 2Q6TA 2OAQ1 4B75A 1DAKA 4AKHA 2ZJZA 2WWWA 4HAXA 4YMTA 5F3WB 3WHKA 3UMFA 4XWOA 1UJ2A 5IT5A 5E3HA 1FUKA 4TMVA 5JHHB 1R0WA 1W1WA 1TX4B 4NZYA 3M1IA 3ICQB 2K5UA 1SKYE 4C7OB 2IWRA 3SI7A 1CKEA 5TXGA 1A1VA 3FOZA 2XB4A 3FGNA 2V7QA 2QTFA 1ZUHA 5FUWA 3SHWA 3E5HA 1BOFA 2VP9A 2BBSA 1S8FA 4Q4LA 5JJIA 1F3OA 5E95A 5EE0A 1OIXA 1L4UA 1E0SA 1YU9A 3ZVLA 2ZVQX 2ECKA 1HT2E 1E6CA 1ZIOA 4OL0A 3KQKA 2ZJAA 2A5GA 4B3BA 1US8A 2ZSEA 2B6HA 2B7BA 2IX3A 2A5FA 1GIAA 2ZAOA 3FB4A 3ND9A 1EFRD 4Q9JA 3LBHA 3EG5A 2ZVPX 3DKPA 1N2CE 2BV3A 3AB3A 3HJNA 3NBFA 2ERXA 1XXHB 1NN3A 2QE7A 3QF4A 4A6PA 3GLHA 4LJ8A 2IHBA 3GFTA 4Q7LA 1YZUA 2GEDA 3EIHA 3FTQA 1KI6B 2H17A 1XTKA 3BFKA 5KOYA 3FKSD 2J5XA 4OK5A 1U90A 4Q1FA 4QHTA 4Q21A 2GAAA 1XMVA 2ZAMA 4M0LA 4LHZA 3FMOB 4NONA 4LPSA 1FP6A 2BKUA 3SOPA 1KSGA 1BKDR 4GSYA 2JLSA 3QKTA 4YXWA 2ZRHA 2VBCA 3CRQA 4NCNA 1M74A 4H9GA 5JRJA 3JVVA 1DAMA 2NTYC 4AD8A 5C4MA 3VU9B 1QVRA 1VECA 1BMFD 4PC1A 3MGCA 3OAAA 2JLVA 1G20E 3A36A 1COWD 1DAGA 3KJIA 4OHWA 3D7MA 4G0NA 2OM2A 1XRJA 4HAVA 1UDXA 3MMPA 4CT4B 1AA9A 3IBYA 1SZPA 2NZJA 3K53A 2EFGA 2ZJYA 2WHXA 3LFUA 4Q4JB 1JI0A 1IN6A 2DFKB 2ZANA 2PT7A 2WWGA 4EIWA 4F7WA 3HPRA 3QENA 2HT1A 4CRWB 4RD4A 2O8CA 4R9UC 3C8UA 2PZGA 4G3XA 3K0FB 1A5TA 1M6NA 4MUBA 2DHRA 3KUCA 2P6NA 5J4YA 3KKMA 1OFTA 4M2LA 4MYUA 3A1VA 3IO5A 3U3OA 3DOEA 1GVNB 2DR3A 4MRSA 1VG8A 3W3ZB 4OHXA 1G8YA 2WICA 2YWGA 2WKPA 3C5CA 2F1JA 1N0UA 4B33A 2HCJB 3ZZTA 3K8YA 3A1UA 5BN4A 3CF6R 1VG1A 3BJIC 2CHVA 4A4DA 3C7KA 1G18A 2A9KA 2VF8A 1OKKA 3LNCA 4JLJA 5HTKA 1FW6A 1KMHB 4CEHA 4MGZR 1KI3A 3LBIA 3PUXA 3UATA 4HUQB 3BFXA 5IK2A 2OZEA 4C30A 2IYLD 2ZI7A 4QM7A 4B47A 3ADBA 3MJHA 1XCPA 2QY9A 2OT3B 1VYVA 3BAFA 3DHWC 4A0HA 4C0AC 3M6AA 2QUZA 3THXA 1ZCBA 3CPHA 3QXCA 5AUOB 3TVDA 1J8YF 3LW8A 2KBFA 1UPTA 3EWAA 5FOWA 2IS1A 3IPYA 5FPTA 3X2SA 3GLIA 2VH5R 3C14C 2G0TA 2CJWB 3FDIA 4LJYA 4PSVA 3LVRE 3H4MA 1Z0KA 2A3RA 3ZLJA 1G64A 3OHMA 1WDTA 5A0FA 4OQLA 1CS4C 1MT0A 1QZXA 4Q01A 1G8GA 2EFDB 3CNNA 3U4QB 2CL7X 3NBZC 4PAOA 4FWTA 1DADA 1TEXA 3QPVA 2ZS7A 4NKRA 1UF9A 1UDWA 5KYKA 3K0AA 1VIYA 3SFZA 1E9SA 2O0KA 5EXXA 2CVHA 3DVLA 1CR4A 3OZXA 3IHLA 4BECA 1JECA 1FP7A 1OW3B 1RJ9B 4B74A 5KDOA 3KQNA 1RE0A 3I73A 3QG5A 4OBEA 1ZM2A 2ZRNA 1RZ3A 4TN1A 4X8OA 4B3DA 2ZITA 1KDOA 3LLUA 1LV7A 2ZETA 1ZIPA 1QDEA 1P2TA 4DDWA 5EE3A 3KFVA 1CXZA 1CJMA 4L9SA 1ZM7A 3KJHA 4AK9A 2ZM5A 1G4AE 1IHUA 1LS6A 4BLSA 3UMRA 2H5EA 1QHSA 2FFQA 3TRFA 5KSOA 4KU4A 4CVNA 2DFLA 3OF5A 4G5OA 4RD0A 3SYLA 3AGPA 1FNMA 4A15A 1A7JA 2GXQA 2OXRA 4V0OA 3F0TA 4HDCA 1XWIA 2CCKA 3DKVA 5JCPA 2CVFA 3WXMA 4LC0A 2KWIA 2WTUA 4L5BA 4M1YA 1U98A 3T12A 1NVWQ 3OIVA 1VMAA 2R6AA 4US1R 5EXPA 2GBLC 1OH5A 3GLFE 3FHOA 1O3YA 1RRPA 1BYUA 4A2QA 3RS0A 1UADA 1JALA 2GCOA 4LJ5A 4AYWA 1JQJC 5A4JA 1IXZA 3N5CA 4QHSA 4EPTA 1UEIA 2YOGA 3NWJA 5EE5B 3CR8A 3KFXA 3CPEA 2QE7D 5AUQA 4CEIB 5UKDA 2HJGA 3MCAA 2ZRKA 1GAJA 3DMNA 1OB5A 4OKSA 2GRJA 4Q7MB 5TDHA 3UG6A 1OXUA 3ZIAA 1H8EA 1CR2A 3BS4A 1AZSC 4JVLA 1BS1A 3DMDA 3OEEA 3GFOA 3TAUA 1X1SA 2WJHA 2ZE8A 4ASUA 5H68A 3U3JA 3WMGA 1U0LA 2WJJA 5EZ5A 5F2EA 4M22A 4TLEA 4X8LA 4C0SA 4UNRA 4ZCMA 5FH9A 4QXAA 1VTKA 1NSTA 1Q1QA 3WYAA 4GFDA 3TJZA 4A0FA 1R8SA 2WPDD 3MAAC 2GCNA 4DT1A 4KFUA 1JR6A 2OLJA 4KJZA 2ZE7A 1MABA 1TEVA 2GF0A 5JBQA 3I8XA 4PPQA 3SC3A 4Q4HB 5DISB 2AD1A 3KDSE 1TU4A 3QEJA 2HXSA 4IOLA 3SJAA 1KYIA 4TT3D 2RGNC 2PLFA 4EJSA 5M04A 1UBFA 2OHFA 4ESHA 4AYXA 3W9YA 1SKQA 1Z29A 1ZP6A 4YMWA 4GL2A 4PXAA 3QKUA 1G6HA 2BIFA 2WWFA 4KSBA 3CLVA 2ZRDA 3P32A 4TQ9A 3K9GA 2RAPA 1AN0A 1XZQA 4WZ6A 2C03A 4XWAA 4RCYA 1D2EA 1Z5ZA 4EPWA 4A92A 4KITB 2NO1A 1KKMA 2OFXA 3EXAA 1XEXB 5FOVA 3U3MA 3PUYA 4MH0R 4TYYA 4DZZA 2XX3A 2CXXA 1JXOA 2QT0A 3FFAA 3GLGB 4B3GA 3AEZA 3NHAA 1KSJA 1NLYA 3AUXA 4DSOA 4CF7A 3NDBB 4Y0VA 5DI9A 1OF1A 5JWRA 5KNDA 2EFEB 2PJRA 4D82A 2B8TA 4URYR 1DE0A 3Q8XB 1T8TA 1G17A 1Y63A 3VAAA 2QAJA 3KXIA 4M9QA 5CB8A 1Z6AA 3ADCA 3LBNA 2WOJA 3BB4A 1LNZA 2DFTA 5IK2D 2R6DA 1C9KA 3A1TA 1NN1A 1ESNA 1Q0UA 3H84A 4QBIA 4GP6A 4ERNA 1P62B 4GNKA 2GAOA 3L0IB 1BH2A 4DIDA 4GDFA 3JZAA 4LYAA 4PO8A 2ATXA 2QNRA 4GP7A 5F9HA 2O8EA 2EW1A 4KI0A 2ORIA 4PO9A 1OXTA 1ZAKA 2GNOA 4Q03A 1I2MA 2XEXA 5FTLA 2Z0MA 2WMNB 1SVSA 3GJ3A 1E2MA 3NC0C 5EJEA 5FR1A 4W9MC 4YDHB 3SYNA 1NVUQ 3CB4A 3SQWA 2FPKA 3GEHA 1ZW6A 4US2R 1B0UA 3RS7A 4ABYA 4NCHA 1IN7A 4KCGA 4IVRA 3GLHE 5AJZA 2JASA 2ZYUX 3ZS9A 5JECA 2G3YA 3MG9A 4AIIA 4OQXA 2ZEJA 1KI8A 2WAYA 2Z4RA 3EPKA 4M9SA 4U02A 2N42A 3HYRA 4LBYA 4TYPA 5K8LA 4DCUA 2KBEA 3KQHA 2NPIA 1HE8B 3CW2A 3VHLB 1G16A 2A7QA 4YLGA 3Q7QA 4E5UA 1G7RA 5KSYA 1XJCA 1XTSA 1OXSC 4Y0AA 2O52A 2G1JA 2WJYA 4NMMA 1GZSA 1XXHE 4HB4A 1P73A 1ZINA 2ZRCA 4PHGA 4IOJA 4PX9A 4X8HA 4QGFA 2JIZA 2FGJA 4B44A 1E9CA 5B64A 5JJKA 1XCGB 2W6ID 4JBWA 1RYHA 3BH7A 5FBQB 4O25A 2IBMA 1E2NA 4KFSA 1Q21A 4M1SA 3U5ZB 4EQ6A 5GVSA 1EX6A 2NO6A 4FWIB 4QGAA 3KTAB 3X1XA 1T3HA 1UKVY 4UNSA 4DKXA 1XB2A 5L3SB 1F2TB 1XF9A 1JJ7A 1ZU5A 2BM1A 4N1AA 4A1FA 1N6LA 1R6BX 3UMSA 4EDHA 121PA 2IUSA 1F2UA 4IDQA 2DPXA 4GRAA 2KB0A 2OBNA 3PEVA 1JEEA 1FX0B 2AKYA 3SQXA 1E0AA 4IJMA 5F98A 4O2RA 4Z54A 4AY2A 2OESA 1G4UR 2CE2X 2ZI4A 4JKIA 1AZTA 1LF5A 1LFDB 3THYB 4A82A 1G3UA 4BE7B 1E2IA 1U8YA 2OCYC 2WIBA 1EFRA 4JLPA 4C0JA 2GXSA 4MGKR 4KXFB 2HEIA 2FV8A 1XMSA 1QBKC 4DHEA 1ZCAA 2R65A 1IY2A 1W46A 2WSMA 5KSZA 3TW8B 1NF3A 4LBWA 3IUYA 3AP1A 3WNCA 3UANA 3BH6A 2C96A 1W5SA 3NBXX 1FL9A 4RZ3A 1ZNWA 3ZVRA 4E03A 2O8BB 4ZDKA 4LYJA 1FNNA 3LO5A 4DLVA 4RKFA 1KY3A 4JLOA 1XD2B 2IS4A 4B6EA 3GLIE 2CCGA 1KSFX 3KB1A 2RGBA 3AVTA 2ZSDA 2J0SA 1JR3D 4Z8YA 3QKRB 5DIFA 1GNQA 3A58B 3REFA 1BMFA 3LRPA 1EGAA 1JAIA 1AIPA 4L9WA 5FUXA 1RPZA 3BWDD 1COWA 4C3ZA 3GPLA 1H65A 4DDUA 1G19A 1W4BA 3VR2A 2XXAA 3V9PA 3FVQA 2IEYA 2Q0HA 3L0PA 2XZPA 4ZCIA 1JPNA 1YZGA 1WBBA 3VNUA 5J4HA 3HR8A 3PENA 4A2WA 2QENA 4ZCLA 1XEFA 2F9MA 1HQYE 1N6RA 2BEJA 1EESA 5JWOA 1YVDA 2WWXA 5KU1A 1KO7A 4QKQA 3B85A 1SVLA 1HH4A 1DAFA 2QU8A 1XPOA 1XPUA 3OIWA 3RS2A 1DELA 4IOMA 2R6CA 1OYWA 3B7GA 3AP2A 3PQCA 4B2IA 1UAAA 2ERYA 2ZI5A 821PA 3B1VA 4PQRA 2OILA 4OK3A 1KIMA 2NO7A 3GLFA 4ZO4A 3T06B 2C99A 1Z0DA 2RGGA 1SVWA 2QQ0A 1DG1G 3LQQA 4YMUA 1QRAA 4DUGD 1Z0FA 1X8JA 3EPHA 4HB2A 1GKIA 1KI9A 1ZMXA 2ORVA 2VP2A 2O8DA 1OYYA 1FTNA 2BBOA 3KJGA 4GZMA 3C16C 5DH9A 3BD9A 5B30A 2ZPTX 4M1KA 4JVNA 4MKFA 1MO4A 4Q19A 2CE7A 4RD2A 5FBLB 5HZKA 2AFHE 3NIBA 1S4QA 1AQYA 2EU8A 1MO6A 1XFAA 1KDTA 1DAEA 4PPNA 3TNFA 4FMCF 4KHZA 4B3FX 2GWHA 1II8B 2VLIA 3QXSA 1N25A 4B76A 2FSFA 3IHWA 5FL7A 5EE9A 2ZI3A 2ZRLA 4RD6A 3RLFA 2IYVA 4GZLA 3AKCA 2GZHA 2J7PD 2BM0A 2QZ4A 3M0EA 2YHSA 4QJ5A 3VNVA 2UZ3A 3GJ0A 5F9FA 2DCUA 1CRPA 2X2EA 2FGKA 2V1XA 5CM9C 1M34E 4TLCA 5J4VA 5JHGB 2QBYA 3P1JA 1Z0AA 1G5RA 4XWKA 3G82C 3CRMA 1Z6TA 621PA 2W6JD 2WJIA 3QQ5A 6Q21A 1D2NA 1TTTA 2CNWD 1D9ZA 3I8SA 4KLZA 4ACAA 1YJ5A 1XX6A 1ZUNB 3OIYA 1GG2A 4IDHA 3THWA 3LX5A 3HDTA 2GVDC 5K8TA 4GOXA 4A8JC 3GEIA 4A8JB 3CX7A 2J0UA 5KUTA 4ARZB 2CBZA 3UIEA 3QKSB 1ZD1A 2BEKA 3CONA 1OV4A 4F38A 1Z0IA 3ZQ6A 1KJYA 1VKJA 4XVQA 1JR3E 1XBTA 4WZAE 2XNSA 2JIZD 2F1HA 2V4ZA 3GJ5A 2KSQA 3TR0A 2R9VA 4IOKA 1SVMA 4URZR 2V3CC 1A4RA 1UBCA 2BOVA 5DSZA 1OXXK 4CIDA 1W5TA 4D6PA 3BRWD 5FTKA 3FWYA 1K5GA 5CYOA 5HE8A 3GJXC 1P4SA 2QGNA 2V6IA 4JL6A 3QNUA 1KTVA 2B92A 2FMXA 3BC1A 1E2GA 2GJ8A 1IJEA 1EFTA 2P2LA 3SYKA 1JAHA 2XSZD 5GJCA 4BWYA 1OH7A 2ORWA 2AN9A 1FPMA 4EFMA 1AQUA 2H1LA 4Q1AA 4Z51A 1E2HA 3K70C 3K70B 4HYYA 1O87A 1YZNA 3EZ7A 4PC3A 1IONA 3L43A 4Q1DA 3QY0A 4LK2A 4OK6A 1TMKA 2JGNA 3OE7D 2L0XA 1NNEA 1CJTC 3N2IA 1UEJA 4LWZA 3JZMA 1SVOA 4GOJA 5CK5A 2FEMA 3AGQA 3D3QA 3W6PA 5JJLA 4D25A 4OI4A 5DHFA 4LJAA 3KXKA 2GHIA 1S3SA 3CM0A 2HT6A 3HU3A 4TQUS 3IKJA 4C7OA 1FOEB 4URVR 3BXZA 4DWJA 5DI3B 4HAYA 4DCVA 4IVPA 1AS0A 4JLVA 5JS8A 2FOLA 3EZ2A 3LY5A 4PPFA 2HJVA 2O8FB 2QP3A 2FG5A 2C78A 4LJ4A 1II0A 3CF0A 1QG2A 4RD1A 1TUEA 1P5ZB 4JBXA 1Z06A 2BMJA 2GETA 3QOFA 4KVAA 4PAQA 1OFIA 4BFWA 3ZZ0A 3MWKA 5TARA 3B1WA 4QBGB 3LAWA 4XTRA 3U7HB 2FFHA 1NJFA 4EAQA 2IHYA 2IC5A 3NH6A 5FI1B 1E0KA 3IDQA 2B21A 5HPYB 2VQSA 1OH8A 4I1OA 4B32A 4DEXA 1QHNA 2GJSA 1J99A 1DO2A 1XXHA 2ZI6A 4B35A 4C9BA 2WPDA 4NE2A 4NU0A 1P2VA 1GL9B 3O8DA 4V03A 4EPRA 1ZNYA 1KI6A 4FMDB 4IXMA 2P5TB 4TT3A 2D3WA 3IPXA 3RAPR 1YZTA 3WNDA 3B82A 3RNLA 1TF5A 4FIDA 4Q5IA 3S1AB 4U7DA 3WRXC 1U2RA 1NMZA 4TLDA 5LBIA 1G1MA 2ZROA 1P75A 4OI0A 4BEBA 4DLXA 2BKEA 4XD7D 4LHVA 3Q9LA 4E07A 3LV8A 3VU9A 4MYCA 4BLOA 2VP5A 1WQ1R 2GJAA 3NDPA 1NI3A 2A78A 1P9WA 1XTQA 4LSGA 2XTMA 5EE1A 4CEJB 4CW7A 4KYUA 4TTPA 2YOHA 4HB3A 1PV4A 1WB9A 4OHZA 4UXJA 1HUQA 2FN4A 4W7SA 4Q4JA 4C0QC 1XPRA 3QBVA 3A8TA 2VSFA 1SVKA 2OE2A 4MA4A 2IUTA 3AH8A 3CWZA 3Q3JB 3RHFA 5L3QA 5A5GA 4MKGA 3V4FA 3U44B 2V8OA 3MFYA 1XEWX 4NDZA 8OHMA 1QF9A 3SDZA 1ZNXA 1OFHA 5E7JA 4DCTA 4DSTA 3TBKA 1S9DA 1EWRA 2QM7A 3NXSA 3K0FA 4DLRA 2RH5A 5JI2E 3AVXA 3QXXA 3E1SA 4TSFD 1U8ZA 4Q1EA 1E2DA 1S96A 4FXPA 2ZUCA 4MGYR 2P6UA 1KO1A 4PC6A 1ELOA 5C18A 2PCLA 1HT1E 1NP6A 1OE0A 2GILA 3L0OA 1M7BA 4KBGA 3X1WA 3HR7A 1BYIA 4ZIRB 4LHYA 1DOAA 2PZEA 3R8FA 1CEEA 2E9SA 3RRZA 1NL3A 5FL7D 2O0HA 3ASZA 1KMHA 3TAHA 2J0VA 1KI4A 2ZRBA 4W5HA 2WZQA 5SZIA 4WBSA 1F5NA 5HZHA 2KI5A 3PITA 1NMXA 4HUQA 5CIQA 2OV2A 4EFLA 3U60B 4Q1BA 4Q48A 3EX7C 1Z07A 1ZYUA 1F48A 2BC9A 3CRRA 3W8RA 2VHUA 3FHCB 4JVMA 4Q4AB 2IS6A 1T4GA 2R6FA 1XZPA 1N6NA 2EFHB 1DEKA 2HYDA 3TMKA 1AJEA 2JJ8A 4BFYA 4Q7KA 3KX2A 3TSWA 2BBWA 1H8HD 1E9AA 4G1UC 1EFUA 3WHLA 3D31A 3EW9A 4KV9A 4BPBA 4CYMA 3CR7A 2ZRMA 4AKEA 1E79D 4KFTA 4PQYA 2CJWA 3FE2A 5FPKA 1XD8A 3FMIA 3I3SR 5EZ6B 5DYGA 2REBA 4D0LB 1L8QA 2OCAA 3LWNA 1N6IA 3I61A 3T15A 3REGA 4IXNA 5KNCA 5HKKD 1VG0B 3I4LA 4JVSB 3WP1B 3U4QA 1W4CA 1WCV1 1WMSA 2YINC 3HP1A 4U00A 4K8OA 4D0NA 3K0CC 2UZIR 1FTSA 2XAUA 4L15A 3Q85A 1QHHB 1DVRA 1LS1A 3EARA 3QPUA 4MKHA 2XGJA 2W6IA 4YQFA 4QM6A 2IYUA 5DNYB 3AV0B 5C46F 1FMJA 4LRWA 1PVOA 3C41J 5CDFE 4A36A 3W6NA 2VSOA 2GZAA 1CF4A 1RJ9A 2ZRGA 4BZXA 4LUCA 3T61A 3AVVA 1Q12A 3RABA 2FZ4A 2AD5A 2ZJBA 4FN5A 4II7A 4OI1A 1ZC3A 5AK0A 2MMCA 1E98A 1E9FA 3RDPA 3W5IA 5KPJA 1GL7A 1TF7A 3A4MA 4P33A 4NL4H 5CITA 1Q22A 5D3MB 4ESVA 4CDGA 3DPUA 5DLQC 2IYXA 3W6OA 4JBYA 3UK6A 3U61B 4DLWA 3CZQA 4QBHA 4Q9LA 2CLDX 3VX3A 1N3BA 5LD2C 4PANA 5LD2B 1IBRA 2X19A 4TLBA 2PEZA 3Q72A 3R7WB 1NN5A 2XNDD 1R10A 2V54A 2QN6A 4P3YA 1DO0A 2V6JA 3LVQE 4IFBA 3KL4A 5HE9A 5HR5A 2FWRA 2WJGA 3T1TA 2NIPA 1HV8A 1ZD8A 2GBLA 1I4LD 1OJLA 3DO6A 1M7GA 2FJUA 2W00A 1KJZA 1E99A 3F8TA 4RCZA 4F91B 1GKUB 2PX3A 3O8RA 1GP2A 1DTSA 1Q3TA 1W7AA 2ZRPA 1C1YA 1GOTA 5JSZB 2C04A 4FMBB 4KFRA 2JDID 1U9IC 4BLTA 4BFVA 3WRYC 1I4DD 5KDDA 3B6EA 3EPLA 3F3YA 2GEUA 5BYJA 3X1YA 3CIOA 3ZZUA 3L82B 4CEIA 1HTWA 1JR3A 2QMOA 3NKVA 2IF2A 1S9HA 3CZPA 4HLUC 3CUEF 2PH1A 5BWMA 5AUPB 5J47A 1K6MA 2D2FA 3I92A 1AKEA 1A2KC 4URXR 1W36B 1W36C 3AVUA 3KXLA 3G5UA 3VR1A 5SZHB 3AKDA 5L3VA 4XTCS 1JEDA 2YNMA 1VYUA 2F3RA 3L0SA 2VEDA 2H16A 3I32A 1N0VC 2QRNA 1L4YA 2VHCA 3TKLA 1OT3A 1Z63A 1GWNA 4X8MA 4JLBA 2OG2A 3P26A 4Q4HA 4U5XA 3EZ6A 1MRSA 5JEDA 2EYQA 2RGNA 4RFVA 1BO6A 1N5JA 1Z2CA 1UKEA 2RGCA 1W47A 2WWHA 3UG7A 3QXHA 4GBMA 4TL8A 5FOUA 5JEEA 3TW4A 3QF7A 3ZD7A 1G41A 3N2EA 3G0HA 2V9PA 1HE1C 4I4LA 3VMFA 4UQOA 3BH0A 2QAGC 2ZQ5A 2QAGB 1T5IA 5AJXA 3K0EA 2EVWX 2F55A 2J59A 3FYHA 4DUGA 3MLEA 1CR0A 3K09C 5GJVC 1M8PA 4C2TA 1U94A 2XJ4A 1ESMA 4G5QA 3AF1A 1DG3A 1JQLB 2OFOA 3B2EA 4A6XA 2XB2A 1CLUA 4G5RA 3CRVA 1Q1BA 3RYTC 3GLGA 4LV5B 4R2IA 2LWIA 1OHHA 3D8BA 3R9WA 1TUIA 4FCWA 5JFGA 1G3RA 1RRCA 4ZPXA 2DFNA 2GZDA 3QE0A 1G8HA 5E7MA 1GITA 1P61B 2IUUA 4BFUA 4YMVA 2WM9B 2IXEA 2WSSD 1WP9A 4M53A 1OPXA 4F92B 1KI2A 2QMUA 3FMPB 5AJVB 1UM8A 4M21A 4DSUA 3ICEA 1QHYA 4MKIA 4FINA 5H1YA 2GXUA 4Q9HA 3K9HA 1KDPA 2J7PA 3B1YA 4XVRA 2O5VA 2PT5A 1NN0A 4OYHA 1ZM3A 4XH9B 1TNDA 1X8KA 5DHAA 4EKDA 2ZS8A 1QHGA 3VQTA 1TADA 1TU3A 1UKYA 2GJ9A 3DZ8A 2A5DA 4JL8A 2W6JA 3BFVA 3OFNA 2H57A 3A4NA 4Q18A 5JLJA 4AKIA 1HURA 4L16A 5IF9A 3LH5A 2CNWA 3LXRA 2J41A 1CJVC 1N6OA 4FCVA 1KAOA 4RFSB 3AKEA 1TQ6A 3BE4A 4QL3A 2JJ1D 2HLDD 5FUYA 4Q9KA 4S35A 1R5OA 2QM8A 4LGMA 5EUMA 1MV5A 2X8AA 3THOA 3QPWA 3IO3A 1ZD9A 1AKYA 1M1YE 5B2ZA 3TE6A 4HLDA 1Z28A 1EG7A 1XNJA 1XU4A 2NO0A 2BHRA 4MRRA 4MYHA 3I5YA 4BFZA 4M1WA 4BZPA 1NG1A 2MSDB 3DL0A 3EA0A 4P32A 2OEPA 3QVVA 5JI3E 1FQKA 1ODFA 2H7VA 2JLRA 4IEIA 4V0MA 1YQTA 2QMHA 4QJ3A 4PO1A 1SGWA 2CL6X 2QPOA 5CIWA 1RC8A 2GXAA 2G83A 4UXIA 3HWSA 1KAGA 2GK7A 2JLUA 2IYZA 4PZLA 2AR7A 1S2MA 4KO8A 4LYHA 1F6BA 4NYMR 4N0EA 3NVAA 2NPFA 4HZUB 4N3NA 3V4RA 4DLZA 1SQ5A 5G3ZA 1GNPA 3EZFA 2XSZA 3HU2A 3MSXA 3E70C 1GNRA 2FF7A 2QPTA 2FSIA 3OEHA 1FZQA 2ZU6A 2MSEB 4JYBA 1R5BA 2CK3A 1NVVQ 5C1BA 1G3QA 2QP9X 3FPAA 4DC9A 3TVTA 5IHPA 4JJKA 1JBKA 3B78A 1DAIA 2ONKA 4UKDA 2F43B 1EFCA 3OE7A 1WRBA 2GJKA 4UNNA 5G53C 3KTAA 3QBTA 3ASYA 4IDOA 3NC1C 2CLSA 5L3SA 3C15C 1F2TA 1T91A 4NCKA 1GM5A 2LCFA 1E2FA 2P65A 2FDCA 3P4YA 3IIJA 2H92A 3PFIA 4JZKA 2FZLA 2BVNA 4GPTA 1G3MA 4OQMA 1FX0A 4IFEA 3SNHA 5GJBA 3B1XA 2TMKA 4DLSA 3THYA 1G291 1N5KA 3ZVMA 1J90A 1NIPA 2HUPA 3CH5A 1Z6XA 5HCIA 4B2PA 1D5CA 2J3EA 5EXSA 4QGHA 4A2PA 2RCNA 1AM4D 1P60A 3IIMA 3Q5EA 4NYIQ 1IN5A 4XJXA 3R9XA 2WJVA 2OAP1 4HAWA 5IDVA 2OXCA 3QG1A 2Q9CA 4Q47A 4W5WA 2IA5A 4JLNA 2ZJ2A 4WA7A 1TQ4A 1ZM4A 3UPUA 721PA 1QG4A 4P4SB 3U7EB 2C77A 2FPMA 1PLKA 1E0JA 2YYZA 2V1UA 2W83A 1UBEA 4M9ZA 2YV5A 3ECCA 3R20A 2AK3A 2ANCA 3MWJA 2O8BA 4C0BA 1A2BA 2IYSA 2ZI9A 3RWOA 4EPVA 2AX4A 5CDFA 3GD7A 1XD2A 2ZJ5A 4KLNA 1NBMD 2QA5A 2XTNA 5FBVB 4HI0E 4ON9A 4D4KA 2D4HA 4HDOB 1W0KD 4LYFA 3ETLA 4XD7A 4D80A 3GCGA 3QKRA 2ZU0C 1Z6YA 5CK4A 1G21E 3ZGXA 1XTRA 4OQNA 3PCRB 4UJ3A 1RW4A 2WBLC 1CULC 3RVBA 3FKQA 2YKGA 1W36D 4WXPA 4ILEA 4QJ4A 2A30A 4JT2A 2D06A 1QHXA 4URUR 1FMLA 2R62A 2VHJA 3PUZA 4Z1MD 3W5JA 1B23P 4BASA 2AKAB 2QI9C 1VCIA 4I1UA 4MUAA 3GJ7A 4B34A 1WBDA 3DDCA 2EYUA 1FQJA 2F9LA 4DVGA 2F1IA 1MH1A 5B58C 1W4RA 2VHTA 2RKOA 2C2HA 3PV0A 1VDZA 2IYQA 4BRUA 2RB4A 3MUFA 5KNBA 4JSYA 3H86A 4LDJA 5FL3A 3RS4A 4BLQA 1OHHD 4TSFA 1CJUC 5KSPA 221PA 2P3SA 2I4IA 2BMDA 3AQ4A 3U6KA 4TYQA 1N6KA 4PZZA 2IXGA 4PC2A 4P4TA 2WAXA 2DY1A 2ODWA 4ZI3A 3WBJA 5EP3A 1IY0A 1GKYA 3EC1A 2ANBA 2DWPA 4JLKA 1E2JA 2B8WA 3QJYA 1R0XA 4UNQA 3N70A 1IJFA 3CX6A 3ADKA 3CNOA 2ONJA 4IDPA 2X1VA 3BORA 4B6FA 1XJQA 3MWLA 4HZIA 3IBGA 1AGRA 1VYTA 1MRNA 2ZTSA 3PEWA 4Q1CA 5FBRB 4IW3B 5TMPA 1N0WA 3OFND 4M4SA 4GT1A 1Z47A 2FSHA 2BJVA 5EUQB 2NQ2C 3AVPA 5GADl 1W0JD 1T3LA 1II8A 1G9XA 2FPLA 4JS0A 5GJWC 1T9HA 1VCNA 4M1MA 3LDAA 1Z8FA 2I3BA 1KGDA 1H8HA 3TQCA 3A6PC 1T0HB 4EPXA 3CWQA 1Z0JA 2YC2C 4BLRA 1E79A 4RZ2A 4EUNA 2Z5FA 5GVRA 1S3GA 2Z43A 1AGPA 5CLQA 4YMSA 3RWMB 3I1FA 4OQFA 4R98A 2LKCA 1MO3A 2OCPA 2PBRA 5FR2A 2XOKA 5HKKA 1P3JA 1SXJC 1SXJB 4WOPA 3CKLA 2ODEA 2GESA 3DM5A 3IIKA 4HATA 4AG5A 1KO8A 2YWEA 1VG9B 4PSKA 5CJ2A 4QNRA 4XSHA 2HF8A 4PSAA 4A8JA 3T35A 2R6GA 4ARZA 5D3QA 1Q1ZA 5BYKA 1IY1A 1G8PA 1ONBA 3QKSA 5L3RA 1NBME 2W2VA 4TMXA 3BK7A 2QEQA 3GJ4A 2EFCB 3OEHD 1KO4A 4RZXA 4LJ9A 4ITRC 5DE3A 2IYYA 2CK3D 3ZQJA 5P21A 2BCJQ 4B71A 2PLRA 2C9OA 3SS8A 4DDTA 3VKHA 5JWHA 1D6JA 1QVAA 4NP6A 5DYIA 3EPJA 1AS2A 1MO5A 4QBFA 1RRFA 2HXYA 4RVCA 5CLLA 2OFWA 2ZR9A 1US8B 2OLKA 1OLOA 4F4CA 1PLLA 1EFHA 1JB1A 1GSIA 2EWWA 1X86B 5KO2A 1NJGA 3FHTA 4AG6A 1A82A 4JLDA 1GTVA 3KQLA 3SHFA 4NYMQ 3QF4B 3GLHB 2QTHA 2XNDA 2HF9A 4EFNA 3WMFA 4Z8XA 2X2FA 5FPYA 1E2LA 3L2OB 1X8LA 3GLGE 1E1RA 4NHOA 3K1JA 4DCSA 4QHYA 1YZKA 3CX8A 3SJBA 4C2UA 2IYRA 1MOZA 4Q7JB 4TZ0A 3SR0A 4DRZA 4WZBE 2GCPA 1OH6A 1KMQA 1ZVQA 2G1KA 1T5LA 3QI2A 4QFMA 3PXGA 2J7KA 4HEJA 3IQXA 3J81k 2JLWA 4V02A 3Q5DA 4C0LA 1OIWA 2JDIA 2SHKA 4LHWA 1SHZA 4LX0A 1HQCA 1N5IA 1DBSA 2ZE6A 2NOAA 5DI3A 2G6BA 1Z22A 2B7CA 4FD2A 3AF4A 2GF9A 4TTRA 1X3SA 5LB4A 4DBLC 2O8FA 2WV9A 5C4GB 5FOXA 1UFQA 2IK8A 1U81A 4US0R 3MWYW 3KJEA 1P9RA 1W48A 1GRNA 1Z83A 2AL7A 4QGGA 1T0JB 1T8UA 3SEAA 4AURA 3TUJC 4IKEA 1L7VC 4A0GA 1Z3IX 1ZNZA 4HLQB 1R4AA 4NCIA 3W90A 2O8CB 3TQFA 5BXQC 4D0GA 3GFPA 2VSXA 5FFMA 3X1DA 5DGXA 4B3XA 1KSHA 1CJKC 1E4VA 2BMEA 4TYWA 5JRZA 5FTJA 1E1QD 2FEOA 3T5DA 4MRNA 3NH9A 2IEZA 1II9A 3ADDA 4V0ME 1DAHA 2AWNA 2Q3HA 1Q44A 2ZJOA 3NEYA 5AWFC 5L3QB 2WWYA 3S1AA 4D4LA 1VPLA 2ATVA 1NIJA 4CEHB 4PZYA 4MDEA 1KDRA 3LW7A 1DS6A 2ZXUA 2D2EA 5IRCD 4LV8B 5KTYA 5EQTA 3CPJB 3DEFA 4LOAA 4PR0A 3HYTA 3H2YA 1G7CA 3BGWA 3BOSA 4FMDF 3SU8A 1GILA 3GJ8A 4C0HA 2ASEA 3O47A 4MGIR 4YDSA 3TR5A 4D2IA 1NLFA 4CEJA 2FX3A 3BIFA 5AR1A 4YONB 2C5LA 2YC4C 2BBTA 4BLPA 1N6PA 4LV6A 1YRAA 4PQFA 1HA3A 1IAQA 4MRVA 3PEYA 3QIAA 2WKQA 2VIIA 3RANA 2AFIE 4EPYA 2WSSA 4AC9A 3F5FA 2W0MA 2WIAA 4L8GA 5B57C 3GLIB 3U44A 1VIAA 1NLZA 5SZKB 1NKSA 1IOZA 1J8MF 4TL6A 4F93B 2PJZA 2QL6A 3UKDA 3CH4B 3W8NA 2GVZC 1KNXA 1UBGA 1IXRC 4LBVA 1NMYA 4JYCA 2XJ9A 2PCJA 4DDVA 3BB1A 4QRHA 4P31A 3RRNA 2D7CA 2R8RA
chains in the Genus database with same CATH superfamily
3QVGA 4ZI7F 4M49A 3GGCA 5HM6A 4AO8A 1FFHA 2LIVA 2G07A 2PL1A 1GUDA 3CISA 5LU9A 3K0AB 1OFUX 2NSHA 3ROMA 2Q3JA 4RUKA 1FFGA 1GRRA 2NPOA 4GLOA 4CN9A 3D54D 5ILGA 2A4MA 5KTSA 3U7RA 1Y8RA 3DTNA 5IDWA 1Z7YA 4KBFA 4EI7A 3PX2A 5C8ZA 3LUDA 4Y2TA 1U4SA 1G6OA 3R5XA 1KOGA 2WB2A 3EMVA 1G21A 2EIXA 1Q2XA 2FN7A 2QM3A 2VPQA 3EASA 4KLAA 3X2EA 3LKZA 2O7RA 3LLMA 3H4TA 5CDHA 4BNVA 3CBQA 3I2GA 4XPIA 3H0CA 3NHFA 5SYAA 1U1GA 4DCNA 5JD6A 1NXTA 1O9HA 1K9VF 5G40A 2DBYA 1TU0A 1WO8A 3T38A 2G9UA 2OZLB 3LVBA 3NEPX 3I05A 4UJ5A 5BW4A 4EI8A 5FTNA 1CJCA 2IGBA 4RTQA 1AQ6A 1N2JA 4MUIA 3RTAA 3NHYA 3QEBZ 2KM1A 1MTZA 2OFPA 1P72A 1OYVA 1U31A 2GM5A 2LRHA 2O4CA 4O2LA 2PVCA 3ZWBA 1KVUA 3CKMA 2AUTA 4UEKA 1OBCA 2GMWA 2XTAA 3HJAA 3HB5X 5TVGA 1NMEA 3UB2A 5JDIC 4URFA 3P9SA 2C98A 4RK0A 3TK1A 5J4LA 5CCBA 4MB0A 3NTRA 2EQBA 2IS2A 5DN6D 2JLXA 3KKNA 2YRXA 3IRUA 1EI9A 1RVDA 4YJGA 4ENWA 1BAPA 3H5RA 5LB2A 3T1OA 3T7DA 4B45A 4D81A 3ZX4A 3HU1A 1TTPB 4FYKA 4OP3A 4R9RA 3P27A 3ACBA 5AO9A 4ZKDA 3VX4A 5JXJA 1Q92A 2R2GA 4HB0A 4FVTA 4CM9A 5D7NA 3HRIA 2RI0A 3LZDA 4PY2A 3L02A 4QDJA 4EW6A 4EVQA 4CXMA 1D8TA 3QVTA 3B8HA 3IRVA 1QHHA 4C29A 2GCOB 5LQNA 5HP4A 4XAQA 1K88A 2R8ZA 3SN6A 4YA6A 5MN4A 1XR3A 3J7AC 4L02A 4F6RA 2YXNA 1NTRA 1Q20A 1XKLA 3P9IA 4JA2A 3VYRB 4BP8A 1CR1A 2PMDA 3FDFA 1HE4A 3EAQA 4FYIA 4I4TF 4Y2JA 5ALLA 4LXXA 4BL5A 4C0KA 3A06A 3C0KA 5BSFA 3WLJA 5TGZA 4QTYA 3ZGNA 2J32A 2GN6A 4GZ3A 4OHKA 3CRW1 5KHOC 1T6ZA 1PQYA 1Q50A 2TSYB 3HPQA 5EIOA 5FOSA 4FEYA 4YQZA 3W5HA 1NUTA 4ECEA 2DGDA 5LIRA 1LLFA 3PXUA 1DIHA 4MVJP 1EQ2A 1UZAA 3PHJA 4DEXA 4ZDIA 1SEVA 1X1RA 2G0NA 2IIVA 3ONDA 1SC6A 1W2GA 4LXYA 1V9LA 4M54A 5D3MA 1GYPA 3U3RA 2PMFA 3HWWA 3ON5A 3KU1A 4LJ7A 5BV0A 1K06A 3CF2A 3PUVA 4QXRA 4A0SA 4YCSA 1JFSA 1VL5A 1I36A 3F47A 4I6JA 1P7ZA 3B2NA 4BMZA 1RAGA 1IUOA 3AR6A 1ZITA 2Q4EA 1M8KA 3L7CA 5FHQA 4ML3A 2GEVA 2JIDA 3AERB 4YPOA 1MUUA 5IU6A 2I03A 3AG5A 3MTEA 4R7TA 3GLGA 4ZKEA 1WF3A 4MJLA 4R9SA 3RPEA 4PAMA 5D1NA 3U3KA 2VHXA 1WEKA 3EQ7A 3DKRA 1T2DA 2DJIA 3QLVA 1X0VA 3OOWA 4G1EB 3UUGA 4BGVA 3GK3A 4S3MA 2HEGA 2QP4A 1V1JA 3DGEC 2C42A 1RPNA 4Q1VA 5AJWA 1DRKA 4EMSA 3EW7A 5EHNA 1NFQA 2FH5B 3M6WA 1KZ7B 3PG5A 4P1ZA 1GLGA 3PNYA 4LZZA 2OUKA 1Z17A 1W19A 1VCMA 4JUCA 1V2HE 1K9SA 4KQ9A 4H15A 5JY1A 5CX1A 3OJFA 4XSGA 3OAAD 4XOIA 1E94E 2XYHA 3QX8A 4GGPA 1I6WA 1U0OC 2P9CA 3WRYA 3C6KA 3GOQA 1BVHA 1NBMA 4BO6A 1UT6A 4XQ0A 3BM5A 3SE0A 5HJ2A 1YI0A 3FPSA 1W0KA 4CQLB 1RCUA 1TUBB 1XPJA 1Y48E 2ILTA 2VSQA 3K5WA 2ZUWA 2Q3MA 4HLUA 2JFYA 3UV6A 3ZXIA 2Q2NA 4IIJA 3ZGYA 3ZWAA 4JLWA 5TQ0A 1K6IA 2W2TA 3RF6A 2IUYA 2OBLA 2ZRFA 4EB3A 5D2CA 5C8XA 4UBJA 1HL3A 1NF8A 1EIZA 1UOEA 1E7YA 1I80A 3ORSA 3LPNA 2FETA 4BQSA 1O95C 4UVIA 3V3KA 5HTOA 4ETMA 3UJ6A 4PLHA 3PNPA 1G8FA 2ZYRA 3AHFA 4WL0A 3ZXUB 1XZCA 4CF5A 2WD7A 4RZUA 2P1ZA 5K0FA 3O8BA 3E03A 1HFKA 3WIVA 1KBZA 2QORA 3AP3A 3MMXA 3WQQA 2M6RA 3KYDA 4P54A 4A8TA 1VHWA 7MHTA 1F20A 4H1UA 3SM9A 3LPCA 1G5TA 1HLPA 1PRYA 3IEXA 3O94A 4UVHA 3ZCVA 3CSUA 2DCMA 4B84A 3ABOB 1FU4A 1KOFA 2I8AA 2AQIA 1RPTA 2EWVA 3G68A 3HNOA 5CG1A 3HKBA 3PXBA 1ZRHA 2IHVA 1SXJE 2OBMA 4KO2S 1AXRA 2J45A 1A96A 3SQMA 3A4VA 1SRQA 2BJWA 3W34A 4V0NA 1CEXA 1W2HA 2FA9A 4W5RA 4HLCA 4QVGA 5DO9A 5EP1A 3KZKA 3QEAZ 2P0EA 4TV8A 3WWOA 3KJFA 1PGPA 3BFPA 1K7EB 4BVJA 2OO7A 2JJ2A 3CW9A 3CKKA 2GOYA 2XMDA 4GXRA 4JELA 5IC4A 3O1JC 1X19A 1KK2A 4DLUA 1AOXA 2CLOB 2I1VB 2O7VA 3AF5A 4FDUA 4BFXA 4PN7A 5A6VA 4KODA 1QNLA 5U4QA 2UUCB 1Z0UA 3RS3A 4CKWA 3ECSA 1V4NA 2JEOA 2PRJA 2XUAA 4JVOA 2VNKA 1TL7C 2ZIUB 3WP0A 1NZFA 2A1UA 4HQKA 4NG4A 1Y42X 2PUBA 1R8QA 5JG7A 2LIPA 4QLOA 4ZI2A 5KJ6A 3NDRA 1T2EA 5ICSA 2GN9A 3TDNA 5ALUA 5LYJB 3MTBA 4NTZA 1GO2A 1CUSA 2ECPA 1JVNA 3JWGA 1XQXA 4CCSA 3WTBA 3PYMA 1H66A 3LC2O 3NG1A 2OBYA 3I42A 3TQTA 1ISMA 2FFRA 2FDRA 1JEYA 5FORA 3RNOA 1G20A 1Y6GA 1RADA 1MAAA 3O9ZA 4HDQB 1YI1A 5DYYA 4DGQA 2IW3A 3LECA 3LJKA 3IT0A 4DGSA 1CZRA 2NTJA 4GPZA 4EUFA 3GWZA 2VHQA 3ISJA 1E3QA 2A9FA 2NUAA 1WXIA 1T9GR 2C3YA 4L9AA 4KQMA 1GTZA 2ZM6B 3FBGA 2OO5A 2REOA 5DHRA 4D9FA 3D7KA 4O0LA 1QQTA 3OLQA 3K9NA 1IBCA 4K9LA 5AW4A 1C3EA 2I9PA 3E22B 5JD4A 2ZUDA 1B6SA 1SCJA 3H65A 3MPOA 3V2UA 5MGNA 2L18A 1RABA 3C3EA 1B43A 3LBYA 2OQ2A 4RTOA 4FX5A 4EQ6B 2CHQA 3UAXA 1W49A 2P0AA 2QW0X 3EXHB 5A05A 2V03A 4QOEA 2FPRA 4LC1A 3OJ0A 4DEYA 5DOVA 2W42A 1UBHS 1O94D 2FSGA 3GEEA 2YBDA 1IZYA 3E8XA 3HI6A 1Z08A 3GPBA 3WBKA 5T7BA 4OHYA 1JIIA 1ISPA 1JZSA 2NG1A 2CEKA 4DDMA 1KEZA 2J3QA 4AVYA 5LL6P 3VJRA 5B1YA 1LGYA 2O1WA 5AOAA 3MJ4A 3JASA 4I2VA 5G1PA 4KRGA 1CUEA 3HCNA 3AFOA 3V2GA 2HKIA 3T4PA 2W2LD 4LZAA 5CXUA 4DCPA 2WKRA 3BL5A 3SIRA 4XGNA 1CQZA 4TMTA 5JS6A 1J7KA 1TT5B 1R74A 1C4WA 2GDJA 3G2JA 1FFWA 4MCIA 3ZDQA 4BS9A 1E96A 2IKSA 1V26A 1REQB 2NUTA 1IG0A 1BWPA 1EHCA 2FE4A 1J09A 2K87A 3AF2A 3CLUC 3QWHA 4JR0A 2Y1FA 4C3VA 1G6Q1 1U04A 3K0SA 1RYYA 5EIWA 5FBKA 3L7OA 2OFFA 4C7KA 2UXBB 3CEAA 1YVUA 4RK4A 3ZI0A 2PL3A 4BB5A 2HA3A 3MGKA 4W5QA 2JLYA 4ZGGA 4HKTA 2KLHA 3OBIA 4NFYA 1OOEA 2WMYA 2FFBA 3CTPA 1JU9A 5C51B 2CBGA 1B1AA 1Z6ZA 3GZNA 3ZEIA 3PRKE 4GX1A 2R6R1 1P1RA 1WKVA 2J1LA 3WIOA 4PNEA 4JJZA 1U3FA 4OHRA 4KR9A 1U7XA 2QD5A 4DAEA 1UBSB 5TMDA 1S2GA 2IYPA 3SBDA 3AJRA 1LFAA 4PQEA 5EVJA 5FX2A 1XCOA 1ETUA 4RHFA 1X14A 1VA4A 1KYVA 3C3KA 2Z6VA 1CZNA 3DFUA 1U6JA 3H8SA 4QUJA 2C4VA 1IEVA 2F43A 1C1DB 4X93A 1VE3A 4GKJB 2RGAA 4BMYA 2J3KA 1NW6A 4TVKA 1PJ4A 3AY7A 2PBZA 2ZSBA 2VJYA 3TVTA 3TXYA 1Y3FE 2SECE 4FGSA 3E2IA 1L4NA 1M0TA 3M49A 1WXQA 3FHLA 2LPMA 2G67A 3LDGA 2I1QA 3UT0A 1S1CA 3Q2IA 2AJDA 2B20A 4BBZA 1UJ5A 5BRAA 1VL8A 2AOTB 4LY6A 1GNLA 1JNYA 3LWBA 3TAXA 2HHCA 1IATA 2ATCA 2R4UA 2RGXA 1U8AA 4DV0B 1A97A 2OB2A 5GZ3A 2YWHA 4ZDWA 4OX9B 3IXLA 3KJZA 4ISBA 3EGEA 4EMTA 1P2UA 3B9PA 3LXMA 4QEKA 4KTTE 2CL0X 4QT0A 4QPZA 3T5CA 1GFIA 3W8FA 2B69A 2R5FA 3EWSA 1HL7A 2HHLA 1YDHA 4JLAA 4LFBB 4G01B 2VF7A 5ICCA 2IFTA 1T6NA 3MUEA 4RTPA 5BMVB 5E0OA 5AYVA 2OD7A 2C8VA 3BXEA 5IN5A 4L4UA 3WC4A 4DG8A 2PMKA 2PVPA 1P8AA 4AI6A 2AJ8A 3AM4A 1TPZA 2FW7A 1R0LA 4ER0A 4F6LA 4M1TA 4TWAA 4RTLA 3RFXA 4GNRA 1OXVA 1CY0A 3L04A 4DRXB 2BFBA 1X7ZB 2QG6A 4A23A 5DSXA 4WESB 3EGXB 2PMEA 1V16B 5BY2A 1E7RA 1JPUA 2DUWA 4PR3A 3TSCA 4N5DA 3RRYA 4A0RA 2O2JA 3OU2A 3BGVA 4V0RA 1ID8A 1JHAA 4WOBA 1DI0A 5JCZA 1IY8A 1I4TD 5C5DA 3P7MA 2WU4A 1S2OA 1VLVA 2R6ZA 2JRLA 2Q4DA 3BTUA 4GG1A 3WLSA 2I65A 4YLYA 3FJ1A 1Q1GA 4Z99A 4QC2A 2IYNA 4L1KA 1BOOA 1R8JA 1J0XO 3M34A 2JCSA 5TEVA 4E3ZA 1DJLA 4MHOA 3BIXA 1ZUD1 4M6WB 1M1UA 2SKCA 2N1MA 3PVZA 5CYFA 3BBPA 5HG0A 4OQQA 4PBSA 1YR7A 2O57A 3ITEA 3NWOA 4GYWA 3TRJA 4CFYA 2ID8A 2NYAA 4Q02A 3CZCA 3C43A 3HR4A 3KB2A 4QG7A 5T5QA 3WMEA 4MUXA 4I1YA 3NBUA 4FYJA 2WYHA 3P20A 2B4YA 5F2KA 1EVLA 2DFVA 3OMXA 4CIWA 2FJPA 3D5EA 5IPFA 3K9FC 1TQ8A 1XTTA 1RFLA 3NLLA 4G5SA 3HDQA 5C1PA 4I9FA 4KKXB 2JJ2D 4G2NA 4F2HA 4D8WA 4RTRA 4D26A 4KGDA 3KQOA 4HN4B 1DC5A 2V8BA 2HO5A 4H7DA 4WE3A 1HYEA 4J7XA 2NNLD 4NBSA 3REQA 3RKUA 4MI1A 1H23A 4OHVA 1XP8A 1KK3A 4AWXA 3Q7IA 4CN8A 2BTEA 2QBYB 1U3VA 3A6GA 3VR3A 1YU6A 2BHSA 2JEZA 1DG9A 1P7CA 2W4QA 4DBVO 2WG1A 3U40A 3L8FA 5B1IA 2VC2B 3DWIA 4J16A 3NHJA 4NPHA 1W87A 3IKMB 1PNRA 2EEZA 1Y33E 3AF3A 4L2IB 3R41A 2QYOA 1TECE 2JFFA 5DNAA 1DT5A 3SJCA 4BNIA 1F9EA 1Y6RA 4ZO7A 3ZX5A 1ANKA 2ISCA 3UWKA 3J80A 2XH8A 3LUAA 2HH9A 2VT3A 1A7UA 4IHQA 4OAPA 1BGVA 4HAUA 1JPJA 4FEGA 4K81B 2FR0A 5BSKA 3H5IA 4I99A 2JGKA 3A4IA 3PQEA 4FLFA 2IT1A 4UDXX 1YS2X 4R1UA 5HF5A 3A14A 1D3AA 1MW9X 1V8FA 2A35A 2W0SA 1KU0A 5IBRA 5LP6C 1HM5A 3WNBA 4IJ5A 4WJLA 2JAQA 2PR2A 4OVKA 1M8GA 1EE9A 1SHUX 2HZ7A 3FHJA 3PNKA 2P6OA 5CURA 4G81A 4YO8A 5BR1A 2FQQA 1A2OA 3B5JA 3DFKA 1YJBA 3UN1A 2FFAA 3D1VA 1XJ0A 2HPVA 3WQRA 4EGQA 4ZYXA 3GVCA 2E1RA 4B6SA 3ZH9B 2D74A 2HPAA 3RU9A 1E4YA 1XCMA 3LUCA 4RL6A 1IC6A 1TO1E 2X9LA 4AYXA 4TLAA 4Z3KA 1A27A 1POXA 1A5SB 1RHMA 1Y7TA 5BNIA 3MJRA 5KNCH 4CIVA 3DW1X 1IBKB 2ZS9A 1IL0A 2R00A 2B37A 2CMGA 2RHLA 1PFKA 4ASUD 5C5EA 3B1ZA 2ZGVA 4RKEA 4AJOA 1BIFA 3ICCA 4JSTA 2R7MA 4BC1A 3R7LA 3I5XA 1OB2A 3ESRA 1QORA 2D62A 4MR7A 2O2ZA 5EINA 5BNFA 4OPMA 3P4XA 3G5AA 4FFSA 2EHJA 3T54A 4JL5A 3WE7A 4PRZA 6PFKA 1UUFA 1C9NA 2VDRB 2ZXEA 4QXQA 2Z4SA 5A7GA 2COEA 2GTIA 4PSCA 4TWZA 5CDYA 3ESBA 1R12A 2D54A 1PL0A 1DIRA 1BX3A 4YJHA 4A9AA 1GPJA 3O5AA 5B1HA 2NZ8A 3U26A 4TYNA 4N49A 1DIGA 2Q6TA 1FFXB 2R7NA 3U37A 5A4IS 5AKXA 4B75A 3HK2A 3PQ3A 2FW8A 2WWWA 4HAXA 2Z2KA 2FLWA 5ES3A 3V7UA 5H4GA 3JALB 4AMYA 2DPYA 5E3HA 4RANA 4UUAA 4DHWA 2QVZX 4NZYA 4RLHA 3M1IA 3I1YA 3QGMA 3OP4A 2K5UA 3RC1A 1SKYE 1VIDA 2IWRA 3KV1A 2Y76A 2OHJA 3WWDA 3K6SA 2CL5A 5LNK1 1C7JA 4U1RA 1XRMA 4HADA 3MGAA 2DH5A 4QFCA 5BSUA 2BBSA 1AX9A 2VNAA 4R1TA 5E9JA 4M9UA 1PEDA 5KTTA 3N2GA 5JSQA 1Z6QA 2EAUA 2XOEA 2G36A 1YU9A 1L4UA 2IU6A 3AX6A 3FLEA 3NOXA 1MGOA 4S0XA 1V1MB 3ZVLA 1H4SA 2WFZA 1YZHA 4OL0A 4NOKA 4RH3A 3L6BA 3IULA 4OGKA 2VCYA 3FB4A 5EERA 1P18A 2HDOA 3EG5A 3CKYA 3COYA 4RE6A 1NV9A 1N2CE 2BV3A 3OBBA 4RHYA 4EA8A 3HM2A 3ZV3A 4K5QA 4TKMA 4ALLA 4IJWA 5B7PA 1NN3A 3F4BA 5IS2A 4OLAA 3GFTA 4Q7LA 1ZVMA 1OR8A 3I01A 1YQEA 2GEDA 3FTQA 4ZU1X 1Q1NA 2E6UX 3BFKA 3D4BA 5C35A 3LI2A 5KOYA 3DAYA 3L6EA 1TDJA 5FPQA 5CD1A 3N2LA 4QHTA 2GAAA 3FSGD 1YBAA 4LHZA 1PGNA 3A6EA 1DEAA 3LGAA 2J30A 4PX3A 2Y0DA 4WLOA 5KU7A 3STXA 1NJ1A 2QY6A 3EGVA 3KCQA 4GSYA 5FNVB 5AVRA 4U39A 5ITSA 5KYXB 2ZRHA 2OL4A 1SUPA 4WXYB 3TPFA 4H9GA 3INYA 3TWOA 5JRJA 4HPJB 3UBTA 1DAMA 1TMGE 2NTYC 2G6TA 3ASUA 3LPMA 3VU9B 4UTPA 1A5BB 1B73A 3K5IA 4K9KA 2HD4A 2V3VA 5F2OA 5I7FA 1DAGA 2FUKA 4YAJA 1ZVKA 4YGXB 3D7MA 3VR2D 4E4YA 3KXDA 1DHTA 3PHIA 3UKOA 1DC6A 2LE0A 1RCFA 5C81A 4CTJA 2PFKA 4Q4JB 1XQ6A 2VKQA 3IQGX 3ZJTA 1IN6A 1E3WB 1M5UA 3KTOA 3F6CA 4EG7A 2OM6A 4BXOA 1A4UA 4R9NA 1CF2O 2H6EA 3RFCA 7ADHA 4CNBA 3E7PA 4AZSA 2O8CA 2GARA 3VSEA 2QRKA 1M6HA 1T9AA 3AHIA 3VH4A 3C8UA 1R6AA 3FUXA 2WG0A 4FQ7A 4G3XA 4YJ3F 3G0CA 4MUBA 4F0JA 5IKMA 4RBNA 5J4YA 4PRKA 5I9IA 4MYUA 3L7NA 3V4VB 1RXCA 5IEJA 4WT7A 4GI3A 5ALDA 1RS0A 4OHXA 1H2XA 2WKPA 2D5IA 1WZCA 3IDZA 2PXHA 5C3UA 5K6AC 1ZGAA 3ZZTA 2PU5A 3K8YA 3A1UA 1TCBA 3RKRA 3PYLA 4M3NA 1KAEA 2Z9BA 1VG1A 1DUVG 3IAXA 3HFGA 5A7FA 4GI2A 3UAWA 1G18A 5T8KC 3RSCA 2NUPB 2EZTA 1SBIA 1NF2A 2GN8A 3D64A 1KMHB 4W1SA 2OQRA 1W8IA 4GVXA 1DXYA 3LBIA 4TV9A 3W5BA 3S5JA 1G8JA 3B89A 5CFMA 3PDIB 2B99A 4RHCA 3FYCA 4D4HA 4RC9A 4OQPA 4QM7A 4PFJA 2R4TA 1QVWA 1WTCA 2FN8A 2LD4A 3MJHA 3AU8A 3OICA 3NIDB 3ZDZB 3B6IA 1ZHOA 4HX9A 3KV3O 4HGRA 3MHPA 3X1KA 4AMUA 1TZBA 4J9VA 3BAFA 3F4LA 3RVJA 4UD2A 4NZ9A 2PTGA 3GEBA 4FSDA 1M2GA 1HE5A 2RB5A 4C0AC 2P0YA 3BF7A 4D57A 3THXA 3IESA 3RIYA 3FSEA 1K86A 3ZCQA 2XMQA 3N0VA 3A27A 3QXCA 4ES6A 2HWWA 4RF3A 5HFJA 3TVDA 1A88A 2D7JA 4QYXA 5FI3A 2KBFA 4HNGA 5G0WA 1UPTA 4YXFA 2PUAA 1DL5A 1UANA 2HW8A 2CUTA 3X2SA 4BMCA 3GMIA 3C3MA 4J07A 2JIPA 4WLUA 3WADA 3ZYZA 3C14C 3OIFA 1YA6A 2CJWB 1KYTA 3R4CA 4PONA 2XV1A 3STTA 3FDIA 4ZU6X 1T1IA 4MWBA 1M83A 1HT0A 3LVRE 1QRTA 2FEXA 2I2AA 4L5CA 1Z0KA 2A3RA 4XQCA 1G64A 1V5GA 5I3CA 1RBYA 5CLJA 1WDTA 4JYBA 4PLGA 4OQLA 5JH7A 2VS1A 4HFMA 4PW0A 4HYEA 1CUUA 4M88A 1QYWA 5CVJA 2EFDB 3T5AA 4WK4B 1NVTA 4LKRA 4K3UA 1OZFA 3HCEA 1TEXA 3DEIA 3WYDA 3DE5X 1J1ZA 1LKZA 1G5HA 1UDWA 4Q3EA 1C9DB 1NUSA 3FUTA 2EZUA 3HSSA 2L82A 4PIMA 4BYMA 2O0KA 5EXXA 3WYEA 3DVLA 2VK1A 3HACA 3OZXA 4FR5A 4RXMA 4BECA 4GC5A 1N77A 5AW0A 4TQGA 1K7XB 2QRVB 1FK8A 2PHZA 1WVIA 4IM7A 1RE0A 3GF4A 3K4QA 4GD3Q 4OBEA 4M0EA 4I5EA 4MDYA 4UMFA 3OCWA 3M33A 2ZITA 4BMSA 1FJGB 1KDOA 1RYZA 3LLUA 5FEUA 1ZJ4A 4B2YA 2OXTA 2Y6UA 1ZIPA 1QDEA 4DWOA 2GRUA 4B8ZA 3ENNA 2VTBA 1CJMA 2VDLB 3T3OA 1WPXA 2OPBA 2WPNA 1G4AE 1LS6A 1S2IA 3IOBA 1PX2A 4BLSA 4BNDB 2OHXA 1Q0QA 5IABA 1VB3A 3N2ZB 3TRFA 1CHNA 4HUJA 3ZWXA 1C8BA 1OI7A 3FTNA 3OF5A 3PC2A 4X54A 3SYLA 3AGPA 4NJMB 5ALGA 2GXQA 3ZWYA 2Q4OA 1CDZA 3FPGA 4HDCA 2CCKA 3DKVA 4FS8A 2J5BA 3WXMA 5JZMA 4LC0A 5IH7A 1CDOA 3GFRA 3WWPA 4BCCA 1U98A 3DEAA 1F8FA 3OIVA 2MIIA 4GSKA 3VDXA 4X41A 1JHRA 2WTEA 3H7IA 3GAMA 4US1R 2F8LA 2GBLC 1RKVA 2I2WA 4BGIA 3N87A 4C6TA 1O3YA 1DQRA 4YH1A 4CM3A 4AYWA 2C29D 1J1UA 2OBBA 3T3MB 4BEVA 4QHSA 1I3CA 4ZMSA 2YOGA 3I8OA 3R3HA 3CR8A 5EE5B 3HCCA 2AOVA 5FO1A 3W79A 2O54A 4XFKA 3W4JA 4UU1A 4CF3A 4O1MA 5TPWB 4RDXA 1V41E 2HJGA 3MCAA 3QMMA 4M1EA 1YOVB 3DMNA 3FNFA 5PNTA 3F4KA 1LRJA 1OWNA 4RELA 2CWDA 3SG0A 3AM1A 4WZZA 4Q7MB 3AUJB 5LP1A 1Q77A 3H2ZA 3BS4A 3MHTA 4JVLA 4OJTA 1JIVA 2X58A 3GFOA 4BO4A 5HIKA 2ONCA 3FWPA 3P71T 1NW3A 5CB0A 2OGZA 4X60A 1U0LA 5EZ5A 4LCJA 4NDNE 4W6ZA 1GR0A 3L8MA 3GDFA 4TLEA 5FH9A 2C7RA 4WEOA 3RYCB 1EFAA 3DFZA 2CV1A 1R1DA 3D6AA 4LQLA 2RJOA 2MSKA 4XFDA 1C50A 4IIDA 3VH2A 1W59A 1X7YB 2FCRA 2GCNA 2Q1WA 3MAAC 2VQEB 2DRIA 3RHZA 4L3VA 2RARA 2UYYA 2ZE7A 3GW8A 1TEVA 1J49A 2XI4A 3ESXA 5T6MA 4XDZA 4D3XA 3SOZA 3BZBA 1OI4A 4CR7A 2H54A 3L8HA 2ZBDA 3KDSE 2IIQA 5HKOA 2GYWA 1BX0A 2HXSA 4IOLA 5IT9A 1KYIA 2XGSA 2PLFA 2IW1A 2YZKA 1ZJJA 4EF6A 4EJSA 4ESHA 2VATA 2C00A 4MUFA 4JYAB 1SKQA 1NDUA 4DTCA 4TQ9A 4HT3B 1OX4A 3CLVA 4LQ4A 3K9GA 4RLFA 1H2AS 4AJIA 4Y9UA 5AQEA 2C03A 2QJWA 3GUVA 3O4GA 4KGXA 4RCYA 2RD2A 4JODA 1XEXB 1CUBA 2XHEA 5H59A 3E1GA 2F4NA 5KHAA 3ET4A 1JKXA 2HIMA 2QJFA 3U19A 2PKCA 5E3IA 5A03A 1JHDA 1R6DA 1W1IA 2X3UA 4L50A 4TYYA 4N40A 5J23A 1RRMA 2KPOA 3EOZA 3GGJA 3KZCA 1B0AA 2YFYA 1BFDA 5DNVA 1UP7A 3NHAA 3AUXA 3GJSA 2UYHA 2WTAA 3EISA 5J3JA 1WLSA 3RKSA 6NULA 3BX1A 1Q0LA 5JWRA 2B8TA 2P8JA 3L18A 4HNAA 1RXSA 4WZBB 5KNBH 1T8TA 1G17A 1YXMA 1X1BA 2WLTA 2QAJA 1NZDA 3KXIA 3P0EA 2WMDA 4G4GA 1JR2A 2G5PA 5HIAA 3FFTA 2PUHA 1CQXA 1Z6AA 3FR8A 4MS3A 4NJEA 3ADCA 1QJCA 1UBTS 2JFHA 2VHYA 5KEIA 2YUTA 1C9KA 1ZXBA 4O6VA 5DM1A 2FW9A 3NALA 4BVHA 4TTTS 5JV5A 2D0DA 2GPSA 4QBIA 4GP6A 3UV7A 3PQ4A 1BH2A 3BDVA 4N03A 4DIDA 2TS1A 4BO8A 1TA9A 2P9JA 3UV3A 1WKCA 2O8EA 4ND8A 1NZJA 1HNZB 1ZAKA 1GNVA 4QPCA 4JK3A 4ZCQA 1U0SY 2XEXA 4I5DA 5DW3A 2O3UA 5A3QA 4H17A 2RGWA 3A7DA 3FKJA 1EJ2A 3QPAA 4H7HA 4O4LA 2W43A 1SVSA 3A4YA 1TEZA 1E2MA 5HWSA 1BHJA 3JQFC 3NC0C 1T8YA 5FR1A 4KE6A 4W9MC 5B3KA 5L7YA 3WGQA 3CT6A 4DE5A 2FPKA 1YULA 2Y05A 2RHBA 1T5BA 4NVRA 1NAIA 4QUKA 2XQGA 1GPAA 1ZW6A 1DX9A 3DFMA 4X3OA 1SU4A 1TZ2A 5KWSA 3RS7A 1K1EA 1P33A 1A76A 2PTHA 1IN7A 1N9GB 3W8EA 3ND5A 4IVRA 3RH0A 1IPEA 2JASA 5HS6A 4S1NA 2JIQA 3C3XA 2BFNA 2WTNA 4M0UA 4MWDA 3U7QA 1C1HA 1FP4B 2G3YA 4DMRA 5E6SA 2OVFA 2MOKA 4YIHA 5JECA 1EXDA 2G9VA 3GL9A 1EA5A 4AUKA 1YNSA 3SZUA 4DARA 4Y0NA 4QYWA 1AXEA 1RACA 2C5EA 4HRAA 4UAUA 5AOCA 3HYRA 3LOUA 4TYPA 1Z38A 5K8LA 4GZ5A 5AXAA 2NPIA 1YRQA 5EQJB 2ENUA 2XUJA 2Q5IA 3Q7QA 1ODCA 2V97A 1J20A 3U1TA 1OXSC 5KC9A 2O52A 2G1JA 2WJYA 4E13A 1U2TA 3H99A 3IUPA 1P73A 1DFGA 1VKZA 1VMEA 2ZRCA 4PHGA 3SIXA 2EV9A 3TTWA 1GCAA 1K8XB 3DZHA 1QIJA 1P9LA 5D5QA 4ZVLA 3DTVA 3KB6A 2C92A 3H5VA 1GTG1 5JISA 1XCGB 3AJDA 3C8MA 2A59A 3HVJA 3ZHZA 1O4WA 2M32A 2W6ID 4K9DA 2Q9UA 3ZKWB 4NU8X 2C7BA 3C4VA 3D7NA 5C8YB 5C1DA 3GFSA 2MYPA 4HSGA 2OAEA 1Q21A 4M1SA 4JQSA 4GPBA 4G36A 2VRNA 1C9YA 4G1MB 5HDBB 4JJ4A 1IRXA 1UDBA 4KAJA 1YS7A 1XB2A 4X90A 4DKXA 3SHTA 3FLMA 1ISRA 2WFMA 3BJEA 3IAEA 3VISA 5KC8A 1UJCA 4A1FA 7REQB 1N6LA 3GRKA 4BIIA 1LW6E 3H1BA 4BV2A 4EY8A 2UZ4A 1ULZA 4QLAA 3IBFA 4GRAA 1U3DA 2Q27A 3HYLA 3ZEAA 4IMJB 1JEEA 1FX0B 1E0AA 2DG2A 2QNBA 2DERA 1OCEA 2CWWA 1UBUS 3PPIA 4OFWA 1Y1SA 1WUYA 1QQBA 3FF4A 2CE2X 2OHGA 3G89A 4HWTA 1AZTA 4U7GA 2JAWA 4C76A 3BXPA 4BCBA 2QVLA 2OK7A 1X7HA 4DR2B 3R3WA 4DMGA 3KQTA 4RPJA 1AGYA 5JC1A 1EFRA 4ZYUA 2BW0A 3DBHB 4MGKR 1HNNA 2Y27A 4KXFB 4AMGA 1GQOA 4YRTA 2QRMA 3E8MA 4XQEA 4BP9A 3VHQA 3R5HA 2R65A 1J2UA 4AJHA 1IY2A 2PM8A 3KVRA 5JAOA 1RKXA 3FCOA 4TVOA 3TGWA 1QS0B 1PO7A 3U4CA 4V24A 2BFCA 1XVLA 1THMA 4BE9A 2C96A 1FL9A 6GPBA 4QOGA 1C1XB 3V1LA 1QO0D 2IU0A 3D6MA 5KI6A 2O6LA 4XPZA 2VTVA 4LYJA 1J7JA 4HNQA 4RPLA 5HOEA 4OQZA 2P3QA 3C8HA 5AOVA 3WKCA 5L6MB 4B6EA 2CCGA 2ZCJA 3KB1A 1QZZA 3KL2A 1V1RB 4NBUA 1G2PA 2ZSDA 3NONA 1N5OX 3PU6A 1BXGB 4FNMA 4RVSA 5LA6F 4G0YA 4ZHQB 1BMFA 1JAIA 3FTDA 5FUXA 3G85A 5TSDA 3BWDD 5GV8A 4C3ZA 4MIOA 1H65A 3ADPA 2EEPA 4I50A 1VBNA 2HUNA 3QBJA 2CDRA 3JQ9C 2DXIA 4F5EA 3FVQA 2XXAA 3OIDA 1XDDA 1U7DA 3N2KB 4Z0HO 4F84A 4QDOA 2D1QA 3UMSA 1M2HA 3PENA 5THQA 1J5PA 1FYDA 4C88A 4BNTA 1WVMA 2F9MA 3WV5A 4DYHA 4KMOA 1XO1A 2PKYX 1TGVA 1XXLA 5IWAB 5KU1A 5INTA 2PXAA 3B85A 1V4VA 3CZMA 3TOSA 1CZKA 2VHWA 1XSEA 4GW3A 2B83A 1OYWA 3AP2A 3PQCA 1ICEA 5CBKA 2GERA 2DT8A 2ZI5A 4RVGA 2ZJ6A 821PA 2OILA 1PJ3A 2F4VB 3GLFA 5CH3A 1AB5A 1H6CA 2XQIA 4NPAA 4EBFA 1NYTA 1WL8A 1JW9B 4NBLA 4FEEA 2QQ0A 4NNJA 2Y66A 1KDVA 3W8DA 3PVCA 4DUGD 3EQ6A 5HBGA 3JARB 1X8JA 3EPHA 5J2TA 4HB2A 3GROA 4HQFA 1KI9A 1MVNA 3RJ9A 2PQ2A 3W04A 2H7CA 3GPCA 3OUZA 3OHSX 3LTNC 3ILHA 3KJGA 2H1FA 2GO1A 5B30A 4KXWA 4M1KA 4MKFA 1MO4A 4PAWA 3EMDA 3AW9A 3CPSA 5HRCA 5HZKA 2AFHE 5AW7A 5C52B 1E1DA 3K0HA 1DRJA 4WBNA 3NKFA 4KN5A 4X84A 3WXBA 4YWHA 4PPNA 3RU3A 1G98A 3TNFA 1G1AA 3VSBA 1Y5MA 4CR8A 4NAUA 2RHJA 1MA3A 2Q41A 2GWHA 5T64A 3MINB 3QWFA 3SXJA 4B76A 5I47A 1HQKA 2FSFA 4IR7A 5K01A 3WL4A 2ZRLA 4M7PA 1FRNA 3H18A 4MIYA 2GZHA 3M0EA 2QZ4A 4R8RA 3SX2A 4E51A 4P7FA 2RJNA 2UZ3A 1XAJA 4BU0A 3O2QB 3BWMA 5AI8A 1K7SN 2V1XA 3C7TA 1ADGA 4TLCA 2VJKA 2K7FA 1EE1A 1IEXA 4GKBA 1Z0AA 4HN2A 2JHGA 2ADMA 1GQSA 3G82C 3M5PA 2H1CA 4G9BA 3STYA 2R1TB 3RU2A 1WCIA 1ORIA 3VDRA 4WUTA 6Q21A 2L2QA 4JGGA 5EZYF 2WJWA 4Y2YA 4KLZA 1O96B 4R3UC 3ZD9A 4EP1A 2VAVA 1SEPA 1UEXC 3DCYA 4IDHA 1I4WA 1L3BA 3UHAA 4N9QA 5BOSB 3LCCA 4EELA 3THWA 3GN2A 5A9SA 2FQXA 3KIPA 4Z7OB 2GVDC 2I6GA 2IUFA 4FR2A 3UWSA 1G0OA 3EYWA 4Z7NB 4N9WA 3FR7A 3KCNA 2EQAA 2GD1O 3D3EA 4GEKA 3TZHA 4ARZB 2PA0A 2O59A 1PDWA 1ZD1A 2VYNA 3LY8A 3OX2A 3N28A 1QF6A 4RA9B 1KVTA 1OV4A 3D3JA 4F38A 5FB3A 2QV7A 3B3FA 1KJYA 3ZQ6A 1BVUA 2VXBA 2XNSA 2V4ZA 2F1HA 2HZBA 1QCDA 2PGIA 4NJOA 3JV7A 5HQ3A 1DKUA 2GHQA 4OUDA 4G1CA 4GVPA 2Y2UA 1OZ0A 1H85A 2OMEA 4M36A 2Z2YA 1SVMA 2FSSA 3ZHQA 4EDFA 1SD1A 3GFFA 2EF0A 2J67A 2V96A 3IELA 2ODTX 2XR1A 4LISA 5CH5A 3VYSB 4CODB 4DADA 3CEJA 4X63A 3WZ2A 2GFQA 2QGNA 1Q95A 5H0IA 3TLKA 3QNUA 4H7FA 1OTYA 2QB5A 4TWJA 3CMCO 4D5GA 2FMXA 1CE8B 3WGGA 3IB3A 2GJ8A 2E18A 4TN5A 1EFTA 1NU6A 3ZWOA 4PYNA 1PT6A 2VBIA 4ZQGA 3QE3A