3OF5A

Crystal structure of a dethiobiotin synthetase from francisella tularensis subsp. tularensis schu s4
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
222
structure length
222
Chain Sequence
SNAMKKFFIIGTDTEVGKTYISTKLIEVCEHQNIKSLCLKPVASGQSQFSELCEDVESILNAYKHKFTAAEINLISFNQAVAPHIIAAKTKVDISIENLKQFIEDKYNQDLDILFIEGAGGLLTPYSDHTTQLDLIKALQIPVLLVSAIKVGCINHTLLTINELNRHNIKLAGWIANCNDSNIKYIDEQINTIEELSGYKCSAKISRNADYLDFIDLSKILI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dethiobiotin synthetase
publication title Crystal Structure of a Dethiobiotin Synthetase from Francisella tularensis subsp. tularensis SCHU S4
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Ligase
total genus 72
structure length 222
sequence length 222
chains with identical sequence B
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 2010-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13500 AAA_26 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3of5A00
3R20A 4N0EA 1DG3A 1NSTA 2CCJA 4HZIA 3SDZA 3FMFA 4E5UA 1SQ5A 2QZ4A 3EWSA 3X1DA 5A0FA 3R9XA 3U3KA 1HQCA 2GXSA 3OEEA 3ZZUA 3S1AA 2NOAA 1XD2A 4GPTA 4C3ZA 1EFTA 4O2RA 3RLFA 1KK1A 4BLQA 3UWOA 4US1R 4DDTA 1KZGB 4R9UC 5CB6A 1R5BA 4B73A 4KITB 1CEEA 5EUMA 2NGRA 3REGA 3T34A 2RMKA 4R98A 4B48A 3VKHA 4KLNA 2R9VA 5D3MA 2PJZA 2WAXA 2AD5A 5EP1A 2Q9AA 4TSFD 2GCNA 2KWIA 4PAMA 3EPJA 2JLVA 3I5XA 1F2UA 4GOJA 1ZRHA 4MKHA 1X1RA 4Z8XA 3KJIA 2EYUA 2HDNB 1BS1A 1Q20A 3GQBA 1K6MA 2RGEA 3KKNA 3Q9LA 3M0EA 4Q4AA 1N5JA 1TMKA 3DMDA 4KCGA 1OV4A 4OQNA 2BMDA 2IS6A 2QUZA 1G9XA 1ZNZA 2IXFA 1P2VA 1OIVA 2ODEA 1P9NA 1VCMA 4BUJA 4V0MA 4BEBA 4OK5A 5L3SA 1CIPA 4I4LA 2FOLA 1A5TA 3THYB 1GIAA 2H17A 4OQMA 5L3QA 4BECA 2XGJA 3P20A 5TXGA 3Q3JB 4P4SB 2ZSFA 4P0TA 4U02A 2XB2A 1ZM9A 3BAFA 3QOFA 3RRZA 3OAAD 3AB3A 2OESA 3E5HA 1QDEA 3FKSA 2G77B 2GJAA 5L3RA 4BFVA 4BFSA 2YOHA 3DO6A 3JZMA 5KPJA 2GJSA 2ZRNA 1R8SA 1EESA 2E9SA 2QTHA 1G3QA 3MG9A 1CJMA 1DPFA 2WOOA 2WPDD 1HURA 4RFSB 4CEJB 2XXAB 3OIYA 2CHQA 3D7MA 3NTUA 2DHRA 4MYCA 3A1VA 1KDRA 4JVSB 2V4ZA 2DWOA 4F91B 3VTKA 3C5HA 4IDNA 4KU4A 4P33A 2J0UA 4PPGA 4C0LA 4D2IA 1UJ2A 2GHIA 1W1WA 4LBVA 1T8UA 2GJKA 4XTRA 5JJIA 4M1YA 4IDQA 5CLLA 1TU4A 2WMNB 4B32A 2CE2X 1W36D 1GKUB 3AV0B 1UM8A 1DE0A 4TYWA 4Q1EA 2OZEA 4HLUC 2CMKA 3FTQA 1T6NA 3ZVNA 4DLRA 2X2EA 1OH6A 4F4IA 1XEWY 2K5UA 3UPUA 3B9PA 2IS1A 2QP3A 3TE6A 5AUQA 5G3YA 3TLXA 3B6EA 3AEZA 1YRAA 2B8WA 2AKAB 4LJ8A 1CS4C 1NG9A 721PA 1YJ5A 2BKUA 4GOXA 3QENA 1NRJB 5FTMA 2J45A 2NIPA 3SEAA 4M22A 4ARZB 1OE0A 3LNCA 1TQ6A 2VH5R 3QF4A 5EXTA 1D8TA 1E96A 2V1XA 4HAVA 4C30A 4ZI2A 1ESMA 1AGPA 2DCUA 3AKYA 1K5DA 3IUYA 4MUBA 2GAOA 2V8OA 3PUWA 4AWXA 821PA 3WHKA 1MOZA 4LI0A 3TSZA 1IXZA 1N6KA 1XU4A 2ORIA 4XOIA 4QGGA 3FYHA 5HE8A 1KSHA 3K9HA 1GL9B 1Q1BA 4W5WA 2IYRA 1U8YA 3GJ6A 4ZDJA 4D25A 2QA5A 2GVZC 1VTKA 2QAGB 4FCVA 4F4JA 2ZPTX 3MJHA 2BEJA 2HYDA 1OB2A 5JS7A 4TN1A 1ZCAA 2C98A 2BEKA 4AG6A 1UBCA 1W44A 2WWHA 3MGCA 2LKCA 2Q3HA 2P65A 3KXLA 2F6RA 3K0FA 1RRGA 2AKYA 1G5RA 3CNLA 4IVPA 1KHTA 1OH8A 3UMSA 2QM7A 1E2LA 1RZ3A 1A2BA 1KJYA 4UNRA 4H1UA 2VF7A 2CHVA 3VU9B 5DSZA 4DHEA 5DNYB 4TLAA 2ZRFA 3KUDA 3R7WA 4V0LA 1JJ7A 3D6TB 1OXSC 2P6RA 3RS4A 1E98A 5B58C 1DS6A 1I4TD 4HUQA 5EE9A 4M1SA 1NN0A 2CEAA 5HZHA 3QPWA 5EE3A 2KBFA 3FVQA 3P26A 1I4DD 3FFAA 5GJBA 4RCYA 4XD7D 4NKRA 3BB1A 4GL2A 3WYFA 2D62A 1J8YF 1E9SA 4D0LB 1N2CE 4I1UA 3DL0A 3UXMA 1AZTA 4QGFA 3RABA 2FH5B 4JL6A 4XVUA 2WTUA 3CH4B 4TL6A 4JZKA 2ZI7A 5LD2C 3E1SA 4PZLA 3S1AB 4C0QC 1XD2B 4AI6A 1HT2E 1KI1A 3A37A 3N5CA 4GMDA 2A5GA 5KO2A 2O52A 1E1QA 3ADDA 3LQQA 1NMYA 4PC2A 3RANA 4DLZA 1PV4A 1YR8A 3EG5A 4M0LA 2CLDX 2OHFA 2O8BA 1JXMA 4URVR 3CF2A 1BH2A 1F48A 1G5PA 1YZKA 2P0EA 2R6GA 2XNDD 3WBJA 5D3MB 1B0UA 1WMSA 1E2EA 5IDVA 3IBYA 4GT1A 3TGPA 4OL0A 1IXRC 4P4TA 4UJ3A 1XZPA 3PV0A 3I1FA 1F2UB 5FPSA 4ACBA 4TT3D 4B6FA 3U60B 1IY2A 1FZQA 1CJTC 1EX6A 3SE0A 4IW3B 1DAKA 4HZUA 4AK9A 2G6BA 2JLWA 4NU0A 1KZ7B 4ZCLA 3PEYA 2HT6A 4NCNA 5KSYA 2Q9CA 4PSAA 1IY1A 5J40A 5L3SB 1SVMA 5L3QB 1GVNB 4NZYA 1AK2A 4JL8A 2WMOB 2CL6X 2ZE8A 2JLRA 2FFBA 3IKJA 3PG5A 3U6BA 1GRRA 4D81A 2FPMA 2RB4A 1IXSB 4BLRA 3BH6A 1ZMXA 2J9RA 2ODWA 4MDEA 4LHZA 5CITA 3FWYA 3VX4A 5GVSA 1R4AA 3GLIE 3KQNA 4BZPA 2PBRA 4L5BA 4QKQA 1Z83A 3KJHA 3CRMA 1N6LA 2IYXA 1UKZA 4M1OA 3RS5A 2J0UB 3IPYA 2V7QD 4B6EA 1BOFA 2QL6A 2OBMA 2CK3A 5FOXA 3NDBB 2IUUA 3T06B 2WJYA 4RD6A 3OESA 2FPKA 2ZUCA 3BWDD 3RRNA 1JR3D 3GLIA 4F93B 4URZR 1Q1ZA 4Q66C 1DG1G 5KOYA 3ASZA 2W2VA 3LVRE 5BXQC 1GRQA 4M4SA 1JPNA 1ZC3A 1JALA 4DT1A 2XZLA 5AJWA 3WYGA 1ESNA 1ZUNB 4MYHA 1KI7A 4W9MC 1FTSA 4EPXA 1AQYA 1XPUA 3TUIC 4EJSC 1NVVQ 1L8QA 2UVQA 1KSGA 2ONKA 5FI1B 3VR6A 3SS8A 2ZE7A 3TMKA 2R62A 3K09A 4IOMA 3MWJA 4ESVA 2CNWD 1S1CA 4DIEA 3OFND 4Z8YA 3PXGA 5HE9A 2A9KA 5CDFE 2KJQA 2OBLA 3LBHA 5FBQB 3AM1A 4TL8A 1VIAA 4JVNA 5B64A 2W6IA 4WZBE 3MAAC 2OE2A 4IKEA 4E07A 1HA3A 2EWVA 2AN9A 4FXPA 3GEEA 3QF4B 3B8HA 4M9ZA 4WA7A 1CXZA 4JLDA 1F2TA 2EWWA 2O0HA 4EUNA 1ZNXA 4QBGB 1GZSA 3QI2A 3K70B 4KHZA 5CDFA 1LV7A 5CM8B 3I3SR 4ZKEA 1J90A 1G6HA 2VBCA 4S35A 1TL7C 2X77A 3WP1B 4L9WA 5LBIA 2LKDA 5SZJA 4FCTA 3SBDA 2YNMA 1Y3AA 2G88A 5LPNA 2VHUA 4R7ZA 4A2PA 2PMDA 1PUJA 3THOA 3GJ8A 1YR7A 1KGDA 2R44A 3AGQA 4Q48A 3SR0A 1W0KD 2XOKD 2PEZA 2AK3A 3B2EA 3K0FB 4L4UA 2AXPA 3VKWA 1W5SA 3LWNA 4QGAA 1FL9A 2OT3B 5JZVA 3LX8A 4QJ5A 5AUOB 2RCNA 4XIGS 1KI6A 2GF0A 2QE7D 3X1YA 1BO6A 2LWIA 1QHGA 4B76A 1QHIA 3C8UA 3K0AA 2V55B 3CWQA 3RC8A 4P32A 2IK8A 3R8CA 5JRZA 1ZP6A 3R7WB 1CKEA 2DB3A 2PZFA 4PQRA 1MRNA 4WZAE 2QP9X 3MD0A 1U0HC 2AD1A 4RZUA 4Q9LA 1Q57A 2J1LA 2JATA 4HUQB 4MRNA 2QT1A 1FX0A 2F43A 1CF4A 1G64A 2OBNA 4PSKA 1OF1A 2ZRCA 1LS1A 1N0UA 1SXJE 1OYWA 2IT1A 4M9QA 4MITA 3BFVA 2GRJA 2GXQA 2KBEA 5B57C 5IHPA 4GMXA 2IYTA 1YRBA 4HB2A 5KSPA 4C7OA 3KJEA 3UIEA 4KO8A 1S4QA 4WOPA 3R9WA 1QHYA 3GJ0A 2PZEA 4M53A 2IEYA 4D4JA 4ZDIA 4U7DA 4A9AA 4OKSA 4BFTA 3VKGA 2PZGA 1KSJA 1SXJA 2QGZA 5JMTA 3LX5A 3EASA 3DHWC 3LW8A 1Z63A 5CLQA 4L16A 1E9FA 3RYTC 3GD7A 1H65A 5BW8A 4D4KA 2FV8A 5TARA 3HWSA 3NG1A 1W0JA 4Q18A 4ASUD 4PFSA 3UMFA 3O8RA 3B1WA 2RGXA 1QG4A 2O8BB 5JJLA 1NY5A 1L2TA 4NCJA 1P60A 1P5ZB 1TQ4A 1V5WA 4XWKA 3NIBA 1LFDB 1J99A 1KI3A 3TW4A 1A1VA 4JIMA 2ZRJA 1NN5A 5DYGA 2JCSA 5FUXA 3VX3A 4Q1BA 2VEDA 1KO7A 4KYUA 4GOKA 2WSSD 1DTSA 2ZRPA 1VKJA 2WHXA 1T4GA 3EPLA 1CP2A 3P32A 5LB2A 3LD9A 2BHRA 5JLJA 4HZUB 3VNUA 4Z1MA 1DAEA 2HF8A 4B71A 1U9IC 1L4UA 1FUUA 3GMTA 5DI3A 4QL3A 1DAFA 2ZSBA 2BOVA 4JBYA 4WXPA 3RS3A 1Q44A 4JBWA 4D4LA 4ZI3A 1TEXA 2KSQA 2YVUA 3AVYA 1QHNA 2NPIA 4KV9A 1E4VA 3ZJYA 1GL6A 2ZJ8A 1NBMD 6Q21A 1T3HA 1SKYB 1UDXA 3TVTA 1HTWA 4X8OA 1ZJ6A 3TQCA 3NVAA 4MUAA 4DIDA 5DE3A 5FUYA 5FPKA 4NONA 4JSTA 1WBDA 1W49A 2GDJA 2ZYUX 2QORA 2CJWA 4DSUA 3ADBA 4KAXA 4POAA 5EZ6B 2AWNA 1OKKA 2PL3A 2QMOA 3ZZ0A 2C95A 1CTQA 2UZIR 4ACAA 3AVOA 4QHTA 1NN1A 5TMPA 1XNJA 2QMHA 3GLIB 4XVQA 1DAGA 2GILA 3NBYC 1S3GA 2W2TA 2R6AA 4YXWA 4DT1B 5FBLB 1NVUQ 4TQ9A 3QXHA 2JIZD 3L0IB 2HLDD 3U7EB 3WXMA 3B78A 3KQHA 2DFKB 2HJVA 4IXMA 4LHYA 1YZLA 4KI0A 4YMSA 2ZUDA 3DMNA 1IN4A 2ZVQX 5TY0A 1H8EA 1TU3A 2IW3A 2BDTA 3QKTA 4B3CA 5EJEA 4BGDA 3HP1A 2ODBA 1E2HA 1W4RA 5E95A 1RIFA 4HATA 3RDPA 2IF0A 4U5XA 1W5TA 5SZKB 3BK7A 4QC2A 4ZIRB 3KQUA 1NNEA 1NSFA 3C7KA 4TMTA 5GJWC 2FEMA 4ERNA 1JXOA 4IRUB 1WRBA 4X8MA 1MRSA 1M7GA 4CZ2A 3TW8B 1F2TB 3ZD6A 4XH9B 1AIPA 2IUTA 3IBGA 3VR2A 4HYYA 2EFGA 3BXZA 3L8YA 1FQJA 1NJGA 3KXIA 2OO7A 3K9GA 2PX0A 2C99A 4QHSA 3OIVA 1CU1A 3B9QA 1N6HA 2ZVPX 1HEIA 5JEEA 4EAQA 3CPHA 1B23P 2J7PD 2ZIAA 3H4MA 4M9SA 1NF3A 4LJ4A 1H8HA 1X8KA 2WVJA 1C4OA 4KYIB 2C9OA 4BRUA 3CRRA 3AF0A 1EFRD 4IVRA 1G18A 4LC1A 5P21A 3SHFA 4PSVA 4IOKA 3U3RA 3ZQJA 4CF7A 1K8RA 2EFEB 2ZRGA 5LB4A 3FHCB 3Q5EA 2GXUA 3T1OA 1KI6B 4A2WA 5BN5A 3OHMA 4DCSA 1E0KA 3I5YA 1BMFD 4Q5IA 4YDSA 5FBRB 3K0AB 1T0HB 3NBXX 1CJUC 2FSGA 1II9A 2JJ2A 2FSFA 3QUSA 2QT0A 4JT2A 2A5FA 4DSTA 2PJRA 3OAAA 4B2IA 3QSYA 4NYMR 3CW2A 4L8GA 4UXJA 1AM4D 4Q9JA 4DKXA 5FTLA 4DUGA 5J4YA 2OCYC 1FQKA 1FX0B 2F43B 3IO3A 1VPLA 5EE0A 2QAJA 4QOSA 5EXSA 1ONBA 2VHQA 5FL7A 4AKEA 4C7OB 5DH9A 2IYYA 1L7VC 2N46A 2OFXA 3PUVA 4YC7A 5JCPA 2TMKA 1FTNA 1PVOA 2JJ1D 3PIRA 4DLVA 1XTKA 2GJ8A 3X1XA 4AKIA 1T5IA 1VYVA 4TQAA 4H9GA 5DN6D 2R8RA 3QXXA 1G41A 2P6NA 4TLCA 1SXJB 2QMEA 1T3LA 1XX6A 1R0WA 2EQBA 3MFYA 5CJPA 2G83A 2F3TA 1NI3A 4TZ6A 5KU1A 1VHTA 1UBFA 2MSCB 2JLZA 3U7GA 3HYTA 1TADA 4YDHB 3W5IA 3T12A 1XTJA 1D2EA 4CIDA 4JLBA 2IEZA 3LRPA 5C4MA 1Z0DA 4A6PA 2YC4C 5DHAA 2GBLC 1COWD 1G3MA 3AVXA 4OI2A 2QEQA 1W46A 3T1TA 1DOAA 2NQ2C 2R2AA 5CK5A 2FFAA 5FH9A 1IN5A 1ZAKA 3WMEA 4TMVA 3EA0A 4NTZA 5FI0B 4NBSA 3OIUA 2QAGC 1E1RD 2ZJYA 2IL1A 4DLXA 3UANA 2WSMA 3U61B 1GOTA 5GVRA 2UZ3A 4LBZA 3HPRA 5DI3B 3C16C 3CZQA 3QEOA 1ZNWA 4JLMA 3L43A 3NDPA 4MRSA 4WXRA 3AVVA 2QI9C 1OH5A 2BMFA 2FMXA 4B3BA 1IONA 1A7JA 2ZI4A 3DEFA 3NKVA 4OYHA 2VQSA 4BFUA 3BH0A 1G16A 3CPJB 3CBQA 1SHZA 4NPHA 1Q12A 4RD1A 4EPRA 4EPTA 4FMCF 5G40A 3ICQB 3M4YA 2ZAMA 4DLYA 3C15C 2XX3A 1YE8A 1W2GA 3A1SA 3RSOA 4LX0A 5FR2A 2PT7A 5JWOA 4D4MA 3KKQA 3NC1C 5FL3A 5DO9A 1EFCA 2JLUA 2CJWB 2REXB 4YMWA 3LXXA 2IWHA 2P5SA 5EZ5A 1E9BA 4JLAA 2VL7A 5FTNA 3CLVA 3AF1A 2WM9B 4OJKA 3CPEA 1WE2A 1CR4A 5E7IA 2WIBA 2IWRA 2H57A 4TLBA 4BQSA 5CM9C 3QPVA 4I99A 2PEYA 1NVWQ 4LPKA 3X2SA 2GETA 2EVWX 4IEIA 4QXAA 4XD7A 3GJ4A 3GJ7A 2OCPA 1TX4B 1EWRA 1P4SA 2R6FA 1MR3F 5JEDA 4V02A 3NHBA 1ODFA 4DLUA 5C1BA 1DAMA 2FU5C 4KFTA 4MQBA 2RGCA 3GFTA 3CR7A 3AF4A 3DPUA 3X1ZA 3PENA 3CH5A 4MRRA 3ZIAD 1XWIA 2JEOA 4DDVA 1WQ1R 3WYAA 5KPDA 1D5CA 1U94A 4HDCA 3HU1A 4RD0A 2BBOA 4OQLA 4PHTA 5CIWA 3AVWA 3DOFA 4FWIB 4KVAA 1FOEB 2GZHA 4FD2A 3RNLA 1X86B 4PC3A 2HCBA 4IHQA 2GZDA 3K8YA 1E99A 3H86A 4NMMA 1M7HA 4X8HA 4Q03A 1XEFA 3CX8A 1HE8B 2JAQA 3O47A 5C46F 1RYHA 2CLSA 1XMJA 4FMDB 2IF2A 5TV2A 1TPZA 1E79A 2YKGA 2CCGA 1OXTA 1GKIA 2BVNA 1GAJA 4HAZA 2HF9A 3GJ3A 5KNDA 4RKFA 1II8A 2FFQA 1O87A 4HAXA 4WVFA 2ZSEA 3VR4A 2GESA 1P2TA 3KKOA 3QQ5A 1KI8A 1ZC4A 4PAQA 2QTFA 1ZYUA 2WJIA 3WBKA 1BYIA 2YV5A 2XEXA 3ZH9B 3T1QA 2ANBA 3SFVA 2WJVA 1CR0A 3A4LA 2CCKA 1QBKC 2GTPA 4MGKR 3IIKA 1E0SA 3AP3A 1NN3A 1SVLA 2VP4A 3MUFA 5CYPA 1E3MA 2IYLD 1JBKA 4CRWB 3OEHA 4Q4HA 2ZYVX 1KDPA 1JR3E 4MKGA 3EXAA 4ZO4A 4LK2A 5HPYB 2CBZA 3W3AA 4N0DA 2ZI3A 2IYSA 4UNSA 3NC0C 4CW7A 4PC6A 3BOSA 4E09A 2V1UA 3EIQA 2F9LA 1G17A 1UF9A 4JKIA 1HQYE 2Z0MA 4LDJA 3PUYA 1Z2AA 3ADCA 2IS4A 3NEYA 1GL7A 4XJXA 2XSZD 3KDSE 1OFUX 2VYFA 1W36B 1M2OB 3LLUA 2VLIA 3ONWA 1Z6GA 3Q5DA 4QBFA 4TZ0A 1N6PA 2ZRMA 3DKPA 3HR7A 1AS3A 1KI2A 4AIIA 1HUQA 3OEED 2OG2A 1G8FA 2ZJ2A 2ZI6A 3TAHA 2FSHA 2P5TB 4YLGA 3KFVA 5FOSA 3UG7A 4Q4LA 3P1JA 4PTLA 2GJ9A 4EFNA 3OFNA 3K70C 4BFZA 3LV8A 1OYYA 1R5OA 5GADl 2XZOA 4PR0A 4UXIA 3M6AA 4QG7A 5AJZA 2HJGA 1XZQA 1Y63A 4KODA 1FP6A 2BJVA 1N6IA 3PUZA 3LQRA 4MA4A 1TUEA 1AKYA 2QRNA 3CUEF 3QBTA 2GAAA 4OBEA 3B1XA 1N5KA 4EFMA 2IX3A 5BQ5A 1KO5A 3TSWA 3WNDA 3P4XA 4K8OA 3W6NA 2QQ0A 2YZ2A 4Y0VA 1MKYA 1M8PA 2RGBA 1RRCA 5DI9A 1R0ZA 3QG1A 4A36A 1XCMA 2BBWA 1IBRA 5C18A 2QPAA 2B21A 2V3CC 2QMUA 4BWYA 2ZQ5A 5SZIA 2ZSAA 3TSOA 2YYZA 3AVQA 4HB4A 1KTVA 5JI2E 5K8UA 2XJ4A 3U4QA 5J47A 1D6JA 2OAQ1 3LO5A 3KUCA 1G19A 1XEXA 3QXJA 4TTRA 3B1ZA 3FKSD 2H5EA 5ELXA 4KSBA 1E32A 3JZAA 3SN6A 4URXR 2VSXA 4ZKDA 2C9YA 3DZDA 1PUIA 1ZD9A 2I3BA 3THWA 3HPQA 4Q4AB 2GWHA 3WP0A 5HZKA 4GZMA 2R6CA 3L2OB 2WOJA 1W7AA 1TF2A 1LF5A 2OV2A 5EP3A 4ZCIA 1RYFA 2UKDA 5JBQA 1ZUHA 2ZJAA 5FOWA 4LHXA 5FBWB 1P73A 3TQFA 4HUTA 2QSYA 5JHHB 1RE0A 2CVFA 3AUYA 2OM2A 5K8TA 1UBEA 3RRYA 3V4RA 1LB1B 2QTVB 2ZRKA 4DCVA 5HTKA 3REFA 1U0LA 2H7VA 1N3BA 2V54A 4UNNA 1KAGA 3IEVA 2WKRA 4DBLC 1P2UA 3FB4A 1TF7A 2WKQA 2W6JA 3RAPR 2JASA 2WJGA 2ZI5A 4DCUA 1XTSA 2C78A 4OK3A 1PZNA 2IYUA 1LTQA 1EFHA 2ZRBA 4R2IA 1JQLB 1RRPA 3ETLA 5KTYA 2NO6A 1SZPA 2BMJA 4KFRA 1N6NA 3LXRA 1ZIOA 2EFHB 4NCIA 1YR9A 4GNKA 4D0GA 3HU2A 4EJSA 3W34A 3LBIA 3SJCA 2DYKA 1WF3A 4G5OA 3I73A 1FPMA 1D2MA 4MYTA 3KQKA 5UKDA 5F2EA 4A8JA 3K70D 3I92A 1CR1A 1KKMA 3R8FA 2GEDA 1U0JA 2VHTA 1OHHA 2AL7A 3Q85A 4TMWA 4I1VA 3UMRA 4U00A 3FHTA 3OF5A 3TUZC 1Z6AA 1II8B 1IN8A 3HR8A 2WZQA 3K9NA 1G7TA 1G20E 5K8LA 2WV9A 2JLXA 4BFXA 4II7A 5J5CA 4C0BA 4M21A 2VP6A 1VCOA 4URYR 4W7SA 4ZPXA 2P2LA 2QM8A 3PEUA 4FI3C 2G1JA 3FMOB 3IPXA 4QJ4A 4LCBA 2O0JA 3LBNA 4QBHA 5FUVA 3VMFA 2HUPA 1DADA 2C5LA 1XP8A 2GVDC 4NE2A 4YMTA 3GFPA 3KKPA 2ZR7A 5IK2D 1HT1E 3EC1A 3FGNA 3VNVA 4Q4HB 5G53C 1FNNA 2XAUA 4F4CA 4QM7A 3I32A 2ZRIA 1WXQA 5J4VA 3CWZA 4GDFA 3EARA 4LV8B 5F3WB 2NO7A 4J0QA 4BFWA 5E4FA 4G5RA 3EAQA 4LZZA 3GCGA 4A0GA 2AX4A 3WMFA 2YC2C 3CRVA 4R2HA 1N6RA 3AQ4A 4PQYA 1ZM3A 5TDHA 4DLSA 1R6BX 1W4AA 1VDZA 1AGRA 3K09C 4FMDF 2ZI9A 3U3MA 1MO5A 1BKDR 4ON9A 4ZV4A 2Q6TA 3W6PA 5EUQB 1G21E 1GP2A 4Q1FA 3D31A 4LJ5A 4TYNA 1VG0B 2DWPA 3T1VA 4RSGA 4ZDKA 4P31A 3A36A 3U6KA 2FGKA 2ERXA 4A82A 2C2HA 1E1QD 2D7DA 3GLGE 1AZSC 1G8HA 2B6HA 1L4YA 1XTIA 3WNCA 1OJLA 1XJQA 4ZCMA 2J0QA 2CL0X 2L0XA 2BCJQ 2F1HA 1N0WA 1G7CA 3RHFA 3O8DA 1ZD1A 1BIFA 5FOVA 4XSHA 1QHXA 5DGXA 2N1BA 1KK0A 1FUKA 2J46A 1R0YA 4P4UA 4MGIR 2FG5A 4OI4A 4I1SA 5KHOC 3GLGA 4AG5A 3BGWA 3ZZTA 1RFLA 1ZW6A 4US2R 4O3MA 1NMXA 2CE7A 2VTKA 2ZRDA 4IEEA 1F3OA 2WWYA 4LYFA 1KK3A 2V6JA 5G3ZA 1JI0A 3V00A 1M6NA 2KB0A 1XMSA 1G3IA 1Z8FA 4AD8A 4M1WA 3VFDA 3UATA 5AR1A 4AYTA 3FFBA 2J7PA 4FMCB 4QNRA 4HDQB 4CGZA 1ZVQA 2I4IA 1AQUA 4JVLA 3U4QB 1WA5A 1R10A 5CYOA 5L8VA 2IUSA 1SKQA 1XEXB 4IFEA 1P72A 3U2QA 3SYNA 2ZITA 1U9IA 2DBYA 1V43A 3VR5A 4C9BA 1QHHA 4Q7MB 2QP4A 4DDWA 3GP8A 3AKCA 4DSNA 2BM1A 4EIWA 4YMVA 2VHCA 3ND8A 5AUPB 3HDTA 3THWB 3T5DA 3SYKA 5J4KA 4URUR 4HLQB 2YJTD 4K81B 1J2JA 3GEIA 3MCAA 2ZROA 3QKRA 1E9DA 1SXJC 1VYUA 2CK3D 2NPFA 3QY0A 4HB0A 1FW6A 4RJLA 2WWWA 3BJIC 2IHYA 3WY9A 3HU3A 3U5ZB 5HKKA 3TVDA 4BFYA 1ZBDA 4JLVA 3CF0A 4FCWA 1HY3A 521PA 3WMGA 1Z0IA 4D0NA 2BKEA 3BORA 2OCAA 2W58A 5EE1A 4DCTA 2C8VA 5L3VA 3BD9A 1IJEA 1HH4A 1WCV1 2EFDB 2ZJZA 3FKQA 5HCNA 4HSEA 3TK1A 1P9RA 2H1LA 1MH1A 2Z43A 2REOA 4PPNA 3MWKA 3VR1A 1W4BA 2XITA 5KDLA 4B33A 2OUKA 3AGPA 3LAWA 2JDID 5AWFC 1ETUA 2GEVA 1ZU4A 4NP6A 4L15A 4QBIA 4UNQA 3J81k 5EE5B 2DWQA 4NYJQ 2W6ID 3IEUA 3RS2A 3QJYA 4DEYA 5K8IA 1XMVA 1EXMA 5FUWA 2VRWA 221PA 1QF9A 3AKEA 1D2NA 4DRZA 3MMPA 1F6BA 2WIAA 3AF2A 4A8JB 3ECCA 2FZ4A 2GKSA 3MWLA 5CIQA 3CB4A 4HAUA 4F38A 1KDOA 1FFHA 1RVDA 2B8TA 1HE1C 3U3OA 4LBWA 1XF9A 2IA5A 1A2KC 3BFKA 1E1RA 4B74A 1Z08A 3H0KA 4Q21A 4Q02A 2A3RA 3TRFA 1U98A 4RVCA 4JJKA 1Q1EA 3A58B 1TF5A 1J7KA 2ZE6A 4DLTA 5F98A 4KJZA 3K9LA 1GTVA 2YWGA 2RGNA 1XXHE 1VIYA 4BLPA 1E2FA 1KI9A 3B5JA 5KNCA 1W2HA 1Q0UA 2D4HA 2VF8A 2O8CA 1RJ9A 1XD9A 5H8WA 4Z51A 2EYQA 1E2GA 3KJGA 3K0CA 3KXKA 1P75A 3C5CA 1X1SA 1YZGA 3QVVA 4DZZA 2P6UA 2J0SA 3BBPA 3EPHA 1XXHA 2ZJOA 1W4CA 2FJUA 2YWEA 5H1YA 4V0NA 3EX7C 3C41J 4BZQA 3ZVMA 2W0SA 4TSFA 4RKEA 3FMIA 4L9SA 3MLEA 4OQXA 1NKSA 1KIMA 2NZJA 2C03A 2AFHE 4C0SA 3SQWA 3CIOA 2RGAA 1YZNA 2YOFA 1U81A 5AJYA 1G8GA 2IXGA 2FE4A 3H1TA 2FA9A 4TMKA 4LHVA 2FX3A 1J8MF 1QVAA 1VG1A 1VG8A 3K53A 2GZAA 2KI5A 2OXCA 3PITA 3QEJA 4B47A 1Z6YA 1SXJD 1N5IA 4EPYA 3W8RA 3C14C 1X8JA 3AF3A 3U3JA 1G6OA 3QE0A 2EW1A 4LWZA 4DXAA 1OIWA 1TUIA 2C96A 4A0HA 1JPJA 1D9XA 5E7MA 2QBYA 4FW9A 1FMLA 4XVRA 3U7HB 2ZUBA 1U8ZA 1N0VC 3T35A 3GJXC 3FE2A 2PT5A 2F3RA 3KTAA 1YZTA 2QENA 2WPDA 1T9HA 3NEJA 5DISB 1KO8A 5KUTA 2ZETA 2QSZA 1AS2A 4TTPA 2PLFA 4IDHA 1RKBA 3C4JA 3LLMA 3PFIA 3GLGB 2ZSDA 2JA1A 2GCPA 3E2IA 3SOPA 3QNUA 1G3UA 3BERA 2HCJB 4JKYA 2GBLA 4UNPA 4WBSA 4G5GA 1GNPA 4G1UC 4DSOA 4Z1MD 3GLFE 4HDOB 2X8AA 1LY1A 1I2DA 1N6OA 3LW7A 3I4LA 1PLJA 1UADA 1AS0A 1KSFX 3PJRA 1QZXA 4O2LA 4PZYA 1CRPA 4H1VA 1M7BA 1TQDA 4C0JA 3FPAA 2V9PA 4B34A 1HV8A 1WB9A 1PJRA 4A15A 3CX6A 3GLFA 3L0SA 3B85A 3O8CA 1Z0FA 4DEXA 1UAAA 2V6IA 3BS4A 4RD4A 4AKHA 4CT4B 2QPTA 2YWHA 1QHHB 3CKLA 4Q00A 2BCGY 3P27A 1R7RA 4TQUS 5FTKA 3F3YA 3CZPA 1JJVA 2OCBA 4TMXA 2XNSA 1XJ0A 3QKUA 4M8NE 4GRAA 2N42A 4KBFA 3NBFA 1HYQA 2O8DA 3H2YA 1XCGB 4RY2A 1MT0A 2D06A 3LDAA 3QKRB 4EFLA 2ZXUA 2P3SA 1CULC 1OKKD 4GZLA 1WP9A 4JYCA 3O8BA 1E94E 2Y8EA 5IF9A 3WRXC 4KVGA 1I4LD 2AK2A 2GA8A 3DM5A 3SHWA 3SJZA 4AC9A 2DR3A 4MDFA 4YXWD 4OHVA 3IDQA 3DDCA 3GEHA 1U90A 2J5XA 4M1KA 4PANA 4BE7B 4RZXA 4D6PA 2REBA 1GILA 2NG1A 1E6CA 2ORVA 4ZDWA 4URWR 2CVHA 5BN3A 1H8ED 3I61A 5JWRA 2P67A 2A30A 3FMPB 2W00A 1XBTA 2IS2A 4PO1A 5DYIA 1S8FA 5B30A 4TLEA 3NXSA 1CJKC 4X8LA 3G82C 2XJ9A 1MO6A 3QG5A 5FPTA 2IHBA 3DZ8A 1NIJA 1E2NA 1Z3IX 4NYIQ 3CRQA 1Z06A 2J0VA 1O3YA 2OFOA 4G5SA 3N2IA 3RS7A 3CM0A 1GUAA 2EFCB 2R6DA 2BC9A 3DKVA 3PEVA 1GFIA 3RWOA 4OI0A 2FN4A 2GK6A 1P61B 4TWZA 3N70A 4V0ME 4B3XA 2ZANA 4B75A 1R2QA 1E0AA 1OXUA 5M04A 3IGFA 3B82A 2VSFA 1G291 2ATXA 4N1AA 3V9PA 5JCZA 2OAP1 1NJFA 1H8HD 2X1VA 1NVVR 2VPPA 4MGZR 5JRJA 2DFTA 2BJWA 1SHKA 2G0NA 3TIFA 3QXCA 1E2IA 2ZU6A 3VAAA 3W8NA 2D7CA 2O8CB 1RJ9B 4RD3A 2ZU0C 4HLUA 3EC2A 1CRQA 4G5QA 3IIJA 2PH1A 2Q9BA 4K46A 1P2SA 3Q7PA 3U44A 1YHNA 2OXRA 2JJ2D 4OHZA 4DC9A 5JHGB 1XXHB 3W6OA 2XNDA 4LY6A 3I8XA 2GEUA 4O0MA 2LCFA 4TL9A 4QRHA 4DUGD 3A8TA 2IXEA 1OFHA 2J41A 2AFIE 3L0OA 1KNQA 2G3YA 4ILEA 2C04A 3ZQ6A 1YR6A 2Z83A 4TT3A 4A0RA 4TYYA 3ZVLA 1Q21A 5CJ2A 3UK6A 5FL7D 2VP0A 3CO5A 4QM6A 2AR7A 1F60A 3W90A 4Z54A 1WDTA 1DBSA 3CRW1 4PPFA 2IYWA 1Z22A 4TL7A 2CHGA 2D2EA 5HR5A 2ZE5A 4M9XA 3BE4A 1IM2A 4C0AC 4EQ6B 4WZ6A 3QBVA 2HT1A 1W48A 2DY1A 3SBEA 4NCHA 5E3HA 1FMJA 2VO1A 2O8FA 1NIPA 2F7SA 4GBMA 1KOFA 1II0A 1OT3A 2OSBA 3ZDQA 1N25A 2ERYA 1OH7A 1QG2A 1UEJA 1TQ2A 1KDTA 3TAUA 2AXNA 1J70A 3B1VA 4N3NA 2QBYB 1XB2A 2FEOA 4OHYA 3OE7D 2VP5A 4FIDA 3K0EA 3IHWA 2RHMA 3KTAB 4ESHA 1E4YA 2ZYWX 1ZM7A 2FFHA 1QVRA 1FNMA 4ITRC 5KSOA 4A92A 2HXYA 1KY3A 3BIFA 1KI4A 4Q1CA 2QNRA 3Q8XB 1RPZA 2EU8A 5EQTA 3SZRA 2V7QA 4RZ2A 5JSZA 4D80A 1QRAA 2Q0HA 5A5GA 1R5NA 1Q3HA 2QG6A 2MSDB 1LS6A 2ECKA 4TMZA 2IYZA 3ZYCA 1JR3A 4QJ3A 4NHOA 2Z5FA 3B13B 5KYKA 2XTZA 1XJCA 4PX9A 4AURA 3EA5A 3PR1A 1UKVY 2GCOA 3KZ1E 5DLQC 5KDOA 1GM5A 4Q47A 2ZJBA 4CEHA 1NY6A 4EPWA 1Z5ZA 4V0OA 2D74A 1IOZA 5G41A 2DFNA 2Z4RA 2DFLA 3A1UA 2A5JA 1TNDA 5FPYA 3Q72A 3GLFB 1US8A 2CNWA 4C2UA 1XDBA 1OW3B 1SGWA 2A2ZA 1M1YE 4JLNA 2B7CA 4NCKA 3Q7QA 2WAYA 2WJJA 4WAUA 1R8QA 3L82B 1S0UA 4DJTA 3HYRA 3KFXA 2JGNA 3IQXA 4DB2A 1E2KA 1T91A 3IIMA 1JAIA 2WWIA 2ZRHA 3P4YA 2RKOA 1GNRA 2VP2A 4NYMQ 1MABA 4JJZA 2O8DB 5J4HA 5IK2A 3SC3A 2W0MA 3VQTA 1EFUA 3MWYW 2F1IA 1VMAA 1JQJC 1GRNA 4KFSA 1VCNA 2F55A 1VHLA 5TB5A 4F92B 2C77A 1JB1A 4LYJA 3I72A 4RD2A 2WWXA 1XCPA 5SZHB 4Q9IA 1MV5A 3KL4A 1XEWX 2W83A 3BB3A 2RGDA 2ZTSA 4A6XA 1W0KA 2XOKA 1KMHA 1P62B 2XZPA 1GWNA 1KJZA 3KB1A 4JS0A 1E2PA 1Z07A 4UXHA 4XTCS 4MYUA 1NMZA 1SULA 1VECA 4IDOA 3BB4A 2ORWA 2ATVA 2QE7A 1ZUIA 3LVQE 2R65A 2IC5A 3IHLA 4MRPA 1UKYA 1Z0AA 3QKSA 4PO8A 4PHFA 3RVBA 1W47A 2DPXA 1GG2A 4XSGA 5D3QA 5IT5A 4PC1A 2NO9A 4DB4A 3ZD7A 4NYJR 1UFQA 4G3XA 4QNMA 5CK4A 2AWOA 3CR8A 4IFBA 1KAOA 2PX3A 4HEJA 2D2FA 2J3EA 4XWOA 3QF7A 1LNZA 3K1JA 3W3ZB 3BRWD 3SQXA 2JLSA 2H18A 2PLRA 3ZLJA 3A4MA 1Z28A 4BPBA 3LH5A 2YWFA 4WW0A 1P3JA 2ASEA 3TNFA 3ASYA 4OHWA 1JECA 1NLFA 3U7FB 1DVRA 1Q22A 1LW7A 2MSEB 1E79D 1EWQA 5FFMA 1SKYE 4LJ6A 1KY2A 3MSXA 4Q1DA 4QFMA 5KNBA 2W2XA 1Z2CA 2B92A 4Q7KA 1NL3A 3VHXA 3MRSA 3WNBA 4YMUA 3TJZA 4CEIA 1E69A 2IBMA 3ADKA 1QHSA 1G8PA 3L0PA 4ASUA 4CT5A 4BASA 3U44B 2MMGA 2PCLA 3CNNA 5JI3E 4M1TA 2QY9A 4Q1AA 3AP1A 3GFOA 1OXVA 5KDDA 3UWKA 3GLHE 1KKLA 4PO9A 1OIXA 3VR3A 2Q3FA 4PZZA 2J87A 4AKGA 4Q4JA 3OEHD 2WSSA 1LF0A 1U2RA 4IVQA 3TBKA 2PMKA 4B35A 1R0XA 4MRVA 4E03A 2Q21A 3WRYC 3QVUA 1XPOA 1G1MA 1NBME 5JWHA 2FF7A 1IAQA 1ZCBA 4MH0R 1P6XA 1RW4A 4I81A 2BWJA 4Q01A 4OJQA 3KQLA 1YU9A 3GLHA 1G4AE 2D3WA 3OZXA 1JEDA 3TR5A 1PLLA 4HI0E 3UKDA 4LHWA 4LPSA 5TVKA 5EXXA 1JAHA 1UKEA 3HJNA 1KK2A 2G0TA 3JVUA 1KJWA 2NO1A 2O8FB 2ZREA 1NBMA 5FOUA 2XB4A 1U8AA 4JLKA 5CB8A 1C9KA 1T5LA 3RWMB 2BIFA 3AVPA 3AP2A 3KKMA 4Q7JB 4ABYA 1KO4A 1Z0JA 2F1JA 1E9AA 1EGAA 2WJHA 3SJAA 4LOAA 1U99A 1IHUA 2CLCX 3RS0A 4QGHA 3AUXA 2WKPA 2JDIA 4A8JC 4AYWA 1XD8A 4ZIRA 3DVLA 1P7CA 2CDNA 2J7KA 5JSZB 4B3FX 1S9DA 4YQFA 4HLDA 3SYLA 1NG1A 1CJVC 4US0R 4DLWA 1IN6A 4UJ5A 2Q3MA 4A0FA 2ZS7A 2WICA 4JLJA 1S96A 1E2QA 1JNYA 2A5YB 2H16A 1ZNYA 3ZVRA 3T5GA 2NMVA 3NH9A 1KNXA 3EW9A 3D8BA 2ZRAA 3EZ7A 4LYHA 2GCOB 4V0KA 1DO2A 4CEHB 5B2ZA 2JIZA 2HLDA 1G4UR 4KFUA 1ZINA 2E1RA 5H70A 4I1OA 1OXXK 2ZEJA 3ZGXA 3ND9A 4MKFA 1VYTA 1AA9A 1US8B 4LJYA 2RH5A 2ZJ5A 3SI7A 3NBZC 1ZD8A 1T3SA 2ODNA 5EXPA 1Z6TA 1VCIA 4C0KA 5LD2B 3BC1A 2WBLC 5J4LA 5BYJA 2XTNA 5DHFA 3KB2A 4JLOA 4LBYA 4P3YA 4CDGA 1MABB 1T0JB 2O0KA 4LJ7A 3WHLA 3K0SA 1JR6A 2ZRLA 2CXXA 5LDDC 2IYQA 4FINA 2FGJA 1YVDA 3RSLA 1OLOA 1DAIA 4AYXA 2QROA 4IXNA 3F5FA 3X1WA 4FMBB 4EPVA 5AJXA 4JL5A 4PAOA 4DDUA 3V4FA 8OHMA 1F5NA 1OFTA 3ZS8A 3B1YA 1GNQA 4A2QA 5EP2A 1EFRA 2B7BA 1KMHB 4QHYA 4AY2A 3IO5A 4W5HA 3TUJC 3AKDA 4IJMA 1OPXA 2E87A 1BMFA 2GF9A 3CNOA 3SJBA 4HAYA 2W6JD 3QKSB 1SVIA 2WWGA 2I1QA 3EZ6A 4Q19A 2FPLA 1X3SA 3ZS9A 2GNOA 2IYVA 1GSIA 4D26A 4DCNA 1ZM4A 1IQPA 4PQFA 1Q1QA 3BH7A 1ANKA 3EZFA 2FDCA 1TTTA 4V03A 4PPQA 5FBVB 1AJEA 4NYIR 1SVWA 2HEIA 3VHLB 2ZS8A 2O8EA 4JLPA 1WBBA 1KO1A 5BWMA 1S3SA 5F9FA 1KYIA 5BN4A 1YQTA 3W5JA 2QQEA 2H8KA 2JJ1A 1N5LA 2BM0A 4M1MA 1T8TA 5DN6A 1XPRA 4TYQA 1OHHD 3THXA 4BRWA 1GDDA 1PLKA 2A7QA 3EPKA 2FWRA 4KBGA 3GPLA 3LFUA 3NH6A 4MKIA 2HXSA 5C2JB 3FOZA 1CLUA 4CEIB 2G1KA 1CBUA 4C0HA 2A5DA 1S1MA 4CYMA 4M2LA 4GSYA 2OFWA 3RC3A 3E70C 1SVKA 4LSGA 4EJSB 1IY0A 1COWA 1EK0A 4B2PA 2VP9A 1TAGA 2X19A 2KE5A 2H92A 4B3DA 5GJCA 3NWJA 4A4DA 5A4JA 1NLYA 3A1WA 3AVTA 1E9RA 4LC0A 2ZM5A 2MMCA 3MJRA 1S2MA 4Q4JB 2VA8A 4LRWA 4Q7LA 4LV5B 3UG6A 1C1YA 3AVUA 1TEVA 5JS8A 3NHAA 2QGNA 2PCJA 2ZYTX 1EG7A 3CF6R 3M1IA 1Q3TA 3DM9B 1E2MA 1NLZA 3IQWA 2VSOA 4S2EA 1DAHA 3GLHB 5FPHA 4FWTA 4NH0A 4JYBA 4Q9KA 2GXAA 5BYKA 2CL7X 5JJKA 3G5UA 3EZ2A 421PA 4OHXA 1SVSA 1ELOA 3PVSA 5FR1A 5ANRB 5C4GB 4A1FA 4LYAA 2JLYA 1VG9B 3FDIA 3OIWA 1YKSA 2Z6VA 1EX7A 1S9HA 5JFGA 2ANCA 121PA 1A4RA 1XFAA 4PHHA 2G9NA 1XTRA 1E2JA 1XMIA 2AHOA 2FSIA 1DELA 5AK0A 2BBSA 3THYA 4IDPA 4B43A 2BV3A 2OILA 1G3RA 4P4SA 1G7RA 4LV6A 5AJVB 3R9IA 2OLJA 3QPUA 3A6PC 1Z47A 3JVVA 3EWAA 1DEKA 3SU8A 4CVNA 2ZS9A 1E0JA 3T15A 3AH8A 3BFXA 1D9ZA 4JVMA 2BBTA 3PUXA 5FOTA 5E7JA 4B2LA 4C4PA 4CEJA 4RFSA 2XXAA 1G5TA 1G8YA 1LVGA 2SHKA 5KSZA 2HYIC 1IN7A 3KX2A 1Z29A 4OQFA 2ZR0A 2ONJA 3TR0A 3I8SA 1P9WA 1CR2A 5DIFA 2F9MA 5JECA 4YONB 4JMPA 5GJVC 2RGNC 1YZQA 3SNHA 2RAPA 3SFZA 2OLKA 1NVXQ 2A78A 4RFVA 2NZ8A 4UKDA 4PXAA 4BLTA 2F1RA 1UPTA 2X2FA 3K0CC 3GJ5A 4PC7A 1W0JD 4RCZA 4R71A 4TLDA 5IRCD 2VIIA 4B44A 4LGMA 4RZ3A 4BEJA 3N2EA 4D82A 1MO4A 4FN5A 3EIEA 1RRFA 4OK6A 1SVOA 3CX7A 3EIHA 4UQOA 3TH5A 1GKYA 4LUCA 4DVGA 1K5GA 3ZIAA 4G0NA 3G0HA 621PA 1Z6XA 2FNAA 1YZUA 4G01B 4O25A 2WWFA 4OI1A 2RGGA 4BLOA 1AKEA 2O5VA 4KSCA 1E2DA 2JJ8A 2NO0A 4ARZA 4GI7A 1MO3A 3F8TA 5EP4A 4EQ6A 2FZLA 3QIAA 3A4NA 1IJFA 3W9YA 1OFIA 3ICEA 4MGYR 3T61A 3H84A 2QPOA 1AN0A 3B60A 3TKLA 1XTQA 5AUNB 4EKDA 1E9CA 4GFDA 3LY5A 1KMQA 3LA6A 2OEPA 2ZAOA 2HV8A 1RC8A 3I62A 1M34E 5FTJA 1DARA 5HKKD 1M74A 3DOEA 4PHGA 2JLQA 4JBXA 2QAGA 2GK7A 2QN6A 4JT4A 1ZIPA 4E22A 3IILA 4NDZA 4KLZA 1UEIA 4BZXA 1OB5A 4JSYA 5F9HA 1E9EA 3CONA 4IOLA 1ZM2A 1XRJA 2QU8A 4F7WA 3F0TA 2NTYC 4HLCA 1FP7A 1JEEA 2RHDA 2ZR9A 3D3QA 2XTMA 1UDWA 1X8LA 2YOGA 4XWAA 1ZU5A 3QXSA 3VU9A 3OE7A 5H68A 2VHJA 1NP6A 1OSNA 3B7GA 2O8EB 1A82A 4HAWA 4Y0AA 1BYUA 1Z0KA 1G7SA 1W36C 3PCRB 4IOJA 2YINC 2BMEA 4B3GA 2YHSA 2Z4SA 4KXFB 4TYPA 3EZ9A 4WIAA 3RRMA 4W5JA 4EDHA 3A1TA 4LJ9A 1GITA 3FHOA 4DWJA 2J59A 4HB3A 3THXB 4C2TA 1UBGA 4BLSA 4NL4H 3PEWA 1I2MA 2I1VB 2XSZA 1NKTA 3L8ZA 3PQCA 2QRZA 4GP7A 5HCIA 4LJAA 4GP6A 4TTQA 1X6VA 1DO0A 4Q9HA 2C9CA
chains in the Genus database with same CATH superfamily
4ARIA 4N0EA 3PJFA 1DXYA 1WDKA 3H5WA 4HZIA 2HRZA 4FFOA 3R74A 3SDZA 1FS4A 1FFDA 1P7YA 4AG3A 1QIMA 3ZD8A 4E5UA 4LXTA 1WSDA 3U3KA 3R9XA 3OEEA 2BHTA 5ALIA 2QAIA 4A91A 4N3CA 3S1AA 4TROA 4GPTA 5EQFA 3KUXA 5LYJA 4O2RA 4BB0A 3ZHCA 1NJ5A 1DHRA 2WIGA 1U5BB 4US1R 4DDTA 3Q3IA 3OI7A 1R5BA 3DHVA 4JQZA 3GROA 3T34A 3QLJA 4CKEA 4QQFA 5LQKA 1SBHA 1M6VB 2H31A 4IWNA 3VR2D 1F0PA 4KLNA 4JX9A 4OQ4A 4EI2A 1EVKA 2YV1A 2PJZA 3WLHA 4BX9A 3LXUX 2AD5A 2B1JA 5EP1A 3L4JA 5DCUA 3L7LA 1RIIA 1F2UA 1I6LA 5AHXA 1NBAA 2FXIA 3PTAA 4HNQA 3IEMA 1EDDA 1Q20A 3N8HA 4ARBA 1K6MA 3HZRA 2ECQA 3FR7A 4FEEA 5JRDS 2H3EA 3WMXA 3ZCQA 1OYVA 1TT5A 2BMDA 2GZ2A 1G9XA 1ZNZA 1GGVA 4JELA 2BHLA 2B36A 1Q7RA 2OGTA 3ITNA 1B6GA 1CIPA 4DA9A 3LMKA 2IEDA 1A5TA 4YCDA 2H17A 5DMHA 3SXUB 3THYB 1M5RA 3P20A 5BMVB 1DDIA 4DCJA 3HFSA 3IAS6 1GPH1 3BAFA 4MV7A 5L4LA 1MIOA 2XBUA 3DWGA 3RRZA 3OAAD 3NHMA 1HOXA 4RL6A 3TO5A 3PDWA 3DMFA 2PQ2A 3L40A 3QBDA 4BFSA 1L3CA 1EDZA 2A5LA 1NQVA 4NH4A 1XWWA 4M9RA 1R8SA 2AE1A 1M1NA 2E9SA 2QTHA 3LXMA 4IV8A 1EESA 2GO1A 1QIFA 3UJCA 3AY3A 4REQA 2XXAB 5LQAA 3OQOA 2VCHA 5EWJB 1BMTA 2P79A 1BD3A 3O8LA 3TIGA 4WXMA 4MHSA 2DHRA 4MYCA 4UMDA 5FWNA 3HNRA 1MXHA 3JYNA 5JAUA 2YJ3A 3U7JA 5BR7A 3VTKA 5A0VA 4BS9A 4IDNA 4KTTE 4PPGA 3MOIA 3IT2A 4FBLA 3WZMA 4D2IA 1FSZA 2P1DA 1FDIA 2HXGA 3AB7A 3FSEA 1W1WA 5CHYA 4CMIA 5IM4A 3EEQA 3QV2A 4KQCA 4D3XA 1JNXX 4PZUA 4EW1A 1OPRA 1TU4A 4B32A 2PWPA 2CE2X 2I22A 5ALZA 1GKUB 5FO1A 2W9XA 4C22A 1W36D 4LK3A 1UM8A 1DE0A 2QZSA 4J7CA 4F3RA 1THGA 4HNGA 3W8EA 2GD2A 1LRKA 1LK7A 2XB9A 3Q8MA 2DB3A 3GGGA 4F4IA 1FLNA 1YKFA 4WN9A 4WNAB 1EFAA 1XEWY 1EUQA 1LKZA 1PT8A 3B9PA 4QDXA 4RDIA 3J7TA 5HKAA 3UPUA 5I7WA 2IS1A 1RAFA 3D4NA 5CMLA 5K2OA 3F4KA 3TLXA 3JATB 2VXYA 1YRAA 5GONB 1CS4C 2LCIA 3PJGA 1YCHA 3M4NA 1KOLA 2R60A 1J0DA 3L1JA 1GPBA 1FA9A 3ELDA 4F21A 3J80A 4GE3A 2C3OA 1J49A 2EZTA 4GOXA 3U3ZA 4XUDA 3QENA 4ZVKA 1PO7A 4UW9A 5CG1A 2NIPA 3N1UA 4GXRA 4IIHA 2J9FB 1CEQA 4HNRA 1N77A 5AI5A 4AP5A 4AY6A 3UT5B 1J8VA 4N39A 5ALUA 3A32A 4JDUA 5H3CA 2Z2IA 5IAJA 4XR9A 2G1UA 3EWNA 4LDAA 3W05A 3MTGA 3UV6A 2AXQA 3L8HA 4BO1A 4EKDA 4PZAA 4PYRA 4U0KA 1K5DA 3GFGA 4AWXA 1WHSA 5AIBA 3PUWA 2I8AA 2EF0A 4LI0A 1IXZA 1N6KA 1XU4A 4ZI3A 3IEIA 4XOIA 1QWOA 3TIIA 4KUHA 2VDWA 2Q3DA 1U8YA 2QL5A 2QK4A 4IG4A 1Y9DA 4C88A 2QA5A 2NYAA 1EDOA 1VTKA 1JE0A 1GUFA 2DGDA 2FY8A 2WF5A 3EXHB 3FETA 3NIDB 5BSRA 5B2FA 5LUAA 4GZ6A 3KT6A 5FEMA 1TJ5A 2OGWA 2NM0A 3A6LA 4GWGA 1IDOA 5JS7A 5I4IA 4QYIB 4W9NA 3EQZA 3MGCA 1NPYA 2Q3HA 5JR3A 3KXLA 3TKYA 1RRGA 4LGYA 3S27A 1G5RA 3BWXA 2CUNA 2YS6A 1CJSA 3C4VA 2VRCD 3CNLA 4HDAA 4IVPA 1KHTA 3V1KA 1K1EA 3AHGA 2QM7A 4Q3KA 4TM7A 3UMSA 3W78A 3RS9A 4AP9A 4WBNF 1YIAA 1KR2A 4NI5A 3P2IA 5DSZA 4PNPA 4BNZA 2O1SA 1K68A 5DNYB 4JOQA 4TLAA 1EFLA 1TLTA 2ZRFA 3KUDA 3R7WA 1S7GA 5FBHA 3QPBA 5L3ZA 4FLEA 1OXSC 2P6RA 1BDIA 3WWPA 5TPZD 1DS6A 1I4TD 3FPSA 2A35A 2M6LA 3HCCA 1WSBA 3A4TA 3OT4A 3DW3X 2CEAA 5HZHA 4HMOA 4BMNA 1CVRA 4J29A 3WQRA 1REQA 4MVJA 3LQ2A 3GBSA 5DTEA 3BL6A 4YMLA 3VO8A 4BNNA 2I67A 1YVEI 3FFAA 3VU8A 5BVHA 5GJBA 2GUGA 3EZLA 2ISSD 3HEAA 4H27A 3RIMA 2I8LA 2A3NA 2BR3A 3LT1A 1UDBA 2HA7A 3WYFA 3T9AA 5IPFA 1RXWA 1J8YF 4OV6B 3NMUF 2GR9A 4OAOA 2VKTA 2W5UA 3UXMA 1AZTA 3RG8A 2G9ZA 1DAPA 1ZK2A 4QGFA 3RABA 5CFLA 1YK1A 3ABSB 1B6RA 1A71A 1TYAE 3GDWA 4F56A 3T5PA 1ZVVA 1OXMA 5TJHA 3E1SA 3JQ7B 1XD2B 5ALVA 5F23A 3MCWA 5A05A 3A37A 3Q7TA 3TYXA 1F9EA 3PK0A 3W9BA 3ADDA 1KVRA 4O8ZA 1PV4A 2ACVA 4DLZA 2G17A 1AHPA 2CLDX 3TEJA 3ZLVA 1H5UA 4O33A 2I87A 4RTQA 1IHYA 3CR3C 1DO8A 1KC3A 1B00A 3WLFA 4H6XA 1OAKA 4ZU6X 1BH2A 2R6GA 3KD2A 3N6RA 1E2EA 5IDVA 2FOXA 4CODB 2EQAA 3FG9A 4P22A 4OL0A 1IXRC 2WVAA 4EMUA 4P4TA 1XZPA 4W5TA 5CDUA 3HL0A 1HYGA 1Q11A 1IY2A 4BJ6A 2RH9B 1EX6A 2PKEA 1Z7BA 2XPCA 3GQBB 3BSSA 1WLSA 2VZ9A 4O4JB 4R1NA 3SE0A 3P4UA 1UDCA 2G6BA 5D5QA 3S28A 2E5WA 1CUFA 3DMTA 1NNUA 1O03A 2WMDA 2HT6A 4G4GA 5FPQA 3VISA 2FEAA 5L53A 5KNDD 3THWB 1C9NA 2LIPA 2Q9CA 3UMVA 4J91A 4PSAA 5GIPE 1CUWA 3T3PB 4NESA 5L3SB 2UU9B 4KIFA 1ICIA 3L7KA 4G41A 5JJCA 2RE8A 2V4UA 3G17A 4NZYA 3RU3A 4BJ3A 4E7PA 3A6DA 2WMOB 2Z30A 3K16A 1ODLA 2CL6X 3PA8A 4C2BA 5B4VA 1OI3A 1Q74A 5CEJA 2N75A 2F3QA 2ZPAA 2FFBA 1DUVG 3RHTA 2QUBA 2WK1A 3U6BA 1O0BA 4Y0NA 1AD2A 5CFZA 4ARCA 5TGTA 3W6ZA 4CF3A 2PUBA 3WFIA 1XVVA 3W7BA 3L0DA 3VX4A 5GVSA 1LW6E 1R4AA 4BZPA 1KMNA 3GR6A 4L5BA 4UDYX 2YYAA 5EJMA 2R48A 1TQ8A 4EG6A 4M1OA 3RS5A 1PJ2A 3L07A 3T3HA 1X8XA 1EH5A 5C1DA 4B40A 3BEDA 5FOXA 2X5JO 4JN6B 4K6KA 4EHJA 5BUZA 1B0PA 3G1UA 3KELA 4OB8A 2W2KA 1A2QA 1CNFA 3AW8A 2GCEA 4LYDA 5JDCA 4CPDA 4RV4A 3BICA 3BD7A 4PU0A 4F93B 1B1CA 1KYQA 1Q1ZA 2HRQA 1U2GA 3GMIA 4KN6A 4Q66C 4URZR 4ZV7A 1XE3A 5BXQC 4DT1A 3ASVA 1JPNA 1RXYA 3EY9A 4WKBA 2DY0A 4JOCA 3PD7A 4I0WB 5FTWA 3HKEB 2L69A 4D44A 1ESNA 4X7BA 3HDVA 1FTSA 3SMVA 3OA2A 1AQYA 2HZ7A 2GBPA 1THMA 4EJSC 3HY6A 1KVTA 4RY9A 5FI1B 3ZE2B 5CB0A 2XMRA 1C3LA 3VR0A 3MWJA 3WIVA 3I3OA 4DIEA 4B6FA 4UASA 4Z8YA 1RAHA 2BGNA 2YX1A 4OUDA 1O4VA 3UUWA 2JFWA 5EMMA 2YXEA 4FX2A 1L5HB 2HSEA 3A4YA 5A03A 2OE2A 1FBNA 3IURA 2EWVA 1PFQA 3NPAA 5K3DA 2AR0A 4M9ZA 3SVZA 3ESZA 2V7UA 1HETA 1PG2A 2A14A 1TVKB 3TW8A 1K06A 2ZGVA 4JLDA 4DMMA 2EWWA 1XC7A 3CZ9A 1GZSA 3QI2A 1DV1A 4IGFA 4L1KA 3K70B 4YCLA 3D5TA 3BTOA 1J42A 3D5QA 3HEMA 4G89A 4S35A 1FFYA 2X77A 4EBFA 2BI7A 3IDFA 2XR1A 3DFIA 5B1YA 3UOWA 5BNZA 4N47A 3Q7SA 4FCTA 1SC6A 3NNDA 1HDOA 5LPNA 2Q4DA 5ARDA 2B6NA 4L07A 1OLSB 3THOA 2C4MA 4D0RA 3GHYA 3H5RA 5C53B 3AGQA 4D8UA 4Q48A 1IHXA 1OX5A 1SHLA 2BM9A 2VSNA 2XOKD 2H2GA 3B2EA 4L4UA 2PNJA 3OH8A 2Y1GA 2A0YA 1YGYA 3LWNA 4LWOA 3P0FA 4KQXA 1FL9A 5B3JC 2NQTA 1TVEA 2Y0DA 4YHBA 3MS4A 2D5LA 3E15A 4F1WA 2RCNA 2QE7D 1OILA 3X1YA 1UOEA 1BO6A 3OT1B 4AJEA 3NWPA 1LQUA 3GXOA 3OZAA 4EF5A 1S89A 5TRTA 4P32A 4X85A 4KX5A 1XRRA 2IK8A 4B4VA 1ZP6A 2PZFA 4PQRA 5EHGA 2GVNA 2QP9X 1P1IA 1U0HC 2Z09A 4HUQB 1FX0A 1J97A 1G64A 2BH9A 3IIIA 4MV9A 2EZ4A 1LS1A 1N0UA 2IKQA 1OYWA 1NYQA 2IT1A 4MITA 4TV9F 3BFVA 1NF9A 1IUKA 2BP7B 2KBEA 3C70A 2E6KA 4GMXA 5B57C 2IYTA 3K32A 5AI9A 5KSPA 3UGKA 1Y3CE 3KJEA 3VGJA 1JLRA 4AZWA 3WWYA 1S4QA 2A0XA 2LTAA 4H59A 1CLEA 2CZQA 3Q10A 4WOPA 2LR0A 2UYGA 4C08A 4C7BA 3IMFA 3RLIA 4YT8A 3IMKA 3GNQA 3TJMA 3LTNC 3QX3A 4RADA 3PQ4A 3RVJA 3VKGA 5JMTA 1KSJA 3LX5A 4MO2A 2XMSA 1RWOA 2BUAA 3GAAA 3DHWC 5IN4A 4TTTS 5KOIA 1FJ2A 2D2IA 1ZW1A 2FEWB 5CLQA 4ZHSA 1BWRA 1XNHA 3COWA 2XCIA 5BW8A 3ACCA 4IO1A 5EIXA 3FWZA 3IP8A 5FB3A 1DJMA 5TARA 3N2YA 3ZV5A 2Y1DA 4IJ5A 4PFSA 2IY8A 3UMFA 3O4GA 4W8HA 2B4QA 1J9ZA 2YH2A 4F45A 1NY5A 5BWLA 1FB5A 3AJDA 3CJRA 1QMGA 2ZTUA 4O2BF 1P5ZB 3HY4A 3QFFA 1V5WA 4XWKA 1D0IA 3NIBA 2XT6A 4F4UA 3OEWA 4U2DA 3L18A 5CA1F 5E8JA 3L0CA 1KI3A 4HNAB 4CIVA 4JIMA 1L4FA 5BT8A 1KIFA 1A1VA 4YACA 3H2BA 3ZI0A 5JFOA 5B5SA 1KO7A 4NU6A 1CIJA 3AEKB 4D8WA 1QIJA 2WSSD 5DX0A 3E2PA 4U2KA 2AOWA 1R8XA 1VKJA 2ZRPA 4FFBB 4YRSA 3O4FA 5K3EA 3UJNA 1QYXA 4TSRA 1RLIA 5E2IA 1F14A 1LPNA 3DT6A 4DMRA 5JLJA 2PE5A 3A9TA 4WK0B 5JG7A 4RTRA 2WM3A 3VTAA 1ECCA 5LQDA 2YWRA 3WL7A 4AUNA 3G68A 3ICCA 1YQUA 1L4UA 1TCCA 4H3KB 3UWPA 2E4AA 5GV8A 5FEUA 4Q3AA 5C80A 1Q44A 4JBWA 2NADA 1HMYA 1XTTA 2HJHA 3RBZA 1T29A 3DNMA 4B4KA 2YVUA 1QHNA 2NPIA 2ZT5A 3LYUA 4KV9A 4MINA 4PG7A 3WLAA 2QLMA 2ZJ8A 4LGCA 3MJTA 1NBMD 4R05A 4X41A 4Z2YA 1HTTA 2HEGA 6ADHA 1SUCA 1T3HA 1SKYB 3JQBC 3LP5A 4QDKA 2H5JA 4YJHB 4PWYA 1DCFA 2YASA 1WDMA 4H0NA 3KAPA 3UFBA 5K2MA 3T7KA 1NNSA 5DM1A 2GAJA 4MQFA 4DIDA 4MUAA 1GZDA 3H13A 1OREA 1GR1A 3KTDA 1OASA 1W94A 4NONA 3DTVD 4JSTA 2BGJA 5HG0A 5LXTB 5AVXA 5IU6A 5L7WA 4AQ7A 3K6RA 3DHNA 2QORA 3ZDBA 4LY3A 1VPVA 1E4OA 4JUFA 3WGQA 1RXVA 1IM8A 2AUMA 1YTUA 5EZ6B 2AWNA 1DC4A 2A84A 2QMOA 4UBNA 4MQMA 1G6KA 2JH9A 1CTQA 1A50B 1Z73A 1GFWA 3ANNA 4B7UA 2PSJA 1T9BA 4LYGA 1N2HA 4UTVA 3EIOA 4UTOA 3GK3A 1M83A 4XVQA 3EEOA 2UYOA 2A1TR 2GILA 2YMQA 4AJNA 2W2TA 2CWWA 4X1IA 3RTDA 1G8SA 4ZANA 5IEBA 2EIHA 4TQ9A 1Z9BA 3OLCX 4MVJI 4W1QA 2H9YA 3RVNA 2LDXA 4R2LA 4BYGA 4IXMA 2PKWA 4FMPA 2C61A 2ZUDA 1T35A 2IW3A 3JQFA 3LHFA 4G36A 3VSBA 3W1WA 8MHTA 3MF4A 2ODBA 3N2KA 3OG9A 2BGUA 2VATA 4WFQA 4HATA 3TOVA 2JIBA 3IHKA 3RDPA 3V2GA 3U1VA 4U5XA 3Q9UA 3BK7A 3P52A 1ATIA 1I5EA 1PP4A 1PR9A 3GEDA 3BMCA 4QC2A 4Z9FA 3W5CA 1A98A 5H4HA 1T5BA 3C7KA 2GEBA 3UAOA 4M98A 2FEMA 3TNLA 5A3SA 3HJHA 4Q15A 3CKKA 1WRBA 5F21A 3GUHA 3VOBA 4CZ2A 2QTTA 4P7BA 3O1HB 3A10A 3ZD6A 2PXCA 4P3OA 1AIPA 2GNPA 3KKEA 2VKQA 3DTTA 3V4PB 2D13A 4PLHA 1OVGA 1NJGA 4E2WA 1YA4A 1XEAA 2OO7A 1UZAA 4U7PB 2ZUWA 2C99A 4QHSA 3WSTA 1SY7A 1Y8CA 5ICEA 3FD8A 3HCFA 1QP4A 3TRDA 1JWBB 2ZVPX 1X1QA 3FROA 1HEIA 3FWKA 2QRVB 2H2WA 1E64A 1B23P 4A10A 5ER6A 2SECE 4M9SA 2GJ4A 1NF3A 1VXRA 5THQA 1H8HA 3NYRA 4KYIB 3TB4A 1UKAA 1A5ZA 4KC0A 3WWOA 3ZOZA 4WUTA 4ENTA 1P5RA 1P81A 1X94A 1PFKA 3KL2A 4YAEA 4RETA 3BKWA 3O93A 4GX2A 1GV0A 1YO6A 3KLPX 3LPMA 5EZYF 3U3RA 2IEBA 3I42A 1K8RA 1FZTA 2EFEB 3BMNA 5HRUA 4R8VA 1VE9A 2GXUA 4Y9TA 1BHQ1 1RWBA 4Q5IA 4EUSA 3KCNA 1EB8A 4KPUB 4YDSA 3K0AB 1CJUC 4KQWA 3MZ0A 4BV8A 3RT7A 4FX5A 1RLOA 4AWBA 4JT2A 1V5EA 3DAOA 4FFSA 3GBVA 4ZGBA 1UCFA 3K94A 5IULC 2YW9A 4XGKA 1AM4D 3H1EA 3DQZA 4JB3A 4Q9JA 5ERYA 4B8WA 5FTLA 4NDAA 2F43B 3P9NA 1LBEA 2WDPA 3HBMA 2G5GX 2EX0A 2BY4A 3G0OA 3I6BA 4O4IB 2QQGA 3H5VA 1XCOA 2QTAA 2HMVA 3CUWA 2V6BA 3L7BA 1IAVA 3OPQA 4H15A 4IKPA 4QOSA 4Y8VA 3PA6A 5K0SA 3QVXA 1EIWA 3PNBA 4LHSA 4RACA 3TFWA 2VHQA 1EE9A 4DNPA 1YFJA 2FEPA 2SCUA 3LCMA 4AKEA 1OLUA 4AS2A 4YC7A 3A3OA 2JH3A 4YP9A 4AKIA 4G9GA 3C97A 4TQAA 1UK7A 5IFKA 2JFZA 2R25B 4H9GA 4RJJA 4MYRA 4PN3A 3F9IA 1R0WA 1QOPB 4R16A 2O5EA 3MFYA 1BRTA 2XA9A 4G26A 4YQZA 3TSYA 1XNRB 2B9VA 4N6GA 4NQRA 4TZ6A 2CDAA 2P4UA 3I09A 2QRMA 2CMFA 2G08A 3NFRA 3WRXA 5GQSA 2CWDA 2JLZA 3BJZA 3HYTA 1NRWA 1HDRA 3IR6A 4YDHB 3T12A 3HVIA 1HRKA 2BRUA 3PEFA 5G4KA 4CIDA 3PQDA 1SK8A 4AJIA 2HGSA 4JJ7A 1UKCA 1COWD 3AVXA 2E0IA 2J30A 4KXWA 5ADVA 2E4ZA 5A7FA 3T1TA 4OFBA 2P4EA 3GEGA 3QU9A 4FT4A 4DJJA 2R2AA 1RFGE 4ER5A 1NUAA 3NHPA 4IGKA 2PMCA 5K4AA 5BW4A 2R751 1AT1A 5K4GA 3ZKAA 4GBGA 1Y8AA 4YP1A 3IS3A 1U2DC 3D1LA 4EY7A 5CB4F 1JYFA 2NLOA 3LC2O 3RYFA 1J0BA 3WYNA 3R75A 5ICGA 4J3NA 2W11A 2QAGC 1E1RD 2CLHB 1WOYA 5PGMA 3NHZA 2GPSA 3JQGB 3QGMA 3U61B 3CFYA 4RWZA 4MIKA 1AKQA 2PUHA 4RKRA 3V1YA 1WUIS 1H3FA 1TGYA 1P2DA 3HPRA 4LBZA 5LMCA 1CF2O 3HB9A 4YRGA 1NZFA 1XZJA 4YJ3B 1T9CA 4BLUA 4YR9A 5EQDA 3RKRA 2O8VA 3L0YA 1OH5A 4X3OA 4CHGA 1IONA 3EFOA 3VNAA 1V1RA 1SUFA 2AC4A 2Y2UA 1LPSA 1CZKA 4Y7CA 1K0FA 2BFDB 1J24A 3L02A 2ID4A 1UAGA 2JHAA 3DG9A 4FQ8A 1SHZA 4QTUB 4EPTA 4NSNA 2ZWMA 5G40A 2ON6A 2VHEA 1MP0A 3TF5A 2YR0A 4DMLA 5E6RA 3NAQA 1JA9A 1BE8A 2FP4A 2PT7A 4O3FA 3OE4A 4AJHA 3VPAA 4F8YA 4ZYLA 3RPEA 1QSGA 2J67A 3NC1C 3Q2OA 5DHUA 1GDHA 3ILYA 2REXB 3K05A 1J56A 2GRAA 3LXXA 4I5GA 1SEPA 3D4LA 1MMFB 4F6CA 3IYLW 2VL7A 2YZKA 2HHLA 4MPDA 1TYZA 3EXFA 4OVKA 1MFZA 1T1EA 2AMYA 1WJGA 2P0AA 4DJAA 4JBNA 2BZ1A 3CLVA 5ESRA 2QRKA 4Z3DA 1OC4A 2GZRA 2WJZB 2AVDA 2WM9B 2A33A 2W2PA 3DVRX 1WE2A 5G1OA 2X3FA 5E7IA 6REQA 1IYZA 5AVRA 5CM9C 3UXHA 2QLTA 2JHCA 5HOQA 1NVWQ 3NJ8A 4LPKA 4BTEA 4O5OA 5ALNA 1M5UA 1TCVA 3U9SA 3ZE0B 3A6KA 4WLOA 4EO9A 2QTVA 3JY6A 1NNLA 3VNSA 2Q2QA 4PLGA 2YV2A 2JEZA 1X80A 1N1DA 3LQYA 5CXUA 5IJZA 3PGKA 1K8QA 4BU1A 1Y6RA 2NYVA 2FU5C 4IXTA 1HSZA 4KFTA 2PUFA 2RGCA 4CKXA 1NVKA 2IY7A 4L3VA 3D6MA 4N5HX 1WXGA 3AF4A 3DPUA 3PENA 4IIXA 4MRRA 3KQYA 4JB2A 2PSEA 1WQ1R 5H59A 4J1TC 3WYAA 3DOIA 3OQPA 1BS2A 2BKXA 4D9FA 2CMDA 4LX8A 1JEQA 4ZZ2A 5IJ0B 4QOJA 5KYGA 2HWYA 1D2GA 2XUHA 4LMAA 4OQLA 3OX4A 5CIWA 1EFDN 4FI3F 2FVXA 4ITUA 1NFQA 2OOKA 4L9AA 4B9AA 5LOVB 1YA6A 2FZCA 4PC3A 4BGUA 1P4AA 1E99A 4HDNB 2JFNA 2VDNB 3H6GA 1UK9A 4BMDA 3VA7A 4PGFA 2Y4NA 2JAQA 5JJBA 2FN3A 5LMNB 4RIFA 4MP3A 2VH1A 1G5FA 3EGXB 3LE8A 4ZU1X 5T3UA 4OHFA 3V9AA 3KSAC 1QZZA 2IF2A 5TV2A 5C7LO 1ST3A 1NXPA 3EEIA 3WL6A 1U2EA 1GKIA 2BVNA 2XADA 1ISHA 3OLXA 2QN3A 4XCVA 3UJPA 2OP1A 1II8A 1Z15A 2FFQA 2VNHA 1XN1A 3C5WP 1JGTA 2RG1A 4UPDA 3VR4A 3B6IA 4YP5A 3QQ5A 2VJPA 5M29A 1KI8A 1ZC4A 2BDUA 1ZYUA 2WJIA 3VDQA 4YO8A 4ZOLB 2YV5A 5JQGA 2XEXA 1E7WA 2LW7A 4M3NA 5BY2A 3T1QA 2QZZA 3ORHA 4XA8A 3SFVA 1ZWLA 4PZCA 3BFJA 2CCKA 4C6RA 1YZHA 1H6BA 4MGKR 5C4IA 2G4LA 3IVAA 3EN0A 3MUFA 5CYPA 2ECPA 2XYPA 2HU2A 2IYLD 1A8SA 1KORA 3VZDA 2ZYVX 1UJNA 1JR3E 4ZO4A 1QLHA 3GGCA 2WMYA 1XZNA 1U11A 3B3JA 1LH0A 5FQOA 4LQLA 4C87A 3INRA 1MX3A 3AY6A 1FRZA 1JHUA 3NC0C 4ISCA 3PKJA 1CPYA 1JQBA 4PC6A 2V1UA 3EIQA 3AU9A 5AIAA 1UF9A 1Q7GA 4LDJA 4N5LA 4GLOA 3ZHYA 4C2AA 4D6YA 1Z62A 1ZICA 3PUYA 4MUXA 3U7IA 3ADCA 1T8YA 2MSKA 3OIFA 1JTVA 4MVXA 3N8NA 3FDZA 4RHUA 1V16B 3G0DA 3O82A 4JUIA 1M2OB 1AKTA 3IUEA 4FGSA 2QJWA 1Z6GA 3AILA 4Q93A 4TZ0A 2PWZA 2ZRMA 5T4HA 1L6IA 4BMVA 4GKKB 3V1UA 1W73A 2W48A 1K7EB 3DKIA 4QYTA 2QR5A 3FH0A 3OEED 2QMZA 2YXLA 3KSRA 3NBKA 5LQSA 3H83A 4IEFB 4ZO9A 1IXYA 4L85A 1UXGA 4XQEA 2F67A 3FPFA 3P1JA 3PL5A 1ZITA 3W8FA 2O7VA 4NMXB 1QQ6A 1SZDA 1OYYA 1R5OA 4UXIA 1QFYA 1TYDE 2C20A 1OI7A 1PK8A 3IDOA 4QG7A 5CT4A 2PH5A 2CKMA 3S2UA 4DILA 3WDKA 1OI2A 3PUZA 3GGPA 4HT3B 4MA4A 1G6Q1 3O9ZA 3G2PA 2FJPA 1BEEA 4GOND 1AKYA 1XK6A 4K6FA 3L6CA 4XPIB 3QBTA 3PT5A 1BVHA 2OA0A 1RHMA 4NU5A 1NVGA 3WNDA 3C1OA 4FDUA 2ZUUA 3NTLA 4W9NC 4TV8B 2ADFA 5E1OA 4AF8A 1N36B 2DQKA 2ZB7A 4MLPA 2HGZA 5DI9A 1Y3DE 1IMOA 2J5BA 3AIOA 4WKNA 2I7CA 2YN4A 1JDUA 3ISJA 3KYIB 4FW8A 4IS3A 3RFXA 4CIYA 2B21A 2MYNA 2FSPA 3DLTA 1MX1A 3FY4A 4FC6A 1Z2OX 2HK6A 2PV7A 5TPWB 1JQ3A 1UZUA 1WZNA 1KTVA 5C34B 1A9RA 1CDOA 1QTRA 1TAHA 1D6JA 1ZUWA 2I4LA 2OAQ1 3LO5A 3OBBA 4LEIA 3GZJA 4L4RA 1BJKA 3QXJA 4BV2A 1BS9A 1E92A 4MCAA 3EQ7A 3NHRA 3LFHA 4KEAA 4QPPA 5ELXA 4BGIA 4F4FA 1USWA 4PYNA 3FYCA 2HRRA 1YR1A 1ORIA 4G1VA 1PE0A 3DMHA 4ZKDA 1QU3A 2C9YA 3MB5A 2I3BA 4EA7A 4KDCA 2IBSA 2P3LA 2DHEA 5B1SA 1W8IA 4P34A 3DZCA 2TYSB 5D00A 4PGMA 1WL8A 4IYRA 3NEAA 5K99A 1C50A 2VDRB 5TQJA 2OV2A 1XKTA 5EP3A 1RYFA 3ORFA 1X70A 1PZMA 3OZIA 3EW7A 1ACLA 2HPZA 2X76A 2VPYA 4PWZA 4G0VA 3KR9A 3K96A 1G2QA 1P73A 1QRSA 4IILA 5K8TA 2OM2A 3NPMA 4N41A 5DBOA 3RRYA 1P77A 3V4RA 2ZRKA 4YIHA 4D3SA 5DZSA 5JJ5A 1KAGA 3CG4A 4EGAA 4DBLC 3VR4H 3FB4A 1NXWA 1TF7A 4MP8A 4YALA 2YN0A 4IRMA 4CQMA 3EUWA 4P3PA 2ZI5A 1NV8A 1PQUA 4OMCA 1R12A 4M88A 5F4BA 4S1TA 3QE9Y 4DCUA 2D8AA 1XTSA 2A0UA 3TLGB 2IYUA 1K0UA 1N7JA 2R4TA 3RAJA 1FDWA 4CMGA 2DERA 3G8YA 5C9ZA 5BO5A 1L6RA 1XQ9A 4KFRA 1ZCJA 4DNXA 1N6NA 1O8CA 2G8LA 4CM8B 5HSGA 2HCRA 4EABA 1JU4A 2OVFA 5HDQA 1LDBA 5BOVA 5SYMA 3VH1A 3DMTC 5LKAA 3HDHA 1WF3A 3KLBA 4G5OA 1WMFA 3EYAA 4LXHA 4F7DA 2XWQA 4OHKA 4UARA 1KWGA 1NZDA 1Z5GA 4TS3A 5EKDA 5EHXA 2IU6A 1ZGCA 5J2TF 3GRVA 2GEDA 1OHHA 2AL7A 1L8OA 2OYSA 5C32A 3O4HA 1SXPA 1ADCA 4U00A 5H80A 2BFWA 3TLKA 4ER3A 3CZ5A 4F9FA 2WU4A 3OF5A 2A1IA 1Z6AA 3MTEA 7ADHA 4YPOA 1IN8A 4XUGB 4UDXX 5JALA 3NVKI 3K9NA 1DXQA 1O95C 1Q7TA 1G20E 5HW0A 1CX9B 4KR0A 4P3KA 3DTYA 3U4HA 3GFSA 4M21A 4EVRA 5JIBA 2JC3A 4HDSA 1Y6ZA 3DZJA 3IPLA 5KTMA 1JH8A 4JEMA 3WLEA 1FDOA 4ZPXA 4ZYVA 2IU4A 2G1JA 3ZWPA 1KH2A 5ITZB 4LCBA 3LBNA 2XIJA 5FUVA 4PNEA 1MPXA 4PVCA 3VMFA 1QPZA 1ZI9A 2GVDC 4YMTA 3U56A 5D84A 1U7WA 3V8QA 1RXSA 1HT1E 1U0GA 3FGNA 4CWAA 1JJFA 3LYAA 5G53C 3UVEA 5JDCC 2XAUA 3VNVA 3M33A 1VKNA 2BMVA 3I32A 4JI1B 5LWQA 2J33A 4L5YA 1U2GC 3OCCA 1M1UA 3H6KA 2CUKA 3NHWA 4GDFA 3K0KA 4J0QA 4KBYA 4QD3A 5E4FA 4BFWA 3GCGA 2YIVX 3G2IA 1JF8A 4TVSA 4HXFB 1I94B 1XDSA 1OQAA 2CXQA 2DH5A 3DH0A 4R2HA 3NNSA 1OX6A 1B8VA 1C8KA 1RJWA 5BRNA 1NVDA 1QMPA 1EK1A 3FFXA 2WTEA 1VDZA 3FJOA 5F77A 2VDLB 3ZHVA 3BT7A 2QPLA 2EARA 1X7YB 1M76A 1EK5A 4ON9A 4NY1A 1H66A 5F78A 5GP1A 1TYEB 2FRVA 3D31A 4RW0A 3O5AA 5EMJA 1RJFA 2I6TA 4K6MA 1HE3A 2ZCJA 3U6KA 2X6TA 4A82A 1NQAO 2D7DA 5DLEA 2AOXA 4NFHA 1BA3A 1E18A 1LX6A 2B6HA 3K5IA 3L93A 1XJQA 3DE4X 4L3WA 4ME6A 2J0QA 2L0XA 1OV6A 2EZ9A 4QECA 3A25A 4KGDA 4HQ6A 4I3GA 1ZD1A 4R8MA 1BIFA 5IDYA 2P5UA 3EQ9A 3P9SA 2FMIA 4O2AA 5AHRA 4BCCA 2YHAA 4AS3A 1GUZA 3TAXA 4JP3A 1KK0A 2NU9A 2Q3BA 2HAEA 3PFKA 3GPCA 4MGIR 1I9CA 4QJBA 2FG5A 5KI6A 1C1DB 4DCMA 4DXHA 3PEEA 4IVNA 5KHOC 1EJ0A 1JHYA 3BGWA 4CIWA 1GNVA 1VE6A 2WYOA 4YK7A 1NMXA 2P11A 2VTKA 1JG7A 2I34A 3DR5A 5JCOA 5T5QA 3KZMA 2NV2B 1YJBA 4LYFA 1KK3A 4DV3B 4YJ2B 2O2SA 1M6NA 2KB0A 3EISA 3G79A 1GPDG 1XMSA 3EDQA 5HILA 1RLTA 1UFRA 4OA5A 2CT8A 3GWZA 5EPOA 1H2WA 3DOOA 4MR7B 4WJZA 2GQ0A 4AYTA 4FMCB 4QNRA 1AK1A 4TKUB 1LWNA 3QH4A 4G0PA 3TRKA 2ZB2A 4PGAA 5DK6A 3V46A 5MDHA 4JVLA 1WA5A 1E77A 4FLMA 1AKUA 3OHPA 5DTRA 3ZDAA 1J06A 5L8VA 3D7NA 3JQAA 2Q3LA 1DKPA 1SUPA 3KO8A 4H18A 1NBWB 1N5MA 1P72A 3PX3A 4XJTA 3DULA 3STWA 3M6FA 2F9FA 5E3IA 5DTQA 2XLBA 4EOGA 1O95D 2OBFA 3VR5A 1VJTA 4C9BA 4DDWA 4YRQA 2AEJA 3BGIA 3NOXA 4XXHA 1LC0A 4YMVA 1FTWA 3A26A 5AUPB 5I3CA 2I91A 2D7JA 2Z3VA 1LBSA 3PX2A 4INAA 3WLOA 4XAQA 2RKBA 2V5VA 1M73E 2D5CA 5ES4B 2VAWA 1J2JA 1U7HA 3MCAA 2ZROA 1OA1A 2DWUA 4E88A 1VYUA 5ALGA 3X2EA 4BEVA 1OBVA 4BNWA 4RJLA 3IT0A 1K7SN 3BRSA 3WY9A 2B5OA 4AN0A 5A5VA 1UPFA 3AW9A 4R7TA 1DT5A 1JLKA 1ZBDA 1BEZA 1XVUA 2PTHA 3CF0A 3WMGA 1Z0IA 4D0NA 4E2FA 3VUFA 3O2JA 3LECA 2M9MA 3BORA 4YASA 1LSUA 2D0IA 3TOSA 1E7MA 4Q3OA 4XLTA 5ALHA 5EE1A 5K09A 2ZUVA 2C8VA 4DCTA 3BD9A 5L3VA 1JZSA 1IJEA 1P29A 1CW2B 1WCV1 2EFDB 4D9JA 5K6TA 3CTMA 1MORA 3QVKA 4LYEA 1M1ZA 5IAEA 3ZV6A 1IH8A 3HB7A 2XUGA 4J6FA 2ZWAA 1P5FA 3EG9B 3DD5A 3FZYA 4N65A 3W7VA 3WIEA 2REOA 4URHA 5E9JA 3V7YA 4BNTA 5BRAA 5E6UA 1UJMA 5KDLA 1QX4A 1H0KA 1K6JA 1W9HA 2OUKA 4GMKA 1Y4UA 4U0JA 4B33A 2AG1A 5I7EA 2G7ZA 3RVQA 2H9IA 1ETUA 2OAGA 2GEVA 2K4MA 3FTPA 4CU5A 4L15A 1Z7GA 5ALLA 4ALLA 4UNQA 4CQJA 3J81k 4XW2A 1UC4B 3HJAA 4BWFB 2XQVA 1JHQA 2OAEA 3KWFA 5FUWA 3RR2A 5K8IA 1XQXA 4TTAA 1GLNA 2WJ6A 2QG9A 1PR0A 1UZNA 4L8VA 2CNNA 4U8GA 1BKYA 4MQ5A 1QO7A 1VDMA 4FKMA 4KVFA 2OL4A 3MMPA 1ISFA 4YRIA 5E6SB 2Z3WA 3MWLA 2DAPA 5CIQA 2H7CA 5TEWA 4F38A 2C7PA 1FFHA 2B8TA 1HE1C 1RHUA 4LBWA 1XF9A 1HT0A 3BFKA 4NJOA 1TI7A 3MWGA 4Q02A 4D9HA 2BFNA 2XCOA 1NR5A 3MT9A 4JQOA 4YCSA 5DM70 1N5OX 3IOBA 4OIMA 4IIDA 2PVPA 5FYQA 2Q5QA 3JR7A 4PYLA 4WH0A 2YWGA 1W25A 2WQ6A 2CVZA 2FPWA 3ZU6A 2WLSA 4D79A 4CETA 4DV4B 2Y67A 2JBWA 1M6YA 1VIYA 2IKSA 3DLIA