2HM7A

Crystal structure analysis of the g84s est2 mutant
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
308
structure length
308
Chain Sequence
b'LDPVIQQVLDQLNRMPAPDYKHLSAQQFRSQQSLFPPVKKEPVAEVREFDMDLPGRTLKVRMYRPEGVEPPYPALVYYHGGSWVVGDLETHDPVCRVLAKDGRAVVFSVDYRLAPEHKFPAAVEDAYDALQWIAERAADFHLDPARIAVGGDSAGGNLAAVTSILAKERGGPALAFQLLIYPSTGYDPAHPPASIEENAEGYLLTGGMMLWFRDQYLNSLEELTHPWFSPVLYPDLSGLPPAYIATAQYDPLRDVGKLYAEALNKAGVKVEIENFEDLIHGFAQFYSLSPGATKALVRIAEKLRDALA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxylesterase
publication title Functional and structural features of the oxyanion hole in a thermophilic esterase from Alicyclobacillus acidocaldarius.
pubmed doi rcsb
source organism Alicyclobacillus acidocaldarius
molecule tags Hydrolase
total genus 99
structure length 308
sequence length 308
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2hm7A00
4M0MA 1SCIA 3BF8A 5LZ8A 3OG9A 3DKRA 2HHAA 3DOIA 2EEPA 4KR0A 5AJHA 3OM8A 3LIIA 2WTNA 5AICA 4O08A 4KE6A 4AMZA 4I3FA 4IO0A 4BBZA 4PNZA 2H7CA 4N8DA 5EI5A 3A70A 1JFRA 5K5EA 3SWWA 2BFNA 3L1IA 1YAHA 4P9NA 1VA4A 2XUQA 1EHYA 2DR0A 3BDVA 1TCAA 1YB7A 3AZOA 3STWA 1BN6A 3AFIA 4PQEA 1CEXA 3R3UA 4XWGA 5FPQA 5BWCA 4AXBA 4WY5A 3AIKA 1X70A 2PX6A 1TIBA 2ZYIA 5K3CA 3EIOA 1WPRA 2DFPA 1JI3A 5LKRA 4HVTA 3QYJA 3WA6A 3FYUC 5ALHA 5FDFA 1QGED 4UBIA 1F0NA 4G4JA 3C8HA 4EUSA 1TRHA 2DSNA 2GBFA 1GKLA 2H9YA 3BIXA 2PUHA 3STYA 1FFEA 5AOBA 3H1BA 1ZIXA 1ODTC 1CUCA 2JEYA 4ROTA 2J4CA 4MWTA 5KREA 1MTZA 1UZAA 1R9MA 2XE4A 3DD5A 2BGRA 4GLBA 2BCEA 3D4LA 5EGNA 1XZCA 4C01A 3H1AA 3I1IA 2ZYSA 5EHQA 1YR2A 4UBJA 3R3WA 1C7IA 1C7JA 1N5RA 5BV7A 1GPKA 3VKFA 4HXGA 3T4UA 1D07A 4L0CA 1SOMA 1Q0ZA 4J0CA 1G5FA 3D5EA 5JD6A 1ZD4A 4JEIA 4G4IA 5EHNA 4Q3KA 1XFDA 2VSQA 4FBMA 4C4XA 2GBIA 2WIJA 3FSGD 5AHXA 2HU5A 5CH3A 2XUHA 3U0VA 4Y2UA 1Q84A 1G66A 3C5VA 4ZV7A 3BE8A 3WJ2A 1YAJA 4DYHA 3D7RA 2XMCA 4H7KA 5AK6A 4DIUA 5C8VA 4UHDA 1IMJA 2ZYRA 2DQYA 4MWSA 2C5FA 4UPDA 5FUMA 2JGEA 2WTMA 4H18A 3ICVA 4A23A 2WHPA 3N0TA 4MJ3A 2XUDA 3R3VA 2OCGA 1ZJ5A 3IUQA 2WUDA 4L72A 3ZLTA 5AKLA 4QDTA 3B12A 4BVKA 5JAHA 4FBLA 1XZLA 4X00A 4Y2PA 3QITA 3O0DA 3I6ZA 2XMBA 2RGUA 3IDAA 5BOVA 4XJVA 4G8CA 4KRXA 4K6GA 2XUOA 3C6XA 5I9IA 4QNNA 4B82A 5AIBA 1KEZA 5LZ4A 2PL5A 3GELA 4OD0A 1WB6A 3QBJA 5E4TA 3O4IA 3ZLVA 3O4HA 4F60A 1H2WA 4G9EA 2PM8A 4BRSA 1A8QA 3FNBA 5ALRA 1CRLA 1XQXA 4GI1A 4LYDA 2V96A 1CUAA 1IUOA 4W1RA 3O9VA 1E66A 5E4JA 2AJDA 4G5XA 2XUIA 3QMWA 3Q8WA 2GYVA 4OU5A 5EIHA 2QUBA 3F67A 2VT6A 2XB6A 1VE6A 2WUGA 3RKSA 5EIAA 1EB9A 2XUKA 2JIDA 2YXPX 2ACKA 2WG0A 4WCVA 3IUMA 4P08A 3WKCA 2VT7A 1CUDA 3IBTA 2VJCA 5AKEA 2JGKA 2HA2A 1W75A 2I3DA 4INZA 5KWIA 1A8UA 2OCKA 1QLWA 4LIPD 5LZ9A 1MJ5A 2QJRA 4CCYA 4ZWNA 5FOQA 1YCDA 3G02A 2G5PA 5CMLA 1JJFA 4G8BA 1QIIA 3O9MA 3VVMA 1SCQA 4OCZA 4RPCA 3WL7A 3G0CA 2VF2A 1AKNA 1THTA 1SCKA 1LPAB 3HJUA 2FUKA 3FWHA 4X93A 4B83A 3M3DA 3WK6A 1TQHA 1F6WA 3G9ZA 3I2IA 4H7EA 4Y2RA 2IITA 3VXKA 4J3JA 5LIPA 3V1LA 3A2MA 3DNMA 2WKWA 4BAUA 1E8MA 2HA6A 5AKJA 2ACEA 1MU0A 4HRYA 2O2HA 5IVIA 1PFQA 5JZ9A 2WFLB 3GA7A 4J0DA 4ZI5A 4CI9A 1DWQA 4DNOA 4M0FA 4KACA 2BJHA 1CLEA 5AK5A 4IH1A 3IA2A 2OGTA 3C43A 3HRHA 2X76A 4Y2JA 4Q1VA 5AI0A 2AJ8A 4I4CA 1MAHA 2PSEA 3IB3A 3O4GA 2I03A 3KDAA 3FCXA 3JW8A 1JT2A 2HFKA 3ZPXA 2AJBA 1QJ4A 1JJBA 1DX4A 1QIFA 3VJMA 3QZUA 5CTAA 2OLEA 2LIPA 4IH4A 4B6GA 3LS2A 5AIAA 1KU0A 2XQGA 5ALKA 5D3KA 1A8SA 2FX5A 2HU7A 5SYNA 2Y1KA 4WDQA 4E15A 5ALNA 4EBBA 4UHCA 2GZRA 2XMZA 4H77A 4Q3OA 2XQFA 4U2BA 4MYSA 2O2GA 5CW2A 2BUBA 4GHWA 5J3JA 4HAIA 5AM2A 2XMRA 4H7HA 4W1SA 1VXRA 4AQDA 2OGZA 4EB0A 3TRDA 5DWDA 4U2CA 4AN1A 5IVHA 1CPYA 1YS1X 1CUWA 5JAUA 2HADA 5FKJA 4J0GA 1ZI6A 4OYLA 1S8OA 1QONA 3PI6A 1IZ8A 3ESCA 1Y7IA 3H2GA 3BF7A 4KAJA 4H7IA 4Y2XA 2VTVA 5CT4A 3WLAA 1CV2A 5FXMA 4AN0A 1Y37A 4OB6A 1GQSA 4LXIA 4G8DA 2PSDA 4RGYA 5ALYA 4CCWA 4HZGA 1XZKA 2Z8ZA 2V97A 5ALPA 1K63A 5ALFA 5A7HA 3WMRA 1B41A 4G1FA 1VZ2A 2AJLI 2WIKA 3A2NA 5AKKA 1R9NA 5HZGA 5CURA 3S2ZA 4B7ZA 3IVMA 4BE4A 3RLIA 4MYDA 2B9VA 3AIMA 2HA4A 4MEBA 3VJLA 4E14A 3PFBA 4DMHA 3AJAA 4NZZA 4MXDA 3QPDA 4Y2QA 3I2KA 4KE8A 1W76A 1UOPA 3QMMA 2CB9A 1XZGA 1VJ5A 2JEZA 1K6EA 4MQLA 3WWOA 5AM1A 4HS9A 4BTLA 1TCBA 1DX6A 5A62A 5LZ7A 4Y7DA 5ALLA 3FYUB 4B81A 4FNMA 4YK7A 1DQYA 5HCUA 3KWFA 5ALEA 1CUXA 1XLWA 4GBGA 5FPPA 1P0MA 2QVBA 1BN7A 2ECFA 4RE6A 5A7GA 3L1HA 4X7BA 4Q34A 4N5IX 1TK3A 2I78A 3E0XA 5JALA 2WG1A 1MX1A 2Y2VA 1RYYA 1BS9A 1EVEA 1GQRA 3A2LA 1DWOA 1R50A 1DQZA 4E11A 3LCRA 4X95A 4PF1A 1E3QA 5I7UA 2XT0A 4FOLA 1ACJA 1NU8A 4DGQA 1CQZA 2YH2A 5A71A 4EY8A 1VZ3A 2VAVA 4C89A 3DDUA 2D5LA 1W52X 4B9AA 1F0PA 2QMQA 1KU6A 2QKYA 5CH5A 3STVA 5T4BA 4TPKA 3H19A 2QUAA 3OURA 1J2EA 1CUHA 5DYYA 3WWPA 3EF3A 2DHCA 2WUEA 5FV4A 4UBNA 4DNFA 4Y2TA 2FJ0A 1ZICA 1MPXA 4C6HA 3GFFA 1LLFA 2BUAA 2C0QA 5D3ZA 3EBLA 1LGYA 5JAOA 1P0QA 4U2DA 4K2AA 5ALUA 4RNCA 4NS4A 2WIDA 2Z3ZA 2ROQA 3HABA 3BWXA 4GWLA 2XUAA 1EINA 2GBGA 1UK8A 3WWDA 1ODCA 1XQVA 1XLVA 5JANA 1WHSA 5K3EA 3W04A 5AI6A 5DNUA 3RK4A 1H2YA 2XQKA 3E3AA 3C6YA 3BJMA 3KOOA 2R8BA 3I6YA 4NVRA 3JWEA 4YASA 3BXPA 4RE5A 1LPSA 1BE0A 2AXEA 4G9GA 5AKIA 5LP1A 2WILA 1MAAA 2WIGA 3H0CA 1UKAA 2CMFA 4X6XA 5JD5A 2ZJ7A 4FTWA 4Z49A 1WOMA 5DJ5A 3H2KA 5AM3A 1T2NA 3BJRA 3V48A 2JF0A 5DYWA 1ORVA 3ANSA 2Z8XA 1ZD5A 3D2AA 1P0IA 5ALQA 2YYSA 2Z5GA 4N8SA 4X92A 1TKRA 1HLGA 2RIPA 2D0DA 3JYHA 5HK9A 1L7RA 5AI5A 1QO7A 5AI9A 1MX5A 4IQ4A 5D7BA 2EDAA 2VATA 2WHPB 1XZJA 4K6KA 1ZI8A 1VLQA 5KBYA 1VE7A 1FSSA 1Z68A 5HF5A 3EQ8A 1XZAA 2XMSA 4H0CA 2RONA 1CUJA 4Y2SA 2ORYA 2DHEA 2WJ6A 4DMFA 1FFAA 5DTJA 1CUIA 4DM7A 2JBWA 2HM7A 3FAKA 3DCNA 2WQZA 1R88A 3WKDA 1P0PA 1HBJA 3OC0A 3OTQA 2XMGA 4N5HX 5K3FB 3G9XA 1YS2X 3HC7A 3MGAA 1AGYA 4NMWA 5SYMA 5DTIA 2PKYX 4Q82A 1YB6A 3V1KA 2XUPA 1E8DA 1ZI9A 3HYSA 4AB1A 4CIAA 1FFDA 4LXHA 3WL6A 2C0PA 1H23A 3STUA 4L3WA 5AKHA 4IH9A 1QIGA 1Y7HA 4LXGA 4AO7A 4WJLA 1XRNA 3R0VA 1BCSA 3O95A 4EY4A 2HL6A 4PSCA 1VKHA 2ZVDA 4LYEA 3FVRA 1QIKA 5AM4A 4IHAA 5JZSA 5AM0A 4B0OA 4AO8A 3CN9A 2OQIA 5E2IA 1Q0RA 3B3QA 2WU3A 5JYCA 1LBSA 3UUEA 4OUKX 4X71A 1HQDA 1WB4A 1DT3A 1E8NA 1MNQA 3HACA 2I3ZA 1T4MA 3ESBA 2JGIA 4J0IA 1HDEA 3KWJA 1XZBA 2O7RA 5EIEA 3WL5A 2W6CX 1N5MA 3TJMA 2OCIA 1U4NA 5JARA 4PV7A 2G63A 3SX4A 1TCCA 1ZD3A 4AO6A 3G0BA 5FP0A 5ALWA 4J7AA 1WHTA 4DSAA 5HKAA 1CUSA 3H2JA 4X94A 4XX1A 5C81A 3X3HA 5CT6A 5JATA 2C4HA 1HL7A 3FBWA 4HRXA 3HI4A 4X97A 3H2HA 1RWQA 2JGMA 1GGVA 3FCYA 3WL8A 3IUJA 3TGLA 1QFMA 4BCCA 4KJXA 1MO2A 1J1IA 3DQZA 5IVKA 2K2QB 4ZV9A 1OXMA 5ISMA 2XLCA 3F98A 3WK8A 3C70A 4DNQA 2HDWA 1SC9A 5HFNA 4K6HA 4FFWA 4QA9A 4BVLA 3I6MA 1UOQA 4UBOA 2QOEA 5DNWA 1CUGA 4DLNA 1XRMA 4XVCA 1MT3A 1BRTA 5HK8A 4LHEA 3DL4A 1YASA 3R3ZA 1U2EA 4A5SA 3R41A 4B84A 1H22A 1W1IA 2IX9A 3MUOA 5HF6A 1BCRA 4UUQA 3AZPA 3ZI7A 1E5TA 1R3DA 3PF8A 1GKKA 1I6WA 1M33A 4KAFA 5E4YA 3W06A 4W1QA 1QIDA 1CUBA 3STXA 5A6VA 1MN6A 4UHEA 3C8DA 4U2FA 3OOSA 4UFNA 2RHTA 3F97A 2QXUA 4J0KA 4PSUA 4KAAA 1CUZA 1K4YA 1BEEA 1FFBA 2HU8A 1UFOA 3PF9A 1XRLA 5ALJA 4KRYA 5AI4A 4BB0A 1N8SA 4BTVA 4L9AA 2HRQA 4PO3X 2VQ6A 2X5XA 1ISPA 5JD4A 5T4FA 2ZJ6A 1CR6A 2ZSIA 3DL7A 5AOCA 5I8PA 1ZOIA 4BYMA 1A88A 2XMQA 3AIOA 5IH7A 2DHDA 2PSFA 3I1YA 4AZ0A 3VVLA 3ILSA 1YA8A 4HXFB 2CZQA 1QIHA 3EQ9A 4X90A 2YASA 4QDZA 5AKZA 3WYDA 1CUUA 4EY5A 2GZSA 5AKYA 3R40A 3FSGA 5ESRA 2XDWA 2XLBA 4X91A 2WIFA 2WM2A 2AJCA 4J0HA 3WKEA 2WLSA 1AZWA 1JU3A 4BVJA 1U8EA 5D6OA 2CUTA 5EFZA 3LIPA 4BATA 1EXWA 1XZIA 1ZGCA 4ZREA 3NUZA 2CEKA 3STTA 3ESDA 3PUIA 2HA3A 1XKTA 3IURA 3ZV7A 3HEAA 3M81A 4OU4A 4CIBA 4X6YA 5HQ3B 2V98A 3WA7A 4QE3A 1TAHA 3D2BA 3C5WP 5JASA 5F4ZA 3WKBA 1ORWA 2QS9A 4ITVA 1VOTA 2V9ZA 1AQLA 2CKMA 2W22A 2O2IA 2JGLA 1IZ7A 3HLKA 3NWOA 4C4YA 5ALOA 5CT9A 1WCYA 1A7UA 4OPMA 3BDIA 1LZKA 1WPXA 3GROA 4UBLA 1G42A 3CXUA 4QWMA 1DU4A 2GBCA 5ALVA 3QPCA 4EZIA 1J06A 1IUNA 4CFSA 5AOAA 5CT5A 1AMNA 2XI4A 1LPMA 4JUIA 3A6ZA 4UHFA 1FFCA 1QFSA 2HA5A 3Q0TA 3QM1A 4CG3A 4OB8A 5ALTA 3G9TA 2NW6A 3DYIA 5ALMA 4B85A 2J3DA 3WWEA 5LLSA 1LPBB 4DNPA 4FHZA 4HTAA 5IVDA 1CUYA 4A16A 1EK2A 5ALZA 3ZWQA 5LZ2A 2HA0A 2QZPA 1C4XA 4AX4A 1CFJA 4FFVA 3D0KA 2R11A 3WK7A 3L1JA 2C58A 3I2GA 1ZIYA 5JZBA 4JNCA 4H7JA 1XZMA 4OYYA 2C7BA 5K3AA 1QZ3A 1U65A 1XLUA 3IIIA 1IUPA 1THGA 3OPMA 3VDXA 1LZLA 4EY7A 2XQIA 1UT6A 3K2IA 3TEJA 3O4JA 5AKXA 2WHQA 1BEZA 1JMYA 4QDXA 5A2GA 3F9CA 1B6GA 1CUFA 1XZEA 2HRRA 4KYVA 4BP9A 2Z3WA 3V9AA 3RARA 5CBKA 2J4FA 2WHRA 5AH0A 5CXUA 2GYWA 2XUFA 5AO9A 3PICA 4X85A 1DWPA 1K5PA 4OB7A 4OSEA 3H2IA 3B5EA 4QLOA 3F8SA 4MEAA 5IKXA 3GZJA 3I2HA 1E89A 3WK5A 4H35A 1OCEA 5LKAA 2G4LA 3IULA 3R3XA 2RI6A 1QIMA 3N2ZB 1DINA 3IUNA 2ZYHA 1H2ZA 5KWJA 3UMJA 4K5QA 5FLKA 3BIWA 3T52A 5EHZA 1LBTA 3W05A 1XROA 2DQZA 4BDTA 1UK6A 2ZSHA 4QZVA 2GYUA 2OXEA 2H7YA 2HIHA 2QT9A 1WM1A 5LYYA 3FYTA 5FRDA 3UUFA 2OAEA 2OG1A 2OCLA 2B20A 3LP5A 3G0IA 4BCBA 2VJAA 4KE7A 3ED1A 5DNVA 3HSSA 3QPAA 4F21A 2PVSA 2HA7A 4WFIA 2P8SA 3GBSA 3H17A 4UHHA 1O6GA 1EX9A 1CIJA 3G0GA 2WJ4A 2PSHA 4U2GA 4MQMA 4B9EA 4BZZA 2BGNA 4D9JA 1EA5A 3DJYA 3KD2A 5T4HA 1LPOA 4DSZA 4LKOA 3PE6A 4J0JA 2CJPA 2J3QA 4M0EA 1H2XA 3AINA 3VJKA 4I19A 3WZMA 1GPNA 2HFJA 4AMYA 3H18A 3WI7A 3ZLUA 1O6FA 1HPLA 4BAGA 3DS8A 1XQWA 4FDMA 4BDSA 3QVMA 1XRQA 1LPPA 4JH0A 2XUJA 3SC2A 1UK9A 4QWWA 5HF8A 4ETWA 1UWCA 3NOXA 5K3FA 2IIVA 2BKLA 3DYVA 1UXOA 2OGSA 1CVLA 3FLAA 4G4GA 4GW3A 4ZXFA 2UZ0A 3WYNA 4UFPA 4V2IA 5AP9A 2WUFA 4F5ZA 5C7YA 1HKHA 3F96A 5LZ5A 4C87A 4Y2YA 1ETHA 2BAGA 1BU8A 3HXKA 3I2FA 2VA9A 3WJ1A 1GXSA 5K3BA 4ZGBA 3W9BA 3ICWA 4QLAA 1BROA 1UKCA 1YSCA 3W9UA 4AZ3A 4XIIA 4FLEA 1OILA 3C6ZA 4TVKA 4FLFA 5HF9A 3DOHA 3M83A 4WY8A 3V1MA 3GUUA 1J07A 3WIOA 2O7VA 4FNGA 7YASA 1EH5A 2WJ3A 5HFAA 1F8UA 3I2JA 3K6KA 2VJDA 1DT5A 4ARAA 1XZDA 4EA6A 4GEGA 4CCYB 4N8EA 1EVQA 1QTRA 3AZQA 1Q83A 3BL8A 2H1IA 5AI8A 2Y6UA 5C8XA 1QTIA 1QIEA 3YASA 2PUJA 4DMCA 1EDEA 4BCDA 2XUGA 4W63A 1PV1A 4JYMA 4Y9SA 3W2TA 5JAPA 3ESAA 3HZOA 4BE9A 4H7FA 4FKBA 5ALSA 1MX9A 4BC1A 4UHBA 2RAUA 2Q0XA 3G8YA 2E3JA 1XZHA 3FLBA 5DYTA 3PDCA 1K8QA 2XQJA 1UKBA 5C8ZA 5A7FA 5AK3A 1GT6A 1X2BA 4QEKA 5BWBA 3S8YA 2VJBA 3CN7A 3M82A 6YASA 4S0XA 3I28A 1XRRA 1EB8A 2PU5A 4YX9A 4YPVA 1UOOA 3QMVA 4WDRA 1LNSA 1WB5A 4EHBA 1R4ZA 4Y2VA 4P93A 4BAZA 3WWCA 1YA4A 2ZJFA 3WZLA 3WIBA 2VAXA 1JKMA 5CH8A 4BP8A 3FOBA 1R1DA 4B0PA 1EDDA 1QOZA 4J03A 3AUKA 1XQYA 3MUNA 3DEAA 5ALXA 1ZJ4A 2B61A 2WFLA 3WK4A 1CQWA 1GPLA 4W9RA 3D59A 1JMKC 4C88A 4FLMA 3LLCA 5AK4A 3C45A 5CXXA 2JGJA 3CCCA 2B4KA 5H3HA 5EHXA 2QM0A 2ES4A 3D2CA 4KE9A 4W1PA 2G5TA 1EDBA 1NX9A 4E46A 3ANTA 3WK9A 1ZD2P 4UBMA 2C5GA 1XKLA 5K3DA 5JADA 4TGLA 2JGFA 2RHWA 2H7XA 2Y6VA 4PSDA 3G7NA 2OAGA 5ALIA 3AILA 2EDCA 1GZ7A 5AKGA 1AUOA 2QJWA 2QR5A 2PBLA 5CRIA 5JIBA 2BUCA 3G0DA 3DKKA 3D3NA 4X3CA 1FJ2A 1QE3A 2QRUA 2FJPA 4HXEB 4JYPA 3DLTA 4FMPA 5YASA 3E4DA 1IVYA 3C6BA 3SK0A 4UFOA 2PSJA 4C4ZA 3P2MA 4GDMA 5DLPA 2OQVA 4CG2A 3KXPA 1L7QA 1MNAA 4H7DA 2PPLA 1ZGBA 1USWA 3V1NA 1ACLA 1EK1A 1L7AA 2ONCA 3H04A 5ALGA 1DTEA 2QXTA 4WFJA 3K9BA 4BC0A 2X8BA 1VA5A 5AM5A 2WSLA 4UBKA 4DTCA 3PFCA 1CUVA 4KEAA 1JU4A 3NGMA 4FWBA 3VISA 3E1GA 3WKAA 4QDOA 1W6RA 2CBGA 4ZRDA 1X2EA 3RM3A 4BRZA 5T4EA 3R3YA 2VEOA 1JJIA 2PU7A 3C87A 1AC5A 5CT8A 1UK7A 1AURA 2WU4A 4B80A 2XMDA 3G9UA 5ALDA 4DMKA 3FVTA 3WQHA 1W4LA 4Q3LA 3EQ7A 1ODSA 3QH4A 4ARBA 3U1TA 4X6UA 5HQ3A 2OPHA 2WFZA 1G4HA 4WFKA 4BZWA 1QO9A 1VXOA 1N1MA 3KSRA 4EY6A 1NU6A 1LPNA 4CG1A 5HKBA 1XRPA 1SFRA 2Y2UA 1PJAA 4U2EA 2QTBA 1QIJA 2DCMA 4PW0A 1CUEA 1EI9A 4F0JA 1AX9A 1RP1A 3CCBA 1XZFA 2WFMA 3FYUA 4GECA 2WG2A 4P92A 3MVEA 3FLEA 4Q05A 3PUHA 4GXNA 4QDUA
chains in the Genus database with same CATH superfamily
1PK7A 1VM6A 2JFYA 1XMSA 5D01A 5LZ8A 2NVUA 3DKRA 3H4TA 3DV2A 1OT5A 3BORA 4R1SA 4URFA 2PUWA 4XM2A 4WGGA 5M3BA 5AJHA 2CW5A 2FPOA 3OZFA 2D2XA 4ND5A 3U4QA 3NBUA 1NYQA 3TZHA 1CNEA 1JL3A 3PHBE 4LXTA 4O08A 2LDXA 3EXFA 4Q1CA 3IBSA 1O7JA 5IC6A 3UA3A 3T99A 4AMZA 3NHZA 2BYTA 2QNIA 3T1VA 1QHYA 5LN1A 2GPNA 4B2IA 1Q92A 2D1QA 4BJ3A 2DLDA 5A9SA 5BVGB 1Y9EA 5SZKB 4C03A 1Z4NA 2PUVA 4MVYA 4OHVA 2B6NA 2X9GA 5K5EA 5ANRB 1GGEA 2BFNA 1EEXB 4R9UC 1FU8A 5K20A 1YAHA 4GX2A 3FJOA 1GZVA 3LLUA 4HWPA 4M0KA 4YR9A 4P9NA 2W2XA 1HLPA 2XUQA 1I3MA 4UTRA 2ENUA 1YJ8A 4Z3KA 1HDIA 2HXGA 2XNKA 1FNBA 1TCAA 2JJ2D 3AZOA 1MB4A 1IJFA 2YV4A 5G40A 1WCV1 5EXTA 1VLZA 2ZB7A 3QK7A 1FE8A 1HT2E 1J5PA 1OXUA 1G17A 1SZPA 1SKQA 2H1WA 4PS1A 4QPDA 5F76A 5T3YA 3KLNA 3MJDA 1J0EA 1CWUA 3AIKA 3G59A 3CF4A 4NZOA 3K70D 4CN9A 4YGYA 1QS0A 2VL7A 2YYAA 1ZVQA 2I33A 3A27A 3LNTA 1NQAO 3N1UA 4M0LA 4TRMA 4BO8A 1JWLA 2ZE7A 2HMSA 1YE8A 4KITB 3E27A 4J8PA 4PLGA 5DSXA 4L76A 5K8IA 1WPRA 4L0MA 3U4GA 3VOSA 4DT1B 4E2WA 2GVZC 3F3SA 2NPOA 3IALA 4NV1A 5KNDA 3FYUC 4ZT7A 2BMJA 1Z16A 4DV1B 1E6CA 1ZFNA 1UFQA 4D1YA 1S2IA 1F0NA 3E5RA 4G4JA 1QKIA 1V5FA 1UF9A 4MH0R 4RY9A 2A0KA 3DWGA 2R1VA 2GBFA 2PZKA 3IQDB 4KLRA 2ZSFA 3VZQA 2H9YA 3MS2A 5B37A 3QW4B 2D4AA 2RE8A 2ILVA 3AOGA 4PVCA 5D87A 3STYA 2GCNA 1FVFA 1FFEA 4HV4A 5BUSA 5J1SB 3H1BA 4QUAA 1DS6A 1I5OA 4NG5A 3EWNA 3T15A 4F4CA 2EL9A 4ALIA 3O2SB 1ZIXA 4BZPA 1KNQA 1FSPA 1ODTC 1R5JA 2P78A 4TMVA 2UXBB 1XVLA 5E1DA 5JS1A 4PQEA 2JEYA 4QOIA 5GGXA 3WMWA 4BUJA 3LUJA 2H92A 4C76A 3Q2KA 1QGYA 4MWTA 3HYLA 4TMTA 2C2OA 3WRXA 5KX5B 3MF4A 1RCFA 4XOIA 4NCBA 1RQRA 3CUWA 5KMGA 3NB0A 4ROSA 1XD8A 1Y4AE 4NH4A 1G8AA 4LJLA 4IJWA 3U9TA 4KREA 1GADO 1R0XA 3KAQA 4DBZA 3R0JA 1NNSA 4MRMA 1T3LA 3D4LA 2G07A 4LJ5A 3CBGA 4NENB 3KSAC 4GM4A 1UXKA 3WGNA 4M9SA 5K0ZA 1S2GA 1Z25A 2I29A 4L15A 3QLUA 4FXPA 2L18A 4QHSA 3A36A 5AJTA 3AQ4A 4ZQFA 3BPSA 3O6VA 1DUVG 3I1IA 3QHPA 5DRYA 1NTRA 1T6BY 1G8JA 1RLIA 1ZSVA 3LX6A 4AXXA 2HHLA 4Y7CA 3A6EA 3I01A 2OD9A 4Q12A 2ZETA 4WEQA 1K86A 2FHPA 3R23A 3WB2A 3O8BA 4GS5A 3WO1A 4DWJA 5JC8A 4MKZA 3Q4GA 4DZRA 3DLAA 3WLPA 4C3ZA 1C7IA 1A71A 1LLDA 2YN0A 4MKXA 4O4HA 4O63O 6NULA 4URWR 5FPYA 3WGYA 5BV7A 3ZCUA 4P4NA 1FZTA 1DO0A 2JFOA 3EIFA 4L0CA 3ZHYA 3KOUA 2NTVA 1QVWA 5DT9A 3SXPA 3AUJB 2F3SA 2WJAA 2BFAA 3RS5A 3EVTA 3ZDCA 3MM4A 3JQ7B 4PYIA 2GQ0A 5JD6A 1LWOA 2GETA 2I7TA 1L4EA 3M9XA 4QXQA 3HYRA 2E4XA 4G4IA 1VL6A 1QK4A 1TLLA 4IP0A 3ZK8A 2ZJ1A 2PJUA 3GYGA 4ZCPA 3ZXYA 1C3EA 1E1NA 4P35A 2QZZA 1Z12A 2HMVA 3LHKA 4DDTA 3HM9A 2GBIA 2VBFA 2VNIA 4RZHA 3EW9A 5GINE 4JQSA 2A4KA 1G41A 4KDEA 4P5DA 5I9MA 2ZCVA 5CBPB 3OZEA 3MCVA 3U0VA 3FF1A 1G66A 1R0KA 2PKQO 3CTPA 2F3PA 3TQTA 3ZW7A 5F9HA 1F48A 3A9WA 3KJQA 3WJ2A 1GPUA 4HB3A 2FPGB 3GN1A 4HFMA 4MMZB 1Z5PA 1XD2A 2P27A 4WASA 4DYHA 4J1QA 4A8HA 3HCCA 1OYYA 5EZYB 3D7RA 3ICPA 2VXBA 3IPYA 5AK6A 3SQXA 5K8JB 2WT9A 4FM9A 4YP1A 1IMJA 1XI2A 3OLCX 4R2WA 4DJEC 4RH3A 1JUDA 3KYCA 5I9BA 5A3VA 4DQUA 5EP4A 5CEJA 5EWJB 1HDGO 4DLXA 4TV9F 2MIIA 1WMEA 2D7CA 1JA0A 2JGEA 4LZZA 4BE7B 3N6VA 4ER6A 4YIHA 2IYPA 5E3JA 5FR1A 2HNAA 3DEFA 3EXIB 1FJXA 3F1KA 4N39A 1P18A 3H16A 4LSMA 2ECKA 4WH0A 3BEOA 4JQCA 4LFBB 1T9BA 3TNDA 4EK9A 2JAXA 1N9ZA 3AVVA 4OH7A 2G9ZA 3N0TA 3TNLA 1WSDA 2BN4A 1UWKA 2SECE 2XUDA 4RTQA 3AU8A 1AD2A 1D1QA 3IP9A 1MQ8B 2OCGA 2ZG6A 4R83A 5JTUA 4N7JA 1GFIA 2HF9A 1FYFA 1RPTA 5DX0A 4YPOA 5C1IA 1S01A 3OCWA 4FEYA 4J7XA 1AS2A 2HWWA 3ZV5A 5CFZA 1M0EA 1L5LA 1J2JA 3S28A 1BS1A 5AKLA 1M8PA 3AW8A 1GPBA 2ZU6A 3LHDA 3PKIA 1FK8A 3S70A 3OE7A 1HYGA 4RVUA 3VYRB 3ZJYA 4YRSA 4KIGA 1L8XA 4KPUB 3DVAA 4LF6B 1UBRS 3CB2A 1JR4A 2G08A 4QTXA 3V8VA 1LJLA 1RKQA 2JFPA 3OAAD 3TCKA 2XCOA 1SHUX 5D5QA 4B3TB 1PS8A 3ND7A 2WB4A 3F6CA 1FRNA 5FNVF 5JXIA 3T3DA 1XJQA 3LLMA 4DG8A 1WVIA 2TSYB 1YBHA 3E5NA 3FVWA 1J90A 2X4DA 4M1QA 2FPSA 3OEHA 4PIMA 3THOA 2DQKA 4UTVA 2PMBA 3R7DA 4FGLA 2XMBA 4RPIA 4YJ3B 3R75A 1H2FA 3L7DA 3D6MA 3NRJA 4RXMA 2F1RA 4G8CA 2P9CA 3NEYA 3BXZA 1ISGA 4KRXA 4K81B 1KEVA 3TFQA 5I9IA 3PA8A 1U0TA 2WRZA 4WV3A 1PZGA 4YJFA 2I0FA 5LZ4A 1OI7A 3VAAA 3H3JA 4KK4A 3UEOA 1G5RA 2RH8A 2W98A 4TSRA 2XPCA 3JARA 3MTDA 5E4TA 4K87A 3UWOA 5AXCA 2XOKA 1AF4A 1PJCA 2AVNA 3PGJA 4M1KA 4AT1A 1Q1BA 1RM3A 2VT3A 4ZAWA 5JNRA 1VSVA 4OQLA 5K4GA 2HSZA 1DBRA 3E5HA 2Q6LA 4KVFA 3FNBA 4MYHA 2O8CB 4YCAA 4TKVA 2IYFA 4GI1A 4LYDA 3CE9A 1ZH0A 1CUAA 1X38A 2VHJA 3O9VA 3MXTA 3I6IA 3TRFA 1YRAA 4YYZA 4X7RA 1X15A 1EBBA 3BTOA 4XLLA 1RXCA 2PBRA 2Z2XA 1WKBA 1WZEA 3QVKA 4KDRA 1FP6A 1NY6A 4YRLA 1QV9A 5JXGA 3R7FA 3VC1A 3D3EA 5KPJA 1GZ6A 1H6BA 4RCZA 3LD9A 4YYEA 2BF7A 2VDWA 3FFXA 1T6YA 1T36A 2ZBPA 4K9NA 2RKOA 2XB6A 5M7EA 1NVKA 1EFUA 3RKSA 3VFDA 4CKCB 1TPZA 4W5QA 1HDZA 2XUKA 3I0ZA 4GYYA 4MOWA 3IOEA 2JIDA 1G6KA 1VLJA 4P38A 2ACKA 4D02A 2RBGA 3ELBA 4B6EA 2WG0A 2PLWA 3WFIA 3QI7A 2I6FA 6Q21A 1PFVA 1MT0A 2IPOA 3LW8A 4NPAA 5CHEA 5LQJA 3ZQKA 1M6VA 2CFSA 3LDAA 4LC9A 1KZYC 4RC9A 1YS9A 1T2UA 2BI4A 2XNCA 3IBTA 3O0TA 4DNXA 2FPKA 3PCTA 4QYTA 2FWPA 4ZYUA 5JHGB 3PC6A 3RU7A 3I76A 4C08A 4TL9A 3WG9A 3ZU6A 2YJ6A 3S2EA 3ETNA 2ZEJA 4OLJA 4RTSA 3UMRA 2FW8A 4R5MA 1KVRA 1M5RA 1PFGA 3PUYA 1K7FB 3I5MA 3MW8A 2AG1A 3IHKA 5KWIA 1P5HA 3ELDA 1R6UA 5JTTA 5AHKA 2JGDA 1QLWA 5K4HA 1JQJC 1G291 3P2YA 3QW2A 5HZMA 4EWLA 1UPAA 1XAJA 1KEEB 2QJRA 4IX1A 4CCYA 4EKYA 2OXTA 5EJ6A 1Z73A 1BVUA 3AU9A 3G02A 4DAEA 3GB9A 3L8DA 1JJFA 1OJLA 4L78A 4G8BA 1NMZA 1QIIA 4ND3A 3O9MA 3RUFA 1VRWA 1E3JA 1SCQA 4RPCA 1IYZA 1KMQA 2AZDA 1ISSA 5GM2A 3WL7A 2PT6A 1PWYE 2YWGA 3CUEF 2AI3A 3JD1A 1W9HA 5JMOA 2REQB 3ETCA 1CERA 3I39X 1MD9A 5ABPA 1D4FA 2CNNA 4Y9RA 3RUIA 4O4HF 3BSYA 4E5KA 3UMBA 3QU9A 2JI7A 3FGZA 4QM7A 4EHHA 1WB9A 3M3DA 2ZJ3A 4G4SP 4JVLA 1XAIA 5GZ3A 4CMAA 2GO7A 5KJ1A 1UMBB 1B8VA 2Y1CA 2QM8A 1KXZA 2O9JA 3QTLA 5KHAA 3VPSA 2BFFA 3JTEA 1SCBA 4B48A 4AL4A 1ZVJA 3AKDA 2IITA 3MCAA 3ZKWA 2GKSA 1IVSA 4MDFA 1N7HA 3HA7A 4MDHA 1I33A 1MVOA 3U7QB 5FTMA 4D5EA 3F78A 2BHNA 1DJQA 1RDFA 2ZBQA 3N5KA 4MPTA 4C06A 3E22B 5I9NA 5ICFA 4HQOA 1E8MA 4MUBA 2OG2A 4DG9A 4ER5A 1HT1E 1YBAA 3EIUA 2XZOA 3FWKA 1ZX1A 5AKJA 1TYCA 3FMGA 3L7IA 1V37A 3LT5A 3PUXA 1NIJA 4HRYA 5E6UB 1PT6A 2O2HA 1NV8A 1X9GA 1Q11A 2O3QA 2GPBA 5G4KA 3K70B 3E81A 4DV0B 1L4LA 3IMGA 4KKVA 1HYEA 3WL4A 4GP7A 2WFLB 2BFEA 3WSTA 1QE0A 3ABOB 1BMQA 3GH3A 3HLTA 3NDIA 4LDZA 1TU4A 4ND2A 1RJ9A 2QD5A 5FBRB 4ZI5A 3ZN2A 5LPNA 1DWQA 2I55A 2Z8YM 4B1FA 4D3SA 1RC1A 1V47A 2H8GA 1ORRA 2QN9A 2ZYGA 4WKNA 4HAUA 3EVBA 3BDAA 2EX1A 4IH1A 3ZZNA 2V1UA 3IA2A 3UOGA 3F5MA 4FCCA 3RWBA 2OGTA 3D31A 1AQJA 2C8KA 4L8GA 4BP1A 2GMWA 5JPDA 2JAOA 4NRDA 2P79A 1XK6A 1ZVVA 4BN4A 3PD0A 3WIVA 1S89A 1VLHA 4U7GA 4PFKA 1PZEA 1PN3A 1YACA 4QC2A 4WRRA 5EKSA 3N9IA 4F46A 3LM8A 5ECGC 1IB6A 2OP0A 4FVTA 2CVOA 4F7WA 2UDPA 3PX3A 3SQNA 2PL3A 1EP1B 1QU3A 1JT2A 5B53A 4F4FA 2I71A 2AJBA 3HDJA 5BYBA 1I32A 4R9VA 1QJ4A 4BNDB 3BZUA 3OQVA 5HDQA 1LW7A 4QJ3A 1M1NA 2CNLA 2J87A 2ST1A 3ZHXA 5GJVC 1A9PA 3DQQA 4O4LA 1JYSA 2JH9A 4IH4A 1MC4A 1YC2A 1P5JA 1KY4A 3IDQA 2I67A 4G6ZA 1CLUA 1H69A 2FU5C 4FNOA 3P26A 3JY6A 5AIAA 3EX7C 1JDBC 1KU0A 4KBGA 2XQGA 4RSRA 4KQXA 5E6SB 3U3XA 3NBYC 4Q1BA 3N8HA 1FFHA 3NC1C 5ALKA 5D3KA 4J76A 1JHAA 4FZ3A 4NDAA 1JYFA 2FX5A 3F7TA 2XNSA 4R1OA 1G8MA 3C5EA 4UHKA 4YUAA 2WM9B 4ZA2A 5K7SA 1U3GA 3H13A 3SC6A 3P2IA 4RD3A 1EWTA 5A4DA 5ICMA 1AHPA 2FPXA 1TT5B 3AEQA 2C5SA 3LT1A 1GKYA 5EYPA 1LDYA 1I2CA 1QZUA 1ND5A 8ABPA 3U56A 4JI2B 1BWQA 1SM4A 3BKWA 4UHCA 4HGQA 2GAFA 4MVJG 4A10A 1RBMA 3NG1A 4MVCA 3AKZA 3FOAA 1KYQA 4GZ5A 1KKLA 4KXWA 1ONSA 3AL2A 2F1IA 3NVKI 4O8ZA 1WUIS 2G4VA 2XQFA 3FYSA 3LK7A 3L04A 3VR4H 4WOPA 2GZ3A 1KH2A 3CW8X 4KQMA 5E1MA 4QUJA 3MK31 4REOA 2H8KA 2XMRA 3G5TA 2ID9A 1Z3IX 1JEQB 4H7HA 4P4GA 4W1SA 2YWDA 2ZATA 1J09A 4GWGA 5MHTA 4RF3A 2OGZA 3EPPA 1D1TA 4GPEA 3QKTA 4EB0A 3AX6A 2VDOB 4U2CA 2ETVA 2Y68A 1PYGA 3CNHA 3CYFA 1GG8A 4MWDA 5IVHA 3PYLA 1NXVA 3QP9A 3JAMA 4B3GA 1X7ZA 1A4XA 5DMHA 3T9BA 4B5LA 1V1MA 1E3WA 4PGGA 2WU8A 3TECE 1U7UA 2HADA 5FKJA 1R10A 1CETA 2VHWA 2ZUSA 2FSVA 3G2IA 1BXKA 4B47A 4E3ZA 1RT9A 1SB9A 1YZNA 3VPGA 1XYVA 3HN6A 4HVCA 1IZ8A 1IWBB 3ESCA 3OX3A 4XWKA 1XBTA 2Q6IA 4KVGA 5HP4A 1H3EA 1U31A 3RASA 5AUNB 1VDMA 4MTCA 4RM2A 2A0XA 4ESHA 2PD6A 4HUQB 3TAUA 1JBEA 3TFOA 1JQAA 4QTZA 1V5GA 1UQUA 2VP0A 4QXRA 3VDQA 2R25B 3PNVA 4EI9A 3FNQA 4AN0A 1COZA 1DE0A 4RQBA 3RW9A 1NRXA 4OB6A 1LW6E 3EZNA 1GQSA 2WJWA 1QTNA 4B8WA 4CQLB 1U8FO 2XWPA 3KUDA 4FFBB 3QKSB 2HQSA 2XNDA 5J40A 1IQ0A 1QHIA 1KPIA 4TMFA 3TIFA 1RAFA 3BE4A 1LVHA 3C14C 1CZLA 4N6NA 1OA1A 4Q16A 4MV3A 1ZM3A 4AZVA 1WEHA 1WUJS 3WAKA 1A5ZA 3UAOA 2E37A 3DAYA 2FR1A 1ZCJA 1K63A 5A4MS 1KZ7B 4YAFA 4Z4GA 3R6TA 3ZNPA 2GGSA 1URPA 1CE8A 3RGWS 3VDRA 3OJCA 5GJBA 3CRVA 2C3UA 3OI7A 3PQCA 1I1QB 3OPYB 4M49A 2EG9A 2X0JA 1C5KA 1R9NA 2G36A 2NU7B 5JROA 1OZHA 1ECGA 3LCJA 3GR6A 3LLVA 3S2ZA 4B7ZA 4UTPA 3E9EA 4KXLA 4JA0A 1HZZA 5JFTA 3ZNOA 3D4OA 2HA4A 3GUZA 1B8OA 1SXPA 2ZYVX 1Z35A 4O1HA 3SDZA 1I4DD 2HRZA 4D97A 3OF2A 3CSSA 4JLOA 5M5BA 1I9CA 4E14A 3T5GA 1FMJA 3AJAA 3RSSA 2X6QA 5CJ2A 5LD2C 3OP1A 3TDKA 4XYBA 4MXDA 4W7SA 4EUNA 4C0BA 2VYND 5EAIA 3ER9A 4U3JB 5HDBB 1D7AA 3QOYA 1Q0HA 4IIVA 1VJGA 4QGBA 1W76A 4GX5A 1UOPA 4L8LA 4LOJA 4M6WB 4OQMA 3KTFA 3H7IA 4HBGA 2A5JA 3UK2A 3GLHE 1VJDA 2WYOA 1UDWA 2O2CA 3D8SA 3K8OE 1ITZA 3CNLA 4RHTA 1UDXA 2RHHA 3PZRA 3TQRA 1XZGA 4Q4CA 1VJ5A 4NTZA 4D8TA 4WNAB 3TTYA 4ETMA 1K6EA 5F3DA 4JQOA 4G0MA 3S44A 3TE6A 2VBGA 4ZZ0A 1GN9A 2NSYA 5HNKA 2P6OA 2X0IA 3FMIA 1PJ4A 5FLYA 1O03A 2PUBA 1CCWA 4PINA 1RXEA 4YRBA 4RVDA 1Q1QA 1TCBA 2X8AA 4KNWA 1KY5A 1T4CB 3N2EA 2Y93A 5ALLA 3WRWA 3NJRA 5A62A 1RPZA 5SY4A 2LCIA 2PIDA 1DAFA 4NQRA 5IJ9A 3O75A 1SBQA 3ZHOA 3EUEA 4R6XA 5F5NA 3LCCA 4UDXX 1VHTA 5KCMA 1CY6A 5C5EA 1ZH6A 4F12A 3K5WA 2XRFA 2IYNA 3KWFA 4H9GA 4ZVUA 2J33A 3AUUA 4RX1A 4WBSA 1YU6A 2BE9A 2J30A 1RBQA 4ND7A 1U0HC 3VU1A 1J0DA 2ECFA 3DVRX 1UZMA 4ZGWA 1ONNA 1OIVA 2QMYA 2VWQA 4FN4A 2JD1A 3R09A 2NVUB 3VMFA 5SV2A 3PU6A 4QTYA 1RE1A 2JJ1A 4MICA 4C04A 1YZVA 4GI3A 3B38A 3DDZX 3REQA 3EIQA 5KQRA 3THXB 3Q3VA 3DT6A 4X20A 4PYLA 4RNDB 2P3OA 3LYLA 2VJMA 1ZZGA 1Y3FE 2QLJA 3B1WA 1G1AA 2PGDA 2H3EA 3CLSD 4MS1A 1F0YA 4R51A 2OBXA 3QKWA 1CQPA 3I5UA 5JJIA 2AB0A 5ER6A 2GXQA 2IDJA 2TMKA 3RAPR 1GN8A 2H4WA 1LV7A 3IXQA 4E11A 2MINB 3CLVA 3AJEA 4BQEA 1R6BX 2ZS9A 3SEZA 1D6JA 5C46F 4IDBA 1XT6A 3O1HB 1K7CA 4JDUA 5I7UA 4JLWA 3K53A 2F62A 4HB2A 3WRYC 2QBYB 4B87A 4UU8A 2PQ0A 3TM4A 2BBTA 4V1CB 5G41A 1DKPA 3H1FA 1ACJA 1P17A 3ANXA 1LTHR 1NU8A 5JD3A 1AKMA 1UH5A 4Q4JA 4XASA 5IJZA 4Z99A 1JQKA 2ZSBA 3AB7A 5EMHA 5IUKC 1VZ3A 5KJFA 1P8JA 3DDUA 3LUKA 2D5LA 1CZRA 4EP1A 4AN4A 1KY3A 3AM3A 4O4LF 4WVLA 3TYXA 1E6KA 2QKYA 1E7YA 3OLXA 4C0SA 1OBFO 3QBDA 5GWXA 3LE8A 3IT1A 1MJFA 3H2ZA 1YZGA 4HDOB 5H82A 1WQ4A 4AWBA 4WQMA 4Z1OA 4LWQA 3WFZA 1RQXA 2ODWA 2WWGA 2FMTA 2BFWA 2O3RA 1BVYF 2I4LA 1V8BA 1GG9A 1OWPA 2QUAA 2NU9B 3TDNA 3LG2A 1MOPA 5FORA 1FFXA 2HV8A 3FUWA 2H1OA 4QYMA 1P1CA 2IV2X 1DIBA 2B69A 1UMCB 4LQ4A 3F7OA 3KYDA 2WUEA 3V7WA 2QR3A 5KWVA 1T9HA 1EG2A 4DCUA 3KJFA 4KSBA 5C1PA 3W2EA 3PWKA 4HDMA 3RI3A 3LC2O 1EUCA 2JCBA 3WGVA 1E2PA 3VR5D 3JRNA 4C6HA 1GRQA 2Q3LA 5DBFA 2HGZA 2KSQA 1WU8A 4KDCA 3FUUA 4GYWA 5FHRA 1GPMA 1NONA 3OZDA 2HIGA 4UZFA 4ZVQA 5I6DA 3W0LB 1LGYA 4JXZA 4NQZA 1U3UA 4HGNA 4BMCA 4DQ0A 4LZOA 4O4JF 4UQLA 4BKOA 1BE1A 3FLMA 1D2HA 2V5UA 3NP7A 3WLQA 4L0DA 2H1CA 5KMGB 2IK8A 1O95D 3B9BA 3T4XA 3FW1A 1NLUA 4P2GA 3V9PA 1Z4QA 4I9NA 3T9FA 2ZE8A 4GWLA 4UXJA 3GDWA 1E58A 2W6JA 3M6AA 4IIJA 3W8DA 1M5TA 3IT3A 4MP8A 1WRBA 4RK0A 3KKEA 4E08A 3E9MA 3ZCSA 5DHUA 2H4FA 5IPFA 1WHSA 1COWA 3K96A 5HGJA 1L4FA 2B6HA 5J58A 3W04A 4UUOA 5AI6A 1OI2A 1V71A 3V00A 3RK4A 4E51A 1JZSA 4AQYB 3ONVA 4TKUB 5G0SA 4Q3EA 2BM9A 3BJMA 4JITA 4AAYA 4IS3A 1L7BA 1XLTA 1TCVA 4FGWA 1IJEA 4UUAA 4DJJA 3K3PA 1PNVA 2A33A 3CVJA 3U7FB 3F5QA 3JWEA 3P9NA 4HR7A 4OHKA 4YASA 3AV3A 4RD6A 3MJFA 1Q15A 2HIAA 2MJLA 2Y27A 5T67A 3WNDA 4DCNA 4EPYA 2H51A 1B26A 4OGKA 1LPSA 1RD4A 2D8MA 2XVZA 4PZ9A 5F12A 5LP1A 4QTTB 1TM3E 4JT4A 4MUJA 2GTPA 3H0CA 2FCRA 1UKAA 2FP4B 5KTNA 4G89A 3BWCA 4KCGA 1O4VA 1VIVA 1T0BA 3NO4A 3PHGA 1OZFA 2PZAA 4L95C 1R74A 4G0UA 1C9JA 1S6YA 1XCBA 3VKHA 3NWPA 1I7QB 3A28A 1WOMA 3LUCA 1N8KA 2FMFA 3BRCA 5AM3A 3IQWA 1P80A 1KK2A 2JAUA 2YWXA 3GMSA 3NHKA 2CCGA 2HQBA 2FPWA 2H54A 1H05A 2BR5A 3HZZA 4ZTUB 1ZD5A 1MLDA 3ADOA 3KT6A 3LY9A 3PE4A 4BGUA 5L3QB 1FCJA 2V6MA 4HLUC 2WIBA 1XD2B 4ZOCA 2WAAA 4A5OA 2KBFA 2MU1A 1WUYA 2XSZD 2IC5A 5C34B 3PNPA 3TIVA 1UAYA 2RGNA 3PPWA 2BRUA 2D54A 1XVIA 4Q6BA 3PUZA 4N8SA 5DN6A 4PC3A 5JVDB 5AESA 2XF2A 1TMGE 2DUUA 1DRVA 2PMDA 3QA3E 5BN5B 3RO7A 2VPTA 4XWGA 4BKUA 1X7YA 4K1XA 3CR3C 3OT1B 1PEKE 1WZNA 3VU9B 1PGOA 1L7RA 3X1DA 2WVGA 4JC4A 5BWMA 1NBEA 4IIDA 3BL6A 3Q8XB 5AI9A 3FUVA 3LGXA 5DPMA 3K8ZA 1P2DA 4BMNA 4H0NA 2GI4A 5JJCA 3K0KA 3SLRA 3LA8A 1XJWA 3ITKA 4MS4A 1ZI8A 3E61A 4BVFA 3FDZA 3OJEA 4RV5A 4UUNA 4WNCA 5H81A 5A0FA 3CLRC 1ELOA 2E21A 1T1IA 1FSSA 4NDZA 1Z68A 3FZEA 1OE0A 1U8AA 2HMUA 4L6CA 3WDMA 4ZOAA 2YV1A 4JBWA 3IAAA 3S1AA 2ZDQA 2F17A 2W2KA 3BICA 3KSDO 4IDAA 4L9RA 2QTMA 2DHEA 5F35A 5IKEA 4JJIA 4D4IA 4G0YA 1JQLB 2RHMA 4RMJA 1SOWA 2WJ6A 2C04A 4QU0A 3VA7A 1V3VA 2W2PA 3PNYA 2EYUA 4YPFA 3AQIA 1T9DA 3DOFA 3I37X 1RR6A 2HM7A 3DVAB 2C8JA 3C3YA 3K0EA 1BKYA 3MIIA 1P7WA 3FAKA 4BLTA 2OV2A 3COYA 3FTNA 1PR3A 4DDKA 4EELA 1EG7A 3ZD6A 4DXHA 3AI3A 1U0LA 1Z26A 4FMBB 2WQZA 2BKEA 1YB5A 2YW2A 4RKRA 5H3CA 3RROA 1P0PA 1S3IA 3WIDA 3A7EA 1WMSA 5JWHA 4AS2A 1HBJA 2NZUG 3GWZA 3I9MA 3OTQA 2AYXA 4FOTA 3WLLA 1GZSA 4P3YA 3AJDA 3HB9A 5B7PA 5LNK6 3KB1A 5K3FB 1U9IC 3GA0A 1KO5A 2DJ5A 4WXYB 2DBVO 5J43A 2QA5A 3JQDA 4OHFA 5EMJA 4RENA 3G7SA 4TVSA 3HC7A 1O87A 2PUEA 1KE1A 5JMTA 4Z54A 1U80A 4RD1A 3SM3A 1EHIA 3AVWA 3HU5A 1AGYA 3QJGA 4YJFB 5SYMA 5DTIA 1S9HA 2W90A 4MUIA 2ZITA 4OGWA 4RANA 3IVCA 1JVNA 1JMVA 3W8FA 3EJWA 3NBXX 5J5CA 4OATA 1J97A 3V1KA 4EG6A 2UVQA 1LK7A 3HYSA 3PKZA 4AB1A 4LX8A 1G6HA 3L4EA 1D6NA 1FFDA 3N2NA 5J4VA 3MN1A 1IL0A 3P4YA 2QZSA 2O1SA 4MKIA 5TQ2A 3STUA 3VR4A 1KJWA 2ATXA 2AYZA 3HWRA 3T5CA 4L3WA 3DEJA 3SF8A 5K0CA 1ZN9A 5HQJA 4TKVB 1QIGA 1Y7HA 4LXGA 3BHJA 3RRZA 2YFQA 4GLFA 3W1WA 4BL5A 1QE5A 4E30A 4ZC1A 5BNWA 3PJRA 1T13A 4CZ2A 2VPYA 4BRUA 1XRNA 2YRWA 5BVHB 1V41E 4IEIA 4FDUA 5HSGA 1EFVB 1JW9B 4PSCA 1R5NA 2QRQA 3HKDA 4LZNA 2NX2A 4P7BA 3NIDB 4AZ3B 2DPHA 1SN7A 1VBNA 3IQHX 4ABTA 3CA8A 4IEFB 1NXSA 1YJAA 2ZKLA 1G8YA 4RMHA 3VOTA 2BI8A 1GUZA 3CN9A 4DPLA 3JAKB 3ZU2A 1Q0RA 2OC4A 3VYWA 1NZJA 4CLOA 1NLYA 1Q22A 2JLCA 1WBDA 1KMNA 2JATA 4OP3A 1KI1A 2C3MA 1J9ZA 1SCUA 4JEHA 2R7LA 3VX3A 1WB4A 1DT3A 2WKSA 2ZB4A 4B3MB 4HP8A 2UVDA 4M0UA 3TZCA 1Z5GA 3T7IA 1O57A 3CURA 3U61B 1C81A 4HHEA 4WXEA 4KTVE 4KX3A 1M6VB 4L27A 3T9EA 3HACA 3TLCA 1TD9A 1RHRA 1CY4A 2EJBA 3PYXA 1DI0A 4EHDA 3E4CA 4TYNA 6ADHA 1XCMA 4JB8A 1HSOA 2I4RA 1RW4A 4NONA 1V8OA 2Q28A 3HY3A 4KLAA 1IXYA 4MGEA 3DMDA 1RYZA 2E82A 4GP6A 1VSQA 1Q0LA 4O25A 2FW6A 2POCA 4FZJA 3BWBA 1RZ3A 5J1TB 5TVKA 4R68A 1R0WA 1E0AA 4IIJF 3WL5A 2P9GA 3WQBA 1H3FA 4PBTA 1VKNA 4QOJA 2HDNB 2PJDA 4HAWA 5FAXA 3TW0A 2P2GA 2ZR7A 3WGOA 4NCKA 3A9SA 1R5OA 1U1GA 1GNQA 1H1LA 2GN1A 3GNSA 5BT9A 4YQEA 2YJNA 4QOGA 3W6PA 3NHLA 1JPJA 4F3TA 3VDMA 5KC9A 4OQXA 2CL7X 5CFPA 2IBTA 1R64A 1M74A 1QNFA 5TJHA 5CVTA 1T3HA 1TPYA 2JI4A 4JI4B 1TM5E 3MWEB 3IAHA 5F1YA 1AKWA 2C9BA 5ILQA 5FP0A 3EGEA 3AETA 2GILA 2PO5A 2QZJA 1WHTA 2H0AA 1WMDA 2MR5A 2V7GA 4G5SA 3L7YA 3FCEA 4J7AA 4W8GA 5JISA 4YH1A 5I47A 2D1TA 2XCQA 1YCHA 1GAJA 4N3GA 2HPHA 3Q15C 3I58A 5BSGA 5B6JA 1OBOA 2ZZKA 4BO7A 2CNWD 1U4OA 2PY6A 3QXJA 3DF7A 4LMPA 4OJNA 5C81A 3OM0A 2JEOA 1QMGA 2P90A 4YO7A 2EKPA 4AICA 1X7XB 4EJSA 3GRZA 2OKGA 2BFFB 2YQ4A 1GFZA 3GOHA 4MW4A 4UASA 3HR4A 2C4HA 1RZVA 4EW3A 2W6JD 4KR2A 5CB0A 1JQ5A 3EA4A 3DVSX 3FBWA 1Q0PA 2PQMA 4RF2A 4GX0A 3WBJA 4X1KA 5IDWA 1J7JA 3ZVLA 5GONF 3VH2A 4N03A 4Q7EA 1QAMA 2MMCA 4JSTA 1XJCA 2JGMA 3E2IA 3VNAA 5ADHA 1KHTA 2HSJA 2E6UX 2H7VA 3IUJA 4GOND 4TTVA 4ETNA 3GLTA 4LE1A 3VO1A 1IN7A 4BCCA 3DEIA 4DV2B 1MO2A 1A2KC 3DQZA 1AKTA 4FKMA 4Q02A 4ZT4A 2N75A 2IYSA 2NNLD 4GC9A 4JASB 3K2BA 2IHKA 5G4KB 2NUAA 4FC6A 4DHEA 4IINA 1S7GA 1KWGA 2VPWA 5E8JA 2IU3A 2SKDA 3P5SA 4NCHA 3ROFA 3O1JC 3UK6A 4EB6A 4EHNA 4F91B 1K7YA 4PN7A 1K5DA 1YFZA 2MSNA 2QAIA 1RJ9B 3A26A 1FLVA 5ILGA 4AMGA 1JLLB 4DNQA 4LRUA 4TSFD 1IWPB 3BXXA 4K6HA 3L93A 4QA9A 4B44A 4F3YA 3F46A 3PE3A 3FBTA 1KQNA 1FTNA 1Z83A 5JSZA 1C1XB 1VRCA 4WESA 3FRJA 4XGNA 1BNCA 1TYDE 1AG9A 1ICIA 1U2QA 3CGGA 3GDHA 4QX6A 4A15A 4XVCA 3A3NA 3G8DA 4ZQGA 2PTHA 2RCYA 2OFWA 3QVGB 1PO7A 4J0QA 5ERXA 3MPOA 5I9SA 4BNJA 4RKWA 3ML1A 3F5FA 5TXGA 3AF6A 3IBGA 1YASA 1NVGA 1U2EA 2I6XA 3AHFA 3R41A 4OKNA 4QUEA 2JZOA 5K51A 4A5SA 3HZRA 1QTQA 1W1IA 4QGGA 5EXPA 5AW5A 4AK9A 3S4YA 5ARBA 3AZPA 4P0PB 4DUGA 3PQ8A 2XCTB 1E5TA 2Z98A 4JMPA 4M55A 5FTJA 2ZGVA 5CYOA 3SS8A 1GKKA 4MHOA 1NZFA 1M1NB 2J85A 2PZFA 2WPDA 4O4LB 5TMBA 4KMSA 5E4YA 5CFNA 2PFGA 1CUBA 1V9LA 4JX8A 5C4MA 1NKSA 1KI6B 3BMOA 4UHEA 2IA5A 4DLRA 2FRDA 4U2FA 1YL6A 1NDUA 1PX0A 2ZYAA 1ZA1A 3BQNB 4IRUB 2Q0QA 4IIBA 4KO2S 4W5WA 4DHWA 2EQAA 3TWOA 1DCTA 5H5JA 3PRHA 4JWTA 3ZXUB 4EDHA 1EFPB 2VDKB 1GTJ1 2Q6TA 5DWQA 1GUAA 3FCAA 4DIOA 3C1AA 3CEPB 2ZTSA 1ID1A 2DG2A 3O8CA 3TSCA 3L07A 3TQIA 3ZXSA 4P6VF 2AEJA 1G4AE 5BV0A 3F97A 2FAXA 3VU0A 4DARA 1U8CB 4PCAA 5TQ0B 2WF8A 4J0KA 4Z2YA 3TZQA 1MVLA 3MT9A 4ZO9A 1HNZB 5F51A 3OA0A 2BCGY 3ENZA 1YB1A 1GTSA 4DR7B 3B6IA 4P3PA 2PAFA 2VP2A 1P0FA 2OLJA 4ENUA 3DP9A 2OT3B 1UFOA 2FEWB 1FXUA 4IDGA 4L6IA 2ZBEA 4QQ8A 1XRLA 4MVJF 1U7OA 1IHXA 4DSAA 1U5CA 2IYTA 4CEIB 1G2OA 3UIEA 4O4JB 2J0SA 1FFGA 1SD1A 3PR3A 1FP1D 2L19A 3FOZA 2BEJA 3N5CA 3DC2A 1QSGA 1HT3A 2WSYB 4JX9A 1TKBA 1K8YB 3K6RA 1OAOA 3EHDA 2HRQA 4HEJA 3TLBA 4BTVA 4DE5A 5MFZA 2CLHB 2XA9A 2HY7A 1U63A 3UH1A 3GLVA 1JR2A 2A9RA 4FKZA 2ZJ6A 1CR6A 5CIQA 3VHQA 5B6IA 5I8PA 1Z08A 1LVUA 1GGNA 2GEJA 1NULA 4EGSA 1J0XO 4TXHA 5K01A 3CC8A 4RZQA 3C48A 1YXMA 2R4UA 2XMQA 1YZFA 4JJ6A 4QATA 2BGUA 1RXYA 5KNBA 3AIOA 4D4HA 2CMDA 5IH7A 3N2KB 2GN0A 1VL1A 4FFNA 1W4AA 1UJCA 1I10A 1QFXA 2PSFA 3EEYA 3I73A 1OXSC 4YAJA 4YUYA 4CIWA 2YHIA 3WQSB 1FW8A 2QN3A 4QVGA 4AZ0A 1V39A 3UQYS 3Q98A 1S3FA 4QU9A 2PX4A 4JLMA 3OKFA 1M1YB 5JQGF 4L08A 4W6ZA 4HXFB 3L8EA 1B2LA 2RGCA 3F6YA 4R81A 2R48A 4TQUS 3GMTA 2ISSD 4MWEA 4WVFA 2EBWA 2I76A 3PEVA 1KJQA 3I9KA 4GPIB 4MVJD 4WFQA 2HB6A 4D4GA 4P7JA 4O2LA 4Y98A 5K6AC 4OI2A 5F3RA 4Q9KA 5MFPA 4LJSA 1CB7A 5AKZA 3WYDA 2FWNA 2HF2A 1Y89A 3HRIA 4ZYZA 1V7PC 3GBVA 5BOSB 1VMIA 2R6CA 3BWDD 3DBRB 5AKYA 4DQXA 5HWSA 1R6DA 2ERYA 1XXHA 3AM4A 4KLNA 1J8DA 1TZMA 4ZZ2A 1SURA 2OA0A 2FGJA 3PT9A 1H94A 4QELA 5P21A 1MC1A 1NRWA 5L4SA 1U1IA 5DNAA 1HYBA 4U9HS 2JAQA 5HTOA 4H6XA 2OD7A 3SYKA 4D8WA 1ZSNA 1GILA 1U2DC 3UWMA 4JC8A 5LVAA 5CB6A 1EK0A 4JUFA 2UUBB 1OFUA 2NG1A 5CW1A 3GGPA 5EG5A 3OQNA 3M1IA 1U2PA 3OQPA 4IXMA 4P80A 4AULA 1VHDA 3WY9A 2CUTA 2GXUA 3B1FA 3PVCA 2X9LA 2AFHE 3MMNA 3LF1A 5F21A 3LOQA 4JYAB 1WMFA 4BGDA 2Q4BA 2ECOA 3LIPA 3OIFA 1FB5A 2GPTA 4DPMA 4JI0B 2CD7A 1N0VC 2FE4A 3G68A 1T2EA 3A14A 1SPXA 1ZGCA 2FFAA 4NOMA 1B8NA 4KWCA 5FO1A 1R0ZA 2I8LA 1NRIA 2QTNA 2R1UA 2WSIA 1YU9A 4HWTA 5JMWA 2RJNA 4ESEA 4G09A 3MOIA 3ZS9A 4M60A 4QO8A 3ESDA 3HBMA 1M2EA 1NBME 3NM6B 1Z3CA 3G2KA 1Z36A 2PWYA 2TRSB 3PUIA 4BKRA 5DP1A 4N76A 3D8BA 1Q0UA 1NKTA 3L18A 4UDOA 4CHGA 1XKTA 3JZFA 4RIHA 3RHTA 1S1CA 4D26A 1LX7A 1NVEA 3D6UA 5CA0A 3PTAA 4B8YA 4YCBA 3NKLA 1N9GB 4FS8A 1E2IA 5G3YA 3GGCA 4S1TA 5TPWB 2I2XB 1B1CA 2FLKA 5A3SA 1L8QA 2RGBA 1VI6A 1XL0A 2R85A 4LEIA 4AECA 4EPVA 1Q1AA 4JGGA 5T57A 2PKWA 1F7VA 1SMKA 5D5PA 4E21A 4LMRA 4XQ0A 2YIDA 1RXUA 2P5YA 3PSHA 4RPHA 3WA7A 4BVEA 1K27A 3FB4A 3PK0A 1M6HA 4Q21A 3TAXA 2HF8A 3WNQA 4CMIA 3D2BA 1SZCA 3ZD7A 3LYAA 1E5XA 6LDHA 3C5WP 5JCOC 5IW8A 4OHZA 1WOYA 3WKBA 1ORWA 3A25A 3BAFA 1ZN2A 3AR6A 4BLQA 4HNAA 4A1OA 1OWMA 2QS9A 4ITVA 3HEBA 1G5HA 3DXYA 5KS2A 1QUEA 5IJ9B 1IQPA 1HOXA 5DLQC 1EP9A 2GN6A 3KQQA 1QQAA 2VJLA 5KTMA 1VECA 2XZDA 5HJ5A 2W22A 3HY4A 2QV7A 2O5EA 2YMLA 1FP2A 2X15A 3GFTA 3JQ9C 4S3MA 5LA6A 4NU8X 4RK4A 3B2QA 5CT9A 1JSCA 1WCYA 2UZAA 4HQKA 3A9UA 2C4TA 2ZXFA 2BD0A 2UKDA 2CLEB 4MNTA 1ECLA 3Q10A 1K8RA 1THZA 2WOJA 3V3TA 4BUCA 2QP4A 1E9AA 3CXUA 1Q0TA 4QWMA 4WACA 3T7SA 5ALVA 4M99A 1AQIA 3QPCA 1E7RA 3N74A 3B2EA 3IBFA 1DKRA 3G7UA 4TRRA 5FB3A 3RG8A 4EZIA 4P7GA 1KI7A 1IUNA 3CLTC 3SZOA 1KAQA 4JIMA 2HDHA 1A95A 1I2AA 2CK3A 3NIBA 1MO5A 4HNGA 5E2BA 1C0IA 1WIWA 2XDQB 5LBUA 5DWVA 1NLZA 4MVXA 5AUPB 2VZEA 5GV7A 1D09A 1EQ2A 3NPAA 3E1KA 4LRQA 1U0RA 3RC7A 1Z8FA 3G0OA 2ICAA 4UHFA 5K2MA 3GRAA 1LK0A 1QFSA 2CVPA 1HGXA 2HA5A 4Q5IA 4RVNA 2WWYA 4G97A 1OKKD 1EEHA 2YIJA 1IG3A 4HH0A 3O74A 4TS1A 5CM2Z 3UM9A 4CG3A 5KTRA 1NNEA 2A0UA 2OZLA 3CISA 3GFBA 2C07A 3X1YA 2MYNA 3MCZA 3RSLA 3W1EA 3A1EA 2OKCA 3D8HA 2NW6A 2CZCA 1POWA 4KPEC 4L57A 4UM9D 4DIEA 2IQIA 5DNYB 3RTDA 3U17A 4A7PA 2J3DA 1TUBA 4MVJP 2WWFA 4GBMA 1LPBB 3DE1X 4MDYA 4DNPA 3U3KA 3DJFA 3ED5A 5HIIA 1DKUA 4Q9NA 4RHCA 4AIRA 4CMKA 1N2EA 3I8OA 4IDPA 2GDZA 4A2CA 4KI7A 2DRIA 4XB6B 2YN4A 1EWYA 4E4YA 2IYAA 1HUQA 4RAQA 4WE3A 2O6HA 2BM8A 3FPCA 4DSUA 1SRQA 3CG4A 2HA0A 2HH9A 4MKFA 2B4AA 2AF4C 5A5EA 1VC2A 3PGLA 2LV8A 2O07A 3MRSA 3O93A 1C4XA 2CUNA 1CKEA 5KI6A 2G5GX 5ICGA 3OQ6A 5LQKA 4DZTA 2AC7A 4FFVA 1KZ4A 3OPXA 1W8DA 3OTHA 1FDSA 2GCOB 5I4CA 2AFHA 2G9QA 1M7BA 2XOXA 4URHA 2CHUA 5JXWA 3N0WA 2EF1A 4YAIA 5B4VA 5J4HA 3SIXA 3A1SA 3ZVMA 4DREA 4OYYA 1MH9A 1YGPA 4HEHA 3L0SA 4G86A 2GFHA 3KYDB 5K3AA 4EG5A 3TG2A 1BTOA 3NOQA 4ES6A 4OSPA 4Q0MA 2QQEA 1ESNA 4JSRA 2ODAA 3DHYA 1I2DA 1THGA 3C1OA 4HDMB 2C4UA 3WNVA 1XVAA 3RTAA 1NBMA 3K2IA 1DMRA 2PQ6A 3DE7X 3HCAA 3TEJA 5CLIA 3O8OA 4DR2B 4B6SA 3ZD8A 3KU1A 5LQNA 5FI5A 5LUBA 4GX1A 3ND5A 2IHVA 3RRMA 5CIWA 4KDFA 2J6BA 4I4TA 1GL3A 2G09A 1KZ6A 1TK2A 2ZR8A 2EKBA 4NIMA 4ZHQB 4UXIA 5LLTA 1U2TA 1FMLA 2VUHB 3FWYA 2QI9C 1JTFA 1B6GA 5A2GA 3OLVA 1XZEA 2QN8A 4KYVA 4FCTA 4Y0VA 3U80A 4Q1EA 4XSVA 4IIJB 3E9RA 4HGOA 4JBHA 3RARA 1AA6A 4JLNA 4BEWA 1CHNA 5CBKA 1K7EB 1LK5A 4PNHA 1NI5A 1I7NA 1TO1E 1SUDA 2OENG 2WHRA 2YBDA 4E5YA 4YS6A 4N01A 2CFIA 5B3AA 4CLEA 5JI2E 3FZQA 1RTTA 1OC4A 3OEED 1WHSB 1IHPA 2AUNA 2GJAA 3AI2A 5A2QA 4GT1A 5KSYA 3PICA 2WQ6A 2GRJA 1JDVA 1K5PA 3TPFA 5KCZA 3GUHA 5FOVA 1QB8A 3RC3A 4QLOA 1JHMA 3EVFA 2HMTA 3F8SA 4QQKA 5A9RA 2FEOA 3B5JA 5IKXA 3GZJA 1XDSA 3AFNA 4ENSA 3LC7O 3AI7A 4DLVA 1E89A 1JJAA 4YAOA 2PZBA 2R97A 1VCIA 3VBEA 3GJ0A 3PXCX 4DA8A 4UULA 4BQNA 3ZNNA 1QIMA 3LV8A 3N2ZB 3PQ6A 4WNIA 3DAHA 2W2LD 1DINA 1FSZA 3MBOA 2FN7A 3PRJA 4HRAA 4XWOA 5AW3A 2VSFA 2DFKB 4GVPA 1WZ2A 1T3SA 1M1XB 1AGNA 1Q0SA 3UENA 2I9PA 5BNIA 3P9ZA 1BWPA 1GY8A 5CDUA 5KWJA 1JE1A 1CXZA 3ND9A 4QQRA 5C8YA 3I5YA 2CSUA 5BW6B 2PJRA 1K3TA 1LBIA 1ECBA 1Z0SA 3Q2OA 3EVEA 2C7VA 1FS5A 3BIWA 4UW9A 5CNKA 2UUPA 4EHAA 1DWUA 4TTAA 4RWEA 1LBTA 2OQRA 2BHRA 5GONB 2WF5A 3L43A 4L7QA 4BDTA 3CNNA 4QBIA 1GGMA 3PCRB 1OYVA 4WT7A 3A11A 2BHSA 1HEIA 2B1IA 2JHPA 1EP3B 2DH5A 3IVGA 4KXVA 1WDKA 2HIHA 4Y1FA 5FEMA 1R0CA 4HS4A 3A8TA 4KFSA 1P3DA 3HUTA 4IUYA 3VC3A 3WXBA 1GDTA 3KB8A 3TLGA 3FYTA 3I0MA 2PZLA 4P3OA 5FRDA 2IZOA 3PNMA 4TKLA 3UUFA 2OG1A 2OCLA 5F5XA 2B20A 5CU7A 5E6RA 1NAHA 2Z6AA 1AH2A 3B9PA 4B3JA 1HTTA 1ORTA 2F8MA 3W7BA 3EGCA 2R5FA 1GJRA 2IZ1A 2AMLA 1CULC 2EOAA 3CSUA 5EE9A 1H93A 3B8HA 2WJPA 3AB8A 2GH1A 3DWIA 4I9FA 4Z4EA 3GJ7A 1C50A 3H5AA 4BCBA 1PQPA 1WXEA 2YNMC 4XGQA 1UL1X 4DC1A 5A9TA 3CEMA 4H3KB 1X7YB 3GD5A 1E9CA 1I3KA 3K92A 4UPVA 3OQOA 1PLJA 2DFDA 3P0RA 4FR2A 4KE7A 5DNVA 1CBUA 1XEXA 1RNLA 1UM9A 2M32A 5KDLA 1QUFA 4BFCA 4AP5A 2P9YA 3GFGA 1MORA 2YQZA 3I32A 5CA0F 1HDOA 4V39A 4WL0A 1PQWA 1X1RA 2FN8A 2G9UA 2ZVJA 5AVRA 3JPWA 1U0EA 1NQOA 2IPAB 2FZ5A 2V6JA 3ELWA 3Q7EA 4MHTA 3M49A 2PVSA 6ABPA 2O5RA 1QWSA 5B1SA 4MI1A 3F6PA 4EO9A 4LTMA 4UUPA 3U3ZA 2DB3A 4EHFA 1P7CA 1KI9A 1LI5A 2QTHA 3H17A 3S1AB 2DPGA 4FHGA 4XDYA 1EX9A 3G0GA 2AMFA 1CJUC 4U2GA 4LAFA 1ZSYA 2ID7A 3H3FA 4HWKA 3D6TB 1R6TA 4UD2A 4BV3A 2C54A 1IY1A 1PV2A 1EA5A 3OD1A 4DCVA 1GAEO 3F7MA 5DXJA 1Z0ZA 1SQSA 3OPQA 1GPAA 2V5VA 1P0CA 1ORIA 1NOKA 2LPMA 3OQMA 3CNOA 4XFKA 1YQ9A 1SU7A 3UCEA 1DDIA 4DSZA 4LKOA 1ZVMA 3F5SA 4ZAZA 4CTMA 3LGAA 3PYMA 1RRFA 2V9PA 1FDWA 3OTGA 3KCNA 2DPYA 2VLIA 1TVMA 3VJKA 2WLTA 4I19A 3JPYA 4YTEA 1G1MA 1Y7PA 1GIAA 2KW5A 2O1WA 3LP8A 3TVYA 2NTYC 3A4NA 5TMPA 4G85A 2BDUA 2Q2OA 5B7NA 3SQMA 2QMOA 1TEXA 5DI9A 3PHIA 4PG4A 4QJ5A 1ADFA 4PQRA 3U44B 1X1QA 1B6TA 4HYYA 1G21A 1O6FA 3QPUA 4H08A 3IQIX 3W2HA 3DS8A 2PEZA 3L46A 1HFJA 1XQWA 1W2WB 4GL4A 4P98A 3VTFA 1OD6A 5JZVA 4FDMA 3LCUA 2C77A 2UZ1A 1RYHA 2XOEA 4BDSA 2QRLA 1P1IA 1IATA 3PGKA 1TTPB 2DT8A 3QVMA 4YCDA 1PR1A 1XRQA 2FRVA 3R9IA 2ONJA 2IP4A 3TRJA 3WGLA 4B3CA 4Q47A 2C7GA 2MMGA 4ZICA 4KQWA 3GLFA 2F64A 4P4SA 2ZE6A 3BFKA 3SC2A 3SF8B 3A10A 1UWCA 2A9VA 2OBFA 3PUKA 4JFAA 5IARA 1TJ3A 1UBEA 2ZWOA 3FFBA 3K1AA 1G3UA 4E7OA 5ITSA 4ACBA 2JD0A 1JE0A 1CVLA 2OGSA 4HZUA 5BUCA 4GW3A 3LZDA 2GCGA 5JDIA 2UZ4A 1BQEA 3DCIA 5DGXA 3ZU4A 3PFIA 4RELA 3NDRA 1F2VA 1O4WA 2FFQA 2XUZA 5AP9A 5JQGB 5IKOA 1F4PA 5EP1A 1WA5A 221PA 2P0AA 2RGXA 3MRTA 4U4AA 3G23A 4ZAFA 5C2JB 2RGGA 3PC2A 3F96A 1RVV1 4C87A 5BW4A 4EFKA 4NMXB 4MUYA 3K7EA 3TEMA 3WGGA 4CLOB 3M4ZA 1LRLA 4ENTA 3EG5A 4CI0B 1CJCA 2HAEA 3HGMA 4EW1A 3R9WA 1HH4A 3I2FA 4ALMA 2VA9A 1SCUB 1VG1A 2J5KA 2XIJA 3BMNA 3H8SA 1NOIA 1T6NA 3WGHA 1GXSA 4ZO4A 3OM9A 1WQ1R 4QLAA 4W9MC 4LGMA 3VZRA 1MQSA 1UXJA 2JB9A 1UKCA 5EPUA 1YSCA 4PHCA 2Q5HA 5HOEA 2BBOA 2Q9UA 4LMAA 3W9UA 3Q8KA 4XUGB 3TQCA 4ASUA 4CF5A 5FPKA 2GPSA 5M29A 1GU7A 4GKKB 3ZE8A 1OILA 3QFHA 4ZQEA 4FOOA 4FLFA 4BB5A 4MW2A 4I4TF 3V1MA 3DNPA 5REQB 3N8GA 4B71A 1BGWA 5BMVB 4K88A 1VPVA 1XF1A 1KBQA 1VRVA 1L5NA 2M2IA 7YASA 2LIVA 3HB1A 5JAMA 4BPBA 1NVAA 4HDKA 1UANA 2X8LA 1D04A 5HFAA 2FG7C 3EVCA 4IFTA 3PQFA 4J1SA 1LCIA 4LY6A 1HORA 3I2JA 1X19A 1JRLA 1XQ1A 2VJQA 1SG0A 3BFJA 1LNQA 3BSSA 3FZYA 3GJZA 3V55A 1NW8A 4NX2A 4C3VA 1GP2A 3UPTA 3Q1KA 3IAM1 2XTMA 1YQGA 3MOGA 1UMKA 1KYXA 3CEHA 3WO0A 3G8CA 4Q4AA 4GGPA 3ENWA 3ZC3A 1GQYA 2R62A 2AK3A 2P6MA 5HMLA 3OPNA 1BJRE 3TSWA 1CTQA 1M2OB 1PK9A 5H9VA 4F72A 4MROA 2H1IA 5AI8A 5JDCC 1C4OA 1Z34A 2JFGA 1ZWKA 1GTVA 3AETB 1WHTB 3COPA 3BSFA 1LI4A 3VR6H 1H6CA 2J9RA 3YASA 1N4DA 4ZK2A 3F8WA 1L5SA 3B82A 2AFVA 4GKAA 2VWHA 3G6KA 4IQGA 1NQ5A 4XWTA 2ZJ0A 4TTTS 1OJ7A 2Z6QA 3VHXA 3W2TA 3ESAA 2D0IA 2JHFA 4JJGA 4KL8S 4UM5A 3HZOA 5BURA 4IDDA 1B43A 4FKBA 3QE0A 4JL8A 5ALSA 4EJSB 4EO4A 1FSFA 3OZXA 3GJ6A 1ZD9A 1Q77A 5GPBA 3NFYA 3CV3A 3MLAA 4O1MA 5C8YF 3G5AA 4DUPA 4EATA 2E4WA 2ZYTX 3QFRA 4GKBA 4IPTA 4UHBA 2A4MA 2ZJAA 3ZE0B 2QN6A 3PFWO 2C88A 2ZOSA 2DKNA 3EEFA 2V7UA 2D1RA 4X1KB 1CSEE 3ADKA 4CTNA 1NGSA 3MJCA 2JCXA 3E7XA 4F86A 1RU3A 2PUGA 2GFQA 4UM9B 4O33A 2YWCA 5JO9A 3DUWA 3RS8A 3F90A 3UC5A 2YXNA 3EQ6A 2VN8A 2UVPA 2ZBGA 3N53A 4M36A 5AK3A 1IY9A 4AIIA 1MMFB 1GT6A 2FEAA 1YQXA 2F3UA 2OO5C 4CPDA 2H4ZA 4Y6LA 4QEKA 1NVBA 4IMRA 3WNZA 1KFJB 3K2EA 5BWBA 3RS4A 1QQ5A 3E0QA 3GEEA 3NHPA 4PAGA 2EW1A 2VJBA 3ETDA 3M82A 4C7OB 3JRXA 1P1HA 2FZLA 3HJHA 4JOSA 4ZKDA 1A7AA 2VLBA 2GOYA 3UF0A 2PR7A 4QPNA 3UK0A 2NUAB 2J3IA 4WY2A 1ZUNA 4EB6B 3AF2A 5KJCA 2HCTA 3OFKA 1TA0A 2XKBA 5AUOB 3V4VB 3ZZ1A 4GAEA 2BGLA 5H8WA 3F6SA 4WDRA 1Q3HA 5EHIA 3T7TA 2GRAA 3NBAA 1B3BA 4JODA 4Z7JA 4IJMA 4MW9A 1DEXA 1SELA 1WB5A 5FJIA 1HNWB 3GBPA 3LK6A 3E9QA 2I91A 4P93A 3WWCA 1DZ3A 3U6KA 3NP9A 3VR3D 1L5ZA 1MEEA 2WWHA 2ZUTA 5DI3A 4TWBA 1H8EA 2AVDA 3LDUA 3WAGA 2OK7A 5JNUA 1EE2A 1JKMA 2AGVA 2ODEA 1R1DA 3L0PA 5C52B 3W1VA 1DBVO 4FZRA 3TNJA 1EDDA 1F3OA 2XCLA 3HADA 3GGGA 2GCPA 1E1DA 4G0NA 3AP1A 3RIYA 2NVOA 3IIMA 3MAGA 4US0R 5B3JA 3BXHA 4LE0A 5DP2A 3MUNA 4AKEA 1UFVA 2B61A 4G67A 3WK4A 3BVPA 1BXRB 1TYBE 2DX7A 4W9RA 3SKXA 5BWNA 5HX7A 4WZAA 4RDHA 2ILTA 2ODNA 2ZTUA 3KRTA 4C88A 4F56A 5LQSA 5KNCH 1XDWA 3M6VA 3B7GA 3GFSA 3I5AA 4O59O 4YECA 1F1BA 3RREA 3BMOB 6GPBA 5AK4A 2N46A 3TN7A 3C45A 3ABIA 1X7DA 2ZI9A 3BM5A 4OYHA 4WZBA 1KYTA 1QNLA 5EHXA 4L2IA 5EJ5A 2QM0A 2E2WA 1Y6RA 4JLSA 3U37A 4XFJA 2ZM6B 1Y6ZA 4QODA 1XJ5A 2GARA 4RVFA 1EDBA 3BCHA 4IHJA 5JAZA 3HI6A 3WTBA 4E46A 4BLUA 3PB3A 2FUG6 3MD9A 1QK5A 2MSKA 2W4QA 2Z57A 1UBMS 2LBPA 2R8EA 3PDWA 4UBMA 3I52A 4J49A 3RNLA 2C5GA 1XKLA 2D13A 1W36D 2FDXA 4NR0A 3JQQA 3KLMX 1F38A 1Z38A 3DM9B 3I6QA 4GD3Q 1G7RA 4XR4A 4IUDS 5EESA 1GPDG 5FULA 2Y1DA 1L7XA 3TRHA 2VTDA 6REQA 1XQ6A 2Q0HA 3C3BA 3L7BA 3P2JA 3IILA 3PC4A 3W5HA 4GI5A 4PSDA 4EAQA 1N8NA 4QVIA 3H8WA 2FWRA 1BDHA 1UEIA 4BX3A 1IJKA 1Q21A 1A8PA 2PH5A 2PVCA 2QSYA 3TLAA 2XVAA 4YI3A 3GP8A 4DSOA 2JASA 2EDCA 3I0NA 1IMOA 1AUOA 2QJWA 3DXFA 4MUMA 1G6OA 4R84A 1X6VA 1B8UA 2QR5A 4AMUA 5JIBA 4FJ1A 4NJMB 3ITEA 5EQDA 3DKKA 1EM8B 1V2HE 4IDQA 3SQLA 2YICA 4DR6B 4L85A 4EW6A 1QE3A 1SD2A 1U3CA 2FJPA 2IZ5A 1L6RA 3NATA 3DZIA 4MV1A 2FXVA 3KEQA 4JYPA 3TBKA 5L3VA 3K70C 1PVOA 1N6IA 2FK8A 4Z6KA 1F60A 2D7JA 3C6BA 4A0SA 4II3A 3IQZA 4UFOA 5E7MA 5IBQA 4EH1A 4R1QA 2RHLA 1YKGA 1QH1B 2ZQYA 3KVOA 1U1EA 1VI5A 1XG5A 3MYRA 5JE8A 3WJAA 1MZPA 2CCJA 3ORHA 3TUIC 1YTUA 3SKVA 4DY6A 5BPFA 4K40A 3SNHA 2OQVA 2I66A 2QZ4A 1AK2A 3HY6A 5KVAA 2ZM5A 1A0OA 3E82A 3EZFA 3FDXA 3PXEA 4OXKA 4CG2A 2CFCA 3WNCA 2DVMA 3QVSA 1EFTA 4E4TA 4EX6A 5LQUA 1JLRA 9ATCA 1MRSA 4F1KA 4IJ5A 1ZGBA 1USWA 1ACLA 3DGFC 1MAVA 4Y18A 5BSMA 1EK1A 2H52A 1Z5ZA 2EW2A 4DEYA 5C3MA 1W7AA 5FYDA 1E4VA 1P73A 3A6FA 2NYAA 4WFJA 8ATCA 1ESMA 3DE6X 1PS0A 2JKYA 3EAGA 3IKLA 3JXEA 4JLKA 4HBZA 3HZHA 3PLAE 2OHJA 2Z08A 1UQTA 4O4IF 3RANA 4LF8B 3HCWA 3L7KA 4M7OA 2O05A 5EA2A 4DY4A 1RFGE 4UBKA 4R2XA 1RWWA 2BFCA 2NO4A 2Y3IA 4DDHA 2WK1A 4DTCA 5L8VA 3A6HA 3PFCA 3LKDA 3D6FA 1DG1G 3EGVA 3TUJC 1DCFA 1X80B 3TF5A 1N7JA 4NAHA 3GAAA 3RBAA 3WBKA 2GS9A 3KSUA 2VWGA 1GFSA 1ML4A 4D43A 1FVHA 4Q3NA 2XBUA 3COSA 3MFQA 4W8OA 3H86A 4CDRA 1BDJA 3ESRA 2JFHA 1SCJA 3TCXB 5ERYA 3WV5A 1W6RA 4IIUA 5FBHA 3RVRA 3A6GA 1XKXA 5LQAA 1I01A 1H5UA 3IP3A 3OZAA 1WZIA 2C7OA 4BRZA 1RYNA 4EKNB 1GTRA 4XUDA 1L0BA 1E6MA 3PHLA 5ECDA 1USVA 1JFFA 4XEHA 2WR8A 2BMFA 5IVPA 3L8HA 2QP3A 3D7LA 5IRCD 4KQJA 3EAFA 1P9RA 3HA5A 4XQGA 3RRXA 3WLHA 2PE5A 4FGZA 1GAQA 4CKWA 5CT8A 1UK7A 2HR1A 1U81A 1SNYA 1BEUB