2HM7A

Crystal structure analysis of the g84s est2 mutant
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
308
structure length
308
Chain Sequence
LDPVIQQVLDQLNRMPAPDYKHLSAQQFRSQQSLFPPVKKEPVAEVREFDMDLPGRTLKVRMYRPEGVEPPYPALVYYHGGSWVVGDLETHDPVCRVLAKDGRAVVFSVDYRLAPEHKFPAAVEDAYDALQWIAERAADFHLDPARIAVGGDSAGGNLAAVTSILAKERGGPALAFQLLIYPSTGYDPAHPPASIEENAEGYLLTGGMMLWFRDQYLNSLEELTHPWFSPVLYPDLSGLPPAYIATAQYDPLRDVGKLYAEALNKAGVKVEIENFEDLIHGFAQFYSLSPGATKALVRIAEKLRDALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Carboxylesterase
publication title Functional and structural features of the oxyanion hole in a thermophilic esterase from Alicyclobacillus acidocaldarius.
pubmed doi rcsb
source organism Alicyclobacillus acidocaldarius
total genus 99
structure length 308
sequence length 308
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2hm7A00
1MX9A 2WG2A 2CJPA 2WFLB 5DWDA 1CLEA 2FJ0A 5D7BA 1SFRA 4JUIA 4W9RA 5JADA 4ROTA 2XUIA 4X6UA 1FSSA 3IBTA 2GBGA 3BXPA 4H7HA 2WIGA 2HIHA 1ODSA 1WB6A 1E8MA 3DL4A 1WPRA 2HA6A 1XZDA 4XVCA 2QVBA 5E4TA 4BZWA 4U2GA 1UOPA 2EDCA 1F0NA 3HSSA 4Y7DA 3STWA 3OURA 4X92A 4OSEA 1BCSA 1XZHA 5CH5A 3STXA 5HF9A 5JALA 2GBIA 4GHWA 1IZ8A 3E1GA 3GBSA 4AMYA 1A8QA 1B6GA 1LZKA 3V1NA 1XZFA 2C0QA 3C5WP 4FFWA 4B84A 3B12A 1FFAA 3KSRA 5ALUA 2WIKA 3ZWQA 2QJRA 3LS2A 1ZD2P 1HL7A 2OQIA 4U2DA 1R1DA 1U4NA 3IUJA 2XUQA 4EY5A 1CQWA 5AI9A 4UHEA 1DWOA 3V9AA 1FFEA 2XUPA 3H04A 1XZCA 1PV1A 5EHXA 4G9EA 1LPPA 3VVLA 1UK8A 1EH5A 1RWQA 5I7UA 3CCCA 3WKAA 4JNCA 5HFAA 2ZVDA 5ALNA 1WB5A 4XX1A 3C6XA 1XLVA 2HU5A 5HFNA 3C43A 1ZIYA 1UOOA 3WWCA 6YASA 4OU4A 2RHTA 3IUQA 5DTJA 5D3ZA 5JAOA 2XMDA 3A6ZA 4OD0A 2RI6A 5DNUA 3BWXA 4E11A 5AM0A 4J0HA 4BVJA 3W9BA 5LZ4A 3LCRA 3O95A 1CUAA 3IUMA 3VJLA 4BRZA 4UUQA 1IZ7A 2QMQA 4INZA 2XLCA 2FUKA 5A7GA 1YSCA 4QE3A 1TQHA 4WFIA 2H7YA 3AILA 3SX4A 4CCWA 1CUEA 3TGLA 3I6ZA 4UBKA 2HRQA 5AJHA 5AI5A 1C4XA 5E2IA 1UT6A 3YASA 1B41A 4PW0A 2ZSIA 3VJMA 5AKKA 2VTVA 2GBFA 1GKKA 3V48A 3WIBA 1TCAA 5E4YA 4H77A 1YS2X 4Y9SA 3VVMA 5ALHA 3EQ7A 4PSCA 5F4ZA 4IO0A 3FSGD 4G8DA 4H7KA 1JI3A 4Q3LA 3ZI7A 1W6RA 1CUIA 2PL5A 3W04A 1EK2A 4GEGA 1TCCA 2PSEA 3Q0TA 2Z5GA 4CI9A 2J3QA 5JAPA 2LIPA 4B9AA 4ZWNA 2XUDA 4KR0A 2ZYSA 3QZUA 4KE7A 1ZJ5A 2H7CA 3VJKA 3C70A 3P2MA 4ITVA 2HADA 4XJVA 2Q0XA 1HQDA 2WJ6A 1EVQA 3UMJA 1WHSA 4H7FA 2Y6VA 3OM8A 3F98A 3ZLUA 4AMZA 2V96A 2I3DA 5ISMA 2Y2UA 2Z8ZA 5AM4A 4UHCA 5LKAA 1ORVA 2QUBA 4MWTA 5BV7A 4ETWA 1MNQA 3A2NA 4BBZA 4QWMA 3ILSA 1VKHA 2OCKA 2G5PA 4W1SA 1EINA 2JGMA 1XLUA 5FKJA 2OQVA 2DCMA 1YA8A 5EIAA 1W4LA 2JGJA 2VJDA 4W1PA 3W2TA 1TKRA 1CUYA 1JJFA 2OCLA 1XQYA 1TK3A 4GWLA 3BJRA 1JFRA 3V1KA 2OG1A 1CR6A 3O4HA 4MEBA 5K3CA 3EIOA 4E46A 3X3HA 3G0DA 2PSDA 3C6BA 1P0QA 1T4MA 4BE9A 4BTVA 1CPYA 1ACJA 4BB0A 4AN1A 4FBLA 1R4ZA 1MPXA 5EHZA 3OG9A 1LPMA 5KWIA 5CBKA 1AC5A 1UWCA 4DIUA 1EX9A 1MAHA 5HKAA 3V1MA 5ALXA 1XRNA 1CUZA 2O2GA 3VISA 1UKCA 4K6GA 3D2AA 4P93A 4YASA 4B6GA 3AIMA 2QXTA 4UHHA 2J4CA 1OCEA 1LBTA 5I9IA 1CUFA 4FLMA 3ESBA 3HXKA 5ALFA 1CUWA 2WIDA 3C87A 2RAUA 4RE5A 4UBMA 2J4FA 5A7FA 4NS4A 2Z3WA 4A23A 2HA7A 4Y2PA 1JJBA 1QZ3A 5LZ5A 1QFSA 4EY4A 1LPNA 4G4IA 5AKZA 1VXOA 3I2HA 4Y2YA 3I2GA 5IVIA 3G9UA 2XDWA 5EHNA 4BP8A 3RLIA 3DKKA 1S8OA 3WYNA 1QIJA 1DINA 3WWEA 2PPLA 3T52A 4EA6A 3WK4A 3N2ZB 1QIEA 2VF2A 2Z3ZA 4L72A 4B7ZA 3WYDA 5HKBA 1E3QA 5AO9A 1ISPA 2D0DA 5LP1A 4GXNA 4H7IA 4E14A 4UBIA 5T4BA 5CW2A 1GT6A 2PM8A 1U65A 3HC7A 4WCVA 4BCCA 4UFOA 1WHTA 4DNPA 4WDQA 3I6MA 4Z49A 3DKRA 1BN6A 1YB7A 2OGSA 3H2JA 1LBSA 4JYPA 1VXRA 4CCYA 4FOLA 4XWGA 1N5MA 3W05A 5CT9A 3D3NA 5K3FA 3TJMA 2WLSA 5D6OA 2WUEA 2I03A 4ZV9A 3F96A 3QH4A 2H1IA 4AZ3A 1Y7IA 4N8EA 4KE6A 4A5SA 2QZPA 2HA4A 4C88A 1FFDA 4H7EA 4DTCA 2H7XA 3H2KA 4X97A 3UUFA 4EY7A 4KACA 2FJPA 3DNMA 4PNZA 1OILA 3F97A 4BYMA 1GQSA 3EQ9A 4IH1A 5ALKA 5LZ2A 2JGEA 4UHFA 4AB1A 5ALDA 3ED1A 3C6ZA 3UUEA 4FBMA 4D9JA 4M0MA 3L1IA 2WFLA 1X70A 3WA6A 3H1BA 1J06A 1VLQA 1XZIA 3A2MA 4N5HX 1W52X 3LIIA 3QYJA 3C8DA 4OUKX 2K2QB 3PFBA 2XI4A 3K9BA 4KYVA 3RARA 1MAAA 4QDXA 1CUVA 2YH2A 1Z68A 1E8DA 5AK5A 4A16A 2H9YA 5K3EA 1CIJA 1XRLA 3ANTA 2WU4A 3TRDA 3Q8WA 4QEKA 4AO6A 5BWCA 2Y1KA 5CT6A 3WJ1A 2C0PA 1U8EA 4F21A 3OPMA 1AMNA 2XB6A 4CCYB 4CFSA 5AHXA 2QKYA 3O4GA 3STVA 1MNAA 1HBJA 3PE6A 2C58A 2R8BA 3K2IA 2XMCA 3RK4A 1AZWA 2Y2VA 2ZJ7A 2NW6A 2EEPA 1UFOA 1SCQA 4PQEA 3IUNA 3SC2A 4C01A 1XRPA 4PSUA 2XMZA 5IVDA 3WMRA 1XZEA 2HFKA 3GA7A 5HF6A 3HI4A 1QO9A 1MN6A 3E3AA 4BDSA 1IVYA 1XKTA 3FVRA 1N5RA 1Q84A 5D3KA 4C87A 5FDFA 5JAUA 2VJCA 4AXBA 2WIFA 1LPAB 5AOBA 1XFDA 3V1LA 3H2HA 3SK0A 1A8SA 2JIDA 3FWHA 4RGYA 3O4JA 2I3ZA 1MU0A 1BRTA 3C6YA 3D4LA 2HA3A 3FLAA 4Y2TA 3LP5A 5CRIA 4LHEA 2ZYHA 3G0CA 4WY8A 2QM0A 4BAZA 1QIDA 1QIGA 4UHBA 5KBYA 4UBNA 3U1TA 5EI5A 5K3AA 4BRSA 4I19A 5JZSA 5FPPA 3NOXA 4YK7A 3EQ8A 2ONCA 2HHAA 3TEJA 4CG2A 1EXWA 4FDMA 2HL6A 5FPQA 2QR5A 1LZLA 1R88A 5YASA 2I78A 5T4HA 2ECFA 2CUTA 1XLWA 4BP9A 1F0PA 2CEKA 4OPMA 3A70A 4BAUA 2WUGA 4FFVA 3K6KA 5ALMA 2WQZA 1K63A 2EDAA 3AJAA 1X2BA 5ALGA 1CVLA 4PF1A 4EB0A 4OU5A 2PVSA 4TPKA 3WK9A 3M81A 3WIOA 2X8BA 3DLTA 1DU4A 2JEYA 4OYYA 1NU6A 2QJWA 3QITA 3NGMA 1DT3A 1GPKA 3CN9A 2DQZA 4LXGA 1QTRA 3I2IA 1D07A 3NUZA 1L7AA 2RIPA 5EFZA 1WPXA 3WZLA 3VDXA 2OXEA 5HCUA 4U2FA 5JIBA 4H0CA 4M0EA 2BCEA 5T4FA 4HAIA 4W1QA 1YB6A 4DGQA 4B80A 3H0CA 5A6VA 3I6YA 2PU5A 3STUA 2ACKA 2WHQA 2UZ0A 1MX1A 1DX6A 2JGIA 4DYHA 2VA9A 2O7RA 3IA2A 4C89A 3PICA 4OCZA 2WUFA 3BF8A 3WK6A 2O2HA 2GYUA 5ALJA 1EI9A 4B85A 2WU3A 1L7RA 1XQXA 2DR0A 2JGLA 2R11A 3D0KA 1G42A 5HF8A 3IVMA 3R3YA 1DWPA 2ZYIA 4EBBA 1CUJA 3F8SA 3DQZA 5FOQA 3MUOA 1CUDA 4BC0A 4GDMA 5C8VA 4CIAA 2AJLI 5LZ9A 4KRXA 5JD6A 3R40A 5ESRA 3U0VA 4B0OA 5JZ9A 2CB9A 4HTAA 4Y2RA 1EB8A 4JYMA 1L7QA 3PF8A 4DMKA 5ALTA 1K5PA 3HABA 4X71A 1F8UA 5AK3A 1QO7A 2OCIA 4Q82A 5AKXA 4B9EA 2XUJA 4IH9A 1R50A 3PUIA 2GYVA 1IUNA 3I2FA 2WFMA 3OTQA 1WB4A 3E4DA 5ALRA 3G9XA 3AZOA 4ZREA 3R3WA 5FP0A 3SWWA 1MO2A 1VE6A 2J3DA 4UBOA 1GXSA 4JH0A 2C7BA 4KJXA 1UK9A 4QDUA 4WJLA 4J0CA 4BE4A 1PFQA 1I6WA 4FNMA 2AXEA 5CT5A 1CV2A 4HXFB 2VT6A 1Y37A 3ZLTA 1CEXA 2WILA 4B83A 4UBLA 2XMSA 1E8NA 4DNQA 3FCXA 1WOMA 1W76A 3OOSA 2IITA 5HF5A 5K5EA 4P92A 3PFCA 4DNOA 1Q0RA 1FJ2A 4C4YA 1JT2A 3H18A 4MWSA 2OAGA 5FV4A 5AM1A 4MEAA 3ANSA 5FUMA 4Q1VA 2G5TA 1C7JA 1XZGA 2VT7A 1KU0A 4LYDA 4ZGBA 3GELA 5DJ5A 5AP9A 3WK8A 2OCGA 4H7JA 4H7DA 4RNCA 1TAHA 2PUJA 4Y2XA 4Q34A 1XRQA 4MXDA 5CURA 1QE3A 1KU6A 2BUAA 5K3BA 1AQLA 2JBWA 3BDVA 3BL8A 5SYNA 1MT3A 3FBWA 5LZ7A 2XQKA 3HLKA 4N8DA 5AOCA 4DM7A 3S2ZA 3WI7A 2WTMA 2CMFA 5IVKA 2ZSHA 4UBJA 2DHDA 5DLPA 5AH0A 3G0BA 4AZ0A 2PSJA 4GI1A 1AKNA 1HPLA 2XUOA 4K6HA 4C4XA 1VA5A 5JARA 2VAXA 2PUHA 1YAHA 1ZICA 3G8YA 2VAVA 3GFFA 3D2CA 3IULA 1CUBA 3IURA 3WLAA 3JW8A 2O7VA 3O0DA 4LXHA 5FLKA 4PO3X 4BATA 3BDIA 3D5EA 4X6YA 2OPHA 2B9VA 2OGTA 1THTA 3CN7A 1EB9A 1QLWA 4B81A 5E4JA 4AO8A 5K3DA 3F67A 2DQYA 2WKWA 4AO7A 4J0JA 4G8BA 5AKYA 1Q0ZA 1T2NA 4H18A 2BKLA 3BIWA 1EDEA 2XQGA 3I28A 3MGAA 4ARBA 3WK5A 1MTZA 4J03A 2B61A 4KAJA 1BU8A 1QTIA 2YXPX 4HRXA 1X2EA 4FWBA 2XMGA 1VOTA 4J0IA 1YCDA 2IX9A 2GZRA 3DYVA 1E89A 1QIKA 1PJAA 2XQJA 4Y2SA 2IIVA 2ACEA 1XZJA 4HXEB 1H22A 4UFNA 3AIOA 1W75A 4LKOA 4G4GA 1BEZA 3M3DA 3DS8A 1ZI9A 2VJBA 3HZOA 2XLBA 1EK1A 5AM2A 2PKYX 3D7RA 2V9ZA 2OGZA 3WWOA 1CUGA 4AN0A 4FMPA 1ZD3A 1MJ5A 4KE8A 1UZAA 2YYSA 4DMHA 5DNWA 5BWBA 5ALZA 1ZD5A 1GZ7A 2AJBA 4DSAA 4DSZA 4UHDA 3HACA 3WL7A 4X95A 1CUSA 5IKXA 4U2BA 1AURA 3LIPA 4W1RA 4DMCA 2HRRA 4G9GA 4LYEA 2PSFA 2W22A 4F60A 4V2IA 1GKLA 1AGYA 3G7NA 2GBCA 3HYSA 1U2EA 1TCBA 3FYUA 5DTIA 3H2IA 2DHCA 2BUBA 4UPDA 2XE4A 1JKMA 3KXPA 2WTNA 5LYYA 3ESDA 4Q3OA 4KRYA 3AINA 2JGFA 5ALVA 4W63A 2OLEA 1QOZA 1GPLA 5AKLA 1H2ZA 4NMWA 5LLSA 2WIJA 3WK7A 5ALYA 3G9ZA 2BFNA 3WL6A 2AJCA 4DMFA 5A62A 2QS9A 3WL8A 3R0VA 5EIHA 3FSGA 3WKCA 1NU8A 2C4HA 3QPAA 4FTWA 3GUUA 4IQ4A 3KWFA 1ZI8A 4HS9A 2HA5A 4GBGA 2ZYRA 4J7AA 4U2CA 4N5IX 3EF3A 4PSDA 2WJ3A 2VJAA 5EIEA 1IMJA 1THGA 2CZQA 1UKAA 2PSHA 2XUGA 1VZ2A 2QT9A 5A7HA 4YPVA 3QBJA 1O6FA 1UXOA 2V97A 5JYCA 2BUCA 1CRLA 1XRMA 2VATA 4BC1A 3PI6A 4WFKA 3WWDA 2WUDA 5AIAA 1WCYA 4OYLA 3FYUB 2HDWA 1ETHA 4AX4A 4G1FA 4ZRDA 4JEIA 3PUHA 3DJYA 1A8UA 2PBLA 3PF9A 1JU3A 1QIIA 1USWA 4BCBA 1VZ3A 3IB3A 4X91A 2AJ8A 1XKLA 4OB7A 5C8ZA 1H23A 1R9NA 3STYA 1AUOA 4MYSA 3NWOA 4F5ZA 1C7IA 3DL7A 5AK4A 2ORYA 4Y2JA 1HLGA 5FXMA 3WQHA 2VQ6A 5ALQA 3LLCA 5C7YA 2RGUA 3I1YA 3RM3A 5EGNA 1BCRA 3WL5A 5AKHA 5ALSA 5JATA 3E0XA 4GECA 5J3JA 4G5XA 5CT8A 3O9MA 1ZIXA 2BAGA 3WWPA 2CBGA 4MJ3A 2YASA 4EY6A 2WHPA 2WG1A 2QUAA 3R3ZA 5FRDA 3ZV7A 1WM1A 1ZOIA 4RE6A 2ZJFA 2Z8XA 1GGVA 3C5VA 4QLOA 3HEAA 2QTBA 3O9VA 1K8QA 2ES4A 2RONA 2XT0A 1SCKA 1CFJA 1H2YA 4OB6A 3CCBA 3FAKA 2WJ4A 1G5FA 1QGED 3MUNA 4QWWA 2HU7A 1N8SA 1ODTC 5HK9A 2GZSA 4TGLA 4X7BA 4Y2QA 2XMQA 2HU8A 4M0FA 2DSNA 1IUPA 5EHQA 1F6WA 5BOVA 5AI6A 3L1JA 4GW3A 1CUUA 2D5LA 4FHZA 1XZBA 3FCYA 4QDZA 3QPDA 4X6XA 1P0PA 4S0XA 5DYWA 4YX9A 4WDRA 3KD2A 2ROQA 5ALEA 4FNGA 1BROA 3FNBA 3AFIA 3I2JA 3GZJA 2HFJA 2O2IA 3DOHA 1P0IA 5AKIA 3FVTA 4CG3A 2XUAA 1DX4A 5IH7A 2PX6A 4L3WA 3QMWA 1G66A 1JU4A 1EDBA 3RKSA 3FOBA 3W06A 4Q05A 5AOAA 1YA4A 1UKBA 4K6KA 4Y2VA 1KEZA 5T4EA 2HA0A 3H19A 3FLEA 1VA4A 3GROA 3M83A 4DLNA 4X00A 1VE7A 5JANA 1LPOA 4P9NA 1EDDA 4MYDA 2WHPB 1K6EA 3WKEA 4K5QA 3AUKA 1UOQA 4X90A 2X5XA 4X94A 5CH3A 2WG0A 1TRHA 4C4ZA 5A2GA 5HQ3A 1DTEA 1QFMA 3AZQA 1GQRA 4BAGA 3HRHA 4EHBA 4CG1A 4HVTA 4X3CA 3QPCA 2HA2A 3I1IA 1FFCA 1N1MA 3IDAA 4X93A 3WKBA 1J07A 4NZZA 3N0TA 1VJ5A 3G0IA 3QVMA 5CXXA 1DQYA 2XQFA 1DWQA 5A71A 3QMVA 2ZJ6A 4ZV7A 2GYWA 1J1IA 3DCNA 3DYIA 5C8XA 1G4HA 4ARAA 1R9MA 4B82A 4BDTA 4IHAA 3VXKA 4BCDA 2WFZA 4QDOA 3M82A 4E15A 3WZMA 4L9AA 4QDTA 3H17A 2WM2A 1BS9A 5AI4A 5JAHA 3PDCA 5LIPA 3KDAA 3R3XA 2BGRA 4HXGA 2PU7A 1NX9A 3R41A 2V98A 4J0GA 4NVRA 5ALOA 4UFPA 2DHEA 4QA9A 1CUHA 5AKGA 2W6CX 4BVLA 1HDEA 3S8YA 1YR2A 4LIPD 5LZ8A 1A88A 5CMLA 5CXUA 3VKFA 5DYYA 1XQVA 1UK7A 1IUOA 2P8SA 3WJ2A 4H35A 1FFBA 2VEOA 2JEZA 5AKJA 5HQ3B 5AM5A 2BGNA 1JMYA 1SOMA 1MX5A 1ACLA 3I2KA 1RYYA 1ORWA 1ZI6A 5JASA 4WY5A 4BTLA 2WHRA 1DT5A 1SCIA 3G02A 3L1HA 4OB8A 1LLFA 4QLAA 2XUFA 5C81A 4L0CA 1SC9A 4RPCA 1EVEA 4P08A 4J3JA 3MVEA 5AIBA 1EA5A 1BN7A 5JZBA 3OC0A 3EBLA 2QOEA 2C5GA 2G63A 3D59A 1LPSA 1ZD4A 2B4KA 4QNNA 2JF0A 4AQDA 4IH4A 4XIIA 4I3FA 1K4YA 1W1IA 4MQMA 4HZGA 4EZIA 5H3HA 4ZXFA 2Y6UA 4CIBA 3QMMA 3O4IA 3ZLVA 3FLBA 2AJDA 5JD4A 1OXMA 1LGYA 5AI0A 1QIFA 3BIXA 1Q83A 1ZJ4A 2CKMA 1YAJA 5ALWA 4PV7A 4F0JA 1H2XA 3F9CA 3JWEA 2XMRA 3ESCA 1QIHA 5ALLA 5IVHA 4J0KA 1AX9A 4EUSA 1BEEA 4FKBA 1XZAA 5HK8A 4GLBA 3T4UA 4N8SA 4U2EA 5AM3A 3ESAA 1QIMA 4FLFA 1YASA 3DEAA 5CTAA 2XQIA 2JGKA 3G0GA 1JJIA 3C8HA 1O6GA 1M33A 1RP1A 3AIKA 3G9TA 4BZZA 3H1AA 1GPNA 5ALPA 2OAEA 5AICA 5ALIA 1QONA 4Q3KA 2FX5A 4G4JA 3R3UA 4ZI5A 2HM7A 2XMBA 1XZKA 3R3VA 2BJHA 4G8CA 3DOIA 1J2EA 3ZPXA 2G4LA 4BVKA 5LKRA 1P0MA 1ZGCA 7YASA 3IIIA 4O08A 3JYHA 4J0DA 3FYTA 1A7UA 3WKDA 1E5TA 1ZGBA 4KEAA 1DQZA 3DD5A 2RHWA 5KREA 3QM1A 1XZMA 3BF7A 2QRUA 1QJ4A 5HZGA 2XUHA 1CUCA 1Y7HA 1XQWA 5SYMA 5DYTA 5I8PA 3DDUA 2VSQA 1TIBA 1HKHA 3BJMA 2X76A 1YS1X 1XZLA 4KE9A 3WA7A 4K2AA 3KWJA 4MQLA 4QZVA 2XUKA 1EHYA 5JD5A 4HRYA 4KAAA 5AI8A 2QXUA 4KAFA 3B3QA 3CXUA 3BE8A 4LXIA 3A2LA 4DNFA 2E3JA 2C5FA 1ODCA 3KOOA 1CQZA 1LPBB 5CT4A 5AKEA 5K3FB 4I4CA 3AZPA 4WFJA 1LNSA 1UK6A 3D2BA 1H2WA 5AK6A 1XRRA 3C45A 3H2GA 1JMKC 4C6HA 4Y2UA 4X85A 4B0PA 5KWJA 3STTA 5DNVA 3FYUC 1XROA 3HJUA 4TVKA 1BE0A 3W9UA 2B20A 2DFPA 2WSLA 5CH8A 3B5EA 4FLEA 4EY8A 1CUXA 3ICWA 1R3DA 3ICVA 1E66A
chains in the Genus database with same CATH superfamily
1ST2A 2NXNA 1KYWA 1SBIA 1SQ5A 2ATEA 2PRJA 2V7QD 2WG2A 3M6VA 2R60A 4A27A 1KF0A 4LRXA 1J00A 4PLVA 1P7ZA 3KVRA 4YRKA 1LF5A 1V47A 3WX0A 4AKTA 5AW5A 5A3SA 2F3TA 1CLEA 1DG1G 4LHWA 1YBFA 5JBIA 1GQOA 1VIDA 1OI3A 4MI6A 4A8PA 3E7PA 1IC6A 2WJZB 1SFRA 4P0QB 3BFXA 3LPDA 4PC3A 4BGEA 2IT1A 1YNSA 2VHJA 4RMJA 2C99A 4X6UA 4ZT4A 4RIFA 5AFSA 5AUOB 4UCXA 1HGXA 3MQFA 3IBTA 1G3IA 2IPXA 1VSVA 2G72A 1NLYA 3PL5A 3SEQA 4XJSA 2A0XA 2Q6OA 3BXPA 2NUBA 4PPYA 2WJVA 1DKRA 1V3TA 1ODSA 1OTHA 3CE6A 4KQCA 4XB2A 3D7NA 5DSZA 1Z4IA 3D4BA 3DVSX 4FONA 1RQXA 2FN7A 2XW6A 3DL4A 4CV0A 4E2YA 1JWLA 2G0TA 3SNKA 3LK6A 1DBSA 2O7SA 3B6KA 4MW9A 1UOPA 4ZYZA 4YONB 4XOUA 4A2CA 1SXIA 1ONPA 3GGDA 4L15A 1ZM3A 2R48A 3DOEA 3KG2A 1KJ9A 5G3ZA 4AK9A 2NP7A 1E0KA 3P20A 3WOVA 3RHFA 3DE2X 2CFTA 2ZSJA 1X13A 4F72A 2QZSA 1NFQA 2W0SA 4HEQA 4Y7DA 3E5NA 3EGDB 3W2FA 4BO0A 3FWKA 5IX8A 1IIBA 2GA8A 2NU9B 5I51A 3R20A 3MWEA 2OR3A 3K94A 2NT3A 1ZS9A 2O2JA 5DGXA 1FRZA 2G4VA 1UBCA 3BMXA 3DP9A 1PSDA 3G9QA 3UTCA 4RH0A 5ADUS 3UJNA 1TFUA 5CH5A 4MGKR 4PANA 2B35A 2CLEB 3C98A 5H02A 4BRUA 1NNEA 2GBIA 1BA3A 3FPFA 4HNAA 4M7OA 2FEAA 4WOCA 1EX7A 4GHWA 5FL3A 1XTZA 1IZ8A 4ZGGA 1EDOA 2PMWB 1A8QA 3H5VA 2AQKA 2IUSA 1B6GA 3V1NA 1XZFA 1FVFA 1OYWA 4QRDA 2I4TA 2COKA 3IAM6 3NBFA 4M87A 4R81A 4FFWA 2REBA 1M8KA 4G5OA 5IZCC 3B12A 1NG1A 3V42A 1E2IA 3OJLA 4H4EA 3UHOA 4LNUB 3FSJX 2ODTX 2G07A 3I58A 1G60A 4TTAA 3CEMA 3HWWA 3H3XA 2WICA 1T0PA 2O2EA 1KI8A 2HQSA 4OI0A 1DTSA 2J0SA 2Y67A 1US8B 3GLUA 2XVZA 1BGXT 2WYUA 3Q98A 4FOOA 5DULA 4YDHB 3R7DA 5JFOA 4DV4B 2OQIA 3E6AA 3ETNA 3G8AA 4J07A 2XD4A 4U2DA 4CLOA 5AXCA 5DNDA 2Y0DA 5HUQA 3AF6A 3FMFA 3IUJA 1AUPA 2YXDA 2BGTA 4L28A 2SKCA 5EXXA 2EGUA 4UU8A 1OZAA 4WOBA 3I9MA 1KJJA 4QYIA 2NYVA 3OZFA 4B5KA 3V9AA 4C7VA 3U5TA 3HKEA 3AHEA 3DWEX 2WMOB 4AKGA 3SXUB 2PAFA 3QELA 1B76A 3P9NA 4OAOA 1YD7A 2YV1A 4N65A 5DHFA 4YAWA 2J5XA 1Z33A 1UK8A 2NAPA 1J8VA 1Y8RB 4RGQA 3GLVA 1RWQA 4FZJA 4P81A 5DIZA 3ZZNA 5B12A 1NNUA 2TSYB 2NQ8A 3B2EA 3KTOA 4J1SA 4DCGA 1FRNA 4Q19A 3WKAA 1C4OA 5J1SB 5TQ2A 4FZ5A 5HFAA 2FYTA 3TZBA 3TBFA 1F6BA 1ISGA 1N5LA 4QU0A 3ZWWA 4NY1A 3CNOA 2FSUA 1UJ5A 4AROA 1FRQA 5KUTA 1TLLA 3RSOA 1XLVA 3ZD6A 3U0BA 5I7VA 1AT1A 4BL5A 2XHZA 1Q57A 3KPWA 4CLDA 1UBNA 5HFNA 1ZIYA 3T9CA 1O97C 3L2OB 2Q1WA 1W25A 1YQDA 2PDAA 3UWDA 6YASA 4Y0NA 4C3OB 4LF9B 5CLGA 1ZUD1 5D3ZA 5C7LO 5CYGA 5JAOA 2W6NA 2XMDA 1OH7A 1L8AA 3U9TA 3UKDA 1EQ2A 3A6ZA 2QUKA 5NLLA 4KO2S 1X9GA 2BZGA 2L19A 3RNOA 5DNUA 2QN6A 3NHLA 3CRZA 1OLSB 1T43A 4KUGA 1BRMA 4F91B 2EFYA 3C6QA 5EEHA 1NVVR 3PHGA 3DMTC 4XLZA 1CE8A 2WJPA 3PWKA 5KINB 5KQSA 1IY1A 3AW8A 1VIMA 3ELDA 3KPYA 5EKXA 4KMSA 1QVAA 1LCIA 2HQOA 5LZ4A 2O5RA 2BSXA 5DB4A 1ICIA 3FZYA 1B1AA 2AW3A 2XNCA 4JJKA 4BRZA 1JS1X 2OHIA 2IE8A 1H2BA 3HZZA 4INZA 4TVOA 1JQKA 5KEIA 4KKXB 1DRKA 3PLRA 2Z5FA 5KAPA 1BCSB 3WRYC 4AYTA 2AKYA 2QYSA 2F3PA 2GOYA 2CC2A 3II6X 4X8LA 1TUEA 1E1QA 4WFIA 4YIHA 1SQ6A 2ST1A 3H97A 3QEMA 5IW8A 1HLPA 4F5WA 1F60A 1B16A 1XL0A 3BGSA 4M0UA 4EEXA 2ALJA 1QS0A 2M9MA 3VAAA 4E5YA 2VQDA 3KXLA 2CLDX 4WTOA 1ZEJA 5EJ6A 1N8NA 1V9LA 1U5AA 3FPCA 1EE1A 4CLEA 2KB0A 1NZDA 1C4XA 2QGFA 2R6ZA 3WLLA 5H7XA 2BE9A 5DCLA 2ZUEA 1UT6A 1U81A 4CQMA 4K26A 1HT1E 2LWIA 5BN5B 2OYSA 4YV7A 4EJSA 3PC8A 4PW0A 2O05A 5CM9C 3R0ZA 4JWTA 4LC1A 4OHVA 2GBFA 3RC7A 2C97A 3VZQA 4XW2A 5A02A 1GKKA 3V48A 5KDDA 3DBLB 4AJHA 4R71A 1OX5A 1H2EA 1TA9A 1FTNA 1QGAA 3FR8A 3LVQE 4H77A 1YS2X 2I2AA 1WW3A 3NM4A 1Z0AA 1RW4A 1G3QA 2EFGA 2NLOA 3OAAA 2PHZA 4HLDA 1LWOA 3EQ7A 5ALHA 4B3CA 5IFKA 4EK9A 1K7XB 1P1IA 3KB6A 2QT1A 3PPWA 5I3CA 1JI3A 3ELWA 2WJYA 2YWDA 3FFWA 3D3WA 3PJEA 1W6RA 1CUIA 1P2UA 2PL5A 4QJIA 3ZH2A 5K0SA 4CM9A 1QKIA 3OM1A 1TCCA 2OFWA 3IOEA 4YH1A 3U4QB 2Y0PA 5JHGB 2JDIA 4PQYA 4P4SB 2RK4A 2XOEA 5CM2Z 3LH5A 4A73A 2R8ZA 3ML1A 5JYBA 1EXMA 3DF7A 1QK3A 3SZMA 4CI9A 5J5CA 1SA0B 4PYNA 4QOEA 3EDCA 4BNWA 1A9OA 1RBYA 1F7UA 4EG3A 1YCFA 2XKJE 2B2XA 4PYLA 1WU7A 1XU7A 5IU6A 1E5DA 3FTPA 3UWOA 1T4BA 5TMDA 3HN6A 4D8VA 1E0JA 2GK4A 1E1RA 2ZIGA 4FI3F 5A9TA 4KFSA 1HNNA 1MG0A 1TU3A 1X38A 2IKSA 5K4HA 3V3TA 3AH8A 2AWNA 3ZGNA 3WLRA 4X24A 2PTGA 2KJQA 3OCZA 3EISA 3GPBA 3HYTA 3RC8A 4TWRA 1LVHA 5SY4A 2Y6VA 2FZVA 1XTKA 2UVQA 3LW7A 16PKA 1OBFO 1S2IA 3C14C 3I9OA 3OM8A 3P5SA 3SN6A 3L8GA 3W6PA 1GFIA 3DLBA 1BAPA 2V96A 3LL4A 3ABSB 2DPHA 2QBYB 5E3JA 3RS9A 5IMSA 3TOCA 1JAXA 3KR9A 4NR0A 4HD8A 1E1CB 1KY2A 1CY2A 2Y2UA 2Z8ZA 1QNLA 4YUYA 1UM8A 2AMJA 1G3UA 1NW3A 4I1YA 3B1FA 1FFSA 1GKUB 4QBIA 4UHCA 5BMOA 1RQ7A 3LQRA 1G6HA 5FNVF 3L5KA 1W47A 5I01A 3NOQA 1ADFA 1N0WA 3KPUA 4BO3A 1B3BA 1GGNA 2VI5A 4RC9A 5DP2A 4E70A 5M04A 4K1XA 3CZPA 2OCKA 2QV0A 2IL1A 2IHTA 1UBKS 2JJ1D 2ECOA 2VHVA 3HEBA 4QATA 3SBOA 4CM6A 5AVXA 1J56A 1FSFA 1TM2A 3T15A 2RHHA 2QDXA 3TLEA 3B1JA 1M5TA 1L5RA 4QQRA 2AA3A 2JFQA 3B51X 5LP6B 2UKDA 3HJBA 1YA8A 3LYAA 4GX5A 5EIAA 2JGJA 5C1PA 1FFHA 2G28A 2VIIA 4DANA 1GSAA 2CEAA 3F49S 4S1NA 2Q5HA 1T6YA 5KYVA 3W2TA 4HAXA 1CUYA 1JJFA 2FPUA 3GJZA 4C7KA 1BD3A 5DBOA 3TLMA 3AM5A 4GXRA 1W44A 2YY5A 3QVSA 4Q4HA 1JFRA 1TVEA 2CL6X 2IYTA 5HYVA 4TYYA 4V0OA 2Q8PA 1K9VF 1Q2XA 1Z6PA 2WWRA 4FFSA 4O6VA 1CS0A 3RSHA 4ZI7A 3ACCA 4RJLA 3NKFA 4LYFA 4MULA 4ZVQA 5CNIA 1I3MA 4FWIB 4WJZA 4HB2A 3I30X 2P5YA 2UVPB 5EKUA 4YQEA 4BASA 4PM4A 4PTYA 1YHYA 3CVUA 3V4VB 2H2IA 4NOKA 2C4WA 4WW0A 2WYHA 4XQCA 1PTJA 1ZMOA 2FZKA 1FZQA 2DTDA 3QVVA 4PINA 5GJWC 1C1DA 5T6MA 1YR3A 2W11A 5BPHA 2J45A 4G0ZA 1KQNA 1C3OB 2FRDC 2HRCA 5KTKA 4KI0A 4MDFA 3OIYA 3BYZA 5F2EA 4PG5A 1ZVKA 2G8LA 2V6BA 3PC2A 3A04A 4MB2A 4ANFA 4V39A 3L4BA 1R27A 1E1KA 4BB0A 4YT4A 1W4ZA 4FBLA 1OLUA 3VHQA 3NEJA 2X8WA 1SWWA 2RFLA 3BC1A 2JCBA 5EHZA 3OG9A 3KUDA 5KWIA 3LPAA 4QGGA 2OBLA 3RVSA 1AC5A 2O8NA 1V7ZA 4Y9UA 3E81A 4DDUA 4IXMA 2G82A 3SJ7A 4ZARA 4XWAA 1QC5B 1NE2A 1SK8A 2QJOA 3PHHA 3PXAA 3Q5GA 2ZUBA 2FPIB 3SHFA 3ZE1B 1XRNA 1CUZA 1UXHA 2Z83A 1D8AA 1YH3A 4QTZA 3V7YA 2O2GA 3VISA 4YCAA 3VR6D 4GGOA 3QUTA 4ZVRA 4US0R 1XALA 4CL8A 3D2AA 2HOQA 2DY1A 2MR6A 1XMPA 4JQSA 5EJGA 3ZHSA 3E35A 1XHEA 4G5SA 3HK2A 1X1QA 2WI8A 2J4CA 2FW0A 1QWSA 1CUFA 1P4SA 2CCGA 2SECE 2XE7A 2VDWB 1HFKA 3ESBA 1I4LD 3I4CA 3IJ5A 4F2GA 2QTCA 4CTOA 1NULA 4QL3A 4QPPA 2R5NA 2V55B 3LHSA 3S1SA 3R9XA 2AOVA 1SQ0A 2VN8A 2J4FA 3OQJA 5A7FA 1DCMA 1MA3A 1N77A 4KHPB 4P36A 3JU3A 4YVFA 2GEBA 2HA7A 2GWRA 2AUMA 3NTLA 4LVCA 4TWZA 3WB9A 4BMPB 4I1PA 2UUBB 2AQIA 5AJXA 1QAOA 2VLIA 3ISTA 1G7TA 1H0SA 4QU5A 4CF5A 1R18A 1SN7A 4I66A 4LNAA 5LZ5A 4KQEA 4LI3X 1QFSA 4NE9A 4B32A 3VUFA 1GQQA 3ABIA 3EVEA 3G2LA 5JG7A 4ZZ3A 4NV0A 3ND8A 2CV0A 4BMXA 5ITSA 2R8RA 1CNEA 1X3SA 3JXEA 3O1JC 3L1KA 3PXXA 1GZ3A 1Z16A 3I2HA 3VH1A 3LT2A 1GTL1 5CB4B 1V3UA 4TL7A 3BE5A 5I7AA 2DR2A 3P2EA 3VNUA 2WU1A 1YUBA 1VYHA 5THQA 3V3KA 4X1IA 3O31A 4IINA 2J9XB 4BEBA 3ZQKA 4E94A 5JPDA 3E82A 2OYCA 4M0LA 4Z3OA 2W6JD 4OQYA 2NMVA 2G9QA 2V7PA 3WYNA 1DINA 1WUKS 3MMSA 2C31A 1NOKA 3W5AA 2J8ZA 4ZVPA 4RKYA 5JBQA 4AXXA 2YR0A 1ZMRA 1AQYA 2R7KA 1T0IA 3REGA 1KWGA 2IS2A 3QE4A 4WLUA 3T54A 3TW4A 4B7ZA 5JH7F 1BH2A 3WYDA 2IBTA 5E0OA 3H4TA 1HT2E 1PJTA 3GDWA 5L3SB 3C1OA 3T1TA 2XDQB 1ISPA 3IILA 1MOZA 4HQLA 4R84A 1QK4A 2C8JA 1TAQA 4TYMA 5EQTA 5F5NA 2EYQA 3ENKA 4ZEWA 4NJEB 4E14A 5DI9A 5IZ4A 2HMAA 5T4BA 2BI8A 2OQRA 4P83A 2C4MA 1MJNA 3IERA 2OAP1 2H4YA 5TRTA 3LP6A 1HFJA 1Q1QA 2HJWA 3MK31 1H9AA 3PVZA 2JI7A 1S3IA 3HC7A 4MROA 1W87A 4BCCA 4UFOA 2GQ0A 1KYZA 4JEHA 1PO7A 3CPEA 3WLPA 4YXWA 2FEPA 1ID1A 1AF4A 1G6KA 1JYFA 1EK6A 4OI4A 3BXGA 3NM5A 4PO1A 4NECA 2FRXA 1E1NA 2HHLA 3DKRA 5H4HA 3CW2A 1GGEA 4ABTA 1IK6A 4JY7A 1P31A 3L7CA 2YMLA 4NZPA 5LYJA 3S2UA 3T5AA 1OA1A 2GCOB 1E3IA 1PUJA 1LBSA 2MYPA 2ZI9A 3DEYX 2ZIXA 1HYGA 1J70A 3IEUA 4DHWA 4TUYB 4GZ5A 1FSPA 2ANCA 3AUFA 2WNIA 3OCXA 4FN5A 4QXMA 3RIGA 1N5MA 3W05A 5G40A 3LWDA 1MRZA 4FJ0A 2FR8A 2HCTA 3H1PA 4J6EA 1SKAA 4R6WA 5H81A 2GO1A 4QUBA 5D6OA 2I4OA 2DETA 4A6PA 1OT3A 1PNQA 1X7ZA 3KE9A 4KGDA 2ZBQA 2F9MA 5D3MA 1O6ZA 1QGZA 1J42A 1GGJA 1V8DA 1SUAA 3Q0EA 4NFYA 3ZVRA 7REQA 2RH5A 3RJTA 1PRYA 3NVMB 3V7NA 5U4XA 5CX1A 3TTSA 4EI9A 3NI2A 4NZYA 3WJAA 1Q91A 2JLYA 1VI5A 4OMCA 4YRDA 1Y7IA 4YLEA 3GY0A 2ATVA 3C8ZA 1N25A 4R83A 1OHHD 3L7IA 4F84A 1JR3A 4HNGA 5KTNA 1OIVA 1XEWX 2EBHX 3PHCA 3UGKA 2EXXA 2IF0A 2Z9CA 3SXJA 3ASVA 4CTNA 3F2VA 3PGA1 5F3WB 1DTWB 4UNNA 2LNDA 4ZVNA 2RAPA 4WZBB 4H60A 3ZW7A 3AF5A 4BWFB 3OUUA 1PHRA 2AT1A 4V3BA 5C31A 4DDVA 1H5QA 5ABPA 3W6UA 2P5SA 3F0TA 4XYBA 4GSKA 3CH4B 1FW6A 3PV0A 1KSHA 2FJPA 2YWRA 3PYLA 1TB4A 4M0PA 4PNZA 1DAHA 3EVAA 5ES3A 1NM5A 4URXR 4AQYB 2PUDA 2AYZA 4L1KA 1K6IA 3F97A 1L5SA 1GQSA 1TU0A 2GMWA 3DM5A 4DEVA 1DCTA 5CUQA 5C5CA 4DM4A 5LZ2A 1AF7A 1VCHA 4JV5B 2P5UA 1FMFA 3WAGA 3OFND 4OFBA 4AB1A 5ALDA 2Q7DA 5IM5A 5KX5B 3VKGA 2CVPA 1Q7TA 3W2GA 2XZDA 2NGRA 1MEEA 3C6ZA 2QTNA 4Y3UA 3TE7A 3UUEA 4HFNA 3ESXA 1AKWA 4O59O 1JYSA 1W73A 1I3LA 1P2BA 2VXBA 4EKDA 3E7XA 2W2KA 3QFTA 3L82B 1J06A 5D6NA 1GUDA 1Z9BA 2VRCD 5B3JA 2CK3A 2ODEA 2QSJA 3OCWA 1AKVA 1J33A 1QAQA 3LIIA 2Z2KA 2K2QB 2PH7A 2FRVA 4DJJA 3FKQA 4G63A 1PL0A 4II2A 4RVSA 4KYVA 3KM0A 2F48A 4QDXA 3IRVA 5BVGA 2VDMB 1SCUB 1PNRA 2YH2A 1WXIA 1XFAA 1U8UA 1FX0B 2I3GA 3FUTA 1KJIA 1QCYA 2VSFA 4J1QA 3U7EB 2H9YA 2A86A 1IM8A 3G23A 4V0SA 4YQFA 2FEXA 2GAIA 1OAOA 2VBCA 4RQTA 4LJRA 1PVOA 1CIJA 1T5DX 1B4DA 3MIZA 3TQSA 4Z4IA 4XXHA 2G67A 2WU4A 3TRDA 5JQGB 1V1JA 1TM1E 2WSIA 4BZPA 4QEKA 5EJIA 2O5EA 1GTG1 3OFSA 1X1BA 5F2KA 5KKNB 2JI8A 3Q87B 4Y30A 4OL9A 4C1NA 3LX5A 2C0PA 2RIRA 4HQNA 1GG9A 4F21A 4I36A 4MB0A 1NI4A 2OM2A 1G21A 2RHRA 1CZKA 2FPOA 1B8UA 1M10A 3RSQA 4MWDA 3I32A 5AHXA 3O4GA 3L8CA 1WZIA 4A82A 5JJKA 2E87A 2O9JA 3H84A 3NBZC 3S5UA 1HBJA 3FNEA 3AJ8A 1Z0ZA 3PE6A 5AJTA 1XTQA 2BVNA 2J5QA 5M7EA 1TAUA 1CU1A 1KPHA 5TPZA 1Q95A 2A1TR 1IH8A 2FWJA 1U0EA 1XBTA 1SIWA 3K2IA 2CJWB 5JDIA 2XMCA 1S5PA 2XNKA 2PS9A 2Y1CA 4K28A 4RAQA 4AMGA 2Y2VA 2OKGA 2Z0MA 1DCKA 2NW6A 2P3LA 4WECA 3AMVA 2BD0A 3TLKA 1V45E 1UFOA 1A9YA 4FFPA 2PV7A 4U8GA 4AZ3B 4PQEA 3IUNA 1BWPA 3WGIA 1S9HA 4F3KA 4BNDA 1IZYA 4R9VA 3V8NA 5KPDA 1MLDA 4URUR 1RYDA 1T2EA 1VGVA 1IHYA 2XMZA 4HDNB 5IVDA 1W35A 3ZQ4A 1Z2EA 4RM3A 2AXQA 2X7HA 4W5HA 2YDXA 1PIWA 3L9XA 1D4AA 3K4QA 3BHJA 2AR9A 1E2QA 2JLXA 2BMVA 2WP8J 1QBGA 2GBLA 3K1AA 4LDNA 3E22A 1LRKA 3TBHA 4DSTA 4F3YA 1UC8A 3P0IA 4JLJA 5MN5A 5T7BA 1IVYA 3WHIA 2PT9A 4EHKA 4YR7A 3D4IA 2E4ZA 1H9BA 2ZJ2A 1SCDA 1Q84A 5D3KA 1H3FA 4C87A 5IBCA 1HNXB 5T57A 1Y1LA 2X7JA 4TYQA 4DA7A 1T6XA 2BKEA 4TMVA 2IV7A 1P62B 3UUWA 5DBGA 1M2JA 3G68A 4QFCA 3WICA 1T0JB 3WIVA 3JQPA 3FHLA 1IJBA 1D4ZA 1RYZA 4GUAA 4WCFB 5DH9A 5C4IA 2YV5A 1L5FA 1KAGA 1SKUA 2UZIR 2ZZMA 4LYYA 1DRWA 3RWOA 1LPAB 3A6GA 3KJHA 1GPYA 1FP1D 3D81A 3LY5A 3DEHA 4HH3C 4WL0A 1HSOA 3ESQA 3T94A 3V1LA 5KOIA 4EF5A 1N33B 1A8SA 2R7LA 3N2NA 3TDNA 1MU0A 3IRUA 3CW9A 4RJ2A 4UAUA 5DNEA 4AF6A 5F1YA 4JJEA 4RDIA 5ECDA 3JQDA 3JQ7A 1R12A 1RWOA 1ZCZA 2P90A 2YOFA 4WKPA 4ZCLA 4CCYB 1Q7RA 3TB4A 2F8LA 4Q9LA 3TBKA 4LGYA 3LP5A 1EFLA 3WR5A 5I7SA 1TZCA 1XKXA 5IMBA 3SLGA 3N2EA 3ITNA 4MKHA 4V2UA 4B75A 4K6FA 4GXQA 4BRWA 1JQBA 1A9QA 3D6VA 3QLEA 4IXWA 4UJ5A 3G0CA 4WY8A 4QUGA 4MIOA 1Z8DA 3E1KA 1CG6A 3A9VA 5GJCA 3W8DA 4JVOA 5M29A 3OJFA 2GNPA 1DFHA 1U5CA 3KQOA 4L8YA 4QPZA 2G08A 4BNIA 1VG1A 3VU9B 4UBNA 4ESEA 2PO7A 5JWHA 3LC7O 4RH1A 2I4IA 3NOXA 4IS3A 2MSEB 4NKRA 3KXKA 4X1YB 1U1IA 3GGPA 3JALA 4NJMA 3K9CA 4HYTA 4POOA 3HJFA 3WADA 3ELBA 1NVGA 4CM3A 3W5DA 3TEJA 4CG2A 1I24A 3ACBA 1FU8A 1KVTA 2D2VA 3OC6A 1W4RA 4RY0A 4M9UA 4WE3A 5EE5B 4CUZA 4EDHA 1YHZA 3FPJA 4IJ5A 1U3WA 1EX1A 2I29A 3HADA 3JARA 2QR5A 1OX6A 5YASA 4FQ5A 3DD1A 1A71A 4JITA 4C9BA 4PCLA 4NBUA 2ECFA 2ZETA 1SVSA 1O9GA 2HAEA 2PWPA 2QTAA 1G20B 3FETA 3GNSA 2CUTA 4QDKA 2I76A 5JO0A 2YXNA 1LNQA 3N05A 5G1OA 4EG8A 1A9PA 4KXWA 1T3TA 3AM4A 2GXUA 2HMTA 5IUJC 4YDRA 3O7WA 1D1QA 1XMVA 1JNXX 2DM6A 3JAKB 2WQZA 4MI9A 4OHCA 1K63A 1YQGA 2FA9A 3LFUA 2E4XA 1X2BA 1E7YA 1WE2A 1CVLA 3BWCA 4PF1A 2ZP1A 2PVSA 3RAEC 1SHJA 4EGFA 4ZI7F 1IEQA 3I9V6 4GPIB 3TKAA 2PSSA 1XCPA 3I04M 3V6LA 1TC2A 3BMOA 4TROA 3FROA 2B34A 1UT8A 3A9CA 4WFQA 1V7PC 1I7NA 1YB1A 2NUAA 4ZZ0A 3K0AB 3WRVA 4C29A 3M34A 5AW6A 3SQDA 4ON9A 2PYZA 1NLZA 3HHEA 2ZWVA 1XA0A 1C81A 4P7GA 3HR7A 3OETA 3WLHA 2IDMA 1PLKA 1XJ5A 1N78A 2HGZA 2VOJA 5D84A 2YWHA 4LOKA 3CN9A 2WMYA 1L7OA 1ELOA 4Q1AA 1JDVA 4NATA 3OTGA 4CF7A 3I2IA 4KX5A 4EELA 1GILA 4U7TB 4QHSA 1D2MA 1L7AA 3L8YA 5EE9A 2DT5A 4K7JA 3PNMA 3WZLA 2QJTA 4M8IA 3I3OA 5E6UA 1N3YA 3EOBI 1YVEI 5ECGC 2JVJA 4XIGS 3GLFA 3AR6A 3INTA 3RAJA 3SVLA 1I1QB 2P35A 3V8MA 4CDRA 5HCUA 1IFXA 3BJIC 4LXTA 5A9RA 1I3OA 1A82A 2VJYA 1YBAA 7MDHA 3NVAA 2IU0A 3TTTA 4K2HA 4H7PA 2TRSB 4LRWA 1E4OA 4KV9A 3EPJA 4CCSA 3MXOA 1FYVA 1AQ6A 7ABPA 4YBRA 3DBRA 5B37A 1WCXA 3ADPA 1FQOA 1T1IA 2HSWA 3KZ1E 3FJ1A 5LP6A 4GUDA 1V16A 3ZHBA 4O4JA 3K70B 3LLMA 1UF9A 4YJ2A 2FPPA 3ORQA 3CF4A 2BTEA 4IZIA 2IH4A 2HWWA 1DX6A 4DYHA 4FFOA 3OBIA 3AONB 1QQAA 2XYPA 1WXGA 1EA7A 2O7RA 3IA2A 5HCNA 3SI7A 4BNZA 4OCZA 4DQXA 1M2VB 1ZN7A 3EC1A 1IVNA 3EGVA 2OBBA 3DFKA 1SKQA 5F33A 4AIRA 4YCJA 4OMDA 4Q1FA 3AIIA 2YCLA 2G36A 4YT2A 3HCFA 1ZK0A 2D62A 4N5DA 3E5HA 4WEQA 3PXDA 2HWKA 4GVLA 3ET4A 3D0QA 3Q6MA 4REQB 1EI9A 5ALJA 3S8MA 4RKWA 1S2LA 3IKVA 1UZNA 4DR7B 1L7RA 1XQXA 3N2GA 2E85A 2DR0A 3OZ7A 4QYSA 5EWMB 2R11A 4ZU6X 4AP6A 3QNUA 3WSWA 3JWHA 1TYCA 3CRMA 4L5JA 4L07A 4UNQA 4ZQGA 3TX2A 2DEUA 1FXWA 1EXVA 2QUIA 3PHLA 7AT1A 1A7JA 4EBBA 3HDTA 2WOOA 4GP6A 4GPZA 2D1TA 5DLEA 4N54A 1I13A 2VDRB 3KE8A 1CUDA 1QB7A 1K97A 2HZBA 3MUOA 4HMQA 4I4IA 1RMQA 4BC0A 1T15A 2H9IA 2P9TA 4TV8B 5DM4A 4Q5IA 3RYFA 3KAQA 4M83A 2BTOA 3PNQA 4PX9A 3SHWA 5KZMB 1KAMA 2AJLI 5LZ9A 3LSTA 2IYEA 4Z99A 1RYBA 2HNBA 3EMDA 1G3RA 1EJ0A 2H4XA 1R0WA 3HDQA 2W70A 4TKVB 4B0OA 1B0UA 2F00A 3AG6A 1FFGA 4HTAA 3DC7A 3UK6A 5IEJA 5A04A 1L7QA 4J16C 3PF8A 4MVJH 3L0IB 4ICIA 3S1LA 3UXMA 5CJ2A 1MFZA 3STHA 2EHDA 4X71A 2ZWPA 4EPYA 1KI2A 1XAHA 2HMVA 4L16A 1SUWA 2GARA 1YKGA 3L79A 4MYTA 5DSTA 1VYTA 5HR5A 4Q82A 3SF8A 3FCEA 5K8JB 2C98A 4QXPA 1OROA 2XBLA 5AKXA 5HRAA 2XUJA 4IH9A 4B8ZA 3EA0A 2QB5A 5LYJF 2Q6IA 2AI3A 1IUNA 3TD6A 3KZCA 3H7IA 2V45A 2WDPA 2PJZA 2BM1A 5A4MS 2HW8A 3E23A 3GJ4A 1SXJB 1WB4A 3K7EA 3PVSA 4MW0A 5G2OA 4YMWA 2XXAA 2C3PA 4DC9A 1ZUNB 3K73O 3HNOA 1AKYA 5CR9A 2NSHA 2XUZA 1GZ6A 2IEBA 4OOFA 3GIWA 4UBOA 1O96A 3U2QA 3OMWA 3MRTA 3DVAB 2YINC 3OQVA 3CX7A 4NJOA 1GXSA 2PYDA 2D13A 3FCSB 3EFEA 4RBNA 5C3MA 2VK4A 5MN4A 3TOVA 3G3EA 4KJXA 4ZPXA 3L8HA 1QHIA 5AW2A 2V7VA 4MJXA 4WJLA 1HEIA 2B0CA 4H1WA 4BE4A 4XIYA 3T5BA 4TKUB 1CNFA 1I6WA 3GPCA 1EVYA 3OQHA 4NAUA 4YGYA 1YQQA 4JI6B 1E2MA 2WJHA 4PAGA 3ZH9B 1QMPA 4FNMA 2QN8A 4WZAB 5JV5A 1ZCAA 2OZVA 3GGOA 2AXEA 4YI3A 1RKQA 4KMOA 3QG5A 5IG2A 1PJQA 3DTYA 3KT0A 2ZR0A 2A5GA 1CRQA 1QCDA 2R85A 4MW6A 4BLVA 5DNYB 4HXFB 2CL7X 3OHMA 5EXSA 3I9LA 3INYA 4KHZA 4LMRA 1SKYB 5DYGA 2N9UA 1HDZA 1USVA 1YZKA 2GPYA 2WILA 3C0KA 3DLIA 3PXEA 3ZLTA 4C6TB 4DMUB 4ZDIA 5A5DA 3EAGA 4HC4A 1EFRD 2EG9A 5K8CA 4F7DA 3MFYA 4GPEA 1W76A 1EE9A 5DI3B 3QX3A 1KMHB 1K9SA 4FBGA 1P7VA 2ZTVA 3PFCA 4R41A 1KDYA 3TH5A 4DNOA 1KEEA 1EVJA 3JQ6A 1CX9B 2UYGA 3WAKA 3AP1A 2R79A 3KLPX 3ABQB 3V7UA 1F0KA 3WNZA 4LPSA 3H18A 3C3AA 1FJHA 2OAGA 1WKVA 1TF5A 5HMLA 5FV4A 4HUJA 1FDVA 2R84A 5AM1A 5B53A 2OOSA 3MMZA 5FUMA 1IXSB 3DKPA 2C9OA 3PTZA 5KTRA 4PZPA 4UDNA 4XYEA 1AHHA 4FDVA 2W2OA 4P22A 3ZBPA 4Q1VA 4Z5XA 4EZBA 3MGBA 1D8TA 4MP8A 3PEWA 3JVIA 3N53A 3F4KA 2QK4A 4B6EA 1C7JA 2FQQA 3GD7A 3HJHA 3HVHA 3CX8A 5H59A 2HHJA 1LK5A 3R44A 2BONA 3NNNA 2VJMB 1ZP6A 4G0YA 3LUCA 4AKEA 4Q3NA 3GELA 4DV1B 4IHKA 1PV4A 4BLUA 3A1TA 3T06B 4COKA 1O58A 1XE3A 2PUCA 4HYEA 3IAS1 4G5QA 2Q3EA 4AT1A 3OVMA 4IDGA 2X4DA 1E2NA 3WRXC 3JQAA 2XX3A 4AJJA 1P6XA 1QH8B 1VBKA 4CM8A 1QE3A 2BUAA 3PVCA 5LOVA 3NANA 4AZWA 4YT5A 3DUFB 4E5VA 5GONB 4XD7A 1GRVA 1KR2A 4KXLA 2FK7A 3Q85A 3V1UA 2WJGA 4FSXA 3WOHA 5SYNA 3X1ZA 4UQLA 1EGQA 3FBWA 5LZ7A 1L5NA 2XQKA 4XDYA 4G81A 3J7TA 1A77A 5A0TA 3DTVB 3HLKA 3VVCA 3FA2A 1XQ9A 3H9GA 5IANA 2Z5LA 3NFRA 1J8DA 5ENZA 4Y9TA 4DAOA 1RWKA 1NURA 4IGIA 2Z2YA 1ZSNA 2DX7A 3GRFA 3OPYA 4J1TA 1NXQA 1OXVA 3O2NA 4KNVA 4DILA 1GRNA 4R54A 1D1TA 1G4UR 3S68A 4TTVA 1FMCA 2Z56A 1FEZA 5DLPA 2C7OA 3SSMA 1O4VA 4FB4A 4B47A 3B36A 3G0BA 2B37A 2QX6A 3BULA 2WM3A 2VXOA 3DHEA 1Q1NA 5DRTA 2BV3A 4FR2A 3EA4A 2XYQA 2ZG6A 4R2MA 1T35A 3IX7A 4AW9A 4QM6A 1W5TA 4YRFA 2LTAA 1Z13A 2EW2A 3F7OA 1B0ZA 2PUHA 2HH9A 3BZWA 2FWIA 1ZICA 3EPHA 1SHUX 1HT0A 2VAVA 3G8YA 3GFFA 2FUNB 4R4JA 2QN2A 3ROPA 2YJNA 1I9GA 1G8MA 2QNRA 4FQ8A 2IHVA 3QF7A 1G98A 4N82A 1JX6A 2O7VA 3JW8A 1TJPB 3FF4A 1G8PA 2DFDA 3O0DA 4O5AA 4NYJR 3C1AA 4BV9A 1CBUA 1DO2A 1YONA 121PA 1UPUA 2Q5FA 1NDHA 1W0JA 2W48A 3BD9A 3INGA 4A26A 9LDBA 4IIEA 3D5EA 2RKBA 2IYZA 4Y0VA 1KDOA 1TX4B 2MSNA 3TXXA 1Y9DA 1O95D 3TUIC 4C0BA 3LPMA 5KQRA 2GFIA 2R00A 3HKBB 4LC0A 2VVTA 2MSDB 3QLVA 5P8WA 3EG9B 1Z73A 1P45A 1THTA 2VTDA 3T4XA 2ACVA 3DVRX 3U16A 4PG8A 1V4BA 2CLLB 4FC6A 5EIFA 4ETNA 4XOIA 2FTKE 2QMOA 2PD4A 4CMIB 2ZIFA 1PG2A 2DQYA 1XDBA 3QNMA 4M6WA 4GIBA 5FA5A 4DG9A 3TVYA 4M9CA 1Q0ZA 3UT5A 4KQFA 2M32A 5L7TA 5AJVB 2X0IA 4K40A 5JXHA 3H3FA 3FRJA 5T3YA 3I28A 1IPHA 4LTNA 3OKAA 2H1FA 3V4FA 1KOJA 4LRYA 2HUNA 4R51A 3N9IA 1SVWA 5D7NA 2QTLA 2FNAA 4WN9B 4ZOBA 1RXWA 4A6XA 1QTIA 4N7RA 5FBKA 2HHCA 1KBQA 2BFEA 3NDJA 2XMGA 3TR6A 4PWZA 4DLLA 1VOTA 1XCOA 3EQ6A 3PXGA 3T6KA 1U28A 2HR1A 1Q3KA 1QANA 4FHGA 3CH7A 4XWOA 4DRXA 4J0QA 2B3DA 4RA6A 1JAIA 3H9UA 3SYLA 5IC4A 4IDOA 2WUWE 4W6ZA 2CXXA 3N6RA 4ESVA 1NYLA 3COVA 3GHHA 4N3AA 4HXEB 1AN9A 1JG1A 1BMFD 2J9FA 4UARA 4LXYA 5G0UA 3W6ZA 2QMUA 3CVJA 4L2IA 4GXTA 4MINA 1G8SA 1BEZA 1BQ4A 3M3DA 3VNQA 1E9RA 4BBPA 2F8TA 1Q0LA 3DVLA 2X14A 3K0BA 4ZCSA 1IM5A 3Q8LA 2WAMA 3P4XA 1QHSA 1K2WA 3NHPA 4EABA 2AC2A 3KYBA 3GIDA 5JSUA 2Y1GA 2B0JA 3GYGA 3K53A 3Q12A 3S28A 2FWMX 2RBGA 2FFBA 4RD1A 5DVZA 1ECGA 2X9NA 1D4OA 1X94A 3VV2A 3WHKA 2QLFA 1ZJJA 4NRDA 2B36A 1FYDA 4ZAYA 2ENWA 5K0FA 1DI0A 1HOXA 2OK7A 4IGFA 1QYXA 4HG2A 1NAIA 5JPCA 3CNNA 3LBFA 5DDIP 2J30A 2OM6A 2WE8A 1LSUA 4EOGA 3Q9SA 2NO7A 1Z8NA 1CUGA 4ISCA 2JFZA 2WM9B 4KGZA 1P7WA 2OB1A 2XVXA 3RROA 2YQ4A 1XZ8A 2YYSA 1MIOB 1YUMA 5F21A 4AJ2A 4YUAA 3LU1A 3K6RA 3L40A 2I87A 2M6LA 1RRKA 2GCPA 4AJKA 1GNTA 3DPUA 3L0PA 4QOJA 1WTCA 1X8XA 3PBKA 4TMWA 2I1WA 2VJPA 5H3CA 1QHYA 1R6AA 1C50A 1KP9A 1GZ7A 1C29B 1XJCA 3D5QA 2H3HA 2YKGA 3HDJA 3KQMA 1E3TA 1ZGGA 2ZRCA 4YP7A 3WL7A 3HACA 3SQWA 1U1EA 1YWGO 2YZNA 4XDHA 1D4FA 1OZFA 2P2NA 3HKDB 5C51B 4V03A 5JI3E 4NXNB 1DE0A 1BKDR 2DJIA 4LRTB 3PYMA 3KRTA 3CPSA 4JUDX 1VPDA 2D5AA 4A8TA 3FY4A 2WAAA 1G21E 5FD8A 1XMIA 2XSZD 2QZZA 1I6KA 2MOKA 2MSKA 2PSFA 5C4GB 1JPJA 2GN4A 4XFJA 2PR7A 2VWHA 1AKUA 4P5EA 3T1VA 1WDWB 2G5GX 4LMAA 3REFA 3A1NA 3G7NA 1DEHA 4MI3A 3D8RA 3VPSA 5BOSB 1U6KA 2XYRA 5FLXA 1YR7A 2G0AA 3FYUA 3ILHA 3UJPA 4QRHA 2VPXA 3H2IA 2QAIA 3G0OA 4BMDA 5IJ0B 2DHCA 3D7LA 5B7PA 3VDMA 2ZWOA 4YMUA 5HWSA 2EFEB 2KYRA 2XE4A 3SQLA 1W34A 4KH0A 1NFRA 1K86A 4GRAA 3RTAA 1WA5A 1JKMA 1X7YA 2IEDA 3KXPA 1II0A 3TLJA 3JPWA 2ZW9A 3PQEA 2WWTA 4BJ6A 1Z2NX 4KRYA 3NIWA 1FP4A 5HBRA 3C4QA 2C95A 3R7FA 5C1OA 3OX4A 5AVOA 4EAAA 4DR3B 4DM3A 3JZDA 3WLFA 1FUYB 1OI2A 2D1YA 3AINA 5LP6F 1TO6A 4FGLA 4Z51A 3L7KA 3UGTA 2QR3A 3CZAA 4X3OA 2EFHB 1IPFA 4O4JF 1RQGA 2O2ZA 4YALA 5D5HA 5KCMA 3RFCA 4YJ2F 5HUHA 2VYVA 3O8OA 3SIRA 1S8AA 2OLEA 3FDZB 2HTFA 4BUCA 3AVPA 3BMQB 5AKLA 3TLCA 4XH9B 1H2ZA 1EWKA 1JVSA 1KJWA 2Y92A 3BEDA 1SELA 3NT2A 4O2BA 3WRWA 5KHOC 3I5XA 4B3MB 4IJUA 1I2MA 3N0VA 1GGKA 2NNWB 1P4RA 4MV8A 2EBUA 4MW1A 5K51A 2H2AA 2BGMA 1COWD 2DUMA 2QS9A 1SIOA 3EMVA 2AN4A 4MRAA 4CG0A 1WF3A 4URFA 1JJ7A 5I7FA 1NVKA 4YUWA 3QKTA 3LHKA 3WHPA 3WKCA 4WSOA 2W71A 3ZWCA 4JMLA 5J2TB 5JVDA 1H2HA 2PWYA 3EEQA 1K7EB 4FTWA 3E9ZA 1E63A 4LF6B 4NCAA 3KWFA 3NYQA 4O4HB 2HA5A 5MGNA 4QXOA 1KJYA 2AHOA 2J87A 3R4CA 2VPPA 3G6WA 4MPTA 4KQ6A 1FXWF 1KI1A 1JFLA 1R0SA 3EASA 3EF3A 1KKMA 1XIVA 3WP0A 3RVMA 2H52A 1DQSA 1IMJA 1ODLA 4YV0A 1UEJA 2DWUA 4ZYTA 1UKAA 2IVZA 1S96A 4DIOA 1EVZA 1IPEA 2ZYVX 3HUEA 2J46A 2X2FA 2XUGA 1MB3A 4QYTA 2GRJA 4HGYA 3UCXA 2Q2OA 3IDFA 3TRIA 1L3IA 2FEWB 1VCIA 3W0LB 2CZCA 1NASA 1PKEA 3HZHA 1BMQA 3C48A 4WASA 1AH2A 3RIEA 2RK3A 3CLRC 1Z7BA 4WESB 3N74A 2C29D 2HJHA 2V97A 4I55A 2BUCA 4EMBA 1P9LA 1EFVA 2ZITA 4N7MA 5BW6B 3PL1A 1A9XB 2PUVA 3O94A 4JROA 1LLQA 4RELA 3TLXA 4F1JA 2JKYA 1ULAA 4OAPA 3AGQA 4M1SA 4MCJA 4NIMA 1G5PA 1GUAA 4L5YA 3RRNA 5BR1A 5BSEA 1GFZA 2XWBF 5BUSA 5FO0A 3QE9Y 2C1XA 3I6IA 3IT2A 3R5FA 3I01M 5TS3A 3WYFA 1XNGA 3IKJA 2C94A 2KHZA 2H4JA 1A2QA 1DAMA 3EFBA 3FUVA 5IF9A 4BMCA 1O08A 3OZRA 4X20A 4AX4A 1T9KA 3ZQ6A 1ZO8A 1XEXB 4QNRA 1IBMB 1V8ZA 3GLHA 4ZRDA 1CTQA 3S5JA 1PV2A 4OEHA 3IXMA 1GSOA 4O02B 3DR5A 5BW5A 3FDXA 2QGZA 1XCGB 4QUAA 1QIIA 4NMHA 1T8YA 4BCBA 4H4DA 1KO7A 5KPJA 1MABA 3BE4A 4OB7A 3OOWA 4B17A 2QENA 3RUCA 1XVIA 4UVIA 3MSCA 4MYSA 3C7AA 3F90A 4PYJA 1YQUA 3NWOA 2GHTA 4DPKA 1A69A 1C7IA 3DL7A 4C04A 4DEXA 1OFTA 5JS8A 1DJPA 5FXMA 4BN0A 4ZTBA 1C4KA 1GQ2A 3ED5A 3HXLA 2QSUA 1KQFA 1ZM7A 1D5CA 5ALQA 1N2CE 1TVKA 3ESYA 3V2UA 1P61B 4DRZA 3NMUF 1YCGA 4X65B 3DA8A 5FPTA 4BNMA 1ZMTA 1ND5A 2R6CA 2RGUA 4E3ZA 4WEOA 3ROFA 2Y1XA 1RXUA 3OWHA 3GU3A 3EXHB 3PHJA 5KYGA 4V24A 4O4LA 4NNJA 4AURA 3ZGZA 2ZE6A 3IT3A 3DP7A 3E2IA 3VOAA 5TMBA 3F8WA 4TXJA 5D1HA 1Y3DE 2D2IA 4MUXA 2ZJ4A 3AEQA 3M5PA 2W2XA 2JH8A 2Q41A 4UVDA 5E1OA 4L51A 1LA2A 3R2JA 1P7CA 3WQBA 3ZGYA 2CWDA 4IIHA 2K7FA 2EERA 3RRXA 4NAHA 1B1CA 3KCNA 4D5GA 1X42A 5ER9A 3W2IA 4GBJA 5K9ZA 3DMTA 3O03A 3D64A 3DWGA 2QLNA 2Q8NA 3ORHA 2BAGA 4FJ2A 4IUCS 5ARDA 4ZT6A 3SYKA 1LWNA 5FWXA 5CFPA 4V3CA 1JEYA 4NBKA 5LQSA 1S3FA 1CHDA 1H0RA 1V41E 5DK6A 3SR0A 3LX4A 1AA6A 2WG1A 1MTOA 3R3ZA 2IUEA 3IV7A 3UH0A 3AERA 3LLSA 4RHXA 2C96A 2ZAIA 2C8KA 5F51A 4RJIA 3WJ7A 3IEMA 2C2WA 1BHO1 3C5VA 3GT3A 3VO2A 2IHKA 4D41A 1AOXA 1WW8A 2IYLD 1NBOA 1L7MA 1V9SA 2B30A 3UAYA 3HXMA 5LXTA 1WUYA 3WV4A 4DUGD 4H6WA 2EFCB 2ES4A 2HBRA 2JEOA 1PNOA 2X13A 2XBMA 2MJLA 1H2YA 2ZT6A 5LOVF 2YIVX 1M2KA 2I8AA 2O8VA 3L6OO 3HJNA 4RVOA 3AXSA 1MC1A 2IUFA 2QMZA 1QGED 4FE4A 3OD1A 4JOBA 3NIBA 1WDTA 5AVQA 4QWWA 3EPKA 1L5YA 3I9JA 1TK9A 3TNYA 1SHTX 3ROGA 1R0KA 4G01B 2R1VA 4QOHA 3VKWA 1N8SA 1Z6YA 1GADO 1KH3A 1P3Y1 1ODTC 1T1GA 1V6SA 2AMYA 2GZSA 1GLGA 2ZKIA 1Y3CE 3JQ8A 2F8SA 1Q3TA 3GEGA 2W6MA 4Z54A 1AK9A 1P29A 5JT1A 5IRCD 5DW0A 4E5UA 1FUIA 5JCPA 2G1PA 4M0FA 3BTOA 2DSNA 3DL2A 4MS4A 1YZYA 5BOVA 3U62A 2O5VA 5EUCA 1EGVB 1L4HA 4K1LA 1EVLA 2D5LA 3FCYA 1TUIA 3RYTC 4J76A 4D82A 4F71A 1BW9A 1VHLA 3IAAA 2WWVD 4X6XA 2X9QA 3HB7A 1F12A 4MWZA 5IKEA 1H1DA 2V3VA 2XV1A 3DONA 3ZWXA 4CM5A 3R8CA 1P1FA 1EPUA 5FQOA 5A5VA 1Q0QA 2HWUA 1RC1A 2Q4TA 1BROA 2ZATA 3FRHA 4MWOA 3CNLA 2I22A 1E0SA 3BILA 3RUDA 4H08A 5CEFA 1EHIA 1M1YB 3FGPA 4KSBA 4HWSA 2HFJA 2QI9F 3ILYA 3ON5A 1QH1B 5EERA 4CLXA 3I45A 4CTKA 2A14A 4EW6A 2HU2A 3GUHA 3HRKA 3TB6A 3W3ZB 3FMOB 1OMOA 3BVPA 3UK0A 2H07A 5AKIA 4RTNA 2ZBUA 4H6XA 3V1TC 2INGX 3A6KA 3MYRA 4ZA2A 4YRQA 4FMCF 2PX6A 4L3WA 4D4JA 1RIFA 1EG2A 1MAWA 4UTZA 1YU9A 5FI5A 3GCGA 4ND8A 1I30A 4C7MA 2P91A 4KQ1A 3RKSA 2ZJ5A 3K6JA 3I62A 4UAGA 5EC8A 3SBXA 3NWPA 4R2IA 1KOFA 3L6DA 3QLTA 4P8RA 4R1NA 1RHKA 2C0CA 1M6VA 2BHLA 1QRSA 1OH6A 5T4EA 4B2IA 3FTDA 4ZAVA 3SZGA 5L95A 5FTMA 3ZDDA 4YMVA 3ECCA 4D0GA 3EJ6A 2C42A 5J43A 1RM5A 5B1SA 3OX1A 3S2IA 1V95A 3RFFA 1UKYA 3EARA 5JANA 2GRUA 1LPOA 3IKLA 3QHQA 1AV7A 5GZ6A 4CLHA 5HNKA 3OQ6A 4JC0A 4QD3A 1HMPA 2ZRAA 4Y6LA 4C2TA 5IKMA 4MYDA 2QVYX 1IM2A 1RRFA 2PX4A 2ZWIA 5LBUA 2CT8A 1YDFA 2WKSA 4RVGA 2FUG1 4D8XA 4YMHA 1RLTA 2XWPA 5TQVA 3PE4A 3I4FA 4YAEA 2GXSA 2X5XA 5L3ZA 4X94A 2Z6UA 1ISHA 4LOLA 3AW9A 1RCTE 3RJMA 2WG0A 1YULA 4ZVTA 2EWMA 1JDZA 1R5OA 1TRHA 3GCWA 4BMZA 5KOJB 3D6HA 1USGA 2Q29A 2Z95A 5EZSA 4DC1A 4MHTA 1SZDA 5HQ3A 5EWJA 3I42A 1QH9A 2YVQA 1M6NA 2OCBA 3L0SA 4U02A 5L3QB 1OGYA 3BEOA 3EWIA 4PXYA 3PLAE 4EI7A 4HDMB 2AZDA 3QKSA 4IDQA 4KNWA 5A0VA 1GQRA 1P3JA 1DAEA 1Z5WA 3ASYA 4DBZA 4EGSA 5LQRA 3L7NA 1R6DA 4KLRA 3TM4A 1N9ZA 1R7RA 2DBVO 2FB9A 3BQNB 5CHEA 3V4OA 1H8ED 2X0KA 4OUDB 4RTJA 3M4JA 1YV9A 2WHYA 5HKKA 2YW2A 3PUJA 4DIEA 2RKWA 1WIWA 1S01A 2HA2A 2Z9DA 3I1IA 2BGIA 9MHTA 3HSKA 1T5IA 4OHWA 2EHJA 2HIGA 2JH3A 4YXFA 5FH9A 3T3PB 4QUJA 1F4PA 4D25A 5K4AA 4TT3D 3AX6A 1QQ7A 2XHEA 2BTQB 2GLTA 1LX6A 5ETJA 3T9AA 4ZVLA 3UHJA 2A0WA 1JF8A 4P0TA 1IDOA 4MRNA 1C3EA 5BP7A 5G02A 5SZJA 1SBHA 4KLNA 2QORA 1M1UA 3EZFA 4EPXA 3NPMA 1I3NA 3GJ3A 3F47A 3FB4A 2WPNA 4YCBA 2X4IA 1ZMBA 5AVSA 2YXEA 4RHFA 5I4KA 1JIVA 4PPGA 5FNZA 1A8PA 4RZXA 2JIBA 4D3FA 3HYCA 3IQDB 5J1TB 1NJSA 3HP4A 1A4UA 4ZV7A 1P75A 3LZDA 1PR0A 1XTSA 1DNPA 1N8TA 2B6HA 4DXAA 3MJVA 1QYCA 3O93A 3DCNA 1JSZA 3DYIA 3K35A 4RD6A 5C8XA 2W6QA 2QG9A 3R9IA 3WDSA 1UIRA 3CF2A 4C5AA 3EZ6A 4W9NC 3JAWA 2EL7A 5DBHX 4IW3B 1RJWA 4J3NA 3NATA 3VXKA 3TG2A 1QX4A 2P1RA 1JEQA 1U9CA 3HCNA 1TTPB 1S02A 1Y4ZA 3PA8A 3ZHOA 4BQNA 3OPVA 3THXA 4MPDA 4EECA 3G59A 4YRLA 3WZMA 4L9AA 2WTXA 5DASA 4EB6A 2BDEA 3IFSA 2G77B 2PMCA 3DBHB 1CY4A 4DIKA 5LIPA 1XN4A 4HDRB 3DDHA 3K70D 1G55A 3V7WA 5BORA 3R3XA 1A27A 4GE3A 1P1JA 2B98A 4CF6A 3OP4A 2C9CA 1P6QA 1HQYE 1NX9A 1IXRC 2XB8A 2UV8A 3QXGA 4J0GA 1AZTA 4LK3A 4WH0A 3K0HA 2F9LA 4DL9A 1RRGA 2X4LA 4MEJA 3K0FA 1MB2A 1RVDA 3PFGA 4NVRA 4RX1A 4EHAA 3R6LA 2FSGA 4UFPA 1GITA 3QUAA 4MP6A 2DHEA 2FSPA 1HORA 5B2ZA 2IEGA 4C4OA 2VOEA 2W6CX 3LCJA 3IKTA 1HK7A 4B79A 1HDEA 1E2FA 3DE5X 1DSSG 5FBQB 1LBQA 3PD7A 1KK2A 1N3IA 4JUAA 4LIPD 4NARA 3I5YA 5CMLA 3DBVO 1X7XA 1TM3E 4BZQA 5DYYA 4LJYA 3KZMA 1UK7A 1W88A 1IUOA 4FGZA 3UY4A 4B87A 4BWVA 5A9SA 5BV8A 5IAAA 2C2YA 4H35A 4FXOA 4DE5A 1Z25A 5JY1A 4BGVA 4V0MA 2G04A 3IJPA 4WN3A 5KJEA 4AFNA 4MV3A 5AKJA 4CMCA 1CQJB 2DE0X 4WCDA 1QQTA 1ZD1A 2QR2A 2O8CA 4IOKA 4C5BA 1JMYA 4PZCA 1HZZC 3HLTA 3OU2A 4RLQA 5CDUA 1AV6A 1RYYA 4YB8A 1ORWA 1ZI6A 1F8YA 3QFSA 3THYA 4WY5A 5C7OO 3WGJA 1M0EA 4A0HA 2WHRA 3M7IA 2VXYA 1UJ6A 4O2BF 2IELA 2VDJA 1SCIA 3LXXA 5T3UA 4DREA 1ISSA 1CZHA 2C92A 2P0AA 3L1HA 4ZMRA 1WF6A 4N0MA 1RLMA 2A57A 1SXHA 3A8TA 4XGKA 1IOZA 4BKRA 4MVJM 3GC6A 4PX2A 5LLTA 6ABPA 1LLFA 4LWQA 1WCWA 3BGVA 1OOEA 3I8SA 3R3JA 4FIZA 2IZ7A 4QLAA 5EP1A 3H6KA 4NK4A 3AHJA 3ZZUA 3U7HB 2Z2IA 1XD2A 1XC7A 1OJ7A 1DEXA 1XGKA 2GUGA 4L0CA 5I9NA 3EA5A 1Y1KE 3EDYA 3D4NA 3UFBA 3I9KA 1CR2A 4P08A 4J3JA 1T1SA 1PX0A 1KYTA 2EBWA 2K87A 5JVDF 3CUSA 3W5IA 1I14A 3K5IA 1GO2A 3SE7A 1KTVA 5TPWB 5JAMA 4GR4A 1NW8A 4RZIA 3W1EA 3OC0A 3P97A 1DRJA 3U49A 4O29A 3J7AC 3H2ZA 1TCVA 1Z3IX 1BZYA 2DKFA 1LI7A 3GFSA 1D1SA 3FDJA 3IEKA 3QOFA 2WF6A 4XJTA 2Q6VA 1SXJD 3OMLA 4FYJA 2D3TA 4PYRA 4TV9A 2HGSA 3DZHA 3D59A 4LPKA 5FBHA 5SZKB 5KSWB 2QRQA 3QNWA 1LPSA 1T2CA 1VPEA 1SCNE 5C80A 4N0EA 6REQA 2B4KA 2SBTA 1OTXA 1USUA 3TSWA 1BFDA 821PA 2BSQA 1Q20A 1UMKA 4RFVA 1ESMA 3FBTA 1DL5A 1XLTA 2H29A 4D96A 2OL4A 3UWKA 3JD3A 1W1IA 5F4BA 1YZ3A 4M37A 3SYNA 2XKKA 4I55F 3IP6A 4HNSA 1HEUA 2Q45A 4GU5A 4M7WA 2RGBA 2BFCB 2CCKA 3PWSA 4GGPA 4B71A 3CNEA 3E9EA 4N6OA 3BN3A 1ZXXA 2VCHA 3ZHVA 2FUCA 2C8VA 5EP4A 2NU8A 4C5CA 3U39A 1YTUA 1PGNA 3E27A 1GPJA 4IYRA 4ACBA 2X86A 1FPMA 3LDUA 4X3PA 3ZLVA 4ZQCB 4BU1A 4D6XA 2N42A 3EVDA 4PLPA 1VDMA 1H0KA 2AJDA 4EIWA 1VYUA 2HK7A 3F9IA 3MLAA 1XWFA 1ZM2A 4DWOA 3AKEA 1YZQA 5KYNA 1DUVG 2G8NA 1QIFA 3BIXA 3QQ5A 1Q83A 3NT5A 4JLWA 3A26A 2YC2C 1EX6A 1JKJA 4DY4A 2JVIA 3LXMA 3WB2A 1YAJA 2XPCA 4ESOA 2YQZA 2IDKA 3MF4A 2Y71A 2PRYA 3VR5A 4BNNA 1VB3A 1JBQA 1RJ9B 3V2IA 4G5YA 2A9OA 3NYIA 1EUDB 3TOXA 4IF6A 5EJEA 1EM6A 3D4OA 2FN8A 4FMDF 5ALLA 2ZAOA 4OLFA 1L7XA 2PS3A 2EJTA 2DH5A 5TJ9A 4GMXA 4QU9A 2WWWA 3A27A 1KIFA 1R74A 4LJ9A 5G1NA 1IATA 4DT1B 4BBJA 3VKHA 1S3SA 2VDOB 2O4CA 4U2EA 5AM3A 1TJ4A 3ESAA 3RIHA 1TQ6A 4KL8S 2J1LA 5EQDA 5K6RA 1L4NA 2BFMA 3AF3A 3E9RA 4Q7KA 3TW6A 3THWA 1BS1A 3HO8A 3EGWA 2YBDA 1I94B 3RU3A 3CF0A 1E1YA 1LFAA 1YRQA 2PMBA 4O4LF 1R3UA 5BNFA 1JJIA 4M88A 3PDIA 3CUTA 2JCVA 1K27A 2ZDQA 5EXTA 5IN5A 5K01A 3AIKA 4TTJA 2O23A 3MTQA 2E4AA 4US1R 5EVJA 1TPZA 3P32A 5ALPA 3VZSA 1AKTA 4FDUA 2DFTA 2YC4C 3EDQA 2FSHA 5KDLA 4F3TA 4IDBA 1D9ZA 1MB9A 2WYIA 5AICA 5FT9A 1QYWA 4MNTA 4QOSA 2UYYA 5IASA 1Q7BA 3NG1A 5LUBA 4GP7A 2P40A 4Q7JB 3RR2A 2V3CC 4MCAA 1MC4A 1Z6ZA 5HM6A 1AUXA 1RM3A 2HB6A 2PKQO 3F5FA 3HXOA 5IH3A 1UANA 5FEUA 1BXGB 1T9AA 1Z5OA 2XZOA 2XAUA 4M0KA 3R3UA 4WGGA 2ZGVA 4EARA 5TDHA 4ZI5A 2SHKA 1UFVA 3HXTA 3ZY6A 1W7AA 1SZPA 3R3VA 4YAFA 2WUVA 3L6CA 3DTVD 3ZN2A 4FSDA 4JFRA 4BLRA 4P4NA 5A6SA 2MSWA 3F78A 5IBQA 2G4LA 4BVKA 4HH1A 2PNFA 2GM3A 5FLYA 2A0UA 2QTHA 4JFAA 4PICA 2AN9A 3RIXA 5EHGA 3IIIA 4NU0A 3TVTA 2M1XA 1UJ2A 3JYHA 2A3NA 4MYHA 4URZR 1ZGJA 4CF3A 1XNRB 1ZH8A 2O1XA 1ZGBA 4LA4A 3SJZA 1BFKA 1JHPA 1DBQA 1N2XA 4NI5A 3NEAA 1VLMA 3I3SR 3L0CA 4HTFB 2IZZA 2C7RA 3QTLA 2V54A 5BQXA 5LXTF 3BHIA 3WL3A 3DAFA 3ZWAA 4XD2A 4OQFA 3QFFA 5TARA 3AL2A 1L8QA 4RD3A 2XUHA 3O3OB 4LHSA 3B6JA 5D1NA 1UBTS 2DPMA 4E5PA 1L5WA 1UMDA 1A0OA 1I5EA 5IAEA 1Q6ZA 2OZLB 1OWNA 3IQWA 4JLVA 3CVYA 4D43A 2PWZA 4EPVA 2OFPA 1YB5A 2PT5A 4MTCA 1XVUA 3DTTA 4BB6A 4E33A 3DM9B 1DBVO 2ORED 4JMPA 1BVYF 4F2PA 4IIVA 4HATA 4DLKA 3K31A 4HP8A 1NQOA 1JVBA 1P19A 3R6DA 5F52A 3VR2A 5M2QA 1HKHA 5E6SB 4IYJA 2X4GA 1THZA 3O82A 2CZGA 5F7XA 2W4IA 1P8AA 3S70A 1PQUA 3WA7A 4K2AA 3WMFA 5KHAA 4ALNA 4MQLA 1TZKA 2NTJA 1I7SB 4I50B 1SNYA 2XUKA 2ZS7A 1J2YA 3JYQA 3HL4A 3N28A 1ENYA 2ECPA 1KO8A 4PXAA 2PV0A 2AFIA 1T5OA 3N8DA 3B3QA 1XTIA 5LSAA 1N8KA 1XWIA 5B3KA 5AW1A 1YJAA 2GK3A 1XYVA 2YQ5A 3RTDA 4DLXA 1YMVA 3LFTA 4LXIA 5KAMA 3RIYA 3D8SA 3EXFA 1UH5A 2P6NA 3FFAA 5EZ6B 3D2LA 4JA2A 1R37A 2D1RA 2J85A 2BFFB 3KOOA 3FNFA 4RVCA 2OHOA 4QT4A 4DUPA 5EZYA 4P53A 2R8PA 4HNTA 1FUUA 4GQAA 4EHDA 4PPQA 4WCFC 4RD0A 4MDHA 4EENA 3QFHA 4WFJA 4Q1DA 1SVOA 1UK6A 1KDVA 1FCJA 2FU5C 1UXGA 2OBMA 4CV3A 5JQWA 4PGHA 1DOAA 5DTEA 5G4LA 4C76A 3QKIA 2RC5A 3T12A 2FEMA 4LE0A 5EPUA 1Z22A 2IEZA 1K06A 5CFOA 4IJQA 3MA0A 2BP7B 5GIPE 2ZPTX 4WNAB 2ZEJA 2ZBFA 5DWQA 3ACDA 1SBNE 1TTHA 1PVVA 2OMEA 2VDLB 4Y2UA 4Z9YA 5GP1A 1CY0A 2J6BA 3KUKA 3RASA 5C53B 5FNVB 4B0PA 1E64A 2HLHA 4FJ1A 3OZIA 4JBNA 5KWJA 2ZJAA 3OJOA 4LDRA 4MQEA 1Q7EA 4IWYA 3W4IA 1FLDA 4IMPA 4PXSA 3NHYA 4N5LA 4OHMA 1XROA 4XR4A 1J4AA 3HRIA 4O0LA 5ILQA 4BWGA 1KVRA 2B1JA