2HM7A

Crystal structure analysis of the g84s est2 mutant
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
308
structure length
308
Chain Sequence
LDPVIQQVLDQLNRMPAPDYKHLSAQQFRSQQSLFPPVKKEPVAEVREFDMDLPGRTLKVRMYRPEGVEPPYPALVYYHGGSWVVGDLETHDPVCRVLAKDGRAVVFSVDYRLAPEHKFPAAVEDAYDALQWIAERAADFHLDPARIAVGGDSAGGNLAAVTSILAKERGGPALAFQLLIYPSTGYDPAHPPASIEENAEGYLLTGGMMLWFRDQYLNSLEELTHPWFSPVLYPDLSGLPPAYIATAQYDPLRDVGKLYAEALNKAGVKVEIENFEDLIHGFAQFYSLSPGATKALVRIAEKLRDALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxylesterase
publication title Functional and structural features of the oxyanion hole in a thermophilic esterase from Alicyclobacillus acidocaldarius.
pubmed doi rcsb
source organism Alicyclobacillus acidocaldarius
molecule tags Hydrolase
total genus 99
structure length 308
sequence length 308
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2hm7A00
4BZZA 1CEXA 3QH4A 1G4HA 4KEAA 5JAUA 1XRMA 1TRHA 1WPXA 4AO8A 2WG0A 4DLNA 3GUUA 4LXHA 1MT3A 1E8MA 5FRDA 4K2AA 4HS9A 4X00A 5C81A 1Q0ZA 1XQVA 1JU3A 1ZIYA 3QPDA 3WWDA 5ALGA 5IH7A 4WDRA 2VJAA 4OU5A 3H0CA 1XRQA 2OCLA 2XI4A 1R4ZA 4PF1A 1JJBA 2HFJA 3PF8A 4H0CA 4W9RA 1HDEA 4C4YA 5AK6A 1JKMA 3E4DA 4UBLA 5DYTA 2GZSA 1UT6A 2XQGA 3PFBA 1S8OA 2QVBA 1CR6A 2WUEA 3O9MA 4Y2YA 5ESRA 1QFMA 4Q3OA 4Y2SA 3BDVA 3EQ8A 2GYVA 1QTRA 1BN6A 1BEZA 3VKFA 2WSLA 2XMGA 4G5XA 5EIAA 4BTVA 5EI5A 4Y2QA 4DNPA 5J3JA 1GZ7A 5AH0A 1ZD5A 3HJUA 4P08A 2BAGA 4GI1A 4BDSA 3G0GA 4CCWA 3ANTA 1AURA 1OILA 4XX1A 1XZCA 4B0OA 2GYUA 5ALPA 1WCYA 3WWCA 4CG1A 4UFOA 3WL5A 5I8PA 5AKIA 3WK7A 1OXMA 1XRLA 1E8DA 3D4LA 2XDWA 3DNMA 4J0IA 3VVLA 3AIMA 1LPMA 1FFAA 2WHQA 4I4CA 2XMZA 1TQHA 1VXRA 3FVTA 1MN6A 3H2JA 1TCAA 4JYPA 4UPDA 2QT9A 5JALA 2ACKA 2DFPA 1LPAB 4KE7A 5CH5A 1EVQA 1FFDA 2ACEA 3HLKA 2Z3ZA 4AB1A 4QNNA 4X97A 1QIFA 1PFQA 4FHZA 1QO9A 3D5EA 5IVKA 5AKHA 3I2IA 4BE4A 1KU0A 5FUMA 2ORYA 1DQYA 4NMWA 4JNCA 4EBBA 5DYYA 1E5TA 1A8QA 4BAGA 1QIEA 2XQIA 1UKBA 4BC1A 5LZ9A 4ARBA 4BCDA 1JMKC 1EH5A 1XRPA 2EEPA 1CUVA 1QGED 3VXKA 3WK8A 4DTCA 1C4XA 4AN0A 1AGYA 2ES4A 1MNQA 2VSQA 4EB0A 5KBYA 3C87A 2XB6A 3X3HA 2OXEA 1ZICA 4Q05A 5EFZA 2FJPA 1ORWA 4N8EA 3WL7A 1DX4A 4DIUA 1AX9A 1NU8A 4GECA 2OCGA 3G8YA 4BAZA 2V96A 3M82A 4BP8A 3VJMA 1CUHA 4UUQA 1L7AA 3HC7A 4U2EA 4UHHA 1UK7A 1DWQA 5AKZA 3FYUB 4G9GA 3FCYA 1GPLA 4HVTA 2I03A 4UBJA 3BE8A 4HTAA 4E46A 4ZI5A 5BWBA 4HRXA 3KXPA 5LYYA 4O08A 4QDOA 3O95A 4P93A 4WFJA 2E3JA 5T4HA 3G0BA 3FOBA 3OOSA 4FNMA 3MGAA 4QLOA 4MJ3A 4ZV9A 2V97A 3BJRA 2YXPX 4U2CA 1ODSA 2EDCA 2JEYA 2QM0A 4X3CA 5EHNA 1Q0RA 1R3DA 3PUIA 2HU7A 4YASA 2ECFA 2OGZA 2HA4A 1XKTA 4WY5A 4BP9A 4FDMA 2VTVA 4P92A 1UK8A 3JWEA 4MWSA 4OB8A 5EHZA 1WB6A 1YSCA 1TKRA 5AK4A 5AIBA 4XVCA 4KE8A 1ZD3A 1KU6A 5JD6A 1F0NA 5YASA 3FYUA 1FFEA 2WUDA 2C58A 2XMDA 3H2KA 5ALNA 5EIEA 1DTEA 3G9XA 3A6ZA 3UUEA 4Q3LA 3GA7A 3V1MA 3D3NA 3WLAA 5JD5A 1UKCA 5DWDA 1MO2A 2PU7A 4H7FA 4M0MA 3A2NA 2WU3A 4H18A 2QR5A 4G4IA 1J1IA 3Q8WA 2PPLA 1E8NA 3WK9A 5ALKA 2HRRA 4HAIA 2PSDA 1UKAA 1IZ8A 2WQZA 5JATA 5CT4A 3K9BA 3OG9A 3DEAA 1UFOA 1EHYA 5HZGA 2I3ZA 4TVKA 2C5GA 1OCEA 1XLWA 4JH0A 2ZJ6A 4UHCA 3EQ9A 5AO9A 2B9VA 1Y37A 4A16A 4DNQA 4EUSA 3PDCA 4B6GA 5EHXA 1W4LA 5ALQA 4Z49A 1MU0A 2XUPA 3IUQA 2VT6A 3CCBA 4XWGA 5A62A 4GBGA 4B0PA 1W76A 3ESBA 1I6WA 1ZJ5A 4Y2JA 4BRZA 3DKKA 4LHEA 3PFCA 5JIBA 2WFMA 1VLQA 3WI7A 1UXOA 4G4GA 1BEEA 5AKKA 1LZKA 2BFNA 3QITA 1T2NA 2XUHA 2RHTA 3LIIA 3R3YA 5CXXA 1XZEA 1YAHA 2QS9A 5I7UA 5DNVA 3NWOA 2OQVA 2CBGA 3UUFA 4DMHA 2Z8ZA 2PBLA 3I2FA 4CFSA 5C8XA 1CFJA 5I9IA 4Y2RA 4QE3A 3STVA 1EVEA 1ODTC 2FJ0A 1VKHA 4Y2TA 3IULA 1EB9A 1HL7A 2XUFA 4H7KA 4B9EA 1B41A 5CH3A 3DYIA 5BWCA 4XJVA 3ZLTA 4X71A 2XMQA 1A88A 3V1KA 5JD4A 2XQKA 2J3QA 4PSDA 4BVJA 1ODCA 2XUOA 1XZMA 1QIHA 4Y2VA 2XE4A 4I19A 5E4JA 4IH1A 3STTA 4IQ4A 4K6HA 3W2TA 1XKLA 2YH2A 5LZ5A 3ZLUA 5FV4A 3DQZA 1MAHA 2VAVA 1VE6A 5ALOA 1SC9A 5K3EA 4X93A 1C7IA 4GW3A 1LZLA 3L1JA 1P0PA 1BROA 3ICWA 3BJMA 1H2ZA 3D2BA 3FCXA 5AM5A 1E66A 2XUGA 2QXUA 3R3XA 5ALZA 1C7JA 1ZGBA 3QVMA 2CMFA 1ZI8A 4V2IA 2WUFA 3N2ZB 5JYCA 4FBLA 4EY6A 3GFFA 4IH9A 4RPCA 4H7DA 1XZDA 3H2IA 5CT5A 4AQDA 5CW2A 4CIAA 5FP0A 3LLCA 2WTMA 4IHAA 1K8QA 1CUDA 1HPLA 5AKJA 2ZJ7A 4B85A 4LYEA 2WTNA 3B5EA 4AZ0A 1XRNA 5D7BA 1Y7HA 1DT5A 1XZGA 1EB8A 3QPCA 2WG1A 4MYSA 1ZI6A 1CQZA 3F97A 2JIDA 3C43A 1DT3A 3BF8A 2FX5A 3BWXA 3F9CA 3PE6A 4G8CA 5A2GA 1CUSA 4DYHA 2RONA 3QM1A 4J0JA 3HXKA 3ILSA 5ALXA 2PM8A 3YASA 3B12A 3WL8A 1XQXA 4FFVA 4M0EA 2PUHA 5HCUA 1BS9A 2DHDA 2DCMA 3WL6A 1YASA 1L7RA 1P0IA 4UBKA 4WJLA 3WKEA 1EI9A 1QFSA 1LBTA 2PL5A 4NZZA 3P2MA 3C6BA 4FMPA 4KAAA 4J0HA 4KE9A 1YB7A 2QTBA 4B9AA 4I3FA 4OYLA 4BC0A 1X2BA 1USWA 1LGYA 3H04A 1AUOA 5ALFA 3SWWA 3GZJA 5CMLA 3R40A 5ALUA 4BRSA 5CXUA 1QO7A 4DMCA 3IURA 3C5WP 5FDFA 5C8VA 1MTZA 4Y2XA 4HRYA 1AC5A 1QIJA 2OGSA 1PJAA 2AJDA 5AI6A 2Q0XA 4QDZA 5ALRA 3DLTA 1MX9A 1SFRA 1N1MA 5HFAA 3WIBA 1X2EA 2QMQA 5DJ5A 1FJ2A 1WB5A 5E2IA 5AK3A 3PI6A 4G8DA 1THTA 4B7ZA 4P9NA 3A70A 4OYYA 3V9AA 3HEAA 4BATA 1O6FA 4X6UA 4F60A 3C70A 3UMJA 2XUJA 3BIXA 1ACJA 5AOAA 1BCSA 5A6VA 4C6HA 1LPNA 1CUFA 1VA4A 2OQIA 4OU4A 4H7EA 1CUIA 2HA0A 1CUZA 3Q0TA 1IMJA 2BKLA 2WLSA 2FUKA 3KD2A 2H1IA 3OC0A 2ZSHA 5D6OA 2Z8XA 1QTIA 1WM1A 4RGYA 2C0QA 4W1RA 1LPBB 5ALYA 3I1YA 2R8BA 3CXUA 3DL4A 4OD0A 2IX9A 2CKMA 4C4ZA 3G02A 5EGNA 5KWIA 3VDXA 4U2DA 5C8ZA 4TGLA 4MWTA 3I2HA 1IUPA 3HSSA 5AKXA 1U4NA 4KAJA 2AJCA 2HM7A 2AJBA 1CUBA 4FKBA 4X90A 4TPKA 2XUKA 1CUXA 3N0TA 4C89A 1W75A 1EXWA 2JF0A 1LPOA 4RNCA 2OPHA 4QWMA 1CQWA 2HIHA 3I6MA 2XQFA 3E3AA 4FLEA 3W9UA 3WJ1A 5JAHA 2V98A 1WHTA 3IVMA 3EF3A 3PICA 3ICVA 4AO7A 3O9VA 1MX5A 2JBWA 2WFZA 5ALJA 4PNZA 1ISPA 2YYSA 2XMBA 4DNFA 1B6GA 1FSSA 3KWJA 5AKEA 1RWQA 1IZ7A 2DQYA 4UHFA 5DNWA 1HQDA 3HZOA 2Y2VA 3OPMA 3B3QA 1JJFA 4H35A 4PV7A 1XQYA 1LPSA 2PU5A 1EDDA 2VATA 3OM8A 1JU4A 4J7AA 5AOBA 3L1IA 4MQMA 4Y2UA 2CJPA 4BE9A 3TJMA 4A23A 5AM2A 4MYDA 3CCCA 2G63A 5LKAA 5HF8A 4AXBA 2CEKA 3AZOA 3WK5A 5JARA 4OPMA 2G5PA 4INZA 1IUOA 1GPKA 3C6YA 1SCIA 4ETWA 1XZKA 1O6GA 3CN7A 1CUJA 3QPAA 1NU6A 1YA8A 5HK9A 5LIPA 2VJDA 2Z3WA 3TGLA 2WU4A 1XZHA 3IUNA 3EBLA 4X94A 4C4XA 3DDUA 5HF9A 4YX9A 4X6YA 2QJWA 2QXTA 2V9ZA 2J4FA 3H19A 5FKJA 4EY8A 3I1IA 2H7YA 2WILA 1XZBA 2HDWA 3MUNA 2B20A 3I2JA 3LS2A 5DTIA 3IUMA 1A7UA 3SK0A 3A2MA 4N8DA 1WOMA 1J07A 4D9JA 3G9TA 4W63A 4BBZA 2OCKA 1QE3A 3C8HA 5EIHA 5C7YA 4N8SA 1N5MA 4JYMA 2WJ6A 5AJHA 2HADA 2O7VA 4PQEA 2RHWA 2HL6A 3FLEA 4KJXA 4H7IA 2XMRA 1JMYA 4ARAA 1K5PA 3H2HA 5LLSA 4EHBA 4B80A 1JT2A 2D0DA 1HKHA 1H23A 5D3KA 1UOPA 1QIIA 2WHRA 2HFKA 2XUAA 4BDTA 3FSGA 2GBFA 3PUHA 3WWPA 5T4EA 4F0JA 4OCZA 2ONCA 2JGIA 1GXSA 1H22A 3WKCA 3H1BA 1JJIA 2WJ3A 1MAAA 2WIGA 4L3WA 4G4JA 4ZXFA 1EINA 4EY4A 5EHQA 2PSHA 2WKWA 5CTAA 4B82A 3FLBA 3I2GA 2WHPB 4XIIA 3HABA 1F8UA 5ISMA 5AKGA 3FYUC 2JGLA 1SOMA 3AJAA 3AZQA 1TAHA 3H17A 4OB7A 3OURA 1ZI9A 2HRQA 5K3BA 5HF5A 2QZPA 3IB3A 5JADA 4ZWNA 3QBJA 2OLEA 2IIVA 1CRLA 1CUGA 3QMVA 2HA7A 2GBIA 4B81A 2Y1KA 4HXEB 1XFDA 4BCCA 2XLBA 3G9UA 1XRRA 1A8UA 4JEIA 4FLFA 3O4IA 4KAFA 2C4HA 3KOOA 5AI5A 3DYVA 2BCEA 2PVSA 3W9BA 4WCVA 3HI4A 3O4GA 5AM0A 2WHPA 4L72A 4Q34A 5HQ3B 5AI9A 1AZWA 1ZIXA 3VJKA 3T4UA 2XUIA 1QIGA 2J4CA 3WWEA 3CN9A 4J0KA 4HZGA 3K2IA 2XT0A 4GXNA 4X95A 3BIWA 1XQWA 1Q83A 3BL8A 1QIDA 1RP1A 5JAOA 4J3JA 2WIDA 2X8BA 2W22A 4C88A 2HU8A 3WA7A 4UBMA 2VEOA 2PUJA 5ALEA 1TIBA 5JZBA 5LZ8A 3M81A 2WM2A 2WIJA 1CUWA 4KRXA 2NW6A 4ZGBA 1CUUA 2QJRA 5LZ7A 5HQ3A 3ZV7A 6YASA 1R50A 4LKOA 1HLGA 1EK1A 2RI6A 1EK2A 2W6CX 4FWBA 1UK6A 3IUJA 4UFNA 5JAPA 3QMMA 2H9YA 2VA9A 4X85A 5AI4A 2XLCA 2UZ0A 4YK7A 4ZV7A 2B61A 4LXIA 1EDEA 1WHSA 3HYSA 1D07A 1XLVA 1R9NA 1GKLA 5JASA 5AI0A 2C7BA 2J3DA 4HXGA 1CPYA 4MEBA 1W52X 5ALVA 1IUNA 1MX1A 5AKYA 5DYWA 3W05A 5HKAA 4UHBA 4EY5A 3FVRA 5CRIA 2B4KA 2ZVDA 4JUIA 3KWFA 3STUA 1ETHA 2CZQA 1VA5A 3H1AA 4U2BA 5K3AA 1E89A 1WPRA 3LCRA 1GT6A 2ZYSA 3WKDA 4BZWA 2D5LA 3WK6A 1H2WA 2WG2A 3R3UA 2ZSIA 2QKYA 3RLIA 1K4YA 3WK4A 4U2GA 1XROA 4G9EA 2JGFA 4CCYB 4QEKA 5FPPA 2VJBA 2BGNA 3E1GA 3EIOA 5LKRA 3TEJA 5IVHA 1VZ2A 4K6GA 5FOQA 4IO0A 3R0VA 5K3FB 3RARA 5E4TA 3AZPA 4DGQA 1J2EA 5JZ9A 2H7CA 5KREA 3I6ZA 1DQZA 1SCKA 4AO6A 5HFNA 4DNOA 1P0QA 3WA6A 3GELA 4F21A 1AMNA 4AZ3A 4S0XA 1H2YA 2PSFA 1LBSA 3FWHA 3AIOA 3VISA 2I78A 2ZYIA 1FFBA 4QDTA 3EQ7A 2LIPA 1T4MA 4DSAA 3DD5A 3NOXA 1UWCA 5IVDA 2ROQA 4CCYA 1VXOA 4W1QA 3AUKA 1XZLA 4DM7A 1MPXA 3ZLVA 5CURA 2AJLI 3G9ZA 4QDXA 5LZ2A 5K3CA 1TCBA 4FFWA 1UOOA 2HA5A 5K3FA 3L1HA 3V1LA 4FLMA 3R3VA 1F6WA 2XMSA 1BCRA 4RE5A 5KWJA 2XMCA 1ORVA 5T4FA 1QOZA 4UFPA 1DWOA 2I3DA 1XLUA 5LZ4A 1TCCA 4B83A 2C5FA 5A71A 7YASA 4FNGA 1G5FA 1VJ5A 5ALMA 3S8YA 3BF7A 4X91A 1Z68A 5CT8A 1YS2X 3O4JA 1JFRA 3RK4A 4NS4A 3R41A 2P8SA 3E0XA 3D0KA 4U2FA 1J06A 5ALDA 4BVKA 1VE7A 2PX6A 4OUKX 3C5VA 4J0DA 2GYWA 1M33A 3H18A 3WZMA 2AJ8A 3WYNA 5BOVA 1U2EA 1YB6A 4DSZA 2HHAA 5ALLA 2JEZA 4FOLA 3AIKA 1ZOIA 3C8DA 1R1DA 4UBOA 3KDAA 1EDBA 1GKKA 3MVEA 1K63A 5AICA 4H7HA 2QUAA 5H3HA 3BXPA 4NVRA 5K3DA 1LNSA 4QDUA 2OG1A 2H7XA 1XZFA 1MNAA 3K6KA 2BJHA 2YASA 3F98A 4OSEA 2PSJA 3F8SA 3C6ZA 5F4ZA 4Y7DA 3FAKA 3GROA 3DKRA 3VVMA 4ZRDA 2VF2A 4OB6A 2GBCA 1BE0A 5AIAA 1AQLA 3C45A 3WQHA 2BGRA 3AINA 3WZLA 3D2CA 4ROTA 5AK5A 4QWWA 4X6XA 5AM3A 4J03A 1Q84A 4Q3KA 4Q82A 3R3WA 1G42A 1UK9A 5IVIA 3G7NA 1THGA 1ZGCA 2DQZA 1CUEA 3RM3A 2EDAA 2WIFA 2C0PA 2XUDA 3ZWQA 1GQSA 1QJ4A 1FFCA 4CG2A 1VZ3A 2O2GA 1R9MA 2X5XA 1W1IA 3NGMA 1K6EA 2HA2A 5ALWA 3DJYA 2O2HA 3WWOA 1R88A 3RKSA 1N8SA 1QLWA 4FTWA 4EY7A 4GDMA 1A8SA 5DTJA 2QRUA 4Y2PA 4BCBA 4X92A 3T52A 2JGKA 2DHEA 5ALTA 4MXDA 2PKYX 2OAGA 4HXFB 2QOEA 3D2AA 2CUTA 3I2KA 4WY8A 1P0MA 5CBKA 2HA3A 4Q1VA 2WIKA 4UHDA 4QA9A 3IIIA 4AMYA 3AFIA 4E15A 1IVYA 5E4YA 1JI3A 4BVLA 4J0GA 3DOIA 3I28A 3V48A 1WB4A 3GBSA 1VOTA 2Y6VA 2ZJFA 4DMFA 2PSEA 5FXMA 4BB0A 3STXA 3WJ2A 4ZREA 4B84A 4K5QA 2HA6A 4WDQA 1YAJA 1Y7IA 5DNUA 3M3DA 1BN7A 3SX4A 5JZSA 4G1FA 4CG3A 5D3ZA 2WUGA 5K5EA 2IITA 2X76A 1XZIA 4CIBA 3ESAA 2DSNA 5AI8A 2XUQA 4H7JA 2Y2UA 1EX9A 1ACLA 4QZVA 2RIPA 4C01A 5FPQA 2DR0A 3M83A 3IBTA 3V1NA 4M0FA 2O7RA 1L7QA 3LIPA 3QMWA 1ZJ4A 3F67A 3ESDA 3F96A 1AKNA 4WFKA 5BV7A 4X7BA 3PF9A 1XZJA 5A7HA 4IH4A 4UHEA 5SYMA 1ZD4A 1YR2A 3O0DA 1YCDA 2Y6UA 3FSGD 4BTLA 4C87A 4K6KA 3ANSA 2XQJA 1LLFA 3C6XA 4EZIA 3D59A 1SCQA 3WMRA 5CT6A 2BUAA 3H2GA 2GBGA 1NX9A 1CLEA 1GPNA 1CUCA 1QZ3A 3SC2A 4A5SA 4RE6A 2VT7A 3QZUA 5AKLA 4AX4A 3FNBA 2OGTA 3ED1A 3JYHA 4PSUA 4GHWA 4AN1A 3U0VA 3STWA 3IA2A 2VQ6A 4MQLA 1UOQA 4N5HX 5ALHA 3TRDA 4KYVA 3AILA 4LXGA 3FYTA 2K2QB 5T4BA 1QIKA 1HBJA 4LYDA 5ALIA 3G0IA 1MJ5A 3STYA 2ZYRA 3BDIA 1N5RA 3G0DA 1F0PA 4ITVA 3W04A 4GLBA 1GQRA 4WFIA 2WJ4A 3HRHA 4G8BA 3DS8A 5IKXA 5ALSA 4KE6A 1CUAA 4PO3X 3HACA 2HU5A 2WFLB 2CB9A 3QYJA 5AHXA 2G4LA 3A2LA 3D7RA 2AXEA 3DCNA 3I6YA 5AOCA 3WKBA 2JGEA 5JANA 3VJLA 1G66A 1U65A 3OTQA 4PSCA 1E3QA 3DL7A 4BAUA 5LP1A 5AP9A 2R11A 4YPVA 3ZI7A 2ZYHA 2OCIA 2OAEA 2VAXA 5CT9A 4CI9A 2RGUA 1RYYA 4EA6A 2JGMA 4LIPD 4KR0A 1W6RA 3FLAA 4E14A 4E11A 1CVLA 1DWPA 4BYMA 1UZAA 1KEZA 4KRYA 2DHCA 1YS1X 1BRTA 1TK3A 5SYNA 2BUCA 3R3ZA 4DMKA 5AM1A 3U1TA 4FBMA 4PW0A 3ESCA 1CV2A 4L0CA 2Z5GA 2VJCA 1DINA 4GWLA 5CH8A 4UBNA 4F5ZA 2WFLA 3JW8A 3LP5A 4KACA 5HKBA 5AM4A 3W06A 2JGJA 3KSRA 3O4HA 1CIJA 1U8EA 1YA4A 3FBWA 1BU8A 1LPPA 1EA5A 4L9AA 3ZPXA 4UBIA 3MUOA 1H2XA 4QLAA 1QIMA 1QONA 1DU4A 4GEGA 4N5IX 3WKAA 1X70A 1GGVA 1PV1A 5A7FA 4J0CA 5HF6A 5A7GA 5FLKA 4W1SA 4AMZA 3DOHA 4MEAA 4Y9SA 1DX6A 3S2ZA 4W1PA 5HK8A 3G0CA 1ZD2P 3WIOA 4H77A 5DLPA 2RAUA 3WYDA 1CUYA 2QUBA 2BUBA 1XZAA 3IDAA 3NUZA 2O2IA 2GZRA 2G5TA
chains in the Genus database with same CATH superfamily
2EFDB 1S8NA 1ZVQA 3DEFA 4NZYA 3VR2A 3V34A 3VV2A 3U5ZB 2E21A 2JIOA 1CYDA 2YXLA 4MR8B 5D2CA 3ZY2A 4ASUA 4BZZA 5LYJB 3O1IC 4KEAA 4TMWA 4R2JA 5B3KA 4KIJA 1JIJA 1H6BA 3DBHA 4KV7A 4MYCA 4ZEOA 2WUWE 4CDGA 3TLKA 2O5VA 4AO8A 1L5HB 3HVJA 1NUSA 2J32A 2RC6A 2WG0A 4BXOA 3ORYA 2UUPA 2D7JA 2IBTA 1RXYA 4OBEA 4RSRA 2LUOA 3F8WA 3I9MA 1ZCFA 3IDOA 1Z22A 4X0EA 3WLQA 1FDOA 2B8NA 2QN9A 1Z0JA 2WT9A 4AY2A 4J49A 3FI0A 1DXOA 1RPAA 1E8MA 1T1SA 2QLFA 5FRDA 3VDRA 1Z7BA 4K2AA 1N2ZA 5I9SA 4WNAB 2RARA 2QRVA 1IQPA 1T1JA 3NEAA 3CVUA 2BI7A 4RW0A 3EH2A 4QOEA 4E4RA 3M6AA 5L3ZA 1JU3A 1K6JA 1VB5A 4JP2A 1Z2DA 1XD9A 3D4BA 1KEKA 4EP1A 3BXXA 1QFJA 4L5JA 4TYPA 1V6AA 5BSUA 4BS9A 2CMKA 5BR8B 4EPTA 4MCAA 5IH7A 2RJ3A 2JK1A 4B40A 3TI7A 3ZZNA 3O91A 4FGUA 3TDNA 3DT6A 5H3LA 1U6KA 4QNRA 4G2TA 2D5IA 1P1IA 1V3QE 4PF1A 1B2LA 1T43A 2O3UA 3WLHA 1Z8FA 2VQFB 1DCTA 2OC4A 2ZE5A 4W9RA 4I50B 1T25A 2VZLA 4C4YA 3ER9A 1SQGA 2ECPA 5AK6A 3OC6A 3ZV4A 5AW2A 3E4DA 3FJOA 2OILA 2WV9A 4PLPA 1JTFA 2G5CA 2C03A 3PUXA 3OZFA 4XXHA 2WJZB 3KBBA 1F6BA 5H1YA 5IXYA 1B15A 3EZ2A 1H0HA 3G2HA 4HL6A 4MVJF 1KZ1A 1JEQA 1Q7EA 1U1FA 1UT6A 2I6TA 2XQGA 3FZQA 3PXEA 3ROEA 1DAKA 4JLKA 2HRDA 1VL0A 4ZU6X 3PFBA 4YP5A 1QQBA 4P4SA 3UXMA 4N18A 1S8OA 4HQFA 1GNLA 1NUHA 4PC6A 4QEDA 4DIFA 1Q3TA 4D81A 3WJAA 2Q3BA 3OZUA 1EG7A 5ESRA 2VF4X 3VUFA 1ZK1A 3T9AA 4QTYA 3BMNB 2FMIA 4MUBA 4QQKA 4TWRA 2IWRA 5BN4B 2O7QA 3BDVA 4LDQA 3UMVA 2K4MA 2VNHA 9MHTA 1VHDA 3QYAA 2YJ5A 5FWXB 1WSBA 3TKYA 3C3PA 1VFPA 3PZRA 1ZS9A 2WSBA 3WL3A 3LD9A 3FTFA 4U63A 2OV6A 4AF7A 2EFYA 3QUAA 2XMGA 1R0KA 4YGXB 2PUFA 1X7XB 2IHBA 1P18A 4GQBA 4L74A 3ZDYB 5D8DA 3R7FA 1TYAE 1GP2A 3WE7A 2YXNA 2FW0A 2GN2A 4Y2QA 2YNMC 2GPTA 2HOQA 4RH1A 5K0JA 5M5BA 1HY3A 5FBVB 3TTYA 1ZD5A 2QE7A 3NFRA 5E2AA 2XCQA 4KXQA 3IIMA 1RMQA 1J8DA 4ZQGA 5EJ4A 4P08A 2ZI6A 3H9GA 3QBEA 3UA4A 2XGGA 2FU5C 1KMCA 1U7WA 5H8WA 3NBAA 3O7WA 2BGUA 3L7AA 4PNEA 1OFUX 4TTAA 2FCRA 5C1OA 3AKDA 2HO5A 4LI0A 5DEIA 2XNJA 1EE2A 3A06A 2ZBEA 2R5FA 3EUAA 4QOSA 2CXQA 1ZL0A 5D3MB 3UWMA 5AVSA 5FAKA 9ATCA 4C2UA 3OZBA 3PNSA 3H11A 4M76B 1PEYA 2B5OA 2BEUB 2ECKA 1OILA 1TC2A 2EBWA 4XIFA 2I66A 2QJTA 3TCNA 2G7MC 3TB4A 4HDQB 3PPYA 2QTFA 1NRXA 3OQVA 3UG6A 1NJ5A 3U7FB 2GYUA 1WU8A 1B3RA 2P35A 1WCYA 5EWJA 3WWCA 4PQGA 2D59A 2X5OA 3OEWA 2QYHA 1C14A 2WD7B 5AKIA 3WL5A 4LJ4A 4QG3A 1OXMA 5K9ZA 5DHSA 4A82A 1UAAA 4J0IA 3KJGA 1NNEA 4KXFB 5I4KA 1VKRA 4MVJH 3WGYA 2HBZA 3AUXA 3NUGA 3G2MA 4U3JA 3CLHA 2WHQA 5C1IA 1U3DA 4D9HA 3OFND 3KXDA 2QN7A 1TNDA 3TYXA 3DE6X 2COUA 4BWGA 1UT8A 2LR0A 5A3QA 4JYPA 3H2JA 1TCAA 4DQDA 4BNWA 2D0IA 4PZUA 2E49A 2JI4A 4FINA 1SBYA 2FPUA 2P4EA 3GP8A 2CVFA 1I0IA 1D4ZA 2G6BA 4WZBB 1PFVA 1OBVA 1KY5A 2VJLA 3QUCA 1V47A 1TIKA 1ENYA 4MRAA 2H4HA 3DV2A 2QORA 1XALA 3DC7A 1T1IA 4LWOA 1EVQA 3SCZA 5DCWA 2QX9A 3ELYA 4D7AA 4J9UE 1I7LA 4RZQA 1NVTA 4L7QA 4DKXA 1BWPA 2B8EA 1N2CE 3BFXA 4IBOA 2OYRA 4YPOA 1UBFA 5L3QA 4X97A 4LF9B 1E2QA 1PFQA 4FHZA 3O3NB 4NWIA 2FPRA 1GG5A 3D2LA 2WSMA 3EQZA 3NOQA 3S2FA 1E2PA 5BSGA 5GTDA 4C0SA 5AKHA 4ZICA 3HNOA 4K9PA 3GQVA 3MBKA 3UWSA 1FUYB 3TUZC 2QM3A 1TZCA 1NKVA 4MW4A 2ERCA 3EFOB 2P40A 3F47A 4MKIA 2XRFA 2XITA 5IT4A 2JAWA 2WWTA 2XODA 3BH6A 1BO6A 2Q21A 3EWSA 1DQYA 3L6BA 4HGZA 3GNTA 4Z0HO 1GTL1 1W35A 2VPIA 3FUUA 1K6XA 1JMVA 1SA0B 1Q0QA 2HIMA 3ELUA 3N2KB 4JA2A 1ZN8A 2CJWB 4PVDA 4Z3DA 4BAGA 2RGAA 3ULKA 3SQDA 3X1MA 1UKBA 4A0FA 4AW9A 1I1QB 2WDPA 3J7TA 3JYPA 2C07A 3K1JA 1EFLA 3L8HA 1QRRA 2EFCB 4J0QA 1UMDA 2P9YA 2ZZKA 2JAXA 3K9CA 4K86A 1EH5A 2A9JA 4US1R 4ARBA 3NT2A 3KQVA 1NQUA 2IOYA 3ROGA 3DTNA 4YJFB 2GJ9A 4EVQA 4IUCS 5CEEA 4DCOA 1CF4A 1Z0SA 4EPYA 5JR3A 1AF4A 3VZDA 2MWMA 4MW7A 2CFTA 3B1VA 3CX8A 4RABA 1K7SN 3SX0A 3VZBA 4AN0A 1AGYA 4OXXA 2HQRA 1MNQA 2AK3A 3JWIA 4EB0A 3NWPA 3A7EA 3C87A 4WJZA 2C5LA 1Q16A 2GFIA 1KAMA 3MAJA 4OKIA 3SSAA 2VT2A 4ENPA 2F3PA 1CLUA 1I51A 4MQFA 4UM9B 5GY7A 3SC6A 1ORWA 4J07A 1G0OA 2QLBA 2BGMA 2XF2A 3GCWA 5IFLA 2PA3A 3B78A 4HX2A 2PQ0A 1PDWA 1RE0A 1T2EA 2OCGA 1SO8A 1IEXA 1RLIA 4MS3A 1Q15A 4BAZA 5FYQA 2CY0A 1NVVR 2IZ5A 1XLTC 2JAPA 4FFLA 3G89A 1BWRA 4COOA 3Q9UA 3KAJA 4IVNA 3E2IA 3DFZA 4Q00A 2I99A 3U1VA 3U80A 3NEJA 2QK4A 4DA9A 3Q4GA 3IQEA 4TTRA 3WIDA 3LLVA 4UUQA 4E31A 1KAHA 3KJFA 2ZE7A 3VOAA 1GSAA 1P1CA 4KP7A 3R76A 5BR4A 1D7OA 4TV9A 2F3RA 2IXAA 1L7AA 3HC7A 4U2EA 3T35A 5CFPA 2ZITA 4H3KB 3G8DA 3BSFA 2IPAB 3BWDD 4JGBA 3QEOA 821PA 1QR6A 1HZJA 1CBUA 5AKZA 3UJ9A 4CN8A 1ZWLA 2NO7A 3A6EA 3KKZA 2XWJI 1ATIA 2C3MA 2H11A 3ITDA 4WBNF 5IK2D 5KTNA 3H8WA 3AB3A 1WCXA 4BLRA 3SBDA 4FYMA 1XCLA 2BHLA 2ZZNA 1A0OA 2Q6IA 3QPUA 1FPQA 2NO6A 4E46A 4IIXA 4BJ1A 3RC8A 4QBIA 1KNQA 1PHPA 4U02A 4YJGB 5EZYA 5LYYA 4B3CA 3ZD6A 2I4LA 2IL1A 3LOQA 3NETA 3O95A 2ZCVA 1ZRMA 3AM4A 1ML4A 3GUZA 2W2KA 3M1AA 4HH4A 4JCCA 3VUEA 2C2KA 3G0BA 4QFDA 4RZIA 4KIWA 4E2XA 4E5KA 3FWPA 4URXR 3NWJA 3GN1A 4ADSG 3CWQA 1TTTA 3CLSC 5COAA 4QLOA 4MJ3A 4M8NE 2FP4B 2V97A 2VP5A 2Z56A 4YJ2F 4AMUA 4B75A 5KX5F 3KU1A 1ZMRA 4M99A 2QG4A 3K0AB 2X77A 3JYQA 1X77A 1KE2A 2AYZA 3EIXA 4YRFA 1WU7A 2JEYA 3CWCA 4G1MB 4X3CA 4ZTBA 1EXVA 3DLPX 1X42A 3EISA 3LYAA 3DVQX 3F2IA 4UM9D 4OGGA 2XQVA 3B1YA 1YDGA 1GN8A 2HU7A 3BB4A 4TS4A 1MJGA 3DL0A 1L8XA 3I2YX 4KYIB 2R6DA 2OGZA 2HA4A 1V7CA 3QFRA 3W5JA 3K1TA 5KQPA 1G7CA 2AMYA 4ZDWA 3G2NA 4P3OA 1Q0TA 5BUZA 2EGHA 1UK8A 3FZNA 1W19A 2BFPA 3JWEA 4MWSA 4OB8A 4P92A 5G0TA 3CJTA 4U7JA 2PUCA 1WB6A 4LI3X 2DKOA 2PUDA 5JAIA 1SQ6A 3L02A 1RQPA 5EVCA 3H3FA 3ONDA 1O9GA 3NTQA 3OECA 4W9NC 4OO3A 3X0DA 3TJRA 2X8AA 2JKYA 2XBLA 3A6GA 3AETA 1ECJA 1GPMA 1JSRA 3DPSA 3WGGA 5YASA 5C8YB 3E82A 1KC1A 1WSDA 2O14A 3QWAA 2JBAA 2Y4NA 2FKNA 4Z4GA 2XMDA 1S2IA 1U9IA 1YS7A 4PGFA 3RIEA 5ALNA 4I9HA 4A0RA 4EEZA 2Y1DA 4MO9A 2OT3B 1UBGA 4PM4A 5JLJA 2JFXA 4GKBA 2W4MA 3E03A 2IW1A 3N07A 3L40A 3UANA 2FR0A 3G9XA 1JG3A 4L6CA 5LZ9A 2BGGA 4E4TA 2O06A 3L2OB 4EKDA 2OO5A 2HMAA 4D0SA 3RVSA 1ZK4A 2GAAA 5G0UA 1NW4A 3WLAA 4ZIRA 1UKCA 4H17A 1MO2A 1VPVA 2PU7A 2Z1NA 3D6NB 1MABB 3GGOA 5DWDA 1GPAA 1Y4AE 2GDZA 4LHZA 5BT9A 1QHFA 4RSGA 2H2DA 3OP4A 3W2IA 1GG8A 4HB4A 1TVKB 4H18A 3TZQA 1YZUA 4B74A 5DRYA 4AS1A 4ZCRA 2Q5LA 2W8BA 3FUTA 1J1IA 1AXRA 4M9ZA 3HY6A 4RHYA 5AUNB 4ATNA 2ZDGA 4Y7CA 1E8NA 2OO3A 5G1PA 3RSOA 3U7QB 2GPAA 2HT6A 3KYIB 2AWOA 3GVPA 2I7VA 2HRRA 2J3KA 5IXJA 2PSDA 4P3KA 2OFWA 4GBMA 5TGTA 4HAXA 4IG9A 4C9BA 1IN4A 5BMVB 1IZ8A 1JLMA 2DE0X 4GRIA 1XTRA 3CSUA 2VP6A 3TLXA 4D4JA 3GJ7A 2PUGA 1SC4A 1HXHA 2BFBB 2CLCX 4WLEA 5EXEA 1JT9A 2XTJA 1PAUA 4RXMA 4GOLD 2I3ZA 2OL4A 2GZHA 4PRLA 3SQXA 4AJ4A 2FLKA 2ZT8A 3MJEA 1OB2A 4OI2A 1T1GA 4CM3A 3R20A 2Z8YM 4YAKA 1Y1LA 5BVGB 5CNJA 3DBRA 4KWIA 5K99A 5EIWA 4FFBB 1WG8A 2GXUA 3RGGA 4DF3A 2ZWVA 3EQ9A 4B6QA 1E0SA 4EJSA 4HLQB 3OT1A 1VE3A 4UTNA 1G8MA 3H5WA 1Y37A 1U2GA 2BTQB 1KDVA 3PU6A 4A16A 2YL2A 1OPXA 3JQAB 4TV8B 1WB9A 1IBKB 1IK4A 1Y8ZA 1Q57A 1N5KA 3DXXA 3OTGA 4JWKA 3PDCA 2O8CB 1WDWB 1HNWB 2ZDHA 4KUEA 2QM8A 4N3GA 3SS9X 4Z49A 2QYSA 1HRDA 2PX2A 2QQ5A 3C24A 3ED5A 1KP2A 1LDMA 3KALA 4UUBA 4A0QA 4EGAA 1AS2A 4ND2A 5TX7A 2VT6A 1LVHA 2BIFA 5A62A 4JKYA 3BICA 1FYVA 5BYAA 1UZUA 1E2IA 3R8XA 1H93A 3GNQA 4QVIA 4D3SA 2W2LA 3UB3A 2Y99A 3HLTA 4OI4A 3ZVKA 1WNFA 1D0SA 1L7DA 2YV1A 3CFYA 3QWIA 1QAOA 3AYXB 5CYFA 2GZ3A 4IMRA 4N0DA 4NICA 2IHNA 1VECA 1C7ZA 3CX6A 3GOQA 3IXLA 3LT2A 4YRDA 2PE5A 1L9KA 2MR6A 4OA8A 5CJPA 3U9TA 1U9YA 2FMXA 3NBUA 1ODJA 3H2BA 3W0LB 5AW0A 3H5LA 4NIMA 1VLQA 1IYZA 4DSOA 4HCJA 2HQOA 3HEBA 5DBIA 5CB8A 5SV2A 1TYZA 1ZEMA 2ZWOA 3OQIB 4IS3A 1L1EA 3DV0A 4CIVA 2YHIA 2BFCA 2G1KA 3N5KA 3ZQ6A 4DLUA 2ZREA 1R0WA 2CDAA 3CR7A 2H8KA 5CU7A 4B47A 5IUNC 3CKYA 2HBQA 1TL7C 4N5DA 1NN5A 2RAVA 3AWDA 4D5EA 5JOQA 5LWHA 4RL4A 4G5OA 1S0UA 5FBHA 2IYSA 4UOZA 3V4SA 1EFPA 5LBIA 4HO1X 5I7UA 3ZQUA 1NVAA 1WW3A 2TECE 3WC4A 3T99A 3ZW8A 5LQUA 3KSBC 2PZAA 1TAUA 1ECLA 3LX8A 1PL6A 2GEDA 1FF9A 2EBUA 2XTZA 5KWVA 2E4ZA 1E62A 4E03A 3QJYA 4AY6A 3O4RA 4EG7A 4YMVA 5B37A 2ODBA 4LDAA 1PJRA 4RHUA 3OU7A 2FUG6 4BV8A 5LVAA 3DMPA 1I14A 1G2IA 1XCPA 2CLFB 2FRDC 3ANLA 5JS2A 4CFSA 2PVPA 1DP4A 1N3LA 4EI9A 3V2GA 4DLYA 1SHKA 3JQAD 1Z62A 3NHPA 1TQ2A 2JFZA 4Y2RA 4NK5A 1U2QA 2I2AA 1ADFA 2PEZA 1ODTC 2OXCA 1N4AA 1VKHA 2DWOA 2FW9A 1WVIA 4Y2TA 1ORIA 5LM3A 4GI5A 1K92A 1IL0A 5JBQA 5JRJA 3DUWA 2XUFA 1XTIA 2NQ2C 3KLOA 5JCZA 3MRTA 1R18A 2XNDA 2UUBB 4EPWA 1WXGA 4B9EA 2AC2A 4JBYA 1HLFA 3CJQA 4PZCA 1ZKMA 4R4JA 4ZVRA 2YWCA 3IOEA 1CNMA 5CH3A 3H4TA 3Q12A 3CLTD 1CFZA 3G2LA 3PUJA 4MDEA 2GM3A 2GK4A 4MA4A 5ECWA 3U4CA 5KMGB 1UZNA 1VCIA 2XMQA 4JR1A 5I7OA 3LKVA 1IXRC 2XDYA 3R7AA 3SSOA 4OVKA 4YMWA 1ADYA 4QRDA 2EF1A 3T9EA 2R1UA 4CGYA 5KHLB 1ODCA 5F9HA 3SZMA 2LW7A 4ZVOA 1EWRA 1KBOA 5TRTA 1WKVA 4J75A 4TTIA 1F5NA 1GAJA 1PT7A 1FX1A 4DLBA 1C3OA 3EIUA 2PUEA 3DLIA 4XWYA 3ME5A 2VHYA 4FYVA 5DK4A 2IYLD 2Q62A 3F5DA 1A3CA 1YBFA 3CT6A 2ZJBA 4BVFA 1O77A 1YVRA 2X0RA 4DLPA 2AGVA 2EGUA 2QTAA 4QTTB 2ZI5A 4YP9A 3U2QA 1OY1A 5CDTA 5L3SA 2BKVA 4IQ4A 5DSZA 3W2TA 1MZPA 3PHGA 5LZ5A 3JRWA 3L7MA 3DQZA 1CNEA 3OF5A 3QU7A 4NZNA 1KSGA 1KIFA 5L9AA 1KVSA 1H2BA 2IYYA 3D9QX 2TYSB 2PQ6A 3BFVA 2RGXA 3JX9A 4RELA 5ALOA 4E2YA 3R2JA 1O6BA 1JLLB 3TQTA 4ER5A 2Y1FA 3DHNA 4OIFA 1CP2A 1LZLA 3W3AA 5H0IA 3SMQA 5KOJB 3FOFC 2Y0PA 4B6OA 4JI6B 2OA0A 3BJMA 2F8SA 1DC5A 4JZYA 2NP7A 1MB0A 3G59A 1PL7A 1W49A 4ES6A 3ZWNA 2JLRA 2DTDA 4YI3A 1E66A 1YIOA 3AF0A 5AM5A 2A33A 4AQYB 2Z2JA 5HOQA 1RLJA 1Y6JA 3FOWA 2DLNA 2QXUA 2XUGA 3FNEA 3MLAA 5FBQB 5L7YA 3EF0A 2JHPA 1IHUA 2FGJA 1KJWA 2KM1A 1C7JA 1UJBA 3EXHB 3EGWA 4XDZA 5ALZA 3WGIA 1GGFA 2Z6UA 2VL7A 2AW5A 3A6LA 2AOTA 2CMFA 1ZI8A 4ZHQA 1NP7A 4GF5A 3WMGA 4BNIA 4DG5A 1ZAYA 5EAIA 4OHKA 4PHFA 4FS3A 5EMLA 3S7ZA 3T7CA 3AUFA 3ESRA 3S44A 4A1OA 3JQFC 5GVRA 1CETA 4R8VA 5JYCA 2ONYA 1TUGA 3CPJB 3L7KA 4FBLA 4EELA 5CA0F 3R23A 3AXSA 3FNQA 3D3EA 1SELA 1TMKA 4Q9IA 2OAQ1 5EQDA 4EHLA 5IM4A 3GFFA 1C9MA 4MV4A 2X15A 4K88A 1IWOA 1JR3A 3G17A 3ZHUA 5CDHA 4H7DA 3H8VA 1UC5B 4RKRA 1OMOA 4GL2A 1Y1PA 3H2IA 1T15A 4MYUA 2PRIA 2IA5A 4J0FA 4X1IB 1IWPB 4XJSA 1U8UA 2FMHA 1ZD9A 3BHMA 5EZ6B 1D5WA 2DHQA 4EQ6B 4C04A 4EJ6A 5KO2A 3V1TC 1MC5A 2JLUA 2Q99A 3Q9NA 4M7OA 4RF2A 1W7AA 1T5HX 1YONA 3FM9A 2OHJA 4GKAA 4JVNA 2C4NA 2VTDA 4KRGA 4CFZA 4I9FA 4IHAA 1K8QA 3HA3A 2XT9A 4RXUA 1EGAA 4LSGA 3P0FA 4DV4B 4CT5A 1WDKA 1CZLA 1K7XB 2V54A 5JPIA 2G7ZA 4AXXA 3ZDCA 2WTNA 4CT4B 4AZ0A 4Z2AA 4WK4B 1KWKA 4O8CA 4EKIA 1Y7HA 3TL3A 2UYHA 1DCFA 1XZGA 1NOIA 1D5CA 1B0PA 1Y48E 2ADOA 3BS4A 3I9FA 3OICA 1SIOA 3QPCA 4M9CA 4S1PA 3DE1X 5FULA 1F8GA 4XCQA 3QVXA 5A3JA 4OQLA 3PTZA 2JIDA 4CKXA 1DADA 1FB5A 2H4YA 3VSCA 2YNMA 1SCBA 2R47A 2BLLA 5LJIA 1Z2PX 3BF8A 2UUAB 3F9CA 4G8CA 3I8XA 4YB8A 2JJ2D 1XRJA 3FPFA 3RFTA 2V65A 2VO1A 4D42A 4DIUA 4R31A 2YVAA 5IG2A 4DYHA 3HJBA 3L1KA 3UNXA 5HRUA 3QM1A 4PG8A 1JR2A 2CN1A 4J0JA 2RHMA 3U3OA 2NO1A 1VCOA 2C99A 1NLMA 4RQTA 4X1KB 1UMBA 2YX1A 4BTEA 2CXUA 3SDSA 3OMLA 2REOA 3VTAA 3JQBA 2WF5A 3KYBA 4DXAA 3VTFA 4F3YA 3N2GB 5LU9A 4OYHA 3IT1A 2JI7A 1PS9A 4KN5A 4RD0A 4LTNA 2JFUA 2DHDA 2GHRA 4M87A 1CS4C 2DCMA 4IKOA 4OA5A 2X6RA 4FMCF 3P32A 4DA7A 4NCAA 1RHJA 4BJ3A 1Y4SA 3JVVA 3C5HA 2P8JA 3KKKA 3RYCB 1QGUA 2B8WA 2QT0A 2V4ZA 4JDUA 3RKUA 2NV6A 3I5UA 4UBKA 1JE0A 4RKEA 3T3PB 3U4AA 4DCCA 1WQ4A 4FMDF 3FBTA 4QFCA 2PRJA 1V4BA 1OWNA 5HBGA 4G5QA 5E1MA 4AY4A 1JTVA 1QFSA 3RF7A 3RUAA 2PL5A 3DXZA 4NLLA 5JQGB 4HAOA 5E6UB 4YCNA 4BNJA 3IPYA 3MCVA 3TM4A 1MA3A 1MDBA 2UZ4A 2W4IA 2DPHA 2O1WA 4J0HA 1BX3A 4KE9A 1HA3A 4GICA 2A9RA 4OJTA 4QGBA 3T1VA 1COWD 1ESEA 3RS8A 2NYAA 2QTBA 3LXXA 1GD1O 5J1TB 3ZIAD 3OZ7A 4E5MA 1L5WA 4RIEA 2EP7A 4LHWA 4DW8A 5IHXA 1WMEA 2BEWA 3LPCA 4KXMA 2O3RA 2OR3A 5I4BA 1Q0SA 3H04A 3S3TA 4MCJA 3A25A 4FILA 2WJWA 2ZAYA 4MMYB 3TMYA 3ZQKA 5K8LA 3SWWA 5FHRA 3AIIA 4AZTA 1FJXA 4DPKA 3MEQA 4RGQA 5EP3A 5IZCC 4Q7QA 1DAFA 3SXPA 2WM3A 1WVMA 2J8ZA 4E08A 4IDQA 1I13A 4P36A 5TGDA 4EVRA 4BMDA 1WPGA 1YQXA 1RPTA 3AM5A 3W5BA 1UODA 2FPLA 4I9GA 1TW2A 1Z5WA 1ICEA 1GPYA 3UFXA 4MIYA 3HYNA 4EFLA 1MTZA 1JAIA 2K7ZA 3LWDA 4Y2XA 2PLWA 5AVTA 2VXCA 2HZ7A 4XWAA 3CEPB 1IZZA 1DFGA 1QIJA 2OGSA 3HP4A 3Q3VA 4HI0E 1A9ZA 3SLKA 3UQZA 2IDJA 2BP7B 5I7FA 1JNYA 1U9JA 5E9WA 1MO3A 4D2IA 4IIYA 2IYNA 3JQRA 4EG6A 3PA6A 5EQFA 1E7SA 1I6KA 2YZ2A 2ZP1A 1GRQA 2V7QD 4ENWA 2DYKA 1OX5A 3I3SR 1VL1A 3KWMA 3OIUA 4U2KA 4E1AA 4F11A 3INNA 1JDSA 1Z6QA 1A9SA 5E0OA 4CEIA 1N1MA 2I7TA 5DM0A 1T4BA 1X2EA 5CLHA 2VHCA 2GFHA 2G9ZA 3OLVA 3RVLA 1JA0A 5GVSA 3GDWA 2DFKB 3FOCA 5A1JA 5K6AC 1I3CA 5EP2A 5AK3A 1MDFA 1ESNA 3PI6A 2DH5A 1RBYA 2LGJA 3I39X 4IUDS 1TYCA 3PZBA 4QXPA 4WA7A 3DR3A 1QAQA 4MAAA 4Z4EA 5JAMA 2JFHA 1W6UA 5ERYA 1IQUA 4KMSA 4GX2A 1O4WA 2VWQA 1ZIDA 3DVAA 3NGLA 4IDFA 4BATA 4X6UA 4HT3B 1GL9B 5TV2A 1S2NA 1TFUA 4EHFA 3GLTA 2WAXA 3I76A 3LOPA 1Z7YA 2BMVA 4OI1A 4BNDB 4WECA 3NTXA 1OREA 4PLFA 4WN9B 4X1OA 2PR7A 4X3OA 2XOXA 2O2EA 3SX2A 2H17A 3KXLA 2IPNA 2WW8A 5AOAA 3I1FA 4A6PA 4QGSA 1MV5A 2B9EA 1YL5A 5IC5A 3D6AA 3OHSX 5DTQA 2VRCD 3HDGA 4KBFA 1LPNA 5CHEA 2YZMA 5HX7A 4RY2A 5K01A 1FOEB 3BORA 1V7PC 2W93A 4OU4A 4HWKA 5AMXA 2PMEA 3ZBQA 2E18A 1SN7A 1R3UA 1IM8A 1PKXA 1DPFA 5B6PA 1P8AA 3IELA 2HA0A 2IYQA 4MW1A 4TLEA 1GSIA 1M7GA 4XAQA 3RYIA 1HWYA 2JKZA 5F78A 2BKLA 5CD9A 5KTKA 5SZKB 4ZYTA 4D8VA 5JRZA 4IAOA 3VPDA 1DIBA 4TS1A 3ZU4A 1NASA 1KFKB 1MXHA 4OXKA 3LYLA 2YYAA 1E2MA 4RZ3A 1G20A 4E2FA 3H7AA 2Z8XA 4BVGA 4YQFA 4Z7QB 3AB7A 3H3JA 2YS7A 3U0BA 1K6MA 1LPBB 5ALYA 2R8BA 1N2SA 3I1YA 2Q9BA 3WFIA 3GO4A 2QQ0A 1XJQA 1I4OA 3OJWA 3U9LA 4IZHA 2B0JA 1L7VC 3GYGA 3BOSA 4C4ZA 3ZCQA 4Z1MA 3SF8A 1DOZA 2ZIXA 2C82A 4FGWA 4JEUA 1I9CA 1XX6A 1ZLYA 3QYPA 2ONKA 3RU3A 1TT5A 1V8OA 1X7ZB 5C8ZA 1J8FA 5AVVA 1WR8A 2IYAA 3ZC3A 2H1WA 8ABPA 1AM4D 1X1QA 1NUQA 4EB6A 4Y0AA 4RCZA 1UXIA 1Q3KA 3W90A 5A9SB 4M1SA 2J9ZB 3OE7A 5M04A 1IUPA 3HSSA 4MGYR 4UQPA 1RI3A 1U4NA 1ADCA 4B8WA 1KPHA 3JXEA 4WNCA 4MHOA 1L7OA 3K30A 1XWWA 4KMOA 5CXSA 3P2EA 3OETA 1RXCA 2C7VA 2DSTA 1Z5NA 1P62B 3BPSA 4UVDA 4EBFA 2XZOA 3F3MA 4E5NA 1EKXA 4EA9A 2H4ZA 1X8LA 3KZVA 1CUXA 2QTCA 2AWNA 2R5NA 4HN2A 1QHXA 4LDNA 5A6SA 1OH8A 4HNAA 1H69A 5DCUA 5GZ6A 3TRIA 1RXSA 4RNCA 2X22A 1J70A 3KLBA 2QVYX 2VHZA 1IOLA 3KQLA 1Z07A 2SECE 3UOAB 3QA9A 1CCWA 3QKWA 3MJSA 4O4IF 4YCLA 4O4HB 1H2HA 2FWBA 1UBRS 3RG8A 3GJRA 4EJFA 4EB8A 2C31A 3C85A 2AXQA 3H1FA 2QMHA 1KAGA 4YFYA 4FLEA 1PG2A 3WJ1A 3GHYA 3GJXC 3DZJA 2VDVE 5JAHA 2V98A 3MFQA 1ELOA 3LCCA 4KQWA 3IVMA 4RTQA 1KVRA 5DV9A 5J43A 2VYVD 1N77A 5C5DA 2FFHA 1X3LA 4RFSA 3GDFA 1ID8A 4G84A 1KQPA 2I2DA 3PICA 4EGSA 1QWSA 2BELA 5BQOA 4C7OB 5ICFA 3E3MA 4QX6A 3ILVA 1WY5A 3L0PA 3TX6A 5IYZA 1JG2A 3DDZX 3T5BA 3X1ZA 4RM2A 4Y6RA 1IXZA 2A8YA 5ALJA 4RTKA 1GFSA 1PDOA 1J0XO 1Z2AA 3HB1A 4IINA 3I12A 2CSUA 5DXFA 4PNZA 4RJJA 3K4QA 3EEFA 4TKVA 3Q72A 1YE8A 2ODTX 3T4EA 3CC8A 4AJ1A 1B6GA 2VWGA 2G70A 1E9SA 1T5TA 3KZ1E 5FNVA 4R83A 4QFMA 5JE8A 3KWJA 1HDOA 2ZWPA 3DLBA 2G9QA 1RWQA 2Q3DA 1PLKA 2DTEA 3JQ9C 5E8RA 1IZ7A 1LWNA 2BY4A 3FB4A 4G81A 4UHFA 3AJ9A 4XM1A 4EB6B 2IGTA 1NI5A 2JAHA 2UXDB 3OHPA 1R6BX 1KFBB 1F48A 3OZSA 2IHYA 4XOUA 3TNJA 4TN5A 1W36B 3X1YA 4P0PB 1NXOA 3SFZA 1J0EA 1IAVA 1HQDA 1SBTA 2ID8A 3O2NA 4PG6A 4V0LA 4YDSA 4YRIA 3GIWA 3VA7A 1RHMA 1W9MA 5BVHB 3F9IA 2EFEB 1REQA 1URPA 4ZEWA 4LZAA 1G5PA 5JS6A 4QPZA 1JJFA 4H35A 4PV7A 1OH7A 3TRJA 4HBZA 1T0UA 1YJAA 1LRJA 1LPSA 4CQLA 2I62A 1SHTX 3TVYA 4J7AA 3OM8A 4R0MA 5BN3A 5AOBA 4OHOA 1CDOA 3SPXA 4AYTA 4DCTA 3L1IA 5CEJA 1L5GB 3Q98A 4LHSA 2GFQA 1L6RA 4J2OA 3ZTYA 2WP8J 2X2PA 4L6AA 3I8OA 4A23A 1BOOA 4R2IA 2QTZA 4ZYYA 1EDOA 2O2CA 1NG9A 5EUCA 1WS6A 2IPXA 2A92A 4Q21A 4AXBA 5CAEA 4YMTA 4ZAVA 3KVOA 2CL6X 4ZAGA 5ED4A 2QPLA 3AZOA 4JCOA 4K6MA 3PGXA 4IIJF 2FPXA 2G5PA 4INZA 5IWCA 2Z1MA 2ZWMA 1BXZA 2ZWAA 3H5AA 3P97A 1UEJA 3UW1A 5GONA 3C6YA 3BQ9A 3CN7A 1CUJA 1QJCA 2B35A 1OVMA 1NU6A 1DBSA 1Y1QA 3B3JA 3MFYA 4JQZA 3UXHA 5HK9A 1W5SA 5IJ0B 5LIPA 3BQNB 1OW3B 3HR4A 2VJDA 3HZHA 1SRQA 2O23A 4ZT2A 2A1TR 2N1BA 3GNLA 1EVYA 3PQCA 3BSWA 3F4LA 1Z34A 2P11A 1YZHA 3H6GA 4HWPA 3DDUA 3EFBA 4BV9A 4YX9A 5D85A 3C1TA 3EASA 3I52A 4DNXA 1WJGA 1EWKA 1JPNA 1XDDA 1XO1A 3QFFA 4X6YA 2Y1CA 3PNOA 2V9ZA 4TZ0A 4QUIA 3QVGA 3DHWC 1S3FA 1A1SA 1M6WA 2WAMA 4OHCA 1O08A 2IUFA 3H19A 4IV5A 4RK6A 1YJCA 2Z04A 3K20A 2V7PA 1W36D 1D0IA 4WBNB 1LY1A 2HNKA 2UYYA 4KNVA 2ZI4A 1QZTA 2E9SA 2AUMA 3HH8A 1IHOA 1RWMA 2QB5A 4L50A 3I1IA 2NQTA 5FEMA 5FKJA 5IBQA 4Z7NB 4OUDA 3KKLA 3SBOA 5KWSA 2WILA 3USES 3VNUA 4E3WA 1K0FA 3E9ZA 2XXAB 3JCZA 4R1NA 4UUMA 4XSGA 5ILQA 2AHRA 1M2HA 1NIPA 1JQEA 2CUKA 4RMIA 5F1KA 3TSYA 3BD7A 1FVXA 3UJ3X 2D00A 5EC8A 4HUTA 2RK4A 1DZ3A 2RH9B 4X3PA 3KVRA 3K9LA 3CISA 3K6SB 3DE7X 5DTIA 3IUMA 1E2KA 5K3SA 1VHLA 2VJKA 4NCNA 2FUG1 3D64A 3ND6A 1AO0A 3RJZA 4IP0A 3S28A 1FZTA 1AS0A 3EEYA 4C4SA 1VJGA 1YRLA 1NMEA 4BWYA 4HH1A 4OIMA 1TD9A 1MB9A 4B2IA 2P1DA 5A4IS 4WLUA 4ZMBA 3ANYB 4MR7B 4YUAA 1Y1SA 3COWA 3ZV6A 5ER9A 2F1OA 4JJAA 5H7XA 1M0WA 3O03A 1Y3HA 3OFVA 1KDOA 1EESA 3C8ZA 2OXTA 4PVCA 2PGAA 1QG2A 1MO5A 4H0FA 1N5MA 4L4UA 1P3DA 4JYMA 4N7JA 5TT1A 3T5DA 4ENTA 4P58A 4HATA 2OKGA 3SGLA 4WZAE 2Z43A 2RHWA 1IZ9A 2XOKA 3TLCA 4F4FA 1RZRA 3ABRB 1LKZA 3HVHA 3EAFA 4PLCA 1Q14A 3WHPA 1UAGA 4H7IA 2XPCA 5K03A 2KSQA 2IRWA 4QQNA 1G4UR 3E9DA 4X66B 3NALA 4FI3C 5KKAA 1K5PA 3U3DA 2WVJA 1Y8CA 1UJ6A 1KK2A 3NPMA 4FSDA 2NU6B 3DXFA 4PAGA 4XJXA 2FZLA 2PAAA 5EL0A 4OKNA 1VJCA 2J3HA 5A9TA 4JGIA 1WBDA 1MCZA 2P62A 1GITA 5D3KA 1BFDA 5DK6A 2R0QC 4MGEA 4IVQA 4CXMA 2HFKA 4UQOA 4EQZA 4LV8B 4QT0A 3PUHA 3HJAA 3KG2A 1QP7A 4MR9A 1NFQA 4BFXA 3I04M 4N01A 1L7XA 1WW2A 2NQ8A 1A95A 1PZHA 4R6XA 3O0TA 3KOZA 4YC7A 1X74A 1HQKA 1V37A 2HCJB 4IX1A 1RPZA 2ONCA 3Q7EA 1ZW6A 2JGIA 1GXSA 1Q7CA 2V03A 5LA6A 1P2SA 1TE2A 1I4TD 2LKCA 1MAAA 1JQJC 4ZXFA 2EWMA 2PGIA 2IYWA 3E18A 4FR5A 1JTEA 1MIHA 1AKYA 4RPLA 3V8MA 1TUBA 1QB8A 1S4QA 3FLBA 1JHMA 3MF4A 1CRQA 1HNXB 1E59A 2VZEA 3TQRA 1NFRA 3T5PA 3ZJYA 4BKPA 3C3DA 1PK9A 5LQRA 2EP5A 2VF5X 1R27A 1V25A 2O3TA 2QMUA 5JSKA 4B8ZA 1BHO1 3ZN2A 3ZCRA 1EAYA 1EHCA 1NT4A 5KB3A 2VUSA 3OMXA 3O8QA 2YY6A 4QAJA 4BFSA 4DJAA 2ZAGA 5BT8A 3GUCA 2QRJA 3GZNA 1QGAA 3RRMA 1ZU5A 3H17A 2V1XA 4IOJA 2PUAA 5ICEA 1XJCA 3OURA 2RGRA 4JSTA 2V4UA 4MS4A 3I5YA 3D6VA 4WX2B 1A7JA 2UZ1B 4JC5A 2QZPA 3HJCA 3JAKB 4PBRA 5LWQA 4RKFA 1LLQA 3TAUA 2B7CA 5T57A 1NSTA 2YN4A 1VL5A 2WZBA 3UWKA 1CE8A 4O29A 3SHVA 4ETMA 5CUQA 4CM1A 3W5VA 1GKYA 4KO1S 3TNLA 2ZUEA 3TD9A 1IOVA 1YS6A 1JN0A 1XVAA 4B3JA 4E5DA 2PK3A 2YCLA 3J80A 2QZSA 4G5HA 4KBGA 4OLHA 3WYFA 4UASA 5KC8A 3KPWA 3ZHZA 3A10A 1R10A 3VI4B 4B3SB 5JECA 1G21E 1V1MA 1W47A 1XRRA 1OIXA 1TMGE 3EHEA 4P38A 4QHSA 4JEIA 5IKMA 4FLFA 3A9WA 3O4IA 1KQNA 4WOPA 1IXYA 5L53A 3L8CA 1VPWA 4M2LA 3DYVA 4GMKA 2W5UA 4U9HS 2Q5CA 4CV3A 1XZPA 2BEKA 4ON9A 1MQAA 1P75A 2BFOA 1LX7A 3G1UA 1KEEB 1RM3A 1VSQA 2JJMA 2WHPA 2ZIVB 3CNOA 3IKLA 5HQ3B 1OLSB 1PR2A 4Z7JA 2WTXA 1ZIXA 2FWJA 3N0RA 4G0XA 1TF7A 3KDPA 3ZWDA 2HV9A 3R6DA 4JBHA 5EXTA 1E7YA 2IELA 1IY1A 3KQOA 3ZH2A 4BQEA 3VOSA 5J23A 1SGWA 2BE7A 1XMIA 1Y3FE 1PGJA 5I7VA 2PD3A 2TMDA 1A2BA 3BKXA 4ZU1X 4RZSA 1GSOA 1O9BA 2O2JA 3CN9A 1KJZA 3GFPA 1PX2A 3OOYA 1ZEJA 4J0KA 4RNDB 2H1LA 4LJRA 1G8AA 2TMYA 3D7KA 5HDBB 3AWIA 3T54A 3KV1A 1BE1A 2H59A 4PAOA 5GV7A 2H52A 4GXNA 3JD0A 4O3MA 2E89A 4HRVA 2CVHA 3KB1A 5A3RA 2C1XA 3ZJVA 1T29A 3PWKA 3OU2A 1OX4B 1Q83A 4U7TB 3NEYA 3JAMA 3DBVO 3PIIA 1NTRA 4PGMA 2ATEA 4RACA 5F12A 1RM5A 5FWDA 1FP4A 3S6JA 2WF9A 3UJPA 1U28C 5BQPA 1VE5A 1KL7A 5E7JA 5TQ2B 4XGNA 3FW1A 1N3BA 5KEIA 2Q45A 4C88A 3INGA 4LMAA 4YRAA 2FPPB 4CRWB 5BORA 3MJHA 4BB6A 1D9ZA 2ZTMA 3EAQA 3BIFA 4R2KA 4QUAA 1N9ZA 1UZMA 5T41A 4GXTA 4AZWA 2BBTA 1TMOA 4B5KA 3BXGA 3IR5A 4GFDA 3THYA 1N3YA 4P4TA 1P74A 2HTEA 1XAGA 3V8VA 1E20A 4F4DA 3LTNC 2Z6QA 1IMOA 2W0SA 3HBAA 4ZOCA 5TDHA 4Q1AA 4QGGA 1LK7A 3UHOA 2F1HA 2GM4A 3K70B 1WF3A 5JAQA 1L5VA 3VR5D 2JH8A 4KRXA 4PPQA 4B6PA 1DKRA 3NIDB 4XVHA 4C6TB 2XGJA 2O8FB 1UZLA 1XMQB 5G2OA 1Z4JA 4CLOB 4ZEVA 3CVJA 3A11A 6YASA 3LVRE 3KKMA 4UMEA 5LNK6 4LKOA 1VDZA 5ECYA 4QM6A 1HLGA 1PSWA 1ZM4A 2P9BA 2R60A 3BFJA 3JQEA 2NZYA 4ETNA 5IZCA 1EK2A 2QPAA 3RFUA 1JZTA 3GG2A 4URVR 4X85A 3SU8A 4F3RA 2XSZD 4NJOA 1EUCA 3UJDA 4IDBA 5GZ3A 3BRQA 1JDZA 2P7IA 2WSSD 1OGYA 1QHYA 2QW1A 4DFDA 4KXWA 1XNQB 1BKSB 2HK9A 3IQDB 1LDGA 4GXQA 3HG7A 1WHSA 4Q18A 3H9QA 1SG9A 4LW8A 3H6KA 3GRCA 1D07A 2QTVA 4GP7A 5ABPA 3BD6A 4FFOA 1OA1A 2ZSKA 4YRBA 1XE3A 1QCCA 5JNUA 2J3DA 2ODPA 3CRRA 2BMAA 1KMMA 1Y8QA 3CLTC 3DE3X 4H3HB 2VJOA 5AFSA 1CPYA 3D7SA 4GG1A 2A30A 2GKGA 4JEMA 4UW9A 2Q2WA 3ZHOA 5IASA 1RYHA 1ZH4A 5AKYA 1SUFA 3UYKA 5DYWA 2Y0EA 1N5DA 5E2BA 4R1TA 4UHBA 4EY5A 4CF3A 5F3DA 1UQUA 2P79A 3EW7A 4RGVA 3F6CA 3VPGA 4IQGA 2GZMA 2QVXX 4PO9A 1ZIPA 3ZWMA 4BMZA 1T0PA 1EIWA 1LI7A 2AR0A 1EP3B 2GDJA 3IT3A 5FH9A 3KQKA 3UZUA 4Q4AB 4K9SA 2CZQA 1H8ED 1HMYA 2AOXA 4QQRA 2P6PA 2B25A 3P71T 5K3AA 2Q1TA 4JC0A 3O8OB 1YQWA 1E89A 2BDTA 3DWFA 1BQEA 1EGMB 4EYQA 2OXRA 2PFSA 2C2WA 2VPXA 3VR0A 1JFFA 4DSTA 4DRXB 5JYBA 2BEVB 1WXQA 2PCJA 1FYDA 3CRZA 3P0JA 5KQLA 1JECA 2F1RA 1QQAA 5DU2A 5KQGA 5KYVA 4CM5A 1NZDA 1UBKS 4ZZ3A 4EECA 4XSHA 2QKYA 1JDUA 5HTKA 1O9HA 3QVLA 4P83A 1T9GR 3IFSA 1BH2A 4RSHA 3WSTA 4ZYXA 5CA0B 1SD5A 2GESA 4G9EA 5LP6B 1U2DC 4S1VA 3CY6A 3NV7A 3OO0A 4G25A 4D5GA 1W0KA 2QD5A 3W8RA 1KI6A 1F4VA 4UVHA 4QEKA 2IUYA 1XZ8A 5ED0A 4J0EA 5BXQC 1JILA 2VLBA 4YBRA 2O48X 3IV9A 3JARA 5DHRA 2BHSA 3AUAA 4C76A 3VHXA 4IDPA 1YRQA 3E1GA 1DKMA 5B1EA 1PZFA 2A5YB 1TJ5A 3VR4D 3AONB 1VZ2A 4ESHA 3PT9A 5L95A 4UATA 2GZ1A 1Z0IA 4S24A 2FN9A 3L1VA 4OP1A 2XR1A 2Z5VA 3F5MA 5FUYA 2BONA 4MIOA 3VR6A 4B73A 5B1HA 3QF7A 3ZWXA 4RY8A 4MWZA 5B2FA 5KREA 1SCKA 5F2EA 3PHCA 4O3FA 4NBWA 3HA5A 5L7WA 4ZI7A 3Q0IA 1PYDA 4OMDA 1QHSA 4BB9A 5BSVA 1KYZA 2QW0X 1H94A 1H9BA 4YAJA 3HYLA 2VHUA 4ZO6A 3WA6A 1RXWA 1MEJA 3Q6MA 4WSOA 3SJZA 2CYBA 4F21A 4YIHA 4AZ3A 1H2YA 3W8FA 1N9GA 2PSFA 3AIOA 1H8HA 2CVOA 1V11A 2BM0A 2IUTA 1WDTA 3FJ1A 5A5VA 5THKA 1WZ2A 4IRUB 4CKBA 4ZYVA 3RYTC 3QX8A 1RFLA 1KWGA 1OJ7A 4H9GA 3HXQA 3KSZO 3D4IA 3E4CA 2B4YA 2R4UA 4GDFA 1OAOC 3EQ7A 3NEPX 2J9RA 3HJRA 5FO1A 2E82A 4LRQA 4ZMSA 4NZOA 4JLNA 3F3YA 3L4BC 4YRMA 2Y93A 1KK0A 2HMTA 2JFFA 2ZAIA 1SCAA 3IOCA 1VIYA 1CZUA 4C0AC 4F3NA 1P6UA 3HVIA 2NO9A 1I6LA 5DP1A 2V4MA 1W88A 2MSKA 3Q5EA 4WVFA 3WNBA 1QGYA 2BOVA 2CWDA 2EW8A 4JIMA 1L5HA 3ZS9A 1TJYA 5IVDA 4ARVA 5B12A 4OGWA 5F2NA 1G3RA 5KOIA 2LCQA 3DHEA 4RVHA 1EGVB 3FPBA 3P9CA 1FMJA 3IUSA 4QO7A 4XLTA 1LC0A 3EFHA 4UU0A 4DM7A 4JVLA 3LX4A 2WD9A 1DV2A 5CURA 4EW6A 3MELA 3ZHBA 1RYEA 2F3QA 2DY1A 2HK6A 3CWZA 4ZOLB 3WJ7A 4BLWA 5FBWB 4FFWA 2QJOA 5AK0A 5K3FA 3RAFC 3G13A 1LJUA 3V1LA 2ZR9A 5EE0A 2WOJA 1ULZA 3GQBA 3G2QA 3Q11A 4HDCA 4JA0A 4NHOA 5EKXA 3MGGA 4KPFC 1FYXA 4RJLA 5B6IA 5KPJA 2P9CA 3FFXA 3ZD8A 3EXHC 5JXWA 2XMSA 4YGYA 2LCIA 3A9VA 3ONFA 2XMCA 3K09C 2IOFK 2WJJA 2XYPA 4EY3A 2ZATA 2BYTA 4HNSA 3ENKA 5KQRA 3EK2A 2DUNA 1HFEL 4EI8A 1BDJA 4AP6A 3OLQA 1N1EA 5CLFA 1V1RA 2I3DA 4JJ8A 1ARZA 1WSAA 2RIRA 3CA8A 1JHZA 1XLUA 2R8ZA 4FFMA 4G41A 4Q4DA 5BV0A 2PMCA 4IJ6A 5HJEA 1YR9A 2H2GA 2ISQA 4BO2A 4HEHA 1XTUA 4LVNA 2HSJA 2FZCA 3WLOA 4C78A 4LY9A 3H4MA 3BXZA 1SBZA 5K2OA 1QORA 4A1FA 4GX1A 1NVKA 3ZU5A 2IS1A 2PRYA 3HA2A 4UTVA 1GUZA 4LQ4A 1BGXT 1EX7A 1VJ5A 3L7CA 1KPGA 4ESEA 3NVKI 2FEXA 1N6OA 2NTVA 3G5MA 3TNYA 4NR0A 1OAKA 4L7VA 4CF5A 2APJA 2JJYA 5JJCA 5KSYA 1PNRA 4BO5A 1Z68A 3D8BA 3IC5A 4R0NA 2Z2YA 1SM4A 1OE0A 4QYMA 3RK0A 3KJXA 2PWAA 3SYLA 1GYPA 4IDHA 4JUDX 4GR5A 5CNIA 3SQOA 4EG3A 1Z4MA 4WLVA 5FA6A 5A1TA 4JJFA 5ALDA 1Q44A 2YHUA 4R3UC 1AHNA 1CY6A 1JGTA 1VE7A 4Y6QA 1YCFA 3HMKA 2XA9A 1DAHA 1X13A 3ER6A 3K35A 1IZYA 1JFLA 4J0DA 3VKUA 5I9BA 3LLUA 4OHMA 2CNBA 1PYOA 4WCFB 5DNDA 5TY0A 3WZMA 5B7QA 5AVXA 3CH7A 3U6KA 3ZY4A 1SVWA 1TGYA 1R74A 4IDOA 2HT1A 1C9DB 2WSYB 4L16A 2HHAA 1XBTA 4D9FA 1R5OA 3GRFA 3OJCA 3C5EA 3IUPA 4NBKA 1M6EX 4FOLA 5ALLA 4YWJA 3SP1A 1II0A 1S9DA 3AIKA 3TLYA 5H9WA 5ICGA 1UBSB 2NAPA 2CJYA 3IV6A 1RT9A 3WISA 3HQ4O 4QSMA 3UKJA 4AICA 4DTIA 4M0PA 3C8DA 1R1DA 1XZQA 3BWYA 4NCHA 1J90A 3ISTA 3S2UA 2WR8A 1GKKA 3B9PA 4RTRA 3MTJA 3MVEA 2HQSA 4TZ6A 4M3NA 2EKBA 2NSJA 4G37A 4KPUA 5ITVA 4I9NA 3G7SA 2MYUA 2P2LA 4AYXA 1M75A 2J6CA 4K81B 4QHTA 3BXPA 3G2JA 3JD1A 2CFIA 2MSNA 3BVPA 2IEZA 1X1RA 1LNSA 3EEOA 2BEUA 4EUKA 1JHOA 1PR5A 3E9MA 3DZIA 2VHJA 3BQMB 4D9NA 1E5LA 5DIZA 1Y63A 2I71A 3KQYA 4LF5B 2H7XA 2WAYA 4M22A 1CY7A 3VKWA 4CTJA 4F04A 3H75A 1VG9B 3NTOA 2RHLA 3PNVA 4FNAA 5E6RB 3PJFA 2GK3A 3KQQA 2EXXA 5ILGA 1FSFA 2PSJA 3K5IA 4RF4A 4F4IA 2CL7X 1Z47A 3QBDA 4AKHA 2JGDA 1V95A 3T15A 1M8GA 1I01A 5GADl 4MCHA 3KYCA 1CJBA 4LDZA 4BY9E 2GN0A 3R5FA 3BFPA 1LDNA 5IUKC 7MDHA 3D54D 1W73A 3DKRA 2CXOA 3IKVA 5AIAA 2DKFA 2WVGA 2Q0HA 3HJHA 5H16A 3C45A 1NBOA 3M5PA 2PXXA 4AC9A 3IRVA 3E5NA 3PR2B 5IW8A 2Q6VA 4ROTA 4DN6A 4I7EA 4MMXB 4H1HA 3EULA 1XKQA 4PYMA 2VK2A 2PZ8A 2ZBQA 5AM3A 2FEMA 4DG8A 5JBIA 4J03A 1W44A 1FC0A 5DN6D 2ZLBA 4XPZA 3R3WA 5BNFA 4DV0B 3D3WA 1LV7A 3IP7A 1MOQA 5CVEA 1YNSA 5D1HA 3EDOA 3IOMA 2VH1A 2DPYA 5FTKA 2PUVA 4G89A 3RM3A 4A7PA 1IOWA 4XYLA 4PZLA 1P19A 2PGLA 2ENUA 2XUDA 4LGCA 1CY8A 3EIHA 1C3LA 1XFAA 3H4VA 1XT6A 4R1OA 1II8A 1B2RA 1Z12A 3R8FA 2D6FA 3E9QA 3NORA 5JI3E 1NR7A 4IEEA 3PX2A 4OQDA 4IW3B 4XDHA 1TQ4A 3L0ZA 1E3LA 4QASA 1FFCA 2ZYWX 3ILYA 3O1JC 4C0HA 5CFRA 2JLWA 1BJRE 1PJ3A 2PRZA 4B5LA 2Y67A 2ZSFA 3ET4A 5IFKA 3E61A 5I7WA 1KXZA 5BN5A 3QELB 1K6EA 4KYTA 3KXIA 1KMHB 1KJ9A 5IK2A 5HRCA 2YIJA 3N2KA 3C39A 4BQPA 1DNPA 3AEZA 2CJWA 3IMFA 4UULA 4DMMA 3CVXA 1CP3A 2PGXA 2Y1EA 4F71A 2G08A 1AQYA 3SHTA 4RANA 1KHHA 1MIOB 5AW3A 2RKBA 4K9OA 4I55B 2WYHA 3B6KA 3MD9A 3QKSB 5KNBA 2JBHA 3PFNA 4GSKA 1V7QA 4EY7A 4RENA 1AZLA 9LDBA 5IPFA 4YJFA 1JKXA 3MCTA 3NHAA 2IZ6A 3L4SO 2QRUA 2CE2X 5JMWA 4Y2PA 1OYWA 1EWYA 2WWVD 4LVOA 3SZ3A 1GZ4A 1UEXC 4ZJUA 3MLEA 4NNOA 1E2FA 5HZHA 1VHQA 2XVAA 2PMBA 4I6EA 3T52A 5LQAA 3JZFA 2DHEA 3FFWA 2C2HA 4CGZA 4H15A 3REQB 2J9GA 1SHJA 2PKYX 1UBCA 1RMTA 3L8YA 4KYUA 2HMSA 4RHCA 4JS0A 1C2TA 3CUUA 2CUTA 3W8EA 1NBHA 3RYHB 2IYXA 2A1UB 3AL2A 1U5BB 2D4AA 1MV8A 4DLXA 4C30A 1FTGA 5CBKA 2HA3A 3C4JA 4Q1VA 1TEZA 4YXWA 1ITZA 4UHDA 4QA9A 1R4MB 1AGNA 4Q5IA 4LEIA 1AMOA 5IF9A 3AFIA 4EL5A 4IZIA 4N7MA 4O1HA 3IHKA 4GZ5A 5I47A 2QP3A 2GN8A 3FCEA 4NX2A 2W2PA 3VC3A 3VPAA 4KFTA 3HTXA 2E6UX 4RTLA 5HUJA 1VOTA 2WKSA 1QVRA 1DIHA 3EZLA 2NWQA 1JEOA 1E5VA 4K9DA 4LYHA 3WGNA 4F1KA 4GI3A 1GPUA 3FF1A 1H66A 3D7LA 4BO4A 4UJ3A 1E2NA 1RLTA 3SQMA 3R7DA 3GX1A 3JSXA 2YKGA 2IIBA 2GETA 4LC9A 4P5PA 3LCUA 5JO0A 5FQNA 3FHOA 5A5EA 2GAJA 1XKXA 4Y9DA 2Y1XA 1K3UB 4E4YA 5TNXA 4O1IA 4OGKA 4RL6A 1MAVA 4CEJB 1I24A 3FVQA 4IHJB 4WDQA 1YAJA 2QVGA 2X19A 5DTMA 3EIEA 2O8DB 4E2WA 3TW8A 4DBLC 1TF2A 3PIDA 4YV7A 4CMHA 3UKDA 1DLIA 3QEMA 1M10A 1QR2A 1RTTA 3C7DB 4F72A 3L9XA 4RDXA 3QXHA 4G1FA 2IP1A 3C8UA 3HRIA 4O4LB 3LOUA 3Q3HA 2CL5A 4PXYA 2O5EA 2VC2B 3E58A 1EX6A 3EPRA 1TAGA 3MTDA 4LBWA 3ORRA 4PANA 3FKSA 4NMMA 1SVNA 4J1QA 5CB4A 4FT2A 1PV4A 1QCZA 3BXHA 3O82A 4FW9A 1JAZA 4QFBA 3DCYA 5D01A 1EWVA 3ESAA 3U61B 2O8VA 1XP5A 4LISA 1F0YA 3K0AA 1DQPA 2ICAA 1EFRD 2CBXA 3O47A 3C3XA 1AKTA 1P9RA 1WMFA 1EX9A 1SIWA 4JHLA 1W5EA 4GM1A 4TQUS 3OUUA 1ACLA 1GQQA 2QRHA 2RG7A 1F8YA 1L1QA 1T8RA 1OLUB 2NYUA 4C01A 3K0SA 1D2GA 1AH2A 2PMWB 4OTZA 4UAVA 5FPQA 3P1JA 3IBTA 2BGLA 3D3JA 3V1NA 4R40A 1DC3A 2NZUG 3HCDA 2HLHA 5KOHB 2VDMB 1QGZA 1DO8A 3WLEA 2HK7A 3OIDA 2HUPA 3I64A 1WMBA 4JLDA 3GEGA 4M54A 4NECA 4GRAA 4ND8B 4E33A 3A1UA 1C8LA 2BRUC 2X4DA 5JNRA 3OAAD 4MRPA 2QMYA 5B58T 2FSGA 1QNLA 1JBEA 4MB2A 5TMBA 4GI2A 1NF9A 2ZQ5A 4XB6B 2P5UA 3B3FA 4D80A 4OL0A 4E70A 2BFFB 2ZYDA 3ZWKA 1XZJA 2MSWA 2VH2A 3BXFA 4ZPXA 3IAFA 2FEPA 2G8LA 3WNQA 2QBYB 1C0PA 2HWYA 4YMSA 3OSUA 2QU7A 3O8NA 1HLDA 3ENNA 2XHEA 1ZD4A 5FPYA 1P6QA 1Z4PX 1Z6AA 2ESRA 4IEFB 4M89A 4U9UA 1E77A 3IBCA 4R7TA 3KOWA 4YFVA 1JFTA 1YCDA 5CG2A 3FSGD 2LP4Y 1Y0BA 3JALA 1JDPA 3JQ6A 4MKRA 4C87A 5L4LA 1FVHA 2IY9A 2G0TA 2ZBRA 3JWJA 4G07A 4HUJA 3ANSA 4ENRA 2WVAA 1KIMA 1PDVA 2R2AA 3LQ1A 1YZVA 2B2XA 4FQ8A 4X6LA 2HHHB 4PFKA 4I8IA 1R5JA 3CVYA 1LLFA 3BGWA 3C6XA 5EYPB 4ZHQF 3UHPA 1SCQA 3WMRA 3L0OA 2NUPA 4IF6A 3B13B 3GCZA 4C4AA 1U28A 2EZUA 4KODA 3FHLA 4MP8A 3SEQA 5C51B 2JA1A 1SKYB 1QZ3A 2ZI9A 3LKBA 4YCCA 3KKOA 5J4VA 3DEYX 4RE6A 4W5WA 4J3NA 4AX4A 3GLFA 1DKQA 3FPLA 3LUJA 3ZHYA 2PFGA 5KAMA 1P3Y1 1UFVA 2GEJA 2ZRQA 3GY0A 3S4YA 3U0VA 5IULC 4K2HA 3STWA 2VK1A 2OO7A 4OGFA 4BHTA 2CF5A 5BSHA 4O2AF 3EGCA 5D1NA 2VZ8A 2I1WA 3KAPA 4N5HX 5J5VA 2BFDA 5FWYB 1L4EA 1W36C 1QVWA 3ZYZA 3UAYA 1UXJA 5CG1A 4LXGA 3DZHA 2HEGA 3DDWA 5C7OO 4R54A 1N36B 4A10A 1FS6A 1UPTA 3JQ7A 3ML1A 4TM7A 5T4BA 4D56A 1BW9B 3QE3A 3ZGOA 2FFBA 2WIAA 2X5JO 2IXBA 2UAGA 3F9RA 1DKUA 3I9KA 3IEUA 1IAQA 3NV9A 3LO5A 4GMGA 4XD2A 2C88A 2OCYC 2IEIA 2NXWA 2ZYRA 1QANA 4KLZA 5BVGA 5I7HA 3UGTA 3G0DA 3OEEA 1XMSA 4MUJA 4WGGA 4TWZA 3VH1A 1XQ1A 4GLBA 1GQRA 4B2PA 4MUFA 1EFVA 4WFIA 2WJ4A 3OWXA 3UAXA 4WK0B 3N8DA 4NBLA 3JS5A 2QRMA 3ACBA 1CUAA 4PO3X 1CB0A 3GLHA 3DMYA 3DBOB 3IDQA 1HF3A 1E3DA 3TTTA 4G01B 3ES9A 2C5EA 1DC6A 2AXEA 4FKMA 1KH3A 3GPCA 2VBFA 3L46A 1AXEA 2E5FA 3OFJA 4AQ7A 1J7JA 2YZKA 1PD1A 1N57A 4K05A 4K6CA 3RVKA 4NU5A 5BPHA 3GVIA 4QVGA 1SXPA 3UV7A 2D0OB 1QU2A 4PSCA 3AVTA 3VU0A 4A26A 3T12A 4MVJG 2OK7A 1C9NA 1NOKA 4O5AA 3AU9A 4YALA 2AF4C 4YNBA 2Z2ZA 1K5GA 5CX1B 1XTVA 2ETVA 3FGPA 2YOGA 2DQ4A 3HUFA 3ZI7A 3G2OA 4AYWA 1EP9A 3QP9A 3KVNA 1B3BA 2C98A 2L0XA 5HE9A 1YDFA 4P33A 2VAXA 4KO3S 1PR1A 5CT9A 1CIVA 1V2GA 3TX2A 1CJTC 2H54A 3DT9A 4J4TA 4S05A 2NVWA 1MMFB 1WF6A 3FLAA 2A14A 4E11A 4DSNA 1CF9A 1MRSA 2R6GA 1JB9A 4BLSA 4IL5A 2ARKA 4CLRA 2BZGA 3CZ9A 1KEZA 4HYQA 4WXEA 5L4SA 1FUEA 3HGMA 2D1QA 4KVAA 1YS1X 4DDKA 3QUBA 5COQA 2IODA 3D5QA 1TK3A 4MWCA 2WC1A 1F3LA 2WQ6A 4HSEA 1E64A 3GJ8A 3ETJA 3LCVB 3IUYA 4WVLA 4ZTZB 2F8TA 2ALJA 4DMKA 3WAGA 4IIUA 4EKNB 4Z8XA 5TPWB 1DTWB 4B44A 2ORED 3HMQA 3OJXA 1CZKA 3K9GA 4DCNA 3M2PA 1FDIA 2CHUA 1U2DA 2ZKIA 2QM7A 4R01A 1G6Q1 3PQ2A 4GS5A 2XUZA 1DINA 1RCTE 1M2VB 4QC2A 3TNFA 4AMGA 4D97A 1GCGA 1UP4A 2DBRA 3HDVA 4WASA 4YMIA 2ILTA 2YDYA 5M7EA 3NDIA 1DI0A 1WXWA 2PL9A 4XB2A 4KACA 3PXAA 4CYMA 3CEHA 4XLLA 4PLGA 5ELXA 4LVUA 4YRTA 1LCIA 3OKFA 3RNLA 5IC4A 3G1TA 1UDAA 2J5KA 2ZRPA