4QTUB

Structure of s. cerevisiae bud23-trm112 complex involved in formation of m7g1575 on 18s rrna (sam bound form)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
191
structure length
190
Chain Sequence
IFYNDSEAHKYTGSTRVQHIQAKMTLRALELLNLQPCSFILDIGCGSGLSGEILTQEGDHVWCGLDISPSMLATGLSRELEGDLMLQDMGTGIPFRAGSFDAAISISAIQWLNADTSYNDPKQRLMRFFNTLYAALKKGGKFVAQFYPKNDDQVDDILQSAKVAGFSGGLVVDDPESKKNKKYYLVLSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multifunctional methyltransferase subunit TRM112
publication title Structural and functional studies of Bud23-Trm112 reveal 18S rRNA N7-G1575 methylation occurs on late 40S precursor ribosomes
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Transferase
total genus 63
structure length 190
sequence length 191
chains with identical sequence D
ec nomenclature ec 2.1.1.309: 18S rRNA (guanine(1575)-N(7))-methyltransferase.
pdb deposition date 2014-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08241 Methyltransf_11 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4qtuB00
1VE3A 5C9ZA 4KIFA 1I1NA 1QAOA 1MJFA 5E2AA 4KDCA 4CKCA 4QDJA 3LX6A 4KVZA 2AS0A 5DXAA 4PWYA 3JWIA 5K0NA 2LD4A 3HP7A 1QAQA 5B1SA 1MHTA 4ZTBA 5DSTA 3TLJA 3G2OA 2HMYB 4IKPA 3AWIA 3OU2A 1VLMA 1YZHA 2P35A 2PXCA 4HSGA 4C06A 4DM3A 1YF3A 3SM3A 2FHPA 4K6MA 2AOXA 4LWPA 3LCCA 5DSXA 1G60A 2AOTA 3S68A 3AXSA 3B3JA 3GRVA 4B17A 4YV2A 5DXJA 3KQWA 3VSEA 1VQ1A 3NMUF 3FUXA 3ANXA 3PFHA 4ER7A 4GBED 5EPEA 2IH5A 2ZTHA 3PX2A 3EVFA 4P7GA 3KPVA 5EHIA 3UJ6A 5DLYA 3P9NA 5P8WA 5ICGA 3FYCA 5GIPE 4A6EA 3G8AA 4AZVA 4BP1A 3FYDA 5K01A 4PYIA 4PGHA 3UJCA 3OE4A 4CKEA 5CVJA 3LDFA 2I9KA 1QAMA 3C6KA 2IPXA 3RODA 2P7HA 2P1DA 5EEGA 1EG2A 3CJRA 3LBFA 1KYZA 3AXTA 4C03A 2JH8A 1RI3A 4KWCA 3HCDA 3BGDA 4ISCA 1KPHA 1PJZA 2PX4A 2VDVE 5F2KA 3MTIA 3HEMA 3FTCA 2Q41A 4XUCA 5HFJA 5K0LA 4PYQA 4BLWA 1JSXA 4EK9A 1KPGA 3HTXA 3BWBA 5U4XA 4U7TB 2CKDA 2ONYA 3LHDA 2H11A 3HVJA 1U2ZA 2I6GA 5LQAA 5E2BA 5C0OE 1R8YA 1PRYA 2QM3A 4PYJA 5ICCA 1R6AA 4BY9E 2H1RA 5E9WA 3FPHA 3KQPA 5ERGB 4YV1A 3PS9A 1EIZA 4QVKA 4C08A 5BP7A 2YR0A 3BKWA 2EFJA 3K0BA 3O7WA 4E31A 4RYLA 1XCJA 1KIAA 2AOUA 2PGXA 3BWCA 4M38A 2GB4A 4PYNA 3V97A 2IH2A 3FRHA 4FR0A 1SQFA 4IV8A 3I64A 5DX1A 3TKAA 3T7RA 1M6YA 1NE2A 3SSNA 4GC9A 2FK8A 2PV0A 2ZULA 1VP9A 2ONZA 2JHCA 2XVAA 3LKDA 2E5WA 1KR5A 3I58A 4GOND 3KU1A 3BXOA 2ZBPA 5FHRA 4FSXA 2OBFA 3LCUA 1M0EA 1VL5A 3MQ2A 1DUSA 3GO4A 4P7FA 5FA5A 3G2PA 3BKXA 1YUBA 5KQSA 2IDJA 3I53A 4RTJA 5H02A 3GWZA 3DR5A 2XYQA 3OU6A 1QYRA 3DMFA 4HTFA 4XUEA 5F2NA 3ORHA 3MTEA 3PTAA 3HVIA 3MCTA 3LDUA 4DKJA 2B78A 3KQTA 3KKZA 3PB3A 3TPZA 3IV6A 2OYRA 2ZLBA 2VP3A 1NW3A 3ELYA 3U81A 2BM8A 7MHTA 3A25A 4R6XA 5GP1A 2PWPA 3TKYA 3LCVB 2YUIA 1VBFA 3WSTA 3X0DA 2ZCJA 1UIRA 4PYKA 5KS2A 2FYTA 3I5UA 2UYQA 5DPMA 3UWPA 4OA5A 3P2IA 4GF5A 5HIMA 2OB2A 3EVDA 2IFTA 3GRZA 5LQKA 3SSOA 4ER0A 4GEKA 1BC5A 1XVAA 5BW4A 1ORHA 3GIWA 3LKZA 3BWYA 3AJDA 1KHHA 3E23A 4L7VA 4PNEA 4IV0A 3UA3A 4RTPA 1YFLA 5CVVA 3G89A 5FCDA 1P39A 1SKMA 5G02A 1RI1A 3QOXA 5DM0A 4RTNA 3CJQA 2Z6UA 1RJFA 4XUDA 5EIFA 3ER8A 4E30A 2PX2A 5DM1A 3DMHA 3M6XA 4PCLA 1JG1A 5K8VA 3KR9A 3NWBA 5EZSA 3FUVA 2G70A 3MAGA 4M36A 5HOQA 1UWVA 4E2ZA 1BKYA 2ZWAA 1O54A 3B7PA 3NWEA 3O4FA 3TMAA 2FCAA 1JG4A 2AZTA 3NDIA 3GDHA 3B89A 3VYWA 2YQZA 5FHQA 10MHA 3THRA 2VDWA 3HCEA 1M6EX 4E2WA 5K0CA 4YUVA 3EVEA 1XTPA 4ATNA 4WVLA 3UBTA 2G71A 2IH4A 3LPMA 4DMGA 3JWJA 4PYLA 2F8LA 1JG2A 2V74B 2GAFA 3MCZA 3PFGA 3CJTA 5FQOA 1P1BA 4AZTA 5FUBA 1RI2A 3Q87B 2R6ZA 3ME5A 4RVDA 2AR0A 4LWOA 3FPFA 5E1DA 5FWDA 1NT2A 1KPIA 1N7JA 2ADMA 3GRYA 3UFBA 5DRYA 1ZGJA 5ICFA 3DMGA 3FUUA 3OCJA 3QV2A 1QZZA 2BR4A 4KDRA 5M5BA 4HGYA 1SQGA 3R9XB 3FTDA 3KR2A 4EQZA 3NTVA 3RW9A 2NP6A 1RJDA 4YUYA 9MHTA 4QTTB 3OZTA 5E1BA 5LQCA 3GRUA 3F4KA 1YFJA 1XJ5A 2AOVA 5EKUA 4E2YA 3PVCA 4RTLA 2WA1A 5K0BA 5T6BA 5ICEA 3T0IA 3HA5A 4R8SA 3FZGA 5DX0A 4EKIA 1TPYA 3ELUA 1NV9A 3EGVA 4ER5A 5FULA 3UZUA 2Z6AA 5HZMA 5CVUA 5K05A 3KQYA 4P58A 5CCBA 3PLAE 2Z6QA 4RVHA 2R3SA 3A7EA 5MHTA 4CWAA 1QANA 2DULA 4Y2HA 1P91A 1RJEA 1VIDA 3E8SA 3KQOA 3FTEA 5KVAA 2YVLA 5K0JA 3REOA 3QOWA 4RSRA 2V7EA 4QPPA 3G88A 1R00A 4C07A 3Q7EA 5K03A 4RV9A 2UYHA 2BR5A 4RWZA 1X19A 3A27A 4XCXA 2P3OA 3ER9A 1TW2A 4WXHA 4RTSA 3GJYA 2C7QA 1T43A 2GA9A 4X41A 3DH0A 3UJDA 1NBIA 3HVKA 3P2KA 3GU3A 1JTFA 4A6DA 1SUSA 3BGVA 4NECA 4RTQA 3TOSA 3THSA 1XDZA 2EJTA 2HR1A 3MHTA 1WXXA 1WS6A 4MIKA 2AOWA 3FPJA 3CGGA 3DULA 4Y30A 2O0LA 2ZSUA 3T7TA 3VC1A 4DF3A 1WXWA 5BW5A 2B2CA 3DXXA 2OO3A 3EVAA 2EX4A 3JWGA 3DLCA 4PONA 4EVIA 4RTMA 4PIMA 2KW5A 4FP9A 4KRGA 5C1IA 5HEKA 1NW8A 2NXCA 2AVNA 3V8VA 4P7JA 1ZG3A 2Y1XA 1VPTA 4DZRA 5BXYA 3DTNA 4H0NA 4OQEA 2ZBRA 3P71T 4RX1A 3GGDA 2HNKA 2Y1WA 3DOUA 3HA3A 2NXJA 3P9IA 4U7PB 5CVDA 2JG3A 2ZWVA 4M7RA 1AV6A 3EGIA 3KR0A 4YUWA 3B3FA 2I7CA 4CKBA 2NYUA 2OZVA 2QRVB 3TFWA 4E70A 4FGZA 3KPJA 4KIGA 5EMKA 3UJAA 1JQ3A 4F85A 3SVZA 1RJGA 2P8JA 3EGEA 4P7KA 5DTQA 2OB1A 3PT9A 3AY0A 3L8DA 3OZSA 5K09A 3G2QA 5E1OA 5EC8A 2ESRA 3R3HA 4GUAA 1FPQA 2IIPA 1ORIA 1H1DA 2O07A 3G8BA 4C04A 2YXLA 3M6UA 2JH9A 2XYRA 3KQVA 3IYLW 3UA4A 4E32A 1FJXA 5EOVA 1O9HA 2ZZMA 1G38A 3R0QA 3CKKA 3ELWA 3BUSA 2I62A 1G55A 3G2MA 2CMHA 5CD1A 3HNRA 3LSTA 1L3IA 2AOTB 1D2GA 2UZ4A 4FZVA 3TM5A 5K0GA 3NVKI 5DM4A 1WZNA 3VC2A 1KYWA 1L3CA 1NW5A 5DX8A 2PXAA 2IDKA 3C3YA 5LQNA 4AX8A 3OZRA 2BZGA 3FUWA 1JQDA 2P7IA 3FPGA 3HA7A 4C05A 5E8RA 2O05A 1FBNA 2GS9A 5EMJA 5HILA 3G7UA 3C0KA 2OKCA 2XYVA 2GPYA 1JR4A 1Q0SA 2ZW9A 3RIEA 5GM1A 2PSSA 4AUKA 3EVGA 5LSAA 3DLIA 4O29A 1JSZA 2ERCA 3UJ8A 1AQJA 8MHTA 3IEIA 2JHPA 1R8XA 2IP2A 2P41A 1N7IA 3HCCA 3M4XA 4GOLD 1JG3A 2ZZKA 1TW3A 4FT2A 4AZWA 5HIKA 3E7PA 5LQUA 3I9FA 2B25A 4R6WA 5T67A 3HVHA 1IM8A 3CCFA 2H00A 2OPBA 4F84A 3KPWA 3LL7A 4OBXA 1I9GA 3EMBA 1Q0TA 3ELDA 2ZIGA 4HGZA 3FPEA 1EAMA 2JHAA 3TR6A 2AN5A 3KPUA 4HH4A 1DL5A 5EMMA 1NKVA 1Y8CA 2XVMA 1ZQ9A 4R05A 5DWQA 1WG8A 4PIPA 1P1CA 5E9JA 3IHTA 1EJ0A 1R18A 1XDSA 4OQDA 2B3TA 4GOOD 2CWWA 5EHGA 2IBSA 2XBMA 1FP1D 2EJUA 2G8NA 2OY0A 5D1HA 1X1DA 4RTRA 3A26A 2C7RA 2NP7A 5GOZA 5E9QA 2NXNA 5IKMA 5GWXA 4E2XA 2A14A 2NXEA 3BGIA 3ID6C 2AVDA 3OE5A 4QTUB 5CUQA 4QQNA 4R8RA 3CC8A 2P40A 1IXKA 3M6VA 2AOUB 2FRXA 2PJDA 4BLUA 3BZBA 2PT6A 2PY6A 1O9GA 3BWMA 3C6MA 3KHKA 3EVBA 1ZKDA 4MWZA 5EMLA 3OFKA 1XXLA 3SXJA 4DCGA 2WA2A 4BP3A 5EKXA 3MB5A 4EKGA 4ER6A 2BH2A 1BOOA 4CTKA 4DA4A 3EPPA 2HV9A 3H2BA 5E8JA 5HIIA 4MQ4A 1JQEA 3A4TA 3LECA 4HRAA 5EZQA 1KXZA 5JUWA 4RTOA 1HMYA 1D2CA 3GXOA 3GNLA 3P8ZA 3UJ7A 5EQJB 3M33A 2QE6A 3OFJA 4RVFA 4QDKA 3KQMA 5E1MA 3FTFA 1BHJA 2CL5A 4V0QA 3TRKA 2OXTA 1X1AA 3G5LA 4LG1A 4YUXA 4HTFB 5FADA 1RI4A 2O57A 1KP9A 4PINA 4RVGA 3EMDA 3M70A 5IH3A 3TM4A 4QPNA 5KYGA 5EEHA 2GH1A 3JWHA 1YZ3A 3K6RA 2FK7A 5KQRA 3CBGA 2UYOA 3A7DA 2K4MA 3O31A 1G8AA 5HIJA 3GCZA 4C4AA 4KW7A 4QVGA 5EG5A 3P97A 1NV8A 5K0FA 1IY9A 4FS8A 4HC4A 3EEYA 4PYOA 4YMHA 3OPNA 4BLVA 2PBFA 4F86A 4PCAA 1X1CA 1XDUA 4X63A 1DCTA 2QYOA 1NW6A 1NBHA 3EVCA 3KQSA 2ZFUA 1NW7A 3UJBA 4DQ0A 3MGGA 1L3BA 4CTJA 1HNNA 2PX8A 5DT2A 5LQRA 4X60A 1SVUA 4V0RA 3B5IA 5CVEA 4QQKA 4IWNA 4POOA 3DP7A 4FSDA 3P9CA 3T7SA 2BM9A 4AZSA 4MHTA 5LR6A 1RI5A 1ZGAA 3HM2A 3UJ9A 1ZHFA 3LDGA 3CVOA 1X1BA 5CM2Z 2HTEA 3NVMB 1AF7A 2WK1A 4X1OA 4OX9Y 5DM2A 2P3QA 3C3PA 4YMGA 5EIWA 5FWAA 5DRTA 1I4WA 2ORED 3MERA 3P2EA 3SR4A 2YXDA 5GINE 2B9EA 3HCAA 2ZBQA 2JJQA 1F38A 3M6WA 4OA8A 2VDUE 5EVJA 4Z2YA 3SSMA 3P9KA 2AN3A 4ER3A 2YXEA 5GIOE 1OR8A 3G5TA 3PX3A 4UOEA 4GC5A 4YV0A 4DCMA 5CCXA 3KR1A 2C7OA 2NNWB 1INLA 4FT4A 2ZIFA 3B3GA 3DXYA 4GQBA 1YB2A 2PVCA 4M37A 4E33A 5EGSA 3NJRA 1VP3A 3ERCA 2AN4A 1D2HA 3LBYA 5D1NA 2EG5A 2PX5A 2C7PA 2ZIEA 3SGLA 3LGAA 1L1EA 2IBTA 3KQQA 1EQAA 2QY6A 3FRIA 5DTRA 3NDJA 1L9KA 4X61A 5FTWA 2UYCA 5GM2A 3KPYA 4JXJA 4RTKA 4PGGA 4LECA 1AQIA 4G56A 1V39A 3HCFA 2HWKA 1XCLA 5LQJA 2PKWA 2IGTA 1EJ6A 2G1PA 1UFKA 2FPOA 2O06A 3NW9A 5F2OA 3EEOA 2ZVJA 2G72A 5T64A 3R6TA 2GLUA 1SUIA 1JTEA 2PT9A 2CMGA 5FQNA 3TQSA 2VS1A 3DXZA 3GRRA 1F3LA 4YUZA 2YTZA 2BR3A 5DTMA 3SX0A 4EMSA 3BT7A 2PWYA 2P3LA 2YX1A 3DUWA 2PXXA 1R74A 3FUTA 3HCBA 4MTLA 5FA8A 2VZ9A 4CXMA 1B42A 1FP2A 4PYMA 4OBWA 1WY7A 1G8SA 2PLWA 1G6Q1 3E05A 3SMQA 5K0EA 2ZZNA 2N47A 5JR3A 3OU7A 3D2LA 2QRVA 1N2XA 4GOMD 1SG9A 3R24A 2DPMA 4HG2A 5CIYA 1Z3CA 3EVZA
chains in the Genus database with same CATH superfamily
3OZWA 2B0JA 3NTQA 3S1LA 4B6RA 2Q46A 1KYIA 3TO5A 5DNVA 3CHYA 4M49A 3IJEB 1O0SA 4B3RB 2FRDC 4OQLA 4G5RA 2J0VA 2P35A 4A27A 2ECFA 3LZ6A 3KWJA 1XPOA 3HUFA 5IFLA 4MB0A 3JQ9C 5DJ5A 1Z7BA 1LZKA 2W7TA 1CNFA 4WLNA 3KQWA 2AD5A 2QOEA 2VA9A 2XDAA 4NTZA 4URXR 3W6UA 1SXPA 1SEPA 4W9RA 3DAHA 1H9AA 4MI1A 2QZ4A 1Y3IA 2Z3VA 1N2CE 2VJQA 4RPIA 5A5VA 3AG5A 4UD2A 4G4GA 3PFCA 2OVFA 2I1VB 1TGVA 3OE7D 1D6NA 2IYOA 3BQNB 3MJEA 3QVKA 4ZEVA 5HRCA 4J0EA 2WTUA 4YRRA 4PSCA 5LDHA 2ORYA 1KERA 1NI3A 3GFBA 3DKRA 4PYIA 5DGCA 4CGZA 1ZS9A 2ZJ8A 3CLSC 5CVJA 4CKEA 5K6AA 1E0AA 3R4VA 2GEFA 3RVBA 2FG5A 2J7PA 4KXLA 1NXPA 3RJTA 2EERA 2W70A 2XNKA 4YJFA 3UGKA 4KWCA 3Q0IA 1MAUA 2QUZA 2XB9A 2CXOA 4LSZA 1PJZA 4EELA 5HQ3B 2JASA 4DSNA 2O8VA 2QX6A 2GZAA 1BFKA 2X9QA 2L18A 1JH9A 1NRWA 2YDYA 1U8EA 3KRTA 3F1LA 1KMHB 1ZAKA 4FXOA 4U7TB 3EG9A 1RPJA 2MSNA 4JKYA 4L5AA 4RKYA 1SIWA 2IT1A 3AVQA 1XZJA 3CURA 1YQUA 5CEFA 1Z6QA 5KYYB 1L5KA 2Q8QA 3NJ4A 5CFOA 5ICCA 2FZEA 3L43A 5TQ2B 4TQAA 4PBRA 2IYQA 4KIJA 3PSHA 2BDUA 3OZFA 5CT4A 3W34A 1AMUA 4RVNA 1ZH4A 5C31A 2JBHA 4UCFA 2O0MA 5AYVA 3K7EA 5FBRB 4YRQA 2AHRA 3Q41A 1UMDA 3QEKA 3BL8A 3LC0A 4A7PA 2PZAA 3NS7A 1QYWA 1DX4A 2ODEA 4EWLA 521PA 4QG3A 5BSFA 4U7DA 4K6CA 5K45A 2F6RA 4MCAA 4Q12A 3PENA 2G09A 4U9UA 2PRSA 2EFGA 1DEOA 3V8EA 5AW6A 1I14A 1K63A 2CXHA 3EUFA 2EW1A 2OT3B 1W36B 1B76A 4J3FA 1DRVA 4NV1A 4F2DA 1K7SN 1G5IA 2H0RA 5A71A 1XEAA 2Z8YM 2H2WA 2YY5A 2BMDA 4OV6B 1D2AA 3CYFA 2R6CA 3K73O 1P33A 5EPOA 3E5HA 1KGSA 1QYRA 1XVLA 3PUVA 5JZSA 2Q5HA 2HSDA 2CXUA 4COKA 1FPMA 1QB8A 3IIIA 2JCVA 3O83A 5DV9A 2WG1A 4KV9A 1NNEA 1PLLA 3ANMA 3B7GA 2C4KA 3L1JA 2ZTUA 1XPUA 2BTEA 1C9MA 3R7BA 4LMBA 5ITWA 1LLUA 4E2FA 2CL6X 1TB4A 2W6OA 5KKAA 3CTMA 3LH5A 1YOBA 3PHCA 3TKYA 3AYZB 2QX4A 2GKSA 4O2LA 3WSTA 1M2FA 1UIRA 1OYVA 4G97A 3H1AA 1QGZA 3F5SA 4XYBA 4CIDA 1GGKA 2CNWA 1I5RA 3T4UA 2K7FA 1RFLA 4K5QA 4WH0A 4ZOEA 4H77A 1FS6A 5EZYF 2I66A 5DU2A 4ZICA 4LWZA 4MXDA 3ZIAA 1WA5A 2HO4A 5ERXA 4LZPA 3QX9A 4UXHA 5HJ2A 1BGWA 4C0AC 4O3MA 1GPAA 1TZCA 4OJNA 2PT5A 1TTQB 1TVCA 1X77A 3I5AA 3RH0A 3GLQA 3G89A 3NKLA 1MENA 1FDOA 3P2MA 4ZCPA 3EDMA 1ECCA 5KVQA 3REQB 4MO2A 2IS6A 4R2MA 4Q19A 1P0CA 3ER8A 2PGIA 4O4LA 1WB4A 2I1LA 4ALNA 3K2IA 1JG1A 3AVWA 2P8SA 3GLRA 4FZ3A 2GZDA 5HX7A 2YN2A 4ZI7A 4DR4B 1W1WA 4P86A 4LW8A 2IIBA 4CG2A 3JWPA 5AICA 5L3QA 3L0IB 2YIMA 1IUOA 3C2QA 3ROEA 1EINA 1VLHA 3NBZC 4CEHB 4MS3A 3IEXA 3EFOB 1BCRB 4M6WB 4XGNA 1VG0B 4XCVA 3RB8A 3WISA 3JYLA 5ILGA 2HYIC 2G1UA 4CGYA 2O8DA 1K9SA 2LCIA 4A10A 2OBYA 4HZUA 4HFMA 1YB6A 3RF7A 4ENUA 3U5ZB 5DF1A 1CY1A 1VGQA 4OKSA 1ZRNA 1RACA 2ZSDA 4NHEA 2XMPA 3AKYA 5FUBA 3NRJA 3VDXA 3K9QO 4KSBA 4W1RA 3H5VA 2C07A 3AM5A 1HORA 3OKAA 2GDZA 3DBRA 1NT2A 1TJ3A 2JIZA 4LBYA 1KYTA 5L95A 1UJ5A 4FN4A 2HUNA 5JMWA 1V35A 4HGYA 2K7ZA 4JC0A 4L85A 4KAFA 4KLNA 1OFGA 1EVJA 1U0HC 3RS3A 4ZI5A 1K27A 3TR0A 4KITB 2EF0A 1RPAA 2ANCA 1XTZA 4J6EA 5KO2A 1CYEA 1XJ5A 3JASA 2EVWX 3EW9A 2G9VA 2PMCA 3UT5B 2H2FA 1EX6A 1CUSA 2DKFA 2NTYC 2R8ZA 4YT4A 2H0QA 5EXEA 2OHGA 4RBNA 5DX0A 5T3UA 1JU3A 1X8LA 2RGRA 4RHYA 3ASVA 3OQHA 2OQVA 1Z0UA 2QMHA 4BCDA 3TFOA 4ZAFA 1TU0A 4BQEA 3N0XA 1A5AB 2DUMA 3KVVA 4RVHA 3V9PA 4AICA 5EIEA 1XJQA 3PGVA 4NMWA 3AK4A 1VIDA 3N1UA 4UFNA 1G98A 1FRVA 2WFLA 1VL0A 1E3SA 3BK1A 5ARDA 4IZIA 4JROA 2WU3A 1THZA 2F8TA 1GG2A 1A9SA 2KPOA 3KZMA 1TA4A 2CMDA 4X8LA 3UMFA 1GU0A 4W9NA 3ZR4B 3UJDA 3NYRA 4A6DA 3KB1A 3TW8A 4CF7A 1OAOC 2G0AA 1K88A 1DXOA 1WVIA 4XKJA 3RYHA 1H2RS 1G8JA 4XVHA 3S2IA 4L0DA 3VTAA 3VC1A 2OV8A 1CJMA 1GRRA 3BMQA 2H17A 3MT0A 4IF6A 2IPAB 1ID1A 1SCUB 2C78A 3NV9A 4NV0A 4DIMA 4RTMA 4JFAA 3E1KA 1VSQA 3PPYA 4KRGA 1M0WA 3A1UA 1KAHA 2Y1XA 1DRJA 2BYTA 5TMDA 2Z58A 4G24A 4XX1A 3QEMA 3E35A 2Y1WA 3OPYI 1NVVQ 3KR0A 4EF6A 2OZPA 4JDUA 3VNRA 1YA8A 1MNQA 3ZLJA 5BSHA 3O9VA 1FU8A 2UZ1A 3FHJA 2BFWA 2I7CA 2Y1FA 3LVQE 2A8YA 3ASYA 3UJAA 4Y1EA 3TJRA 1EGMB 5DTQA 3OSUA 1JYSA 3EUEA 3I2GA 3L05A 2IPMA 4LQDA 4ZV9A 2PTGA 5BR8B 1KNQA 1H8ED 4UHCA 4Q4JB 2AEMA 2C9OA 3KQVA 4TTSA 2QU8A 2B34A 1JFLA 4FHZA 1WF6A 2ZZMA 2C9DA 4TLLB 3CKKA 1GUAA 4G41A 3PHJA 3QEOA 3WA7A 5LIRA 4JXZA 2NVWA 4LDAA 1P19A 2CYBA 3NLLA 4Y2JA 3WAKA 1Z56C 1D2GA 1GQQA 1TA0A 5BR1A 2DKNA 3ETCA 3AUXA 5DLQC 1Z75A 5BN4A 1IUKA 1NW5A 2FPRA 4MRMB 5B37A 5JDCA 1N2CB 5IM5A 2AN1A 3FPGA 3NH6A 4DPLA 5AUPB 2QZSA 2ZSEA 3TH5A 3V7FA 4GMGA 1RJ9A 1NLUA 2SKEA 1IZ8A 3D7SA 3R23A 4I2NA 2AIRA 4YAIA 1WXIA 1R8XA 1Z0DA 2P2NA 2WFZA 1XELA 1BHSA 4LNAA 2C94A 4BKUA 1Q0RA 4PFKA 3ICQB 1UQUA 1DQYA 4L5IA 4MYCA 2HWWA 3FHCB 2AEJA 4E46A 2QV7A 4X93A 4KKVA 2CBZA 2JLQA 5LWHA 4IGKA 3DKKA 1WOYA 4Y6LA 3AJ9A 4MHSA 5JNWA 3M8KA 1YI1A 4IJQA 2EIXA 4BEVA 3ANNA 4B2LA 1CHDA 4LTDA 4EHDA 3TZHA 3EIEA 4YHHB 3X1KA 2ETXA 2Y76A 3IHTA 4DC9A 4LV5B 4UU0A 2GRAA 3KAQA 4BJHB 5JNTA 1WCIA 3ZV4A 1T2FA 1I2ZA 3ZTTA 2OY0A 1WLYA 3VAAA 2I2XB 3OZXA 4Z7OB 4W6ZA 1MH9A 2A3NA 1L7BA 3U6BA 3MELA 5EYPB 2M6SA 2QSYA 4IINA 3RBZA 5JEEA 2GZMA 4LI0A 2WWYA 3UMRA 1RPNA 1VDMA 3C3MA 3KO8A 4MUHA 1QUEA 4HRXA 5C8YA 3QYJA 1ORRA 4BKMA 5C80A 4NX2A 5JW6A 1FIUA 1NMQA 4L4XA 3SXJA 2HK9A 1PP4A 2WJAA 2WAXA 3GJTA 1AGXA 4MW4A 3RCBA 1B2LA 3DDSA 3IELA 5KYXA 1LDEA 5E3JA 2XB8A 4B4VA 3BXEA 2G4VA 4OREX 3VO2A 5DYYA 4RABA 2AMYA 2RH5A 4BNUA 5HZGA 4K2AA 1TMOA 3SMVA 1J06A 4LAFA 3O3CA 3O0TA 1DC8A 3E81A 3FG9A 4RVFA 3SU8A 1MC4A 1NKSA 1WTAA 3IMEA 2X0IA 1DFHA 4Q3EA 2VK1A 5A06A 2C7GA 1T24A 2VJLA 3ZX4A 4EO4A 3QMVA 1KP9A 4PINA 1E6LA 2D4AA 2EGHA 2X2PA 1PZMA 1THGA 4OB8A 1REQA 2LKDA 2VPYA 3DNMA 4LVUA 4X6YA 5ALHA 5I7HA 5LYJB 3QUTA 1KOLA 5D84A 4NCJA 4L8GA 4Z4CA 4XJTA 2B4TO 1EFPB 2ZB8A 5J2UB 2OGZA 2REOA 3FR8A 1DRKA 2OBNA 1UC8A 1Z2CA 2GPNA 3HU3A 1YJCA 2FOXA 4KAXA 4U0JA 1KWKA 2EGGA 1T13A 2AZXA 3EJ6A 2RH4A 5IJ9A 1OGJA 2FDCA 4NMHA 3LOQA 1SIUA 3H9BA 5LMCA 3A1TA 4ZQEA 1XNGA 2HT6A 4GWGA 1H6BA 1VKZA 2B37A 3T6KA 1JPNA 3ANTA 4Y7DA 5FPKA 4DYHA 2X86A 5JROA 3A36A 2X40A 1HNNA 2O4CA 2OCAA 3AU8A 4Q37A 3ZC3A 4PO8A 1L7MA 4F5EA 3VDRA 3RGGA 1C9JA 1T35A 2G0TA 2IYXA 2N0SA 3BG5A 5AM4A 1KJQA 4N3NA 4PLVA 3TW6A 4ITVA 3R5XA 2HF9A 4TV9B 3U3DA 4MVJP 3N0TA 1ZH0A 2VDOB 4C89A 1ZIPA 2XNJA 1Y8QB 3CVOA 2DMRA 2OO7A 3QWBA 4RMNA 3KQNA 1ZCJA 1S3GA 3TL3A 3NBYC 4KQGA 1N8KA 1R3UA 4BC0A 2AF3C 3N7TA 3WRWA 1BG6A 2CDCA 2ZUTA 3MERA 4YQFA 1E4EA 5LZ5A 3JQ6A 1RQRA 3OAAD 4HDSA 3C74A 1IHOA 4I36A 4XIJA 1MTOA 4ZZ3A 2QMYA 2Y68A 1IBCA 4Z2YA 5C35A 3EUWA 3AKCA 1OR8A 1R4NB 4HDRB 1N5KA 2PZKA 2P9EA 4MHOA 1M33A 2CDAA 5SYAA 2NNWB 3II6X 3SP1A 1XRQA 5EGSA 2ZUDA 4GI3A 3WDMA 4QARA 3KTAA 4XZ3A 1CVLA 1NR1A 3LBYA 3ZJ4A 1D1TA 3DQQA 4RHUA 2C7PA 4W5JA 5IKXA 4JP1A 4HOYA 4FFBB 3SYMA 1EUQA 1FMFA 3C7TA 2OYCA 1K97A 5DI9A 3PR2B 4JXJA 4LHZA 4RL4A 4H7IA 1M0TA 1KJ9A 3W2TA 1CEYA 1A9XA 1WZUA 4MWBA 5I5GA 1BDJA 3NGXA 3INNA 1LSUA 1RKXA 5DMXA 1W8IA 3GRAA 2BN4A 3HMKA 3LYHA 2F1RA 5CNIA 3WNBA 5LP1A 3PUZA 2QW8A 4ME6A 1SUIA 4RY9A 1T2DA 3C3WA 4MAAA 4DIDA 3E7DA 2G80A 1H9BA 3W3AA 5JCPA 3GW8A 4DSTA 5DTMA 1N8TA 5A6VA 4GX1A 3FWPA 5G3YA 1E2IA 3E4CA 1M5TA 4KGZA 1SHKA 4CXMA 5FLYA 5LFAA 1IHDA 2HSEA 3WFZA 4DJAA 1Z8DA 1TQ4A 2OAGA 1R0ZA 4MLDA 3ZXSA 2WWFA 4BECA 1FUEA 2PLWA 5BSMA 3E05A 1LDBA 3U5TA 3I42A 4QEZA 5D01A 3SYLA 3OU7A 5IBRA 1G2OA 2FF7A 3NCHA 3LIPA 4UNQA 4CV1A 1J9ZA 2V97A 5I7VA 2H1CA 3QVVA 3QUAA 4FUQA 2RI1A 4DUGA 3WOHA 4RE5A 1I1NA 1UAAA 2DSTA 1OZFA 1GTRA 1UDXA 4RWEA 3D8SA 3WHIA 4BV3A 4QFBA 1Y6FA 3RU7A 2LD4A 2RSLA 1HG0A 3KTOA 2P4HX 1U6KA 1NLMA 3SZLA 3CEHA 3L8ZA 4R8MA 4NCXA 1R9GA 1LVUA 1GN9A 1ZWKA 3WQQA 2Q2VA 121PA 1C8BA 3GNQA 1E5QA 2AOXA 2HXSA 3GFTA 5JECA 5KOJB 3IBCA 1HKHA 1TQ8A 4I1PA 3E1SA 1MLDA 3V9AA 1H1LA 3D9QX 5ALRA 1DP4A 4IDFA 3VA7A 4D25A 1NY6A 3K20A 4NCNA 1KDYA 2ZTHA 2W2NA 1QFMA 2MU1A 2O6HA 3L6CA 3NO4A 1JFFA 4BHTA 1YD7A 5BMVA 5KQMA 2QQ5A 3H1FA 3S8YA 5ICGA 3FYCA 1QIFA 2D1TA 3PRHA 5NULA 4EEXA 5L3SA 4A3SA 3A2LA 3G02A 2JCXA 5HXAA 3IP9A 5LPNA 3NAGA 4NH0A 2ZB4A 4EPVA 1GGHA 4EABA 3OQMA 4ZVNA 3JZDA 1JPUA 1WULS 3OJCA 1ISIA 5AM1A 3SIWA 4L28A 3C70A 2A7XA 3HCNA 3C6KA 4J0CA 4MEAA 2C2XA 2J46A 4RM3A 4G01B 5K8CA 4P0QB 2RC5A 3AW9A 1LH0A 1LI5A 2JFGA 2MINB 3AXTA 2CLDX 4FC7A 4MQBA 4D97A 3LVBA 5HJEA 4RGBA 4L02A 4GL4A 1RQLA 2OXCA 5T4EA 2O2CA 3MLEA 4ISCA 1KAEA 3RSFA 2VDVE 2CNWD 4EJ6A 2J6CA 1FNDA 16PKA 1MJGM 1SQ5A 2QG9A 1NBAA 1GTL1 2QWXA 3SKVA 3AEXA 4HGQA 4HLNA 3FSGD 1S89A 3GCWA 3ZIAD 3IIEA 2D00A 2Q0SA 2E55A 2YCBA 3L07A 2FP4A 4U9IS 2IUSA 4DLYA 2HA6A 4TWRA 3MZ0A 5C0OE 3X1ZA 1R8YA 4BZPA 3BICA 4IDHA 1NXVA 4LISA 3WIDA 5C8DA 5IHPA 2RBGA 3KQPA 2G7ZA 5CVTA 4PFQA 4XM0A 4B6JA 5E4FA 4LJAA 1W94A 4KX3A 5BSWA 1AUPA 3K9HA 3MWLA 5CEJA 2ZI6A 4HEJA 2Z30A 3AL3A 1CIJA 1YZQA 2FJPA 1A4RA 3FDXA 3GRPA 3K0BA 4Q4AA 4BMVA 3MWDA 1SBZA 4KDEA 2GB4A 2L82A 2P2YA 3U3ZA 3FF1A 5H3HA 2AUNA 4AG3A 2QPLA 1J2TA 1BDMA 5LMUB 3CRQA 3TKAA 5A4IS 4N7BA 4KLCA 4Q3AA 3IEMA 1RQNA 4G65A 2ZULA 3Q88A 4CLHA 2QQFA 3L8YA 1Z5GA 3D1JA 4RIHA 4BPBA 1KDPA 3BJEA 3SJUA 3HYNA 1ACMA 5FL7A 4CV2A 2WWIA 1AQ6A 5FHRA 4ARUA 5EJ9A 2NSDA 4FNOA 5C4MA 4AKIA 1ZI9A 3RASA 1X80B 2A5LA 2O4UX 4H0FA 5DBGA 1TVKA 5DTJA 2LPMA 2NVOA 4IPTA 3W4KA 3AM3A 4K40A 3H5TA 2Q1SA 3LDUA 4LVCA 2B78A 4QYTA 4TM8A 4TXLA 3ZV5A 1DXQA 4CUJA 1EUYA 1Z16A 3AG6A 2OYRA 2G25A 4CMAA 4FDLA 1IZ7A 2IPNA 2PGOA 4NBVA 2ZAGA 2IHJA 3WL7A 3SOZA 4X64B 3CVYA 2Q1UA 4FOOA 4NYJQ 5HE9A 3HMQA 3X0DA 1HT3A 4Z49A 5K3EA 2ZYIA 1A9ZA 1HZJA 1G3QA 1Y98A 2IDZA 2JGDA 2Z5VA 1MO6A 1X3SA 3FWKA 3H9UA 3PQFA 4GF5A 1GNTA 5EXDA 3TN7A 4B83A 5AM3A 2NPOA 4DJTA 2FW6A 4DRYA 1S3IA 3V42A 3NP9A 1IC6A 1PT6A 2BFOA 1XX6A 2NLOA 3HP1A 3LKZA 3WNVA 1AUVA 5C1OA 1JDZA 2WICA 3KLBA 3QE3A 3CEPB 1JR3A 1GD1O 3H04A 1PTKA 3LWDA 4EAQA 4EKNB 4P5PA 1DKQA 3KOYA 2Q9AA 2VUSA 1VIVA 3CJQA 3FNHA 4WWHA 4B8ZA 2VUTA 2BVNA 3H4TA 4IXTA 3SEFA 2ZJYA 4GPZA 3MJTA 3PDUA 3U4AA 4TLMB 2C5HA 3FTQA 1UPCA 2IUTA 3VSBA 2JFPA 4NHOA 4WLFA 1U9ZA 4TX1A 2X1VA 1G0NA 3NWEA 4KN9S 4HVLA 3NU1A 5GONB 2H4FA 1CS4C 3L5KA 3QM1A 4H7JA 1GO2A 1EQ2A 2ZBUA 3THRA 4DIFA 4DTIA 1TIKA 1W5BA 3EVEA 2C3PA 3BFJA 4LZOA 3X43A 4G1CA 3VKHA 1YBFA 2IH4A 3WKEA 4JVLA 3CV3A 1L7OA 4NR0A 3I5XA 4PYLA 4UUNA 5K1ZA 3LHSA 4EUFA 4RPGA 1EDBA 3WWEA 2MYTA 3ABOB 3L0DA 1F9AA 1O89A 3M7IA 4UNPA 3BILA 3ME5A 4X7MA 2JEZA 4WERA 4ETWA 2AR0A 1HE3A 1MVLA 4K3UA 3LO5A 4FDTA 4CU5A 4MUXA 1DEHA 4QX6A 3VMFA 3WKDA 3HDVA 4CQMB 3FUUA 2H2AA 1NIPA 4ZOCA 1NA5A 1PJSA 1G64A 1NF3A 4PBSA 4FYYA 2E3JA 3ZU2A 4JZKA 4AT1A 3LT5A 1UUFA 3KEFA 1DU4A 4HQ6A 1CZLA 2VJPA 4MINA 1VDZA 4V0OA 2WA1A 5AVXA 1L4HA 3EC7A 2FZCA 2VZEA 2XWSA 4BYMA 3F2VA 4BEBA 4WZBB 4Y18A 1HQCA 3UOWA 4BJ3A 4B3MB 1KDTA 2HU7A 1E2KA 4F92B 3OCYA 1CR4A 4KDFA 4YR9A 5A4KA 2H4YA 2ZAIA 4HQOA 4CM8A 3ND8A 4UAVA 4J0HA 1HZZA 2UVPA 4P4SA 1Q21A 1TO1E 4WRRA 4ILKA 1GZ3A 4KQMA 5TEWA 4IMIB 2Y05A 4WLOA 2YY7A 1XHFA 5IAJA 3ZCUA 1P91A 3VOTA 2ATIA 3A6EA 4AJOA 3DMTC 2DR3A 2H07A 4DLWA 5JZOA 3ZXYA 1OI4A 4QPPA 3RVDA 1R00A 2BFCA 4ID3A 3DLTA 4FFSA 4ZOQI 1RC8A 3WBJA 3H99A 2VF2A 2XNDA 3A27A 3GLKA 4H3KB 5DM60 1J5EB 2D1YA 3NEPX 1GQFA 1QPGA 1ZC3A 5DNAA 1GV0A 2IVZA 1ISMA 3O2NA 2I80A 3NHSA 3NT5A 4KMOA 4PZEA 3KUUA 2RFLA 4MUGA 2WM9B 2X7XA 4DY6A 1WS6A 1FEZA 1ULZA 3QF7A 2X2FA 1MX3A 4HLQB 2YXBA 4NESA 1FBTA 1FLVA 2PUWA 4WECA 3U7IA 3UMJA 2AE2A 4JJIA 4MRAA 5I8WA 3LX4A 1WXWA 4WDRA 2GN8A 4JB8A 4B80A 3IQGX 4JMPA 4ZJZA 4YO7A 4JV5B 4YMTA 1NW8A 2WJWA 4DZRA 3BMNA 4ABTA 2YIVX 1X9GA 1NDUA 4O2BB 3PNLA 3V4FA 4HEHA 2RB5A 1JR2A 1EE2A 2TS1A 3KKOA 4NS4A 1A8PA 3QFCA 5AOVA 2R1TA 1IVSA 2QD3A 3NTXA 4IFEA 3VKUA 1CQJB 4DPMA 3LC2O 1Z36A 5EE0A 1YFZA 1N5RA 4CT4B 5TR9A 4KR2A 3GPLA 1SD5A 4LNUB 2FSVC 3JPWA 2YNMA 1OI7A 3NIDB 3LNCA 4ZDWA 2IE0A 1GVHA 3MRSA 1EFKA 2BFNA 2DFPA 3ONWA 3COZA 3MT9A 3PSAA 4G89A 3V48A 1DCMA 1II0A 3Q12A 3T3NA 2QP3A 1OX6A 4GUAA 4RAQA 1NN0A 3HVRA 2X6QA 4KXQA 2IS2A 2WIKA 3OX3A 2D1SA 3CR7A 2PPVA 2OD9A 3PQEA 2J9FA 4NQRA 4NOJA 3QXGA 1E7MA 5TE9A 4EHHA 3SVTA 2NYRA 2A86A 2GQ0A 1ZIYA 1DO8A 3R7FA 2WE8A 4LHVA 4G37A 4B7AA 2JJ2D 1HLGA 5DM4A 1IU9A 5H4HA 4AZ0B 4WK6A 2X9VA 1FUKA 3R09A 4ZC1A 2L19A 5DX8A 2W37A 4N0PA 5AW0A 1GYQA 3MWFA 1EFUA 1XQYA 4MJXA 2YW9A 2CKMA 1D7AA 1VKOA 1V8OA 3EEFA 1I8TA 1VLJA 1L7DA 4G1MB 1GFWA 4JVSB 5LBTA 1ECJA 3L6OO 3LBHA 1UOPA 3RYIA 1G21A 1LBHA 1GQSA 2QLFA 3CF0A 4NMXB 1BCSA 2RHLA 4ERXA 2G8LA 2EYUA 3B6EA 3VDNB 1ISHA 4DNFA 2YQ5A 1KU0A 4Z1MA 4ESOA 1K86A 3M6FA 4KR6A 5A2GA 4OJQA 2RGBA 3I32A 2FR0A 1ZOPA 1HE1C 4I5DA 1UC5B 4J49A 2NU8A 5KTMA 2REXB 3DOHA 3GGOA 2XGGA 1S7CA 4IGFA 2FU5C 3ZVNA 4ZOLA 1E6MA 3BK7A 3SJBA 5CHYA 1C9DB 4PS1A 2AA3A 4DSOA 1AQLA 1BDBA 1GG8A 2GJ4A 5BV7A 4AJ4A 2NV2B 3QWAA 4EZIA 4G0VA 4C7OB 4BGIA 1J9GA 2XI4A 4JAVC 4YQYA 1WG8A 3JAKB 4PZDA 4P3OA 4ABYA 1P1CA 3F8TA 3NTOA 4RVOA 4WLVA 5E9JA 1OX4A 4PG5A 3STYA 3WLIA 3S70A 1GNPA 3DM9B 1T2VA 3HPRA 1WCXA 4R7GA 2WHYA 3DT9A 4KMRA 5JZ9A 1DEAA 5D1HA 3OM0A 1NLFA 1M0SA 4GOKA 1K2WA 4M0DA 5GWXA 4AMZA 1EX1A 1OY1A 3OIDA 4QEDA 3LGSA 4EO9A 3JQAB 1U1GA 3GT3A 2J3EA 2D0DA 1EGHA 2DFKB 3QUCA 3LF1A 4GWLA 2ZUWA 3DE4X 3VFDA 3D02A 2DBRA 2FGKA 2BEWA 3VJKA 1ZL2A 2XHEA 4B4UA 4CBVA 1O5TA 3MLBA 2OV6A 1MU0A 4AMVA 4QYXA 4EG8A 4EEZA 1FC0A 1KU6A 3ZCQA 4L0QA 2TMKA 5FTNA 5FOQA 4WZAA 4E94A 3URMA 2QYHA 3EVNA 5CTJA 3UW3A 4PC7A 3ZDAA 4CLDA 1AXRA 1ICIA 1W29A 4HLDA 1SC4A 4IIYA 5EWMA 3SLGA 2OVBA 2PUVA 1AT1A 2QE6A 4KNVA 3QTBA 4P3NA 3VO9A 1E77A 2OORA 3KCNA 5HBGA 2DPGA 4QGAA 1P75A 4D8VA 2DG2A 4UZSA 3Q72A 3BAFA 4ON9A 1RI4A 5B6IA 3P27A 1VL1A 2P77A 5CAEB 3KP1A 4HH1A 3PD0A 4L0MA 3N87A 1BMDA 1HT0A 4XAQA 1EDEA 1XCOA 4YUAA 2BEKA 1GUZA 1MOQA 1CZRA 1BAPA 1SBNE 1Y8RB 3AEYA 5ENZA 5LP6A 3TGPA 4I1VA 1TZMA 3LHKA 1J21A 4IDAA 1CE8B 1QRRA 2QTZA 5FO1A 4BNFA 4D0SA 5KX5B 2RK4A 4FS8A 2JAOA 4MCHA 4AMYA 3VSDA 3DCYA 1RM3A 3W5SA 2OAEA 3W3AD 4PCAA 3LVRE 4U2FA 1JEYA 2YDXA 1VSVA 4EJMA 3GQBB 3RS4A 1D3AA 1DWPA 1D7OA 2XX3A 1J2JA 3HCWA 5JO0A 1DUVG 1QYDA 1U02A 3U0BA 3KC2A 3QU9A 4U7WA 4FOLA 4GPTA 3P0JA 5GZ3A 1NQOA 1ZD1A 3FNIA 5IVPA 1WRBA 2HJGA 5IVHA 3T3PB 4OF4A 4CF5A 3MLAA 2O7VA 3P9CA 4MQUA 4OXXA 5KU1A 5TNXA 1QS0B 3H5IA 4MHTA 4Q1DA 4BIMA 4JNKA 1P5HA 4XDHA 2VP5A 3UXEA 5B58C 7MHTA 5H82A 1KL7A 3OO0A 3K4QA 5H3CA 1D0IA 4QUBA 2FPXA 3ICCA 2GYYA 4YBZA 2IYFA 4HDMB 1LS6A 4A8HA 4EJSA 4EUEA 4MDYA 4E5NA 4MRNA 3LAWA 3FPSA 2J6IA 1Z0AA 2WBLC 1U31A 1DQZA 2FMHA 4HO1X 1T9ZA 1HO3A 1Y1TA 3TJZA 1D6MA 2VYVD 2XITA 1QE0A 1I4DD 3LI2A 1G8GA 3PUHA 2AFHA 4YIKA 3DS8A 2RJ3A 3EK2A 3NVDA 1GR0A 4I1OA 2WYIA 3X2EA 2R47A 2FVXA 1CHNA 3ZJ5A 1D4OA 5JXHA 5KCZA 4KWIA 4LMPA 3RRBA 3QVUA 2NZUG 2XOKD 4X7PA 3DTYA 3KPYA 2HA2A 1F0NA 3IR5A 4G67A 2FUEA 4IH4A 1OWNA 2G04A 3OT4A 3S1SA 3IHLA 3UC5A 4U2GA 4F1WA 2C61A 5LNK6 2ZVJA 4CLOB 2LUOA 2Y6UA 4RPCA 2ZBVA 3D31A 3TQSA 1F0YA 4M0KA 4DV1B 4LYDA 4K9DA 2I55A 2ZTSA 3SX0A 4HWRA 4TVSA 4D96A 5KYNA 5AK6A 1A9YA 1RLMA 1XTVA 1GAXA 5KJ6A 1FVFA 5ADUS 4PHHA 5IDXA 4I3GA 3NHLA 4QPZA 4XJXA 1XRJA 2XRYA 2XWPA 5TPWB 3R74A 1G6Q1 2X8BA 3ROMA 2C2GA 1XA0A 1NVVR 2N1BA 5ALDA 3U3MA 2QRVA 2VNSA 4CG0A 1I7QB 5LD2C 4DLSA 2Q2OA 4UXJA 2JBAA 5BOVA 4AP5A 1A0OA 1ZOIA 3PD7A 3V4ZA 1ZN8A 3OLVA 2ZI3A 3QBDA 4KDCA 2HIHA 1GTMA 3PNQA 2FPWA 3B78A 4KVZA 1RCFA 4NU5A 3Q7SA 4J0GA 5K0NA 4BMPB 4BE7B 5CX4A 1AKQA 4OGFA 1DT3A 1LS1A 1Z8NA 2RIPA 4EJFA 1DV1A 3LT0A 4MVJF 4ZOAA 2PXCA 5IN5A 1P17A 3KSBC 4BVJA 2IEBA 2Z2IA 4R0VA 2D7JA 4JH0A 4YJGB 3V2UA 1X13A 1DGQA 4RS3A 1DDOA 5DSXA 1G60A 2NU6A 1HOTA 3IV7A 4JP3A 2IUUA 4P1ZA 1H5UA 2HA5A 3OLWA 1N2HA 3OQPA 3SZGA 3TQTA 1J20A 5DFAA 1Z2EA 5EPEA 3PHLA 1MAHA 1F7UA 4BO1A 3PX2A 3F9RA 2D2VA 3A1EA 4AJJA 4E88A 2VHQA 5DLYA 1NI5A 1E7YA 4OL9A 3PKIA 1E9RA 2WLSA 4PAQA 2P62A 2IU4A 4MYUA 3MJSA 1PL7A 1BA2A 3BX1A 3KBBA 3K9FC 3FYDA 5BR7A 1QFSA 4RD4A 1G18A 4WCDA 3VR5H 3HRKA 3IIMA 2HQOA 4FIDA 1O8CA 2I9KA 1WUKS 1T3SA 2Q6LA 3QLVA 4MS4B 3C3JA 3ZGNA 3C5HA 1BJRE 1L4MA 4DQXA 3WK5A 3I37X 3MTIA 3FTCA 4JJGA 1OBHA 3D59A 3LSYA 1JSXA 2ENUA 4JOCA 4C6RA 1LX7A 4CM3A 4EK9A 3HTXA 1PT7A 4GE3A 4FK8A 5F64A 1P2GA 1VJDA 2OO5C 3A2NA 3QW4B 2AMVA 3OPVA 4LRWA 3CT4A 4YRKA 1EU1A 2ZYRA 3FB4A 4CCWA 3OUZA 4KQ2A 2WRZA 2X6RA 2YJ3A 1I5OA 2CFCA 2P65A 4NP6A 1R64A 4U3JB 2ORWA 2YIJA 3GEIA 1NIJA 3HDHA 4K6HA 1SIOA 4JYBA 4BTEA 5JDCC 5I47A 1ZSVA 4B6FA 1PQUA 2P30A 1FNCA 1MR3F 2YR0A 3UCEA 5L8VA 1WUJS 3DGFC 2GHTA 2O2DA 3PE3A 2DCMA 3BWCA 3CS3A 1K5HA 2V5UA 1J07A 1Z4JA 2CHQA 1KWGA 1Q7EA 3H65A 5AOAA 1J8YF 4TV8B 3U4DA 3PX7A 4P80A 1VZ3A 2OOKA 3TI7A 3H0CA 3L79A 4G23A 4O2AB 3AERB 2O2JA 3I9MA 4W4TA 1VIYA 4CW7A 4UTPA 2VH1A 1SXJB 3KYDA 3AEZA 4MMXB 3AR3A 3S29A 3V8BA 3OJEA 4OH7A 4TUYB 5EN4A 5KOHB 1V37A 1M0EA 1JT2A 4M88A 5D2CA 3G2PA 1DC6A 3M5CA 1K98A 1PD0A 4LN1A 1W59A 3FCCA 2NO9A 3RKUA 2ZT8A 2MTBA 2D7CA 4UE3S 3USZA 2IYPA 3RREA 4BYGA 4QM6A 5KJCA 3F2IA 4C22A 1OLXB 2BMEA 1XAGA 2AMLA 2X15A 2FX2A 3I9NA 4TKVB 2KJQA 3BYZA 3OZDA 3RK0A 3I9LA 1KO5A 1LI7A 1BQEA 3Q4GA 1QO0D 1JJAA 1RWOA 1YBMA 2C4MA 2OKGA 3MCAA 3V7NA 2OCKA 1QKIA 5AMXA 3VU9A 3MRVA 3IBYA 5KS2A 4OHUA 3KXPA 1MG0A 3JYPA 3M6LA 4FZRA 3V4RA 3B3QA 3O8QA 1H3FA 5KNCH 4MPJA 3EVDA 1PJTA 1UJMA 3GRZA 1H6DA 4KCGA 5CBPA 1E9DA 4EVQA 2BGWA 3ZZUA 2A1TS 3AEUB 3DLAA 4YAKA 3ZJUA 2ES4A 3AHCA 3ENZA 3P20A 4M0EA 2R2GA 2JFOA 3Q7PA 1N6NA 3WGJA 3GEBA 1JG6A 1DAPA 2WPDA 5JD4A 1ZI8A 4JVMA 2VK8A 1UT6A 3BDAA 3V1LA 1CQWA 4TVKA 5JYBA 2Z6UA 1PF7E 4UMDA 5BQ3A 4Z54A 3I09A 4LHXA 2LNDA 4J1SA 4TTVA 5J5CA 1FFSA 5EWJA 4TSKA 2W98A 1QWOA 3LFUA 4XIYA 4M36A 1AHPA 3MGKA 5DHAA 1O54A 3CEJA 3O4FA 4J16A 1MIOA 1EXWA 4LZLA 3AUFA 2AZTA 2ZWIA 4KK4A 4O59O 3EXAA 5CA0F 3GLFE 1YRQA 3OZCA 4JELA 5FEMA 4AJEA 2QGNA 5FHQA 1E9BA 1OROA 2LV8A 2EQAA 5K0CA 1M8PA 1Q2UA 1XTPA 2Q5JA 2N3ZA 4OFXA 1FDIA 2W4MA 4LPKA 3A6JA 4X8MA 3ZPXA 4D9NA 3FN4A 2WSMA 1Q3TA 3EZXA 5AO9A 1OTYA 3KX2A 3R3HA 4AZTA 4BUZA 2Y67A 4JHLA 2QW0X 1W35A 1UOQA 4RVDA 1UWKA 1LVHA 2FI1A 1TUGA 3GDGA 3JALB 4FFDA 3UFBA 3MCUA 3KQLA 4W9MC 3WMGA 2WWTA 4PC3A 4RA6B 9ATCA 3TG8A 1I01A 2J3QA 3N8DA 2O54A 3FI9A 4WXPA 1QMPA 3WLEA 3PG5A 2I4NA 2JBWA 2AT1A 2XB4A 3A4VA 3IIKA 1NVUQ 2YNMD 3OTQA 4P22A 5LQCA 1DFIA 3G9TA 1KFBB 1M34A 2QTNA 3I01A 3KFVA 1KJ8A 2OGUA 1KI2A 4OI4A 2FR1A 1OZAA 4ETMA 3GFQA 3H42B 4JA0A 2VDQB 4WFJA 1TPYA 1LQTA 3TPCA 1M1YE 1L9XA 3ZDQA 1JX6A 2E1PA 1WXHA 5CA1F 2FUNB 1LU9A 3NXSA 1S2MA 4L4ZA 2CXNA 3DVAB 4O1IA 4JI8B 3VH2A 3HADA 4A0QA 3P4UA 1MOPA 2HBRA 2LE0A 1KKUA 1L5FA 5LQDA 4LOHA 3B52X 4B35A 3CWZA 4DSAA 3ROFA 5CFMA 2PS9A 2PL9A 1P4GA 4L2IB 3AKDA 4KH0A 3TAXA 1KI4A 1SXQA 3DBIA 3K1ZA 1ONOA 2Q6IA 1HLFA 5DSZA 5B3AA 3RTGA 3VPAA 3ZY6A 4ZYVA 5JSYA 2YJ4A 4HMOA 4XCXA 4BCBA 4D9KA 1FQWA 1OWPA 2QSUA 5CTAA 3ZE1B 1Z0JA 4DY4A 3JD3A 4Q9LA 1O2DA 1JIJA 3KJXA 3TOSA 2ZJ6A 3P52A 2X9LA 2A9KA 1BE1A 3MHTA 3EYAA 1TYAE 1Z0ZA 2AOWA 3AI2A 4U6NA 2GUWA 3H86A 2YWGA 3S2GA 3B9BA 4DF3A 3D4LA 5LA6A 2C20A 3H11A 4WT7A 2Q28A 3SQLA 2AEEA 2W22A 2YV3A 4URFA 4F3NA 2R8PA 1QFXA 2ZJFA 3T7IA 3JR7A 2Q3MA 1RP1A 2H65A 2J9XB 4UAUA 5WRFA 4XASA 4QICA 3H8VA 1W75A 2ZCVA 1EK2A 1JKJA 5HKKA 1K7EB 3A04A 3OICA 4BVGA 3OHPA 5BNZA 2UUAB 1SRRA 3FFXA 1ULHA 4RGYA 3VV3A 3AHHA 4CKBA 2SHKA 4HGRA 5AKHA 1ECGA 3TXAA 5JAOA 1B73A 3H87A 4KIGA 2XCRB 4KQEA 2Y4OA 1O7JA 1GG9A 1PL6A 2IZZA 1A4IA 1XD2A 1L5SA 3AY0A 4EI7A 3GV0A 4YLGA 3UBTA 2W6QA 1NVFA 1FPQA 3LFTA 1ORIA 2WJGA 3BREA 1GDHA 3OF2A 3E70C 1U0NA 2YXLA 4OY3A 5ALKA 2BF4A 1JLLA 2PM8A 3C3DA 2OCLA 2AJDA 3MBKA 4LJ4A 3SC6A 4C4PA 4XQGA 5AJWA 2B99A 1VA5A 4R1NA 3HXOA 3RYCB 1LRKA 2JLXA 3TLCA 1G55A 3RV4A 1OA1A 1FSSA 3HNRA 1MG5A 3LSTA 4LY6A 1XAJA 3L7YA 4GMXA 3EGOA 1GLVA 1TMYA 1VKRA 3MSCA 5KNCA 1KYWA 2VAVA 2H31A 4XWWA 2OCGA 4D8TA 3Q8MA 2WVAA 3E9EA 4HB2A 4JLAA 5J63A 3OZRA 2LDBA 5DOVA 2DYKA 4EY6A 3PKZA 5CXSA 3SM9A 2W6CX 2DUJA 3AB8A 3N86A 3UATA 5BWOA 3AR9A 1FYVA 2Q4RA 1RDFA 4JJEA 2ZRLA 5E0OA 3FNEA 5EZYB 1LW7A 4PSVA 5M34A 1P6QA 1XR3A 4O29A 3UJ8A 4UZEA 1C9YA 3BERA 3AHIA 2QMUA 2PL1A 3HYTA 1NJ8A 3VOAA 3I28A 1ZGBA 1D5CA 4N3AA 1S7GA 1YDFA 3DBOB 1W49A 5E7MA 3T7AA 4MRPA 3ASUA 2Q1WA 1PJ3A 5DNWA 1WUTA 1V1MA 3CCFA 3K0CA 4H1WA 1IBMB 1U5BB 1WW2A 1UXGA 2H00A 1H69A 3I1FA 3BE8A 3OTIA 1VHTA 3QEJA 1QVWA 2QN6A 4OQ4A 5FNVF 5FWYB 2WMYA 4D6YA 3TECE 2HDNB 1Q0TA 5JWOA 4X20B 4QBGB 3FPEA 3FYUB 2DETA 4RH0A 3MCVA 2O7RA 3IPRA 4HH4A 1KBOA 3NBFA 3MWGA 2VDPB 4A8JB 1O0BA 3FJ1A 2Y66A 2VUHB 3CM0A 3N5CA 3UMYA 3CE6A 4OQDA 1ZQ1A 1GA6A 2XW6A 2PKYX 5C81A 5BWBA 2HUPA 1RXSA 3QJYA 4LJYA 5GOZA 1DO0A 1PDVA 1W0CA 1I7PA 2Q3HA 2Y1KA 3FMPB 3IP6A 3LFHA 3QTTA 4ECEA 3VISA 4EBBA 1HM5A 4Q34A 3DLHA 1YC5A 1QF7A 4R01A 3D1VA 4MGEA 3CX3A 4NYJR 1R0CA 2H54A 3NRBA 1AY0A 2QPTA 3U3XA 4PPNA 1P4JA 3ONFA 1ZKDA 3I5YA 4Q1AA 1IBKB 4KE8A 2H7VA 1XVVA 1E6EA 4V1CB 1KI9A 3F97A 3ZDCA 3QELA 3QYAA 3RRMA 2KI5A 1JQLB 2RK6A 2VHUA 3A4TA 2PLAA 3O84A 3U3JA 4DYDA 4OMFG 3K0HA 3KJNA 1DMSA 3OLCX 3IUBA 3PP8A 4UPEA 4R81A 5JH7F 1Y89A 5BNFA 4RLQA 3N74A 2XUFA 1C2TA 1BHJA 1ZJJA 4M1YA 1P7PA 4IIEA 4UQLA 1ADJA 2GN4A 2IZ1A 3A2KA 221PA 2NZJA 2V9ZA 2GF0A 2FN3A 8ATCA 2XZPA 1KZYC 4H6XA 4KP7A 5H81A 2GASA 4YDHB 1ENPA 1AN9A 3D0OA 4EG3A 3TD6A 4YACA 4JENA 2QTRA 4LSWA 1WF3A 1SG0A 2G9UA 3AEQB 1VM6A 2IW3A 4HH0A 4LRYA 4Y6RA 5D51S 1K3TA 3TSOA 1NV8A 2Y8EA 4U00A 4YJ3A 3AIMA 4KQWA 4Y9TA 5ALFA 3W5JA 1OT3A 1PQYA 2ACWA 3U4IA 5H68A 5AJUA 4F2HA 1GRQA 1XHLA 2EHJA 2HQBA 4J03A 4P82A 4UARA 4NK5A 2ONJA 1VPDA 3JQCA 3PWSA 3Q2IA 1H2YA 5FWNA 3TPFA 1VCNA 1JLHA 2G9QA 2DE0X 2BFEA 3D8BA 1OGIA 2YW2A 3QFHA 5CB4B 2VCHA 1M2GA 1TA9A 2VRWA 1EZZA 1XMJA 3G2LA 1JDPA 3KZ1E 3PQCA 4UBLA 1R12A 2GO7A 1P1RA 2BWJA 5FP0A 3RTDA 3U37A 4H7HA 1W88A 3NZEA 4XX0A 4Z8XA 3HZOA 2QTFA 3T7SA 1V11B 1WNTA 4TXHA 5FBWB 5B3KA 3W9YA 3AU9A 3COSA 1Q95A 3KHTA 2PX6A 1KZ9A 1NAIA 1E98A 3PA8A 3ZWMA 4Y2TA 5EJ7A 2ZPUA 2ZIAA 4CL3A 2PYIA 4AKSA 5EJ4A 4KUGA 1U7OA 3PTAA 3GLFB 4HAUA 4G0ZA 4OMCA 5FT9A 1R6DA 3C98A 4J2HA 2H8KA 4FBGA 4EFKA 3CPSA 1WDWB 3SR4A 2CLHB 4HWGA 1QHHA 8ADHA 5L9AA 1YKFA 3DJYA 5MFZA 4YALA 3EOBI 1TUEA 1YDEA 4IIJA 1XTTA 2W42A 2JIMA 2ZJ0A 3DV9A 5H9WA 2FW0A 3F9IA 4FYXA 3G5TA 3KJHA 4FDAA 3DDZX 2RAPA 1J24A 4GRDA 3GLUA 1ZOOA 2E21A 3L82B 3P4YA 4JR0A 5DLDA 4E33A 1YB2A 1QQ7A 3AP3A 3DFUA 1E3DA 4M1TA 3GEGA 5FTMA 5KNBA 3PXCX 4K88A 2YZMA 4JBXA 1FYXA 1M66A 1WD7A 5CW2A 3M49A 5KWEA 1EUCB 4MVWA 3PUKA 1UMBA 2OG1A 5FBQB 1QH1B 1CJTC 3ETHA 4KODA 2ZBFA 3IDSA 1KR2A 3VUEA 1GAJA 2XMCA 1V39A 1E3WA 3EARA 2HWKA 3HXKA 3WFIA 4TS3A 1P7ZA 3NW9A 2QD5A 1ESCA 3QI2A 2GF9A 3TQQA 4YDRA 5BSVA 4JD5A 3ET4A 3ZD6A 4I4TA 4KPUA 3AYXB 2QYSA 1IJBA 4CIVA 4GM0A 2RHJA 3MNFA 3ZBTA 5KVSA 1DLIA 3N2GA 4JEMA 3S1AA 2GPSA 2ZQZA 3L0BA 5TGTA 1I7NA 3KZNA 4BX9A 3LS2A 1TD9A 4LPSA 3RI3A 4R8VA 2WU0A 5GVSA 2X0DA 1DWUA 1KEUA 1JW9B 5FPSA 3P9SA 4G5HA 4IIHA 1R3DA 4JASB 4JYPA 2N47A 5KAMA 4B3SB 5JFTA 1R0WA 2F8MA 3A4YA 2OBXA 3D6UA 1E69A 3R24A 1TM3E 1XOIA 4DLBA 1X8JA 2XMDA 4YYEA 1K9VF 1V48A 4HWTA 2X1MA 4FE4A 4C6SA 1SZPA 2X4GA 3CQ9A 1JLSA 1KK2A 1SPBS 4IFTA 5DCUA 1JQ5A 5L7YA 1FSPA 4IUBS 2CVFA 5B1SA 3OVMA 2JZNA 1W4BA 4AUMA 5DSTA 1TXGA 3HO8A 1C1XB 1NI4B 1FNSA 5FTJA 3URKA 1Q20A 2GO1A 4TXNA 4IQ8A 1L4UA 4BNGA 3ORQA 2IWRA 3WADA 1ZN7A 4MV1A 3AVVA 5AVWA 3MQFA 2A5YB 2J4FA 1T8UA 1YBAA 2G1PA 1M2OB 2GDJA 1EWTA 3ORSA 3D3JA 1L5MA 3ANXA 1TJPB 4TYPA 5IU6A 2VZ8A 5KWIA 4UW9A 1XD9A 1Y3BE 4P7GA 4FWBA 2HNAA 3VH4A 2H57A 4B79A 3WQBA 3FYSA 1P77A 3DJFA 3HHEA 4BFCA 3QHPA 1E7WA 1KI6A 1WE2A 5EHQA 2Z95A 2YFHA 1TM4E 3DEJA 5AW9A 3UXHA 3AUAA 3QFTA 2QR2A 4ZMRA 2OV3A 2C4HA 3QG1A 4QUKA 5DI3B 1XMOB 3K9LA 2ZS7A 4RZHA 2CEKA 3RODA 2FAXA 2HT1A 2FDRA 2YNMC 4Q48A 3MRTA 3NHAA 2E82A 4Q00A 4X6UA 3BGDA 1E59A 2ERXA 4XCQA 4MB6A 1G19A 2CHGA 1G8YA 4G1FA 4TYQA 4KGDA 1YS1X 4NULA 4YMSA 1Z0SA 1J09A 4XUCA 3RS9A 5JSQA 2NWQA 5EJ5A 3N6VA 4WNAB 1QNFA 4D98A 2AG0A 2YJGA 4H3VA 1C7JA 3CT6A 1N0WA 3VR6A 2VA8A 2XD9A 4HPJB 5KJ1A 4GGOA 1K0FA 1KSFX 3O4HA 1NJGA 3STHA 1YH3A 1PRYA 2RIRA 4MVXA 3RC2A 2DZDA 5J23A 1EIZA 1CP3A 4LY3A 4TSRA 1ONSA 1S96A 2AFIA 5CLJA 2OLKA 4MLZA 3UHOA 5A62A 2FMIA 5K8UA 4MSUA 2IYVA 2JLZA 2GFHA 3I4CA 4QJ4A 1IBSA 3KUKA 1KAGA 1XRRA 1KSGA 4GBJA 3UWKA 4A8TA 4DQUA 1ZNYA 2PQ6A 5EP3A 2VQSA 3VPFA 5HSGA 3GF4A 4XM1A 4Z99A 2EBUA 3L8CA 2P4EA 1KR5A 1QDLB 4NATA 3GLHA 2WM3A 4UCXA 3QKSB 4HQKA 1NBMD 1ZN9A 2ERYA 1OH7A 4P7FA 2CVQA 1RZRD 1EK5A 3L7MA 5A7FA 5ABPA 1Q1QA 4AQYB 2V55B 2IUEA 3DOFA 2VZLA 4HZGA 4OGWA 4DV6B 3HKCB 4J4TA 3TLGA 1I4EB 2YUTA 1MMFB 1YFKA 3FMFA 2FPGB 2PMWB 3INGA 1CRQA 3LBNA 4FFMA 1VJ5A 3KKZA 3ZHBA 2PGJA 3PEYA 3DWGA 4NOKA 1NG1A 2JFZA 3BFXA 3QX7A 3V4OA 1W48A 1Y5IA 2ZKLA 3AY6A 3B9PA 4FNGA 4BN5A 4UTVA 2NO7A 3R4CA 3RT1A 3A25A 1VIAA 2BRUA 1G0OA 2XTZA 2C42A 4ZQGA 3SZRA 1N5JA 1PFKA 2C7VA 2GEJA 2R7MA 2IEAA 4TXMA 2AC4A 3BH7A 5HIMA 2O8BA 4ND1A 5DCYA 3FSEA 5BW4A 2D0OB 2P68A 4KYTA 4YRNA 2QRGA 1JS1X 4TN5A 2QAGA 3HBMA 1X7HA 1WV1A 3CZ5A 4G3XA 4GEGA 4NIMA 1IN4A 3HJTA 3U7QB 2DJIA 1HPLA 4AI6A 4LXQA 3GPCA 1RI1A 1EEXB 2CCJA 2IC5A 3FA2A 5G4KB 4IDEA 3N8KA 4DWWA 1FLAA 5ILQA 5DIZA 3SC4A 3WTCA 4LXYA 5I3ZA 3FHTA 3VNSA 1AXGA 3ORFA 1L5RA 2CXRA 1C4WA 1DDGA 3I6IA 1PFUA 1SQ0A 3BDVA 3VR0A 2JANA 4MB2A 3AP1A 1KZ7B 2J5QA 2RK3A 3DBLA 4OBEA 5K3DA 3C6QA 3MC1A 4DDKA 1Q0PA 3RKSA 3VPGA 3UFXA 5LC1A 2AW3A 1IPFA 4N1AA 4ATNA 2EIHA 5B1YA 1SOMA 3JQ8B 5LP6C 5F5LA 3LPMA 1DHTA 1EM8A 2OLJA 3V6MA 4FX5A 4OHMA 1XVUA 1QRUA 3U19A 1XRPA 3DYIA 3B6IA 4CDRA 5T7BA 5I7AA 2QRNA 1E7QA 2R6ZA 3I0NA 1KYXA 4PHGA 5DTEA 2GN2A 2HKIA 4A4DA 1CKEA 5G1OA 3EQ6A 1T4DA 2RGYA 4O4HB 1QK3A 1IG0A 5CU7A 3VQTA 3ZZTA 5IKEA 5KDDA 1SUCA 3A9RA 3BCSA 1UBKS 1RLIA 2XRMA 4Z0HO 3JQRA 1TVEA 3CKMA 2NUAA 1RAHA 3NQ41 3OZTA 3OPXA 2WHQA 2AQ8A 4N6GA 4RCZA 2ZJ3A 4Z4HA 3PVCA 1LLDA 1YCFA 4XWAA 5JY6A 2ZRJA 3QY0A 3HA5A 5JSKA 2PH1A 1H3EA 3ITNA 2YRWA 1RHQA 2BZSA 2JGJA 1LSOA 4UEQA 4GH5A 4XIFA 2QM7A 3G9UA 2UVDA 3TKLA 1FDRA 3JRNA 1L5ZA 1PWHA 1EUZA 4J0JA 4UEJA 4P36A 1EXVA 1DJOA 5CCBA 1AA6A 4BP8A 5B3LA 1DNPA 2CY0A 5KNCD 3P96A 2HOQA 2GARA 1BS9A 1E92A 2IITA 3KL4A 1IG3A 1NFQA 1I7DA 2AYYA 4LF8B 1UDAA 2IP1A 1LX6A 4LE2A 3I1YA 3SD7A 2Y1GA 3QPWA 5DO9A 3EISA 4E09A 3FH0A 4JLWA 2A6PA 5DLPA 5AVKA 4A2CA 4GZLA 4R0MA 4DM4A 1ORDA 1PI3A 4OJTA 5B58T 2ZXFA 3BCHA 1PS8A 4FBLA 4I9FA 3UKDA 3ZCTA 4LYJA 4WXHA 5BUQA 3ER9A 1LEHA 5AKIA 1PFQA 4PNPA 2CC2A 1IB0A 3DAFA 3AFMA 3SDZA 1FXUA 1TYZA 4CF4A 1XF1A 3NATA 1QV9A 4QODA 3RVJA 4C1NA 4HX5A 1T5TA 3CF2A 4D9EA 5J4LA 3K6SB 3DKVA 2VNAA 1Q6YA 1DCKA 4RQBA 5A4AA 3F6SA 3DC2A 2O0LA 2Z9BA 1E9FA 1JHVA 1OLUA 1YZFA 3CUVA 1S5PA 3NPMA 4O4LF 4PZPA 3DXXA 3DE3X 4IWYA 3V8NA 4RPHA 4UXIA 4MPDA 4H2DA 4HGPA 1IY0A 2R8YA 4FD2A 4K3VA 4P7JA 5NLLA 1L5LA 1R4MA 5DE3A 4ECAA 2XGSA 1L8OA 2YXNA 4QHYA 1GPLA 1HDEA 1MO2A 5CVDA 3U44A 1OV6A 4JI4B 3WWYA 3BXGA 1NT4A 3N53A 2XR1A 3LQRA 4DNQA 1OHHD 4WGGA 5CNKA 1FSFA 1J2YA 1OFIA 2GWRA 2NTEA 2ZRGA 4UCWA 1AJEA 1AGNA 2WWGA 3LY8A 4HNHA 1NVEA 1GYPA 4BZXA 4WOCA 3BGWA 4GT1A 3SJ7A 2FTKE 3ZWAA 3KHUA 1XWIA 3FMOB 3HDGA 4L5BA 3WWZA 1U04A 5EC8A 5DHRA 3PKJA 4JNCA 4YRIA 1GCIA 1H1DA 4Y1FA 1C9NA 1E79A 1TCAA 2PWBA 1Y1RA 4HDNB 5AUQA 2O9JA 4NZ9A 3RSGA 3NASA 3LT1A 4FKBA 5F4BA 5L53A 3VTFA 3ZD8A 1Z68A 3AVXA 2F4VB 5EINA 5BQOA 4A73A 4G8JA 1RLJA 4ZC8A 1R0RE 1L3IA 4QU9A 4N3BA 1L7EA 1U2PA 2WSIA 4LJ6A 1HDZA 3LQKA 1RNLA 3BXHA 1VMKA 1U2QA 2HWYA 3B53X 4M4SA 3PQ7A 5HZKA 2KQUA 1Q3KA 2Z8YA 1SCKA 4Q3OA 3T9EA 4Q16A 4R5HA 1V5GA 3ZWDA 3FCUB 2GVZC 2P6UA 2Z2XA 1LPAB 1QGYA 3DBHA 3RVQA 2XUHA 3PFKA 5FH9A 2OESA 3P2YA 4TN1A 4PAWA 2AG1A 4DSUA 1GZVA 5K3AA 2CL7X 1HX7A 1YJBA 1ZMBA 2NADA 3O8OB 2IP2A 3BF7A 4H1UA 1PO7A 3T3DA 2VQEB 2HFJA 2A5GA 1KH2A 2VSFA 2ZZKA 3I1IA 5B53A 4EHKA 5DBIA 5CD9A 3IEUA 2B25A 4ZGWA 4WASA 3GMDA 1QMGA 1JECA 5B4VA 4FFLA 2NUPB 1CK4A 2P5YA 1NVMB 1RVDA 3HVUA 3G7NA 4PC1A 1ZK2A 3KOOA 1FDUA 4RK6A 4WK0B 4EY5A 5JQGF 5I9LA 1EAMA 2JHAA 3O4RA 4HUTA 3UT6A 4D5EA 4BNXA 3VPSA 2WU8A 1YTLA 3SBEA 5EHXA 3QFFA 2ZETA 1B0UA 2ODTX 5IDWA 2DPHA 2WDPA 4L3VA 1EJ0A 1XDSA 4MV0A 5MN4A 1P81A 4OQFA 1BRMA 4S3MA 4W5WA 1KK0A 2A0WA 1QRSA 1OVMA 4OUKX 2IEGA 2CJXA 4TZ6A 3L9XA 2DLDA 3L46A 3N3BC 5KINB 1G9XA 2B69A 3OM1A 2AFVA 5LB2A 3HO1A 1IHXA 1OV4A 2BOVA 4B48A 2J31A 1Z6YA 1EFRD 1L4KA 2HAEA 3CC8A 3P0RA 1IXKA 1XP5A 2IXBA 3P94A 1FDSA 1P2SA 2EU8A 3REGA 1ECBA 3ZWPA 4JOSA 4HLUC 1JDBB 1DO2A 1O9GA 3QA9A 1DAKA 4BMNA 2HJHA 2EKDA 2WIJA 3ZU4A 2A30A 5TS2A 1W85B 4AYWA 4BO7A 1RRFA 1SKAA 2C3YA 4MYTA 2J0UA 5K4AA 4F4FA 4Z7QB 1C14A 1HGXA 1U2GC 2FEWB 1SVOA 1ZONA 1ZCZA 1YKGA 2YWEA 2OM6A 5CJPA 1XK6A 1I5EA 4A26A 1ZWLA 4F12A 1CD5A 1DJPA 4UUQA 1C3XA 4XSHA 4ENSA 4LDPA 2V7QD 3K0AB 3KQMA 3GJZA 4KIWA 4BNWA 1HDXA 3C1UA 2VSQA 2OXTA 1X1AA 4PLCA 3WMEA 2DBQA 4U2BA 5KTNA 2O57A 3E27A 3K6JA 4RVGA 2O19A 5ALJA 5KQGA 2C98A 4Y9DA 4I6GA 2IDMA 1GTSA 1CP2A 1H8HD 3CPJB 1A98A 3A7DA 4ENVA 1K92A 2K4MA 3CBQA 5COQA 3GCZA 1W6RA 2J7KA 1BE8A 3QP9A 2H18A 4F3YA 1CUCA 1SY7A 3B2NA 4OCZA 3G1WA 2CCGA 4GMKA 4LHSA 2XKAA 4KTTE 4WLEA 1X92A 1NW9B 1NP6A 3Q3HA 4YH1A 3ZWYA 1W25A 1NW6A 1RC1A 4XD7A 3UJBA 4FKZA 5C46F 2PX8A 4N8SA 5DT2A 3TTYA 3R6GA 2A94A 1XEWX 3W6NA 3WGTA 4MCIA 4PQFA 3A3NA 2F3TA 4ZO9A 2YH2A 4POOA 1H4VB 4QKQA 2HW8A 4NH4A 4N54A 1YMUA 2B1JA 1UXIA 1F1JA 3L7BA 3C5VA 4JITA 3DT8A 1GUYA 1LZLA 3TLBA 3TVDA 4RMHA 3PC3A 1AS3A 2LCQA 2CV0A 2E37A 4CZ2A 4E5UA 4IAOA 5LDGA 2HEIA 5GV7A 5K6TA 4DV0B 4V2IA 4J16C 5FWAA 4R1PA 3ZLVA 1MT3A 3BC1A 3NUGA 3O91A 1HL7A 4PX2A 3W05A 1RZ3A 2TRSB 2EKPA 4B3XA 1QVZA 1GY8A 2NAPA 1JJBA 2WKWA 2YJTD 3QKRA 1G8PA 4MGKR 5C7OO 1TUBA 3DMRA 2FUKA 1F06A 4O8CA 2YXEA 1NRIA 1Z4IA 3D3EA 3NOOA 4BFZA 4UOEA 3LK7A 3EH1A 4ZKDA 4N5LA 2CB0A 2G7MC 4I4LA 4HBGA 4DWOA 1RWXA 5JBNA 3QITA 5HP4A 2NTJA 4MQ5A 3TW4A 5B12A 3SE0A 2C92A 5I4KA 1U80A 3PNPA 3FD8A 4XB6B 5B2ZA 1SOWA 2RAVA 2E4ZA 1YOVB 3C85A 1Q19A 4N9QA 4R68A 3RUCA 1PZEA 3TJMA 1J2EA 5KCMA 3QA3E 1MPTA 1AOXA 4BU0A 4XYMA 1XZPA 1EQAA 3RFUA 4BFSA 2AD1A 1BXRA 1KK1A 4N03A 2W9XA 3B38A 3LZDA 1NBOA 5BN3B 3NNDA 3NKFA 3GLGE 2Y4NA 3BB3A 2A1TR 3OEHA 4L4UA 1Y4ZA 4BWYA 3EEOA 3GR6A 4V03A 4M55A 2ID9A 5KWVA 2N1MA 1U8UA 2OZLA 2Q6VA 4KVAA 3THOA 3R9IA 3KLOA 5BV8A 2QRZA 3HKBA 1T3TA 1N1EA 4TLDA 1VPEA 2NVBA 3GD5A 5JIBA 3IHKA 2BEUA 1RWMA 1UDBA 1MB4A 1UAYA 1ZOLA 3MWKA 3QI7A 2Q1TA 3WL8A 3WGUA 2G5PA 3VR6D 4AC9A 4C4RA 3UGJA 1U4SA 3IA2A 2JFWA 3ADDA 5AHKA 5HCUA 4B3FX 5IUNC 1GQ2A 5JAUA 2YCLA 3D2LA 3OZEA 1VJ1A 3ISVA 1SG9A 1NMYA 4KQIA 3BN3A 3LLCA 3MYRA 3RVSA 2J45A 4KIFA 2OC9A 4BN0A 5KHAA 5JWHA 3HB9A 4HVCA 4DIKA 4DUPA 2AS0A 3H6HA 3SQNA 3HP7A 4EB3A 4XEHA 2OP1A 3ESDA 4FOPA 1SBIA 3OM8A 2CLFB 2IU6A 2QJWA 3AWIA 4HSGA 4MA4A 5HK8A 3ZD9A 4N0MA 3LPDA 3KXDA 3WYAA 2VSNA 3ADPA 4EW1A 1NSTA 3C3EA 2JFNA 4WI1A 1P80A 2IOFA 2ZIZA 2O7NA 2ZJBA 2E6KA 3EGCA 4YRPA 5SYMA 1Z83A 2PUHA 2VOEA 3MJ4A 3O4VA 2Z3WA 4GR5A 3COWA 3OZAA 3T7KA 3BMCA 3EVFA 1EH5A 2O2XA 5D6OA 4CMGA 2YC2C 1YJ8A 1ABBA 3KVNA 5LXTF 1QV6A 1NMEA 2RG1A 4Q3BA 3PNVA 5BN5A 1V0JA 3LPLA 3Q40A 2QX7A 3VDMA 3JX9A 3JQFA 1YACA 3X2SA 3DOJA 3IVRA 3G79A 1YR1A 3I1JA 5J1TB 4QOSA 2J6BA 3BJZA 2PZLA 4ND2A 5DB4A 2IRWA 3A3KA 5GJCA 3QRWA 3FCAA 1GZ7A 2FZVA 2H06A 3AILA 2XB2A 2NQTA 3KVRA 3VO1A 2FWMX 3ZKWA 1SQ6A 4O02B 5FBHA 1IDOA 2R60A 2P0YA 3G0BA 1PR2A 3JTEA 5FX2A 3FOZA 2ZDGA 4GE0A 2X41A 3L6RA 2J9GA 2QUIA 4MR7B 3IVCA 1OU4A 3OCUA 1VMEA 4B7ZA 4R7TA 5HFJA 1Z37A 4QOEA 5E7JA 4J7AA 4PLGA 5KAPA 4M22A 1I6WA 2VLBA 4RQAA 2VAMA 4CEJB 1JNXX 5P21A 4MR8A 5K8TA 2QN1A 3S2ZA 5TVGA 1Q7GA 2Q5CA 1PFGA 3HYSA 3O0DA 5CK4A 5LIPA 3IEVA 4JJFA 1A8HA 3IFSA 2EEPA 5CGZA 3OZGA 3TNYA 4YV1A 3E0XA 3GA5A 1D04A 5DP1A 4B4WA 1T0JB 4S0ZA 1KJZA 3BKWA 1WB6A 3A31A 4EY3A 4ZZ1A 5EWLA 4BV8A 2RBEA 4R2XA 4US2R 3FTNA 3OEED 4JK3A 5TARA 1X7ZA 2I76A 3W7VA 4FR0A 5CW1A 2XVXA 1QGUA 4YMUA 3GFGA 5EHZA 2VT6A 3FY4A 3I64A 4CKZA 1A7KA 2ZJ4A 3SCZA 3AIKA 4ND8A 2QZPA 1MABB 3WGIA 4CT5A 2LDXA 2I6TA 4Q6BA 3I45A 5AFSA 3BE5A 2WILA 1PR0A 3IO3A 3IE1A 4YJHB 2WHEA 3DV0B 2ID8A 4A5OA 2PPLA 3K0CC 4Y6SA 4IX1A 4ARAA 1KFCB 4JLVA 1VYVA 3CZ9A 2I2WA 5CB8A 3MA0A 3U7EB 3WDSA 1FL9A 3I53A 3GDWA 3MHPA 5IAOA 3KSMA 4II2A 1WMDA 3SBDA 4C88A 4Z9FA 4QOGA 3KZVA 4IS2A 1QCZA 4P6VF 3SYRA 3GN2A 5KMGA 3EULA 2X5OA 2VEDA 3CKYA 3KAJA 1IJKA 3EG5A 5T4FA 1X7XB 4WPGA 4BNDA 5FLXA 1SOVA 1OW3B 1D1PA 2NZXA 3IXMA 1XROA 1Z9BA 5TXGA 3SXUB 1DPGA 1AKMA 3A1SA 4YA6A 3IDOA 5D3KA 4PTLA 2QR5A 2QN9A 4BBPA 1WSAA 2ZIXB 3CUEF 5B1HA 4CLEA 5BMVF 1DT5A 1QHEA 3P2IA 4IO1A 2OB2A 1DG9A 1RTKA 5LQKA 3X3HA 3W9BA 1A7JA 3KAPA 2PNFA 3H2GA 1U1DA 2ASEA 3E23A 2XUAA 3WGVA 2PR7A 3HBAA 2Q07A 4RTPA 1YFLA 1W2HA 3TNDA 1XZFA 5EIXA 4QRHA 1P39A 4YPOA 2OE2A 3LMKA 4RTNA 2CXQA 2KLHA 2BDTA 4ZVQA 5ERYA 2R6FA 4CTMA 3TLXA 2I7DA 4HQ0A 4FZJA 4XI9A 4CCYA 2W2VA 1KAQA 1ZX1A 3ZVKA 3ITKA 5DGXA 1IPHA 4MUKA 3TCXB 4NEGA 3X44A 3B7WA 3DUFA 4ARZB 2DHRA 4XE5A 3VYWA 1ULTA 3FCXA 1YHYA 1JHUA 1HRDA 1WDTA 1LBSA 1SUEA 2BFAA 2FLVA 2VYNA 2W6JA 4E2WA 3DWIA 1Y42X 5KYWA 1DJLA 4RK4A 3OLXA 2R0QC 1NJ2A 2AI2A 4HB3A 4D3ZA 3EA5A 3A37A 3RYFA 5AVYA 1U1EA 2QL9A 2V74B 3PFGA 4OKNA 5H16A 5A4DA 1PV4A 3VGJA 4MMZB 2OHIA 1MRZA 2GN1A 4FPXA 2WEKA 3BRWA 3FPFA 3L7LA 5JSFA 1N2CA 3CVXA 4C4ZA 2E5FA 5ICFA 2IV2X 3A4IA 2EKQA 2GZ3A 1BMFD 3IAUA 4I1SA 4LSGA 3M4YA 3R9XB 1ZXXA 5G4LA 3NTVA 1W9MA 3T9BA 2CVHA 4YUYA 2PGNA 3E7XA 1V5FA 3CLTC 1I4OA 5CT5A 4RZQA 5AKKA 5KSYA 1HV8A 3SEQA 3HFRA 2MOKA 1BZYA 2ZE7A 3DZJA 1KI7A 3FPLA 5DHTA 2OILA 4BUJA 1M72A 3O73A 1BSVA 2I4RA 1P0QA 1Z2NX 3LU1A 2I22A 1W19A 2C3MA 2RGNA 3A1CA 4MAFA 3UV6A 1DBSA 4CVNA 2QN3A 4FNAA 4BQFA 1B6SA 1OH5A 3ABZA 2ROQA 4EJ0A 4H08A 1U3TA 3AR6A 1OPXA 6ABPA 3Q9NA 2Z4TA 4WHMA 1LVGA 5FOXA 5HF6A 1Q1BA 1YGPA 4LFBB 2GAAA 2YVQA 3O8NA 4FEEA 2VHXA 1T5LA 2UUPA 3SY8A 1HOXA 1PGJA 4C0LA 2WB4A 4NL4H 1Z0IA 5FFNA 2B5OA 1GZ5A 1XUOA 5CPBA 3NM6B 3DNFA 5BNIA 3F4BA 4Q4HA 5CLQA 3T3OA 5KYVA 4FEAA 4HI0E 3WHKA 4KXYA 3A6GA