4QTUB

Structure of s. cerevisiae bud23-trm112 complex involved in formation of m7g1575 on 18s rrna (sam bound form)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
191
structure length
190
Chain Sequence
IFYNDSEAHKYTGSTRVQHIQAKMTLRALELLNLQPCSFILDIGCGSGLSGEILTQEGDHVWCGLDISPSMLATGLSRELEGDLMLQDMGTGIPFRAGSFDAAISISAIQWLNADTSYNDPKQRLMRFFNTLYAALKKGGKFVAQFYPKNDDQVDDILQSAKVAGFSGGLVVDDPESKKNKKYYLVLSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multifunctional methyltransferase subunit TRM112
publication title Structural and functional studies of Bud23-Trm112 reveal 18S rRNA N7-G1575 methylation occurs on late 40S precursor ribosomes
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Transferase
total genus 63
structure length 190
sequence length 191
chains with identical sequence D
ec nomenclature ec 2.1.1.309: 18S rRNA (guanine(1575)-N(7))-methyltransferase.
pdb deposition date 2014-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08241 Methyltransf_11 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4qtuB00
1D2GA 2YTZA 3G7UA 4RX1A 1VLMA 1D2CA 2PT6A 3BGIA 3P97A 4RSRA 5GM1A 4ZTBA 1UIRA 2HV9A 5K05A 3TM5A 4A6DA 1AF7A 4X1OA 4YUYA 2OXTA 2IDKA 3HM2A 5JUWA 1P91A 4M37A 2Q41A 4X41A 2I6GA 1INLA 5LQAA 4ER0A 3LCVB 2B3TA 4EKIA 2YR0A 2PJDA 1VPTA 3FTDA 2IH2A 1NW3A 2CMHA 1SKMA 3ERCA 1R00A 4AUKA 5D1NA 5C0OE 3HCEA 1PJZA 1NT2A 3B3JA 2G8NA 3UJ6A 4DQ0A 3EEOA 4XUDA 1KPIA 5FA5A 2PKWA 4FSXA 1RJEA 5E8RA 1I1NA 4F85A 5CVUA 5FHQA 3LX6A 5MHTA 4YUZA 2AOVA 2ZBPA 2ZFUA 3DMFA 5FQNA 1N7IA 2K4MA 2ORED 5ICGA 5CVDA 4A6EA 3NVKI 2UZ4A 2IBTA 1F3LA 3P71T 1TW2A 4RYLA 5EMKA 3GU3A 1NV9A 3FPFA 3TR6A 3HTXA 4GBED 2P3OA 4PYLA 5B1SA 3MHTA 7MHTA 5K09A 2FRXA 3FYCA 3KQVA 3LCUA 4BP1A 2JHAA 3KQWA 4FT2A 3EGVA 3BWCA 1ZGAA 2BR4A 3B3GA 4HGZA 2P7HA 4M36A 3O7WA 4BLVA 1QAOA 2YQZA 5C1IA 4RTLA 1KYZA 2ZIGA 5FCDA 3DUWA 5EMJA 3NDJA 4DCGA 2IIPA 4HTFB 3OZRA 1JR4A 3F4KA 2ZZKA 2JHPA 1EQAA 2P7IA 3UWPA 2C7PA 1ZQ9A 2P41A 4GOND 2NXCA 2CKDA 1VP3A 2O07A 5EPEA 2VZ9A 2AS0A 3UA4A 4YUVA 3VC1A 5K0LA 1ZG3A 2A14A 4GOMD 5K0NA 3T7SA 5K8VA 3NMUF 2ZULA 4AZSA 4WVLA 4C05A 2ZBQA 2GB4A 3BKXA 3UA3A 3O4FA 5E1BA 5FULA 3UFBA 1IM8A 3AWIA 3OZSA 4MTLA 3T7TA 3REOA 2GH1A 1FP2A 2VDUE 3MERA 3UJCA 3GNLA 5DM4A 1O9HA 1X1AA 3P2IA 3LPMA 5DX1A 3M6WA 4CKCA 4HC4A 3GRYA 5CIYA 3OE5A 4XCXA 4E2WA 1AV6A 2OY0A 1FBNA 3MTIA 5KYGA 5CCBA 3KPJA 2Y1XA 2JG3A 1G8AA 2IPXA 3KKZA 3G89A 3GDHA 2PVCA 1VBFA 3GWZA 3UJAA 2JJQA 4FT4A 4HGYA 5ICCA 1L3BA 2PY6A 2WA2A 4X63A 2YX1A 3SM3A 3VYWA 5K01A 1I4WA 1F38A 3M6XA 2R6ZA 1JSZA 4X60A 1I9GA 1L3IA 3BWYA 5BP7A 2FPOA 4M7RA 3P9KA 1RJDA 2FK8A 1NKVA 3UZUA 2ZW9A 1X1BA 3BUSA 2OZVA 4KWCA 2IGTA 2AN4A 4AX8A 3A27A 5E9QA 4R6WA 1KP9A 3FPEA 1VQ1A 4RTRA 3C6KA 3CJTA 3NDIA 4KIFA 4HTFA 1X19A 1SQGA 1U2ZA 3B5IA 3G2OA 5FWDA 4F84A 1SUIA 2JH8A 3P9CA 4KVZA 4PGGA 2ONYA 3CVOA 3HCCA 3LL7A 3LSTA 4PCAA 1DCTA 3R24A 5DM2A 1YB2A 3R3HA 5HIIA 2ZIFA 3MCTA 4B17A 4P7FA 3M33A 3AY0A 3MCZA 4G56A 4YUWA 2HMYB 3D2LA 3E05A 4RTKA 3GRZA 2P35A 5DSTA 3BXOA 1XDSA 2VDWA 3FPJA 3PTAA 2O05A 4PYJA 5U4XA 1X1CA 3IYLW 3I58A 2G72A 1BHJA 4GOLD 4M38A 5CM2Z 2PWYA 2NXNA 1YUBA 2JH9A 5KVAA 4BLUA 2PX5A 3PFGA 3SSNA 5GIOE 4EMSA 3NWEA 4AZTA 2XYQA 4U7TB 2AOXA 2GAFA 2IDJA 3FRIA 4IV8A 4QDKA 1M0EA 4ISCA 3TOSA 2I9KA 1L1EA 3SR4A 2AZTA 2BR3A 2ZWAA 3OU6A 5IKMA 3FTFA 1MHTA 3DXYA 5LQKA 3GCZA 2CMGA 3EGEA 3FUTA 2NNWB 3B7PA 3ME5A 3A4TA 4OBWA 5DRTA 3UJ7A 1RI1A 3ELYA 2EFJA 4LWPA 5CUQA 5E1MA 3LGAA 1R6AA 4QDJA 3RW9A 2AOUB 5KQSA 5ICFA 4YUXA 3OCJA 3G8BA 3P9NA 4K6MA 2PX4A 5GP1A 4KRGA 3G2PA 4V0QA 3AXTA 1EG2A 3TLJA 4E32A 3FTEA 4CKBA 4QPPA 1QAQA 1SUSA 2ZSUA 4GUAA 4ATNA 4FR0A 3EVDA 4BLWA 3DOUA 1JG4A 1XDUA 4QPNA 3FPGA 3X0DA 4MWZA 3CC8A 2PV0A 2FHPA 3GJYA 3CCFA 3CKKA 4DZRA 3A25A 5DXJA 3SSMA 4RTJA 3M4XA 4F86A 5F2NA 9MHTA 4PINA 2EJTA 1KR5A 3KQMA 3UJDA 3HA5A 1VP9A 3CGGA 2GLUA 3TMAA 3TKAA 2KW5A 3G5LA 4AZWA 4E70A 2C7RA 5GWXA 4IV0A 3P8ZA 5HIMA 4YV0A 3TPZA 4MHTA 1NE2A 3OE4A 2H11A 3H2BA 5K0JA 5DM0A 3NJRA 3A26A 3KPVA 3ELUA 4NECA 3DLIA 2EG5A 5HIJA 4FZVA 4R8RA 3HP7A 3IHTA 5GOZA 4QVKA 1NBHA 5FADA 5DTRA 2YXDA 3CBGA 5DSXA 1JG1A 3UJ8A 3MAGA 5JR3A 5CVEA 4QTUB 5EQJB 4RTSA 4CTJA 1B42A 1WG8A 3E23A 3KPUA 2P40A 2E5WA 4JXJA 5K0EA 2AOTA 3DMGA 3LDFA 4KDRA 3SMQA 3DMHA 2PXXA 5DTMA 8MHTA 5FHRA 4ER5A 1V39A 1O54A 4ER3A 3K0BA 2WK1A 4C07A 4LWOA 1R74A 3EVZA 3GO4A 1XDZA 1X1DA 3T0IA 1WY7A 2HTEA 3KQQA 2GA9A 3P9IA 2ESRA 4O29A 3HNRA 4GQBA 4C4AA 5FTWA 3R9XB 4E2YA 4OBXA 4MIKA 2QM3A 2QY6A 2ZCJA 5G02A 3MGGA 4KDCA 2XBMA 5K0BA 2BZGA 2NYUA 2XYRA 3OU7A 1ZGJA 5K03A 5DLYA 4P7KA 5EIWA 1P1BA 4GEKA 1DL5A 1ORIA 3ID6C 2UYOA 3GIWA 4X61A 2ONZA 4OQDA 2ZLBA 3QV2A 3NW9A 2ERCA 1WS6A 1RJGA 5DX0A 4V0RA 4IWNA 3G5TA 2PBFA 1RI5A 1YFLA 3DH0A 2YXLA 4RWZA 2OO3A 2UYQA 2HNKA 3NVMB 3FUUA 3S68A 2PX2A 4QQKA 3I53A 5T6BA 3FRHA 1XVAA 3QOWA 3BWBA 5GINE 1PRYA 3KQOA 1UFKA 4P7GA 3B89A 4RVHA 3DXXA 3C3YA 1KXZA 3SXJA 1Z3CA 4GF5A 2DPMA 2LD4A 2N47A 3JWGA 3G2MA 5EG5A 5EIFA 3OZTA 2ZZNA 2ZTHA 5E1DA 4HRAA 3ER9A 4EKGA 2Z6AA 2PXCA 1KPGA 4C06A 2UYHA 4FGZA 3CJQA 1EIZA 3EEYA 3GGDA 4KIGA 1JQ3A 5CVVA 2G1PA 5FWAA 2O06A 5F2OA 4E30A 3MB5A 3VC2A 3GRVA 4FP9A 4OA8A 5T67A 2V7EA 3KR9A 1JQDA 5HFJA 4L7VA 3PX2A 3LDGA 3IEIA 3Q7EA 1DUSA 3EVEA 3BZBA 1NBIA 2B25A 2P8JA 3HVHA 1FP1D 4R8SA 5K0GA 3M6UA 5H02A 2YUIA 4RTMA 2AR0A 3SSOA 3PFHA 4FS8A 2XVAA 3DTNA 3PVCA 1P1CA 1JTFA 3FUWA 4E31A 1XJ5A 3KR0A 3V8VA 4YV2A 2AVDA 4YMHA 5K0CA 2IFTA 5CD1A 3FTCA 4XUEA 5GM2A 3GRRA 5BXYA 2NXJA 3PS9A 3G88A 1JSXA 5EEGA 3I5UA 4BP3A 4CXMA 5E1OA 3U81A 1WXXA 3BGVA 4PYOA 2GS9A 5DRYA 5EGSA 5FQOA 4DM3A 5LQNA 2OPBA 3FUVA 2PWPA 2ZBRA 4HSGA 1JG3A 4QTTB 4YMGA 3OU2A 4PYMA 3PT9A 1O9GA 3EMBA 4CWAA 1QZZA 2P1DA 3LECA 5DWQA 5EVJA 4HG2A 3UJBA 1N7JA 5LQCA 1YZHA 4GC9A 1BOOA 3JWJA 5EMMA 2Y1WA 3TM4A 4RTPA 3FPHA 3ELWA 5DM1A 3CJRA 1G6Q1 3IV6A 2NP6A 2DULA 3UJ9A 1M6YA 2VDVE 2O57A 1BKYA 3GRUA 4PYIA 2P3LA 1NW6A 3DULA 4MQ4A 1G60A 3HCBA 5IH3A 2Z6UA 2IP2A 3KQYA 4LG1A 2VP3A 4LECA 3FUXA 1Q0TA 1XCJA 4P58A 2ZWVA 2HR1A 3FZGA 3HCDA 4C03A 2ZZMA 2I7CA 3TKYA 1G38A 4RTNA 2BR5A 5FA8A 4UOEA 2V74B 3V97A 3KPYA 5ICEA 2B9EA 3DP7A 2IBSA 2H1RA 4H0NA 1VIDA 5LQRA 2C7QA 1HMYA 3C6MA 4PYNA 4RTOA 1YZ3A 5HZMA 2FYTA 4DMGA 1N2XA 1AQIA 2P3QA 2AN5A 2XVMA 3AJDA 2YXEA 2QRVB 4Z2YA 2OB1A 3M6VA 4QQNA 4DCMA 4RVGA 2B2CA 1EJ6A 1JTEA 2FCAA 3EVBA 3HVKA 4RVFA 3LKDA 4XUCA 1T43A 1H1DA 2BM8A 2G71A 4OA5A 4E33A 5BW4A 4E2ZA 1G8SA 1AQJA 5EC8A 2B78A 1VL5A 3RIEA 1QYRA 5LQUA 1WXWA 3KR2A 4CKEA 4EK9A 2AOUA 3WSTA 2O0LA 3SX0A 4PIMA 5EKUA 2H00A 2OKCA 1M6EX 3R0QA 5BW5A 1L3CA 4POOA 1RI2A 1HNNA 1Q0SA 5HIKA 3TQSA 3DR5A 1IY9A 3THSA 4PGHA 5FUBA 2BH2A 4RV9A 1BC5A 10MHA 4KW7A 1R8YA 3GXOA 4C08A 2ZIEA 1ZHFA 4R05A 3L8DA 1NW7A 1EJ0A 3OFJA 3LBFA 2ZVJA 2NXEA 4DA4A 2OBFA 2PGXA 3HA7A 3HA3A 1FPQA 1UWVA 3ORHA 5EHGA 5LQJA 2PXAA 3I64A 5KQRA 4PNEA 2YVLA 3NWBA 1XXLA 3EGIA 3LKZA 2Z6QA 3HEMA 3KU1A 3C0KA 1P39A 3KHKA 3DLCA 2BM9A 3RODA 1SG9A 2AN3A 1RI3A 5LSAA 1MJFA 1KIAA 3KR1A 5DXAA 3TRKA 4FSDA 2G70A 3ELDA 2VS1A 2EX4A 1IXKA 4WXHA 2NP7A 3DXZA 2QRVA 2QE6A 2AOWA 4DF3A 1JG2A 3AXSA 3EMDA 3LBYA 2QYOA 3C3PA 5DX8A 5P8WA 4E2XA 4GC5A 1FJXA 2IH4A 1KHHA 1R18A 3KQTA 4PWYA 3EPPA 1EAMA 3LDUA 4HH4A 1R8XA 2AVNA 4YV1A 2CL5A 3PLAE 1ZKDA 5DTQA 3HCAA 3PX3A 2C7OA 4PIPA 4R6XA 3THRA 3T7RA 2HWKA 3HVIA 3K6RA 4ER6A 4DKJA 1RI4A 2GPYA 2CWWA 4Y2HA 2PLWA 4U7PB 3SGLA 1XCLA 1XTPA 3JWIA 5EZQA 4IKPA 1TPYA 4Y30A 2PSSA 3MTEA 5E2BA 5E8JA 5D1HA 1G55A 5KS2A 2ADMA 5HEKA 2OB2A 5K0FA 3P2KA 5T64A 4RTQA 4PONA 3EVAA 1YF3A 5E9JA 1L9KA 3ANXA 3E7PA 3SVZA 3EVCA 3PB3A 3MQ2A 3ER8A 3OFKA 5HILA 4BY9E 3EVGA 5EZSA 1NV8A 3HCFA 5HOQA 1KYWA 1WZNA 3R6TA 4QVGA 4GOOD 3NTVA 4RVDA 2FK7A 4CTKA 3UBTA 4OX9Y 2WA1A 1NW8A 5LR6A 2XYVA 1OR8A 2I62A 3KQSA 3LHDA 5C9ZA 2OYRA 2F8LA 3A7DA 1RJFA 3EVFA 1QANA 3QOXA 5DPMA 5DT2A 1TW3A 3B3FA 3BT7A 1D2HA 4PCLA 3M70A 5GIPE 4PYQA 1Y8CA 2PX8A 3KPWA 5ERGB 3A7EA 1QAMA 3Q87B 2R3SA 3G8AA 4C04A 1SQFA 1KPHA 3BGDA 5F2KA 1VE3A 3JWHA 3FYDA 2JHCA 2PT9A 4AZVA 4EQZA 5EHIA 3G2QA 5EKXA 4P7JA 3VSEA 3BWMA 5E9WA 5E2AA 1SVUA 3I9FA 5EOVA 3HVJA 3OPNA 3TFWA 3LCCA 3BKWA 5M5BA 3P2EA 3E8SA 4ER7A 4OQEA 2IH5A 5CVJA 3O31A 3KQPA 2UYCA 5CCXA 1NW5A 5EMLA 2AOTB 1ORHA 5EEHA 2EJUA 4PYKA 4EVIA 1YFJA 1JQEA
chains in the Genus database with same CATH superfamily
3A3NA 1E3SA 2QD1A 3CONA 4LN1A 1HYHA 4G01B 4D3DA 3KZCA 4ZOEA 1R9NA 3Q0TA 5E2IA 2YMLA 3AM5A 5B58C 4ZVTA 2AIRA 2R60A 4JC8A 2GZ2A 4QYIA 3AVPA 2VWQA 3N2IA 3C70A 5DMXA 3QLEA 3ZJUA 2QW0X 4ER0A 5J5AA 3ZWVA 1U7TA 1DPGA 1NG1A 2J6BA 3T35A 4B6OA 1TIPA 2FXIA 2ZOSA 3RH0A 3KB2A 3H42B 1D04A 1VHDA 3ABIA 1JKXA 4IHKA 3AP3A 3QPCA 4G0ZA 3CH4B 3UJ6A 5AJHA 4L6CA 4GMGA 1IATA 5JAPA 1IM2A 3KZMA 4XOIA 4N5DA 5KWIA 1C1HA 1W5SA 721PA 4F3RA 1X70A 821PA 4QARA 5EUCA 1Q95A 3AR6A 3UPTA 4O5OA 5HF6A 3ZV5A 4CL8A 4QELA 4XYGA 5D8DA 2WD7B 2CUTA 2QAGB 2GEVA 2A94A 2RGAA 2VRBA 2X5XA 3N0RA 3ZU6A 3R9WA 1JBQA 3IJPA 7ABPA 2P3OA 1U9IC 3IQEA 4ETWA 3WLTA 1TEVA 2ECFA 1EE2A 1NI3A 3DMTA 3FIUA 2XH8A 3BWCA 4IDGA 5BRAA 4TTIA 3WK5A 3HB4X 5F33A 5BR7A 1XG5A 2V4ZA 2IXBA 2ZIGA 3KQKA 1JZSA 2A4KA 1Z2OX 4CQLB 2BFPA 3D3QA 2NTVA 1JR4A 4HV4A 4LMPA 1FJ2A 2AKAB 3PC7A 4N7MA 2NO4A 1ZIYA 1NYLA 3EF1A 1S3GA 3MG9A 3QWAA 4Q4JA 4DQDA 4DDVA 1VP3A 1W6RA 2E37A 2GHIA 2YRWA 2ZWIA 5CA0B 2DMRA 2I4RA 4FFBB 4I8IA 1DPFA 1E1DA 4HWRA 1WABA 3MRVA 4BQEA 3DLBA 3DXFA 3INNA 1XEXB 3ROGA 1ND5A 1VKHA 2RH4A 4GU5A 2XTMA 1QC5B 2ZBQA 3BF8A 3JZIA 4L4SA 4U6NA 3V42A 3QX3A 5JDCA 3PCTA 3V3KA 4YP6A 4OHRA 3E84A 4MGZR 4DNOA 3REOA 1DT5A 2NSDA 3ZY3A 1KO8A 1OA1A 4KN6A 2NZYA 4Y2XA 5ALZA 4DIEA 1OB5A 2IHZA 3ZLVA 3BK7A 3LQYA 4JLNA 4XCXA 1NHGA 3V4PB 2PZBA 4DQXA 3NALA 3ZHUA 5JEEA 5KYGA 3BIJA 1IY2A 1DMSA 1WOYA 3KXPA 1Q5PA 2Y0CA 1FRVA 3FTQA 3SFTA 4CN9A 4DM4A 2WU8A 3G89A 4IM7A 1K86A 1N2SA 4LPKA 2DE0X 2IV7A 4A27A 1UJMA 1RWVA 3UJAA 4GECA 2NU6A 1WD7A 1WU8A 2CVOA 4K6CA 1Q83A 4H3SA 4X63A 5HF5A 4J9UE 2X7JA 1EZ4A 2FMHA 2VBGA 3EC7A 1VCOA 3GZ4A 3SMVA 2BM0A 4ON9A 5AUQA 3OH8A 3KSAC 1NKVA 1S7GA 4BRUA 2QPOA 1PFWA 2BGNA 1B8NA 1GZVA 5F5XA 3B6JA 1LDYA 1L6IA 1C7FA 1KP9A 3FPEA 3FWKA 4KWIA 3WV4A 3C6KA 9LDBA 4BVFA 2G9UA 2XWSA 1JHAA 4GOKA 3RBZA 3ANYB 3OLXA 2PVSA 2PAAA 3LL7A 3FPSA 3THYA 4TUYF 3QFTA 4WQMA 4W1QA 1H94A 4RW0A 2R86A 4QJ4A 2ORWA 3O7MA 2P67A 2UUBB 2XECA 3AJEA 2D8AA 4NIMA 4G1BA 3UCXA 3EGXB 1G4HA 3PZBA 1GPBA 2EX0A 2JFOA 4KYVA 3WBFA 5HTOA 4KVFA 1EU1A 3ZI4A 4AJ9A 4G5XA 2JLRA 5CXSA 4KX3A 2G36A 2H2GA 4PYJA 1DELA 1D9ZA 1PJQA 2QN9A 4ZWNA 2EZTA 3KAQA 3ROPA 3S27A 2NXNA 4OGFA 3A1FA 4O3FA 2IELA 4Q1DA 1ZCJA 2P6MA 1NTOA 1VJGA 2G09A 5IUKC 2CKMA 1ZUNA 1UUFA 1Z56C 2BFBA 5BSFA 5ESRA 4CQJA 2Q2WA 3IBGA 5JARA 3MIIA 4MVJI 3VQTA 3GCZA 1R6XA 1PR0A 5EJ4A 4CMAA 2O2SA 4Z6KA 5IU6A 5IEBA 1ENPA 2I2AA 4WCVA 3NVDA 3WMRA 4AY2A 4EGJA 2DFDA 3GOHA 5AHWA 1BMQA 4QGHA 4J49A 5ICFA 2JLWA 4O33A 2WPDD 4IDAA 2C2YA 5AO9A 5A4IS 2DY0A 2VPXA 4I6GA 4E4TA 2F3TA 4GKVA 4HYTA 3LVFO 3O47A 5D5PA 4AURA 4B3IA 3IJRA 2ZYAA 4EEXA 4YDQA 1E2LA 1EPUA 1U11A 2C83A 3DE0X 4Q1FA 3WLIA 4Y9RA 1E0KA 3ABOB 2ODBA 2X1VA 2X76A 3HB0A 4YRZA 3ASZA 4GUAA 1A1SA 2DFTA 4URFA 3HHEA 2BI4A 4XAQA 4BIMA 3FPGA 3QFHA 1SIBE 5G4KA 3V8EA 3DB2A 1HT2E 1WIWA 5KKCA 2XT9A 2D59A 2RHWA 4E6EA 7YASA 1RZVA 5FBHA 1MAHA 3C3MA 2GASA 3I83A 3SSMA 5IG2A 2QTFA 3TIIA 4LJRA 3A6FA 3PE3A 3FYHA 1YR1A 3MS4A 2QUBA 4LJYA 3NRJA 4RFLA 5ESWA 2OGZA 1XELA 2GLUA 1BGXT 4A8JC 1JIXA 2I3GA 2G9NA 3EQ9A 1NMEA 5H83A 4UNQA 4LKRA 4X5OA 2OFWA 5AI8A 4GGPA 4CYMA 1GG8A 1QGUA 1U3GA 2CZGA 4K28A 2VT2A 2Q4TA 5HMLA 3BJMA 3D1VA 4TLMB 2IYLD 3O8OB 5GMOA 4DWWA 5M04A 3OCWA 3GL9A 5FADA 1EM6A 3QEAZ 5H5JA 1TMKA 2ZIWB 4QFMA 1QCZA 1UXOA 4KEAA 3U9LA 5IAJA 3I76A 2R4UA 3BWVA 3LIPA 4QLOA 2AMLA 2RKWA 3MPUA 3F5SA 3GEGA 4I19A 1T5HX 5K0EA 3HYNA 4M0CA 3DEAA 8MHTA 5JOQA 1A50B 3IDFA 4JOQA 4RH0A 2G07A 1YAJA 5EXSA 3USZA 2BBWA 1W2GA 1DC4A 2JHGA 5FOUA 4D9GA 1DBQA 1TCVA 3B60A 4TVSA 4PBRA 4RJLA 1JQBA 3N8GA 1AD2A 2GA9A 5C3UA 2ESRA 2FGJA 2I29A 3QNMA 2B7BA 4V03A 3T94A 3FFTA 3KCQA 2X77A 4C4AA 3F7NA 3IUQA 3G49A 4I9UA 4OBXA 1E96A 2BKXA 3I30X 2GJ4A 3TK1A 1RYHA 4OOFA 5C7OO 4WLVA 4N7BA 2PA3A 5G02A 2ZBEA 3SM9A 5BN3A 2I80A 3BJEA 1NFRA 5DLYA 4D9NA 2V7QD 4B3GA 1Y5RA 2BAGA 3L01A 2YMMA 1Y8RA 4W1PA 2XB2A 2AZ4A 1OUMA 1ZH4A 2ILVA 3EY9A 3IB3A 3QVGB 4UTZA 3R7DA 5KJ1A 2ZRCA 1PFKA 1UDXA 5HRAA 4PPGA 5J4VA 1MEOA 4A0GA 3GFQA 2UYQA 4D0LB 3N28A 3L1IA 2IP4A 2WU4A 3ASVA 4YO8A 2HGSA 4ZQHA 1EWVA 3FRHA 3HFRA 4ZMRA 1Z68A 4LV8B 4HQOA 4N5IX 4NHOA 3ZLJA 1HV8A 5A05A 3ZBTA 4EHJA 3SXJA 4MWBA 4QODA 4UU0A 1FRFS 3ZNOA 1SG0A 1RJ9A 5G3YA 1P7VA 3MUEA 4WJKB 1ZCAA 3OZTA 1PW5A 5DBHX 2PQMA 1FNNA 5E7IA 5B1HA 4A8HA 2K2QB 3SZUA 4ZCIA 4MNTA 4M6WB 4RZ3A 3NJ4A 4ZCTA 3R75A 3QQ5A 1C3OA 3SJAA 4KIGA 3KEFA 2O3UA 1AXEA 5A1JA 1UFQA 3OQMA 3BFXA 2YJTD 4ILKA 1D0VA 2JI9A 3N1UA 4FJ0A 2GTHA 3I6YA 1Z35A 2CEKA 3JQDA 1AKMA 4QBFA 3VC2A 3DM9B 4EUEA 1X1SA 1TO2E 2BFEA 2IIBA 2X3UA 2XUFA 3IUBA 4M1EA 3RSOA 4JNCA 2HCTA 1R3UA 5H82A 1T3SA 2XLBA 3Q7EA 2Y0EA 3QBEA 4Z8XA 5GTDA 4U2KA 4G86A 5IHPA 2GO1A 5LXTF 4R8SA 1OFIA 1IEXA 2YBEA 3KJIA 3HJFA 2H31A 4JLVA 3M6UA 1PEYA 1CUDA 5SYAA 5ELXA 1AHPA 3H8VA 1NWHA 4M1ZA 5HFNA 1SZJG 2F9MA 1GAWA 2HFJA 2WM2A 3DTYA 1SOAA 3QMWA 3WHIA 3ZU2A 1IQ0A 1FU8A 1YDHA 4J6FA 1GRRA 5AK3A 3VUEA 2Q9AA 4R3NA 1W88A 1QOPB 1FFCA 1JVNA 3PWZA 4O02B 2MYTA 2AG8A 1JPJA 5DV9A 3WC4A 4CXMA 2CNOA 4L3OA 5CFOA 3CZQA 5E1OA 4DTIA 3AR5A 3UMSA 3HRHA 4AX4A 2J0SA 4PAGA 1E2DA 2QENA 4BZPA 3SQNA 4EUNA 1YFZA 5B7PA 5FBKA 3ZHSA 4HS4A 3MT9A 4HMQA 2JEYA 4MO2A 3UJBA 2N42A 5EMMA 3QE4A 4MLZA 5EXPA 3S1AB 5CIWA 5K3SA 3KYBA 3QITA 3ELWA 2FPPB 3C4QA 1TQ6A 2I0FA 3FCAA 1H0KA 1PT6A 4FW8A 2JI7A 4PCUA 1US8A 2XXJA 5DTIA 5JYCA 3SSAA 1GKUB 4MQ4A 4Y2UA 1YVPA 1RYBA 3BH0A 5DASA 3GYGA 4JOBA 2Q6LA 4E5DA 2QHXA 1OTHA 4QOGA 3HJTA 1ZD2P 2ZU0C 3N2GB 1IOWA 4TLAA 2BLLA 5BYBA 1ZAKA 2I7CA 2YZKA 5SZIA 2ZI4A 5C5CA 1KP3A 3G3EA 3DEFA 4JIMA 4ETMA 3JQAB 1PT9A 4NYJQ 2YZ2A 4D9MA 5HJ7A 5LQRA 3BA1A 4BECA 2PN1A 3PJFA 1BSVA 4IX1A 4ZQEA 1TC1A 2EC5A 3R44A 4CTOA 4PC2A 3AJDA 4AUMA 5JZVA 1UJCA 2FWJA 2ZR8A 5KC9A 1V9SA 2OHGA 4QHYA 2FPXA 2GBPA 3DO8A 2B2CA 2MIIA 1KZ7B 5EYPB 1X0VA 4YP0A 3NT2A 3IQGX 3NATA 1Z5GA 1RM5A 3AF6A 3Q85A 1NUQA 2B78A 3B1ZA 3PHIA 4G1CA 4I50F 2I6SA 4HJXA 2NQ8A 4S24A 3G8CA 4HLUC 3E2IA 3WYBA 4EK9A 5KTKA 4M60A 4AC9A 1G5RA 1NJ2A 5EKUA 1FFGA 4OHMA 2B6NA 3VHXA 3H4VA 2CNNA 1YJBA 1OTXA 2GDZA 1O97D 1ZD3A 2FF7A 1E60A 3E0XA 4DJTA 3E70C 4PW0A 3SHTA 4DW8A 4ZGGA 2FEAA 3QPWA 1DAMA 3OWOA 3U61B 3KTAA 3UGKA 1PJLA 3LLUA 1CF9A 3LBFA 4RDIA 3BIFA 3MMSA 1XCPA 3KJNA 2GRAA 2YMQA 2A92A 2P2SA 1BE1A 3HA7A 2JLYA 2FSFA 5T4HA 2FSIA 3HY3A 3EGDA 4MV3A 1QVZA 3DYBA 4RD1A 1ZZEA 2R6FA 3SKVA 3X1ZA 2M1XA 1TLFA 3C0KA 4HQRA 1EFTA 1PHRA 4LSZA 2EEPA 3D0QA 3K3PA 1AU9A 1Z0UA 4L9WA 3T1OA 4N18A 1DZ3A 4B40A 1IDN1 4CCSA 1CERA 4D43A 4GSKA 1FP7A 3V6MA 4F5ZA 2WWYA 4YA6A 1DXHA 5JS1A 2WFZA 1GILA 3SYTA 1JYSA 3DXZA 4FFNA 1IN5A 1YR9A 4INZA 1UBTS 1YRWA 1JKJA 4Z0PA 2GKGA 1OILA 2OHXA 4AJLA 1ZA2A 1G7RA 4RKEA 2HL6A 1E3WB 3U1TA 1S2GA 2HADA 4B3BA 4QPCA 2A7XA 2MSKA 4TTPA 3WRVA 2W37A 2W42A 3RI3A 4B8WA 1K9SA 1DG1G 4XM0A 3TBHA 3CB2A 2BMDA 3L4KA 3AHEA 1CHNA 4NESA 1AF4A 4R7TA 4G0QA 4YTEA 4CKYA 2PLWA 4HNHA 3WYNA 2HF8A 3FYUA 4KE8A 1N6LA 2OGSA 5K8IA 1UPAA 3OE1A 4Z4QA 1RADA 4UTNA 3ZH2A 4F21A 4M0KA 2DUMA 5BN4A 1N92A 3LFUA 1OGYA 5AKLA 3ONVA 3O8CA 4KR7A 4RTQA 5TMPA 1KY3A 1K3UB 1T9GS 5ES3A 5JPIA 5KOIA 2RG1A 3URMA 4INJA 2GN0A 3RIHA 2WUWE 4FWTA 3GLGA 4X85A 5TQVA 2C9DA 3EDCA 4YREA 1Z6TA 3GLUA 3ESYA 3ND5A 3VZQA 5F98A 1WZNA 3V4ZA 4MS4A 4OX9Y 4MCIA 3V2GA 3WMGA 4JL8A 3KQSA 1I0ZA 1BEZA 3QVJA 4MB2A 4DQLA 3LHDA 3C2QA 1R4NA 1J0AA 1MABB 2HA7A 3USES 1B15A 3N3AC 2C59A 2YCBA 2Q1SA 5KJFA 3W7BA 2PRJA 2PANA 4PCLA 5SY4A 2HXYA 4PYQA 3SQXA 4BC1A 3OX2A 3KUUA 1D9XA 2P2NA 1W4CA 3E48A 3KPWA 2NSYA 3OG9A 3OLCX 3LM8A 1FP4B 1ZI8A 2QNBA 4LZPA 4WEQA 5JLAA 4D9KA 3UT5A 3DFKA 2WB2A 1JEYA 4I4TF 2R3SA 1X7HA 1E1YA 2VC2B 3V33A 1QRTA 1KRWA 5EXTA 4JI5B 3RVLA 2JLSA 3WQHA 4ZEXA 2EW1A 1RWNA 1NA5A 3T12A 1X9IA 2OVBA 2VK8A 2VNAA 3K1ZA 3ZV6A 4CN8A 4NL4H 1Y0BA 1C1DB 2QVGA 3E8SA 3CM0A 3GG2A 3H6HA 3HKBA 1H2BA 2PZAA 4QNRA 2H2WA 3H9CA 1FXSA 1MMFB 5CVJA 4BQSA 1ZYUA 3GUHA 1WUHS 1KEZA 2Y4NA 3HKCB 4HYYA 1TE2A 4PQRA 3ZWNA 1D1TA 1CEXA 3DBVO 5B2ZA 3RSCA 4AZ3B 1BVYF 2WJWA 3ED5A 4HAYA 2FUG1 2PX6A 4F12A 1URPA 5C5IA 3K71B 3F7TA 4HEA6 1DEXA 4NENB 2HV9A 1TVKA 4D3YA 4R2JA 3DAOA 3O3MB 3VR4A 2JFVA 3GCGA 3WWDA 4D96A 5IT0A 4HDNA 1UT8A 5IPFA 4ID9A 1EFCA 3H1BA 4U5XA 4TWZA 3VH2A 3PQEA 1W49A 2QR2A 5ED0A 3LUFA 2I4TA 3HXPA 4WX2B 4J0HA 1SUCA 2I6FA 1ADJA 1HQDA 1U7ZA 4AUKA 5L4SA 1OH6A 4MW5A 4OSOA 1U3TA 4WXRA 4BS9A 5L9AA 1E1LA 4R31A 2FDCA 2BDTA 2W6QA 1F2UB 1J2EA 1CY8A 3F90A 1II0A 1F8XA 3OAAA 1H2HA 4MTCA 3O1JC 2BV3A 2D62A 3GA5A 3DHEA 3F5QA 1W6UA 3F3SA 4YP5A 4U7HA 4YUZA 3T9CA 1H65A 3VA7A 3IXMA 4KXLA 3WMFA 1E2EA 3FOFC 3HTXA 3GLFE 3PNYA 1EK6A 5B1SA 3MHTA 4CGZA 4QPDA 3ICVA 2XMSA 4XSHA 4ZT4A 3RUAA 2CNWA 1NNUA 2QMHA 1ZK4A 1SOWA 1WPRA 2RBEA 3DKVA 1LRKA 2CVPA 3GR6A 4MW7A 1DIRA 4MUAA 3P9YA 4BNHA 2C9YA 1X80A 2DFPA 2WTNA 4DUPA 4YONB 1XRMA 3RS4A 4TYMA 4EG3A 2GCOB 4FKMA 1P7WA 4C88A 4L4XA 3C8HA 1VSUA 5BWOA 2HRBA 5HHTA 1M34E 2ZIVB 2P7IA 5SV2A 2K87A 3GGJA 3HABA 2YC2C 3I5AA 4NEHB 4GOND 3VDXA 2AXEA 1Q7GA 2SNIE 2X0NA 4OYRA 3F6YA 3PI6A 3MLBA 5EP1A 4P22A 3HXQA 5EI5A 3ECAA 4GP7A 1OT3A 3RIGA 4JT2A 1YJCA 3V1MA 4Q1AA 1TCCA 2HA6A 1VL2A 1MAAA 1KMCA 1U04A 3CF4G 3NDBB 1RRGA 1FDUA 1MB0A 3GK3A 4NFLA 3VU0A 3C85A 1N2GA 1IM8A 1SUAA 3IDAA 3JQ9C 3KEOA 2V9CA 3LQ4A 4K6FA 2OENG 5A7HA 5AW0A 4MS3B 3L7DA 1YZQA 3JALA 4DT1A 4U3JA 5E7MA 5AMXA 4EARA 1XZNA 1DHTA 3KBOA 2MCFA 5JAIA 3T5AA 4FJ2A 4BXOA 4FW9A 3TCKA 5HGXA 3PVSA 3H9UA 1O95D 1RFLA 4X8LA 4JA2A 2IPXA 1X8XA 1XKQA 2WG2A 2WWXA 2ZWOA 4LYGA 2PVCA 2W90A 2F17A 4IHQA 1T13A 4GR4A 1Z2NX 5L45A 2PY6A 2IZOA 2WAXA 4RK6A 1PSDA 1CR0A 2VJOA 1E59A 1NN3A 5BP7A 1UADA 4K2AA 3R41A 2FHSA 2Q49A 1LPMA 3JQ7A 4KWCA 2XCLA 4ZI7B 1BHSA 4JBWA 1XHEA 4P32A 5AICA 4R6WA 4AX8A 4CKZA 3IPLA 3O91A 4H18A 3DLHA 3OF2A 3KWFA 4TV9B 4L57A 1A0OA 1KFEB 2BRUC 2G6TA 5ALYA 4FHFA 3RTBA 4D8WA 4PGGA 3E6AA 1RYNA 4G0NA 2ZVPX 3R24A 5DM2A 3GC6A 1V96A 3Q7IA 4GFDA 1G0OA 1A7JA 2I4MA 3K0HA 4FZ3A 4BFSA 3LC7O 4XIJA 3F97A 4YUWA 4ZOCA 1NUSA 3D2LA 4A1FA 1M1XB 4B5LA 3T6KA 1YMQA 1P4RA 5DSTA 3D4BA 2VHWA 4KIUA 2Z8YA 3WLHA 2D7DA 1E3TA 4OUDA 1KQPA 1VKJA 5LL6P 1IZ0A 4M38A 4WOKA 1J00A 1JAZA 4KHPB 1LNZA 1TTPB 1J1ZA 2PSEA 3I1YA 1X86B 1QG2A 2PNFA 3VKHA 4FQ7A 1O96A 2PX5A 4EECA 2GHRA 2XDWA 3K35A 1ZLYA 2PO5A 2ZBVA 3QWIA 4JJ7A 2I6QA 2ZJ7A 1GPYA 1J39A 4DSZA 4JUBA 1E4EA 4TVBA 2XDAA 2XUKA 3H1TA 3I9NA 3NTXA 3AU9A 4OQZA 5HKKD 2AA3A 3OQ1A 4RCYA 4YI5A 2JGEA 1LFDB 2NU9B 2CNBA 2GF0A 1NBAA 2DBYA 5GV7A 5CAEA 3NTLA 3QBTA 1ISGA 2QAGC 4YUXA 1JYFA 1ZSVA 2J31A 3OCJA 2NQTA 3W5BA 4CTMA 3RAJA 2VYNA 3OQIA 5HYVA 2QD5A 2IYRA 3OJEA 3Q7TA 3KYCB 4O4JA 4EX6A 3UMMA 2B6HA 3NHZA 2HIHA 1TQ8A 2AEJA 3UM9A 4ENQA 5B37A 5AFSA 1H2YA 1LW7A 4OY3A 1DUIA 4HB3A 1CC1S 2UZAA 1LH0A 4W7HA 2FPIB 3LVRE 1CQZA 3C5WP 2HM7A 2QRUA 2BFFA 2D0DA 2O1XA 4ZT3A 1IXSB 3PR3A 1QCCA 3IQZA 1L6RA 2CF6A 3CYFA 1AGNA 2LDBA 4AZWA 1W35A 3L3BA 4IGFA 4EG8A 4AMVA 4MHTA 4CEIA 2IE0A 1KFCB 1OVMA 4CNQA 4PO8A 2EP7A 2IYVA 5FPHA 3RV4A 5AD1A 3A26A 3IXLA 4DEXA 4YRSA 1SXQA 4RMHA 3SIXA 2IOYA 3IHTA 3PA8A 3WISA 1JFVA 1SVSA 1T0PA 3M9WA 4IZ6A 4MPJA 1GR0A 1G6KA 5DTRA 1FX1A 1P33A 3AEZA 2WJ4A 3IOCA 4QSMA 4ZI2A 4UAVA 5I7UA 4KFCA 4D4KA 1QLWA 2C58A 5TGDA 3G13A 1VA4A 3UWDA 4FI3C 2OKGA 3IMFA 1TJYA 2H2AA 2KX7A 2QAJA 2R48A 2ZTUA 3DMHA 3LPNA 3P4YA 4M7OA 4J1TC 2DH5A 4UOQA 3DO6A 1YA8A 3R5TA 4F92B 2FLKA 1N0IA 1TFUA 3GO4A 3OLZA 1Z83A 2VA9A 4KN9S 2TMGA 5EZ6B 3CH5A 3T0IA 1Y6GA 2F3QA 3TPFA 3T3MB 2IVZA 1ODCA 4GQBA 2W43A 3UATA 5KCMA 1EKXA 4ZAGA 4KNWA 1T5IA 5EHXA 1Q6YA 2QTGA 1WXGA 1D6SA 4MIKA 1I10A 2VFAA 3CLUD 5FWYA 5K0BA 1Z36A 2XCUA 4QYWA 1C29B 1LXCA 2B8NA 4ZQFA 5BSMA 3D2AA 3WGYA 3DE1X 3I39X 1YK1A 1N2OA 2BGKA 1RCFA 2OHHA 4II7A 1DADA 1HKUA 2H1VA 3NJ8A 5ALVA 4Q0MA 1JJBA 1LTKA 5I9TA 2WF6A 4C21A 4BRWA 2FEMA 3OE7D 5J2UF 2RC6A 3IP8A 4TUYB 1TUBA 1H0RA 2OV8A 4HNVA 4UUQA 2BUCA 5FL7D 4MCJA 5BSRA 4HT3B 5AVKA 1NOIA 3KVOA 3U3KA 2P3SA 4EG1A 4IDNA 3R8FA 1J42A 4ZFNA 1OJ7A 4JBIA 2E4XA 1MIHA 5CLHA 1R0WA 1AMOA 2WG0A 4RVHA 5IF3A 1YH3A 4N3BA 1BVHA 3VHRA 2Q0QA 4ZVLA 3P7MA 4DXAA 1Z2PX 3GZJA 4ZN6A 4WK4B 1GKLA 4EPYA 1CE8A 1QFYA 1M8JA 2B8EA 5F4ZA 5GPBA 3ER9A 3K9NA 4RMNA 2AKEA 1C7JA 1J2TA 3HGMA 4KKVA 1NMXA 1D2EA 2PS3A 4HXEB 1Z39A 1IQPA 4Q6BA 1HEIA 4YBZA 1DBVO 4YDHB 2WP8J 2XB6A 2DSNA 4OBBA 4KNYA 5GZ1A 3CBQA 3S40A 2H06A 1DFGA 1WQ1R 2ZSEA 2CVQA 3B78A 3G59A 3RK4A 4EG4A 2ZM6B 2CCKA 3MOGA 1NBIA 4S04A 2YS7A 2J5QA 3QW4B 1WOMA 4P8RA 3T99A 2DFKB 3HKEB 1AQYA 1Z4IA 4W1SA 1ZUIA 2C61A 3FWYA 2A0WA 4MJXA 4QIHA 1JTFA 1V5WA 4A92A 5A4AA 2Z1NA 3U60B 3RFFA 4EGSA 2XF2A 3FTCA 1I4EB 1NQVA 4G5YA 4GPZA 3UK7A 3V4RA 2NXJA 1U7PA 2Z9BA 1EFUA 3UK2A 3E7WA 4DVJA 1U8YA 3CX3A 2W8BA 5I8WA 1NVVQ 4DL9A 1XX6A 4X3CA 2Y6VA 3EAQA 3G2NA 4UXHA 4TXJA 3IT3A 3OT5A 1F7VA 2IZZA 3UJPA 4C76A 1H69A 3F8WA 5JCOA 3U40A 1IBLB 3ICCA 1FTWA 1PGPA 4B74A 3WL7A 3RBXA 2P1DA 1MV8A 4M4SA 4NYIR 2QX7A 1N7JA 1Z5PA 2ZUFA 1XDGA 4C1BA 2QSYA 2R00C 3ZHTA 1XLVA 2LCQA 4EPWA 4ZYXA 2AG5A 3TLYA 1TYDE 3HR4A 1R5OA 4IH1A 4R2LA 4RH3A 4CIYA 2IP2A 3VJLA 1SCKA 2R65A 1TM3E 4MVJE 4XWOA 5ETJA 5F7JA 4B2LA 4CPDA 1HO3A 3T1QA 4B85A 4P54A 1JJ7A 3GJZA 3ZDBA 1CZOA 1GLNA 1A4UA 1G3MA 1QB8A 2HJVA 2RONA 3KPYA 4NZYA 4UOEA 4R1MA 1PNVA 1Q1ZA 1CUZA 5IAKA 3VSCA 1OAOA 3IRVA 3L0SA 5IDYA 4XTCS 3WBBA 1SEVA 1TEZA 3ZWQA 1VPVA 1XIVA 3L4BC 4DMGA 4DWJA 3IKVA 2JFGA 3E27A 4KH0A 1ZJZA 1QX3A 3AFIA 3CH7A 4H4CA 1Y3BE 2JLVA 1JU4A 1L5YA 4M3NA 2K2WA 4L5YA 3AUTA 2V5UA 4MVJD 2R2GA 4XUCA 3QMPA 4DEVA 4C0XA 4Z53A 1QBGA 2X1MA 3UKOA 5KYWB 4AYTA 3PGKA 4NDNE 2O5CA 2NYVA 1SHZA 4IOKA 3HS3A 4LNUB 2FR1A 5I48A 5KTNA 2AOUA 3LY5A 4F04A 3AM1A 2CDNA 4PRZA 1W5BA 3JVEA 3FMIA 4P08A 2WZCA 4MVYA 5EIEA 1CJKC 3PIRA 5HIKA 2QW1A 1DZIA 4GX5A 4EH1A 5IAOA 5JCPA 3ZDDA 2MT9A 3RYHB 3VR2D 2VTBB 3B1WA 2GAAA 3OPYI 1U80A 4FN4A 1MDBA 2CMFA 3L8DA 5FFMA 2W4IA 5HWSA 2XKAA 4UATA 4WE3A 4DA0A 3TLEA 1U6JA 3PD0A 4DWOA 4AY5A 5SY6A 5KYXB 5FTJA 5LUBA 3AHFA 1T2FA 5L3RA 3ZGOA 1GL9B 1RM0A 1L7MA 2Q1TA 2XZDA 4D0RA 1M83A 1PL8A 1QS0A 2WOOA 4U0JA 5TVGA 3RYCA 3KHKA 1Q21A 3FOAA 3HY6A 1K0FA 2JARA 2IYYA 1E4OA 4YCJA 2KYRA 1TLLA 4I55F 1KQFA 2OQVA 2H48A 4KR3A 3DBRB 2O5EA 5BQ5A 5REQA 1JNYA 2G70A 2KQUA 3NHRA 1DKMA 1E2HA 1OH7A 3O3CA 1M2KA 2R8YA 3BMCB 3HLKA 3NAQA 4K46A 4NABA 5LXTB 4YRJA 4IIHA 1QIJA 3TGWA 2ZIZA 2Z9DA 4FBGA 1SNYA 4H17A 1AC5A 1L4UA 3AMVA 5KNCH 3AKYA 3AOGA 2BFWA 3PC8C 2ZRHA 4TOIA 3VZBA 4QD3A 1QH9A 1X15A 3OIYA 1T10A 1M2EA 4TSFD 5DK4A 3STYA 1XCLA 4BN5A 2ZANA 1QE0A 2J33A 2JCVA 5AW3A 4QGBA 4BX9A 2WKPA 3R8XA 1XHFA 4QUKA 5JW6A 1G55A 5EINA 5ECGC 4LSGA 3U4DA 4GS5A 1YF3A 1JR6A 1NSYA 4NV0A 1OXMA 1N8KA 4MEAA 3MYYA 4QT0A 4ZO6A 2FNAA 1EM8A 3NRCA 1QRAA 5KQGA 1E3QA 2G4LA 2CD9A 3DOHA 3I2JA 3JAWB 3QVTA 4JU8A 5HILA 3A0RB 1A8HA 3I2FA 3LDAA 4FFDA 1JALA 3NIDB 3ZQ4A 3R6TA 3LP8A 4NWIA 5DULA 3TW8A 1OVGA 3B6KA 2VDQB 4Y7DA 2I62A 4WKOA 3OHPA 5AKEA 2PQ6A 2LIVA 4ZJUA 1G5TA 2JCGA 3CT4A 3QLVC 4QREA 3CX8A 2F8LA 1VKRA 3KOZA 2ZYWX 3KXKA 4FGJA 4V24A 2XA2A 4F96A 3QOXA 4PZYA 3NEJA 3QU4A 4NMHA 4RADA 5IW8A 1GU1A 1YJAA 3U13A 1UXGA 4IIXA 2M32A 2V7GA 2WUGA 3TLCA 4B6PA 4LRTB 1M8KA 3NPMA 4DDWA 1D09A 4M46A 1E4VA 3LPAA 4URWR 4O4IF 1MTZA 1WU7A 1YKSA 3G8AA 4YRPA 3PCXA 2Y71A 5A0VA 1GCUA 4A6PA 4LBZA 2YWRA 1TF2A 1Y7IA 5F2KA 1ONOA 1THZA 2DX7A 4G37A 1U2DA 3JWHA 2PT9A 3ESCA 4OHPA 1H9CA 3R7BA 4MR9A 1UP4A 3VH3A 1TA4A 4AI6A 1EP1B 3B85A 4OQFA 1KS9A 4EAQA 1YQGA 1W5TA 4CT0A 1NVGA 2HLNA 4I50B 1H4SA 2BMWA 5F7XA 2P30A 3ZN2A 2BHTA 1GIAA 2XCTB 1E62A 1IFXA 4E5MA 3KDSE 1RKQA 4V0LA 3CV3A 2ZJYA 3Q3HA 4JFRA 4DBLE 4LXXA 2FQ1A 3LJKA 4FOLA 5FLEX 4UHJA 4ABYA 3I6ZA 1D2GA 3G7UA 3ZHCA 4NJMB 4MR8A 5LP6A 4RSRA 3WLOA 2I33A 3VR3D 3AIOA 3TM5A 1IC6A 5DHPA 4MWSA 3V6LA 2PUFA 2A9RA 2QQFA 4YHHB 1IN1A 4RIGA 1PV2A 3JQCA 5BN5B 1XTJA 3BDVA 3CR7A 4OXRA 3CVJA 3L4SO 4B47A 5LQAA 3LCVB 4DR2B 3N07A 4R5HA 3QE9Y 3QKUA 3PUWA 4KQXA 5K3DA 3ERCA 1P17A 3D4LA 2PJZA 3LXRA 1ADYA 4NBKA 1W9HA 5FI1B 3ZE2B 3G0DA 2WV7A 1VYUA 2PIAA 4R8KA 1KPIA 3WFJA 3VO9A 1K5HA 1HE8B 3GMTA 4S1OA 1PR3A 5FORA 3C6QA 1L8XA 4S1NA 5CVUA 1S1MA 4B6QA 4TYNA 4BMCA 5FHQA 1ISFA 2RJOA 2L17A 4QOFA 4W9RA 2ZBPA 3AI2A 4Y2TA 5FQNA 3DMFA 5ICGA 2JGIA 2F3UA 2PJUA 2AZXA 3QE0A 4BP8A 3NHPA 4JI1B 5D01A 3GEEA 3U7IA 2W2KA 3NOOA 2C29D 3GBSA 1UQUA 1B1CA 1GT91 2C2BA 4ETNA 4YQFA 2FRXA 3KQVA 4D56A 2J48A 1FL9A 1T9AA 1BCRB 3MSXA 4Q7QA 3MMNA 2NO9A 5AIBA 4KYIB 4KITB 3EPLA 2BGTA 3IA2A 3K9HA 5H0IA 4UFPA 4R9SA 4HEHA 1L0BA 1JI3A 2C82A 1FFHA 2BEVA 2RAVA 3RFXA 2P9JA 4NCNA 3ZTYA 1ZD9A 4DYDA 1UMCA 5C4IA 1J7KA 3DUFA 4P4NA 5JIBA 3NIWA 4UU8A 1HDOA 2C7PA 3ZXUB 2P41A 4MWTA 4P6VF 2F1JA 1WHSB 4FOOA 3V4VB 2AS0A 1L7RA 5B6JA 1PQUA 1KYTA 1L1QA 1GKIA 1QWSA 2KMLA 2FCRA 3DE6X 4JLKA 3RS7A 5D6NA 1WUTA 2ZRBA 3ZWKA 4W6ZA 3FVWA 3TNLA 3WK9A 4EUKA 1JJAA 1QVRA 4BVKA 4DB2A 1LRJA 4UMEA 3U44B 3CF6R 2IYEA 1M1ZA 1Y5NA 4HC4A 4IQFA 2FSVC 1XNHA 4K9SA 4PC7A 4DBVO 1FBNA 2FMKA 1NULA 4FGWA 4LGMA 3B7GA 3DEZA 1Y33E 4W5JA 4WHMA 3U3DA 2KBEA 5I9MA 3ONNA 1I2BA 4J0EA 3OOWA 4PN7A 3BHJA 3BG5A 3RWMB 4PR0A 4EQ6A 3SS7X 4CM1A 5BWCA 4IGKA 1DKQA 2EFDB 4NF2A 5K01A 4I4TB 4Z8YA 2J09A 1QX4A 4EFDA 2VUIB 5T4BA 2CHEA 4WUTA 2IHUA 3G5AA 1T6NA 2FAXA 5TSDA 3RC2A 1JDNA 1G8HA 1HDEA 2QN6A 1HZZA 2ZB8A 2NUPB 4L2IB 1Q92A 2YV2A 3OPVA 5BQXA 1E1NA 1UC4B 1FQKA 3AF5A 1TTTA 1U0RA 4JZYA 3W3AD 1OYVA 1L7NA 5LJIA 2E4ZA 1NAIA 4MR7B 1W19A 1BJRE 4Q3CA 4X65B 4IH9A 4OSPA 3GA7A 4XDYA 3I72A 1N3YA 1FTSA 3GJXC 3QVMA 3VR5D 4N8DA 3WA6A 1QH8A 1HORA 1P0MA 2CBGA 2PBLA 3EMKA 4G56A 3AY0A 4HNGA 4P7FA 1W36C 3IODA 1XZPA 4UEJA 3BIWA 3CLRC 3E05A 1V2HE 5ANRB 3VPHA 4RV4A 2BTQA 4MQFB 1GGKA 2VIIA 1CPYA 1VPEA 4REQB 4NCHA 3N74A 1DQRA 1X1CA 4Y1EA 1TU4A 4PC3A 3RUPA 1P7CA 2YOHA 1ENZA 3R2JA 3UQYS 3I23A 1FYEA 3PFGA 4U2GA 5JPCA 5C51B 2WVAA 3BTOA 3CR8A 5G0TA 1R5NA 4UUOA 4F5YA 1J8MF 1DAFA 1QZTA 5B57C 2XGGA 3L0CA 3DZGA 4FHZA 4QX6A 5DVZA 1TIKA 2LNDA 5ALRA 2RHBA 2X0JA 2AYXA 4ZC8A 1UPCA 4L5IA 2RGUA 3NFYA 2IHBA 3FTFA 5LQKA 3L7YA 3ME5A 2ALJA 2Z56A 3HI6A 4TKLA 2CLMB 1NSFA 5KQMA 5B5SA 5MF6A 4GAEA 1XZAA 4QDJA 1UPUA 1ECLA 3N7UA 1EP3B 1N7HA 4L78A 4MUHA 2Y0DA 4C2UA 1GGVA 1JFRA 1VLVA 5K51A 4OHBA 3IESA 4U5QA 5NULA 2YY6A 2Z30A 1ZN8A 2OHIA 4RH1A 2XJ4A 1CF2O 3JATB 1G20E 2AJDA 4QPPA 4UE2A 4Z9XA 4C22A 4DJEC 3E5NA 3EVDA 2GYYA 2AX4A 3DOUA 4GO1A 4LDQA 4QPNA 2O23A 5F52A 3B8HA 3X0DA 5J4LA 3T3OA 1RJWA 3G17A 3S8MA 1SOVA 3BBPA 1DBPA 3F3YA 3GHHA 3O90A 4D92A 2ZJ4A 1V11B 3ZGYA 4S1PA 3VTAA 1J2UA 4QHSA 3T1TA 5FLYA 3SDBA 4PWZA 1KR5A 1J5PA 2XMBA 3D0KA 4O8CA 1ZRHA 1HM5A 2IXAA 2WHXA 3D1JA 3IMCA 5TJ9A 1NPDA 1XMXA 3G5LA 5A0FA 1AY0A 2GMWA 2XBLA 1IPHA 1YS9A 2GM9A 1ZW1A 3IAUA 4PZZA 3RE1A 4WNIA 4A23A 3P9SA 5G41A 1JG7A 4B7ZA 3AKZA 4RA9B 1WB4A 5T4FA 1Z08A 4P1ZA 5DM0A 2BJWA 2ECKA 4DV1B 2QBYB 3CWZA 3X2SA 2LRHA 4L8VA 4WZBA 4CL3A 3SI7A 1NBHA 3K70B 4JB8A 2JL1A 3S44A 2VYFA 2VHXA 3P0IA 1PGOA 5CVEA 1ZCFA 2OMKA 4RTSA 1B41A 2P40A 2ZXEA 3ZBQA 4TMZA 3UHPA 4G2TA 1UINA 3G68A 4ER3A 5KDDA 1LPSA 7REQA 2GPSA 2FKAA 4OI0A 3G2HA 5IJXA 2FW6A 3NBZC 4RFVA 4MPTA 4MITA 3T5DA 4C7KA 2ZSAA 2C3OA 4N48A 4JI7B 1E7RA 4DIOA 4MQMA 2D8MA 3ETNA 4KXUA 4UPDA 1BFKA 2D0IA 1NVMB 1E2NA 2XRMA 5C34B 4ZOQI 2QM3A 4O2BF 3VPFA 5D5QA 4EB3A 1KK1A 1N0VC 4R98A 3IUPA 2BZGA 3EULA 1BXGB 3HFGA 1BEUB 5D51S 3EPJA 3RWBA 3HSSA 4Y2GA 1F14A 4PNHA 1ADCA 4RD4A 3MOSA 3HR7A 4II3A 1DWUA 3GN1A 2ZI3A 3OLVA 2VPIA 1G41A 5FV7A 4CDRA 3U6KA 1Q0QA 2UYOA 2ONZA 4G5SA 2ZLBA 3QV2A 4MW0A 3AH8A 4MW1A 1RJGA 3P0HA 3R6LA 4JR2A 4X93A 1TVEA 3EOZA 4MS1A 4V0RA 3GB9A 3GMIA 3NCHA 5KX5F 4MA0A 1RI5A 2I76A 2CJFA 2JKZA 2IEGA 2OO7A 1H3FA 3GFTA 2DHQA 3U7JA 2J5KA 1GFSA 1GPAA 2GXSA 3K4PA 4OGGA 2GCGA 2RHGB 3H8SA 1RAIA 1KBZA 4NQZA 3TNYA 1W48A 2QE7A 3DZBA 5GGXA 3X1KA 2Y1DA 3P96A 3MPOA 2CHFA 5E38A 3B89A 1R12A 4UBLA 3EXAA 3H2JA 3OCVA 3M5WA 4MVXA 4UM5A 2WIAA 2YWFA 5DI3A 1ORVA 1EBFA 3KFXA 4B81A 4I1VA 4HRAA 5GADl 3IT1A 3QBJA 5JVDA 4IVNA 2DUWA 1KU0A 1P29A 2UYHA 4ESVA 1BJTA 3D4IA 4AULA 4EFMA 1B14A 3OOYA 1KVUA 2C8VA 3LRXA 1RHRA 2HWYA 4F2GA 1I1HA 1USUA 2XT0A 2DVMA 2VUUA 4DUGD 1EFLA 4HGOA 4HQLA 1TRKA 3OCCA 5MN4A 3HCNA 1KWKA 4K2HA 2IXGA 5IKPA 5JAUA 3PPIA 8LDHA 3GFFA 3TAUA 2UAGA 1FS6A 1DUSA 1HKHA 2PGJA 1L5WA 3HU3A 4OCZA 4C4TA 5AVXA 1Q0RA 4O4HA 4I36A 4JQYA 1QIHA 1GL3A 1QGED 1Z6ZA 2HCFA 2HMAA 3NC1C 4PHGA 1RS0A 3PFHA 5E6UA 4RTMA 1YR8A 3U4QB 5C80A 2DPYA 1B8UA 1JECA 1P1CA 1UDAA 3SIWA 3WLKX 3A14A 1CBUA 2FWPA 3SZ3A 4W9NC 1UBMS 1TCBA 1WVGA 2FB9A 2QTHA 1NJGA 3BYZA 3GRRA 2FR0A 2BSAA 4YRKA 1V5GA 4QASA 4CQMD 4FEAA 5JI2E 5DYYA 4FCTA 3L2OB 2RBKA 3E9NA 1GTZA 1THGA 3FUVA 4DSTA 1QYVA 2HU2A 4UPEA 1OZAA 3DDUA 4YMGA 2TS1A 1B93A 1SCDA 3GMDA 4KOEC 3WO1A 2X3YA 1QZZA 4M98A 4L95C 1NJSA 1RRCA 3F67A 2OGWA 3JWJA 2PRZA 1Y8AA 1T1IA 4ITVA 4JHLA 1XMSA 4Q4HB 5H4HA 4OHYA 4S1TA 4Q19A 2JDIA 3UJ3X 1GUZA 2O57A 1GQYA 1UDRA 5AKKA 4HDQB 3WZMA 1A9TA 2Y05A 1XXHA 4OYLA 4RANA 4ZQIA 1PTJA 3V80A 1IEVA 1AO0A 5ARCA 4RE6A 3GGOA 3UB3A 3TR0A 1Q0TA 1OIWA 2X2OA 2HR1A 2O8FB 3HCDA 2QTAA 1UPTA 3OSZA 3LUAA 4E15A 5LPNA 1LKZA 2WIJA 3EZYA 2I87A 4UNRA 2JJ1D 1OX4A 1QHXA 3Q1LA 1QR2A 3QSYA 2HTFA 3R23A 1NXWA 3A36A 1AQIA 3NTOA 4IZIA 5JG7A 1EB8A 2ZUBA 4ZZIA 1G4UR 4QQNA 4L02A 1E6WA 1KOJA 1U90A 1JTEA 4H9GA 4K1XA 4RVFA 4GH5A 1L1FA 2R25B 4E2WA 3KQHA 4QOIA 3MINB 1CUWA 4YQZA 3A9CA 4YAEA 5C5EA 5JDIC 1WXWA 2BBSA 4FKBA 4IMPA 5K3OA 3SD7A 1TJNA 5J2UB 4QEKA 3SJUA 4C0AC 2TMDA 4O1IA 5KQLA 2VAVA 2D3WA 2VDKB 4LE0A 3TTUA 1T4CB 2LXNA 3LFTA 3UT0A 5BW5A 2XB8A 5ILOA 3PD1A 1H0HA 1LX7A 1RWQA 1LBEA 3MTDA 4RV5A 1WCV1 4CTNA 4JEMA 1JZQA 2VDLB 5DCLA 4RXTA 1V0JA 5G0VA 5J4KA 5IUNC 2GPNA 3U19A 1E9CA 2I67A 3U7EB 3KSUA 3K1JA 5CEJA 3SK0A 4EEKA 1WQ3A 3KO8A 2FWNA 3U0VA 1KY2A 4GMHA 1IEQA 5H3LA 3RWOA 4H60A 5CLLA 2E4AA 1Y80A 3G0IA 5D3KA 2VZ0A 1Q1QA 3AHCA 2V7BA 4UZFA 4DJFC 2YZGA 4ROSA 3KU1A 1S02A 4EVQA 4BGIA 1VHTA 4OB7A 3KALA 2I6XA 4A26A 3TTXA 1V95A 1E2PA 2KPOA 1CQXA 3MWJA 5JISA 2Z58A 1T15A 1ZOOA 1X7XB 3HEAA 3PFIA 3S5UA 1VI5A 2J7PA 3EIUA 3NM5A 3IAM6 1G5HA 4I5GA 2GAJA 3ELDA 2AN9A 1FFSA 4PBSA 4HH0A 2QRVA 2V4UA 1WSWA 3EY4A 1ZKMA 2QYOA 2QD3A 1BXZA 5JJCA 4P33A 3GLIE 1MA3A 1QU3A 5EWMB 1E1RA 2X42A 1KI2A 1K2VN 2UV8A 2OD9A 3PD7A 1LWNA 2VNSA 2N9UA 1E9FA 1MTOA 1AKWA 2HWKA 3NFRA 4COKA 2RB4A 2C8LA 2OCLA 5TVKA 4X6UA 4D8TA 4TXLA 3MJRA 1N5IA 1MHPA 4NNOA 1YOVB 5BY2A 1WNTA 4WINA 4Y30A 4MJ3A 1V25A 1WVMA 4YUAA 1KYYA 4Q66C 3WRYA 1XCOA 2WLTA 4GRIA 4PHTA 1ZIPA 1SFRA 3BCSA 4HI0E 5JNTA 4YAJA 3MJFA 2XE6A 4KO1S 2A6PA 5IDWA 1AGRA 3EDQA 4RLQA 2P0AA 3GRPA 1ZL0A 3JCZA 2EBUA 3CW9A 1MENA 4M86A 5HG0A 4BP9A 3LC1O 4KO4S 3VNVA 3HCFA 4O4LA 3UMFA 1M1NB 4PG4A 4TWRA 3F47A 5FAKA 1M2NA 2WA1A 3GN2A 4FYXA 4LUCA 1C9EA 4A5SA 3LRTA 3OBBA 1ZU4A 5K8UA 3C3WA 1KARA 4OL9A 3T38A 3ZDQA 5H3HA 1WNFA 1ZCZA 3AKCA 3I45A 4LJSA 5LMCA 4UOZA 3HACA 3TKAA 5KBYA 3N2YA 4KX5A 2XYPA 2I4LA 3ND7A 1LDNA 5AJVB 3H5NA 5IDQA 3CVVA 2OBLA 1FNDA 1NRXA 4C04A 1P74A 1UM8A 2B7CA 2BJVA 4TMWA 1KSFX 1QG4A 2W93A 3E4CA 1EGMB 4KU4A 4HNTA 3GJRA 3UJHA 4UTOA 3S99A 3VO8A 1K6IA 3QY9A 4L72A 2XWQA 1W4ZA 3I9FA 3HDGA 3OX3A 1EX6A 2Q2QA 2QRPA 4L74A 3UGJA 1RTTA 3DB1A 3OT4A 1YB6A 4GLJA 2BUAA 1E79A 3FR8A 4F93B 4E07A 1HYQA 1SUPA 2NU7A 3G6KA 1NWCA 4CM6A 2UYCA 5E4JA 3A6EA 1XL1A 2EJUA 3O95A 1ZHOA 1QUFA 3KT0A 1NURA 3CZRA 4IY1A 3GIDA 4J7CA 1FPMA 1BE0A 1G63A 2AXPA 4OV6B 1SELA 1AQ6A 2CK3D 2OXTA 2IUEA 5KOYA 4M9SA 4E7OA 2HUNA 3MJVA 3OOHA 4UD6A 1XBTA 5A6VA 1U0OC 4K5QA 2QMZA 3OD5A 2IEZA 4EKIA 3QEBZ 2I2DA 4RY0A 3EHEA 5EAIA 2IH2A 3HJNA 2C4VA 4ND5A 3F8SA 4L5JA 3K9CA 1RFGE 2P4UA 2WNHA 3FZEA 2G8NA 3K1AA 3O8DA 4RHCA 3ZV7A 5A3JA 4L16A 1EUCB 1Y9EA 5K8LA 1MR3F 2IW3A 2GJ9A 4Q5IA 2LUOA 2I55A 1S4QA 3IDSA 1X77A 1Z4KA 3T7JA 3CEJA 2PVPA 2Y9MB 3NB0A 3MT7A 1E9EA 4I55B 4X1YA 1E66A 5E95A 2H8GA 3Q5EA 2WAOA 1QOQB 5I7EA 1DC8A 1ICIA 1HE1C 1RXSA 2AOVA 1LUAA 2QLNA 3UAOA 1O97C 4M9XA 2IEIA 2IKSA 4CIVA 3VGPA 1TYBE 2BONA 2GHTA 2A67A 4N1AA 3ZS8A 4M49A 3IX7A 4PYLA 1OAKA 4Q47A 5KAPA 2GM5A 3GRAA 3PDWA 1UEJA 2W2LA 2J6CA 1YVRA 4C2AA 3FYCA 1ULAA 3OF5A 5K09A 2DH6A 4I3GA 3AQIA 1T35A 4IIEA 1ULSA 1WCYA 5EXDA 3FHCB 1W9MA 5HQ3A 1X8JA 4FD3A 3N0TA 1QAOA 2RC5A 4MYHA 4L5BA 4RS4A 5FCDA 1EVKA 2Z6VA 4OLHA 3HXMA 4K26A 2MJLA 1QZUA 2H1SA 4HTFB 5D86A 4IRXA 3Q6NA 5FBRB 2WP0A 4FK8A 4N7RA 2NXCA 1Z25A 2GYUA 3SX2A 2AFHE 2EXXA 2Q4RA 1XMQB 1OIVA 4YUVA 3WICA 3DCNA 3L6DA 1D0IA 3NMUF 3FCSB 4HNAA 1YRQA 3C3DA 3BKXA 4PVDA 4ALKA 3WLMA 1Y8QA 3HVRA 5FULA 1KZYC 1XN1A 2UYGA 3IQHX 5CDGA 5EJEA 3CRNA 2XRFA 3MERA 4GWGA 5IJ9A 3UJCA 5DX1A 2G1JA 1DJMA 2QQ0A 3NAMA 5FNVB 1U0EA 2YHUA 2DUJA 3F9RA 3AVYA 1NNI1 1YZGA 1TAGA 1NE7A 2Y1XA 1I3LA 3O75A 1X74A 1XMJA 5LB2A 4QUAA 5HBGA 2COKA 3M1LA 5EQFA 2PKCA 2JJQA 1YRAA 1I9CA 3B6ZA 5CR9A 4CDNA 4O4IB 1Y6JA 4BO6A 4CMEA 3GZTB 1JSZA 3R7WB 3DVAB 4F8EA 2ACEA 2QMUA 2GBCA 2P9GA 1CJMA 3BUSA 2AN4A 4EELA 3Q8WA 4Z4EA 4HAZA 4E1VA 1NMQA 5AW1A 3NDIA 4U02A 1X19A 1MEEA 2VOJA 3OTHA 4ESOA 3O8NA 1DKNA 3K5IA 3P9CA 2ZSIA 1WR8A 3CVOA 2PWZA 3LSTA 4B32A 5JXGA 3ZCXA 4JR1A 4WASA 5KNBH 2QLBA 4HFJA 3ZIAD 5BNWA 2BFCB 1MD9A 3HY4A 4ZDWA 2QZJA 3B53X 4OHOA 5KTRA 2DM6A 3AEUB 1HRDA 1SKBA 3ER6A 4NAHA 3REGA 4TKVA 3F2IA 2OGUA 1W87A 3HZZA 5F1YA 5KSPA 1JIVA 1PSZA 3WKAA 1X7GA 2HEIA 4NHEA 2J4DA 4F72A 2B2NA 5EJ7A 4XQ0A 2YFKA 3HDVA 1FZTA 1A98A 2AW5A 4IXNA 3SC2B 1U5CA 1CB7A 3L5OA 3OQOA 3FRIA 2IV3A 3GXBA 3PHLA 4ISCA 4FCWA 1A9RA 3G02A 3HCOA 1Q15A 4O2AF 2WAAA 3LHIA 4F5WA 2CMGA 3WLPA 3WHLA 4TLDA 3BXPA 3ELYA 4DA4A 1UMDA 3ZW9A 2ZAGA 1R6AA 4K6GA 1L5RA 1KY4A 2ZJ3A 4QPZA 3ILSA 4UUPA 4AWAA 5I9IA 2E85A 4G0VA 2A5JA 3TW6A 2X5NA 4EY3A 2HHAA 3BDAA 4RK1A 2OGTA 1VSQA 3WGVA 1EG2A 2ZGVA 3OO0A 1T9BA 1IN6A 1P75A 5AJXA 1DC7A 1GGHA 1RLIA 3NYWA 2YHSA 4ATNA 1BE6A 4AO7A 2Y2UA 3D81A 1GPH1 3CLVA 4RA6A 3H5OA 1WUJS 3R7NA 4E5UA 3CCFA 5JWOA 4DZRA 5BUCA 4ZC1A 5DXJA 4BGVA 1QNLA 3MCWA 2D2XA 3A4VA 2J4FA 2RK3A 4P2BA 2C42A 4I2VA 4R2MA 4L3VA 1APBA 1CZHA 4YWHA 3KT6A 3HWWA 3HBFA 4ZVUA 4WCDA 1JAXA 4LE2A 4HZUA 4A0FA 1SA0A 4NYJR 4NCBA 3SR0A 5DW0A 3H2BA 2MSCB 1C9JA 2IYTA 3R3JA 5A71A 2V6GA 2EG9A 5C8YA 3ZI0A 2HQBA 3PRJA 3SC4A 3WNVA 4KLZA 1OSNA 1SULA 3RB8A 5A03A 4ZPJA 2FW9A 1RAGA 1CDDA 3AHGA 1N5MA 4P3OA 2FZEA 5EA2A 1TQ4A 4DAOA 2GDJA 1SEPA 3GZNB 3MAGA 3LX5A 1E5XA 1IWOA 1XCGB 2D2VA 4IIVA 1RHUA 3JPYA 4J16C 3SMQA 5FB3A 1R4ZA 3JQBC 4LWOA 1GNRA 1AKQA 3CO0S 4KYUA 4BO3A 2JGKA 2UYYA 4RUKA 1WY7A 3PICA 4X7BA 4RD3A 3CVYA 2CSUA 1VIYA 4NS4A 8ADHA 4B7CA 2QVZX 4F97A 4C87A 1S9DA 2YKGA 3X2EA 1IY0A 1M6HA 4Y6SA 2SKCA 3R9XB 1P0QA 1XV5A 1PJ8A 3WYCA 3EXG1 5D3ZA 5IC6A 4MX8A 4OXIA 4G0PA 1DQNA 1XU7A 1G20B 2J9ZB 3DM5A 2X0RA 1PE0A 5JBIA 3ZX4A 1ZK3A 3KT8A 2CSXA 2NPOA 3ID6C 2JIDA 1YU6A 1E9DA 2C92A 2NVOA 4FYIA 1TA9A 4U6SA 2AWNA 4ZICA 1EFKA 3GLRA 4BGEA 4QAJA 5K6RA 3IVGA 4PF1A 2ASEA 1SPXA 3MAJA 3TDNA 4UTPA 2DQZA 2G17A 3PQDA 3DH0A 4I81A 2NMVA 1RAHA 1G5QA 2EZ4A 1ZOPA 5AK0A 1GG2A 4FYVA 4WOPA 3FBGA 2HU5A 2JIZD 3E58A 3M3HA 3LVBA 3O4HA 1HDXA 1V71A 1XP8A 1XVAA 3A1DA 4WA7A 4XPZA 4WY2A 4HXYA 1PWHA 4V0KA 4RE5A 4LRSB 1C0EA 3OQHA 4B35A 2C04A 2QYHA 5DHAA 1O94D 1OW3B 1WW8A 2LD4A 5A04A 3FVVA 3G2MA 4PPQA 4RHTA 1ZD5A 2E7ZA 4UBOA 3DDSA 1UBFA 1ZC3A 3V8BA 4EKGA 2MYNA 3JVIA 3FMFA 4ZYYA 3UUEA 1KR2A 1MIOB 3QRWA 3LE8A 2WHPB 3UC5A 3CA8A 3IAFA 1A71A 1L7DA 5L51A 2QGZA 3C6BA 3AKEA 3GNTA 2Z2YA 3IUMA 4X84A 1Q7TA 4OFWA 2V7EA 1MC1A 4CV2A 3NEYA 4BUZA 1UK8A 3FD8A 2VK1A 2GD6A 2JFZA 2EYQA 3EXEA 3IEIA 3IUSA 3JTEA 3PF9A 4IUDS 2P9BA 1NVXQ 1AGXA 1PJ3A 5LA6A 1A9XA 1YL7A 3HWX1 2CFTA 2R6CA 4KQGA 4YXFA 3MS2A 3T5MA 1XTQA 1UKEA 4N6OA 4ZDIA 2YUIA 4BPBA 1PT8A 1Q6ZA 2VJBA 1G8JA 2VPTA 4LTDA 2EFEB 4H6WA 1QVAA 4NRDA 3TX6A 3JZAA 3HU1A 4WN9A 4WK0B 1ZICA 4XSGA 3WWOA 1NLFA 1PG2A 3ESZA 1B6GA 3W6NA 4LFAB 5F12A 4H7DA 1QQ5A 4E4YA 3NBMA 4QDUA 4US2R 5DYGA 3ESBA 2WTMA 5TPZD 1AKTA 2I03A 2O2DA 4QTZA 1CWUA 3D3WB 2I5PO 3E18A 2GLTA 4M76B 3ZHRA 4QRDA 3D6TB 1PSWA 1YTUA 4ZT7A 1IL0A 3UK0A 3RU3A 1L2TA 2ZRFA 2YV3A 1T3HA 4H6XA 1KC1A 5DLEA 1CUVA 3K70C 5DWQA 2XNSA 1M2OB 4RZQA 2QX6A 4HG2A 4IQ8A 4C4XA 3R20A 3T4XA 1MAUA 2DR3A 4GT1A 4RTPA 3LUDA 3PA6A 1YV9A 3QELA 1TB4A 4KZPA 4NSNA 5CK4A 3CJRA 5DM1A 2A78A 5KVQA 3RYIA 3DVQX 5DN6D 4YC7A 2DULA 3BCHA 1BD3A 2HFKA 3EIHA 3M5PA 5DPMA 1G7CA 2Z6UA 1GQ2A 5K0SA 1F8FA 4FJ1A 1AZWA 3U4AA 1DEAA 2IEAA 4N03A 3TUZC 4H7HA 3VI4B 4B0PA 2ZZMA 2RGRA 2QQEA 2VNHA 1J2JA 4HSEA 1A8SA 2QNIA 3QU9A 4UNSA 2AJBA 2Q0SA 3NORA 1C4KA 1OFUA 3RGWS 5IK2D 3I28A 3DPIA 2I2CA 3D1LA 1CEEA 1R4MB 4H0NA 1VIDA 2RHMA 2YVUA 2GK6A 1C8LA 1LS1A 4CQMB 4K0KB 1ES9A 1W0KA 3D7SA 4WADA 5DHTA 4K9LA 3AUKA 1G9SA 1GZDA 3M6VA 2DHEA 1KZ6A 1T6XA 4YYEA 4TS9A 3PEFA 3CPHA 1AQJA 3WJ7A 3DC7A 5B12A 2YWDA 3QXHA 3OURA 3UBMA 3PGA1 3KR2A 3L18A 4EYGA 4TTQA 4M1TA 3TG2A 2BKUA 5BV1A 5DBGA 3DTVB 2FPWA 2OQIA 3AYXB 5KX5B 2ZAMA 1YZUA 3ZKWB 4A16A 3KEQA 5CA1F 1PGJA 1XRQA 2VAWA 1JWBB 3FIJA 3FBWA 4EEZA 5FUBA 2X1HA 4W6QA 3UENA 4FKZA 1JHXA 4RPCA 4RF2A 4AF7A 1DBSA 4CJXA 4QUHA 4NARA 3DL7A 3OKAA 4RZUA 4EM6A 3HDYA 3DJYA 1J21A 3MBOA 2C0CA 3PE6A 2UKDA 1SU7A 4HAUA 4ZO4A 1L5HA 3CLUC 2VDOB 1EDOA 3IERA 1RPAA 4MAFA 4ND1A 4WKPA 3G6WA 4YHBA 3VU1A 2FMUA 4HN2A 2JGAA 4YNBA 1L7OA 4YRMA 2WJVA 5BWMA 3QHPA 4EHHA 1RLUA 3I37X 4QU8A 3OUZA 1I3NA 2OZPA 1PFVA 4FNAA 4FR5A 3VYTB 4V1CI 1HNXB 1HDCA 1XRRA 2CB0A 2WILA 3C45A 3MS7A 1MJFA 5FUMA 1GD1O 1QV9A 3PEVA 2EYUA 4MWCA 3K8YA 5K8CA 1KH2A 2DHCA 4BBPA 1KEEA 3L6BA 5JPDA 2WQZA 1I7SB 3MEQA 4LOIA 1JEJA 1PWXA 5FWXB 2J6IA 4L9SA 3LDUA 1P0IA 2R1VA 4OREX 4UKDA 3IO3A 2FPSA 1MC5A 1RIIA 3IOBA 4LEIA 3V8NA 4LY0A 3OJLA 4XDZA 4YMLA 3OLQA 4JLOA 1JLLA 3DD1A 2XD9A 1V4BA 5ITVA 2DWUA 3WLFA 1PR2A 3GBVA 4Y2HA 1DO2A 2A1UB 3MN1A 4TTVA 2CJWB 2GAIA 3BEDA 1X7WA 1IN7A 1NPTO 2Q7XA 5AHRA 5CYGA 1BXKA 2CXQA 4GPEA 3UMYA 2HSDA 3DOCA 2CFRA 4M1KA 1I4OA 3DT9A 5IXYA 4XB2A 1Q0LA 4KMRA 2CBZA 1FXWA 2X4LA 3AYZB 3EVCA 3EZ2A 2B82A 2V5VA 3BSWA 2YNMA 4GXTA 4BNXA 4D8YA 2VQSA 4BFLA 1I6MA 4E1BA 1PWZA 1RAFA 3MA0A 4S0XA 4P92A 4QTYA 3ER8A 1Z2EA 2QTNA 2PKQO 1NV8A 4BQNA 1OCEA 1SOMA 3SIRA 5KZMB 2GBFA 3ST7A 1YT5A 4HFRA 3LQQA 1OR8A 1MO2A 4TN5A 3ZZ1A 5IVKA 2FR8C 2V55B 5KTTA 3MJSA 2VWPA 3RF6A 2FZVA 1PLJA 4ZHQA 2VKQA 2WC1A 4BNDB 4BOYA 4BBJA 4YS6A 5IC4A 1L8LA 3RNLA 3I9V6 1I7PA 2QVBA 1FX0A 4M89A 4XGNA 1NJ1A 4P4TA 4TT8A 4XUGB 4GD3Q 1KAGA 3GAMA 5TS2A 3VISA 4CUKA 2XNDD 5AXDA 4CMJA 2NX2A 2XTNA 3STTA 3VKWA 1LSUA 4N0MA 2D2IA 4OQPA 1D8AA 4D4MA 3GLIB 1NUAA 3RM3A 1L5FA 3WLLA 1TKRA 4DR6B 3P4XA 4M8IA 1Q1AA 1T3LA 3Q8MA 2Q3HA 5ADVA 1KDYA 3BMOB 1J8FA 5GJBA 3LCCA 1CQIA 3L7MA 3ORYA 1U8UA 5M5BA 4TQGA 4IAOA 4OQEA 4ICIA 1HLPA 1KIFA 1Z74A 2HDNB 2BL4A 3QYPA 4HYQA 1L5LA 4AD8A 1C9MA 1MCZA 2PS1A 3PF8A 3B6IA 2B61A 4DQKA 5LYJA 4MV4A 3HJBA 4AJEA 3FWHA 3GLFA 2X3FA 2JLXA 4LYFA 3K0KA 5A7GA 3SBXA 1J2YA 1K9VF 4WFJA 4YP9A 1AF7A 1I0LA 3HM2A 4WDQA 4KXNA 3IPCA 4JFAA 4YRLA 5G4LA 3RVOA 2CZCA 3RHSA 2WKRA 3RLIA 2YYZA 4DV3B 1TT5B 3AEKB 4M9RA 1SWWA 5ALXA 1VMEA 5JY6A 4JBGA 2PJDA 1JLKA 1LC0A 1Q11A 1AKUA 2QTBA 3EJWA 4MI9A 2WAYA 2BFDA 5BSVA 1JQ5A 4ENVA 1GUFA 4R4JA 4CVNA 2DTDA 2FLWA 2J67A 1ICEA 1CRLA 2UU9B 1M34A 1CZLA 2VJMB 4HX9A 4R0VA 1F60A 1WPXA 2GZ3A 3LOPA 4WDRA 1N5DA 1YA4A 2FRVA 1D8TA 4FC6A 2ZDGA 3GELA 1JDBB 1O95A 1L4KA 3I0MA 4CMIA 1GAJA 3BZUA 4RL6A 4BFYA 2FG5A 3M1AA 3WK4A 1BKDR 4RQBA 2XRZA 4U4AA 1C0LA 1IG3A 1HA3A 2GD1O 3MUOA 4A6EA 2P69A 2UZ4A 1X7ZB 1I13A 3P71T 3WE7A 2J30A 3PFCA 4CM4B 4OB8A 4D4HA 1SC9A 2BGUA 2ODQA 1RT9A 5HKLA 3I2HA 4J2OA 1Q57A 5ALDA 5IBRA 4GWLA 2ZREA 3U7HB 3EFOA 1S2MA 5TQ0A 3V00A 2OO5A 3NHBA 5TT1A 4JT9A 4IDCA 4EY4A 3RS2A 1UQTA 2R8OA 3A2NA 1E7WA 2RGBA 1LU9A 4NZNA 3VPGA 3ZY5A 4AYWA 5MN5A 3KDAA 5CT4A 3ETJA 3QVUA 3WYFA 3NDJA 3KG2A 4NKRA 5C7YA 1U3VA 4OIFA 1IXRC 1YUNA 2EEZA 3TSYA 1ILEA 1QRUA 1PUXA 2BSXA 2GEBA 3O73A 3C3BA 4X20B 1A9QA 5CM9C 4EJMA 2F2TA 2VZ9A 4KQEA 1MW8X 2W9XA 2WR8A 1M33A 1THTA 3COZA 5HF9A 4J0QA 2EKZA 3G2IA 4JSYA 3ZI7A 4LQLA 2GB4A 2Q5LA 3LC0A 4BEBA 4B79A 3PIDA 4ND2A 3VH4A 4YQYA 1LA2A 3DYVA 2XUJA 1VJCA 4D4IA 1N34B 2VDUE 4B9AA 2SKDA 1Z0DA 4Y6RA 2DT5A 3JVVA 4ZYWA 4EHIA 3WV5A 3CNLA 3EF0A 1VLJA 1TK9A 4EHBA 1EWQA 3KSMA 4ZCMA 3MTIA 1DXOA 1EDDA 1CR1A 1HFKA 4NU0A 5IBQA 2JI6A 1OV4A 3UQZA 5MFPA 3A58B 4LOLA 1SY7A 4G81A 4HDOB 1UCFA 1TU0A 4KTTE 1VI2A 3M2PA 4JKOA 3IBYA 4PZEA 2G76A 1DDIA 4X60A 3EIOA 4ZYVA 2GZDA 1XI2A 4Q93A 1ZCBA 3U7QA 4LI0A 4AU1A 3PHJA 1CNFA 4D3ZA 3KUXA 4CM7A 1Y4DE 4RGBA 2Q45A 1OROA 2BZ0A 1NXOA 1Z5WA 2QM0A 2QTVB 3B1JA 2Z04A 4PNZA 3W7AA 4RTRA 4CKBB 4KNVA 1IB6A 5F76A 4ZYZA 2A9KA 4W5WA 1DIOB 4PZPA 3PGVA 4DBZA 2AR7A 1X1TA 3UV3A 1QGYA 4TWBA 4Q4CA 5FFFA 2WU0A 5KHOC 1PS8A 3HHPA 2B99A 3MLEA 1FDVA 2AJ8A 3M33A 3MCZA 1Y9DA 4FWIB 4ITRC 4LDPA 4G4JA 3O82A 3HYSA 4KR0A 4QXMA 1XA0A 2QUZA 4ZU6X 1VHWA 3ZZNA 3CG4A 3HXTA 3PRYA 5A4JA 5JSHA 3WQRA 3FNQA 5JHGB 4XDGA 2G72A 2O50A 2QW8A 1EK5A 2W6JA 3DE7X 1KMHA 1YUBA 3H5WA 1K5DA 1MG5A 4NMMA 5K9ZA 3EIQA 4PLGA 4R1OA 2XYQA 5EIBC 4IV8A 4IXMA 4S2EA 2V45A 3R0ZA 3TOSA 1L1EA 4LGYA 2OD7A 5AM2A 4CM9D 3LHFA 2I65A 5IKMA 4HUJA 2WV9A 5HUQA 2TRSB 1Q14A 5F5LA 2GN4A 4BFCA 3IQIX 2P9YA 1DLJA 2JLQA 2OILA 1X7YA 3A4TA 2P4EA 3PDUA 4OBWA 4TZTA 3ZCTA 1SUWA 4ZIRA 1RXIA 2EFJA 3T1VA 3TSAA 1U3DA 3QEMB 1A8UA 3MD0A 3VR6A 1ONPA 5SZHB 3PYXA 3DWIA 1Q1EA 2G9VA 2JCBA 3KIPA 4LMRA 3D8TA 1Q17A 1E20A 1HE2A 2HA2A 3CWCA 3E3OA 3I2GA 4PZ9A 4L27A 3UIEA 2PKXA 2RB5A 5JT1A 2X0EA 3VZDA 1V1MA 1VYHA 2P9FA 4MVJP 5DZSA 1M9NA 5CGQB 3FJ1A 4CMCA 1FDWA 2I7TA 4X91A 3DLPX 3PUJA 4ZXPA 4JLSA 1RC1A 1YMVA 1SU4A 2O7RA 1XZ8A 4KL8S 4XWYA 4B3CA 1GA6A 4IPTA 4BATA 2RKBA 4DBLC 9MHTA 3OE7A