4QTUB

Structure of s. cerevisiae bud23-trm112 complex involved in formation of m7g1575 on 18s rrna (sam bound form)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
191
structure length
190
Chain Sequence
IFYNDSEAHKYTGSTRVQHIQAKMTLRALELLNLQPCSFILDIGCGSGLSGEILTQEGDHVWCGLDISPSMLATGLSRELEGDLMLQDMGTGIPFRAGSFDAAISISAIQWLNADTSYNDPKQRLMRFFNTLYAALKKGGKFVAQFYPKNDDQVDDILQSAKVAGFSGGLVVDDPESKKNKKYYLVLSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Multifunctional methyltransferase subunit TRM112
publication title Structural and functional studies of Bud23-Trm112 reveal 18S rRNA N7-G1575 methylation occurs on late 40S precursor ribosomes
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
total genus 63
structure length 190
sequence length 191
chains with identical sequence D
ec nomenclature ec 2.1.1.309: 18S rRNA (guanine(1575)-N(7))-methyltransferase.
pdb deposition date 2014-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08241 Methyltransf_11 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4qtuB00
3LX6A 3KPUA 2I6GA 1I1NA 4FSXA 3REOA 3CGGA 3TFWA 4MHTA 3OE5A 1T43A 3QOXA 2VDVE 1UWVA 2CWWA 3G5TA 4P7FA 5FCDA 4GEKA 2ZBRA 3P71T 5CVUA 2Q41A 5HFJA 3IYLW 3EVDA 4HTFB 3UFBA 3HCCA 3KPJA 2YVLA 3DMGA 3O31A 5DSTA 2CMGA 5EMLA 4E31A 2UYCA 1G8AA 1UIRA 3A4TA 4DM3A 1KPGA 5F2NA 1NBIA 1L3CA 3KHKA 4RYLA 2Z6AA 3M70A 3DUWA 3GU3A 2ZTHA 2VP3A 4AZSA 1EG2A 4P7GA 2YX1A 3BGVA 3BZBA 2HWKA 5K0GA 5DSXA 5BP7A 4HC4A 3UJ6A 5EEHA 1XXLA 2G1PA 5DXJA 2HTEA 4C06A 4E70A 4RTPA 1JG3A 1NV9A 2AVNA 1G8SA 2ERCA 4R05A 2AOXA 2AVDA 5C0OE 3LECA 1WXWA 3GDHA 3HM2A 2P40A 3KQYA 3ER9A 2OKCA 1INLA 4IV8A 3QV2A 2GLUA 3LDFA 3MGGA 3GRZA 2P41A 1JSZA 5E1OA 2YXEA 4JXJA 4C04A 5BW4A 3FTEA 3NWEA 3FYDA 1BOOA 2JH8A 2GH1A 2CMHA 1QANA 3FTDA 3TPZA 3MERA 5IKMA 1R8YA 1YB2A 3B3FA 1XDZA 4RVGA 3C3PA 3F4KA 3A7DA 4U7TB 5EMKA 3UA4A 2N47A 3JWGA 4OA8A 1KPHA 2VDUE 2ZIGA 5EPEA 4BY9E 5EOVA 5BW5A 3LHDA 5ICCA 2GPYA 1VP3A 3AXTA 4MWZA 4BLWA 2JHCA 3GRVA 2PWPA 4MQ4A 1PRYA 2ZBPA 5GWXA 4BLVA 1P1BA 2AZTA 3FPEA 3UJ7A 3LCVB 4KWCA 2AOWA 1ZKDA 2P3OA 1X19A 1XTPA 1RJDA 2AN5A 3R24A 1VLMA 4QDKA 4FT2A 3TKYA 4DA4A 2ZWVA 3I64A 3GCZA 3O4FA 3VC2A 1M0EA 3Q7EA 5CM2Z 2PXXA 4KDCA 2PT9A 1RI2A 1EQAA 1KXZA 3FUXA 1KIAA 2BH2A 3M6WA 2K4MA 1KHHA 1XCJA 4PYJA 2XYQA 3NDIA 2BZGA 2I7CA 2OO3A 2EJUA 3FPJA 3TOSA 5GM1A 2OPBA 4PINA 3LBYA 4ZTBA 3TMAA 5CD1A 4RTKA 5EC8A 4PYNA 3TRKA 1YZ3A 3SXJA 5B1SA 3VC1A 3AXSA 3G88A 3JWIA 5CUQA 4Z2YA 3B3GA 3CJTA 4OQEA 3MHTA 4RTNA 5IH3A 3TKAA 3RODA 1N2XA 2ONYA 1RJEA 4GQBA 3P9KA 5EMJA 1XVAA 2PT6A 4XCXA 1WZNA 4EKIA 2AN3A 5LQCA 3EPPA 3GRUA 3OFJA 4FR0A 4B17A 5GOZA 1IM8A 1ZGJA 4K6MA 4CKCA 3CJQA 2ZIFA 1M6YA 3AY0A 1KP9A 5G02A 1WXXA 2BR4A 4QPPA 2JJQA 3ORHA 1AF7A 3ELYA 1JQDA 2EFJA 2QY6A 3MTEA 1Y8CA 3FUWA 5K0FA 2ZLBA 3ID6C 5K0EA 3NMUF 1XJ5A 5FQNA 4LG1A 5EKUA 5DPMA 3HVJA 4Y2HA 1FP1D 2BR3A 3M4XA 5E1DA 4E2YA 1ZHFA 3E23A 2IH4A 8MHTA 3T7RA 4U7PB 4YMHA 4YV2A 1R6AA 2KW5A 3P2IA 4PCAA 1RJFA 3VSEA 3QOWA 1B42A 4O29A 3LCUA 2AOUA 3LL7A 4WXHA 5FA5A 5E9QA 5H02A 3V8VA 4GOOD 3B3JA 1JSXA 2UYOA 5HOQA 4RTRA 5LQNA 3JWJA 3PX2A 3LGAA 3R0QA 2ZZMA 1G38A 1JG2A 3MCTA 1NT2A 3MB5A 4LECA 2G70A 3EGEA 5DX0A 3Q87B 4FSDA 3HA5A 5EZQA 3FZGA 4M36A 2OB2A 4F85A 1V39A 3KQQA 2NXNA 3G89A 4NECA 1EJ6A 5CCBA 2IGTA 2NXEA 1QAMA 3EVEA 5LQRA 2PV0A 1P39A 3C0KA 3BWYA 1SQGA 3I58A 5D1NA 2GA9A 3FPGA 3VYWA 4CXMA 1L3IA 2FRXA 1X1BA 5K0LA 2XBMA 4GC5A 2PBFA 2PX8A 2BR5A 3G7UA 4IKPA 1ORHA 2G72A 2WA1A 4F84A 3OPNA 1KYZA 3UBTA 4PYMA 3A25A 5EHGA 4QQKA 4HTFA 4YUVA 3NDJA 4C03A 3BKXA 5T67A 5DM1A 4RTQA 4RVDA 3SGLA 4DQ0A 1EAMA 2O06A 3PB3A 4DKJA 1NKVA 4E2ZA 2NYUA 5E1BA 2VS1A 2P3QA 2XYVA 1KPIA 1VPTA 3SX0A 2ZULA 3BWBA 3EVFA 5EIFA 3PTAA 3HVIA 3TR6A 2JHAA 2FHPA 3OZTA 4RSRA 3HA7A 3KR1A 5DM2A 3KKZA 1MJFA 2AOTB 1BC5A 2XYRA 3SSOA 4M37A 2PVCA 2AR0A 4YV0A 3RW9A 3OE4A 4GC9A 1TPYA 4E2WA 2JHPA 2XVMA 5HIMA 4IV0A 4C05A 2IFTA 1EIZA 3G2MA 4HGZA 4AZWA 4ER6A 3KR2A 4BLUA 5K05A 1NE2A 2Y1XA 1H1DA 1G6Q1 3PFHA 3PLAE 4IWNA 1MHTA 3KPYA 1FJXA 1AV6A 3P97A 1WY7A 3D2LA 5F2OA 2YQZA 1P1CA 5EVJA 5EG5A 2IDJA 2PLWA 4UOEA 3NVKI 3TLJA 3G5LA 1FPQA 3LSTA 1JR4A 3C6MA 5LQKA 1Q0TA 3HEMA 2HNKA 3I53A 3KPVA 2HV9A 5GIPE 1WS6A 4HSGA 4OA5A 1D2CA 3NWBA 3BGIA 5FULA 4BP3A 3UA3A 3KR9A 5FA8A 5MHTA 1ORIA 5CVEA 2Z6UA 3EVZA 5EIWA 5EQJB 3L8DA 5M5BA 4PYKA 3UZUA 3OZRA 4FZVA 3IHTA 3DTNA 2IIPA 3GGDA 3OU2A 3ER8A 2FPOA 2O05A 1NW3A 10MHA 2IH2A 5T6BA 2JH9A 5DRYA 4ER3A 2P3LA 2H11A 4OX9Y 1RI4A 2VDWA 2FYTA 4LWOA 4X61A 3EEOA 3KQVA 2F8LA 1SUSA 1NW7A 4H0NA 2QRVB 3EVGA 4A6DA 3CBGA 1L1EA 2AN4A 4P7KA 1IY9A 1F3LA 3UJ8A 1JQEA 1QYRA 2BM9A 3GIWA 3HCAA 3JWHA 5JUWA 4PIPA 5EZSA 1EJ0A 1L9KA 2ZZNA 5DX1A 4X63A 2OY0A 4GOMD 4POOA 5HEKA 4FT4A 1RJGA 4P58A 4E32A 4KIFA 3A26A 4PGHA 5T64A 5ICGA 4M7RA 4MTLA 5EEGA 2PGXA 5BXYA 3BKWA 5E2AA 3G8AA 1FBNA 3P8ZA 2HMYB 2BM8A 3LCCA 3EMBA 3KU1A 4YMGA 5K0CA 1R00A 5F2KA 1JTFA 2ADMA 2LD4A 4KIGA 3EMDA 3NJRA 3NTVA 2UYHA 2IPXA 2ZIEA 4KVZA 5DLYA 4PNEA 2NP6A 4QVKA 3E7PA 3E8SA 4RVFA 5E8RA 3THSA 3U81A 4R6XA 5KVAA 2IH5A 3DMHA 2GB4A 1QZZA 5K0NA 5FTWA 1I4WA 3ELWA 4EK9A 3DULA 3GWZA 5EHIA 1VQ1A 4R6WA 4WVLA 5E9JA 4RTJA 4R8RA 2V7EA 3R3HA 3K6RA 4X41A 5KQSA 5E1MA 1X1DA 2OB1A 5CIYA 1KYWA 2R6ZA 4DCGA 3EVAA 3B7PA 4YV1A 2VZ9A 3M6UA 1AQJA 2OZVA 5ICEA 1YFLA 1JQ3A 1YZHA 4QTTB 4X60A 5FUBA 4HRAA 3ELUA 4PWYA 4EMSA 1JG4A 1JTEA 1YF3A 1YUBA 3HP7A 4DMGA 5U4XA 1N7JA 2I62A 3DLIA 4GF5A 2PXAA 4AZTA 3UJ9A 2PSSA 4C08A 1RI3A 3H2BA 3HCEA 2PX4A 1BHJA 2PWYA 4RWZA 1XDSA 2OYRA 5FWDA 5HIKA 2I9KA 3PFGA 2B9EA 2IP2A 3LKZA 3HTXA 3TM5A 2C7RA 5DTRA 4KDRA 3GO4A 5K0BA 2ZSUA 3CJRA 2C7PA 2WK1A 3AJDA 2YXDA 2EX4A 3DXYA 1X1AA 3FTFA 2NXJA 1NV8A 5CCXA 2O57A 5DM4A 2P1DA 1VP9A 3TQSA 2E5WA 3S68A 3FUUA 2A14A 2QYOA 1FP2A 2G71A 5K09A 4PYIA 3K0BA 3UJCA 1I9GA 2B25A 2NXCA 4FS8A 3P9CA 3HA3A 3FUVA 1TW2A 5DM0A 3T0IA 3LDUA 1ZQ9A 3CVOA 2ZW9A 1SQFA 2AOVA 3DXXA 1IXKA 1PJZA 3HVKA 5GP1A 4YUWA 3FTCA 3DH0A 3P2KA 4PONA 4CKEA 5KQRA 3OFKA 3GRRA 5FADA 4FGZA 3KR0A 1G55A 5DXAA 5FHQA 1Q0SA 1QAQA 3THRA 4MIKA 4YUYA 4GOND 2EJTA 2ZVJA 3KQWA 3A27A 3NVMB 4QVGA 1XDUA 5LQAA 5DRTA 3KQSA 1D2GA 4YUXA 4DF3A 4ER7A 1O9GA 4OBWA 2AOTA 4P7JA 3UJDA 2ZBQA 2DULA 2YR0A 5CVJA 5E9WA 3TM4A 4BP1A 5LQUA 5GINE 4RTOA 2NP7A 2QE6A 5EMMA 2OXTA 5KYGA 3T7TA 3CKKA 1RI1A 4V0QA 2R3SA 3DLCA 2G8NA 2ONZA 4GOLD 3LBFA 1WG8A 2H1RA 3BWCA 4Y30A 4QQNA 5E8JA 3UWPA 3MAGA 4CWAA 7MHTA 5GIOE 3ME5A 1P91A 4C07A 3BWMA 3P2EA 1RI5A 4XUCA 3X0DA 2JG3A 1YFJA 1NW5A 1TW3A 3M33A 1R8XA 5DX8A 2B2CA 4ER0A 5DT2A 3M6XA 4A6EA 3KQMA 2ESRA 3P9NA 1ZGAA 2Y1WA 5FWAA 5CVVA 5JR3A 2O0LA 4RTSA 4PYLA 2CL5A 2FK7A 3EVCA 5HILA 3MCZA 1G60A 1SVUA 4AZVA 4LWPA 2YUIA 5ICFA 3G2PA 3E05A 1F38A 2H00A 2ZWAA 3IEIA 4F86A 3BXOA 3BUSA 4EKGA 2FCAA 1BKYA 3FUTA 3OCJA 2C7OA 1VBFA 4PGGA 3PS9A 4X1OA 4XUEA 4RTMA 3HVHA 4KRGA 4R8SA 4G56A 3PX3A 2IDKA 3EVBA 1SG9A 2QRVA 4DZRA 4EQZA 4QTUB 1NW8A 2DPMA 2QM3A 4QDJA 3SSMA 1ZG3A 1SUIA 3MTIA 5K8VA 2B3TA 2UZ4A 4XUDA 3SSNA 3DP7A 1QAOA 2XVAA 2PX2A 2Z6QA 3FPHA 3G2OA 4CKBA 3HCDA 4ATNA 1NW6A 3NW9A 4PYOA 1HMYA 4ISCA 5EKXA 2YTZA 4RX1A 5FHRA 5LR6A 5LSAA 3R9XB 1X1CA 3BT7A 2GAFA 3PT9A 2PXCA 3CCFA 3C6KA 1O9HA 3B5IA 4QPNA 3RIEA 3MQ2A 3SM3A 2PX5A 2IBSA 2UYQA 2V74B 1XCLA 3G8BA 3OU7A 1VL5A 2ZFUA 3EGVA 2EG5A 5DWQA 2B78A 5HIJA 2P7HA 3UJBA 5HZMA 4AUKA 1NBHA 2ORED 3ANXA 1AQIA 3KQPA 3OU6A 9MHTA 4V0RA 5K0JA 2GS9A 2AS0A 4E30A 1D2HA 5ERGB 1JG1A 4HG2A 5K01A 3G2QA 3I9FA 2CKDA 2PKWA 2NNWB 5C1IA 3EEYA 4AX8A 1L3BA 1OR8A 3FRIA 2ZZKA 3GNLA 3HCBA 1Z3CA 3O7WA 4HH4A 4E2XA 1SKMA 3B89A 4CTKA 3V97A 3GJYA 2P35A 4KW7A 3SVZA 4C4AA 2HR1A 3DXZA 2FK8A 3KQTA 3M6VA 3GXOA 3KPWA 5GM2A 5P8WA 2C7QA 4PIMA 3DMFA 3FRHA 3DOUA 3R6TA 5FQOA 3HCFA 3SR4A 5DTQA 3UJAA 5C9ZA 3HNRA 3WSTA 3PVCA 4YUZA 5K03A 4PYQA 3I5UA 1M6EX 5CVDA 3ERCA 4FP9A 3DR5A 3IV6A 3C3YA 4M38A 4RV9A 3LKDA 4RTLA 3P9IA 3KQOA 4RVHA 5DTMA 3AWIA 3LPMA 2IBTA 2AOUB 2OBFA 2PY6A 2YXLA 3GRYA 5D1HA 1U2ZA 3A7EA 2ZCJA 4HGYA 4GBED 2O07A 1HNNA 4GUAA 3T7SA 4EVIA 1DCTA 1DUSA 3LDGA 2PJDA 3CC8A 4CTJA 4L7VA 2WA2A 2P7IA 1R18A 3SMQA 1O54A 4ER5A 1VIDA 1N7IA 3OZSA 3FYCA 5KS2A 1KR5A 3FPFA 1DL5A 5EGSA 1VE3A 2P8JA 3EGIA 3ELDA 4OBXA 3BGDA 5HIIA 4DCMA 5LQJA 1UFKA 4OQDA 1R74A 5E2BA 4PCLA 4E33A
chains in the Genus database with same CATH superfamily
5U1PA 3URMA 4EHBA 3B8HA 3PC7A 3U9LA 3CLHA 1VJ0A 3MXOA 1KJ9A 1IMJA 3BRSA 1OOEA 4MUIA 4M0LA 4Z4GA 1ODIA 5IJ9B 1BSVA 2XDWA 4LEIA 4HPJB 4JJ4A 3MAAC 3P71T 4YRRA 4DZTA 4OYYA 4HTFB 4TLLB 4U2KA 3AETB 5B3KA 1YT5A 1Y4ZA 3N3BC 2QN3A 1B2RA 2HMVA 1HETA 1Z82A 3NHYA 4CUJA 4QUDA 3U3XA 1E79D 2P79A 3AERB 3GU3A 2PLNA 4ZVPA 4AZSA 2WB2A 1EG2A 3EEBA 2Y0BA 3N6XA 1AQLA 2NAPA 3BZBA 4JBLA 4KIWA 3WTCA 5DCLA 1U0NA 3IEKA 2G1PA 4QUKA 3JV7A 2FMXA 4NIMA 4RPLA 5AKGA 4KPYA 5JQGA 1H4TA 1IHDA 1TZBA 2X4DA 2ERCA 4DZZA 1TO1E 2N46A 3A6ZA 4FDMA 2Z9DA 2TS1A 3GDHA 1CY8A 3HM2A 4QYSA 1X38A 4W4TA 4WOJA 1BX1A 2Q4DA 4Y6QA 5FFNA 2WQZA 3SZRA 1OLSA 3PIIA 4OP2A 2ASVA 2VJAA 3QKRB 4G0OA 4Q4DA 5HJ5A 5J4HA 5JAZA 4RHYA 4L9WA 5KYUB 4QYIB 1VC2A 3BDIA 3KXKA 4Z51A 2CWDA 2B61A 5ALUA 3WWZA 4LC9A 2PA3A 4P80A 4YPVA 2BC9A 3ZHQA 2Q6IA 1TGYA 2JA2A 3ZEAA 3GEEA 4JLMA 4XIFA 2V5AA 1CS0B 3RQSA 4ALLA 2FUNB 1I4LD 1R6XA 3JQ7A 4FZJA 4L27A 5EERA 4ZKDA 4UQPA 3U5TA 1E3TA 3GAZA 5C1PA 3D54D 3KFVA 1SN7A 4I1UA 4JWTA 3AY6A 4X1IA 3UXEA 1DTSA 2PS1A 3ZXUB 3RTDA 4F60A 4CE6A 3LL4A 4ESEA 1QHHB 2O8BA 3SF8B 4JP5A 2IELA 3HU3A 2ZWVA 5KAMA 3QEAZ 1XRMA 2QRJA 1EFRA 3E3AA 4P5DA 3K0SA 1W9HA 1ZIXA 2GN9A 5C80A 3L4BA 2Z4RA 4OPMA 2BH2A 3RTGA 4KQHA 2WU3A 2ECPA 3VR4D 4EVRA 4FHGA 3R9XA 2B4KA 1U2QA 5IP5A 4IM7A 2ZBDA 2WYHA 3MUNA 4HWOA 3TNYA 3O93A 4V0ME 4ENTA 1V2HE 2FWPA 2Q9BA 1T35A 4R1OA 2CK3A 3ZDYB 3CUKA 4ZOLF 4CV1A 4NOKA 2HADA 2O3SA 3D1LA 3AIKA 4FZRA 1WOYA 2IYXA 1ISHA 1MAVA 2A3RA 2YWEA 3ZE8A 4WK2B 1VRCA 2QXUA 3FKSD 5A4DA 4ND4A 3T1QA 4GBJA 4O5AA 3IVCA 1EE9A 2A78A 4JSYA 1WQ4A 1CKEA 4IIJA 2VYFA 1PZXA 2Q07A 3EOAI 5BOSB 3M6MD 5BV8A 5LIPA 5AUPB 1VSTA 4P0QB 1MX5A 1H69A 3RTCA 2DB3A 2NYRA 1QPBA 5K0EA 2AN1A 1I33A 4MAMA 3I6BA 1PX0A 3FSEA 4GPZA 2X0JA 2WMDA 3HVJA 5J63A 3RBXA 1ILEA 3JQ9C 2PSEA 4K5QA 1Y6JA 5CU7A 1P7WA 2PANA 3HEAA 5HRAA 2VDPB 2G0NA 1I1HA 3IMGA 1F2TB 5EE0A 3V8BA 1JSCA 2RHBA 1MB2A 3K0CC 3IELA 2FX3A 3CVJA 3T3OA 4RDCA 4AG5A 1GNLA 3JALA 3PLAE 2SKDA 4RSHA 3FMGA 5H02A 1XDWA 1K06A 6NULA 1JFLA 3OURA 1E2EA 2P4QA 3BBPA 4G37A 2DY1A 2D1QA 4D97A 1UMDB 4UBNA 1W4AA 3HK2A 3J80A 1W0JA 1QXSA 1NNUA 2E1RA 1PZEA 1QZUA 1XQVA 2ZB8A 4MRPA 1UEXC 3GBPA 3II6X 4RKRA 3O92A 5ANRB 5FPKA 2O0JA 1E92A 1EK6A 1UZAA 1X8JA 2QTBA 2EBWA 1ZK3A 1ZD4A 5E38A 3T1VA 5A4FS 1DUVG 3NB0A 4J43A 4TMKA 2IGTA 5HQJA 1GTRA 3L01A 5KTPA 3WXBA 2XVYA 3LW8A 1OI2A 1BAPA 2I7VA 4CXMA 3BHNA 4GMKA 1MO3A 4G4SO 5BSFA 1KJNA 4INOA 3WX0A 5KYTA 2GSWA 2FLWA 1IFXA 2CL6X 4CIYA 4OX9B 1RYYA 5AO9A 4JA2A 1MOSA 4AIRA 3PD0A 4A8HA 3RS2A 1Y9EA 1DLJA 2PU5A 2G1KA 4XVQA 1TKAA 3KUDA 5K4GA 3E5MA 2G63A 4W9RA 4QTXA 1C2TA 2O20A 2QGZA 5KNBA 2I1WA 1M0WA 3LQ1A 4G1UC 4EBBA 1NVKA 4QKQA 1XG5A 5F98A 3A70A 4KO1S 4U2EA 5EFOA 1U2TA 3VOSA 4K8RB 5AUNB 1US8A 1ZD9A 2R2GA 3HCRA 4P81A 4XWTA 3U7EB 3A2KA 4HF7A 4B6SA 1ISMA 3TBKA 2IPNA 1M8JA 1DQYA 3CW8X 4D0RA 2FMKA 2A0YA 1UZLA 1KFBB 2JGFA 4LQLA 4MB2A 3FLAA 5FI0B 1PI3A 1TQHA 5IJ0A 1EBUA 1GKLA 1U1IA 3SSOA 4UOZA 3A9TA 2ZTVA 3GMIA 3MILA 4MRMB 3RW9A 4EHJA 3TPFA 1VBMA 3QKSA 1TX4B 1FFSA 2XVMA 4E2WA 5MF6A 4GHWA 4C05A 4WXEA 2V6GA 4GPEA 4JQYA 3N2GB 4F6RA 3I4LA 5HMMA 4IWNA 5EUQB 1DRUA 3L49A 1N2GA 3GJRA 4JMPA 4WN9A 4QDUA 3PBKA 5EWMA 1CPYA 1UWKA 1YV9A 3LHFA 2CLMB 1XMPA 5A02A 1JR4A 2JA1A 3NYQA 2FEMA 3GP5A 4IY1A 5TJHA 2EKZA 3TWOA 1KTIA 4G1VA 1CJKC 1EINA 5SZJA 3S28A 1XK6A 4G07A 4B7AA 2VF5X 3R09A 4AMUA 1N9KA 2PSFA 3TMKA 3ZGZA 2JRCA 2LXNA 1E1KA 3BAFA 1NATA 1ESMA 3OHPA 1HL3A 2H63A 1H22A 4CDRA 2Z09A 1H1TA 2Z3VA 1XROA 3CG0A 1A5BB 1L5YA 5FP0A 4D8YA 4QLBA 4R0NA 1IZ8A 3OJ0A 3KAQA 2Z0MA 3WNBA 5C8ZA 2JH9A 3L79A 3QKTA 4JCCA 4UHFA 1MG5A 2I6QA 2ZB2A 3FVVA 3QF4A 4LMBA 4DGQA 2F8LA 5C8XA 4YRCA 1A0OA 2ZRCA 1W94A 2Q4OA 5JO0A 4JNKA 1XMIA 4X1KB 5D3MB 3X2SA 2VTBA 4KXVA 5HP4A 4KHZA 1Y4AE 1I2AA 4PU0A 2ZZNA 1ZUWA 4EPWA 2CJWB 4R2XA 2J4DA 1O9BA 3LX5A 4MCJA 4XYMA 4R54A 4KYTA 3RUDA 3M4NA 2V4UA 1QIIA 3G5AA 3LIPA 1MOQA 2NYAA 2Y1KA 4FHEA 4U0KA 1D6JA 2JCBA 5ALJA 4KXQA 1NIPA 3IILA 4Y2JA 1YC2A 1VLVA 4S12A 3TOVA 4C22A 2RIRA 1N5DA 1XB2A 3HWWA 3NTVA 1P7YA 5IF9A 4YREA 4XRRA 2LCQA 3PPVA 4Q05A 2OBBA 3TD9A 1WXQA 2QVGA 1XEXB 3WDKA 4RM3A 5AJXA 2CV0A 1KMHB 1LI7A 3HZOA 4R6XA 4U7DA 5E95A 1MT3A 1TAHA 3AJ8A 3K20A 4RH3A 4XPIA 4D4MA 5IS2A 3CR7A 5WRFA 1EK5A 2CF5A 4CM8B 3M9XA 1W5AA 1ZINA 5EHIA 3RJTA 2P4EA 1SC1A 1VLZA 1DXHA 5LFAA 5IUNC 2XSZA 1QGOA 4QPJC 1I4TD 3O5AA 4WCDA 2FY8A 4KLZA 5TT0A 2VEDA 4FDUA 3EQ7A 1AKRA 2Q3BA 1U2EA 2G9NA 4YV1A 4TV8B 4WADA 5EXEA 4II3A 1ABEA 1SRQA 4PFKA 4RFLA 4Y9SA 1IHUA 3ZWNA 3CX4A 4B0OA 5FUBA 2GBGA 3ELUA 2GN0A 5HQ3A 3DGFC 3EQ9A 2I62A 4PG7A 4D44A 1E64A 1XV5A 4ND3A 2C29D 5JG7A 4AZTA 4AY6A 3GGGA 4JI2B 1IN6A 1UOEA 4RWZA 4AZ0A 1O8CA 4AQDA 4FU0A 2QF7A 4KWEA 4ICIA 3W5SA 5FV7A 5HIAA 1PYDA 2H85A 1NVBA 1KSFX 2DSNA 3U3OA 2UVPB 4UATA 5A7FA 3IODA 1TK9A 5K0BA 3F4LA 4S1WA 3PR1A 5JY6A 4UBMA 5AIAA 3QVTA 2CNWA 5I48A 1QTNA 2ISCA 4MP6A 1PN3A 3NC1C 1MU0A 3OCVA 4P35A 3VKVA 4A16A 4CU5A 5JHHB 4B4OA 5L3QB 5K1ZA 5GONB 4OP1A 5FJJA 2QYOA 1T6XA 3UMFA 2ZVDA 4AP9A 4BMYA 2AL7A 4IDGA 4ADSG 3UJCA 2WYOA 1IG0A 1I9GA 2JLYA 2DLNA 2G77B 5CDUA 1HFWA 3ROZA 3D6AA 5KCZA 1W1WA 1A88A 4JITA 3E27A 2CXXA 3DT9A 1UMKA 1M6VA 2HK8A 2QP9X 3CX8A 4WW0A 2JCXA 1CFJA 4OVKA 3UPUA 4Z4CA 2D5AA 3VR2A 5EE9A 5F1KA 4BZPA 3T4EA 2OAGA 2CGEA 2VZLA 3U7IA 1YR9A 1JEJA 4XWAA 3IUQA 5FHQA 1ZH2A 3IDOA 4EI8A 2JFPA 2WWGA 1PDOA 1YRWA 4NI5A 4GM0A 1UP6A 2A0WA 4JC0A 3A4LA 4BNYA 1UPXA 2FOXA 5EJAA 2QRUA 5J59A 1C4KA 1KR2A 1GSAA 1ZH4A 3NEPX 3ZIAD 4DR7B 1TU3A 4JX9A 4I8IA 2CYCA 4C0BA 4QXAA 1Y5NA 3VZDA 1W5BA 4IYRA 1QCYA 2PKXA 4L9SA 4MS1B 2G8NA 5D5QA 3FVWA 1GO2A 2H1RA 5DNUA 3DAOA 1VHJA 1F8UA 3JQGA 1X86B 2C77A 2JFHA 3LGXA 3P0JA 5CYOA 5IX8A 1DO8A 5IKOA 1FSPA 4KYIB 4EHFA 1HEYA 1OX4B 5C18A 5KNCA 3R3VA 3JVUA 4XRGA 1EBBA 4H7KA 4TN1A 1VL0A 2BFDA 2NUAB 2H5JA 3DFKA 4P3YA 1DX4A 3CG4A 2GD1O 3O8OB 1EM8B 4JAVC 4NSNA 4OMCA 5FBRB 5J5VA 1RJ9B 3RBVA 1SM4A 4YIHA 5H9WA 1TCBA 4YAOA 1N2BA 1C1XA 2O7SA 4HNAB 5DP2A 3L9WA 3D6JA 2NVBA 2XQJA 4BX9A 3DM5A 3J7TA 1WA5A 1L6RA 4S3MA 5HILA 1C3VA 1DKRA 1H6CA 2D8MA 4COKA 5DBEX 2BBWA 5ICFA 5BN5A 2ZYIA 3G2PA 5M34A 1D1QA 5LBIA 3OM1A 1GLNA 4YX9A 1L5GB 4G5QA 8LDHA 4D26A 3O8CA 1RFGE 5KYNA 2G9VA 3I9OA 3IBSA 4QXRA 5TGDA 3O0DA 4KRGA 2MYTA 1X7GA 1NRXA 1YRAA 1ZUHA 4OHKA 1E9SA 2AC2A 4EMBA 4QTUB 1ZCFA 2X40A 1W581 2KE5A 1T4CB 4JIGA 1UWCA 2F1KA 3NOXA 3WNCA 1LPMA 3I3OA 4RA9B 2HBYA 1XJQA 1JPJA 1F2UA 1RU3A 3ELBA 1W5FA 2IP1A 3F0TA 1O6ZA 4Q03A 4YMSA 2YIDA 5EUCA 3VV3A 2Z6QA 1QG2A 2ZETA 1N4AA 1QO0A 4PYOA 1Z3IX 1QRAA 4MPTA 4CLRB 2B98A 2R5NA 3UH1A 5CG1A 1TM4E 4U7JA 5I8PA 2X42A 4EPRA 5JAUA 1KYTA 3DNMA 3MQ2A 2BUCA 4QVIA 3ITNA 5KNBH 1E2LA 4KN9S 4TMXA 5BVHB 1L5ZA 2I9PA 2I8CA 2FP4A 2AE1A 3LUBA 3OJFA 4U9IS 4WTOA 5E3IA 3ZNQA 2ZR9A 1IDOA 2B8WA 1K8ZB 3JQ8A 1GPJA 3V42A 1C7FA 2E6UX 3R6GA 2O8CB 2GPTA 2R8ZA 3L7AA 1KZ9A 1AQIA 1G8HA 3KQPA 4JYBA 2ZT8A 4EG7A 3G9TA 3NHUA 1AUQA 2GS9A 3BD6A 1UBTS 1XDGA 3HU5A 1BS1A 4GDMA 4EL5A 1QP0A 3RK1A 1NP7A 4RD4A 1NYLA 4BWGA 3AVTA 3D8UA 5IANA 1QIFA 3GNLA 1GV1A 4RQTA 2QZJA 3O7WA 3QUBA 3KJZA 4A8JC 2GAIA 4J9VA 4CL8A 5HNKA 1WPQA 5JCZA 2VPPA 1DWUA 3LOQA 1GGMA 4JUBA 2ZR8A 3BXPA 4Q3KA 1MIOB 1NMZA 2DBVO 5DHAA 2OXIA 4ZQCB 4A26A 1A8PA 3THOA 3OEHA 1B16A 4JP8A 1EM6A 1T0BA 4IMIB 4MUAA 1PLJA 1KJIA 2D0PB 5K03A 2A1TR 1DPFA 3QWFA 1M6EX 3S1AA 1C9EA 2Y27A 4ND6A 3ERCA 1NJFA 4YRNA 3U13A 1MQSA 3K53A 2QROA 2FGJA 3QEJA 1QRRA 2CY0A 3K1AA 4P4TA 2IBTA 3ISVA 3BCSA 4JJ6A 2UZ3A 3A7EA 3OICA 4P92A 1DDGA 5LXTB 2QD3A 1C3OA 1WVGA 1B0ZA 3EZ6A 1YDEA 3GW8A 4PBTA 2FOIA 4TTPA 5DT9A 3QELB 1JHDA 4K2HA 3UJHA 5B58T 3GLSA 3QXJA 3O8QB 4PQYA 2GWRA 5CMLA 4IOLA 1X13A 4BQQA 3ZV6A 5AKKA 2JC3A 4L5JA 1KR5A 3K2QA 3KLOA 4FBLA 2GUWA 3OJCA 3EFEA 2JAHA 2AFRA 2FEXA 3BGDA 1COWA 4LXUA 4NOMA 4LTMA 3T61A 2HRDA 3JAKA 5I6DA 3GYGA 3GN1A 3E61A 1A77A 1U1CA 3DE2X 1L5NA 1AA6A 1ZXLA 3CZRA 3VV2A 3ZWXA 4BKOA 1MA3A 2ONCA 2YV4A 4Y6LA 1Z4KA 1NF9A 2PKRA 1AMNA 4DT1B 1H0HA 3U1BA 3OE5A 2RBKA 3Q5DA 3TZLA 5KQGA 2WIBA 4MHTA 1HBJA 2NXWA 4UUQA 5DN6D 3FZEA 4P7FA 4BJ5A 3LUJA 1GGEA 4PAOA 1KDOA 5PGMA 1CZKA 1ND5A 2C5LA 1QIDA 2YJ6A 3H3JA 1XZMA 1KAOA 3GRFA 3OQ6A 4L2IB 3HCCA 4CLHA 1C8LA 4F96A 1WXHA 4TYYA 4XDGA 1SNYA 1YE3A 1NBIA 3QEOA 1SR8A 4IOKA 1L4HA 1WD5A 3BE8A 4HDMB 4LK3A 1D8TA 4XIIA 1JDJA 3RO7A 1D0SA 3BD9A 5FEMA 4DRYA 3LOPA 4LRTB 3GA7A 4P7GA 1G3RA 2A0FA 4CVNA 4ZEXA 4DKXA 4DSTA 1WUHS 4LHEA 3V5NA 1XXLA 1P7CA 3GP3A 2XIQA 3ZWQA 4AMBA 4QDZA 2I6TA 1DXOA 2C0QA 3QSYA 2C2KA 4MGEA 1NFRA 2B4QA 4WESA 3QOYA 3NJ8A 3QOFA 2J33A 2P40A 3DR3A 5DO9A 3CGWA 3SE0A 1ZBDA 2CNBA 2QRHA 2AUMA 1PVVA 2AIRA 2X0DA 1WBDA 1NW9B 3LKVA 2B30A 2PZEA 1ZOOA 4G0XA 1DWOA 4QL3A 3C45A 3REGA 4N54A 2BJVA 3BJIC 5DULA 4OJMX 4I55A 4GRIA 3WJAA 1GZ3A 1R4NB 2CKMA 5BSKA 5G2OA 3A7DA 1Q7EA 4H1TA 2UZ1B 2AQKA 2DFPA 3DD1A 3JWGA 2BFNA 4MLZA 4WLOA 2UXCB 1ZA2A 5HKKD 2MYUA 1XZKA 4TVOA 3BE6A 5D3KA 2XUZA 4J1TC 1R9NA 4M4SA 1FFXB 1RKXA 1LBSA 2IBMA 3DV9A 3VNBA 2HK9A 1QBKC 4EWLA 4CQMD 3ANLA 2DWPA 2W8ZA 1XAGA 3COSA 5EIBC 4JUFA 3NWPA 1N8KA 1DC6A 1N0HA 1SO8A 3JQAD 1XYYA 3GAAA 4A1FA 4XWOA 4BNZA 3GCZA 1OA0A 2HU8A 2ZBUA 3MMSA 5AJUA 5H3LA 4RV4A 1RI2A 1YO6A 1KXZA 1UXJA 3CRRA 5CLGA 5DBGA 5EJEA 3UK6A 2GFIA 4NU8X 2VUTA 3ZCTA 1B6GA 4F4CA 1L4LA 2W6ID 3AFHA 3BHMA 1S3SA 4IIGA 1RYDA 2H48A 4Q1AA 5ILOA 5EKDA 4DR2B 1A04A 1PR2A 5B2EA 1QK4A 1YI0A 3QYAA 4X65B 5TMBA 4K9NA 4KX5A 2IE0A 2X3FA 5H8WA 1R0XA 3AEKB 3NWOA 3ZLTA 3VC1A 1BEZA 4PZPA 1P4JA 3RRFA 4IMJB 1ZHOA 4YXWA 4B75A 2BGKA 3K4PA 4TX1A 3OBIA 4ITRC 1C7JA 4D57A 3TKAA 2XBUA 4RTNA 1P4RA 3OIYA 4GQBA 4CR6A 2NYVA 2Q9CA 4GGPA 4ZZ0A 1FLVA 1K97A 4JLSA 5D7BA 1XPOA 2PT6A 4R7GA 1C4OA 3FYUA 4GXRA 3VU1A 4ZHQF 2FEAA 1ZGJA 2DH6A 3EXHB 3UYLA 4R7ZA 1Q6YA 1M6YA 1W6UA 1Z7BA 1YIOA 4IAOA 5B1DA 1A9TA 5G02A 5BPFA 1Q17A 5AM5A 5ALVA 1YQGA 5IAKA 3ADPA 2AW3A 3OVMA 3PDJA 4OIFA 2RHCA 1C0PA 3I12A 3ILSA 3QX3A 1K66A 3KV3O 3B5JA 4R9RA 5CGZA 1EWQA 3EY9A 4TWIA 1P77A 2PUAA 2RGNA 2BHRA 4CODB 3T5GA 3VH4A 1FP1D 4JT8A 1KO4A 3CRQA 3QU9A 3RS4A 3T3EA 4EA9A 3B9BA 5CBPA 1WEKA 1V8OA 3D3JA 5KNCH 1N6KA 4U7PB 1UT6A 1W35A 3R8FA 4OKNA 4JOCA 2QR5A 5HYVA 4TKZA 3K8YA 3QQPA 1QQAA 2QLBA 5E9QA 2E9SA 3H16A 2YINC 1KI3A 1JIVA 2BT4A 3U4AA 3NZEA 1II8B 1AXGA 2R6GA 5IAJA 5LQNA 4FYWA 2ZYSA 1N5KA 4IQ0A 3BJRA 4K6HA 3VUFA 1O0SA 3BDAA 2P9CA 4DLLA 2ZT5A 3VH1A 3KJHA 4YJ3F 2H57A 4MCHA 2D0OB 3AL0C 5EINA 2PVPA 3IXQA 1A9PA 1M72A 2OB2A 3AHDA 3N5KA 4F85A 2W37A 3AZPA 1WCIB 2GHRA 2JGAA 2QL5A 3FB1A 3INRA 4GZLA 2HOQA 1ZN9A 1RHUA 2WHQA 3BMCB 4K9RA 4WNIA 4YI3A 5BQ5A 3USCS 3D9QX 3PYMA 2XGSA 3AX6A 3FNIA 4HQOA 3WADA 4AECA 5AHWA 1G8JA 4ZPJA 1M83A 3BULA 5G1NA 3QG5A 2XBMA 3TL2A 3JZMA 1RHJA 3QX9A 3AUFA 2XADA 4Z99A 1KETA 1U5BA 2Q6LA 3A4IA 3IPLA 3OPNA 4RM2A 4Y9RA 5L7YA 4U2BA 4NCAA 2YV1A 4DNOA 4QQKA 2HX1A 1QORA 3HDTA 5L53A 1QYIA 4ON9A 1VPWA 5BYKA 4KGVA 2O06A 1OLUB 1PNRA 4IGKA 3C7DB 3E9CA 4LISA 5E1BA 3W90A 3HJNA 4AWXA 5I7SA 1JDBC 3K32A 2XI4A 4NOJA 3A8TA 3NHPA 5TS2A 2ZSHA 1SULA 5DHTA 2JFFA 3HA7A 3FNFA 4UBLA 2DT5A 4TV9A 1Q0TA 2ZYGA 1JHYA 2AOTB 4UDNA 3U9SA 4I4LA 3FOCA 1A7KA 3QLTA 4JD5A 2VHZA 5HIMA 3ZLJA 4FWIB 4JB3A 2Q0XA 2IHVA 1ZMRA 2Y67A 2AFIA 1SBCA 3L6UA 3E7DA 3ORFA 4Y1FA 4BO3A 3NAGA 2XCTB 4N5IX 1LSUA 5DI3B 4D3FA 1GPAA 4UFOA 4WV3A 3SJ7A 3DAGA 2QA5A 3D8TA 3KYCB 2C3PA 1FCJA 2PG3A 1XO1A 1DTEA 3UUEA 1JV2B 4FNGA 5DIFA 3LWNA 3BCUA 3D7KA 5IK2D 3BM5A 2HDNB 3OCZA 2QTWB 3Q7PA 4Q21A 4YMIA 3DEFA 1VCHA 3FOAA 1NVTA 3UHJA 2QRLA 1Q95A 2WIKA 2JD2A 4TTRA 3T1TA 3MIIA 3P20A 4Q3LA 3IAM1 2Q3HA 2VBCA 4ANFA 1DU4A 4D79A 3KPVA 1GPKA 5CB4F 1R6BX 3NWBA 3QPWA 4X5OA 4C1BA 2Q2VA 3WFIA 4JVLA 1E0JA 4TRMA 2X76A 5TPZD 1U5AA 2VSYA 3NBZC 2ETXA 4PYKA 4RPHA 1RBYA 2MT9A 1M66A 5GAJA 4Q02A 1SB9A 3FLBA 5AVWA 2XCQA 2PXHA 4I50B 1G3QA 3IT0A 2V7XA 4JLWA 3GZNA 3KKOA 3ESXA 4DSOA 2QUZA 2FA9A 3RU7A 2IZZA 1E5VA 4RJJA 3VR5D 2FUG6 1FMCA 1KAQA 3MTJA 2OGZA 3K2BA 4J6FA 4Y6PA 2QLFA 3GF4A 3GPBA 4P7KA 3UJ8A 4DBVO 5JVDF 2W00A 3HCAA 1JNYA 1QE5A 3E84A 4FOOA 3DZDA 2WJ3A 3OPQA 4HDRB 4BV8A 2V1UA 1KGSA 1B15A 2GFHA 1IEWA 5HEKA 3KDPA 1Y6QA 4HQKA 2GARA 3SMVA 3TN7A 4MJ7A 3CT4A 3ZY6A 2FR0A 2GJ8A 1Y5MA 4LWZA 4XWWA 4BNIA 3UC9A 4AQYB 1NN1A 2BEVA 3EH2A 2ZJ1A 4LUCA 2ZRQA 3HKCA 1TNDA 4QUIA 2O2ZA 1TJ5A 1GZUA 3L7IA 2O2EA 4INJA 4BRZA 4IQ4A 4XKJA 3EMDA 2BZ1A 2A9VA 4J7UA 2ZIEA 4EW6A 5A6VA 621PA 3JYOA 4H4EA 4RH0A 3O75A 3EXFA 5C1OA 4KITB 4I3HA 4ETWA 3VO9A 3ZCQA 3ENQA 2NVUB 3KT3A 1MTOA 3ELWA 2SECE 2F8MA 3IQDB 4PX2A 1E89A 1OIXA 2C88A 2ZE8A 1CRWG 1VOTA 2GJ9A 4KUEA 4WVLA 5DK6A 5K99A 2DBZA 3C3BA 3E1GA 1XD9A 2VKTA 2A92A 3DDUA 3OLYA 3UMMA 3L7JA 1P33A 2C97A 3NM6B 2NU8B 5TDHA 3ZI7A 4KGXA 5K45A 2OFWA 4CQLB 4URXR 3F73A 4YDQA 4RKWA 3UICA 2ZUWA 2QXTA 2GCEA 5A3RA 5KX5F 5DWDA 3NDRA 4IF4A 4JLBA 4CUKA 3TAHA 2GVDC 3R6LA 4BNUA 1GSHA 4HNGA 3U4QA 4IIUA 1Q11A 3ONDA 4EI9A 5A9SB 2HWXA 1OBVA 4HRXA 1RRVA 2YJ5A 3ZE9A 4O4LB 3NU1A 2VRCD 2XTZA 2DHRA 2H0QA 2L69A 1PR3A 3JASA 3O47A 4FYXA 4MWSA 3TM5A 4F4DA 5C4IA 3CJRA 2XA9A 3PE6A 4JT4A 4E46A 3C6BA 2QLJA 2NLOA 2QTHA 3ECSA 4H0CA 4DCUA 2HZ7A 4XYBA 1VBKA 2GK7A 2OPHA 1GG9A 2QGFA 1VIVA 1CUDA 3HVUA 4NZ9A 3NHLA 3B5EA 3FUUA 1APBA 5DYNA 2ODQA 5EP4A 1SXJD 3AKCA 3PNKA 1TC2A 2HAEA 3HG7A 3K0BA 4JX8A 4PYIA 2I2WA 2XRMA 5DH9A 1CLUA 2W6JA 3TQRA 4YLYA 5JW6A 1V6CA 3P9CA 5FPPA 2RHTA 2H2HA 3ENWA 4GKBA 4JKYA 3RF6A 2Q0SA 4NYIR 4F9GA 4C7BA 3NHAA 4I4TF 4CKXA 2ZJ7A 5DGHA 1C7IA 1GKUB 2B3DA 2NTVA 3N28A 3GGCA 4GT1A 3T06B 2QN9A 1E1CB 4HDKB 4PHCA 2EWMA 3RRMA 4I99A 1CRQA 5CITA 3L7LA 4RFSA 2WV7A 1L2TA 4B9EA 4S1VA 1FW8A 1I6KA 2ZVJA 1P0IA 4IXTA 3AFNA 5DLEA 4DLNA 4GI2A 4G2TA 4JEIA 4WDQA 3PPXA 4B44A 1CUEA 1GU7A 4WNAA 1LK5A 4I8XA 1ODCA 4F2PA 1D2EA 2UZIR 2C00A 5FRDA 3BSSA 1R6TA 3DUFB 5G53C 2ZPUA 4BTEA 5ALRA 1AZWA 1SBIA 3N8KA 2CE7A 5AW4A 1C9DB 3A37A 5I4CA 1I7SB 3OEED 2QZPA 4RXMA 2IOFK 4LXHA 2DQKA 3A9UA 3NS7A 5JSQA 5GIOE 4D0GA 4DV6B 4PY2A 3P2EA 5LZ7A 1K0UA 5FTNA 4O5OA 4FCWA 4LY3A 5FT9A 4CT5A 1YVUA 3M6XA 1MC8A 3HB5X 1CUIA 2VQ6A 4JJEA 4ENWA 2HMSA 2AHRA 3SIXA 4D9KA 4K28A 1H9BA 2ZJAA 1XYVA 3NM4A 2BSAA 4ARIA 4AO6A 1AQYA 1OA1A 2QYTA 4B7XA 3LU1A 5KYYA 2ZWAA 4M9XA 4F86A 3PDIA 1YRBA 2Z83A 3QNUA 5EE1A 1TZ2A 5H3CA 2C7OA 2MU1A 2OO5A 1KEWA 4CM9D 1JQLB 2ETVA 4QOJA 4OFXA 4E22A 2WMNB 1D6NA 4RTMA 2FWNA 1SBZA 3RKSA 4R71A 1PO7A 4P8RA 4H7PA 5LQSA 5I7WA 2NUBA 4E13A 5F35A 3GT4A 2PUBA 5FD8A 1MNQA 2ZDGA 4EF6A 1KK2A 2H29A 2W2MA 4P4UA 1GZSA 4XUDA 4W5OA 1GGHA 2ZEJA 4MUFA 4QECA 3VPCA 3K0AA 1FB5A 4KQ6A 2HSDA 1H6BA 3AR4A 3KSDO 3GXBA 4YRLA 5JEEA 4LMPA 3KUUA 3NW9A 4LMRA 3KXIA 4ZU6X 3B3QA 3OF2A 2BYTA 3CCFA 3NX4A 2F67A 1LZLA 1SC4A 4FFLA 2VSQA 4KHPB 4JEHA 3W8NA 3K4QA 4GLJA 3V7NA 1F0YA 1ZEJA 3FCOA 1TO6A 4O1IA 1EPUA 2V74B 3KZXA 3OU7A 4GKVA 1J25A 5KOIA 1M5TA 5IXSA 2ACKA 3Q6MA 5AOAA 1A2QA 1R9GA 2GEBA 1NKTA 2DKFA 3PWKA 4AXXA 2GERA 3O2NA 1T2FA 4JELA 1I3OA 2A33A 3OU6A 3FKQA 2FWJA 3E2IA 1MC1A 2JGIA 1JG1A 1UK6A 2WJJA 3E1KA 2CSXA 1KU6A 5GGXA 2O6LA 1Z3CA 3JQAB 3ORSA 1CQXA 3SF0A 3MJSA 2HSWA 2PTHA 2ZKIA 4NULA 3ZGNA 1YAJA 3QVOA 5I9MA 3BVPA 5IYZF 2HA3A 3U5ZB 4AQ7A 1W52X 3DFZA 3DP9A 2QVYX 4FE3A 3Q7RA 3CMCO 4R1UA 5HKOA 3R1IA 2BIFA 1E7YA 2H5IA 2HUPA 2NPOA 1FU4A 2WWIA 4JS0A 4UCWA 3EZ9A 4JYMA 1QU2A 4C78A 2JCYA 5DTMA 1BW9A 1CW2B 4BP8A 5EZYB 4YCNA 1FYXA 3Q5EA 4L22A 4NFLA 3GRYA 3DMTA 3N8HA 3WKAA 3I3SR 3BHJA 3R3JA 3ZVRA 3V2GA 1EG7A 1IY0A 2P6MA 3ND8A 1F12A 3HV2A 1W4BA 2XNJA 4F3KA 1VMEA 2GEVA 2ZAOA 3LFTA 2C4VA 2HCFA 4ER5A 4B6EA 1NPYA 5EWJB 2CUNA 4JLAA 2MINA 1DL5A 4M8KA 3EGIA 3Q98A 2OVBA 1U3VA 1YZVA 1I2CA 3H11A 2G17A 4ARAA 4JI0B 4DS3A 1Z4OA 1VKJA 3KLNA 3GNTA 4ENUA 2AH5A 1PT9A 2V58A 4F9EA 1A50B 1GPLA 3VOBA 2B1IA 1VYHA 1ODSA 5JPCA 2C9YA 5C8DA 3N8IA 3IQHX 1S3IA 3ZWYA 1UWVA 2IXDA 4O4IB 2PU7A 1MAAA 3EDYA 4GH5A 4OHZA 3RRYA 5JH7B 3NBUA 2LTAA 3RGWS 2XMSA 2RHWA 4Q6BA 4MUEA 2JAOA 2IX9A 4HN9A 1RRGA 3H5AA 3W5AA 1T6YA 1TQ2A 2YDXA 1CK4A 1NAIA 1UXGA 1XQ6A 3HR8A 3WRVA 5A2GA 1RRPA 3FPCA 2JW5A 1FS6A 5EJFA 4IINA 3CQ9A 1HQKA 5LQMA 2FR1A 3L1KA 4CF5A 2AG6A 2AYYA 1YQTA 5CDSA 1Z4MA 4PZDA 3UJ6A 4W9NC 4WBXC 2IE8A 2OA0A 5AVTA 2IYQA 4FB4A 3ZXYA 1A9QA 1N6HA 2ATEA 4YK7A 5JNLA 2IOYA 3ND9A 3KQYA 4Z9YA 1R8QA 4GM1A 3EZFA 1OFVA 2CUZA 4RIHA 2PIAA 3O94A 1VKNA 3Q1KA 4IS2A 3GRZA 3TNFA 4D9HA 5BY2A 5EHZA 5A1JA 1X1QA 1KOFA 4BVLA 2GO1A 1ZCZA 1GTZA 4FI3F 2CMHA 1QANA 1CXZA 2AEJA 1FUUA 2H07A 2KM1A 3GN2A 1RQRA 4XOIA 3U3ZA 4A8PA 2DPXA 1Q2UA 4KAAA 1L5HB 2GZ1A 4BWFB 5EOVA 4BGIA 1LJUA 1VRWA 2ZJYA 4EY5A 3OTWA 2TSYB 3DV0B 3BWDD 3JYLA 1HYQA 2VJBA 3CB2A 2Y1FA 5DYTA 3HH8A 4L3VA 1KAEA 2AFHE 1T1SA 3FHCB 1QRTA 3X44A 1E3EA 3LTEA 1ZKDA 1X19A 2V7UA 2ZGVA 2MSCB 1J0XO 2JGKA 5AVUA 4E07A 4N82A 2BP7B 5LZ5A 4DA4A 2HA5A 3P2YA 4AJ4A 1HFEL 2I2XB 1A8UA 2CVPA 3DMRA 3QLVA 3HLTA 4ZKEA 3IAAA 5DNDA 3RM3A 5KOHB 4M9CA 1LWNA 4GDFA 4JV5B 3NAZA 1MXFA 2VDWB 4K0RA 1EXWA 2JARA 4F5WA 2EFDB 3HI6A 3OZGA 5EXSA 3TLXA 3EJ6A 2ZIXB 1ID1A 4MGKR 1SCDA 4NYJR 1CRLA 2EJUA 3WWYA 4BNDB 2EKPA 3Q12A 3IERA 2AFVA 5AVJA 4P4GA 4DCTA 1QQ5A 4IX1A 2IITA 4BMPB 2R25B 3QVUA 1GZ7A 1TIBA 3ST7A 1T4GA 3LC7O 5EYPB 1CY6A 3RYFB 1OCEA 4Y8VA 1VJTA 2R7LA 1MRNA 5B6PA 4I6EA 5L4LA 2XMZA 1F6WA 2EARA 2C83A 1XVAA 2Z08A 3CRVA 4EG0A 2CLHB 3DJYA 5E4TA 2YWFA 1PZHA 3NASA 4J3JA 2JAUA 4H15A 1SCUB 4INAA 3U0BA 4CM3A 1ZRMA 3Q72A 2Q1UA 4ETMA 1J8YF 2Y05A 2XTNA 2C61A 2YZGA 1G9TA 2FOLA 4BAUA 1KP9A 2PRIA 1WXXA 3C41J 5GJVC 1YQQA 1E7RA 2YVKA 3M5DA 3VKFA 1UZMA 3UCEA 4JOBA 3ZJ4A 4B76A 2EW8A 2PAAA 3EW9A 4RQBA 1SVMA 4GYWA 4GPBA 4LZJA 5JDCC 1V2GA 2Q2NA 3QEBZ 2YQ5A 2VNAA 3UAWA 2XT9A 3VDXA 1F3OA 1TLTA 2LGJA 2VT7A 1E3QA 1EP3B 1ZA1A 1QV9A 1V8DA 2WNHA 3GFSA 4HXFB 3DFMA 1L7RA 2RHGB 3ANYB 1BE6A 3IUMA 1SA0B 2XA2A 4RZ3A 4GUDA 1K7SN 4XYGA 4P2BA 4MPJA 3JWJA 4J0EA 4PZ9A 5FDFA 3RC2A 1Z5GA 1OXVA 4EATA 4Z9BA 4CT4B 4LY0A 3SKYA 3BXEA 4HAXA 3DF7A 3ENVA 4QAQA 3DLAA 3P0FA 5AT1A 4LCJA 2Z98A 4R0MA 5EQTA 4LXXA 4OLBA 1Z74A 2WD7B 2ZIUB 4XDZA 1RPAA 3QFRA 1NVVR 1GYPA 2YRWA 3GHYA 2AK3A 3QE9Y 4KQCA 2J9XB 2R87A 1L3IA 2I7TA 2RB4A 1JF8A 3PYXA 1AK2A 2VZ8A 1WXGA 4JR2A 1PKEA 3TGLA 1FFEA 4J0QA 4C3OB 2WA1A 1EP1B 2UAGA 4Q0MA 2PGDA 4LJ4A 2YS6A 3MCUA 1UJ4A 1C9JA 1ULBA 1YE8A 1R0YA 3EGXB 1T1IA 3G0GA 3QK7A 4LOAA 5EWLA 2V7TA 5A71A 3TZEA 3ZWMA 4YUVA 4CKWA 1EDBA 3H1FA 1OTHA 3INNA 3G7SA 1B00A 2B4YA 2W5UA 4IZOA 1XZPA 1NUQA 4HMPA 2DP4E 4N0DA 1JA9A 4YCAA 3B48A 5ED4A 1DXYA 3OIFA 2REQB 3PC6A 3WYFA 5C32A 1J0AA 4J3NA 3SX0A 1NJ1A 4OB6A 5EI5A 3GEIA 2FQ1A 2WP8J 2AQHA 3HGTA 1G42A 3MRXA 4XSVA 2ZJ6A 2RHLA 2ZR0A 3V8MA 2QE7A 4OBBA 3NFRA 2C8KA 1NBAA 3LMKA 4NXNB 1KK3A 3KKZA 2IP4A 2R47A 4BNLA 5J4KA 4DMLA 3SJZA 4XE5A 4AS3A 1I7NA 2NUTA 4GC9A 4AG3A 4AY5A 3L8MA 5C8YA 2HU5A 1NVMB 4KV9A 2FPUA 1EXNA 2X8BA 4B47A 3VVLA 1ID8A 5EXXA 3TDNA 1XZGA 2IF0A 3DHNA 1EWYA 3ICWA 1PFYA 1FDUA 1VB3A 5HE9A 5K05A 1A8HA 4I1YA 3GZTB 2OSBA 1Y42X 2X0RA 3VPSA 1Q83A 4C5CA 2JLXA 4DW8A 4QFDA 3OM8A 4IO1A 4CMKA 1BMDA 1R1DA 3LFHA 1NOKA 1FRQA 2QSUA 4WQMA 2XNCA 4N65A 5CK5A 2QRZA 4OAQA 3ZVNA 2EL9A 2XTJA 1EVLA 2P9EA 1JFSA 1YOVB 5CVCA 5KI6A 1KWGA 4GZ6A 3RVOA 2DT8A 5FO0A 2W70A 1IN7A 3T7AA 4BB0A 5IC6A 3IBYA 3R0XA 1XD2B 2OD7A 5AM3A 2FN3A 2WYUA 1P7ZA 3OAAA 4RK4A 4QWWA 3VPHA 3EVZA 5BMVB 1F5NA 4I14A 3ZQKA 3UZUA 4K1LA 2YJNA 5L7TA 1YR8A 2EKDA 2IH2A 1FQJA 1KOJA 1R4AA 2VYVA 3D4PA 1RAIA 4EHNA 1KVSA 1T9DA 2VPXA 3OD1A 5FLKA 2GKSA 1Z9BA 2IW3A 1P60A 2PLFA 3KYBA 4ZVOA 2VHVA 4PQRA 3HKDA 4A27A 4FYPA 3BX1A 1IM5A 4JEMA 3CFYA 4MIOA 3MRVA 5ALQA 3UGTA 1WHSB 4MYUA 3PX7A 1FXSA 2EF1A 1D4OA 5B7GA 3SZMA 2VKQA 4H3VA 1WLSA 1Y63A 2OY0A 5JPIA 4B5LA 5CD9A 2ZIAA 1ZJWA 3OA2A 1P9LA 2O3RA 4GD3Q 1UDXA 2FB9A 3CLVA 3ANNA 4W6QA 3WYBA 1O0BA 1B76A 4M7RA 4EMTA 2GZSA 1D2AA 2I3AA 1LLUA 3UC5A 2WSBA 1C30A 2ZXEA 3NHJA 3X1KA 4DANA 3OC0A 4TSRA 4AUNA 4LNAA 1DMSA 1JTFA 2HMWA 2OV8A 1ACMA 3W1VA 2A9FA 4PN3A 2UYHA 3WLMA 3BEOA 4RHXA 1PHRA 4RF3A 1EE2A 4Y2SA 5NLLA 3ZQ4A 3BA6A 3UUFA 4FYJA 1J00A 1W1IA 3VR1A 4IQGA 4WNCA 3WB0A 1JXAA 3C87A 1AZLA 1G21B 4MV8A 4Q9AA 3EXEA 1O5TA 1VQ1A 4JNCA 2X0EA 5LNK1 3A9WA 3BILA 1QX4A 3R5HA 4MMYB 3T7DA 1R3UA 2PX0A 2Y77A 3E9EA 5TQ2B 2A9QA 3W3AA 4IIJB 4Q1EA 3OFVA 1T2AA 2BMFA 2OB1A 3GFVA 1YNSA 5E1MA 4BUJA 4D8TA 3VNVA 2R96A 4ZZ2A 2BF7A 3M3HA 3V4SA 3I45A 4Q39A 3ZKWB 5DKFA 4XVRA 1IY2A 5BNTA 4TTJA 3AG5A 1VHTA 4BVBA 3FNHA 2E4WA 2O2DA 3TIFA 1DQNA 1JTEA 4HPXB 3A28A 3HP7A 3P0RA 4DMGA 1NU6A 1MX9A 5TS3A 3FDJA 1T24A 2PH1A 4ARVA 2ZREA 2JGMA 2X1VA 5DMHA 1JG7A 1M74A 2HHLA 2PA0A 1IWOA 4ZU3A 5FXMA 2XNKA 3OZIA 1FZQA 1UZUA 2OQIA 3VJKA 3VNSA 4DYHA 1YRLA 1A5SB 2JBAB 2PR2A 2C7RA 1LBTA 5J23A 3G0HA 4IILA 4O8CA 3QMWA 3BHIA 2D5CA 1OXUA 5AW1A 3BJEA 4U63A 3P9QA 1VPDA 1DJPA 1LA2A 1D5CA 1CE8A 4H0FA 3T7JA 5C52B 1L7MA 3RIXA 1QK3A 2VJOA 3W6OA 2J85A 2O59A 5AHOA 4BN0A 2HT6A 3R74A 1IATA 3L6RA 4E21A 1YR6A 2O50A 3ABIA 3WA6A 1RVDA 3TSOA 4YRKA 3FLEA 3T41A 3BGSA 4QTYA 2ANBA 1EUCB 1KI6B 4XCVA 1Z13A 1S7CA 4Q6WA 1XL0A 1WPXA 2R00C 1UK9A 4NEHB 1PQPA 3AV3A 2ZW9A 1UWLA 2H17A 4K26A 3GJZA 1G16A 2JPDA 4PONA 4Q7MB 4YCSA 3VX4A 4I5IA 5F5XA 4DV5B 1FXWF 2XUQA 3LO5A 1BGWA 4KQ1A 4QE3A 1S89A 3K70D 1G9SA 2OVFA 2HCRA 1YJ5A 5K3DA 4QJ3A 2HA0A 3RFTA 3LPNA 2D8AA 1M9NA 1E9RA 2FG6C 2JNWA 1WU8A 5HUQA 2O54A 4WCVA 1Q6ZA 3TF5A 1C9NA 1N7GA 2QDXA 2IU0A 1ULZA 2WB4A 2EL7A 2YR0A 3UOAB 5AVVA 2MSEB 4PSKA 1QRUA 1VMKA 4G01B 5IXJA 3HB7A 1L4UA 1LF0A 4A2CA 2R3SA 3I72A 4KZPA 5I3ZA 2QZ4A 1QGUB 1WSBA 2AEFA 2ZATA 2FI1A 1RPNA 2J9YB 2Q6KA 4IIEA 3ETNA 2QG9A 5TXGA 3JR7A 2OR3A 3OM9A 3K0CA 5CNJA 3VGJA 3U44B 3A1SA 3TCKA 5IJ0B 2XMGA 1A5TA 2FF5A 2WM2A 4EJ6A 2HFKA 1YJQA 1XI2A 2GM9A 2R1UA 3A04A 4H4CA 5KC9A 3AEQA 2XQGA 3UKOA 1CD5A 1FYVA 3FOBA 4CI0B 3H5TA 3OH8A 3QBVA 4GG1A 4UCXA 3WGZA 1JNXX 2WYWA 1P74A 3ZV5A 1DGQA 3EXAA 1IB0A 4LMAA 4DG9A 2RCNA 1N3LA 1IJFA 1L5RA 2CL5A 3QRWA 3HB9A 3HCWA 5CYGA 1Q7TA 3MM4A 4L6AA 4NF2A 4XA8A 5EWMB 4WK0B 2BMJA 2XMQA 2X0FA 3WYDA 1UEIA 4IH4A 4KQXA 5A9RA 3LUHA 2OQ2A 2YNMD 2QD5A 2WYVA 5KNLA 3KEMA 1C7ZA 2PBRA 1DEOA 1NYTA 5DXFA 4HATA 3S8MA 2VJYA 1BU8A 2EDAA 2G9ZA 2I4NA 3AVUA 1U7PA 1DOAA 3NEAA 5CJJA 3QEKA 2BHTA 3T4UA 4KR2A 3HACA 4TVKA 4B71A 4MVXA 2ZDQA 3UGKA 1N6PA 1ZNYA 5K8JB 3ETJA 2I55A 1A71A 1RM3A 2TMGA 5IAEA 3X1ZA 2XOXA 4KPUB 4EQ6B 3G6KA 4PSVA 1XOIA 1HMYA 5IDYA 2QTVA 3QF4B 2GJKA 1AKTA 3TZCA 3HPRA 4PPFA 4IL5A 1ZGBA 4RZQA 1SU7A 3HYTA 4KRXA 3WGHA 2XMCA 4LQ4A 4QPNA 3RIEA 3GAMA 4V03A 3O3MB 1YJXA 4D1YA 5KWIA 2HDWA 4DQLA 3B7GA 1W36C 1QP7A 4Q15A 5JS6A 4BVAA 1ZH0A 3WGJA 4KO2S 3N7UA 1Z56C 4YC7A 1U9CA 3SC2A 2ID9A 2VHYA 3WHLA 4IMPA 4HN2A 9MHTA 1GLGA 3FCYA 3EOBI 3RVJA 3QNMA 2PH7A 3RC1A 4H1UA 1DEKA 4ZCMA 4UCQA 4RGYA 1RPTA 2CLLB 3RIYA 4FN4A 2ZYDA 3AI1A 3OESA 1GZVA 2X0NA 3TPZA 4CV2A 3ON5A 5FI3A 2W42A 3M6VA 1JLMA 1DAEA 3ED5A 3D64A 4OKIA 4Q7EA 7REQB 1CY0A 2GCOB 4L51A 4NZZA 4Q66C 1EESA 1A98A 4PSUA 1UOOA 3E22B 3IR6A 2OQRA 4NDZA 2J59A 3ADOA 5H7XA 4B4KA 3GVCA 4XW2A 1XQ9A 1THTA 2XCSB 2WFLA 2JRLA 4E15A 1F17A 4CN9A 5GMOA 1GPDG 1E63A 1NUHA 2W58A 4I5GA 5FPYA 5C4MA 2P2ZA 3PQ6A 4IHQA 1J8DA 1E4EA 2GDZA 1HNNA 2EJVA 4UMEA 1XVUA 3B53X 3NYIA 4DUGA 1PVOA 1BCSA 1N6RA 1PJCA 4CFYA 5HUJA 1NMYA 2DFVA 1C0KA 1SCNE 3IIEA 4L7VA 2PSHA 2GD2A 2WG1A 4PLTA 3EIXA 3WO1A 4WCFB 1LCIA 4JT9A 2IHNA 5AQEA 1IG3A 3VRHA 3FPFA 2EKBA 3B60A 1WB4A 1VIAA 4WT7A 3NUZA 1LPPA 3UTCA 1QIKA 1DQZA 4UNNA 5BYAA 3PC8C 4KFUA 1P61B 3GK3A 5B7NA 5DP1A 5COQA 1SUAA 1H4VB 2ARKA 4DTIA 2HIHA 3UH0A 3CRW1 1XTKA 1FTQA 4RIEA 1T43A 2BFWA 1DEXA 3EE6A 4M9ZA 3CPEA 4GZ5A 4TWRA 2DXIA 5JWRA 4KWIA 1YS2X 1J39A 2I4RA 3J81A 3ZIDA 4PC6A 1OW3B 1WTAA 1H1LB 3Q9LA 3D6HA 3PRJA 3RLFA 3EF3A 3RU3A 3M5PA 3OQIA 4DYVA 3L9XA 5BN4A 4IVQA 4RZHA 4ZAGA 1II0A 1KPGA 1X9IA 2OYSA 1GFWA 1LDGA 1XQ1A 3L7YA 4PM4A 4KXMA 4F2WA 3KVYA 4R83A 1E1YA 2YX1A 3KYIB 1FFAA 4EO4A 3I2KA 3B1KA 4WKNA 2Y3IA 3H87A 2B82A 2WAMA 4FFWA 4OTZA 2P6NA 1OXTA 1KMCA 3NAQA 3R7LA 4EOGA 2JI4A 1HOTA 4QEDA 1JG3A 3DONA 2ECQA 3ITDA 5TRTA 5CH5A 2BBSA 4OQZA 3V4LA 5HXAA 4D8VA 4OYHA 4BEVA 2D54A 4BZZA 1U8ZA 2OMEA 3W3AH 4CKYA 4HVLA 1Z6TA 4KAJA 4DUZB 3LF2A 5ERYA 5ER9A 3NWEA 5IW8A 4WWHA 1Z63A 2VK4A 1XXHE 3QEMA 1WZ2A 2FR8A 2PRJA 4RVGA 4JJ7A 1MX1A 2VFAA 5ADUS 2J0VA 3JR3A 3HYRA 3EXIA 2ECFA 1E77A 3GRCA 3LHDA 3MWLA 2YIJA 3EDOA 3Q41A 1XTSA 4MW9A 3AVPA 3SYLA 2ODEA 1I0IA 1PRYA 2OWEA 4Z54A 2OHHA 1Y1LA 1C1XB 1U3GA 2ZAIA 4HWGA 1TLLA 3HO8A 2A5JA 4WECA 3S2YA 1RJDA 2C2OA 2E4VA 2RHJA 3R7AA 4PEVA 1DO0A 2I66A 2HK6A 4ZFNA 3GIDA 3O4FA 4FDVA 1PS0A 2I4MA 3M9WA 2WU4A 3OP1A 4MAAA 3VC2A 5HE8A 3BN3A 1SHZA 1I4OA 1Y4UA 1R0ZA 3BE4A 4DCCA 1F60A 1GUYA 3CNNA 1T0HB 2HA2A 3RJ9A 3O7MA 4O4JB 1P2GA 1SJ9A 1U4NA 2W93A 4KNVA 2FVYA 3LYLA 1FPMA 3MD0A 3OPVA 4LVUA 4M0DA 4TTTS 2WIFA 4QM7A 1Z5UA 4RTKA 4ZTBA 2P4HX 3TRKA 2DUNA 1UBFA 3KTDA 3L8GA 1SAYA 1N3BA 3I1FA 2HPHA 4HLQB 4I6JA 4ZC8A 1QHEA 2IHZA 2IYAA 5KVVA 4MTCA 3DOIA 2I1LA 3WRYA 4D56A 4TLAA 1GKYA 3V1UA 1AF4A 1ADJA 3ZC3A 1YJBA 4GX2A 4EJSA 1OLOA 3ICVA 1SQ6A 1QH8B 1WZNA 3HN6A 3NPMA 2JVIA 2XA1A 4HD8A 5H3HA 5FWYA 1HMPA 1U3DA 4TMFA 5IAAA 4QGFA 4C87A 1WB6A 1N57A 2JJ2D 4J0HA 3JQBA 1Z0KA 1V5WA 4DREA 2FGKA 1TU0A 1EB8A 2OM6A 3BB4A 3OIWA 1VG8A 4GL4A 4MS4B 4OO3A 4EHHA 3DWFA 2WHPA 2X1MA 4IGFA 4P4SA 3ORHA 3JQRA 4Q9HA 3IMEA 3NHRA 4C7KA 5I8WA 5EIOA 2WWYA 3FOWA 3DSRA 2NZVG 2IS1A 2SCUA 4GBGA 4MVJA 2J3KA 2P30A 4BTLA 3ISTA 3NETA 4Y2HA 3MC1A 4D8UA 2AG0A 1OT5A 1S3FA 2BR3A 4R2KA 2GYYA 2BFCB 1Z5ZA 3GCGA 2X2PA 1O58A 4R1LA 4Z0TA 3SXUA 4NMWA 3E2PA 1TXGA 4MARA 4YMHA 1E59A 4FNOA 4YV2A 1L5KA 1DAPA 1FL9A 1RJFA 4QYWA 3WB1A 1XNHA 3ZBPA 2AOUA 2H0RA 2XD9A 3VZSA 3F9CA 5BN3B 5JD5A 2CNDA 4EGJA 1FF9A 2W2KA 3QYFA 1HLFA 4IEFB 1NM5C 1UINA 3FCAA 2C7GA 3HU2A 4AXBA 5B3LA 2W7TA 3PGJA 1RCUA 3MB5A 3ML1A 3S1AB 3LY7A 1HLDA 2AK2A 2C9ZA 2QMYA 1S2IA 1JMYA 3FSRA 5CFNA 3QWIA 3L6BA 3N05A 4O4HB 1V47A 4DNQA 3D3WB 3GLIA 4EF4A 3AVWA 3OF5A 4KAFA 5F9FA 4DHWA 2PV0A 2ASEA 3BWYA 3O2QB 3M4JA 4AWAA 4CU2A 1C3EA 4MB0A 2PBLA 3D8SA 2XE7A 4MV4A 4X20B 2BELA 2G72A 1BS9A 1G64A 2C07A 2IOHA 4W82A 3WDMA 2ZSFA 1J2YA 4NCKA 4R0VA 1KYZA 3ZNOA 3GPCA 3NVAA 3T3DA 3JAKB 1Z34A 1P4AA 3PFFA 1UDRA 1U9IC 4ZCPA 5CA0A 3RUFA 2PNJA 1XZBA 4DLKA 2IEIA 4QBTA 1QFZA 1RMQA 4RVDA 3N9IA 1WWKA 1XGKA 1NKVA 1C9KA 2ZRFA 1D4ZA 3ETEA 5TQ0A 3HJHA 4QJBA 1H5UA 1NP6A 2PJZA 4CQNA 1CZHA 5DVZA 3T7EA 1XEWY 4DAEA 4FCVA 4TLBA 4E5PA 2VQ3A 4WOBA 4A8JA 3EHEA 3AYXB 3FGPA 3KOYA 1EHIA 1ULUA 4I3GA 2I1VB 4OQXA 4QOGA 5T3UA 3VR3D 2VHEA 5LZ9A 4GKAA 1PKXA 4J4HA 2ORIA 3HBAA 4C2TA 2F00A 4S1OA 1U6IA 2J0SA 3H5LA 1E6CA 3OUUA 3MUEA 5LUBA 3ZCSA 4XVUA 2B9VA 3S2IA 3ABQB 4NJEB 4V0NA 4NZNA 3VYVA 4ER6A 4IXNA 5FO1A 4Y9TA 2V6MA 4PG4A 2AF4C 1U2SA 1C9MA 3N53A 1QCZA 1EGVB 3EQ8A 5EG5A 1ZSNA 3HEBA 3DTVD 4DLPA 3LVRE 5LQKA 1LSOA 3C6MA 2I2AA 1IRXA 3BH0A 2BFOA 1VFPA 3L1VA 4I1OA 5AKIA 1TAQA 3AIOA 3I53A 1MPXA 3GEHA 3HMQA 4V0OA 3SBDA 4US2R 3K70B 2V0GA 1QC5B 1R4MA 1ZXXA 2JI6A 2BM1A 1ISGA 4AJJA 3U31A 1UM9A 5DNCA 3MVEA 1FU8A 4JGIA 1VG9B 1OJLA 3MS4A 1QG4A 1TEXA 3CPSA 1GG2A 1D0IA 3OZEA 1NDUA 4Q4LA 1SUCA 3H18A 4OU4A 3A2NA 4LYEA 4F7DA 4ISBA 4J4BA 4M6WA 3AJEA 2HA6A 3PHCA 1GFZA 3CW9A 4TL8A 2RBEA 4X61A 3PWSA 2J0EA 2WINI 1OLXA 1L7BA 4CKEB 2WF7A 1A9SA 1NTRA 5KBYA 3R5TA 4MWTA 4V2IA 1R3DA 3GLHB 2CXNA 3B1XA 4R51A 1RACA 3LUAA 2OXFA 4LHXA 4CF3A 2WTAA 2NPFA 4RK0A 5C1BA 5JHGB 2ZWMA 4DJDC 1TEZA 3NNDA 3ZU2A 5H59A 3HXQA 2QU7A 3UMSA 1JVSA 2PBZA 5BQFA 2DPLA 3PUJA 2B1RA 3N6RA 3GVIA 2Z95A 4UEJA 1FBNA 3RVMA 2ODPA 1GUFA 2AJTA 2HMYB 2R1ZA 4QZVA 3ADDA 3AF2A 3EMBA 1COZA 2VR1A 3IQWA 1NXSA 5A4KA 2UKDA 2WT8A 3WL8A 3A14A 1UKZA 3DDOA 3B6MA 1JT9A 1TEHA 2NIPA 1CDOA 1G5RA 1NLMA 2DCUA 3TRIA 1D4AA 3ND5A 4OHVA 4CMAA 1FDTA 5E6SA 5TQJA 1NXQA 2ZJ3A 3IP7A 3HBJA 3Q7IA 1FQWA 2M6LA 1DOZA 2IKSA 3MFYA 4C0XA 4LWQA 3B8EA 3BWEA 5BT8A 5BYJA 5AW0A 2V7EA 5CIYA 3ZS8A 4A03A 3T3HA 4PN7A 2ABWA 4OI0A 3S81A 3KE8A 3RG2A 2JLUA 3U4IA 4OEHA 4QG3A 2IY9A 1G7RA 4K87A 4M76B 3NV7A 4B09A 3ISJA 4K0KB 1Y7PA 3JRXA 1JEAA 3CUWA 2ZAGA 4ZYZA 1GXSB 3S2FA 3EISA 3MNFA 1LX7A 4I46A 4YJHB 3Q9SA 1TQ6A 3VNUA 1FFYA 4J1TA 4K03A 4Y18A 1C0EA 1HE1C 2W48A 4HUQA 4C7JA 3X2FA 2BLLA 1C7RA 3H1EA 5T8KA 3TB6A 1T3SA 1KMIY 1V5EA 3RIHA 1PL8A 3PL5A 4QBIA 4DNFA 3EY4A 2ZIWB 2ZIZA 2WK1A 4D3SA 4PO3X 4IRUB 1XEFA 2WT4A 3Q5GA 4ZCLA 4CLOB 3KSBC 3NTLA 5AJTA 3CXRA 2I76A 1YOBA 5DFAA 3TQSA 4AY3A 1FP2A 4MNTA 4LXYA 5AK3A 1Z39A 3EN0A 4N6GA 3SKXA 4HMOA 1BOFA 1DIOB 3ZV4A 3PJEA 1MC4A 3OJLA 4C43A 3L8ZA 1WV1A 4ZZ3A 5CP8A 2NSYA 1TW2A 2CW5A 1A69A 2DBRA 1UT8A 4BO4A 3PQ2A 4EYQA 5D2CA 1RYBA 3DH0A 2HQ1A 3NIDB 1CQIA 1QS0B 4QUGA 3TCXB 2MYPA 1LDEA 5IG2A 3JVVA 4QSHA 1YL6A 5CGQB 1A9RA 2IEBA 4D5GA 5IEJA 2ZQYA 1E6KA 1KO7A 5DHUA 2MSNA 2ZYTX 3QIAA 5TGTA 1AJEA 3ZDBA 5GJCA 3TO5A 3D81A 3OP4A 2JFXA 3EYAA 3MMXA 3SY8A 2QTFA 5LQUA 2ZPTX 4MKIA 5GINE 4EG5A 3ETGA 1KDVA 1MVNA 4XGNA 3BAZA 1EUQA 5F12A 2VDJA 4NOLA 3UQZA 7ABPA 5HS6A 5K8LA 3EG5A 3WYEA 4D4HA 2QR2A 2QQFA 4C4RA 4DA7A 3EF1A 3PWTA 1UEJA 2GF2A 4YRAA 1LLCA 3SLKA 1EFDN 1WDKA 3UW1A 4B4WA 5COBA 4A0HA 4CWAA 4LZWA 4K3VA 4HVCA 4KOAA 2XQIA 4TV9B 2A1UA 3L6EA 1D09A 2XRYA 2BPOA 4P83A 3IEMA 2HLDA 4MVJH 1RHQA 2YZMA 4HDNB 3VAYA 1H3FA 3SVTA 1K6MA 4MA4A 5DT2A 4OP3A 1ONBA 3S29A 4FDLA 1U7HA 3WQSB 2GBPA 3I4CA 4BJ6A 1PV4A 4A6EA 3GLRA 1TGVA 1S02A 1WXIA 1G98A 3W34A 3V3KA 4H7HA 3ZHBA 3ILHA 1X1EA 5JJLA 4PANA 2XR1A 4RCYA 3WTBA 2RH9B 3LCMA 2CVQA 5KKCA 1NQOA 1SQ5A 3LXRA 4LRXA 1RZRD 1F38A 4GOJA 1QIMA 3MB8A 4QU5A 1M2OB 3C3DA 4LRQA 4OXKA 2CEKA 2H2DA 4FHZA 4RKEA 5IT9A 1VBFA 4LPSA 3JZAA 5L6MB 1QG0A 1KMQA 3D6MA 1W88B 4JBHA 3M3DA 3S2SA 1H23A 3U3MA 4WZBB 3MWGA 1W0CA 2QRVA 5JD3A 4XLLA 4L9AA 3LFUA 1TF2A 3HWSA 4N49A 4NATA 5H0IA 3T9EA 4DJJA 5EUMA 4QDJA 4NQRA 1R10A 3ER6A 8ADHA 4ZI2A 2QBYA 3MTIA 3A3OA 4C4XA 4IFIA 4LZPA 3PI6A 4MIYA 1NRWA 4C0KA 1U7ZA 2PX2A 1NQ5A 1EFLA 4CT0A 2W2LD 3FPSA 3HCDA 3N8GA 4G8BA 4CG1A 1RWMA 5JSUA 2F8SA 1DHTA 3PE4A 4J0CA 1Q57A 2XAAA 4M83A 1J22A 2W6PA 3NH9A 1J56A 4DCSA 5BRJA 3NV9A 3EPKA 4FOSA 1U99A 3GLFB 5FAKA 2ZJOA 3JQFA 4RY2A 1M1UA 2GI4A 3NTOA 1TTQB 3ESAA 2W0MA 2ZFUA 5FPHA 3TS1A 4FR5A 5DWQA 3SR0A 3UT6A 1XALA 2C5GA 4CMGA 3RAJA 3A6PC 4EAAA 4F21A 2F3RA 3BFVA 2FE4A 4BGDA 3UMJA 3TZQA 3GLQA 2A5LA 2PK3A 3HKCB 4V0RA 4B80A 2JJ1D 2AS0A 5AXBA 1L6IA 3IAFA 1RWBA 3N0VA 2HCBA 4HG2A 2CKDA 4D42A 3GFRA 4Q9KA 1HDZA 4AX8A 5BPHA 2A30A 5CDFE 2VJNA 1X87A 2HRRA 1B41A 1LVGA 1HT3A 3R0VA 4HYTA 1Q1BA 4QRHA 2GUGA 2E82A 2QT0A 3TNLA 4A82A 2JZCA 4BRSA 2PFKA 4UVIA 3TOXA 1Z17A 1T91A 1ZH8A 3L46A 1S6YA 2EHJA 1WSDA 2WZBA 1UMCB 2BDTA 1KY5A 1QNFA 1Z4LA 1DJOA 2P69A 4G4JA 2WR8A 3UK1A 3E8XA 1AKEA 4B3GA 5JTUA 2ALJA 1Q74A 4XIGS 1XMVA 3DVLA 3ZK8A 4R1PA 1RWPA 2FPGA 3LPMA 2AWNA 4JH0A 4BNVA 3IP3A 2LKCA 4B2PA 1R66A 1Y1KE 1JDTA 1JKFA 1LBEA 1ZOIA 2PZFA 2DQ4A 1T4DA 2GTPA 2XJ4A 4PPNA 2V6IA 2CV2A 4QREA 2VSOA 3S7ZA 2G3YA 1XFAA 5IVDA 1J9GA 2GBFA 1ABFA 1FRFS 4QU8A 4FOTA 3U4QB 4HFRA 1ZDMA 2FZ5A 4HAIA 3URKA 3WIEA 3NATA 3CNLA 3BMNA 4QEZA 5B5SA 1NR7A 1VYUA 2RKBA 4MGYR 4RVSA 3TLGA 2XHEA 4OQDA 3SC3A 3BMQA 2PZKA 3ZXXA 5JXIA 1MVOA 3UOGA 4F9TA 4Z2AA 3P9XA 4OI2A 1VA4A 1XPJA 2EIHA 2F9MA 2R1VB 3AY7A 3DMPA 1USWA 3FFTA 1NJ2A 1WHTA 5DU2A 3GA5A 3QOXA 1CP3A 2ZVQX 3K15A 4C6TA 1HDOA 3PQ3A 5CDHA 3G5TA 4WASA 2R6CA 1HYGA 4HAVA 4YCBA 5BO5A 4ZQGA 1KY4A 1X3SA 4MVJG 3BD8A 1ETUA 5F1YA 1XTUA 3N76A 3OT1B 4BTVA 1JHXA 3OKCA 3A9CA 4FGJA 3BRWD 4JU8A 3F3MA 5ADHA 1BG6A 2CDAA 4GYKA 1ADYA 2JI7A 4TS3A 1KI2A 5E9AA 4QLAA 2TECE 4Y1RA 1FNNA 2ZPAA 3FIUA 3RSQA 1J49A 1RLTA 4RIFA 4FZ5A 3R77A 4YBRA 4C5AA 5IVKA 1S4QA 3BL5A 2ID7A 2IVFA 3QKWA 3DPUA 2C82A 4QDTA 3PXBA 2HI0A 3UCFA 3ZDFA 4BHTA 3KKKA 4FOPA 2UDPA 4YGXB 1YCHA 1Z07A 2RK3A 3GFTA 2XB2A 3DEYX 3F74A 3H84A 1Z6ZA 5THXA 2DZDA 1EZ1A 2NO7A 1EA5A 4GZMA 1JAHA 2Q21A 3ZKAA 3IPAA 2QJRA 1WUYA 4JLVA 2DSTA 1JIIA 2WY2D 4R9SA 1JAYA 3D6TB 3N8DA 5KSPA 4ZEVA 1E4OA 1YHNA 3NH6A 4LNHA 3Q6IA 1IUOA 1XZEA 5JQWA 2QM7A 2FX5A 2IYZA 2WJVA 3UJPA 3HDHA 3K8OE 3OTHA 4RL4A 3NIWA 3UA4A 2H4JA 2DERA 1F6DA 1R0CA 1X7ZA 4DDHA 3VO1A 3DKPA 4G9EA 3KB8A 3RSSA 2GXQA 1R8SA 4G09A 4N9QA 5A7HA 1U4OA 3OPXA 4B3RB 1WJGA 1FFCA 1Q1AA 3MHPA 4HLDA 3OJOA 1U2DA 2VJLA 3IJRA 4PXSA 3H4TA 4OH1A 4ZVMA 1M76A 4Q4JA 1XTPA 4GX5A 1M1NB 1QH1A 2GPBA 2BGGA 5EZYF 4M9RA 1ONPA 3IALA 4RKFA 4UAUA 4WFQA 2HTFA 1F7UA 3HXKA 3HV0A 1KIAA 2WZDA 4QX6A 5CURA 4YDHB 4ZICA 2VQEB 3KWLA 4UHDA 1BVUA 2MMCA 4LDRA 3VPXA 4F72A 3SVLA 2BZGA 3O1IC 1T10A 4ZI7A 2OPBA 3C2QA 3LBYA 5JYEA 1GUZA 1MKYA 3AUTA 4NG4A 5B1SA 2ZWIA 3AXSA 1VTKA 3RR2A 3SXJA 4A0RA 1EFUA 7ADHA 1RTTA 3I23A 3MN1A 3HO1A 1IZ9A 4HX2A 5LIRA 1ABBA 2OKGA 3KOWA 3RS8A 2P11A 5IH3A 3A1WA 1KQPA 1N2XA 2GHIA 3DTVB 4H7FA 1UOQA 4TUYA 3T5DA 4PC3A 1YZNA 4CCSA 4A15A 5JH7F 5CDFA 2Q2OA 3W7VA 1YTUA 3ZWKA 5LQCA 1CP2A 2W11A 3D59A 2H2WA 1PSWA 2C2YA 1IM8A 5GOZA 4CKCA 1CEXA 3PEVA 2B20A 4BE7B 2ZIFA 5K3AA 2YZ2A 1JBQA 5AJVB 1PE0A 3LPCA 3UFXA 2CVZA 3K2EA 3B70A 2R0QC 1EYZA 1QIEA 2HSZA 2OYCA 4FLEA 3HP1A 2WPDA 1XLTC 3LBNA 3V4ZA 4EF5A 1DO2A 3D7RA 3MTEA 3SR3A 3NMUF 3GV0A 3FAZA 2XVZA 4KZKA 2IUSA 3KU4A 1G4HA 1P6UA 1ZWKA 2XDQB 2H7YA 1WUJS 4BWVA 1PWEA 3MTBA 5JASA 3CT6A 4K6OA 3AFGA 3A1TA 5LL6P 1O08A 1HY3A 3W8DA 3LM8A 3WLQA 1OILA 1JQAA 1SXJC 4DQDA 4LZZA 1CT9A 4BQIA 2KW5A 4MW5A 3BXGA 4ZEMA 3T4XA 3OD5A 4L4XA 1N78A 2GN4A 1BE1A 3CBQA 1E94E 1U8TA 4LC0A 4AF6A 1WXEA 4GW3A 3F3KA 4OAPA 2GJ4A 1SVIA 1Z75A 1CSEE 4NL4H 4MWGA 4HS9A 1LW6E 1NOJA 2P0EA 2PUDA 3ZJVA 4CUZA 2JIMA 3H2GA 4GVXA 4G5YA 1EU1A 4FSDA 4WLVA 4JR0A 5F73A 4MPDA 4YJ2B 2QQ0A 2WUGA 3U7GA 4BRUA 4UW9A 4FYHA 2K5UA 3I2FA