3H2YA

Crystal structure of yqeh gtpase from bacillus anthracis with dgdp bound
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
313
structure length
309
Chain Sequence
DDDFLRILNGIGKSDALVVKIVDIFDFNGSWLPGLHRFVGNNKVLLVGNKADLIPKSVKHDKVKHWMRYSAKQLGLKPEDVFLISAAKGQGIAELADAIEYYRGGKDVYVVGCTNVGKSTFINRMIKEFSDETENVITTSHFPDLIDIPLDEESSLYDTPGIINHHQMAHYVGKQSLKLITPTKEIKPMVFQLNEEQTLFFSGLARFDYVSGGRRAFTCHFSNRLTIHRTKLEKADELYKNHAGDLLSPPTPEELENMPELVKYEFNIREPKTDVVFSGLGWVTVNEPGAKIVAHVPKGVSVSLRKSLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of YqeH GTPase from Bacillus anthracis with dGDP Bound
rcsb
source organism Bacillus anthracis str.
molecule tags Hydrolase
molecule keywords GTPase family protein
total genus 76
structure length 309
sequence length 313
ec nomenclature
pdb deposition date 2009-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3h2yA01
4LJ6A 4S2EA 1R0ZA 1P2UA 1NIJA 3ADCA 2FV8A 2L0XA 4LX0A 5F2EA 1G6HA 4XTCS 4QG7A 2PMDA 2QG6A 3TVTA 3VNVA 3SHWA 2XGJA 4OYHA 2XNDD 1G291 1P9RA 1S4QA 4UNSA 2J87A 4A15A 2VP4A 3D31A 3OEEA 5K8UA 2NO7A 4MITA 4CF7A 4B2LA 3TMKA 1QBKC 3FHCB 2GETA 2GKSA 2J0VA 2XTMA 1GUAA 3CRVA 1IN7A 1L2TA 5FTKA 1LF0A 5J4YA 1CR4A 1XMSA 2YV5A 3AF3A 3K9NA 4QXAA 3RWMB 1W36C 3FMOB 5EUQB 1MRSA 2GA8A 4LHVA 2P2LA 1US8B 3F3YA 3ADDA 3MGCA 4R7ZA 1E9BA 2VEDA 4RZ3A 3W3AA 1KO4A 1CBUA 5C1BA 4LV5B 5DO9A 4ESVA 1A4RA 1G3IA 4N0DA 4Q1DA 4TT3A 4GMXA 1TF5A 1OFHA 3C4JA 2J0QA 4B43A 1P2VA 3PR1A 2WTUA 1ZMXA 5EP2A 1K5DA 1I2MA 3ZS9A 4UJ5A 1Z0AA 4PZYA 1T0HB 2QN6A 1E2JA 3LD9A 3GLFA 3IHLA 4LPSA 1U9IC 4EPWA 4URVR 4YXWD 3LH5A 4DLYA 1II8B 3M4YA 2ZRJA 3A36A 1OSNA 4BZQA 1W4AA 2ZE6A 3LWNA 5KNBA 1EK0A 4ZIRB 3K70D 1F60A 2RMKA 1CEEA 3QVUA 2GJSA 2OSBA 3LV8A 1TEVA 3VMFA 3BH0A 1XPRA 3I72A 1DAEA 2R62A 4Q5IA 1HUQA 2V1XA 5FI1B 2VP0A 3QOFA 2HT1A 2WIAA 4M22A 3TKLA 3WNBA 4HB3A 3KJEA 2GJ9A 2Z5FA 1UDWA 3QPUA 1EFCA 1KZGB 2OZEA 1NP6A 3HYTA 2ZI5A 4PPGA 3ZQ6A 1RPZA 1D2NA 3V9PA 5EP1A 3LDAA 4JLAA 1FMJA 5KTYA 4A8JA 3K0FA 5J47A 2FPLA 1E2QA 1ZU5A 3C14C 1GNPA 3UIEA 4QRHA 2YWHA 1Z29A 2VP6A 3QKRA 2DWQA 4HDOB 3THOA 2IF2A 1A2BA 3AEZA 3D8BA 3P32A 4RD4A 5AUQA 2GEDA 4Q4AB 2F1IA 1HT1E 3Q7PA 2E9SA 4NPHA 4QM7A 3A1UA 1OXVA 2RKOA 5B57C 2MSEB 2R6FA 1FTSA 4QGAA 1VDZA 4YMSA 2RH5A 5TVKA 1UM8A 4AWXA 4ARZB 4YMUA 4D26A 1L8QA 2QI9C 4DWJA 1NIPA 1E6CA 1DAFA 4NCHA 1Z6XA 1NVXQ 4QJ4A 1HV8A 3R7WA 4BLSA 4G5RA 2XSZA 4EAQA 2ZJ8A 2JCSA 1KY2A 3G0HA 1XTRA 4GOJA 3CLVA 4MRNA 2VF8A 2ZUBA 3B5JA 1TU3A 2FEOA 4Q9KA 3Q7QA 4OBEA 4M53A 3UPUA 1G9XA 4B47A 5IF9A 4JMPA 4IJMA 2J7PD 2ORIA 1U8AA 3C8UA 4JBXA 5FTMA 2Q9AA 4JLDA 2AWOA 3OEHD 4URZR 3NDBB 1EFRD 1W5TA 1FOEB 2J59A 5AUOB 3FMPB 2WM9B 3FKSD 1D8TA 4ZDWA 2IXEA 5AUNB 2WOJA 1XB2A 1KK0A 2JJ8A 4PO8A 5LBIA 2OHFA 2O8BB 1E0AA 5FUYA 4NCIA 1AIPA 1U2RA 4QJ3A 4Z8XA 2J0UB 2NG1A 2JASA 5GJBA 2HJGA 3KQKA 4PQFA 4FN5A 4RFVA 4C7OA 4CIDA 3GMTA 4IRUB 5DIFA 4A2PA 2XJ9A 3A37A 3REFA 1L4UA 1TMKA 1XPOA 2JJ2D 2PEYA 1QHSA 2G0TA 4R9UC 2OLJA 5TMPA 3B6EA 3FMFA 4CEHB 3C7KA 4FW9A 1SULA 4RFSA 2NPFA 1OE0A 2OESA 2IYUA 5DSZA 2YZ2A 1E2EA 4OHWA 5GJCA 3PFIA 4DHEA 5J4KA 4ASUD 2QAGB 2LKCA 621PA 5B64A 5JWHA 1FUKA 5KSPA 1P4SA 2F3RA 3QF4A 2WKQA 1T9HA 1UKEA 3MLEA 3ZVRA 2I4IA 1E2KA 5AJWA 3AF2A 5D3MA 4B32A 4B76A 2GXSA 2WSSD 2G77B 2RGEA 3QKUA 5JS7A 3SYKA 4V02A 1S96A 4Q1BA 5BYJA 2J41A 2BBTA 3MFYA 2DR3A 5KSOA 1WA5A 2BC9A 2ZU6A 4LJ7A 4WZ6A 1G3RA 4FMCB 4OHVA 3KKMA 4TWZA 1JAHA 4Q48A 4D0LB 5CDFE 5HPYB 2AKYA 1QG2A 3CPHA 1RRGA 3C15C 2YWGA 2ZJAA 1E9AA 2C9YA 1NKTA 5G3YA 3LRPA 5EXSA 4IEEA 3TR0A 1DAMA 2ZSDA 4ZPXA 4AD8A 5AJXA 2VHTA 1OXUA 4DLRA 2G83A 3K09C 4HUQA 4RY2A 2DFKB 2OCBA 2YKGA 3BFKA 4TZ0A 221PA 3CX7A 4DSUA 3MSXA 4ZO4A 2BEJA 3EX7C 2JEOA 2BMFA 1S0UA 3THYA 3B85A 1JQLB 3DMDA 3HDTA 3RLFA 2AHOA 1G7CA 1I4TD 1CTQA 4DUGD 1JR3E 4EJSC 2ZSFA 3QPVA 4Q4JA 3RVBA 4ZDKA 2EU8A 5HZKA 2IS1A 2JDIA 1VG0B 3QIAA 1AZTA 4P31A 1KO7A 3H1TA 1A1VA 1E9RA 1G64A 3EC2A 1YU9A 4ZDJA 3RS0A 4QGGA 2XX3A 1SHZA 1D9XA 3ZD7A 5BXQC 1Q44A 4AI6A 2CVFA 2WWWA 1SXJA 3GEIA 4GPTA 3KKPA 4C0BA 3ZDQA 3OIVA 2ZSEA 5JSZB 3T34A 4MA4A 1DS6A 1WB9A 1G18A 1NVUQ 2WKRA 3K09A 5TB5A 3NEJA 4DDUA 5CDFA 2WV9A 1RRCA 2ZU0C 1XCPA 4ZI2A 2A5JA 3CW2A 3U2QA 4UXHA 1DAIA 1BO6A 1G8GA 1TQ2A 4ABYA 4JLJA 5F3WB 4CDGA 1S2MA 1KSFX 2NO9A 4ZDIA 4DC9A 2C8VA 3DMNA 4JLOA 4BPBA 4O2RA 1DG1G 5AR1A 1ZBDA 1R4AA 4B6EA 3IGFA 2KSQA 1FTNA 1LW7A 2DHRA 3VAAA 1EFTA 1E79A 4JBWA 5CM8B 4C0SA 3GP8A 3CF0A 3K9LA 2ANBA 3LW8A 1YZQA 3WYFA 5HKKD 1G19A 3U3JA 3M0EA 2X8AA 1ZCAA 4JYCA 4LI0A 3ZVMA 3ZGXA 2JLYA 3E70C 4PHTA 3PEYA 3QKRB 3B1YA 2REXB 3A6PC 4C7OB 4Q47A 2YINC 3B60A 4EKDA 1N6NA 3VX4A 2JLVA 2CNWD 1KMHA 1LB1B 2VHCA 4OQLA 1YZTA 3ECCA 3BXZA 5TV2A 3P4YA 3B8HA 4EFNA 4ILEA 3UXMA 1Q12A 3NH9A 2ZS8A 2ZR0A 1XXHA 1N6OA 1D9ZA 4TL9A 4Q9JA 2AXNA 1KNXA 3WY9A 3A1TA 3QXJA 1E4VA 4HB2A 2BBWA 1GKYA 3ETLA 1HE8B 3U7GA 5FOUA 1XEWX 4LHXA 4TYPA 4KLNA 2QQEA 2VSOA 2C03A 2AN9A 3B13B 5BN4A 1Z0DA 3MWYW 4AYWA 3I1FA 2OBLA 4F7WA 3R7WB 1VKJA 4RFSB 1NLZA 1OHHA 3VKWA 2P65A 5JCZA 1U0LA 2REBA 3LBIA 3CNNA 3PEUA 4JLPA 2V4ZA 4D82A 4C0JA 4TQAA 2F9LA 1X1RA 3EWSA 1KAGA 4PO1A 1IXZA 3L43A 1I4DD 1ZNWA 3BAFA 4U02A 5SZKB 1X8LA 5FBWB 5E7IA 4PAQA 2NO1A 2V3CC 3PUYA 5J4VA 3EG5A 3CM0A 1Z6YA 1LS1A 4M1OA 5SZHB 3PV0A 2QTFA 2WWIA 4YMTA 4I81A 1E2DA 1XRJA 5CJ2A 3TK1A 5GADl 2GNOA 3HR7A 3HU1A 3ICEA 2IS6A 3C5CA 3ADBA 3X1ZA 5JI3E 2Q0HA 2AFHE 4QHSA 3WBKA 4PAMA 3GJ3A 3JZAA 1NRJB 2VRWA 4II7A 5FUVA 4A0RA 3TRFA 2BCGY 1JXOA 3GLHE 3CH5A 3IPXA 3RRMA 2BVNA 3I73A 1GIAA 1E1RA 1UEIA 4PHGA 4Q00A 4UXIA 5EQTA 3W8NA 5KDLA 4I1OA 4C0AC 2SHKA 1KI9A 3T61A 2VHQA 2QMHA 3MWLA 4M1TA 1YJ5A 2C95A 4NBSA 2PZEA 1IN8A 2LKDA 4GI7A 4WA7A 1OXTA 4IFEA 3R9IA 5B58C 2HUPA 2WPDA 3UMSA 4LV6A 2JATA 2QUZA 1R5OA 3LLUA 4AG5A 3PENA 4LJYA 4MGZR 2ODWA 4UJ3A 3A1WA 1NN3A 3KXLA 3TQCA 2GEUA 2BWJA 2CHVA 2BMJA 2VHUA 3I3SR 3I5YA 4HAVA 2QSYA 4LSGA 4WIAA 3TAUA 4YQFA 2GRJA 1G5PA 2RHMA 2H57A 1GILA 521PA 2CBZA 3VQTA 2ZE5A 1P61B 4S35A 1XMVA 3HYRA 4JT4A 2P67A 4PC7A 5GVSA 1FPMA 1GSIA 2WHXA 3CB4A 1MABA 1US8A 1P9NA 1LNZA 1MH1A 3NC0C 2KI5A 4AY2A 2VBCA 3AF0A 2N42A 3Q72A 1GRRA 1HEIA 4I1SA 5JRJA 2FEMA 4PZZA 3I4LA 5DYIA 2JJ1A 2KJQA 3ZVLA 3TUJC 5IRCD 3LX5A 1XZQA 3NIBA 3TVDA 4O25A 1W5SA 4BRWA 2XOKD 3IPYA 4MYHA 3W6OA 2DFLA 1G16A 2JLQA 3K0CA 3QVVA 4W5HA 3ZJYA 5KHOC 3V4FA 4HLUC 2QBYA 1OIWA 2IWHA 2FH5B 4MKHA 1HYQA 1XD9A 1ZVQA 2WWGA 5IT5A 5HCIA 4IKEA 1VYUA 4BFZA 1W0JA 1WMSA 4QKQA 4PPFA 3GEEA 1EESA 3NBFA 1IY0A 4HZUA 1COWD 3PUXA 4Q66C 1G8HA 5IK2A 1AJEA 3UWKA 3W5IA 1SZPA 2WJGA 1NI3A 2QAJA 3EAQA 1BMFD 4Z51A 4JBYA 3U60B 2DCUA 3HPRA 4NH0A 1YRAA 2F43A 1QVRA 2ZJ5A 2GF9A 2ZITA 1JPNA 3BWDD 3CNLA 4QFMA 1M6NA 4PTLA 2HDNB 4US0R 2G6BA 5CM9C 5HTKA 4FCTA 3KX2A 4OQMA 2DY1A 1IJFA 3F8TA 1OH8A 4MDEA 2QMEA 4D4KA 2D4HA 3L0OA 4O3MA 2GF0A 2WSSA 3RC3A 1ZC4A 1IN4A 1L7VC 1KJWA 1N6HA 2CL7X 3WNCA 3DZ8A 1EG7A 4UKDA 2XTZA 4TTRA 4C9BA 3T1QA 2OAP1 3GFOA 5HE9A 2YOGA 3JVUA 1WCV1 2J0UA 1T3HA 2V7QA 1AGPA 2QAGC 3ASYA 1CLUA 3GJ7A 3IDQA 3NBXX 4EUNA 1ZC3A 3TIFA 3ADKA 4TQUS 2F7SA 4LYJA 1EFUA 2NOAA 5JRZA 1GAJA 4K81B 4Q1AA 3U4QA 4QHTA 3AUXA 3TH5A 1KI1A 3SEAA 2XITA 4ACAA 1VIAA 2D06A 4PPQA 3CBQA 5C4GB 1YRBA 4G1UC 3TW8B 3UMRA 3CPJB 2OT3B 4D80A 4FWTA 4OHXA 3RWOA 4GZMA 3QI2A 4PX9A 4IDOA 1W7AA 2TMKA 1XTQA 1ZD9A 3L2OB 1Z0IA 3U3OA 3QF4B 4DUGA 4E09A 1HH4A 4A82A 4EFMA 4F93B 3IBYA 5EUMA 2C04A 1NN1A 1AM4D 1XMIA 5FTNA 3EPJA 2YC4C 2ZYVX 4XTRA 3X2SA 4JLVA 3T5DA 4DLUA 2A3RA 3VFDA 3CNOA 4KAXA 3BBPA 1F2TB 4IOMA 1XMJA 3GLHA 4KODA 4QM6A 4TSFA 4BFXA 4ZCMA 1FNMA 2P5TB 2OAQ1 4C0HA 1YR7A 4PO9A 1ETUA 2ZRNA 4L5BA 5D3MB 2WJVA 2XEXA 5L8VA 3K70C 3CRW1 1XFAA 1SXJD 1X3SA 2X19A 2ZJ2A 2EYUA 4UNRA 1Z6GA 4XD7A 1VYVA 2WWFA 4E22A 2QENA 2VLIA 1KDRA 1X8KA 3BH6A 3PG5A 1PLKA 4IHQA 3LQQA 2V6JA 4QGHA 1NVVR 4XIGS 4RZXA 5DISB 2JLRA 4RD6A 1G7SA 4M0LA 3EXAA 4Z54A 2GBLA 2CLDX 1BKDR 2F6RA 2EFCB 2MMCA 4M21A 1TQ6A 1U8ZA 1DG3A 4IDNA 3CH4B 1SVOA 4AC9A 1TTTA 2QL6A 2P6UA 4IVRA 1W4CA 2IHBA 1E96A 2J9RA 1X1SA 2OXRA 3CIOA 4JKIA 4LYHA 3TSZA 4TYNA 3R8FA 1PLJA 3FKQA 3DHWC 4MH0R 2GDJA 4PZLA 4EDHA 5DN6A 2AXPA 4Z8YA 3NXSA 3CKLA 1JEEA 4XH9B 2A5DA 4NYIQ 4D25A 1QG4A 1VTKA 3NWJA 4HYYA 1CULC 3REGA 3N70A 1KHTA 2FE4A 1Y63A 3OE7A 3U3KA 2ZAMA 4PC2A 1VCIA 4NYIR 2VPPA 1CR2A 4YMWA 2FPMA 4QOSA 2JLXA 5FPTA 5EZ6B 3VR3A 3O8DA 4Q7KA 1RZ3A 2QMOA 4BGDA 4CW7A 1SVMA 2FZLA 1MV5A 3PVSA 3AF1A 2GTPA 1E2IA 2AKAB 2R6AA 2V8OA 2GCPA 2RHDA 1UKYA 3L0IB 4FI3C 5EZ5A 4LCBA 2Y8EA 4Q4HA 4Q1FA 1FW6A 5FL7A 3RAPR 2PT5A 2CJWB 2ZRPA 3VTKA 1KI3A 2EWVA 5FPSA 1BOFA 4Q21A 1FP7A 4JJZA 3X1WA 2JIZD 4V0OA 5JJLA 2XXAB 4MRPA 5CB6A 2WMNB 3W5JA 4TMXA 1IHUA 2VSXA 3AM1A 1HT2E 2BDTA 4MRVA 4A0GA 5AJYA 3GLFB 1KGDA 4DIEA 2GAOA 1XDBA 3G5UA 5C4MA 4ERNA 2WVJA 2C78A 2HLDD 4CEIA 2RGBA 2VYFA 3CPEA 4F4IA 3V00A 1VCNA 4RZ2A 2IS2A 1OHHD 4H1UA 1W4RA 2AWNA 3E1SA 3NH6A 1ZIPA 5ELXA 4LC0A 1TQDA 4K8OA 1E2PA 1ZRHA 3T1VA 2VF7A 3WHKA 1AKEA 5K8LA 4HAYA 3QEOA 1R5BA 2RGNC 3EIQA 3R9WA 1KI4A 1GKIA 3AVWA 1AGRA 2OO7A 3SNHA 1IXSB 4LJ8A 1LY1A 1EWRA 3MAAC 2Q3FA 2ZSBA 4DLXA 3FFAA 5JEEA 1VPLA 2QTVB 3KUCA 4MYUA 1V5WA 5JECA 3TR5A 4WOPA 2AFIE 3WHLA 3FVQA 4Q9LA 4TZ6A 1DOAA 3VKGA 4D0GA 2PT7A 3AKEA 4TQ9A 2PEZA 2EQBA 5ANRB 3DVLA 1WP9A 2PJZA 2ZJZA 4PHHA 4V0ME 4OK3A 1NBMD 1E3MA 5JWOA 1N0VC 2D7CA 2MSDB 3AVOA 3MWJA 1XXHB 4KHZA 5HCNA 4B3FX 1WDTA 2WWXA 2IW3A 4KBFA 1XTSA 4DEXA 5GJVC 2Q9CA 1Z6TA 821PA 4O2LA 2P0EA 1E1RD 4PAOA 1NBME 3LFUA 4GRAA 2H7VA 1G5TA 3QJYA 4B2PA 2FZ4A 3B78A 4JSTA 3WXMA 3KJGA 1H8HA 1BYUA 3TBKA 1RRFA 2HXSA 2WPDD 1P9WA 3EZ9A 1U81A 2ZM5A 1TAGA 1C1YA 1J70A 5FPHA 1UKVY 1XEXA 4KLZA 4DJTA 3KZ1E 3FGNA 4TTQA 3DL0A 5AUPB 3B1ZA 4B2IA 3A1SA 4MGYR 1G7RA 2ONKA 5BWMA 3NBYC 3OFND 3HJNA 4LZZA 3GLIE 3C5HA 4LJ9A 4KI0A 3KKNA 3W34A 5JEDA 2WWHA 1CJKC 3RC8A 1YZLA 2IYZA 4ACBA 3QBVA 4H9GA 4KXFB 1VYTA 3O8CA 1R6BX 2ODNA 1VMAA 3AVPA 3RS4A 3GLFE 3CF2A 1E9DA 2ZUCA 3RS3A 2IF0A 1VHTA 3W9YA 2IBMA 2R6CA 4C0QC 4LK2A 3Q85A 4B3XA 4YMVA 3K0AA 1K8RA 1G3MA 1AKYA 2N1BA 1EXMA 1ZUHA 1D2EA 1XEXB 4Q02A 2DB3A 2ZRFA 3U44A 2FSIA 2GZDA 1IM2A 1FX0A 2D7DA 4NP6A 4JJKA 3K0AB 3RABA 3P20A 2W6JA 2A2ZA 4A2WA 1M7GA 3W6NA 1W0JD 2FJUA 4DLWA 1SVKA 1VG9B 3KKQA 2XTNA 4LY6A 2V55B 2VIIA 3EPKA 1H8ED 5JI2E 721PA 1T4GA 3EZFA 2NQ2C 4BASA 1U0JA 2JA1A 2J1LA 2YWFA 3DKPA 4LRWA 3X1XA 3U44B 3FWYA 3J81k 3P4XA 5E7MA 1N2CE 2DWPA 3Q5EA 4EJSA 4F91B 3PUVA 3EPLA 4P33A 3QPWA 4TLAA 3M1IA 4QBFA 5J4LA 3CO5A 2OILA 1F48A 1F2UB 1QHYA 4CZ2A 4QNMA 3SDZA 3UKDA 5L3SA 1L4YA 4RD3A 1NY5A 4JLKA 1QHNA 3UMFA 1U94A 3A4LA 2RGDA 3NKVA 1KKMA 5AJZA 2RGNA 2ZRCA 4IXNA 4HATA 5DHAA 4PSVA 4GDFA 2JAQA 3SJCA 1TEXA 3W6PA 1DEKA 4DLVA 1OXXK 1VCOA 4QBIA 2IXFA 2RCNA 3PQCA 4EQ6B 1NVVQ 1XEFA 2Z43A 1RJ9A 3EIEA 3JVVA 5LD2C 1YZGA 2AR7A 3BRWD 4HZIA 1IN6A 2ZSAA 1JQJC 4JT2A 2JGNA 1GG2A 1XCGB 1YQTA 4LJ4A 4JVLA 3IQXA 4LPKA 4DKXA 2W2XA 3CX8A 1SVLA 4HLUA 2OBNA 3WBJA 2X1VA 4V03A 1N5IA 3RRZA 4BFUA 1KSGA 1CS4C 2I1QA 4A6XA 4DB2A 1GWNA 3TGPA 1DTSA 5KPDA 4IXMA 2H92A 2YYZA 4R98A 4A2QA 1IAQA 1RW4A 2OCAA 2ERYA 4J0QA 4C4PA 1G1MA 3DKVA 4URWR 2PLFA 1X8JA 3ND8A 3TUIC 1ESMA 1NNEA 1E69A 2J3EA 3L82B 4WVFA 2Q9BA 2QTHA 2BKEA 2QM7A 3CRRA 3SN6A 4US2R 1Z63A 2P3SA 4BFWA 2X77A 3DPUA 4P4TA 5KO2A 1ZINA 4IFBA 3U5ZB 2O8CA 1H65A 4LOAA 3RS2A 4TSFD 1FQKA 4GL2A 1M8PA 2V54A 3UG6A 1YR9A 1JAIA 1E4YA 3U7HB 1OFTA 5JBQA 3AF4A 1P62B 1Q0UA 2BIFA 3QNUA 1E1QD 2ORWA 4NL4H 3AP3A 3BB3A 2ERXA 5JSZA 3TSWA 4WW0A 2YWEA 4HAWA 4UNQA 1P60A 1SXJB 1ZU4A 2W58A 3AGQA 1G20E 4ZCIA 5JLJA 4UXJA 3S1AB 2BCJQ 2A5GA 3HP1A 2OCPA 3GLGE 2C5LA 1W36D 2QGNA 2QRZA 5KYKA 1UJ2A 5KOYA 1IN5A 1NSFA 4HI0E 1UFQA 4Q9HA 5L3VA 5FOSA 4RJLA 1A82A 2XSZD 1OIVA 3OESA 5FBVB 2GEVA 1N25A 2I3BA 3D6TB 4D6PA 3X1DA 3I92A 4OI1A 2MSCB 2ECKA 2ZS7A 1DAKA 1G3UA 2CE7A 2J7PA 3BERA 4B35A 1KMQA 2RB4A 3B2EA 4C2UA 3ZH9B 1Q22A 2DBYA 3MD0A 1T5IA 1EFRA 1T3LA 4KFSA 4L8GA 2LCFA 1T8TA 4KCGA 3OF5A 3P1JA 3T35A 5L3RA 5H70A 2W0MA 4LHYA 3L0SA 2IEYA 4HAUA 4TLDA 1Q21A 4WZBE 1E9EA 5DGXA 1MO6A 1FZQA 2AD1A 2ZETA 2BBOA 4R2IA 1ZM7A 3NBZC 5E4FA 2IS4A 1KDPA 1R5NA 3KB1A 2JLWA 3KUDA 2OBMA 1W48A 4NDZA 2FSFA 1OYWA 2Z4SA 4W5JA 4XJXA 4EPVA 2AK2A 1VCMA 1KO1A 1V43A 2RGAA 2JIZA 4CEJA 1KK1A 4XWAA 2JJ2A 4B71A 2A5YB 4IOJA 3QBTA 5L3QA 3GFTA 2C9OA 3EA0A 2C77A 2BMEA 3AP1A 1SHKA 1RYFA 2GJ8A 2NIPA 1NMYA 4I1UA 2WWYA 3AVVA 1OPXA 1ELOA 3K9HA 1MO3A 1JB1A 1N5KA 1JBKA 4AKHA 1QDEA 2OEPA 4OHZA 4N1AA 1DADA 4CT4B 3MCAA 1R10A 3BH7A 1PZNA 2QT0A 4ZCLA 1PV4A 4M2LA 2C98A 1Z0FA 4CEHA 1II9A 2DWOA 1EX7A 2F1JA 4AURA 3GD7A 1HA3A 4QBGB 1E2LA 2IYQA 3AQ4A 4HEJA 4DIDA 2AK3A 2ZYWX 4JYBA 3MRSA 4WZAE 2B8WA 2O52A 4LUCA 3KTAB 2A9KA 2C96A 4D4LA 1NY6A 2ZE8A 3T5GA 1GP2A 1CKEA 1ZIOA 1XZPA 3OHMA 1DAHA 4RCYA 4RD1A 1GZSA 3GLHB 4Q4LA 1IQPA 3SBEA 4EQ6A 5BYKA 1P3JA 2WMOB 3LLMA 2ZANA 2ONJA 3TUZC 2R65A 3WYAA 1QZXA 2W6IA 4X8MA 1RVDA 4GMDA 1JJVA 1LTQA 2VO1A 4K46A 3MJRA 4MYCA 4WBSA 4E07A 3GLGA 1OH6A 2OFWA 2G1KA 5EE1A 1OKKD 1EFHA 2ZRHA 4G5SA 2DFNA 1WBBA 1GRNA 3KTAA 3LQRA 3RS7A 3QXCA 1T91A 5FBLB 1ZM2A 121PA 1ODFA 4DCNA 3VNUA 1ZM4A 2FF7A 1VG8A 2GHIA 1GL9B 3KFVA 4RD0A 4BRUA 4ZIRA 2ZRBA 3KQNA 1NG9A 2J0SA 2J46A 2XAUA 1SKYB 1CP2A 4D2IA 1U99A 2JDID 3GCGA 4OJQA 5EJEA 2ZI9A 3E5HA 4FMDB 1E9CA 4PQRA 1OFUX 2A78A 2B21A 3AVQA 3NHAA 1Q3HA 4R71A 1YE8A 2OXCA 1IY2A 1U98A 5JFGA 4TYQA 4B48A 2G3YA 1GNQA 1OH5A 1LS6A 5AK0A 1WE2A 3BGWA 3N2IA 1E2FA 2QE7A 4LHZA 4ESHA 3SQXA 1HQYE 2DPXA 3H0KA 2B92A 1HQCA 2KWIA 4PPNA 3K1JA 4L16A 2IYRA 1NN5A 2VP5A 5M04A 2A7QA 3QG5A 4NTZA 2GCNA 2FG5A 3I5XA 1OV4A 4HAZA 4JLMA 4V0MA 3H4MA 2AL7A 3VX3A 1SXJE 3F0TA 1KK2A 5FH9A 2FDCA 4B73A 2PLRA 2QNRA 3ONWA 2IHYA 2VTKA 1Q1QA 1J8YF 1YHNA 6Q21A 4GBMA 5HE8A 2GK6A 3T1TA 2IL1A 1SVWA 2OUKA 3MG9A 1XNJA 1M7BA 4TL7A 2W6JD 2O5VA 4BZXA 2OV2A 1KNQA 3PEVA 3Q9LA 2ZQ5A 2QT1A 2H8KA 4AG6A 4HZUB 5G53C 2P6RA 2GJKA 4LWZA 1LF5A 2W2TA 1OYYA 3T15A 1H8EA 1XF9A 3SJBA 2CNWA 2FMXA 4B75A 5FL3A 5BN3A 4QHYA 1CRQA 1J99A 1U8YA 4FMDF 4EPYA 3IHWA 3GJ0A 3K0CC 3EZ6A 2UKDA 1OW3B 2ORVA 4W5WA 3TNFA 2ATVA 5TARA 2QP9X 2R2AA 2ZE7A 3U6BA 4DDTA 5J4HA 2BM0A 2H18A 3K0FB 4MDFA 5IDVA 5LB4A 5KDOA 2EYQA 4DLSA 5LPNA 2NPIA 1ZNYA 3ZLJA 1W49A 3B9PA 1T5LA 1Z2AA 2GBLC 1P7CA 3LY5A 2ZJOA 4Q19A 3LVQE 3N5CA 4V0KA 4XSGA 4DB4A 2ZPTX 5FUWA 4YC7A 1XD2B 3KQUA 2FFBA 3GJ5A 3OEED 3THWB 3C16C 1EX6A 2NO6A 3OAAA 4MGKR 5JS8A 3FHTA 2QROA 1BS1A 2VHJA 1ZCBA 4LBVA 5SZJA 1IY1A 1G21E 2IT1A 2PCLA 4JVSB 3SU8A 1KAOA 2WKPA 2V1UA 2O8EB 3RS5A 4EPTA 3KXIA 4Q4HB 4B3DA 5CLQA 2QAGA 3CR8A 4FWIB 3CX6A 2XZPA 4KO8A 1ZW6A 3T1OA 3A4NA 4DLTA 1II8A 3SOPA 2PMKA 2YC2C 3THYB 2RGXA 1OIXA 2ZRGA 4NYJQ 2WAXA 4X8LA 3UATA 4PC1A 1Q1EA 4URYR 1RFLA 3AKYA 2C2HA 4TT3D 4BLOA 4DRZA 1W44A 2CL0X 3TQFA 1P2TA 4JIMA 4NYJR 2FFHA 2IYWA 4IEIA 3TJZA 1KI6A 2OE2A 3F5FA 1KO5A 2HT6A 4N0EA 3I8XA 2PX0A 3D7MA 2KBEA 4YXWA 3VU9B 4MGIR 1N6LA 5DI3A 3SHFA 1S1CA 1XTKA 2Z83A 2QPAA 3BC1A 4I4LA 2HJVA 2PCJA 3MJHA 1OB2A 1XCMA 4NHOA 3SS8A 1IJEA 3B1XA 4DDVA 3H86A 5FBRB 4Q1EA 3IIKA 3V4RA 4TYYA 1ZD8A 3E2IA 4M9QA 1NG1A 3B82A 4OI4A 4HUTA 3H2YA 2B7CA 2O8CB 1SVIA 2CJWA 2QEQA 4QBHA 1CJVC 2UZ3A 5CYPA 2CCGA 2H1LA 5KNCA 3DDCA 1N6KA 2F1RA 3PUWA 1KJYA 1ZJ6A 4Q4JB 5FR2A 4A9AA 5KSZA 4GOKA 1WRBA 4HLQB 4RSGA 1RC8A 1YZUA 1KSJA 4ON9A 1GITA 3RYTC 3SQWA 2KE5A 3LNCA 4OJKA 1II0A 4JVNA 4P4SA 1QHIA 4I1VA 4LC1A 3GQBA 1SKYE 4RCZA 3SBDA 1RYHA 1KY3A 2VP9A 3H84A 4IDHA 3ZIAA 4EFLA 4N3NA 5EXXA 1VECA 3IO3A 4X8HA 2CK3D 1SXJC 1W47A 1M7HA 2HV8A 2QRNA 1CR1A 4KYUA 4BECA 4M4SA 3HR8A 3MWKA 4F4CA 2BV3A 3LVRE 3GLGB 2XOKA 3BORA 4EPXA 1G4AE 3KJHA 4DXAA 8OHMA 3U7FB 4DT1A 1R0XA 1S8FA 4JKYA 1FNNA 3WRYC 3LAWA 4BEJA 2ATXA 1EWQA 1T0JB 2OG2A 4KV9A 3VU9A 4BFTA 5KUTA 4BZPA 4FMCF 5BQ5A 2ZRIA 3DEFA 4NYMR 5EP4A 1KDOA 1XXHE 2GXUA 4A4DA 4B3GA 2P5SA 4PFSA 4B6FA 5L3SB 1XEWY 3DM5A 2QZ4A 1N0WA 1COWA 5IK2D 4LYFA 4NYMQ 1NVWQ 1XPUA 3NDPA 3ICQB 1OLOA 1YZKA 3A8TA 3LBHA 1BMFA 4M1KA 1KJZA 3DM9B 2FNAA 1P6XA 3ZZTA 2HXYA 4HSEA 5J5CA 2QPOA 4BFYA 1Q20A 2C9CA 1W0KA 3K0EA 1D2MA 3U4QB 1VG1A 2JLSA 3IEVA 2K5UA 3BS4A 2XZLA 2YJTD 2V6IA 3GJXC 4A8JC 4LBWA 3QY0A 4WXPA 4DSOA 3HWSA 1MO4A 4HLDA 2QP4A 1Q1ZA 4BLQA 3Q3JB 4DCVA 4AYXA 2E87A 2RGCA 2ZXUA 3GJ4A 4KFTA 5CLLA 4BFSA 3WMFA 3P27A 3GLIB 2ZTSA 3EW9A 4OK5A 1VIYA 1XD2A 1J2JA 2G88A 3PJRA 4CEJB 4ASUA 1G6OA 3FHOA 4V0NA 1WBDA 1P5ZB 2G1JA 2WOOA 4GFDA 1G4UR 5UKDA 2RGGA 4R2HA 1E0KA 3RRNA 3WP0A 4PSKA 4RZUA 3AVXA 1G3QA 1Z06A 1SGWA 5D3QA 4AK9A 4A1FA 5HZHA 4TLBA 2XZOA 4B44A 5A4JA 1EGAA 1PJRA 2O0HA 5JZVA 2BKUA 5E3HA 1N6PA 4FINA 5FOXA 1FMLA 2W6ID 3RANA 5DNYB 5EE0A 4P32A 1XJ0A 1XX6A 4P4SB 4F92B 4A36A 3CUEF 1NLFA 4B3BA 2D2EA 1P75A 1CJMA 1IBRA 3AP2A 1TF2A 4Z1MD 1GNRA 2IK8A 1UPTA 4C0LA 4OL0A 2YVUA 2QA5A 1AQUA 1SKQA 2FGJA 3PXGA 2ZAOA 4DSNA 2R6DA 2ZVPX 2G9NA 2ZJYA 2Z0MA 4B74A 5KNDA 5E7JA 2F3TA 3OIWA 1G8YA 1AS2A 2NZ8A 1JJ7A 3GFPA 5SZIA 3GPLA 2PZFA 3FB4A 4HB4A 4HUQB 2HYDA 2VP2A 3AKCA 2ZUDA 1NJFA 1DO2A 3KQHA 4LBYA 3QF7A 4C2TA 1UAAA 4PR0A 4YLGA 2DFTA 3SE0A 2YOFA 3ND9A 5KU1A 5JJKA 2VQSA 3AGPA 5LD2B 1Z8FA 2O8FA 5DLQC 1ZP6A 2ZRKA 2PH1A 1G5RA 3IIJA 4FMBB 4XD7D 4C30A 3EPHA 1MABB 2WICA 2R9VA 5A5GA 2X2EA 3VR1A 2XB4A 4P4UA 4IVQA 2GJAA 1BIFA 2GAAA 4WAUA 4Q4AA 1E32A 4Q7MB 2XXAA 2LWIA 2FA9A 5DH9A 1GRQA 3X1YA 4GNKA 1JEDA 2N46A 1E98A 2Q6TA 4I99A 4D4JA 3R9XA 4XWKA 4GT1A 2IYSA 1E2NA 1N3BA 2HCBA 2D74A 5CIQA 1JR3A 1MO5A 1E0SA 5BW8A 1QF9A 5GVRA 5DN6D 1JNYA 1ZD1A 2GZAA 3BE4A 1JR6A 4BUJA 4ARZA 5FPYA 1Q1BA 5EXPA 2QBYB 4M1YA 3K70B 2FWRA 4NE2A 2JLZA 2ZROA 4QL3A 3FTQA 1TPZA 2BOVA 1IXRC 2AD5A 3PIRA 4DVGA 1P73A 4UNNA 1GKUB 3HU3A 3FPAA 3MMPA 1KK3A 2IWRA 1CF4A 1E79D 1XP8A 1GOTA 2NO0A 5HKKA 4L4UA 2BEKA 1NL3A 4LJ5A 4M9XA 2H5EA 5DHFA 1RIFA 2PL3A 1G7TA 5FOVA 1WQ1R 2ZI7A 3UG7A 1W2HA 2QORA 1RJ9B 4BFVA 4HDCA 3VR5A 4D4MA 3O8BA 3NVAA 4JL8A 1LFDB 1BYIA 3R20A 3W3ZB 4LHWA 4TYWA 1N6RA 5BN5A 1XJCA 2GVDC 3NHBA 5A0FA 3ZYCA 2ZVQX 2J7KA 1KTVA 3Q8XB 4G3XA 3LO5A 1RE0A 2H17A 5G3ZA 1QHHB 2HYIC 1T8UA 2WAYA 1LVGA 3AH8A 2NTYC 3U7EB 3N2EA 3LXRA 3IKJA 1G17A 3CZQA 2WJIA 3OAAD 4LV8B 2BMDA 4A0FA 3NC1C 1QHGA 3SFVA 3EZ7A 1S9HA 3FYHA 4PQYA 2O0KA 1UKZA 2I1VB 2IYVA 4F38A 3SR0A 4U00A 3VHXA 1Y3AA 4M1WA 2EFEB 3RDPA 3KL4A 4MYTA 1KKLA 4Q01A 4FCVA 5L3QB 2VSFA 1M34E 1X6VA 3EA5A 5GJWC 1CR0A 4BLTA 4OQFA 2ZREA 4NCKA 1GM5A 1X86B 1B23P 4KBGA 3BFXA 4KJZA 1OT3A 2ZYTX 3WYGA 3CZPA 5P21A 1TL7C 1AS3A 5LB2A 3AVTA 1T6NA 2E1RA 4JS0A 4XVQA 3U61B 5KDDA 2FFAA 4UNPA 1TUIA 4E03A 4AKEA 2IUSA 1DBSA 2EFDB 2HF9A 1BH2A 2X2FA 4G01B 4IOKA 3EC1A 1HY3A 1QRAA 1M74A 5JHHB 2GILA 3LA6A 1KI2A 5JMTA 4BWYA 1S3SA 1A7JA 1KIMA 5H8WA 1E0JA 4JZKA 4TMVA 4CGZA 1J90A 1OJLA 1YR8A 4DCTA 3MUFA 1AK2A 3AVYA 4TMWA 2QQ0A 2J5XA 4Q7LA 5JCPA 5G40A 4AIIA 1JALA 1Z22A 1Z83A 2IYYA 1DELA 2O8DA 5EP3A 2WSMA 3I8SA 4TN1A 1F3OA 3WNDA 4XOIA 1Z6AA 3KJIA 2CEAA 2HEIA 1ANKA 5TXGA 1N5LA 2OLKA 2QPTA 1AZSC 1U90A 1NMZA 3CRQA 1W1WA 3OFNA 3QE0A 3RSOA 1R8SA 2IYTA 5KSYA 2NZJA 3ZZ0A 2CHGA 4FD2A 3QKSA 4TL8A 4CEIB 1FX0B 3THXA 3EASA 4EIWA 3QKTA 4O0MA 2IC5A 1UBCA 5DE3A 3ZIAD 2OCYC 4L9SA 2UZIR 2PJRA 2J45A 4LJAA 5JJIA 2CK3A 4AKGA 1KI7A 1R0WA 1G8PA 2ZYUX 4TMTA 5EE3A 4A6PA 1XD8A 5CYOA 1PVOA 4KSCA 1QHXA 1R2QA 1R8QA 3IILA 2G0NA 2VL7A 4DCSA 1A5TA 3A4MA 3PITA 3ZVNA 1T3SA 4GSYA 1R7RA 3K53A 4KSBA 1YVDA 1C4OA 1UBFA 4Q18A 4TLCA 2W2VA 3IBGA 3UWOA 3QG1A 2JJ1D 1OF1A 3VR6A 4P0TA 4M9SA 4IDPA 4AYTA 1DE0A 2GK7A 2CXXA 3IIMA 1TQ4A 2Q21A 4IVPA 4MUBA 1PLLA 2BHRA 3OZXA 3QXHA 4KYIB 4TL6A 1GL6A 2BJWA 3TW4A 4DEYA 1MKYA 1KYIA 3CWZA 1GTVA 1XTJA 4Y0AA 2NGRA 2ODEA 3WMGA 2WIBA 1NSTA 1J8MF 4TMZA 1CXZA 1UADA 5F98A 3QKSB 4G5OA 4Q9IA 3VR4A 2FU5C 1RKBA 4HLCA 1W0KD 1K5GA 4JL6A 4JSYA 5FFMA 4NU0A 5FTJA 5H1YA 1F5NA 3GEHA 4DCUA 4ZKDA 3U6KA 1DVRA 5FPKA 2OFOA 4KFRA 4PXAA 1Z08A 3FDIA 2IEZA 3AV0B 2ZR9A 4JL5A 3CWQA 4W7SA 5EE9A 2ZEJA 1GDDA 3RNLA 1S9DA 4URXR 3JZMA 3CRMA 1AS0A 5CITA 1I2DA 1MRNA 2XNDA 4B33A 2WJYA 5CJPA 3BK7A 4ITRC 2IYLD 3EARA 5B30A 4KVAA 4DSTA 4M1MA 4Q1CA 2QY9A 4MQBA 1ZNXA 3WMEA 4M1SA 5C2JB 3LBNA 4DBLC 1FUUA 1XU4A 5AWFC 4BEBA 2D3WA 4E5UA 4LBZA 5F9HA 3HU2A 3SC3A 1M2OB 4M9ZA 4CYMA 4MRRA 2D62A 4B3CA 1TUEA 4NCJA 3U3RA 1NMXA 4OQXA 3NG1A 4A0HA 3O8RA 2FPKA 3VR2A 2JLUA 2ZRDA 1TF7A 2QSZA 5K8IA 4M8NE 3QXXA 1MOZA 2V7QD 3B7GA 3EIHA 5E95A 2HCJB 4Z1MA 3SYNA 5HR5A 3NTUA 2HF8A 1Z5ZA 1UBEA 4IOLA 4QNRA 2GXAA 1E9SA 2W83A 5J40A 421PA 1RRPA 1DPFA 4FXPA 1N5JA 2F43B 3KB2A 1WF3A 3T12A 3GLIA 1TNDA 1TU4A 2GZHA 4FIDA 1DARA 1AA9A 1KOFA 2RAPA 2F9MA 3QSYA 1FP6A 3CF6R 2NMVA 2BJVA 3K9GA 1N0UA 1XWIA 3LXXA 3WRXC 3SJZA 3G82C 4GP7A 4NCNA 3FFBA 5FUXA 3FOZA 1B0UA 3IEUA 4TTPA 5DYGA 4BQSA 3AVUA 4KITB 1PUIA 1O3YA 3IUYA 4D0NA 1NN0A 4JVMA 4EPRA 4MUAA 2CDNA 1UDXA 1J7KA 1HE1C 3DOEA 4G0NA 5K8TA 1CJTC 2PX3A 4IW3B 4V0LA 5FI0B 1E1QA 5FTLA 2V9PA 3B1WA 1ZNZA 2FFQA 1Z07A 2VH5R 3WP1B 3EWAA 4G5QA 1TX4B 2O8BA 3OIYA 1YR6A 2EW1A 1E2GA 3A58B 1YZNA 2ZS9A 2ZRLA 1JI0A 4KU4A 4OK6A 1R0YA 3B1VA 5F9FA 3T06B 3TAHA 2GXQA 2CVHA 4OI2A 5CK4A 1F2TA 1LV7A 3UK6A 5DI9A 4JLBA 1DAGA 2YHSA 3AKDA 3TE6A 1GL7A 1JR3D 2ASEA 4OI0A 1AN0A 3BD9A 3SZRA 4X8OA 4GP6A 1D5CA 2O8FB 3RHFA 1C9KA 1D6JA 4XVUA 2QM8A 1M1YE 2YOHA 1PUJA 4ZKEA 5TDHA 2Q3MA 3U3MA 2B7BA 4Y0VA 3BIFA 2FOLA 4F4JA 3PCRB 3ZQJA 4PHFA 1XBTA 1SVSA 1CIPA 1OH7A 1W36B 4POAA 4U5XA 3HPQA 1ZUIA 2IYXA 4C0KA 1E2MA 4H1VA 5DI3B 3BFVA 1HURA 4Q7JB 4YDHB 2VA8A 1U9IA 4NMMA 1GFIA 2QGZA 3PEWA 1U0HC 3QEJA 3L8ZA 3P26A 2D2FA 2GESA 4MKFA 2CLSA 3OE7D 3OEHA 1UF9A 1YKSA 1Z2CA 4P3YA 1JXMA 4CVNA 4ZI3A 1IOZA 5G41A 2XB2A 3FKSA 1Z0JA 4HAXA 5AJVB 1FQJA 3M6AA 3GJ8A 4US1R 2H16A 1ZYUA 3THWA 2EVWX 2R8RA 3S1AA 4MRSA 1Z47A 3Q5DA 2XNSA 1DO0A 1S3GA 3K8YA 3KDSE 3D3QA 3LX8A 4D81A 4DLZA 2F55A 1OB5A 1O87A 2CL6X 2XJ4A 3FE2A 3IO5A 2EFHB 2BBSA 2P6NA 5FL7D 2QU8A 4TMKA 3QQ5A 4BE7B 2ZR7A 1AQYA 3ASZA 5C46F 2ANCA 1XTIA 4PANA 1Z3IX 2MMGA 2O8EA 1E2HA 1KI6B 4RKEA 2EWWA 3QXSA 4L15A 1KSHA 2ZJBA 3A1VA 1JECA 2IA5A 4HDQB 4C3ZA 4DDWA 3RSLA 1F2UA 2HLDA 2A5FA 3IQWA 3FMIA 4WXRA 2GVZC 2A30A 3ZZUA 3I62A 4LGMA 1ZUNB 3QENA 1MT0A 1GVNB 4L9WA 3ZD6A 4NZYA 2Z4RA 2OM2A 1CRPA 3KFXA 1P72A 5FOWA 1NF3A 3TSOA 4URUR 3KQLA 5JHGB 3AB3A 3DO6A 3L8YA 2AX4A 2IXGA 5LDDC 1TADA 1OFIA 1Z0KA 1KDTA 5EE5B 2QP3A 1Q57A 3W90A 5C18A 2W00A 1QVAA 1F6BA 1SQ5A 4TLEA 3C41J 4PC6A 2KBFA 2YNMA 1OKKA 4EJSB 4A8JB 2R6GA 3SYLA 5FBQB 4XWOA 1W2GA 2F1HA 3K0SA 2WJJA 3B9QA 2C99A 1A2KC 2EFGA 1OXSC 1HTWA 3R8CA 1NBMA 2QMUA 2CHQA 2DYKA 2REOA 3BB4A 2CMKA 2W0SA 4DT1B 4NKRA 3PUZA 4XVRA 2FSHA 3KKOA 3SFZA 2FN4A 4KVGA 4PSAA 4U7DA 2ZI4A 1FFHA 5TY0A 2Q3HA 1ZM3A 2FGKA 2FSGA 1G41A 4UQOA 1NJGA 2GCOB 2WJHA 4OQNA 4PC3A 3SI7A 3ZS8A 4ZV4A 5IHPA 3CONA 2WBLC 4OKSA 1KZ7B 3KXKA 5FOTA 5H68A 2R44A 4QJ5A 4YDSA 2QE7D 4A92A 1H8HD 2FX3A 2IUTA 4XSHA 1IONA 2KB0A 1NKSA 2O8DB 1UBGA 2ZI3A 4Q03A 4BLPA 4OHYA 4GZLA 1N6IA 4MKGA 1QHHA 3I32A 1VHLA 4CRWB 2B6HA 2CCJA 4G5GA 2GCOA 2ZIAA 4NONA 2IX3A 2CCKA 1E99A 4CT5A 3CR7A 2PZGA 4JLNA 3DOFA 4DZZA 1KO8A 4RVCA 1G8FA 1ESNA 3QUSA 3OIUA 4GOXA 1KI8A 4W9MC 1E9FA 5CB8A 1ZAKA 1E94E 2BM1A 1P2SA 1WXQA 3O47A 3TLXA 3GJ6A 4BLRA 5CK5A 1ZM9A 2ODBA 3AUYA 4RKFA 3SJAA 1W4BA 2ZRMA 1KMHB 5FR1A 1NLYA 5B2ZA 4RD2A 4FCWA 4YONB 3BOSA 5JWRA 2B8TA 2UVQA 3EZ2A 4LDJA 3THXB 3DZDA 2IUUA 4IDQA 1I4LD 4B34A 1XJQA 3L0PA 3UANA 4QC2A 3VHLB 1UEJA 2GWHA 3BJIC 1Z28A 2OFXA 1JPJA 2CLCX 5CIWA 2ZI6A 1FL9A 3W8RA 3BB1A 3RRYA 2PBRA 2Z6VA 4MKIA 1CU1A 4HB0A 1ONBA 3I61A 4KFUA 4AKIA 4QGFA 1W46A 2O0JA 1CJUC 1Q3TA 3NEYA 1MR3F 3LW7A 3VKHA 1S1MA 5EXTA 2ZRAA 4LYAA 1K6MA 2WZQA 2CE2X 5KPJA
chains in the Genus database with same CATH superfamily
4LJ6A 1QC5B 4E2XA 4ZT4A 1R0ZA 2FMUA 2VT3A 3UNXA 3LBYA 3RBZA 1FLVA 3S7TA 3D6HA 3H7AA 2A67A 2LGJA 3HDYA 2L0XA 3ILSA 4GVXA 4IDFA 1C81A 4R2JA 1JYFA 4D43A 1GGKA 2BFAA 4YUYA 4QZVA 2EDAA 4YI5A 4CLXA 4XGRA 4WQMA 2XNDD 4MQLA 3CUUA 1S4QA 1P9RA 1D8AA 2YDXA 3N59A 5AJUA 5G1OA 3ELYA 3R23A 4LRXA 4CL8A 1AF4A 2VJYA 4CF7A 4LY3A 1D2AA 3U4AA 5C8YB 4EB8A 4MW4A 4PYOA 3P0JA 1GUAA 1TQ8A 3CRVA 3L01A 3CW9A 4Y67A 3COSA 1L2TA 4M7PA 5FTKA 5J4YA 2WD9A 3GPBA 4J3NA 1H94A 3BWMA 3FMOB 3K0HA 1MRSA 4WLEA 2GA8A 4AICA 1ZVVA 1N33B 4XX0B 4TKZA 1US8B 5A5FA 1RXIA 3CX4A 3F3YA 1G8KA 1RT9A 1E4EB 2FQWA 4LOKA 3MGCA 4W5TA 1NJ1A 2VEDA 4OJYA 3ADDA 3IBSA 1E6KA 5T3UA 3VR2D 5K0ZA 5KYYB 5KCZA 3W3AA 1CBUA 2W71A 4LV5B 5IH7A 2XQVA 5DO9A 4IGAA 4N0DA 5FI5A 2H48A 3ZE2B 1MX3A 5ALNA 1JDJA 3O4GA 2JIBA 4G5XA 2J0QA 4S1OA 2Q5CA 2AOUA 2COUA 1E62A 1P2VA 1PNOA 1KGSA 2J8ZA 1GGVA 1VLMA 4BNFA 1K5DA 2AG1A 1MEOA 5EXDA 4QD3A 1GT6A 1T0HB 2DJIA 1EM6A 4IQ4A 1FTYA 2NZVG 4FYXA 3IHLA 4LPSA 5J63A 4URVR 4YXWD 4RTLA 4ZC8A 1YKGA 4E5DA 5I9MA 4ARUA 3G2MA 3LWNA 1EK0A 4WCDA 5G02A 3VH4A 1EDZA 1F60A 1ZJYA 1XZLA 1QIEA 1CEEA 1MJGA 2C2WA 3LV8A 4JBHA 3VMFA 2P9CA 3BH0A 5IKMA 4R2XA 2GK3A 2CUNA 1JP7A 4BAUA 3C48A 3MWEB 4EJ0A 3CLSC 5FI1B 3IB6A 4J49A 2R8XA 4M1EA 4M22A 1THZA 1LLQA 2C61A 4C7VA 2GKOA 5SYMA 4EGAA 3PR3A 3KVNA 1A2OA 2ZCJA 2C5BA 3M70A 3HYTA 5AP9A 4BNJA 4R1NA 1FDVA 4PPGA 3DZKA 4IHJB 5E2AA 2ZRQA 4JLAA 5AOAA 2D1QA 5EKXA 3U49A 1ZUD1 3K0FA 5EWLA 3EH2A 2FPLA 2XMDA 1ZU5A 2QTLA 4C6TB 1ZK4A 3C14C 3UIEA 5MF6A 1Z8DA 2NVUA 2NXNA 2YWHA 5AKLA 2PZLA 3ROPA 3VTFA 5IM4A 3ULKA 1YVPA 2DWQA 3VHRA 4LSZA 3BA6A 1EH5A 2NT4A 2IF2A 2HRCA 3K0KA 4QPDA 3W2FA 4BP9A 4LXYA 2GEDA 1P4AA 2F1IA 3A2LA 2XUOA 3QE4A 1W75A 3BIXA 1UK9A 2Y71A 4CKCA 4OVKA 4BMDA 2RKOA 1KYTA 1P74A 2MSEB 2YVAA 4MW1A 4QGAA 5B57C 3MF4A 5JSUA 2C9ZA 1XZFA 3OQJA 1P7YA 2F59A 4JWTA 3T94A 4AWXA 5C51B 4D26A 2QI9C 2J6HA 2CMHA 5DIZA 3WBBA 1WR8A 4JC8A 1JFRA 1O6FA 1UT6A 2IGTA 3EHDA 3USES 5BSUA 4MUJA 3R7WA 2BGTA 4LKOA 1O5IA 3UKJA 2ZJ8A 4EAQA 5IBQA 3G0HA 3JAMA 1H4TA 4JJIA 2CFSA 1YDHA 4MRNA 2ZBEA 1TU3A 3ADOA 4Y2PA 4JUBA 4Q9KA 5KKNB 2WM2A 4LGYA 4CIBA 4DQ0A 4P8RA 1IB0A 1USKA 3N87A 4HRXA 4JZYA 4B47A 2GN2A 5E9JA 4F12A 3UAVA 4YCLA 1VIMA 5IF9A 2ZDHA 2CWDA 4YXFA 4YMLA 2OHGA 3ZUGA 3M6UA 5FTMA 4ARIA 1L9XA 1A8PA 4E46A 1ZEJA 2Z3ZA 4OOEA 2AWOA 3OEHD 4XR4A 4URZR 3PNSA 1EFRD 4QTXA 1ZGAA 5H80A 5AUOB 5FQOA 3BD6A 1HO3A 4HRVA 3ZPXA 4D4HA 1ZQ1A 4Y9TA 4KWTA 2C4KA 1XB2A 3RIMA 3H5WA 4S1NA 1WWKA 4BJ6A 4KLRA 2WB2A 2V5VA 3O2QB 1C1XA 4MV0A 4UVIA 4X6XA 4YJHA 3ZXXA 2O8BB 2BTQB 5FUYA 4RY9A 1HORA 1AIPA 4K9LA 4JITA 4NCIA 5KJEA 1AMNA 1U2RA 2YXEA 1P1BA 1ORTA 5EIOA 3RYHB 3OJLA 2HJGA 1UPXA 2RARA 1HMPA 3IBFA 4FN5A 4PZAA 1K0UA 4CIDA 4ZAVA 3WGJA 5K9ZA 3GJRA 1OZHA 4IJUA 1ECCA 1L4UA 1ATZA 4D98A 1XPOA 2ZBUA 3X1KA 3ZHXA 1TPYA 4H6PA 4R68A 3I1YA 5DGIA 3OKPA 3C7KA 1R00A 4OYLA 4EBFA 3HKDA 3T99A 2XVZA 5DSZA 2YW9A 3HN6A 5E1DA 2V6BA 3FA2A 2X86A 3JY6A 3A1EA 4OHWA 3PFIA 3TRIA 1BU8A 3UUWA 3LYUA 3B7PA 1MDBA 4UTOA 3LK6A 5GONA 2QAGB 4DHEA 5J4KA 4RHEA 2Q46A 3LUGA 3QZUA 621PA 3ANXA 4C3VA 1P4SA 4K9PA 2GM4A 1M3SA 2F8TA 2EBHX 3H05A 2G5CA 4DV6B 2WKQA 4GMHA 1T9HA 5AW0A 3F3SA 3K16A 4B7XA 2I4IA 1E2KA 3VOAA 5D3MA 4B32A 2PWYA 3RUDA 1EK2A 1S01A 4NVRA 4MVJI 2G77B 1DLIA 1M33A 2RGEA 3ID6C 4ERXA 2RHTA 4WNAB 3W7AA 3IC5A 3R3SA 2CY0A 3BZUA 4RSMA 4EHLA 2J41A 4L72A 3BTVA 2BBTA 3PC8A 3QFTA 4GOLD 3KE8A 4RV5A 1QCZA 2X23A 2VBFA 5HUJA 1WA5A 1GKKA 4FW8A 5KSOA 3C24A 5KTNA 4LJ7A 4WZ6A 5K0JA 1F6WA 3K5HA 2VAPA 4TWZA 3SIPA 2MDTA 2V9ZA 3SLGA 5KQPA 2AKYA 1GUBA 3CPHA 4BIIA 2OXEA 2NZYA 1K98A 1RRGA 5JVDF 5JY6A 2YWGA 4D3YA 1KMCA 3ESXA 1MFZA 3KR9A 5G3YA 1NWCA 3IJRA 5EXSA 4EG1A 1O94D 4LKRA 4DABA 3DPSA 5E3JA 4F3CA 2ADFA 5AJXA 3SYMA 1C9JA 2VHTA 4AD8A 4D4IA 2G83A 3D2CA 2DFKB 4IYJA 3ISVA 2YKGA 4J0IA 4KQ2A 2VUHB 3H8JA 3FLMA 4DSUA 2BEJA 4XGNA 1ONOA 2BMFA 2ZK7A 5HKOA 2WTAA 5EEHA 3KELA 2OTCA 2DQZA 3HDTA 3RRJA 2AHOA 4E88A 4G25A 2Q0SA 1EZ4A 1VGQA 2X76A 5GZ3A 3LK7A 2QF7A 3IODA 2B25A 2HSEA 2ZSFA 4O4LB 3IP7A 1FRZA 1U3FA 2C84A 2XW6A 3K8ZA 3UW1A 2IS1A 1PR3A 2JDIA 3OX2A 3AI7A 3VXKA 4P31A 3NKLA 3EVAA 5ALXA 5IDWA 2R5FA 4F2HA 1UKCA 1E9RA 3EQZA 4BCDA 1TT5B 1YU9A 2I65A 4WNIA 4MVJD 3CLRD 2B8JA 3RS0A 4LVOA 4CM7A 4CM8A 4ZHQF 4UREA 1SHZA 1P7VA 3ZD7A 3RTBA 1Q44A 3QBEA 3VNRA 2NV6A 3GEIA 3KKPA 4B4KA 1LDMA 4M1ZA 3ZDQA 1JMYA 1SQFA 1S8NA 3R09A 4LOIA 4C0BA 3OTOB 2ZSEA 5DWQA 3PT9A 1WB9A 5JC1A 1PEAA 4QQFA 3K09A 2CD9A 3ITEA 1E6UA 1F0YA 3NHRA 1Z33A 2HFJA 2WUEA 4DDUA 5I7HA 5SYAA 5LZ2A 2OHVA 3C98A 5F3DA 4ZI2A 3ZDCA 2E2WA 3U2QA 3QX9A 4UXHA 1DAIA 4FFLA 4RKQA 1BO6A 3ZNQA 4AN0A 1G8GA 2I8LA 3HP4A 1BH6A 5F3WB 1S2MA 5KJ1A 1CUFA 3V1YA 1H0KA 2GD0A 2NO9A 4ZDIA 4UARA 3VDMA 2XGGA 1B73A 2BH9A 4DC9A 3PTAA 3CS3A 5L4NA 1GG8A 2CLEB 3G9UA 3WFZA 1F2DA 4RK4A 1HLFA 5AR1A 3C3EA 4PLYA 4QUAA 3STTA 1FTNA 1FDIA 3VAAA 1QU3A 2J0EA 3VYTB 1JSCA 1YZQA 5HKKD 3ZE1B 1ODTC 4DE5A 2X8AA 1ZCAA 4E0BA 3X43A 3G2PA 4CLOA 3OEWA 3ZVMA 3PEYA 3EUEA 3FG9A 2R4UA 4B5KA 4C7OB 3IDOA 4Q47A 1MUUA 4YP6A 2YINC 4RJJA 4DR6B 2P7IA 4ZZ3A 4Y3UA 3B60A 4DC0A 1FP4A 1N6NA 1WCIB 4EKDA 5HJ7A 3WL6A 4D8WA 4Z9XA 1AKUA 3AZOA 2V7TA 3GUHA 2P7HA 3DMFA 4L0QA 1YVRA 2B0JA 2RK4A 1GV1A 2HTFA 3HCRA 2WTXA 3J81A 3L4SO 3P4YA 4EFNA 4BHTA 3UXMA 3NH9A 1AHIA 1C0KA 4LZLA 1XXHA 1KEUA 1U9CA 3M2TA 4UBMA 1W9HA 3K8OE 3UK0A 1GPNA 1C9NA 3ZWQA 1FU8A 1ZZEA 4LTNA 4FJ2A 1FYEA 4KACA 6NULA 4JOBA 3ZLTA 4OMFG 1NULA 1DFGA 1N2XA 1LD3A 4E51A 2WJ4A 3TLBA 4LHXA 1KVTA 3IAM6 4TYPA 5K0CA 2IEIA 3A32A 3AHHA 2VSOA 2OYRA 3ZHYA 2AN9A 2WD7B 1N32B 1H6BA 1W581 4NEGA 1Z0DA 3T7KA 2QYOA 1HDZA 5K0FA 3R0ZA 3R7WB 3SHVA 4K0RA 4D8VA 4UM9B 1GYQA 2R4QA 3WLTA 2P65A 4C21A 1A72A 4X1YA 1L1EA 1VM6A 1DL5A 2F1OA 1WSWA 4C0JA 4TQAA 1K4KA 2WABA 2PLAA 3W5VA 2V6FA 1KJ8A 3KUUA 1VSUA 1WBJB 1IXZA 3HXPA 1QNLA 4KN9S 1Z38A 5BSRA 3NVKI 2PSJA 3BAFA 3IUSA 4B3BA 1PNVA 4O8CA 4QPNA 5EJIA 5KOJB 1QCYA 2B20A 5EJ5A 4IXDA 5E7IA 1LLFA 2GPWA 2HA4A 3TFQA 4CKEA 4WBNB 5J4VA 5DCWA 3FM9A 2NSYA 4YMGA 1LS1A 3PFBA 4RH0A 3DKIA 4F84A 4CXMA 3S2EA 1Q92A 1H3FA 1J1ZA 3PV0A 3E7WA 1E2DA 4F86A 1XRJA 1XTPA 5CJ2A 2FKNA 2GNOA 1QF6A 3IT2A 2P9YA 4MS3A 4RVSA 2PUTA 2OHHA 1GCOA 2AFHE 4QHSA 3EG9B 4BYMA 1U0GA 2H1SA 3GA0A 3B6MA 2I2BA 1G66A 2IZOA 4ZQCB 4N0MA 1DIBA 1NRJB 4II7A 2DH5A 2FG6C 1KJJA 2KLBA 3MTBA 3GLHE 4H0FA 3MMXA 5LP6F 3RRMA 3RH0A 5IFKA 2AEJA 1GIAA 3I73A 4M0KA 4PHGA 3RGGA 4HTFB 4S24A 3F90A 4DQUA 1DWPA 3T61A 1AQ6A 2VHQA 2AHRA 2XA9A 4M1TA 4MQEB 4C88A 3H9JA 1DUVG 3PGVA 2LKDA 1JBQA 1RJFA 4KJXA 4WKGA 4KMRA 3ZN2A 1ICIA 4IFEA 5B58C 2Q7XA 4W1QA 1NF2A 1V7ZA 4ZMSA 3SVLA 5GGXA 4LV6A 3WLFA 1YS4A 1UC5B 2Z3VA 4RPGA 4ZVMA 4BB9A 2PSHA 5HM6A 4TROA 3BGVA 4FFMA 5IN5A 1OLSB 3K2IA 3O38A 3JQAA 4AWBA 3BTOA 2AEMA 2G7ZA 3KVRA 1DHTA 1VPVA 4AKSA 5ABPA 1UZNA 2OP0A 3PDCA 4UUBA 3ONVA 3I3SR 2QSYA 3I01A 5KYYA 1RRMA 1G5PA 4N5HX 2H57A 4CMJA 1UJBA 2CBZA 1XZGA 2ZE5A 4LDPA 4H15A 4TVBA 1LPAB 4PC7A 3VQTA 3KLOA 3NBQA 4ML3A 1GSIA 1FPMA 1UBLS 4EATA 4BO2A 2EHDA 5GVSA 4I55A 1KYVA 1MH1A 2HA0A 2GYWA 1UC8A 2O8VA 2ZUWA 3Q72A 3ZCSA 4I1SA 2FEMA 2V5AA 1SMKA 5CLIA 2P1RA 4L5AA 1JFSA 2EZ9A 1Y4ZA 4Z0HO 4R51A 3AXTA 2B78A 3LOQA 4AP5A 5DX8A 3OICA 4MYHA 3A6PC 4JX9A 2DFLA 1G16A 4EEKA 3K0CA 1BQEA 2Y6UA 1HE2A 4JEMA 4W5HA 3RUIA 3UV3A 2X5KO 1U7HA 1PF7E 1HZZA 1JHYA 2NT3A 2QIPA 3KJFA 1QV7A 4MKHA 4V1CB 1MAAA 2J67A 4DF3A 4HC4A 1EEHA 1XD9A 1PO7A 1WUTA 3E18A 5ALOA 2QUAA 2B35A 2WWGA 3UT6A 3VNQA 5IT5A 4BFZA 2E21A 2FDXA 1NI4A 3ZXSA 1WMSA 2AR9A 4PPFA 4X85A 4HZUA 3AHFA 2MYPA 4FNMA 2VNIA 3F6PA 1J25A 5I7RA 4GLJA 4MUGA 3T38A 5H82A 1CUGA 1DO8A 4HEA1 1RZVA 3IP5A 3U3ZA 4JBYA 3Q7SA 3H2SA 5ES3A 4NH0A 4XD2A 1XU7A 2EZTA 3KTOA 1Y1SA 3NTQA 3NOOA 4ADSG 1QVRA 3GEPA 3P0RA 4Y2YA 1CUCA 4MCHA 3PF9A 1GGEA 1DKMA 3E8SA 1YIDA 3QPBA 3V42A 3FCEA 2G6BA 2H31A 4AMGA 5HTKA 3KX2A 1H1LA 2P9QA 4RAQA 5JYEA 1RQGA 1SA0B 4OQMA 3IMCA 1OH8A 1ESDA 1WCYA 5EIBD 4GR9A 1CDEA 3D3NA 4D4KA 1YRYE 4FGWA 1MNAA 5CVVA 3LQYA 2HNKA 2VK8A 1CW2B 1N6HA 1KJWA 2BR3A 4MS4A 2CL7X 2FWMX 4WCVA 4UU7A 4YCJA 3WNCA 3DZ8A 1EG7A 2G5GX 1M76A 2EW2A 5EIXA 2V65A 3TDMA 1NUAA 2YOGA 3MFQA 1WCV1 4UTPA 3I2IA 2JH8A 1T3HA 3ASYA 5I7AA 2FN8A 2YZMA 3IDQA 3NATA 1ZC3A 3O8QB 1Z2OX 3SP1A 4C4YA 5ICSA 3QJGA 2NOAA 4LYJA 1ZMRA 4MLCA 1T0UA 3A31A 3SZMA 4NG5A 4TLLB 5CVJA 3V1UA 4G0QA 4Q1AA 3SHOA 3HVRA 5J2TA 4QHTA 3AUXA 2VTDA 4WOKA 3SEAA 2D06A 4TUYF 5JXWA 1IC6A 1E60A 2P9FA 5JZOA 3CZ4A 5J1SB 4UDYX 1EDDA 2OT3B 2WSIA 3GGGA 1KFEB 4OHXA 4DJEC 1RC0A 4A73A 3MQ2A 3M4NA 3FVTA 2JVIA 4IDOA 4PX9A 1W7AA 4G0UA 3RYIA 3SC2B 3ESAA 1M8JA 3U3OA 3FTDA 3THSA 3H4IA 3JD0A 1QSGA 4OHCA 5KVQA 2VF5X 3ND5A 3NQ41 4A82A 2AMVA 2FMKA 3IEIA 1Z75A 5M5BA 2XUAA 4TTIA 1AM4D 2E6KA 4XTRA 3ESQA 4F71A 1IBKB 4JLVA 2B7LA 4LNUA 4G9EA 1CUVA 1CZUA 3OBBA 1XCJA 3CNOA 3ODGA 3ZS9A 4FWBA 4JP8A 5C5EA 4LFBB 3A9UA 4IOMA 1Z6ZA 5GPBA 1XMJA 2BLLA 4TSFA 4Q3EA 2X3FA 4BFXA 4NZMA 5A6VA 1YR7A 4NAUA 4PO9A 1XRLA 2ZRNA 4TXLA 5J1TB 2NV0A 4CQMD 3LHFA 2EJTA 3OP1A 3WVNA 1XFAA 4CM4B 1X3SA 3AUTA 1D2HA 1DDOA 2WWFA 3NHSA 2O7VA 4TXNA 3PG5A 3R0JA 3ZG6A 1KAMA 2WZCA 1RBZA 2Y1XA 1V9CA 3LQQA 5GIOE 4NBUA 4XM2A 3MTQA 1PZHA 1DIOB 4QXOA 4CF6A 2QJOA 1Q2XA 1R15A 2WSBA 2BEVB 4ZALA 2O1SA 1FTQA 2YQZA 5CG2A 4QUEA 3GFSA 5CYFA 4ZD6A 4U2GA 1MB9A 4Z54A 1BKDR 4R7GA 3U09A 5DULA 3QEKA 4G4GA 1DG3A 2EX0A 5KTOA 2P6UA 5EHZA 2IHBA 4HTFA 1PD0A 4AL4A 2ZSUA 3M6XA 5EFZA 2OXRA 3CIOA 4JKIA 3GNQA 4EVRA 2WTNA 4EDHA 1SRRA 2E4YA 3EN0A 5AM2A 4K87A 1SNYA 5EJMA 1QCCA 1ULSA 1XZ8A 2CFRA 3HY4A 5ALRA 2CT8A 2YUIA 3DUFA 2I34A 3MUEA 1CC1S 4XH9B 2NVOA 3VHXB 1D7OA 3ZZNA 5JD6A 4WI1A 1U3TA 3SE7A 1FMTA 5DLDA 3IXQA 3PRYA 3REGA 5M34A 4YBRA 3PYLA 1CY4A 1KHTA 1TZBA 1Y63A 2PG3A 3HWX1 2ZAMA 1Y3IA 3FNQA 3U3KA 1KFKB 5ITZB 1WULS 3DE7X 1GAXA 4WERA 2VPPA 4LHSA 4AVYA 1CR2A 3S1SA 2DG2A 1X13A 4FHFA 4QOSA 1Y3DE 4TS1A 4ZAZA 1I24A 2JLXA 3L3BA 1JG7A 3TYXA 4CW7A 4EAAA 1CUEA 1E1NA 2FZLA 2JVKA 3AF1A 3FBGA 3DCNA 2PSEA 1YOBA 4HWSA 5NLLA 4UUOA 2RHDA 1UKYA 2PV0A 3H0EA 5EZ5A 3V33A 2Y8EA 4Q4HA 2NYAA 1RIIA 5ARDA 3UW3A 1GCIA 1AUOA 3BCUA 2PT5A 5EVCA 4ZEWA 4RUKA 1KI3A 4R0VA 2OO5A 4UASA 2AJDA 2EWVA 5FPSA 5K0LA 1BOFA 4Q21A 1ZOLA 4JJZA 2A9QA 4J0CA 1H6DA 4XGQA 5CB6A 1M8FA 4IHJA 3TJRA 1IHUA 5HF9A 3AM1A 2EZ8A 1HT2E 3EH1A 2RHOA 4I5FA 3WGGA 5JCJD 2JCVA 4DIEA 5I48A 3G5UA 1XDBA 3MLBA 3JAKA 4M9CA 2WVJA 2HLDD 3KZOA 3UAYA 3CPEA 4CEIA 4EGCB 2Q1XA 5EJFA 4BNIA 1VCNA 3C6YA 1VXOA 1BXRA 3ABZA 4YPOA 2IS2A 4FLMA 3LC7O 4H1UA 4E14A 2QX7A 3LGAA 3E1SA 3DMTC 1ZIPA 5BR7A 3ET5A 5ELXA 1K7XB 3GGJA 1TQDA 2PYDA 4K8OA 4DJDC 1N2JA 3ELDA 1O96B 1DIHA 2VF7A 4NCXA 3WHKA 4DIOA 4P2GA 3EYAA 4A23A 3L7NA 2VS1A 1FXSA 1SUIA 3OPYA 1GXSA 1KI4A 1ZGBA 2WFLA 4L4SA 3AL2A 2EKDA 3V34A 1EXDA 2GPTA 1NUHA 4M76B 2VHZA 5AVOA 3OOEA 2LXNA 1Z2NX 2PKXA 4IAOA 3ZZMA 1OLUB 2W6QA 3AIIA 1UANA 4CTOA 3F74A 1P39A 2RG7A 2C97A 2XUJA 1NNUA 2DUMA 4UDNA 4DLXA 2JIMA 1VPLA 2QTVB 4C1BA 2W2PA 3TR5A 4DW8A 4WUTA 3H65A 1S2LA 2AFIE 1DOAA 3O83A 4YT2A 1O0CA 1GV0A 1T6BY 6PFKA 5ANRB 4P6VF 5AI9A 4BLVA 4FFBB 2FDRA 2Q2QA 5BSWA 4CLRA 4F3TA 4P3XA 4V0ME 3BWBA 5IP5A 1E3MA 1F5SA 3NB0A 2CUKA 1L4FA 1LSOA 4HGRA 3QWIA 1P7PA 4J7UA 2VCHA 2Z98A 4MCAA 2WUWE 3FYUA 4A8HA 1H3EA 1E92A 4UHBA 3DL7A 2EL9A 1PHPA 1WDTA 4KRGA 1VRVA 2IW3A 5CD1A 2HJRA 2PLWA 1EA7A 5JAUA 1Z6TA 2Q45A 3G0GA 2PT6A 2AG8A 4N9QA 3OCCA 2P0EA 5EEGA 3LE8A 3KJZA 4DPKA 2EBWA 4QTZA 1F8XA 4PAOA 3BGDA 3LHKA 4HBZA 4HDMB 1G5TA 1YB7A 3QJYA 1HKHA 3R3HA 1H8HA 3EZYA 1CQJB 1O97D 5AVVA 2OGZA 1GLNA 1V11B 4QOIA 1D5WA 1YB5A 3H6HA 1P5RA 3AW9A 2HHCA 5T4FA 3R3UA 1U81A 2QM3A 2JGDA 3BHJA 4IKOA 4PYNA 3SOZA 3VISA 3WJ2A 3FN4A 3E3OA 1GL3A 2C0QA 1J70A 4QE3A 5L4SA 1UKVY 1EX1A 1HDYA 4Q7QA 1UMBA 3BFPA 3FGNA 4F9GA 2ONKA 4G63A 2PU5A 1T15A 3K96A 3NBYC 2B4AA 1GA6A 1P29A 3E1GA 3OFND 5DCUA 1DQRA 3E58A 4DMRA 1U0SY 3B51X 1F12A 2GBIA 1E18A 3NP7A 4D5EA 1J9ZA 1CJKC 1PT5A 2C4TA 3G5AA 3OWHA 4DIFA 2VYCA 4B3IA 3LA8A 3PQ6A 2FPGB 1KEKA 2YV1A 1SKUA 3KBOA 1M2JA 2VRNA 5KOHA 4XQ0A 5EERA 4QELA 4H7DA 5AK3A 3HCBA 3AEKA 4L5JA 1ECFA 3CF2A 4Z7JA 4O1IA 4P53A 1RI2A 1CHDA 3E9QA 1VHTA 1ENZA 3SD7A 1O9HA 3W9YA 4EG7A 2H1OA 4HKTA 4I9GA 4FS8A 3RVDA 7REQB 3VR4H 4KX5A 3FCOA 4ARCA 2XCSB 1FXWA 4KBYA 4XGKA 1VRWA 3E27A 3A04A 3NHZA 4B3XA 3K0AA 1K8RA 4EB3A 1K9SA 1AKYA 2J3QA 3WK6A 1E77A 1ESEA 1UIMA 1KJQA 1JVSA 1MENA 1SN7A 2DTXA 3GCXA 4XKJA 5A03A 1XEXB 1W5EA 1YT5A 4FBMA 2ZRFA 3LT2A 1P6QA 4BEWA 3U44A 2DB3A 1I1QB 2BHLA 4EG8A 5ICMA 3D0KA 4A2WA 3NNDA 3ETJA 3OCUA 3M3DA 3W4IA 2FJUA 3W6NA 4ZVRA 1HYEA 3OD5A 2JKVA 4EY7A 3AR7A 5KI6A 4EKYA 1XHEA 3PDUA 2O9JA 2VIIA 1YUMA 5LC1A 4P86A 2VXYA 3VPCA 3JZDA 4GPBA 4LVNA 3AL0C 1XR3A 4OJNA 1Y1QA 2OC9A 2NQ2C 2FZGA 5EXEA 4BASA 3RM3A 3NWOA 1GR1A 3Q9UA 5JNTA 2ZXFA 3E9ZA 4LQ4A 2FP3A 3DKPA 4KXLA 2OV8A 4LRWA 3U44B 1BHQ1 1F7VA 4RXTA 3S99A 1I3NA 3A70A 3TGWA 2JAPA 3W1EA 1I0LA 3AX6A 5I5EA 2TMGA 2R3SA 1H2AS 1YFKA 4EJSA 4DNPA 3NPAA 1EPUA 3M1IA 1KEZA 1AO3A 2O2XA 3NTOA 3ROMA 1ZXBA 4ITUA 4U4AA 5E1BA 1N2EA 3UKDA 4I50F 2ZBGA 1L4YA 4RD3A 3SX0A 5HRCA 5L3SA 1GPH1 4V38A 2PRZA 3WIDA 3A4LA 1U5CA 5ALHA 1LQUA 2E89A 2RGNA 5DHAA 3WGOA 1VHDA 3EC7A 4RNCA 4PSVA 3ORHA 4GEGA 4ESOA 3I2GA 1RZUA 4ND1A 2GZRA 4OQDA 4DJFC 4QBIA 4EQ6B 4NNOA 1VBKA 2QX4A 3L0BA 3K32A 1KORA 2A86A 5IJ0A 4OQZA 4GI3A 1I80A 4HZIA 4IFIA 4INPA 1JQJC 3E8MA 3PE4A 3RS8A 1XCGB 4K3UA 3D3KA 2FQXA 3Q4GA 4JJ8A 2VJOA 1KS2A 4DKXA 2GEKA 1YQDA 3RQSA 2DHCA 1JU4A 2NZWA 3D4LA 2TS1A 3QELB 3ZHCA 2X1VA 3HUFA 1FSZA 1LC0A 4V03A 2XQKA 1KSGA 2E18A 1CS4C 4DMLA 3R3WA 3K35A 4YDQA 1RJGA 5T8KC 4R9SA 4DB2A 1WMEA 4QPPA 4TV8F 1DTSA 4IXMA 4RKWA 1IAQA 2OCAA 1EM8B 4WXHA 1G1MA 1YUNA 3DKVA 3I0ZA 3GBPA 3THRA 1UINA 3LOUA 3ND8A 3PWKA 1ESMA 1NNEA 3TRHA 1G5HA 4HQFA 3UBTA 3DSRA 5ESWA 2QM7A 4QYIB 1DX4A 3CRRA 5CNKA 3SN6A 2XKBA 4X1KB 4F5DA 1Z63A 2P3SA 3NAGA 2FHPA 2O7RA 5KO2A 1PJ2A 4BDTA 2O8CA 4BO0A 1DEXA 3KHTA 3IP8A 4E3WA 3UG6A 2V54A 5IASA 1V41E 1JAIA 5KYTA 2F8LA 3CE9A 5BNWA 1NDQA 1NDUA 2IYEA 1OFTA 1P2FA 1YF3A 1IPFA 1Q0UA 4XARA 2ORWA 3TIXB 3AP3A 3UJPA 4YNBA 1TB4A 2GPBA 2Q7OE 1TAHA 2ERXA 2C5FA 3GFGA 3EWNA 4JP3A 4MVYA 1LVHA 1X9HA 1AHNA 4UNQA 3KZVA 3TXYA 1P60A 1SXJB 4O2BF 1MV8A 4DV7B 1G20E 4UXJA 4BVGA 1GA4A 5G0WA 2WU1A 3N3AC 2J9YB 4UAUA 3PDJA 2OCPA 1BW9A 2PN1A 4HQLA 3T7TA 5JTTA 3M6MD 4UOZA 1MGOA 2GEBA 3PHJA 3DEJA 3DLBA 3R6TA 4LMRA 2HKIA 3R5SA 5KOYA 2FXIA 4HI0E 4IZOA 1NASA 2JKYA 4GL2A 4FE3A 3QY9A 3CZAA 4IPTA 5KYWA 1Q6YA 1WKBA 1QQ7A 1FPQA 1IE3A 1QYRA 4CMIA 3OESA 2P2GA 4UMVA 1GLVA 5HZMA 3OIGA 4BNHA 3D6TB 4D6PA 4DLLA 1JHZA 1HTTA 4Q15A 3UJBA 3H97A 2A1IA 2XYGA 1S7CA 1FIUA 2FR8A 3M5PA 5FHQA 4QYTA 2GN1A 1FFSA 1L0BA 2RB4A 4RVHA 5B58T 3U0VA 2EFJA 2O5CA 3F9IA 5ED0A 2DGDA 1RPAA 3KLPX 1T3LA 3ZHOA 4L8GA 1OGYA 3ST7A 1FVXA 3MJCA 3OF5A 5TMEA 5LA6A 3P1JA 3C7AA 1BE0A 1BX1A 4QTUB 1HEYA 1NXOA 3T35A 1AQJA 5TF0A 4N0PA 4TXMA 1CS0A 2YFQA 4V24A 3L0SA 2IEGA 4GM4A 4HAUA 3CEPB 1IEVA 5HWSA 2CD7A 3AHIA 3DVSX 3GCDA 4R2IA 2V0NA 2WZBA 2FN3A 3NBZC 1BEEA 1EHYA 4IWXA 1RXSA 1KDPA 3KB1A 2OBMA 3DTYA 5CLHA 4GXNA 2PANA 4TV9F 5F51A 1HQDA 1OYWA 1FNDA 3PCTA 2IU4A 4W5JA 1PRYA 1KO1A 4PR3A 5D6OA 4OX9B 2JIZA 4JX8A 1G5FA 4X6LA 3D4OA 3Q3HA 1XMPA 4IDBA 5GY7A 4IOJA 4B71A 2Z58A 5J58A 3D54D 3SQMA 3WGTA 4EH1A 1POXA 1SHKA 5KOJA 4ZU1X 2G06A 3EF3A 3KPUA 2C5GA 2YVQA 3G9QA 3HBFA 4F3NA 2NZUG 5IVIA 2RHBA 4AJPA 1Y8ZA 5TQ2B 3D59A 3OLXA 1XQ6A 1N5KA 1YBAA 2B61A 2HHHB 4MHSA 3SFTA 2V7WA 2BFOA 2CLFB 4XIYA 1N0HA 1U2GA 4PONA 1M8GA 2Z04A 3HBLA 5F77A 3W3AH 4K5QA 5BV8A 4RMNA 3L1UA 1JEAA 4DMCA 1AK1A 3IPRA 3TNLA 1PZNA 4BX8A 3L7JA 1GD1O 2QT0A 2F17A 3PFWO 4WASA 5ALJA 4ZCLA 1JEQB 1GQ2A 3QM1A 1XPJA 3A4VA 1WD5A 5E3IA 3QJ5A 1XVUA 1XDZA 4RZQA 4K6FA 4K8RB 2DWOA 3K4HA 5AVUA 2F1JA 1XVTA 2A94A 3O4JA 4AURA 2E49A 2JS7A 3E3MA 3USZA 4HNTA 4DIDA 2AK3A 4JYBA 4LXGA 3DMGA 5AKGA 2B8WA 4HK4A 5E2IA 4MA0A 4RETA 5JYCA 3AM3A 3R9XB 3Q6MA 1NY6A 2ZE8A 3W5SA 3T5GA 1C1XB 1N9ZA 1U1GA 3F4BA 3K2QA 1CKEA 1QIMA 1XZPA 2P9HA 3OQPA 5BQPA 4EX6A 2Z5GA 4RD1A 4Q4LA 3LDHA 2G9QA 4OFWA 5LLDA 4IUDS 3E3AA 4EJ6A 5MGNA 1SB8A 2R65A 3TZ6A 2W6IA 1SXGA 2ZAGA 4X8MA 1RVDA 1C7EA 2X8JA 1W73A 4GMDA 4MYCA 2G76A 1H2RS 3MJRA 4FKBA 1NQWA 4E4RA 3AKZA 2OFWA 3Q0TA 4JUIA 3HXOA 1PEYA 5EE1A 2ZYIA 2QD2A 1D6SA 2WDZA 1NQUA 1WHSA 2X9QA 3KWMA 1A50B 2GUGA 3A6DA 1M2WA 3IUMA 4G5SA 4B85A 4EW3A 4FFRA 4JA2A 3LQRA 3HO8A 3KLMX 2IU6A 5GAJA 1TM7E 2EW8A 4RJTA 1NJ8A 1MTZA 4ZIRA 4PWYA 4ETNA 1ENYA 1WXDA 1N77A 1UT8A 3EMBA 2HRZA 2ZIGA 4D4GA 4OJQA 3UMMA 4OP3A 4OB6A 3DMHA 4PQRA 3CJTA 1N2SA 3M33A 2BCEA 2ZQZA 4MI9A 4S1VA 5IJZA 3T3MB 4YECA 2H85A 3O4HA 4TYQA 1OX5A 4FXOA 1SO8A 3IAXA 2COEA 1OI4A 1APBA 1LBTA 2FOXA 5LQMA 1XAHA 2B82A 4OMDA 5TQVA 3NEPX 5LL6P 1Y89A 3LC1O 1FUEA 4I4IA 1E2FA 4LXHA 4YVFA 1TMOA 5SY9A 1HQYE 2DPXA 3HCFA 3MA0A 1HQCA 1IDN1 2ZIZA 1RXUA 3TE7A 3H9QA 5IJ9A 1S3IA 2VP5A 2WM3A 3C1UA 3EXFB 4W6ZA 4DANA 5M04A 1DJLA 2O59A 2NSDA 4CFZA 1XEAA 3KT0A 3HJBA 2R1VB 1OV4A 2XUZA 4O3FA 4HAZA 1A88A 2AL7A 4ZANA 3G2HA 5FH9A 5AXBA 3NKFA 4TVKA 2FDCA 5JNRA 2CMGA 3LUJA 1GO2A 1PGJA 1T2VA 1Z5VA 1NI5A 2IHYA 1RWOA 2VTKA 3AUJB 4MPTA 3OMWA 3VHQA 2AMLA 1IM5A 4YX9A 2FRDA 1EJ6A 1ZH8A 4IUCS 2PGNA 1ULUA 4IIXA 4L02A 3V7NA 1O97C 5ALWA 3EIFA 2VPZA 2BEUA 3N6XA 4PVDA 5JSQA 5PGMA 4IRXA 2WVHA 3AOGA 4G1FA 4M6WA 1EXWA 2HIMA 4TL7A 2W6JD 1KEEB 4JQSA 5DM1A 1DXOA 2PMWB 3ZU3A 1KNQA 2H59A 3PEVA 3Q9LA 5DV9A 2VJBA 3TTTA 2GHTA 5FT9A 5FFNA 2QVGA 4AG6A 4FZ5A 4UOQA 2PTHA 1C14A 3D0QA 4QVKA 4IP0A 5IT4A 3TIIA 1OYYA 2X7HA 1L7NA 3SJBA 4G6ZA 2WFAA 2ZOSA 3UT5A 3QLEA 1UT5A 5FLEX 3HEMA 4MUMA 5HP4A 2HNAA 3G3EA 1SY7A 1U8YA 4WMLA 1DQYA 4ZT3A 3VH2A 3DKKA 3R3VA 4D9EA 3IHWA 5AVRA 3GJ0A 4NZZA 1PYGA 3ML1A 1AF7A 3MRVA 1X1DA 2PX6A 2MU1A 3W4KA 2ATVA 1MQ9A 4II2A 2X0RA 3HFSA 3HKEA 4MSUA 3TMAA 4BYGA 4DMFA 4K6CA 5HOQA 3GUZA 5IDVA 5KDOA 5F4ZA 4NR0A 1J06A 4DLSA 4YUAA 1L1QA 4G23A 5FJJA 3H1BA 4LQLA 1WMBA 1NAHA 3B9PA 1T5LA 1NUTA 2GBLC 3LY5A 3EIWA 3OZVA 2VDJA 1KQNA 2FFBA 3TTYA 1Y1KE 3THWB 3C16C 1EX6A 1X9IA 2EARA 2NO6A 3OAAA 4BIMA 5KYVA 2QROA 1BS1A 3GUVA 4UBKA 5T64A 1L7RA 4EHKA