3H2YA

Crystal structure of yqeh gtpase from bacillus anthracis with dgdp bound
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
313
structure length
309
Chain Sequence
DDDFLRILNGIGKSDALVVKIVDIFDFNGSWLPGLHRFVGNNKVLLVGNKADLIPKSVKHDKVKHWMRYSAKQLGLKPEDVFLISAAKGQGIAELADAIEYYRGGKDVYVVGCTNVGKSTFINRMIKEFSDETENVITTSHFPDLIDIPLDEESSLYDTPGIINHHQMAHYVGKQSLKLITPTKEIKPMVFQLNEEQTLFFSGLARFDYVSGGRRAFTCHFSNRLTIHRTKLEKADELYKNHAGDLLSPPTPEELENMPELVKYEFNIREPKTDVVFSGLGWVTVNEPGAKIVAHVPKGVSVSLRKSLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of YqeH GTPase from Bacillus anthracis with dGDP Bound
rcsb
source organism Bacillus anthracis str.
molecule tags Hydrolase
molecule keywords GTPase family protein
total genus 76
structure length 309
sequence length 313
ec nomenclature
pdb deposition date 2009-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3h2yA01
2H16A 4PX9A 1F5NA 1U99A 4M9QA 4EJSA 2FWRA 5JLJA 2N46A 1JEDA 1KI2A 2WV9A 4M2LA 3CPEA 3V4RA 5FL3A 3I5YA 3VQTA 4Q1DA 2YV5A 1PV4A 5DLQC 4BFXA 3THWA 1A2BA 2RB4A 1VYVA 2MSCB 2G0TA 5FL7A 2CE2X 3H1TA 1CRPA 4BFYA 1Z2CA 1AA9A 2OZEA 4KITB 4Q01A 2ZYWX 3LV8A 2OG2A 1MV5A 1QHSA 5DHAA 2FF7A 4QHSA 4CVNA 4LJ8A 5KDDA 4KHZA 1D8TA 2RGDA 1SXJC 3QUSA 2ZRJA 4Q7JB 1K5GA 2XOKD 5JWHA 5FTJA 3QEJA 2V8OA 1CRQA 2GXQA 3R8FA 3TIFA 1NY6A 3VU9B 3FKSA 2IYSA 1A7JA 3P4XA 3AKEA 4OQFA 5J4LA 4XTCS 4WZAE 2WAXA 3U7HB 2J0UA 4OJQA 4IOKA 5BQ5A 5BYJA 3A58B 2ZRIA 3MWLA 2ZRKA 2PX0A 2P2LA 1Z06A 1KMHB 2ZETA 3ZS9A 4B71A 3X1DA 3AVXA 2CCJA 3I73A 2OESA 2Q9AA 4BLPA 4CT4B 3FWYA 1HQYE 3ZD6A 4LHZA 1KJWA 2KB0A 4HZUA 1J8YF 1J8MF 4TQUS 2ZJOA 3SE0A 3RLFA 2O8FB 3B2EA 4YMWA 2FJUA 4DLXA 3OIUA 2J0VA 1JPJA 1HE1C 4GFDA 3TW4A 4PFSA 3ASYA 2XJ4A 2REXB 2ZE6A 2QG6A 3FMFA 3ZIAD 5CM8B 1XXHA 4MDFA 4DT1A 1E0KA 2GZHA 4JLAA 5LB2A 4G3XA 3TGPA 4F4CA 1T6NA 1NSTA 2A7QA 1J99A 4JMPA 3A1VA 1ZYUA 4ACAA 2I1QA 1X8JA 1BS1A 2UZIR 4FMBB 4LYJA 4OK5A 3EC2A 4X8LA 1TQ4A 1W2HA 2YWFA 3QENA 1ZUHA 1FP7A 3GLHB 4M9ZA 5JZVA 5BYKA 1Q1BA 2WWYA 4BGDA 3KQKA 2Z83A 3E2IA 1WDTA 2G88A 3SOPA 1OHHD 1X1RA 4Q47A 4A92A 2P0EA 1RYFA 3EARA 2IYQA 4D80A 5JHGB 3C4JA 3IBGA 4KAXA 4EDHA 5JEEA 1KZGB 3B1VA 1G7TA 3EWSA 1IAQA 4AK9A 3I8XA 2ZE8A 3GJ6A 4K8OA 3GEIA 4E07A 4DIEA 4NH0A 4FMDF 4QGFA 3KQUA 4MA4A 2NG1A 1GDDA 1OFUX 2BM0A 1JAHA 4EPRA 1FTSA 3CF2A 3GJ4A 2QSZA 4QG7A 3SFVA 4HAYA 4JVSB 5JMTA 1M74A 1NVUQ 3CWZA 4LJ4A 1NG9A 3CF0A 2LWIA 2J5XA 1Z08A 3GLGE 3O8CA 4C0SA 3U7GA 4J0QA 1TAGA 4ZCLA 4XWKA 3WNCA 2AXPA 4AKHA 2W6IA 1NLYA 4FN5A 3SHFA 3QF4B 1G5TA 3NC0C 1Z0IA 1Z07A 3GJ0A 3K0EA 4G1UC 3QEOA 1OYYA 2JLRA 5FFMA 2ZSDA 1HQCA 4Q4JB 3EZ2A 5JECA 121PA 3BH6A 3AKCA 1UKZA 4Q5IA 4C3ZA 3G0HA 2ZI6A 2RAPA 1DAIA 3AGQA 2A5DA 2FEOA 3MCAA 3OIVA 5K8UA 2W0MA 3CKLA 1GKYA 1N0UA 2QMUA 2ZRBA 1R0WA 2VEDA 3QPWA 3SYNA 2O8CA 2GJAA 1FQKA 1E2PA 1N6IA 5DNYB 4V0MA 1XTJA 2QRNA 3OEHD 2C5LA 1EFUA 2A30A 3Q3JB 3CNOA 1OYWA 3KJEA 5EP4A 1E1QD 4A9AA 1YR7A 1R0YA 5JFGA 1G19A 3UMSA 4PC3A 3CPHA 4CW7A 5FUVA 3BK7A 1NSFA 4FI3C 1QHNA 2JIZA 3DZDA 4OHXA 1GZSA 5FR1A 1YZGA 3THYB 3IHWA 2ZUDA 3AGPA 1Q20A 2NTYC 1CEEA 1LVGA 4R98A 3AP3A 3VU9A 4A0HA 3R9IA 1WRBA 4GDFA 2OFOA 1M6NA 4YMTA 3NBFA 2JLZA 4DDTA 1E94E 3LH5A 1NIPA 3KKQA 2ZR9A 4LPKA 2CMKA 3VR1A 5L8VA 1S4QA 3CH5A 3C14C 3CONA 1CIPA 1T3SA 4TMWA 3SYLA 4LC0A 1HEIA 1UFQA 1Z0KA 1N0VC 2C03A 3FFBA 2FGJA 2HCBA 3NTUA 1FUUA 2CJWB 3RWMB 5EE3A 3GFPA 2VHJA 2I4IA 2IK8A 2FG5A 4NONA 3BWDD 1N6KA 2AD1A 3WBJA 5C46F 2B8TA 4BFTA 2IF0A 2BEJA 1UBEA 1ZW6A 3RNLA 4S2EA 5E7JA 2VSOA 3FKQA 3BH7A 4OL0A 4JBYA 1W36C 1Q1EA 4DXAA 1BOFA 1IBRA 2GAOA 5EP1A 4B3GA 1CLUA 1XNJA 2WJVA 3BERA 3CO5A 2VSFA 2JJ2A 4EFNA 1CJMA 2NQ2C 4EPXA 5FBWB 2NO1A 2G83A 2R9VA 4H1VA 2YOGA 2Z43A 4A2PA 2W6ID 1CTQA 4DCTA 1MO3A 3PFIA 5AUNB 1WCV1 4QJ5A 2ATXA 2Q9BA 3PUWA 2H17A 1OJLA 4TL9A 1FNMA 3ZYCA 3ZVRA 5AR1A 2IX3A 3FPAA 5ANRB 1ZUNB 1G7SA 1D2EA 1P9NA 2P67A 3OFNA 3TJZA 3NBZC 3TR5A 4EJSB 2CJWA 2MSDB 1E9DA 3CPJB 4XVRA 1T3LA 2XTMA 1G18A 3ZDQA 3THXA 2KBEA 2ODWA 1IXSB 1HYQA 5E7MA 3SHWA 4DCVA 1VCNA 2XEXA 3KJHA 1SXJA 1Z5ZA 2C9OA 4LBZA 5E95A 4YMVA 3KFXA 1KO7A 1SVKA 821PA 1SVMA 4KODA 4MDEA 4KFRA 4DLYA 3OEHA 4MYCA 1W0KD 1JB1A 4DC9A 1E2IA 3ADCA 4OHYA 4AC9A 3K70D 3KTAB 4A0RA 4DLTA 4KBFA 2IHBA 2YOHA 3DO6A 1FQJA 5H8WA 1G5PA 4DSTA 3U60B 4NBSA 2HLDD 3IPYA 1NN5A 4JLNA 1N6NA 4HZUB 4UXIA 4AD8A 4NCHA 2XGJA 4A1FA 1DS6A 1AIPA 2DHRA 5CB6A 3CWQA 3SEAA 5FTLA 2GA8A 2ZRCA 4ZO4A 4US2R 5KPJA 2GWHA 3BRWD 2JASA 3C16C 3TE6A 4FMCF 3GLIB 5CYOA 1T9HA 3KQHA 4LI0A 3KKMA 1KDPA 4A2QA 1Q0UA 1W1WA 1JXOA 3NEYA 3G82C 4CT5A 1SKYB 3B13B 4TL7A 4FIDA 4ZI3A 4A8JA 1GITA 1SULA 1MABB 3IIMA 2AWOA 2VHUA 4NP6A 1WB9A 3T1VA 1UBFA 1SKYE 2VP0A 1Z0FA 2KSQA 1N6RA 2XZPA 3DVLA 4MRVA 3EXAA 2GF0A 3W6OA 1R8QA 2J45A 1E9SA 3L82B 1AZTA 3K09A 1R2QA 2FFQA 3FMPB 4P4TA 1IN8A 2RGGA 2IYZA 2PLRA 3UWKA 2ZANA 2RGAA 1W2GA 2O8EB 2J7PA 3TKLA 5J4VA 2FPLA 3VAAA 2PZEA 5KSZA 2CNWD 3QIAA 3H86A 4E5UA 1WXQA 4BQSA 1Z0AA 3CW2A 4QGAA 1NMZA 1FL9A 2W6JD 3B1YA 5CLLA 4C0QC 4OHWA 1W36D 2ZRPA 2ZSFA 1NY5A 4PHGA 1YZTA 5FH9A 2ZSAA 2GBLA 5FUYA 3H4MA 3U7EB 3W8NA 3HYTA 1UJ2A 3MJRA 5AJZA 1LF0A 4FINA 4XWOA 3ZVMA 1E2HA 3VX3A 4RFSA 2X1VA 2VH5R 3BIFA 2V6JA 4HAWA 3EIHA 4HUQB 3W5JA 2HT1A 2ZREA 2C9YA 3B1XA 3GFTA 1VCMA 2CLDX 2K5UA 3NDBB 1DELA 4TMKA 4ZKEA 5TDHA 5JHHB 4M1KA 1AGPA 2PBRA 4Q1FA 4M53A 4QBFA 4PHTA 5BWMA 3QG1A 1G4UR 4BZXA 4QC2A 2J41A 2JLQA 3D8BA 1WP9A 4NYMQ 5AJXA 5KUTA 5JI3E 4FCTA 1GAJA 1F2TB 3LXRA 1NBMD 3AUYA 5DE3A 3AVUA 3WMFA 3SZRA 1NJGA 1X3SA 3U4QB 1UKVY 4HB3A 1QHIA 4JSYA 2H57A 4EFMA 2YVUA 2BV3A 2VIIA 2GF9A 3ZVNA 1IJFA 4AKEA 1CU1A 3UMRA 3QE0A 2OBNA 5LPNA 3GJ3A 2H7VA 3EZ9A 1G3MA 4GBMA 4F92B 4AWXA 3ZVLA 3B1WA 1AS3A 1QDEA 3LDAA 1Q21A 3BS4A 1QHGA 3U5ZB 2OXRA 3TMKA 3HP1A 1WF3A 2W0SA 5AJWA 4GMXA 3F0TA 3W6PA 1OLOA 3DKVA 1KOFA 3DHWC 3JZAA 5IK2D 2XOKA 4L4UA 4DT1B 3LFUA 3OE7D 5EP3A 5FOWA 2VPPA 4EIWA 4BLRA 2ZVQX 1Q3HA 2FX3A 3O8RA 4HLQB 4OJKA 1BYIA 3IIJA 1ZIPA 5HE8A 5JRJA 2IS6A 4GOJA 3PUYA 1XZPA 2AD5A 2OCYC 4XWAA 4BWYA 2Q6TA 2E87A 1RJ9B 1VHTA 4DSNA 3KX2A 5C2JB 4R7ZA 1XPUA 4QGGA 4JYBA 2ZROA 3BGWA 4JYCA 1YU9A 4KBGA 4Q4AA 4IHQA 2A78A 3NHAA 4D0LB 2JATA 3RRMA 2AFIE 4DLVA 4ZIRB 1SKQA 3CRMA 3BJIC 2V54A 1U2RA 3DZ8A 1AK2A 1ZM2A 4LSGA 2C77A 4Q9LA 1G21E 2QBYB 3IILA 3CNNA 2AHOA 5AUPB 1C9KA 2R6FA 4LDJA 2AWNA 3ADDA 3OIWA 5DSZA 1PLLA 4GZMA 5IF9A 2D7CA 4QNRA 5FUWA 3CM0A 4JBWA 4TMVA 1YQTA 2QMEA 2TMKA 3NBYC 5AWFC 4Q4HA 3IKJA 1E79A 3EZ7A 1G3QA 4KVAA 4Z1MA 4OKSA 2OFXA 2ZJ5A 1VKJA 3H2YA 4I1OA 3ZLJA 1LS1A 3PEYA 3RANA 1UDXA 1JBKA 2FE4A 2C8VA 4MGKR 5F9FA 4LHXA 3DDCA 4TSFD 1OFHA 3K9LA 4QBHA 3B85A 521PA 4Q4LA 4XVUA 1EGAA 2BBTA 1TQDA 4NYMR 4FMDB 4E22A 1SVSA 3DMNA 4LGMA 2OO7A 1XMSA 4PC6A 4PQYA 4RKFA 4O0MA 1Z47A 4B32A 4M4SA 3VHLB 3T1OA 1KKMA 1JXMA 3KKNA 2BM1A 1JI0A 4TYNA 4K46A 2WWXA 5JRZA 3TUZC 3REGA 1KI8A 2QRZA 1GG2A 4RZ3A 4LPSA 4LV8B 4XSHA 1WMSA 1YKSA 4KO8A 4URUR 4ACBA 1E2LA 2OXCA 4ASUA 1OIXA 1G41A 5A5GA 4D4KA 1JR6A 3UK6A 4AKIA 2FFHA 4HZIA 4MKFA 1D5CA 4DCNA 4DKXA 1KO4A 3PUXA 4M1TA 1N5LA 2GXSA 2VL7A 3LY5A 4TZ6A 2VHTA 4PQRA 4YDHB 2C96A 2IXFA 4RJLA 3RS0A 3GLFA 2VHCA 2DFKB 4RFVA 3TR0A 1IM2A 1CR1A 5F2EA 1AN0A 1EX6A 1NN3A 2QQEA 3B82A 1QHHB 4A2WA 5EXPA 3HU3A 5IK2A 1Z29A 2C78A 4YMUA 3Q8XB 4B6FA 4D4JA 3K0CA 3BFVA 4TL6A 4JLMA 4LCBA 4JJKA 1M34E 4C4PA 1SVIA 1KI6B 3KL4A 4TLBA 2RHDA 1CULC 1CKEA 2R62A 2ZITA 5KNCA 3BBPA 1G64A 2FOLA 1EWRA 4NCJA 4EPVA 5SZHB 4TYWA 4GNKA 1G8PA 4XTRA 4AY2A 2ZTSA 3AF2A 3K0AA 3KXKA 2MSEB 4R2IA 4A8JC 5A0FA 1SXJE 3AVYA 5EP2A 1S1CA 5DGXA 2N1BA 3CLVA 3EPHA 4CEJA 4IJMA 1VTKA 4NPHA 4NCIA 2QM7A 3N70A 5EZ6B 5IHPA 1Z22A 4PO9A 1QF9A 1IY2A 1DOAA 2GCOA 3IBYA 1UM8A 1YHNA 3A1UA 4LJYA 4RFSB 3HR8A 1KAOA 3MWJA 4L5BA 2GZAA 1F6BA 3W8RA 4OQNA 3LRPA 1E1RD 5SZIA 1NN0A 3U3JA 4A15A 1E9RA 1KTVA 1P9WA 3ZZ0A 2XZLA 2HYDA 2GETA 4QXAA 1H8EA 1QHHA 2EVWX 1N6PA 4HDQB 1T8UA 1SVWA 3SN6A 4E03A 4NYJR 1Z83A 4ZDWA 5GJBA 2YKGA 5FTMA 3Q7PA 3MLEA 1RRFA 2RHMA 3AEZA 3W34A 1UPTA 2DPXA 3WYFA 2BC9A 2AL7A 2CXXA 4V0LA 4LYHA 1JJVA 1AS0A 1E96A 1ZNXA 2ZI5A 1OF1A 4I1UA 2QP9X 2F43B 2RGNA 3SFZA 2WKQA 2R6AA 4TYPA 1PLJA 2NZ8A 4JLJA 3IEUA 1OFTA 4DLWA 2YWEA 1RRGA 2OBMA 4ERNA 2JJ1A 3ZZTA 1A2KC 2YOFA 3KUDA 1A5TA 5E7IA 4CZ2A 4F91B 3LLMA 2V6IA 1U0JA 3VTKA 2ZS7A 4OI2A 4EPWA 4LHWA 5KSPA 1X6VA 5EE0A 2BIFA 2ZRGA 4JLVA 5DO9A 3VKHA 2VSXA 3O8DA 4IDQA 4D4LA 2ZJ8A 1IY0A 2NO9A 4GOKA 4PSKA 3UATA 1HTWA 2BMFA 3NDPA 2YYZA 4H1UA 2IXGA 1WBBA 2VYFA 1E99A 3IO3A 3TQCA 4EQ6B 1HT2E 5FPTA 4IDHA 1B23P 2O8EA 4GT1A 3DOEA 3CUEF 2WJYA 4LZZA 2Z4RA 1S9HA 3QXCA 2KI5A 1M7GA 4AKGA 1OW3B 1ZNWA 1RRCA 1X8KA 3X2SA 4U7DA 3SJZA 1XXHE 3K0SA 3SQWA 3FB4A 3IGFA 4RCZA 1DVRA 3OEEA 2B7BA 4YXWD 1MH1A 2QPTA 3AVVA 4AURA 1XPRA 4OK6A 3IUYA 2D2FA 3NVAA 2GCNA 3QKSA 2C98A 4V03A 5FPSA 4NZYA 4ITRC 5LD2C 1S8FA 4B2LA 3GLFB 1EFCA 2IWHA 3AKYA 3KXIA 3KDSE 2DWPA 4PC2A 2IHYA 3PEVA 4GMDA 4NTZA 2QZ4A 1L4UA 1KHTA 4LUCA 3C5HA 2OFWA 2QAGB 3JVVA 2QTHA 1Y63A 2GJ9A 2FSGA 3AVOA 1VCOA 1W4RA 1TU4A 1H65A 1HURA 2QPAA 4WBSA 4CRWB 3VFDA 3T12A 2CEAA 3QKSB 2WAYA 1E2NA 1OXVA 1ZD9A 1G3UA 4PQFA 4PZLA 1PUJA 3LA6A 5GADl 4US0R 2QUZA 5FUXA 4BFWA 2Q3FA 1NF3A 1XEWX 3V4FA 4DCUA 3B60A 1M1YE 1CR2A 2ZSEA 3U2QA 2FMXA 2GTPA 2OT3B 2ZJ2A 4DHEA 2IUSA 3RAPR 4NDZA 5FL7D 2GEUA 3K1JA 5DI3B 2O8FA 1TL7C 2JLYA 1HT1E 4IRUB 5J4KA 4NKRA 1IONA 4KSBA 1W44A 4BE7B 2RH5A 1YZKA 3Q72A 2A3RA 1KNXA 1FUKA 2YJTD 3QF7A 1OKKA 4TLCA 3JZMA 4M1SA 3I1FA 1MKYA 5EE9A 2FSHA 2ZJBA 3PITA 2G6BA 2I1VB 2C04A 4LJAA 5FOXA 3U3KA 4B6EA 621PA 1EG7A 1HE8B 2J0UB 2WMOB 4PPQA 4TT3D 1JQJC 2P6RA 4HUQA 3W5IA 1FMJA 1XEFA 2R65A 4ZDIA 5JSZB 2GDJA 3W3AA 2QAGA 3N5CA 5FR2A 1P6XA 2JDID 1AKEA 3ND9A 1SGWA 1DAEA 1H8HA 3QXSA 4XD7A 3GP8A 1P2TA 3U44A 2OAP1 1NVXQ 5D3QA 4R71A 3AQ4A 1XCMA 1W0JD 3PVSA 5L3QB 4PSAA 2JJ8A 4LJ7A 4D25A 1W4AA 4BEBA 2BBOA 1OH6A 3A8TA 1LFDB 1KY2A 4DLSA 2NPIA 2WWGA 3PIRA 4DDUA 2CDNA 3O47A 1E2FA 2UKDA 2A9KA 2WWFA 3QQ5A 4P4UA 3OEED 1Q3TA 1Z6AA 2OCAA 5A4JA 2QBYA 4EKDA 1D9XA 2OBLA 2ZU0C 1R7RA 2PZFA 5K8TA 4XJXA 1M7BA 1JECA 3CRQA 3SBEA 4OQXA 5DYGA 5ELXA 3QPUA 1FPMA 4E09A 2NO0A 3RABA 3BH0A 3K8YA 4IXMA 2VA8A 1LB1B 1Z6XA 2ZRHA 4WXPA 5BN4A 2J46A 2MMCA 1OHHA 2ZRAA 1XP8A 3GFOA 3BFXA 4QM7A 2J0QA 4O2LA 4KFSA 2XB4A 1IHUA 2IXEA 2IYRA 2VRWA 1G6HA 2PCJA 4EPTA 1P75A 2BWJA 3IQWA 4BZQA 1A4RA 2DR3A 5FOTA 4M22A 1MRNA 2ZXUA 3SNHA 2AXNA 3VR3A 3I3SR 4AYXA 1I2MA 4B3CA 3M0EA 4KLZA 3K9HA 4Z54A 1R5NA 1VG9B 3RC8A 5J47A 1VPLA 2QENA 3CBQA 2ODEA 3O8BA 4HAXA 2V7QA 1YZNA 2PT7A 2ORVA 1D6JA 4PPNA 3U6KA 1P62B 5TV2A 3REFA 2VO1A 4DLZA 3HU2A 4W5JA 1VIAA 4OI4A 2QSYA 4B3BA 4I99A 5GJCA 2KE5A 3ZS8A 3ZQJA 4Q4HB 4UKDA 3OE7A 3B9PA 1NMXA 3TVTA 4TT3A 3NKVA 1TTTA 3SR0A 1ETUA 3K70C 4QNMA 2WSSD 1JALA 1W4CA 1E0JA 4M21A 3U3MA 2CVFA 3FHOA 3EASA 1UEIA 1ONBA 4TLAA 3K9NA 4PO8A 1G1MA 3ND8A 4LWZA 2OEPA 4JL8A 4B34A 1RZ3A 2VLIA 3RRNA 2AKYA 1DBSA 1G4AE 4PR0A 1GSIA 4A36A 1MO4A 4DEXA 2BOVA 4KLNA 3BD9A 1J2JA 2ECKA 4JBXA 4TMZA 3PUVA 4DDWA 4TMXA 4Q7MB 2F1RA 1CR4A 2WHXA 1F2UA 1OXUA 1DAKA 2LKCA 2FA9A 3Q5EA 4JVNA 1F3OA 4YC7A 5H70A 1LS6A 3LLUA 2YC2C 1XTSA 2GVZC 2IYYA 4B2IA 2JIZD 3C8UA 5CYPA 2QMOA 2V55B 2CL0X 1PLKA 4LBVA 4BFZA 4UNQA 2R6CA 4G01B 3KTAA 4A6PA 1VYUA 1YVDA 2FPKA 3QG5A 4TL8A 1Y3AA 1ZD1A 4Z1MD 2OM2A 4XSGA 3NXSA 2JLVA 3KB1A 4LRWA 4POAA 1IN4A 3RC3A 5HKKA 4KXFB 4TSFA 3GLHA 2DFLA 4B48A 2GJSA 4URYR 1ESMA 1G17A 3PEUA 5AUQA 2N42A 1GOTA 4JLBA 1P2UA 2QEQA 4BFUA 1RRPA 3QBTA 4Q00A 1ZVQA 4V02A 3VMFA 1BMFD 5CK5A 3RWOA 2DB3A 1QVRA 3MJHA 2H8KA 2VBCA 2KJQA 1NP6A 4JLOA 4OI1A 4BFSA 3MD0A 4DSUA 4IOJA 3T06B 2PMKA 2QAGC 4TLDA 3NBXX 5B2ZA 1LV7A 3D3QA 3BFKA 1E2MA 1QHYA 3AB3A 3K0AB 1RC8A 1W7AA 1E2KA 1GRNA 5EE1A 5GVSA 1MO5A 4DLRA 1TU3A 1XX6A 3SU8A 1LY1A 1S96A 4A0GA 4V0NA 1GM5A 5GJWC 2GBLC 5E4FA 1ZINA 2CL7X 1ZRHA 5JJIA 4GSYA 5FOUA 5HCNA 5DISB 2B21A 5FOVA 2EYQA 5G40A 3X1XA 3EWAA 2Q3MA 5FBRB 4BZPA 3OIYA 1M8PA 1KO5A 4OI0A 5JI2E 1NVVQ 1LTQA 1OT3A 1NN1A 4P33A 3TNFA 3K0FB 1P4SA 2IC5A 3I62A 3I8SA 3OFND 2YNMA 2D4HA 5F3WB 3ZZUA 1G291 4BPBA 2E9SA 4W5HA 1W49A 2FV8A 3FHCB 1NRJB 5IT5A 4LV5B 2H92A 4Q4AB 2GK7A 1W5SA 3EA5A 4PO1A 421PA 1OH8A 3F8TA 2IS1A 2ZRDA 4FCVA 4HB2A 1KDRA 4C9BA 1GUAA 2F1JA 4CIDA 3KQNA 2YHSA 4IKEA 4IFBA 4PPGA 3GLGA 2PT5A 5FPHA 2B92A 4KVGA 2JAQA 1HY3A 1X86B 3RRYA 5M04A 3AVPA 1KMHA 1J7KA 1OSNA 3QSYA 3L8YA 2IF2A 4RY2A 3B5JA 1G8FA 4Q9JA 3W3ZB 3MMPA 2ERYA 4MUBA 4GL2A 1XMIA 4NCNA 3W6NA 1US8B 5L3SB 3T5GA 3UANA 4GRAA 1E1RA 3ZIAA 4S35A 1T4GA 1G8YA 2ZEJA 2GAAA 1XWIA 4OK3A 3RVBA 3WHKA 1N0WA 4Q02A 4LYAA 1H8ED 5AJYA 4EQ6A 4Q1BA 1D9ZA 2DWOA 2GEVA 4OYHA 1GFIA 4V0OA 3R7WA 1OXXK 3K9GA 2OV2A 4JKIA 4ABYA 1GNRA 3AVTA 2FU5C 1P2SA 1CXZA 4MITA 2G77B 1JR3E 1XF9A 2OHFA 2LKDA 2ZRFA 1C1YA 3HDTA 1LF5A 3QNUA 5CDFE 1KZ7B 4V0ME 3V9PA 4AIIA 3PG5A 3SJAA 5FTKA 1HV8A 1NJFA 3KXLA 2HUPA 5JJLA 1ZNYA 1XJ0A 1GL6A 1Z3IX 1VDZA 2JJ1D 2X19A 3KKOA 2J0SA 1TEXA 5DH9A 1ESNA 3LX8A 3T34A 3EZ6A 4B47A 2UVQA 1ELOA 4I1VA 5J5CA 4IXNA 2ZU6A 3SJCA 4CEHA 4V0KA 2HXYA 4P4SA 2CNWA 4LJ9A 4MYTA 1I4DD 1QG2A 1KI3A 2O8BA 4Q1EA 2O8BB 3BOSA 4PAMA 3LW8A 1PUIA 1E9CA 1R0ZA 2WJHA 5C4GB 4NU0A 4B74A 5JWRA 3I61A 2XXAB 1WQ1R 3U44B 3MAAC 2O0HA 3A1TA 3DM9B 1UEJA 4GOXA 4PAOA 3L0SA 3DKPA 1R8SA 3EAQA 1ZCAA 2QGZA 3GJXC 1MABA 5KDLA 4BLQA 1CF4A 2HF8A 1OFIA 1P61B 3DEFA 4R9UC 2ZJAA 2G3YA 2V1UA 2F6RA 3U3RA 1BH2A 3AF1A 4ESVA 1XJQA 2XXAA 4QHTA 1VECA 2EWVA 4Y0AA 3PUZA 2PLFA 2JCSA 2ATVA 4GI7A 2MMGA 2DFNA 1YRAA 4PHHA 3CRW1 4AYWA 3R9WA 1A82A 2NO6A 3Q85A 3W9YA 1SXJB 2HDNB 2ODNA 2A5GA 2F7SA 1VCIA 1F48A 2BVNA 2QP4A 5KSOA 3ASZA 5HE9A 2PEYA 1NMYA 5FPKA 2QT1A 4LJ5A 2RGNC 3F3YA 4QM6A 3DMDA 4ZCIA 5DI9A 2BMJA 2FSIA 3ONWA 1NBMA 4LX0A 4P0TA 3I72A 2REOA 1DE0A 3C15C 3HJNA 1ZUIA 2WIAA 5JS8A 4B75A 5FI0B 2GILA 2ZS9A 4TTPA 1NLZA 2CK3D 3OESA 3PR1A 4G5OA 1N5JA 4LHVA 4WVFA 2R6GA 5KNBA 1EK0A 3ADBA 5K8IA 1Q12A 2BCGY 4MRRA 3GLIA 4DCSA 1QRAA 1YZQA 3GLFE 4MRPA 4OHZA 1FOEB 2ONKA 2WTUA 3M6AA 2NIPA 2EWWA 1TADA 1KJYA 8OHMA 4IW3B 2ZPTX 1XD2A 1RKBA 1XRJA 3D31A 2WKPA 2WJJA 4C2TA 3CF6R 2CVHA 4C0JA 2VP5A 1KK0A 1OIWA 1OKKD 3LAWA 2DFTA 2HXSA 1TF5A 4HYYA 4LC1A 1AQYA 2GNOA 4HI0E 5JCPA 2QMHA 3D7MA 2RGCA 3RDPA 1Q57A 1T91A 3A36A 4EJSC 4IEEA 3THYA 2L0XA 4QHYA 2KBFA 3Q5DA 3AH8A 3AF3A 2G1JA 2IEYA 3LD9A 3E1SA 5SZJA 4MRNA 3ICQB 1T3HA 4M1YA 1SVOA 3TH5A 1XD9A 4D6PA 1TEVA 3CB4A 1OV4A 1SZPA 1ZM4A 2ZRLA 2O8DB 1TQ2A 1KNQA 1U98A 2P3SA 3MG9A 3A6PC 1KO1A 1QVAA 2B7CA 1XZQA 3BORA 4HAZA 4B35A 5CIWA 2XNDA 2C2HA 3QKTA 5KNDA 1I2DA 1GL7A 4L16A 5DI3A 5JCZA 4R2HA 3PEWA 4MQBA 2PMDA 2JJ2D 4FXPA 4UXJA 3WNDA 3T5DA 2G1KA 4RD3A 1EFRD 2XSZD 1XD8A 3TLXA 2IYLD 4P3YA 4RVCA 5G41A 4NYIQ 2WZQA 5KPDA 2E1RA 3C41J 4YLGA 4C7OB 1ZP6A 5D3MB 1E9FA 5EUMA 2D06A 2GESA 3WP0A 3P27A 3FGNA 3NC1C 4GPTA 3UG6A 4M0LA 4ILEA 2RGBA 2GCOB 2VHQA 2QM8A 4NCKA 1Q44A 4W9MC 2QTFA 1KK2A 5G3YA 1RE0A 3NH9A 1E4VA 1NL3A 4GZLA 5CB8A 4KFTA 3TVDA 2DBYA 4JSTA 2W2TA 3IEVA 2VF8A 5JWOA 1N6HA 2AN9A 2NOAA 2Z4SA 2ZUCA 3A4NA 3HR7A 1E9BA 1W4BA 5EXTA 2WOOA 1SXJD 3FHTA 4KSCA 1N6LA 1P9RA 1R10A 4LY6A 1TF2A 2BJWA 2J87A 1IQPA 1KO8A 4IDNA 3R8CA 3K09C 4MH0R 2J1LA 2VTKA 4N3NA 4WOPA 5IRCD 1Z2AA 3B9QA 4FWTA 3DPUA 2JLUA 1AS2A 1US8A 4UXHA 1SHZA 3VNVA 2Q21A 3WY9A 4HLUA 1NKSA 4M1OA 2WVJA 1EESA 4HAVA 5AK0A 1U9IC 1DARA 5H68A 2A5JA 5B58C 3AV0B 1E2QA 2CK3A 4XIGS 5TB5A 4LOAA 4ASUD 2ZI9A 4ARZB 3U61B 1BO6A 2EFCB 3ECCA 2WJIA 1SHKA 4YONB 1KI9A 3SC3A 1R5OA 1TNDA 3TUIC 4D4MA 5KOYA 3KQLA 1YR9A 4MGZR 4Q9KA 4B3DA 1FP6A 2ANBA 1Q1QA 4TLEA 1VYTA 3KFVA 1NBME 1Z6TA 5CITA 1N5KA 1MT0A 1X8LA 1W47A 1ZIOA 1OIVA 3ZQ6A 4L15A 2O8DA 1ZBDA 1YZLA 4C0BA 4KFUA 3BB3A 4X8MA 3EIEA 4AG5A 3M1IA 1M7HA 4QFMA 5J4HA 4D26A 3VR4A 1UADA 4G5QA 5EXSA 2GJKA 4A82A 2PH1A 2WSSA 4FWIB 5J40A 3FKSD 1VG1A 3DL0A 1J70A 3FE2A 1ANKA 5HZHA 1KGDA 4IDOA 2XTNA 1P3JA 3KB2A 4Q66C 1AJEA 1XMJA 4PXAA 3IIKA 2OE2A 3BB4A 3S1AB 2VP2A 3T35A 3RRZA 3AVQA 1E2JA 1XD2B 2DWQA 4EPYA 2GVDC 1RVDA 1KDOA 3VKGA 2XNDD 4LJ6A 3CNLA 1FX0A 4KCGA 4NYJQ 1M2OB 3FMOB 2W6JA 4PZYA 1E9EA 2XSZA 4F93B 1V43A 2G0NA 3CR8A 4YDSA 2W2XA 1CP2A 1J90A 2GEDA 2VP6A 5FBQB 1NKTA 1ZNZA 4JVMA 1QBKC 5FBVB 1T0HB 3Q7QA 4B43A 4TYYA 1P5ZB 2AX4A 1E2GA 2IYWA 1HA3A 4QGHA 4KYUA 3QVUA 2LCFA 4L9SA 3D6TB 3GEHA 5B64A 1CS4C 4TN1A 4PTLA 4C0HA 4G0NA 3FVQA 1HH4A 1UKEA 3AP2A 3A1SA 2D7DA 3FYHA 2EFGA 1MRSA 5C4MA 2CCKA 2QROA 4F4IA 1QHXA 4WIAA 1YRBA 2ZJZA 4N0EA 2OCBA 1P2VA 4QJ3A 1IXZA 1EFHA 3LW7A 2ZI3A 2X77A 1BMFA 1GL9B 5HR5A 4UQOA 3B6EA 4D82A 4A6XA 2GXUA 1YR6A 5LD2B 3ADKA 2AFHE 2IUTA 5JEDA 3IO5A 1G3RA 3FMIA 2ORWA 1W5TA 1C4OA 1IN7A 1ZD8A 2VQSA 1G16A 2OUKA 4RZUA 1FZQA 1U94A 4AYTA 1E98A 3KKPA 4TZ0A 2C95A 4OQMA 1XDBA 2UZ3A 3FTQA 2WBLC 3X1YA 4TQ9A 2PZGA 2NMVA 2BBSA 4PANA 2WPDA 1L8QA 4DB2A 3RS4A 1KSFX 3ZJYA 2WM9B 1KYIA 2FPMA 2R8RA 2QE7D 3HU1A 2H1LA 4QKQA 1G9XA 1E0SA 5JJKA 4AI6A 3LBIA 3VNUA 1U9IA 4WW0A 3QKUA 3EPLA 2NGRA 1VMAA 2HEIA 3V00A 2Z5FA 3LVRE 4MGIR 1DO2A 1KIMA 2GZDA 3EPJA 4YXWA 1E9AA 1GNQA 2A5FA 1RPZA 5DHFA 4JLDA 2FNAA 3SBDA 2QTVB 2PJRA 1R5BA 2HJVA 4A4DA 3GJ7A 1N2CE 2O52A 3X1ZA 5FTNA 2ZM5A 2FFAA 2H18A 3P1JA 4MKGA 4XVQA 2CBZA 4DWJA 1D2NA 4UJ3A 1EX7A 3H0KA 2QORA 3GQBA 721PA 2FEMA 2GKSA 1DADA 2CCGA 5GJVC 1T8TA 1QG4A 3T1TA 4NE2A 2W83A 2OSBA 2G9NA 2YZ2A 1E1QA 1SQ5A 2Q0HA 2ZSBA 3VR2A 3TW8B 4AG6A 6Q21A 2CLCX 1TPZA 2AK3A 2V1XA 4Q9HA 4Q4JA 3TSWA 1IN5A 2J9RA 2EFHB 3QXXA 4JKYA 4RSGA 3C5CA 4UNSA 3K0CC 4IOMA 2ZRMA 1E0AA 4URXR 2YWHA 1DG1G 5G3ZA 3UG7A 1T0JB 4PZZA 1AQUA 1O3YA 3LVQE 2JLWA 4B3XA 3EA0A 1JQLB 1XPOA 4CF7A 4PHFA 3EIQA 2ZS8A 4DVGA 5CJ2A 1Z63A 1Z6GA 2HV8A 5L3QA 3MUFA 1NG1A 3NEJA 1R6BX 1KI6A 5FPYA 2Z6VA 5SZKB 3WMGA 5C18A 3RSLA 4D0NA 4FD2A 4P4SB 1UBGA 1VHLA 2QL6A 3UIEA 3CH4B 5DYIA 1XMVA 3PQCA 3UKDA 2QP3A 3PJRA 1ZCBA 3A4LA 5C1BA 5CDFA 3K53A 3U6BA 1DEKA 2A2ZA 4BUJA 2CHQA 3HPQA 4ZI2A 3VR5A 1G6OA 2JDIA 1G3IA 3QY0A 4XD7D 1D2MA 2D74A 3T61A 4DSOA 3QF4A 4D0GA 4ZV4A 2ZI4A 4D81A 1LNZA 4RD2A 3QKRA 4B2PA 3OAAD 4Y0VA 4ZKDA 3JVUA 4MUAA 3SYKA 1IOZA 1ZM9A 2OILA 2YC4C 3ICEA 2QE7A 3AM1A 4U5XA 3T1QA 5HCIA 2OLJA 1U81A 5EZ5A 5LDDC 3LQRA 2IL1A 1CBUA 1II0A 2IYVA 3TRFA 4Q18A 2ZYUX 2ZQ5A 4WZ6A 1AM4D 2AR7A 1RIFA 2BDTA 2IT1A 2XZOA 1XCGB 5DIFA 3UWOA 4PC1A 1KMQA 2FDCA 4URWR 2FSFA 5JSZA 4C7OA 1S0UA 5JS7A 1JR3D 1ODFA 4QOSA 1II9A 3P4YA 3KJGA 5CIQA 3MRSA 1U0HC 4LBWA 1S1MA 1TX4B 4IVRA 2F9LA 4P32A 3LBNA 3P26A 2X8AA 1UAAA 2BEKA 4O2RA 2O0JA 4TWZA 1W0KA 1P7CA 2F1HA 1V5WA 1GTVA 3L0OA 1R4AA 4U00A 1KI1A 3EW9A 5IDVA 3SS8A 4BFVA 1DAFA 3B1ZA 3R20A 1S9DA 5LB4A 5CLQA 3BXZA 2GCPA 2ERXA 3GCGA 1DPFA 4DEYA 3B7GA 4C0KA 4KU4A 5DN6A 1GILA 2BKUA 2CE7A 4M9XA 4MGYR 4NYIR 2HYIC 3VR6A 4N1AA 5L3RA 2O0KA 2ZR7A 3TQFA 3I5XA 3L8ZA 2F43A 2NO7A 2HJGA 4KJZA 3RSOA 3QKRB 4M1WA 3NHBA 1LW7A 2XNSA 3I32A 1YZUA 1GRQA 4RD1A 1PZNA 2QPOA 2W58A 4UJ5A 1JPNA 4O3MA 1EWQA 4EUNA 1OXTA 2F1IA 1L2TA 1E6CA 5K8LA 2GXAA 3GLIE 1GKUB 2ZE7A 2F9MA 1KKLA 3QI2A 1E32A 4F4JA 2QNRA 1KK3A 1U0LA 4KV9A 1K6MA 2Q3HA 2JLSA 4KYIB 3AUXA 4IEIA 2HT6A 5J4YA 1N25A 2XJ9A 4XH9B 2ZRNA 2GJ8A 4URVR 1GNPA 3MWKA 4JLKA 4CYMA 2KWIA 1JEEA 4I1SA 2ZI7A 4ZDKA 1G7CA 3L43A 5KU1A 2WSMA 1DTSA 4ZDJA 2RMKA 3L2OB 2IUUA 1B0UA 1DAGA 2OCPA 4IOLA 1MR3F 4TTRA 1TUEA 2FFBA 3P20A 1YE8A 5KHOC 4JL5A 1KI7A 4MKIA 1RYHA 4PAQA 1NVVR 2Q9CA 3C7KA 3ETLA 3WHLA 4HLDA 3QJYA 4M1MA 2F3RA 4JT2A 3SDZA 4GP6A 4F7WA 3THWB 3R9XA 1Q22A 3TAHA 3QOFA 1CJVC 1EFRA 2SHKA 5TY0A 1JAIA 2WWIA 3E70C 4PPFA 221PA 2IBMA 3U4QA 2YINC 4NL4H 4DJTA 3QXHA 1IN6A 4BLOA 1FTNA 2CLSA 1KJZA 4HATA 2RGEA 5EUQB 2JEOA 2GHIA 3TUJC 3MFYA 1X1SA 2B6HA 1COWA 2RCNA 4DLUA 1GP2A 3LNCA 1TQ6A 2WOJA 3DOFA 1II8A 1JJ7A 1L7VC 4DZZA 2WWHA 1F60A 3AP1A 1VG8A 3PXGA 1E69A 1JR3A 1IY1A 3RS3A 3RS5A 2RKOA 1E2DA 4DRZA 3FOZA 3U3OA 3GPLA 3LX5A 3M4YA 4NMMA 5KSYA 1AGRA 4ZCMA 5B57C 4DUGD 4ARZA 2PJZA 1EXMA 3NIBA 1CJUC 2PCLA 1VG0B 4OBEA 1U90A 1XTIA 2QU8A 2ANCA 3X1WA 4BECA 2I3BA 1G5RA 3A37A 1OE0A 1P60A 3BE4A 4BEJA 2P65A 2ZYVX 4QRHA 5KTYA 1HUQA 1ZC4A 2D62A 1NLFA 2WIBA 1Z6YA 2REBA 4XOIA 3CIOA 4UNRA 4MKHA 1Z0JA 4II7A 4B3FX 3QBVA 2DCUA 1ZAKA 4LHYA 4CEJB 1F2TA 2WKRA 2ODBA 4BLSA 5F9HA 1YJ5A 5DN6D 4X8OA 1K8RA 2BJVA 3PV0A 4P31A 2ZAOA 2EFEB 5BXQC 1FX0B 3MGCA 1Z0DA 4JJZA 5HTKA 4UNNA 2FZLA 3E5HA 4HDCA 1N3BA 2XB2A 3CRRA 2J59A 5AJVB 4CEIB 1OB5A 1K5DA 4JZKA 4UNPA 4B44A 2VP4A 2F3TA 2JGNA 4HLUC 1RFLA 4Q7KA 3NH6A 4LYFA 1R0XA 1AKYA 4PSVA 4H9GA 4BLTA 3L0PA 4HB4A 1KAGA 4HLCA 1OH7A 2NPFA 4FMCB 1IXRC 5G53C 3LXXA 2JLXA 2V3CC 4Q9IA 2FH5B 4GP7A 4EAQA 2EQBA 4G5GA 3WBKA 2IW3A 5EJEA 4CEIA 4CDGA 4OHVA 1P73A 3RS2A 1KSJA 2R6DA 2XAUA 5CM9C 1FW6A 1W36B 5LBIA 3HWSA 4EFLA 3TK1A 3BC1A 1UDWA 3KUCA 2V4ZA 5BN5A 1KI4A 3MWYW 1FFHA 1KSGA 1W0JA 5EE5B 4HAUA 2EW1A 2IA5A 3GD7A 3PENA 3VKWA 2GK6A 1N5IA 2P5SA 4B73A 5KYKA 4FW9A 2PL3A 3QVVA 3FFAA 4PC7A 4TQAA 4U02A 5CJPA 2BCJQ 2R44A 2QAJA 2ZVPX 5KDOA 4HSEA 4WXRA 1WBDA 5KO2A 2C9CA 3UMFA 2PEZA 3BB1A 2W00A 4OQLA 2XITA 1S2MA 1IJEA 1E79D 1COWD 1I4TD 3TBKA 3GMTA 4HDOB 2ZUBA 1DAHA 3EG5A 1WE2A 4HEJA 4Z51A 1G20E 5BW8A 4Z8XA 2Z0MA 2IYTA 4M8NE 3VX4A 3WYAA 4US1R 3AKDA 4M9SA 3QXJA 2ZIAA 5EXXA 3UPUA 1MO6A 2QY9A 4I4LA 2ZJYA 1JNYA 3TSZA 4DUGA 4KI0A 2C99A 5TARA 3UXMA 1MOZA 2ORIA 4W7SA 2QI9C 1OH5A 3THOA 4LBYA 2J7KA 2B8WA 3CZPA 4DB4A 2ONJA 4IFEA 1XU4A 5P21A 4QJ4A 3EC1A 1NNEA 1KK1A 3CR7A 2JA1A 4DDVA 4BRUA 1GVNB 4WA7A 2HF9A 2EU8A 3N2IA 5FBLB 1UBCA 4IDPA 4JIMA 1NIJA 3WRYC 2XX3A 1BIFA 1H8HD 2QT0A 1PVOA 1FNNA 1OPXA 5TVKA 2WWWA 3LO5A 5TXGA 1OB2A 5FOSA 1E4YA 2OLKA 2X2EA 1FMLA 4FCWA 4RCYA 5L3VA 1DAMA 2BHRA 1XJCA 2P6NA 4G5SA 4QL3A 1CJTC 3R7WB 2V7QD 4RD6A 5FI1B 3RYTC 3VHXA 1BKDR 1CJKC 2BKEA 2WPDD 2J3EA 1T5LA 2FZ4A 4Q21A 2BBWA 3U7FB 1TF7A 1I4LD 1PJRA 1OXSC 1TUIA 1ZM3A 1XEXA 4C0AC 4CGZA 3P32A 1N6OA 3RHFA 2ZE5A 1DG3A 4Q1CA 4JS0A 3T15A 1P72A 3WRXC 3QPVA 4JVLA 1RJ9A 3NWJA 2CL6X 1NI3A 3KJIA 4WZBE 4ON9A 3MSXA 3K0FA 5EQTA 4RZXA 4C30A 1W48A 2EYUA 2Y8EA 2YWGA 3LBHA 3A4MA 1Z28A 1F2UB 1ZU4A 1WA5A 3DM5A 4URZR 5D3MA 1ZJ6A 3A1WA 3Q9LA 5H1YA 2WMNB 4C0LA 2CHGA 2P6UA 4RD0A 1A1VA 3W90A 3SI7A 4ZIRA 4WAUA 3GJ5A 1GKIA 5TMPA 2F55A 1QZXA 2QGNA 3IDQA 1XBTA 2FGKA 4MYUA 4RKEA 2ZR0A 4DIDA 1G8HA 4K81B 1AZSC 4C2UA 3GLHE 2CHVA 4B33A 1XEWY 4MYHA 4Q19A 5E3HA 4JT4A 3BAFA 3F5FA 4IVQA 1UKYA 2BMEA 3K70B 1GIAA 4QBGB 1ZM7A 2HLDA 4MRSA 2IS2A 4N0DA 5L3SA 3WP1B 1XEXB 2VF7A 3OF5A 2D2EA 3IQXA 2DY1A 2IYXA 4A0FA 1EFTA 1CR0A 5BN3A 2EFDB 2W2VA 5JBQA 3WNBA 5HPYB 1RW4A 4LK2A 3RS7A 4TTQA 1Q1ZA 1G8GA 4L8GA 3J81k 4ESHA 3CX7A 3LWNA 3TAUA 1U8ZA 2O5VA 2VP9A 4IVPA 1XFAA 3G5UA 3CX6A 3THXB 2NZJA 3FDIA 3LQQA 1GWNA 2WICA 1DO0A 1ZMXA 1ZU5A 1U8YA 1S3SA 3EX7C 1XCPA 2ZYTX 4JL6A 3H84A 3AVWA 3B78A 2QA5A 4D2IA 1S3GA 5AUOB 5GVRA 4X8HA 4DBLC 3ZH9B 4Q48A 1XB2A 4RD4A 4LV6A 2AK2A 3GLGB 3ZGXA 2D3WA 1KY3A 2A5YB 2R2AA 4G5RA 4YMSA 1SVLA 2J7PD 3WXMA 4YQFA 2P5TB 4Z8YA 3WMEA 1KDTA 1Z8FA 4TMTA 3CX8A 1ZC3A 4W5WA 1GRRA 2O8CB 4O25A 1O87A 3KZ1E 3OAAA 3S1AA 1VIYA 1YR8A 3PCRB 4BRWA 2V9PA 3HYRA 1XTQA 1TMKA 3L0IB 3IPXA 3N2EA 2ZAMA 3CRVA 1KSHA 2DYKA 3GJ8A 2IEZA 1T5IA 1W46A 4NHOA 4Q03A 1NVWQ 3EPKA 1U8AA 2QQ0A 4L9WA 4HB0A 4Q1AA 2IWRA 3TSOA 3AF4A 3ZD7A 2AKAB 4QBIA 3SQXA 2HCJB 3I4LA 4A8JB 3OZXA 4Q7LA 1G7RA 3NG1A 4TYQA 1UF9A 1E3MA 3AF0A 2QN6A 3GEEA 2PX3A 2OAQ1 3IHLA 5HZKA 1BYUA 2RGXA 2FN4A 5HKKD 4RZ2A 3I92A 4F38A 2XTZA 1XTKA 5UKDA 2X2FA 2WJGA 5CK4A 4HUTA 5B30A 3SJBA 1E2EA 4BASA 4B76A 2IYUA 3HPRA 2GRJA 2ASEA 1II8B 4I81A 3WYGA 1XTRA 1XXHB 5F98A 3CZQA 3OHMA 3EZFA 4JLPA 4ZPXA 2IS4A 2H5EA 3B8HA 2BMDA 1L4YA 4CEHB
chains in the Genus database with same CATH superfamily
4NMXB 1U99A 2Q5OA 1U2ZA 3MTQA 2H6EA 1V8BA 2WU8A 4FR5A 3M3DA 1XFDA 2QJWA 4PLPA 1H4VB 3L7NA 3PX2A 1T8WA 1EB8A 3JASA 3JRNA 4M2LA 3WL5A 1VPWA 2PQ2A 5FPQA 1XTPA 2VP3A 2XCTB 1B2LA 4IHJA 4OY3A 1XEAA 1CZNA 2VJPA 4WLNA 3DMFA 3VQTA 2ID9A 2WSBA 5DLQC 5KIAA 2CHEA 2RB4A 2BFFA 2JFOA 1L1QA 2MSCB 3I01A 4RA9B 4Z86A 5E2BA 1CUFA 2ZOSA 1Z2CA 1PL7A 5D7BA 2REQB 2ZYWX 2E5LB 1QHSA 1ZESA 5DHAA 1CY7A 4KHZA 3SQOA 1GHTA 1D8TA 3ET4A 3QUSA 1G2PA 3S7ZA 2ZRJA 2PR2A 5LCXA 4C6SA 4JYAB 1GU1A 1K5GA 4Q3AA 4OOFA 4QGBA 5BO5A 5JWHA 1GGMA 3FVRA 3WISA 2WP0A 4HD8A 2YASA 3QEJA 2CFTA 2EJTA 3BL6A 2J4FA 4MULA 5FI3A 1VJRA 3K7EA 4I0WB 4PLWA 1H85A 2C0CA 1U7PA 2HDHA 3VU9B 1GYQA 2OC9A 3W3AD 3V2UA 2NSHA 1VKRA 1G98A 4IDFA 3M33A 1W6RA 2XQFA 1YKGA 2FVYA 1Z13A 1Z7YA 4XTCS 4L7QA 4AJNA 5I47A 2AW3A 4HQKA 1IQ0A 2RD2A 2A4KA 2J0UA 5TX7A 4CL8A 5HW0A 3NHUA 3S5UA 3QLVA 2ZRKA 5J63A 1KMHB 2ZETA 5AKZA 3ZXIA 3H2SA 2WU4A 5JD3A 5A05A 5JC1A 3ISTA 4HH3C 1L6RA 2CCJA 3I73A 4GBJA 4HZUA 2KB0A 1YRWA 1RWBA 2EWMA 2GBFA 2QVBA 3SE0A 3UTCA 4RF5A 2LGJA 3IVCA 5E2IA 2JHCA 5H16A 4YS6A 4QLOA 2FJUA 3W4JA 4J0HA 4LNUB 1JPJA 3E84A 4LVNA 3V8EA 4AY4A 4IG9A 3MOIA 2Z3ZA 4J8PA 2P2CA 1RVV1 3ASYA 3IC5A 3G17A 3JQ7B 2ZE6A 1SIUA 1IBCA 1P44A 3ND6A 5IW8A 4UPEA 1PJCA 2TS1A 2HBZA 2Y1XA 4JLAA 5LB2A 4WLUA 4DR7B 4ZJZA 1YL7A 4JMPA 4OQDA 1EA7A 2FFRA 3NOXA 4OD0A 4BV8A 2AT1A 3FPSA 1T8PA 3QYJA 4FMBB 3M6VA 4LYJA 3I9KA 4XUDA 1LI5A 4GEGA 3GRRA 5FLYA 5FF9A 5EHIA 1JLMA 3O2JA 4NZZA 5JZVA 2KW5A 5BYKA 5MHTA 1ZN2A 4BGDA 3P0JA 5HWSA 4UUPA 3KQKA 5HRUA 1X87A 1WDTA 2G88A 3WK4A 1DKLA 1ZUWA 5I9MA 3SOPA 1DTEA 3SR3A 1LNSA 4AJPA 1VI5A 1KAEA 1N1EA 1ZH4A 1MG0A 1BJTA 3IBGA 2Q6OA 4H1HA 2J6CA 3D8SA 3IE2A 5ALHA 5JEEA 3B1VA 3EWSA 3M2TA 3T4PA 2BZGA 1CUWA 1BDMA 5LQMA 2JIBA 5F5NA 2VK1A 2C4UA 3PHBE 4COOA 3G9XA 1XXLA 4GYWA 4NV3A 4EPRA 2IQIA 3KHSA 2WKSA 1FTSA 4QG7A 3G9TA 2R4UA 4HAYA 3H5NA 2X4LA 1M74A 4J43A 1Y3FE 4LJ4A 4HYTA 3CF0A 1TZBA 1OWPA 2LWIA 2YL2A 3H1PA 3M4NA 2W22A 4RIIA 5E6UB 4FFVA 3GLGE 4C0SA 3U7GA 2AZDA 1V7PC 3AHIA 4GQBA 4HWKA 4BYGA 4XWKA 3OIGA 3PXUA 3UMMA 2J08A 2PRSA 1HOXA 3CYFA 3KQQA 1OROA 3QF4B 2C9DA 4FN5A 5F5XA 1G5TA 3VZQA 4ATNA 1Z6QA 1ZZGA 2D1TA 1WLSA 2EBFX 3RIHA 5KX5B 4HFJA 3X43A 2V7GA 4CDNA 2H0RA 4F8JA 4C4RA 1CQZA 2JLRA 2IOQA 1OZFA 2ZSDA 4RACA 2JIRA 4B4KA 1K97A 1Q3KA 2I67A 4FJ0A 4DFDA 5JECA 1N5OX 3BH6A 3FSEA 3AKCA 4C3ZA 3QVMA 2ZI6A 3F6YA 5KMGB 1DAIA 1V95A 2A5DA 4N3GA 5LQUA 1M33A 4M54A 4EB6B 3OKAA 1JFFB 3CKLA 4CM6A 3WYDA 1WVIA 2PN1A 5B1DA 3SYNA 1R0WA 2VEDA 2O8CA 1KHHA 3SE7A 4NAHA 4M9CA 4JXKA 4QA9A 3G2QA 5AW5A 2W6QA 3EQ2A 2H2HA 1BXKA 2QNIA 4E5SA 2A30A 1M83A 3L6DA 5AVYA 1OYWA 2G7ZA 1V9CA 3JZFA 3VNAA 1YR7A 4UULA 1U2TA 5CVTA 1K1EA 1IFXA 3JQFC 4DXDA 4D3FA 4X65B 2G67A 1GGFA 4UFPA 3CPHA 3BK7A 1BJRE 3LC2O 1RWQA 1NSFA 3PQFA 4ISCA 2JIZA 3IOBA 4IS2A 4EB3A 1DCFA 3MD9A 3MM4A 3DH0A 2G04A 5F2NA 3AGPA 1FFAA 1Q20A 1VE7A 3RVKA 3ZE6A 3DO5A 4EB8A 1CEEA 2O3RA 1Z8HA 4FHCA 4DMKA 7ABPA 1A8IA 1C7FA 3V46A 3WR5A 1J1IA 4S24A 1K0FA 5AIAA 3RQIA 4RQUA 5HTOA 2J07A 1O08A 4LQ4A 4DDTA 2JLZA 3MILA 5IBRA 4INOA 1JEYA 5JAIA 4WZBA 4CDRA 4O4LA 3VR1A 3W6UA 2CMKA 5AW0A 3FNFA 4JCOA 2RAVA 4IEFB 1IZ0A 1R8JA 3CONA 3HE3A 1T3SA 3SYLA 1KVTA 4TMWA 2FSVC 2PM8A 1WNTA 1HEIA 4RS4A 1UFQA 1Z0KA 4MQLA 1U7ZA 2C03A 3BXEA 3BWCA 1L7EA 3HWX1 1D7AA 2QVXX 3D6NB 2H1HA 1CC1S 3RWMB 1DGQA 2O9JA 5ADVA 2I4IA 2J3MA 4LIPD 2O2YA 4NONA 3BGVA 5AOBA 4JXXA 4MLDA 1QF7A 2C3UA 2Q4OA 3HJUA 1SCAA 4UEOA 4M8LA 2RH4A 3QTBA 1UDAA 1OBOA 3TW0A 4AX4A 4CM4B 5JARA 5FWYB 1I10A 1N0HA 3IDFA 3T0FA 1PYOA 3RNLA 2RI6A 1T4CB 2PUTA 2VSOA 3NBMA 2QN3A 5IEBA 5M2QA 4EY8A 2B2CA 1XZBA 2V45A 2ZIEA 3BH7A 1RMYA 3FYUC 5ALNA 3S81A 4YRLA 5EG5A 1TZJA 1EIWA 4JOSA 2M6SA 4G9BA 3VSCA 4UTOA 1PSWA 2GAOA 1YGYA 2OVFA 5EP1A 1Y3HA 1H3NA 1NVBA 1Z34A 1ZK4A 5IAOA 3BERA 3CO5A 2VSFA 2V4UA 3BM5A 3I1YA 2C97A 3HZRA 4OGWA 5AVOA 1XK7A 1P7WA 5FBWB 2WV7A 3D81A 3L4BC 3B3JA 2R9VA 5CT6A 2YOGA 3RAGA 3GVCA 2Z43A 4BKRA 2W6ID 1CTQA 1ZA1A 3L6UA 1B74A 1WL8A 4QQKA 3NKFA 4O8ZA 3A9UA 2I65A 3PFIA 3JQRA 4FBGA 5LP6A 3BVPA 1T0BA 1YBHA 3ZVRA 4C2BA 2WMYA 2LVBA 2ZUUA 3FPAA 3GLUA 1EG2A 4D96A 1HDYA 1U2QA 3NTQA 4RTPA 1P4HA 3C24A 2IH4A 2C88A 3FY4A 3AFIA 3O82A 4YACA 3ZI0A 5IVPA 4GMHA 3TLZA 2MSDB 5IT0A 3CPJB 3DR3A 1RABA 1UQTA 4XVRA 3QH4A 2XUIA 1QTRA 5CPFA 3EGDB 3R7AA 4FDUA 6ADHA 1SUEA 3ABSB 4JMLA 4DCJA 2X0IA 3IHTA 2HU5A 5E95A 4DTCA 2MR5A 2Z8YA 1ZWKA 3EVTA 4Y30A 1KYYA 3QX3A 4R0MA 4QU9A 2WNSA 2MYTA 4MDEA 1CG6A 3DOIA 1V1MB 3PI7A 3ADCA 4DC9A 1EM6A 3ETJA 1P80A 1W2WB 4GKAA 4O5AA 4RV4A 2BGTA 2EGUA 5FORA 5B1EA 2ZM6B 5A4AA 1DIRA 4DLTA 3IDOA 3UBTA 4X7RA 3L0DA 4GKJB 3BULA 3E5NA 3J81A 5E1BA 3HL0A 1KP3A 4YCCA 5H8WA 1FVOA 5B7NA 1G5PA 1WS6A 4NBSA 4U9UA 1TT7A 2HLDD 2LCQA 3FJOA 4MCIA 1W1UA 1D04A 3NOQA 3QGMA 3TCNA 2E4XA 2JBAB 1N6NA 4JLNA 4S05A 2HJWA 3OX2A 3WO1A 4AD8A 5DNEA 4XCVA 2XGJA 5FTLA 2B3DA 1G2QA 3G5TA 3CWQA 3RB8A 4ND5A 4PRKA 1QJ4A 3K2IA 1HTTA 2ZRCA 1DEAA 3Q3EA 4L22A 1RRVA 4DDMA 4US2R 3ZX4A 3HCRA 3P5SA 3L0CA 4YJ2B 4A91A 2X3YA 3C16C 3LHKA 3LUPA 1MIOB 1OCEA 2YIMA 1T9HA 3JQQA 1V4BA 4F2WA 1A7KA 1YQGA 3SZGA 4LI0A 2G5GX 4O2AA 1I30A 1ODCA 2E4ZA 2Q1WA 2ZQYA 2OBFA 3C70A 4Y98A 4IJ5A 1W1WA 2CZCA 3NEYA 1A2OA 3MRXA 1EUYA 4WDQA 4P9NA 1O54A 1IOVA 1MXFA 4HGQA 4IGKA 2LXNA 4DJJA 5EY5B 2PUCA 2ZYGA 3KDAA 4MV5A 3T52A 3TFQA 5ILOA 2IZ5A 2HWYA 3IIMA 1JVNA 4NNOA 2XZPA 1SKYE 3G2JA 4JQOA 1N6RA 4RMNA 2BM8A 3MS4A 2X0FA 3SXUB 3IQHX 1ZR4A 3Q12A 2W2QA 2YY5A 2PGIA 2WVAA 1KOJA 3WDLA 5FPPA 3WLIA 4HGPA 1AZTA 2NSLA 4GPD1 3S55A 5DW3A 1U02A 2BSAA 5C1DA 5JCOC 3T5MA 3A1NA 3FMPB 3TD9A 3PEFA 3TIGA 1LXCA 2RGGA 3UWKA 4ALMA 3UJNA 3H04A 1W2GA 1JQBA 4MI9A 4A7PA 1VLMA 2JCBA 4AXXA 2WUDA 3TKLA 5AM1A 3VAAA 1SZJG 2PZEA 3R2JA 2ODAA 4OYRA 3AR8A 5DNAA 4AUNA 1Q2XA 1WXQA 5EYPA 2FR8A 1RKVA 1Z0AA 4N3CA 1DP4A 1MD9A 5I8PA 4U2FA 4TGLA 1H4SA 1T5HX 1C81A 4H0FA 2C2OA 4DV5B 3B1YA 2OFFA 1WV0A 4OHWA 4NS4A 4EL0A 4MRMB 3VVLA 3GT3A 2PUDA 1CHNA 1J8DA 5T67A 3UKJA 3WWDA 3BBLA 1NPYA 3ICVA 3PD7A 1F5SA 1DJMA 2Q6VA 4IQ0A 4O2BA 4RABA 1LX7A 1E2HA 3VX3A 5KVSA 2FW9A 1IBKB 3TX6A 2Q07A 4QOFA 4JGGA 4HXGA 1WG8A 5CW2A 3EIHA 1QPZA 4CKZA 4JNCA 2CLDX 2BGIA 1B4DA 4KE8A 4K7JA 3NDBB 4IDAA 4NPAA 5JMWA 4ZKEA 3E82A 3TYXA 5JHHB 4NG4A 2DQKA 3TTSA 4Q1FA 4BEVA 2ZCJA 4M53A 3ZE8A 4N5IX 2DWUA 3OPYA 2VK4A 3BA1A 3Q15C 2QN1A 5CLFA 5CDHA 1M10A 3PIIA 2E4UA 4OM7A 1G4UR 1TM1E 1LBSA 1AB6A 4XQEA 3I6YA 4QC2A 4YRFA 3UA3A 3VPCA 4NYMQ 4GPBA 1Q77A 1QYCA 5KUTA 5JI3E 3RC2A 4F12A 1GAJA 1SXHA 2CLIB 1XRQA 2JAOA 2H2FA 3GV0A 3MF4A 5T41A 3HUUA 3TJMA 3LT1A 1NJGA 1SBNE 3ICCA 3FUTA 1R4MB 1MB0A 3AU9A 4U7GA 1S7CA 2VZ0A 5AO9A 3RASA 2HPAA 3JR3A 4MXDA 5HFJA 3CLTC 3P9RA 1JMVA 5AXBA 3ACBA 3OZDA 1PBTA 3P0EA 2OKCA 4HV4A 3H5AA 2O3QA 3ZVNA 4MW2A 4G84A 2QRMA 4LGVA 2EDCA 4NJMA 1XSEA 3FBGA 1YJBA 3B36A 5F1PA 3UA4A 5KYXA 3UMRA 4O4HB 1S8OA 1J22A 2OBNA 2LUOA 2XAAA 2H7VA 3EZ9A 2K2WA 3GJ3A 4R8MA 4QPPA 5DTRA 1WF6A 2PWBA 3ZVLA 4M55A 1FTGA 2Q4DA 4AWXA 3KUKA 1NUSA 1QDEA 1EI9A 3IT2A 1GARA 2W0SA 3KR1A 3Q2IA 2IIPA 4TKVB 1OLOA 1UAGA 1GGHA 1ZCZA 3DKVA 1O0CA 4N7RA 2XPCA 1ULTA 4QTUB 3VHQA 3EDQA 1KOFA 3DHWC 3ZDYB 4AURA 1D7OA 1AQ6A 3LFUA 4DLPA 2GDZA 2OCGA 2PJDA 4R8KA 2VPPA 1NF2A 2JHGA 2QRPA 2ZVQX 4KUGA 4UAGA 4AJIA 4B3SB 3O8RA 2F90A 1BYIA 1H4QA 2FPOA 4LMBA 3EISA 1M6YA 4AZ3A 1Y6GA 4GOJA 1XZPA 3RBVA 1KS9A 4RKRA 2AD5A 5MN6A 4NAVA 2O1XA 4PBTA 4BWYA 4CDMA 2E87A 1Q74A 4Z7QB 1T3ZA 1E62A 1YS4A 2IHKA 1W4ZA 3AYXB 1NI5A 2Y99A 5BSKA 1KEPA 3GU3A 5F7XA 3LPNA 4JYBA 4MWGA 3LU1A 3B1JA 3EGCA 3GGJA 3NATA 4W1SA 1JWLA 3VC7A 1NX6A 3L77A 5L3ZA 2EV9A 2OHOA 1KIFA 2FE1A 1NVAA 2GM9A 3C6MA 1C0LA 1V5IA 2J3JA 2JGJA 2GMWA 2Y1WA 3GWZA 4L5IA 4RELA 4U5QA 3PUIA 5G1OA 3JTMA 3RRMA 5CFNA 1T9BA 1UQUA 1VLLA 2WTNA 3WL6A 5LMCA 1TQHA 1PL6A 3BJIC 2V54A 2JF0A 1TGVA 2XZDA 3E5MA 5B4TA 1CUJA 1PNOA 3KAQA 4OGLA 4U2DA 2QBYB 5AUPB 1C9KA 1KIAA 3AEQA 1PWYE 1E3QA 3E35A 2XNCA 4RFLA 5CEFA 2D54A 1Q19A 4N54A 1Q91A 1WAMA 2OO5C 2D7CA 4GZMA 4QNRA 1FK8A 5JAQA 4W63A 1E8MA 1PDOA 4JBWA 3TJRA 1CZRA 4F45A 5ER6A 1DKRA 3T4EA 3F7MA 2X4GA 4WGFA 5DNUA 4KVAA 1JR2A 3ZE9A 2NU7A 3PQ8A 1RADA 4AZTA 2C8VA 4MGKR 1OVGA 1SBYA 1U2DA 1U0FA 3DBHA 4TSFD 5CA1A 3GRAA 5KYGA 1X7WA 2X6QA 4Q4LA 1MQAA 1AZLA 1EGAA 1GRVA 3UQYS 4EGCB 5LDHA 4X1YA 3JAMA 2UU9B 4FMDB 1SVSA 3RSHA 1W8IA 1QAMA 1M54A 4U6NA 2EG9A 3D2LA 4PC6A 4PQYA 4RKFA 5EPOA 1GY8A 1XTBA 1QX4A 3FKJA 4WV3A 1PS0A 3TMYA 2GKOA 3PNQA 4P84A 5EKXA 3R7DA 2BM1A 2C00A 4GBGA 2OA0A 2CXOA 2WWXA 2C4KA 2QRZA 1V0JA 4YAEA 1ZG3A 1HE3A 3H2KA 4LV8B 5MFZA 1GPUA 1NV9A 1K4MA 4ACBA 3QX8A 1E2LA 3KOZA 1G41A 4G4IA 4ZXPA 3K15A 1FY2A 3UK6A 2FFHA 1K63A 3HEBA 4HZIA 4DKXA 3AM3A 2C1XA 4G5HA 1VL6A 4JBGA 3LY5A 1ACJA 1EXNA 2GXSA 4YYEA 3OZCA 5B7QA 4JJ8A 2IXFA 3RS0A 5HOQA 4F97A 1MAVA 3A3OA 1F8GA 1HFJA 1SBTA 1WMAA 3TR0A 2I7TA 2KX7A 2VDVE 3HXPA 2H4JA 3EYAA 3ZHVA 2FLVA 1EXVA 1I1OA 2FPIA 2M6LA 2A84A 4W5NA 5KEIA 3QUQA 3ZQKA 3DB1A 4DPMA 2C78A 4Y1FA 3Q8XB 3BPSA 3TAXA 3PJFA 4JFAA 1C4XA 4J03A 4YWHA 3WJ1A 3C8HA 3P96A 4JJKA 4LCBA 1FRFS 2PZJA 2QN7A 1B73A 4NJOA 3AFGA 1KI6B 3N8HA 4FKMA 4YO8A 1S2IA 4NVRA 2ZITA 5EKTA 4CLDA 4E5PA 3Q3HA 5KNCA 1P74A 2RAFA 4OA5A 2RG1A 3BSWA 4E2FA 5LP6B 3BEOA 5KVAA 2P5YA 5IVHA 4TYWA 1PT7A 4DEVA 2BTEA 2WSIA 4XTRA 3HK2A 1TVKB 2OORA 4N0PA 4ZVPA 1N7JA 4DW8A 3AF2A 5KJEA 2Q29A 2V7UA 1H1LA 1BA3A 2Z5GA 1ML4A 1PKEA 4MWOA 3AEUA 4X93A 3V1KA 2PKQO 3GBVA 1EEHA 1WM1A 1Y9ZA 5T64A 4TXMA 3TO5A 5BT9A 1SXPA 1L7RA 4MTLA 5DGXA 3ZXYA 3CLVA 3M83A 4CEJA 5ALGA 3DXYA 4K9QA 3RNOA 3KYCB 1AF7A 2ONCA 4EJMA 5CURA 4PEVA 3WS7A 3IBYA 1Y4AE 3LTNC 1VSBA 4OJMX 4E1VA 1O96B 1KAOA 1LBQA 1C7QA 1PGPA 3CMMA 3KV3O 3MWJA 5I9TA 3W8RA 3EXEB 3DUFA 1NN0A 2PZKA 4J1TA 1E9RA 2AC7A 1P9WA 2R8XA 2QR3A 1NW6A 1XLTC 4MB0A 1SZDA 3R5JA 4BMNA 4DTIA 1WUTA 3AL0C 1A8UA 3ZU5A 4NY1A 1ZA2A 3FYDA 2NUBA 2CXHA 4Q16A 4O0LA 5LQRA 4FSXA 1K7YA 5K0TA 2GASA 2HX1A 1YE5A 2C2ZA 3ORSA 3GHYA 4ZDWA 2C5GA 1E3DA 2P4SA 2IV7A 3W5HA 2NVOA 2XB6A 1XNQB 5GJBA 1Y5MA 3LDFA 3MLEA 3GLVA 2RHMA 5DGTA 4E4TA 4ZZ1A 1R6TA 3GFGA 4PYNA 3P5BA 1FW8A 2BC9A 4BO0A 1ZJWA 1VPEA 1AS0A 1E96A 2GWRA 2R0QC 3IT0A 2BMAA 3A1DA 2P27A 1OF1A 5DW0A 1BKYA 2F43B 1UC4B 1OGJA 1ZVJA 4QDJA 4CIBA 3SFZA 2V5UA 3EXHB 3O4RA 2ZDHA 4H3VA 4BVKA 4JLJA 4QEKA 4BMXA 2QIOA 4BO1A 4YT4A 3D1VA 1IG0A 2GBIA 3OP4A 1IUOA 1KRHA 4N5NA 4PXSA 1E6MA 2E4AA 1KP2A 5ULLA 2JJ1A 2W70A 4UBOA 5LP1A 1ODJA 3U09A 4UUNA 1RJGA 2YOFA 1EKXA 2FUNB 3K73O 5E7IA 4CZ2A 3L7CA 4ZTZB 3P2OA 4MCHA 4OSEA 3VTKA 4EOGA 4LHWA 4RQAA 3EQ9A 3EULA 4PRYA 3S2FA 4U7TB 1MENA 2BIFA 1A98A 2DH6A 1EUCB 3DMGA 3PIDA 3QWBA 5BXYA 3VKHA 4KX5A 3SIXA 4ZJYA 1PN3A 4IGAA 3EOAI 1ZMRA 3I2IA 3CH7A 4IIVA 3UATA 3UUFA 1AGYA 1Y5LA 2P0YA 2YX1A 5BQXA 4X90A 1N5MA 3UAZA 3TQCA 3CE9A 1LC3A 2IU4A 1X7WB 1I4WA 2WMDA 4G25A 3MCUA 3AUKA 4IDHA 3JD3A 4DR1B 2O8EA 3D7KA 1NMQA 3L8DA 1I1HA 3RBXA 4C4XA 4WLOA 2O4UX 3CUEF 4LY0A 4P5PA 5F76A 4JP8A 4FLFA 3FXAA 4FQ8A 3O2QB 3UC9A 1F06A 1JGTA 1CUCA 1NUTA 3B1FA 4RM3A 5DP2A 1SBIA 4XUEA 2FRXA 4HX2A 3SJZA 1XXHE 1Z36A 3QLUA 4M98A 3X2SA 3SQWA 2YWRA 4E2YA 1FDTA 3CTPA 5BMVB 3UNXA 3PQ3A 3IEKA 4H60A 1NBOA 2V59A 2HH9A 4GHWA 4GOND 3VGPA 2HHJA 3JPWA 4N3AA 4MUGA 1IWPB 1C3JA 1GV0A 2FQQA 3QKSA 4V03A 1TM2A 2J3QA 1XZLA 3PXCX 4E3ZA 1XRRA 5LD2C 4B2LA 3F47A 1J1ZA 1NBIA 2ID4A 4RA6B 3ZWVA 4B7UA 3DEAA 5LR6A 3MBKA 2DWPA 3VPHA 4NTZA 2QZ4A 1L4UA 2RJNA 5AI8A 1KHTA 2A0XA 4Z49A 4CQJA 4CKCB 2Z56A 4G0VA 2OFWA 4L1KA 4BNTA 1S7GA 4AIRA 4UAUA 2FSGA 2OCLA 4FDTA 1VCOA 5B5SA 2UXDB 5CIYA 2UUOA 3FCAA 2J48A 2QZZA 3VFDA 3Q1LA 4Q37A 2CEAA 3QKSB 2FSPA 1E2NA 1ECBA 1PFVA 4PQFA 1PT8A 5IF3A 3WL7A 1P18A 5ENZA 1UAYA 2C8JA 2E0IA 4FZJA 3MNFA 4IICA 4RHEA 2G07A 4WN3A 4DCUA 5CDUA 4LMPA 3UT5B 1CR2A 2L19A 4X1IB 3RS8A 3ECAA 5KX5F 1X1QA 1HDZA 2IUSA 3T3EA 5FL7D 1IK4A 4IIGA 3HKEA 4DHEA 1FJGB 2VDJA 3HKEB 3K1JA 5JNWA 4YQEA 1DJNA 1J42A 2JLYA 1HT1E 4FGZA 3GRKA 4P5DA 1IONA 4CTNA 4KSBA 1W44A 1YB2A 3OTGA 3Q72A 1GQYA 4F2DA 3K16A 1FUKA 4OM8A 4PRZA 4Q24A 2WM2A 2FY8A 2O2XA 2OSVA 3FUWA 2ZJBA 1IEWA 3D6MA 3FJYA 3I05A 2NW6A 1GPYA 3I04A 3PP8A 3PR2B 2C04A 4LJAA 5C34B 4J1NA 4RETA 1F6DA 1WHSA 1HE8B 4KJXA 4PRLA 1EQUA 4XSVA 4B6EA 4EYGA 5EJFA 2YHIA 4TZKA 1SZCA 1XEFA 1RAAA 5I51A 2GDJA 5ALZA 1P1HA 1QVVA 3E9CA 3IBSA 3N5CA 3ACCA 5FR2A 5ICGA 2NUPA 3VR5D 2E2WA 3DLIA 3AEQB 3HMKA 4NU6A 1FDVA 4AMGA 4B80A 4G0PA 2E7ZA 5BMOA 4OKIA 3ZW8A 4WTOA 3C7TA 2BZ1A 1I9CA 4MVXA 1NVXQ 2VDKB 5D3QA 5DB4A 1M1XB 1E6EA 3ROQA 3ITEA 4MO9A 2EATA 1HR0B 2FDXA 3EXIB 3KALA 3EMDA 4LJ7A 1IAVA 4D25A 3ONFA 5CNJA 1V7QA 4CKBA 2LTAA 3PNBA 5AYVA 1LFDB 3KSMA 1SB8A 5KYUA 5JROA 3VTFA 2HPHA 4AM8A 1T1JA 4V3BA 1XRPA 1OV6A 2WWTA 2C9MA 4FCCA 4P82A 3ESQA 3CVOA 1E2FA 3VH4A 2A9KA 2WWFA 3BE8A 4EGAA 4CKEB 1JYEA 1RJFA 3WVNA 2OCAA 3HVKA 4I1PA 3P2YA 1NF8A 3I37X 5F73A 1IRXA 2X9QA 2CJPA 4JB2A 1JIXA 1M7BA 1NUQA 1I1NA 4U8HA 4XJXA 5DM60 1EDDA 5DBIA 3WICA 1YH3A 4ZYYA 4FHFA 4UDNA 1FFGA 1J9ZA 3G02A 4OQXA 2JLCA 2CFIA 4AAYA 5HQ3A 2Q0SA 5DYGA 4I1RA 5ELXA 2J9GA 1FPMA 1QYWA 2WI8A 2NO0A 1SVUA 3HVJA 4OQZA 4IH1A 4E09A 4EUKA 2QUKA 3K8YA 4JGBA 4B7XA 3KSBC 1LB1B 1Z6XA 2ZJ3A 4CNQA 1SD2A 3ZHBA 2VZLA 4YV2A 4BGVA 5F51A 4NATA 5JO0A 3PDJA 1F6WA 4DS3A 2QLNA 5BNZA 4AO8A 3VJMA 1SUBA 2JKVA 2XB4A 3ZNOA 5KWSA 4DV4B 4FQ5A 2PCJA 3G2LA 4ZD6A 2QKYA 1P75A 2BWJA 1DPGA 2Y0BA 3IQWA 3S29A 1GG5A 1RPAA 2DR3A 1NYTA 3AERA 3AZQA 4GP9A 4M22A 2GD6A 4QT4A 5IFKA 2ZXUA 2BR3A 3I3SR 3Q7EA 5B3AA 4AWAA 4WK6A 3W2IA 1L1FA 1I2MA 1HE5A 3D2BA 3HG7A 1AKQA 4B3CA 5AH0A 2O7SA 4KLZA 4UPDA 4DANA 1G8SA 1LSOA 2Y1LA 3GNSA 2XIJA 3KE9A 3NPMA 4WK0B 3ZNQA 1M2JA 2PGDA 3MT0A 2VQDA 2CZQA 3CBQA 3O8BA 5HKBA 2HN9A 3CVWA 3GZJA 2XW6A 3F6BX 1T10A 2E85A 2NTEA 2ORVA 4XQ0A 2RGUA 2BHLA 1HOTA 3RRFA 3R0ZA 4RH1A 4H27A 2YFYA 4W5JA 2DLCX 3TL6A 5IYZA 4JJ7A 1RXEA 5GJCA 2KE5A 3ROTA 4DQXA 1SO8A 4HPXB 4Y1EA 4ZHSA 3ZQJA 1WCWA 1WXGA 1AKVA 2IPLA 4QO7A 3UAOA 9ABPA 2GZRA 3H4TA 2QPLA 4XX0B 2O5EA 3GNLA 1U3GA 3K94A 4IZ6A 1EGMB 5KQRA 1GGEA 4MEAA 1TTTA 4OU5A 3AOEC 1ISSA 1QANA 4NR0A 5BSWA 3B52X 1W4CA 2Z9CA 1SU8A 3K70C 2AEMA 3FAZA 3FHOA 2COEA 3A27A 3EASA 1ONBA 3P2IA 1ZSVA 4BVHA 1G1MA 3HGQA 2D8MA 1QTQA 5LQJA 2WTAA 3PPIA 3RF6A 4B34A 3HRIA 3RJZA 1LLCA 2PKXA 5JADA 4RULA 4U7PB 2CUNA 4FK8A 4LRYA 1G4AE 1R0KA 2GB4A 4A36A 4DR3B 3SCZA 1TZKA 3BD9A 1J2JA 2ECKA 4TMZA 3RH0A 4YV7A 1SEVA 2JK1A 2QK4A 3NKLA 1OXMA 1M9NA 4BAUA 2WHXA 1R0CA 4U0JA 5C1PA 3ENNA 4EA8A 3PF8A 2FQWA 1OAKA 1DAKA 3S2EA 3T5TA 3CQ9A 3SYMA 2FA9A 3Q5EA 1EUQA 3T7CA 4YC7A 4YJ2F 2C9BA 2UYGA 4EI9A 5TMDA 2YC2C 2VJDA 2GCEA 1Y1LA 3AINA 2DFDA 2IYYA 3C8UA 3MJDA 4B2IA 5BN3B 3NTXA 5LJLA 1BWSA 4LBVA 1EJ0A 1XT6A 5E0KB 2PIDA 1QPGA 5CA1F 5JXWA 1MAWA 3OURA 2FPKA 1NI4B 4HCJA 4YUWA 1XZAA 3NVMB 3RUEA 4LRWA 1SVNA 2I34A 3RHZA 1JB9A 3UENA 2HRBA 4LJRA 2HNBA 2GJSA 4QQ8A 4AMVA 1ESMA 2CY0A 3H1GA 3J80A 2DXIA 4DR2B 1XG5A 4JLBA 2J8ZA 4BFUA 1RRPA 3PE4A 1R3DA 2GNAA 4JR1A 5K3OA 5IT9A 4PYQA 3D8NA 3G2HA 2AG0A 1ZK1A 4HQ6A 4Q00A 3F67A 4V02A 1V71A 3GEGA 4KNVA 3E3NA 3OTQA 5LMZA 3IEMA 3QNMA 3LT4A 3HP4A 1K5HA 2CXTA 3G2OA 1DTWA 2VBCA 3MBIA 3O3OB 4TVKA 4JLOA 4I3FA 3VVMA 4YAKA 2OFPA 5DZSA 4C6TB 3DE1X 1O4VA 3A6FA 3BHMA 3DE6X 1VOTA 2I6GA 1RBYA 2P2YA 4PLHA 2I2FA 2QG4A 1X39A 3BFKA 1E2MA 2PS1A 3H9QA 3RF7A 5HF5A 1H0RA 4PM4A 1U7TA 2WYOA 1NW5A 1YRQA 3AIIA 4M87A 1RI3A 3HBNA 4KPFC 2CL7X 1ZRHA 3COVA 4GSYA 3TOXA 1GCGA 1U8CB 3FF1A 3PKJA 5FOUA 2PWYA 3I6IA 4XCXA 5G0SA 3S27A 2B21A 5BOSB 5FOVA 1M2HA 4ZRDA 3KIPA 5K0LA 4B17A 1RU3A 2C3YA 2RHWA 2W4QA 2BEVB 1YKFA 4JASB 4DBVO 2ATCA 2DECA 1TRKA 3HSKA 3G0IA 1G20B 1KORA 4XB2A 1KO5A 1WOMA 4BY9E 4OI0A 1JSLA 4H1TA 1NVVQ 1UQRA 2QYOA 3C3EA 4UCXA 5CX1A 4P33A 2JAPA 2PUWA 3K0FB 1G42A 3TLEA 2IC5A 3I8SA 3AYZB 2YNMA 1E8NA 2TYSB 5F3WB 2C2KA 5DWDA 3I4FA 1EWKA 4D0SA 1P5HA 5CM2Z 3HN2A 2BAGA 5A71A 4AU1A 1W49A 2FV8A 3KG2A 1MC8A 3LYAA 3K8OE 5BPFA 5IT5A 2H92A 2GK7A 1W5SA 2PT6A 4PO1A 1PHPA 1M1NA 421PA 2C0QA 3F8TA 3HBAA 3G8CA 2JIQA 3O1JC 2QR5A 4DUZB 4FCVA 1IUNA 2XMZA 4M1ZA 2F1JA 2W6OA 3I5AA 5IULC 5C51B 4IJUA 4IFBA 3ZV6A 1E0DA 2W43A 2B92A 5LLSA 4DGSA 4JV5B 1BHQ1 1X86B 3PXXA 3RRYA 2O2SA 1J25A 2YYSA 2OC4A 3IFSA 4UBJA 1WUJS 2CB9A 2YV2A 5I3CA 3QMMA 3H75A 4HDSA 3A1FA 2AOXA 1FYFA 3OQHA 3BD7A 4GRAA 2YDYA 4HFNA 1S8AA 4MQMA 1E1RA 3INTA 4BE4A 2GRAA 2ZEJA 1PR9A 3EXIA 2GAAA 1XWIA 4OK3A 4NESA 3JPYA 5EIWA 5HG0A 4C78A 4HVLA 2I2BA 1N0WA 1E1NA 1IG3A 3QVXA 2HJSA 4FGKA 1H8ED 4H7FA 4EQ6A 4Q1BA 1D9ZA 2GEVA 4DDHA 3AHCA 1GFIA 4V0OA 1CY6A 3C6XA 4UASA 4DYDA 3TLMA 2ZPUA 2OV2A 1XMQB 1LSSA 2FU5C 1P2SA 1CXZA 2HMUA 2PSEA 3D8UA 3L9WA 3RARA 3ZQUA 4ZEWA 3AG6A 4BQOA 3HDTA 4RM2A 1BW9A 3QNUA 4E6EA 5E6UA 4MYDA 5L4LA 1KZ7B 5EGNA 1TZMA 5TS2A 1WHTB 2Z08A 2IV2X 1UXGA 2D1FA 3PXDA 2PR7A 3SVTA 1E8DA 2YWXA 4RTQA 1DC3A 2GO1A 4JUAA 4I1YA 5BR1A 4IXTA 1XJ0A 1GL6A 3MCZA 3DULA 1Z3IX 5I01A 3GEDA 6REQA 1JHPA 2JG3A 1UM9B 2ZWVA 1KGSA 2ACVA 4Y2SA 4MI1A 4QQNA 2VH2A 3HB5X 3WKEA 1ZOLA 1BW9B 4B47A 3PHLA 1ELOA 5J5CA 4IXNA 1EPUA 3AF6A 4BJ1A 4V0KA 4F3TA 2IXAA 1KPIA 4AZVA 2ZJ6A 3DXXA 4HBGA 2XQVA 3WSWA 3K0BA 3S2IA 1QG2A 1KI3A 3NWOA 1XZMA 4JELA 5A1TA 4TTAA 2WZBA 2AFIA 5LP6C 3IS3A 1I32A 4CM9D 5C4GB 1E9CA 1R0ZA 4NU0A 1C0PA 2RH8A 5DNWA 2J6HA 1P33A 5CTJA 2PU7A 5DBHX 1ZMBA 4BNKA 1ZH2A 1Z8DA 1ZN9A 2P5UA 3JAKB 2G17A 1MN6A 2OL4A 1MO2A 3KS9A 5ERGB 5G4LA 3SDSA 5JASA 4HL6A 1BFUA 4HFRA 4E2XA 5ES3A 4IYRA 2HLHA 1ZCAA 3T9BA 1CV2A 3GJXC 1F1JA 5KTPA 1OFIA 4R9UC 3NT5A 5CB0A 4DAOA 5JD5A 2X0NA 1QAOA 1SKBA 2D1RA 1KY4A 1FFCA 4H1VA 2X0EA 1E7SA 1UDRA 2GEJA 3AF1A 3CEPB 4HADA 1XJQA 1C8KA 4NEGA 4ESVA 2XXAA 2PGOA 1VECA 2B1QA 3KJQA 3CEAA 4L4YA 1XLVA 3PUZA 1Z4NA 1GN9A 1Y34E 1DUSA 2PLFA 5CG2A 2ATVA 5MFPA 4WJKB 1PHRA 1GSAA 4DIMA 3EH2A 4X62B 1UBHS 4EGFA 4YAOA 1CUBA 4AX8A 1PDWA 3AU8A 5ITWA 1XKXA 1PSDA 2LCIA 2HA7A 4MJLA 5KSOA 1F0NA 4GBED 4O33A 2NZYA 3ROPA 3WAGA 3TIXB 1TJ3A 2RFLA 4HBZA 1Y42X 2BMJA 3ZLTA 3R6LA 2D13A 1N32B 5DXFA 2VH1A 3HXKA 4WWHA 4J0IA 2X41A 1GN8A 5JS6A 4Z0NA 3BIOA 2WIAA 3IXLA 3JWHA 3OJWA 5FI0B 3VKVA 1YMVA 5B58T 4EH1A 2C83A 2H2GA 3PZBA 1WCXA 2PIAA 1IZ9A 2CK3D 2ZBFA 3D4NA