3H2YA

Crystal structure of yqeh gtpase from bacillus anthracis with dgdp bound
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
313
structure length
309
Chain Sequence
DDDFLRILNGIGKSDALVVKIVDIFDFNGSWLPGLHRFVGNNKVLLVGNKADLIPKSVKHDKVKHWMRYSAKQLGLKPEDVFLISAAKGQGIAELADAIEYYRGGKDVYVVGCTNVGKSTFINRMIKEFSDETENVITTSHFPDLIDIPLDEESSLYDTPGIINHHQMAHYVGKQSLKLITPTKEIKPMVFQLNEEQTLFFSGLARFDYVSGGRRAFTCHFSNRLTIHRTKLEKADELYKNHAGDLLSPPTPEELENMPELVKYEFNIREPKTDVVFSGLGWVTVNEPGAKIVAHVPKGVSVSLRKSLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GTPase family protein
publication title Structure of YqeH GTPase from Bacillus anthracis with dGDP Bound
rcsb
source organism Bacillus anthracis str.
total genus 76
structure length 309
sequence length 313
ec nomenclature
pdb deposition date 2009-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3h2yA01
2VTKA 1LY1A 4JLVA 2VBCA 2VEDA 4O2RA 1VCNA 3F8TA 4URYR 5CB6A 2BKUA 4US0R 5HCNA 4B43A 4QJ5A 1NVWQ 2BCGY 3LXXA 1NSTA 4X8LA 4CEIA 5KDDA 1OSNA 1A5TA 5KDOA 2OXRA 5L3QA 4FMCF 4W9MC 3I62A 1KSJA 1KI4A 3QENA 1XXHA 3PG5A 1J7KA 2GXQA 3B9PA 1FTNA 1G17A 1R5NA 4B6FA 5TV2A 2ZR0A 2J45A 3T15A 1CR1A 1KI6A 3QIAA 3ZD6A 4LJ5A 1PVOA 2WHXA 3KXLA 3UK6A 1RVDA 2GK6A 5EE0A 3MRSA 3D6TB 3U4QB 1HE1C 1JAHA 1YR7A 1E32A 2YZ2A 1T8TA 1CJMA 2EU8A 4DSOA 3KKMA 4WBSA 4MKGA 3REFA 3AKDA 5FFMA 2QPOA 1N6IA 1NJGA 3A58B 1TQDA 1W1WA 3VKWA 1GDDA 2LCFA 3AP3A 3PCRB 4GOKA 5JSZA 1E94E 3REGA 4P4UA 5CK5A 4PANA 3W6NA 3AP2A 4PZZA 2J7KA 1GNQA 4FIDA 3EZ7A 3H86A 2IYQA 5J4YA 1E6CA 2WIAA 3K9LA 1XEXB 2YC2C 3LBHA 1G6OA 1H8HD 4LBYA 4N0DA 2VSFA 4QGHA 3C4JA 4LPSA 1GNPA 1Z28A 1FQKA 1DG3A 2GXSA 5DLQC 3C8UA 1DAGA 3BC1A 4GMXA 3PXGA 3I4LA 4MGKR 4YONB 3ZDQA 3SC3A 1E2FA 2FE4A 1TEXA 1T9HA 1G8PA 1H8EA 1TF7A 5CIQA 5CDFA 2HEIA 5E95A 3WBKA 4DJTA 2GBLA 3NWJA 2J0UB 1FMLA 1Z2CA 3GCGA 3GLIE 4IFEA 4DIEA 2JLZA 1ESNA 4FWIB 4ZV4A 1YRBA 1E1QA 2ZJ2A 3TBKA 5FBQB 2GJSA 3FDIA 4Q1AA 1RRPA 1OJLA 2HLDD 1SKYB 2QM7A 2AR7A 2QSZA 4DBLC 2ZJYA 3THWA 1GKYA 3T5DA 2XSZD 2ANCA 3OEHA 2GF9A 3SHWA 5SZKB 1H8HA 3U61B 2X1VA 4OJQA 4Q1DA 2QI9C 2AKAB 2PH1A 3V4FA 3VAAA 4AWXA 4JYBA 2RGNA 4PAQA 3VR6A 1GP2A 2WWFA 3WMEA 3EZ9A 1X6VA 1K8RA 4AKHA 4RVCA 4IOKA 2ECKA 4D4JA 2J1LA 1D6JA 4LGMA 2HUPA 1UDXA 4XTCS 1OH8A 4O2LA 1HTWA 1XMVA 2YWGA 1VCIA 1G16A 3T1TA 4Q7KA 1U0LA 4EJSC 2VP5A 1FFHA 1C1YA 1W47A 2BOVA 4P4SB 4TTQA 2HLDA 5LBIA 4URVR 2B8WA 1EG7A 4YC7A 3EA0A 2QMOA 2XSZA 2OAP1 1FNNA 4QBIA 421PA 2FA9A 4L9SA 5DYGA 5ANRB 2ZRDA 1E98A 2XZLA 2Q3HA 2QE7D 1W7AA 2ZI3A 4NHOA 2QENA 3WYAA 3EPLA 2A5FA 5B57C 4UNSA 3IIMA 4HAZA 3DMDA 4WW0A 1NL3A 1OW3B 3K70B 1IONA 1T5LA 1VCMA 1XU4A 2Y8EA 3Q9LA 1KAOA 2CLSA 3R9WA 1EWQA 2QQEA 4OHVA 1VTKA 2ZRMA 5EXTA 1Z22A 3GJ7A 1ZUNB 3AF3A 4B3XA 1P5ZB 2OBMA 2NQ2C 1VIYA 4KODA 1SQ5A 3KFVA 4V03A 4GFDA 3EARA 4PSAA 1IY2A 4B74A 4XTRA 2IT1A 1H65A 5E3HA 1KKLA 3QEOA 1NN1A 3DVLA 1II9A 2WJGA 3E5HA 3JVVA 4DDTA 2NIPA 2AXPA 3JVUA 1EFUA 2QRNA 3WRXC 3HR8A 1BO6A 4LYFA 4Q4HB 5KSYA 2H18A 3V00A 1XEWY 2YOFA 4RFSA 5F9FA 1P75A 2Q9AA 1SHZA 1RFLA 1MOZA 4FINA 4A0FA 1XTQA 4YLGA 2CHVA 1UBEA 3CIOA 4CEJB 1E2EA 2XNDD 2E1RA 1E2PA 3RRNA 3QKSB 2CK3A 2HCJB 1ZC3A 3C5CA 2XZPA 3FMFA 4TQ9A 4ITRC 4LY6A 3UMSA 3EC1A 4QHYA 1KZGB 4DDUA 3I32A 4Q47A 3A6PC 2BHRA 3UG6A 4A8JC 2BM0A 3S1AB 1HA3A 3MWYW 1M8PA 4GZMA 1GRNA 4BECA 4DUGA 1CTQA 1G8YA 2D62A 2DFLA 1T0JB 2IUSA 2Z0MA 3EW9A 2EFHB 3PVSA 3VU9B 3SQWA 1RE0A 2JEOA 4DDVA 4AKIA 3MD0A 3QG5A 4M8NE 4QFMA 1OPXA 1E2DA 3LX5A 4N1AA 3RANA 3VNUA 1VG8A 2JATA 3VR1A 2FFQA 2V6JA 2V1XA 2ZRPA 1YHNA 2YC4C 4R9UC 3IBGA 2B21A 2G1JA 3HR7A 4NE2A 5L8VA 1ODFA 4HYYA 4M1KA 5AR1A 4MYUA 3BFVA 5J4HA 3QSYA 2P6RA 2X77A 4LBWA 4ZCMA 2R6AA 3BK7A 3SBDA 5TY0A 2XNDA 5FOWA 2HYIC 3BWDD 2ZREA 2ZEJA 1XZQA 1ZIOA 1R0ZA 4DSUA 1W5TA 1DG1G 2BM1A 2KB0A 3LXRA 4WAUA 3BGWA 3K9HA 1WCV1 1KYIA 4EJSB 4AYTA 4JBXA 4JBYA 4DDWA 4M9XA 3Q3JB 4DLUA 3SZRA 3M1IA 2H8KA 4TMXA 3TSZA 1EK0A 2JIZD 2V7QA 4NPHA 4O25A 1HT2E 1R10A 2O0JA 4LHXA 2R6CA 2ZR7A 3BFKA 5GJVC 5DO9A 3WXMA 1ETUA 2GEUA 1UBGA 3U5ZB 4NYIQ 1D9ZA 4W7SA 2IEZA 1K6MA 4D2IA 3RS4A 3U60B 2ODEA 5FTJA 5GVSA 5KSZA 4Q4LA 4ERNA 1OB5A 3LA6A 4IVPA 2F1RA 4M9ZA 1NBMA 3TR5A 2G77B 1RRFA 2F9MA 1IXRC 1LVGA 3ZZ0A 2ERYA 3BE4A 4NYJR 2TMKA 1TADA 3X1WA 1ONBA 1JECA 721PA 1P2TA 4C0LA 1FX0A 2WAYA 3A8TA 4ARZA 2JLXA 1KI8A 3TVTA 4LYHA 1JEEA 1E1RD 2I1QA 5F2EA 1P9WA 3K0SA 5E7MA 1P60A 1PJRA 1KJZA 2P65A 4TTRA 4LSGA 1NKSA 1U8ZA 121PA 2ATXA 4Q7LA 3TAHA 5F98A 3ZGXA 1G3RA 2DFKB 3IBYA 4Q5IA 1ZRHA 1R7RA 3U3MA 3IKJA 2QBYB 2Q9BA 1OLOA 2P5TB 1VCOA 4JVSB 4BZXA 1G41A 2W0SA 1Q1BA 1EX7A 3SN6A 5UKDA 4RD6A 3AVOA 1PLJA 1V5WA 2IYTA 2YV5A 2OO7A 2QAGA 1A2KC 2ZJBA 4KI0A 4JVNA 2W58A 4MGZR 1T4GA 4NCHA 3IPYA 2VHTA 2WBLC 3SDZA 3ZYCA 3VHXA 4UNQA 4DSNA 3SJCA 1UBCA 2FPMA 2WTUA 1XMSA 3QBVA 5JJKA 2AHOA 2IUTA 2GKSA 2RGXA 4KV9A 2QRZA 3DMNA 1RJ9A 2QMHA 1CF4A 1CS4C 2QMUA 2ODNA 5FBWB 1Z6XA 2P6UA 4A9AA 1T0HB 1PLKA 4Y0VA 3CO5A 5TMPA 4YMUA 2D3WA 2YJTD 5AUOB 2ZIAA 3U44A 5FPTA 3D3QA 1S3SA 4MH0R 2P3SA 5SZIA 4GDFA 4BE7B 1E0AA 1N0VC 1AIPA 4K46A 1OXXK 2ZJAA 1W4RA 1J70A 2PCJA 3F5FA 1II0A 4PC6A 5KPJA 1NMZA 3JZAA 1MABB 1VECA 2UZIR 1P73A 1Z3IX 4JSYA 1TQ2A 221PA 4KFRA 4HZIA 1II8A 5AJXA 4C7OA 3B5JA 2VP9A 4I4LA 3CW2A 4BUJA 1Z63A 3B9QA 1G8HA 4QNRA 1F2TA 4GZLA 4NYJQ 2DFNA 5EZ6B 1NIJA 4DEXA 5KSOA 1FZQA 2WMNB 4BLRA 4TSFA 3UPUA 2O8DA 5P21A 4II7A 2NPIA 1EFCA 2BMDA 2Q0HA 2PX3A 3KTAB 1IN6A 4LYAA 3RRMA 2ZPTX 4NDZA 4XVUA 1N6NA 4QC2A 4D26A 4TN1A 3K1JA 4AIIA 1ESMA 3FYHA 3KQUA 4JT4A 4LV8B 3O8DA 1VHTA 2A30A 2B8TA 6Q21A 1E9RA 3T34A 1KMHA 2ZAMA 2JDIA 3A37A 3FVQA 4OQNA 1G8FA 1S0UA 1OFIA 5DISB 5FBLB 3PR1A 5CM9C 2F3RA 3I72A 1KSFX 1U0HC 2MSEB 4V0OA 2HF9A 5G3YA 5CYOA 1MRSA 2QNRA 1GVNB 3FHTA 1KHTA 4WOPA 1RW4A 2JJ2D 2ZI5A 4HZUB 3OAAD 2R2AA 1KNQA 5EXXA 1YVDA 4GMDA 3GJ4A 4UJ3A 2O0KA 5AK0A 5HE8A 1M7GA 4PC7A 4DCTA 1KI2A 2FWRA 5HZKA 4LCBA 4Q4JA 4KO8A 2OCYC 2VLIA 4EPRA 3NEJA 3T35A 4QM7A 3CRRA 2Z43A 2GZDA 1XP8A 4NU0A 1CR2A 1OH7A 2JJ1D 4XSGA 2WWYA 2BBOA 1CKEA 4Z1MD 5A5GA 2PJZA 3QKUA 3ZVRA 2XOKD 4RD4A 4C0AC 1P9NA 4HAVA 2IF0A 3TSWA 5FBVB 3KQLA 4PHFA 3X2SA 2BBWA 1G18A 4AURA 3AUXA 1KZ7B 1XTIA 5KTYA 3ZIAD 1P2SA 4JLDA 1P2VA 1KDPA 3FWYA 1VYTA 2G88A 2OCAA 4D4KA 4MYHA 4OHWA 2QG6A 3FFBA 1Q1ZA 5LD2C 5C2JB 2Z4RA 4Q01A 4D82A 1MV5A 4Q9JA 3R9XA 2OFWA 4IDPA 4NZYA 1XZPA 3DL0A 3Q7PA 1S9HA 2XEXA 5AJZA 3CR8A 4LC0A 1W48A 1QVRA 2R6FA 5HE9A 4LK2A 4U00A 3OEEA 2MMGA 1GITA 2WWHA 4URZR 1I4TD 4R7ZA 4Z1MA 4DXAA 4LX0A 1B23P 2L0XA 1Z0IA 2XOKA 3N2EA 4OK5A 5HKKA 3KB2A 1WB9A 5KYKA 2Q9CA 3GMTA 5F9HA 2C2HA 2ZSEA 2ATVA 2XB4A 4RZ3A 3QF4B 4JL5A 3TH5A 1AGPA 2B7BA 4F93B 1DAMA 1XEWX 2XXAA 3Q5EA 1XJ0A 2OHFA 1E4YA 2LWIA 3FKSA 2ZITA 5L3QB 1XXHE 1IM2A 2AL7A 4NCNA 5JMTA 4HUQB 3CPHA 2JLUA 1OFHA 2CE2X 3TK1A 1G64A 3K0AA 3OESA 4IDQA 4ZCLA 4TLDA 1G9XA 3I8SA 4ESVA 1TAGA 3PUVA 2AKYA 2CCGA 4QHTA 4Q7MB 3PEWA 4A36A 3ICEA 3BD9A 5JS7A 1UEIA 1SVWA 3QI2A 1MH1A 2Q3FA 4NMMA 4QBFA 4BQSA 2G6BA 3A1UA 3I92A 4EQ6A 2QP4A 2ZRKA 3RS0A 3L8YA 4RY2A 2FX3A 2AD5A 5JBQA 621PA 4ZDWA 3B13B 3NHAA 3W6PA 1QHHB 4XH9B 2P6NA 2V55B 2PEYA 3IO5A 3W9YA 4QL3A 1L8QA 4DCSA 1S3GA 1NVXQ 4YDHB 4C4PA 4FN5A 1JR6A 5LPNA 2QP9X 5KDLA 4FWTA 1JAIA 4XJXA 2O8FB 3MLEA 2XJ9A 3KXIA 1W4AA 3OZXA 1GRQA 4PXAA 1ZNZA 3NDBB 1G1MA 5E4FA 4RD0A 2BMJA 5EUQB 2H17A 2BC9A 3ADCA 1AGRA 3ZZTA 4HSEA 4QKQA 4C0BA 1JNYA 4PO9A 1P3JA 1Z8FA 2G0TA 2NO7A 5CDFE 1G5RA 1M34E 3CZPA 4V0KA 1G6HA 1G7RA 4X8OA 4A0RA 4ZPXA 4PO1A 1T6NA 5C1BA 2FPKA 2V6IA 3MMPA 3TW4A 3B1ZA 4Q1CA 1NRJB 1Q22A 2JA1A 2YYZA 4FMDF 4FXPA 4NP6A 4M1MA 1TUEA 3EZFA 4OK3A 1IHUA 2BMEA 3HPRA 3Q8XB 5FPYA 3LQQA 3EX7C 8OHMA 1HH4A 2CJWA 1R0YA 2FFHA 3F3YA 4Q18A 4IXMA 3DDCA 2J7PD 3VR5A 4BFXA 3RSLA 4WVFA 4MRNA 1G4UR 4P4TA 1U8AA 2UKDA 2OILA 5LD2B 3NXSA 1XMJA 4EFNA 2BCJQ 4C0KA 1RPZA 1AZSC 2IUUA 2H92A 4D80A 4WXPA 3NBZC 1KTVA 1XBTA 2NO6A 3D7MA 3SI7A 1JJVA 2YOGA 1QHXA 1R8SA 2D06A 3AVUA 1NMXA 4KYIB 4KJZA 2GJ8A 1Z08A 2JJ8A 3GLHA 5IRCD 1IXZA 1MT0A 2IHYA 4HB4A 3UMRA 4BEJA 1R4AA 4TLAA 5DSZA 1X8LA 3GD7A 3CNLA 5JSZB 1UJ2A 3GFPA 4TWZA 4BPBA 2O8CB 4TMKA 2OXCA 4LJYA 2H16A 1VYUA 2F1JA 5EP3A 5L3SB 4POAA 3B6EA 1G7CA 2KJQA 2J7PA 2JAQA 2YWEA 2ZI6A 4TMZA 4PQRA 1G5TA 4KYUA 1YKSA 4R2IA 3BH7A 1E96A 1Q1EA 2WSMA 2D4HA 2WJJA 3TIFA 4B71A 2FJUA 3DEFA 4PPQA 2GA8A 1N25A 5BWMA 2ZE8A 5EP1A 1CJKC 4B75A 1F48A 1CJUC 2ZJ8A 2EWWA 1JXMA 2X8AA 2IYYA 3CF2A 4DLZA 2OT3B 3CBQA 3NC1C 4NBSA 4DLYA 2V3CC 4Q66C 4GOXA 2WPDD 3EPHA 4EKDA 2ONJA 1DVRA 1P9RA 1NY6A 1GL9B 4PHGA 2JLWA 3GLFA 3BH0A 3CZQA 3QPVA 3T12A 3C16C 4CYMA 2QSYA 2EYQA 3ZZUA 1LTQA 5JJIA 4HB3A 3Q85A 2IYLD 2IWHA 1H8ED 3W8NA 1F60A 2IS6A 2CL6X 4US2R 1KO1A 4JT2A 4NCIA 3ICQB 1IN7A 3DZ8A 3C15C 2OAQ1 3B2EA 4GSYA 4Z8XA 1JALA 1DTSA 3R7WA 2PZFA 3KQHA 4RKEA 5J4KA 4L5BA 3AVXA 1NF3A 1QF9A 3F0TA 2ZRFA 3VQTA 4H1UA 4RSGA 1E0SA 1E1QD 1KO4A 2AFIE 1US8B 2H1LA 1FW6A 3KJHA 2QAGC 2OUKA 4LJ8A 5L3RA 4C0HA 1AKYA 4KLNA 4I1OA 3LNCA 4IHQA 2WPDA 3OEHD 3P20A 4FI3C 5FBRB 2J59A 2GWHA 3GLGA 2C04A 3AGQA 3DZDA 3L0PA 4Z54A 3Q72A 3CF6R 1S8FA 4TYWA 4JJZA 4OK6A 1XFAA 2RGEA 5EZ5A 1P2UA 2WKQA 1N6LA 4PAOA 5DYIA 3TUJC 3THYB 4TLCA 3M0EA 3ZLJA 3QXCA 2FDCA 1ZD1A 3AF1A 4LJ4A 1X8JA 2BV3A 4I99A 4LHZA 1FMJA 3K0CA 4IEEA 1F2UA 5TB5A 4MGYR 5JEEA 3GLIB 3TE6A 3EPKA 2VP2A 3CRQA 4L9WA 3VR2A 3X1YA 1GRRA 4P0TA 1YRAA 2ZAOA 4JIMA 4RZXA 2HV8A 3K0FB 4B3DA 3P27A 2IF2A 3BERA 5B64A 2FEOA 1E0JA 4Q9LA 2FPLA 2KBEA 1GZSA 3T06B 2AD1A 4PPNA 2WZQA 3PUZA 4BLSA 4V0NA 2GVZC 3CLVA 1NMYA 4UXJA 2ZE7A 2R6GA 4A0GA 4H9GA 5JCZA 4HAUA 4QJ4A 2FGKA 3FE2A 3WHLA 2R44A 4NH0A 2VQSA 1TMKA 2C99A 1W36D 1NVUQ 2GHIA 2ORVA 2P67A 3MGCA 4DCNA 1N5IA 5IHPA 2GXAA 1W2GA 4CEHB 1GTVA 2PZGA 4BWYA 4ZIRA 1Z47A 4E5UA 3PEVA 4IEIA 3FFAA 1E9BA 4OBEA 1GOTA 1OXUA 5GJWC 3KKQA 2A5JA 5DHAA 1OFUX 2J41A 1E4VA 2NO9A 4LRWA 3TKLA 1G8GA 3CNOA 2DYKA 1X8KA 1K5DA 2WOJA 4Q7JB 3SNHA 3TRFA 3PJRA 1SXJA 1VG9B 2AN9A 4ESHA 2GF0A 4BFVA 2ZXUA 4RJLA 3D31A 1Z2AA 2ZI7A 3T61A 4HI0E 1NBME 2ZVPX 3GJ6A 4QG7A 3T5GA 1LFDB 1IN4A 1I2DA 4DLVA 4JKYA 5CJPA 2RHDA 3ZVLA 4F92B 2VF7A 5A4JA 5FR1A 3SJAA 4B3CA 4B6EA 4GI7A 5JFGA 3KKOA 4B35A 2ODBA 1NLFA 5EE9A 3CX8A 4HDOB 4MA4A 4E03A 4GL2A 3SQXA 521PA 1SHKA 3CB4A 2ZUBA 2W00A 4LJ7A 1NLYA 4M9QA 1GL6A 1J2JA 1VDZA 2PEZA 2QTHA 1OKKD 3MCAA 3ZJYA 5FUVA 3NKVA 2VP4A 2CK3D 3WYGA 4G3XA 3CPEA 3TAUA 4YXWA 3TW8B 2F3TA 3DKVA 5KNCA 2O5VA 4MRRA 2C03A 1UEJA 4KU4A 4CVNA 1E9SA 1VMAA 4RZ2A 3UWOA 4CW7A 2IS2A 4DUGD 3L2OB 4UXIA 4WA7A 1SULA 2BVNA 4KAXA 1TU4A 4YMWA 3AKCA 4P32A 3ZQJA 1N5KA 2HXYA 1YQTA 4ON9A 1PUIA 4HAWA 1JPJA 1YE8A 4NYIR 2HYDA 2Z5FA 3CRW1 4R98A 1E99A 2GEDA 4AY2A 4DWJA 2VHCA 3BXZA 4CRWB 4IDOA 5FH9A 3U4QA 2QEQA 1OYYA 3AF4A 1OKKA 4BASA 2RKOA 1YZTA 4M0LA 5LDDC 2JLRA 5FOXA 3QKRB 3MJRA 2JLQA 2OV2A 1WP9A 4YMTA 4Q1EA 3KQNA 3IGFA 5DI9A 3OFND 4BFSA 1LF5A 3A1TA 2VF8A 3VR3A 3ZD7A 2X2EA 5JWRA 2WIBA 4TL7A 3RWMB 1J99A 1T3HA 2D2FA 2V7QD 4IOMA 1E69A 4LHYA 4PX9A 4QM6A 1UKVY 1AM4D 1F6BA 4EIWA 1W4CA 1XD2B 2CDNA 1JQLB 1XEXA 5EE5B 4CZ2A 2WJHA 4DZZA 4TYNA 5BYKA 3SBEA 3KL4A 3K53A 1OIWA 2WKPA 3OIWA 3T1OA 2A5GA 1NY5A 2BIFA 3L43A 2V54A 4QNMA 1Z29A 4YQFA 1XJQA 4A82A 1YZQA 4A2QA 4QGFA 1KMHB 1U0JA 2A7QA 2CL0X 3QUSA 4Q4AB 5BYJA 3ONWA 1NBMD 2J0UA 3U3JA 4AG6A 1B0UA 2F43A 4NYMR 3EWSA 4ABYA 2PLFA 1DADA 1ELOA 4C0QC 5DI3B 5KU1A 1G3UA 2GTPA 3OFNA 1NIPA 4HLCA 3WY9A 1XCPA 2ZYWX 3AV0B 4WZBE 3FOZA 3QXSA 2IX3A 3E1SA 4ACAA 5CIWA 4N0EA 3TNFA 2GZAA 4BLOA 2ZS7A 4M9SA 1X1SA 2N42A 4RKFA 3W6OA 4F91B 1KKMA 1HUQA 3GPLA 1QHYA 3LD9A 4M1OA 5KOYA 1PLLA 3GFTA 1DARA 4TL9A 3LVRE 3TSOA 1X3SA 2FNAA 2W6JD 3QNUA 1WDTA 4BZQA 4YMSA 5FOVA 3PENA 4L15A 4PC1A 1UDWA 3PV0A 3K70D 4DIDA 4TL8A 4CDGA 3TMKA 1R2QA 5KHOC 2RHMA 3KJEA 1U9IA 1W0KA 3EWAA 3AQ4A 1X1RA 2ZYVX 1F3OA 1XTJA 4ZDJA 3I3SR 5JS8A 1N0UA 4P4SA 5IK2A 2JLYA 3B8HA 2GDJA 1ZU5A 1N2CE 3M6AA 1HQCA 1WQ1R 2ZU0C 1BS1A 1D2EA 5FR2A 3FMOB 1OH6A 3BAFA 2YWHA 1KK2A 1KO5A 1GKUB 1ZU4A 2GK7A 2I3BA 4UQOA 2NTYC 1O87A 4OL0A 1XEFA 1R8QA 3RNLA 1BIFA 3AVQA 1E2QA 2EYUA 3FTQA 3IPXA 3L0SA 3LBNA 4FCTA 5DGXA 2W6JA 4DT1B 1DO0A 2IYXA 3PEUA 1ZM3A 2AWOA 4U02A 1KSGA 5DN6D 3KZ1E 1A7JA 4NYMQ 2F55A 1DE0A 1OF1A 3A36A 3VR4A 3BRWD 2B7CA 2YWFA 3KUCA 3MAAC 4QHSA 3HU2A 4OHXA 2QY9A 4TSFD 3UXMA 4Z51A 3WNCA 4QXAA 2DHRA 1KO7A 1HY3A 4GT1A 4F4CA 2EFGA 4KBGA 4B76A 3HDTA 2ZRNA 3Q5DA 5D3MB 1CEEA 3O47A 4AG5A 1ANKA 1YZUA 2RMKA 4A8JB 3QXXA 1SZPA 3LW8A 1JR3D 4S35A 4YMVA 1YR6A 4AKGA 5L3VA 2JDID 4HB0A 1IQPA 1JBKA 4U5XA 2ZRIA 5K8IA 4U7DA 1Z0KA 4JS0A 2PZEA 2JGNA 3RS5A 3CM0A 2DWPA 3GEHA 2ZSBA 1D8TA 1QDEA 2WJIA 4ZDKA 4BGDA 5DN6A 4Q4HA 2VHQA 4US1R 2EW1A 4G01B 2F1IA 4PR0A 4CIDA 3KKNA 1TUIA 2OLKA 4FMDB 1ZM7A 1NVVR 4CEJA 1E9FA 2ZJZA 2OCBA 3AKEA 3QKSA 2VIIA 3VHLB 4JLMA 3CX7A 4GOJA 1ZMXA 1IXSB 1FUKA 3B1VA 3IUYA 4TMWA 1P7CA 1EX6A 3U7GA 1Z6TA 2BEJA 1E2NA 1JR3A 1KK1A 3S1AA 3T1VA 5FOUA 1GNRA 3U6KA 1LNZA 3VU9A 4IDHA 4PC2A 2V4ZA 1XB2A 2W0MA 3BIFA 2J87A 4OYHA 4V02A 1C4OA 1R5BA 2ZSFA 3V9PA 5EP4A 3RHFA 4B32A 3TLXA 3MUFA 1OE0A 1YJ5A 3GEIA 1OV4A 1S2MA 2CLDX 4MYTA 5HPYB 1M74A 5CLLA 2C8VA 5DE3A 3SJBA 1QHSA 2IYZA 4URUR 5JRJA 1XD9A 5BN5A 5HR5A 1KI9A 3IHLA 1DAIA 1OIXA 2ORWA 3GQBA 5TARA 5JWOA 1SVLA 3R9IA 3SR0A 3D8BA 3QE0A 4K81B 3OEED 2GBLC 4EJSA 3EC2A 1CU1A 1E2KA 2JASA 2ZVQX 1AZTA 2WWWA 3HJNA 3CH5A 4KBFA 1VIAA 4MKFA 5FTMA 1ZYUA 3K0CC 5LB4A 2CVFA 5HKKD 1UAAA 1HE8B 2FZLA 5HTKA 4FW9A 3VNVA 4G1UC 2GAOA 4H1VA 2FU5C 4C9BA 4KITB 3NBFA 5JRZA 3DOFA 2O8EB 2CCKA 3LRPA 3LQRA 3W90A 1U81A 4JSTA 3FKSD 2W83A 3GLHE 1ZD8A 2HT6A 4HEJA 2G0NA 1E9EA 1E2HA 1VKJA 5BXQC 4P3YA 5C46F 2PMDA 3SYKA 1NVVQ 1Q12A 3HYTA 1DO2A 3RABA 2C9OA 2EFCB 4CT4B 3THXB 3U2QA 4BEBA 2RGNC 1Q0UA 3ND8A 4MQBA 2NZ8A 2VSXA 3QG1A 1U94A 1ZUHA 1U8YA 5GVRA 2F6RA 2ZU6A 4KHZA 2GRJA 2EQBA 2PT5A 3AF0A 2WSSD 4V0MA 1BYUA 4UJ5A 2N1BA 4OI1A 1M7HA 1AN0A 3HP1A 4RFVA 3Q7QA 3EASA 2QROA 4TZ0A 1XWIA 1QG2A 4MUAA 4Q48A 2QBYA 3IHWA 4KCGA 1E2LA 1TQ4A 2QN6A 4D0NA 4KLZA 4CEIB 4JLJA 2QTFA 3QJYA 2GETA 2ODWA 4M1TA 3ZQ6A 2QU8A 4XVQA 1R6BX 2WWIA 1N3BA 1SKQA 2J46A 2PMKA 1BOFA 1XXHB 4G5QA 3TGPA 1TU3A 3QVVA 2IC5A 3A4LA 5AUQA 4OHZA 1KI1A 2FFAA 2IYWA 4JZKA 2REBA 4NONA 4W5WA 3UIEA 3W5IA 4OQLA 4E07A 4MDFA 1W36C 1ZNXA 5K8UA 1KI6B 1WXQA 4C2TA 4JVMA 3U7EB 2GCNA 3UMFA 1YZLA 2WSSA 2XITA 1N6PA 2C96A 4G5SA 3OE7D 2CE7A 1CULC 2KSQA 1G21E 2FZ4A 2B6HA 1S96A 2D74A 4I1SA 3RWOA 3VFDA 3V4RA 4MITA 5ELXA 4L16A 2AK2A 5FUXA 5EXSA 2REXB 3LBIA 2QM8A 4HATA 1EFHA 1UF9A 3NHBA 3UATA 1W44A 1CJVC 4ZDIA 5AUNB 1I4DD 4I1UA 3RC3A 1E0KA 1W49A 2A9KA 2ZRCA 1UM8A 2FSGA 2C9YA 2G1KA 1ZP6A 1MABA 2RGBA 2RGGA 1XRJA 3NBYC 4C30A 1EFRA 3UKDA 3BB4A 2LKCA 4HDQB 3BORA 4KFSA 3RS7A 4EFMA 5JEDA 2ZETA 4LWZA 3ZS9A 5TXGA 4TYPA 1HEIA 4MGIR 3I8XA 5JCPA 4OHYA 3GLGE 2DY1A 2O8BA 1U99A 3IIKA 2OBLA 1BKDR 5JJLA 2Z83A 1HYQA 4OQFA 1WE2A 2ZRGA 4Q02A 3KTAA 2UZ3A 2ZRJA 4IDNA 1WBDA 4ACBA 4TTPA 1TL7C 3OE7A 4DLRA 4LHVA 2AWNA 2E87A 5H70A 5TVKA 1P4SA 4L4UA 1U90A 2N46A 3MSXA 821PA 1OHHD 1P61B 4PQYA 2H7VA 3LAWA 4HB2A 1EFTA 1QHNA 1GKIA 5BN3A 2MSDB 1OXTA 2OESA 1ZBDA 5AJYA 1FPMA 2QMEA 3I73A 1L7VC 1ZJ6A 4O0MA 3WBJA 1G3QA 4DEYA 4DCUA 5FPHA 4TL6A 1HT1E 1IBRA 1XMIA 2QORA 2H5EA 4G5OA 1CXZA 1R0XA 1TF5A 1EWRA 4ZO4A 4C3ZA 4HZUA 1QZXA 3THWB 1G7TA 1VG1A 2G3YA 5JHHB 4LUCA 1KOFA 5D3QA 1CP2A 4B3BA 4PQFA 4K8OA 3O8BA 1S9DA 4P31A 5FTNA 1JPNA 4TQUS 3CPJB 2RGDA 3AEZA 1G4AE 1KJYA 2F9LA 5E7JA 3QBTA 4TZ6A 4M21A 1GG2A 2JLSA 4S2EA 4GP7A 1Z06A 2FSHA 2WVJA 1KI7A 1Z6YA 1DBSA 1OIVA 1OHHA 4IJMA 4FCVA 5J4VA 1A4RA 2IA5A 2GCOA 2XGJA 1SXJE 3KFXA 5KO2A 3KB1A 1SVIA 1P72A 2NGRA 4JBWA 1Z0AA 3TUIC 2VL7A 2B92A 4ZI3A 3I5XA 3U7HB 3L0IB 5DIFA 2AFHE 3SS8A 2XB2A 1ZNWA 3U7FB 3AP1A 2CMKA 3IEVA 3SFVA 2A3RA 4DB2A 2YINC 1WBBA 1DOAA 2GEVA 1P6XA 5B58C 1GL7A 2WWGA 4XD7A 3WMFA 5GADl 4TT3A 3ADDA 3QXJA 1N5LA 4EPYA 1W36B 4ILEA 2PT7A 1ZC4A 1VYVA 4OI2A 5GJCA 4KVAA 4BFUA 1ZVQA 4D6PA 4XOIA 1M6NA 2D2EA 2YVUA 4LBZA 3PUYA 3IQWA 3LDAA 3MWKA 4DKXA 2QTVB 1CR4A 1DAHA 4V0LA 2Q21A 1YZNA 1C9KA 1J90A 3WP1B 3SOPA 4JMPA 2XJ4A 1XJCA 2ASEA 4C2UA 3B1XA 2QUZA 3QF4A 2Z4SA 4M53A 2NO0A 2CNWA 2DR3A 3TJZA 3AVTA 5IT5A 2P5SA 5J40A 5FL3A 3RS3A 1A2BA 2RB4A 1HV8A 1TTTA 1CRPA 1CBUA 4A4DA 1PZNA 3EZ2A 2PL3A 3EA5A 4HUQA 2W2XA 3MG9A 4A2PA 3BOSA 4JLNA 1R0WA 5CJ2A 3X1ZA 1Q21A 3GP8A 1XTRA 4GRAA 4IOLA 1MO5A 1AKEA 3MWJA 3H1TA 2IEYA 5J4LA 2WJYA 4BRUA 5M04A 1UFQA 1FL9A 2ZROA 4HLQB 4JLBA 5C4GB 5FPKA 4MRVA 3K70C 4B2PA 4RFSB 3EIHA 1M2OB 4JLOA 4LDJA 4LC1A 1N6OA 1D9XA 3ZS8A 2FFBA 1KGDA 4JKIA 3KXKA 2J3EA 3VMFA 3NG1A 3LY5A 1V43A 5FUYA 2QZ4A 4B73A 1QHHA 2OBNA 3PFIA 1G5PA 3T1QA 5AWFC 3RS2A 1Q3HA 4D0GA 3AUYA 1YR9A 4M2LA 3BB1A 1KDRA 3CRVA 4AKEA 5JHGB 2RGAA 1NN5A 2VHUA 2IS1A 3WYFA 4B48A 3GJ8A 2VPPA 1Q57A 4IXNA 1Q1QA 5EUMA 4PPFA 5H1YA 2O8FA 1L4YA 3B82A 3H2YA 4AYWA 2Z6VA 4F38A 4JLAA 3NH6A 2DPXA 2F7SA 3A1SA 2CBZA 3R20A 3R8FA 2ORIA 1AS0A 3IEUA 1SXJD 1RZ3A 1AQUA 3TQCA 3NDPA 4IRUB 4JJKA 1DEKA 1BYIA 1JB1A 1BMFD 1Q20A 2CVHA 4DB4A 1IY0A 3C7KA 3L8ZA 5K8LA 1PV4A 1FOEB 4PZLA 4KVGA 1DPFA 1E79D 1FTSA 1T8UA 2F43B 2WKRA 3JZMA 5EE3A 3ASYA 3OIVA 3E70C 2ZRLA 3NVAA 1ZUIA 4N3NA 2A5YB 4WZAE 4BFTA 1W4BA 4HUTA 3QQ5A 4R71A 1SKYE 4QOSA 4KFUA 2WJVA 4Q9KA 5FI1B 2HT1A 1WA5A 2GJ9A 2BMFA 3MWLA 3I61A 2X19A 3KJIA 1NN3A 2FG5A 2BDTA 4EAQA 4X8HA 4KFTA 2XNSA 2IYSA 4OKSA 2DWQA 2EFDB 2ZE6A 3KJGA 5JLJA 3LW7A 1GFIA 4YXWD 2BEKA 4G0NA 1Z0JA 3CKLA 1XTSA 4LV5B 5IDVA 1RIFA 3K9NA 1U2RA 2ZS9A 1BMFA 2V9PA 4OQXA 2BBTA 1IN5A 1NP6A 2QQ0A 5GJBA 3QXHA 2NG1A 2C78A 1XPUA 3CONA 1E79A 2QT1A 3UWKA 4CT5A 2WICA 3H84A 4DHEA 2IHBA 2OSBA 1HURA 2QT0A 3UANA 3A4NA 2GAAA 1EGAA 4EFLA 3PEYA 2FSFA 4QJ3A 1FX0B 2O8CA 4ARZB 4Z8YA 5L3SA 2KI5A 4MRSA 2C5LA 3L82B 3N5CA 4TYYA 4LV6A 1KAGA 3DPUA 3U3OA 1Z0FA 4DC9A 1R5OA 5FOTA 2WMOB 2R65A 2HCBA 3QF7A 3C5HA 1KJWA 2IYRA 3H4MA 1VPLA 1RKBA 3AH8A 4YDSA 5A0FA 2GCPA 2O52A 5G3ZA 1S1CA 3FB4A 1JEDA 4M1YA 3UG7A 2ZQ5A 4MYCA 3SEAA 3B85A 1XD8A 3P4XA 2QAGB 4UNRA 1MO6A 1E3MA 2O0HA 1TX4B 3IQXA 1XPOA 2ZJOA 2CHGA 1ZM4A 3EIQA 3NC0C 3KX2A 4UNPA 4QBHA 3IIJA 2A2ZA 1TF2A 2FV8A 1RYHA 5EXPA 2OE2A 2LKDA 2ZI4A 1RJ9B 1T3LA 3LFUA 3W3AA 1LS6A 1E9CA 4KSCA 2OFXA 4R2HA 2KBFA 4HLDA 3I5YA 1VG0B 2G83A 3GJ3A 1Z5ZA 2FF7A 3O8RA 3IILA 4FD2A 3U44B 4EPXA 1L2TA 2I1VB 3GJ5A 2EFEB 2OG2A 2REOA 2PJRA 1CJTC 1NNEA 3EG5A 4LJAA 4XVRA 1NKTA 3CUEF 2QE7A 2XX3A 1N6HA 4IFBA 1BH2A 3SFZA 1II8B 3CX6A 4C7OB 3AVWA 1I4LD 4A6PA 4GNKA 3BBPA 1YZGA 1US8A 2VHJA 2X2FA 4UXHA 1F2TB 1OXVA 3AKYA 2XTMA 3DM5A 3TR0A 1G19A 1QRAA 3CWQA 1IOZA 2O8DB 3GFOA 5BQ5A 3RLFA 1XF9A 4JL8A 4UNNA 4O3MA 4B3GA 4B34A 1KIMA 1RRCA 3GJXC 1COWD 4PSKA 3U3RA 4ZKEA 4DRZA 4TLBA 3LX8A 5JI3E 3DOEA 3U6BA 2IWRA 3SU8A 1FP6A 3P1JA 4B3FX 1JR3E 4HLUA 5AJVB 1KDTA 3AF2A 1IJFA 3BB3A 4A15A 1Q3TA 1AS2A 1Z83A 2NZJA 3THYA 5DNYB 3RRZA 2IXEA 1GSIA 4EDHA 2D7CA 2OFOA 4EUNA 1W0KD 3GLIA 3WHKA 2YOHA 4LJ9A 3NTUA 4FMBB 4PAMA 1ZW6A 5C4MA 3DM9B 4PHHA 3W3ZB 3K0FA 4E09A 4MUBA 4AC9A 5IK2D 3M4YA 2BBSA 2EVWX 4OQMA 1AS3A 2VRWA 1ZD9A 2P2LA 3HWSA 3WRYC 3ZVNA 1AJEA 2A5DA 2ZANA 2J0QA 3GJ0A 1N6RA 1CIPA 5BN4A 4Q4JB 1YR8A 2C77A 3TVDA 3P26A 1COWA 1YU9A 2IYUA 2FMXA 2QP3A 1Q44A 1Y63A 3WNBA 5FTKA 1JQJC 2XTZA 3G5UA 3N2IA 3CRMA 1J8MF 3CF0A 3OIUA 4G5RA 3RRYA 1NLZA 4CEHA 5KUTA 3CNNA 3QKTA 4Q00A 4M1WA 2NMVA 1KY2A 3NBXX 4A1FA 2XZOA 1XNJA 4C0JA 3L0OA 2A78A 3WP0A 1ZINA 4PFSA 2JCSA 3K09A 1KO8A 1XDBA 2MMCA 2JLVA 5KNBA 1UBFA 3CWZA 1KI3A 2FN4A 2ZSAA 5JI2E 1X86B 1Y3AA 3W5JA 2HXSA 2QPAA 2IS4A 1YZKA 2CEAA 5F3WB 3VKGA 4IKEA 2QL6A 4B44A 5B2ZA 4DCVA 2CL7X 4LI0A 2FH5B 3TUZC 1SVKA 2G9NA 1M1YE 2C98A 4GP6A 2OEPA 4Q9IA 1ZNYA 4W5HA 4LBVA 3O8CA 1G20E 1RYFA 1U98A 4DLSA 4B2LA 1CR0A 1Z6AA 4ASUD 3DHWC 1ZCBA 3EZ6A 2QGZA 1E2JA 1SVMA 4PTLA 2VH5R 3VX3A 4V0ME 2OCPA 3AB3A 3CR7A 3K9GA 3THOA 5J47A 4Q21A 2EWVA 4A6XA 1QVAA 2ZRAA 1Z6GA 2ZYUX 2JIZA 3AGPA 4WXRA 2HJGA 3ASZA 4NCJA 1D2NA 3W34A 1MKYA 2R6DA 3B1YA 1FNMA 5KPDA 1K5GA 2XXAB 1IAQA 2RH5A 4Q1FA 3FPAA 4A2WA 3FHCB 1KDOA 4PZYA 3B78A 3QOFA 5IF9A 1XPRA 3FHOA 1MRNA 1N6KA 3PITA 1NG1A 2PCLA 1IJEA 4Q19A 3MJHA 3K0AB 1GILA 4I81A 1JJ7A 3LVQE 3NEYA 3LV8A 2DBYA 3OF5A 2NO1A 2UVQA 2FOLA 3EAQA 1UKYA 4M22A 4ASUA 4NCKA 2CXXA 3C14C 4BZPA 1OT3A 3FGNA 4X8MA 4DLTA 2HJVA 4PHTA 2J5XA 5DH9A 3I1FA 2D7DA 3DKPA 4D0LB 3EIEA 4XSHA 3QEJA 1E1RA 2IL1A 1QBKC 2ONKA 4EQ6B 4WZ6A 3E2IA 1W2HA 4PSVA 3VKHA 4JVLA 1SVSA 1ZM9A 1KK3A 3QPUA 2OLJA 1GUAA 3CH4B 3A1WA 4ZKDA 1QG4A 4EPTA 4D4MA 1SGWA 3QKRA 3KUDA 4IW3B 4Q9HA 4NTZA 4A92A 5G41A 4CF7A 2IXFA 1QHIA 4LOAA 3RSOA 1ZIPA 4I1VA 2ZJ5A 3AVPA 3SHFA 2H57A 2RCNA 3ADBA 1FP7A 1TPZA 1UKEA 2O8BB 1TNDA 4LJ6A 4URWR 5J5CA 5B30A 5H8WA 1VHLA 2RGCA 4QBGB 1XD2A 5CM8B 3MFYA 2ZM5A 3R8CA 1L4UA 2HDNB 3ECCA 4RD2A 4XIGS 4URXR 4JYCA 4BLQA 2DFTA 4TYQA 5JZVA 2ERXA 1GIAA 1N5JA 1XCGB 2ZYTX 4D4LA 2VYFA 4EPVA 1TEVA 1KMQA 3OIYA 4NKRA 4Q4AA 4BFWA 4BLPA 5FL7D 2I4IA 2OM2A 1LV7A 1OXSC 4OJKA 5FI0B 1MO4A 2CJWB 1GWNA 1XTKA 3HU3A 5DI3A 5SZHB 3QVUA 2J9RA 1AQYA 4MRPA 4B33A 4DLXA 2DCUA 1LF0A 2Q6TA 3HPQA 1XCMA 5HZHA 4QRHA 4MKHA 4RZUA 5CITA 1KK0A 3ZH9B 3HU1A 3EPJA 2AXNA 2ZTSA 5DHFA 1F5NA 3BH6A 5K8TA 4QGGA 2CLCX 5HCIA 1O3YA 2WAXA 1QHGA 4AK9A 2CHQA 3P4YA 1CRQA 3B60A 2IK8A 1A82A 1ZM2A 2GZHA 3FMIA 4Q1BA 4RD1A 1RC8A 4IOJA 3GLHB 3ETLA 5JWHA 2CCJA 5FPSA 2ZE5A 4PC3A 5FL7A 4AD8A 4AYXA 2GCOB 1E2MA 5KSPA 2V8OA 3RDPA 1W0JD 4IVQA 4F4JA 1OB2A 4TLEA 3K8YA 2VP0A 1GM5A 5BW8A 1J8YF 3KKPA 4RCZA 2F1HA 1S1MA 3X1DA 2PBRA 1FUUA 1UKZA 3W8RA 5CLQA 2JJ2A 3OAAA 3AVVA 2YNMA 1AK2A 2AX4A 3PQCA 1P62B 4FMCB 3ZVMA 2V1UA 2GJKA 2PLRA 1IY1A 1SVOA 2K5UA 3B1WA 4TMTA 3NIBA 1T3SA 2VA8A 1Z0DA 5EJEA 1SXJC 2FSIA 4LYJA 4XWKA 4Y0AA 4BRWA 2YHSA 1G291 5EE1A 3RAPR 5E7IA 2IBMA 4HDCA 5FOSA 4DT1A 5KNDA 1EFRD 4NL4H 4BFZA 1T91A 2ZRHA 2JJ1A 3SYNA 3AM1A 3GEEA 2MSCB 4KXFB 3IDQA 1GAJA 5EQTA 3OHMA 3GLFE 2Q3MA 4JL6A 4HAXA 4Q03A 1W0JA 1E2GA 1JI0A 3GLFB 4LPKA 1I2MA 4C0SA 3C41J 2VO1A 4EPWA 1NN0A 2RAPA 2VSOA 4JLKA 4ZCIA 2BKEA 1NJFA 2WWXA 4GBMA 1EESA 4TMVA 3ZIAA 3QY0A 5D3MA 1W5SA 5EP2A 1DAFA 2XTNA 1NG9A 3VTKA 4A8JA 1G3MA 4LHWA 3PIRA 2KE5A 3LLMA 4P33A 5FTLA 3R7WB 3A1VA 2QA5A 1S4QA 4W5JA 2W2TA 3WNDA 2W2VA 3RVBA 3SJZA 2AK3A 2ZUCA 2DB3A 1UADA 3PUWA 2WOOA 5CB8A 2IYVA 1M7BA 2R62A 3QPWA 1FQJA 1NI3A 5SZJA 1DAKA 4F4IA 5LB2A 2XAUA 4BLTA 2IW3A 2ZRBA 3LWNA 3B7GA 2ZR9A 4M4SA 3X1XA 3KQKA 3IO3A 5JECA 3GLGB 3RYTC 5C18A 4M1SA 3G82C 1T5IA 1OYWA 1AA9A 1RRGA 3HYRA 2DWOA 2YKGA 2VP6A 2OZEA 1UPTA 4AI6A 4RCYA 3BS4A 1LB1B 1ZCAA 4DSTA 4IVRA 4D81A 4HAYA 1WMSA 2ZS8A 1DAEA 1E9AA 2BJVA 3SYLA 4OI0A 1XX6A 4B2IA 3P32A 4PO8A 1F2UB 4TQAA 1MR3F 4MDEA 4QGAA 4L8GA 1PUJA 1MO3A 2HF8A 3PUXA 5G53C 2ZI9A 1OFTA 1EXMA 1A1VA 2R9VA 3EXAA 4J0QA 4A0HA 2FGJA 3BFXA 3FKQA 4LZZA 5TDHA 2GXUA 1NSFA 4RD3A 4G5GA 3DO6A 2QGNA 4XD7D 2GVDC 4TT3D 1E9DA 1HQYE 3K0EA 1OH5A 1G7SA 2J0SA 1TQ6A 2IXGA 4HLUC 3VX4A 2PX0A 3U3KA 2ANBA 4ZIRB 1G3IA 1KNXA 2BJWA 1DS6A 1WRBA 3ND9A 5CK4A 2FEMA 1W46A 2P0EA 1D5CA 2NOAA 3BJIC 2BWJA 2QAJA 2GESA 2C95A 4ZI2A 2J0VA 3TQFA 1CLUA 5AJWA 3N70A 2W6ID 5G40A 5AUPB 1LW7A 4KSBA 4BFYA 1SXJB 3AVYA 4D25A 3H0KA 4UKDA 3G0HA 4E22A 2CNWD 2ZSDA 3LLUA 1ZAKA 2R8RA 3KDSE 2O8EA 4DVGA 1N0WA 2E9SA 1WF3A 4GPTA 4JLPA 4CGZA 1LS1A 3A4MA 1D2MA 2QPTA 1E2IA 2KWIA 4MKIA 2NPFA 1KSHA 4DLWA 3ADKA 3THXA 1IN8A 4FCWA 4F7WA 4XWOA 1DELA 3FMPB 3LO5A 3WMGA 2WV9A 2WM9B 4XWAA 3RC8A 3NH9A 4WIAA 3LH5A 2SHKA 2GILA 4PPGA 4B47A 5H68A 5FUWA 1KY3A 3J81k 2GJAA 2ZUDA 1Z07A 4OI4A 5CYPA 3SE0A 3K09C 1U9IC 2GNOA 2W6IA 2C9CA 1JXOA
chains in the Genus database with same CATH superfamily
2VTKA 1JVSA 1LY1A 3BKWA 1SD5A 2VBCA 4JLVA 4JP3A 4MQMA 2VEDA 3G6WA 3F8TA 5CLGA 5CPBA 5ALHA 2W4QA 1CJSA 2EX0A 3KKEA 2C83A 3KVRA 3MMZA 4US0R 1WTAA 3B6IA 1XLVA 3ZTTA 2HZBA 3LXXA 1OBFO 4X8LA 1QOQB 2B9EA 2QYOA 2H11A 1OSNA 4JP1A 3KEGA 4MS3B 2OXRA 4LXHA 5CVTA 3QEKA 5K0FA 4LMPA 3ZV4A 1X7XB 3KUXA 4CXMA 1QDUA 3LQFA 4IYRA 3W8EA 4C7XA 3UGJA 3B9PA 3STUA 1CS0B 4KMMA 1YBHA 1E8NA 1AA6A 2D5BA 5FLXA 5TV2A 1A9YA 2H54A 2NZXA 3B3FA 1CZKA 1GA4A 1V8PA 1NI5A 1NQTA 5I7RA 5L9AA 2W6OA 3D8TA 4MLDA 4MYSA 1G59A 1PVOA 4GYWA 5TLSA 3A26A 1SN7A 4HDKA 3EGDA 3PX2A 2NXJA 4Z2YA 1R1DA 3PR3A 1YIOA 5CBPA 1I33A 3BL5A 3DEKA 6YASA 3U4QB 1H3EA 1E32A 2QK4A 1T8TA 1WSBA 2NSDA 3CJRA 3I2JA 3U4MA 2JGDA 1EBBA 1NP7A 2OK8A 3ENVA 3KKMA 4MKGA 4WBSA 3REFA 2BFEA 2VDPB 3ICCA 2OBBA 4FONA 5G0UA 5LZ8A 2R6R1 3TEFA 1PKXA 2XE7A 4KH1A 4QWMA 1YFJA 4P1ZA 1NJGA 2JD0A 3G89A 2FUCA 2G7ZA 3DV0A 4G0QA 4KIFA 1W1WA 5ICMA 4GOKA 3AP3A 3PK0A 1UT5A 3OTIA 5EESA 2QW8A 1CHNA 1JMKC 3UTDA 3TRIA 4U4AA 5LQDA 3EOZA 4KNYA 5JV5A 1LDMA 2VK4A 2IYQA 3H86A 1E6CA 3I0NA 1FUYB 2VVTA 2Z2YA 2YC2C 3IEKA 3NALA 3GRAA 2NSHA 1G6OA 1FVFA 4QT4A 2PRKA 2Z6QA 3R0VA 4AY6A 4W1PA 3CRNA 2BFCA 3LI2A 4TXNA 3NBQA 4PCAA 3GUUA 1DAGA 2OQRA 3F98A 4GMXA 3PXGA 5HX7A 4YONB 3AHHA 3UB4A 4M8KA 1REQB 5CIQA 4EY5A 5KTNA 2HEIA 5E95A 3WBKA 1ZSNA 3NWJA 1FDRA 4XWYA 2D0IA 2J0UB 1FMLA 3P45A 4NAVA 2DT8A 4PZCA 3ZBQA 3DOUA 1E7RA 5CXUA 3GLIE 3K9CA 1H05A 5KCMA 2HMUA 3E3LA 4DIEA 4ECAA 3KVVA 1ZMTA 3ONDA 1ESNA 1PHRA 4UEWA 2JLZA 3BXFA 5HKLA 1E3JA 1YRBA 1CRLA 1ZN9A 2H51A 3IPAA 4Y2GA 2GZRA 3TBKA 1AQNA 4GPIB 2BCEA 4EHFA 4RQUA 4R7GA 4JEIA 1KR2A 4Q1AA 1RRPA 2RI6A 2VBIA 2XODA 3IULA 1G0NA 3EIUA 3CU5A 4RXTA 1QTIA 3PL1A 4ARAA 5TQ0A 2ZJYA 2JH9A 1GKYA 3HJCA 2XSZD 1FP4A 4WN3A 4ZT5A 5F2NA 2QYHA 2P9GA 2DKNA 2XQJA 3TNLA 3K30A 4IS3A 2F4VB 3HCBA 4Q9DA 4MJ7A 4Q1DA 4R8RA 3WQQA 3VAAA 4AWXA 4AF6A 3NO4A 4Z2AA 3AIMA 2HC9A 1EJ6A 2WWFA 3ULKA 2B78A 2QX4A 2HQRA 2JFOA 4OF4A 4AKSA 3HXLA 4H6WA 5HJ7A 5JASA 3UUEA 3EZ9A 1X6VA 3AR8A 3ESBA 1U9ZA 1WPRA 2POQX 3HB5X 4NJMB 4UPDA 1RWKA 4R6WA 1ECCA 3BCUA 3CB2A 2HUPA 2FP3A 2E48A 2JAWA 2F2TA 3E27A 4ZJUA 3E58A 2A9PA 1QTRA 1ISJA 4P2BA 4ZEOA 1P80A 1SC3A 3NHKA 4I14A 1B16A 4OU5A 4EJSC 2VP5A 1W47A 1PNQA 1DIRA 4WDQA 1U7PA 1EG7A 1NJSA 1K8YB 1X8XA 5IM4A 1EK1A 3V8MA 1QV7A 2XSZA 3LE8A 3PWKA 1FNNA 1WSDA 4REQB 5I8PA 5HEKA 2Y2VA 4C01A 4WT7A 1BGXT 3KV1A 3PD7A 5HIIA 4N5LA 4B2YA 2NUTA 1KZ4A 4A3SA 4JP2A 1Z8HA 2JAOA 2IEIA 2RI0A 4JA2A 5CFNA 2XZLA 1P18A 1KARA 2QE7D 2QENA 2ZJ4A 1Y5RA 5HUJA 3EPLA 3I58A 4ALNA 1ZHOA 1Y9ZA 4TXJA 4UHJA 5AJUA 4BP1A 3E2PA 3DMDA 1NSYA 3SQDA 4R2KA 1C2TA 1T2UA 3FPBA 1T5LA 2AG1A 1EVQA 2H1RA 3RF6A 4Y1RB 1KAOA 3NGLA 1TTPB 4YUVA 5BPFA 5BNZA 2VQ3A 2P0YA 1SWVA 3FFWA 3R9WA 1QS0A 1SVUA 1VFPA 1JYEA 1H5QA 1R6AA 2AI3A 2QTMA 3EVCA 3M1YA 4YJGA 5FUMA 5JJCA 3JWHA 1Z22A 3GJ7A 2PYIA 1FQOA 1RVV1 1YCDA 2C3PA 3PZBA 3QVKA 1D1TA 3VPCA 2F1OA 3OEYA 4CFSA 4CLEA 1X1EA 1SQ5A 3MD9A 1BQEA 4G0MA 2P7HA 4C7BA 2FUNB 2H4JA 2VPTA 1BEUB 4HH4A 4GFDA 4PSAA 3QTBA 2HBQA 5B4TA 1UDCA 5ICEA 4GVLA 4XTRA 3C6KA 4XDZA 1Q0RA 2P79A 3JARA 1WCWA 5IFKA 3K2QA 3P4UA 1II9A 4ZCSA 3E5HA 2WFLA 4S04A 2NIPA 2NQTA 2MINB 3SVLA 2AXPA 2IPLA 2WF5A 5CNKA 4M8IA 2J9XB 4BMVA 4CV3A 3EXEA 4NXNB 1PZXA 4LXQA 4Q4HB 1X0VA 4WN9A 2H18A 2IGBA 5HNKA 3SZMA 4L50A 1GPH1 1ZD2P 1AH2A 2YOFA 1P75A 1U2EA 2XTAA 1Y6JA 1GUZA 4NMHA 1SHZA 4A0FA 4ZMSA 1NLUA 4YLGA 1WCYA 1MCZA 3CIOA 2Q8QA 1GKLA 2PGLA 3DB1A 3DAPA 1ZC3A 3C5CA 3WA6A 4IIJB 2C2WA 4ITRC 4LY6A 1Q7EA 3AY0A 2Y1LA 3GT3A 2RHOA 4MIKA 3UMSA 3WGJA 3AF5A 2A0WA 4JUIA 1TZMA 3OKPA 3PFNA 3DKIA 3H5LA 5C3UA 4A0QA 4OATA 3A6PC 4XJSA 1MZPA 1NVAA 2BM0A 3S1AB 1M8PA 4ZT3A 3UA4A 4B84A 1G8YA 2DFLA 1T0JB 1RAEA 2WLSA 2Z0MA 1TRKA 3L7LA 3Q88A 2H1CA 5DLPA 3UUWA 5FQNA 5KTTA 2P1DA 4BVLA 3R0IA 5GWXA 3P2IA 4AKIA 3MJCA 3L6DA 2JZNA 2XD4A 4IXWA 4M8NE 1UM9A 1OPXA 5F52A 1YASA 1E2DA 1FIUA 4QEDA 1J8QA 5HMLA 2O20A 3R7AA 1IY8A 2XCSB 3WGIA 1O8BA 1OFGA 2EL7A 2V1XA 3EQ8A 1YHNA 4YK7A 2XUJA 2XXJA 2B21A 2OGSA 2IKQA 1H9AA 3RVSA 4EY8A 4O59O 4YMHA 5L8VA 1ODFA 2YQ4A 3ME5A 3KSAC 4MYUA 4HS9A 3ZDXB 5BN5B 2GBFA 1B0ZA 2Q0XA 3QWAA 4ZCMA 5HGJA 2P6RA 2R6AA 3AUAA 1BX1A 3BK7A 4BB0A 1Y8RB 4TUYA 5BR7A 2RHWA 2ZEJA 1GVHA 1WWKA 1NUUA 1R0ZA 3EY4A 4IF6A 2CHEA 1DG1G 2JJYA 3EUAA 4WAUA 3AJEA 4MLPA 3WV5A 3COVA 1KOGA 1QX4A 2I7VA 3K9HA 4AYTA 2B20A 3ROGA 1P8AA 2DERA 4IDGA 3LY7A 1RLIA 3EFOB 3Q3JB 3ZQ4A 1JU9A 5DULA 2OXIA 4U2CA 1CUAA 2XMZA 1HT2E 1ZA1A 1Z4QA 4OGGA 3CNQS 3CCBA 2GAIA 1FJHA 2R6CA 4LHXA 4R8MA 3OOJA 1OI2A 1V35A 1VRCA 1V4VA 3FGPA 3HCAA 5GJVC 1E66A 2OHJA 3UJ8A 2O3SA 1RWOA 2GEUA 5CDSA 4I5IA 4IMPA 3U5ZB 2C88A 1D9ZA 2LBPA 1I8TA 1LDGA 3DC7A 4TWRA 3RS4A 2RK6A 4C0WA 3T1YB 4XX1A 4F0JA 4MX8A 4KACA 4ERNA 1OB5A 3JR3A 1W30A 3LFTA 1H4SA 1QCYA 4RY8A 4D0RA 2FMHA 1ZMBA 3N8IA 4ENVA 5DKFA 3BE4A 4NYJR 2E0IA 2TMKA 3FLBA 3FX2A 1X7ZB 2RJNA 4NC9A 1ONBA 1GAQA 2NN3C 5FO0A 1V1RA 5F23A 3TTXA 4LTMA 2EQ5A 5T4FA 1WCIB 3ZDDA 3KAQA 1RMTA 4F46A 3PUIA 3A8TA 4ARZA 3GP5A 1C80A 1RP1A 3C3JA 1PYDA 1X77A 4OBBA 5DYYA 4D0SA 2XKKA 1QMPA 1LBQA 5E7MA 2XF8A 1ZESA 4OXQA 3T1NA 4TTRA 5JNRA 1NKSA 1U8ZA 1X7YA 1E64A 3D6HA 4YV0A 2XHZA 3TAHA 2FTKE 2HLHA 1JG3A 1DQPA 2DFKB 3DP7A 3K92A 5EAIA 3TI9A 4BP8A 1IWOA 3IAAA 4CMEC 3SM9A 2Q9BA 1C8KA 3T7IA 2IRWA 3UOAB 3EVBA 3UA3A 3HXOA 1QP8A 3OPXA 3L18A 2BT4A 3N0RA 2XF2A 1PE0A 4JVSB 4TQGA 1G41A 4RNCA 3FUCA 2D5AA 3FSGD 3QPBA 2WHPB 4LQ4A 2YV5A 2QAGA 1A2KC 5TMEA 2XNKA 4RLHA 3RTDA 1YRQA 2ISSD 3CNEA 4I55B 4MGZR 4EARA 1T4GA 5REQB 3SDZA 1ZXXA 3MAGA 4M8LA 2GI4A 3EXG1 3VHXA 4CQMD 4DSNA 4FOLA 3SJCA 3MILA 2O14A 1A9ZA 2FPMA 3L06A 5IM5A 1XNQB 5ARBA 2AHOA 2IUTA 2GKSA 3L6BA 3TDNA 2BFFA 2RGXA 4HNTA 4JGIA 2QRZA 3KSUA 3KL2A 2WJAA 4J76A 2QMHA 1O97C 3ELUA 3BWBA 3HM2A 2QMUA 1IK4A 5FBWB 2AN1A 2IOYA 4KQGA 3V5NA 4A9AA 1PJSA 3QEMB 3FFXA 4Y0VA 3V2IA 3V9AA 5E9JA 1HF3A 1AV7A 2YJTD 2YJNA 1TZBA 2I6XA 3D6NB 3GEPA 2E85A 2H4FA 5A7FA 4AP6A 3JQAB 3D3QA 1S3SA 3NOXA 5H9WA 1RQXA 4BE7B 3NZEA 2WNIA 3A6ZA 4K9LA 4MWOA 1DIOB 4Z5XA 1W4RA 4O2AA 1YE5A 1VSVA 1E1NA 3RVQA 4L28A 4FKBA 1VECA 1Y4AE 2UZIR 1XEAA 4NFYA 4I50F 1XN4A 5F1OA 5TT1A 4C7OA 3FSGA 4DC0A 2VJMA 2IYPA 3U1VA 3NOQA 3UT0A 4YT8A 1R6VA 1WEHA 1MZVA 2HREA 3HACA 3MGKA 2DFNA 4X61A 4JOQA 4OYYA 5GV7A 1QAOA 1JIQA 5EZ6B 3RC9A 4CQMA 5AYVA 1AUPA 5KSOA 2WG2A 4IJWA 4OB6A 4TSFA 3UPUA 3MQFA 3NONA 4UTXA 4UULA 1JHDA 3E0QA 4R1PA 1GZHB 3RRMA 4YUXA 1PBNA 2EGHA 4KX3A 3GFRA 3KE9A 4LSZA 3TRKA 1N6NA 1J0AA 4QC2A 2X22A 4AIIA 4UFPA 3AM3A 1A9PA 5ERXA 3LCCA 3O8DA 1VHTA 4PLTA 3W7AA 5BRAA 5B12A 4Y0NA 5FBZA 2JDIA 4YIHA 1VRWA 1KDVA 4OKIA 4UAJA 4GYJA 5J9FA 5FBLB 3MWEB 5B6JA 5CM9C 4MUNA 4ZI7B 2F3RA 1VLHA 4TKZA 1KSFX 4LNHA 3WGNA 3HY3A 2HF9A 5ALOA 3ZZ1A 2PKWA 3G3EA 1GVNB 3DFMA 3FA2A 1D2HA 1O94C 5G4LA 4KWEA 2XQIA 1PQUA 2O2EA 4RORA 4ENUA 5HRUA 3UK7A 4QDKA 1KFCB 1COZA 1DTWB 2EGGA 2FAXA 2O0KA 4JITA 4Q3EA 4RUKA 4UJ3A 3DJFA 4EYOA 4QTYA 2R6ZA 4Q39A 4JYAB 1KI2A 3KB6A 3OJXA 1JNXX 3QLUA 3SHOA 4RC9A 4NE7A 3KC2A 2QI9F 1JDNA 4EPRA 1KBOA 4QM7A 1Z74A 4R9RA 4B7CA 2GZDA 4YCSA 2WJ4A 2OYRA 5J1SB 5EIEA 2YJ3A 3C7AA 2JJ1D 3NIDB 2BTQA 3SSNA 1M54A 4M38A 4J0IA 2Z9DA 2Q27A 3I0MA 4ND8B 5A5GA 4NULA 4KR3A 3NDRA 1I14A 3L8FA 4C0AC 4HAVA 3EUFA 4WXMA 4JUCA 2YHIA 4OPMA 4CG0A 3H5RA 3QW2A 1KEZA 2I4RA 3EG9B 4OJNA 5C81A 3AEKB 2CXQA 1XTIA 3PFWO 1OYVA 1FXWF 1MVOA 3A28A 4JLDA 1P2VA 3Q0EA 4NAHA 2AI2A 1VYTA 2NYAA 1V25A 4ME6A 4OUDB 4WKNA 4CM4B 2CLLB 2QG6A 4I3HA 1WQ4A 1YONA 1M1YA 1N2CA 2HCTA 4L3VA 3R9XA 2OFWA 4C3VA 3DL0A 3UQYS 3ILHA 2JI4A 2KPOA 2P3LA 1UWVA 2Y1DA 5AJZA 4W7HA 1T9AA 2PLWA 1YI8A 1W48A 3M1AA 4LC0A 3CLTC 1E4OA 5LZ7A 1YBAA 5HRAA 5IUKC 3SDBA 1YDWA 4U00A 3BF7A 3MINA 4XDHA 5IAKA 2WWHA 1I4TD 4R7ZA 3N2NA 3FNFA 3SS7X 4GI5A 3TZHA 3QYAA 1LTHR 3JYLA 4KZPA 1MAHA 2YQ5A 4BAGA 1TLLA 3GMTA 1P9LA 3GRFA 4RANA 3EGVA 2ZSEA 3LUKA 4F3CA 2CDCA 4RZ3A 3QF4B 4ENSA 3D2BA 1KP3A 1AGPA 2WJ3A 1HFEL 3TTWA 1DAMA 1O6GA 1XEWX 4YLEA 1XJ0A 5L4SA 4CHGA 5C52B 1OR8A 1E4YA 2VDOB 3FKSA 5H59A 4QAJA 2QL7A 1GU7A 1CLEA 2AL7A 3GIWA 3ZXIA 5JMTA 4HRXA 1LJLA 3AR2A 1XZDA 1OFHA 1U3UA 3CF4G 3MWDA 2WUWE 4I8DA 3MYRA 4UHEA 4BQPA 2AUNA 4IDQA 2J3KA 3PNQA 4S1WA 4ZCLA 4TLDA 3NUGA 3GZTB 1MVLA 4ESVA 1M9NA 3BM5A 4U2KA 1TAGA 4XQGA 1TZJA 1YA4A 2Z2JA 1RKUA 1ZVMA 4ZCPA 4EZBA 3PEWA 1QIMA 4B4KA 2HNBA 4OGWA 3K4HA 3PHJA 3OOSA 4NMMA 4R1MA 4UM5A 1TAQA 4NJEA 6PFKA 2E4YA 1ZWKA 2XDQA 3W5AA 3RF7A 3L8YA 4MVXA 3RS0A 5ESWA 4OAOA 2C5EA 1CUSA 3QVOA 5HOQA 2I2AA 2PRJA 1E1KA 2YFHA 4IF4A 3VSBA 4QDTA 5CA0B 3W6PA 1T6BY 3NPAA 3N2GA 4ZHQA 4KN8A 4BMPB 3DHNA 3W9YA 4U7GA 5CVDA 5I5GA 2Q5QA 1RE1A 5JMOA 4BE9A 3UB2A 1L8QA 4HN4B 3EF1A 1X9IA 2WJPA 4WEOA 4UU1A 4N39A 1XZEA 4YDHB 2E18A 2OGTA 3MMSA 3V8BA 4OLFA 3E7FA 5KDLA 2HGZA 2PFSA 4X97A 2O8FB 3H9EO 1WZIA 1DJLA 3EQ2A 3OQ6A 1W4AA 4G2NA 1GRQA 3FBGA 1HYGA 2C1XA 1G1MA 1TJYA 2D13A 3BILA 3CA8A 3H5OA 5TF4A 5LJLA 2WMYA 5M29A 3KALA 1YMQA 2P2GA 2H17A 2BC9A 3RU9A 3DFKA 4EHAA 1ORRA 2VJYA 4QPPA 3ADCA 1E3DA 3ZZTA 4XQ9A 1KJNA 1NPYA 2HHAA 1MRZA 2NO7A 1BEZA 3G1UA 4UUBA 4ER7A 3TPFA 4MB6A 2ISCA 3OO0A 1VCHA 3D4IA 2G80A 4EJ0A 1T6NA 4IEFB 1U3FA 5IDYA 1V8FA 3T7SA 3MMPA 1HFJA 4GE0A 2JA1A 3CHYA 3E7WA 1PI3A 3ESZA 2ROQA 4V1CI 1JE0A 3Q8XB 4WDRA 4M89A 1MHTA 3VZDA 1HH4A 1LSJA 1JHZA 1RHUA 2FFHA 2O23A 1HETA 2SNIE 2YCBA 4FT2A 1AO0A 4Q18A 4IXMA 4NS1A 4HGYA 1M0TA 3DDCA 4GI2A 3CSSA 1T1SA 1Y7TA 3DKKA 4P5DA 3T3IA 3TRHA 3WZ2A 4WVFA 3VO9A 3UUFA 1C7ZA 5E1DA 2O7NA 1ZSYA 2A1UA 2UKDA 2OILA 4MAAA 1M2VA 1H2YA 2PT6A 3FZYA 2P9QA 1NVTA 5B58T 2J3MA 5F3RA 3ZW8A 4I5GA 3HZRA 1RPZA 4MKRA 4C0KA 2IUUA 3QPAA 4ZT2A 4D80A 3KQWA 1AUOA 5P8WA 2Z8YA 4GXNA 1JMYA 2A57A 1NM5C 4EOGA 1KZYC 4GOMD 2VHVA 3D7MA 1LSSA 5BRNA 4G41A 2YOGA 3AVUA 2D06A 1UMBA 2Q99A 5PNTA 4AP9A 3E1KA 4V0SA 1U0NA 1HDIA 4KYIB 4DCCA 2JGRA 5BPHA 3GLHA 3DMTC 4U2BA 1MT0A 1EJ0A 2IHYA 3ZWBA 2Z08A 3OY2A 4RIIA 4BEJA 4F9GA 2HU7A 4GC9A 3GD7A 2W2MA 2Q8PA 3CNLA 1UJ2A 3I52A 3WGHA 2KLHA 4K2HA 3U81A 5LBTA 1SK9A 4TMKA 3ZI4A 1E8DA 4BPBA 4D9CA 1VYUA 3UGQA 2D5CA 1PEAA 2XUQA 3H9CA 3OO1A 2OO5C 1A69A 3I37X 3V7YA 4DY6A 3LDHA 1G7CA 2KJQA 3EQ7A 2EW2A 4LYEA 4OHOA 2JAQA 5HVNA 2WIFA 4TMZA 3DXYA 3LHDA 4PQRA 1GGKA 1YKSA 1SIBE 2WT4A 1VQ1A 1FLVA 2UYHA 2D7JA 5LUBA 4EKNB 1LPAB 1FLDA 1KJ8A 4LXUA 2RONA 3S8EA 2IYEA 4HG2A 3AI2A 3F6PA 1ZSVA 4RMGA 4B71A 3DEFA 4ETIA 3SZ3A 3FTEA 1SHUX 1K06A 1XSEA 4R40A 3O2NA 5EP1A 3LYAA 3WL8A 2AW5A 1UC8A 1XZLA 2ZKIA 4XX0B 1HOXA 5DYNA 1JA1A 3S0JA 4LFAB 2XNJA 4DPKA 2P78A 2Q7OE 3FCEA 3DBOB 2CDRA 1NBWB 4NBSA 5EKUA 1P7VA 2V3CC 4Q66C 1C0KA 3GMSA 3L0YA 1MXFA 4P53A 1NY6A 3R41A 2C0CA 1BU5A 4PHGA 3CZQA 1IATA 3U7JA 4KWTA 3ZZMA 1XQ6A 2QSYA 1FYWA 1DJNA 3ESCA 1RRVA 4UD6A 3EDCA 3ZZUA 4G9GA 5HUQA 4BNHA 1QX3A 1TM1E 3ISJA 2JEYA 5A6SA 4YASA 4MS4A 1Q6ZA 3ANLA 1WOMA 3AUTA 2BRUC 2QR3A 3DEJA 3MCVA 4HBZA 4QYTA 4DDMA 4YAKA 1XU9A 3KWJA 2CL6X 4US2R 1M6HA 2M6LA 4CKBB 2Q4EA 4K9KA 3WLHA 1IN7A 3DZ8A 3USES 1GL3A 1XMOB 4IL5A 3ZCQA 3CBGA 4Z8XA 1JALA 1RZVA 1YNSA 4GPEA 4Y2RA 5E1BA 1YB7A 1TCCA 1SNYA 1L5KA 1NF3A 3F0TA 1Y1SA 2JGFA 4H1UA 1H22A 1P1CA 1E0SA 1E1QD 2H1LA 4XGKA 2VK2A 4YWHA 2INGX 5LXTF 1Q19A 1VI5A 2H1HA 4RW0A 4BUCA 1N77A 3EUEA 3KR9A 1ZI6A 1F5SA 1PR5A 5FYDA 4P7BA 1YULA 4NQRA 3OEHD 2QW0X 2AMVA 1LPPA 4FI3C 1ZH4A 2HA6A 2JI9A 2J59A 4QYIA 5L4LA 3GLGA 1U0OC 5ARCA 5C0OE 3ZZNA 3TGLA 1ZA2A 4PLZA 4JKOA 3C1OA 2ODQA 5DBGA 3N8HA 4DQUA 4E2ZA 5JATA 1CY6A 1TEHA 3BD8A 2BGIA 4LHSA 1T1GA 3U4HA 4D42A 3AL3A 1FXSA 4HPJB 3VR6D 4AVYA 2YWDA 2RD2A 3F8WA 3LYLA 3KD2A 2QQ5A 1P2UA 4QUIA 2AS0A 1QRUA 4PAOA 4O8ZA 2X8BA 1GPAA 3FYUA 3THYB 2IITA 4UU0A 4AXBA 3ZLJA 1N57A 5TX7A 2D0OB 2FDCA 4J8PA 3FSEA 3AF1A 2OV1A 4LHZA 3VYSB 1GZ5A 4MHTA 3K0CA 1I3MA 4IEEA 4K3UA 4OQQA 4Y1GA 5H0IA 4YREA 5TB5A 1ND5A 3KEFA 4D92A 3X1YA 1VC2A 3WA7A 3K0FB 4B3DA 4RETA 3DMRA 4HP8A 5B64A 4BNYA 1ODJA 2FPLA 4EMTA 5ED4A 2AT1A 1WZNA 3VTAA 4PPNA 3ZEIA 4I4TA 2WZQA 4KYVA 1M72A 3KZVA 3EXG2 3IDFA 1CQJB 1FRQA 3CLVA 3IRUA 4JJ8A 4UXJA 2LE0A 4V0NA 4WINA 5JCZA 3LLSA 4Y2XA 4I8IA 1NWHA 3MTIA 5DTEA 3U49A 2DQYA 3AFNA 3KXDA 2B5VA 3QV1A 2ADMA 4GKBA 3RODA 3WHLA 5IEBA 2CB0A 1D09A 3DP9A 4CMHA 1QWOA 5CMLA 4WBNF 4O5OA 2C99A 5T6MA 2P67A 4BWVA 4FD3A 4Y2TA 1J5PA 1MN6A 1UOOA 4C3OB 1MD9A 1Z47A 4Z86A 5MF6A 2AC4A 3OX3A 3FFAA 4N49A 2F3UA 3RR2A 5A5DA 2BEWA 5BOSA 1GOTA 1O08A 4KDRA 3KKQA 1EGQA 1OFUX 2L18A 3A2KA 4ZVPA 4BZZA 3AOEA 1Q0SA 1E4VA 3OZTA 3C5WP 1TYCA 2DYKA 2NUAB 2QD5A 1Y82A 1CUYA 3DWGA 4X1KB 4BNDB 4NZ9A 2WHQA 2DC1A 1MX3A 2W2KA 3RIXA 3T3HA 5JC1A 2J9FB 1VG9B 5JYCA 4FFBB 4IY1A 4BFVA 4OP3A 2UVPB 5CLFA 3GLUA 4YP1A 4Z0HO 1D7AA 2A8YA 3T61A 4CF4A 5KYXA 3HCCA 4PZPA 1DLIA 1LFDB 1IN4A 1I2DA 4HEA6 5G02A 4BKUA 4DHWA 5KOIA 4PCUA 5I51A 4YP6A 1T36B 4WEQA 4PYQA 3BKXA 2PG3A 3TZBA 1VP3A 1EFAA 1FXUA 3HJRA 2REQA 4ANFA 5A4JA 4CIYA 1F17A 4XR9A 3SJAA 3G9UA 4ESEA 1PR6A 2GPAA 4GI7A 4B6EA 4DV3B 2VZEA 2PX2A 1BMQA 3KKOA 4M83A 4TV8F 4ZTUB 3RASA 3DLTA 4RHFA 1XA3A 1I6MA 5JCOA 1U6KA 1INLA 3EY9A 1JXAA 2KM1A 3ZHXA 2I91A 3G7SA 4HDAA 4O4IB 3MWFA 4HFRA 4OXIA 521PA 4GL2A 4FPXA 3NHLA 3EZYA 4AN4A 2ZT6A 3TNDA 1D6NA 3UMCA 4POOA 1WXWA 4QVIA 1N1MA 1OKKD 2FN8A 1RXCA 2SECE 4H3HB 5DX0A 1SUIA 4H27A 1ZKDA 1HYEA 4AJ1A 4YXWA 3HADA 3TW8B 3U0BA 2F3TA 3WC4A 4BQOA 1PG5A 1EM8B 3UWSA 4ZYZA 4RTRA 1KORA 1G9SA 1CE8A 1VMAA 3VR3D 1VB5A 2GD1O 3JPYA 2BZ0A 3RVMA 4DUGD 1YI1A 1QV6A 3L2OB 4EF4A 4Z3KA 1C3JA 1SULA 3CZMA 4Y2SA 1LCIA 3RH0A 5F9MA 1U3GA 3FJOA 3PDHA 4BAUA 3U4GA 2XUGA 2HXYA 3G5AA 4DC1A 2X4IA 1EGMB 1PUIA 2FY8A 4XGRA 2AYXA 3R7SA 4HAWA 3VPSA 4EUFA 2OM6A 4ZQCB 4NYIR 3TPCA 2Z5FA 5JNWA 4AO7A 1JFFA 3SXUB 2FWPA 2D59A 2B2XA 3BL6A 4G09A 4IDOA 2ID7A 4NNJA 1HT0A 3JASB 2YIVX 3AF4A 1OKKA 4BASA 2RKOA 1YZTA 1APBA 3EAGA 4AUNA 2I1WA 2VQDA 2O2SA 3S99A 3FNEA 1WP9A 2G9ZA 4YMTA 3L41A 4WADA 4RJTA 3IGFA 5DI9A 5D1HA 2DUUA 1LF5A 2HB6A 5DW3A 2OA0A 3VR3A 4ALKA 2X2EA 5JWRA 4TL7A 3ZD7A 3CY6A 4X6LA 2DPMA 4ZANA 1FYDA 1NZFA 1TJPB 4W4TA 4AWBA 1M10A 3U37A 4KK4A 4IOMA 3Q9NA 5JZSA 1E69A 4LHYA 3TL2A 4YRFA 1AM4D 3O3NB 2GVNA 3TD6A 3O1HB 4UBJA 4TYNA 3OA2A 4ZPJA 1GQ2A 4INAA 3PX7A 3E4CA 3SBEA 4LEIA 1EWKA 4D9BA 3KL4A 1ZGGA 5AVWA 5EIWA 2PQMA 1AV6A 4MVJM 2C2OA 5IZ4A 2X0NA 5J5AA 4BX8A 5ADHA 3MB8A 1SUAA 2JVKA 4EATA 2V54A 4GR4A 3CVVA 3KJXA 2W2LD 3T3NA 3D0QA 1PJ4A 3I9OA 1YZQA 5AVRA 1F9EA 4L4YA 2LNDA 5BYJA 4AWAA 3F4BA 1QANA 1NBMD 2RHJA 2HADA 3HJUA 1P4JA 1JIUA 4H7PA 4Y9DA 4ABYA 1GUFA 3ZCUA 3FIJA 4QQKA 1TECE 4C0QC 5DI3B 2OLEA 4Q6BA 1WXXA 4EJ2A 2C4MA 4JZYA 4KYTA 5C3MA 3NHYA 1L4BA 2ZYDA 2YICA 3E1SA 1WOYA 2QX7A 1PVVA 2C82A 3SIXA 1GYPA 4OL9A 4IHJB 1X1SA 2K2QB 2N42A 4RKFA 2VFAA 4P93A 2I67A 5AW5A 5TPZA 4F8JA 6REQB 4FC7A 1ACLA 3IOYA 1WL8A 1I3NA 1QHYA 2UUPA 3D6VA 3TRDA 1M1ZA 4OSEA 4LCEA 5AW9A 4Q37A 3ZJ4A 1I0IA 5IASA 5DK6A 3DNFA 4DGQA 3IAEA 3V55A 1DARA 3RK0A 2W2LA 1X3SA 3FCOA 4IV5A 3VYWA 5IAOA 5IVKA 2JZOA 2CWWA 2QUBA 4BE4A 1E61A 1VLJA 1YZFA 1UDWA 5CVCA 5TQJA 3RS9A 4B4OA 2HMWA 3B1KA 3L8GA 4TL8A 2PUJA 4CDGA 3TMKA 1R2QA 1CUFA 3DFIA 2JBHA 2RHMA 3KJEA 3OQIB 3AQ4A 5HW0A 1X1RA 1XO1A 4EW3A 3DOIA 1C1HA 4CR6A 1J49A 3I3SR 5AHOA 5JS8A 3EJ6A 5LBUA 4UCFA 1J5XA 4B80A 2BGKA 5IK2A 2M1ZA 2R751 1BXRB 3B8HA 1PO7A 1RXIA 5HZMA 2JLYA 1AF4A 5U4QA 1LK0A 3PD1A 1ZU5A 1N2CE 3HA3A 2XWQA 1FFEA 4UOEA 1HQCA 1OQAA 1WQ1R 5IFLA 5KEIA 2D6FA 4WZZA 5GGYA 1XDGA 4MGEA 1YJXA 2Q6IA 4M76B 2FEXA 1JG2A 1KK2A 1GKUB 3P9QA 3RGGA 3W9UA 2I3GA 4EDFA 1DJOA 4DJJA 2VDQB 4Q4DA 1BIFA 3AVQA 3FTQA 3IPXA 3LBNA 2CLMB 6CHYA 4O08A 3LCUA 4BV9A 1WHSB 1V47A 3I39X 5KJ6A 1FRZA 1KSGA 4Y2UA 5AQEA 4C3UA 5DN6D 4G4SO 4NYMQ 5ALQA 4EG3A 1DE0A 2A9OA 3VR4A 4D9KA 2NVUA 4UEKA 2H0RA 3G5MA 4QHSA 4YYEA 2P6MA 1S5PA 2Y1OA 5KQSA 2PGJA 2GM4A 1FVXA 4MQ5A 3SVZA 4RE5A 4CTJA 5IF3A 1Z33A 2W8ZA 3AW8A 4NFHA 5AW7A 1B8UA 1OREA 2OZKA 5COAA 5KYWA 4KBGA 2C8KA 1P1KA 1D5WA 2VDJA 2FETA 5AKJA 4B76A 2ZRNA 1U6JA 4L7VA 2IP2A 2VUTA 5D3MB 5JNTA 3AINA 2R7LA 2CWDA 4E4YA 3FNRA 1U63A 4J1QA 3COJA 4IPTA 1ANKA 1YZUA 3FDXA 3IHKA 3IQEA 1SZPA 2NT4A 4I6EA 4BZWA 1QP7A 4GOOD 1YR6A 4J4HA 3TS1A 3BA1A 2MWMA 4M7OA 1WDMA 1AB5A 1NA5A 4G0YA 3OKCA 2PRYA 2ZRIA 4RVHA 4WOBA 4ZZIA 5BWLA 5IABA 3RS5A 3CM0A 3VSEA 3UGKA 4FP9A 3BZUA 4FYIA 5EWLB 1J42A 3NYWA 2YMLA 5DN6A 1SBTA 1P4HA 4TV9F 4US1R 4G01B 3F90A 4IDBA 4ZOLB 2F1IA 5K3FA 3VPFA 4D46A 1GSOA 3RSCA 2BUAA 1DFGA 4LW8A 4M9UA 3HUUA 3IP8A 3KKNA 5D51S 5E0OA 1TUIA 4ER6A 5DM0A 5AQ1A 4FMDB 3RM3A 3TCXB 2PUTA 4FQ7A 4TKVA 1L7EA 3EDMA 4GS5A 1L4HA 1E9FA 4G1VA 2M1XA 2OCBA 3BD6A 3LXUX 1W88A 1LPBB 3OFVA 1WO8A 3NHUA 5BUSA 1A9XA 1ZMXA 3H99A 1FDIA 1IXSB 1I4WA 1FUKA 1H1LA 3IUYA 4ZRNA 3WWEA 3GUYA 2XVXA 3II6X 3O38A 3P0EA 4MJLA 3TTUA 1QK4A 2QJWA 2ZK7A 4CIVA 1JQAA 2HBRA 3SF8B 5THXA 4MQFA 3LBYA 1GUDA 3T4PA 3VNAA 1VIDA 4B7XA 2ZAGA 5FAXA 2MYPA 5AXDA 2APJA 4IDHA 4PC2A 4DPMA 2ABWA 2V4ZA 3K6KA 3OZEA 2X58A 3FI0A 5C34B 1QH9A 4OYHA 2BSAA 2AW3A 1R5BA 2NVWA 1AG9A 3K2BA 3RU3A 1U0EA 1Z6ZA 3V9PA 4F8EA 2XIQA 4W8HA 5EGNA 3TLXA 4ZOEA 1DO8A 2YXPX 4B6PA 1OV4A 4TS3A 2AI1A 5HGXA 5CLLA 1JIVA 1RQPA 2QRQA 3SJBA 1QHSA 3CZRA 3O93A 5BW6B 3IUBA 2AZTA 2AH5A 3BIJA 2B4QA 1XD9A 4BJ6A 1ONPA 3IHLA 2AYZA 4DDKA 1OIXA 3GQBA 2VXBA 3MUEA 2HU8A 5ALWA 5TARA 2HRBA 2PZLA 3IXMA 4F86A 2GARA 1RBQA 3UMBA 3R9IA 3ETHA 1OJ7A 4WKGA 5T4HA 3OOHA 3D8BA 1IQ0A 1JHAA 3T7AA 3QE0A 3OTQA 3OEED 2GBLC 4DQDA 4EJSA 1KZ1A 2I6GA 5DWQA 1CU1A 4TTIA 4D57A 5AM2A 3RWBA 2JASA 2H3EA 2HSEA 4MKFA 4BMYA 2VQEB 2J3DA 1KVRA 5HKKD 2CVFA 4YCDA 5FI5A 2FZLA 3U9SA 4FYXA 4M7RA 3KYCB 3HUDA 1IZ9A 5ITWA 3I34X 3KDAA 3HY4A 2WLTA 2GMWA 3EQ6A 3OZGA 4GR5A 3DQQA 1U81A 2WIDA 3KQPA 2AFRA 3GLHE 3PPWA 2PZKA 5EQDA 2E4XA 5K3OA 4KE9A 4KQIA 3B6KA 6LDHA 2ZIXA 2JFUA 3ETNA 4NS4A 3AEUB 4UREA 1H1DA 2ZOSA 4P3YA 5BXQC 1RQRA 1DO2A 1JZSA 2C9OA 2QAIA 3HYTA 2C5GA 1Q77A 2Z98A 1FFCA 4KEAA 1UBKS 2DR2A 2EZTA 3GZNA 1G20A 4MQBA 2J08A 4NWIA 3D02A 3FF4A 2ZJ7A 1WW2A 1A8QA 2A59A 2IVZA 1BMTA 3EVEA 4QQRA 5SYAA 2E4VA 4KLRA 3LGAA 2EQBA 1KC1A 1V11B 3OSUA 1L4GA 5IJXA 3HWX1 1DKQA 1EI9A 3NCHA 3RFVA 3X1MA 5C9ZA 3UMMA 5KB3A 2G08A 2QTGA 4L1KA 4W5QA 2W6ZA 3WGVA 3SC2A 1W4ZA 3EASA 1KRWA