3H2YA

Crystal structure of yqeh gtpase from bacillus anthracis with dgdp bound
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
313
structure length
309
Chain Sequence
b'DDDFLRILNGIGKSDALVVKIVDIFDFNGSWLPGLHRFVGNNKVLLVGNKADLIPKSVKHDKVKHWMRYSAKQLGLKPEDVFLISAAKGQGIAELADAIEYYRGGKDVYVVGCTNVGKSTFINRMIKEFSDETENVITTSHFPDLIDIPLDEESSLYDTPGIINHHQMAHYVGKQSLKLITPTKEIKPMVFQLNEEQTLFFSGLARFDYVSGGRRAFTCHFSNRLTIHRTKLEKADELYKNHAGDLLSPPTPEELENMPELVKYEFNIREPKTDVVFSGLGWVTVNEPGAKIVAHVPKGVSVSLRKSLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase family protein
publication title Structure of YqeH GTPase from Bacillus anthracis with dGDP Bound
rcsb
source organism Bacillus anthracis str.
molecule tags Hydrolase
total genus 76
structure length 309
sequence length 313
ec nomenclature
pdb deposition date 2009-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3h2yA01
5F2EA 3U5ZB 2DFKB 1U9IA 1SULA 3OE7D 1W7AA 4M1KA 3NDBB 3A4NA 3K8YA 4PQFA 4RCYA 2CNWD 3T1QA 5K8UA 5M04A 4Q4HA 2OILA 5AUPB 4RZ2A 5E95A 5A0FA 3GJ3A 2JJ8A 4CEHA 3QKSA 3CWQA 1YZQA 2WWFA 2ZPTX 4J0QA 5JS8A 2J0VA 3CF0A 1LF5A 4ZKEA 5C4GB 3EPHA 1X3SA 1QDEA 3GLIE 5DO9A 3V4RA 2YC2C 3W3AA 4NYJQ 4CYMA 1C9KA 2Z43A 3MWYW 3P1JA 2GEVA 5JEDA 3FVQA 2QROA 2QT1A 4PO8A 3PEYA 1LS6A 2Z4RA 2N42A 2XXAA 1GRRA 2PCJA 1S96A 1TNDA 2WPDA 4I99A 3AVVA 3TMKA 4HLCA 2GILA 2GEDA 2RHDA 4D0NA 1BS1A 4L9WA 4HDOB 1Q1ZA 4QGAA 3ASZA 4AWXA 3VTKA 1S1CA 3X1WA 4DLVA 4WAUA 1HEIA 2J87A 2R9VA 1ELOA 2ZJ2A 2O52A 3ZZUA 2BOVA 3QKUA 4LJ6A 2CHGA 3FMPB 2IXEA 4EQ6B 1XEWY 1F5NA 1SKQA 4P0TA 1IAQA 3TUJC 2VP9A 1GKYA 1P72A 3Q72A 3C16C 3OEHD 5H1YA 1IXZA 2BJWA 5C4MA 5EE1A 1UBFA 2MMGA 4JVMA 3O47A 1ZJ6A 1FZQA 2EFGA 3NH6A 2OSBA 1TX4B 3B78A 4GI7A 3BXZA 3LNCA 2JLZA 3BERA 3THWB 3GD7A 2N46A 4GZLA 3EPKA 2GETA 3FTQA 2IYWA 5LPNA 2C2HA 3KKPA 3L0PA 4NYMR 3QUSA 4JLAA 3F3YA 5FTJA 2GXUA 4TMXA 2ZVPX 5BN4A 2YWEA 4M9SA 2OFOA 3HYTA 4WBSA 3U2QA 4BGDA 1JALA 2AD5A 1E1QA 3A37A 1ANKA 2FH5B 3CRMA 1N6HA 2F7SA 5EE5B 3WBJA 2WSSD 4IOJA 1XTRA 5A4JA 3KQNA 1WBDA 5FPSA 3EXAA 2H18A 2DWOA 3NC1C 4IDNA 3A58B 3A1VA 2ZE6A 5CYOA 4TQAA 1XP8A 4LWZA 2R62A 1E98A 5G40A 1XXHB 2ZRMA 1OKKA 3TSOA 1AK2A 2I4IA 5HCIA 4JSTA 1MRNA 2IEZA 5LDDC 2R8RA 3CX8A 4V0OA 4W5JA 2CBZA 3GLIA 1RJ9B 1TQ6A 4TMZA 4DLSA 4JLKA 1QF9A 1KO1A 3NVAA 4LOAA 3EIQA 4MUBA 4KHZA 5CJ2A 4MGYR 3ZH9B 1OB2A 2PT7A 2RCNA 2P65A 4QBFA 4TL8A 5E7MA 5SZKB 2PMDA 3DMDA 4DKXA 3ZQJA 1YR6A 4QJ4A 4BFXA 2G83A 4CRWB 4F38A 1G5TA 5FBWB 1E2QA 1RRGA 2R2AA 1K6MA 1EG7A 3IIJA 4V0ME 4NBSA 2ZJOA 3KJIA 1SXJD 1LB1B 1VCOA 1DVRA 1NRJB 4U02A 1RRCA 1T8UA 4I1VA 1VIAA 2BV3A 2RKOA 4WA7A 3RHFA 1NIPA 4B34A 3CO5A 2LKDA 1MO5A 1OFTA 1WA5A 4HLQB 4D25A 3BBPA 3F5FA 4M1MA 5KSZA 2J7PA 2XTNA 4FMCF 5TMPA 4LC1A 1BMFA 3A36A 1Q0UA 1W1WA 5EXXA 5L8VA 3EZ6A 1E9SA 4LJ5A 4DT1B 3GLFB 4C0BA 3UMSA 1RRFA 4IDHA 4KI0A 5CM9C 4BEBA 5C1BA 2MSDB 4EKDA 1XTQA 2VP4A 2FV8A 2FF7A 2OLKA 1N6PA 3CPHA 1Z0FA 5DYIA 2R65A 4PZLA 3VHLB 2NO0A 3DZDA 4YXWD 4GMXA 4S35A 4Q7JB 1V5WA 4M9ZA 3ZZ0A 5IDVA 3PENA 4EPYA 4XVUA 5JCPA 3K09C 5L3QA 2ZR7A 1P9RA 2ZU0C 3ZIAD 3PUWA 1DO0A 2R6GA 3M4YA 1IN7A 3VMFA 2ZYUX 2ZRJA 3QXCA 1E79D 4HYYA 1VKJA 4KCGA 3SI7A 3WP0A 4BFWA 1HT2E 4DB4A 1EFTA 2Q3FA 1Q1BA 2B92A 2BBTA 3GLHE 5JRZA 3MAAC 3THXB 3B9PA 3AP3A 2IYYA 4HLDA 4WIAA 1Q3HA 2IS6A 4US0R 1EGAA 3NDPA 2V9PA 1JXMA 1IONA 3QOFA 3X1DA 2VF7A 2V7QA 1IY0A 2YKGA 2ZYWX 2AXNA 2PZGA 5KSPA 1HYQA 4DDVA 3UWOA 1F2TB 4EFMA 1EFRD 3JZAA 4PSVA 1OYYA 5DN6D 2HJGA 1TAGA 3WMGA 1XJ0A 4C0KA 4Q1BA 1ZRHA 1U98A 2WWHA 4TL7A 4V0MA 2WJHA 1M74A 1OSNA 2J1LA 3BH7A 4JS0A 2QBYB 5F9HA 3DVLA 4FWIB 2GK6A 1X8LA 2ONJA 2O8DB 2AX4A 3MGCA 2EWWA 1E9RA 3CRRA 4JIMA 1AZTA 4JLNA 2QTHA 3SJZA 1K5GA 4YLGA 1M2OB 3H0KA 3VU9A 3WYFA 4P4TA 3IEUA 3H86A 4ASUD 3ZVLA 2JJ1D 2ZM5A 1O3YA 2PEYA 1RPZA 1DAEA 2C96A 4Q02A 4HDQB 3PUXA 5TV2A 1XEXB 4Q5IA 4LX0A 1NN1A 4QGHA 2H57A 4B48A 1OH6A 1WMSA 2CJWA 5AJXA 4JBXA 4KU4A 1ZU4A 3KKOA 3I92A 1SVKA 3RS0A 2EVWX 4F4CA 3B5JA 1J70A 4BRWA 3PIRA 4CEJA 4IEEA 2OV2A 5J4LA 4RZXA 1HH4A 2OZEA 4AKIA 4CT5A 1FMLA 2HUPA 2BCJQ 1FP7A 4FMBB 2WWXA 4TQUS 3KB2A 2NZ8A 1YZNA 3QEJA 4G0NA 4JL8A 2JIZA 4LCBA 2IYZA 3UK6A 2RGAA 2PCLA 2JLWA 1XCGB 4RD1A 3TNFA 1JECA 3GLHA 3A8TA 4PHHA 1RIFA 2AFHE 5GJCA 2JLRA 2DB3A 3FE2A 1H8EA 2A30A 1ZC4A 3MG9A 1E9BA 5FUYA 3B1VA 2PJZA 3L2OB 1XU4A 4HB0A 1J8MF 5EUMA 1RFLA 3SU8A 1Q1QA 1UEJA 3CPJB 2XZLA 3RWMB 1IJFA 4MDEA 1ONBA 4A6PA 4B71A 1KI4A 2JLUA 1G3MA 1VCIA 5FUWA 1P7CA 1AN0A 2ZRBA 4JZKA 2NPFA 1UDXA 2O8FA 2WOJA 2IYXA 5JWOA 3U4QA 2X1VA 1U81A 4OK3A 4DSUA 4G5SA 2ZE5A 4XSHA 3K70D 2CE2X 4UJ3A 1E9AA 2VHQA 1WDTA 3U44A 1UEIA 4I4LA 3ND8A 4TTRA 8OHMA 2ZYTX 3KQHA 5C46F 1JR6A 1XTKA 1HE8B 2DYKA 2WJJA 4WXPA 1Z29A 3OIVA 3B9QA 3HU2A 3QXSA 1F2UA 3LO5A 1RRPA 4P32A 3WMFA 1II8B 2CK3D 3OFND 4TTPA 2VA8A 5FR1A 5BN3A 2JJ2D 3OEED 1JB1A 1GNRA 2HV8A 3B8HA 4LJ7A 2FMXA 1XMIA 2QORA 1KDPA 3MCAA 5J5CA 1P2SA 4L9SA 5G3ZA 3FYHA 2JGNA 3AH8A 1ZVQA 3GFTA 1ODFA 4AURA 3GFOA 4LZZA 1IN6A 2GCNA 2GXAA 3OHMA 3VKGA 4W7SA 3QSYA 4Q21A 1SZPA 1T3HA 2WIAA 1CIPA 1PUJA 3EC2A 1NLYA 4Z8XA 3AF1A 1CR2A 4CDGA 2ATVA 1AIPA 1YZTA 5IK2D 4QL3A 4OKSA 1NI3A 3SFVA 1A4RA 4UNSA 1ZM2A 2G77B 4NDZA 1XJCA 1FNNA 2BM1A 1N6LA 2WMOB 3CRVA 4WXRA 3VKWA 3B60A 3EX7C 1C4OA 2J3EA 4CT4B 5BWMA 5IF9A 1D6JA 1GDDA 4EQ6A 1GNPA 1F6BA 1E2DA 2W0SA 3A1SA 3U3KA 4RCZA 3UKDA 4ERNA 3T1OA 2QY9A 1VG1A 1G4UR 1Z6GA 2O0HA 1IJEA 1MO6A 2IHYA 4LYJA 3S1AA 2VQSA 2ZRIA 3B13B 3RS7A 2IYSA 1Z08A 3OF5A 4ZPXA 1E2LA 2ZROA 4NONA 3GLFE 1E6CA 3U61B 1KOFA 1HA3A 4LV5B 1AKEA 1ZCAA 1OXXK 3U60B 1JPJA 2QNRA 4PAQA 4XWAA 3T06B 2IS2A 3TE6A 4EAQA 3TJZA 2GDJA 2JDID 3DDCA 4JT4A 5JEEA 4DCUA 5KDDA 3TW8B 3CM0A 2QSZA 3AV0B 3OESA 3Q9LA 1VHLA 2R6CA 4YMWA 5FOVA 3ZVNA 1OJLA 4I1UA 2GZDA 1COWA 1P2UA 3V00A 2HXSA 3H4MA 1HUQA 1TL7C 4C9BA 5HR5A 2ZJYA 2QQ0A 1H65A 3AQ4A 1N5IA 1OFIA 1R6BX 3KX2A 5FTMA 5L3SB 4Q7MB 1M8PA 3DPUA 1MABB 3PEWA 4AYTA 1PLKA 2CE7A 2FEMA 5EXPA 2DFNA 2XSZD 3Q8XB 4HDCA 4PFSA 1YVDA 4NCKA 5ANRB 2DBYA 2HLDD 3P27A 4XD7A 4XTCS 4AG6A 1LVGA 4KFSA 4Q48A 5TXGA 1OXVA 3Q7PA 2ZIAA 3PFIA 2ZEJA 4MKGA 3WBKA 1GP2A 1EFCA 2BJVA 3QKRA 3RABA 5EP3A 3LW7A 4D0GA 2OCAA 2ZE7A 4Q4JA 1QHSA 3I1FA 3EIEA 4DSTA 3MRSA 5KYKA 4IDQA 4B3CA 4IRUB 4JLVA 4F92B 4MKHA 2H16A 2O8CB 3ZVMA 3C5CA 4PC1A 2YOHA 4OHVA 4X8HA 1OF1A 4W5HA 4P4SB 5K8TA 2O0JA 3HR8A 1KYIA 2D74A 3QENA 2J0QA 4M1SA 1TU4A 2VLIA 3K70B 3TQFA 4EPVA 1GKIA 1GFIA 4IHQA 1R5OA 1IQPA 3QBVA 1M6NA 4A0FA 3NEJA 2ERXA 2IX3A 2O8BB 4C0QC 4AD8A 1AS0A 3CIOA 4PC3A 1KZGB 3IIKA 3VR1A 4LHZA 1XPUA 4KAXA 2WWWA 2PBRA 1JEEA 3GJ7A 4DT1A 1N6OA 1E2PA 3OE7A 3GLFA 1KSJA 4Q66C 2R44A 2RGDA 1JXOA 2KJQA 4LPSA 1NNEA 1P60A 4HAUA 1VCNA 2ZI3A 2ZUBA 4YMSA 3SHFA 4CF7A 4NU0A 5K8LA 1IXRC 1W4CA 1E2FA 4DSOA 2IUTA 3MSXA 3T35A 1QRAA 3AGPA 1ZW6A 2HCJB 4B73A 4EPTA 1KO5A 1QG2A 3NXSA 4DDTA 4ZDWA 2PMKA 2OEPA 3AUXA 3D7MA 1ZIOA 4L15A 3U6BA 2VSFA 2C77A 4M22A 4P31A 3HJNA 2NG1A 2AWOA 4DBLC 1LF0A 1ZU5A 1NL3A 4LJ9A 2YWHA 2ZAOA 5FUXA 3UIEA 1NN3A 2F3TA 1KDTA 1DAMA 1UDWA 1F60A 3GQBA 3KKMA 1OH8A 4HEJA 1KK0A 1KSFX 3UANA 4OI4A 1E96A 3RSOA 2REBA 4GPTA 3THYA 2FG5A 2FFQA 1SXJE 4DXAA 2IS4A 3IILA 3MWJA 4JBYA 4Q4AB 1ZCBA 2D06A 2ZANA 4AK9A 1KMHB 1JJVA 4JLBA 3OEHA 5B58C 1E2IA 2IK8A 3CUEF 4PHTA 4XJXA 2HEIA 3R8CA 2WICA 1VPLA 3KQUA 4Q19A 3SYKA 2G0NA 4KYIB 4FI3C 5SZJA 5JFGA 4GBMA 2H92A 4PR0A 4A92A 2QM7A 4PSAA 4ZV4A 4IVPA 2BC9A 3EPLA 4WOPA 5AUOB 1E9FA 2IYUA 2VHTA 3P32A 2EYUA 4OI1A 1KDRA 4DLYA 3BS4A 4HB3A 1U8YA 3K09A 1JEDA 1JPNA 2WSSA 2XTMA 2QUZA 2ZXUA 2O8EB 2ZE8A 4JLDA 4DRZA 2ONKA 3MUFA 2AL7A 1ZD9A 4NHOA 3HPQA 4HUQB 2WJVA 2IEYA 4DWJA 3B1WA 4TLDA 2FA9A 2OCBA 2NO6A 1EFUA 5KSYA 5BXQC 2QM8A 5DIFA 4OHXA 5HZKA 2FJUA 4G5RA 4TMWA 4MKFA 4B44A 4BLQA 2OXRA 2Q3MA 3F8TA 4DJTA 2G88A 1E0AA 1PLJA 1NMYA 4JLMA 2V1XA 3EASA 5KNCA 1D2EA 1O87A 1ZINA 1TUIA 1WF3A 4KBFA 4ACBA 5CK4A 4ILEA 2JLQA 4NL4H 2F3RA 1XD2B 5FOSA 5CLLA 2GA8A 2ZITA 1ZUNB 1VG8A 3PUZA 3Q5EA 5DISB 4B75A 4D26A 1XTJA 3EZFA 1OIVA 5EQTA 3ZDQA 3MFYA 3QF4B 4KFUA 2FSFA 2EU8A 3SBDA 2PH1A 2BMJA 1ETUA 3G5UA 3RYTC 2OE2A 3HPRA 2EFHB 4O3MA 4X8OA 4MYUA 3R9WA 1SXJA 2VSXA 1JAIA 4NYIQ 2FZ4A 3RC3A 1G7SA 3GJXC 1NLZA 4KJZA 2D2EA 1I2DA 4DVGA 2WV9A 1GAJA 4II7A 1M1YE 1NG1A 1US8A 3MWKA 5HKKD 5KNDA 2QL6A 1XPOA 2QMHA 2WWGA 2OO7A 1FPMA 2XX3A 4DDUA 3GLGB 2GRJA 3LAWA 2XNDD 3BGWA 2QMEA 1XB2A 2GVZC 1NJFA 2YJTD 1BO6A 1JR3D 4YDSA 2FFHA 4NPHA 1XTIA 4OI0A 3NBXX 1Z2AA 2RGGA 4HLUC 4YXWA 5EP4A 4LYAA 1D9ZA 1E0JA 1N6NA 2ZRNA 1G64A 4US2R 3X1XA 2AK3A 3PEVA 4HUTA 2A5DA 4PPNA 1AS3A 1VIYA 4LY6A 3REGA 4QRHA 1FOEB 2BKEA 1BOFA 2ZU6A 4V02A 4O2RA 3WYGA 3GPLA 1NY6A 1XRJA 1TPZA 1P75A 2DHRA 2EFDB 4B47A 1OV4A 1BKDR 1AM4D 1E79A 4LUCA 2ZS8A 3AVOA 4DCSA 4QBHA 3SR0A 2IYVA 4RD2A 2W2VA 1GVNB 1H8HA 2TMKA 3DHWC 2KBFA 1N0UA 1S4QA 4DLZA 1E4VA 2WMNB 5KOYA 2GCPA 2VYFA 3LD9A 1G7CA 3H2YA 3SN6A 3BK7A 4KV9A 4A36A 2DY1A 1QHHB 2A2ZA 3EPJA 1R2QA 5G41A 3I62A 3TVTA 1KMQA 3BH6A 3EWAA 1ZUHA 4QOSA 5JS7A 1ZNZA 4BEJA 1AS2A 2VBCA 4CEIA 4HZUB 3TW4A 1NVVQ 3MJHA 2RGNA 2GCOB 3I3SR 4OHYA 4Y0VA 5DN6A 1G17A 4C3ZA 1TF2A 4RKEA 2GAAA 5EZ5A 4TYWA 2NO7A 2ZI7A 4M9XA 1DEKA 4UNRA 3P4XA 2QPAA 3CH4B 3OAAD 2QN6A 1VTKA 1BYUA 1LY1A 2IWHA 1KJWA 1XCPA 1JAHA 1LV7A 2K5UA 4D6PA 5FPTA 3MJRA 3SFZA 4ASUA 4RD6A 2JJ1A 3DKPA 3J81k 3QF7A 1CS4C 3B6EA 5P21A 4Q9LA 4AYXA 1OIWA 3W3ZB 2GKSA 1MO3A 2DCUA 4MA4A 1WE2A 4TYYA 1CLUA 1YZGA 2G3YA 3D31A 1T91A 3FFAA 4W5WA 4OK5A 1KI9A 4L8GA 2ZAMA 3EG5A 2PL3A 2Q9CA 4EJSA 2HF9A 2H7VA 1S0UA 3KJEA 4V03A 4E5UA 2X77A 3BOSA 5FTLA 3D8BA 3GEHA 2WKRA 1ZM3A 1VHTA 2VHJA 4D82A 4JMPA 4F93B 1PZNA 1KAGA 2GXQA 4M8NE 2C03A 3A6PC 2F1HA 1SKYE 2YNMA 1IXSB 1P9NA 2PX3A 3GJ4A 2ECKA 3GMTA 5L3SA 4C7OB 1MABA 3T5DA 4A15A 2NMVA 5EE3A 2BDTA 4URXR 2ZJ8A 1G20E 4JYBA 4QHYA 2E9SA 4KYUA 4RD4A 3VKHA 1KI6B 1G9XA 4LV6A 1J7KA 1CULC 3IQXA 5CLQA 2ORVA 1FQJA 2WKQA 1CP2A 1QZXA 3BJIC 3U7EB 4C0SA 4GMDA 4TLAA 1W4AA 2ZRGA 2DR3A 3C4JA 3CB4A 3SJAA 1ZNWA 1Z63A 1W36C 1DPFA 4NCNA 3FMOB 1TEXA 3SZRA 2B8TA 3NHAA 4LJ8A 3RS4A 3AKYA 4A0RA 4B35A 2KI5A 2GJ8A 1FMJA 4Q01A 3BFKA 4TYQA 3VR5A 1N2CE 3ND9A 4G5GA 3K9GA 1YZLA 4KVGA 3QE0A 4OI2A 3FFBA 3UMRA 1W44A 1NN5A 3O8DA 3IDQA 1EWQA 1IN4A 3KUDA 3A4MA 2CK3A 1TADA 3CLVA 3OFNA 3OZXA 1N5JA 2JJ2A 4CZ2A 2FZLA 2B6HA 3OEEA 4M4SA 4Q9JA 1DAFA 1W0JD 2PZFA 2O0KA 2OCPA 3SEAA 1GL9B 2CCKA 3FWYA 1HT1E 5HPYB 4H1UA 2JCSA 2H17A 1OXUA 1VG9B 3DOEA 4GZMA 1P62B 1CJVC 3B2EA 4DIDA 1E2KA 2A5JA 1FL9A 1NN0A 2W00A 3CKLA 1CXZA 3I72A 2BMDA 5LBIA 3UPUA 4ZCMA 4OJKA 1XFAA 2P6NA 4A0HA 4FMCB 4BZQA 3QNUA 4JVSB 3C41J 1XPRA 3ZGXA 5IK2A 3SHWA 1W36B 3MD0A 3L0IB 3QQ5A 4NMMA 3AF0A 1P3JA 1VYTA 2BBWA 1R8QA 2BMFA 4B3FX 1Z28A 2GHIA 4QJ3A 2IUUA 3THOA 5HZHA 3AM1A 3E2IA 1M7GA 4A9AA 5CYPA 5E7IA 3VR6A 2C78A 2ERYA 2E87A 4KVAA 2C04A 4US1R 2J0UB 3R7WA 2GJ9A 2KSQA 3GJ8A 3WRYC 1FX0B 1EESA 4MGIR 1ZYUA 2WKPA 3B1XA 3IIMA 1UAAA 1KMHA 1KIMA 1K5DA 4DLWA 1LNZA 4QG7A 5KTYA 2P6RA 4BPBA 3REFA 3U3MA 3U7FB 3C8UA 4QBGB 1E1RA 4QNRA 2EFEB 2GAOA 421PA 3CZQA 1Z8FA 3I8XA 4AIIA 2ZUCA 3BFVA 4GSYA 4DUGD 1XZPA 4URUR 5DI3B 1TEVA 2FFBA 4BLSA 5JLJA 1N3BA 1Z83A 4BZPA 2HCBA 4IVRA 1IY2A 2QAGC 1XMSA 3LW8A 2OFXA 4LHXA 4PAMA 5CJPA 1QHGA 4Q03A 2JDIA 5EXSA 1OB5A 2IXFA 4GP7A 1A1VA 3RNLA 4TTQA 2C5LA 1E2GA 1JNYA 4MRNA 4OL0A 1NBMD 4UNNA 2VRWA 4A8JC 1RYFA 3RRNA 1PV4A 2O8EA 2P5SA 1W48A 1Z22A 2JEOA 2GZHA 2REXB 3WXMA 1Z0IA 1Z6TA 2QP9X 2XJ4A 3PUYA 5FBRB 3TSZA 3AB3A 4RFSB 4O25A 3WMEA 2C9CA 1DO2A 4DLUA 1Z0KA 3K0FB 2XEXA 1CEEA 1DELA 1W5TA 2G9NA 3C7KA 5AUNB 1T0JB 3NBYC 2QEQA 2J7KA 4MYHA 4AI6A 5GVSA 4PXAA 3BIFA 3IPYA 1FTNA 3TBKA 2XSZA 2Z6VA 3PV0A 4M53A 4TZ0A 2HLDA 4F4JA 1TU3A 2AKYA 3AF2A 3SQWA 1CJTC 5DGXA 4Z1MD 4PHGA 3QPVA 2YC4C 3ZYCA 3FDIA 2LCFA 3P26A 3FOZA 1U2RA 1JQJC 2MMCA 5KO2A 1PUIA 1CJKC 2W6JD 2RHMA 3QF4A 2W6ID 1TMKA 1GWNA 2ZJZA 1XCMA 2C99A 3CNNA 2F43B 1NF3A 3VR3A 3O8BA 3JVUA 2CCGA 2BBSA 2V4ZA 3FMIA 4H9GA 3BFXA 3KJHA 2JLVA 1DTSA 3NEYA 4HAYA 3UMFA 2QAGB 1Q57A 4UXHA 2GESA 1DAHA 4C0HA 4A8JB 1UBGA 3LV8A 3T61A 3ZJYA 4OHWA 2N1BA 1WQ1R 2C8VA 3KZ1E 1FQKA 5BQ5A 2QRZA 3TUZC 1X1RA 4Q1DA 3I8SA 2Q6TA 2VHUA 3BB4A 1U9IC 1NJGA 2D2FA 2WHXA 1NVXQ 3TRFA 2ZRHA 3HYRA 1KI2A 4ESHA 4QM6A 3QG5A 1T6NA 2ODWA 2IYTA 5FH9A 1HE1C 3KTAA 4AYWA 2Z4SA 3LBHA 4D4LA 2F55A 4JJZA 3ICQB 4ZIRB 1YJ5A 3W5JA 1G3QA 5D3MB 4TN1A 2A5FA 5DHAA 1M34E 4URVR 4BZXA 2QT0A 2FGKA 3PQCA 5KPDA 3M6AA 4DSNA 2XB2A 2GBLA 4E07A 4TYNA 2QENA 3AVWA 5JWHA 2WJGA 1XXHE 4RY2A 721PA 2F1IA 4OQMA 3WNBA 4IW3B 1QHHA 2FOLA 1G6OA 2VO1A 1GSIA 4E09A 3LRPA 5C2JB 1J90A 2EQBA 3C5HA 2HJVA 2RH5A 4EUNA 621PA 1OW3B 3ZS8A 2NOAA 2V6IA 1QVRA 2GNOA 4HZUA 4YDHB 1XBTA 1IY1A 4IDPA 4R2HA 3A1UA 1AZSC 4JT2A 3A1TA 4MGKR 2V55B 5BW8A 2IF2A 2GF0A 4WVFA 1DBSA 1LFDB 4FMDF 1E9DA 5LB2A 3OIWA 1CR4A 2FN4A 3AP1A 2UKDA 2C9OA 1N25A 1XMVA 1JR3E 2AXPA 5EXTA 3U6KA 4KXFB 1SGWA 4Q4HB 2A5YB 3A4LA 3LX5A 4PQYA 4Z54A 1I4DD 2AR7A 3SS8A 4P33A 3GCGA 1S3GA 1I2MA 4EFLA 2OM2A 2OBMA 1HY3A 4CEHB 2CEAA 3QKSB 1P2TA 3T15A 3U7HB 3TKLA 1E0KA 3GEIA 3VHXA 2CL0X 5E4FA 2LWIA 2WWIA 3N70A 5FOUA 5AJWA 3FKQA 5BYKA 1EX7A 2GJSA 3AVPA 1I4LD 3E70C 3TH5A 3Q5DA 2BEKA 3W8NA 2X2EA 5H8WA 3G0HA 3THWA 3IHLA 3CWZA 1OXSC 4A2PA 5CITA 5KU1A 3CW2A 3MMPA 5AJYA 2W83A 3VR4A 1RKBA 2QA5A 1T5LA 3BRWD 3I32A 4C2TA 2IXGA 4ESVA 3L82B 1G8FA 1U90A 3RS5A 3ADKA 4G5OA 3TQCA 4E03A 4AKHA 2H8KA 5FOWA 3LXXA 2KB0A 3NBZC 5IRCD 4A2WA 1NY5A 3E1SA 1L4UA 4MITA 4UXIA 1DAIA 1YHNA 4P3YA 3CR8A 2QP3A 3K9HA 5FPKA 4O2LA 1KK3A 3C14C 1AQYA 1XXHA 5EUQB 3U3JA 3AVTA 2B8WA 4IEIA 4BECA 5KPJA 5L3RA 4KODA 1DE0A 1A5TA 2F9MA 1HTWA 3H84A 1R8SA 5KDOA 5GVRA 5J47A 1R5BA 4NCJA 1RJ9A 2QGZA 5JBQA 2YOFA 2IL1A 5HKKA 3B82A 4QM7A 1DADA 1GILA 4YONB 3MLEA 3ZVRA 2XNDA 1U99A 2ORWA 1KNXA 5LB4A 4D4MA 4XWKA 3K0AB 3FHCB 1KDOA 1JR3A 4Q9HA 821PA 1X6VA 1CR0A 1OFUX 4ACAA 1W4RA 4Q7LA 4TLBA 2XOKD 4MRPA 5EP1A 2FPKA 2HYIC 2XB4A 4MRRA 1U0JA 2H5EA 3CF2A 2IF0A 1OIXA 3NIBA 3QY0A 4PC2A 5HCNA 3B7GA 1B23P 2W58A 1P2VA 3GLIB 1XDBA 4TL6A 5AR1A 4LDJA 4ZCIA 1E2HA 1FTSA 4QC2A 4EPRA 3FKSD 2CLDX 4PC7A 4TSFD 3HU1A 1UBEA 4RJLA 5AK0A 4N0DA 2NPIA 1E2MA 3CF6R 3TK1A 2QP4A 3TIFA 4F7WA 4BE7B 1GZSA 2W0MA 1E0SA 3H1TA 2CNWA 4TMTA 2AWNA 2VPPA 4GNKA 1CKEA 3CONA 2PZEA 5TDHA 4EDHA 4PAOA 521PA 2FDCA 4KLNA 2GTPA 2SHKA 1G18A 3UG7A 4OQFA 1TQDA 4A82A 1P61B 3BC1A 2ODEA 5TVKA 5LD2C 2GXSA 3LFUA 4B33A 5JJIA 1CTQA 1KI1A 3LDAA 1R4AA 1G3UA 1XX6A 5ELXA 2P67A 1Z6YA 5EE9A 4Q9IA 3SYNA 2WSMA 3VAAA 1KY3A 2A5GA 1PLLA 2YZ2A 3EC1A 3SNHA 2FPLA 3CRW1 1RZ3A 4IFEA 3THXA 4M1TA 1FX0A 2IW3A 4DHEA 1EWRA 4G01B 1E32A 4M1YA 3IHWA 4NCHA 1L2TA 1KAOA 3RAPR 1KGDA 2JLYA 1OLOA 5IHPA 1KI7A 2JA1A 4LJAA 5SZIA 4ABYA 1FUUA 2VL7A 2ZRKA 5CDFE 1TF7A 3TSWA 3QXHA 2QE7D 1ZD1A 3C15C 3WY9A 4PO9A 1F2TA 3EW9A 3P4YA 2R6DA 1UF9A 1ZM7A 4LBYA 1W0KD 4ZDKA 2FNAA 1F3OA 1N6KA 5F3WB 2P2LA 1Z6XA 2CHQA 1G8PA 1Z3IX 1HQCA 2ZSDA 4JL5A 2QBYA 3I5YA 1ZAKA 5JHGB 5UKDA 4PPQA 2O8DA 4PQRA 1GM5A 1II9A 1E9CA 1W2GA 1CRQA 4HAZA 1UPTA 1U0LA 1GUAA 2ZI6A 3CR7A 4B2IA 4D4JA 1II0A 4QKQA 2HF8A 1GOTA 4IOLA 5LD2B 2IC5A 2A78A 4RFSA 1HURA 3BE4A 1AKYA 3TAHA 4TWZA 5JHHB 1DG3A 4ON9A 1XJQA 1OPXA 1XEXA 3EA5A 4B3BA 3RRZA 1P5ZB 1I4TD 1WRBA 1A2KC 3ZQ6A 3N2EA 4TLCA 5TY0A 5JMTA 1J99A 2D3WA 1Y63A 4DZZA 2IYLD 4HB2A 3RS3A 5IT5A 1Z47A 3L8ZA 4EIWA 2ZJAA 2Z83A 4AC9A 4XSGA 2ZR9A 2JASA 4MUAA 1XTSA 2CLSA 1LS1A 1JI0A 3FHOA 4K46A 1C1YA 1KKMA 3VU9B 2UVQA 1D2MA 1XMJA 2GK7A 1G3IA 3K53A 3D6TB 3PEUA 3SDZA 5B64A 4V0NA 1A82A 2EFCB 2CDNA 2WJIA 1SVMA 4KBGA 2CMKA 5FTNA 4A1FA 3K0CC 4MDFA 3LY5A 1RVDA 3CNOA 4B32A 4QHSA 3EAQA 3ECCA 2OG2A 5FI0B 4JVLA 1G5RA 3CRQA 1J8YF 2QI9C 1YKSA 4PPGA 5DLQC 5HE9A 4OHZA 3UXMA 4A8JA 4AKEA 1CRPA 5CDFA 4CEJB 5J4KA 3RSLA 1NBME 1MO4A 2PX0A 4HZIA 2QSYA 2AN9A 1KI3A 3B1YA 1IN5A 1COWD 4R71A 4XVRA 1AJEA 4B6FA 3W34A 1W0JA 1YU9A 4IKEA 3KFXA 1VDZA 5FL7D 3KKNA 2X8AA 1ZMXA 4BWYA 3LA6A 3X2SA 5CIQA 1R0WA 3KKQA 2DFTA 2XZOA 2NTYC 2NQ2C 2V6JA 2ZSBA 1T8TA 4POAA 3L43A 5K8IA 2QZ4A 1T3SA 4GOXA 2BHRA 4QXAA 3ZIAA 2XGJA 4B43A 5KNBA 1II8A 1N0VC 2GZAA 2X2FA 3PR1A 3Q7QA 2BM0A 2G1KA 4V0KA 1Q3TA 2P5TB 1S2MA 3KJGA 4BFYA 4LYHA 2O8FB 2MSCB 4NYMQ 5AJVB 2AK2A 2OLJA 3U4QB 1OE0A 2AHOA 2VH5R 4JLOA 4UJ5A 5FBVB 2Q9BA 2WWYA 2Q3HA 4V0LA 3BB1A 3X1YA 1VCMA 2OXCA 1IM2A 2QGNA 4PTLA 4K81B 1DOAA 2BCGY 4A0GA 2QRNA 2VP6A 1KO8A 3AKEA 4NZYA 3EIHA 4FCTA 4KO8A 4PC6A 2XTZA 2C95A 3PVSA 1NVWQ 1UKEA 4LBWA 1LTQA 1F2UB 2EW1A 4F91B 1W36D 1GITA 1TTTA 1EFRA 2IYQA 1L4YA 4P4UA 3ZD7A 5JZVA 3ZLJA 4DUGA 1S1MA 1GL7A 2OCYC 4LBVA 3IBYA 2YVUA 5CM8B 3TAUA 1ZUIA 2OUKA 1YZUA 4ZI2A 2VIIA 1SHKA 2QU8A 3IPXA 1TF5A 2ZSFA 3M0EA 4NYIR 1NBMA 4XVQA 3NC0C 2D4HA 3WP1B 3O8CA 2CVFA 2WJYA 3FHTA 2F1JA 2JLXA 2V1UA 1U8AA 2QTFA 1GG2A 1CJMA 3L0OA 5AJZA 2NO1A 3N2IA 3V9PA 4URYR 2FU5C 2PLRA 1NG9A 3PJRA 4CW7A 1W47A 2Z0MA 5L3VA 3HP1A 1UKYA 4W9MC 2ORIA 2JATA 4M1OA 4I1OA 1G1MA 1E94E 1W2HA 4IVQA 5GJWC 1BYIA 4QJ5A 4D80A 4DDWA 3R9IA 4X8LA 6Q21A 1NMZA 4Z1MA 1QG4A 3AKDA 1KHTA 4XWOA 5A5GA 3W90A 4U7DA 1YE8A 2FGJA 1T9HA 4QNMA 2W6JA 1R0YA 3NTUA 4D81A 1E9EA 4DCNA 2W6IA 3LX8A 3S1AB 1DAGA 1TQ4A 3BWDD 2IHBA 1G291 4Y0AA 3CZPA 4ARZB 3EWSA 4DC9A 1EFHA 3QBTA 4TMKA 4B74A 1OHHD 4LHYA 4F4IA 4Q00A 2F9LA 2RMKA 4Q1CA 1QHYA 4HSEA 3V4FA 3QVUA 2W2XA 3QJYA 1SVSA 3DM9B 3FMFA 1KY2A 1OT3A 2BBOA 2Q9AA 3LLUA 4N1AA 3K0AA 1KI8A 3LLMA 1G21E 1MT0A 3QI2A 4G3XA 1MH1A 4NYJR 2ZRAA 2O8CA 1R5NA 5B57C 5DH9A 2AFIE 1E69A 2RGEA 1N6IA 1NVVR 4P4SA 2ZI5A 1JQLB 1GL6A 1G8HA 1T5IA 3ETLA 4Q1AA 2F1RA 1AGPA 4FWTA 3QKTA 2ZTSA 4TQ9A 4C0JA 1GTVA 1YR7A 1YRBA 1NSTA 4UQOA 4AKGA 3TR5A 5GADl 4BFUA 2O8BA 2YHSA 2VEDA 2CL6X 4FIDA 2Z5FA 4YC7A 3QKRB 4UNQA 4YMVA 1NSFA 2GVDC 4LK2A 4GDFA 1RC8A 4Q4JB 2ZJ5A 1A7JA 4L16A 5FOTA 1ZD8A 2I3BA 3NKVA 1XF9A 1FUKA 1G8YA 1CR1A 3LVRE 3K0EA 1Q22A 4M21A 1N6RA 4KITB 5FR2A 2FPMA 1U94A 4O0MA 2ZI4A 1Y3AA 1XWIA 4TT3D 3QEOA 4A2QA 2ZSAA 2FSIA 1TUEA 3AVUA 1L8QA 4TL9A 2XJ9A 2J41A 3RS2A 2OT3B 2PT5A 1X8KA 1DARA 2VF8A 4FCWA 3EA0A 1YR9A 1Z0JA 3KXKA 3KB1A 3PG5A 4YQFA 3T1VA 1R7RA 1ZM9A 4RD0A 5FFMA 4DCTA 1S9DA 1MR3F 2L0XA 3AGQA 3QVVA 3IKJA 5FI1B 1VMAA 2ANCA 4Q4AA 4XTRA 4DLRA 2QTVB 5G3YA 3LH5A 4H1VA 1OH5A 1KK2A 2XZPA 1G41A 1G7TA 2I1VB 2R6AA 4M2LA 1DAKA 5JECA 3GLGE 5DI9A 2Y8EA 3KDSE 1U0HC 4B3XA 4MKIA 2B7CA 4GOKA 3G82C 4UNPA 4IDOA 4BLTA 5EE0A 4ZDJA 1CU1A 1KSGA 2REOA 4BLPA 5HE8A 2NIPA 2B21A 3EZ2A 3NWJA 2ZREA 1H8HD 2R6FA 2ZS7A 3AP2A 2D62A 3THYB 1SVOA 4ZDIA 3F0TA 2ZI9A 2WOOA 5SZHB 3UG6A 1RW4A 1WP9A 3KL4A 4ZCLA 4HB4A 2MSEB 3IQWA 4D2IA 3KQLA 4I81A 2H1LA 4NP6A 2IUSA 4UXJA 2KE5A 3QXXA 5KUTA 3QXJA 1DG1G 2XAUA 4HUQA 4MYCA 1ESMA 4KSBA 4FD2A 2QMUA 1GKUB 3FGNA 3K1JA 1E3MA 5FL3A 2BWJA 2WPDD 2V3CC 3A1WA 4QBIA 1NKSA 2HDNB 3DOFA 2DWQA 1E2NA 1NIJA 1JJ7A 4QFMA 4Q47A 2BEJA 1IOZA 3SE0A 1SXJC 2YOGA 4JVNA 1BIFA 4IJMA 4A4DA 4JBWA 4U00A 3RRYA 2OESA 5KSOA 4NKRA 1XD2A 2E1RA 4JJKA 3OIYA 1FP6A 2YINC 4JKIA 3M1IA 3AVYA 2WAXA 2FX3A 2OAQ1 2Q0HA 3AVXA 3U3RA 3RC8A 1NVUQ 4RFVA 2HT1A 2XOKA 1W4BA 2XITA 2VP2A 2VSOA 1GRQA 4PO1A 4M0LA 4ZI3A 5GJBA 3UWKA 4BLRA 1U8ZA 1AQUA 4Q4LA 3SJCA 4GL2A 5G53C 1E2JA 4NE2A 5JSZB 5DNYB 4PHFA 1E1QD 2I1QA 4OBEA 4C0AC 3U7GA 3Q85A 2VP0A 3K9LA 3WRXC 3GLGA 3DM5A 3FKSA 1SVLA 4TSFA 4LHVA 1L7VC 5FOXA 3W8RA 4BRUA 4OQLA 4E22A 1MOZA 3ZZTA 4BFZA 2GEUA 1P73A 2BVNA 1Q44A 2HT6A 2QPOA 5E3HA 3GFPA 3KXLA 3AEZA 4JKYA 3L0SA 1OKKD 5JJLA 2CXXA 4ITRC 1SXJB 1YZKA 4N0EA 4N3NA 3DEFA 3ADBA 4OYHA 1CF4A 2VHCA 4OJQA 1RE0A 3QIAA 3W6PA 1B0UA 1WXQA 3TR0A 2FWRA 2ZRCA 3IO5A 4TYPA 5EJEA 1N5KA 1NLFA 5FPYA 3T5GA 1US8B 1KK1A 1SVIA 3ADCA 5CK5A 4B3GA 3N5CA 2ATXA 4K8OA 5DYGA 3L8YA 4MRVA 4FINA 4EFNA 1P6XA 1R0ZA 1S8FA 2RGNC 3K0CA 1G8GA 3GJ0A 5BN5A 5CIWA 3JVVA 4GRAA 2OBLA 4PSKA 2YV5A 5TARA 2ODBA 3RDPA 5BYJA 3EZ7A 3DL0A 1GIAA 4R9UC 4LRWA 4TLEA 3GEEA 1X8JA 1SQ5A 4LJ4A 3VX3A 4EPWA 4EPXA 4ZKDA 1Z2CA 2AKAB 1OYWA 1ZBDA 4TMVA 3OIUA 2D7CA 2OHFA 4R98A 1T3LA 1W49A 3VNUA 2QE7A 3RVBA 1Q20A 2J7PD 4URWR 3GJ6A 4PANA 5FUVA 2GCOA 1BMFD 1W0KA 1M7HA 2WIBA 3W5IA 2LKCA 2FEOA 1G7RA 3W9YA 3SOPA 2ZYVX 2YWFA 2ZSEA 4R2IA 2J45A 5C18A 3LQRA 2B7BA 4HLUA 1FNMA 1AGRA 2ODNA 3IGFA 3IUYA 1S3SA 3CX6A 4MQBA 2F6RA 1G19A 1R10A 1W46A 1P9WA 1BH2A 4OQNA 3T34A 4B6EA 2GJAA 2UZ3A 3WHKA 4EJSC 4Q1EA 3LVQE 4FXPA 2ZRLA 2ZRFA 4G5QA 1Z0AA 1UBCA 2ZUDA 4L4UA 4B76A 4CEIB 4CVNA 1G5PA 2C9YA 2QMOA 3DKVA 4FMDB 2XXAB 2VTKA 3VQTA 1E2EA 1UKZA 2OFWA 1N5LA 2ZRPA 4DIEA 2X19A 3NH9A 2KWIA 5DE3A 5AWFC 3SBEA 4M1WA 3HR7A 5TB5A 3UATA 3VR2A 2RGBA 3RLFA 3TGPA 3I61A 2P6UA 2JLSA 1G6HA 1NP6A 2QAJA 2V54A 1KO4A 3CX7A 2YYZA 5CB8A 3I73A 3DMNA 1Q12A 3SYLA 4HAXA 4PPFA 1FW6A 3R9XA 4HAVA 1E1RD 1ZM4A 3PUVA 4CIDA 5EZ6B 4HATA 2V7QD 4UKDA 2WZQA 2D7DA 2UZIR 3RWOA 5F98A 4ARZA 1M7BA 3WYAA 4C7OA 1T0HB 2P3SA 4LBZA 5B2ZA 4C2UA 4KFTA 4Z51A 3LBIA 2PEZA 1QHNA 1EX6A 3VFDA 2XNSA 1S9HA 1KI6A 1ZNXA 3K70C 3R8FA 2IS1A 5DSZA 2QG6A 1YQTA 4R7ZA 1UADA 4LGMA 3HU3A 4EJSB 2ANBA 4B2PA 1K8RA 1NKTA 2O5VA 3LBNA 1P4SA 4MRSA 2CL7X 1QHXA 4FCVA 4QGFA 4G1UC 4OK6A 1UJ2A 1ZC3A 2IT1A 3RANA 1EK0A 4LJYA 5JCZA 3BD9A 4JYCA 3RRMA 5FTKA 1KZ7B 1XEWX 1Q21A 4U5XA 3O8RA 5FL7A 1YR8A 2IA5A 1SVWA 5F9FA 4DCVA 1UKVY 3AVQA 3LQQA 4X8MA 2FFAA 4MH0R 4IOMA 1KJYA 1QHIA 2EWVA 4BQSA 4YMTA 2BMEA 4ZO4A 1E4YA 4D4KA 5DHFA 1CBUA 4L5BA 3CH5A 4LSGA 3R20A 2FSHA 3SC3A 3BORA 2FE4A 4RZ3A 3CBQA 2GJKA 2IBMA 1X86B 2JIZD 3IO3A 1Z0DA 1G16A 4GFDA 4NTZA 5D3QA 3W6OA 3WNDA 3KQKA 2DPXA 1FFHA 4YMUA 1UM8A 4LV8B 1IHUA 3AF3A 3BB3A 4QGGA 4MGZR 1LW7A 4M9QA 4Q18A 1V43A 1HV8A 2Q21A 4LHWA 2G1JA 2ZRDA 1H8ED 3P20A 4JL6A 1Z6AA 3LXRA 3Q3JB 1D2NA 4KLZA 5J4YA 1SHZA 5FBLB 3ADDA 4RZUA 3VNVA 1D8TA 1MKYA 1YRAA 1KNQA 2NO9A 2RAPA 1XEFA 2BKUA 4WZAE 2ZS9A 1KSHA 4JLPA 2VP5A 2ZVQX 3PCRB 2BIFA 4IOKA 4C30A 4NH0A 1Z5ZA 3K0SA 4LC0A 5FBQB 3WNCA 2FSGA 4DB2A 4KSCA 3D3QA 3PXGA 4CGZA 2J0UA 1OFHA 3GJ5A 5FPHA 4DLXA 2J59A 2AD1A 3OAAA 2WTUA 3TUIC 2WAYA 2ASEA 3NBFA 2A9KA 4AY2A 4RD3A 3ICEA 4DLTA 3IBGA 2WVJA 3KUCA 1XNJA 3QPUA 3AUYA 2OBNA 1SKYB 5L3QB 1J2JA 2ZJBA 4AG5A 2NGRA 4GP6A 1NMXA 4LI0A 5DI3A 4D0LB 1GNQA 2CHVA 2WBLC 3X1ZA 3T12A 2A3RA 2J9RA 3CPEA 5E7JA 4B3DA 3BAFA 2ZQ5A 1W5SA 1WB9A 5H68A 5EP2A 5KDLA 3R7WB 2HYDA 1WCV1 2EYQA 5JWRA 4Q7KA 3NHBA 5JI3E 3VX4A 1E99A 1PJRA 4OQXA 2PLFA 2A7QA 3HDTA 5JI2E 2OAP1 5GJVC 2RGCA 2P0EA 3CNLA 121PA 1X1SA 3K0FA 4GT1A 4RVCA 2J0SA 3AF4A 1G4AE 1KJZA 4NCIA 2KBEA 3BH0A 1ESNA 1IBRA 1OHHA 4QHTA 1JBKA 3DO6A 4KFRA 4JSYA 5KHOC 4I1SA 5AUQA 3ZD6A 2C98A 1D9XA 3I5XA 1MV5A 1WBBA 1ZP6A 4HI0E 4RSGA 2QQEA 4XH9B 1IN8A 3TLXA 4LYFA 1RYHA 5H70A 3AKCA 2DFLA 4URZR 1G3RA 3PITA 1QVAA 4S2EA 3LWNA 3T1TA 2RB4A 4GOJA 3E5HA 1AA9A 2F43A 3NG1A 4LPKA 5J40A 4BASA 4Z8YA 1N0WA 2JAQA 3ASYA 1R0XA 4BFVA 1OH7A 1GRNA 2CLCX 2QAGA 2G0TA 2CJWB 1Z06A 5CB6A 5JSZA 3DZ8A 3MWLA 1KKLA 4DEYA 4BFTA 4WW0A 2WM9B 3IEVA 4BUJA 2W2TA 1VG0B 1ZNYA 4B2LA 4Q1FA 2ZETA 1Z07A 3B1ZA 1DS6A 4PZZA 3QG1A 1HQYE 5B30A 2GWHA 4BLOA 4IFBA 1VYVA 3B85A 2RGXA 3HWSA 2GBLC 1VYUA 1A2BA 1XD8A 1XZQA 221PA 3ZS9A 3GLHB 4XOIA 1F48A 2ZR0A 3SJBA 1UFQA 3JZMA 4TT3A 1OXTA 1D5CA 2J46A 4WZ6A 2IWRA 4BFSA 3TVDA 3FPAA 4XD7D 3GP8A 4WZBE 1KTVA 2CVHA 2GF9A 2YWGA 1MRSA 4Q9KA 4C0LA 4ZIRA 4RKFA 3U3OA 5D3MA 3ONWA 1TQ2A 2IYRA 3SQXA 1XD9A 1T4GA 4IXNA 2J5XA 4PZYA 4JLJA 5J4VA 4C4PA 3I4LA 4PX9A 1EXMA 2PJRA 2G6BA 4TZ6A 2QPTA 1PVOA 4A6XA 5JRJA 3EARA 4HAWA 1ZIPA 2NZJA 5JJKA 1Q1EA 4FN5A 2CCJA 2V8OA 3KXIA 3QPWA 4MYTA 5J4HA 3W6NA 3KTAB 1CJUC 4IXMA 4DEXA 4XIGS 1KO7A 3U44B 3EZ9A 2DWPA 3WHLA 3KFVA 1QBKC 3FB4A 2HXYA 5HTKA 3K9NA 1VECA 4FW9A
chains in the Genus database with same CATH superfamily
3NWPA 4GMKA 1RQGA 3U5ZB 4BFLA 1JA0A 1TVEA 1JVSA 4ZOBA 4JR0A 2WJ3A 3A4NA 5BN3B 1HDEA 2CNWD 1A96A 1GTRA 4BVKA 1ADBA 2VXYA 3F3KA 2OILA 2ALJA 3QVWA 3GCXA 4NZOA 1NZJA 4Y2PA 1QCCA 3KYBA 2W11A 4DCCA 4CEHA 4QTUB 3ORSA 4RDXA 4YRDA 1SZCA 3CPSA 3B9RA 1L5RA 1WV0A 5E6RA 1XRMA 3R09A 3GLIE 4K6GA 3V4RA 4FFBA 2YC2C 3NUZA 2ZTVA 3W3AA 4CYMA 1C9KA 1AURA 1AF4A 3RG8A 3NM5A 4RGYA 2Q0XA 1I5OA 3WL5A 3H5OA 2Z4RA 2N42A 3OZTA 4R8VA 3KM0A 4ARSA 3AVVA 5HX7A 1S96A 3Q4GA 1VOTA 4W7HA 2R7MA 1V4NA 2GEDA 1E2UA 2VZ0A 3VPHA 4G5HA 5K20A 1XUOA 4CQNA 3F3MA 2OQRA 1Q1ZA 2XDAA 4PQEA 3VTKA 1RWNA 3X1WA 4WZBA 1X7WA 2B83A 1FFEA 3OOSA 1PL6A 4EB3A 5F1KA 5K0FA 2ZJ2A 2O52A 3ZZUA 2H1IA 4LJ6A 1H05A 1XEWY 5D8DA 1SKQA 3WIVA 3WG9A 3N8NA 2XNCA 1P72A 3ETEA 5DNEA 1FYWA 4AUNA 4ZVLA 3L0DA 2BP7B 5H1YA 2BKXA 3PWZA 3WGQA 4F4DA 3EIWA 4YJGA 4JVMA 5EE1A 3O47A 2JHCA 3DQQA 3FVWA 1EWYA 3ZK7A 3HM2A 2ZIZA 4FEEA 5ALIA 2VZEA 4GI7A 2GN2A 3DTVB 3EVFA 2VKQA 4OIMA 5I6DA 1R0BA 1GDTA 3T3NA 2JLZA 3BERA 3GD7A 1E62A 1W52X 1ZK3A 1ISJA 2N46A 4ZI7B 1U2SA 2Q5FA 1NJ5A 3R6LA 3LWBA 5H3HA 3CURA 3F3YA 3F96A 4BYGA 4MUFA 4JH0A 1QK3A 3LZDA 5BN4A 2OFOA 4XSVA 4BGDA 1E1QA 3GA5A 3WBJA 3V5NA 1EUDB 4K9SA 4DM4A 1J1UA 4BN5A 3OUZA 1IXYA 2JI7A 3BA6A 1BKYA 4TOIA 3KQNA 4EHJA 1GA1A 3OI7A 5E1DA 4C6RA 5LMUB 2QUHA 3IQEA 3VPCA 2OVBA 1KVQA 1TXGA 1WXHA 3N74A 3Q2OA 2W9XA 1SG0A 3Q7TA 4E5PA 4EARA 4TQAA 1H6CA 1SR8A 2YQZA 3C74A 3NCTA 4MP3A 4N5NA 4AXBA 2IQIA 3H3FA 1EM8B 2ENWA 1Y4SA 3LDGA 3W7AA 3ZNPA 5HCIA 4DXDA 3EQ7A 1ZCFA 1MRNA 2IEZA 3LHFA 1KFEB 3TFWA 5HG0A 1VSTA 2B8NA 3AZPA 3CX8A 4V0OA 4PLHA 2DSTA 2YDYA 1RJ9B 1B14A 5KNCD 4JLKA 1F06A 1CUYA 2XUFA 1CY6A 1KO1A 2ZAGA 3NVAA 4TTTS 4KHZA 5CJ2A 4MGYR 1OB2A 2F8TA 2QZJA 3GFGA 2Q29A 2FW6A 3GRFA 5CCEA 4TL8A 1T26A 3UHOA 4C5CA 4KNWA 2OXEA 4E31A 2JARA 1PJZA 5KVCA 1H2AS 1Q14A 4KWIA 1XHFA 4WLOA 2PX8A 3EDQA 3KR2A 5M3BA 3ZQJA 3UPTA 4Y2QA 5EMKA 4L5JA 3GFSA 2G83A 2JI4A 4CRWB 4YN3A 5ADUS 4CMHA 1Z7GA 2WQZA 5JAZA 1E2QA 3FNBA 4XUCA 2WNSA 4ZAVA 1EG7A 2CVQA 3CLSC 1NUPA 2BR4A 2AOVA 5H59A 4DNFA 4YLYA 1CRLA 4U02A 3U49A 4HRYA 4UTNA 1CEXA 1Z39A 4I1VA 1GA4A 4Z86A 2RJOA 3RHFA 5K03A 1NIPA 4AJJA 3UJ9A 4UHFA 3PZBA 1MO5A 4ND2A 4M7WA 1WA5A 3IEPA 4YACA 1ZVJA 1TW2A 1X1QA 3NAZA 1OBOA 4RDCA 5TMPA 5JQGA 1YONA 2G9VA 3O73A 2ZM6B 4RL4A 3OE1A 4JB2A 3BTVA 1F9EA 3GLFB 4I6JA 4TV8B 1RRFA 2G4VA 3UMSA 1H4SA 5LZ7A 5TLSA 2VHVA 2XVXA 3CPHA 3LBAA 1Z0FA 2VWPA 3CW9A 3KPJA 2CFIA 2P4HX 3I09A 3OH8A 2Q2VA 2PGNA 4TYMA 1FU7A 2VDLB 6REQB 1X87A 4Q7JB 1D2RA 4G4IA 2UUCB 3ZZ0A 5IDVA 3LGSA 4PCLA 3ST7A 5J2UF 1UMCA 3IBCA 2AJLI 3TPFA 2HK8A 3NAQA 2VDQB 5E4TA 1ZR4A 2ZR7A 1Y3IA 5BSHA 2AZ4A 1DO0A 1YFJA 2GNPA 2GFQA 4BN4A 1MOSA 1Y9DA 2F48A 2ZRJA 3QXCA 4DADA 2VQFB 1E79D 1WMAA 1RLMA 4HYYA 1UWVA 2PBLA 3TZLA 4RHUA 2ZSJA 1U8CB 1UMDB 3MZ0A 4PWYA 4ZXFA 3SI7A 4X5OA 2XCIA 1K8ZB 4MR7B 5JRZA 3G2OA 2EKBA 5IXJA 3NORA 4ND4A 1V9CA 5HF6A 1PR0A 4EH1A 1EGAA 2ZVJA 1BCRA 1E1LA 1GZHB 2V9PA 3O9ZA 3PHBE 4J16C 1JYEA 4AY5A 1DQYA 1AUXA 3LX4A 3QOFA 3QX3A 1O9BA 2ZYWX 2JLAA 3PHHA 4FYXA 3NOXA 4B0OA 1XLWA 4P0QB 3QKWA 3ZHOA 3GXOA 3HUDA 4NMLA 5GOZA 3WMGA 1XJ0A 2DPYA 3AHIA 3BJEA 1ZRHA 2CDRA 2WWHA 1QIEA 4IMJB 4RSHA 3OIFA 2CFOA 4YJHB 1J42A 2O1WA 1L5HB 3HUUA 1R15A 3M1LA 4MUXA 3RUEA 4Z53A 2VNJA 5KNDH 2QBYB 3V4PB 4R81A 2GK6A 2PVPA 1K7SN 1MB4A 1IOVA 3MGCA 3UOWA 1USVA 1E9RA 1T9AA 3K2QA 4K2AA 1GJRA 3PX2A 1BDHA 2QTHA 3P0EA 2XYPA 4PW0A 3HL4A 5TS2A 2VDMB 2F3SA 4F2GA 2YV2A 3KV3O 4IZHA 2PUGA 1I24A 3DDOA 3HYSA 4HBZA 1Q1NA 1GZDA 1HDYA 3D0KA 5FA8A 4AY3A 4ASUD 1Y4AE 4CM6A 2JJ1D 2OORA 2CYCA 1WZEA 1C7ZA 1E9VA 1GPYA 3ELYA 3UO8B 4GPAA 1QG6A 1Y6RA 3DBRA 1YVEI 3WLJA 4HDQB 3N2NA 1JG2A 2PZJA 1S89A 4IH1A 4KC0A 5TV2A 3DOJA 3R3WA 4G1FA 1BHO1 3FFXA 3K94A 2REQA 1HG1A 2CJWA 3W78A 1OWNA 4LF5B 1SKBA 3HDYA 2VDOB 3PQDA 4DQKA 4AO7A 4XGKA 4BX8A 4WN9B 3TB6A 4UTRA 1JVBA 1DMSA 1GSOA 3OZIA 1YVRA 1RXCA 4D45A 1WVMA 1BXRA 4Q9DA 3PQ3A 4CEJA 2HCTA 4LGCA 5J4LA 4RZXA 1USUA 2G9QA 1X39A 2LDBA 3FPLA 2F4VB 3PHLA 1FP7A 1YZVA 3BKWA 1TUBB 2PGOA 1IVNA 2WLTA 1Q0TA 2NZ8A 1RXIA 3GX1A 3QEJA 4P80A 4UTOA 2YNMD 4FR0A 3U31A 4M37A 3P19A 4KNVA 4XKJA 1XCGB 2OHOA 3MTBA 2XEDA 4OG2A 4PCVA 3VYUB 3A8TA 3ITEA 5BSWA 5K4GA 3BN3A 4G0UA 3FE2A 5IC4A 4GQBA 4PYNA 3MG9A 3W3AH 1JAXA 1NYLA 3B1VA 1C7JA 1PR2A 3L2OB 1UJMA 1WQ4A 1XU4A 4GECA 4HB0A 4PBRA 4QFBA 3GEGA 3RSCA 1QAOA 1P9LA 2G9RA 2BJHA 5A02A 1R12A 1MW8X 1Q1QA 1RADA 2Q4TA 4NJOA 3EVGA 1JKJB 1TI7A 1J8FA 2ZBVA 3I5UA 5A5VA 3B1JA 5M7EA 4G0XA 1KI4A 2A9QA 1ODTC 5HS6A 4B7CA 1P7CA 1QOQB 1AN0A 2NUAA 2WF8A 1VM6A 2NPFA 4PFQA 2R2GA 3AOEC 4L22A 4OK3A 4DSUA 3WWZA 5K05A 3U4DA 5EKXA 1SKMA 3T7AA 1P2DA 1X7GA 2OB2A 1HOTA 2R6JA 4W6QA 4DC1A 4KO2S 5ER6A 5J9FA 3OCCA 2C7PA 4CM1A 4MA0A 3VR5D 1E9AA 2P3QA 1YJCA 3BREA 1R8JA 2ZYTX 1JR6A 3TKYA 1G1AA 1WDKA 1C80A 1VRWA 1HE8B 1XTKA 2OPHA 2DYKA 3RVLA 2XCRB 1IHDA 2VJMB 5I4BA 1G8JA 3OIVA 2O7RA 3B9QA 3HU2A 1F2UA 3LO5A 1BHJA 1KMIY 3RQIA 4KE8A 3TOZA 1II8B 1L5ZA 2CK3D 5FR1A 1ECBA 2J08A 2JJ2D 3P52A 5KYTA 3OEED 1Y8QA 1GNRA 2Y6VA 3RRXA 3EH1A 2QYTA 2Y3IA 3B8HA 1ZMBA 3AY0A 2QORA 1XMIA 3PGVA 2SCUB 2JZOA 2Q1SA 5J5CA 1P2SA 2WA2A 3FYHA 2XRYA 3L8GA 4RETA 4FPXA 3I0NA 1ZVQA 1JYSA 1U0OC 1ZLYA 3L7NA 4AURA 3ZGOA 2GCNA 2GXAA 3VKGA 2ADOA 4W7SA 2QJOA 2NVUB 1A50B 2HMTA 2WIAA 3ZI0A 3QSYA 3QVJA 4KWCA 3MJDA 4N39A 1NLYA 2VCYA 3P9QA 1A9PA 2JI9A 4OH1A 1KWGA 3AF1A 1CR2A 4CMEA 1AT1A 5IK2D 2AA3A 3TIIA 3WLIA 1C2YA 4MUYA 3ENQA 3SKXA 4RHCA 1WZCA 3A1DA 3KBOA 5CRIA 4B4WA 1XJCA 3VR6D 4KMMA 4DV6B 1WVIA 4WXRA 2XMCA 2QVYX 3UJHA 2INGX 1VJ1A 3V4ZA 3KQQA 4BKQA 4ZYYA 5CB4F 5IT0A 3M6WA 4CUZA 4TKUB 2AC4A 2OXTA 3FTEA 1DKNA 1E2DA 4GEKA 2QX9A 2JHGA 4GO1A 4M88A 4PSDA 5IKOA 1T9ZA 1B8UA 3U3KA 1SBIA 4QOHA 2VG8A 3R5SA 2BEWB 4N5DA 1NAIA 1S2IA 1A7UA 2R1VB 3RIYA 2IHYA 4C03A 5IT9A 2FMTA 1AKNA 1QC5B 3CJQA 3S1AA 3ED5A 1A4IA 1DIBA 1F4VA 1O94C 1XQXA 1U7TA 2V7TA 5AW4A 4N54A 3VAZA 2Q6VA 3DULA 4P3PA 4ZPXA 4MWGA 4NONA 3GLFE 3AR4A 1KOFA 1U9YA 1AKEA 1ZCAA 1Z5OA 3C3MA 3H2JA 3WLEA 4F96A 2QNRA 3RU3A 3NYWA 1MOPA 1V71A 1YV9A 4UCWA 4YRJA 2IS2A 1B41A 3JQ9A 3NONA 4QOIA 4DYVA 3E22A 5JSYA 1U63A 1PR5A 1USWA 4JT4A 2R00C 3FLMA 3FTNA 4DCUA 1OBFO 3WWOA 1BC5A 2QSZA 2QTZA 1XCJA 2H1HA 4UHJA 1L7QA 3ZIUA 2DF8A 2I6TA 4KIJA 4YMWA 4YT4A 5FWYA 3QEAZ 3RQSA 2Y67A 2GZDA 5JPCA 5EKTA 1JIXA 3HCDA 4KOAA 5FPPA 3COYA 3VDNB 3G1WA 1CFZA 1L1RA 2QN2A 4XIIA 5GOTA 4L0MA 3HB9A 1H65A 2UYGA 5K6TA 1UDCA 2PMFA 1ZXLA 4AF8A 4MWOA 5L3SB 3ENVA 1V48A 3DPUA 1MABB 1YJAA 1WG8A 1PJ4A 2FW1A 5CXQA 2AEMA 1I7DA 2Z6AA 4XGNA 2R5FA 4K28A 1T5HX 3Q8XB 1YBMA 4PFSA 1Z4IA 1Z74A 1QR6A 1J06A 3Q7EA 3BSWA 4XTCS 1V2HE 1MAWA 2E5WA 1T1IA 1LVGA 2AQKA 3GEMA 3PFNA 4AULA 1RWXA 1KDVA 5TF4A 2E48A 2GN4A 2HX1A 3OFVA 3OQVA 3IP5A 4HVAA 5BXYA 1M33A 2BJVA 3D5TA 5HZGA 3RABA 2DM6A 5JY6A 3IUNA 4D0GA 1BXZA 3AJ9A 3P2YA 1Q50A 1CVLA 4KE7A 4DXHA 2D2VA 1M0SA 4O4HA 1OBCA 4AG3A 1EFPB 2XRZA 3C5CA 4PC1A 2YOHA 4OHVA 4QLAA 1HDZA 1Z73A 3KQPA 4FLFA 4TS1A 2GPAA 2EFYA 3BMXA 1UXKA 3HR8A 4FWBA 3D8HA 4HRXA 3PJDA 2ZCVA 4MSUA 3QENA 4QVKA 1CHNA 5IAJA 4BBAA 4DM3A 4EA7A 2F9FA 2YFHA 3K70B 2RBGA 4JIGA 5CVDA 3TQFA 4L8FA 1SU6A 1OLXA 4OYRA 3UJ7A 2I55A 3M4NA 2HQBA 4A0FA 3KSBC 2ERXA 3OZDA 1JG1A 5T4FA 1G9SA 1KZGB 3VR1A 1ZXXA 3MWFA 3RVNA 4JJ8A 3K1ZA 3MNFA 3E35A 3P5BA 3U4MA 3GJ7A 3VJRA 2C2YA 2AR0A 4WBNB 2VUIB 3OE7A 3DNMA 1JXOA 1JFFB 1B8PA 2V96A 3PF8A 4QULA 5FNZA 3TSAA 1NNEA 5KWEA 1JMKC 4YMSA 4YWHA 4DCJA 4NU0A 4QARA 3TEJA 3TLJA 3WAKA 1E2FA 4Z5XA 4CF7A 2P30A 2NACA 1Z62A 2Y1XA 4Z4EA 2FLVA 1DEXA 4K0RA 1NVFA 3NXSA 2I2FA 4U2DA 4DDTA 2FYTA 1TCVA 3JQQA 5HILA 3VPGA 1BE6A 1TYDE 3IAFA 3KC2A 3FIUA 2C77A 4G0OA 4KTTE 3W4IA 5L4SA 3QTBA 1DJLA 2YFKA 3U4GA 2AWOA 3FNRA 2WSYB 2XD9A 4ZVKA 5LBUA 4HNGA 4QSHA 4E11A 2YWHA 3ZWDA 5LL6P 2ACKA 3R7SA 1FTGA 3O26A 3RLIA 5FFFA 3QMMA 3UIEA 4KXXA 1KDTA 3OURA 1OH8A 1IVSA 5EIBD 3I6BA 4B7ZA 1VGVA 3DEAA 1LK0A 1KSFX 1E3DA 2APJA 3V4LA 2XW6A 1QCDA 4V1CB 1ZGJA 2BYTA 1LBSA 4HS4A 2F17A 5EY5B 3WB1A 4QM7A 1T6ZA 3MELA 1VC2A 3T4UA 3L06A 2JHFA 2PA0A 1P4RA 1N2HA 1SXJE 2V9ZA 4CMAA 3IILA 3MWJA 3N8DA 3N2GA 5T67A 1ZNQO 3B5IA 1KMHB 3FUXA 1IVYA 3ABOB 1U9ZA 2H00A 3NDRA 4PHTA 2AN1A 5K7SA 3G5LA 1F3LA 1JHYA 2HEIA 3OZVA 3E3AA 2X4DA 4XJXA 5JQWA 1PG5A 2V74B 3BK1A 1HPLA 1QS0A 2G0NA 3HXTA 5A05A 4Z2YA 4D8WA 5A4DA 1QH1A 1EE2A 3MHPA 3JYPA 2JL1A 2BC9A 1P1RA 2P2GA 2QN7A 3EC7A 3ISVA 1XDUA 2I76A 1HBJA 4GWGA 3EH2A 2PDAA 1I5EA 1QM5A 2IYUA 4L9RA 3ICOA 5EJIA 5TGZA 4B8YA 1WUTA 3CXRA 1KDRA 5DHRA 3BS4A 4OI1A 1U8YA 3I6YA 2B34A 2IW1A 1MIHA 1M76A 2V6FA 2O8EB 2QUZA 2YR0A 3KVNA 4YCBA 5EJAA 5FWXB 1ILWA 4LHEA 4TSRA 1OLUA 3HPQA 3CT6A 3PKIA 4WLVA 5BQFA 4TLDA 1GAWA 2TYSB 1OFGA 3HKDA 2C0PA 5JZBA 2FHSA 3UMJA 3GC6A 3PFWO 3SC4A 4NCBA 5HZKA 3DMTA 2YJ3A 4RF3A 1V39A 4NV0A 4MKFA 8ABPA 3VR4D 4GR4A 4KZKA 3VGJA 5AKEA 4UCQA 2G88A 3GH3A 3KJQA 5SY6A 2Q7DA 1N3YA 3QVGA 5K8VA 3E3NA 1O87A 4CLRB 1ZINA 1TUIA 3UGKA 3PNLA 1T0IA 1ODLA 1TGVA 4DRXB 4LZLA 2RSLA 2C9ZA 5FOSA 3FYUB 2GA8A 1ZUNB 3LT4A 3RBXA 3PUZA 5DISB 3EY9A 3E7DA 4GQAA 4ZU1X 2NO5A 3VZBA 5EQTA 5CEJA 3EISA 3MMZA 1YIAA 5JBNA 3R5XA 1EMDA 1FXUA 2EU8A 2QLLA 3T4EA 5K0ZA 3G5UA 5JTUA 4ROSA 3HPRA 1PP4A 1SC9A 4KN6A 1Y82A 4OXRA 4MYUA 3E9YA 1WABA 3WXBA 1M2KA 1YKGA 3R9WA 2NTVA 2VSXA 1Z6QA 2FZ4A 3I2GA 1G7SA 3JY6A 1N57A 2NT4A 1EP1B 3FH0A 4TMYA 1I2DA 2QLMA 4HWPA 2WV9A 3CJRA 3GRUA 5LZ8A 4C2AA 4II7A 3MWKA 4CM3A 5HKKD 5GONB 2GS9A 3DV2A 4HOYA 3DBVO 4UCFA 3BE8A 1FCJA 4NC9A 4XM1A 5B53A 2QMHA 2WWGA 2G07A 2PKRA 3UV3A 1B0ZA 1KFBB 2YZMA 2ZOSA 4NENA 2D0PB 2Q49A 4LRXA 3BGWA 1W93A 3RAJA 4UTPA 1AKRA 3SM3A 5IEBA 2PSFA 3KPWA 3P4UA 4QYIB 4DJDC 4KGXA 3IOMA 4MUHA 2PGXA 1A8QA 4PGMA 4YYZA 4BE4A 3C3BA 1J5EB 5HWSA 3KKKA 1M6HA 1YS4A 4EVIA 4BQRA 4QQRA 3L79A 1PT5A 5T4HA 3IPLA 1T9DA 1H2EA 1RWBA 2RGGA 4G0QA 2K2WA 3NOQA 4LYAA 3WGJA 4H15A 1RC1A 3VH4A 1G2QA 1FDSA 2QI9F 2B2XA 4HEA1 1PJQA 5B1EA 4OLAA 2ZBDA 2HW8A 3CUWA 3X1XA 2AK3A 3PEVA 2FR8A 4PLGA 2A5DA 3VSDA 1VIYA 4RIHA 1XP5A 5T4BA 3KXPA 1EWKA 3M3PA 4YJ3F 4V02A 2ZU6A 5EXDA 4O2RA 2C5FA 3WYGA 2O2SA 1NY6A 1C9DB 5GAJA 2VTBA 3LT2A 4R05A 1HFWA 2DHRA 2J0EA 2V6GA 5IAAA 2EFDB 1EK2A 3LUHA 3S2ZA 2EJUA 3KFLA 1HDOA 2C4TA 4HC4A 4HMOA 3MQ2A 3W2HA 2XF2A 3KUKA 2R8OA 3R3YA 2FMKA 4RQUA 1GVNB 2PX2A 4WNAB 5IZCA 3IXQA 3A3OA 5KOYA 1P0CA 1CNFA 1EP3B 3EHEA 3LD9A 3H2YA 1GYPA 3BK7A 4HRAA 1CB0A 4KV9A 4YCJA 3HN6A 1TRHA 1EBBA 1KBZA 4IF6A 1P0MA 2AGVA 4QGBA 4TX1A 3TVTA 3U4HA 5BR4A 4EKIA 1KMQA 3TD9A 4N41A 3MGAA 3VU8A 4WASA 5JDIA 3WYDA 3QKIA 3TW4A 1ICEA 4BVAA 4CEIA 2RGNA 4XIJA 3YASA 3U6BA 3OZSA 1ZWKA 2QYOA 1K2VN 1S2NA 3PQ6A 4MNTA 4RKEA 2I6UA 2GAAA 1M75A 3V7UA 3WFZA 2EGHA 4MVCA 4TYWA 5ITZA 2NO7A 1GY8A 1V11B 2FQ1A 2HA5A 1AC5A 2V65A 1DEKA 4JBIA 1R4NA 4RJKA 3F71A 1NW4A 3OAAD 3EVZA 3S8YA 3T7RA 4PYJA 1VTKA 1BYUA 1DGQA 4E5KA 1EI9A 1XCPA 2CXRA 3DEZA 3B7PA 4LDPA 2IHVA 3D59A 8ATCA 3K3PA 3FR7A 2F90A 3NZEA 1FFSA 3DR3A 4ZOLF 4D6PA 4OQZA 3L4BC 3DKPA 2O54A 1CZOA 1CS4C 4ZYLA 3ZVKA 3UFXA 2J4CA 1IMJA 4Q9LA 1Y1PA 3OX4A 4BMPB 4DMUB 3GP5A 1WLYA 3TIXB 1WE2A 4EVQA 4TSKA 4Q34A 1L9KA 3V4SA 2X9VA 1BHQ1 3TNYA 2G3YA 4W5WA 1S8OA 1T91A 3FFAA 4RVSA 4D4GA 1QO7A 3CW8X 2ZAMA 4L8GA 4C7VA 2PL3A 2Q9CA 2FVYA 4XGQA 1I0ZA 3U1TA 4EJSA 5TPWB 2Q2NA 3KJEA 3UT5A 4DYDA 4E5UA 4L5AA 2VRNA 2PR2A 4TTIA 4S1VA 2RI0A 2WKRA 1ZM3A 4C01A 1VHTA 2H1WA 5AKIA 5CCDA 4F1KA 2QAIA 4F93B 3VZCA 3N53A 1PNOA 3BCSA 4I2NA 1EK5A 3ETNA 2C03A 3LP6A 3K8QA 5BOSB 5CG2A 1VSVA 3GJ4A 2W70A 5AVJA 3GCDA 2ECKA 3GMTA 3MCVA 3RYFB 4F56A 5CP8A 4RLQA 4Z9FA 1RRKA 5A9SA 2NMVA 2BDTA 3DDZX 4ZYUA 4CWAA 4S0XA 2DVMA 4ENTA 4DV0B 3BWBA 4A5SA 5FUMA 4RD4A 2EV9A 3I9MA 3HKCB 3NDIA 1R27A 4ZC1A 2ORVA 5D51S 5HGJA 4CV0A 4B3SB 7MHTA 1IZ0A 3LY7A 3BJIC 3PE3A 4C0SA 3PDWA 1UXHA 4TLAA 2VLBA 2ZRGA 5HF9A 2JF0A 4FJ0A 2ECQA 2A9FA 3P94A 4PGAA 3SJAA 4W8OA 4D9EA 3KR9A 1DPFA 1WSBA 1W36C 1OX4B 4J0CA 4QUGA 4RADA 2OD7A 3SZRA 3NTQA 4EYKA 5DNCA 4GXTA 1NXPA 3U16A 4O59O 1CQWA 4MV6A 4IJ5A 9LDBA 1U2DA 2BGKA 1YDEA 2BHSA 2GJ8A 2XUKA 5EVJA 5IH7A 4Q01A 4G8CA 4MW9A 4JEHA 2Z5GA 5HM8A 5EHQA 3AW9A 2XIQA 1P4HA 5AVYA 5GIOE 3OKPA 2HADA 3ND9A 3QEKA 4I4NA 3SQNA 4RVUA 4LRQA 4A16A 1XZKA 3K9GA 4E1BA 3EXIB 5I7EA 3CR3C 1E3TA 1IEXA 1W44A 5HEKA 3UMRA 3ZOKA 3FVVA 2TMGA 1WCXA 1AB5A 1QYCA 3RYHB 3DUWA 1E89A 1AXEA 3DVQX 3KUDA 3A4MA 4IJKA 5HA5A 1X1BA 4M6WA 3Q0IA 2OV6A 1NP3A 4HDNB 1TFRA 1USGA 4M4SA 1BWQA 1NVEA 1A2QA 1W0JD 2PZFA 2X5XA 3MWGA 2ZT6A 3OCXA 3PEFA 4L85A 1LZLA 1A2OA 1SCBA 2I3DA 1CY1A 2NYVA 3EIOA 4QAJA 4H1UA 4OBXA 4X1OA 3UHPA 2ZKIA 1EK1A 1WS6A 1LFAA 4PFJA 3W2TA 4CNQA 1DJQA 1QYXA 2B4QA 4YJFB 2QD3A 2ST1A 2Z1MA 3B2EA 2NSYA 5KX5A 1ISIA 1Q0SA 4FDMA 4DQ0A 3E5NA 4S1OA 3A2NA 2VAPA 1Y7HA 3A26A 3I72A 3Q8LA 3QOXA 1XPJA 3NHFA 5ALRA 3S99A 3VNSA 4ZCMA 2H5JA 3Q8MA 1XVIA 1E6MA 1UOQA 5B2EA 5FORA 2IJGX 4QE3A 1SUAA 3TPZA 1FSPA 3SHWA 2PU5A 3CEJA 2PY6A 1GFZA 2CHUA 2ZQZA 3IVCA 3PL1A 1BFKA 4NMMA 1VYTA 4JITA 5TF0A 4Q3OA 5FIUA 4LF8B 4CHTA 3HUEA 2IUUA 2FG7C 2ID7A 3A9TA 3AM1A 2VT2A 1WCYA 3EVBA 3Q9UA 1G20A 5CYPA 2N75A 5K3SA 3CVVA 2C78A 4KVAA 1H1DA 2ZBEA 4XZ3A 1W4LA 5DPMA 5GGYA 3DD5A 4YI3A 2UYQA 6YASA 3H5WA 4C4AA 4MGIR 4ZVUA 4UFPA 1KIMA 1K5DA 4YJDA 4ZP1A 3DLTA 2E37A 2FOIA 5KYXB 1UODA 3JQAA 2GOYA 1E1RA 4AAYA 2CHEA 4E2ZA 421PA 3GIDA 2AI3A 2O14A 4LZNA 4O4LF 5AVQA 3L8FA 1P1IA 2YZNA 4DUGD 1XZPA 4KGVA 4LJKA 1TEVA 1VQ1A 2WHPA 3PQ7A 1P7PA 3O9VA 3WISA 3WK9A 3OVMA 2HCBA 4PAMA 3WGMA 2ZDHA 2HJHA 1PJLA 3PXXA 1XJ5A 2D0IA 3BMNB 1NGSA 3MXOA 3FPEA 1A1VA 3WWEA 4UNNA 1E2GA 4BNNA 1RP1A 3ABRB 3MUNA 3RRNA 1Z22A 2REXB 4OV6B 1KERA 4OL9A 2QP9X 4ZCPA 4QATA 3TSZA 3D1VA 2VAVA 4K88A 3CQ9A 1ZOIA 2QLFA 1M3SA 3KOWA 1NZFA 3PHIA 3N6RA 1S2DA 4X85A 1DO2A 4DLUA 1Z0KA 2XUAA 2VUTA 3AI3A 2G9NA 5EIOA 1T0JB 3HJAA 3NBYC 4PICA 2YN0A 1SZJG 3ZHVA 1DHRA 4K3UA 2XBMA 3BGVA 4UPDA 5B5SA 1Z75A 2XSZA 3WLLA 5FX2A 4PBTA 3UAXA 4KR7A 2XNHA 1R6DA 1RM5A 4BQIA 5ADHA 4ES6A 4GPEA 4WFKA 2G28A 4PHGA 3QPVA 4ZRNA 1OGIA 2IZ5A 3EODA 3MAJA 3WX0A 5JYDA 3DC7A 3LBFA 1U2RA 4S04A 3HZZA 4J7CA 5IWAB 3BIXA 4DILA 4YP9A 4DCOA 1CJKC 4U9HS 2Y68A 2HJRA 1DL5A 2HDOA 2WFAA 3B51X 3NM6B 4J6FA 4MWCA 4XRRA 1IHYA 2ZB3A 4ENQA 4G1VA 4IIHA 2Q8PA 3B2NA 3EIXA 3COPA 1GWNA 1XCMA 1K75A 1TIKA 1U2TA 4UUPA 1WU8A 4CL2A 1KH2A 5JYCA 2ZIXA 1EJ6A 2BBSA 3JVUA 1VJ5A 2OENG 3FMIA 2XQFA 4H9GA 3ZV6A 5A4FS 1KOGA 1P4JA 2FW9A 3LL7A 3JAKB 4IX9A 4J0FA 4P35A 2CJXA 3R44A 1ONNA 2VAXA 4U9UA 3LG2A 1CVRA 1CS0B 1LNQA 4HDKA 4DY6A 4EGCB 2OCKA 4UXHA 3O4IA 2X3FA 4A8JB 5KHLB 1NW8A 2ZBUA 4XIFA 2WY2D 3ZJYA 3TNDA 3JQ7A 1P8AA 4D43A 4ER6A 2YJGA 1T10A 2C2OA 1MIOB 1S6YA 1FQKA 1K4KA 1YL5A 3EE6A 3A2MA 5BQ5A 3BMCB 5TT1A 1UC5B 5EJ9A 3PNMA 2X0JA 3OTGA 2IE8A 2VHUA 1ARZA 3MCUA 1Z7BA 4FFLA 1G9TA 4PLCA 5AIAA 1U9IC 4MVJI 1NJGA 1E8NA 1OROA 2J9FA 3FUTA 2ZRHA 3ZCUA 5FYQA 3K73O 2I4MA 3D8NA 3C7TA 2WD8A 1EDZA 4QO8A 4H27A 1MG5A 1GSAA 1Y6JA 4XASA 2ZIFA 3OTQA 2ODWA 5B4VA 5M2QA 2BF7A 5FH9A 1R4ZA 2Z4SA 3LBHA 3GFQA 3ZWVA 3WK5A 4D4LA 5EYPA 1P33A 3G2HA 1UPBA 1V37A 3NWEA 4NAVA 4LKRA 1U5BB 2O5CA 2GA9A 3IUEA 2GH1A 4I36A 1J0AA 3V1YA 2A5FA 1FYVA 2PZMA 1M34E 2VPXA 3AESB 1XTVA 1YBVA 3GZNA 2IHZA 1IOLA 4B6RA 4URVR 2MOKA 2NVWA 2HTFA 2QT0A 4BZXA 5HM6A 2RHCA 3ECSA 3K9QO 4C08A 4D9KA 2AOXA 1WY7A 3VC3A 2JCXA 3E15A 1XVTA 2GBLA 3FUCA 3IYLW 1X74A 1T4DA 3AVWA 3KZOA 4JX8A 3D3NA 3UC9A 3WNBA 5LDGA 4JI6B 4IW3B 3A9CA 2FOLA 4DKJA 3KSUA 2F3UA 3F4BA 3BIJA 5DEIA 5B3AA 1QYVA 2GEKA 3LRPA 2IKSA 3D6UA 1Y3HA 2XUGA 1D09A 5ESDA 1J1ZA 1DCFA 3OMWA 2GNOA 3OLYA 4MMXB 4IDPA 4R2HA 1YK0A 1N77A 2Q0QA 2P68A 1H94A 4AECA 3K5IA 2HWXA 4FMDF 1T29A 1GPBA 2R8XA 3ANNA 4I5FA 3OIWA 5DKFA 1T43A 3QVSA 2H4FA 4J29A 1XMVA 1M2FA 2AXPA 1L4EA 5EXTA 5FYDA 3FHJA 5AVXA 4K9LA 3HYNA 1E7SA 4BOYA 2XHZA 5LC1A 2DE0X 1R64A 5AW8A 2NTNA 1LUAA 1XTZA 3AHHA 5BO5A 2OM2A 3TLCA 2OBMA 5DYYA 1T4BA 2RG7A 1P2TA 3JS5A 3U7HB 3AJDA 3TKLA 4QEZA 4BX3A 1T8RA 1JDBC 2CFSA 3WA6A 4JI3B 1EFDN 4RTOA 4QQKA 2BP7A 1OXKB 2LWIA 2CDCA 1A7AA 5LU9A 3N70A 2IDMA 2B4YA 4MEJA 3CT4A 4NU6A 3O83A 4Q39A 5AJWA 5DF1A 2EEZA 3ESYA 4R2KA 1AMUA 3AVPA 3P2JA 4HWRA 4DR6B 4U7HA 3DTVA 1FDOA 3TH5A 3Q5DA 2MHCA 2YS7A 3G0HA 3IHLA 3CWZA 3KR1A 2XCQA 1J9ZA 3NCHA 1O9HA 1T0PA 5AJYA 3H9JA 3TL2A 2W83A 2J09A 2GHQA 2QA5A 3BRWD 2Y6UA 3OZUA 4IIEA 4ZI7A 2AOTB 3G0IA 4QA9A 1NRXA 2MR6A 4L1KA 1CVIA 4RK4A 4Y9RA 2FXIA 3TQCA 1FVXA 4HH1A 3KCNA 2GTHA 4UQLA 3E9QA 4AKHA 2FPIB 1UINA 2O7NA 3EHDA 4WE3A 1GLNA 1RZUA 3KWFA 1XYYA 4L8VA 4XCVA 4B3RB 2E82A 5TEVA 3DWFA 3T7IA 1ZK4A 2HSJA 5KQLA 1QGYA 2A1UB 2DBQA 4DWVA 2X0KA 2QP3A 2WU0A 3CLUD 4D0SA 1EWTA 4B7UA 1W9HA 1Z5VA 4IL5A 4O2LA 4L74A 3BULA 3E18A 4D6YA 2Z2ZA 1EM8A 1XKLA 4X61A 1YDMA 4IEIA 2BM9A 4M0MA 4BECA 3PQ4A 5C81A 1OXMA 3H84A 1YH3A 1JEAA 1KBQA 3H2HA 3HABA 5IM5A 1EDBA 4Z4HA 2BM8A 1EIZA 4NCJA 1RJ9A 3N5KA 2C1EA 4EW2A 1Y5LA 4EZEA 2NUBA 1O9GA 4JJ7A 1PN3A 1I0LA 2VNAA 1ZIDA 2YBEA 3DXFA 4FFDA 4NNOA 4OHRA 4MQ5A 3L4BA 4Q3BA 2BFAA 1GILA 3H65A 1IAVA 3T7DA 5KQMA 1HG0A 3KV1A 3IE2A 1I2CA 1U99A 4BVHA 4N48A 2BPOA 5IBRA 4YDRA 4XWKA 3K0AB 3FHCB 1JR3A 5HUHA 2H4WA 2HSEA 1CR0A 2ISQA 1Z4QA 3DZBA 4ACAA 4IMRA 4B5KA 4AN0A 2DPGA 1LSOA 4XOUA 3E7WA 4GOLD 5DM4A 2WB2A 4WADA 3U4AA 3C8HA 2FPKA 5EC8A 4Q7QA 1U0JA 2H5EA 3CF2A 2IF0A 4NOJA 2E4XA 3R1IA 4ZVVA 3RTAA 1B23P 3QVOA 1JL3A 1HLGA 1LCIA 2R1TA 3A3KA 2UXBB 4KAAA 3E3LA 3UJ8A 1U0EA 1U1DA 4OAQA 3DF7A 4BJ1A 4LDJA 3HB4X 4H7JA 3N87A 1VBKA 3GRVA 3ZY4A 1E2HA 4ZCIA 3GN1A 4QC2A 3T7KA 4EPRA 5ILQA 5IJWA 1NUSA 2CLDX 1A8PA 3M2TA 4TM8A 2PS1A 1DJMA 3G1UA 2QP4A 1Z0ZA 3HCAA 1DCMA 5AKHA 1UPCA 1V5GA 4ZCTA 4BE7B 4MP8A 3SK0A 1T1RA 1T0BA 1DX6A 4JBLA 4TV8A 1NAHA 5JFOA 3U0VA 1MQ9A 4QYMA 5BSGA 1DI0A 1CKEA 4FIZA 1SUEA 3CONA 2HA6A 4PZCA 2PZEA 4TN5A 5TDHA 2PV7A 3TNLA 3WKCA 1EQ2A 5K1ZA 6REQA 1X0XA 2DUJA 4YT2A 5JADA 2PT9A 4BO3A 1TQDA 3FNGA 3O2QB 3QMPA 4A82A 3BC1A 2C7BA 4H3VA 2O23A 5C8YB 4J76A 1TZBA 2VDJA 3LFUA 3L8EA 4DLLA 1L4KA 1CTQA 2IPNA 1V9SA 2N9UA 4CQMB 3GJZA 2ZUSA 5FO1A 2P67A 4EMUA 4YROA 5EE9A 3N2KA 2WVHA 1R6XA 4BRZA 5L9AA 4BNGA 1KPHA 2A5GA 1PLLA 3A6EA 2YZ2A 4LMPA 1QRSA 4X6UA 2BZ1A 2H2AA 4M1TA 2IW3A