3H2YA

Crystal structure of yqeh gtpase from bacillus anthracis with dgdp bound
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
313
structure length
309
Chain Sequence
DDDFLRILNGIGKSDALVVKIVDIFDFNGSWLPGLHRFVGNNKVLLVGNKADLIPKSVKHDKVKHWMRYSAKQLGLKPEDVFLISAAKGQGIAELADAIEYYRGGKDVYVVGCTNVGKSTFINRMIKEFSDETENVITTSHFPDLIDIPLDEESSLYDTPGIINHHQMAHYVGKQSLKLITPTKEIKPMVFQLNEEQTLFFSGLARFDYVSGGRRAFTCHFSNRLTIHRTKLEKADELYKNHAGDLLSPPTPEELENMPELVKYEFNIREPKTDVVFSGLGWVTVNEPGAKIVAHVPKGVSVSLRKSLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of YqeH GTPase from Bacillus anthracis with dGDP Bound
rcsb
source organism Bacillus anthracis str.
molecule tags Hydrolase
molecule keywords GTPase family protein
total genus 76
structure length 309
sequence length 313
ec nomenclature
pdb deposition date 2009-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3h2yA01
4ZCMA 4QGAA 4Q4HB 3CRRA 2ZUCA 1WE2A 4U5XA 3TSWA 1GKIA 3I3SR 4I1OA 1ZP6A 2QNRA 1FQKA 2AWOA 3VU9B 3CIOA 3VR4A 4B2LA 5TB5A 4JVMA 1Q21A 2V8OA 4OHVA 2YWFA 2NZJA 2RGAA 3LLUA 1DELA 3X1WA 4W7SA 2RB4A 3GLIE 1A7JA 2AN9A 4OI0A 1OH8A 3PUYA 1E0JA 3OIWA 2I1QA 2IL1A 3THXB 3CBQA 3R20A 5JRZA 1R4AA 4ZDWA 1JPNA 4JLJA 2Q9CA 2RGEA 5CYOA 3VKGA 2FZLA 5EUQB 5KU1A 2C99A 5FPYA 4US1R 2NGRA 1BKDR 1ZVQA 3DDCA 4DT1A 2ATVA 4ESVA 1XEXB 5DI3B 1KZ7B 2QU8A 3LXXA 3HR7A 4IVRA 5EE3A 2XTMA 1OXXK 1P2UA 1N0UA 5B57C 3BRWD 1AS0A 4NU0A 3D31A 1NF3A 1KSFX 2N46A 1KDOA 2VP2A 5HZKA 2VP6A 1E96A 2DYKA 2K5UA 3T61A 4KV9A 3GJXC 2PT7A 4GMXA 3GLFB 1RRPA 1LFDB 2XNDA 3AEZA 1NBMD 1T8TA 1TUIA 5K8TA 3HWSA 4RKFA 1P7CA 4RCZA 4EQ6B 5JI3E 2R9VA 5FTLA 2ATXA 2PJZA 1J90A 5F9FA 1SVMA 5SZKB 2X2EA 5DN6A 4MDFA 2B7BA 4LV8B 4A92A 2OO7A 4QHTA 2JLYA 4GOKA 5FPKA 1ANKA 1D2MA 5KNBA 5LD2C 1TUEA 1YRAA 1G5PA 3KKNA 4IKEA 2BBSA 1U81A 3B60A 5AR1A 1CEEA 2AK3A 1XMIA 2VP0A 3V9PA 3PEYA 4NYMR 2IF2A 3SQXA 3UG6A 4NCHA 3P32A 1XU4A 1SVWA 2WKPA 2FEMA 4DCTA 4EJSB 4YMWA 5AUOB 3LW7A 1KK1A 1DAHA 2A78A 1GRRA 2RGGA 1J8MF 2Z83A 3KUDA 4HAVA 2R6GA 3L82B 2W6ID 5EE5B 2QM8A 3SYNA 4B76A 5GVSA 1C1YA 5HTKA 3U4QA 4NZYA 3LDAA 4ITRC 1N6RA 1AS2A 4HLCA 4G5SA 2OHFA 2P67A 4BE7B 1FMLA 4W5WA 1G4UR 4HYYA 2FJUA 1GDDA 4TTQA 5E7MA 4C0BA 4DLTA 1Q57A 3EPKA 4E09A 2BEJA 4JJKA 4RD2A 3WBKA 4A36A 1E9BA 3WY9A 4V03A 4KXFB 1OIWA 1ZIPA 2WAXA 3VX3A 4DKXA 5KSYA 1PLLA 3CH4B 1ZNWA 5SZJA 4YMUA 2GF0A 5F2EA 4D2IA 4DEYA 2CXXA 1KZGB 2CL6X 3C41J 1HYQA 1VYVA 1XDBA 3A4MA 2GTPA 2IYLD 2CVFA 1MO6A 1E2DA 2WWFA 3BORA 3NC0C 3PIRA 3IPYA 4CT4B 2GILA 2WWHA 5C1BA 1L4YA 1CR0A 4CIDA 2ZROA 5EP1A 3THYA 3K0AB 3AM1A 1M6NA 5FUVA 5G53C 3KQLA 3C15C 3EZ7A 2EWVA 4Q48A 3IHWA 1TPZA 2VHJA 4XVUA 4Z51A 4BZXA 1UF9A 1W46A 3AVQA 3P20A 3SI7A 1KGDA 4HB0A 4TSFA 2ZUBA 3WHLA 4YXWD 1F6BA 1A82A 4PC6A 1A2BA 1P9RA 2L0XA 1YR6A 2X1VA 3EX7C 2ORIA 1II8B 2BEKA 4MUAA 2VQSA 5FOWA 1Q1QA 2YHSA 4LBYA 5G41A 4JYCA 3A4LA 4FCVA 2QP4A 3JZAA 4L5BA 2IHYA 5C2JB 3OEHA 2BJWA 5J4YA 2ZPTX 4IDOA 4XTRA 4KU4A 2XXAA 2ERXA 1MKYA 1CP2A 2W2VA 1RW4A 2R8RA 1WP9A 3VHXA 2VO1A 2GEVA 3OEEA 3OAAD 2G3YA 4I4LA 4C9BA 2RGNA 1F5NA 1ZM7A 4P32A 1TQ4A 2FZ4A 1FTSA 3QBVA 3QEOA 1VCOA 5KPDA 4LV5B 4A8JA 4KHZA 4DDUA 2Q9AA 3AF1A 1GUAA 3IGFA 4URXR 3FOZA 1RRCA 4JBXA 1OLOA 3LWNA 1W47A 1XF9A 4AWXA 1R8QA 2W00A 2ZSFA 3BC1A 3CWZA 3FHCB 4ERNA 4NONA 5CLQA 2O8EA 4NBSA 4NCNA 3PEVA 2A5DA 3GLGB 3OE7D 1X86B 2Z43A 1X6VA 1M34E 2AKAB 1G8FA 3OIYA 5FH9A 3V4RA 4RVCA 2IC5A 3R7WB 2ZS7A 2ZIAA 3LNCA 2BDTA 4IOMA 3CF2A 4MYTA 1FP6A 3MWLA 3VR5A 1HURA 2BMEA 1IY2A 3B9QA 5CB6A 1Z3IX 1T3HA 4M2LA 4KFTA 2ZR0A 4HSEA 5JMTA 4ZI2A 3MD0A 1F2TA 1U9IA 2PEZA 1E2MA 2JATA 1N0VC 2O8CB 4I1SA 4Z1MD 3T5DA 3AVUA 2XEXA 1TF7A 2P0EA 1ESNA 4YLGA 3A1VA 5B30A 4F93B 1RE0A 1HH4A 2J59A 2XX3A 2H57A 1WXQA 1R0XA 2WICA 2ONJA 1RKBA 4XSHA 1SVKA 4JSTA 3VFDA 4B34A 821PA 3NBYC 4JT2A 2IS4A 1ZRHA 4XD7D 5TVKA 2IEZA 2X77A 1Z22A 2A30A 2QM7A 1XBTA 2WMNB 1N6KA 3AVTA 1ZJ6A 2HXSA 2D06A 2IS1A 3VX4A 4ASUA 5H8WA 1F60A 1X8KA 2O5VA 4WXRA 2BOVA 4LYJA 1G291 4Q1AA 1HUQA 4PO1A 3K0CA 2OILA 1IM2A 4TYQA 3WNBA 4ZV4A 5IK2A 2ZJBA 3R9IA 3TR5A 3AP2A 1ZAKA 1IHUA 3IBGA 1Q20A 4G0NA 4NKRA 4QXAA 5EXSA 4G1UC 4B73A 2CK3D 1Z6YA 1NIPA 1FUUA 2BV3A 2B92A 1RVDA 1NNEA 3U7EB 1RYFA 1N0WA 4MRNA 1I4DD 1K5DA 2W6IA 3ONWA 2VTKA 2F1JA 2HT6A 1Z0KA 1K6MA 1MH1A 2N42A 4LUCA 2WJVA 3RRZA 2FFQA 1FW6A 3NH9A 1LNZA 4Q9JA 3L8YA 2IBMA 3IIKA 5GJVC 3IO5A 2QUZA 1SGWA 4Q18A 1DAFA 3I1FA 4KLNA 1MO5A 4PAMA 1Z63A 4JLBA 2ZRKA 1XPOA 1ZUIA 3CX6A 3P26A 2BC9A 1XCPA 2O8CA 3OIUA 2DWQA 2CCJA 1XEFA 1GRQA 3UXMA 2LCFA 1TF2A 2G88A 3KQKA 2CL0X 1HEIA 1OXSC 4G3XA 4BUJA 4R71A 3WNDA 2XJ9A 3R7WA 3GLFA 4LPKA 2O8BA 3QXCA 2YJTD 3TQCA 2I1VB 2JLVA 2JLXA 1F3OA 2IYUA 1GG2A 4M53A 1ZINA 4DCSA 1N25A 5B58C 2ZE6A 5JWOA 4L9SA 3SYKA 4IOJA 3IQXA 3HYTA 4IDQA 5LB4A 2V4ZA 3EXAA 1N6PA 2QGNA 2KBFA 5TDHA 2IS2A 1Y63A 3PQCA 1KNXA 2G77B 3BB1A 2QT1A 5EZ5A 2V7QA 4ZCIA 2WJYA 4R2HA 1CXZA 4C30A 4BFYA 2ANCA 3A4NA 5J4KA 3MJHA 3NTUA 2IUUA 1TEVA 3SFZA 5EE1A 4D26A 5DISB 3Q9LA 4CGZA 2J7KA 2ZREA 2ODNA 1U2RA 2IXGA 1G64A 2ODBA 1VKJA 4QBFA 3THWA 4TLDA 4OBEA 2W0MA 4XSGA 1W0KA 4JSYA 3T5GA 3PG5A 1J8YF 1U0HC 2ASEA 4A2QA 4E5UA 1KHTA 3THWB 4POAA 1SZPA 1FMJA 4BFZA 2IK8A 3FMIA 1TX4B 5C4GB 3W6NA 2G6BA 3SZRA 1G6OA 1W4AA 2VP4A 5KNDA 1ZM2A 1GAJA 4LX0A 3K0CC 1U9IC 3CRW1 3PUZA 4P33A 2W2XA 1VPLA 2ZRCA 1NG9A 4OI4A 3EC2A 5HCNA 4BLPA 4M1YA 3PITA 3SC3A 3AVYA 3UWOA 2DWPA 3IKJA 4UQOA 5FTMA 4EIWA 3AF4A 1ZW6A 2XTZA 5JHHB 4KFRA 1EG7A 2QZ4A 3THOA 2UVQA 4MGZR 1COWD 1VG8A 2OFOA 3IUYA 1US8A 4LJ4A 5CDFE 2W58A 4IJMA 4OK6A 4BLOA 2QAGA 4A8JC 1G3IA 4Q9KA 2Z5FA 2SHKA 5FBVB 2G9NA 3TBKA 3U44A 4OHYA 1FPMA 4IVPA 4HDCA 5DH9A 1Q22A 3UWKA 3DMDA 1VHLA 3EIEA 4Q03A 2YC2C 3IEUA 2RAPA 2OG2A 4Q4AB 3SE0A 3ZIAD 2Q3FA 3LRPA 1IN4A 6Q21A 4A15A 2QE7D 2ZU6A 4HAWA 4B6EA 3K70D 1CULC 1VIAA 3ZJYA 3FKSA 2ZJOA 3AP3A 4TL9A 4DLZA 1TTTA 1SVIA 1OSNA 3N2IA 2O8DB 2JJ2D 2EFGA 2GCPA 1XEXA 1E32A 4LC0A 5SZIA 1E79D 4RZXA 3TIFA 5TXGA 2QMEA 1NLZA 1XJQA 3TVTA 3DM9B 1G1MA 4RKEA 2BKEA 2RKOA 2AXNA 3RS5A 1H8HA 3B7GA 1IN7A 4GPTA 1E98A 3V00A 4WAUA 1KK3A 2VP9A 1SXJC 5J5CA 1Z0JA 2ZANA 5FOXA 2IX3A 1ZUNB 4FW9A 1SHKA 2ZEJA 1S96A 2A5YB 3NEJA 5CM9C 2FG5A 1SXJE 3UMFA 4U7DA 1NN1A 3W6PA 1DG3A 4WVFA 1QHHB 1XJ0A 4LHYA 5IF9A 4EPTA 2ZRJA 3L0OA 2Z4SA 4OHWA 2GNOA 2OUKA 4JLMA 4DLUA 2EVWX 4H9GA 1QHXA 1Z06A 121PA 2EFEB 1Z6GA 4PZLA 4GZMA 3AKDA 5BWMA 5ELXA 4US2R 2ZETA 2E1RA 3KUCA 1VMAA 2ZUDA 2WMOB 4DB2A 2GZHA 5HPYB 1LVGA 1E9SA 1G5RA 2P6RA 4KSBA 2WOOA 1QG4A 5JS7A 4O25A 1KJWA 3C14C 2OT3B 2OBLA 4NYMQ 5EE9A 2QTVB 1F2UB 1SVLA 2DFLA 5KDLA 1EESA 3B82A 5DNYB 4LBZA 3TSOA 3H2YA 5DI3A 2V1UA 1XX6A 3KXKA 4URUR 4LGMA 5DLQC 4F91B 1GNPA 4JYBA 4LBVA 3SR0A 1AZTA 2FFHA 4KVAA 2QBYB 1G3MA 4IXMA 1A2KC 1XP8A 2V54A 4BRWA 4GNKA 4PFSA 4XJXA 2CE2X 3QOFA 2Q6TA 3KXIA 3KFXA 3ETLA 1COWA 5E3HA 4DWJA 4KLZA 3I73A 5L3SB 3PUXA 4YC7A 4HAZA 1OHHD 2CCGA 4X8HA 3RC8A 4A1FA 2REXB 1UPTA 2YWHA 3OESA 4QBHA 1R0WA 2V6IA 5EUMA 5FI0B 1SXJA 1GL6A 3BB3A 3IDQA 5KSZA 1DVRA 3CX7A 2VH5R 3KJGA 4HZIA 1IN5A 3K9NA 1XD9A 1E9AA 2QEQA 2ZTSA 3QPVA 3KDSE 2CHVA 4JLDA 4Q47A 3U3JA 3LY5A 2ZM5A 1F2UA 2H7VA 3Q7QA 1NY6A 2KSQA 1S8FA 1MRSA 5G40A 4QKQA 2D7DA 5P21A 4ZDIA 3SYLA 4LJ7A 3QXSA 2ZAOA 1JXMA 1S1MA 4F4JA 1NMXA 5CJ2A 5DSZA 2PJRA 1L4UA 4CEHA 4R9UC 3ZZTA 3NXSA 2R6CA 1E2EA 4PZYA 3BGWA 5EXTA 1P2VA 2DFTA 4FMBB 3SNHA 2CEAA 3WYGA 2ZYVX 1HA3A 2H17A 1QHYA 3EG5A 1BS1A 2A2ZA 2NQ2C 1HT2E 1NY5A 1G6HA 2VBCA 3C5CA 2QP3A 3NKVA 3RVBA 3CNLA 2FN4A 2VLIA 3P1JA 3T15A 3U3KA 4BQSA 1FX0B 1MOZA 4WXPA 3NEYA 2V1XA 3NC1C 3CWQA 1SKYE 3I61A 2OCPA 3VR3A 4PAQA 4O2LA 4Q4AA 4LYAA 1QHNA 4G5QA 3B13B 3L8ZA 4CYMA 1G17A 4OHZA 4GRAA 2O0KA 3W5IA 3I62A 5HE9A 4JBWA 2WWIA 1GFIA 1KSGA 1E0SA 3X1DA 1BYUA 1YRBA 4P3YA 3TSZA 2EYQA 3QXHA 3Q5EA 4M9ZA 1M7BA 4LBWA 4PPNA 5JHGB 5CJPA 4JL6A 4ZDJA 2ZQ5A 3K0AA 4OI2A 1KAGA 1MO4A 2JLQA 4H1VA 2WAYA 3F0TA 4TTPA 4DXAA 4DVGA 1RIFA 2OXRA 1LY1A 3DEFA 2BBOA 1G21E 1UJ2A 2D2EA 5J40A 2R2AA 3WNCA 1N6OA 4YONB 4B43A 2JCSA 1JAHA 1DAEA 3QKSB 1Q1ZA 2P6NA 3I92A 1LF5A 4R2IA 3P4YA 3RS0A 1S2MA 5AWFC 2JEOA 2PX3A 5GADl 1XJCA 1R6BX 1MR3F 4P4UA 4Q4HA 2VP5A 3CRQA 3TJZA 4JVNA 4LJ8A 4G5GA 1JJ7A 3G0HA 4MYHA 3G5UA 2O8EB 4AC9A 2XJ4A 1YR9A 3KKOA 3AKYA 4BFUA 1GP2A 3KTAA 1W2HA 1SXJD 2AK2A 1NJGA 1UEJA 2JLRA 4Z8XA 2WHXA 3RWOA 2ZRAA 1S9HA 2BM0A 2JJ1A 4Y0VA 4PHFA 2OFWA 4FD2A 3QQ5A 4GP7A 4DIEA 1NKSA 1W4CA 2CNWD 4IW3B 2WIAA 3M4YA 1KSJA 1Z8FA 1DAMA 5BW8A 1NSFA 2WJGA 4OL0A 3A6PC 1GIAA 1M7HA 2JA1A 3TKLA 2WWYA 2AKYA 1JAIA 3FPAA 3LX5A 2GCOA 3RS4A 2ZJYA 4IRUB 1TQ2A 4AG6A 3TNFA 1XCMA 3U3OA 2QSZA 5C18A 4A4DA 3PENA 2XOKD 4JKIA 3GLIB 5KO2A 4FWTA 1N2CE 1FOEB 2BCJQ 4ZKEA 5TMPA 2BMJA 3WP0A 4TZ6A 1YHNA 1GSIA 4WBSA 1FNMA 1H8ED 1OYWA 1XTSA 4IVQA 1YZKA 3M6AA 4D0LB 3GP8A 1OB2A 4EKDA 2GKSA 2C98A 4AI6A 2ZI9A 4TYWA 1TNDA 4WZ6A 4TMVA 2WBLC 2LKDA 4YDSA 1KI4A 2BBWA 4NL4H 4AKIA 2J7PA 1F2TB 2ZJAA 1DAGA 1Z28A 4DB4A 1NLFA 1E4VA 2G1JA 2NMVA 1RZ3A 1XB2A 1W49A 1PZNA 4DHEA 2O8FA 2FPMA 4FWIB 3QKTA 1G18A 5J47A 2J41A 4PXAA 2AFIE 4QRHA 1NKTA 4PQYA 1OHHA 2ZJZA 4C0HA 3AB3A 4C2UA 1E1QA 1XZQA 3FTQA 3OIVA 4GFDA 4JBYA 4Q1CA 4EFNA 4KFSA 1V5WA 2WOJA 2WWXA 2ZRFA 2BCGY 3DZDA 4B3XA 1FP7A 3THXA 3KKQA 4TLEA 3NVAA 2CCKA 3B1VA 3DMNA 2OESA 3KKMA 4UNNA 1W5SA 3IPXA 4V0MA 2PL3A 4E03A 3CZQA 4HUTA 2JLZA 1ZBDA 4Q9HA 4OJQA 2XNDD 1RC8A 1P2SA 3AH8A 4I81A 4TT3A 3PEUA 1D9ZA 5BXQC 2C9YA 4HLUA 4F92B 1JB1A 3U5ZB 1XPUA 3U4QB 3DOFA 1N6HA 1YZLA 1A1VA 1VCIA 4RFVA 3GD7A 4Q7KA 4NDZA 2VHQA 1JI0A 5L8VA 1YVDA 2YYZA 1E9CA 2YZ2A 4FIDA 1IY1A 3W5JA 2PMKA 1M74A 1G7RA 4M1MA 4QGHA 2GJAA 5B64A 2REOA 3RS3A 2UZIR 4LOAA 4DSTA 4MA4A 2OZEA 2CK3A 4FCWA 4TSFD 1EFRD 1EX6A 5G3YA 2VRWA 3PUVA 2ZVPX 5AJZA 5E7IA 3ZS9A 1II8A 4QBIA 1W44A 2O52A 1JEEA 5TARA 2N1BA 4PPQA 4I1VA 5B2ZA 2ZRLA 2NO9A 2FH5B 1UBEA 2BMDA 1ZUHA 4EPWA 1FTNA 3TGPA 1KI6A 2ZXUA 2ZJ8A 5EP2A 4C0JA 4EJSC 4XWOA 1XTQA 3BB4A 1TEXA 1P62B 2YOGA 2XB4A 1Z2CA 2FGKA 3HPQA 5CIQA 4OYHA 3AGPA 3ZIAA 3QPWA 1NSTA 5IT5A 1RPZA 3GFPA 4MGIR 1SVSA 1E2NA 2C2HA 3WBJA 3KL4A 4V0ME 1P72A 1NL3A 5HR5A 4K8OA 3QENA 2D7CA 2C04A 2GK6A 1E99A 2JLSA 2CLCX 3FKSD 1H8EA 4PHTA 3GLFE 3ZQJA 1U8ZA 3SBEA 1GVNB 2DFNA 1OFUX 3DL0A 2QAGB 3UK6A 3K9LA 4Q02A 2GXQA 4RD3A 1D2NA 2FV8A 4ESHA 1UFQA 1P5ZB 2IYWA 1KO1A 2OLKA 2QA5A 4A82A 5IRCD 1QRAA 1RJ9A 1T5LA 1G7SA 4O2RA 2C03A 2XTNA 1G7TA 4G5RA 1DOAA 1ZMXA 3K1JA 3NDPA 4K81B 2XZOA 5EP3A 3GLGA 4MQBA 1PLKA 5J4VA 3WYAA 1MABB 5JWRA 4TYNA 1KI6B 3N5CA 2X2FA 5H1YA 3Q72A 2YVUA 4C3ZA 2DFKB 3K0SA 2RGBA 5JEEA 2YKGA 2A5GA 1OFHA 5DYGA 1VCNA 3K09C 3ZDQA 2JLWA 1EWRA 2NO7A 3UMSA 4B3CA 3SU8A 2RGNC 2D2FA 1AGRA 3FB4A 2AXPA 4R7ZA 3SJBA 1R5BA 3PXGA 1SVOA 2EQBA 4UXJA 3A37A 3EZFA 3K0EA 4M4SA 4B3GA 2JAQA 4NCKA 1FZQA 1Q12A 1AS3A 2HF8A 3A36A 4LV6A 4TT3D 4A6XA 4RJLA 2PCLA 5LB2A 3OEED 2MMGA 5LDDC 2ODWA 2FFBA 3U61B 2QL6A 1XNJA 3R8FA 2C77A 1T8UA 3O8BA 4JLVA 3RWMB 1B23P 5LD2B 1OH7A 1SXJB 1OKKD 4B48A 1UADA 4UXHA 1PV4A 2QP9X 3KKPA 3PJRA 3FGNA 1DPFA 3F8TA 3CRVA 1G41A 5SZHB 5FOUA 1T4GA 2F43A 1KI8A 4LDJA 2EU8A 2CHQA 2WSSA 4ABYA 1J70A 4TMZA 1R2QA 4IDHA 5CDFA 5KUTA 2F1RA 2F43B 4PO8A 1XXHE 3MFYA 1J7KA 3FDIA 2NO0A 1RRGA 1VDZA 2ZI6A 3N70A 4HUQA 4QJ5A 4QNRA 4X8LA 2E9SA 2FX3A 2OBMA 4GMDA 4P4SA 3O8RA 1KDPA 1JECA 5CITA 2NPFA 2OXCA 4IDPA 3GEIA 3C8UA 5L3QB 1JR3A 3REGA 3QIAA 3DM5A 2EFCB 3GLHE 4RY2A 2W83A 1VG0B 1WRBA 1GOTA 3K8YA 4NYIR 3H4MA 1ZIOA 3TUJC 1DS6A 3PFIA 1KKMA 1G8GA 2FF7A 2C95A 1D8TA 4TQUS 1PUIA 3X2SA 4EPRA 4NTZA 1OV4A 4ACAA 1ELOA 3LA6A 3AP1A 2FFAA 1QBKC 2GXAA 5UKDA 3CKLA 2QTHA 4EPXA 2WVJA 4IEEA 4A9AA 3EIHA 2JJ2A 1PVOA 3BFVA 3CPHA 4ZCLA 2VSOA 3ZLJA 2X8AA 1G3UA 2QPTA 4QG7A 3HYRA 3K53A 3A1UA 4LCBA 3CNNA 3UKDA 3K70B 2GXSA 1Q3TA 2ZRGA 3U3MA 4AURA 1WBDA 2BWJA 1X8LA 4QFMA 4RD6A 4V0KA 2JJ8A 4WW0A 3DZ8A 3FKQA 3KJIA 4OQLA 3LBHA 2EFDB 4YMSA 3QKUA 2J87A 1UAAA 4OKSA 5CK4A 4PQRA 3U2QA 1KO5A 1ZD1A 4Q4LA 4UNSA 3AF2A 3B8HA 2G0TA 4YDHB 5FL3A 3VNUA 2FPKA 4NYJR 2FSIA 2AR7A 4GI7A 1SKQA 1PJRA 4QGGA 5BYKA 3QSYA 3GJ6A 4DSUA 1OXTA 2GRJA 2P6UA 4MGKR 4RSGA 2ZS8A 4B2IA 3WMFA 1Z47A 1LV7A 5BYJA 4ACBA 2FEOA 4B3FX 1WQ1R 2P65A 4EDHA 2OEPA 5JJLA 5FBLB 3U6BA 3FWYA 5E95A 1W0JD 2EW1A 1ZC3A 4V0NA 2GDJA 3NWJA 3CUEF 4A6PA 3THYB 1Q1EA 3BAFA 2IEYA 4L15A 1IXZA 2J3EA 3MWJA 2O8BB 4KI0A 1XD2A 1P75A 3A58B 3AKCA 3ZD6A 2ZRMA 2QROA 4EFLA 4NCIA 2IYZA 4P4TA 4HATA 3CB4A 3EZ6A 4XOIA 4DLVA 3B78A 2FDCA 3TVDA 1G8HA 4KCGA 3AVPA 5JEDA 4CRWB 5HKKA 3BOSA 4KYIB 4AIIA 3ADDA 4JLPA 3CNOA 2MSDB 3B2EA 2IXEA 2KI5A 2LKCA 1WCV1 5CM8B 1AJEA 3SFVA 1L2TA 3KB2A 1QZXA 1ZC4A 2VF8A 3GLHA 3I72A 1QHHA 3U7HB 2CHGA 1KO7A 1WB9A 2WPDA 4JZKA 2P5TB 2QMUA 5AJXA 4TTRA 3REFA 1XXHB 3Q8XB 3E70C 3SEAA 1VG1A 2B6HA 4IHQA 4BLRA 4D82A 2DPXA 4X8OA 3RDPA 1S3GA 2H8KA 5L3SA 2DR3A 4TQAA 2V55B 4M8NE 4OHXA 2A5JA 4QJ3A 2H1LA 1UKYA 3MCAA 4URVR 3EPHA 3EWAA 4ZIRB 4OQFA 3RHFA 3KX2A 1P3JA 3ND8A 5GJCA 3ZVMA 1JQJC 2ZI4A 3MMPA 3JVUA 1JEDA 1EK0A 1NBMA 3M0EA 2B21A 4A0GA 2I4IA 2WKRA 3BH6A 4BZQA 3RS7A 4XD7A 1VG9B 5DIFA 3TMKA 1A4RA 2ECKA 5FOTA 1DG1G 4BFSA 3ZYCA 4DRZA 1KO8A 2OCBA 1CS4C 2VEDA 4B3DA 4MKGA 1JXOA 5JWHA 3SJAA 4TLBA 3SS8A 4HAYA 2GAOA 2QPOA 3IILA 4FINA 2CMKA 1KY2A 1CJTC 2WWWA 1OFIA 4LHXA 3ZVLA 1Z0DA 3GJ3A 2NOAA 3QY0A 2J1LA 2D62A 1S3SA 4PC7A 5DYIA 3G82C 2R65A 4TWZA 4YQFA 2ZVQX 2QTFA 1UDXA 1N3BA 5F3WB 1UM8A 4B35A 4JL5A 3VQTA 3U3RA 5EE0A 5A5GA 1MRNA 3SQWA 3PEWA 1T0HB 3FMOB 1CRPA 1OJLA 2QE7A 5CLLA 2HLDA 3UIEA 2PBRA 3D7MA 4Q1BA 5EP4A 2HT1A 1HTWA 4Q00A 3X1YA 1O87A 4ZKDA 3L2OB 1R5OA 1NVUQ 4Z8YA 2HYIC 3BK7A 4LRWA 4W9MC 3B1ZA 3CF6R 4UXIA 2GEUA 2WM9B 4B2PA 4BLSA 3TW8B 2GA8A 1QHSA 3TRFA 4CEHB 2ZYTX 4KJZA 3I8SA 3GLIA 5FBRB 4NP6A 1E1RD 4MYCA 3W8RA 2IHBA 2C9OA 2IF0A 1AN0A 2JIZD 5D3MA 1P6XA 2DB3A 3SN6A 2JIZA 3SOPA 5TV2A 2W0SA 4M9SA 1XEWY 3GFTA 2YV5A 2MSCB 1Z2AA 2R44A 2HF9A 2ZJ2A 3RRYA 2KE5A 4NMMA 4D0NA 2ZRBA 3QXJA 2E87A 4XVQA 1UBFA 4G5OA 1HV8A 1XZPA 2IA5A 3LVQE 1UKEA 2ZE8A 3AKEA 3RRNA 3NBFA 4U00A 1QG2A 2IWHA 2X19A 4MRRA 3CRMA 4PPGA 4O3MA 5BN4A 4EPYA 1P9WA 4RZ2A 4XH9B 1E0AA 5EZ6B 4X8MA 5AJYA 4DT1B 2RMKA 4ZO4A 4QOSA 1NMYA 1VYUA 4WA7A 3ICEA 1ZCAA 3T34A 2C96A 4LSGA 4KITB 2OV2A 3OAAA 4PQFA 4UNQA 4TZ0A 1W0KD 4HAXA 2GZAA 3D3QA 3DKVA 4QBGB 1GWNA 4W5HA 3RRMA 4C7OB 1W36C 4GOXA 1F48A 4QL3A 3CO5A 2ZRPA 2RGXA 4LI0A 3ZQ6A 2IYYA 4F38A 1AA9A 3T1TA 2XZLA 3NH6A 2XOKA 4NH0A 3VR6A 1IAQA 1KSHA 1GL9B 1UBGA 2WSMA 2OCYC 4D25A 2GJ9A 3HU2A 4DDWA 2CL7X 2NTYC 2Q9BA 1R0ZA 1ESMA 2NZ8A 4G01B 4DSOA 3VR2A 5L3VA 4P31A 2Z6VA 2QSYA 2YOFA 2HJVA 2GBLA 5AUPB 3LH5A 1QDEA 1E4YA 1R0YA 4DZZA 3TQFA 2IW3A 2PZFA 2GEDA 4A2PA 2B8WA 2ANBA 3W8NA 1JR3E 1AM4D 1J2JA 2VYFA 3WRXC 1CJKC 3QVVA 3S1AB 1IONA 4BGDA 3CM0A 1TF5A 1TADA 2XITA 1YZTA 2GWHA 4QGFA 1XMSA 3HR8A 4HB2A 4NYJQ 3LX8A 2VSFA 2WJHA 4EJSA 2J0SA 3RSLA 2HLDD 2PZEA 1LS6A 1TAGA 2H5EA 3QE0A 4J0QA 4Q5IA 4PC1A 3NDBB 5D3MB 1DEKA 5K8LA 4MUBA 3VMFA 4QHYA 3RSOA 2QAGC 2FMXA 5JCPA 2BJVA 3O47A 3TK1A 2ZU0C 4D0GA 3LQQA 1IY0A 2AD5A 3QKRA 3GPLA 2JLUA 4CEJB 1JQLB 3DPUA 5KNCA 2FOLA 4H1UA 4B75A 2H16A 2XAUA 4A0FA 2EYUA 4PAOA 4B32A 4MH0R 1YZQA 1NVVR 1E79A 1N6IA 2QAJA 1EWQA 4BFXA 4JJZA 1ZYUA 4Q19A 3WRYC 4TMKA 3T06B 2F7SA 1MABA 1G8PA 721PA 4DCVA 5IK2D 4BRUA 2G1KA 5FOSA 2HEIA 4LHWA 2WSSD 1AQYA 5FOVA 4UJ5A 1E2KA 3WP1B 4C0AC 4KFUA 4M1KA 4HEJA 1T3LA 4WOPA 1U90A 3I5YA 3TE6A 2PH1A 5JFGA 4Q7MB 4P4SB 4DBLC 4TLCA 2VA8A 3LAWA 3AVOA 4UNRA 4BLTA 1EFCA 4F4CA 1CF4A 2FWRA 4IDNA 1G7CA 1FFHA 1KOFA 1KYIA 4RZ3A 1E9RA 4PHGA 1W7AA 2VPPA 1P9NA 1IXSB 1W48A 3QEJA 1G8YA 4RFSB 3O8CA 4C0KA 3BIFA 1RFLA 2GVDC 3RABA 1Z08A 3AF3A 2GZDA 1C4OA 2ZYUX 4MRPA 1ZM4A 1I2DA 1W0JA 4URYR 5FL7D 1VCMA 4TL6A 3DVLA 3KZ1E 1KTVA 2GXUA 2OE2A 1AQUA 1CTQA 1OXUA 2FGJA 3GJ8A 5DHAA 3UANA 5JSZA 4GT1A 3ADBA 2FSFA 1E69A 5HKKD 2Q3MA 3EAQA 3U7GA 3FHTA 3TW4A 2H18A 2O0JA 4PX9A 2Q0HA 3TAHA 1A5TA 2EFHB 4N0EA 3JZMA 4EAQA 1N5LA 1SKYB 3K0FA 2DWOA 4IFEA 4DDVA 5FBWB 2XXAB 4A2WA 4MDEA 4LC1A 3EARA 1E9EA 2JJ1D 3GFOA 3UPUA 1G9XA 2IYVA 3ZZUA 3ZS8A 2PLFA 3GJ0A 2QN6A 1WMSA 1G4AE 4QM7A 4QNMA 1D5CA 2V3CC 4LYHA 1LB1B 3NBXX 1QHGA 2OLJA 1W5TA 1Y3AA 3GEEA 3H0KA 5HCIA 3PCRB 1NVVQ 4XTCS 4O0MA 4C0SA 2CDNA 4W5JA 1KI9A 1IOZA 2IWRA 1X1RA 2Q21A 2WZQA 1NBME 4LHVA 3CH5A 3TUIC 1U94A 2W6JD 3U44B 4D4MA 2NIPA 4CDGA 2D3WA 1K5GA 4CEIA 2VHUA 3IHLA 5K8IA 3EPLA 1G5TA 1ZNYA 2MSEB 1ZNZA 2QMHA 4XIGS 2OM2A 3K09A 1YE8A 1YZNA 5KTYA 3HJNA 3L0SA 4PO9A 3I5XA 4B44A 4US0R 3TH5A 1XMJA 4Z54A 2PT5A 5JBQA 3DKPA 1RRFA 1VTKA 2NO1A 2TMKA 3GJ5A 3LW8A 4HB4A 3TUZC 2PZGA 1NN5A 3P4XA 4OJKA 2GESA 1MO3A 3EWSA 4KODA 3WHKA 5CYPA 4DUGD 1WA5A 1PLJA 1E1QD 1Z0IA 3CF0A 3QPUA 4Q4JB 3VU9A 4DCNA 4YMTA 1JR3D 3K0FB 3ADCA 4B74A 1E9DA 2IYXA 2REBA 3R8CA 5FPHA 1D6JA 1ETUA 1GNQA 5H68A 1ZM3A 3ZD7A 2GVZC 3NHBA 3H84A 2XNSA 4E22A 5JSZB 5FTKA 3KB1A 3QJYA 3WYFA 2YWEA 1DAKA 3I8XA 4HZUB 621PA 4GDFA 3EIQA 3W3AA 2BMFA 2ZRIA 4BPBA 1E1RA 1E2PA 1U99A 1E3MA 3Q7PA 4BFVA 4KYUA 3ZH9B 3KQNA 3SHWA 1ZD8A 3MUFA 4I99A 4EFMA 4Q1FA 3LBIA 4DIDA 2WJIA 2HUPA 1QVRA 3PV0A 2IUTA 2F6RA 3CX8A 2QI9C 4M9QA 3SDZA 3QUSA 1NRJB 3GEHA 4IEIA 1OE0A 3WMGA 1T5IA 1W4BA 3AF0A 3CW2A 3VHLB 5IHPA 1IXRC 2HDNB 2P2LA 4BFWA 1OB5A 4C2TA 3RLFA 4V0LA 3VNVA 2O0HA 3OFNA 5BN5A 2BBTA 4EUNA 3UATA 1CR2A 1KNQA 2VL7A 1KI2A 4TYYA 5FI1B 1LF0A 2QENA 1NN3A 2GJ8A 2A3RA 2JASA 2XSZA 3X1XA 3AVXA 4DLRA 1W36B 1FUKA 3PUWA 5J4HA 2YC4C 3K70C 1UDWA 1BH2A 1GL7A 3UMRA 4TL8A 4S2EA 2QY9A 4P0TA 1V43A 2CE7A 4FCTA 4D81A 4RZUA 3ZZ0A 3KFVA 3EZ9A 2WWGA 1E2QA 2GJKA 4XVRA 2J45A 2KWIA 2YNMA 4A0RA 2J0VA 4JS0A 4ZDKA 5F9HA 1JR6A 2IXFA 1B0UA 2G83A 5BQ5A 5JECA 3J81k 3ASZA 4RD4A 2HCJB 3EZ2A 4HAUA 3W6OA 2JDID 3BS4A 5JZVA 3B85A 1IN6A 1QHIA 4RCYA 3SJZA 2W2TA 3ND9A 1HY3A 1CR4A 4MITA 2QQ0A 3T35A 3C16C 3TR0A 1ONBA 1TL7C 3M1IA 3PR1A 3VTKA 3NIBA 2HJGA 3HU1A 3HU3A 4BECA 4D6PA 5L3RA 1KMHB 1GKUB 4LHZA 1K8RA 1W4RA 1II0A 4MKHA 1AGPA 1XD8A 4ON9A 1NIJA 2IYTA 1OF1A 2ZSAA 3DHWC 3ZVNA 1CRQA 5FFMA 5AJWA 1YKSA 4TN1A 3HP1A 1G19A 2WV9A 3CLVA 2RHDA 1D2EA 3P27A 3QKSA 4JT4A 4BWYA 5F98A 3SHFA 2VF7A 3BE4A 2CLDX 2ZR9A 1GITA 2IYSA 3RC3A 4DEXA 5C4MA 1NN0A 1L7VC 1U8YA 221PA 4KSCA 2F9LA 3T1OA 2ZITA 2O8DA 4TMXA 1Z83A 1AIPA 4M1TA 1EFTA 1AKYA 4AD8A 5EJEA 4MKFA 3OEHD 3EC1A 4ARZB 5KPJA 1DARA 4FMCB 1DO2A 1T9HA 2WJJA 4JLAA 4CW7A 1M2OB 2QGZA 2C5LA 2FU5C 3Q3JB 1Z0AA 2QRZA 4B47A 1E2GA 1E2JA 1OYYA 3IQWA 3QVUA 1HT1E 1DAIA 1JALA 2J9RA 1Z07A 4JMPA 1BMFD 2D74A 4PSVA 3AUYA 3EASA 3KJHA 4JVLA 4Y0AA 1Q0UA 4A8JB 4ASUD 5KYKA 2YWGA 4FMDF 4FN5A 4MGYR 5A4JA 2O8FB 2ORVA 1YR8A 3X1ZA 2FPLA 1GTVA 3FMFA 1R10A 4AK9A 3FYHA 4E07A 1XWIA 1U0JA 4WIAA 4ZIRA 1I4TD 4C4PA 4OQNA 4TQ9A 5EQTA 4JIMA 1NVWQ 1ZM9A 1FX0A 3OE7A 4EPVA 3VKHA 2ZRNA 5DE3A 2LWIA 1CIPA 3ICQB 1LS1A 4Q9LA 4MRSA 1KKLA 2UKDA 5IDVA 1UBCA 1XRJA 5CIWA 1X8JA 1AZSC 1T91A 5A0FA 3ZVRA 4ZI3A 3MWKA 3VR1A 1IJEA 2FSGA 1XTKA 3QKRB 4B33A 1XTJA 2J0UA 4LK2A 3H86A 4HZUA 1NJFA 3HDTA 3GLHB 4U02A 3BBPA 3GCGA 5FR1A 3BD9A 2BKUA 3D6TB 2ZSEA 3KTAB 4HLDA 5DO9A 1HE8B 4DC9A 1P2TA 3VKWA 3B6EA 1N5JA 4D80A 1KMHA 3E1SA 3KJEA 4NCJA 1YQTA 5FTNA 2AL7A 4PZZA 2J0UB 2JDIA 2PX0A 1N5KA 3BERA 1W36D 1IJFA 4S35A 3QNUA 2JGNA 5L3QA 5CK5A 2V6JA 3CONA 4LY6A 4HI0E 5KSOA 3AVWA 1SULA 3BXZA 1KI3A 2RGCA 4EQ6A 2ZI7A 4DSNA 3L0IB 3AQ4A 3LD9A 1KI7A 4K46A 4NE2A 4CEIB 2Y8EA 3B5JA 1DE0A 2OAP1 3MG9A 4L8GA 2ZSDA 4URWR 4GBMA 4URZR 4AKGA 1T6NA 1H8HD 2ONKA 4Q1EA 2ODEA 1R8SA 1GZSA 3IEVA 2CJWA 1YR7A 1S9DA 1UKZA 1U0LA 3MGCA 1VIYA 2CVHA 1XTIA 4I1UA 1YZGA 1I2MA 4II7A 3SJCA 3BH0A 3S1AA 1XD2B 4DDTA 1E6CA 2HV8A 2I3BA 3B1YA 2F1IA 2OAQ1 3L43A 2XSZD 4XWAA 8OHMA 4AG5A 1D9XA 1KJYA 3IO3A 3NHAA 4WZBE 5LPNA 2P3SA 4NYIQ 3T12A 1YZUA 2VSXA 2CJWB 3A1SA 4D4LA 4D4KA 2RHMA 4LJ9A 5LBIA 2HXYA 3CR8A 3E2IA 1J99A 1U8AA 2D4HA 4GZLA 4L4UA 1UKVY 1EFHA 1Q44A 2BHRA 2YOHA 4GOJA 1NLYA 2ZJ5A 3MRSA 2W6JA 2MMCA 3MJRA 1E2IA 4JL8A 2NPIA 3I4LA 3O8DA 1JBKA 5KDDA 3R9WA 4UJ3A 4RD0A 1FQJA 3FFBA 2A5FA 1JPJA 3D8BA 4DCUA 5KHOC 2VIIA 4PC3A 2PEYA 2ZS9A 4FI3C 3RNLA 1KMQA 1G20E 4LZZA 1IN8A 4BZPA 5DN6D 2XB2A 2UZ3A 1II9A 3KXLA 2GCOB 3RYTC 3LQRA 4LYFA 1KY3A 4R98A 1KDRA 1AK2A 2F3TA 3F3YA 4LPSA 1E2FA 4QJ4A 2IT1A 1CKEA 1TQDA 3A8TA 4C0QC 1TU4A 4AKHA 2BIFA 2J7PD 1SHZA 1LTQA 3AV0B 1CR1A 4DJTA 2XZPA 4Q01A 3OHMA 4IOKA 4V0OA 3HPRA 1VHTA 3L0PA 4Q66C 5D3QA 5FTJA 5DHFA 1CJUC 5KDOA 3FHOA 1KDTA 3UG7A 1NI3A 1GILA 2V7QD 5AUNB 1P60A 1GKYA 2WKQA 1R7RA 1HQCA 3KQUA 2WPDD 5JRJA 2CLSA 1ZU4A 2WIBA 4LJAA 3CR7A 5E7JA 5JCZA 2J0QA 1SQ5A 5DI9A 2P5SA 4HUQB 4PTLA 4GL2A 2DY1A 2KBEA 5EXXA 1UEIA 2ZRHA 1GRNA 1CBUA 1XTRA 5AUQA 4CVNA 2GHIA 3LBNA 2C9CA 1T0JB 5H70A 1M7GA 5AJVB 2B8TA 3N2EA 3LV8A 1MV5A 2QORA 2ZE7A 3A1WA 3QF7A 3BFKA 1AKEA 2ZSBA 3EPJA 1M8PA 5FUYA 2HYDA 4F7WA 4MKIA 5JS8A 1VECA 2V9PA 4HDQB 3QBTA 3Q85A 5GJWC 4CT5A 3FE2A 4TMWA 3GQBA 3WXMA 3VAAA 3GLGE 1X1SA 3ZGXA 4JLKA 4Q9IA 1N6LA 1W2GA 3EA0A 3DO6A 1KI1A 1IBRA 2NO6A 1Q3HA 2GAAA 2ZRDA 3LLMA 4QM6A 3I32A 1EX7A 5M04A 4C7OA 1EFRA 2F3RA 1EGAA 2XGJA 2PCJA 5K8UA 5JJIA 3MWYW 2QBYA 4IOLA 4M1WA 1E9FA 4NHOA 5G3ZA 3OFND 2C78A 4HDOB 3RANA 1P73A 4LJ5A 2YINC 3OZXA 4OQMA 4DUGA 4MYUA 4FMDB 5FR2A 2Q3HA 1TQ6A 2OSBA 4BEBA 1EFUA 5HE8A 1KJZA 1QF9A 1LW7A 1ZD9A 5FPSA 1ODFA 2H92A 2NG1A 3TLXA 3E5HA 2QPAA 3K9HA 4QHSA 2QT0A 1CJMA 3CPEA 1O3YA 1FNNA 2ORWA 4FXPA 3GJ7A 3C4JA 1VYTA 4N0DA 3W90A 5E4FA 3B1WA 1YU9A 2ZI3A 3AGQA 4OI1A 2R6FA 3RS2A 1OW3B 4AKEA 5HZHA 1RJ9B 2R62A 4OK3A 4Q7LA 4MRVA 4CEJA 4M21A 4L16A 3BWDD 4N3NA 4C0LA 2VHCA 4ILEA 1NVXQ 4LJ6A 1OH6A 2ZE5A 3Q5DA 4RFSA 2A7QA 3QF4B 3DOEA 3BFXA 1GM5A 4TL7A 3QI2A 4PR0A 2AWNA 4LWZA 1RYHA 1Z6TA 2GBLC 3T1QA 5AK0A 4BEJA 4DLWA 4B6FA 2RH5A 5KOYA 3IIJA 5BN3A 4JVSB 4BLQA 4D4JA 4YXWA 2QRNA 1XEWX 4JLNA 2F9MA 3QXXA 3K9GA 4JLOA 4V02A 2RCNA 4LJYA 4KVGA 1Z29A 4GP6A 4JKYA 2DHRA 3GMTA 4PHHA 5FUWA 5CB8A 5GJBA 1Z6AA 4PANA 5EXPA 3RAPR 421PA 1XPRA 2R6DA 3T1VA 1S4QA 521PA 4HLUC 3FFAA 2KJQA 1U98A 1PUJA 4Z1MA 3TAUA 4PSAA 5FUXA 3LXRA 4PSKA 2QG6A 4KBGA 3AVVA 1WBBA 1HQYE 5J4LA 3FMPB 4BASA 4DLSA 1DBSA 1MT0A 1NP6A 1NMZA 1CLUA 5KSPA 4TYPA 1TU3A 1BOFA 4XWKA 2OBNA 1CJVC 1Z5ZA 1E0KA 3ADKA 4GSYA 3LFUA 1I4LD 3QF4A 4KO8A 1TMKA 2DBYA 2FNAA 4M22A 1IQPA 1P4SA 4NPHA 1G3RA 4N1AA 4HLQB 2IYQA 2PMDA 1OKKA 1N6NA 4B71A 2ZAMA 3QG1A 4HB3A 4UKDA 4YMVA 4M1OA 4AYTA 2AX4A 5JJKA 1H65A 1KK0A 1OIXA 4RD1A 1YJ5A 1E2LA 4BFTA 3U7FB 2KB0A 3EA5A 4IXNA 1G3QA 1G16A 1GNRA 4OQXA 4Q1DA 4IFBA 1M1YE 2PLRA 4B3BA 3NG1A 4DLYA 3FVQA 1KAOA 5DGXA 3AUXA 3KQHA 1ZU5A 2Z4RA 1KK2A 4DLXA 5C46F 3H1TA 2FA9A 2OCAA 1DO0A 1CU1A 4CZ2A 2BVNA 2EWWA 3F5FA 4PPFA 2DCUA 4A0HA 4AY2A 3MAAC 3EW9A 2CBZA 1BIFA 3OF5A 4FMCF 2J46A 3C7KA 1Z0FA 3NBZC 1Z6XA 1JJVA 2G0NA 4ZPXA 2IUSA 3A1TA 4WZAE 4CF7A 1BO6A 2QMOA 1DADA 2GJSA 4UNPA 1Q1BA 3CZPA 5ANRB 1E2HA 2F1HA 2AFHE 3JVVA 1L8QA 4PC2A 1XFAA 2VHTA 1OPXA 5FL7A 1ZNXA 2ERYA 1R5NA 1N5IA 2A9KA 4KBFA 1OFTA 3ASYA 3PVSA 4M0LA 3V4FA 3U60B 2B7CA 4KAXA 1X3SA 5FPTA 2ZI5A 2GETA 2F55A 4AYWA 3B1XA 1P61B 1BMFA 1WF3A 5GVRA 4OK5A 5JI2E 2ZYWX 3U6KA 1JNYA 3LO5A 1E94E 2GF9A 1FL9A 1ZCBA 1XCGB 2RGDA 3BH7A 4ARZA 4M1SA 2Z0MA 4TLAA 1WDTA 1OT3A 1W1WA 2AD1A 4QC2A 1XMVA 4L9WA 1EXMA 5JLJA 2IS6A 2FSHA 2AHOA 3WMEA 3IBYA 2GCNA 4Q21A 1OIVA 4TMTA 5FBQB 1DTSA 1S0UA 1T3SA 3LVRE 3C5HA 3BJIC 1XXHA 3QG5A 3MLEA 4Q7JB 2OFXA 3ECCA 3W3ZB 3MSXA 1US8B 4M9XA 4F4IA 3R9XA 1BYIA 1KO4A 2CNWA 2FE4A 3B9PA 2R6AA 4Q4JA 1NG1A 3IIMA 1QVAA 3CPJB 2C8VA 2QQEA 1OXVA 2HCBA 1C9KA 2BM1A 1S1CA 2IYRA 1HE1C 2GK7A 1OH5A 3W34A 3W9YA 5TY0A 2ZR7A 2WTUA 4AYXA 2J5XA 3GJ4A 3SBDA 1KIMA
chains in the Genus database with same CATH superfamily
1RWKA 1UPAA 2ZXFA 1TO1E 4UEWA 4ZCMA 3ME5A 3RGWS 1H2BA 1WE2A 1O08A 2VJPA 3UJNA 2QB5A 2WHYA 3I3SR 1WPQA 2HGZA 2BFBA 2DH5A 3AOGA 2DQ4A 1COZA 1PJ2A 2YRWA 3GGSA 3I9V6 3GGDA 3GROA 5E1MA 3LY7A 1DBRA 1L4LA 4GGOA 2CHEA 4UBLA 2V8OA 4OHVA 1EUQA 3T3OA 2KLHA 3LLUA 5JCJD 5KCZA 1EWKA 2RB4A 3GLIE 1JEYB 3OIWA 4GE3A 2SCUB 3RC2A 2C2GA 4ZQFA 1RKUA 3JQFC 1VL2A 1QCZA 1PR1A 4ZGBA 3JYPA 3O0TA 2ZWPA 3MN1A 5DRTA 2CV0A 1XZLA 1AH2A 5CYOA 3VKGA 3O91A 4OUDA 5FPYA 1L8OA 4YMHA 1JP7A 1SUSA 2C54A 3DDCA 4LVNA 1TM5E 1IHOA 4H3VA 3LXXA 1N3IA 2QU8A 4HDKB 4TRNA 3PHGA 5EE3A 4LKRA 5FB3A 2YW2A 4O08A 1ZISA 2XTMA 2YW9A 4HWRA 3PA6A 3C87A 4DSAA 4WFJA 1DQRA 2HD4A 2PFKA 4ZOLA 1HKUA 3BRWD 4CM7A 3H1GA 2YZGA 4ZV9A 2FFJA 3VNRA 2HLHA 3D8HA 1I1QB 3K7EA 1KAEA 1UFRA 1YQQA 2Q49A 1OGYA 2ZKIA 5HILA 1C14A 2VP2A 4YJKA 3SX0A 2VP6A 1E96A 4LNAA 3T61A 1OD6A 1FUYB 1WX1A 4QA9A 1LFDB 1OFVA 2XNDA 3KPYA 1A77A 1ISFA 3AEZA 3BA1A 3T99A 1Y5RA 3AJAA 6REQB 3V80A 4ZRDA 1A9PA 3ROKA 3SYMA 3W2TA 1P7CA 2JGEA 3L7AA 4DG5A 4EKGA 5IVDA 4PBSA 2OO5C 4KWEA 3HCCA 1YJQA 4C0XA 1RI5A 2PJZA 4REMA 1E3JA 4WT7A 2GUWA 1PO7A 1QDUA 1ZKMA 1UM9B 2B7BA 3T7JA 4A92A 5BQXA 2HUNA 2OO7A 3CX4A 4NNPA 4MQUA 4R5HA 5KNBA 4IKEA 1YRAA 2C7GA 3C8ZA 3PDJA 4RIHA 4LDQA 3E5MA 4QDKA 4MCIA 5KYXB 1K9SA 4NFSA 4QUJA 5DNVA 1XT6A 3RC7A 3RYCA 1XMOB 3L8FA 1GCIA 1KEPA 3V1NA 1BC5A 1QIIA 1GEGA 3IJRA 2Z1MA 3CINA 3IB6A 2RHWA 2V45A 5M5BA 1DAHA 2A78A 2LBPA 3IURA 2RGGA 3KUDA 4HAVA 2O2DA 5DBOA 2YIMA 3F78A 3U39A 1HR0B 1FDOA 4B76A 2A4MA 5DV9A 3ZHUA 3U4QA 4PG4A 3I9JA 3LDAA 4KQXA 5CLJA 1PSDA 3ETHA 4BE7B 2P67A 2ZIXA 3F74A 5BRAA 4OEHA 4YMIA 1W34A 3RYHB 1SA0B 1EUDB 1Q57A 2VWPA 5FQOA 1VC2A 1NBOA 1DL5A 1N8SA 3CH7A 2BEJA 4OU5A 2OZLB 2V0CA 1E9BA 3A6LA 3VX3A 2JI4A 1ZIPA 5ICGA 2NAFA 4MARA 4JI3B 3LGXA 5K3FA 3CH4B 1ZNWA 2HXGA 3EGIA 4Z4EA 2GF0A 4D2IA 2BGIA 3B3QA 1UIRA 2CL6X 2A1TS 3Q2IA 1CZKA 3E0XA 5KC8A 1XN1A 2GTPA 1NXWA 3LP8A 1Y8QB 5J2TA 1VA5A 1VIMA 4UVEA 1Z2NX 3H42B 1KVRA 3BORA 1XOIA 3NC0C 3PIRA 3IPYA 2VNHA 3QMPA 3IP5A 1HNXB 1FS4A 3WHPA 4MWSA 4EW1A 3U4IA 1CR0A 2IXAA 3THYA 1CLEA 4GD3Q 4MUHA 4KR7A 3AM1A 1RYEA 3A1FA 4R40A 4DA4A 3RVJA 3KQLA 3DT6A 4NBVA 4MUEA 2OAGA 3PPYA 2PU7A 4Q48A 3W5UA 4H15A 2A0YA 1QQTA 5IZCC 4MPTA 2OQRA 3MJTA 4FX2A 3O8LA 1BDJA 1XYGA 3OZAA 1EUYA 2ACEA 3OEWA 1U3FA 5I7EA 1XU7A 2NO4A 4TSFA 3SC2B 2VJLA 1HE5A 3AEKB 2EERA 3LMKA 2EC5A 1EIWA 4PC6A 3C45A 1YR6A 2X1VA 1N0IA 5LOVF 2BEKA 2F8MA 4N01A 2VQSA 3AZQA 4GWLA 4LHSA 3U40A 1SK8A 4JYCA 1BKYA 2YZKA 4ECAA 2W90A 1TUGA 2QP4A 2VT3A 5ENZA 2IHYA 5C2JB 3OEHA 4KE6A 3IBSA 5I9MA 2BJWA 2NU6B 5EPOA 2ZPTX 4IDOA 1GV1A 2EBUA 2XXAA 3EFEA 2Y9PB 3IHTA 1U5CA 1D0SA 1RW4A 2W2VA 1P4GA 1WP9A 2R8RA 4H59A 1MW8X 2C8JA 2D2XA 4MEBA 5BVHB 5JYCA 3U17A 3OAAD 2GEVA 2R25B 1NQOA 3FR8A 4I4LA 4XEHA 4C9BA 4R84A 3GA5A 4XWTA 4RJKA 1D4ZA 1F5NA 1ZM7A 3IELA 2IH5A 4E94A 1I9GA 1TQ4A 3EFOB 3TBHA 2VS1A 2IVZA 4ZVSA 5JZMA 4OH1A 1AO3A 3HCWA 1SK9A 4JI0B 4GIBA 2H2AA 4KHZA 3P0EA 4DDUA 1QYIA 3ZDAA 5AVTA 2PE5A 3OO0A 1CDZA 3DDWA 4A73A 3CE6A 1LWNA 1NJ8A 2QVXX 1OLOA 2E4UA 3EIFA 1W47A 2K4MA 1XF9A 4KQFA 2ZSFA 2W00A 3DMYA 3A9TA 3PQ2A 3R7DA 1Z25A 4ZU3A 5AHRA 2FSVC 2O8EA 1V5EA 3LLCA 4ZVRA 3D3WB 1G9TA 3QGMA 5C9ZA 3GLGB 3DTVD 3BKWA 3KQOA 1TEHA 2MR5A 4HY3A 1XMQB 4U8HA 2AKAB 1UBRS 3OIYA 5FH9A 1KY4A 2VTBB 4XOUA 3EVAA 4P7KA 2JVIA 4H7FA 4E5SA 3NTRA 3F96A 2Q7XA 3K2BA 1O0CA 2ZIAA 3IQGX 4BMDA 4U6NA 4ENTA 1P0IA 5C52B 2JGFA 3MWLA 2BMEA 4KX5A 4YCLA 1XALA 4YRIA 3B7PA 4JC4A 4L8WB 4IIGA 3HVRA 2R79A 4GI2A 1IM5A 5BUZA 4MIEA 4NU5A 1QZUA 2HNAA 1M76A 2BI7A 1E2MA 2B36A 3GNSA 1N0VC 3HJAA 3I2HA 4X45A 3V1TC 4TM7A 4CKEB 2RH8A 4EO4A 3AVUA 2P0EA 1NV8A 2JLBA 3A1VA 3RT9A 4BV8A 2VYNA 2A67A 1HH4A 2XMDA 3GNTA 2VJQA 5ALOA 5LYJF 1U9JA 2RG7A 1R0XA 4YV1A 1V1MB 1ISPA 3BYZA 3X1KA 4LOIA 4XSHA 5CXXA 3VFDA 1B1AA 4UREA 4DG8A 5K6AA 3T7EA 821PA 2R5NA 3N28A 1YTUA 2IS4A 3ZHBA 1SUAA 5TVKA 4AJIA 2D1YA 1PNTA 2R7MA 2REQB 4FC6A 5JTTA 3TOSA 2AZXA 4B3DA 1PDVA 2UUAB 1N6KA 1FYEA 1M73E 3GF4A 4N7MA 4ZAZA 5JANA 3EXHA 2IS1A 2IZ6A 4L95C 1SCUA 1S2GA 5H8WA 1F60A 4MVJG 4UVIA 1NXTA 2O5VA 5HMMA 1T35A 2F67A 4WLOA 5KU7A 4DA9A 1B3BA 3AY0A 4BO1A 5TS2A 4ZV4A 2E55A 1N4DA 3Q0EA 4RESA 4X1YB 3TR5A 3CVOA 3QITA 4NS1A 4G0NA 4QXAA 1DC3A 4YRCA 3MOGA 4G1UC 5HF5A 2CK3D 3EGXA 4NOLA 1NIPA 5F7JA 1Z0ZA 4B73A 1QHEA 1T2UA 2QTBA 2VJAA 3DVAB 2FZCA 5AW8A 4YJ2A 1JBEA 3QWBA 5JQGB 1I6MA 1AO0A 2ETXA 3IOMA 3U7EB 1QZTA 1RYNA 4QU0A 2Y93A 3O3CA 4J0FA 2Q6OA 3BKXA 5BT8A 1JQBA 1T0IA 3G2IA 2N42A 1R6UA 4H3HB 4L78A 4XZ3A 3AHJA 2FFQA 3T4PA 3OMLA 3AEUB 4Q9JA 3GH1A 1FK8A 3IIKA 1QYVA 3HDHA 4Q18A 3ZDEA 1DAFA 3I1FA 1NNSA 4BYMA 1MO5A 4PAMA 4PGGA 5H9WA 1MBZA 2RFLA 1X80B 2O7VA 1VYHA 3RUEA 5LFAA 5FKJA 3P26A 4OXQA 1XCPA 4A8JA 2MJLA 2JRCA 4IIYA 2DWQA 1JHUA 2CCJA 3O9ZA 4PLTA 1VL0A 3GLKA 3VR4D 3KQKA 1GY8A 1TF2A 4BNZA 2XYQA 2XTAA 1HEIA 2V3VA 5IVIA 2GPSA 3IDFA 3HO8A 2XJ9A 1E6EA 3OTOB 1D4OA 5K09A 4LPKA 5CVJA 4H4DA 3GLFA 1LBEA 2O8BA 5J2UF 4IR7A 3U3DA 4K3VA 7GPBA 2YJTD 2C97A 1UJBA 2DY0A 3V4ZA 1T9CA 3JQRA 1X2BA 4XEUA 5SY4A 2Z3VA 3VMMA 4W5QA 1BEUB 1CD5A 4DCSA 3SFTA 3OD5A 3TJMA 3ZDDA 3ZE9A 4MV7A 4ZC8A 5JWOA 3R3UA 2WYHA 1T5DX 3SYKA 4IOJA 2VTEA 1QH0A 2O9JA 4Y0NA 3EUAA 1FDTA 3EXAA 1N6PA 1JRLA 3CZ5A 4C20A 4MUNA 4EB8A 2D8MA 4AQYB 3PQCA 2IPLA 4I1RA 3ZDFA 2V7QA 3W5DA 1U7WA 3QX9A 3KAJA 3M5PA 5DHRA 5K3SA 2C0QA 2P2GA 1NW9B 1GU0A 3R8XA 4QGSA 2BYTA 3HL4A 3A4NA 4WXEA 3NTUA 2IUUA 3SFZA 2P9JA 1RT9A 4UPDA 2ODNA 3GA0A 3O7MA 2ODBA 1K8YB 2IEIA 1VKJA 3OUUA 3CUTA 4G81A 2XGOA 4GEGA 3THWA 4OBEA 4XSGA 1W0KA 1JHVA 1UJ5A 1JEYA 3T7RA 1J8YF 4N03A 3EUEA 4E5UA 3QTTA 3OOWA 3N2GB 3MXTA 5C4GB 4OD0A 5IULC 3IOBA 3JWIA 4J3FA 1UT6A 2VP4A 1U9ZA 2GNPA 4ZVVA 3DZFA 3A0UA 1X0VA 1YQGA 4BN4A 3KOUA 3K0CC 1VKRA 3FWKA 5I7RA 1Y3HA 2ZRCA 3VUEA 3LPMA 4J29A 1ZPDA 5FTMA 4UQOA 3QPCA 3UGQA 3AF4A 4Z6KA 3U0VA 4O4IF 1GPH1 4FKBA 4RZSA 1CSEE 4O4HA 3PVCA 1AY0A 4NV0A 3HBLA 2UXBB 1QGAA 2FSVA 1PEYA 4UUQA 3ANNA 4YP9A 5BVHA 5TMDA 1BW9A 3RSGA 2WE7A 3DE0X 1VG8A 1R8JA 3HZZA 3JV7A 3L92A 2Z9DA 3IUYA 3M5WA 2PH3A 4JELA 2W58A 3GDWA 4IJMA 4CKCA 3QOWA 3CSSA 5IKOA 1GGHA 1PJZA 2QAGA 4HXEB 4I6EA 2OKCA 4LSZA 4R2MA 1PW7A 4QSHA 3RVKA 5KYYB 2VQFB 1G3IA 4F46A 3I5AA 4MUJA 4ALKA 1GGFA 3OCCA 3WBBA 2W4IA 2W2LD 2OP0A 3RUIA 3PFGA 3M3HA 4TV9F 1BA2A 1YA8A 2ZYAA 3FCXA 3JRNA 4IVPA 1YS6A 3AG5A 3S44A 4UDYX 1DG9A 2PWYA 4HFRA 1OJ7A 2HMWA 4PYMA 1JHOA 2PD4A 4NE9A 1UXOA 1X0XA 3C7AA 2ATEA 3LRPA 4HUJA 3WIBA 4K9SA 1LPMA 4A15A 2XE6A 4H2DA 4B6EA 1BEZA 1K5PA 2XUOA 1CULC 4M0UA 4QJIA 1HXHA 1LSOA 2QRLA 3VPSA 2AIRA 1KAQA 3NVKI 1OSNA 4PYLA 5IAEA 1RWVA 4UTXA 3S68A 3ZD9A 3KWFA 3IB3A 3CKYA 1XC7A 3QU2A 1NR1A 4GBED 1XEXA 4J3JA 1E32A 1T5HX 4GVPA 4NF2A 5SZIA 1P0MA 4RZXA 4W7HA 1B8VA 3K20A 4RMHA 1NVBA 1XJQA 5TXGA 3LA8A 1ONOA 3GIDA 3DDOA 3E9NA 3G9TA 3KT6A 3OIFA 1DQYA 4PRLA 4KIFA 1KEUA 1KQ3A 3N7TA 3G2MA 4LGVA 4PX2A 4FSDA 1E98A 2DKFA 3I05A 3V00A 2LIVA 5CNIA 3PRKE 4WAUA 1CVLA 2HRQA 2OXFA 5FOXA 2B94A 2XQKA 4UQLA 2P9ZA 2ZEJA 1UJ4A 3HUUA 2JARA 3GT3A 4UD2A 5CM9C 1V7ZA 3DZGA 5EXDA 2N1MA 1EAYA 3W6PA 4WVFA 1Q1GA 3L8EA 2ZRJA 3L0OA 4CM3A 3ZE6A 2GNOA 2OUKA 4JLMA 2RDMA 1YK0A 3DBHA 2Y6UA 4LY0A 4UUPA 3ON5A 1TO6A 4PN7A 2VUTA 2YJNA 4GZMA 2VWQA 4M0FA 4JR2A 4Z9BA 1LVHA 3NYRA 1QFZA 2Y67A 5ELXA 4AY3A 3UXYA 2WM2A 4W7IA 2E1RA 3Q98A 2DPMA 4O1IA 1FRQA 5G0WA 1GA1A 2B61A 2ONCA 3JTEA 1L7NA 4IX9A 3F8WA 4W9RA 5CP8A 1LVGA 3LDGA 4BNDB 2P6RA 1XCOA 4XQCA 5COBA 4C08A 4DV3B 5LZ4A 4WLVA 3L7KA 1BQ4A 1EYZA 4OCZA 5CVCA 2FK7A 2DOKA 1J49A 3W1WA 5EE9A 1E3TA 2QTVB 1F2UB 4EW2A 2DFLA 2J08A 1YJBA 2NZWA 2P6MA 2V98A 5KDLA 4EFDA 1EESA 2OC4A 3WLKX 1YWGO 5KTRA 2ONYA 1TW3A 2JC3A 2X6TA 4RSHA 4Z9FA 4BJ3A 3H2YA 4N65A 4QT4A 2V1UA 1XX6A 4URUR 4LGMA 3LSYA 5LMCA 2GI4A 3DLPX 1DC5A 1GNPA 4W6QA 4LBVA 3UFXB 2X7XA 2FFHA 1ZD4A 1SQGA 1WNFA 1G3MA 2FZ5A 4KVAA 2P75A 2NV6A 2JKZA 4QX6A 1FLVA 2FZKA 4GNKA 4KN6A 4GHWA 4XJXA 2VNKA 2CE2X 4KUEA 1RYZA 3C8HA 4BQRA 2Q6TA 4HAIA 1GQ2A 3KFXA 4RBNA 5DB4A 5L3SB 1ECJA 2KPOA 3PUXA 4C05A 2P91A 2H9AA 1T4MA 3BTUA 1NAHA 3IAS1 3MERA 4A1FA 3OESA 5FI0B 1R0WA 3PIIA 5K05A 3BB3A 2HJHA 1ZSYA 5KSZA 4LA4A 2J33A 3K5PA 3L1IA 3VR4H 3KJGA 4LZWA 1OLXA 3K9NA 1XD9A 1E9AA 4Q47A 5T7BA 2CHVA 4YACA 3I34X 3HFGA 5K8VA 3DJFA 3K5IA 3ZK9A 1TQ8A 1UC9A 2P2DA 4XR4A 2UYHA 2PIDA 1DI0A 4MW5A 1WU7A 5D3KA 3WVNA 3WWDA 3PL5A 4QKQA 3ZHVA 3OJOA 1A9TA 1NJ2A 1JXMA 1S1MA 2EDAA 4M9RA 4CTNA 1FP1D 1AUPA 4HEA1 2EDCA 2O50A 2BE9A 5EMJA 1Z6PA 4NBTA 4UTRA 5CLFA 2PJRA 2FR1A 3RV3A 5HX7A 1IXKA 3FDFA 2PUCA 3ZZTA 3G2PA 3NXSA 4ENPA 4AS2A 4FMBB 2DFTA 3VO1A 4Z3OA 3FNHA 2ZYVX 3Q9UA 4JXKA 4BC0A 1AKRA 3EG5A 3H65A 1N2CA 3HUEA 3OZIA 4RPLA 1EX9A 1BS1A 2NQ2C 1BGXT 1NY5A 2VBCA 2YN0A 1XLUA 2Q9UA 5B1IA 4XPIA 1E1CB 4RA9B 1ODCA 1RXVA 2FN4A 2ZQZA 5DW3A 2BGTA 4B1FA 2Y1KA 2Q4RA 3TB4A 2BFPA 2GEFA 1ZSVA 3AINA 4FHZA 2FB9A 1J1IA 3I53A 1FYXA 3JQBC 4QPZA 1M0SA 1JDZA 3CWQA 2V97A 5FXMA 4ZT3A 2PTGA 4PLCA 4BWFB 3G5AA 4MW1A 3HA7A 5G4LA 5B1SA 3VR3A 1RJFA 2DBQA 1CHNA 2XUDA 4M8KA 4LYAA 3MUEA 5TQ0A 4AZ3B 3B13B 1K8XB 3AT1A 1QE0A 2HJWA 3DOCA 4YAJA 4YUZA 3SC2A 2P30A 1YS2X 2Y92A 1QR6A 4BJ6A 1LCIA 5A9SA 2WWIA 2VQEB 1ETHA 3E9ZA 5JD5A 3OOHA 1GFIA 3EAFA 2OCLA 5EKDA 3UH0A 1NVTA 3X1DA 3LFTA 1BYUA 1ULSA 4BTLA 3QU9A 2I2WA 3Q5EA 4M9ZA 2RGRA 3U1TA 4C4ZA 5JHGB 3UAXA 2JFOA 3HNPA 5DM60 1G4HA 1H2AS 5HNKA 1MO4A 3COVA 2WAYA 3F0TA 4DMKA 1XDZA 1DKNA 2CMHA 2RAUA 1MPXA 3GP5A 2E1PA 3DEFA 3VXKA 1P19A 2HM7A 4Z99A 5J40A 4YLEA 1QRSA 2R2AA 3MJCA 4RL4A 5EKSA 1B6SA 3DTTA 5KSWB 2J09A 1VLZA 1U5AA 2HIMA 4R2IA 3LFHA 5FNVF 4K03A 1QTNA 1JEQA 4M89A 2WJ3A 3KHTA 4LWQA 1U0EA 2JEOA 4MWEA 1FRVA 5EGSA 1W85A 3PYLA 4ALNA 3JTMA 5IBCA 1JR4A 1XVAA 1OTXA 4FJ2A 1QIDA 4ZEOA 5GADl 1O57A 3AY3A 3CZ4A 2VP5A 3WSWA 3TJZA 1FJGB 1X1AA 4JVNA 4RTRA 4G5GA 3L6DA 1JJ7A 3BD6A 3SLKA 3WC4A 1T2AA 5ALXA 1KYVA 1SPBS 1XV5A 2GAFA 1HSZA 1PSWA 4EGAA 2O8EB 1T43A 1Z0SA 3AKYA 2IDMA 1GP2A 3KTAA 1W2HA 1SXJD 4GDMA 4WDRA 2JLRA 4FD3A 4UUNA 4CLEA 4EVRA 2XCRB 4QU5A 3COWA 3OMXA 2WHXA 4PAGA 2ZRAA 2JJ1A 3CVUA 1DMRA 2FLVA 5DK6A 4B6QA 2B1RA 2IY8A 1NKSA 3R0VA 4FU0A 2WIAA 3NGMA 1SC4A 2Y0CA 2YBDA 2QG9A 4JWKA 1UXGA 2YN2A 3IEXA 3NJRA 3QEKA 5B1YA 5ERGB 1ZGJA 5AKEA 3SF0A 1M2HA 2VZ8A 4OL0A 3ZU6A 1UC4B 4RORA 5BW8A 3GMDA 5IJ0A 2J67A 2JA1A 2J9XB 2FMTA 3ER9A 2AKYA 2CZCA 5DTJA 2JFWA 3QA3E 1J7JA 1BVUA 1E5VA 2E49A 5C0OE 5AOCA 3TNFA 5LZ9A 4Y2JA 2QSZA 4OB6A 1W1UA 1YQ9A 2VDKB 3C5VA 4JBHA 1CY4A 4JKIA 4QDJA 4QO7A 1N2CE 4ZKEA 2EP5A 2R87A 4DV4B 2DC1A 1OYWA 4DGQA 2YYSA 5A9RA 2G5TA 4F3KA 4I2VA 1Z4MA 2CLIB 2GFHA 4EKDA 1XZJA 2C84A 1KA9H 1PG0A 3LRXA 4IUBS 4WZ6A 3HADA 3ZHXA 2FPPA 2ZBUA 3JAMA 2A88A 1KI4A 1P1FA 1EK1A 2B1JA 2JHAA 1KZ4A 1M66A 1SU4A 3PNSA 4NL4H 2AEEA 2LGJA 1A9SA 4KVFA 4IAOA 1ZS9A 2NSHA 5TMEA 4AKIA 5CA0B 4YMLA 2XKKA 1F2TB 3NEAA 1Z28A 3FTCA 3QE4A 4QPCA 3HP4A 4C4OA 4DB4A 4OIMA 3ZCSA 1NX6A 1TT5B 3AUTA 4LDNA 5FULA 4BPRA 1JI3A 2GF2A 3T41A 4ARVA 4DHEA 2TMGA 1QV9A 2AFIE 4QRHA 3EVNA 4BNWA 1OHHA 2V6GA 4EG4A 3WL5A 4BQPA 1E1QA 4MP6A 3ROEA 3NCHA 2ZPUA 3OIVA 4LE0A 3KYCA 3GRKA 4JBYA 4OFZA 4RSRA 4Y2PA 5B3JA 4EFNA 4EHBA 1DBWA 3USCS 5ALUA 5J4HA 1Y7IA 2WHRA 4IDAA 1C81A 5A0TA 5AW7A 3DZDA 1JLSA 1ZMBA 3KUUA 4G8CA 4G0XA 1UJCA 1ZX1A 3E9CA 4CLOA 1YJAA 1MO2A 2CWWA 3KKQA 3KQMA 4MLCA 2V6BA 4TLEA 3KKMA 4UNNA 3IPXA 3NUQA 3H4TA 2JLZA 3PQFA 1ZBDA 2B4QA 4WDQA 4RTQA 1LPNA 5IAAA 4DCGA 4ZOEA 5ALHA 1RC8A 4F6LA 1IK6A 3CVWA 1D9ZA 2ET6A 5JAQA 4BV2A 2PL9A 3RSQA 4F92B 1JB1A 2F48A 3M3DA 3I83A 3WYEA 3QSGA 4FE4A 5LYJA 4RK6A 4UDNA 1JAYA 1YZLA 1ZCJA 5ILOA 1VPDA 1ZMOA 3OJEA 3UOWA 2Y0PA 4Q7KA 3N53A 1X7WA 2VHQA 2VT7A 4QULA 5L8VA 3L8DA 1E9CA 3HRIA 4M8SA 1YXMA 4QOHA 4U9UA 3VVCA 3MTEA 1SBHA 4XPZA 2VHWA 4ZAVA 4D1YA 1QHFA 2C8LA 4IO1A 5ARBA 3MJFA 5B64A 2P9FA 3RU7A 2BZ0A 4XQGA 3PI6A 3GHHA 1ACMA 5DM4A 5KWEA 2CK3A 2H2WA 3MCWA 4FNAA 4G84A 5G3YA 2VRWA 2B6NA 3D6AA 4M0KA 1GCGA 1WMDA 3EGDA 3B20A 1W44A 4F5YA 2EBFX 2VPWA 4BZZA 2XZDA 1ZVJA 2QL5A 1JU3A 4Z7OB 4S0ZA 1V11B 4PPQA 4WKCA 1I1OA 2PQMA 4FXOA 4GVXA 5B2ZA 5DCWA 2HA5A 2VI5A 2MU1A 2NXEA 1DHRA 2Q3JA 4WASA 3TTXA 4OYLA 3NHUA 5G4KB 1XTQA 4XWOA 4OLHA 1P62B 4PFQA 3FWHA 3KLNA 1AMNA 5LA6F 2FGKA 5DULA 5CBPB 3O2SB 2PIAA 1E7WA 4NZPA 1NSTA 4EEZA 3KEGA 5I9LA 2CXQA 3GFPA 4MGIR 1SVSA 1L4GA 1RPZA 4ETNA 4EAAA 5TGTA 3RSZA 4TXJA 1Q11A 3NV7A 2Q41A 3MTAA 5F4ZA 4NESA 3QJ5A 4DYVA 4HGOA 3W5SA 2JLSA 1QGUA 1TJ4A 3G8BA 1TCBA 4LY9A 3L4BC 4EMTA 5BWLA 4RD3A 3IMGA 3KAKA 2VF4X 1BJRE 2OLKA 2WG2A 3D5TA 2QA5A 3ZTYA 4JI4B 1P5RA 2PGIA 5IRCD 1WL8A 3KPWA 2K7FA 1YE5A 2I22A 4B40A 5IYZB 2BMVA 1QP4A 3JQ8B 1SC9A 3GLGA 1YHZA 1GU7A 2BGMA 3TGWA 3UHAA 1H9BA 5J4VA 2DFPA 3WYAA 2G40A 2J3HA 4QUAA 4ZOLF 1KI6B 5J63A 1Y1KE 4BKRA 3L1HA 2DLCX 1L5HB 1V9SA 4L4ZA 4A1OA 5AK4A 1LPBB 3IVAA 2YVUA 2YKGA 3KLPX 2A5GA 4IIVA 4AP9A 2BELA 2WU1A 4RVOA 3QLUA 4MXDA 1EWRA 2NV0A 2NO7A 4ND6A 3T9EA 1BZYA 5DWVA 4B3CA 2A0UA 1Z2PX 2BD0A 2YFYA 3KSDO 1J0CA 3UZUA 3JPWA 4AICA 5HEKA 4N18A 2GSWA 2RGNC 4Y1EA 4D8VA 3DW1X 1P5JA 2D2FA 3MVEA 4R7ZA 2AXPA 4YAFA 3SJBA 2F59A 2BTEA 5AKYA 4AQ7A 3F1KA 1JVBA 3C6XA 3EXEB 5FX2A 3H99A 3I9V1 1T6YA 3O21A 4E4YA 2A1UA 2I6TA 2PFGA 1Q92A 3A36A 3MXOA 4TT3D 5TPWA 2PCLA 3SSOA 3D02A 1FSGA 4C5BA 3OEED 4CKYA 5JISA 3ZE0B 3WSVA 5E4JA 1GCUA 1VSUA 2E3JA 3NPAA 1NVDA 1TXGA 3R8FA 3VO9A 1JKXA 5CT6A 4Q7EA 1T8UA 2G72A 3CVJA 4JLVA 3RWMB 4INZA 1TVKA 4BLUA 1B23P 4TMYA 3KHSA 1B76A 2P2ZA 2X23A 1FXSA 3R4CA 4CG3A 5K0JA 2AUNA 1RQ2A 4B48A 2CJFA 2VSQA 4OF4A 3KKPA 4NK5A 3PJRA 3QPDA 1DPFA 3CRVA 3AIKA 4HXYA 4LTNA 3AUFA 4WD3A 5SZHB 4AMGA 1T4GA 2F43A 2AN1A 5REQB 1KFBB 4UATA 2CHQA 1NU6A 2WSSA 5IFKA 1FJHA 3AR7A 3PGLA 1R2QA 1XVUA 4FLEA 3BGOS 4X71A 3V7FA 1P9OA 5I4IA 3IJ5A 2IHKA 2F1RA 3OT1A 1HOXA 1XXHE 3DE6X 4PX5A 2FAXA 2DT8A 5JAPA 2QAIA 4X8LA 2O7SA 3NFYA 4HC4A 4QNRA 9GPBA 4B8ZA 1GN9A 1X7YA 2I3GA 2ZZKA 2NPFA 3AZPA 3WL6A 5KWIA 4KHPB 1ZO8A 2BFFA 1BFUA 2YDYA 4J2OA 4QDZA 1N5MA 5BSKA 3K32A 5L3QB 4P34A 2TSYB 3H9JA 3ESXA 1E3IA 1L5RA 3EZGA 1LSSA 2FWAA 3UGKA 5T4HA 4U9IS 1K6XA 1DS6A 3DMPA 3D4PA 1YFZA 3H2IA 1KKMA 1QE3A 2A0XA 3CEPB 3ZK7A 3HI4A 2AC4A 3U1BA 3AKZA 3MILA 3FMGA 2WTMA 3FA2A 4DTIA 4DR2B 1JAZA 4NH4A 3WZ2A 4LZJA 4NMLA 4ES6A 4FFVA 4LF5B 2C5SA 3K9CA 3IEMA 4A2CA 1F8FA 3AP1A 3GJRA 3NKFA 2JH8A 1NATA 1I30A 4HQRA 2WQ6A 1RYMA 2EX4A 3A2NA 2GS9A 1UMDA 2WVJA 3A32A 1H2FA 4A9AA 4RTKA 2I2AA 3FPKA 3TTUA 1D6NA 2HMSA 2FZWA 2VA9A 4GMGA 1FNBA 1ORHA 3HSKA 1RKVA 2AJDA 3QUCA 2J9FA 1J20A 3CEJA 2CLFB 3HRKA 2X2OA 3IJEB 5FDFA 1G3UA 4KXQA 3O74A 1UXKA 3KLMX 4H7JA 4EMUA 1HORA 3CNNA 4LJ6A 2ZRGA 3I0ZA 4DC0A 2DE0X 3TFWA 3E18A 4W5OA 1WBDA 2BWJA 4I55F 2OHJA 4G4SO 1UODA 3IVGA 4LNUB 4EYGA 4QFMA 4V0KA 4BKUA 5JRDS 2VATA 1XRQA 2JJ8A 2CVPA 2X0FA 3KK0A 2PVPA 4OQLA 4QXOA 4UPVA 4PIVA 3QKUA 2J87A 4JA0A 4Q34A 4OKSA 2VWGA 5CK4A 1N1DA 4N5NA 1GV0A 3U2QA 3HXLA 3SIPA 2G07A 4MVJH 3JQ9A 4YREA 4UNSA 3QEMB 2GQ0A 3EMBA 2Y71A 4WE3A 5D86A 3DZBA 5CB4F 4PE5B 4WOBA 2VXBA 3WLTA 1QP8A 1U2PA 3ILSA 1HMPA 1MJGM 1U3CA 3OQIA 1PR0A 4NYJR 2J30A 4Y18A 4ZAFA 1JDUA 3OY7A 5IAKA 3AF5A 1YZYA 1MX3A 3D6HA 4H4CA 2AR7A 1MDBA 4KZPA 1PT9A 2ZSHA 5A6SB 4DSUA 4YT5A 1W29A 3BTOA 3WL3A 3EXFA 1JG2A 3BMOA 2ZUTA 3NM4A 3VZCA 4Y1GA 3QLVA 3RFCA 5BYJA 4GLOA 1U8CB 2P2NA 2XCLA 2YYAA 4QTUB 3WAGA 3WLIA 2ZUWA 3FWYA 3M4NA 1QFXA 3V5NA 3OJCA 1RJEA 5KNLA 1J1UA 1JQDA 2CFCA 4W1QA 2I91A 1C5KA 2JCGA 4L15A 5EIFA 4OFXA 2J3EA 3MWJA 4GX1A 5AVYA 4KI0A 1LK0A 2EIXA 3OLQA 3JX9A 1A8SA 4ZHQF 3HVUA 2PD6A 4C88A 2ZRMA 4MA5A 1R15A 3N3AC 3RUAA 2OZLA 3D0QA 2BFCB 4HQLA 3FW1A 4XOIA 2FDCA 4ID3A 3TVDA 5JPIA 1G8HA 4KCGA 3AVPA 4JHXA 3WYNA 5JEDA 2XCUA 5HKKA 4AIIA 4WZAB 3RLIA 5GP1A 1JG7A 4RJTA 5L4NA 1SM4A 2EV9A 2WNIA 4HYTA 4XYGA 1WCV1 3ED1A 4HNQA 5IH7A 1AJEA 3SFVA 1L2TA 2BZ1A 2FEPA 2PGLA 4IDBA 3EGVA 2Y76A 1OAOA 3C3JA 2AFHB 3HN6A 3KD3A 4B31A 3D8RA 2WF9A 4Y30A 5JLAA 3IT1A 3BUSA 5B58T 1L4MA 4UAVA 3PR2B 5LLTA 3IP8A 2E5WA 2QMUA 1HDGO 3RRBA 3THSA 4X7MA 3ITEA 4I9UA 4DKJA 1YD7A 1NU8A 4E4RA 2GYVA 3D5QA 4BLRA 4D82A 1QQ6A 3KOOA 3VYWA 4X8OA 1S3GA 1YAHA 3DEJA 3P19A 4BJ1A 5DNCA 4YO8A 4H6PA 2DR3A 4RDXA 5DRYA 1BXRA 2H1LA 3MCAA 1G5FA 2X41A 3BCRA 4QD3A 4R1UA 4JP2A 3KX2A 4N6NA 1FTQA 2UU9B 1P3JA 1UKBA 1H85A 4ZJZA 2M1XA 2OBXA 5DMHA 1JEDA 5IM4F 3O38A 2B21A 5BNFA 4A0GA 2HBZA 2I4IA 1I2ZA 4EG1A 4LMPA 4GPIB 4XD7A 5LXTB 3AUUA 3QVGB 5DIFA 2QJOA 2Y4NA 5LDGA 1S8NA 4EK9A 4EY4A 4BB9A 2XWBF 3DEZA 4X61A 4QYXA 3MINB 5FOTA 4KYTA 2QVCA 2HTEA 2EWMA 4TLLB 1TLLA 2IEGA 1VDMA 4QAJA 5H7XA 3ZYCA 3KYJB 5JWHA 3T0FA 1S4MA 4TLBA 3G89A 2C1XA 5LJIA 2GAOA 2QPOA 1YZFA 5EJFA 3RK0A 1JS1X 4X97A 1DQPA 3K1TA 1UP7A 2O2IA 3GBVA 3OU2A 2WEKA 4D9BA 2CMKA 1O7JA 1CJTC 1DU4A 2WYUA 4DQLA 3WYDA 2AOUA 4BASA 4BO0A 2B30A 4ND4A 4HCJA 2QL7A 1C29B 3G82C 3K15A 1M8GA 1LDBA 2NT3A 1RJDA 4TWZA 3AUKA 2QTFA 3VZPA 5TE9A 2PLAA 2BR3A 2PZJA 4RYDA 5JSKA 3U3RA 3K35A 3VQTA 3WICA 1ZH4A 2FLWA 5KYVA 4KDCA 4DY4A 1MRNA 4N3GA 4BGEA 1C8LA 1H1LB 1T36B 1L8LA 1XNGA 4N7BA 4O4IA 2O2EA 1GJRA 3CN7A 4RAQA 4EGCB 4RDCA 1JW9B 4RW0A 3HCDA 5AKLA 3ZJ5A 3D7MA 2NXNA 2HT1A 3MTBA 4JUBA 5CAEB 3X1YA 1R5OA 1QQAA 1A8IA 4YHBA 2GZ1A 3B1ZA 3CF6R 3DXZA 2GTIA 4R9VA 3A1CA 3CFYA 3W8DA 3IYLW 2WMDA 2RG1A 1QHSA 3N2KA 1E1DA 3DCYA 3VR5H 5G0UA 5FBRB 2GM4A 2XMPA 4H7IA 1E1RD 2VJKA 4X1IB 3W8RA 1A9RA 1B74A 4U2CA 3T38A 2VAVA 3E1GA 3F7TA 2NO5A 2IF0A 3II6X 1B73A 2R1TB 2OHXA 2JIZD 2HL6A 5D3MA 5IDXA 4L85A 3JYQA 3RUDA 2E6UX 2DB3A 2JIZA 2FMUA 3EN0A 4UFNA 4IXDA 2ATIA 3DNFA 3HYCA 5AOBA 2W0SA 3SOPA 4LF7B 4M9SA 1IDOA 3DHEA 2FCAA 4M88A 4ND7A 2P9YA 3D54D 1VOTA 2ZJ2A 5AHKA 2X5NA 2ZAGA 2QF7A 2ZRBA 4XVQA 1M2JA 4AUKA 3IP6A 4L3WA 4BX3A 3OICA 5LUAA 1XZPA 2IA5A 1H1LA 1T36A 2GEKA 4K9OA 4XKJA 1GARA 3GJQA 3HKCB 3W05A 3G1WA 3AILA 5BUQA 1EVIA 3IP7A 3OO1A 3P2EA 2JGDA 4PPGA 1NDQA 3V2HA 4RV4A 4EPYA 1PGQA 2YIVX 3BILA 1IBMB 4B9EA 4CUKA 5B1DA 4Q3BA 4KDEA 3IERA 2NQ8A 5DM2A 4FGJA 3KBBA 1VYUA 4WA7A 3ICEA 4L5AA 2AHRA 4WUTA 4PG5A 4LSGA 4QVKA 4NOKA 4W8OA 3T34A 1Z36A 2OV2A 5HS4A 2NT4A 4UNQA 3B6JA 4FGUA 4HAXA 5LYYA 4W5HA 4NRDA 4DL9A 3DOIA 3EAGA 2GN4A 3E4CA 5IN5A 3ESRA 4R7TA 4C7KA