3WOHA

Structure of ketoreductase siam from streptomyces sp. a7248
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
245
structure length
235
Chain Sequence
GALSGKVALVTGGSRGLGRAMALRLARDGAAVAIVYVSDDSSAKETQGEIERLGGTARSYRCDVSDAEQVTRCVKAVTADLGPVDILVNNAGIIRDGLAASIKDEDYDAVMNTNLKGAFLFIKACYFGFIRKRSGSIINISSVSGVFGSAGQANYASAKAGLIGLTKSIAKELAERNVRCNAVAPGLIATDRLDPVPMRRFGRPDEVAGLVAFLAGDESSYITGQVVCVDGGMAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords SiaM
publication title Structural insight into the tetramerization of an iterative ketoreductase siam through aromatic residues in the interfaces
pubmed doi rcsb
source organism Streptomyces
total genus 77
structure length 235
sequence length 245
ec nomenclature
pdb deposition date 2013-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wohA00
1I3KA 3EZYA 1DRWA 2CVZA 4EI2A 1BSVA 1A7KA 4J16A 1TXGA 2A9FA 2P68A 4BO3A 1IZ0A 4GL4A 1T1SA 2Q46A 3WDSA 1Z74A 2AXQA 3GA0A 4EUFA 4JJFA 5F5LA 3K6JA 5FI5A 5ER6A 4EITA 1UP6A 2GPTA 1ADGA 1ONNA 4B79A 1TLTA 4WCFC 2O2SA 2VWPA 3NDJA 3U49A 4JP3A 1OC4A 1KOLA 3LQFA 1ZXLA 1HT0A 2Y68A 2Z5LA 1Y7TA 4J2OA 3SC6A 3ZV6A 2CDAA 1HDXA 3PEFA 1JU9A 1ZNQO 2HRZA 4PLVA 4EJMA 4HUJA 1ZFNA 2VZ8A 2O4CA 5ILOA 2DTEA 3GH3A 2Y66A 3I4CA 2Y0CA 4CLRA 5CG1A 3O9ZA 4XGNA 1MG0A 1DOHA 1NWHA 3H5AA 5BT9A 3L9WA 2RHRA 2DUUA 4CLRB 1LXCA 1VKNA 1HDCA 4ZRMA 5MGBA 2DC1A 3LC1O 2CDCA 2J3KA 4UEOA 2G1UA 4JBGA 1DJQA 3Q1LA 3PQFA 2YDXA 5GMOA 4MVJP 5A03A 3TQHA 4BNKA 3PLNA 2PKQP 1IULA 4ID9A 1Y8QA 2HSDA 2O3UA 3GEDA 3GMSA 5ER9A 3K2BA 1E1NA 3BMOA 2VHYA 3C1TA 1CRWG 4BQRA 4JX8A 3F1LA 2VUSA 3C7CB 5KJCA 4L73A 4XGIA 2OOSA 1QMGA 1JW9B 4LRTB 1C0KA 1Y8QB 4I5FA 3AK4A 3BMOB 1C0LA 1DFIA 4NU5A 1B8UA 1HSZA 3VVCA 1MUUA 4YJHB 2DAPA 4PVCA 3WOHA 2JD2A 3V1YA 5IXSA 3WG9A 1M75A 3E6AA 3JV7A 4OKNA 2ZK7A 4WGGA 3RC9A 4E2XA 1Y9EA 3QRWA 4FSHA 1SCUA 3JQCA 4BV8A 4PG8A 1UXJA 2I6TA 2P5YA 5A3VA 1E7SA 2FPPA 2PFGA 3WTBA 2C2YA 3GAFA 3VZRA 3H9JA 4DA9A 4CM6A 4BNHA 2IRWA 2DFDA 1I5RA 2ZYGA 3PLRA 4GWKA 1ZXBA 4BKUA 2HKIA 3JYLA 2YFQA 4ZD6A 5JCJA 4KOAA 4TVBA 1KETA 3VOSA 3T7CA 2GLXA 3GZ4A 5KVQA 4BNVA 3DDNA 3ZU2A 1E7RA 1LX6A 1VLLA 2CNBA 2ZYDA 3LLSA 2C07A 1KEWA 3TRIA 5CEEA 2AQIA 3F4BA 4UUNA 1DC5A 1GPJA 2D5AA 1C0PA 4P4GA 4YT5A 1QV7A 2PK3A 3ICPA 4BNXA 5IG2A 2B4TO 3DHNA 3I9KA 3U3XA 1NX6A 3GRKA 3ZHYA 3GDFA 4RQTA 3GEMA 1GYRA 2JFGA 3MEQA 3RC7A 4UULA 2I67A 5EINA 4KUEA 3E48A 1JN0A 3UICA 2C54A 3GGPA 5G0WA 4OKIA 4Z0TA 3ZW8A 3DXFA 2RH4A 4BNTA 2AEJA 3QWAA 1SMKA 4CQMA 1I30A 1LLCA 4IDBA 3HJAA 2HMUA 4JNKA 5LDHA 3GVXA 2WM3A 1MLDA 4CM1A 4FJ0A 4UREA 1R66A 1UP7A 1N7GA 1T2DA 4I9HA 2HJSA 2DFVA 2W8ZA 2X0JA 4JJGA 4R9RA 4JQCA 4A5OA 1ZW1A 3LSYA 4C7JA 1Y6JA 4R3WA 2VQ3A 4H15A 3U4CA 3QVOA 4YAIA 1T4BA 4KWIA 3ZDFA 1NQ5A 3EYWA 4EDFA 4IQGA 4BNGA 1UP4A 3GPIA 4YJGA 4YJDA 1HXHA 4NU6A 4EEXA 5L7WA 4GLOA 3DBHB 1J0XO 1GQ2A 5JDCC 4AJNA 3RC1A 1P1RA 4YJGB 4NPCA 3DZIA 1A71A 4Q9NA 4IGEA 3ZNPA 2E4AA 1KEUA 1FDUA 1NVTA 1S6YA 4IBOA 2PZKA 5U1PA 3PDUA 3QVSA 1U7TA 2CVOA 2GNAA 4FCCA 4YRBA 4QX6A 3GDGA 5JO9A 3PFFA 2X5JO 1PJ2A 1U2DA 1Y9AA 1U4OA 1UZLA 1WW8A 2IEBA 3DHEA 2C5EA 3VH3A 5IDWA 4IMRA 3VKVA 4E5YA 1U4SA 3PHLA 3TZKA 2QRKA 1PJQA 1K5HA 4DLBA 3AU9A 4YAJA 4CJXA 4IXTA 2P9EA 1H6CA 4NK4A 3DMYA 1G6KA 4XYEA 2H63A 4NI5A 2IXBA 4E21A 2IZ1A 1P3DA 2WSBA 5L4NA 2Y1EA 1AHHA 4S1VA 5L51A 4P22A 3HN7A 4O6VA 4R3NA 4JN6B 4NJMB 4EW6A 4RLSA 4AJKA 3UXYA 4GVLA 3ZU4A 3TFOA 2UUPA 2VHXA 3KXDA 4DWVA 1I8TA 1YDEA 4I8XA 1GYPA 4J1TA 4DXHA 1V0JA 1K0UA 1EK6A 4EZBA 4YT8A 1NQAO 1TT7A 5TJ9A 1AUPA 1RM3A 4QFDA 4BMNA 1U3UA 1UXIA 2FP4A 1U5CA 5C3MA 3R3SA 1ZH8A 3L4SO 4E2YA 5DULA 1LDEA 2PZMA 3VAZA 3EHEA 1O95A 2DLDA 4XGKA 5KIAA 2XF8A 1ENZA 1YB1A 5TRTA 2W4QA 5JO0A 5B37A 5JMPA 1FDTA 4FFMA 3ZV3A 2WDZA 4AJOA 3RASA 3AW9A 3KYDA 3QVTA 2OL4A 4UUPA 1DO8A 5TLSA 3ASUA 3GRPA 5H81A 3DFUA 2BD0A 3FNEA 4YT4A 2JAHA 2QIOA 4PZDA 4CM4B 1HDRA 3QWIA 3KYDB 5DBIA 2FWMX 2O3QA 3D5TA 3KB6A 3U4IA 1R6DA 1JTVA 5L7TA 3LVFO 3WNVA 3Q9UA 4HY3A 1ID1A 5KOIA 1NQTA 3FWZA 1HYEA 1PX0A 5I7FA 3FF4A 4D44A 3H6KA 1B7GO 1ONOA 1GCOA 3BMNB 2P4HX 3GHYA 5A5FA 4WNCA 2PV7A 2ZIZA 4YACA 3F46A 1B2LA 4KWHA 2ZTUA 3VH2A 3I5MA 2C82A 1U8FO 4BNZA 4NR0A 2QW8A 5JDIA 3DOCA 1PJCA 2AQKA 5G4LA 1E7QA 4IIUA 4WOJA 4DREA 3OFSA 5T64A 2OUIA 1CQIA 2AG8A 1MC4A 1ZCJA 4MP6A 4DQVA 3PPIA 3R3JA 4M1QA 2CSUA 4YTEA 4E32A 4OSOA 1JA9A 4L8VA 3HQ4O 1DLJA 1GQYA 2E37A 3AY3A 1NPDA 2XOXA 4CR6A 4B7UA 2X4GA 3PJDA 4FIZA 4J1SA 3NEPX 4MDHA 4EBFA 4YPOA 1KEVA 4GLLA 3ZWCA 3ZZNA 3AJRA 3D3EA 1LA2A 3PHJA 1NHWA 4GVXA 4XX0A 3O8QA 1KBZA 3N58A 2DBVO 1F06A 1FF9A 1DLIA 3WGTA 2EJWA 4HWKA 4ZQFA 3F5SA 2NQ8A 1E77A 3O8QB 4DLAA 5L4SA 1E3JA 1Q7BA 4YVFA 4RL6A 3GR6A 4CLOB 1EZ4A 1ZMTA 1QRRA 2X9GA 2D3TA 3S2GA 4GX0A 2EV9A 4BB5A 3RUIA 5JAIA 1LSSA 2SCUA 1X1EA 4ZGWA 1AGNA 2E6UX 1HDOA 5DCYA 5ITVA 1NFRA 1EVZA 3DAFA 3PYMA 4CMEC 1ISHA 2Z1NA 3ZWNA 4DUPA 1HZJA 4ITUA 4CMCA 1HEUA 3FI9A 4AL4A 4NZ9A 3E1KA 3MTJA 4R69A 4BVAA 4WCDA 2CFCA 2DKNA 3DBLB 1PEDA 3GVIA 4KUHA 1C1DA 2ZB8A 1B14A 3A28A 4RPJA 5JY1A 3AOEC 2H1SA 2FR1A 3K30A 4XQEA 4MVJF 4WPGA 4H3VA 5FYDA 2O48X 2X0IA 2BI7A 4BMSA 1P31A 1LDBA 4FDAA 4AJEA 3VC7A 4OXYA 3B1KA 4MPDA 1P77A 3QE3A 5TT1A 1I01A 1V8BA 5DCUA 1ZJYA 4CM9D 4CUJA 3ICCA 3CZMA 2Q2WA 3A4VA 3RUEA 2DTXA 1C3VA 4IGFA 1Q0LA 4XIYA 1KEPA 1KY5A 1ZK1A 3OJEA 5KTKA 3GN2A 4KDFA 4IS3A 1TT5A 3PYLA 4XQGA 2UDPA 3KYCA 2I65A 1GEGA 3L77A 1Q1NA 1E3EA 1SB9A 4KDEA 3OP4A 1DHRA 1GEEA 4BKPA 5DNAA 3WTCA 4S3MA 2Y0DA 3DHYA 1E3WA 2O3RA 4ZA2A 2PH5A 2VTDA 1ZO8A 5I9MA 2BHLA 3TOZA 2GERA 1T24A 3OECA 4DIBA 4ALLA 4IDDA 3VPGA 1GR0A 4A26A 1E3WB 4OMUA 3ZGYA 1ZK0A 2EKQA 5IXYA 1QYWA 3TZ6A 1WMBA 4KTVE 1VKOA 3OM9A 1A5ZA 5HA5A 3RUFA 1UR5A 5BNIA 5JC8A 2W2KA 5TS3A 3W4IA 3ZN2A 1AXGA 3ZWVA 4F6CA 2ILTA 2XXBA 1OMOA 1XU7A 1HETA 4I1IA 2B35A 2V6BA 1OZAA 4TKLA 1G1AA 2W2KB 2XAAA 1L7EA 2IXAA 2B5WA 2VUTA 4KZPA 3W4KA 5L53A 4OOEA 2X1HA 4YJFA 3ADOA 1H2BA 3VPXA 5ENVA 4J7XA 3WBBA 1ZSYA 5IF3A 3AUSA 2Q3EA 3QVWA 2J5KA 2G0TA 4YJFB 9LDBA 4G81A 2PZLA 3WQRA 3KHUA 3GG9A 4CMAA 2VWGA 2Y1OA 3D1LA 3DR3A 2NLOA 4GKBA 1P1FA 3GUYA 3JQ6A 3WBFA 2BFPA 1PWXA 4BNLA 3GUCA 1P1IA 4F46A 4TRMA 1GADO 3CZRA 4L0QA 4XYLA 5CPBA 1ZK3A 3AUTA 4RZHA 4CMHA 1I36A 3HUDA 3HHPA 2NV6A 3HNPA 3AI2A 4W82A 2B4RO 1H9BA 2WEKA 2H5LA 2J3JA 1HWYA 2VHVA 3JSAA 4WUVA 3A06A 3ZWBA 1JWBB 3UFXA 3T7EA 3M1LA 2EKPA 2GASA 3C85A 5JYDA 1PJLA 1R4MB 4WE3A 4BQPA 3A9WA 1C0IA 5EQDA 4CV1A 1JKFA 3FBTA 4BNMA 1WMAA 5HM8A 4DBZA 1N7HA 3B70A 5L40A 3O4RA 3BTOA 2JCXA 3M2TA 4E5MA 3ETEA 3FPLA 2CF5A 3Q2IA 4K6FA 1UDCA 4ALNA 3NT4A 1FJHA 4J6FA 1LSOA 1E7MA 1YJQA 5B4UA 3FPCA 1J49A 1E92A 4CR8A 2VHZA 4N18A 4EUEA 4CMIB 1E3SA 3OEWA 4R16A 3PHHA 4PN3A 3BMQA 1K6XA 3DQPA 1FK8A 3W6ZA 5ILGA 3QP9A 3L6OO 1YWGO 4GKVA 1DC6A 2D2IA 3BMQB 3U9LA 4W9NC 2VRCD 3KBOA 2I3AA 5THKA 3V2HA 3GNSA 4RVDA 1VL0A 3JQ8B 3NDIA 5COBA 4GBJA 1ZIDA 3BXXA 3B1FA 4I5EA 3ZHBA 1XDWA 3FTPA 5H83A 1VE9A 4BNWA 3IMFA 5JBIA 2D5CA 1CERA 1EQ2A 2VZ9A 3I6IA 1I24A 4MVJD 2C20A 3CPSA 1WPQA 2R00A 1BXGA 4CV3A 4E5PA 4ZRNA 3OJ0A 3ROKA 4DRYA 4YWJA 4NK5A 3WFIA 3OEYA 5A05A 1F14A 3K2EA 3IUPA 3GG2A 1NAHA 3ITKA 3L07A 3LK7A 3FSRA 3QW2A 4NDNE 5J23A 3OIFA 1ZEMA 5F1PA 1XHLA 4F6LA 3UOGA 1ENPA 1I3NA 2TMGA 4PZCA 2E82A 2Y0EA 5G0SA 3ZHXA 5EIOA 3C3XA 1YBVA 1N5DA 4AFNA 5JCXA 4MP8A 3EW7A 3BYZA 2R2GA 4L4RA 2X9VA 3X2FA 5DN9A 3OA0A 4PGFA 1C1XB 5BSFA 5EPOA 4KUGA 2GZ3A 3H9QA 5C7OO 1CQJA 2FOIA 5DDIP 5A06A 1HSOA 3KLMX 1X7HA 3RUHA 3TZQA 3UCEA 5CDUA 3KRTA 5B4VA 3ENKA 3EVNA 3JQAB 4I9UA 1YQDA 5L9AA 8LDHA 4IDGA 3IJPA 3MWEB 3EVTA 4L74A 1PGOA 3QIVA 4RO0A 2J5QA 3W8EA 4YAEA 2PR2A 1I2BA 4FFNA 1A4UA 1D3AA 1NP3A 4GMGA 3AUUA 3GDOA 4M89A 2B83A 3I4FA 2FY8A 4W4TA 4BOYA 3U5TA 3DMTA 5DBFA 4Q3CA 3A1NA 1SNYA 3FNGA 1DIAA 2GF2A 3W8DA 1YOVA 1Z6ZA 5IDQA 2NTJA 4OQYA 4PZEA 2UAGA 1PSDA 3DONA 2X58A 4A10A 1YOVB 2BFAA 4B7CA 4C7KA 4HKTA 1OOEA 3P5SA 5KJ1A 3S2EA 4QSMA 3WQSB 1EVJA 4F45A 4CR7A 1DAOA 3LT0A 1XQ6A 4MOWA 3AFMA 4TRJA 1Z7BA 2B37A 2FRDA 5KKCA 1U28A 1XLTA 1YVEI 1GUFA 5AYVA 2HMVA 4PG5A 2A4KA 4ND2A 2YV3A 4QXMA 2CY0A 4BO2A 4I08A 1LTHR 4AJHA 5L45A 2DM6A 5T67A 3ZWPA 2VYVD 1GQQA 2YJZA 2QG4A 2Y1CA 5I7EA 4RDHA 1XYGA 1UXGA 3K31A 3OJOA 4XDZA 2VCYA 5THQA 3DZGA 3BMCA 2A92A 1QR6A 1XWFA 3ETDA 2X5KO 3AI3A 4G5HA 3O38A 3ANMA 1EBFA 2BFMA 4BNUA 1QLJA 1PS8A 1ZUD1 1MFPA 5ADHA 3IDSA 1MP0A 4J49A 3RUDA 2C2XA 4O59O 4B4VA 3F9IA 2B0JA 4DLLA 5CEJA 4TZKA 3RBXA 4XJSA 4ZVVA 4Q3AA 1GZ4A 1IOLA 3G79A 2I66A 3GT0A 4WLFA 2WYUA 3C7AA 2ZQZA 4FN4A 4FFOA 3H3JA 1U5AA 4IUYA 4R1NA 3H3FA 1LRKA 5F3RA 4CM8A 3SJ7A 1T2FA 5G0UA 4IZHA 3GGGA 1E7YA 4RLHA 1PQPA 4J1NA 5ICSA 4E4YA 1P74A 4CM8B 4G2NA 1I32A 2IYPA 1N9GA 3HN2A 3ZWOA 5CDGA 1B8VA 2GN8A 4MKZA 1UZMA 4MVJI 4PRKA 5JSFA 3GLQA 1N9GB 1SEPA 1RYEA 2NSDA 3HB5X 3WGIA 4BKQA 4CM7A 3PWZA 2NU6A 2O3TA 4FJ2A 3TZHA 2YQ4A 4HBGA 3RCBA 1NVMB 5JC1A 5BNFA 5TGDA 4EEZA 3ORFA 5DP2A 1GTMA 2YQ5A 2PGDA 3PIDA 1EFKA 5ENDA 1FXSA 4Z3DA 2P4QA 4GWGA 1ZBQA 4NIMA 3V1TC 4BKRA 5IZCA 2VHWA 4XJTA 3PJGA 3WB9A 1X0XA 3KEQA 2X23A 2W98A 4E5KA 5T8KC 4B4UA 2HK7A 5GY7A 3W6UA 3IKTA 3TWOA 3B1JA 2ZKLA 1I33A 2QHXA 3PJEA 2G82A 1TA4A 2W2LA 3QWFA 2NVBA 1VL8A 1EVYA 1ZZEA 3NGXA 1TB4A 3F6YA 5GZ3A 1ARZA 3IP1A 1W8DA 1VRWA 4NG5A 1U3WA 2O50A 2EW2A 3ZV4A 3V5NA 1NYTA 3IQDB 1LDGA 1X14A 3SX2A 1V3UA 4Z3KA 3H9UA 4Y98A 2ZB4A 1M76A 3GVCA 4HNGA 3RSHA 1UH5A 2HU2A 1ZK4A 2Q45A 4YAGA 4GPD1 4CQMB 1X13A 1MG5A 2JJYA 4II3A 4RF5A 3VZSA 1V3VA 4BNJA 3S2IA 4DGSA 4JIGA 1GPDG 1GYQA 5JMWA 1KVSA 3WLEA 5C5IA 4DL9A 1L1FA 3JQ9C 4FD3A 1EE9A 3JQBA 3ADPA 1K2WA 4MINA 4Z9FA 2EGGA 2V6GA 4GI2A 4EJ6A 5CFZA 3BHMA 2IEDA 3D3WA 5F5NA 1LLQA 3P7MA 3ENNA 3DTYA 3GNTA 4YT2A 2OO5A 5AXAA 2YW9A 4ZHSA 1KVRA 3QWHA 3WWZA 3RKRA 4Z0PA 2FZWA 3D3WB 1ORRA 3RC2A 5U9CA 4XRGA 5C7LO 1S7CA 3D7LA 4LCJA 4NJOA 2F1KA 3JQFC 1MB4A 4YRAA 1XSEA 4ZQGA 1IZ9A 4A73A 1HYHA 3C24A 1BG6A 4WK6A 1YQXA 5IDYA 4B3IA 3E9MA 1G0NA 5JAZA 1OC2A 2AG5A 4XWYA 4ONEA 2HK9A 3IUSA 1VC2A 2EP7A 3PZRA 5TX7A 4E12A 4FPXA 3KM0A 2DTDA 1V6AA 3RBZA 1RM4A 1HE4A 3WWYA 3UN1A 3GPDG 1XR3A 2BGLA 3RFXA 2P9CA 1E6EA 1KC1A 3CINA 5CEFA 2A94A 1PR9A 1YONA 3WFJA 1BW9A 3ANLA 1AN9A 1E1MA 1QG6A 3ZWMA 1H6AA 4QO8A 2B5VA 3BTSA 3OICA 5L7YA 3UW3A 4UVIA 5TC4A 1BW9B 3G1TA 2HMSA 1IB6A 4TROA 3LC2O 1HE2A 3GVPA 2J6IA 2CZCA 1TVEA 3NDRA 2OXIA 4AG3A 4DC0A 3EZLA 3WYCA 1I3MA 3D64A 1MC5A 1YB5A 2FSSA 2JL1A 4XCVA 1GZ3A 4CM5A 4WASA 1CWUA 1YL6A 2LDXA 2J3IA 1JDJA 3RFVA 5K6AC 3QWBA 3GK3A 3BA1A 3GVHA 4U6QA 4BS9A 2YHIA 1QYXA 3LT4A 3PJFA 4GQAA 4YRDA 2NUAA 1ADCA 2EJVA 4PRLA 1E5QA 2YHIB 4MVJH 1PU2A 3L4BC 1SZJG 4RJTA 1MXHA 3EY4A 1EDOA 3KZVA 4K1LA 1HZZA 2EHDA 1NWCA 4JBIA 3VPFA 1F0YA 4DIOA 4U0JA 5A4DA 2A35A 4JXKA 1X7DA 4R9SA 3PHIA 5AXCA 1O9BA 3JQGA 4CMKA 3KLPX 4O1MA 4BO7A 2QRLA 1HL3A 4GGPA 1WZIA 1GV0A 2GSDA 2PGLA 1P0FA 5DBGA 4XQCA 5HS6A 2Y67A 2G17A 4ZN6A 1T26A 1ZMOA 3JD1A 1JQBA 2Z95A 4HADA 5JPIA 4XYMA 3JQGB 3U0BA 1ZEJA 2VNSA 3LT1A 1B16A 1D1SA 5HTOA 4CM3A 4IJUA 4CV0A 3FWNA 2CD9A 4DMLA 4XR4A 4FFRA 1U1IA 4RF4A 4AJLA 2GN6A 3OETA 1WDLA 3TSCA 1NASA 2VNAA 3NTOA 4U0KA 2JD1A 4IDAA 3EUWA 3IOYA 1DC4A 4IJVA 5IFLA 1LLDA 4BL5A 3L0DA 3KSUA 1UDBA 2VOEA 4UVEA 2O4UX 4Q3DA 3OSUA 4RPGA 4BO8A 7MDHA 3EMKA 3KSDO 4IJWA 2DQ4A 4WCFA 1E1LA 3ANNA 4LMPA 3MWDB 1UJMA 1GZ6A 2EEZA 2FZEA 2B69A 1PZHA 2FPGA 4R5HA 4ZU3A 4AJJA 1PGPA 1XA0A 5T5QA 4E13A 2X0NA 3D0OA 2O7SA 3MJSA 1EUCA 2D1YA 1PL8A 3F5QA 3RWBA 3T4EA 2DU8A 2D8AA 4H7PA 1B3BA 3ROMA 3C8MA 1DIGA 2IE0A 3Q0EA 4IXWA 4K9DA 3QV1A 3LU1A 1HLPA 4IDEA 2VYND 3IC5A 2TMDA 1R16A 3OIGA 4ND1A 1A9YA 3JQ7A 3QJ5A 4B8WA 3CIFA 4FFPA 2H9IA 3PTZA 5FFFA 3DO5A 1R12A 2FR0A 1Q0QA 3PFWO 4LVCA 2WE7A 2PWZA 1LU9A 3JQ7B 3A14A 4MVJM 1ZSNA 1AHIA 2AE1A 4OSPA 1HDZA 4W7IA 4UEJA 2GYYA 4LK3A 2RH8A 1WZEA 3N74A 3Q9NA 4M86A 4UVHA 2C29D 1JLLA 1KVUA 2C7VA 4Q3NA 3TN7A 4C4OA 3AFNA 1WNTA 2Q1UA 3NJ8A 3WNQA 1A4IA 3I3OA 3FR8A 1QV6A 3JQDA 3I9NA 2ZTLA 2WD8A 1LC3A 3PWKA 2QZ9A 4M8SA 2JHFA 4N7RA 4EJ0A 1M6WA 4WLOA 1GCUA 3PP8A 3SXPA 1PR3A 1C1DB 4NFYA 1D4FA 4RF3A 1DIBA 2NVUA 3SEFA 1O8CA 5ES3A 4AJ1A 5AQ1A 2NVUB 1C14A 2EF1A 3NX4A 3JQAD 2PD6A 4PG7A 4D45A 3DAGA 3DZJA 4Q3BA 4Q39A 2GGSA 2OORA 4M49A 1V3TA 1IYZA 1VJ1A 2HDHA 5A3JA 4D0SA 5T8KA 2Q4EA 3OJLA 3S8MA 4BO9A 2PTGA 5LCXA 4I5GA 5JW6A 1KVTA 3UHAA 1TT5B 1NPYA 3I9LA 1YQGA 3DBRA 5ICMA 4XIJA 3KYCB 2X5OA 1F8GA 3LZ6A 2B36A 5KVVA 3C1AA 3CEAA 3JD4A 4RPHA 1ZVMA 1LQUA 1ENOA 3DBRB 5I8ZA 1W0CA 4BB6A 4R68A 3HDHA 3I1JA 1VM6A 4N54A 1DBVO 1TI7A 1KERA 3DOJA 3QVXA 4BKOA 3W8FA 1ULSA 3WQQA 5HBRA 3JD3A 4TWRA 2BELA 4RPLA 4OXKA 4ROSA 1P33A 1B8PA 1U2GA 3JCZA 4Q3EA 3HFGA 4CUKA 3GOHA 1DFHA 1YKFA 3BZUA 1LC0A 4DBVO 4A03A 1YDWA 3ULKA 1DJNA 1UZNA 2VWHA 4GX2A 2OP1A 3PI7A 4TZTA 1CETA 1RKXA 2VZ0A 3HDJA 4CV2A 4E0BA 2G76A 1M6HA 2EW8A 1PWZA 2J5RA 4YCAA 4XB1A 1QORA 2RBEA 5DT9A 1B26A 1A7AA 1LDMA 3FR7A 5JFOA 1P44A 5JDCA 1Q2XA 1BHSA 2P5UA 2YY7A 3IS3A 4K6CA 4UVGA 4FGWA 1PGJA 3UUWA 1GD1O 4YEDA 1YJ8A 3VDQA 3DZHA 1T25A 5BNTA 4DMMA 3M2PA 3I9JA 4M87A 3MOIA 3WMXA 4B3HA 1ISIA 3TL3A 1E1KA 1BXKA 2DBRA 4MVJE 1HKUA 3OQBA 3JD2A 4O0LA 3SBOA 1JAYA 4U5QA 3HB4X 5A9SA 4AICA 3Q6IA 2I3GA 2V7PA 4B8ZA 2PY6A 1SPXA 2ZTMA 1EBUA 3RBVA 1BTOA 1XKQA 3ONEA 1LDNA 2QX7A 4RQUA 4PLFA 1IY8A 3COSA 1LJ8A 3U09A 2Q1SA 4M54A 1N2SA 1NQOA 4DIFA 2Y1DA 5KCZA 1RM0A 4OH1A 1GY8A 3U4HA 4NFSA 1E3LA 3H5RA 2YYYA 4E3ZA 4J9UE 1X15A 3ZW9A 1MX3A 5IN4A 4FOOA 2I76A 2AQHA 3HADA 3UVEA 1GUZA 1K3TA 4N5LA 3LLVA 1R0SA 4NHEA 2DPHA 4PCVA 1U3TA 1YB4A 3OHSX 5JE8A 1PJ3A 3HDYA 3VZQA 1JWAB 3I52A 2BGKA 4OIMA 3ONFA 2O7QA 1FDWA 5FEUA 4GSKA 2EXXA 5CPFA 1LLUA 3DOOA 3FRJA 3CXRA 3JYNA 3ZNOA 3V8BA 3H8VA 4IINA 5F21A 3ZWXA 4HX5A 5JCJD 1T2CA 4QT0A 5G0TA 5BQFA 4J0FA 3UGKA 4AJPA 1SOWA 4BUCA 1NPTO 1UAGA 1V9LA 3E18A 2AEFA 3AY7A 3P2OA 3VDRA 4WOKA 4CPDA 4W7HA 4B3JA 2Q1TA 2OGUA 1WLYA 3I9MA 1D1TA 4INAA 3AM4A 5DZSA 3WLFA 3WXBA 1PS0A 4XZ3A 4BO0A 3HDQA 1MV8A 4XKJA 1KIFA 1PJTA 1WDKA 5CDTA 1YH3A 5GZ1A 3AOGA 1DSSG 1UUFA 4DVJA 1JKJA 1BXGB 2YHUA 4CQMD 2Y1FA 4BO5A 1XEAA 3WICA 1V35A 4Y6RA 2XXJA 3F4LA 2WE8A 4HFRA 4KP7A 4Y6PA 4D7AA 2POQX 5K0ZA 2GD1O 4HXYA 2R6JA 3PGJA 4CQLA 5DOVA 4FFLA 5EMHA 1A72A 3B20A 3GAZA 3PDJA 1XCBA 3GQVA 5BSHA 5JXWA 3E03A 2NTVA 4L9RA 4CQLB 4XYBA 2C59A 5KKAA 1NXQA 1OI7A 1ISGA 1SOVA 1W6UA 3CMMA 3N7UA 3PVZA 4LN1A 4R51A 4XA8A 3DAPA 4L4XA 1K6IA 3JD0A 4FC6A 1VJTA 1VSUA 2FMUA 3NT2A 3TJRA 3WJAA 3ZCXA 3D4NA 3GF4A 1U8XX 2WJPA 3GEGA 4OOFA 3E82A 1AE1A 4M55A 3MJ4A 2ZCVA 1H6BA 2ZQYA 4IQ0A 2GO1A 1H0KA 4ALJA 1J4AA 5T57A 3SC4A 4J7CA 4PLWA 4X54A 5K9ZA 3DTTA 3E5MA 4L75A 3BHIA 4QEDA 2O2YA 3MZ0A 1Z73A 4R1UA 5TSDA 4E33A 5FI3A 4LCEA 3X2EA 4PLGA 4DTIA 2VN8A 5A1TA 4CM9A 4L4SA 2NVWA 5LC1A 1QLHA 4NH4A 4R1TA 4GAEA 4MP3A 5TJHA 3WYEA 3ZI0A 3AM5A 1DEHA 3CH6A 2C0CA 5LDGA 3NTRA 3AWDA 3RIHA 5BSEA 2NNLD 4QFCA 2X6TA 5KWEA 3I6QA 2WYVA 4MO2A 2FSVA 4QECA 5DOZA 3GGOA 1BWSA 4BNNA 3WIDA 2W90A 4CMEA 1EUZA 3DZBA 4FQ8A 1IHXA 1NR1A 1P45A 2OBNA 4IY1A 3OIDA 1QYVA 4NBRA 4RORA 1J5PA 1ML3A 1R0KA 1UDAA 1KVQA 1DFGA 3JQEA 2IZ0A 3Q11A 3UAGA 2HRBA 1NR7A 3ABIA 4CODB 3AOEA 3OA2A 3DL2A 2C5AA 3ONDA 2OZPA 1GAEO 3D4OA 2IODA 4J43A 1P0CA 3HWRA 3OH8A 4AJIA 1PL7A 2XPCA 2JAPA 3NT5A 4P8RA 4JJIA 4PLHA 2AW5A 4DQUA 3EGOA 3RQSA 3NTQA 4DYDA 4URFA 4BO1A 2NM0A 1E6UA 3L6DA 3M1AA 5JDIC 1LDYA 4D46A 4UUMA 1F17A 2UUOA 1NFFA 3GZNA 2X8LA 1IHYA 4R5MA 5FWNA 5TT0A 2Q50A 3PYXA 3QA9A 1PZEA 4O63O 3BMCB 3RU9A 3VHRA 3TFQA 2DBQA 4D3DA 2Q1WA 5EJ2A 3GZNB 3MOGA 1NM5A 3QHAA 3FN4A 1PJSA 1NHGA 4ESOA 1DIRA 2HMWA 2ZJ0A 4Y67A 6ADHA 3GY0A 3BAZA 5CHEA 1HTBA 3CUKA 1LRJA 1SBYA 3ZNNA 3GHHA 1HYGA 4CMJA 3PQDA 3SJUA 4XYGA 5JY6A 1VI2A 2RHCA 4LISA 3GMDA 4EYEA 3GFGA 3ROQA 1EUDA 3U4DA 3FNFA 1IPFA 1PTJA 4LSWA 1ZK2A 3PHGA 4RV9A 3WS7A 4BNFA 1HDYA 5MDHA 2OHXA 4R54A 3ASVA 3KEOA 2CMDA 1FDSA 5I7SA 1LNQA 1IPEA 3OJFA 2EGHA 4YDRA 3WGOA 4MIOA 2AHRA 3ZNQA 1VL6A 5A5EA 4YJHA 3DZFA 4WLNA 3NV9A 3F1KA 1EDZA 2FN7A 3FTNA 1YL7A 1BRMA 2OP0A 4E2WA 1YBAA 2Q99A 1I2CA 2Y1GA 3K5PA 1QXSA 2J3HA 5I7VA 3QY9A 5I9LA 1ZKMA 2O23A 4O5OA 3DZKA 6LDHA 3ZHZA 4A2CA 3FCOA 4K28A 1A27A 3WJ7A 1UXHA 1PQUA 3LF1A 1WDMA 3INTA 1CYDA 3FHLA 3G0OA 3OBBA 3NKLA 5JYEA 5KNLA 4N5NA 1CJCA 2X86A 4IDCA 2PD3A 1ADBA 3AI1A 3PZBA 5G2OA 4D42A 4J4HA 1Y5MA 4I9NA 4QQRA 5EESA 1BVRA 1QYCA 1CIVA 1PJ4A 1YXMA 5FF9A 1UAYA 2VRCA 3UF0A 5BSGA 1EFLA 1DPGA 4PG6A 4WKGA 4PLPA 2CVQA 4ZQHA 1I10A 1QSGA 3ZWYA 3H5NA 4PVDA 4KMSA 4YR9A 5L4LA 3RVDA 1EMDA 3INGA 4CLHA 1O6ZA 4RGBA 3Q2KA 2PNFA 4A27A 1LEHA 1R37A 1T2EA 4GSLA 4TKMA 2DPGA 3VZPA 3B6ZA 4R1SA 4L76A 5F1OA 4MVJA 4AVYA 1LBEA 5A04A 3F47A 3H2SA 5G0VA 4BO6A 4E31A 4B4OA 1YO6A 4TRRA 4ILKA 4HNHA 3NRCA 3HG7A 5H82A 3Q3CA 4BNIA 4E2ZA 1H5QA 3AU8A 4NMHA 3RJ9A 4ALMA 2Q49A 4FBGA 2HK8A 3SVTA 4WLUA 2BLLA 5JAMA 1O5IA 3CMCO 5C7IO 1I3LA 2BRUA 3STHA 3V2UA 2JCYA 3ROPA 4ZICA 3ST7A 4J1QA 1KS9A 3SLKA 2JD0A 5L3ZA 4U6SA 4W9NA 1T4DA 1NTOA 3R6DA 3WR5A 1Y81A 1P9LA 3RFTA 4P4NA 9LDTA 3V2GA 1MA0A 3VH1A 1B3RA 2AQ8A 3HFSA 3BHJA 1SAYA 5JAQA 1HDGO 1MFZA 2IDZA 3DBHA 1PZFA 1F12A 1SO8A 4DQXA 1SC6A 1SB8A 4YA6A 4IZIA 1DB3A 3LT2A 3WGGA 5IZ4A 3I9OA 3DB2A 4FJ1A 2I9PA 1LQTA 4NBUA 2X7HA 4PG4A 3PQEA 1N1EA 1HLDA 3WGYA 5KJ6A 2BI8A 1Q7GA 3KUXA 3FNHA 2GCGA 3G17A 4CMGA 3ITDA 1VSVA 4D3FA 3KSZO 4YAKA 1KC3A 3MJEA 7ADHA 1R0LA 3IKVA 4LRSB 1EK5A 2ZCUA 4Y8VA 5B4TA 1SEVA 4MVJG 1T2AA 3IAHA 5JLAA 2I99A 2VOJA 2EERA 4WLVA 4II2A 5COQA 3RROA 1QKIA 3R0IA 4D43A 1J6UA 5HS4A 5AOVA 5G4KA 1D8AA 4JP2A 2VT2A 4I5DA 3L6EA 4IJKA 5GZ6A 5L95A 3MTGA 2YV2A 3CSDA 1E7WA 1Y1PA 1ZSVA 5A02A 3S2FA 1X1TA 4DYVA 1L7DA 3BTUA 2YDYA 5G4KB 3V1UA 3RU7A 1PS9A 2ET6A 4XR9A 1JAXA 4NJMA 3HZZA 4JGBA 3K9QO 3NGLA 2X9NA 1NVGA 2VTEA 4BV9A 4RCVA 3K8ZA 1EE2A 2GR9A 3WSVA 5CDSA 1BXZA 5JS6A 1P1KA 1XG5A 3ZH2A 4GMFA 3MCVA 4OXNA 2F00A 4FC7A 3QQPA 2HLPA 3KTDA 1QYDA 1K6JA 1H6DA 1H9AA 2VYVA 4ND4A 3P19A 3RKUA 2P9GA 3OQ6A 5IAAA 1LSUA 1YGYA 3JYOA 4JBHA 1HRDA 4GX5A 3S55A 5I8WA 1E6WA 1QP8A 1XU9A 3W4JA 3WSWA 3PGXA 4MIEA 1X0VA 4J7UA 1HF3A 1GV1A 4OAQA 1RPNA 1FDVA 4WLEA 1H93A 2O3SA 4RVFA 2P91A 2EG9A 4CLXA 4PFJA 4LMRA 2O3JA 2C7GA 2BGMA 2ZYAA 5DCWA 4CM4A 2NACA 4IDFA 3JYPA 4ZQBA 2YFHA 3E8XA 1GL3A 3G1UA 4BIIA 1BDMA 1WXDA 5HWSA 5IN5A 4YB8A 1EVIA 2R00C 1IL0A 4YBZA 1VJ0A 1OAAA 4BGUA 2PLAA 3BMNA 1Q7CA 1NFQA 3HE3A 3ZU5A 3RUCA 4XEHA 4D0RA 3DEYX 4TSKA 4DPKA 1R4NA 5EL0A 1M67A 4WCFB 3E5RA 4UAGA 5IDXA 2DVMA 4PIVA 1R4NB 4J4TA 3CE6A 4ND5A 4GX1A 1F8FA 4U7WA 3C1OA 1GFSA 2GZ1A 1WVGA 4QTZA 4IS2A 4YYZA 2PKQO 5AVOA 4TVOA 1PQWA 4FOSA 2HUNA 4QUKA 2I5PO 3VVBA 1LI4A 5JNLA 1UXKA 1Z82A 1RWBA 2Z1MA 2NU7A 5EN4A 4EGFA 2BMAA 1JVSA 1Z7EA 2VUUA 4DC1A 2HCTA 1GU7A 2DT5A 3UCXA 2HJRA 2HO5A 5CP8A 1P1HA 4J3FA 1OFGA 3WIEA 2E48A 1CEQA 1PZGA 2CDBA 3E9QA 3RUAA 3VKUA 1IUKA 1H2HA 2Q2QA 3NUGA 4N5MA 3U62A 4IIVA 4WNIA 3TOXA 4BGIA 2PGJA 2BKAA 4J90A 3NJ4A 1DRUA 3RJ5A 4UEKA 4HFNA 2D59A 1PJBA 3F3SA 2JKVA 5I9NA 4CMBA 3D5QA 4CLOA 3KO8A 2WMDA 2FR8A 3HSKA 3WGQA 3DMTC 1EEHA 3H7AA 4CL8A 4QO7A 4B7XA 4UUOA 2E49A 3QSGA 3H2ZA 1GUYA 1XGKA 4IMPA 3WGZA 1NBOA 2RIRA 2G5CA 4YXFA 3DFZA 1K89A 4P38A 4E30A 3KOUA 1YL5A 5TQVA 1RJWA 1DAPA 2HAEA 3P2YA 1DIHA 5IJZA 3PRJA 4CLEA 5TIIA 4FR5A 3EDMA 2X0RA 4BNYA 3DBLA 1B0AA 2UYYA 3ZWWA 1XIVA 3CKYA 1U9JA 3WYBA 4ALKA 1OBFO 2VT3A 1ENYA 4LVUA 4LSMA 4BGVA 4WEOA 4TMFA 2JCVA 2AEMA 1RYDA 2PKRA 2D0IA 2GRAA 2DBZA 3VTZA 3UCFA 1AXEA 2V65A 5A9RA 3VH4A 2HQ1A 2FHSA 2OMEA 3H4VA 3PWSA 1PIWA 2EKLA 4JLWA 1CDOA 2PD4A 2LDBA 2QRJA 2QYSA 3EAGA 4J4BA 4OO3A 3INRA 4A7PA 4KQXA 3DBVO 1Z75A 3LDHA 4CLDA 3O03A 1MXFA 2PA3A 1DXYA 1NAIA 3GNQA 2RCYA 1JVBA 3K92A 1KY4A 4BO4A 1H94A 3KV3O 2V6FA 1DDOA 4R41A 3IJRA 2D4AA 2PH3A 3OMLA 3MJTA 4A0SA 5AXBA 2Y99A 5DP1A 4NNJA 4RZIA 2BF7A 4AJ2A 2P2SA 5CAEA 3QLJA 1ULUA 4WJZA 1Q0HA 3PK0A 4HFMA 3WX0A 2NU9A 3KETA 3EK2A 4P4LA 4RPKA 3JQ9A 5TNXA 4MKRA 8ADHA 1D7OA 1EQUA 3OF2A 5BR7A 1JKIA 1DRVA 2GN4A 1O89A 2DUWA 1U3VA 4D3SA 3RI3A 3M6IA 2IYOA 4J2HA 3CTMA 3FD8A 4MIYA 4HFJA 3IP3A 3JQFA 1ISMA 3H9GA 1Z45A 2OBYA 4NBWA 1I0ZA 2ZB7A 1LSJA 2ZJ1A 4EUHA 4B4WA 3BIOA 1Y8RA 4BGEA 4ZQEA 3UH1A 2H6EA 5DF1A 1X7GA 2BH9A 2JHGA 4Z9YA 3AY6A 1G0OA 1B15A 4PLCA 3VTFA 1Y8RB 3WMWA 4BHTA 5IZCC 1P1JA 5KVCA 3D4PA 5KJFA 3S1LA 3TPCA 5B12A 4XRRA 5A9SB 3DWFA 4E5NA 1E5LA 2JFHA 2VRBA 4Y6SA 3TNLA 1I2ZA 1RM5A 4H16A 2NTNA 1W4ZA 1HE3A 1FMCA 1YS4A 4U8GA 3TZCA 4RVHA 4J0EA 4MJLA 3FBGA 2GDZA 2OFPA 4JROA 5COAA 2AE2A 4JK3A 1M2WA 5EQFA 3JTMA 1LRLA 4GGOA 2CF6A 4WEQA 4CL3A 5HRUA 1R4MA 4RF2A 4XB2A 1E0DA 1YBMA 1ONPA 2FPIA 4Z9XA 2J8ZA 4K26A 4ALIA 2Y93A 3I23A 4W99A 4XQ9A 4TRNA 2JFFA 1GDHA 3OQ1A 1ISJA 4NQZA 5K6AA 4GH5A 4ZJUA 1ZJZA 4FW8A 4NBTA 4RVGA 3TF5A 3KVOA 3TL2A 4G65A 4CMIA 4F3YA 5B1YA 2Q4BA 2VWQA 2QYTA 4KQWA 4YQYA 4D79A 3JQBC 2GZ2A 3WGHA 3LC7O 2CUKA 1Y5RA 3I83A 4J91A 4OYRA 4RVSA 3L4BA 2WD7A 3UKOA 2EIHA 2PZJA 1ISFA 1O0SA 2GUGA 4IM7A 4D41A 2W2LD 3RD5A 4HV4A 5ITWA 1VPDA 2NADA 1BVUA 2WD7B 3JQ8A 3GFBA 2NQTA 4Z6KA 2ZB3A 2EWMA 5F1KA 1PL6A 1U7HA 1DC3A 4DPMA 2VYNA 3GN1A 3LYLA 1BMDA 4NBVA 2WTBA 1WWKA 4Y9DA 2UV8A 3IL2A 2Q2VA 5AXDA 1DHTA 1N92A 3K73O 3L9XA 2RAFA 4LW8A 2WWRA 1HE5A 4JCOA 1IE3A 2IZZA 3ON5A 4KTTE 3T4XA 4OJNA 4BMVA 4FGSA 1WAMA 4R01A 4PLTA 2GN9A 4WECA 4OL9A 4CUZA 5TF4A 3K96A 2EP5A 2V6MA 3MJCA 1MGOA 2X22A 4TQGA 1T1RA 4PLZA 3ZWAA 1YE3A 5EERA 1N8KA 5U4QA 2B4QA 1LUAA 3IIEA 1CF2O 5C37A 3JYQA 1XQ1A 4J9VA 4NFHA 4UVDA 4R4JA 2YZ7A 3AM3A 1PGQA 1W73A 5A9TA 1PGNA 3ETGA 5CDYA 1C1XA 4IPTA 2UVDA 1KYQA 2Y05A 4ND3A 3MJVA 4LGVA 4PLYA 4W6ZA 2NU8A 4OHUA 3VPHA 3DC2A 3LF2A 4RVUA 4E6PA 4XD2A 4XDYA 4DPLA 3O26A 5KVSA 1YRLA 3NAQA 1A9ZA 1NNUA 3C7DB 3PIIA 3RAJA 3JQAA 3E9NA 2AMFA 4FS3A 1WP4A 2ZTVA 4OGWA 3R1IA 1O94A 1R15A 1E3IA 3PXXA 3ZU3A 2YUTA 1M66A 3VPSA 3G3EA 4Z0HO 5KJEA 3ZV5A 3SLGA 2WYWA 1BGVA 3NYWA 4HP8A 4AJ4A 2YV1A 4IQ8A 2HMTA 3EC7A 3KYBA 2QQ5A 2NWQA 3TDKA 3G49A 4OM8A 2BFOA 3AUAA 5CG2A 1BDBA 1TEHA 4FB5A 3BTVA 3GC6A 4OQZA 4RDIA 2QZZA 4MKXA 1ADFA 3W1VA 1XELA 1N1GA 5T6BA 3H65A 4YQZA 3H9EO 2ZATA 2AA3A
chains in the Genus database with same CATH superfamily
2WF9A 4NESA 4COKA 3WL5A 3W3AH 2ZZMA 3EZYA 1BSVA 3TD6A 2GKSA 4OY3A 4BRUA 4ACAA 2E9SA 1GCGA 1KGDA 1KHHA 1SVLA 1B1AA 1TXGA 2P68A 4TTAA 5ES4B 4GL4A 4NU8X 4U2KA 1T1SA 2Q46A 1LPMA 1KTVA 2X5NA 1IY0A 2PZGA 4W5QA 4O4HB 1PEAA 5HIMA 3UJBA 5J59A 3X1DA 5J2TB 5FD8A 3WO0A 4D25A 1G3MA 1JFFB 2QRUA 2M98A 2W2QA 4MQFB 4V0QA 4I4TF 3ISJA 4EITA 3SR4A 1ONNA 4G9EA 4RKWA 3QUSA 3KZOA 3PC8A 4B79A 4URZR 3VJMA 4QASA 1NVKA 4TZ0A 3KJHA 3U49A 3SFTA 4BB0A 2Y1WA 3S2YA 5LYYA 1ZXLA 1I4OA 2IY9A 4B6JA 2W6MA 3RTDA 5JBNA 5FBQB 5AJHA 1JU9A 3V46A 3B3FA 4PLVA 4EJMA 1ZW6A 3DE3X 4HUJA 4QZVA 3SFZA 2HD4A 1D9XA 3GH3A 1UCFA 1NMXA 2QSYA 4MW5A 2R1ZA 1XCOA 4BZZA 1VHWA 1DOHA 1NWHA 2I33A 1KYTA 4O4JF 3ELYA 3U7RA 4AAYA 1JEYB 1MJHA 4YNBA 1E98A 1HDCA 4ZRMA 3FOEC 1EB9A 1KH3A 2G1JA 2XQVA 2DC1A 3LC1O 4MQ6A 3A0RB 4BAZA 2PL5A 4QREA 4D74A 5KEIA 4AY2A 3AUYA 1H5NA 4ZMBA 1TJ5A 2XAUA 3LQ1A 3NIFB 4KSYA 2YDXA 3O91A 4BCDA 2DT8A 4Z9BA 2Y4NA 3TQHA 3TW4A 2F8TA 1JHAA 2QK4A 3SEQA 5CB4F 1YCDA 3N0VA 1CPYA 1IULA 2RHDA 3NTUA 2HSDA 1F2VA 4ID9A 3GMSA 5H5JA 4DMKA 5I6DA 1JTEA 4RU1A 2GAJA 4ZK6A 5CRIA 3P9IA 5KJCA 3ZY6A 5EMJA 4XGIA 2VQDA 1JW9B 1C0KA 1Y8QB 1FS4A 1M74A 2DLNA 2IDMA 3UTDA 2QN7A 1C0LA 1DFIA 3VAAA 1B8UA 1HSZA 5EC8A 3LW7A 5CFNA 7REQB 4DJFC 1S8AA 3A6FA 3C6XA 2FEOA 4HG2A 1YACA 4OKNA 1A9QA 2ZK7A 1PFQA 1YS1X 3UIEA 5JI2E 4IIEA 4E2XA 3QRWA 3VNAA 3STUA 2XCOA 3P2KA 1SELA 2D1SA 3BWYA 1PFYA 2Q41A 3B3AA 2HADA 1LK7A 5AW2A 3AVTA 1C3JA 1F3OA 1E7SA 2FPPA 2X2OA 3BWEA 3CQ9A 2Y1KA 3NUQA 1I7NA 3PF8A 3BL6A 3OZTA 2FI1A 1TPYA 3LQRA 4MLDA 4DA9A 5BYBA 4CM6A 2QMOA 1QDUA 3MSCA 1AZLA 1ECLA 1I5RA 2GA9A 3MYRA 3DLBA 3R7WB 2YFQA 4YRZA 3EQ8A 1QBGA 2VK4A 1FX0A 2V7BA 3C45A 5KVQA 3DDNA 1OX5A 1E7RA 3ZU2A 1Z2EA 5CVDA 4BLVA 4JEUA 3F90A 3M49A 3J7AC 5A0FA 1WB5A 2C07A 2XV1A 2HA2A 3OLVA 1KEWA 4MW7A 4P36A 2AQIA 5ALTA 3ZVRA 3O2NA 3TXXA 4UUNA 2D5AA 1C0PA 4P4GA 3NXKA 1ICIA 3RTCA 1UZAA 1FQJA 1OU4A 2FSPA 1O96A 2AN5A 1VZ2A 3A9TA 2IYEA 2JGFA 4ER6A 3U3XA 1NX6A 5GTDA 4XM1A 1W48A 3ZHYA 1K4MA 2CZQA 1C1HA 2M32A 4RQTA 5INTA 2QTGA 2I80A 4MUYA 1YQWA 2JFGA 2ZULA 4J2TA 1RXVA 1TQ4A 1JG3A 4DV4B 1QF6A 1JN0A 4QRHA 4AN0A 2MDTA 5G0WA 4EM6A 4Z0TA 1IWPB 4LZLA 3VYWA 3ZW8A 1KO8A 2DFNA 2RH4A 4BDSA 1JPNA 5JJCA 1QRSA 3VNVA 4K40A 4HR7A 2XF2A 4JSYA 1PBTA 1IXKA 1TUBA 2LGJA 3HJAA 1IB0A 5LZ4A 3LDFA 2IHTA 2WM3A 1SC1A 4X95A 3AF0A 5GJCA 4TMKA 1GGFA 1RYNA 1R66A 2BFNA 1RP1A 4QODA 1N7GA 3RI3A 2HJSA 1PNTA 2PWAA 4JBXA 2KW5A 3NU1A 5BW6B 3AI7A 3ZE9A 4H7IA 3I01A 2ZUEA 4QDJA 3LSYA 2P9BA 3BX1A 5KYXB 5LLTA 1X8XA 2WFLB 3M1YA 2CDNA 2WTNA 1M0TA 1E4EA 4HZUA 5AVWA 1CS0B 4GYKA 4R3WA 2VQ3A 3GYGA 3U4CA 2OD2A 4YAIA 5DI9A 1VIAA 4BLUA 3S0JA 1DELA 3IT1A 1U7OA 2H1LA 1ZYUA 4IQGA 3GPIA 5JSZB 4P80A 4YJDA 1O57A 1OE0A 2ZAIA 3NI2A 4OH7A 5AHKA 4R8MA 5D5QA 3Q2OA 2PSJA 5KTSA 1DX6A 4NPCA 3DZIA 4Q9NA 4HNVA 1TLFA 3B1VA 5LOVF 3QU7A 3CV3A 3CVOA 3GBVA 2XNJA 2FCRA 4X20A 5E1BA 4IBOA 2PZKA 1KMHA 4KKXB 3AF3A 3LBIA 4OP1A 3TM5A 3Q40A 1ZD5A 4HQ6A 3QVSA 3A6LA 3HHEA 1VLMA 2CVOA 3VKFA 4QX6A 5CVTA 5IXJA 4FB4A 2NTYC 2J48A 3PFFA 5C80A 4E09A 2IEBA 1U4OA 3DHEA 3UZUA 2C5EA 2WSSD 1SCBA 2XMPA 5IDWA 3U44A 1T1EA 1U4SA 2PX2A 4KAFA 3TZKA 1F1BA 4R05A 2G7MC 3FPHA 1PZMA 4HDKA 1XZAA 1G21B 1PJQA 1S89A 2EW1A 3CF2A 4OJKA 2AMVA 4L8GA 2FPUA 3MF4A 2YC2C 3AU9A 4N6OA 5B58T 5SY6A 4CJXA 2AI1A 3TLYA 4Q1CA 1E2FA 4EARA 2XYHA 2VYQA 4DM7A 2BFDA 3OZIA 4B17A 4A8JB 5HW0A 1G6KA 4XIFA 4XYEA 1EHIA 2ZRQA 4YASA 5AKKA 2WKWA 3LJKA 4QOIA 2IXBA 4XJXA 1G60A 3A4IA 4NJEA 2HHCA 3T5AA 4YV7A 2CCKA 4Y6GB 1GZHB 1AHHA 4ND6A 1XCJA 2KE5A 4P22A 3K9FC 4O6VA 1GWNA 2H1WA 3N2KB 4ZDWA 3EPPA 5JJLA 4RLSA 2A0FA 5JS8A 2QGNA 1Z6GA 3TFOA 3FNQA 1AF7A 4C7OA 4C4XA 1I8TA 2QBYB 4QPJC 2AF3C 2COEA 5JS1A 1MF7A 5ALWA 1D0IA 3SX4A 1W85A 1XP8A 1V0JA 1K0UA 2OCDA 4CI9A 4YV1A 4YT8A 3CURA 1TT7A 1QVVA 4NHOA 1KRHA 1FLVA 4QFDA 3A4TA 3WLOA 4F4IA 4DSTA 2ZITA 2FP4A 1U5CA 3HMQA 2Q0XA 3K1YA 4RTKA 5KWIA 3QF7A 2G9RA 1PT8A 1ZH8A 5DTEA 2I7CA 2R1TA 2Z8YA 4LWOA 4UARA 4Q9LA 1BHQ1 1ZJ6A 2WKRA 3EPHA 3HY4A 2PZMA 3DWGA 3VAZA 1J1IA 3NGMA 1N6HA 2G04A 5KIAA 5BWMA 1W4CA 2OTCA 3IOEA 1I7DA 2WUGA 4U7FA 4AJOA 5TPWA 3RASA 2XITA 4C6SA 1JDNA 3HYLA 4MRAA 5CK4A 4UUPA 5TLSA 3ASUA 3P4UA 1SOMA 4G23A 4LOJA 3DFUA 1JR3E 2BD0A 4YT4A 1NZDA 4KR7A 3F71A 1N32B 4YH1A 5AVYA 4AKHA 1HDRA 2JCBA 2RIPA 2C0PA 2E2WA 3EXHB 1ZGAA 3O73A 1VDZA 1ABFA 5J58A 2WWYA 2FPWA 5HQJA 1I80A 2HSEA 1EXMA 1LBHA 3D5TA 4DM3A 5LXTB 3FPKA 3OZCA 2OG2A 1U63A 2ENWA 1JTVA 4ENVA 4EQZA 1XMXA 5L3VA 2BZGA 4EQ6B 4IFEA 1DAGA 1P2GA 1MB9A 1YGPA 1NQTA 2CLFB 1BDJA 2RGBA 1HYEA 1EX9A 3IUBA 1R8XA 3MXOA 3QU2A 3TW8B 5J5CA 4B2IA 4D44A 5I7FA 3AUXA 3H6KA 5KX5A 1SKYE 2IVFA 2ZYRA 1X7WA 3NYQA 1NF2A 4PYMA 5A5FA 1U8UA 2VAPA 2FG6C 1FYXA 1R0RE 1EX6A 3FM9A 4BNZA 2QW8A 3PXUA 1APBA 1R6TA 4OKSA 4LE2A 3CLHA 3V4RA 4WOJA 3OFSA 1OYYA 3O2QB 1K7XB 1WMFA 4DLYA 3NATA 3W06A 3Q1KA 5FBLB 3NS7A 1ZCJA 4B5LA 4RA6A 5FCDA 3EMBA 3PPIA 1AS2A 2HV9A 1TD1A 2P77A 1CUHA 2WA1A 3R3JA 4YTEA 4M2LA 4X3CA 1PL0A 1DLJA 2E37A 3EF3A 3A1VA 1UINA 3AY3A 3MD9A 3P27A 4DCGA 1FVFA 4N3GA 1V71A 1G6OA 4CR6A 4F2WA 1H4QA 4FIZA 4BXOA 5C9ZA 1DXQA 3NEPX 1GG8A 4AG6A 4LFBB 3EDOA 2BR4A 4A2WA 3VR6D 2C4KA 2NXJA 4CCAA 3D3EA 3NHPA 1LA2A 2IQ5A 4Y1FA 4ER5A 1VYHA 5KNDD 1NHWA 1F4LA 3HPRA 5K20A 2QJFA 3N58A 3OF5A 3SYNA 4G85A 4MUEA 1BXRB 3UT5A 3AKCA 1NUUA 2JGJA 3DDUA 4TKUA 4ARAA 2VCEA 2EKZA 3PLAE 1OZHA 2C99A 3L92A 3D54D 1QAMA 1OXXK 1XDBA 4P98A 4PSVA 1YKGA 1Z06A 2ADMA 4N8EA 1ZGJA 2PAFA 4Q16A 4YVFA 3WB2A 2A14A 1GGVA 4CLOB 1EZ4A 1PUXA 3IKLA 1YIDA 4O4LA 3FOCA 2WT4A 3R7NA 4DGQA 4MDYA 3H75A 3GEEA 3C4VA 4GX0A 1PX2A 1JSZA 1ZR2A 4MVYA 4R8KA 2BVNA 1VTKA 4ZANA 2CXPA 2I4IA 2SCUA 1GG2A 2OZLA 2VNHA 1GPMA 2C1EA 1X1EA 1E96A 3F6RA 2QQGA 3UK1A 3HB0A 1ZUIA 5DCYA 5DX8A 3DAFA 5A4MS 3WADA 3ZWNA 1R0CA 3D1VA 3SC2A 3NDBB 1NSTA 2G77B 2PEYA 1M1NB 1HZJA 2NUPB 4ITUA 1HEUA 1PCXA 3FI9A 2XXAA 2GILA 3MTJA 1U2EA 3IXMA 3T54A 3H5LA 3DBLB 4MKHA 1G59A 2K2QB 4TS3A 1C1DA 1A5AB 4NVRA 4KNWA 3FB1A 1U11A 2H1SA 3K30A 4IXNA 1IY1A 1B8OA 4XQEA 3G2HA 5FOUA 3AEUB 1N6OA 2XTAA 3V1LA 2A78A 2QUIA 2G9UA 1IVYA 2R8XA 2X0IA 4BMSA 1P31A 1J22A 3ANSA 3FTEA 1QFJA 1LDBA 1BD3A 1SZCA 4OXYA 1P77A 4JY7A 4EG0A 2CHVA 4M1MA 4ECEA 1POXA 4JR1A 4YV0A 4ZCMA 3DHVA 3DT8A 1V8BA 3MCAA 4EHHA 1JZQA 4CUJA 2GM5A 1SD1A 3B82A 4AMBA 1D5CA 2QTAA 2UVPA 2ZUVA 1DARA 3A4VA 3WRWA 2GXAA 3PFCA 3I6ZA 3RUEA 5JD5A 1C3VA 5JZ9A 1Z83A 1VJDA 1Q0LA 4X71A 2V96A 2VR1A 1RWVA 3OJEA 3GN2A 2X0KA 4IS3A 3GJ0A 4DLKA 5KSOA 3KVVA 3AWIA 4GIBA 4MUKA 2XE7A 1NI4A 2N9UA 3OPVA 1FDOA 3P9SA 5HR5A 3QG5A 1NW3A 3HCNA 3V32A 4REOA 1EKXA 4KDEA 1YAJA 4UAJA 4IKOA 4WL0A 4G5FA 1JA1A 3ANXA 5CNKA 3VBCA 5J4HA 3QFCA 1TQ6A 2AI3A 4L6AA 2G08A 4WZ6A 3W9BA 2QVBA 2Y0DA 2BF4A 3QOFA 2O3RA 2PH5A 3SIPA 5HIAA 1J7KA 2BHLA 1OV4A 5JJKA 1AHPA 3KOYA 3G2OA 1QGUB 1YZQA 4MGKR 3PTAA 4R1QA 5AQEA 3O8RA 2O8CA 3WIUA 1E3WB 2Z9BA 1PYOA 4M1OA 3ZGYA 4HZIA 5CTAA 4G36A 3ZVLA 5BRAA 3HA7A 5CGQB 5JQGA 4EG6A 2XVXA 1VQ1A 2QMYA 4CQJA 1P4HA 4U2BA 4BX3A 1VKOA 2J3DA 5GIPE 2HC9A 2P3QA 2R2AA 4XIGS 1STOA 5BNIA 2IYYA 2VPZA 5FUBA 5JC8A 3KSMA 3OLXA 4HUQB 2IUFA 1KMQA 5KC9A 1FVXA 3VJRA 1MC8A 1BFUA 2FRXA 3D6AA 5JPDA 2XXBA 5AHRA 1XU7A 4EA6A 1HETA 4G0NA 4I1IA 5A5VA 2V6BA 1GITA 1G1AA 3SYRA 2IOFA 3HP7A 3KIPA 3MS2A 3KKKA 3UA3A 1VKZA 5LLDA 2IXAA 1Q0TA 2B5WA 4GXQA 3UO8B 1R8QA 3VTKA 1TAGA 2O0KA 1JLRA 4AZSA 4MV3A 1QIKA 2F8MA 4C14A 1GQSA 2V7QA 3GW8A 2XMZA 4DWWA 1JSCA 2C1XA 3CRMA 2BJVA 4OUDA 4UDOA 2XUKA 1PYDA 4YJFA 4YONB 1FL9A 1G19A 2BCGY 3AHJA 3N3BC 3OJWA 4J7XA 3VO1A 3R9XB 2O8BA 4ZOQI 3COPA 4ZVSA 3W2HA 3WBBA 2XUAA 4C6RA 5BVHB 5IF3A 1Z0DA 3QVWA 2J7PD 4V0MA 3DE2X 4G81A 3L4KA 1KEZA 2PZLA 4KI7A 1KZ7B 4NYJQ 5G02A 4ZVNA 2VP5A 3RIGA 3SEZA 3G2KA 2NXWA 1SC9A 2VWGA 4UBNA 3DR3A 4KPUB 4CMAA 2RGGA 3HACA 2LV8A 1A2KC 4ZVLA 2J0VA 4DNPA 4B3TB 1P1IA 4TRMA 1GADO 4UPVA 1YFJA 1D09A 4L0QA 5CPBA 3KV1A 1HFJA 4NX2A 3B2EA 5E0KB 4RZHA 1UK9A 1XVAA 2HU8A 3M89A 1VMIA 2J59A 4JBYA 4Q21A 3HHPA 4Q4AA 3C5HA 1TDJA 4EDHA 3C1UA 4YP9A 1H9BA 2WEKA 1P4GA 4IV8A 4WBSA 1C30A 3C6KA 3I61A 2HF2A 2HLNA 3E9DA 4YAFA 3T99A 3T9CA 1AZWA 2J3JA 4C0WA 3MBOA 4WUVA 3A06A 1D8TA 5FXMA 4BNDA 3UFXA 4G4JA 4CF5A 3LCRA 1T8YA 2QRVB 2ZI6A 2GASA 3M1LA 2FFAA 4XOIA 3T7EA 3FW1A 2FSFA 1JKFA 2YXNA 3UQYS 1WMAA 1KU0A 5HM8A 2HXGA 3AR4A 3I2JA 1FJ2A 1GL7A 5LZ8A 2QGFA 4E5MA 1DX9A 2IYWA 1FFWA 3ETEA 3FPLA 4UM8B 4WKBA 3HV0A 4A0FA 4ZI2A 1W7AA 3L7CA 5C18A 4ALNA 2A86A 4F4FA 2JAXA 2XT0A 5BPFA 4OPMA 2P2DA 4H7FA 1FRQA 3C97A 4Q1BA 5AK6A 4B4KA 1C7QA 1D2GA 4FR0A 4MITA 1XRNA 1J49A 1E92A 1VGVA 1WTAA 1Y7IA 3EBOA 2RC5A 2VHZA 3FPCA 4MQMA 5ARDA 3G2NA 3CX4A 2PKCA 4CCYA 4CR8A 3EVZA 2QTWB 3W6NA 3N87A 3RS2A 4RLQA 1GG5A 4W9MC 1IFXA 5AW9A 3RIEA 4PN3A 1OAKA 2BZ0A 2NXEA 2WFMA 3BMQA 3DWEX 3I09A 5BURA 4RBNA 2EIXA 3BD9A 4WZBE 3IUEA 2EJBA 3H5WA 1DC6A 1MVOA 1MD9A 2DWPA 1QONA 2Q5QA 3MTEA 3ZDZB 1CVLA 1ZIOA 4RK0A 4M1TA 4W9NC 2JGLA 1EESA 1KJYA 1M8GA 5THKA 3GNSA 3I72A 5F3WB 4RVDA 1VL0A 4C1BA 3T7DA 3TINA 4JP8A 1B4DA 4A1OA 4JVOA 3C5VA 3IR5A 1EFDN 1QO0A 4Z8XA 1G8MA 3AEQA 4LF9B 2Y9MB 4GD3Q 1XDWA 4BNWA 3OEHD 1VE9A 4PHGA 5ELLA 2BKEA 4EIWA 4XVUA 1ZL0A 1CERA 1MEOA 3KPJA 5GINE 4IMIB 4XUEA 1Y6QA 3IQIX 2OLEA 4EGCB 5KOJA 1YT5A 3L43A 4E1VA 4LQ4A 4LVOA 3DM9B 3B7GA 3CPSA 1IEVA 4IVNA 3KUDA 4TV9F 2Y4OA 3OJ0A 3GFPA 4DRYA 2PAAA 3BHNA 1TAQA 2ZYVX 3BK2A 4TUYA 5A05A 1V1JA 4MQEB 1XQWA 1AO0A 1XVLA 3GG2A 4Q0MA 3L07A 2B82A 3LK7A 1X7XA 2AZMA 2R8RA 2B20A 1TIPA 4W8OA 4YCCA 2O2GA 3OIFA 1D1QA 3EXFA 1G2QA 4NCIA 5F1PA 3WYDA 1YQTA 3W90A 1JHDA 4HN9A 1ENPA 2WP0A 1KEEB 3ZHXA 1U0TA 3C3XA 5JCXA 1BGWA 1FFSA 4CN8A 2IYUA 3FHCB 2FE1A 2AR7A 2YVAA 4HX2A 5E4FA 3EW7A 3LYUA 1OJ7A 1GAWA 3ROZA 4DQKA 5DNDA 3T0FA 4UCXA 3PXEA 3AF6A 2H18A 1YZVA 1A8HA 2X9VA 2QV7A 1ZU4A 3N39C 3OZFA 3X2FA 4Q02A 2JIOA 1OUMA 2OZKA 3ITEA 2YV5A 1WW2A 3CLTC 2GZ3A 2YVUA 1CQJA 2FOIA 2GUWA 2LVBA 4H6WA 5EZYB 3R5HA 4ADSG 1HSOA 5JAPA 3KLMX 3THWA 2IX9A 2XT9A 3TS1A 4UDNA 2C58A 1GGEA 1UXOA 1JDVA 2FEWB 1KDZA 3ENKA 4RD2A 4I9UA 1YQDA 3PIRA 3RF7A 4HB4A 4O1HA 3F9CA 2HGZA 3FDIA 4G1EB 3DSRA 1D2EA 1N9ZA 2YJ6A 3P96A 2IYSA 2J5QA 3QA3E 4M0FA 5EPEA 9MHTA 5F23A 4MTCA 5DGHA 3SIWA 4G0UA 1G5FA 1TCBA 3AUUA 3KHTA 2CJXA 3BULA 3VZBA 3H1GA 4CG1A 1DQRA 2GEUA 3I4FA 1QPGA 2FY8A 4BOYA 2H2DA 3DMTA 3MM4A 2WZBA 3L5OA 4CT5A 4CIYA 1IWOA 1JPUA 1ODJA 1GTVA 3A1NA 4Q9KA 3TSWA 2DPLA 4BUJA 1JPVA 1DIAA 1TM3E 3W8DA 4RPCA 4UOQA 4B83A 4C0XA 1ETUA 1E2NA 2GD0A 4F85A 3VPAA 2Z4TA 1Y4UA 1BN7A 3CT4A 1YOVB 4RMNA 4B7CA 1QPZA 1AKRA 4C7KA 4HKTA 4KQ1A 3P5SA 2H06A 3R0VA 5NULA 5KJ1A 4QSMA 1OHHA 4LFCB 2Q4RA 1T8SA 2R8BA 1ZNYA 1DAOA 4N41A 4WBXC 4W1RA 3FCEA 1Z7BA 4RSHA 4C4YA 4WUTA 1YZUA 1VLVA 1XLTA 4KXYA 2ONCA 3HCDA 2BCJQ 4MWTA 4P2BA 3WRYC 5DRTA 1LPPA 3O93A 3QYAA 3ZXUB 2YV3A 3B8HA 4QU5A 3QSYA 1HNNA 3FOWA 2BMVA 4HV4A 2CXSA 5TV2A 1RE0A 1OAOA 4QUAA 4HAZA 4GZ5A 4J07A 4QDOA 5L45A 2GK4A 5T67A 2W6ID 1DAFA 2A9RA 3BDVA 3OJCA 4HGOA 5FJJA 5IAGA 2QG4A 2Y1CA 3T06B 3W7AA 4TKVA 1OB5A 2WF8A 2HU5A 2Z3VA 4ZXPA 1Q7EA 1QGAA 3OJOA 1MNAA 2PJRA 2VCYA 3TLAA 5THQA 3ENVA 3L8EA 2YJ5A 3FYCA 3OE5A 3LVRE 2A92A 3TI7A 5KTOA 3W8RA 3SHOA 1XWFA 2FUCA 4HAIA 4KLCA 2EZ4A 3FBWA 4UDXX 5I9TA 2WU4A 4KH1A 3FPJA 3PFNA 4ZTZB 1PS8A 4X1KA 4ZAVA 2XB8A 1Z62A 3JYHA 4WV3A 1P1BA 5HZHA 3IDSA 5JVDB 2PCLA 3GCZA 4S2UA 4O59O 3HXMA 2PFKA 1KH2A 3L0OA 3F8SA 5AKXA 4LHYA 4X7RA 3V48A 5KQGA 2KBFA 3RBXA 4ZVVA 5EJIA 4Q3AA 3F73A 3G79A 1YCHA 3G13A 1WG8A 1QHEA 2X42A 2QM0A 1RXSA 2ZQZA 2FW8A 3HRKA 4FN4A 3SOPA 3H3JA 1ZCBA 4R1NA 4EPXA 4C3UA 3H3FA 3FLMA 5E1OA 2CL7X 1YCGA 3KQKA 4PINA 4BLPA 1JH8A 1P5HA 1XFDA 4PQRA 2A0WA 3T41A 1ZQ9A 1QVWA 3UANA 1FLNA 2I34A 1RI4A 3UATA 1P74A 3ZCSA 2VDWB 2VUIB 4UUQA 3ZXIA 2IYPA 2ODEA 2OBLA 1VCMA 3UJ6A 4J8PA 3ZWOA 3ORYA 5CDGA 1B8VA 1PR4A 3OZUA 4TL9A 4DEYA 1N78A 4DY4A 3O0TA 4MVJI 2RHHA 4Z7NB 3GLQA 4WN3A 1N9GB 1SEPA 1RYEA 2R47A 4KI0A 2P6RA 4CM7A 3WHKA 3DPUA 2OV3A 1ITZA 2C8KA 3L7YA 2AOTB 5E7MA 1BX0A 1VPLA 5J2UA 1T9GR 3DOIA 1NVMB 2B99A 4IH1A 5DXAA 1TAHA 2RI1A 2XIQA 2Q27A 4BLSA 2NU6B 4DSZA 5FTJA 1Z5UA 5G40A 4P35A 1EFKA 4NV3A 2JFWA 2P4QA 2OSVA 3V1TC 1P91A 2C2BA 5K3BA 4PS1A 2BEVA 3LY9A 1GTL1 2VHWA 4XJTA 3WB9A 4JLBA 3KEQA 2VTVA 1GFZA 2CEAA 4ML3A 4E5KA 1PF7E 3IKTA 3SE0A 4AZVA 1VDMA 4P7JA 2DULA 1MAAA 5AK0A 1C8LA 2ZRAA 3B1JA 5K3CA 5FWDA 1CLEA 1BE1A 2BTEA 4QU9A 3LL7A 4L8FA 3QMMA 2W2LA 1TA4A 3HH8A 3NC4A 2NVBA 2XCTB 3HRHA 3MINB 4XWAA 3CO0S 5GIOE 1YDGA 2ASEA 3I05A 4QPDA 5FPQA 3LRPA 1M7GA 1TB4A 3OCYA 1SVIA 4FFBA 1ARZA 3IP1A 1CTQA 4JT8A 1U3WA 5JJ5A 4IEEA 2VZLA 1CJBA 4IDHA 3ZV4A 1KTIA 2HJ9A 4JT9A 6GPBA 1TJ3A 3TOCA 5A7FA 1QX4A 4Z3KA 4V03A 3H9UA 3MW8A 1V16A 3ORRA 4Y98A 5EWLA 3GVCA 2XQFA 3NHBA 1DBIA 1E9VA 1UH5A 4P7FA 2C2GA 3EQ9A 5DGDA 4YALA 1TE2A 1SXIA 3GFRA 1TTQB 1GGKA 1UJ2A 4KODA 2ZYSA 2HA6A 4RHEA 3ECCA 2C5FA 1UPAA 3VZSA 5ALOA 1ZRSA 1L8QA 1Q0ZA 1N57A 1GLNA 3GROA 4BNJA 1ZM4A 1ZAYA 3SQXA 1GPDG 1GYQA 3DB1A 3PUWA 5CJJA 1G17A 1HV8A 5JMWA 4O2BA 3FSGA 2YHAA 3RB8A 1WY7A 1S3FA 4DL9A 2BGWA 2OAQ1 3NEJA 3P8ZA 3RHZA 1JTFA 1DOAA 3ADPA 4Z9FA 3HXLA 1FQWA 3H5IA 3ZJUA 4G0WA 1OLUA 3BHMA 4HWRA 2Z6UA 1H5UA 4MJ3A 5D00A 1G3RA 1LLQA 3HN6A 3ENNA 3DTYA 1UKAA 2RGNC 2VJAA 3T9AA 5K05A 1KZ4A 1NVAA 5E6UA 4YT2A 4LY0A 3FTQA 1KVRA 3RKRA 1NUQA 1GQOA 3D3WB 3L0YA 3QYPA 1WB9A 4U2CA 2OFFA 2NYVA 3AETA 5U9CA 4XRGA 3D7LA 4YRAA 2Q62A 3I9FA 1G3IA 3WNDA 1N5MA 3COWA 5LU9A 1KRWA 1KXJA 1A9RA 3EUFA 3CX7A 1U2QA 4H6VA 2MR6A 4GU5A 4RY9A 1U9CA 4LFAB 1JJBA 1QG2A 2JW5A 3HB9A 3HVUA 2GF9A 1L4UA 3R6LA 5TX7A 4U2GA 3FYDA 5BYJA 1Z13A 5CLHA 3O31A 1SK9A 2IXEA 2WF7A 1G64A 1IDN1 5CITA 1RM4A 1XKLA 2BMEA 3WWYA 4FNAA 1EFPB 4B3GA 1DAHA 2VQSA 3VR5H 3F67A 3MELA 1BRTA 1E6EA 3DLPX 4EA9A 2PE5A 3HK2A 3CINA 1IHUA 1PBNA 5G41A 1FFCA 2QRGA 5CEFA 3IEMA 2QJTA 1MVNA 3WFJA 2GF0A 4B6GA 3NWEA 3WZMA 1PQ4A 5ALEA 4C30A 1E1MA 1ULZA 2IX3A 1KJZA 3ILSA 3T3MB 3KYIB 2RK3A 3OICA 1TM5E 5B36A 4ME6A 4PCUA 4P4SB 2IS1A 1IB6A 4D4KA 1D6SA 1HE2A 2EBHX 2J6IA 1NF3A 1TVEA 4AG3A 3L4JA 4DC0A 1N4DA 2PMFA 4JOCA 1MO3A 4KXNA 3JQQA 4FILA 3UUGA 3D64A 4OD0A 2FSSA 2XHZA 5CK5A 2OXRA 1VGRA 1GZ3A 1IDOA 3PDHA 4AZ0A 4IO0A 3VMMA 3P0JA 1JDJA 3WGVA 5ISMA 4F5ZA 4AG5A 2A9QA 1ZG3A 2G8LA 5DJ5A 3DMHA 3JVVA 4FTWA 4X3PA 4PC7A 4WK0B 4DNOA 2PHZA 5JNWA 3LT4A 1KE1A 1EHYA 2BUAA 2O52A 2QLBA 5JARA 4PRLA 2Q7OE 4HNUA 1E5QA 2EKDA 2YHIB 4LRUA 1PU2A 1FE8A 1SZJG 3L4BC 4QPNA 3ENWA 3EY4A 4X9XA 5EXXA 1HZZA 2EHDA 2HCFA 2WQ7A 2ZYTX 4FLEA 3M4XA 5F1YA 1U9IC 2A35A 4R9SA 3ZE7A 1K5GA 5IH7A 1K3UB 2Z57A 2QXYA 3ETNA 4HYYA 2QRLA 4GGPA 2OCIA 1SKMA 1GV0A 1KZ6A 1P0FA 1UJNA 3A2NA 3D2BA 3PNPA 2WILA 1C7FA 2Y67A 1V7ZA 1J5XA 2G17A 2R1VA 4EY5A 4ZN6A 2D5BA 3DQZA 2NP7A 3CWQA 2AFIB 3L7MA 5ESWA 2CD9A 3U9TA 5HZGA 3PHBE 1CY1A 3E5NA 4ZIRB 2JIZD 2BR5A 2W58A 5BT8A 4ARZA 2AWOA 1WDLA 1JLMA 1PWYE 1NASA 1QIFA 1A8QA 1SG9A 3ABRB 3TSCA 4U0KA 2VSFA 5FR2A 4IDAA 1YTUA 3IOYA 2W8BB 3DVLA 4RY2A 4IJVA 4CKZA 4C3VA 1J5EB 5IFLA 4ZRDA 3IPAA 2O4UX 4B9EA 3DFIA 1M2FA 4ODIA 3EMKA 1UKVY 1XE3A 3I39X 5B1EA 3W5IA 4B8YA 1XZJA 2AS0A 5EIWA 3ZGOA 2DQ4A 3OWXA 4JGIA 1XD2B 3HBLA 1GARA 3MWDB 1GZ6A 2C92A 3ZR4B 4C76A 4ENTA 1CJUC 2QAGC 1X80B 2ZBQA 4ZU3A 4JENA 4DIDA 1OKKA 1RRGA 4PAQA 4EH1A 2XVYA 3A6HA 2XRFA 3D0OA 2CYAA 1CUVA 2O7SA 4IP0A 2YVKA 4PX3A 1DBSA 2GEFA 2XA9A 3NASA 4IGAA 3U39A 2ONZA 1LZLA 5AUNB 2H11A 1D2MA 1LBQA 1KI6A 1QPBA 2D1YA 2QUJA 2DU8A 4JODA 2D8AA 4L0CA 5IVHA 1FIUA 1LK5A 3V34A 1EXNA 3ZWQA 4OQ4A 3C8MA 3BFJA 1COZA 1WL8A 4LNHA 1XLVA 2R7NA 5IJ9B 3VI3B 4K9DA 3DE0X 5F9FA 4I4CA 3WMFA 3CB2A 4Q93A 1RAFA 3IC5A 5DB4A 1R16A 1E6CA 2RJNA 5BMOA 2PUFA 2MCFA 1A9YA 2VJLA 3FMIA 4G0OA 3CIFA 1FFHA 3GL9A 5AVRA 1P4JA 4KQ9A 5JV5A 1LI5A 1NATA 1NTRA 3PTZA 5I4BA 3HU2A 1I13A 1Q0QA 3K9GA 3PFWO 4V24A 3RRBA 2WE7A 2PWZA 2GZHA 1PEYA 3OCVA 4LYDA 3FNIA 4MVJM 4UMDA 5DNUA 3PPWA 1RRFA 4TTJA 4W7IA 4Q48A 4UEJA 4AF6A 4DHWA 2PZEA 1WZEA 3LRTA 3N74A 2AOUB 3IT0A 4UQOA 5IBRA 1W5SA 2CEKA 2WM2A 2C7VA 2AJ8A 2JEZA 4K5QA 5AW6A 3OHPA 1KAMA 1NDUA 2Q1UA 4E5DA 1Q50A 1S8OA 1BFDA 5IFKA 2JZNA 3I3OA 1ZRNA 3DXZA 3OJXA 1JQJC 1V6SA 2X40A 3F0TA 3JQDA 4KV7A 1M83A 1NT4A 4DB2A 2WD8A 4B33A 3E0QA 2WJGA 3IQZA 4QKQA 1NF8A 3HJNA 5BUQA 1OIVA 2ZI9A 1JFRA 3ETCA 4HH4A 2FUG1 1RZ3A 3HCBA 4ZYTA 5ICEA 3QPBA 2QZ9A 4M8SA 2IQIA 4EJ0A 1BIFA 4I1RA 1PR3A 4NFYA 3C3CA 4PX5A 3O8LA 1GNQA 2I6UA 4FZRA 3OPNA 2J9XB 1OA0A 1SK8A 2ZEJA 1R9GA 3G5MA 3KEGA 4C4AA 5JZBA 1E1CB 3TSOA 5IAJA 3WQHA 1Q2UA 5FI0B 3HO1A 2NVUB 1C14A 2EF1A 3BT7A 3JQAD 5KQLA 3EGXB 1SWVA 2YMPA 1GUDA 1TQ8A 3I04A 2GGSA 3F9RA 4M49A 3PC8C 1E5XA 1T0HB 1T3HA 1V3TA 1IYZA 3B9QA 3DE5X 5DFAA 5A3JA 3R5JA 4JP1A 4D0SA 2MYUA 3DWIA 2FK8A 1T91A 2VKQA 1SCQA 1NE7A 3NWBA 3O3MB 1U9ZA 4BO9A 2RHWA 4PBRA 3MIZA 5D7BA 3GXOA 3ZHCA 2YXEA 5KTPA 1KVTA 4MV1A 1RCFA 3GCGA 3ZEAA 2IH5A 1SGWA 1NPYA 1Y5NA 3I9LA 1YQGA 4DCPA 2ENUA 3I42A 3UG7A 5AUPB 1W36B 3GQBA 1F8GA 3LZ6A 5A62A 3ZEIA 1QKKA 1G66A 3C1AA 3CEAA 1Y7LA 4X8HA 2XY4A 1P5FA 1UFQA 2I6QA 3R09A 4LYEA 4JP5A 3DBRB 5I8ZA 2PUAA 4R68A 2V45A 4GZ6A 5J63A 3I1JA 1VM6A 4CFZA 2C3OA 4XI9A 1KPGA 3MAJA 3O0DA 1CD5A 1IQPA 4BKOA 3W8FA 1ULSA 5GOTA 4C2TA 3K6KA 1DV2A 2B8JA 2XX3A 3MBKA 1VFPA 4FI3F 2BELA 4LV8B 4O2RA 4OXKA 4ROSA 5JG7A 3T7RA 4S24A 1P5RA 1U2GA 5DBEX 2CNWA 5KKNB 4L28A 1O9HA 3OHMA 2HA3A 4G8CA 1JFLA 1U8AA 1XTIA 3FKQA 3HFGA 3A32A 5ALKA 1YKFA 1EWQA 1LC0A 4MSUA 3ZIAA 2V7UA 3EFOA 4HMOA 1KEKA 5EIEA 1YI1A 1DJNA 4MGYR 4EFMA 1GRQA 5HHTA 3IMKA 1WP9A 4TZTA 3UGTA 1CETA 4AXXA 2AEEA 1ZKDA 2VA8A 3QW4B 1RLIA 5IT0A 2BY4A 2VZ0A 1UIRA 2GB4A 5DLQC 3EARA 4E0BA 1PWZA 3GLIE 2Y2VA 4MQBA 2YY5A 4QGAA 2DQZA 4AD8A 3ZQJA 3EIQA 4NDAA 1N7IA 3FETA 4Y2UA 5EAIA 1LDMA 2IIPA 4F2DA 1UMDB 1U0GA 2YC4C 3EXG2 4QA9A 2R8PA 3GEPA 5FR1A 4KK3A 5ERGB 3FGNA 1YI8A 1S7GA 5JDCA 2P5UA 1BHSA 5EE0A 3IS3A 4MGEA 1E1DA 5LBUA 4D8XA 1AA6A 1ZM7A 4V39A 4FMDF 3UUWA 4YEDA 1CZNA 1YJ8A 3HWSA 5BNTA 3M2PA 4UM5A 4M87A 3FHTA 4B3HA 2Z09A 3IURA 4YN3A 1A4RA 1F4VA 2QZJA 3AB8A 3IBCA 3LGXA 1E1KA 2R8YA 1IUOA 4HQOA 5HKKD 5JLJA 4G5XA 3HVHA 4D6YA 3ACBA 2F17A 2K7ZA 3PUHA 5LYJB 1JHUA 4AICA 1E2HA 4QXAA 3Q6IA 4X24A 1UFKA 3R0JA 2B1GA 4B8ZA 1F3LA 3FCCA 1KQGA 1SUSA 3JVDA 1SPXA 1EA7A 2ZTMA 3PCTA 1X1BA 2CBGA 2IBMA 2FMXA 3WLQA 2DFKB 1LDNA 3I1FA 5BQ5A 4IG4A 2GNPA 4N8DA 3TFWA 4EF4A 1FDIA 4Z4IA 1TQDA 2PSSA 4D8UA 3COSA 1MOSA 4O8CA 3ERCA 1B43A 4JUCA 1W2GA 1J2UA 1N2SA 2Y1DA 2G5GX 3LAWA 3WGKA 1E3LA 2XH8A 2XE4A 3D7KA 3EA0A 4HYTA 4OHBA 2E4WA 4J9UE 1B74A 1H2FA 1WMEA 2I76A 4FOOA 3WGNA 4N5LA 3REQA 3UWDA 1R0SA 3LNCA 5CH8A 4PFKA 1VP9A 3HUUA 1GA1A 4Q7EA 2IHUA 3OHSX 1ZC4A 2EU8A 1GP2A 4KMOA 3F6SA 1JWAB 4KW7A 4NEGA 3LL4A 2BGKA 2WWGA 4OIMA 4XE5A 3VSDA 4DKJA 3HYNA 4HGQA 3VZCA 1GU1A 2Z5VA 4ZJPA 1CUEA 1R4ZA 4CEJA 3ZCQA 1FVOA 1DAKA 2JBAB 3HR7A 3ONVA 1NVVR 2R9VA 4DARA 3LOPA 3TQRA 1Z2OX 4DSAA 3DTNA 3OOSA 2OYCA 1O03A 3I12A 3ZNOA 2XW6A 3H8VA 5KX5F 2H5EA 4LEIA 5KNBH 2IL1A 3EOBI 4PQYA 4QT0A 2YN4A 4F8EA 3BXPA 1EB8A 2F1HA 4EABA 2OAP1 3G9ZA 3IDFA 5BQFA 4JT2A 5H7XA 4AJPA 1FLAA 4BCCA 1AKYA 4ZTBA 4OFZA 4Q4DA 4Q9JA 1V9LA 1UAGA 2J4DA 5E9QA 2IUUA 1FRFS 3E18A 3AY7A 4GDFA 3TIIA 3IV7A 3VUEA 3ET5A 4XTCS 2Q1TA 2OGUA 3U5ZB 1TRKA 1RBYA 3D6HA 2BP7A 1X1CA 2OY0A 1D1TA 2RJOA 4Y9RA 5DHFA 2YFKA 1M72A 1J8DA 4XZ3A 2P9FA 4AULA 2P8SA 3LX5A 4L16A 4XKJA 1KO7A 1M73E 2GAFA 1KIFA 1PJTA 3KJQA 1REQA 2CMFA 5GZ1A 4CKBB 3S81A 4DBLE 3PS9A 4KBGA 3AOGA 1EVLA 3KL4A 4G5YA 2C8LA 2DPYA 1FX1A 4TVKA 1SVOA 1CX9B 1ANKA 3WICA 4PPQA 3OUTA 1X19A 4WJLA 5KSYA 2QR2A 4KO3S 2WE8A 3R0ZA 1FTYA 3LLCA 4KP7A 4D7AA 1N77A 3AJ8A 4HX9A 4EW1A 1Q3KA 4OHXA 4G56A