2OSVA

Crystal structure of znua from e. coli
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
283
structure length
262
Chain Sequence
AVVASLKPVGFIASAIADGVTETEVLLPDGASEHDYSLRPSDVKRLQNADLVVWVGPEMEAFMQKPVSKLPGAKQVTIAQLEDVKPLLMKSDFNMHLWLSPEIARATAVAIHGKLVELMPQSRAKLDANLKDFEAQLASTETQVGNELAPLKGKGYFVFHDAYGYFEKQFGLTPLGHFTVNPEIQPGAQRLHEIRTQLVEQKATCVFAEPQFRPAVVESVARGTSVRMGTLDPLGTNIKLGKTSYSEFLSQLANQYASCLKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Zinc-binding Transport Protein ZnuA from Escherichia coli Reveals an Unexpected Variation in Metal Coordination.
pubmed doi rcsb
molecule tags Metal transport
molecule keywords High-affinity zinc uptake system protein znuA
total genus 89
structure length 262
sequence length 283
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2osvA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2osvA02
4OXQA 3U7QA 2R7AA 1MIOB 4WN9A 1M1YB 2AFHB 5JJ5A 2OV1A 5I4KA 3MINB 1QH1A 2XY4A 3TEFA 1K0FA 4TKUB 4UDNA 2XQVA 3K1AA 3AEQB 3AESA 5JPDA 5KOHA 1K7SN 4WZAA 3AEUB 3AETB 1EFDN 3AERB 3R5TA 4TKVB 3TNYA 2XDQB 1M34A 4HN9A 4K3VA 5CR9A 1L5HA 1K2VN 5CX1A 5AFSA 1QGUA 5BVGA 1QH8B 1H1LA 3GI1A 4G07A 3R5SA 3AEKB 4FKMA 4WZBB 4IRMA 1PQ4A 3U7QB 2ETVA 3PSAA 1FP4A 3EIWA 5HDQA 4WNAB 4M7OA 1N2ZA 2AFIA 1M1NA 2PS3A 4FI3F 4NNPA 4FILA 5FLYA 2Q8QA 4MDYA 4LJSA 3AEQA 4HMQA 2OGWA 4WZAB 4WN9B 4DBLE 1PSZA 4UTPA 3MINA 3ZK8A 1QH1B 1G20A 2QI9F 3LHSA 3LI2A 5M3BA 5JOQA 5B58T 2MINB 4MX8A 4TKUA 2PS0A 3MWFA 3NU1A 4G09A 4N01A 4UTOA 4OXRA 1H1LB 4WZBA 3ZTTA 3G9QA 3MWGA 4XPIA 3AEUA 1N4AA 3AERA 1G21B 4HMPA 4GICA 4NNOA 3ZKAA 1L5HB 4PM4A 5CX1B 4BBPA 4WESB 5KHLB 3AEKA 4INPA 4ND8B 2PHZA 2YNMC 2WHYA 4WNAA 2XUZA 3HXPA 1M1NB 2AFIB 1KARA 2XV1A 1K75A 2MINA 1N2CA 5BVHB 5M34A 4CL2A 3EIXA 4INOA 3PDIB 1KAHA 3ZK7A 4LS3A 5KOJB 1G20B 1TOAA 5M2QA 4WESA 5M29A 4XPIB 4ND8A 1G21A 1M1YA 2AFHA 2O1EA 3PSHA 1N4DA 4HMOA 5BVHA 2RG7A 4MO9A 3K1AB 2PS9A 2XH8A 4PAGA 3BE6A 1KAEA 4MLZA 1MIOA 5GGYA 5GGXA 2M6LA 4TKVA 2YNMD 2XDQA 1M34B 4OVKA 5JG7A 2M6KA 3MD9A 1N2CB 2OV3A 3HH8A 1ESZA 1QGUB 4B8YA 5BVGB 3AESB 3UJPA 3ZK9A 2X4LA 5KOHB 4H59A 2PRSA 3PDIA 3CX3A 3BE5A 3AETA 1FP4B 2WI8A 5HX7A 4FNAA 5KOJA 1XVLA 3MFQA 4UDOA 4H0FA 2OSVA 2Q8PA 1QH8A 3HJTA 2R79A 3TLKA
chains in the Genus database with same CATH superfamily
1ODTC 3HFJA 4JT4A 1O87A 4ZCTA 4S0ZA 1OXXK 2VP9A 4Z9FA 3F5MA 3H5NA 3LT5A 5KTYA 2OB1A 2YXEA 1CUDA 2GZ2A 4HNAA 1IVNA 1DAFA 2EG5A 1SQGA 2FMKA 4R41A 4YRDA 3QSYA 1EXMA 1MRZA 4OU4A 4A5SA 5F9HA 2BFDA 2NT4A 4CDRA 3AM3A 2W71A 2G63A 3VR4H 4W5TA 3LC1O 3ED1A 4R7ZA 1IVYA 4L78A 2JGJA 3VJMA 4D8TA 4HB2A 1IY8A 2JNWA 3EZ6A 5ESXA 1CVLA 1TUBB 1RRKA 3IGFA 4JOSA 1Q3TA 1SUPA 3B9BA 4RPLA 1H2WA 1KZ7B 3FWYA 1H8EA 5F1KA 3E2MA 3WQSB 2HCRA 1JHYA 2BEKA 1SUAA 2V6IA 4Y9DA 1JVBA 1L2TA 5IVHA 2XAUA 3K4PA 5AKYA 5K8CA 2J4CA 1QHEA 3QE0A 3MTGA 3NU1A 5E0OA 1DG9A 4FKBA 3PFNA 5A0TA 1YFJA 4LMPA 1UMCB 3PQ8A 1J42A 3PQ7A 4MQFA 3LLUA 3JAKA 2G3YA 1Y8QA 4EY4A 3OQIA 1XRSB 2R751 3U4AA 2VDOB 3BVPA 3EGOA 3I9OA 3NTUA 3QPVA 4FFNA 1JXAA 3AC0A 1UBFA 1A04A 1IMJA 1PW7A 1I5EA 2DG2A 4LXHA 3G59A 5JH7B 3WSWA 4W8OA 1TTHA 2BCGY 3LDUA 1MT0A 1ZL0A 2B0JA 1LPMA 1LWOA 3D7RA 3H65A 1IHOA 3KHTA 4JVOA 3R7LA 4DANA 5JD6A 5KEIA 5LIRA 4A10A 3PDIB 4HAIA 1C9KA 3CLRD 2Z83A 3QLEA 4BCBA 1GV0A 2BBWA 3IVCA 3M6IA 2GH1A 1P6UA 3DOCA 3ZS9A 2ANBA 3FGZA 4D45A 5C51B 2XHEA 1JAYA 1D2GA 2HDWA 2Q5LA 4I6JA 4EVQA 4DE5A 2X76A 2WWVD 3TW6A 4UU7A 4NV0A 4U7TB 3FZNA 5JVDB 3C1AA 3W8NA 2GCNA 4C9BA 4NS1A 2XZTA 2C3PA 3NOOA 5TNXA 5FUYA 3ONVA 4UHDA 2Y1KA 3NHKA 1WTCA 2DQZA 3F5QA 3KE8A 4DQUA 4Q9JA 2JKYA 1X92A 3AOEA 1RQGA 3MJ4A 4UMEA 5EUCA 5FI1B 2ZJ3A 2W2MA 1RBMA 4ZEOA 3UC9A 2JFHA 4MV3A 4YMHA 1RI3A 5AW8A 1XTBA 2EDAA 2V6MA 4ZI7B 1RAEA 1FNSA 3ESAA 3SHVA 4JU9A 3SR4A 2W6OA 3CJTA 4TM7A 5JNRA 2UYHA 1M34E 3ELWA 5HIAA 3EVNA 2D5AA 4PWYA 3H2SA 1OXUA 3EGDB 5JNLA 4JOCA 3ELUA 4WADA 1NM5C 3IIIA 4G1BA 3VYRB 3U3DA 2GXAA 1WBJB 1UBTS 2GYWA 3ETJA 1B15A 1DAEA 1SIUA 2NZYA 4EFMA 4YRMA 4UDYX 3QW4B 4LHSA 2WBLC 3KXIA 4IGKA 3ZI0A 2W2LA 3E1GA 4D82A 5M7EA 4DUZB 2UZ3A 4HTFA 2NYRA 2C7QA 3EAQA 1NR7A 3DZCA 4DREA 4EZIA 1AK2A 3QUSA 3UJ3X 1TF2A 3G0IA 4BMYA 2RAUA 4IVPA 3K5WA 4CPDA 3FUXA 4WXEA 4XSVA 5K3AA 4RZQA 5EKTA 1XHFA 4OSPA 3A6GA 3ZDEA 5I3CA 4C2TA 3OZBA 4HDMA 1D7OA 1I9GA 1H9AA 2BSAA 2R1VB 4GX2A 4IIVA 1QVVA 2CCGA 3GZJA 2O06A 3T5DA 2WJAA 3V7FA 1X0VA 5CVCA 3P2EA 1YZQA 3SN6A 4J4BA 2HNBA 1BS2A 1BE6A 1GQOA 1V26A 3W34A 3MJHA 2PRYA 3HK2A 5UKDA 1AUPA 1NVDA 2HSZA 3BS4A 4II7A 3C4JA 2BGRA 4HS9A 2J9GA 1NSYA 1HFEL 2KYRA 1R6BX 2ASVA 1F5SA 1JEQA 3EFOA 4MDHA 4J16A 5AK6A 2Q29A 4P22A 4NABA 2L69A 3ADDA 5LZ4A 3PJDA 4AJEA 3HVUA 1BE0A 3KBBA 3NC1C 3OBBA 3AHGA 3PR2B 2I7CA 3SM9A 3WKAA 3JQGA 3ODGA 4Z7OB 6GPBA 1NIJA 5CRIA 3SG0A 3DVLA 3NG1A 4Q24A 1JQBA 3A3PA 2ZS7A 1XDZA 5A4JA 5KS2A 3RFUA 2YH2A 3CZ5A 2X0NA 1CFJA 1HL7A 2H4JA 3WMXA 4GOOD 4L3WA 3TBKA 3AR4A 1C7RA 5BUQA 1XK6A 5E8RA 1X77A 1S8FA 1Y34E 1U9CA 5F5NA 5I7WA 3VI3B 1KMHA 2PQ2A 3PJFA 2PKQO 2WR8A 2NTNA 4PSVA 3SF8A 4DJFC 5BVHB 1MX1A 3IXMA 3FRIA 3QXXA 4TTAA 1T24A 4FE4A 1XCGB 3WLSA 5E6UA 3AVVA 2COEA 3VR5D 2GPAA 1ZH2A 3Q8MA 2GPWA 3C0KA 4XH9B 1GQFA 4HLNA 4GFDA 3C6KA 1ZIPA 3SX4A 2BYTA 1DXOA 3BJMA 3DE4X 1RM5A 1RYDA 3VYSB 4OTZA 1BA3A 1FCJA 1Q1QA 2PFSA 4D56A 3E35A 1NAIA 1ECBA 2Z9DA 4I55A 5K1ZA 5BWBA 3ZZ0A 5FUVA 3VSCA 3CNBA 4R7TA 3MUOA 3I30X 5LMUB 3LUFA 4OQZA 3SZOA 4LG1A 1ZG3A 4DY4A 3PX2A 3UJBA 5JD3A 1Y3AA 2BHRA 3KKNA 3TIGA 1EFUA 3WXMA 4LF4B 2LKDA 1NI5A 3BRSA 3G2KA 1EFPB 4D96A 3EVCA 4EVIA 2OD9A 3VYTB 1M6VA 4BJ3A 3MGCA 4H6XA 3L4JA 3GA5A 1FP6A 1M7HA 1EDZA 2WTXA 2P4SA 5L3SB 1HT2E 3THXA 1FP1D 1M75A 1BQ3A 3DMRA 4PYKA 3C97A 1N0HA 4XYMA 4YJ2B 3DL7A 1B16A 1T3SA 2FUKA 3BWVA 2G0AA 5HX7A 3IQZA 4UREA 3RYHB 3TL3A 2P9EA 3OEWA 1GRCA 2A14A 4CLEA 1VJTA 2WF9A 3SLRA 1B3RA 2OEPA 2WM8A 4P53A 5KWJA 1SG0A 4TZ0A 3ZXYA 4CCYA 2ZM5A 2Z8ZA 1SD2A 2BDTA 3ZX4A 1FSPA 4YRTA 1EFPA 1ZIOA 2E89A 4CL8A 1XTUA 3EDQA 2ZE6A 5AKJA 4M0EA 3ACBA 1D1PA 2XA9A 4GR9A 4MA5A 4PYNA 4CFSA 5EP3A 4M8KA 5L3SA 4AK9A 4KNYA 1NRJB 5HZMA 4P9NA 1N6PA 1JZSA 1E3WB 4Z1MA 1Z7GA 4BB6A 1IUOA 3M9WA 4K3VA 1SZCA 1ADJA 1TFRA 2VXOA 4RHUA 4XYEA 2YTZA 4HGZA 3TKYA 3B3FA 4KRXA 4GSKA 2Q2VA 2AEJA 3NLLA 5AR1A 3RJTA 4F4DA 3GLFE 1KAOA 3EQ9A 4I14A 4DCUA 2XITA 4B9AA 4D6PA 4IRMA 3T7JA 2G76A 1A9ZA 1XTQA 4CKWB 1QO0A 1WABA 3EIWA 3SR0A 2Q3DA 4BNDB 2X6RA 3ILYA 4G26A 1HZZC 4DCTA 2VHUA 2WZQA 3RAEC 3JYHA 2WTMA 4C7OB 4ZO4A 1SD1A 3CT6A 3GJ0A 5HVNA 2XIQA 4INAA 4ZQIA 3IE2A 5KWVA 2MR6A 3H04A 3G9TA 4PFKA 3B1JA 3LHSA 2KS6A 4AWAA 1IUPA 1U2EA 3FOCA 3WDSA 2BT4A 4IV5A 4JUBA 4ARIA 3RYIA 3OI7A 4TXMA 4UBNA 3SKYA 4QYTA 4N76A 2Q2WA 1E7SA 3IOYA 2VTEA 4R2WA 4CF4A 1ECCA 1HDXA 1MF7A 2BHTA 2JLCA 2IP2A 1BYUA 4FFSA 1FDUA 4LQDA 4WOCA 3SJBA 4C0HA 3ZBPA 1W2WB 3T3EA 3X1YA 1E3JA 4MMYB 4IVRA 4O2BF 3FPGA 4QOJA 4MJ7A 4OLJA 3EHDA 5AKXA 2H4WA 2W11A 5DGTA 1YDMA 2IXAA 5IUNC 1QS0B 4MAAA 2P7IA 2WHRA 3IMCA 2WT4A 2X1LA 2ID7A 4ZVNA 2GGSA 1GRNA 2ZJ5A 1MV5A 1WU8A 3OZ7A 2VYFA 2BFPA 3IPAA 4DBLC 1PDVA 2Z5GA 3FKSA 4TVSA 1O54A 1NC1A 1YD7A 3KAKA 3ZGVA 4TLDA 3MJDA 2IKSA 4RIEA 1DQRA 4NBRA 4BRSA 1CHNA 3T3GA 3MXOA 3OOSA 5E7IA 3CWCA 2EX0A 3INGA 3JAMA 1ORWA 5AJYA 3RK0A 2ZE8A 3HBAA 1CLUA 3KTAA 3TE7A 2BTQA 3PC6A 3KDPA 4DCJA 2O8NA 2H5JA 4KWCA 2IV7A 3F90A 2DKOA 2VHCA 3K8QA 4M0PA 4MVXA 4PC3A 3RNOA 5JV5A 5JFTA 3ZW7A 3GLGE 5JQWA 4MO9A 1LQTA 2CNNA 4U7HA 2QG6A 1JKMA 2ADOA 4I46A 5J2UF 4GKAA 2JJMA 3NQ41 1DO0A 3PKIA 2ECPA 3L9XA 4J94A 2DR3A 2YXBA 4BO4A 1YZUA 3WIDA 5E6RA 1OFTA 1ZNQO 2CNWA 2IDMA 1NJ5A 3FSRA 5HSGA 1K6XA 4UHKA 1T8SA 2YICA 3RKSA 2UZ0A 3ZZMA 2MSEB 4EHHA 1UAAA 2EX4A 2B61A 2XDWA 2ZVPX 1ZRSA 5E1OA 4AC9A 2CWDA 2Y1GA 3HABA 1FQOA 2EJUA 3DDOA 5JO9A 1YQ9A 1X3LA 1MNAA 1TVKA 3CFYA 3M70A 1YB7A 4GWLA 2QYHA 2WLSA 4WN9A 4EKNB 2EF0A 4ZI2A 5HK8A 4ZU6X 4ZZ3A 5MGNA 5K4AA 4QDKA 2IOYA 2EZ4A 5JJLA 1E1NA 1DZIA 1FRZA 1Q91A 2BH9A 3N3AC 1QAQA 4I4IA 4Q03A 5DU2A 2WMNB 3FMVA 4JJ4A 5TEVA 2QU7A 3QUQA 3V7NA 4RLHA 4IIYA 4UKDA 1DNPA 4OJYA 3EDYA 5J4YA 2FZCA 4G8CA 1FA9A 4IOMA 3GQBB 4MI6A 3ZU3A 4ABTA 2A0YA 5CX1A 3QHAA 1SC6A 2Y0DA 5CFZA 1YH3A 2Y67A 2QTMA 4G5HA 1WB9A 4YMTA 3LP8A 2F1RA 2YQZA 3ZE8A 2VUHB 5JJCA 1Z0DA 5HS4A 3PIDA 1I1HA 2AVDA 3FY4A 4KYIB 2VNJA 3D3WA 1QIGA 2NO5A 3WY9A 2B35A 2VHQA 4CL3A 3FW1A 4FN5A 1NBIA 3EVZA 4AYXA 4CKCB 1FFCA 2KE5A 3AG5A 4PQYA 4QULA 1H23A 4O2AF 4E31A 1W36C 1P4HA 3I2FA 1BN7A 3KC2A 1HEUA 1L4MA 2C2MA 5D1HA 4RQBA 3PNSA 4XSHA 1CIJA 1FBNA 2REBA 4UBLA 3TKLA 3OIYA 1AKRA 4L75A 1QOQB 1SHKA 5BSTA 3UMCA 1UZMA 5IZ4A 2CFIA 1PZFA 4HN4B 2WE7A 4XR4A 2R2GA 3DUWA 3HCDA 3RC3A 1Z33A 4K0RA 2HOQA 4J1NA 2X58A 5KNBD 4D0NA 1NJSA 1XU9A 3E61A 1SQ5A 4NYMR 1OXTA 2UUOA 2ZDHA 2X86A 3IP5A 1V9CA 1YBHA 1ETHA 1KO4A 2ZXFA 5LB4A 1S6YA 4BO2A 3QG1A 4MR8A 4U9UA 4K9RA 2V4MA 1EQ2A 3PYXA 5B6JA 3PEWA 1TZCA 2ZSIA 4NYJR 3TG2A 1XP8A 1ZJYA 1KZ9A 4B3IA 2QN6A 1W8DA 1QCCA 5EJGA 1FTGA 3IDZA 1JDTA 1V8OA 1JDSA 3NCHA 1G0OA 3NXKA 1MAHA 1WEKA 3BZUA 4QJ5A 2ZJAA 3NGMA 3CQ9A 3THSA 4LF6B 1UJ4A 2JHPA 2JLAA 3NMUF 1TJ5A 3VDNB 4KO2S 2C5LA 1U3VA 2VZ0A 4U9HS 3WLQA 3ZDXB 1KF0A 3HBJA 3KVVA 2HSJA 3GFGA 1CS0B 3QOFA 4M1QA 4D43A 1NJ8A 3OD1A 1C3XA 2QPLA 2WKPA 1L4EA 4GI5A 2RI1A 1V47A 3LO5A 4RY2A 1JH8A 2ACEA 2O3QA 2R8ZA 3WNDA 3X1ZA 3SVLA 1W93A 1OZGA 4OYYA 4PC6A 5HHTA 5KINB 3DMNA 2O14A 2GEUA 3FZEA 3JSXA 4F21A 1X7ZB 1XP5A 1FPQA 4FBLA 2IS4A 1JXMA 3EGEA 4ZOLA 4ZZ1A 5A04A 3ZHZA 3Q40A 1A2QA 1DKNA 2VQSA 2IYZA 1BXKA 2R8EA 2VPQA 3I04A 2F3QA 3NHLA 2VT2A 1QQ6A 4MQEB 3U48A 1SIOA 5D5HA 2HT1A 5EC8A 3PR3A 2AZXA 4XLTA 4KAJA 4ZD6A 5ELLA 4DV3B 4MJLA 4PXSA 3L0DA 2PO7A 5MGBA 3HL0A 1NBOA 3JQPA 3S5UA 3PB3A 3TAXA 3GLGA 3ROMA 3HSSA 1V7QA 3GJRA 2JI4A 3K73O 3OPQA 3F8TA 4IJ6A 3COZA 4ER7A 1KL7A 1PS0A 1UDAA 3WLOA 4ESHA 1R5JA 2D7JA 1D0SA 5JJ5A 2PXCA 1QM5A 5JLJA 5AT1A 4GG1A 4RM3A 2ZWVA 3TZEA 5JCXA 2P1DA 4WW0A 4B3SB 2BOVA 3M4XA 1KP2A 2C2BA 4CFZA 4WBSA 3VTFA 1RKXA 2QAJA 1X74A 2EW2A 1NKTA 2WLTA 1AKUA 5DCWA 5AHOA 1R0CA 2IZOA 4G41A 3VKFA 1YRBA 3TRIA 1IY2A 4AWBA 5HPYB 3BD9A 3L1HA 2OCIA 2JFBA 1M2GA 2HJVA 2JH3A 2QAGB 2UKDA 1MG5A 3KLOA 1WUYA 4NBUA 1GOTA 4DPMA 4QVKA 3UV3A 2FFJA 2X22A 2VA8A 2NUTB 4XVCA 1XZPA 1OH5A 1H2AS 1M66A 1B3BA 3IUJA 4YGYA 4BQEA 3VDMA 3DVQX 3MWYW 2VAXA 2Z0MA 3EW7A 5HW0A 5JFOA 2ZSEA 4UU8A 3DOUA 1BXGA 4A0RA 3L6RA 4IDEA 2I6GA 2BJHA 3KQOA 3STYA 4BMNA 1PU2A 1SC3A 1NUSA 3G0GA 5ALXA 4DJ5X 4B5LA 4F6RA 4BFYA 1EZ1A 3KJNA 1TJ4A 3GEGA 3HBMA 2W70A 3WIUA 3LDHA 3FSJX 1PNOA 3J7AC 1FDIA 5SZHB 3OLVA 2F64A 1I1QB 5LQJA 3JZFA 4J9VA 1A3CA 5EUBA 1J1ZA 4P4TA 4E3ZA 1RRCA 3KD3A 3JQAD 1H65A 1E6CA 4PHGA 4C7VA 2X5OA 4AO7A 4HLCA 2YJTD 5AOBA 3E0QA 5K4HA 2B5VA 4RZSA 1JWAB 4R1LA 2YWBA 3GFBA 3WGJA 1VTKA 4J2OA 3D6FA 3JQ9C 4FGZA 3UCEA 4IIEA 3ESBA 1ZA2A 5FULA 2HU5A 4TUYA 4Q82A 3WKDA 4YT4A 1BHO1 2ODQA 2JEZA 1TKRA 2O6HA 2BI7A 4IMRA 4JR0A 1N6NA 3P0JA 1EA7A 4FFBA 5IC4A 1RACA 4KHZA 3QU4A 2BP7B 1V7PC 2VIIA 1GA1A 4L0DA 4PXAA 3GEDA 4EABA 1QRUA 1C50A 1SY7A 1IU9A 2NSYA 3LYHA 3PYLA 5BR7A 3BZBA 3PRJA 1XZNA 3JYOA 4FE7A 3VH4A 3HLKA 3JQRA 4F96A 2V7UA 3R7AA 1OXMA 4QBHA 1UK6A 1XG5A 1C0LA 1V39A 2W6IA 5BN3A 1AV7A 1U2PA 2DUWA 3LQRA 3QBEA 1QLWA 1SHJA 1GZ4A 3DTTA 3RJZA 2XT6A 3DVSX 4QL3A 1GCAA 1L7QA 3VHQA 1IZYA 1OZFA 2HWYA 4CLOB 1OB2A 2H31A 1ZIYA 3JQ9A 3AVXA 1BWQA 4FFBB 1YAJA 2EAUA 4N0EA 1CNFA 2DYKA 4FZ3A 4MUAA 5JSYA 4HDQB 2IBSA 1NUQA 4MGKR 3BX1A 4H7PA 4B4OA 4YT5A 1GPMA 1D7AA 3DEKA 3UK6A 2XMDA 4QEZA 1KEEB 3UZUA 2FEAA 4R9RA 3L8EA 5BWMA 2VYVD 3C8DA 4RX1A 4P35A 2IHVA 3RVRA 3ZK9A 4C03A 2AKAB 1V43A 4L57A 1CBUA 1AQLA 4BWYA 3GJ6A 1MRNA 3ZHXA 1E9RA 4TZTA 4UPDA 2VI5A 3RUHA 4KO4S 4AS3A 3UAOA 1Z12A 5EG5A 5JPCA 3EPJA 5EINA 4N5HX 2V4UA 3JQDA 1JG7A 2CE2X 3IEPA 2WUDA 4S04A 5HJ5A 3VNVA 2Z6UA 2C3YA 1ZVVA 5F77A 2FMIA 1UBCA 5E9WA 4WNCA 2QZZA 5EERA 2E1PA 2YXPX 3HXKA 4CETA 4OXKA 1Z07A 4YRIA 1T1JA 1Y42X 2P67A 3OESA 3QU2A 4NMXB 2WKWA 1Z8NA 1V3QE 3VX4A 5HEKA 4HQ6A 1OV4A 2QTFA 5EZYB 1USUA 1P4SA 3HNPA 2BUAA 3FYUB 1PR3A 2VKTA 1T0IA 1ODFA 1QIDA 4GD3Q 3BCUA 1UIRA 3L02A 5LNK6 2QM7A 3GLHB 2CJXA 4TVOA 5E1DA 4DR3B 1M6EX 2ID9A 4JXJA 2GM9A 4M7WA 1CTQA 4ZOLF 2C9ZA 2Q7OE 3OQBA 1I10A 4RGVA 1AVTA 2I4RA 4YAFA 1ESCA 4N4AA 1P0PA 1ULTA 2K2QB 3DDUA 5LA6B 4NZOA 4NU5A 3WWYA 3K0FB 4E5YA 1YS2X 5KSPA 4ARAA 4X7PA 2GEDA 1U11A 2G08A 2R5WA 3BJIC 1DINA 5KBYA 3S8EA 3SZRA 2FPKA 2FQQA 1NLFA 4OX9Y 2O2ZA 4ALJA 1POXA 2QJFA 4S1WA 3NJ4A 1QK5A 2HLNA 2NZJA 3IMKA 3LX4A 4MQ5A 2A1UB 4BO8A 1M2VB 5HR5A 1YZ3A 1UP4A 4IQFA 3MSXA 2IELA 4LYAA 4DCCA 2L19A 1DOAA 5JAQA 2JAWA 2NXNA 4RVHA 4KPEC 2D59A 1KYTA 2IJGX 2PHZA 3E22A 4H7EA 1HDYA 1ZINA 3OWOA 5BQFA 4F71A 2VK4A 3BMCA 7YASA 5K7SA 4CEJB 1T0UA 1P5RA 4AKIA 2R7KA 4X8MA 5JCOC 1LI7A 1L1EA 3F9RA 3T3DA 4DC1A 5JYBA 3K1YA 2R6HA 5DN9A 1GEEA 1C14A 3BD8A 1VB3A 4HPJB 4QREA 3R7WA 3ROZA 2Y2UA 3B13B 1IDN1 1WXDA 2WD9A 1T36B 2Z5LA 3ESXA 4RA6B 4XEHA 1U2DC 2QR3A 2V4ZA 3OPMA 4Q9HA 2WJ6A 2AA3A 3WKEA 4HAOA 4HXEB 2MYNA 5EUMA 5DSXA 2EWWA 4BEWA 3F6SA 1PIWA 3VHLB 4AB1A 2VXYA 3QFRA 4OMDA 4D4IA 4POOA 2QNBA 1P0QA 1SVWA 4DHEA 3FPHA 3C85A 3Q72A 4J8PA 2HK6A 4LYEA 4RQUA 4ENPA 2ZRHA 3PDWA 4H16A 4LMBA 5KCMA 3BD7A 5IASA 5I7VA 5CDYA 3EXHB 4BBZA 2C9MA 3ZU5A 1VBMA 1UKAA 4C43A 2PEYA 4DW8A 1A72A 4H0CA 3WL8A 4BTVA 2YNMD 1WXEA 1P44A 2JBAA 4MV5A 1LPNA 4RACA 3S5JA 2PR2A 3O3MB 4HBGA 1KPHA 5H83A 4CEIA 1RAGA 4YJ2F 2R47A 2WUVA 3L84A 1ESEA 5B36A 1RSZA 3K6JA 4M55A 1FTYA 4A3SA 1RM0A 1GZ6A 2PGXA 3G8DA 3LUAA 3PCRB 1C2TA 4I66A 2BUCA 4AUNA 4KQFA 3WFIA 2H1HA 1G4AE 1YB2A 4WCFA 3K0CA 1KP3A 2X0DA 4MJ3A 1ZK1A 3EHEA 3WFZA 1KMQA 4F04A 4FXPA 1FP2A 1U2TA 4ZDIA 1TNDA 1M1YB 2IPLA 3AV0B 2GN9A 2XKJE 3HRIA 3PJEA 4PYRA 4Z0PA 3DKIA 5SYNA 1JIQA 1V16A 2HRQA 4MV7A 1CF9A 1TE2A 1F0YA 2AD1A 1UKBA 3N2YA 4G23A 4CMBA 4CEIB 3FZYA 5IVPA 4LNUB 1I01A 1NZDA 5HA5A 3FA2A 2P78A 3UNXA 1AC5A 1GU0A 3EQ2A 1A8HA 2QW0X 3WLMA 3Q4GA 3UGTA 4DDUA 1G5PA 1N2EA 4KV9A 3I2JA 4HQFA 1ZCBA 3P96A 4L51A 4QJBA 2QN1A 4RO0A 1QIKA 4KOEC 1X7HA 1VMKA 4Y9TA 2VTKA 3CINA 4J49A 4BDSA 1NVXQ 5JDCA 3P27A 4LRUA 3ZQUA 1LGYA 4ZAGA 4K9DA 4WNAB 4JXKA 2GZHA 4NNJA 1ZVJA 2OXCA 3OJ0A 5ARBA 5FT9A 4M1OA 2C2KA 2IC5A 4S0XA 3WWZA 1ZOSA 1OBHA 3QWHA 4PGGA 3QXJA 2IYNA 3ZXUB 2XB6A 1SRRA 1LD3A 1PGOA 1Z5WA 1ZD1A 1O0CA 1X7XB 2RBKA 1B6TA 3L6OO 5TARA 1JB1A 2C58A 4TLCA 5K0SA 5G1PA 4K03A 3FHLA 1R8XA 1H1DA 1OX4B 1L4GA 2JFVA 1E5TA 2Y92A 3GK3A 2F3UA 2JJ8A 4IF4A 2ZYTX 1GPWB 2INGX 1NLMA 1SUDA 3ZWXA 2IVFA 1E59A 4DIBA 1PF7E 1N5OX 1NP7A 4L95C 5JR3A 1R0XA 1G0NA 1WV1A 4TKZA 5PGMA 2QL7A 4UM7A 5T4EA 3ISJA 4BNMA 5EIOA 5IJ0A 5AYVA 2EP8A 3NYWA 2D0PB 4RLFA 2Q3CA 1L7MA 1P74A 3BAFA 4J7AA 1T5IA 2OLJA 1QRRA 1AGNA 3QFFA 4EDFA 2CL6X 2QRLA 1KBOA 1ZQ1A 3UICA 3FR7A 4U4AA 2J5KA 4D3YA 3P0HA 4EBFA 4AJIA 4CMJA 2YZKA 1TAUA 1OU0A 1ESDA 1WXWA 2H48A 1I4LD 3T4EA 3ZE9A 4CKBA 5B1HA 4PAOA 4P7GA 1TUGA 2X40A 4YN3A 3VC3A 3U3KA 1ZRNA 1RBYA 4IXWA 1G8FA 3RAGA 1LV7A 1RJ9A 4KZKA 2GD6A 5FWDA 5K3BA 5LA6A 2JC3A 1OXVA 1MGOA 3V1LA 6LDHA 3EN0A 3V42A 1IATA 3PD1A 4UTNA 2M32A 1FVXA 3G1UA 3WSTA 5EKSA 5C81A 1DI0A 2TS1A 2XUJA 1HYHA 4QXOA 1KMMA 2AN1A 3OEYA 2V7GA 3DZFA 1P5ZB 4JUDX 4K40A 3I2YX 4X6LA 1B6SA 1AKYA 3C70A 3AKCA 3WP0A 3ZHTA 1U8FO 3WDLA 1RYMA 1Z5VA 3FF4A 3NYRA 1B2RA 2CSXA 4E5KA 1E62A 4X85A 1W25A 3OT5A 1SWWA 1JWLA 5FPQA 3W2FA 3M2PA 3EFBA 2I91A 4TRMA 2KLHA 1ZXLA 2MWMA 5K3SA 4E7PA 4KGDA 2M6KA 1Q83A 4A0FA 2QG4A 4PZ9A 4FXOA 1LV8A 2C20A 3HXLA 1HQYE 2VDVE 1M8PA 4IIXA 4IJKA 4QYSA 1C3JA 4JLNA 3ZHCA 1OBFO 2K7FA 3F7NA 3BZWA 3N0WA 3HDQA 1XCPA 4JNKA 4O33A 3FJYA 5B57C 2DUJA 2J7KA 1KOJA 4AJPA 3ZHVA 2CVFA 4BRZA 1IJBA 1EWRA 1WY5A 2F90A 3KXKA 3ZXXA 1M1UA 2E4ZA 4KXFB 3LBHA 2JH8A 4NR0A 5L6MB 2R8OA 3GJYA 2GCOA 4CIDA 2JEOA 4KLRA 2CHEA 4XYBA 1JEEA 1XHLA 3KOOA 4QYXA 4JI3B 3QLVA 3NEPX 5ISMA 2A8YA 1L4FA 2ZBFA 4CGZA 4Q5IA 2FZKA 4F2GA 1F1BA 3UWOA 1LBSA 4M1KA 2VSXA 5IK2D 2ZK7A 2O20A 1DELA 1YVDA 2J33A 3AXTA 2R8YA 3L0OA 4G0NA 2PMCA 4PLZA 1ZJJA 8MHTA 4JBNA 4LISA 2HIMA 5AVTA 2P1RA 4B2IA 2D7DA 2QD4A 2ORVA 5BRNA 3ZCTA 4OIMA 1W0JA 4L4YA 2C5BA 4IFTA 2P4QA 4DSTA 2Z4SA 1X9HA 1YA8A 3FWZA 3HO1A 1DMRA 4J0CA 3PG5A 4RQTA 4DSNA 2X6QA 4IS2A 4LC0A 1Q95A 5LLDA 5A06A 2XYVA 4KXUA 5E7QA 4AF7A 4YXWD 4ZKDA 5CYPA 1E3MA 1K4YA 4O2AB 3TDKA 4FPXA 4KXMA 3TB6A 4B1FA 3BSSA 4L9AA 1Y9AA 4QQRA 1BWPA 1JL3A 3G5TA 1ZW6A 3LRTA 4WK4B 4YB8A 2MOKA 2JIDA 3N9IA 1WDMA 1A9SA 4IXNA 3ZBUA 4N3AA 1SXJD 1TM3E 2D5CA 2ODTX 4LCEA 4RCVA 4UJ5A 4M0MA 1Z9BA 5IAGA 3VR6D 1B8UA 1LJUA 3NI2A 1JLHA 1PJQA 1YDFA 1N3YA 1XL1A 2PXHA 2ZTMA 2ZXEA 2VOEA 4OK5A 4GGPA 3K9FC 1W0CA 1KGDA 1THTA 2V0CA 4JC0A 1VIMA 5I7SA 1KERA 1Z2CA 1PE0A 3F3SA 1Y81A 4DBZA 4PS1A 3T7EA 1QP7A 1XRMA 4U0JA 1OJ7A 1VPWA 2CNKA 3OJCA 1FSFA 4DV1B 1CLEA 1R00A 4WNAA 3UJNA 3RU2A 1QORA 1SUFA 2J9YB 5K03A 1SOWA 4CCSA 1PJCA 2E49A 5HQ3A 2CUNA 5T7BA 2M98A 1N2CA 4OHKA 3KOYA 5FAXA 3NONA 1UCFA 3A4IA 4JL5A 4L5CA 4DMFA 4AN0A 3SHQA 1NJGA 1UF9A 3CC8A 1NW7A 2UDPA 1NJ1A 2GCIA 3KQWA 5CDTA 2NUAB 3PWZA 4D9GA 1OX5A 5FOVA 3OX1A 2Q50A 3S1AA 4D9BA 2C92A 3JWPA 2J5RA 3PXXA 3IQGX 2E9SA 1J0CA 2NU8B 1W36D 3W5BA 1J23A 3C5CA 1XV5A 4NYIQ 1VI5A 5BSEA 4C4OA 1I4DD 2GR9A 2VS1A 2RAVA 3GEMA 3LCVB 3QVOA 4JLUA 1L0BA 4JP8A 3F0TA 2WDPA 4ZVQA 1O94D 1U8CB 2BMEA 4AZ3B 2A1TR 2OCAA 3WZLA 4DMCA 5KJ6A 3MBOA 4DNXA 1D1SA 4YRRA 4UBMA 3SS9X 3B1FA 3QA9A 5CDFA 3LUJA 3N5KA 4AJHA 2OCPA 4B8YA 4ALMA 2VHXA 3AESB 1OYVA 1Z8DA 3DZHA 5ALDA 4ARUA 1U6IA 2IYVA 3WGUA 3TQOA 3SHWA 4NS4A 1CF4A 4RA9A 5TT0A 4ZVSA 3KSRA 3ZLBA 4YRLA 3IEMA 2OKCA 2V7QA 1WZUA 4N6NA 4OQFA 2ES4A 4RVNA 3ZBQA 5ALYA 1EXDA 4HWPA 4FEAA 1OLUB 3JX9A 3S7ZA 3PQ3A 2FPXA 4GPIB 4K9QA 4TPKA 1VA5A 4MW5A 2DR2A 1JJAA 1KZYC 2P5TB 3AO0B 3IUNA 3HVJA 4CW7A 1QZZA 5B3LA 1J56A 1NW6A 2GZDA 4TYPA 3ZEAA 3U6BA 3MYRA 1VE1A 3I32A 5LQNA 1DAOA 4KPYA 1U4SA 1GITA 2I3GA 3DYIA 1E9SA 4TS1A 1DWUA 3ER6A 4KUGA 3THWB 1QPBA 4HXYA 2GN1A 2AIRA 3S68A 1RIFA 2D2XA 2W00A 1U7OA 1YUMA 1LDNA 3CRZA 4P08A 5G4KA 4CM9A 2O5EA 3IVMA 1F2UB 1D04A 2R97A 3E9RA 3RTGA 3W5VA 4ZCQA 4EI7A 2RD2A 1JZTA 3PFGA 4BB5A 1K08A 5NLLA 1GZ7A 2EARA 4WKBA 3HJGA 3U56A 3CU5A 3UOWA 1E9BA 1KO7A 1DTWB 1EVIA 4MUNA 4KWTA 2YW9A 4BC0A 1M1NA 3OLCX 4YX9A 1GN8A 5F1OA 2Q0QA 4KR7A 5K0GA 4GUDA 2UUBB 3S0JA 1JHMA 3BWDD 1XPUA 2ZJ6A 1DQYA 2FFRA 5DTJA 1N8NA 2GCOB 1MG0A 4DDMA 5CT5A 5KYUA 1PBTA 1GARA 1IEQA 2RBGA 2CHUA 3LGSA 3LM8A 3RS7A 3OQMA 2IOFK 3L77A 2OXTA 5KYWB 4PBSA 4DQLA 2J59A 1W1UA 1MHPA 1GZHB 2NTVA 4FYIA 5GJVC 1J5EB 4M1TA 4OJNA 2SECE 4WKNA 4D9FA 2K2WA 4YV0A 2QD2A 2RKBA 1J8MF 3EUWA 2CV2A 4MGEA 1SBCA 1IWPB 1G5IA 1QRDA 3ND8A 5H0IA 5GTDA 4XWWA 4NJEA 4F7DA 4NFLA 1A2BA 2EJTA 1CDDA 3LIPA 4U7PB 2FUG1 5CYFA 3IUMA 3EXIB 4FOSA 1GHTA 3F67A 2ZYHA 3MWDB 4P4NA 1KYZA 4HEHA 4MUGA 2I2FA 5GONA 4YRAA 1M2OB 2OBYA 3TTUA 2FX3A 4F2PA 4MV6A 4PX3A 3DMFA 4Q3NA 4BQPA 1U90A 1XWIA 3ESZA 3O73A 4MWTA 4F5YA 4W9NC 1V5IA 2YJZA 2KI5A 4FN4A 1EFRA 2DT8A 4Q9LA 1RQ2A 2R68A 3IEUA 5IXYA 4Z9XA 4KIJA 1U7PA 4CBVA 4GLFA 1BC5A 2PX2A 3PTLA 3ZBTA 3LH5A 4CUZA 4CLRA 2GKGA 3LKBA 3SR3A 2ZSUA 1GPKA 2OV4A 3AF3A 2NZWA 2ZSDA 5EGNA 2PUHA 3A9VA 4B32A 4HFJA 2V3CC 1ADCA 3QKWA 4GMFA 1WB4A 3INRA 1S02A 1WF6A 4PTLA 1VMEA 4V0LA 3RHSA 1P3Y1 1HT0A 3L7OA 4E70A 2ZITA 1BGWA 3DHEA 2VDKB 4J76A 1ZMRA 5I9LA 2OBXA 1NN5A 1AUOA 3DE0X 2HA6A 4I9NA 2D5BA 3D5QA 1T5BA 1EBBA 2CBGA 4AZ0B 3H9CA 3PT9A 4E5VA 4FE3A 3FFXA 1G66A 1BCRB 3F2IA 3TTVA 5LFAA 5KTMA 3HFGA 5JAIA 1L4UA 1ADGA 1HG0A 2PWBA 4JT9A 4D79A 5J1TB 4Y1RA 1FMFA 2C84A 3MFYA 4G0ZA 2X7JA 5EE3A 3TF5A 1VPDA 2I3AA 5H3LA 1B0UA 2J1LA 4BFZA 5EWJB 2H1WA 4Z3KA 1M0SA 4DIEA 3LLVA 3RSCA 2WD7B 5MFZA 4FZVA 3FGNA 3FUTA 1UKYA 1GUBA 4K46A 3GGDA 5E6RB 3TL2A 1DG1G 3LQ2A 2VH2A 2J5BA 2IYLD 5K45A 1VPEA 4RE6A 3LOUA 1GA6A 3DT9A 2P30A 4MRMA 4Y0VA 5IEJA 1C1HA 2AC4A 1CUIA 1O94A 3CX6A 2BEVB 3PUXA 4IJMA 3QIAA 2X3YA 2LIVA 4BGVA 4DDTA 1CR0A 3ZR4B 1IYZA 4UBOA 4EF5A 2QVZX 4FNMA 3OQJA 1Z2OX 2QAIA 1QZUA 4ZAVA 1Q0LA 4A8PA 1OT5A 2R4TA 2VF2A 5F73A 4UAVA 2QLBA 3R0VA 4XLZA 4B73A 5EJ5A 5CJ2A 4D2IA 4CR8A 5FTLA 5F35A 4MEBA 4KYVA 4V0ME 1ZA1A 1V95A 1PEDA 1MXHA 3F9IA 2VR1A 1FTQA 2OM2A 3KYDA 4JBXA 2JATA 4LJYA 3GRUA 4DF3A 1JJ7A 1DEHA 4N01A 1J24A 1WUTA 4KQXA 1L7RA 2EFJA 2AQKA 2J3QA 5AOVA 4IP0A 4DCMA 4DKXA 4J90A 4C6HA 2XRZA 3AJEA 3JVIA 3R1IA 2JHCA 1PGNA 2D4AA 4UU1A 3TN7A 5BMVA 2OQIA 1J20A 2P35A 1H2BA 1RHUA 1YZVA 1WPGA 3I76A 4WDRA 3P26A 5ICGA 3NTQA 3EIQA 3E0XA 4ZQEA 1VB5A 5BXQC 5C8VA 4XWGA 2FG5A 1SCKA 1UM9B 2RGBA 5EN4A 1XMQB 2Y1XA 3LUPA 5IU6A 2FRDA 1YB6A 1M1NB 2W37A 2O2GA 3BK1A 5D3MA 3FFTA 3O93A 4GS5A 3A11A 2N3ZA 1TUEA 5KHOC 2YWCA 4RD0A 2IQ5A 1ND6A 4I1YA 4RVSA 3ETHA 4R54A 4DMGA 4UD2A 1S7GA 1RPZA 1N2JA 3CPJB 4ZQGA 1KOLA 5HIMA 4QYIA 2I3BA 4EHDA 5LLTA 2WW8A 3S2SA 4DFDA 1ZCZA 2JJ2A 3H83A 5KYWA 1F12A 1P1RA 1X94A 2D5IA 2WU1A 1E2DA 1M6HA 1J1UA 1LF0A 4HRVA 4Q4JB 3TNLA 2D3TA 1BVYF 3PA8A 1CY2A 5KUTA 1GWNA 4CUKA 3BSWA 4KDCA 5EIEA 1EGAA 1YSCA 1FUEA 1S89A 5IT0A 3QNUA 1ISRA 1AMOA 4NYJQ 5CNMA 1C7IA 1FNNA 3W3ZB 1A8UA 1G18A 2ZWAA 5TQ2B 2O48X 1UPBA 1VL0A 2C42A 2Q49A 3BTVA 1FEZA 4CM4A 2FKNA 5KC9A 3MBIA 3KHUA 5GONB 4NZPA 2J6CA 4ZCLA 3X43A 3S1SA 3GCGA 5CVEA 3RVJA 4L8LA 5BN1A 5HKKD 2WG1A 2XYGA 3E7PA 1A4RA 3QU9A 2IHJA 2WU8A 2WA1A 1AHIA 1T4BA 2PT9A 2Q9UA 2Y3IA 4YNBA 5TQJA 3VJKA 2ZJYA 1SIBE 3K72B 4HYTA 3SF0A 1DDIA 2ZWIA 2Q3BA 4Q9NA 4TWAA 2D2IA 5HFJA 2JIRA 3S2GA 1PGJA 5EHNA 3EY4A 5TC4A 3UTCA 1FQKA 4LRTB 5I4BA 4LY9A 5IKMA 3U37A 2RH9B 3CLTD 4IDHA 4CG0A 4MVJH 4O1MA 4J0FA 1K8QA 1MC5A 1XYYA 3ON5A 5EJIA 2YDYA 4HB0A 5BW6B 1VG8A 1FSSA 1JQEA 3FTEA 221PA 3KU4A 4RM2A 5AKZA 1OROA 3HN7A 1ORTA 4E88A 1KJ9A 4Q48A 5SZKB 3TR6A 4LF8B 4EYOA 2OZKA 1K7SN 4ALNA 3U16A 1L9XA 3NWEA 2IPAB 1GPH1 2WAYA 1NZFA 5L3RA 1P7YA 1E7MA 2Q46A 3UB2A 1FZTA 4F2WA 1UPFA 3O1HB 3DA8A 3QKTA 4RD3A 3G9UA 3UKDA 1Y4AE 1NX9A 3E5HA 5LR6A 2PKEA 1FP4A 3LCCA 1V8ZA 1MIHA 2JGKA 2NUPA 1BYIA 3F49S 5EVJA 4ERXA 3ZVNA 1F4PA 1KSFX 1E1LA 3R0IA 5CT8A 2BVNA 4PIVA 4XEUA 2V0NA 4FYKA 1NNLA 1GAJA 1X1RA 2WD7A 4RESA 5F3DA 4IGFA 4BP1A 2C5SA 3PC3A 5ALTA 4N65A 1G20A 3SQOA 2HDOA 3NT5A 2FR1A 2OXRA 2BFNA 3NHZA 1WMSA 5K0CA 4RPGA 3DMYA 4OXRA 3HU5A 1JFFB 5EHXA 1KRXA 2VPYA 2APJA 1GR1A 3NHBA 3ROEA 1Z0UA 2FFQA 4IUYA 1LVHA 1ZC4A 1QGED 2YZNA 2C77A 2CUTA 3LE8A 2CF5A 1SUCA 1VMIA 1VOTA 2WQZA 4FHFA 1JLLA 1E61A 4OHXA 1IAVA 4M60A 1WHTB 3AWIA 1B4DA 2D3WA 3CNHA 3RBVA 4CMCA 1WQ4A 2Q28A 5A7HA 3UKJA 1RWOA 1YK1A 3PNLA 2FPGA 4JDPA 2DVMA 4LJ6A 4OY3A 5C1IA 1QQBA 3WYNA 3EODA 4XUGB 3X0DA 3F6EX 1OU4A 1ECFA 3ZW8A 1PV4A 4P4UA 2MTBA 1GPNA 3RC8A 3TD2A 1NMXA 3H3FA 3QKIA 3QYAA 1JMKC 3W1VA 2AFRA 4JB8A 3W8FA 2FY8A 5E0KB 4BPRA 4CL2A 1ZOLA 1ODIA 1E2LA 1E60A 3NBQA 1E18A 1TEXA 4LS3A 1J5PA 4JJFA 4MICA 5ADUS 3ZCXA 1KPGA 4MVWA 1WMAA 1M73E 2DX7A 1NVEA 2IOFA 1MO3A 5IRCD 2J9XB 2VJQA 4KLZA 5F64A 1YC5A 5LQUA 1LZLA 1GG9A 7REQA 2YKGA 3PL5A 4G5QA 1SC1A 1ZK4A 3EXEB 2QIPA 4PRZA 1TZKA 1ZITA 1J7KA 4NG4A 1T3HA 4HMOA 3D3NA 2DQSA 3C74A 4IW3B 4MRSA 4XYLA 1AJEA 4MYRA 4QT4A 4TUYB 4OI4A 4CKYA 4LBWA 1NG9A 1QU2A 2PV0A 4UDXX 3Q2KA 3EGIA 5WRFA 3KETA 2WYWA 2XPCA 3P0RA 1VRVA 4FMDF 1OYWA 1JKJA 5D3MB 1C4WA 1U99A 3D0RA 4L16A 3RODA 1TCAA 4WLVA 5JXWA 3ELYA 3FBTA 5AK0A 5KHAA 1IXSB 3C5EA 2A9VA 2PRSA 3SJ7A 2D0OB 3VNUA 4QYIB 5AKKA 1PEKE 4GP6A 4BBJA 1U63A 1WDWB 4UDOA 5DN6A 2B1IA 3VNQA 1M6WA 2ZUTA 4EQZA 1QRAA 3HJCA 3P32A 1QYXA 4MCIA 4RU1A 4NZ9A 4BKUA 3TM4A 2JLRA 1NVFA 1R0YA 3IOCA 4DDHA 3CUVA 3PWTA 4O3MA 2AFHB 3B52X 2XTZA 3IR7A 4AURA 2DFPA 5ENZA 4WOKA 4QXQA 5EQFA 5FNZA 5BW8A 1OX4A 1BMQA 1S3SA 2ZUWA 4Y0AA 1KEEA 2O0KA 3P4UA 1QP8A 2OP1A 2E1RA 1YR8A 2JFQA 4ZDJA 4XGKA 5HIIA 4OHZA 2W2KA 4C89A 3IBTA 3RK1A 1E79A 3GVHA 2YN0A 1KEZA 1RP1A 3AEUB 4GM0A 5HZKA 1ZLXA 1PFVA 1FL9A 2BJVA 5CNKA 5F78A 1VSTA 1H5QA 2VN8A 3B9RA 4AJKA 4LQLA 4PC7A 4G85A 2QT0A 2WM2A 3K2QA 4J0KA 4DGQA 4DXDA 4EZBA 3L46A 5AUPB 2UZ4A 2SKEA 2HQRA 4MKFA 3O4IA 2QR2A 3PHHA 4WOPA 3ZGLA 3KX2A 4TTQA 1IEVA 2FMTA 3DNPA 3QMWA 4XFKA 4EFDA 1EUYA 3H2HA 4UCFA 2IZ0A 4E5DA 1I2MA 5AVJA 4BFSA 2DKNA 4YAGA 3NATA 3NETA 4C4AA 1E6EA 2JL1A 3EY9A 4YP1A 3RANA 1TM1E 1ZUD1 2CJWA 1Y1TA 1KE2A 4NJOA 3QVMA 3LMKA 3RC9A 1NBME 5CXUA 3UOGA 3ZYCA 1NF2A 3PEUA 2J6BA 4R69A 2GCEA 2G5TA 1KFKB 4Y2XA 4QYWA 1XD2A 4RUKA 1OVGA 5ALSA 1PYOA 4C7XA 2J0QA 1XNGA 4G63A 3AR2A 1KMCA 1TM2A 1M8FA 2QQGA 2V6GA 3C7DB 4CMEC 3ZIDA 2PUAA 2J31A 4NVRA 3VU9A 5B6IA 1I0ZA 3OT1B 5EMLA 3PE3A 1NBHA 4WX2B 3R0JA 4KR6A 1G5QA 4GDFA 5JSFA 2QTRA 4DR4B 3KKMA 1OH8A 3D4OA 3WYBA 1EFAA 4M7RA 4M36A 4ARCA 1CR1A 5DT2A 3WNQA 5FBHA 1PD0A 3WYDA 3TD9A 4GMXA 3MJTA 4LOJA 3DF7A 2JGFA 3HB7A 4ABYA 1XD2B 3GN1A 4YV7A 5ARDA 2RJNA 3OE5A 5DHQA 3CTPA 3MF4A 3GZNA 2CFOA 1Z74A 1UEXC 1FFWA 3K9NA 4JT2A 4QXAA 3RDPA 3DP7A 3OY7A 2VZLA 4HYQA 1IB0A 3QMVA 5BWLA 1R4NA 1IBRA 3KDSE 1T15A 2HSGA 2P90A 3AUKA 1PJBA 4J0DA 4K9KA 4M9ZA 2VC2B 3A9TA 4KAFA 3UF0A 3CM0A 2MMCA 3K9CA 2MSCB 5J5VA 4UUNA 1CY1A 2O7SA 2V8BA 4JYZA 1LTHR 3I9V1 5KVCA 4B3RB 3IYLW 1KGSA 4YJGB 5EWLB 3F78A 4CHGA 1OSNA 4MLZA 1D2MA 1LJLA 1Y5NA 2P65A 3K1ZA 4LY3A 3VAZA 3V8VA 4B6SA 4EGSA 1KTIA 4ND1A 4OI1A 5AICA 3EMDA 3ZZUA 2P75A 1B8PA 2ZBDA 2B7CA 3VR3A 1ESZA 2PKWA 3OPYA 3U0BA 4MVJD 2VT7A 4TM8A 1YMQA 3ND6A 4BYMA 4NWIA 2VHYA 3I2KA 1Z6QA 2ZKLA 4Y98A 5BSVA 3BL8A 3TZBA 3L7AA 1KQPA 4QG7A 4OYHA 4BQFA 4Q18A 1PL6A 4JP1A 2HN9A 2FFBA 3EWNA 5F2KA 2W6JD 3EXHA 3B5IA 5A3SA 2WICA 4RIFA 3KZNA 3ZNOA 2IHTA 4JSTA 4YMVA 2H17A 2OPHA 2D8AA 2GBIA 2H4YA 5E4TA 3V7WA 2XY4A 1M10A 2VPIA 3KUXA 1Z08A 2GPBA 1B8NA 4FLEA 4KODA 3FYTA 2XQVA 4TZ6A 3W7VA 2FE4A 2YS6A 4NDNE 2NPFA 3TH5A 4EF4A 2C4WA 2QX7A 3F74A 2FYTA 3H2JA 1IXRC 1GZDA 3GV0A 3NFYA 4TKVB 3G2HA 1D2AA 1JKJB 1Q20A 1JLSA 3D6JA 4IIJA 4DIOA 4F5EA 1OB5A 1AXEA 4KFSA 2HJSA 4A8HA 2YWEA 3DOJA 3IQHX 1MT3A 2VJAA 2AR0A 4LUCA 4LBZA 1M2WA 2ZE5A 1Z39A 2D1RA 3IIKA 1JW9B 1QV6A 2E82A 2HCFA 2J3EA 2NYAA 3H2YA 4OHVA 2IEBA 4TL6A 5D00A 1EWVA 3PQ2A 1IY9A 4LK2A 4BVEA 5BR1A 4ZARA 3CVXA 4NBNA 4L5YA 4MUJA 3MS4A 2AB0A 2MSWA 4M37A 5FBKA 4FONA 2HRDA 2CE7A 2R96A 2F8SA 3X1KA 1E1MA 2AZMA 2NUAA 3DKPA 1IN5A 4ZREA 4OF4A 1ECJA 2Y93A 3MWFA 5JW6A 4YP0A 1Z38A 1RTKA 1KQFA 5I8ZA 1QQ7A 2Q41A 3GGPA 2R6CA 3L8FA 5DVZA 1YZHA 3CH7A 4DCVA 4YP9A 1RWNA 1U0LA 3F71A 1MQ8B 4ENQA 4Z2AA 4N3CA 1RAIA 2R1VA 2WWWA 1MAWA 2Y2VA 1M6NA 2X3UA 4FR0A 4Q01A 4BBPA 5AI0A 3A04A 3I6YA 4TX1A 2ROQA 4EL0A 821PA 2ZROA 3RIGA 4ZO6A 3ZWOA 1HY3A 5J58A 3T15A 3K8YA 3N2ZB 1S3FA 4EO4A 5IN4A 1SVKA 4F4IA 5KPDA 4G4SP 1E2KA 2HCTA 5F2EA 1KS2A 3CEHA 4PLVA 3T52A 3WAGA 3DMGA 3TIVA 4ND3A 1XCOA 2FP4A 4CLHA 2XWSA 3EAFA 4OKNA 3GLQA 1EM6A 2QTGA 4KU4A 4O02B 3A2LA 5B30A 2J0VA 1L7NA 2XVYA 5CCBA 4X0EA 5EXPA 4BJ5A 7ABPA 4LCBA 5AW6A 1EJ2A 5AP9A 4RXMA 2XUOA 4XKJA 3T7SA 2Y1EA 3FYCA 1Y8CA 2D5LA 1VQ1A 1I1NA 1ZGJA 2AH5A 4LQCA 4DDKA 4CVNA 4XUDA 1CPYA 5HQTA 2GEVA 3N1UA 2IXEA 3AIKA 3A27A 5L3QA 1PDWA 4BX8A 1T8PA 1VSBA 1ICIA 3PGA1 5AI5A 5B1SA 4A27A 1C3OA 4OLAA 4XDYA 2FU5C 1MW9X 1DS6A 2UXBB 7ADHA 5HOQA 4QBFA 4PICA 1JHZA 3BIFA 3MXTA 3HCFA 5KAPA 5KTPA 2ZPAA 3EUAA 4BNZA 1Z7WA 4X1IB 4AUKA 5FF9A 2YZMA 1K9SA 1QGDA 2A35A 1XROA 4TS4A 3AETA 4PYLA 1TIPA 2JLWA 3MZ0A 3J81k 1LEHA 5TPWB 4X8LA 5L53A 3VC2A 4JKIA 4PANA 3QPBA 4CN8A 1HZZA 1X2EA 3EEBA 2C2ZA 1BXZA 2A94A 4A2QA 5CLJA 4J7CA 5AWFC 3AHHA 1RWPA 1UPXA 3C3AA 4FTWA 2WHQA 5I4KA 1DLJA 1GADO 4O4HF 1QAOA 4UXHA 3D4IA 4R1MA 3R5JA 4PLGA 3RV4A 2AN4A 1YCGA 4DEYA 4R40A 2V45A 1FDVA 2XKBA 3G2NA 4UVDA 2GO1A 2JJ1D 4HGQA 2VDPB 3CONA 1TUIA 4C01A 1I4OA 1YJAA 2MSNA 3OO1A 1YS4A 1H6BA 3E81A 1BW9A 4IZHA 1N9GB 1UBUS 2VJCA 4KXLA 4YQZA 4CG1A 3W6ZA 2O8DB 4IDDA 1J90A 2XQGA 1WD5A 5EE5B 5IPFA 1Q0TA 3WRVA 3FVQA 3PGMA 1KI1A 5CBPB 3W90A 3PSAA 1TYDE 4UCQA 3G2OA 5CVVA 1KKLA 1TLTA 1U2QA 1A5SB 2PD4A 1JHRA 3DTNA 4KMSA 4EGAA 4ETWA 2DBYA 4CFYA 3GBPA 3SBDA 3GLKA 2CMDA 1QYVA 3S2UA 1RWQA 1TCBA 2P77A 4YQFA 1XI2A 3FCCA 5GZ6A 5A3JA 1QANA 4JUAA 2I3DA 1CQIA 4H3VA 4ARVA 3P9PA 1ZW1A 3WE7A 1BW9B 3PPVA 2BKEA 2ZWMA 3I6BA 4GMKA 1QH0A 2IL1A 1XZIA 2V7TA 4OXYA 2XGGA 3T7RA 4AFNA 2ADFA 1ST3A 2J8ZA 3TJMA 3ZY5A 1G8YA 1WNTA 2W83A 1N4AA 5IF3A 2KW5A 1Y4UA 1K98A 1RPAA 2VPTA 1GNPA 2HU8A 1P6XA 1SGWA 2ZIWB 3Q5DA 4KGXA 1IM2A 1DBVO 4O8CA 4OGWA 4YJFA 2HLPA 2XBMA 3ANXA 1KK3A 3LDAA 3OHMA 4DTCA 2P6MA 2R1UA 2R7NA 1AZSC 4AP9A 4UQOA 2HADA 3R41A 3C3BA 3A25A 4RK7A 4C4ZA 1VPTA 1L5YA 2Z5FA 4I55F 5G0VA 5GIPE 2GCPA 2R5FA 3WKCA 4YHBA 5C32A 2O1XA 2CYAA 4OP2A 4U7DA 1B41A 3C1UA 3RAPR 3TLAA 1J6UA 2CVZA 3V00A 1A0OA 2X1HA 3PNOA 4I9UA 5EMMA 1C7QA 4LPKA 2WY2D 3VR4A 5IM4A 1GNSA 1HFKA 3ZK7A 5H3HA 3UV6A 1CQJA 3N0XA 2BFCA 3T9BA 4MINA 2Y27A 2JI6A 3GA7A 4ETMA 2A7QA 5JROA 3IUEA 4EG1A 3LP5A 3KB1A 3QEMA 1HOTA 1TTPB 1U04A 1J2EA 2DQYA 3FUVA 4HXFB 4NU6A 2PD6A 4MXDA 5E7MA 5FTJA 2J46A 5GJCA 3TLBA 4X3PA 6REQB 3FDFA 5JHHB 2GB4A 3ZWNA 4DEXA 3QEAZ 4HL6A 2QQEA 4B47A 4IKEA 3LNTA 4F46A 5SY9A 1LBTA 1ISPA 2X2FA 3KAJA 4JQCA 1TL7C 2F7SA 2QXYA 4Y2TA 1C7EA 1BKSB 1RVV1 2P2GA 3N8DA 3DR5A 2WSIA 3MRVA 4J6FA 3ASUA 2P68A 5LXTA 2NQ2C 1E2JA 3DZBA 2EBUA 3D59A 1T9AA 1H3FA 5F9FA 1K5HA 4LJRA 5F12A 1E77A 1UJ5A 1YOVB 1Y80A 3C3XA 4IMJB 4FD2A 2V7VA 3ZIAD 2C8VA 4MKIA 1SU6A 4ZALA 3D6UA 3TW4A 3L1VA 3TI9A 4QU5A 4XJVA 2BZ0A 3KJIA 4TTVA 1X80A 3BRWA 4X54A 5F2OA 2MMGA 3V8QA 1K8RA 3BL5A 1K63A 2BMDA 2IOQA 3EMBA 1L7EA 4UTZA 5FBRB 2QTHA 1D1TA 1QFZA 3CB4A 4LIPD 4N1AA 3QPDA 3TPFA 1D0IA 4RK0A 1XZEA 5FUMA 1A88A 4UUPA 3I9FA 3NEYA 2GYVA 2HRCA 3RYTC 3UA3A 2P6UA 2ZPTX 2O2XA 1WPRA 2ODPA 1K0FA 3RHZA 4FNOA 4BFWA 1AGPA 2HMSA 3IMEA 3UG6A 3FWPA 3ZJVA 1Q57A 1OZHA 3GCWA 1E3EA 5FWYB 4JLAA 3H1AA 1W35A 2D2EA 1DIRA 5FI3A 3HWRA 4FOOA 5DRTA 4F6LA 1P9WA 2PKCA 3HG7A 2DUMA 2HMTA 1DZ3A 3HYCA 5A3RA 4K9MA 1ZKMA 1C1DA 2I7XA 3GELA 4YAOA 4BB0A 5CD9A 4OHPA 2PK3A 2BZGA 4Z86A 1VMDA 1IBMB 3TFQA 4AWXA 4FX5A 3V8MA 2BTOA 5B1DA 4XOUA 1RKBA 3TGPA 1I7LA 4B8ZA 1OOEA 2DCMA 4Y6PA 1U02A 3W8RA 1XRPA 5JS2A 4XVHA 4ETIA 5HGXA 1NXTA 1P61B 3E9EA 2HJWA 3KSAC 1II0A 1RWBA 2VAPA 1B8OA 4YT2A 1SK9A 3AH8A 3OTHA 4B87A 2RDMA 2ONZA 1SB9A 4NBLA 1G6KA 3CCFA 1OWLA 2VHWA 4RKFA 3RJ5A 2QM3A 3LXMA 2QN8A 2LKCA 3ICVA 3QBTA 1FOEB 1UPCA 3TTXA 4NCBA 1G7TA 3TD6A 3LPLA 3T1HB 1C1XB 1GKIA 1NVWQ 2X9LA 4LCJA 1GZSA 3CW2A 5EJ4A 4Z3OA 3OTGA 5CX1B 2J9ZB 2PUBA 5BN5A 4UM5A 4Z6KA 1KRHA 2RHGB 3DOIA 3VNAA 1QF9A 4TLAA 3KTDA 2YXDA 4L6IA 2VLBA 1DC6A 3OLYA 2QMZA 4MPPA 5DHTA 4CQMA 4D74A 3ZVKA 1WG8A 3EG9B 3T3MB 3T5TA 1UBMS 4BLOA 1T9GS 5KNDA 3OURA 1GILA 1XDBA 5JBNA 2A5FA 3GXOA 1KJQA 2V7QD 1A71A 2RMKA 3DLTA 5AI4A 5DASA 1INLA 3UVEA 1P2DA 3PXUA 3C8UA 3LECA 4RK5A 5CA1A 1K2WA 1XMPA 2YFYA 1BCSA 1NWHA 3GG2A 4CMAA 3R7DA 1UZAA 4DUGA 1E3IA 4O5AA 4LHYA 5B5SA 1QCYA 2WVGA 1KAGA 2W4MA 3C45A 3NZEA 3EF1A 3SJCA 1SA0B 1AF4A 4KXQA 4HR7A 2W5UA 3K0AA 4R4JA 4KIFA 2YASA 3EPKA 3M5DA 3BE6A 3GJZA 3ZGZA 4YY3B 5HM8A 3QA3E 3C5WP 3DE5X 2RH4A 3BIWA 2QRKA 4D97A 2WT8A 5FPTA 4COKA 3GRVA 4XD2A 1HDIA 1SKYE 2FK7A 4QUEA 1PR4A 1WS6A 2DC1A 4HGRA 4OJMX 4MUFA 3CH4B 2OFXA 5I01A 3K6RA 2PFGA 1Z7EA 4N12A 1TGYA 5TVGA 4FYYA 4IZIA 1DX9A 4B7CA 5EZYA 2EKDA 1V3UA 1QVWA 3T1QA 1VP3A 3ZTYA 2NUPB 3EVEA 4DR2B 2DWCA 3SKXA 2J7PA 3JCZA 4YAEA 2NNWB 1L5NA 3UUWA 2OKGA 4N0PA 3V2HA 3RFTA 2AE2A 1BHSA 3W04A 1S5PA 1ZWKA 3BN3A 4FHEA 2N1BA 4H2DA 5IYZA 1R0BA 3BH6A 4JJKA 2IHNA 5TMDA 1QPZA 1NXQA 2PSJA 1E3LA 3M6WA 3OFND 2QROA 5K0ZA 4Y3UA 5J3JA 2EQBA 4DL9A 1U2GC 1E8NA 1TKAA 2VDQB 3IE1A 3C3KA 5SZJA 3QOXA 3DEFA 3RVSA 1NF8A 2R66A 3ET4A 1GSAA 2NN3C 1AN0A 2WJPA 1A8QA 3DHWC 3M3HA 4J3FA 4V0KA 4XYGA 3WK5A 1WE2A 4ZOLB 1Q0ZA 1W6UA 1YHNA 1BEUB 2DR0A 3Q6MA 1O77A 3D8RA 2OD7A 4P7KA 4YI5A 2PUWA 3TTTA 2R6ZA 4REQB 2XOXA 4ENVA 1J4AA 3AEKB 3U31A 3NAGA 5HE8A 3VZSA 1H2FA 4PG8A 5TE9A 4YDQA 3STTA 3JVVA 2RARA 4I81A 4MW1A 3ZNNA 2WOJA 5F51A 3SCZA 5A4IS 5CW1A 2IUYA 1Q7CA 1ZGCA 1W7AA 1W4AA 4IIFA 5KNLA 3KQYA 1JT2A 2QTCA 4R2MA 1MMFB 1CYEA 3TRJA 1RD4A 1J22A 1V35A 2P62A 5DBGA 1WMDA 4JLKA 1K92A 5EL0A 4EO7A 4AI6A 4RXTA 2H5LA 4WOBA 4YPFA 2BM0A 4E2FA 4ZJPA 2FZLA 3O9MA 4QGHA 1K86A 2G5GX 6ADHA 3PHIA 2IPOA 1SEPA 5E2AA 4UFPA 2PH1A 4H7IA 3DJFA 5KDLA 1X7DA 3WQHA 2GWRA 2QZPA 3L6EA 2AKYA 2O8CB 3DTYA 4Z8XA 2MSLA 3IILA 2BKXA 2QLFA 3NAQA 3IQIX 1HDCA 3P9NA 4LVCA 4OSEA 3UG7A 3G1WA 3QUBA 5BW5A 3NGLA 4NBWA 1TJYA 4FYJA 3V2UA 4QGSA 4UHBA 2I2CA 2ST1A 2XCIA 2I4IA 3FPEA 2HI0A 3T9AA 1JFTA 3B5EA 5G02A 3EW9A 2JLBA 5DV9A 1NQTA 4HCJA 2QE7A 4X24A 3R7NA 1GYQA 1L4LA 1P2TA 2QW1A 2JFNA 3IT1A 3QZUA 4R8SA 4I50B 2PLRA 1FJ2A 3AR9A 3L4BA 1D8AA 5EZ5A 5F7OA 4W7HA 2F6RA 1L3IA 4KW7A 4LXQA 3PC4A 4P3NA 5KB3A 1IN8A 5FHQA 1RVDA 1S4QA 5HCIA 3FTQA 2RI0A 3DBRB 5CURA 5K6AC 3LWZA 3O95A 1ONOA 4Z53A 4LFAB 3V1TC 1E8MA 2AEFA 1PD1A 4IHKA 2N47A 1U9YA 4MKRA 4NY1A 2EZ8A 4GNKA 2WNIA 4G0OA 4TN1A 3C1TA 3H1BA 4UZFA 1J8QA 2QR5A 5DMHA 3DB1A 4XWTA 3VOSA 4FK8A 4L8VA 1SBIA 3GHHA 2WI8A 2ZRKA 3FOFC 4ZHSA 4Z4FA 3K30A 4IH1A 1OI4A 3HM2A 4HQKA 3KOWA 1T29A 3AI1A 5JMOA 5D84A 1VBFA 4GHWA 5EJ6A 4QSMA 3ND5A 3PBKA 3STWA 1Z28A 1UQUA 1Z0IA 2X1MA 2ZI6A 4GKVA 2JIOA 2AX3A 3H17A 2GOYA 3PZBA 4G37A 2CXQA 3LPAA 2FZEA 1U7UA 2RHMA 4HX9A 5FNVA 4DDVA 5B1YA 1F2VA 3AEQB 3R3JA 2R9VA 2F3TA 2HM7A 1Y1RA 3EGXB 4RIIA 3BXOA 3MMNA 3W5SA 3H0CA 3PVCA 3UJ7A 3VBEA 3D81A 3GDHA 3W7BA 5CLFA 1C5KA 1ORDA 4QRHA 1IXKA 1S1MA 2AYZA 3CTMA 1H2HA 2XMSA 3R5SA 3WLFA 5K0NA 3T9DA 1OYYA 4MTLA 1D9ZA 5ALEA 1DJQA 3GAZA 3OY2A 4QPDA 2CDCA 2RGEA 1Z88A 2RK4A 2WF8A 1MJFA 2YMLA 4BDTA 3DCJA 3UJDA 4G5RA 3ZU2A 1GJRA 3W5HA 4V03A 1W85A 1W52X 3ZE7A 2BH2A 1F4LA 1UP7A 5IYZB 2ZEJA 2DGDA 4WFQA 1VCNA 1DEXA 2CLHB 2LXNA 3GNLA 3ROTA 3TQRA 4EH1A 4RTQA 2YUIA 5CXSA 3TQFA 1PJ4A 3TZCA 4QOGA 1TZBA 4P4SB 1AQUA 4L4SA 1MGPA 1G17A 4YIKA 1T4CB 3UCXA 1QIEA 2ZS9A 4PG6A 5BXYA 5I9MA 1FFXB 3D7NA 3DF9A 3WGMA 3FLMA 3OFNA 3OKPA 4DZZA 1QG4A 2F4NA 2WB4A 3AUSA 3L0ZA 4A36A 3RIMA 1OFUX 2OYRA 1I4EB 4I36A 3BA6A 1X3SA 3HI4A 1ESNA 1MFZA 1RJFA 3W2IA 1FZQA 1AMUA 3U4HA 4R8VA 1JP7A 1YBMA 3F5DA 3H4TA 1X1EA 4PZUA 4A0HA 4J91A 1XAGA 2OQRA 3LCUA 2E4WA 5DI9A 3PZRA 3U44A 4IG9A 4IJVA 4KREA 3GHYA 4LYFA 3EQZA 1Q7BA 1KYWA 1GDHA 1Q77A 1T4CA 4N7BA 4ZQCB 5DMXA 1R8YA 1P9RA 5LP6C 1S96A 2G1AA 2YFQA 4JBIA 3JAKB 3KELA 1NNUA 3TAHA 5KOJB 3B6IA 4QDUA 1QFXA 1EQUA 1FXWF 1TOAA 1M3SA 3U17A 5BYKA 4BJ6A 1W46A 1Z18A 4Z4QA 2V54A 2PUJA 1YR1A 1S2DA 1VCIA 1Z5ZA 2FMFA 1YJQA 2ZGVA 4PQGA 2O7NA 4IDQA 1ZVKA 4H4EA 2Z2KA 3U44B 5IVIA 4HH0A 3OZAA 4IL5A 3UHAA 1WUJS 3GJ8A 1EP9A 4MDEA 4QUJA 3PUYA 2G36A 4FFRA 3EIFA 4E6EA 1NUUA 4HNQA 3LPCA 2H5EA 2PWAA 2PKXA 4NK4A 1CP3A 4Y2PA 3RKRA 4E2YA 4GR4A 3ETCA 4KE7A 4S1PA 5DP1A 1PJZA 4KRYA 2NX2A 4PZAA 4TXNA 4B9EA 3ZI7A 5CT4A 4DLPA 3ZV4A 5HUJA 5A4AA 5KYYA 4KOAA 2RGNC 3UK1A 4EB0A 2H2FA 1RQNA 4JSYA 4XRRA 1H3EA 3QX8A 5FJJA 5KSZA 5EIXA 1TB4A 3IPCA 2PMFA 1X1CA 3DM9B 3O38A 4RL6A 1U1EA 1UXIA 5CK5A 1QV7A 3PC8C 4QG3A 3A7EA 3MB8A 3VFDA 4DY6A 3Q7IA 1CUSA 4LBYA 1AKNA 2WSYB 3QQ5A 1U8YA 3KVYA 3D8NA 3O0TA 4Q9AA 2Q45A 4QBTA 4V0MA 4UM8B 1NVKA 3I5AA 3O5AA 3TNJA 3USCS 4L4UA 4S1VA 4IZ6A 1SCDA 4XGRA 3LKDA 3TLZA 3DTVD 1ZJZA 2DU8A 5A4MS 2JK1A 3EGDA 1K5GA 2LE0A 2UVPA 3QLUC 4F5DA 2XCRB 4CKZA 2GN2A 1CVIA 2EFCB 5CR9A 2H54A 1GGEA 3P4XA 4ZT5A 1WX1A 2VJLA 1CVRA 2Q5QA 2X5XA 3HBLA 2LCIA 4KI0A 3CEMA 2O6LA 5F52A 2GILA 4NU8X 4PRYA 2C9BA 3MELA 1SZPA 4OHRA 2J4DA 3HVHA 1KY4A 1F3OA 3MWLA 2NU9B 4FW8A 2WWFA 1Z4KA 4DG5A 2REXB 4II2A 3VKWA 1T8TA 3HCRA 1QONA 2O0HA 4G24A 4IJWA 3QPWA 4UHFA 3JY6A 4C3UA 3MJFA 1XEWX 4HFRA 1QDEA 4ENWA 2QQFA 1NXPA 1UM8A 2FZWA 3O2NA 3O4VA 5ALPA 4CLDA 4UTPA 3PVSA 2X5KO 2XCSB 4G3XA 4MGHA 1KYVA 4UVEA 1DDGA 1JAHA 3FPAA 1RKQA 3FTDA 2IIPA 3HJBA 4B84A 2I0FA 4DABA 1XMJA 3BGDA 4M8LA 3C6QA 3KXLA 3RSOA 3RASA 1Y3BE 1EIWA 2Z6VA 4INZA 2YIVX 3TMKA 4QJ4A 4WESB 4FFDA 1O4WA 4RVOA 4HZIA 4AD8A 2RI6A 4RELA 4AULA 4I55B 1EZ4A 1GYRA 3CF6R 4URHA 1V5WA 2OO3A 1OHHD 4DJTA 4AY4A 1F3LA 4H6VA 5GM2A 4RMGA 1NASA 3A58B 2PBZA 2NO9A 1DADA 1X87A 1YIDA 1X1BA 2QVYX 1ZCFA 3PT5A 4F92B 1APBA 2H1VA 3O84A 4RDHA 4MRNA 3RS8A 2P2DA 5I8PA 2EKZA 1X7XA 4NL4H 2Z3VA 4RZ3A 4B3TB 5CDUA 2PUFA 4ZMSA 5E7JA 4GPTA 1IMOA 2YQ4A 3AU8A 4IFIA 3VU9B 3PXDA 1DC8A 3HADA 4MR9A 5HQ3B 5C7YA 1Z6TA 3U81A 5KTKA 4MV0A 4YONB 3VX3A 2RGRA 1GCIA 5IJ0B 2ISSD 3G7UA 3IVRA 3N76A 3HR4A 3EZYA 3FYDA 3MEQA 2ZRJA 3OOWA 1E4OA 1QIHA 2I3ZA 2HO4A 2VJMA 2X77A 3I53A 3JYPA 4ZYWA 3E7XA 3FMFA 1ZL2A 1KDVA 1ZNYA 3SVTA 5BNFA 4LOLA 1OJLA 3K1JA 3KYIB 4RS4A 1JSRA 5TT1A 4ESOA 4X8HA 4RVFA 2ZBRA 4KQGA 1AUXA 4M8IA 4G4GA 4R16A 1YQEA 4MR9B 5IAJA 3ZE1B 5L7TA 4JP3A 2IOHA 4RFVA 2H1FA 3PDIA 1DCFA 4KE9A 1T2DA 2IWHA 4IHAA 4BE9A 3P7MA 3QVWA 1P9OA 4K87A 2GPSA 2G80A 2G9ZA 1A50B 3C7AA 3DZ8A 5AK3A 1P91A 1PLKA 1R9MA 3G2QA 4Q1AA 1R3UA 1WUKS 2MT9A 3O4JA 4RJJA 4YJGA 5ITVA 2JVJA 5L8VA 1U9IC 3U7QA 1R15A 5JUWA 3CBQA 4G5XA 5ERXA 2QRJA 4RKWA 2A0FA 1G2IA 2CKDA 2OR3A 2PGAA 1O6ZA 4RVGA 2F8LA 4WBNA 3PE6A 2QL6A 1JFRA 5E2BA 2C97A 2EL7A 2Z57A 1SULA 2OSBA 2Q3EA 2FF5A 3BHNA 4KP7A 5T67A 3AUFA 4I8XA 2AWOA 4L8YA 3OOYA 5KVQA 1H3NA 1DC3A 2FG6C 3QLTA 4G56A 4PSCA 2M9MA 4YUWA 1JHUA 4CIVA 5KJEA 3U60B 3RYIB 1H1LA 4ZXPA 1ZM2A 1H9BA 3DKVA 5F33A 4Z1OA 1CEEA 5K8LA 1P2VA 1RYNA 2YJNA 3BGIA 1TQHA 4HSGA 3U3MA 2FN8A 4E13A 2QDXA 3QXCA 1NOIA 4QVIA 4LJSA 5H1YA 3DL4A 1LS6A 2GN6A 3OM8A 4OREX 1I7NA 4JBGA 5ED0A 4RMIA 4Y30A 3TW8A 4EF6A 3NGXA 3ROXA 3UHFA 4PN7A 2EOAA 2QDKA 1UWKA 5F1YA 1AIPA 3KT6A 2WHPB 4BGEA 3U9TA 3AB7A 2BV3A 1RJWA 1N7GA 5GVSA 2GF0A 4WCDA 3OF5A 2VCEA 1R5BA 3QX3A 2Q5EA 3ORQA 2AXEA 5TVKA 4XQGA 2OAP1 2Q2NA 3NHRA 4IQ8A 4DT1A 1JBQA 3G9QA 4XCQA 3CKKA 3EULA 1R8JA 1OXKB 4GGMX 4I4LA 4OFZA 5JS8A 1QSGA 3LVFO 3M82A 5KOYA 4Z4IA 2A5YB 1UJ2A 2QOEA 4MIKA 4X65B 3W5AA 4C5CA 4G8BA 3OEED 3VR3D 4D6XA 2BKLA 1YGYA 5BT8A 4NPAA 3B2NA 3U5TA 3PQ6A 3C98A 2VVTA 4R71A 2PA3A 2ZBQA 1V2HE 4AP5A 3HL4A 1W5BA 5C7LO 4MHOA 4RY9A 4M1MA 4HDCA 5DHPA 5K5EA 4LYDA 2QT9A 4OKIA 3GT7A 4GPZA 1XJWA 2XNDD 2NP7A 1SOMA 2W6JA 3GJ4A 4MHTA 3NHAA 2ETXA 3GJ7A 1KH2A 3P52A 2QL9A 5AXCA 1OTXA 1YTLA 2BZSA 2BI8A 5FWXA 4C4SA 4C7BA 3L93A 3L40A 3CRMA 3IKLA 3AEZA 4KI7A 1KXJA 1N8KA 1G59A 3HXMA 4DV7B 1W47A 3AM4A 4IXMA 1EBFA 2ZYAA 3I1FA 4ZYVA 5KMGA 3DNMA 3DE3X 3KQMA 1ZK2A 3E9ZA 3LSTA 3QY0A 3KKKA 3R3XA 4IZOA 4P3YA 3L7NA 2JAXA 3O7WA 3ICOA 1MABB 3A1UA 1HRDA 4KQJA 4KX3A 1ZAYA 3R9IA 1LSSA 3QVVA 4HX2A 2DWQA 4D9IA 1BKDR 3EWSA 4JXXA 3AR7A 4W7SA 2FG7C 3AI7A 1EHCA 1PTKA 1NXWA 1FF9A 1SEVA 1O57A 1JMVA 1CUAA 4H7FA 1BEZA 4WKPA 5KQGA 4B48A 3CF4A 1VL2A 1ZN2A 2OGTA 2TYSB 3ABZA 1ABEA 4Q47A 2LR0A 1U0BB 2YVKA 4PO8A 1GZVA 4UD6A 4UEJA 3M5CA 1TO6A 4F2DA 4INJA 4ILKA 3LA8A 3O1JC 1PR5A 4KO3S 2CB0A 2CNWD 1X42A 3KB6A 2CXXA 5C5EA 3RG2A 3UJ8A 1RRVA 2CNOA 3AI2A 1SPBS 1SKQA 3JZDA 1NU6A 3CRW1 1B1CA 5EAIA 3TRDA 4URXR 3SAJA 4MB6A 4Q3CA 4ZICA 3FE2A 1W59A 3LHDA 4TXLA 4PQFA 1XTPA 1SHUX 4L07A 1WW2A 1IB6A 1YU6A 3AERB 4IVNA 2VLIA 4WRRA 3U6KA 5ABPA 1M5TA 4PGMA 1EFKA 2VPWA 1Q0UA 3P9IA 4PZYA 4EB6A 1SCJA 5I9NA 4IS3A 3DUFB 2Y66A 3VU8A 1FYDA 2P11A 3R9XB 2YS7A 1O94C 1KBQA 4Z51A 1RM3A 4E46A 4XVRA 5HDQA 4GOND 2I9PA 2I87A 3CH6A 1A1SA 2QX6A 3HHPA 3M9LA 3NIFB 2OQ2A 2VXCA 3DBOB 1FJGB 4F11A 3I64A 1P1JA 2QMQA 2ZJ1A 4QDTA 4A4DA 5JISA 5GJWC 2WWYA 1OWMA 1G2QA 1E7QA 2AJDA 5ALHA 1DAGA 3SJUA 1MBZA 4EHBA 4KJZA 1XMXA 4O3FA 1QG0A 2WZDA 2X5NA 1E3SA 2XTAA 4MB0A 3EVDA 3SSOA 4HQLA 4D9MA 1IUKA 2PX0A 1V45E 1BS9A 3M6AA 2Q8NA 3IUQA 4KMRA 5B64A 1OH7A 3OE7A 5D1NA 3W9YA 3HB5X 4F93B 4D9EA 4IH4A 2P6OA 3JAWB 4BMSA 3R9XA 1LC0A 3JZAA 4A0QA 3DNFA 3HKBB 3VO9A 1O03A 1U1CA 4UXJA 1A27A 2QUHA 4IEIA 3G2MA 3GG9A 3IOMA 1J2JA 1RU3A 3CCBA 3R3UA 4FINA 2WKRA 1RHKA 2IEGA 3KJXA 4IOLA 5DNYB 4EUHA 4Q4JA 3W6OA 4I6EA 5EIHA 2LP4Y 4H1WA 1OIVA 1NXXA 1TF5A 4B35A 2QPAA 4TWZA 2HQ1A 1MZVA 2QSUA 3NYQA 2QY9A 4B3DA 3N59A 4JKYA 3QXGA 4LYYA 1U8ZA 2DPMA 5A1TA 2W6PA 3BGOS 1E4VA 4RTLA 1SXJC 1DFGA 3G0BA 4HXGA 3BB1A 5ERGB 3IX7A 3OQPA 1V8DA 4KBYA 4PLCA 5K0JA 4FQ5A 1KFEB 5DGXA 5JADA 4PCAA 3VR4D 4WNYA 4OGGA 4B80A 2LWIA 1L1FA 4BTLA 5LSAA 4BC1A 2IH5A 1AX9A 4I99A 4IPTA 1UK9A 1E89A 2FWIA 4EFKA 2ZQ5A 3ONEA 4NECA 4MVJA 1XNJA 3KE9A 5ULLA 2EFYA 5EE9A 2HQOA 3NX4A 2OAEA 1M83A 2V65A 1JIXA 5THXA 1ZESA 3V32A 1BN6A 3BK7A 2ENUA 1LVUA 2A9FA 2YHSA 3KYCA 3MWDA 4ZQBA 1EP3B 2WJZB 4Q9KA 4C1NA 1YACA 4ZU1X 4B6QA 3QYJA 3TBFA 1NGSA 3VC7A 1UBJS 3OZEA 3HH8A 3HYRA 3H8JA 1J8VA 2Z2JA 3F46A 1B93A 3KXPA 4M54A 3D1JA 3ZWMA 1QLJA 2BMJA 3M5PA 3QFTA 1XZBA 1EBUA 1AXGA 1T1SA 4PX9A 3UGQA 3SE7A 4B7ZA 5DOVA 3UQYS 1P4RA 2EKQA 3VYUB 1Q84A 1A8IA 1IRXA 5IP5A 1I4TD 4BEBA 1XVTA 2V5VA 4MITA 1R0ZA 4HEQA 4AY6A 3WAKA 1Y1PA 2HU2A 4RVUA 3VR5H 2BTQB 2P69A 3WLIA 4AIIA 3LDGA 2J6HA 3T1NA 4B2PA 1QH1A 4RHEA 4HHEA 2C0PA 4KFUA 1U3CA 2W6CX 5AHKA 3RD5A 3A2KA 4UBJA 1IUNA 1I80A 2CEKA 1GQ2A 2EW8A 2P3OA 1JR6A 5LYJF 3VJLA 1T1EA 2YV1A 2G9NA 2FE1A 3CF4G 3C6BA 1QIMA 1I3OA 1XXHE 2GJ4A 4LJAA 2O4CA 1NRWA 2BM9A 1XZAA 3UJHA 3V8NA 1M6YA 1M2VA 2GZRA 5CPBA 2GAIA 1ATIA 2YIMA 3K9GA 3OX3A 4I50F 4X1KA 4XGNA 3WL6A 5HJ7A 1M2JA 5B7NA 1Y7IA 4J75A 1E0KA 1GTZA 1JHXA 1XDGA 3AFHA 1K7FB 4GPD1 4W8GA 3CNEA 5TX7A 2Y76A 3IVGA 4BMZA 5AW0A 5JVDF 5JMPA 1Q1AA 1Y0BA 1UEJA 3TVDA 3BERA 1DPGA 3HWSA 1CUEA 2OZPA 2Q8QA 1ZISA 3ILHA 3N2NA 3O94A 4TMXA 3UPUA 3ETLA 2WVJA 1XMVA 4NMWA 1G8GA 2YWRA 4UUAA 3L41A 3R4VA 5C2JB 1NV8A 4WN9B 1SXJE 2QTWB 1CFZA 2C2GA 5BMVF 1UMDB 3CO0S 2EGGA 2FWPA 2J0UA 2FK8A 2Z56A 5B58T 3SIRA 1Y8ZA 1KY5A 2WRZA 1RDFA 4V0QA 2ZI5A 1YVRA 3EB9A 3JALB 3IHLA 4I4CA 3QXSA 3Q87B 1LPPA 5TV2A 1EWTA 1L7BA 1GGNA 1A9OA 2BRUC 3GQBA 1T5HX 3N86A 4Z9YA 1WM1A 1ZSVA 4TQAA 5E3JA 1WIWA 4EY6A 2MYPA 3CF2A 4WLFA 3GCDA 4MPTA 2CWWA 4KPGA 5HZGA 2XUPA 2E4YA 3ZV3A 3KWMA 3B3AA 1AQYA 3H99A 1SKMA 2D1TA 1PG5A 3PKJA 3ABOB 1MOPA 4IHJF 3RF7A 4WAUA 3E9MA 4JQYA 4P5PA 4BP3A 2W6QA 4RORA 3LUCA 4DC0A 4RTMA 3BH7A 1VJ1A 1VXOA 3PWSA 1OBOA 3Q0IA 5F2NA