2OSVA

Crystal structure of znua from e. coli
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
283
structure length
262
Chain Sequence
AVVASLKPVGFIASAIADGVTETEVLLPDGASEHDYSLRPSDVKRLQNADLVVWVGPEMEAFMQKPVSKLPGAKQVTIAQLEDVKPLLMKSDFNMHLWLSPEIARATAVAIHGKLVELMPQSRAKLDANLKDFEAQLASTETQVGNELAPLKGKGYFVFHDAYGYFEKQFGLTPLGHFTVNPEIQPGAQRLHEIRTQLVEQKATCVFAEPQFRPAVVESVARGTSVRMGTLDPLGTNIKLGKTSYSEFLSQLANQYASCLKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords High-affinity zinc uptake system protein znuA
publication title Crystal Structure of the Zinc-binding Transport Protein ZnuA from Escherichia coli Reveals an Unexpected Variation in Metal Coordination.
pubmed doi rcsb
total genus 89
structure length 262
sequence length 283
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2osvA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2osvA02
2O1EA 1K7SN 3HJTA 1G20B 3AETB 1QGUA 4OXQA 2YNMD 1M1YA 5AFSA 4ND8A 2AFHB 4GICA 4HN9A 1QH8B 2OGWA 4TKVB 2M6LA 2OV3A 4HMPA 1M34B 1FP4B 1N2ZA 2XV1A 4IRMA 1N4AA 3AEQA 3MINA 4B8YA 5BVHB 5KOHB 3PDIB 4WN9B 2WI8A 1MIOB 5M3BA 3TLKA 5I4KA 2Q8PA 4INOA 3MWGA 4UTPA 1G21B 2XY4A 4PM4A 4FI3F 3ZK9A 3LHSA 5KHLB 4XPIB 1L5HA 2RG7A 3AESA 2MINA 3ZK8A 2ETVA 1QGUB 2YNMC 1M1YB 3PSHA 2XQVA 4PAGA 5JJ5A 2Q8QA 4K3VA 2OSVA 4ND8B 3MWFA 1TOAA 3K1AA 4WZAA 1K0FA 1XVLA 4WESA 3R5SA 5CR9A 3TEFA 4DBLE 3AEQB 3MINB 4OVKA 3HH8A 4TKUA 5CX1A 2PS9A 1ESZA 3AERA 4MO9A 3UJPA 3ZK7A 2PRSA 3AEKA 3BE5A 3BE6A 1L5HB 4WZBA 2X4LA 3AESB 4INPA 1PQ4A 2QI9F 2MINB 4NNOA 3MFQA 4G09A 5FLYA 4OXRA 5KOJA 3CX3A 4H59A 5JG7A 1H1LA 4UDOA 2XDQA 3K1AB 4HMQA 4WZAB 5GGYA 4WESB 2PS3A 4XPIA 4WNAA 5M34A 2OV1A 1N2CA 4M7OA 4LS3A 4H0FA 4TKUB 2PHZA 4HMOA 4N01A 4G07A 5CX1B 3U7QA 3TNYA 3ZKAA 5GGXA 3AERB 4MX8A 1M1NA 2R79A 3AEKB 4WZBB 1K2VN 3AEUA 3GI1A 4FKMA 4UDNA 1PSZA 1QH1A 1KAEA 3PSAA 1N4DA 2PS0A 3R5TA 5M2QA 5KOJB 4LJSA 5HX7A 1H1LB 2XDQB 5BVGA 2R7AA 4MLZA 3ZTTA 4WNAB 1EFDN 2AFIA 4NNPA 1N2CB 5JOQA 1G20A 3AETA 3EIXA 3U7QB 4FNAA 2M6KA 4UTOA 2AFHA 5JPDA 1M1NB 1QH8A 3G9QA 4TKVA 1KARA 1M34A 1FP4A 4CL2A 3AEUB 5M29A 1KAHA 5B58T 5BVHA 5KOHA 3NU1A 3MD9A 1QH1B 3PDIA 5HDQA 4WN9A 1MIOA 2WHYA 3EIWA 4BBPA 2XUZA 4MDYA 2XH8A 5BVGB 1G21A 1K75A 4FILA 3HXPA 2AFIB 3LI2A
chains in the Genus database with same CATH superfamily
2X4DA 5J59A 2AF4C 2Q1TA 4DCTA 1VI2A 1KU6A 3I4FA 1UXJA 4QTXA 4WJZA 4PG7A 3HR7A 4EX6A 2VF2A 3H1BA 3IDFA 5F73A 2C57A 3LPNA 3WO0A 5IKXA 3AJRA 4EHHA 5JZOA 3C0KA 1M0EA 4AN4A 3CZAA 1MRSA 4FFOA 1JLKA 1XWIA 1R0BA 4XZ3A 5J4LA 1NJ8A 1EINA 2OOKA 4KP7A 1SCBA 3HADA 3KOMA 4UHEA 4YV0A 4HLNA 3DOIA 3OA2A 3THXA 2LV8A 2AT1A 3JQ6A 3B6EA 3IBSA 5BRJA 4NENB 2XUFA 1XP5A 4YRRA 4D0NA 1X1CA 5LIPA 1YQQA 2VAXA 3MWEB 3IVRA 2JGDA 4G26A 1I4TD 3JQFA 3FNFA 2XYPA 4MWGA 5HUHA 1CY2A 3IBGA 3CVXA 821PA 2HJWA 3FMPB 4KQMA 1IE3A 4CTMA 4QECA 4JI7B 3X44A 4CL3A 1JT2A 3PICA 1UXGA 1FJHA 2IY7A 4IIXA 1IPFA 5JH7B 2Y4NA 1XZHA 3FKSD 2FG5A 4HTFB 3VPHA 1H05A 2J41A 2WHPA 4MIYA 4P4LA 5F51A 3RRBA 3VO1A 4Z4IA 3RJZA 3UAGA 4ASUA 1J09A 1JS1X 3IAS1 1XSEA 4F5WA 2CE2X 1L5WA 3NHPA 3CUUA 1QG4A 5F52A 4AZ0A 1KYQA 4DIBA 5AM0A 1NUQA 2O14A 1UFQA 4NPHA 1SD5A 4YYEA 3DBHA 4JN6B 3OZXA 2ONCA 2VXCA 3I1YA 2PUFA 1V8BA 3PQ3A 3GD5A 4HPJB 4IWYA 2OL4A 4EW3A 3ZLVA 3WP0A 3R7DA 1OZAA 3IQXA 3UBTA 3PLNA 5T6MA 3T4EA 1CVRA 2EBWA 2SCUA 5C5CA 3EOBI 4QEKA 4CDNA 1PNRA 1Y1TA 1XD2B 5IDQA 3NXSA 3DKVA 5HQ3A 1YDMA 1RXIA 2BEWA 4DSTA 3Q8XB 4B32A 1N5OX 5K3AA 3VTKA 1JG1A 1XPUA 3VPBA 2WK1A 5CIWA 5DXJA 1IN8A 3O3MB 1Y4ZA 2QZJA 4ZU1X 4XX0A 5LLTA 1CEQA 3LY9A 1H4SA 2CB9A 4L5JA 3VR5A 1LKZA 3IFSA 4E5UA 4MWSA 5KAPA 1KJYA 1NBOA 3HMKA 2NZVG 3HYTA 3MW8A 1EDBA 1T0JB 4G4GA 1WXQA 3KIPA 2R8OA 3PWKA 4ZDJA 2PGOA 1Z74A 2HTEA 3AR8A 2XUAA 4HZGA 1KFKB 1PS0A 2ZKIA 1U9CA 3PGJA 4V3CA 3SHTA 1AKNA 4CM8B 2O8BA 5BR8B 2P9YA 1SOWA 3ZV6A 3EIXA 2O2DA 3OFNA 4ZJPA 1JDTA 2G25A 4BNHA 1VL5A 1NF8A 2P4UA 4UTOA 3AHEA 2P2SA 4TKVA 3UC9A 2D5IA 1CQWA 1Q0SA 4JLDA 5E6SB 2NVUB 3RC1A 5ICGA 1PWYE 2PMFA 2FGKA 1GJRA 4P3KA 2J0SA 5K3DA 1GAJA 2P30A 4CLOA 2A59A 2ZK7A 1HQYE 2EP8A 2XGGA 3IBCA 3N2KA 4DNQA 4F3TA 1B93A 2PMDA 1P2SA 2OC9A 3KM0A 4IMRA 4UASA 3V1UA 4TLLB 4BTVA 1CRQA 1A8HA 1UIRA 4JQYA 4FR5A 1IHOA 3TKYA 1XKTA 4P58A 3WB2A 3P2OA 4FZVA 4XVUA 3FAKA 3WISA 2RHHA 3NOOA 1AB6A 1X2EA 2XD4A 4QG7A 5J5AA 4B6GA 5B57C 2FFRA 3HJNA 5F7OA 5BSGA 3CLKA 3RC3A 1F0YA 1OFGA 2PZJA 4ZOLF 3UMRA 2WAYA 4B09A 3HJHA 2V8OA 5DNUA 1N6NA 2FRDC 3NAZA 3WK9A 1ZCFA 1ESMA 4CQJA 5B36A 4LMBA 4PZAA 1NW6A 1OI7A 1ZXXA 2C4VA 1X8XA 4MVJD 4I8DA 2GF0A 3BJIC 1EUDB 4TVBA 5JDIA 1LBSA 2FR1A 1Q91A 5CB4F 1T3SA 2GKSA 5IT0A 4C22A 2B1GA 4E2YA 2BMJA 1YHYA 2PBZA 3NC0C 1GVNB 2JIQA 3PUWA 4BP1A 4DDVA 3A0RB 3LNCA 2OPHA 3KYDA 5FBQB 4CUJA 1BTOA 4D96A 1KDZA 3MJSA 3NMUF 5EWJB 1IVSA 3QOFA 3WIEA 2CLMB 2ZJ3A 1JEDA 1SCDA 3T9DA 3ZE6A 2P27A 3JAMA 4ZKEA 4HAWA 5I7FA 2C1ZA 3ML1A 3OPQA 2F9LA 2YFQA 1F17A 4KB5A 5T3UA 4NS4A 3TCNA 1EE9A 1I14A 1R00A 4ND3A 1LZKA 3AL2A 1POXA 4Y7CA 4WUTA 3ZK7A 4CM6A 2B6HA 5IW8A 2VYCA 4P98A 3IOEA 3ORQA 521PA 4JKYA 4B73A 4MV7A 3TNLA 2WR8A 2RHTA 1CCWA 5DW0A 1J9ZA 3ANMA 3I6YA 1TAQA 3IAM1 3KYJB 1SUAA 1MEOA 2DMRA 1AGRA 4LTDA 4UU1A 3ZCUA 1E4VA 2B7CA 1R66A 1KAMA 4B3TB 1D1QA 1OAOC 2D1TA 2J4DA 3IVAA 1W36C 2QR3A 2ABWA 3B1WA 4KSYA 3QX7A 5M34A 4F12A 2DGDA 3W5DA 4OSEA 2E4XA 4RSHA 5E7QA 2WKWA 4CIVA 1AA9A 5CP8A 3HKDA 3OZEA 4HDMA 3IV6A 2H1WA 3BGSA 3VMMA 4ARAA 1ZK4A 2MTBA 5JNTA 1Z88A 3V7FA 5FI0B 3M5WA 2UXCB 3IEPA 1JA1A 3KSRA 3RQSA 3K0AA 3PX3A 4MLDA 2AQIA 2RHBA 3DZCA 2R2GA 2VH2A 3MGCA 4J1SA 3LYUA 4KLCA 3TW8A 1CP2A 3EPHA 1F14A 3EEIA 2ZRFA 4FHEA 5KHAA 2YV4A 1HF3A 4QO8A 4QUIA 3EZNA 3N75A 5CFLA 3W2FA 2H06A 3AI3A 3OTOB 3PXEA 1T8WA 1YVEI 1N57A 4ZTBA 3SQWA 3DLBA 1II8B 3CB2A 3PNQA 1ESEA 2FW8A 3BB3A 4H3SA 4IEIA 4OJYA 4QTTB 3EF0A 1EX9A 2X2EA 3EXEB 4IUBS 4C2AA 4P7FA 1A77A 3LOQA 3EY4A 4H4CA 3GA0A 2YBDA 1NX9A 2YVAA 3OPYA 1UBHS 3IYLW 4HRAA 1H1TA 2D00A 3N2GB 4YMHA 3PDIA 1NVMB 5JSYA 1BRTA 1OLSA 1R9MA 4F3NA 4RMIA 4OSOA 4ADSG 3NEJA 3BJEA 1ZUD1 4G5OA 1Z0FA 1ZOOA 4J7CA 1ZKMA 2FVYA 3PLRA 4CLRA 2FMFA 5G02A 2JNWA 4QYXA 5IVPA 1MD9A 2IXFA 4JYCA 1X8JA 3HJRA 3GLRA 3UKDA 4GPAA 3KQKA 1EK5A 1JQ3A 4MCIA 1OFTA 4JL5A 4CRWB 3GNQA 3QI2A 1WW3A 1YVDA 4AFNA 3VH2A 1PNQA 5LDDC 3EZLA 2WHRA 1QZ3A 5GZ6A 1W36B 2PZ8A 1V5GA 3KR2A 4JCOA 5DDIP 1CJTC 4MJXA 2Q99A 4R2LA 4P80A 5FLKA 2YQZA 1ZK2A 2XYGA 2II6A 3QY9A 4S24A 4H1VA 3TLYA 1FUYB 1GRCA 4C6HA 2JI4A 1YB7A 2YS7A 2IYLD 4MRVA 3MCUA 4G1BA 4AJ4A 1Y4SA 1IWPB 1EHCA 1GPDG 1JRLA 1KI6A 3FPAA 1IEVA 1S0UA 1Z5NA 3GHYA 4MKHA 4QDOA 4RZSA 3URKA 3BWMA 3ZDQA 5BV8A 1GPMA 3FR8A 2Q5CA 2VPQA 3RK1A 1E8MA 2CJPA 2H3EA 2JC3A 3C87A 3FPHA 5HUJA 4L73A 1E3IA 5EE5B 1FL9A 4D82A 2Q3LA 3GEDA 8GPBA 3UG6A 1GPNA 1BDJA 3DB1A 5KQGA 4EY8A 2GD1O 3R5SA 4JXJA 4OATA 2WWGA 5E9QA 5M5BA 1YT5A 3EA4A 1M2OB 1UFKA 1F4LA 5A06A 3B36A 1JALA 4X3PA 4C4ZA 5CITA 4O2BA 5JBQA 4FCWA 4BMZA 3VPCA 2IODA 3WYEA 4Z4HA 1U11A 1P77A 5LUAA 4XD7D 3H9GA 1HE5A 4P3PA 3EXIB 3RHZA 4HT3B 2G7ZA 5GONA 3RAEC 4DVJA 1XZFA 3WWYA 1VRVA 3IX7A 3SQNA 1DEOA 4YRIA 4EI9A 1QYVA 2CUTA 3ZHQA 4GD3Q 3STVA 2YHAA 1LW6E 3TJRA 4NV0A 3T5CA 4M7WA 3S68A 4MQEA 4CKCB 1D2EA 2QRVB 3IILA 1CJSA 2QE6A 5HM6A 3IP8A 1IZYA 2J6IA 2W90A 1K7FB 1HKHA 2JGMA 2W70A 3PQFA 3QUBA 1TRHA 3HDYA 3K92A 3G17A 2ZT7A 3V8MA 4DDWA 2Q5HA 2V9ZA 4UM9D 4H6WA 3NANA 3EUEA 3IIJA 4M0LA 1DQPA 5CXSA 3GXBA 4BE4A 5L95A 2NQ2C 1YB1A 1TYZA 2PAFA 3WZLA 4AJ1A 1N1DA 3U1TA 1SHUX 2F3RA 5KOJB 4MEJA 1DBQA 2A6PA 3I2HA 1T34A 1JG3A 1LC0A 1UPUA 3OQMA 1VG8A 1L5KA 2FZVA 4BPRA 5BR7A 2VTBA 3H1PA 4FD3A 4IDOA 4JJKA 2JGAA 2EJUA 3G02A 5CT8A 1IM5A 1J90A 4FNAA 4GDFA 2JH8A 2BR3A 3L8EA 5EOVA 4AY5A 1ZISA 5CAEB 3P32A 1RXCA 2OKGA 4UHCA 4R54A 4G41A 4TUYF 3G9XA 1A9RA 2L17A 2LD4A 3IGFA 5EMNA 5HZMA 2VHWA 4MINA 4LBVA 3IAXA 2OHFA 2WWFA 3BRQA 3O73A 4MW9A 2C5GA 3EW9A 2GXSA 5ECYA 2A78A 1KAQA 2PH7A 2PPVA 1C4XA 2RJNA 4CM4B 3IHKA 3ICOA 3BKWA 1G9SA 2GAJA 3FSRA 3FUXA 3K72B 1EWVA 3OT5A 3P97A 4IFEA 4P84A 4KKXB 1CHNA 1FXWA 3F0TA 3PUJA 1HFEL 4MCJA 1WPQA 4UOQA 3ZU4A 2C5EA 3O91A 3TRFA 4Q4DA 5FP0A 1EB8A 2GXUA 3D7LA 3CQ9A 2X5XA 2UYCA 1UXIA 3H1TA 4QHYA 1EHIA 3WIUA 4IS3A 5D86A 2JHCA 2C3OA 2IXGA 2KWIA 3MCVA 4MEBA 4R16A 1RC0A 4C6RA 4DABA 2B8TA 1D0SA 5JJLA 3TE7A 4DIFA 2G06A 2P79A 3F9RA 3ZYCA 5BWOA 1S96A 4QLAA 3UUFA 4DLTA 4W6QA 4ODIA 1DEAA 2IU0A 3PGVA 5JEEA 4XIYA 2VPPA 1QFSA 3O3OB 4G1FA 1PR3A 1WVMA 3RK0A 5D6OA 5AW7A 2MINA 3C3CA 3ECSA 4LWOA 4KR9A 3GZ4A 3KSUA 3L2OB 3WGOA 2OFXA 1SIBE 3E2MA 3T5MA 2Y0DA 3T5BA 3TECE 4QPJC 4W82A 2ZJFA 2C95A 3H3XA 5BWBA 1W34A 1P60A 2WTEA 2XT6A 2RB5A 4PQGA 5K3FA 3BRWD 2WAAA 5DF1A 1NVBA 2ZUSA 4ACBA 1E6MA 1PUXA 1A27A 1COWA 1SGWA 3AMVA 5TE9A 3WX0A 2ZRQA 4EEXA 1DEKA 3QVMA 4HPXB 2CNWD 3KLNA 2YZGA 1JKXA 2PZFA 3RRMA 1WNFA 4YHHB 4BZZA 2WUFA 2AXNA 2XMSA 3D6MA 2QQFA 5TV2A 3RS2A 3K30A 2C9OA 5LLSA 3WXMA 3NO4A 3O8QA 2FYTA 5CH3A 5F5LA 2WFLA 3K09A 3BJMA 4EMTA 1VJDA 1ZXLA 3UWMA 1XU9A 2P9FA 4J1TC 1H1LA 2BW0A 2CMHA 3X1MA 3SF8B 1MBZA 3HQ4O 1GEEA 2JIDA 4DMLA 1V43A 3AIOA 2A8YA 1GYRA 3ER8A 3EZFA 4FHZA 3IVMA 3HJFA 1GY8A 1E5XA 2QL6A 1LB1B 4X84A 4DA6A 1KGSA 2PA0A 3B3JA 1U4SA 1Z25A 1WXHA 5B1IA 2OK7A 3F6BX 3P9YA 5AVWA 5KYKA 1C8VB 2X8JA 3JQQA 4PLFA 5P21A 1NWCA 3DKIA 5DIZA 1NJ6A 4NCIA 1A7KA 1ZH8A 1SZJG 4D8VA 4E33A 1KY4A 1ZU5A 1G2IA 3FE2A 4RCYA 4I1OA 3V1YA 2J0QA 1GZHB 2J9FB 4B40A 2VQSA 2CV2A 2FOLA 2UU9B 4BFYA 1VPLA 3N7AA 2HRDA 3OBBA 4IW3B 1IBKB 2VHVA 1HT2E 4FEGA 4EYSA 1P2UA 4YNBA 4H31A 3IIKA 4PX9A 2J3MA 1NNLA 1NSTA 5DLQC 1MB4A 2RONA 3MJDA 1T6BY 2J46A 3TDMA 3OTIA 5I7VA 2R6ZA 2RCYA 1N0HA 4QL3A 1U7WA 4DQKA 3BB4A 1U4NA 4PXYA 1WOMA 2OYRA 3A7EA 4B3BA 2CYAA 3W3AD 1JE1A 2VO1A 3EVDA 1RE0A 1CR2A 3IRUA 4KXNA 3OT4A 4MW5A 5T8KC 2WILA 2QN9A 4U2DA 3ISJA 3ESXA 2QTBA 3MD9A 2HC9A 3LUPA 4PC2A 1OROA 5EZYB 2JLAA 1NU8A 2DOKA 3TGPA 5E6RA 3ILHA 3M4YA 4LNAA 4Y1RA 3SXJA 1PX2A 4HNSA 2E89A 3OE7A 3ABZA 4ZT5A 1JSZA 3O9ZA 3R8XA 4PINA 1P2BA 4XTCS 4FT2A 3MMXA 2QG9A 4TWRA 3LX6A 4KDFA 3EAFA 3VGJA 3WL7A 2F1IA 2PYZA 4JJ4A 1LRKA 2DUWA 3NC1C 4JZKA 3FVWA 4X41A 4JT2A 2AFRA 2J7KA 2FPSA 2HHAA 4O5AA 5FBRB 2W8ZA 4A6XA 1U8EA 3DVQX 3IUYA 4OFZA 4UBJA 3VC3A 4W8OA 2KI5A 2RH4A 3GELA 3H5TA 3U16A 3SZOA 2GB4A 3W5VA 1Z7YA 3ED1A 3KZCA 16PKA 3AZPA 3DTVD 3A6HA 1E89A 3C3XA 3G7NA 2XWSA 1BCRA 3HVJA 3K6KA 4HOYA 5FQOA 2X9LA 3DVRX 1EVEA 3NRBA 3AZQA 4P81A 2NT4A 5COQA 5AKZA 4EK9A 4MKFA 2NMVA 5CG1A 4KV9A 3ICWA 3GDGA 1SULA 1JW9B 2XECA 2ZRMA 2ZCUA 1IOWA 3HCBA 3INNA 3NX4A 3CUSA 4QASA 6Q21A 3FCXA 3H6KA 5FKJA 3KKEA 5JAPA 5EGSA 1LK7A 1JEJA 4D8TA 3UWDA 5EZ5A 4YH1A 2ZWMA 4JLUA 4ZA2A 1QG2A 3IDAA 1CE8A 2IYZA 4M8IA 1T3TA 2D8AA 2YNMA 3LQKA 5KNBD 3PNMA 3CXUA 1A8QA 2BKAA 2H9YA 4DILA 3KC2A 3BMNB 3CLSC 1NXVA 5HZGA 2QN1A 3HU2A 2VJCA 5HQJA 1THMA 4WDRA 3LPMA 4OJQA 5EKUA 3W1EA 4DMCA 4CKZA 5EHGA 4FGLA 1JKJA 4BL5A 2HV8A 1RI4A 4YJ2A 1PTKA 3UAWA 1VLLA 1TAHA 3TD2A 4LRTB 5TGTA 4HJXA 4I4IA 3AH8A 4R9RA 2OXCA 1IQ0A 1MF7A 1JIKA 2EFGA 5BSTA 1IRIA 4DSZA 3IHLA 2AR9A 1ZD8A 4DQLA 4DNOA 1NOKA 2HI0A 4TKUB 4JJZA 4RY2A 4A8TA 1EXNA 3F2VA 1CYDA 5FF9A 3AB3A 1RWKA 1W19A 2WMOB 1PHRA 3AERB 3KEOA 4PFQA 2UXDB 1F0KA 3D8BA 4KFTA 1L7XA 4WKBA 5EG5A 1ZDMA 4R3NA 1QNLA 2FF7A 2HHHB 3TLMA 4P0TA 4XRGA 1JP7A 2ZJ7A 2XMPA 1KI4A 2IOYA 5HMMA 1E1QA 2UUCB 2PT9A 2R1TA 4EKGA 2O3UA 2BGUA 4G25A 3LBIA 3IQIX 2QJWA 1H94A 1MABA 3EFEA 3UG7A 3UK7A 2NPOA 3ORYA 3TZQA 2RHOA 3RUHA 4ETMA 4RTLA 5I5EA 3FM9A 1EWRA 4JYBA 1WHTA 1E1DA 2IYXA 1MU0A 2YIMA 5IBQA 2NAFA 1WUIS 4O25A 4WPGA 1G7CA 3E3LA 3VR4D 2BGTA 5DFAA 2VDUE 3KUXA 5B1DA 4KHPB 4AZVA 4HSEA 1HY3A 1UJ2A 1KETA 3TSCA 2HY7A 1A8UA 2HCRA 4C7KA 5KNBA 5K8IA 4BBPA 3OJCA 4K9SA 2JZOA 3A1TA 4LYJA 5FAKA 1MC4A 5JFGA 3FUCA 1FTYA 1ACJA 1UKVY 1IY2A 2HU5A 1BS2A 3EUWA 3F6SA 3OHPA 4K2HA 4L51A 5K0JA 4JS0A 2D4HA 5IANA 4OTZA 2JAHA 1K7SN 1P80A 1JDZA 2AOUB 3WMXA 3EBOA 1VTKA 1ZPDA 2J3QA 2ZYHA 4JKOA 4QYTA 4XVCA 3BEDA 3LIIA 3P94A 3U4IA 2QPTA 2PMBA 4HNGA 1B0UA 4I4TA 4RLQA 4GLOA 5B6IA 1Z13A 3ESQA 4GXTA 3E9NA 4G1MB 2XV1A 3E1GA 4D3FA 1KZYC 4QDJA 2CUKA 3FJYA 2FXIA 3TL2A 1VLHA 2FJPA 5ALOA 2OUIA 4BQOA 3GP8A 2IS1A 3AUUA 2HYDA 2IYSA 4EO4A 1U0RA 2JBAA 2V7VA 3TW0A 1FCJA 3MWGA 4DANA 5KYGA 2O8CB 2IELA 3CNNA 3VR1A 3GLGE 3OZWA 1UXHA 2CWDA 2DFTA 2G4CA 3KQQA 3OEHA 3FWPA 1DVRA 2QTLA 3FUWA 1DHRA 1ST3A 2CLEB 3DKRA 3OZBA 4YAOA 3AFHA 3B20A 1IY1A 2V4MA 1SCJA 4IGIA 3WGVA 4C3OB 3NHLA 3I5UA 1JB1A 1SEPA 3BF7A 4XLZA 2PS1A 4EKYA 5CA1F 2AW5A 4RKRA 2C2WA 5L7YA 3ZY5A 4RGQA 3OFSA 3Q40A 4I2NA 4L07A 1IATA 2FWAA 2BR4A 1YZVA 3U49A 3DAPA 4EPWA 1IHYA 4JASB 1NN3A 1ZL2A 1OLXA 2QLBA 4HYTA 3FRIA 3OM8A 3QE9Y 1P2DA 2AVNA 4MJ7A 1BE8A 1K5GA 3VR4A 3ZE0B 5FUVA 5ALHA 3MGBA 2OP1A 1I2MA 3K9HA 3RRNA 1PD0A 3I23A 1XF9A 1LPBB 1UBJS 2A9KA 1IJEA 3L4SO 5BMVF 1U65A 1F8YA 1U6IA 2BFNA 2P9EA 2V6BA 1GZSA 1RRVA 2DSNA 3A70A 4RMNA 3V1MA 4BFSA 3D3KA 5DYYA 3P9ZA 1Q83A 2QW1A 4PCUA 4TWJA 4Q4JB 4AROA 1LW7A 2FUG6 2XUOA 3QXCA 1QR6A 4ZCPA 1L6RA 3EZ6A 3SEAA 1IXYA 1DQSA 1J0DA 4UUPA 2KM1A 1L7OA 3QEKA 3PEEA 5ALVA 3EG9A 1YO6A 3DYVA 2WSSD 2AG1A 2W7TA 1EWQA 2GK3A 3H2ZA 5E9AA 4BUJA 3S7ZA 2QLLA 3E22B 3TOCA 4XWOA 2DCMA 2MMGA 1DP4A 3G68A 3JZIA 2V6MA 4FOTA 1C1DA 3MCWA 3ME5A 4HDSB 4GBMA 3QVLA 4X00A 3QMPA 3RODA 5JZVA 4MS3A 1GGJA 3GJXC 4BNJA 3LQQA 3ZCVA 3VISA 5T64A 4DV5B 1DJLA 3L02A 1WEKA 2NU7B 1K27A 1LWNA 5KYWA 1DRVA 1R0SA 3A3NA 1Q7GA 3K8OE 4A7PA 4I9FA 2YWJA 3Q9UA 1Q95A 1PJBA 4PYQA 4FOOA 1Y5IA 2B9EA 3HEBA 3WL8A 4AJPA 1U2GA 4PR0A 3VPXA 5HKOA 2CXHA 1L8OA 1YKFA 4EBBA 3PUYA 2G8LA 3AEUB 4GG1A 4CKBB 4ZJUA 5LZ5A 4V0RA 3UYKA 1ADBA 3K53A 4UXJA 4K86A 3RIYA 3ZQJA 3DEJA 3RKUA 5E3JA 3KVYA 3ITDA 1B15A 2HZ7A 4N7JA 1L3BA 2E1PA 2HDOA 1BGWA 1J0EA 1GKKA 2IYRA 2P4EA 3LCRA 5AXAA 1CIPA 1WXXA 3AM4A 2WY2D 1AKWA 4RORA 1FZTA 1UM8A 1PTJC 1Y3IA 1PYDA 4IMIB 2D13A 2PJZA 3FYUB 4ZQCB 3V6MA 3VX4A 3S8YA 5CD1A 1NI4A 4EB0A 3BGIA 1HTBA 1ZNYA 2BFAA 2DLNA 4I6EA 3EUFA 3DM9B 3L01A 1YAHA 1ZI9A 2OQIA 2AFHB 4ZQHA 3WGQA 3ILYA 4GWLA 8AT1A 2WMDA 2BMEA 4LHWA 1ZRNA 2HNAA 5U4XA 3QLEA 3WLMA 5KOHB 2GK4A 1YDGA 3FJOA 3ZU5A 5FWDA 1EGHA 1A9TA 1KVQA 2DEUA 3LPAA 4OQLA 3V8NA 2R6GA 3KPYA 2GN0A 2X14A 4HDKA 1Q15A 3E4DA 3C3DA 4TROA 5JJKA 3ZJTA 2XQIA 3EB9A 4F1WA 2Q2VA 2XKBA 1GNVA 1Y4UA 4UAJA 3VYUB 4PX3A 1TYCA 2I8CA 2OCAA 4OREX 2RAVA 3MFYA 2C97A 4KSCA 1H2YA 1J70A 4G9BA 4CGYA 1T8UA 5CK5A 5FHRA 3MWDB 3ETCA 2CVFA 3JALB 2C8VA 4JVSB 1E79D 1G7RA 2WKSA 4F6LA 4OGWA 1YDFA 5TMBA 3STUA 3R7BA 1KWGA 1XVIA 1JAYA 1KHHA 2CFIA 2FA9A 5BSRA 1BX0A 3TAHA 2WP0A 1KJNA 5BWMA 4UU0A 4WWHA 2DAPA 2WU1A 3U81A 1CR4A 5KSZA 3QYPA 4DBVO 2AF3C 3BE6A 4N3AA 3E27A 2QUJA 1OH7A 4JU9A 3WMWA 4DWOA 4OI1A 4LXHA 1H3EA 1UP6A 2NADA 2Z2IA 4YLEA 3WWCA 1P18A 3NEAA 2F3UA 2H4HA 5AKEA 1AXEA 5LP6C 4E5YA 5FUMA 3Q7RA 3WK6A 4BNFA 4ZCMA 2FSUA 1QUFA 4Q1FA 3EGVA 3MD0A 3PQ4A 2H08A 1QVAA 1RMYA 2HJHA 4BV2A 1SU6A 1H6DA 3GF4A 2OT3B 2WAMA 2A0UA 1Y81A 2Q9UA 3RIEA 1NP7A 2AN3A 1OYYA 2YDYA 2EZUA 3VKFA 1FTGA 2XUGA 4BNDA 3ZHOA 1R0YA 4HQNA 2PUBA 1DAEA 2NU6B 2VUIB 4G1CA 1XMSA 2ZIFA 5AM3A 2YCLA 3FJ1A 2RGGA 4DBZA 4DT1A 1FSSA 4AUNA 3EIQA 3PHCA 2IXAA 2VDKB 1C2YA 2Y92A 3SCZA 2RGRA 5HR5A 3NT4A 4LOHA 1ZBDA 3AHJA 4A0SA 3ZU6A 3O9VA 1N5MA 4I0WB 4C2TA 4YGXB 2EEPA 1RAAA 1H4TA 4GO1A 4D9CA 5JO0A 2F1JA 3GRUA 4MIEA 3UAXA 3VTFA 1F4PA 5H5JA 2K7FA 2VZLA 5AJWA 4B3DA 3PDHA 3RTDA 3GUZA 2QR2A 4QQNA 3GLGA 2RJ3A 1IBRA 4FONA 4RKWA 5TB5A 3O90A 2Y3IA 4BS9A 1XZQA 5CK4A 1NVGA 4EVSA 4M9RA 3HDGA 2BHLA 4FDMA 3QM1A 5FI3A 5H16A 1E0SA 4EGFA 3JQBC 1NURA 4F2GA 3B5JA 2JBHA 5A1JA 5A4MS 2P5YA 4U2KA 5JNUA 3CRW1 1A9SA 4U6SA 5CRIA 1J22A 3SHQA 4OAQA 4C3ZA 2RGEA 4UEOA 1UPFA 4M1KA 4RIEA 5KNDA 1KEEB 1W0KD 5AVKA 4ND4A 4NU8X 2IS2A 3TD9A 1PZHA 5LP6B 4AS1A 2C2GA 3N6VA 3TR0A 1VJTA 3U0BA 1I3KA 2G71A 1TW3A 1Q22A 1XMIA 1HR0B 4C04A 4E1VA 2AOVA 4H9GA 1QKKA 4AN0A 4C2UA 1FUKA 1NF3A 4ZI7B 2OBXA 2WWIA 4X95A 3RSGA 3A06A 2ZRDA 2IYOA 2JAPA 2JFXA 2ZGVA 1F4VA 4MHOA 4HBZA 4ZARA 1MVLA 4BP3A 2OC4A 4QOIA 3HUTA 5TS3A 1ZQ9A 5DTQA 1JJ7A 3WVNA 2XXBA 4E5MA 3U7JA 2QR5A 1CZLA 5A5GA 2NYVA 3DV0B 1WXEA 3ISTA 4GAEA 4A5OA 4KR3A 2CXNA 3DEHA 1BMFA 3JD4A 4UAGA 4UQPA 3B1FA 2VDWB 5CVJA 2PLFA 4K6CA 5FFFA 2IH4A 2Q9AA 1HEIA 1KH1A 1XVLA 1GSAA 1C0IA 2OSBA 3RVMA 3UKJA 3RHFA 5G41A 3PTLA 1O94A 2FG6C 2GF9A 4P6VF 2D2IA 5AOBA 3P9IA 6AT1A 2G1UA 2XOEA 3QENA 2D1YA 3IBYA 3UJAA 4R1LA 1DOZA 4F9TA 1M1ZA 4F71A 1FYFA 3RAPR 4RPJA 3IALA 3N8KA 4MPPA 1XXHE 2Y2VA 4FW8A 3V9PA 2FPPB 1WUTA 5IFLA 2W6OA 3U09A 4MYTA 2GYVA 5JC1A 4PZEA 5C31A 4LY9A 4OUDA 3PL1A 3EEOA 1WKCA 1W1IA 2ZVJA 4KYTA 2VIIA 3FPCA 4PPQA 4UJ5A 1VZ2A 5AI9A 4EZEA 4D6YA 3CM0A 3ZE1B 4BWFB 3KQLA 3ZD7A 5JSFA 3LG2A 3R3WA 4HGRA 4RVUA 1I4LD 2ES4A 1KNQA 2R1VB 4PW0A 2D8MA 3HDHA 1Y8RB 2OFWA 4HNAA 3KB2A 1J0XO 3GVXA 1XI2A 1ZD5A 4FW9A 4QC2A 4DSUA 4BCDA 2A5LA 1KZ6A 4M88A 1JWAB 3DXFA 5JWHA 5K51A 5JRJA 1WR8A 4X8MA 2I0FA 2XUHA 4X90A 4TYWA 3JATB 2AK2A 1NRWA 4KMSA 1OYVA 1L9XA 3T5TA 5L40A 1ZOIA 1Q0HA 5CVVA 3ILSA 3I76A 4N8SA 4HWKA 1W47A 2CDBA 3II6X 4HVTA 4MI9A 1P5HA 1Q12A 1OX4B 1GTVA 4OKSA 5TMEA 5GADl 1TEZA 1PDOA 2VOJA 4EMUA 3O94A 4Z0HO 4BIMA 4C7OA 4J4BA 2WG2A 1ZW6A 3D0KA 1ADFA 3DBLA 5B64A 4GSYA 4A03A 2I6XA 5TY0A 3V32A 4PG4A 4PO9A 1ZUNB 1L5LA 3WRXC 4G4SP 4S12A 1ABEA 1FA9A 1IVYA 4R41A 4CXMA 3OIYA 3GRPA 5G3ZA 2CVOA 2DFNA 2PX3A 1KK3A 3DD1A 1JAIA 2IZ1A 4Q3EA 1N0IA 2FX2A 1YRLA 3FBGA 4HUJA 4WN3A 5ALRA 3UY4A 4JOCA 4YA6A 3K35A 3DDWA 3BS4A 1VSUA 4UDYX 4EHKA 4YXFA 4QM6A 2HMSA 1SXJD 4GRDA 3NT5A 1NX6A 3JYPA 1XGKA 2C2BA 2BFFB 4MK4A 3I45A 5JCJD 2O4CA 4MW4A 1SUSA 1P0QA 2OY0A 3TJZA 3AL3A 2A4KA 3CMCO 2DFPA 3V7UA 4ATNA 1DJQA 4TUYA 4ALIA 3SJ7A 1NVAA 5G1OA 3AHDA 2R25B 4YMVA 2EKBA 3SGLA 5EHXA 3FTQA 4RA9A 2D1RA 4N18A 2JH3A 5K0LA 2OBYA 4DXHA 2HGZA 3ZDAA 3I5YA 4OHMA 3A0UA 2CFTA 2IU6A 2XMZA 2JLSA 4KQIA 1R6UA 5FO1A 1PKXA 1XCMA 2DUNA 2NSLA 4A8JA 4K0KB 1A71A 3OJXA 4FYHA 3UXYA 4B7UA 4OEHA 2VCYA 1OI3A 3FZQA 1Z0SA 2UZ1A 2YKGA 3HK2A 2P9HA 5IAAA 5JNLA 5K7SA 4K6GA 3PKZA 4H27A 1FPMA 1NIJA 2A1TR 4EJ6A 2H5LA 5EGNA 3UJCA 1L3CA 4AO6A 1NZFA 3OLXA 4OHCA 2NTVA 4NOMA 4K1LA 4XQ9A 1CY0A 3UMVA 2J08A 5K03A 4AB1A 2VYVA 1NZDA 3K0CA 4HZUB 5SYAA 5A6VA 2BEVB 2ZSEA 4YACA 3F6CA 3KL4A 2HXYA 4E88A 3HH8A 4JYAB 3R9XB 2I4OA 3GJRA 5LQMA 3T1NA 4RXMA 5HIJA 3SWWA 1KRWA 5JNRA 1CS0A 2WQZA 3TPZA 4JUDX 1T2FA 3CURA 4Y6RA 4KVGA 1MQ9A 5H4HA 2ZRLA 3I6IA 1VJ5A 1FTWA 5E2IA 4KLRA 4WERA 4AMZA 2VPWA 4BOYA 1WUKS 2XEXA 1ZNQO 4LNUB 4MJLA 4UAUA 4UNRA 3U19A 1U0TA 3QV2A 4UVDA 1NMEA 3G2JA 3JQAB 4NYMR 2W6IA 4DJJA 3K1AB 2W2NA 2JCSA 3I5MA 3W34A 1T2NA 1USVA 3PYMA 4FHDA 4FMDB 3N2LA 4NVRA 2Y1LA 4O1IA 5DWDA 5SV2A 1Y6JA 3FMVA 4ZHSA 2VJLA 1X7GA 3OTHA 2VJOA 5A5FA 3DE0X 1TLTA 2GMWA 1VL1A 3GCWA 2W8BA 3ZG6A 2HWUA 3K0FB 3ZU2A 4B4OA 2A9QA 2O2ZA 3GHHA 3KOZA 3VZDA 3GYGA 1I24A 1FTQA 1KDTA 1NFQA 2XCIA 3ER6A 3GUHA 1SUWA 2WNSA 1MCZA 3PI6A 4GECA 3V55A 3W9BA 4DC1A 4ZYZA 4NI5A 2F9FA 3E82A 5BNIA 1UK6A 2C5LA 3FNEA 3V8QA 4HN4B 3O75A 2CB0A 1Q0ZA 1FEZA 4J0FA 1HUQA 3K71B 2DFKB 1QGED 2JVJA 4HN2A 1LSJA 2GVDC 1O6ZA 2GCOA 2WE7A 3NTQA 4ZI5A 3ND7A 1N33B 4G5QA 2ZSUA 1JLLA 3DDZX 1L7AA 4OQ4A 4OGKA 4BO1A 3UCFA 1GIAA 1Z6TA 1NVKA 3RU9A 2J48A 1D1TA 4XOUA 3NWEA 1Y8ZA 3TTYA 2YX1A 1MZVA 1N7GA 1O58A 8OHMA 1KJZA 2SKDA 4ALJA 5JPDA 1Z18A 2NUTB 3AINA 3NATA 4BGEA 2WF8A 2WQ6A 2CE7A 1AZSC 1M34A 3BGWA 3WLPA 3DGEC 3LT4A 1FSGA 5FFMA 4S1NA 1K89A 4BC1A 2J9ZB 7YASA 3JQFC 5DNYB 4HBGA 3H11A 3C98A 5GTDA 1XYVA 2PE5A 3ODGA 4JSYA 1XR3A 3KKMA 4FT4A 4HDAA 1Z4IA 2BHTA 2E6KA 2R5NA 4EIWA 2MU1A 1TJ4A 3MMPA 4YMLA 3QXXA 4UD6A 5BN4A 1W25A 3QE3A 5LLDA 1MP0A 2FDXA 5J63A 3N2YA 4EO9A 3HUUA 1EFUA 4DPLA 4LOLA 4QGHA 4X8HA 1WY7A 2QRMA 4DV0B 1E2QA 2JFUA 1JH8A 1TK9A 1XXHA 3KR1A 5JE8A 5EUBA 2V3VA 4MUFA 2B36A 3C1UA 4MRMB 4NBSA 3ZGVA 5HXAA 3G5AA 5JWRA 1F2UA 3HXOA 4IJMA 4MVJM 3VR6A 3GARA 3NHMA 3IQGX 4M4SA 5M3BA 1T1SA 4KPGA 1O8BA 4LHZA 2OUKA 3H87A 4NMLA 1YF3A 1QPGA 3UFXA 4KAAA 3TW4A 4FI3F 4TM7A 1YZGA 3OCZA 5AHWA 3KOXA 2ISSD 2OXFA 1ZIXA 3KZKA 2QRNA 2Q5FA 2P41A 4TTTS 4JBIA 2FHSA 5LYJF 4L76A 1E9BA 1CERA 1JZQA 4MWTA 1QK3A 4TS9A 5HIIA 1YUMA 1Q0TA 1EFAA 4B79A 4QBGB 4UFOA 1T1RA 1JFSA 5DK4A 2XF2A 1ONOA 1XCPA 2JIZA 3I9FA 3NOXA 2R7KA 2X7XA 3T4XA 3MQFA 4M1ZA 2HF8A 4I5FA 1RI1A 1YZTA 1W1WA 4HH4A 2GBFA 4JLVA 1W29A 2ZBDA 3VVMA 2H5EA 2ODTX 4M0MA 1O95A 1SHJA 1B42A 1THGA 1Z0IA 3HM2A 1Z2OX 2NSHA 3PQDA 4NK4A 3ACDA 4YRCA 4Q1VA 3ZH2A 1HORA 4YAKA 1HETA 3V4OA 5CXUA 1JXQA 5JFOA 2IUUA 2HMTA 5E2AA 5KC8A 1GTSA 2WWTA 1HI9A 3E84A 2AZDA 2X22A 4CEJA 3KJZA 2WRZA 2QP9X 2YYYA 3W1WA 3B7GA 2ZIGA 3VJRA 1L4EA 2JGDB 5B37A 1PCXA 4HGYA 2PVSA 4R1QA 4IWNA 2Q0HA 1VE9A 2IQ5A 1ZK1A 4LMPA 2BL4A 4UARA 5H02A 3NBZC 1RZRD 1KZGB 1X1AA 3K70B 5HFAA 2Z2KA 4YJGA 3V8VA 4PC1A 1P2GA 5JAOA 3ISVA 1D2CA 4FCTA 2QUAA 1GILA 2B94A 3NT2A 3RWMB 2H7XA 4GWKA 1SPXA 5EPOA 2WHPB 4KJXA 1V5EA 5HW0A 1EFVA 2XQKA 3OJ0A 4PCLA 4YFYA 2FSFA 2P7HA 4CL0A 2J7PA 3NIGB 4W9NC 2EQAA 2YWCA 3C3YA 2MR6A 4AZ0B 1GUFA 2ILVA 3O83A 3RROA 2ZVDA 1R8QA 3DBHB 4CPDA 2XUDA 4LJSA 2Q6LA 2ZXEA 1Z8NA 4IIJA 4WHMA 1OC4A 4FINA 4RF5A 4TXLA 2QD2A 5G1PA 3T5GA 4ZI2A 3SVTA 2JLXA 4DRZA 3RF6A 2I4TA 5AUPB 4YDHB 3KPVA 1RYBA 2SCUB 3QBJA 4RZUA 4AG6A 4BLVA 4US2R 2M1ZA 3PDWA 1WB6A 3BXXA 1KAGA 1NYQA 3F7MA 1TFUA 3EEYA 2JGLA 1E1CA 1JQLB 1K8XB 1G6KA 2BEWB 1W0JA 1W4RA 1F6BA 2EWVA 2JS7A 1X0VA 2QP4A 2XOKD 2NVOA 4WOPA 1A3CA 1GL3A 4GM0A 5F77A 2IWRA 2ZTUA 4BFWA 2R0QC 2FLWA 1EJ2A 3IIEA 3O6VA 4I3GA 5F4BA 1ECLA 1KR5A 3OQVA 2JEOA 4XX0B 4O8ZA 4I1SA 2C9DA 3AJ8A 1RM0A 3BHMA 1P1FA 4CDGA 4IJKA 1VJ0A 1SUIA 1Z0KA 1R3UA 2QTNA 2X3UA 3P19A 4M0PA 4DG8A 4TLAA 4G0WA 1C3VA 5J2TA 1SR8A 4MGEA 2WJAA 4C87A 3AG5A 1XMPA 4DYVA 3FOFC 2VF8A 5BUCA 1RQPA 3BXFA 5ITVA 1R6AA 3ETGA 3G0HA 3W9SA 2O8BB 3N8IA 5MDHA 4RTOA 5I9SA 4Q1AA 2BSXA 4C0SA 3UOGA 1E6KA 3FROA 1T9CA 4D4MA 1PX0A 2YCBA 3Q3VA 2EYUA 4OJKA 3S3TA 4YAGA 3RVNA 4LW8A 1VYUA 3C45A 4TKVB 2OV3A 3OLZA 5BT8A 2NUPA 4GZ5A 1OVMA 3I2GA 4W8GA 2PLWA 4TZKA 3HB9A 3H9UA 3WL5A 5AR1A 1KO5A 3AY0A 2A1UA 4WQMA 4CLOB 2M98A 2NZXA 3N2KB 4JLMA 1U28A 1XTSA 2PMWB 3HGMA 3WSVA 3LKBA 4N6GA 1A9ZA 3ZCPA 4HYQA 3HV2A 4LWZA 2RGWA 3FCUB 5IARA 3MG9A 4P36A 1P5JA 2WZDA 4H3HB 4OJMX 4YRTA 1GA4A 4DLAA 1CUAA 1YC5A 2G28A 4LNHA 4WOBA 2BF7A 3DLIA 4JBNA 2VAVA 4FHGA 4YUAA 3MPOA 3IELA 1GFIA 4MR7A 2G1JA 1UBEA 3IMKA 1Z68A 1U0EA 1QV7A 1H8HD 2I78A 1E4EA 3SJAA 2VJBA 1ODLA 5FTMA 4XFKA 3TFWA 3V4LA 2GEFA 3HCWA 4HRYA 4RGYA 1RM5A 4NR0A 4E11A 4EG3A 3NM5A 1OWMA 3LFHA 4BEJA 1M1YE 1DNPA 3AR3A 1NVEA 3G0DA 5I9LA 2VWHA 3GMDA 3IUMA 3DE7X 1L7BA 1IAVA 2XTNA 4JYPA 1G66A 3L07A 2BONA 5DTIA 5CA1A 4X93A 1OGJA 4XM1A 3THRA 1LLDA 3KYDB 4GQAA 1HGXA 4IDNA 2BP7A 1ENPA 4G5FA 3U6BA 2HEIA 5A5EA 4DCOA 2D6FA 3VYVA 5BOVA 1KC3A 3D31A 3L1JA 5CFMA 2C0QA 1KZ9A 3GBSA 1HYHA 3HI6A 3MHTA 1SBQA 3EC2A 4QJBA 3SKVA 3VOSA 1VKHA 1Q6ZA 2DJ5A 4LX0A 4ND7A 1A82A 1M8GA 3RK4A 5GM1A 2G88A 3C4VA 4BZPA 4FX5A 1WLSA 4L5BA 3K96A 3LF1A 5F2OA 1NXOA 4R01A 4HB2A 2XPCA 4DCGA 4C20A 1M74A 1XKQA 4CKWA 2GZ1A 1FBNA 3E8XA 4MROA 4HGQA 3IUSA 2E49A 1XN4A 1QR2A 4LF9B 1N36B 5JAMA 3FFAA 4ALMA 1V8ZA 5JALA 1ZGCA 4MP6A 3KBOA 1LV7A 6GPBA 5K6AC 1RW4A 2HF7A 1U9IA 2XTMA 4K03A 3HFRA 4ZCIA 5LVAA 1DJPA 4V39A 1ODTC 3HKDB 1GCIA 4HDMB 5ALSA 2XUIA 3WGGA 4CTOA 3ZE7A 1UKYA 4QOGA 2X1MA 4EZBA 4PFJA 4W5RA 3RRYA 2VXBA 3GAAA 1D8TA 2G1KA 3IIIA 3K0AB 1VI5A 2C99A 3PFIA 4LTMA 3GEBA 2ZIAA 2QAGA 3BJRA 1Y5RA 4M99A 4TL7A 4ZRMA 1XDUA 3TW8B 1E2LA 2X1LA 2WDZA 3VU3A 1C9DB 3R6GA 3QU5A 1PL7A 3TI7A 2OHHA 4OFBA 5CPBA 4J76A 4FILA 5IC6A 5SY4A 3SBEA 1M8FA 1XRJA 1M9NA 5TT0A 3CEPB 1JU4A 2XHZA 1S9DA 3QLVA 1VLZA 4QXMA 4MGKR 3CS3A 2FMUA 3E5MA 4TL9A 3HCEA 3QLTA 2ZJ6A 1U3VA 1RDFA 1RC1A 3OKPA 4HTAA 4Y6QA 5DBEX 1KRXA 2H59A 4YPFA 4RIFA 4JITA 4K1XA 2AFIE 1VCNA 2VT6A 3OPYB 4HAUA 2VHUA 1V96A 2PH5A 5E1MA 3OCXA 1WG8A 2XUQA 3PDIB 3ZWCA 2JFOA 1OLSB 1F2TA 1EA7A 5AD1A 1E3TA 1SVUA 2BT4A 4JJAA 1GPUA 4FDTA 3B6KA 1YFLA 4Q7EA 3W8DA 4CLRB 5C5EA 2PUAA 1BXKA 2C98A 2QOEA 4R69A 4LJ4A 4YRGA 3PJRA 3L1IA 3M70A 5F98A 3PP8A 2WIBA 4WCDA 1QIHA 3ADOA 4CM9A 3UGKA 3ANTA 3RGGA 4BCCA 1DUVG 5HS4A 3GFTA 4K6HA 3H4MA 1EPUA 2L0XA 2IUEA 3PCRB 5HZKA 1DHTA 2OLKA 2IDJA 1YS7A 3DWFA 1HT1E 1NW9B 4G86A 3KT3A 2PO5A 4PC3A 4Z8YA 3KUKA 4KBYA 3WGNA 4LOAA 3WKDA 3F47A 4RH0A 4BJ1A 3U4MA 1E3EA 4ND2A 3VPGA 2AJ8A 1N9KA 1DEXA 3VR5H 5LXTA 5TLSA 2AZXA 4FDLA 1KI6B 1TA0A 1OC2A 1PT9A 3BORA 4HO1X 4KQGA 1SIOA 3T61A 1ORIA 1VXRA 1ZGZA 1N3BA 4FE4A 2EJTA 3HR4A 3TZEA 4GE0A 3ZCQA 2BGRA 1GA6A 1ECBA 2V54A 1A5BB 5F2NA 3NV9A 1YB4A 2OECA 5JXWA 2AEEA 1QE3A 5CNMA 2FCRA 2J6CA 1NSYA 2J0EA 3OJLA 1Y33E 2WG0A 4KBFA 1JL3A 1JPUA 3FUUA 2TS1A 1KOGA 2Z5FA 3K20A 4O2BB 1RRPA 5BNZA 5KB3A 1LI4A 3PUKA 4TVOA 5JSKA 4YRQA 2BOVA 4AMUA 5FTWA 4QSMA 1GQYA 4RK1A 1Z7BA 5EKDA 2Z9CA 4BEBA 5BW8A 5F9HA 5DW3A 4P9NA 5GONB 1N32B 5EP2A 5ELXA 2PX4A 3KJFA 4HGNA 5B4TA 1GRNA 5BP7A 1SVNA 1BA3A 4FKMA 1GPAA 1KK0A 2LR0A 4FK8A 4JUCA 3KQOA 3H5NA 3I53A 1RXEA 3NBFA 4KLZA 3QVKA 2OLJA 4OP1A 3WWDA 1Z4JA 3C5CA 4BMVA 2OYCA 4MQEB 1YL5A 5H82A 1GZ7A 2J07A 3DUWA 3O1JC 4LZZA 1IM2A 2NNWB 3UBMA 4EA7A 2H7YA 2QB5A 3IEXA 3SSOA 4UQOA 1NDHA 2ZQ5A 4KOEC 5KC9A 1DQNA 2WBLC 4XFJA 3W5BA 4QATA 2C4TA 5CW2A 1YL7A 3GRKA 3GEIA 2HQRA 1RYZA 1UXOA 4P54A 3V8PA 5A0VA 2PXXA 2PUGA 4FUQA 4YAIA 1P6UA 3AGPA 2ZRBA 1KARA 4AC9A 1FP4A 2H5IA 3ZV3A 1I5EA 2CDCA 4C0WA 1P29A 1E1NA 3NZEA 5GM2A 4DCMA 1QQ5A 2FUG1 1SHZA 1U2QA 1VL6A 3CKKA 3F5DA 4MV1A 1M54A 5EA2A 1QTIA 1OF1A 3ZGLA 4P38A 1P1IA 4TRJA 5JD6A 2HPVA 5IJAA 3A25A 1DCTA 1OASA 3WGUA 3ZW9A 4C0AC 2VTBB 2X0FA 3TVYA 4MAMA 1XHLA 2IQIA 2ZR9A 4BNZA 4ZVTA 1FFWA 1RYYA 5GJWC 1TCVA 1SCIA 4HNRA 3SVZA 1M1YA 4GYJA 2RHLA 3SM3A 1XDWA 1PFWA 3EJWA 4DIOA 4YBZA 1TT7A 1DO2A 5G53C 1SU4A 4OLJA 1RJGA 3SLKA 5JJIA 3G8YA 3OX3A 4DDTA 1BWPA 5I4KA 1QIMA 1PGQA 2IIPA 2YVKA 3PNYA 4RENA 1TM4E 2HIHA 2MSKA 2PJUA 2WLSA 3MJFA 3Q3EA 4I1IA 3S2IA 4AF7A 5KEIA 3C7CB 5FT9A 3ZXYA 4N9WA 4RQTA 1MRZA 3ZJ5A 1ADGA 4U7WA 3V42A 3C39A 4UPDA 1YK0A 2I7CA 1UWLA 3EXFA 4OM7A 4XLLA 4TTAA 5B55A 2B3DA 1HV8A 1ZICA 3RTBA 4IJWA 1JN0A 3UWOA 3DF7A 2NXNA 3BRCA 4P7JA 2DTXA 3SDSA 1NI5A 4Z1MD 1AK9A 2OM2A 2XF8A 3PKIA 2JJQA 2BTOA 3QKTA 3Q7QA 2NM0A 1KDYA 4YUYA 3G5MA 1YB5A 2P0YA 2IYNA 3NAQA 1M2JA 2HJ9A 2QHXA 3ENKA 3FSJX 3M6UA 3T7EA 4AJJA 3KX2A 3W9UA 2GOYA 5FA8A 4KIFA 1D2GA 1WSBA 1O3YA 3QYFA 3D8TA 1L5VA 3T3GA 4DN6A 1IYZA 2CN1A 2DRIA 2QI9F 3E9EA 2MINB 4OK3A 4RDXA 5KJ1A 2P8JA 2R00C 3ZEIA 4EA6A 1LDGA 1V3QE 2EIHA 1QXSA 1FMLA 1Z29A 1C3XA 3KLPX 5GGYA 1I6LA 2OPBA 1UKCA 3WLRA 3KXDA 3TSZA 3CCBA 4LCEA 3S2ZA 3WQRA 4PO1A 4ZVQA 5DGCA 1XNHA 2WLTA 2NUAA 5K3FB 1J2JA 2CDNA 5E3HA 1BDMA 3SNKA 1PNTA 4KUHA 1O96A 2AHRA 5GV8A 1UINA 4HDOB 3C3AA 4HXYA 1ULZA 1AO3A 5GJVC 5C51B 1MH1A 3AF3A 3ZXSA 1JNXX 4WZAE 1JSCA 1K4KA 2G9QA 1TTQB 3W06A 1VQ1A 4B2YA 5KQSA 1N34B 2HWKA 2OGTA 3DDOA 2V96A 3O8QB 2FMKA 4RD1A 3QSYA 2UUPA 1NMZA 2WFLB 4HY3A 4KJZA 1N6LA 1FDTA 1SQFA 4AKSA 3D0RA 1H1LB 4JX8A 2Q1XA 2OAP1 5AVJA 1QIJA 2AFIA 1DARA 2ACEA 1P7WA 1XTKA 1VA5A 4X92A 3UA4A 3P5BA 4YP6A 3ERCA 2Q5EA 3P20A 1Q44A 3AETA 3RS0A 4F46A 1P9OA 3I1JA 3NKLA 4Z4CA 4FFVA 2X8JB 3SLRA 4EAAA 1FY2A 4UOEA 3ZDXB 1RACA 1Z4NA 1DKUA 1Q5PA 2YXPX 3IXLA 3QFSA 4XGQA 3ZGNA 2JK0A 5J43A 2EV9A 4GKKB 1LS1A 1F1BA 4RHCA 2YWGA 2SBTA 3ZVRA 3CZ9A 2PGXA 4XX1A 1XMJA 4UXIA 4A5SA 3H5LA 4IJVA 3CNLA 4EYEA 4F5DA 4WXPA 3LPDA 1N3LA 4YJKA 2YXEA 4CTNA 4R7ZA 4UM8B 2ZYGA 3PFKA 1KI1A 1MB0A 4BQNA 5JCOC 1CC1S 3QEAZ 3STXA 3M9LA 1YI1A 3AZOA 4Y2GA 4G97A 4KRXA 3WBBA 2QUZA 5FBWB 2QMEA 3DE5X 3IUEA 5CM2Z 4XLTA 4V1CI 1E0AA 5ENDA 4L8YA 4MB0A 4ME6A 3MUFA 3QE0A 4NAUA 3R76A 2JHFA 3LCMA 2CHEA 4H18A 3ZZUA 4D9NA 3O4HA 5HOEA 1JPVA 5TMDA 5JISA 1Z4QA 1OHHA 1UBUS 4KITB 1TT5A 1XEXA 3DDNA 3GUVA 4TRNA 5HIAA 3RWOA 1K86A 1X74A 4IV5A 1UKEA 5FWXA 2JLUA 2FPLA 5E6RB 2O3QA 5CYGA 4Y1RB 4AX4A 4Z54A 3WKEA 2FEMA 1JEYA 3RVQA 4N4AA 3K4PA 3LC7O 1WCV1 2PQMA 3K9CA 3NHKA 4PC7A 1RP1A 5IUKC 4PGMA 4HC4A 5JRDS 4F8JA 1V11A 3CN7A 4RGVA 3M9WA 2EF1A 1OU4A 3B1JA 1BNCA 2FPKA 5EPUA 4A36A 1DC3A 2X23A 3EW7A 1GTMA 4QBKA 2Y67A 5F1OA 4B6EA 5KOYA 4LXTA 3V7YA 3BBPA 1FZQA 5A4DA 2P75A 2ECKA 1WD5A 1LF5A 3ADKA 3DWEX 1G2PA 4HNTA 3EQ8A 4I1VA 2B34A 1L8AA 4X1KA 4YGYA 2H6EA 5AW2A 2N47A 1ADYA 1Y1PA 1DWUA 2Y6UA 4GKBA 9GPBA 5JMWA 1H2BA 1QB7A 1BCRB 4RPKA 2Z6UA 3KAQA 4GYYA 1C9MA 3AFOA 5JD3A 2ZJAA 4JQCA 1PNOA 4K26A 2PU7A 1BXGA 5EXSA 4MVJG 1DWQA 2UYQA 2Z6VA 1N3IA 5ADUS 2DECA 1SH7A 2XDQA 1E1MA 2YOGA 1K8QA 2WYOA 4DCUA 5C8YF 1JEQA 3OUUA 1CE8B 1ZONA 4AJ2A 4FSHA 1M0TA 2NV2B 1Q14A 2ZTVA 2CXTA 2EKLA 2IU4A 5CYOA 1GDDA 2F8TA 2XCLA 4QUAA 1HZZA 4M3NA 3EA5A 2IYQA 2GJSA 4WFIA 1TK2A 1AHHA 4XCVA 1V5IA 4BJHB 1JH9A 4HDNA 3AC0A 4GSLA 3DXZA 4RFSA 3VZRA 1U8ZA 3U0VA 1HLGA 5CYPA 2MYTA 4DCSA 1UBNA 3PIIA 4ER6A 1JKJB 5JV5A 2BJHA 4YJ2B 4POOA 3JWGA 2NO7A 5K4GA 1Q7CA 4D74A 3G2PA 4XYBA 4JOQA 4LC0A 4FNMA 3L6DA 2WPDD 4PSUA 1CR6A 1YR1A 2Q9CA 2QLNA 4W1SA 1GO2A 2DBYA 1VB5A 3BTUA 4Z7JA 4JI4B 1HH4A 3EIUA 3QFRA 2FK8A 1AN0A 3AI1A 4NU5A 4Y9RA 3OMXA 3OM0A 5D7NA 1HNWB 4RK0A 1TEVA 1CB7A 2MSCB 4I9HA 1RLJA 2IEDA 5KWIA 1OXSC 1DTSA 7REQA 1GZ3A 4EFMA 1WPXA 1GZ6A 1M6HA 2HOQA 5TQ2A 3ZV4A 4FVTA 1OTHA 1JBQA 2XSZA 2FSVA 4JL6A 1B6RA 4L22A 1UZAA 5AQ1A 4U8GA 1WCIA 1XCLA 4XI9A 1SU7A 3FCOA 4TQUS 1R6VA 4YRDA 1OGYA 1MX3A 4BMXA 4TX1A 1Z39A 1FDRA 2AYXA 2W2OA 1EGQA 2WM2A 2R1TB 2P9BA 4ZWNA 3ST7A 3J81k 3SR3A 1MABB 3GJ3A 4AMVA 2QEQA 1WHTB 2BKEA 2L42A 2REXB 5CJ2A 4DG5A 1DAMA 5CDSA 4KVAA 2UXBB 2NO0A 1IY0A 2P3QA 1L4NA 2Y1DA 2Q6TA 1P5RA 2JI6A 3I01M 4HN9A 4M1TA 4MR9A 4URYR 2OQVA 3W2GA 5IULC 2PGLA 1T5HX 4KI0A 4MUHA 3AR5A 1IUPA 4MYCA 5LQDA 4XRRA 4CM7A 1VMEA 3BXHA 2AOXA 3H2HA 3WGKA 4QOHA 2W6MA 3HL4A 5LQAA 2P6MA 2RARA 3EZ2A 4RPCA 1ZH4A 1UPXA 1JB9A 3MRVA 1AQYA 4RTKA 1Q7TA 4BVBA 4ZT3A 2JDID 1ZINA 3LDGA 5A4KA 1L4GA 1RPTA 1XJCA 1OIWA 3DE3X 3QYAA 1LLUA 3HZRA 3ZVMA 1GXSA 2D7DA 3FR7A 1GLVA 1YQGA 1K63A 2ETVA 4G9GA 4R3UC 3WDSA 2PRKA 1IDN1 4GPTA 4DNPA 2Q3BA 1ZOLA 2R8XA 4I4TB 3KJXA 2OAQ1 4JX9A 2DR0A 1VPTA 4FS8A 4WZAA 3TYXA 4YUXA 4PVCA 3K5HA 3UB3A 5ETJA 3CLUD 1CVIA 3JZAA 1S4QA 4RK5A 5FEMA 1C9EA 4YMWA 1ESDA 1BHSA 4X1IA 2Q9BA 4Q4AA 4HLUA 4ITVA 2JBAB 4WT7A 5LYJA 2CMFA 2V5VA 1TK3A 3GZJA 2JFZA 1W76A 2G17A 4RHYA 3ROZA 1V45E 1WXIA 3OX4A 2WJZB 4EA8A 3ACBA 1DC7A 3BCHA 3E9CA 4R9NA 5FPYA 3WRVA 1UDAA 2YJGA 4BAUA 2GYYA 3BDVA 4AULA 3DNMA 4DARA 1TM2A 5FUXA 4EQ6A 1KYVA 4DZRA 2TMDA 1I7NA 2PQ6A 2IKQA 1XEWX 4NE2A 4B6FA 1NMQA 2O2IA 3R20A 1KY3A 3PE3A 4JELA 1PYOA 3JRWA 3GL9A 3R75A 2D1SA 1OLXB 4C01A 4G0VA 5DBFA 3IXMA 3DULA 4AM8A 1FS5A 2OBNA 4NMHA 1ADJA 2R79A 1WF6A 3GN1A 4NLLA 4A91A 5J3JA 3C3MA 1W7AA 2NP6A 2P6NA 1QPZA 4G8BA 1NNSA 2QLFA 1BJRE 1RCTE 2AD5A 4QT0A 3BG5A 2EATA 3FHCB 1B8VA 2GI4A 2XB2A 3T7SA 1K06A 2WP8J 4QARA 2IXDA 3HFJA 5ELMA 4AAYA 4UCFA 3QW4B 1QV6A 1E2BA 5JAIA 1RKUA 1BD4A 1DX9A 1RQGA 1U5CA 4U5QA 5T5QA 1PJZA 1PJSA 5BSUA 5C35A 4PZZA 3IUBA 1BFDA 1U0SY 2CF5A 4M1MA 3Q0TA 1U1IA 2A30A 2F4VB 4PN7A 3EG9B 2V65A 2J4FA 3BK7A 3ZI0A 2FEXA 3COSA 1DAGA 1I3LA 1T9GR 4R68A 1Q50A 4OXKA 5TVGA 3NHYA 3LUJA 5F9MA 5KSYA 1QSGA 2B9VA 3RLFA 1C1DB 2IY8A 2C54A 4B6RA 1KR2A 4GP9A 4XCXA 1WPGA 5FPSA 4MS3B 1N0VC 3HB0A 4YR7A 4L78A 4DMFA 2ZIVB 4PPYA 1GU1A 2GARA 5CYFA 3QEBZ 1ZI6A 4UUNA 1SC6A 4Y6PA 3T7KA 2AEFA 4WKGA 3ZDEA 2QMUA 1RBZA 5F3RA 4TVSA 4H7KA 5KYWB 1MZPA 1KEVA 2NV6A 1PFGA 1DTWA 4XDHA 1ORWA 2AJDA 2YOHA 4ARZA 2PRZA 3DO6A 2QUKA 2V5AA 5FYDA 1DG9A 4PICA 3TQTA 2OVBA 3HXMA 2CLDX 2FWMX 4FQ8A 3EOAI 1V35A 2DT5A 1VFNA 3F49S 2CSUA 2OBBA 3KD3A 3PIDA 1PLLA 5E2BA 5B1HA 5F3WB 2JGEA 3ZJVA 3AM5A 4OP3A 1D2RA 3RRZA 4CR6A 4PO8A 1IAQA 1PEKE 1O08A 2CK3A 4LY3A 2WMNB 1M33A 4LQLA 3ZXIA 5HYVA 1IQRA 1X92A 3BA1A 3GGSA 1NI4B 3HLKA 1CUWA 1XVAA 4F4CA 3B6ZA 4MRPA 5HEKA 3MYYA 2NIPA 4AQ7A 1N2IA 1JIVA 4Y7DA 2WIKA 1U2ZA 1VJCA 4Y2JA 2DG2A 4FZ3A 4DBLE 5KTSA 4OIMA 1T5DX 3GJ8A 2P68A 4DJFC 3O4JA 2FETA 4X1OA 1D0IA 1Y80A 1DAPA 3W4JA 3CONA 5IT4A 4UZSA 2D5BA 2IC5A 4HDKB 1JUDA 1V39A 1NR5A 2G5TA 2QIOA 1BU8A 1T5OA 4NYMQ 3T12A 3HEAA 4CL8A 4HV4A 3QZUA 3HCOA 4PYNA 5H3LA 1WM1A 3MFQA 2RAUA 3EMDA 1XP8A 3DXYA 3L6CA 3CZ4A 4JMPA 3I2IA 2QE7A 4Y2XA 3CX3A 3IO5A 1VBKA 2VT2A 3DZFA 4N3CA 5EJFA 4J2TA 3QPUA 3ZNNA 2OKCA 4WCVA 3R6DA 5H0IA 4S05A 2CV0A 2O20A 4N65A 3E2IA 4N54A 3HJBA 3IODA 4QFBA 4FSDA 1U0NA 1QU2A 1OI2A 4DQXA 1J2UA 4Q37A 1L1QA 5CIQA 3T1OA 2R48A 1RD4A 4NC9A 4OB8A 4RQBA 2X8AA 3NTUA 4ZC8A 5KAMA 2FWJA 3AFIA 3B2NA 3QLUC 3R2JA 4KAFA 4HJRA 5ESWA 1UPAA 3H75A 1Z37A 3N2NA 2QD5A 3H5RA 3RI3A 4NBUA 5FEUA 2KE5A 3ED5A 4M46A 1Z4PX 1QZUA 1GUAA 3CGWA 3I5AA 4WIAA 3UMSA 2AJLI 4DCJA 5LB2A 3NGXA 3NH6A 5ALTA 5EP4A 3QWFA 3ZJUA 3LQRA 4KYIB 2I33A 3K0EA 1BVHA 4R98A 3EK2A 4OU5A 1W49A 4J8PA 1P7YA 4IH4A 3EZ7A 3F9IA 4BNDB 4CQMD 4XWWA 1NVDA 5DKFA 1NRXA 3BMQA 1I51A 2WKRA 1CUUA 3IOYA 2ZUVA 4HI0E 5F9FA 2XWJI 2AG0A 4TV9F 4RL4A 4H3KB 4DT1B 5LOVA 3LS2A 2H0RA 2FPRA 1T1GA 1XEWY 5JDCA 1EFCA 2B35A 5BN1A 3U9SA 4XVHA 2ZU6A 2NQTA 1B8PA 1MO2A 3ICCA 5DIFA 1NQAO 1DGQA 4NSNA 1C0PA 2P2YA 4GWGA 4HQOA 1I6KA 4X54A 1ZIOA 5L3QA 3I83A 2BE7A 4ENQA 4JT9A 5BV2P 3UKOA 1L4HA 2WUEA 2QSZA 3H6GA 3E2PA 1GFSA 3JYNA 3PPVA 3TNFA 1K68A 5KQRA 4QDTA 4ILEA 2QSJA 1PEAA 2D1QA 1C7JA 2HB6A 5J9FA 4DDUA 3GLGB 4DV7B 1ZL0A 2NW6A 1CNEA 3GZNA 2OQ2A 4B4WA 3OFKA 2GD2A 1TGVA 4NFHA 2Z2JA 3CHYA 1J8QA 5CLJA 1F48A 3EXG2 1Z3IX 2I3ZA 3A6ZA 3R5KA 3KXKA 4ZT2A 2PNJA 3S1AA 4C0LA 2GA8A 5ADVA 5IBPA 4EYOA 1BXZA 2FFAA 2VHYA 4JB3A 4P4NA 5B12A 4XWTA 3T9AA 4UFPA 3CH4B 3O8CA 1DRUA 3HDQA 4B9EA 4F2HA 4O0MA 1Q0QA 4X20A 3VC7A 4HEHA 5H9WA 5I7WA 3S28A 2QS9A 4A0HA 4TL8A 3U4QA 4PGGA 3FFXA 2Z6QA 3M33A 4FIDA 4LDRA 2CZCA 2C7GA 1YNOA 5C8YA 4RZHA 1P33A 4GNKA 2OO3A 1OIVA 4ZHQF 4TYNA 3MCTA 2DWCA 3ES9A 5K5EA 1EHYA 4JJ8A 4YTEA 3UANA 4WCFC 1M0SA 2N0SA 1WQ1R 3D3NA 3GGPA 5L3VA 4MO9A 1P61B 2W71A 1UP7A 4TTRA 5HJ5A 3IKVA 4B85A 3FHJA 1QHYA 1I0LA 1XVVA 1GQQA 1KK1A 2YJZA 5D1HA 2GESA 1XBTA 4B75A 5L8VA 3FW1A 2B1JA 3KPUA 4KI7A 4N0MA 3SHFA 4OI0A 2JFQA 1IM8A 4Y0NA 5G2OA 4U9HS 3S29A 1SVSA 4OYRA 3M4XA 2Z98A 5CH5A 1ZSYA 2BEJA 1PQYA 2X6QA 2IYVA 4ERXA 4F96A 4ZDWA 1VP3A 3F3YA 3FH0A 5K3OA 1BOFA 4OXYA 1PJAA 1SVLA 3BCUA 4AIIA 3VNUA 3E3AA 5EXPA 4KMOA 3RW9A 1GZ4A 3GROA 2FPUA 3KDSE 4WNIA 2CGEA 4QJ3A 2JHPA 2XZPA 1WW2A 1HWYA 3S27A 4DIKA 4NS1A 2FP4A 4FFDA 3A9SA 1D9XA 1N1MA 2HO5A 4DOMA 1I9CA 4OUDB 2HQ1A 1XROA 4B33A 3Q15C 4E22A 3QWAA 3MXOA 2VP5A 2W6QA 2HT6A 3HWX1 2Y1EA 3UB2A 2YIDA 4Y9TA 3PQ5A 1C4OA 4XJVA 5JO9A 5IF9A 5IKPA 1JQBA 1NC3A 1R0KA 4NFSA 3W04A 3ZBQA 3ZIAD 1H0RA 1KJ9A 4I08A 3L8GA 4HNAB 2I66A 4PQYA 2ZRJA 4OQFA 1Z62A 4IO1A 4EENA 4JI3B 5IS2A 2VRNA 4IEFB 4FYPA 3R23A 3YASA 1DG3A 2E1RA 1KAHA 1F8XA 3QKRA 2HJRA 4JGGA 4LRWA 3SYLA 3SYNA 4PF1A 2PKCA 4DF3A 2PQ2A 2V9CA 3KYIB 3CH6A 1SAYA 4GPIB 4Q47A 4BBJA 5IM5A 3MTGA 4FBMA 3AVTA 1DXOA 1SNYA 3DTNA 4C4PA 5F2EA 2DUUA 1WZNA 1I13A 3CLTD 4M7RA 3T38A 3SYRA 1WETA 5MGNA 2RCNA 3UXMA 2Q3FA 1UBMS 3HABA 4UAVA 4BKQA 2A35A 3DBLB 2JI9A 3VC2A 5HVNA 1TW2A 1JTVA 3V48A 4QVIA 3PPIA 5AKIA 5JARA 2IGBA 2JFHA 2YFYA 1X38A 1USUA 2GM3A 6CHYA 1X1QA 3L41A 1KYZA 2JJMA 4MDEA 2J5KA 2VG8A 4LJLA 2AMYA 1XG5A 4FDAA 3UYLA 4JC8A 1DTEA 3BH6A 3L0CA 2AQKA 2C7PA 3BXEA 3M2PA 5IHXA 4MWEA 1XTTA 3R7WA 3VPDA 1SXJC 4PLYA 5CT6A 5H8WA 3PEWA 1YU9A 1SKQA 2O1XA 3H9EO 4EY7A 3T7RA 2F64A 5CVCA 4WJLA 4LJ8A 4UUQA 1UEIA 3ORHA 4BCBA 1B0ZA 3TEJA 4BVHA 3RQIA 2CCGA 1CQXA 4QQRA 4LJ5A 4TUYB 4R83A 3ZK8A 1MLDA 1IY8A 1GRQA 1U5BA 3AKYA 5LQKA 3UK6A 3ZUPA 4RA9B 4IIEA 2H2DA 5KKCA 3KQYA 5K8TA 2Q5QA 4KO8A 2WV7A 4LXUA 3FDZA 4O4JA 4PZYA 1VJ1A 4XYMA 1R10A 1WY5A 3ELWA 1P9NA 4K05A 3W4IA 3WJ2A 3UUGA 1PBTA 5BV1A 5DHSA 1XZKA 4A8JB 1BQ4A 1W87A 4MUNA 5K0SA 3FYCA 4JI2B 2P5SA 1NQ5A 2UZ1B 3IKMB 2ZYUX 1E9RA 5AVZA 4GOXA 2G40A 1EWKA 1NXTA 5AW4A 1RXVA 3PX2A 3EDRA 4LZWA 1F2DA 1L7NA 1P0CA 5IDYA 4YAEA 3K15A 1ZVKA 5HPYB 2ZSFA 4FC6A 3FXAA 3HRIA 2BFEA 5FYQA 4RJTA 4XB2A 5DNEA 2RJOA 4CF4A 3ECCA 3WIVA 1DIOB 3G3EA 3R44A 4P08A 3FI9A 3W6OA 2A88A 2LGJA 4EB3A 4C7OB 2EW2A 2MYUA 1C7QA 1PGNA 5DX1A 1G16A 1KI2A 1XPOA 1YVPA 1CS0B 3DG9A 2PZBA 2JK1A 3GLTA 4COOA 2ID4A 4Y0AA 3LLVA 1G5IA 4QULA 2IP1A 3O8NA 3VZSA 2JF0A 1L5YA 2RHRA 2CLCX 3LKVA 2AWNA 3OOYA 4YJ3A 4F86A 2HLHA 1AQUA 1B73A 1X1DA 5KNDH 3RT7A 4EHFA 2XGOA 3AP3A 1E9VA 2FOXA 3H5VA 5JBNA 1NYTA 1UWCA 5CDGA 5IXSA 3A4YA 2RHWA 1DRJA 3CZQA 3SZRA 4AJHA 2WYIA 3H99A 2INGX 4WY8A 2DC1A 5IJ9A 2NAPA 1UBTS 1MEJA 2W8BB 4FGZA 2JJ8A 2PL9A 4FGWA 3OFJA 4K40A 3SXUA 4IO0A 1RQ7A 2F90A 2JFYA 3BRSA 2I2BA 2FEWB 2H1HA 3ENQA 1U90A 3GGCA 3NP9A 3TXXA 5JTUA 1RI2A 1V95A 4LX8A 5TF4A 5T67A 3ND9A 3LA6A 2C78A 3FTCA 1LPPA 2IK8A 3GVCA 4P93A 1CZKA 1TLLA 1R6BX 4QBTA 4DQVA 3ILVA 3DTYA 3H0EA 2FZ4A 3MGKA 2XH8A 3Q3GE 2X9GA 4O3FA 4YB8A 5DM4A 2FWNA 2J5RA 3M4ZA 1RR6A 1SQ0A 2GCOB 4R9VA 5C1PA 1ND5A 4H1TA 4L5CA 3R77A 2KHZA 1CJBA 3W6UA 1JLLB 4Z4GA 4F6RA 1YHZA 4TGLA 1O6CA 1EDEA 3AT1A 1RU3A 3A4NA 3CR3C 3S5JA 2Q27A 1WUHS 2H07A 1CLEA 1I4WA 4X94A 3EN0A 2BLNA 3Q1KA 1NW7A 4Y2YA 5HILA 4D99A 1CDOA 2I71A 5A7GA 5EFZA 2Y99A 2ZR7A 3QXSA 2GS9A 4LFCB 2KLHA 3EQZA 4EG0A 1QYCA 1M34B 1NVTA 4QNMA 1T5LA 4GM4A 4LGMA 2OXEA 3TZCA 4YMIA 4NDAA 2QAJA 4RM2A 2EBHX 3PQ8A 2RIPA 3TJMA 1AC5A 3H8VA 4YJDA 3T8YA 3VH4A 3H11B 4CMGA 3UHPA 4OB7A 1IZ8A 4D44A 3W5CA 2NXJA 1ONNA 1I01A 1GA1A 1TJNA 2EBUA 2X86A 3PA6A 3QQPA 2RGYA 4HX5A 4RE5A 5FOTA 1ZEMA 4Q9JA 2AYYA 2Z8ZA 4MSUA 1A5AB 1F6DA 1L6IA 3FMFA 1NQUA 4PQEA 1KQNA 2OBFA 5BN4B 2GCEA 3SZ3A 4ARSA 1CUIA 4BQEA 2CT8A 2ZRCA 1P9LA 3BTVA 3FVTA 5LIRA 1KXJA 1TZKA 3MWFA 4L75A 1M2NA 3RSHA 3L7KA 1CS4C 1UDRA 3RREA 5C9ZA 1H5QA 5IDWA 3PUHA 1XXHB 1VM6A 1UT5A 2HFKA 3LRXA 2NTJA 4OLFA 4Y8VA 2FW6A 1HTTA 1L7MA 2IFTA 3VI4B 2QXYA 4O4LF 1F2UB 2VJPA 3HFSA 3HXTA 3I04M 2GQ0A 1P4RA 3L1VA 3QPWA 1XJWA 2HLNA 3FZEA 1LBIA 1T4BA 3IBFA 4ID3A 1VMIA 4LF8B 2FN8A 3O4FA 4XDZA 1AKUA 3NIDB 3UFXB 5KREA 1G59A 4BVGA 4E5KA 4EI2A 2C7QA 1LJLA 1K4MA 3VJMA 4B74A 3SZMA 5B7QA 1XDZA 3WWPA 4BX2A 5IVIA 1QOPB 3AXSA 3KV3O 4NNOA 1N6PA 2OMEA 3VV3A 5ECDA 4EPYA 3HWWA 1C41A 4RZIA 5LKAA 3JW8A 1BZYA 4TVKA 4DJ5X 3HGTA 1F8GA 3BCRA 3NTXA 1IBCA 2FE1A 3K2QA 1DI0A 2EXXA 4PHCA 3SQLA 3AKCA 4CIWA 1YZQA 5EKSA 1RM3A 5EZQA 3U7QA 1K3TA 4FFMA 3VUEA 2QY6A 1OZHA 3D3WA 4EOGA 2PSHA 2FW9A 2GO1A 2Q3DA 3B2EA 4HZIA 4MVXA 1IG3A 1DKRA 1Y9ZA 2R85A 1OV6A 2C29D 3KUDA 4P4UA 1R8YA 2W4MA 3HYSA 2LDBA 3SMQA 4A27A 3RADC 3V4PB 2JCXA 3BHJA 4P5DA 4YROA 3B7WA 4K9PA 1AGPA 2Z8YM 1QGYA 2JKYA 3E03A 2VPXA 3R5FA 4IDCA 4IZIA 3DH0A 5AH0A 5REQA 4OCZA 1ICEA 2JCBA 4QJ4A 2B4YA 4FMPA 3UCXA 4DM3A 4ZOQI 5I47A 2IS4A 5TDHA 3JASA 1G2OA 1QM5A 1WAMA 2IW3A 3N0VA 4OL9A 4YJGB 4DEXA 3S81A 4PS1A 2E7ZA 4NPCA 2XCTB 3MLBA 1JLHA 1SVKA 2PD3A 1YNSA 4GW3A 1SA0A 1UADA 4JUFA 3TE6A 1RIFA 4D9IA 4BASA 1POWA 1Y37A 2QPLA 3AG6A 2TMYA 2ZSJA 3DFUA 1EFVB 2RGAA 5EJIA 4N3GA 2AR0A 3VC1A 2BDUA 4K8OA 3O93A 3PNBA 2Q7OE 1SZCA 5F5XA 1PV4A 421PA 4ROSA 1YRBA 5G0SA 1KOFA 2HJGA 1EK0A 4ITUA 4OQQA 2NVBA 2YBEA 9LDBA 4IIJB 1DFHA 3C8UA 3VU1A 1DMRA 5ILOA 1LUAA 4AP5A 5I8ZA 3AY3A 4CMEC 4DCCA 3NFYA 3U13A 3MSCA 5BRNA 3U44A 3HA2A 3V4FA 1ETUA 3L0SA 5ALMA 4BZQA 4U5XA 4N48A 1E1CB 3OHSX 4QIHA 4PRLA 4ZOBA 1SCNE 2QRQA 3V4RA 4NEQA 1ZVJA 1SCUA 2P3OA 3FOBA 4PXAA 3OPYI 1BKDR 1G8YA 3QG1A 3Q8KA 1AUXA 4QFCA 4MULA 2PUWA 2JI8A 5BN5A 4HG2A 4IDGA 1G1MA 1Q74A 3VSEA 1WOYA 3TVDA 1T35A 1NI3A 4PS0A 5JADA 3RJ9A 2GXQA 5J2TB 3SY8A 2MSEB 3QTTA 1L4FA 4R1MA 2I3GA 1K5DA 2O2XA 3SC6A 4CW7A 2A5DA 1F12A 2FRDA 4J91A 4ZMBA 4B4DA 1M2WA 4J0GA 1PD1A 3K0KA 3AI2A 5HF6A 3VNVA 3TBKA 2HPHA 4RVDA 5KYYA 2H1OA 3DR3A 4R9SA 5MFZA 3R1IA 3UUWA 2O3TA 3D3QA 2KBFA 1S5PA 3JQ9C 2FQYA 1DFIA 1P39A 2FEKA 2J33A 2NUPB 4JLSA 4H3VA 4XD2A 4DLSA 3AOGA 1KIMA 4GMDA 2ERXA 1GNQA 3A9RA 2A1UB 2YJ4A 4QOEA 2JD0A 3D7RA 2B3TA 3VHRA 3TEMA 1QORA 1FB5A 3E0QA 1AJEA 2QU8A 4RIGA 3TB4A 4WXMA 4E31A 2ETXA 3MPUA 4L95C 3VYRB 3P9PA 3FKJA 1E5VA 4LAFA 2Z3VA 1XTJA 4LZAA 3GEGA 2P69A 5T6BA 1U9IC 3DA8A 4H15A 2PK3A 4EJSC 1A9XA 1MAVA 1XLTA 3Q3IA 2ZYRA 5TT1A 3IL2A 4Y9UA 4WBXC 5SY6A 1OH8A 1G9XA 3DMHA 5F2KA 3UHJA 4MR7B 1WXGA 3QNUA 4JUBA 4OA8A 4C1BA 4UNNA 2EC5A 3MJTA 2AZ4A 2B1IA 5CMLA 1U8CB 2EFYA 5DGIA 2NNLD 4RACA 2MSWA 1QANA 3IDSA 1Y3AA 3BL6A 1JAZA 4G85A 3AEZA 1E4EB 1U8UA 2V4ZA 3F5QA 2PMKA 3F98A 1EVIA 2NT3A 2ZXFA 3D8NA 1E2MA 1U3TA 1OAOA 2C84A 2G8NA 3PT5A 3TNYA 2XRZA 4F3RA 3V1LA 4JQZA 3OJOA 1YV9A 3H4TA 1FUEA 4C5CA 1VIMA 1AD2A 1VIYA 3C6XA 5FTJA 5DO9A 5DGTA 4ZQGA 5FL7A 3JQGA 5CA1B 3FTFA 2VUSA 1K6JA 5JUWA 2QV7A 6REQA 2BP7B 2M1XA 4Q7QA 1MB2A 1KS2A 3WR5A 1NBAA 2XGMA 4BQSA 4IHJA 2YXNA 1KE2A 1NOJA 5FBKA 2XDAA 3K9GA 2HWWA 4ESHA 4IDQA 1OJ7A 3RYHA 1EXVA 1U81A 3GPBA 1ODIA 3NASA 5GP1A 3NJ8A 3HP1A 4YHBA 5KTPA 3T0GA 2ZITA 1K6XA 4JR1A 2PX8A 4QE3A 3VR6H 4BJ3A 3L0OA 2WWYA 1N2SA 4ZT7A 4CKWB 2I80A 4DM7A 2BPOA 4ZZ2A 1SN7A 4OH7A 1T1EA 3I5XA 3O2JA 1R8XA 4M6WA 2GPBA 3PGXA 3A6EA 2BCJQ 4E5NA 5GZ3A 5GIOE 1OXUA 1RHUA 3CCCA 5BN3A 1MOSA 2ZSKA 2PANA 3CEJA 5HCIA 1QK4A 1LNQA 1T2UA 1T8TA 5EMLA 1PRYA 3OBIA 3DBVO 2IH5A 1NV8A 4J0KA 5CLLA 1S9HA 1KDVA 3VV2A 4KFUA 5EXXA 3RVPA 4OGFA 4PG5A 4K9LA 1F20A 1S8FA 2YHUA 3G85A 3VI3B 2PKQO 3NHZA 5JAHA 2XD9A 2CNOA 1VCHA 2LIVA 2PRJA 4HXEB 3MBKA 3TB6A 3ABSB 4R5MA 4OHYA 5AXBA 2W48A 1R4AA 1F06A 1OXKB 1BS1A 2QAGB 2WZBA 3I9MA 3IT3A 3QXHA 3QEOA 1ZS9A 4GL2A 4Q7LA 4NCXA 2HO4A 3RVLA 2ZI3A 2WI8A 3EVTA 1T0BA 3N7UA 3O4GA 4ZVNA 4IX1A 3SP1A 3DT9A 3T7TA 3TLKA 4C4XA 3ZHSA 3N05A 7ABPA 3SDZA 2AHOA 2R3SA 4BNKA 1E1RD 1L7PA 3B7PA 5FQNA 4CHTA 1I7PA 2OTCA 2Z5VA 4JD5A 1E99A 3HN6A 1OXBB 3HNPA 3PSHA 3QTBA 3VBCA 4B3XA 4ARCA 2CXUA 1P7CA 1RBQA 4ZEWA 3U4AA 1NXWA 3DBOB 1WZEA 1AGXA 2HBQA 5ADHA 4LF4B 3BWEA 3RH0A 3LGSA 4D1YA 5CLFA 1N7HA 2A92A 2ZPTX 3BSSA 3DVSX 5FA5A