2OSVA

Crystal structure of znua from e. coli
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
283
structure length
262
Chain Sequence
b'AVVASLKPVGFIASAIADGVTETEVLLPDGASEHDYSLRPSDVKRLQNADLVVWVGPEMEAFMQKPVSKLPGAKQVTIAQLEDVKPLLMKSDFNMHLWLSPEIARATAVAIHGKLVELMPQSRAKLDANLKDFEAQLASTETQVGNELAPLKGKGYFVFHDAYGYFEKQFGLTPLGHFTVNPEIQPGAQRLHEIRTQLVEQKATCVFAEPQFRPAVVESVARGTSVRMGTLDPLGTNIKLGKTSYSEFLSQLANQYASCLKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords High-affinity zinc uptake system protein znuA
publication title Crystal Structure of the Zinc-binding Transport Protein ZnuA from Escherichia coli Reveals an Unexpected Variation in Metal Coordination.
pubmed doi rcsb
molecule tags Metal transport
total genus 89
structure length 262
sequence length 283
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2osvA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2osvA02
4TKUA 2AFHB 4IRMA 4MO9A 3GI1A 4MX8A 4FNAA 1TOAA 1QGUA 4B8YA 4WN9A 2XDQB 4ND8A 5I4KA 3MINB 2MINA 4INPA 4UDNA 1QH1A 1G20B 5JG7A 2M6LA 5M3BA 2XH8A 2OV1A 1K7SN 1MIOB 4WZBB 4XPIA 4NNPA 3R5TA 3HH8A 3AEKB 1L5HA 1KARA 1N4DA 3AEUA 1K2VN 3LI2A 5BVGA 3AETA 4MDYA 5AFSA 4H0FA 5FLYA 3AESA 5BVHA 2X4LA 5B58T 4FKMA 2O1EA 5CR9A 5JPDA 3PDIB 2PS9A 1G21B 4G09A 1QH8A 4G07A 4HMOA 3U7QA 4UTPA 1XVLA 3K1AB 4WNAA 4N01A 2ETVA 4GICA 3EIXA 4UDOA 4TKVA 2AFHA 3HXPA 4NNOA 1M1YB 2OSVA 1M34B 5JOQA 1K0FA 3UJPA 4HMPA 4WESA 5KOJA 2XDQA 2YNMC 4TKUB 2OGWA 3TLKA 1ESZA 1G20A 1H1LB 1MIOA 3AERA 2AFIA 3PSAA 4MLZA 1QGUB 3AEKA 3ZK7A 3EIWA 3HJTA 4K3VA 5GGXA 1N4AA 2WI8A 4UTOA 1QH1B 1N2ZA 4XPIB 4WZAA 5HX7A 2XV1A 3AEQB 1L5HB 1N2CB 2OV3A 3ZKAA 5BVGB 5CX1B 3ZTTA 3K1AA 3NU1A 1FP4B 2XQVA 4LJSA 5BVHB 2QI9F 2R79A 2PS3A 3U7QB 1KAHA 2Q8QA 1M1NB 2PS0A 4INOA 2RG7A 5KOHB 3ZK8A 1EFDN 5GGYA 3MINA 5HDQA 2WHYA 2YNMD 3MD9A 3MWGA 4FILA 2M6KA 4HMQA 4WZBA 4FI3F 3PSHA 4TKVB 4M7OA 4BBPA 4WN9B 4DBLE 4ND8B 1KAEA 3ZK9A 2XUZA 2MINB 3CX3A 1H1LA 2R7AA 3LHSA 5M29A 4WESB 4CL2A 5KOJB 2XY4A 3PDIA 1G21A 2PRSA 5KHLB 3AEUB 2PHZA 3AETB 3R5SA 3AERB 2AFIB 3AESB 3MWFA 3AEQA 1N2CA 2Q8PA 5M34A 1QH8B 3MFQA 4OXQA 1PQ4A 3G9QA 5CX1A 3TEFA 1FP4A 4OVKA 4WZAB 1M1YA 3BE5A 1M34A 4PM4A 3TNYA 4HN9A 4WNAB 5M2QA 1PSZA 4H59A 4PAGA 4OXRA 5JJ5A 3BE6A 4LS3A 1K75A 1M1NA 5KOHA
chains in the Genus database with same CATH superfamily
5MF6A 4RK4A 3RFFA 3DYVA 2H2DA 1T8PA 4D9BA 4BNWA 1E2MA 3CG0A 4KEAA 1EM8A 4ZQGA 2RGDA 3CB2A 3MS4A 4CFSA 1K8QA 4FGLA 3DOCA 2ZVDA 4EFDA 5TQ2A 4PAQA 1R0RE 4LVUA 4FBMA 3LECA 4GZ3A 1ZH0A 4M99A 2HZBA 2JJ2D 1N6PA 4R8MA 4C4TA 5AIBA 4K9LA 2PH5A 3QWHA 4NMHA 3NHBA 1EP1B 4XQCA 3GP8A 3OQJA 3P0HA 4UU7A 2RCYA 2ZPAA 4K9OA 3PEFA 1IN8A 5DTIA 9MHTA 2BKLA 5DEOA 3GLIB 3W8FA 2XCRB 3HYNA 3QTBA 1FSGA 3QU4A 5CBPB 1G8FA 3A4MA 1E5DA 1C1HA 2R00C 2XOKD 1BEEA 4M0FA 5FLKA 4FJ1A 2YYAA 3AJRA 3E03A 3A4NA 3K1AB 2WTEA 4HFNA 1VJRA 1QQBA 4HDMA 1AB5A 4KE7A 4F4JA 1FMFA 4PGAA 5F2KA 3EVGA 2R751 2ZREA 5IYZA 2F9MA 1IBCA 2CBXA 1TU4A 1G8JA 2XKJE 5E6UA 2GAOA 3U31A 2REBA 2ZUTA 1JJBA 2AQIA 1JLRA 5A7GA 2PEYA 3WHLA 4WASA 4DB4A 1WG8A 2ACEA 1WO8A 4DWOA 2BHRA 3K71B 2ZWOA 4OHRA 1E98A 3CH4B 3Q10A 2C94A 5DHTA 1GQFA 1EAMA 2IRWA 2R6R1 4I99A 4UE2A 5AI8A 2LTAA 4PE5B 3SFTA 2QE6A 1NJFA 3PJGA 1IEQA 2XTZA 3FSJX 2FMXA 2HCFA 3E4CA 1L0BA 3N75A 1E3WA 2VTVA 3Q2OA 3UXHA 2IYQA 2DUMA 3V6LA 2O7VA 3ICEA 3VNUA 1ZNXA 1E4YA 2HV8A 3UY4A 3ZNQA 2OC9A 4KXNA 3B20A 5JVDF 1WUTA 3IB3A 3U1BA 3I62A 5LXTF 2GBLA 2GK6A 3EGIA 1AK1A 3COZA 2Y4NA 4MV4A 4BB9A 2AUNA 1NR7A 1CJBA 1JEYB 4AF7A 3OZSA 1YT5A 3FYDA 5ALMA 3C15C 1M10A 1UDXA 2BI4A 2DQYA 2GPWA 4M4SA 1G59A 3ETCA 3FNFA 3G5MA 4PBSA 2Q3DA 3DAFA 3MJ4A 2V55B 4M7RA 2WR8A 2R7NA 3NIGB 3VPDA 2DBVO 3G2KA 4XZ3A 4H1TA 4UCXA 3C39A 2VP4A 4REOA 2GHTA 2V7WA 1YA4A 3RYFB 5AYVA 5IDYA 4H7PA 2V7QD 1G291 1NBHA 4MLPA 4ZI7F 4JBHA 3AF6A 1ZMTA 2J6HA 2BKEA 4CIDA 4HTFB 4AKSA 2WWYA 4WXRA 2AJCA 1JV2B 2ZBGA 3ON5A 1RI5A 5F2OA 5K4HA 1BW9A 4RF4A 3LDGA 4M1WA 4RY2A 3VGPA 3PNMA 1ZSVA 3HTXA 4H6WA 4O08A 1VSTA 1J00A 1Y81A 2X8JB 2YWFA 4ISCA 3RAFC 3BSFA 3B6ZA 1E9BA 1EP3B 1WRBA 2PV7A 2VHWA 1T2CA 1RPTA 3C74A 1M0SA 3DZHA 5DZSA 3VNSA 3VAYA 4ARUA 4E7PA 1SXQA 4LFBB 4A8PA 1A97A 1PK9A 3CZQA 5KSOA 1U0RA 3ANXA 4IMJB 1R3UA 5KYXA 1KEPA 1YCHA 4ID9A 4Z0TA 3SQOA 2QU8A 4TTQA 1RJ9A 4G1FA 2DJ5A 1TKBA 3I39X 4JITA 1AS3A 4RPGA 4WKOA 3WRXA 4TMWA 3RRMA 3R09A 2VK1A 5EMHA 5AJYA 5ELLA 2C2WA 4YXFA 2G9QA 4ZD6A 3QXGA 4O4LA 3VR6H 2AZTA 4MB0A 5T4BA 3UXMA 1MKYA 3OFSA 4G8JA 3CMMA 4A0RA 4JUFA 4FOTA 1YQEA 4ZT2A 2Z2XA 2QNRA 2YY7A 4EG3A 2H4HA 1PN3A 2X23A 3IURA 4JGBA 5HW0A 3LA8A 5BORA 5J43A 3F6BX 3UMBA 3OEEA 3ZDAA 4YDHB 4AI6A 2VH1A 2Y9MB 1EFAA 4M87A 4S1TA 1F3OA 1MABA 1PEYA 4GWLA 4L8LA 3COVA 2VBFA 5EWMB 4CKEB 1JWBB 1STOA 3OOSA 4RLQA 3OF5A 2BFFA 3L07A 3ZE8A 1E61A 2Q6OA 3P45A 4OB8A 3D8SA 2K87A 4G0PA 3AVWA 4IX9A 4RTPA 4CM7A 3BX1A 1ZFNA 3DEFA 2IH5A 3ZVKA 3OU6A 5LU8A 3IUNA 1TECE 4DG8A 1ZXLA 4JP8A 2WB4A 3G8DA 4GP7A 4RTKA 5ALTA 1NBME 2YWEA 1Q20A 4PXSA 3B2EA 1K5PA 2EKPA 3PCTA 1CUJA 1LK0A 1XMVA 1M34B 1TZBA 1TZCA 3Q2IA 4XB6B 2LPMA 4J7AA 4RD3A 4BB5A 1TM3E 4QBTA 1H23A 1BAPA 1BA3A 2AVNA 3G59A 2W6OA 2DZDA 3I6YA 4Y2UA 3ZWDA 3IVMA 2VJDA 3H2IA 3RK4A 1EJ0A 3W9UA 3IRUA 3FOZA 4QU8A 4EGSA 5BR8B 1OXXK 1PZNA 4ZI3A 3I2FA 1PWHA 2RIPA 3I09A 2FN7A 4EKYA 5ICMA 2GCNA 1T9AA 1ZL2A 1CNFA 2OORA 2XQJA 4Q3EA 3PDHA 1M0WA 5E9WA 1UUFA 2XUDA 4ZV9A 4AULA 4DJDC 4QLBA 2BD0A 4URHA 1WKCA 1R8SA 3RNLA 3RSSA 1SFRA 3QKRA 1Q12A 5FULA 3OCVA 2VNIA 4LQLA 3DZKA 3ESYA 3I23A 4EHJA 1N33B 3W04A 4ALLA 4UJ5A 4OKNA 4WZZA 1A9RA 4BJ3A 2F1JA 3D4LA 3WKDA 5ADWA 5HOQA 2WFLB 1H5UA 2C7OA 2R7KA 3JU3A 1IN7A 4L85A 5CG1A 1X38A 1NVVQ 3WIOA 1YTUA 1Y5IA 3UTCA 2NTVA 3FH0A 3CIFA 3NIWA 4CF3A 2HHLA 5AOVA 5THXA 3B3GA 3FWHA 3ROQA 4D99A 1HDYA 3OE4A 3CURA 1UOQA 3WYNA 3ICQB 1A4RA 1SBIA 2W22A 2A4MA 2XSZA 2IWHA 1IBRA 3N2NA 2HO5A 3D54D 3SIPA 3U3ZA 2MT9A 1Z5PA 1DBRA 4JAVC 3ABRB 2HPZA 5FADA 4BLVA 5I7FA 2FJ0A 2CVFA 3T1NA 1MQSA 5JTTA 1B0AA 1TVEA 3B7GA 2DULA 2HCTA 2ZYUX 2PMDA 3LX8A 3AUXA 3QMMA 4KODA 4WE3A 4HG2A 1P45A 1O1YA 2PVSA 1KE2A 4GW3A 3V8QA 1QP0A 1NM5A 3WY9A 3W4KA 1DB3A 4E2ZA 2M9MA 4G9EA 3ADOA 2ZCVA 3RHTA 3TOSA 3DFMA 2GNAA 3FKSD 2ZSBA 4JLNA 1BA2A 2H5IA 2L18A 4D6XA 2AE1A 1QFXA 4Q4HA 1KEZA 4EB6B 4E21A 5BYKA 2I62A 3IAS1 1YK1A 3U9LA 1FP4A 4UM9B 4PM4A 4RVUA 5AM1A 5DPMA 2HLDD 3ZDDA 2WKWA 2WJ6A 3D81A 3WLEA 3UCEA 2A59A 5LP6C 4D9IA 5AW2A 3Q3IA 5GINE 3RWBA 1FY2A 4MW6A 3C3DA 4RXMA 1VHLA 1VI5A 1FMTA 4W5HA 5JCZA 2ZIXA 2BLLA 2BMEA 3LC2O 4PHHA 3ZWAA 5LM3A 2ZYVX 4FNAA 3ROGA 4LQDA 1JKJA 4BECA 2P5SA 1E63A 3X1DA 5LBIA 5DT2A 5F2NA 1JTVA 1IJBA 1K86A 1SQGA 1YV9A 2C5SA 3R6WA 1BHJA 2QX4A 4NIMA 1QK5A 1VYUA 2WNIA 4OGKA 4YROA 3DXZA 4PRZA 2VCHA 4RHTA 5EJMA 5JE8A 3WL7A 1DIHA 1GPJA 1JHQA 2VH5R 4TMTA 1QPBA 1S2OA 4MA0A 3R7DA 1M1UA 1MAUA 3V48A 1K2VN 1KWGA 5LXTB 4BV9A 4MWGA 1ZD1A 2DBRA 2NWQA 3TCNA 4EEZA 1V7PC 5KYYB 1BC5A 1DOHA 2DT8A 2FUG6 5IBRA 3VVMA 3TG2A 4DV2B 1GPNA 1CP3A 3TVTA 1UXJA 4URUR 1BGWA 3DT9A 1GYQA 1T0IA 3R76A 2ZQZA 2HY7A 3SS8A 4DCGA 1PTJA 5EGNA 3MPOA 1TUIA 3MWEA 3QUBA 2BSQA 5L8VA 3BH6A 1DC6A 2EARA 3HEBA 1Y89A 5EJ8A 5BV2P 4ACAA 2BFDB 2L42A 2PSHA 3BIFA 4Y2YA 2QJWA 2LD4A 3PUXA 3L05A 2RAVA 3O31A 4TZ0A 1D6MA 4IMRA 1PFQA 3E2PA 4HEHA 2QP3A 2IGTA 3IMGA 3MWYW 3D3NA 2D0PB 4J43A 4BQQA 1ZD9A 4BGEA 4D8UA 5LN1A 2CMKA 4DMLA 2JGNA 5GZ1A 2P41A 3JQGB 4K6FA 1EJ6A 1E79A 1MNAA 5E8JA 1H65A 1E6KA 1IG3A 1JR3E 4WERA 5D3MA 2AOVA 1KK2A 1F48A 4XWGA 1S3SA 3OIUA 2GZHA 4KAFA 1B4DA 4DEXA 2PO5A 5FPYA 1A8PA 1KORA 4WJLA 3NV7A 4GLOA 2OV3A 1PTKA 1EXMA 4PYLA 2DH5A 4MW4A 4F85A 4R7GA 3R7WB 5ULLA 5AW9A 4A36A 5K03A 2V74B 3PTLA 4ND8B 4Q1FA 1DJNA 5HFAA 1V26A 2ZTSA 3EULA 3DL0A 3STUA 4AJ1A 3IAM6 3LPNA 3PL1A 1JH9A 5FA5A 4CCAA 3F98A 5K3FA 2HRRA 4ITRC 4HQKA 3ENZA 3WP1B 2QTAA 3W5BA 4YRPA 3FJOA 2VJMB 2CFTA 1OB5A 1T24A 1POXA 2P4QA 5EYPA 2XMCA 2PX2A 2B1JA 3KX2A 4C6RA 3F6CA 1JB1A 2CVOA 1RS0A 1Y3HA 1M6WA 4F4IA 1MQ8B 4MWDA 3B5JA 3ZXXA 4KWTA 3F1KA 1XHLA 1SHJA 2AFVA 5BXQC 5JCXA 2XUIA 1X7GA 4LOIA 1Z8HA 1E2HA 4WOJA 5IUKC 4BV3A 4AWAA 2H0RA 2ECPA 4JQCA 3QHQA 1PJZA 2NV2B 1ML3A 3FNHA 4JOBA 3VKUA 1G60A 2Z8ZA 2V5UA 1WTAA 4C5CA 1Q0RA 1VFNA 3BG5A 4ENQA 1G64A 5A5VA 3ECAA 3B53X 3WK6A 1XZNA 2RGGA 3ZCXA 1XHFA 4GMGA 3ZCPA 4XDYA 4BEVA 1YACA 3MXTA 3NVMB 3JQAD 1XPUA 4KZKA 4IQFA 1DIOB 3GDHA 5HMLA 3NAZA 2X1LA 4N0EA 5F21A 1QYVA 2AYXA 1WZ2A 2VQDA 3W5SA 3KKKA 1SB8A 3IALA 3C8DA 4P7KA 2Y0CA 4JI6B 3KR0A 2V3CC 1ISSA 3IVRA 5JNWA 1TM2A 4KXVA 7MDHA 3O90A 4QBGB 5ICCA 2AMLA 1O94D 1VJ0A 2IW1A 4GQIA 3O8CA 2X7HA 1CQZA 4BIIA 4NONA 3A32A 1YS2X 2FSHA 3KKMA 1DIGA 5D5PA 5FOTA 2VLBA 4D3FA 4BOYA 2WJIA 3A37A 3WGKA 4F4HA 2DVMA 3OQ6A 4B6EA 4BWYA 5E1MA 1ZGCA 2A86A 3V1TC 4OOFA 3JVVA 1E1NA 2JFVA 4WFJA 3CW8X 3OECA 3T7RA 2GS9A 1XAJA 2OK7A 2HK6A 4ZVPA 1RLUA 4XAQA 2F9FA 4RFSB 3FNRA 3T4PA 2GYWA 2ZYAA 4YAFA 4O4HA 1UT5A 3KB6A 4LJ7A 3CNLA 3EPKA 1DZ3A 1SKYE 1VOTA 3QLVC 4E0BA 3NBXX 1U0SY 1HYBA 4UOQA 4CEIA 1S2MA 5DM2A 4F4CA 4IS3A 3CQ9A 2I2FA 4CCYA 3IBSA 3T15A 2OBXA 2OAGA 2YHIB 5EIFA 4QU0A 4YUXA 1GPMA 4NFLA 4WCFC 1U7WA 2QXYA 1H42A 2WVJA 1M2EA 3MXOA 5G3ZA 3PHJA 3RVLA 2BT4A 1IUNA 2C7VA 1GL9B 4DLNA 4DSTA 3QUTA 4MW9A 3VR4D 4C3OB 5T4EA 3FHTA 5AI4A 3ZU6A 1NJGA 1YRQA 1MHTA 1K68A 1HL7A 4QYMA 4NKRA 5T3UA 2F1HA 2IUFA 2A5LA 5DLEA 3KR9A 5HA5A 4AUKA 1W0KA 1OGYA 1O3YA 2J7PA 2YUIA 4LXYA 1ZK2A 2C92A 3GUVA 5GP1A 2WHQA 3GFFA 4AX4A 3BGVA 4OCZA 5CIQA 3F7TA 1PJBA 3V33A 2OO5C 5BVGB 1TB4A 2CUKA 3SFZA 3IA7A 2X6RA 4U6SA 1K5DA 1RI2A 3HCNA 3EF3A 4AMGA 3PUZA 4YAEA 3W34A 1Q83A 2AX3A 2GRJA 1RPJA 3N05A 2APJA 3FYUA 4QYIB 4RADA 3ZDEA 1W36D 2ZJ6A 3PVSA 1RVV1 3QXJA 5L3VA 1W5EA 1EJ2A 3DZIA 4HC4A 2QTLA 4WDRA 1MO2A 1DX9A 3NR2A 4ZQIA 2OCBA 3D4PA 5TQ2B 3GFQA 3W06A 3I8XA 4CMKA 3H1EA 2QMHA 1TQ2A 4YECA 3SSMA 3V8PA 2IPOA 1LXCA 3CRVA 5EE9A 3DYBA 1FQJA 3OP4A 3UG6A 2VZ0A 5EXXA 1M6YA 1KDVA 3ZXIA 2W90A 3OZAA 3WMFA 1NAHA 1W94A 2DAPA 4BFCA 1ZZEA 5EP2A 1XQ1A 1N1EA 3QX7A 2HXGA 3ROKA 3VYRB 4U63A 5JXWA 3ZD6A 3UB2A 2BFCB 3T06B 1ACLA 2WNSA 3GV0A 1UXGA 1OLOA 2Q9CA 1K6MA 1LFDB 2NXNA 4Z0PA 3IVGA 4Y2RA 3RSHA 1Z82A 4KR6A 1S8AA 4RK1A 4TUYA 1BNCA 4I1RA 3UMRA 2UXDB 4B82A 5F1PA 1VE5A 4QOIA 3T7EA 4C7XA 3RG8A 1YI1A 5IABA 3K4QA 3QKSB 2NYAA 4KCGA 5DE3A 5IYZB 3ZBTA 5E6UB 3QPUA 3DXFA 3L82B 4YWJA 3ZZTA 3K9FC 2LBPA 1KI1A 3P9SA 5A4IS 4IICA 3PFKA 1ENPA 1UXOA 2PMFA 2R8BA 2QP4A 2CLDX 4FD3A 3TAXA 4YV7A 3PICA 1Z3IX 4N7RA 3TL3A 4BN0A 2IHJA 2V5AA 1X3SA 1I5EA 2Q3EA 2W4QA 4Z2AA 1PJQA 3OZXA 4BS9A 3I6ZA 5A7FA 3LUFA 3HA2A 3ILSA 4OQEA 1H2ZA 2C4KA 2I22A 3V3TA 3K8ZA 4HGZA 5DW3A 1E3WB 2JASA 3E1SA 4HK4A 1JU9A 4HX2A 4J91A 4NWIA 3RJMA 4MDYA 3PXDA 3BN3A 4ANFA 3H19A 1QK4A 1N5MA 3CINA 2Q21A 3AILA 4QIHA 4LRWA 1XKQA 4HUQA 2PJDA 4FR0A 3AFHA 1A82A 1IDN1 2B5VA 4FDTA 4IQ4A 5BQ5A 5CRIA 5BWOA 4ZVKA 1QO0D 1WF6A 1QCYA 1AVTA 1P1RA 2WUDA 2BDEA 4WNAA 4ZJYA 1H2BA 2AOUB 3ODGA 3O8NA 2ZP1A 3P5SA 1GL6A 3JALA 4J4BA 3V2GA 4NAUA 1QOQB 2COUA 3GQBA 2P2LA 3BK7A 4JODA 1L7BA 2BE9A 5CVVA 2FN8A 3TXYA 3AM1A 4Z9BA 3K5WA 3S5UA 5ECDA 1RHRA 1NLUA 2JGJA 4RVFA 4I1IA 3WV4A 5I8PA 3X3HA 4AY2A 2PMBA 1QV7A 3U9SA 2EF1A 3LE8A 4XVUA 5L7TA 3RRNA 3Q8WA 4LZNA 4GO1A 3RRYA 1EWTA 1ENZA 3HN2A 1NT4A 1CWUA 2WRZA 2ZB8A 4OHUA 3X2EA 2XB4A 4DVJA 4G5RA 2PLFA 1NT2A 1ODTC 5CDYA 4BNLA 4YRAA 2JKZA 4N8SA 4QOGA 4DXHA 4JSYA 1F8GA 4DF3A 1AMUA 5JU6A 4RYLA 2FZGA 4M1MA 3QYJA 2WZBA 2PUVA 2RBGA 4KFTA 4MRMA 3IJRA 3VPCA 1JDZA 4KYUA 4UHEA 2A0WA 3RODA 2FW1A 2HADA 1FYWA 5ENDA 3ZY6A 2XQVA 3DTVB 4WFQA 4MRRA 3OH8A 4FFSA 1SQ6A 4NF2A 2CCJA 4HDOB 1QGAA 1XCMA 1E5QA 3R75A 1A76A 3QVUA 2XRFA 1RHUA 3UYLA 2WF9A 1A27A 2AG8A 3FVQA 1M67A 1EFRD 2ZSHA 4DMMA 3JSAA 1CUXA 4NFHA 3UG7A 2JCBA 4BWVA 2O0LA 1Y7HA 5EQDA 4A15A 5LDGA 1JJVA 1NYLA 4ZKDA 4D97A 3NP7A 1WBJB 4RZQA 2ZS8A 1Y5NA 2ZRKA 4AO6A 1T35A 3P96A 4M2LA 1WU8A 1JR6A 1VCIA 1LK5A 3IXQA 4B46A 3WIDA 2Q5CA 1TU0A 1MABB 3UICA 4FW9A 4A03A 4OGWA 3M6UA 3M7IA 3VA7A 3I1JA 4FR2A 1GFIA 4GECA 1DKRA 5A5GA 2BFFB 1IQUA 1M1XB 1EWVA 4K9RA 1OCEA 1THTA 4LOKA 1L5SA 3TSWA 3FXAA 1TA9A 2JCVA 2YY5A 3NOOA 4NR0A 2FMFA 3DP9A 4OQLA 1BRMA 2H1CA 4EY7A 2B4AA 2O4UX 3PBKA 4YDSA 1PR1A 1XFDA 3EGCA 1W30A 4DOMA 5TLSA 5TARA 1Z8NA 1AV7A 2BMJA 1RFGE 2P9CA 4GWKA 3WMRA 4ZVRA 4M36A 5JW6A 1JDPA 4R9RA 1F4PA 1I9GA 2QZ9A 3C7CB 2C2YA 4W5WA 2EP7A 4EOGA 1NRJB 3E23A 5J1TB 3TX2A 2JAQA 4B8YA 2Z6AA 2NO0A 5IJZA 3B6JA 1WXIA 1IONA 5FL7A 2KS6A 3ZJYA 3DEIA 5JZVA 4LF9B 2RH9B 3FUVA 4L4YA 1DTEA 4BBZA 3UPDA 1NW7A 3I53A 5F7JA 5FNZA 2HX1A 3EEIA 4BNMA 4PCVA 1R0YA 1JJAA 1E6MA 1K8RA 1E9SA 1Z2PX 2D74A 2WA1A 4J1TA 4ZU6X 4CMEC 3FTCA 1WCV1 2QUIA 4P22A 3HADA 4DA7A 2Q45A 2Q3BA 3IYLW 2ORIA 1JPUA 2UVPB 4J07A 3AINA 4HAOA 3LNCA 3ZDCA 4B3GA 2X9GA 4BLUA 2XUKA 1QYDA 1ZGBA 3RLFA 1WXGA 5EXDA 3AGPA 2RJOA 2E87A 2C4TA 2AI2A 1CUUA 2EVWX 3FUWA 3GEPA 4HQLA 5G0WA 1FSFA 1DKNA 3A4YA 4CV1A 3KL2A 3L7MA 3R7LA 2I2DA 1IM5A 3HSKA 1S7GA 5EINA 3NLLA 3Q7QA 1IK6A 4KPUA 1ZNZA 1C8LA 3R9XA 4RF3A 2H7CA 3HC7A 4HBGA 5CB4A 5J4YA 2QM0A 2IOFA 4TQ9A 2XEXA 1RYDA 5KYGA 4TLLB 2I6GA 1Z34A 3USCS 3HZRA 3PEYA 3ZS8A 4TVBA 1U90A 1K2WA 3AONB 4BMNA 1KBQA 3LJKA 4YFYA 4ESVA 5L9AA 1BU8A 3KC2A 3N58A 3KQOA 3JQ7B 5JMTA 2F4VB 4BO0A 1YQWA 3U4MA 1QH1B 1S2LA 3FROA 1Q74A 4BFLA 1BEZA 4OHPA 2XPCA 3M49A 4I50A 4EPVA 1NMSA 1XCBA 4RIFA 1H94A 1E5LA 4I9NA 4MGEA 3MRVA 2Z5VA 4D4LA 3C6YA 4R01A 2R00A 1FP4B 2XGSA 5JECA 2ID4A 3D1LA 1XD2A 4KAAA 1Z0SA 4AZ3B 1IOLA 1WCXA 5AUPB 1BMQA 2G8LA 1NFQA 2JFZA 5INTA 1JEQB 1V8OA 5JADA 2JHFA 1T2DA 4MQFA 4N0DA 4XLZA 2G07A 1R0BA 2IIBA 4NMLA 1Z68A 3T9CA 2A6PA 1VL5A 2Z2JA 2L2QA 3A3NA 3HWX1 2ZIXB 4FNOA 4UMEA 4Y6QA 3TLCA 2ZJ8A 5KTOA 1A7AA 1VHDA 5B1YA 1FLNA 1JKJB 5IKOA 3A9UA 2QORA 4RTSA 4GLJA 2R6HA 3O5AA 1ZKMA 4ZTZB 4INJA 1QZ3A 2H08A 3I9NA 1KVUA 2QRZA 2XOEA 3ZQJA 1RPZA 3SX0A 1N57A 4DBZA 3DNMA 5CCXA 2XEDA 5KTTA 1OH7A 1Q91A 3DNPA 4DLTA 2ZTVA 3ICCA 3OFVA 1HT2E 1RMYA 3NXSA 3SS7X 3AVQA 3DKKA 3ND8A 2FP4A 3ADPA 4G41A 3R5SA 3B8EA 3GLRA 2IXBA 2FPUA 3BD6A 1VFPA 4PHFA 5IRCD 4QUEA 4HXEB 3FNQA 1HDGO 1SG0A 4GXTA 3KWJA 3PEVA 2BGIA 4PRLA 4HL6A 2C2MA 1OLXB 1QZTA 5CUQA 4U7PB 2H9IA 2MSKA 2NU7A 3NJ4A 2HA4A 3QFFA 5K4AA 1GQQA 4LHWA 4BZZA 5C8YF 1YQTA 1USIA 1X9HA 3JYHA 5I7UA 3HRHA 4YMTA 4PR0A 8GPBA 1Z5VA 1PVVA 1Y82A 2OLKA 4O4IA 4G0UA 1G9TA 5AP9A 2JFGA 3KQHA 3NRBA 4I46A 3SYTA 3D5QA 3RHZA 4KACA 1YR2A 1SCKA 2V45A 3F6SA 1OVGA 2FEAA 5L4NA 1JEDA 2ZYHA 1MDFA 5A3JA 1E3EA 1RYYA 1PO7A 1WDLA 2HAEA 3RUCA 4BQIA 1GCUA 1E1YA 1L1EA 3GCGA 4YXWA 5JD6A 3KL4A 2WSBA 4K0RA 2ZUSA 2WTNA 4N5HX 2I1WA 3BH7A 3MT7A 2HA6A 3K6RA 1R12A 3TW4A 5BVHA 3HLKA 3I2GA 2WQZA 3QMWA 1PL6A 1FOEB 4FNGA 1MTZA 1BGVA 2FN3A 3IIIA 4OYLA 3EF0A 2IP2A 2J9YB 3H18A 5CVTA 2CL5A 2M98A 4GOXA 1CUEA 2HPAA 4WIAA 1YRYE 4CQJA 1RJEA 1IMOA 3PR1A 4MR9A 4XD7A 4X7RA 3UGQA 5HUJA 3ED5A 1X9GA 2O1WA 1U0EA 2WSMA 1RLMA 4FONA 3TR5A 3VO1A 3AWDA 4Q1BA 1J0AA 1GGEA 1ZM4A 1QC5A 3DGFC 4A8HA 2C7PA 5CLLA 4ZOBA 4XIIA 5LIRA 3U1VA 5CDSA 1I1HA 2JHCA 3DONA 2E89A 2PT7A 4L27A 4IXDA 4F2HA 2W70A 5FAKA 4FINA 4AY5A 4HAUA 4Q3AA 1OX6A 1DUVG 4I5EA 1UMKA 2V4UA 1ZUWA 1JDBC 1S8FA 4C0BA 1CYDA 4YUYA 1M2VA 4A0SA 3WTCA 1WB4A 1I32A 3C7AA 1QTRA 4ZJPA 4U0KA 2XAUA 5K0CA 4Y1RA 3CTPA 1YR8A 1NVBA 1KI9A 1CJCA 3GAZA 4UARA 3K3PA 3BXZA 4OH7A 4FMBB 2A3NA 4R2IA 3KDAA 3TLMA 1KJNA 1QYXA 1SXHA 2VPQA 1QS0A 1YCGA 3OZDA 4WUVA 5FF9A 4YCDA 5T57A 5JNVA 2IZOA 3H2ZA 3VNVA 1OMOA 3E5NA 1QIFA 5CFPA 4TMKA 1K88A 2PL5A 5CTJA 2P6NA 1JLLA 4WI1A 4EJSC 1GAXA 4OK3A 3DOFA 1YS9A 3M5CA 3QW2A 1IWOA 2O8EA 1U3GA 5EE5B 1P4AA 3M6AA 2G06A 4MH0R 3ZYZA 1P77A 1T6YA 1IFXA 4EJFA 2SKCA 2I71A 4YDRA 3ZCQA 1O0BA 2MDTA 4PLHA 3L0YA 3UV6A 3FAZA 3R1IA 1FFBA 5A62A 2V9CA 1IPHA 2J6IA 1MB3A 2O6HA 2WP0A 4TXMA 5IHXA 3IJEB 3PUWA 3WLPA 4LYHA 3ND7A 1I10A 3OVMA 4UU1A 2CNKA 3HCRA 3RC8A 3MTJA 3ZBPA 4DBLE 1ENYA 5KYTA 1RRKA 1LF0A 2WYWA 4WKGA 3PDWA 2VHJA 2A35A 1UQRA 3Q7TA 4ROSA 5FH9A 1Q1BA 4Q93A 4E70A 3GFRA 2ODPA 2Y99A 4QFBA 2PUJA 4NDNE 2UYGA 5P21A 5I3CA 1RM4A 1E1QD 1N6IA 2Q6KA 1SIWA 2HWWA 1GNRA 1N2JA 3EH1A 5HHTA 1YJBA 1WZUA 3K8OE 4J75A 4PFJA 4DV7B 4AKHA 4O4HB 4TTPA 3NANA 1L4GA 4WXYB 3X1XA 1W85A 4U7FA 4BNXA 3ZW7A 3HUFA 4C76A 1ZBDA 3R3HA 2DU8A 4MA5A 1ECLA 4UNIA 4KKVA 1QIKA 2FWBA 3KO8A 3HXQA 2J32A 4CLEA 4CEIB 4YV2A 4EAAA 4C4SA 3PQDA 4CCYB 1VZ3A 1QWSA 1T26A 3KVRA 4MS1A 4R5HA 5LZ5A 4F91B 4LJRA 4J76A 2YHAA 2EYQA 1B6GA 2HRZA 4NPAA 4OSEA 5BQOA 3UGTA 1CIJA 1GAWA 1N1GA 5E9JA 5H5JA 1UZNA 1QHXA 2Y1KA 3JYPA 3RM3A 2PBFA 2ZSUA 3I6MA 4XVRA 2X8LA 3AEUA 5JZBA 3D7LA 2EFEB 3V55A 3URMA 1IY2A 3AKDA 1PGPA 5J5VA 4F6LA 3KUKA 4M1YA 2NAPA 2PEZA 1BDMA 2DHRA 3PDIB 4UEWA 3C2QA 4XSVA 3K9GA 5ECYA 5FJIA 3ZEAA 4RQUA 2AZMA 2GLUA 3OKAA 3VR5H 2R60A 3EVEA 3WSVA 4TV8F 1NBMA 3DV0A 5UKDA 1PNOA 3N2YA 4D02A 1RYBA 2IU4A 4RNCA 2E21A 1XJWA 2A5DA 4LHSA 1FU4A 1PZEA 3FPEA 4MICA 1USKA 3S1AA 4DBLC 2DPGA 2VTDA 4AY4A 2WM8A 5KKAA 3NGMA 1CG6A 5DRYA 1HX7A 4MV5A 1BVUA 1GTJ1 2DJIA 2Y1DA 1MX3A 1Z08A 4HMPA 3RT9A 1OAAA 4IIYA 4C0JA 2QXUA 3CB4A 4XR4A 5CNMA 4J9VA 1WETA 1XMXA 1G66A 1V71A 1ESZA 4L5JA 3IT0A 2YVUA 2AN4A 1R8YA 3QBVA 4FU0A 3WYAA 3KKLA 1F17A 3HSSA 1N6RA 3OCZA 2NPFA 4BC1A 3T52A 2E4XA 4R0MA 2X5XA 3NALA 4EI8A 5BSFA 1JR4A 1NVDA 3A70A 2BSXA 5ALVA 2ZRIA 5BQ3A 3ZE9A 1DMRA 3H2HA 1DAMA 4RSGA 4C7VA 2GN0A 2JB9A 1A8SA 5AO9A 3V1NA 4JGGA 5F3RA 3UJNA 3RYTC 4ZYZA 3E7WA 1LLFA 1CS0B 1D1QA 1BROA 2WSLA 3F73A 3DB2A 4X6XA 4CUJA 4GX5A 1QJCA 2Y27A 3PIRA 4DDHA 1RADA 3KJIA 4TUYB 1UOEA 3WLIA 2WAAA 1YBFA 5B1EA 3B9RA 4GVLA 4MMXB 3ROPA 1HKUA 3IB6A 4MVJE 4N76A 1XI2A 1RXWA 1K0UA 1KJ9A 1VHWA 1VDZA 4M8SA 3NWEA 4YP0A 3MWGA 1A72A 1LZLA 4EUHA 2HLPA 1XU9A 1S2GA 2X1MA 3AZPA 3RS2A 2G9ZA 4RV4A 4TYYA 3IR7A 4XQ0A 1N0HA 4UAUA 3DDUA 5BN3B 4YMUA 1LX7A 3PVZA 4GH5A 4G0YA 2CNOA 4O2RA 5JXIA 5ALUA 4MITA 1IN1A 4RVNA 1C3JA 3EHEA 1AOXA 4LDPA 1Q7TA 4OYRA 3EXEB 1YZNA 4LYGA 2H3HA 3PD0A 4OP3A 3RDPA 3EW9A 1NF9A 2X77A 3A4VA 4RV5A 1WSWA 4WOBA 3V7UA 4B6OA 3L7NA 4YMVA 2JA1A 5JLAA 5IVIA 4MUHA 4E6PA 4F45A 2DEUA 3GJ7A 2HK7A 2KQUA 2N46A 2L17A 3DWFA 3MJSA 4H1UA 4HUQB 2CZQA 4UHKA 4UUOA 3TUIC 5KBYA 3PF8A 1DTSA 3UF0A 2YOHA 3ZGOA 4JMPA 4IY1A 4CM6A 2DBYA 1HPLA 2VDPB 4WNAB 4Z9FA 2XCQA 4CQLB 4UUMA 1ISFA 2FXVA 3M34A 4F71A 4IPTA 2I3DA 2QRJA 4LDAA 5T6MA 5JY1A 4TT3D 4OMFG 2PKYX 4WK4B 3A9VA 2VUIB 3S6JA 3MWDB 1MVNA 1HE4A 3AF0A 3B2NA 4NZPA 3RTEA 1SBQA 3ETHA 3T9DA 2I6TA 2P6MA 1XEFA 2PGAA 3D6FA 3WA6A 2GB4A 5IEJA 3P2YA 2QZPA 4B3JA 4Q05A 1IEXA 1XA3A 4FEYA 5M3BA 4G2TA 4KHPB 5FI0B 3W2HA 3K2IA 1TLFA 4IDCA 4EA6A 1N4DA 1DAOA 1TO1E 3FWZA 3H8WA 4E5VA 1V9LA 1GUBA 1W2WB 1XZJA 1IMJA 2WOJA 1X39A 5BOVA 4JBGA 1ZSNA 2HF9A 4MRMB 4MHOA 1YZ3A 5LLSA 3IP1A 3Q87B 1QNLA 2V7XA 1DC8A 1VLVA 3PGXA 3L01A 3EXHB 3URKA 4JUBA 5KQLA 4JV5B 2NACA 1EB9A 4YP1A 4B3HA 3GFSA 2EKLA 2O2CA 3LD9A 1U9CA 2WIJA 2WW8A 3MELA 5FWYB 3WADA 4MJ7A 3TAUA 4DWVA 2JRCA 1OXBB 4OAQA 1K5GA 1HLPA 3GH1A 4Q3CA 1VL6A 1ZNQO 5GJBA 4HH3C 2NT3A 3Q41A 1Y3DE 1KFEB 2ZUFA 1AUOA 1NLZA 3RUIA 3CLSC 3AJEA 1VLMA 3IUBA 1H0KA 3DE0X 3IUPA 4X24A 3S2UA 2W2OA 3EVFA 5BR7A 4Z1OA 1QFZA 2RDMA 5EMLA 4N47A 3FMIA 5BV0A 3IT2A 1F2DA 1TJ4A 4EVIA 5LR6A 1IVSA 2XDAA 1U3TA 1FJ2A 1RZRA 1LUAA 1H4QA 3MT0A 5ALRA 3AZQA 4BQFA 1JR3A 5BSKA 1B26A 1W0JA 1OXSC 1V7CA 3FOWA 1RYNA 1HDCA 1O96B 4POAA 1CUYA 1OX4A 1E1RD 3ANYB 3OFND 3AKEA 2YR0A 1CQJA 4IFBA 1NTOA 2WVAA 4R2MA 3G17A 4MRPA 4IOKA 4V0ME 3M1LA 2QRNA 1T1IA 2OB1A 2X0KA 3NBKA 3IMCA 3ZTWA 1OWLA 1QLJA 4NCNA 3RK0A 5DISB 3SSOA 3PX7A 4PZDA 1S9HA 1E3MA 2AK3A 2HPVA 4M21A 5DVZA 1EM6A 5ALFA 3U7QB 1CE8B 4P36A 4B74A 1S2NA 1T9KA 1UDCA 1YHNA 2QY9A 2HKIA 4TN5A 3UWOA 3VHRA 1RXSA 1TZKA 4RESA 2FGKA 3PQEA 4CMCA 2Q4TA 4DPLA 3ME5A 3FDJA 4AF8A 5HKKA 1OXKB 2BGTA 5AVKA 2A92A 4W1QA 1EI9A 1E7YA 1P5ZB 1J8QA 2P9GA 1LGYA 4DQUA 3CUUA 1JHZA 2PGLA 5A7HA 3ZVRA 2EX0A 2GBFA 4WCFA 4F06A 3CVVA 2OTCA 1QIHA 4IXWA 2YMMA 3RK1A 1MFZA 3U5TA 1XZFA 1DADA 4KTVE 4OK6A 4X63A 1Q84A 5JAOA 4GGMX 4QL3A 1G0NA 4FEAA 1PR2A 1ZU4A 4QUIA 2G1AA 2YYZA 4PSCA 4TV8B 3QVGA 4PO8A 4CGZA 2QZJA 4LWQA 3E58A 4XYGA 3EVCA 1COZA 1PNVA 1O5IA 2R7LA 2XB8A 1DQZA 1QORA 1T25A 5IAKA 3UB3A 2HMYB 2W6PA 4GI2A 2OO5A 4NBKA 2EJCA 4DQLA 5L51A 4YRZA 3B9PA 2ZQYA 1GCGA 2NU6A 1W5SA 4OGLA 1Q7BA 4HDNA 5IK2A 3ZU2A 3WLOA 4OUDB 3U37A 1JKFA 2I6QA 2OZLA 3P9PA 4BAGA 1CY6A 1WX1A 2PSSA 3IUYA 1O2DA 3ILVA 1ZJ5A 3NDBB 5CB0A 3RGWS 1Y9JA 2P2ZA 5KVAA 3O8OB 1DAHA 1QLWA 2B7BA 2AEFA 2AJLI 1KJYA 2R6AA 2QLNA 3Q7SA 4XARA 5KHLB 2XRYA 4D9EA 1SIUA 3N0VA 3RFUA 1H6CA 3HEMA 3EB9A 1XZQA 4LYJA 4HLCA 3ZUPA 2N1BA 121PA 1IZYA 1ZH2A 4UKDA 3WGOA 2Q1YA 4WOPA 4AW9A 3L3BA 5EJ9A 1Z47A 3GELA 2V7GA 2IA5A 4I50B 4MS4B 5E3JA 5AW4A 1NVTA 1ODFA 2ODBA 1XD2B 1O6CA 2XGGA 1VA4A 3WBKA 5I7RA 1P1JA 2Z04A 2GD2A 3L41A 3TQOA 4YCCA 1TEZA 3T7IA 1TM1E 3DM5A 3OMWA 5EIOA 3N0RA 5SYAA 1RAEA 1Q7RA 3DBHA 2QD4A 5EP4A 3KQSA 3E5MA 3WGYA 1PDOA 3M6FA 4OBWA 3VR3D 3TRHA 5ECWA 2F8LA 4AWXA 2PQ6A 4TX1A 4EHDA 5EC8A 1GG8A 1ZR4A 3V97A 5HTKA 4QA9A 4NH4A 1Y6FA 3B78A 1GT6A 3ANTA 5JH7A 1V11B 3ZW9A 3FNIA 5KNCA 5TT0A 1JILA 3GRRA 1WQ3A 1S5PA 1IULA 1PQUA 2FP4B 3OTWA 1FJXA 3AVXA 1C1YA 1W52X 2VJNA 2HJSA 5CDTA 1SCUA 1YMVA 5EJFA 3VOTA 3CRZA 2OM6A 3S40A 3QE3A 2HHJA 4EJMA 1IIBA 4JOQA 3R7AA 3ZTTA 1F2VA 1QP8A 2N3ZA 2NUPA 4JP1A 4CBVA 2Y0BA 3FPSA 2R79A 2NZJA 1RQ7A 1CDDA 2PS3A 4Y6GB 1C3LA 3N8NA 2NU7B 4N65A 4WQMA 2YRFA 4GG1A 4IKPA 4L9SA 4V0RA 1H8HA 4DARA 3RUAA 5A2GA 5EJIA 5L4SA 1Y6RA 3IQEA 1NF2A 5I47A 4P4NA 3FHJA 1TD9A 5E2AA 4A8TA 5FBVB 4FHFA 4PX5A 4QWMA 1TZ2A 5HBRA 5IASA 4FOLA 1AKNA 1ZN2A 4K6HA 4EJ6A 5DH9A 5J1SB 1PV2A 2JGRA 3WGJA 5HIKA 2DLCX 2H11A 2HXSA 4PN7A 1RM3A 1UCFA 4I4IA 4Q01A 4YALA 5SY4A 1LSJA 2ZI9A 3QYPA 3L6RA 3OPMA 5TJHA 4Y6PA 2HR1A 4OHMA 4A10A 1EX6A 1EEXB 5D6OA 3UCFA 1VI2A 3PNSA 3T5BA 3M4XA 4NYMQ 1ZGHA 1JFTA 3LLMA 2I7TA 3EJ6A 5FR1A 5SZHB 4Z9AA 3M6WA 4LZZA 3MD0A 5DGIA 1U1EA 1PJ3A 3ZWPA 1ZCFA 2ZSJA 4A1OA 2IEZA 4MR9B 4CLXA 2PUWA 1F1BA 4PC2A 4TSFD 4V02A 4ZOLF 3QOWA 1Z12A 5LZ7A 2O2EA 1GVNB 1I1QB 1YCFA 3PQ6A 3TEJA 2Y1WA 4FTWA 2ZUEA 3D4OA 3KETA 2FEMA 3TKYA 2YV2A 1DPFA 1NRIA 3LK7A 4ABTA 4U6NA 2CXNA 4PNZA 2DLNA 4MVYA 4NCXA 4MS3B 4WN9A 5FV7A 1A5TA 1GFSA 1L4NA 3RUPA 5C7OO 1G8YA 1TL7C 2ZG6A 3DHVA 2B4YA 1R4MB 3AIKA 2ZB3A 3TIFA 3EIUA 4EWLA 5KTYA 4E30A 1WZIA 4LOHA 4GYJA 2FOLA 3PD7A 4MYUA 1P39A 1DP4A 2YRXA 5KKCA 5GM2A 3T5GA 3NC1C 3K20A 1YL6A 3GVIA 1QS0B 3RR2A 2WU0A 1ZJZA 1HG1A 3KQPA 4LJ4A 2RKOA 1T9CA 4B85A 3LMKA 4BCBA 1JLLB 4O02B 3HXTA 3HKDA 3IBGA 3N2LA 3A6FA 5CLFA 2UYHA 1KIAA 2GZ1A 1KYYA 3NHZA 3OJ0A 2JZCA 1XQXA 2Q3FA 1TX4B 4OA5A 3STHA 5FEUA 4CN9A 1AZSC 2VAXA 4H1HA 5IG2A 3ZLUA 4BQPA 2VYFA 2R65A 4TL9A 1E2BA 1H5QA 1DX4A 1HRKA 5J2UF 1KJ8A 1I51A 1BHQ1 1EQUA 2AMFA 1PJCA 2QZZA 3O82A 3N8IA 4PG6A 1TRKA 1XRQA 5EFZA 5IT0A 4ZCRA 1XLWA 2PUBA 1CEEA 3M6VA 1QZUA 1BX3A 1F60A 2IOQA 2OKGA 4GEGA 3E84A 3GLGA 3O26A 2PD3A 3AG6A 4MP6A 2O50A 4WW0A 4Y0NA 3P2OA 1A95A 4BFUA 2JD2A 4DC1A 1YL7A 2R6ZA 3U3MA 2CXRA 2Y71A 2Q5OA 3QBTA 4TYWA 2DYKA 5B57C 1SUBA 4M0UA 3KJXA 4CMEA 5CXSA 1FP1D 4KQJA 4R2KA 1SBHA 4ZCSA 3WGHA 3ESCA 4C0LA 5IW8A 3ZWMA 2A4KA 2C99A 1INLA 2DUJA 3LQQA 1YASA 3P0FA 3Q9UA 4PWYA 4Q9IA 1FIUA 2MSDB 4KE9A 4DIFA 1X6VA 4EEKA 1G16A 2FQWA 2RGWA 4FYJA 2KWIA 2PRYA 1W85B 1ZJJA 2HA5A 2PPLA 3C3XA 4OQXA 2PFSA 4H6XA 3O1HB 2Z9DA 2FPSA 1WZCA 4GBMA 2XT6A 4L4ZA 4NBUA 3CH7A 4X54A 4Y2TA 1DKUA 3WWEA 3VPFA 1LQ2A 3QTTA 3V4FA 2D5IA 2PKWA 2BGLA 4FMDF 2F1RA 2PD6A 4MS1B 3WWPA 1XNQB 1TMOA 4RMJA 1MENA 3D43A 2MSCB 1UPTA 3FZGA 2HW8A 3PWKA 1ISHA 1Q1AA 4F8JA 2EF0A 3EC7A 1OIXA 1THGA 2I76A 3EY9A 3L8YA 5AI0A 2FFQA 2O54A 4HAZA 1V2HE 3P0RA 4Q1AA 1AUXA 5EQJB 3AEUB 3C3CA 1NZFA 1R5OA 1ELOA 1WLYA 3EYAA 4MVCA 2OAP1 2CDRA 2R7MA 1V9SA 3IEIA 2X3UA 3L77A 2J6CA 5DSTA 4IDOA 3L6CA 3NBZC 4BMCA 2ATCA 2F59A 2XBMA 2YVLA 4TXHA 2PJRA 3BWDD 2RH4A 1CUGA 3O94A 4XI9A 4GPZA 1Y3BE 1MO5A 1HNNA 3GPCA 1L5FA 4JT2A 1T2FA 2HT1A 2GPAA 1TI7A 2AT1A 3A6DA 2BFEA 4HXYA 4E12A 1RM0A 4CTMA 3GGSA 3LX5A 4LKRA 1IQ0A 4NEHB 2VP5A 1SC3A 4XDHA 3S1AB 4CTKA 2C3UA 2IUYA 2J3DA 2PG3A 1AF4A 1CQXA 1SUWA 4MPTA 5C8XA 3EGXA 1SMKA 5AK5A 4DR6B 1GZVA 4NL4H 1H2EA 4IHKA 4ZXFA 3PRHA 3TSAA 1VKRA 1Z0AA 1E5VA 1U99A 2WIDA 1SCDA 5HZHA 2PZAA 1HURA 5CITA 2I4MA 1EESA 2CNBA 1E64A 1OE0A 4ND6A 5AVJA 5CFQA 3DMGA 4I9GA 3RUEA 7MHTA 1HE5A 3HH8A 3K7EA 3UA4A 3WAKA 1X80A 1PQWA 3T5AA 2R8PA 1Q19A 4BMZA 2GDZA 4CCSA 3JQEA 2XXAB 3AMVA 2YXBA 4X62B 2VG8A 2OXFA 4V0KA 2RGAA 1HEYA 4DCOA 5C52B 4FFNA 1A04A 2P6PA 4LPKA 2O52A 4MRAA 4EW3A 2EFGA 4CHTA 4RKWA 1E58A 4OBBA 4I5IA 4TV9F 2DFLA 1AQUA 2BZGA 2CB9A 3HYLA 2AL7A 5B37A 3OCYA 1XROA 1CC1S 2ZXFA 2AN5A 4FK8A 3RBXA 4RTRA 4Q21A 1YWGO 4OL9A 4GPTA 2O6LA 5CLIA 1U5BA 3FCAA 3ICOA 3QEJA 4YRJA 5C51B 4BPBA 2HRCA 2JAUA 3LS2A 2ZUCA 2QSZA 2NPOA 1GZ3A 3ER9A 3OA0A 3HVKA 1A8QA 4KAXA 3P2KA 5G41A 1EGQA 1SUSA 2XBUA 3H1GA 4X0EA 2ST1A 3BGIA 2V03A 2ZGVA 2VUSA 3OZWA 4GRDA 3ZPXA 3OQIB 1CBUA 1FXWA 1LPAB 1UBGA 1QB8A 1SBCA 1TYCA 1EFVA 1EE2A 3N3BC 3LW8A 5ED4A 1VMKA 5LLTA 3IKJA 1YAHA 5HQ3A 5F52A 3PLNA 4ZOLB 2GTIA 2W83A 4DQVA 3NTRA 3LTEA 1SOWA 2VQSA 5MN6A 2C04A 2W2QA 2XD4A 4LGMA 1CEYA 5C2JB 4FWTA 3JAMA 5JWOA 4ND7A 1DJLA 2CEAA 2VWPA 2A1TS 2GJKA 5ALYA 2QRKA 3IO3A 2D2XA 1GDTA 2V7VA 5CD9A 4MCHA 1D6SA 2QX8A 2Z9CA 3ZWCA 3EVDA 1WKBA 1IEVA 2UUCB 2JI9A 4AG5A 2W2MA 4MAFA 3LGAA 2AN9A 1W75A 1VL0A 1RR6A 1TAGA 5BUQA 2UYCA 3OC0A 1WDKA 4OYHA 4YRDA 3VSBA 5DNVA 4ZZ3A 1WB9A 3CR3C 5FLXA 1FPQA 2JHPA 1MG0A 3O3OB 4LCEA 4DKXA 3ZIAD 4F86A 1IVNA 3A1UA 3DL7A 2GM5A 4UDYX 4DMHA 2PYDA 1KYZA 2I03A 5M34A 4L8YA 4BKRA 4MZDA 1BQEA 3DE6X 1SGWA 2R6GA 2OAQ1 1G9XA 5F5NA 3VO2A 4HZGA 3G23A 3ZU5A 4EJSA 5K0ZA 2ZE8A 4MUGA 3AY3A 2PLWA 3JASA 5G0UA 5JI2E 3RBZA 4A2CA 1SKMA 1BDIA 2A9PA 3F9IA 3GZNA 1DAIA 3OJXA 4G4GA 4RJ2A 1CT9A 1JLSA 1WCIA 3FLAA 3P9QA 1ZN8A 3DKIA 3DTYA 5I9SA 3C85A 5J2UB 3T3HA 5TQ0B 2Y6UA 1JT2A 4BQSA 1ZD5A 3A28A 4J3FA 4ZVOA 1GU1A 2GM4A 1Z0FA 1E0JA 2C54A 4NDZA 4P58A 5EPEA 4B3SB 1MX5A 2EZ4A 3HJFA 4JP2A 4PG7A 4B73A 4EFKA 2NLOA 4A6EA 2XNKA 1JTFA 4HADA 2H7YA 1OX4B 4EARA 2J5XA 1FYVA 1CQJB 1G2IA 1ESCA 2CFCA 2RFLA 4TS1A 3S8YA 1QIGA 1KO7A 3IHKA 3JPYA 3LUKA 3TXXA 4NYJQ 5BVHB 5JISA 5LPNA 1KERA 3T0IA 2ILVA 2VJCA 5E1DA 1LEHA 4AKIA 1OWNA 3IS3A 4M7PA 2IYXA 5TY0A 1Y3FE 4QPDA 4QPZA 4BNHA 4G86A 1PUXA 3I9FA 4D0SA 2VOEA 3MRSA 3FF4A 3QKUA 4FE3A 2QZSA 5GONA 4ZI2A 4MYTA 2WU8A 3JATA 2CMHA 1E1KA 1N3LA 4C5BA 4C89A 3BBLA 2PR2A 1FQKA 4G8BA 4W63A 4L57A 5HRUA 4I6JA 5JEEA 2OSVA 2PZBA 1OW3B 2CDNA 1KO8A 1DEAA 2B94A 2VJKA 4FMDB 2GEJA 3AB3A 5F1KA 3ZV4A 4BFYA 3H5IA 1GTL1 5DRTA 4FGZA 3V9AA 1XKLA 2J9FA 4KVFA 3VI3B 2BAGA 4YRTA 3PIDA 1Q0TA 2OGWA 3VZCA 4ZCQA 4XCVA 5JBIA 3UAXA 4BO3A 3TUZC 4I55F 2A5GA 2YWBA 3A7DA 5BNTA 3KBBA 1BWSA 4JLDA 4TS3A 1BE6A 2OG2A 4WCFB 5ARCA 4EA8A 3WQSB 1P1HA 2IYOA 2PUDA 4ZO9A 1QOZA 2ZIZA 5KX5A 2OCYC 3ROMA 1UFOA 2BL4A 2ZETA 4OXIA 1PGQA 4B40A 2YV5A 4RIEA 1EFTA 1RABA 3RC7A 3E5HA 2VP3A 3FTNA 4AZTA 4DE5A 5EUQB 2EQBA 2QE7D 2AA3A 1UM8A 1FA9A 4HNUA 5EXEA 1LSOA 4OQNA 1PT5A 3IUEA 1LI5A 4HDNB 4M1QA 4O1IA 3VM6A 3VZPA 4NE9A 3G1UA 3NOQA 4U2EA 1CUVA 5K8UA 1JWAB 2WUWE 4TSRA 4RPHA 1I13A 5K3SA 3ZY5A 4CMHA 4WZBE 2VP9A 1U9YA 3DR5A 4Z86A 1BCRA 4MGIR 4X6YA 1WQ1R 2D0IA 4AMZA 4E46A 5FX2A 3KJEA 2GPNA 3OQBA 5FWXA 3TW8A 4FUQA 4B7ZA 2R1TA 2IHNA 1DKOA 4FDLA 5CPBA 3TLXA 1QDEA 1XU7A 1HC7A 1S3GA 1PS0A 3QSGA 1P1BA 1AKMA 3UMJA 1VI6A 3C7TA 1FL9A 2JFFA 1P1CA 1ZG3A 1NPYA 3SJBA 1AZWA 2QQEA 3WG9A 2JIDA 3ZQUA 2PZ8A 2AC2A 4Z51A 2JD0A 2WLSA 4OEHA 5JMOA 1E4OA 1F51E 3O75A 4ZVUA 3VI4B 5IAAA 4RPCA 2I1LA 3VPAA 2JA2A 3DZ8A 1GRVA 2P8JA 5CW1A 2H31A 3R0IA 4EUNA 5A4AA 1TF7A 3JVIA 1L5MA 3OX2A 4WZ6A 2E1PA 2IIQA 3PHLA 4IQ8A 2QTFA 4G65A 4TLDA 4NCAA 1Z74A 3DZCA 2EZTA 1TE2A 4FJ0A 5CT9A 1YDGA 4LHXA 4EGJA 2FDCA 2IE0A 2VYCA 4AJKA 1K27A 2WTAA 3HEAA 4O63O 1BXRA 1QQ7A 5FBWB 1CRPA 1Y8QB 4I36A 4FFBA 1N1DA 1ORWA 1NMEA 1ZO8A 4FXPA 5KO2A 3EXG2 2IZ0A 4R1LA 4RPIA 2GJ8A 1R0SA 4B9EA 4DJ5X 4UEJA 1W73A 2AYYA 4NSNA 1YS1X 4MINA 1RQNA 1T2EA 3WL8A 1VXRA 4LNUA 1JKMA 2VA9A 2HWUA 2Q07A 1PNRA 3GLKA 1Y5LA 3OCXA 2ZK7A 1P7PA 4FFOA 4YRLA 1NDQA 2NUPB 4TN1A 2IZ7A 5KSPA 3TTUA 3UOGA 4JFAA 3CVXA 3D3EA 5JJIA 1U2PA 3VNRA 5ALEA 2W2KA 2BVNA 2OCGA 4R3WA 4UHHA 3V00A 3GPBA 2ZR0A 4UVDA 1NOKA 4HGNA 4FFPA 1FYXA 3U3KA 1LNQA 1UMBA 1B3BA 3SYLA 1UBUS 4EEXA 2ZRDA 4MMYB 3O4FA 2V1UA 5I5GA 1KI2A 4F7DA 1L7EA 2G5CA 4BCCA 1XBTA 4OLFA 2OZPA 4LZWA 3HP4A 5JALA 2VWQA 4R8SA 3FYTA 1YZVA 4KWIA 1YQGA 5TMBA 4ETWA 4TL7A 1XVAA 1XVIA 3AHEA 5FBLB 1UDWA 4JZKA 1NC1A 1RYFA 1ECGA 4F5WA 2BYTA 2WWHA 3B2QA 4LTNA 2AVDA 2Z2KA 4BFSA 4EMSA 4AJOA 5JNRA 1UBJS 4RY9A 1CKEA 3RUHA 2WEKA 4S2UA 1TPZA 2QYSA 4AURA 1ACJA 2E5LB 4IIGA 1XPJA 4A3SA 3FCOA 3HBFA 1JJFA 3HWWA 4KMRA 4YAWA 4J3JA 3WO1A 1Q0SA 1OR8A 3F0TA 4B5KA 2P9JA 3SE7A 3WLHA 4MVJA 1U5AA 3FI0A 3N39C 4TZKA 1YJAA 3H1FA 2B78A 3KYBA 2BGUA 3KRTA 4YN3A 4QGSA 5C46F 2J5KA 3EWIA 4YGXB 3CYFA 2PX5A 4BPRA 1MHPA 2H65A 2CLMB 2D1FA 4NBSA 3LQRA 4Q3LA 3MWKA 3RVPA 2ESRA 4WN9B 3WDSA 4Z3KA 3MJCA 4NFSA 3CX3A 5AM5A 3AJ9A 3SQNA 3GEMA 4PLTA 3HCDA 4KB5A 5K3CA 3TJMA 3RT1A 4LBZA 1JYEA 4LBWA 3SXUA 5JS2A 4IFIA 1RRPA 2Y0EA 5L6MB 4PAMA 1KZYC 1P4GA 1YU9A 3CLRC 4ZAYA 4Z9XA 1C30A 2WBLC 3TQTA 1FFXB 4GSLA 1TIKA 4R05A 4CLRB 2O2DA 1WXQA 2ACKA 4BLWA 3P4XA 5EJ7A 1AA6A 5TB5A 1XDBA 5FUWA 2B30A 3CRQA 4M9ZA 1AV6A 3T99A 5HNKA 2AQHA 3E3OA 3HGMA 3HKDB 4PLFA 2G08A 1RMQA 4EHKA 3REFA 3RJZA 3SF0A 3ZJ5A 2BEJA 1DVRA 1DG3A 1HYHA 4RABA 2C0QA 3Q8LA 4RD0A 3ESAA 3ZDBA 1KTVA 4TRNA 5E6SA 4EF5A 1KKMA 1SH7A 3CMCO 4WNIA 2JPDA 1NVVR 1XFAA 2W2VA 3UYKA 4F4DA 2WMYA 1LPPA 1NJ5A 3IOYA 4P3PA 2PQ2A 4EKDA 2ZITA 4I55B 4GP6A 1ZCZA 4UDNA 5G4KA 1ZXXA 4R41A 5HIIA 1G1AA 1HFWA 1W6UA 2Q99A 3SF8B 3WQBA 3GLGB 4HQ0A 3WGVA 4PY2A 2DWUA 3OOWA 2AHOA 4X3CA 3TE7A 3V4RA 3C1OA 4JL6A 2ZPTX 2E5FA 5HCNA 3AVOA 3I04M 1JWLA 3R8CA 2GF2A 3B48A 4OHWA 3TK1A 4HH1A 4L7VA 2XNDA 5E2BA 4DRYA 3BEDA 4V0QA 3GNSA 5BRAA 3MIZA 3VU1A 1YUNA 3M4ZA 1N2SA 3PWSA 5D00A 3Q3HA 3DW1X 5ESXA 4O29A 1BDBA 3JZFA 2JBWA 3PG5A 4CQMD 1JEEA 4D4MA 1E3DA 1JXOA 1T9ZA 2ETVA 2GNOA 3HU1A 4MSUA 4B6JA 3SVZA 4MR8A 4LE2A 1VLZA 2OBBA 1VL1A 4MIYA 5ALJA 3HVJA 3C3AA 4Y9UA 3TLAA 2A9FA 1O6FA 3FOEC 1PGOA 1DFGA 5KU7A 1TMKA 4OQQA 1K6JA 4ZEVA 3GRCA 2KM1A 4FMCF 2A3RA 1TYBE 1OUMA 2P0AA 3CSDA 5J9FA 1IL0A 3ZZMA 1ABBA 3UAOA 1RJFA 2YJGA 1DWQA 5AQEA 2FCRA 4UM9D 2WQ6A 3EN0A 3ZWXA 3IBFA 1HLGA 2PZGA 2WU1A 4JWKA 4HSEA 4UNRA 3QVOA 3WICA 2H17A 3O91A 2CZCA 3O8DA 1KO4A 4HQ6A 4V0MA 3N7TA 1ZITA 3GQVA 3E9EA 4BVHA 2HQOA 4HEA6 2NO6A 1XD8A 3Q11A 1VPDA 3NYIA 3N2GB 4F11A 1VXOA 1PR9A 2VAMA 3NWPA 4FQ8A 5EIAA 5H80A 3FTFA 5E4TA 4HDSA 1IOVA 4JL5A 1QQ6A 3PPVA 1HORA 2XRZA 2XCSB 2IYNA 3KYDA 1UWCA 3BMCA 3G0BA 3WC4A 5LIPA 2GPJA 5JDIC 1JHYA 2Q1XA 2RAUA 3QX9A 2G7MC 4E07A 1NL3A 4YMWA 2LW7A 2O19A 2VAWA 1DIAA 3GVHA 1DBIA 4M8LA 4DJTA 3AOGA 1LDEA 4P4GA 2DUWA 3ZX5A 5K45A 3OHSX 4E88A 5JCOC 5KWIA 1XCJA 4PZ0A 2NSDA 2EQ5A 3BEOA 4TMYA 3MJRA 4M49A 5F4BA 1EQ2A 3TR6A 4G4JA 3A3PA 1XOIA 4HX9A 5B4UA 4CT5A 3CM0A 4IEIA 2QVXX 4JKOA 1EUYA 5EXTA 1CZRA 3ESXA 1O8CA 2J07A 2DFDA 2J3JA 5BMVF 4CL0A 1KQPA 5IJWA 4ZC8A 5FR2A 1WSBA 1WJGA 3VVLA 2C9CA 2BZSA 3H7IA 2M1ZA 2XE6A 4GPIB 3DH0A 4OTZA 3FVTA 2AZXA 1DTWA 3FMFA 3GHHA 4P31A 1I0LA 1PQ4A 3TZEA 1U28C 4X41A 1G8SA 1MX1A 4OVKA 4I19A 3R7SA 4NJEA 4RLHA 3SX2A 3UXYA 4EX6A 2JAHA 4G1UC 5J2TF 5CK4A 3KQWA 3EBOA 1JL3A 2VP0A 4CNBA 1VIVA 4KLAA 1NATA 1UBEA 3G1WA 4UEQA 3IDSA 2GBIA 3H97A 1ZD2P 5CM8B 4EUKA 1CIPA 3L04A 2NM0A 4IDFA 4NPCA 2VPWA 3BQMB 4QQFA 1XQVA 3COWA 2YKGA 2Z3ZA 4LHYA 2O7QA 3U56A 1HNXB 1IDOA 3LKVA 4HI0E 4HUTA 2ZROA 1V1JA 1BWPA 1SOUA 2XH8A 3THWB 2J0QA 1PZFA 1RM5A 5CAEB 1XX6A 3OJEA 3N8GA 1J06A 1EIZA 2XNJA 3G0OA 1PE0A 5FPPA 1E2NA 3ZBUA 5KTPA 3TLZA 4K1LA 3FFWA 1U0TA 4BZXA 1YBVA 3DUFB 1NV8A 1Z26A 4FFVA 2XZTA 5NLLA 2FWIA 1CNEA 5JFGA 1T5IA 1V0JA 4UU8A 5KEIA 5CR9A 3M0EA 1HBJA 1JQLB 4JJ4A 3OLQA 2LKDA 1FDRA 1X8JA 4LY0A 4XLTA 2O5CA 1UBLS 1ZIYA 3N28A 4CMJA 2Z6QA 1DO2A 2HL6A 4YPFA 3UEOA 2H3EA 5I51A 5G2OA 1EUDB 3OLCX 1R3DA 3VYSB 2P5YA 1WSAA 2F3PA 1UP4A 1Q6ZA 4OUKX 4LE1A 3AUFA 1RXIA 4QULA 4A92A 2J41A 3BMNA 1XYVA 5IC6A 2BBWA 1Q1EA 4U00A 1BDJA 4U3JA 2JCYA 3TKAA 2NSYA 4RWEA 4RDIA 4YWHA 3PFGA 5AKIA 3BXEA 2DFVA 1I30A 4ZGBA 1W4BA 1XZPA 2GHQA 3LBIA 3KOZA 4QEKA 1I3CA 2HD4A 2P62A 4M1SA 4KO3S 4KIWA 3LRXA 3PGVA 3U4HA 3J81A 1U4NA 2ES4A 1NYQA 4Y7DA 2IBSA 3PDJA 4IZHA 4RY0A 5BV1A 1WAMA 2ZAGA 3Q6MA 2HEGA 5KNBA 1JTEA 3B13B 3CZCA 5J59A 1L7NA 1YKFA 2ZTLA 3A6HA 3VU9A 2IXDA 3DBLA 3R6LA 5DP1A 3S81A 3TD6A 3TQQA 2FWPA 1FDVA 1PKXA 1XZEA 1RWPA 2C5LA 4X44A 1DBWA 1PBNA 2KBEA 1UF9A 1B8UA 4BRZA 2WJ3A 4HQNA 3S5JA 2D1RA 2X19A 4Z49A 2LCIA 2QTVB 3H3JA 1WCIB 3CX8A 2VFAA 3ABSB 4NH0A 2ZDQA 1AO0A 4Q7QA 2OC4A 1CR6A 3EDYA 4JQYA 3C87A 2F1KA 3FWKA 4PYIA 4BIMA 4X45A 3LVQE 1CUFA 1RWOA 2ZI6A 3QPAA 1WIWA 4UNNA 1UJBA 4BN5A 2G28A 1QO7A 4DC0A 4QRHA 3WLFA 1E9DA 4J94A 5KDLA 4RCZA 2A1TR 3GIWA 3LOQA 3S0JA 4B3DA 1YOVA 1ADJA 3BILA 4G89A 3H5OA 2QMZA 3UIEA 4L1KA 5FV4A 2HGSA 1QUFA 3DL4A 3O84A 5TSDA 4HWTA 1HEUA 4GYKA 4C4AA 3NHAA 1LPBB 3L49A 1RQXA 1A5AB 4GR9A 1U6JA 4P0QB 1TKCA 3R3WA 4Z8XA 4XLLA 3ODPA 4LY3A 1AUVA 4R8RA 4R54A 4GKVA 1P0CA 2IYFA 4IGAA 4N18A 3QPVA 4GS5A 2N9UA 3CTMA 1PSZA 4DS3A 2ONKA 3VKVA 4ZC1A 1Z5UA 3FHOA 1TA4A 1BG6A 1X87A 4YB8A 1M75A 5JZMA 5KKNB 3B12A 3SIWA 1DC3A 4RGQA 2HGZA 5IWCA 1JUDA 4FMCB 2EC5A 4Q1DA 3AFNA 2JC3A 2BFAA 5ER6A 3H5VA 1T5BA 3EZ2A 3P27A 1OTXA 1CPYA 2J9FB 1CR0A 2WYVA 2J3IA 2OL4A 3ZW8A 2Y68A 4EVRA 2HSZA 4L74A 2VTEA 1XZDA 2EJWA 3IKMB 3OQHA 3ABQB 5CA0A 1FFAA 4KI7A 5CEEA 1AS0A 1GGVA 1U5CA 2IOHA 2PUFA 1EK6A 1VP9A 1AF7A 1JQ5A 2AFRA 2PXXA 3NQ41 4I6EA 4O4JF 1CFZA 1N5IA 2NTYC 2EFCB 4LK2A 1HYEA 3RANA 4C4XA 4YRMA 4ZN6A 1MAHA 3ONDA 5KX5B 1A9QA 3KDPA 4ES6A 2ARKA 4UQOA 4EATA 4AX8A 1GYRA 1K8XB 3DG9A 3T3GA 5JYDA 3LUDA 4HEQA 1Q77A 3WIVA 5DJ5A 2RGNA 1RCFA 5DN9A 3QWBA 3C14C 1IRIA 2WVHA 4L8GA 4GZMA 3HXOA 2H1OA 3H7AA 2QKYA 3FHCB 2J45A 3GROA 3GVPA 2OCLA 4B32A 1M83A 2IT1A 2GFQA 4URYR 4BV2A 1E59A 1N6HA 1N9GA 2JS7A 1RWWA 3BFPA 1KDZA 4R2HA 3ELYA 3O7WA 3STWA 3TBKA 4JKYA 1Y4DE 2Z1DA 4ZKEA 2PL1A 4W5OA 2YXEA 4QASA 1OC2A 4YT4A 2WD7B 2WZQA 5L3ZA 4JP5A 5C18A 1SVMA 3JV7A 4K6CA 5BMVB 2B6HA 4YMHA 3L4BC 1BCRB 1OFUX 1U2TA 1RAAA 3QU7A 1G20E 1DKPA 1MEOA 3REQA 4Y98A 1PLJA 3FYHA 3FLMA 5IJXA 4HDCA 1Y1LA 3BKXA 1C8VB 4E09A 2R1TB 5FWXB 1V48A 2OGTA 4ZT4A 4XPIB 5JQGF 4U9HS 4ZT3A 4G0NA 2WJZB 1IN5A 1LBEA 2EWMA 1HOXA 4GNRA 2YVAA 3GIDA 4DKJA 4UM5A 3BQ9A 2WHEA 3IL2A 1WY5A 3OOHA 3OU7A 5J2TB 4MO2A 4DUYB 2JFOA 3JVDA 1P4RA 2H54A 4V3BA 3B6KA 1RFLA 1GNSA 5F7OA 1W19A 1AN9A 3NONA 1WU7A 2J4FA 4UBJA 1P61B 5F7ZA 1XDGA 1EFDN 1LDMA 2R0QC 3U0VA 1NONA 2GD0A 3UK6A 4ZTUB 5JNTA 2EXXA 3OQPA 5A9SA 2YW9A 1BMFD 1XXHE 2VQ6A 4OPMA 4B84A 1CHDA 1W44A 1Q95A 1ZGGA 2YFHA 3AXTA 3CVOA 4F8EA 4N8EA 2B4QA 4KBYA 4NAVA 1A3CA 1K9VF 1FFCA 2QUJA 4UPVA 1BXRB 2H07A 3B6MA 3R5HA 5CIYA 2XXBA 2JLRA 4FFBB 2Q6TA 5DV9A 5GADl 3B85A 5EZ6B 3TGWA 3W5HA 2GETA 1VTKA 5DIZA 3TXAA 2VSFA 1A4UA 4RVOA 4C0AC 3BTSA 3UHJA 3KHTA 4I9FA 4ZIRB 1FDIA 2XWJI 1N2CA 3WMXA 5FUMA 5KC9A 2LWIA 3EISA 4IP0A 1CJTC 5DN6A 3HNPA 3R0JA 2ZRAA 5AJWA 1U8CB 3PXCX 4PZLA 4ISBA 2EDCA 4WECA 4Y18A 2BTOA 5J58A 1P0FA 2I78A 4NS4A 2G80A 4BNDB 1SVKA 3GXBA 1M1NA 4JLAA 1CUSA 3KQMA 4E2FA 5A4MS 3AHCA 4IIVA 4KGVA 4KO1S 4UAJA 1ZZGA 3FM9A 4LZJA 4Y3UA 3TI9A 4AECA 2VHCA 1E8NA 3GB9A 1UMBB 1GNLA 4PLZA 4X85A 5LNK1 4HLUC 1MO6A 1W48A 2PK3A 1U7PA 3MA0A 3VZBA 1JA1A 1LRLA 1N92A 1RE1A 3HBLA 1Y34E 5FAXA 3DTVD 5IWAB 3TVDA 1DV1A 3ORQA 4AN0A 1FS4A 1S01A 2PY6A 3IUJA 4YRRA 4BQNA 1QTIA 1MVOA 1BMDA 2PUTA 2Q1WA 2Z2YA 3GFPA 4MIEA 5G3YA 5I7WA 2XUHA 3R24A 3BA6A 1VJ5A 3ENQA 2GZDA 3VUEA 5U9CA 4PLYA 1K1EA 1NGSA 3J81k 1XO1A 5H83A 4CPDA 4AU1A 5HXAA 1U1FA 4KXWA 2GNPA 3RVKA 1X7YB 4HEJA 3HXLA 1IBLB 3CBQA 2G88A 4ER7A 1JH8A 2VZEA 4L73A 1G2QA 2OLJA 2VYVD 5D5QA 4NMXB 221PA 1Y7IA 1ZX1A 2WM3A 3PB3A 3KOXA 1TF2A 3E7XA 1P2FA 3W5DA 3WGQA 2BIFA 5CM9C 2MSWA 1AKRA 4RZ3A 3DB1A 4Y1FA 1ZUD1 3A2MA 4X7PA 3PXBA 3ZE1B 1C7RA 2G25A 1Z0IA 2NUAB 3NV9A 3UJCA 4I4TA 2C5AA 2P2SA 5C8VA 5TX7A 3L1VA 3P0IA 4MEJA 2BF7A 1PRYA 3LIPA 3ZQ6A 3QUQA 4LJ9A 1ORDA 3G02A 4NYIQ 1UDRA 2C20A 4Y6RA 2ZJ7A 3O4JA 3EXIA 3UAZA 4X61A 4KRFA 1OQAA 1ZEMA 4FYXA 3Q6IA 1ORHA 2WM2A 2HNAA 5DBFA 5LQNA 3FGOA 3AERA 4DA9A 3HKBB 2AKYA 4S05A 1DWOA 4DNPA 2EG5A 3ZNNA 3CN9A 1U04A 2AR7A 2RK6A 2G6BA 1W96A 4ND2A 1QRRA 1ZIPA 2QEQA 1MXHA 3TUJC 3QLJA 3EUWA 1EWYA 1W46A 3WXBA 1GGJA 2EW8A 3WNVA 4CEHA 4YACA 3VBCA 2HFJA 2V98A 3EQ2A 2DPHA 3VOAA 3K4HA 3HLYA 4ZT6A 1UPBA 4PYJA 3NHRA 3S3TA 5FCDA 1KRXA 3CZPA 1MT0A 2DQKA 3SEZA 1XTZA 4KPGA 2RKBA 4QTXA 3RS0A 5DU2A 2JFPA 4YV1A 3HYTA 1CUCA 1G6Q1 2B4RO 4F2PA 1RP7A 2E6UX 4FW8A 2II6A 4KQFA 5E6SB 5FLEX 1FTYA 2VP6A 2ZJZA 3TD2A 4BBPA 4CQNA 5JZSA 4KQEA 1D07A 1NBEA 2FFBA 3ELWA 1APBA 3Q8KA 4YI5A 4E1VA 1EJBA 7REQB 3BFKA 2XB6A 3WK5A 1K8ZB 1L6IA 1N5RA 2FRXA 3DEYX 3K92A 4QZVA 1QG6A 2JGKA 2QIPA 4ZOQI 1AMOA 1NASA 4XUCA 5BSGA 2FFHA 3BCHA 3DLCA 3NGXA 1RTKA 1NKSA 2YCBA 3Q5GA 4GDMA 4QECA 4OI1A 2AFIB 2ZIAA 3T7JA 4CFZA 1E3SA 5EJ5A 5ALPA 4GMXA 3HDJA 4WGFA 4OJMX 2XSZD 3AR3A 1KXZA 4PC3A 5D8DA 4BP8A 5JMWA 2W7TA 4YIHA 1EWQA 1EK5A 3OZFA 4HYQA 2H92A 1LS6A 4YUAA 3IE2A 4RMGA 1M1YE 2LR0A 2C98A 1QVWA 2VDWB 4LSGA 1Q2UA 5C34B 1KDPA 4EW2A 1KDYA 4RKQA 3STVA 4ZGWA 3NASA 2CB0A 2QVBA 3A9RA 5AI9A 4CF7A 1SVSA 2C59A 4L28A 4X94A 4DLXA 5LL6P 4DJFC 1XDSA 2JJ1D 1T8SA 2CNWD 2JGDA 1Q1GA 3FPJA 2IW3A 3L7YA 3Q9LA 3TQSA 3U6BA 2I99A 1AUPA 2HA3A 2QRLA 3OE1A 4URWR 1M7GA 4GUAA 2X0EA 3SZ3A 1EPUA 2ZANA 4NEQA 4U1RA 5CDHA 2GXSA 2YFYA 3DE4X 1GA4A 1YZFA 2BOVA 2G0TA 1GYPA 2HUNA 2QV7A 3CO5A 3I0MA 4YUVA 2Q46A 2XECA 2Y66A 3ZH2A 3INTA 3SYMA 5IDQA 3BJIC 4QXQA 2IPMA 3TTYA 4G1EB 4BDSA 1YR7A 4N12A 4ND3A 1QIDA 1EFHA 1Y6ZA 1FFHA 3TE6A 5EPOA 4JEMA 3UH0A 1A1SA 1QH8A 3KVNA 5B3KA 4Z4IA 2Z4SA 3PPIA 1ZU5A 1BYIA 3G9XA 1XJ5A 3GD5A 4JVMA 1IJFA 2CT8A 4LRXA 2Y1EA 3VHQA 1MP0A 1P60A 4IJMA 2JAPA 3CA8A 5JNUA 3LUCA 1ZDMA 2A0XA 2NO9A 4RGBA 4JXKA 4YK7A 4G5FA 3JWJA 1ZMXA 13PKA 4GOND 2OYRA 3KQQA 3OM0A 1POWA 4MGKR 3K6JA 3EVBA 3FUXA 4MI3A 4RJTA 1S89A 1VG1A 3NUGA 1PHPA 3ANSA 2WIAA 3HCBA 4QXRA 2FMUA 1U4OA 3HO6A 1WCYA 2Z58A 1V1RA 4GSKA 1EUCA 3GOQA 1DNPA 1P7YA 1U8EA 3KEOA 1RC0A 1VC2A 3LQFA 1SC1A 4K05A 1UKCA 4N03A 2OY0A 3UQZA 1EA5A 2VXBA 5JAIA 3W6OA 4FZVA 2R6CA 4I4LA 1MDBA 4OBEA 1DBVO 1MAWA 4Q66C 1XUOA 5HQJA 5C3MA 5KNDH 5CFRA 3K0BA 3IKVA 3ZWVA 1ZS9A 1HT0A 1LLCA 2D5LA 4PSVA 3KSMA 4N5NA 3SEFA 1D9ZA 2DTXA 5HIAA 1J23A 1DTWB 1YC5A 4JOSA 4YBRA 3OEYA 5AXDA 1FNNA 2Z8YM 2NO4A 4G0OA 1OBHA 2YH2A 1YR1A 3KXPA 4BYMA 2QTNA 3HVUA 5I6DA 2CD7A 4BGVA 4IEEA 2D0OB 3UATA 4F21A 2WWFA 3O93A 5IP5A 1GJRA 4G5YA 4P4UA 1WPGA 3D59A 3QSYA 3IXLA 4BKPA 1ZAYA 4EL5A 1UFRA 1JS1X 1WDWB 4HQOA 3W77A 1XAIA 4P98A 1C3EA 4WZBA 3UVEA 5D2CA 4C6TB 3OQ1A 2B1QA 2AEEA 3IUSA 1NUSA 3PA6A 4ZFNA 2XUZA 2J5RA 2IH2A 3OZRA 1H2FA 2BR5A 5HIJA 4FGSA 1O94C 4D3SA 3ENNA 3LV8A 3IKTA 1JSRA 1LTKA 3M9XA 3W9SA 1BS2A 1MOPA 5EVCA 1LV7A 2CJPA 3IAFA 3A9CA 1KEUA 1PNTA 4ZGGA 2GXAA 2Q5JA 4IFTA 4BO9A 3L8DA 1N8KA 2K6GA 3BRWA 3AEQA 3W5AA 1I14A 2H16A 1DARA 3THRA 3V4VB 4F96A 1G19A 1GHTA 1XRRA 4FT2A 4EM6A 4YI3A 2BTQB 3HSYA 3ZOZA 2H5EA 2PFKA 2W00A 3K0KA 1ECBA 1W88A 3G9UA 1RJGA 3H99A 4XGKA 5DTQA 4L6AA 5AK6A 3LYHA 3DT8A 3RWMB 3SDBA 4EPWA 1PFYA 1H1TA 1V4BA 3K0FB 3PENA 4L50A 2DSTA 2O20A 3DEJA 1NA5A 2X13A 1NHGA 3WFIA 4DABA 1NX9A 3TCKA 3PK0A 3V2UA 6ADHA 1YQXA 1SHUX 3GHYA 2YZ2A 4G0VA 3UT0A 3BMNB 1TOAA 5LFAA 2GBGA 1NW8A 1Z6AA 3F6RA 4RE6A 5A0FA 2HQRA 4A8JC 2RC5A 1P7CA 5IF3A 4DSAA 1QQ5A 1S4QA 2A58A 2J0UB 2VRCD 3DJFA 3WBBA 3VDRA 5DWDA 4IH9A 5CNJA 4Q6WA 2DHCA 2JIZD 4H3HB 4QTZA 1CNMA 2Z5GA 1ZRHA 4KAJA 4RQAA 3D3KA 3I5UA 4WLFA 2OFXA 3GP5A 4QREA 4JLBA 2Z1NA 2ZB4A 4EJSB 2OR3A 1L4KA 3FVVA 5DGCA 3A7EA 3V4OA 3VKGA 2QT9A 1Y8ZA 1NWCA 1FTGA 3TBHA 1ZLYA 4LXTA 4YUZA 1Y8CA 2A2ZA 2AOTA 2QMYA 2QMQA 3DBLB 3OBBA 1OF1A 4DWWA 4JLUA 3TLGA 4ITUA 3K05A 3NKFA 4PCLA 3TMYA 3U4QB 1RLIA 4R0NA 3WZLA 5IKPA 3AF4A 1J22A 2IGBA 1KA9H 1GPUA 4FHZA 1OFUA 4G84A 4BLTA 4S1WA 1OI7A 3FPAA 2XVYA 2IYEA 3GWZA 4LV6A 4N8DA 1W36C 1G17A 1LBQA 3IQHX 1PGNA 1E0SA 4IINA 2O8CA 5JRJA 1I0IA 1XR3A 4P1ZA 1UPCA 4KUEA 1KMIY 2DE0X 2XI4A 3HDTA 4NK5A 4Z54A 2O2SA 5CLJA 3LQ2A 4UMDA 4YJDA 4MP8A 5H02A 1BTOA 5LZ9A 1YOVB 2AI1A 3M9WA 4ESOA 1B00A 5AW5A 5EHXA 2J08A 1CIVA 2NP7A 1JFVA 2Y1CA 2O0JA 2GCOB 1T6ZA 1Y98A 2I6FA 2X2OA 3CWQA 4QO8A 1TT5A 1GIAA 1K7FB 2G5GX 5J5AA 5H4GA 4M1TA 4NE2A 2FW8A 4W5RA 2Q7DA 3BAFA 4XWWA 3CPJB 1C7ZA 1X1SA 2YWXA 3DSRA 1VLLA 3ESBA 3PR2B 2JKVA 4IF6A 2MWMA 4XDGA 4JELA 4JR2A 4KLNA 2R5FA 3GJQA 4GAEA 1QYCA 4F12A 1T3GA 4JR1A 3WVNA 4NESA 3JQ8B 3L4EA 3KUDA 2O7RA 1ZVJA 3OFJA 4H27A 4C21A 2BFNA 4LXUA 5ISMA 2VSYA 4J4TA 4OK5A 5CG2A 3F4KA 5L53A 2QN3A 1ODSA 2AV6A 4LDQA 1U8TA 2E1RA 1W0KD 3D6AA 1NC3A 2V1XA 3EGVA 4OMCA 2DGDA 3TRJA 3FVWA 1P33A 3R40A 4OX9B 1ILEA 4CL3A 2IYWA 4EPTA 1X1RA 2PZMA 4FFMA 1Z88A 5CA0B 5KDOA 4DA6A 3U4AA 1Y9AA 3RVJA 2B8JA 3IDFA 4EG4A 1OAOC 1RWVA 2OQ2A 4G85A 3HXKA 1BU5A 1BVRA 3HJHA 5DCLA 3ZR4B 3FOAA 5KQMA 3AL3A 1P31A 4OF4A 1ZOLA 2QLFA 3ENKA 5BN4B 3VOSA 2YWCA 3STTA 4AJ4A 3NI2A 2DOKA 3OJOA 1VE6A 4H18A 4R7TA 1VCOA 1B8VA 1COWD 1LS1A 1NQWA 1Y8RA 1B1CA 1FPMA 2IYYA 3BE5A 4N9WA 2I91A 3WAJA 4Q15A 2CMFA 1FLVA 1N78A 4B6QA 3ZVNA 1FUIA 2ZBVA 3AUUA 4TZ6A 4H1VA 3AYZB 3R0VA 3M6XA 4JIGA 5FTLA 5JDIA 4AY3A 2WTUA 5K0LA 4AK9A 2LIPA 3DR3A 1XP8A 4BUJA 1G6KA 4IXMA 3IAS6 1A9YA 3TFOA 1PUJA 1BSVA 2XODA 5E0OA 4NXMB 4JNCA 1E69A 3L0PA 5HTOA 1EGAA 3DBVO 3GGDA 3MZ0A 1E4VA 3KAJA 3IESA 5FIUA 2Q6IA 4W1SA 4BE7B 3MJFA 5JCOA 1X19A 3A6EA 2XVAA 4Z8YA 5AWFC 3LVRE 2RHGB 3MWJA 3PNBA 1JT9A 1WSDA