4KQ6A

Product complex of lumazine synthase from candida glabrata
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
158
structure length
158
Chain Sequence
QNYDGSKLRVGIIHARWNRVIIDALVKGAIDRMLSLGVKEENIIVETVPGSFELPYGSKRFAEKQAKKGEPLDVVIPIGVLIKGSTMHFEYISDSTTQAIMNLQDKINIPVIFGLLTCLTEEQALARAGIDEGKTMHNHGEDWGAAAVEMATKFGANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 6,7-dimethyl-8-ribityllumazine synthase
publication title Catalysis product captured in lumazine synthase from the fungal pathogen Candida glabrata.
pubmed doi rcsb
source organism Candida glabrata
total genus 51
structure length 158
sequence length 158
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 2.5.1.78: 6,7-dimethyl-8-ribityllumazine synthase.
pdb deposition date 2013-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00885 DMRL_synthase 6,7-dimethyl-8-ribityllumazine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.960 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Lumazine/riboflavin synthase 4kq6A00
4KQ6A 2F59A 2C9DA 2B99A 2A59A 1T13A 2O6HA 3NQ41 5IM4A 1KYVA 2I0FA 1NQWA 1NQXA 2B98A 2C92A 2A58A 2C97A 1NQUA 1KYXA 1KZ9A 1ZISA 1DI0A 1KZ4A 1KZ1A 1NQVA 2C9BA 2JFBA 1EJBA 5IM5A 1RVV1 1W29A 1HQKA 2VI5A 4J07A 2OBXA 2C94A 1KZ6A 2A57A 1C41A 1W19A 1KYYA 1C2YA 3MK31 1XN1A
chains in the Genus database with same CATH superfamily
1QPZA 1CCWA 2AFVA 4TMFA 3IUQA 4BQPA 4HRXA 5HFJA 4MQ5A 1ZGJA 3LY8A 3MD9A 3R7SA 3FD8A 5EXTA 3T8YA 3P27A 1I3KA 2R9VA 4XUCA 3W06A 1HUQA 5F5XA 5DSZA 3TQCA 5BQ5A 8ATCA 8GPBA 3CRW1 2Q6VA 4A3SA 1TM5E 3RRNA 3K1JA 2P3OA 4NKRA 1YZUA 5F7XA 2QLMA 1QE5A 2F4NA 1JZTA 1XP5A 5H81A 1SPXA 2EP7A 3DE3X 1M1ZA 3LF1A 4U4AA 1X7ZA 3D7MA 4Q7MB 3KUDA 4OI4A 4TWRA 1MO5A 2BKUA 3FTDA 3EULA 2AF3C 2Q4BA 3HSYA 3SBOA 4ZICA 4WBNB 1VLJA 2KX7A 3OU6A 2WD7B 3LKVA 4YONB 2BGWA 1STOA 4CR8A 4POOA 3BVPA 3WYNA 2WJPA 5KYUB 2GQ0A 2W2OA 3IMFA 1NMYA 5F73A 3FTEA 3CWZA 3P9PA 4ZVMA 1HDXA 1TAGA 2YOHA 1U0FA 2ZBUA 2V3VA 3G2QA 3KTDA 4OK6A 5T6BA 2RH9B 2ZI7A 1OGJA 2C8KA 3IIEA 1MHPA 4HDQB 3U44A 3FAZA 2CLLB 2IHZA 3TW6A 5IYZB 4DBZA 2C83A 1KZ1A 5LP6C 4DSNA 1JA1A 2ODAA 4HDSA 5BN5A 1V5FA 2IT1A 1IQRA 3OZTA 4G84A 1M0WA 2DLDA 2O50A 2D0PB 2GS9A 1PLKA 1S02A 4M1SA 4R41A 4ZTBA 5CA1B 2N47A 4L07A 3TX6A 3BKWA 4Z51A 4H7EA 3AC0A 5DXJA 3HCWA 3NP7A 4H1WA 3UIEA 5DNAA 1Q7RA 3IP9A 3F49S 1K9VF 4Q6WA 1FFXB 3WLTA 2ZP1A 1P29A 1ZWKA 2HMWA 2Z6AA 3J7TA 4M36A 3KFLA 4Y7DA 4OLAA 2JFNA 4BLVA 1Q1AA 1VP3A 2J3JA 2QTRA 2X42A 3PNPA 1L1RA 5ILOA 4FYHA 1KQPA 1ADFA 4ZKEA 4BNFA 2YY7A 2ZYHA 5C4IA 1RM5A 4MO9A 4RGQA 1Q7TA 4EX6A 1HFKA 3ITEA 1JHQA 1MJ5A 2OCXA 3KU4A 4HQFA 4UM9B 1GU1A 4QREA 3NHSA 1QE3A 2WYUA 2RJOA 5EERA 3RSFA 4AZ0B 4O2RA 3KT3A 3EZLA 2YW2A 4IVNA 4WZAE 2PQMA 3UHFA 3PR2B 3EZNA 4ZJPA 1ZFNA 4ZMBA 3FGZA 2A67A 4BX2A 3BJMA 1H2EA 1F2UA 2IUTA 4P8RA 2GJAA 3ESQA 4HEA1 5FTNA 1KZGB 1TM7E 4FZRA 2ZRGA 4JLNA 4KVFA 2G8LA 2FRVA 4PPFA 4WL0A 2XITA 3QJYA 3VC7A 4LZAA 3TOVA 3C5HA 3GBPA 1ADCA 3S3TA 5KX5F 4OGGA 1I6KA 1PGQA 5HKBA 2FUEA 4HFJA 4BKMA 4L6IA 2TMKA 1SVIA 3ROXA 3SNKA 3D3NA 3CNNA 1N75A 2ZYIA 5KTSA 2J3DA 1XDWA 4EW2A 2QXYA 1Z38A 3ZE7A 5EZYA 2CZGA 1XZAA 1Y7TA 2ZXFA 2IUYA 1XWWA 3LD9A 2MR6A 3LT2A 2RFLA 1IHYA 2ZIXA 1BN7A 2ZPTX 3LM8A 3CX4A 3ITNA 1WE2A 2DFVA 4IIJB 3TXYA 4DA0A 4C76A 5HM8A 2I6SA 4LJ6A 2ZI6A 1VE6A 1NSYA 5SYAA 3OZEA 721PA 1XAHA 1KY3A 1P0CA 1P1IA 2BFCB 1UK9A 2HQRA 3GMSA 1IRXA 2C4NA 2QMUA 2TRSB 3N8DA 2FU5C 3AKDA 1AQ6A 1RRMA 4HRVA 5BMVA 3V7FA 3P9ZA 4W5OA 2D4HA 3OLZA 5HKAA 4WKOA 4CBVA 2W2QA 3UB3A 3PFWO 1PQPA 3FNIA 3PU6A 2YJ6A 5DBHX 1G8KA 2IXEA 2WBLC 1W4BA 2A92A 4GI1A 2CXPA 2I80A 4DLYA 5JEDA 1KSGA 1FP4B 1NQ5A 1PJ2A 3DBRB 3IQWA 1M6YA 1DO2A 2C3OA 2YC4C 3M9WA 3LCVB 4Y1RB 2JLYA 2FR8A 1RC0A 2ON6A 1IUKA 1O95A 1HRKA 2ZKLA 4PG6A 1YRLA 4CMIA 3HHEA 2IW3A 5H4GA 3FTNA 5JJKA 1K89A 1FDWA 1P1KA 4LNHA 1QIIA 1AQLA 4LBZA 4DCNA 2GM5A 4WVFA 2G5CA 2DWPA 3W9UA 1NIJA 1H23A 1MFPA 2FPWA 5CDSA 4YR9A 3LUAA 3PNOA 2BE9A 2CNLA 1OWMA 4BFWA 2VJMA 4NS1A 4OIMA 4FN5A 5BMOA 4ZC8A 4UHDA 1RNLA 1F2TA 2PMDA 5IVDA 5B12A 1NX6A 3BXPA 2J3QA 1XVTA 3H8JA 3ZWYA 3PTAA 3F3KA 2E2WA 1H6CA 1Y37A 1FNCA 2OY0A 3LY7A 4MMXB 1GZSA 1UOQA 3EOAI 3FDZA 4MW7A 4Q3DA 3W6UA 5B7GA 3L6CA 3U19A 5EL0A 4BE4A 3CPSA 2AOXA 4EY5A 4LF8B 1VHQA 4MAMA 4UPDA 1MU0A 5EE5B 2E4WA 4RV5A 5EUQB 3E9DA 5CT9A 1XU7A 1ZHFA 5T64A 5J2UA 3H18A 4CM9A 4JSTA 5L3QB 1MC8A 3LXUX 3ZY3A 2D8MA 3EUWA 3EBOA 4GVXA 1V3TA 3HXOA 4MRMB 5LQUA 4RULA 1XQ6A 4KE9A 4Y9SA 1KO8A 1Y63A 5B58C 1R9MA 3VH3A 2KQUA 1I5EA 4WI1A 1GPMA 1GZUA 4BKOA 2H5LA 3RI3A 5ICEA 5JS6A 1JSCA 2VYND 2BMVA 3OQJA 3GAZA 3Q3CA 4F6RA 3FN4A 2Q5JA 5G0SA 3FCXA 3AW8A 1GZHB 1QV9A 1Q19A 3GJQA 2ONJA 3HCEA 4P98A 1NKSA 4RJJA 3AF5A 3CR7A 3LXRA 3C85A 1T9BA 4OU4A 5EMJA 4BLSA 3QE4A 3RRJA 1QLWA 2PHZA 4ZEXA 2BSQA 3SQWA 2V6IA 3AVOA 1LNQA 2BKAA 1DC6A 1HQCA 4KQ1A 1NLYA 4A8JC 2QOEA 2GZ1A 4HEQA 4GOMD 2JGFA 1U2EA 2A9JA 2IIPA 4HWRA 4LY0A 5ALMA 2HH9A 2YIDA 1Z2PX 4EAAA 3EWIA 4MR9B 4ATNA 5K0GA 1AJEA 1FS6A 2D1TA 1JNYA 4PAQA 5FEMA 3VPHA 5AKEA 3G59A 1OBHA 3AOGA 1CK4A 4IUYA 4ZZ1A 1TO1E 3V3TA 4FD3A 2IYUA 1LVGA 2JFBA 5FPSA 2J6BA 3LBIA 5LZ5A 2FW8A 5BSTA 1MD9A 4X71A 4WE3A 2Z83A 1L4FA 4LSGA 4Z8YA 4W5RA 1X0XA 1Y3CE 2IK8A 5EE1A 2C9MA 4UHBA 1O96A 1UCFA 2IDZA 5EUBA 3M6MD 3ML1A 3I52A 4GMDA 1G7CA 4U2FA 3KHSA 1W4CA 2GARA 4JLJA 4BX3A 4QX6A 1REQB 1LBEA 2C4VA 3H65A 5BO5A 4NFYA 3A3KA 2XZLA 3VVCA 1Z4NA 3X0DA 1HKHA 4R7ZA 3OZVA 1HDIA 3ZW8A 2DKNA 1Y4UA 1WR8A 3PQ6A 1GO2A 4IWNA 4NYIQ 2XUFA 3GLIE 4RJ2A 1H0HA 3DOHA 2GMWA 1EVJA 4WZAB 5NULA 3EF1A 4D80A 4DM7A 3SJAA 4U2BA 3KR1A 4MWGA 1BJRE 5FO1A 1I2DA 5K0EA 1WXWA 5CJPA 1LVUA 3TMAA 1BE6A 1WB6A 4P58A 1TUIA 4K9OA 4JEHA 4KR3A 2JLVA 2LE0A 1IK6A 1SUEA 3KCQA 3L0BA 2NU9B 5AJUA 1VA4A 1ZP6A 4YAKA 2O8DB 3MS7A 5DHRA 3TZQA 5LUBA 3SS8A 3CO5A 4YCLA 1ZGGA 2OO5C 2P9JA 2VDVE 1Z5PA 2PT7A 2VHQA 2XUIA 4HX2A 1E63A 1OI4A 3C6MA 1I1HA 3M2TA 3QY9A 4KXLA 4US0R 5LZ8A 3OTHA 5JH7A 4L57A 1U1DA 4FBMA 2B0CA 1IXSB 3B5IA 5AW3A 2RMKA 4Q93A 1BDJA 1XTRA 2ACWA 3LSYA 3Q5DA 1MABA 1XZQA 5LOVB 3M6LA 5CLIA 3F7OA 3HR8A 3Q3HA 2PUHA 4JL6A 4P82A 4B3HA 4EJFA 2O5EA 1BVUA 1IN6A 1JMKC 3LBHA 4ZVSA 2HSJA 3DNFA 1UP7A 1KYVA 2G08A 2FGJA 3LHKA 5JQWA 4DIKA 4R1PA 1CFJA 1HQYE 1VMIA 5BUSA 4H4DA 1ZEMA 2OZKA 4G5FA 5LOVA 4ZOLB 3LX4A 1E60A 1GLVA 4GP6A 2J3IA 1L4EA 1XJCA 2VSOA 2YCBA 3ZDRA 2P75A 5ADHA 5DNEA 3DE6X 3CZRA 2QRUA 1R00A 4EG3A 2WLTA 4EUFA 2RH5A 4LYJA 3LA6A 4H3HB 1SXHA 5KYTA 1XEWY 1JHYA 1UZAA 2R86A 1C1DA 1IEWA 1ZRSA 2COKA 3AG6A 3CN9A 3IKJA 3OZGA 2NXNA 3UFBA 5HKKA 2GCEA 1EUYA 4G0ZA 3TW0A 2BT4A 1OYWA 4BFCA 4PONA 1Z4JA 3W05A 3P2OA 1AQJA 1E69A 3CZ4A 4RDXA 2MINB 2FPLA 1YZKA 2GF0A 3E3OA 4IR7A 4QNMA 4C7JA 4CV1A 1NQTA 1Z4QA 3GMDA 4QYTA 1KPHA 4V0QA 3VZSA 1U3WA 4BQIA 2E21A 4LYDA 1TUBB 3C3EA 1VJ5A 1U8XX 2DOKA 4IF6A 3OZSA 1BKYA 2I54A 4DIBA 1PV4A 5D5PA 3DNMA 4LG1A 1U3UA 4GEKA 4H1UA 3CLSC 3AVYA 1QB7A 3MIIA 3G6WA 2XKKA 4OX9Y 3FOBA 4J0GA 4QXQA 4QEZA 3MTAA 4PZ0A 4DLBA 5EJEA 1B6TA 4D43A 3JQ8A 1UBFA 4EGQA 2Z6UA 4B7UA 4ZOCA 4CLOB 1JF8A 2UVDA 4DT1A 2OXTA 2I7VA 3CXUA 4X1KA 4G1FA 4GECA 2QLNA 4L95C 1Z63A 3IQZA 3PQ5A 3UEOA 3ZTYA 1HOXA 2PMBA 1J56A 2EP5A 3OE5A 4OHPA 4PLHA 1RZVA 3K5IA 4I50B 4NHEA 4YMIA 3WHPA 3ZE0B 1VE7A 1YDFA 1Z74A 1YJ8A 2XQKA 2G71A 1PE0A 2OHIA 4P7FA 3OCZA 1D6MA 4ZVNA 5BQFA 4CF4A 3C39A 5IBQA 5F76A 2RGNA 1I10A 1ZM2A 2OG2A 3LLUA 1KFEB 4CPDA 1M6VA 2A3RA 2QIOA 3E22A 4O2BB 2W42A 4NYJQ 4M89A 5HIMA 1L2TA 4HGQA 4L73A 5KVAA 5KYXA 1QGUA 1R5OA 3JD0A 3FSGD 3R24A 3PLRA 4C4ZA 4W9MC 3Q9NA 5DN9A 1ZVKA 5DWVA 3RAEC 3D4NA 5HDBB 2BFEA 3UYLA 3FNRA 4IIXA 4LXIA 1M6HA 1X1AA 1EFLA 4PO9A 4OMUA 3QKRB 3AEYA 3IR6A 4RQAA 4G1VA 4J1TC 4KPGA 4AROA 4EY6A 3QLVA 3ZIDA 1IPHA 4KYUA 5EIOA 3T95A 3WIUA 1NW4A 3NBFA 1E9SA 3NGMA 4DC0A 5J4HA 4C2TA 1JR6A 3I4LA 3IUNA 4X9XA 1C7IA 4I19A 2HR1A 1W49A 5E7JA 3W77A 4M1WA 3GA7A 2DR0A 3HBJA 3AEUB 4U3JA 2Q28A 1E1DA 3P1JA 1NUHA 3IE0A 1ZMRA 4U6QA 1P3DA 4CIVA 5U1PA 4LMRA 1JI3A 3NHPA 6ABPA 4UHJA 3OT5A 5JLAA 5CAEB 2VQ6A 3PWZA 2ZT7A 2NN3C 5FUMA 3ZYZA 4NP6A 4FWBA 1LXCA 2BY4A 4RPJA 3IAXA 3KDSE 1TEHA 1HPLA 4YUYA 2XUZA 3WOHA 1N2CE 1ND6A 5KMGA 3KB6A 3ZX5A 2FAXA 4CT4B 3DBIA 4ZI7B 4GH5A 1JAIA 1ZH8A 4XEHA 2NUPA 1IWBB 4RZIA 5FOUA 2D6FA 1P9NA 1ZR4A 3BAFA 3K0CC 5IM4A 1Z36A 3ZJUA 2BUBA 3L3BA 3GLIB 1OZ0A 3KTOA 5I7RA 5IW8A 3U0VA 2I2AA 2FSPA 4EFKA 4WV3A 1SUWA 1XA0A 2CZCA 2PUDA 1IQPA 1WSWA 4O4IF 4JI4B 4DYDA 1PT8A 1TD1A 4DSZA 1EKXA 2ZDGA 4RHTA 3Q2OA 3FHCB 4KI0A 1G3IA 3WDKA 3QP9A 3IIJA 3FR7A 4QEDA 4AF7A 4W5NA 4WX2B 3D6HA 3ER6A 3LHIA 2IV2X 3VZBA 2ZJ3A 4RF3A 3TR6A 1WDTA 4DBLC 4S35A 5BSKA 4DV4B 5I7UA 4P0QB 2PR7A 2MR5A 2NV0A 2RHRA 2VDWA 4PLPA 1B0ZA 2XUGA 3QK7A 4TL9A 5EMHA 4JAVC 1ZVJA 4BBJA 3E84A 3HCCA 4WXHA 4CTMA 1UMKA 3FHLA 2BI8A 3AB8A 2JFPA 4MHSA 4RKRA 2RI1A 2VJDA 3I0ZA 2I62A 3LT1A 3QMPA 3RS7A 2OWEA 3KJHA 5LLDA 4P7GA 1ID1A 4X90A 1PFKA 2PBRA 2BGTA 5HIIA 3E7PA 5SZHB 5A1TA 7REQB 5DW3A 5IF3A 4N54A 1C9KA 1O87A 1YQXA 3TRHA 4ESOA 1E94E 4PG7A 1L7EA 3CF6R 4PS0A 1ZO8A 1IN8A 2NNWB 3IBFA 4WFKA 3TW8A 4B87A 1DXYA 2R6AA 3WGHA 1R64A 3D3KA 3QWIA 2GEKA 1CJKC 5JWHA 5AQ1A 1D5CA 4UUNA 1D2CA 3EEBA 3C5WP 1Y80A 1Z0ZA 4W9NC 4R05A 1V8BA 4M9CA 3T7RA 1E3WA 1AUOA 1AO3A 2E4ZA 2OFPA 4W8OA 4GSLA 1TA9A 4X97A 3MWGA 3EFOA 1G64A 4CLDA 4H18A 2BCEA 4DCTA 5K99A 1XHEA 1J7KA 2O8VA 5BWOA 3HL0A 5IU6A 2CD7A 2VF7A 3T3MB 4RTKA 3UFXB 1BMTA 3IAHA 4PXSA 3ZK7A 3U39A 2PLNA 3K6JA 2W6IA 3FSJX 1NXPA 4L5CA 1YZGA 2ZJ4A 1ZISA 5JBNA 2VJBA 3WGZA 2C1EA 3QKWA 1KE2A 3Q8KA 1DX9A 4C0XA 1U98A 2AD1A 2ZUVA 3QPVA 4QGBA 2LP4Y 1FJXA 1M6NA 4KFRA 4DDMA 3DVQX 2VTDA 4MV0A 3DOUA 5CURA 4UTXA 1ZICA 5BVHA 4Y98A 2OSBA 3BH6A 3USCS 2HT1A 3HKBB 3WGYA 4BL5A 4Z4GA 3QQPA 2QRVB 5EGNA 4IDHA 3TEJA 3F4BA 2GNPA 4PQFA 1U4NA 3DWGA 2C4KA 4GQAA 4DM3A 3SBEA 1K06A 4LZZA 4F45A 1JXAA 3TB6A 4TVSA 2RHBA 1TK2A 3R5JA 1E5QA 1MA0A 3PBKA 2NZUG 4O4LF 2DWCA 2XYGA 1Y1SA 3C6BA 5CM9C 1MQAA 4HN4B 3SZGA 3O1JC 1IFXA 2DTEA 3L9XA 1C1XB 1N2XA 1S9DA 2I6XA 1U2ZA 3CURA 3KKZA 3D6JA 3HUDA 4JZKA 4MQFA 4PRYA 5BY2A 5KU1A 1KK2A 4JR1A 4FLMA 3CW8X 3IV6A 4Q4HA 4E15A 4PLVA 2TMGA 3ESBA 1EWKA 4CN8A 4E5SA 4RXMA 2I7CA 2ZZKA 5BYKA 4N48A 3L05A 4XDGA 1WABA 3ROGA 4KO1S 1Q20A 3MCUA 3DDHA 3SPXA 3FHJA 4OQZA 1AKTA 2C2YA 4HEHA 4LKOA 3MPOA 4M8SA 3RIXA 3GQBA 1IJKA 4Y67A 3OT1B 4BP9A 3HCBA 1UT5A 1M1YA 5AXDA 5EJGA 3WP1B 1XD2B 2XVYA 3IQEA 4UUBA 2FW9A 4TTRA 2X1VA 4HBGA 4I1UA 1PG5A 3WQQA 1ZG3A 1L5HB 5SY9A 5LQAA 2D1QA 3K0AB 4C0LA 2QN3A 5FT9A 4ZV9A 1CY6A 2I6UA 4BO0A 3PGKA 2YQ4A 4U8HA 1CJBA 5ILGA 1YS9A 1K08A 4PO8A 4R2MA 3IJEB 4ABYA 1R6DA 1E2LA 4UVEA 3ZWAA 1K2WA 4JVMA 2G9RA 3FWHA 4QL3A 2J6HA 3C24A 1RTTA 5JJBA 2DVMA 2XY4A 2W5UA 2Z9BA 2ZJ2A 4IDNA 4J16C 2CMFA 4EPRA 5C8DA 4HNTA 4FM9A 5AVYA 3GFFA 2FPPB 2ZT8A 1XTVA 3PYMA 1JFLA 3IJ5A 4IGAA 1V16B 3UNXA 2EW2A 3T1YB 3E61A 4KXUA 1TVMA 2BBSA 3KZXA 4BFUA 1J90A 3EE6A 2H8GA 4M99A 2P69A 3HTXA 1KC3A 5ALHA 3F3SA 1Z5UA 1T4BA 3IIKA 4TV8A 3IPLA 3M1IA 4XSGA 4TT8A 5E95A 4ZAZA 4RSHA 3FW1A 4PG8A 1E6WA 2CVZA 4LSZA 5IJAA 2GD6A 4DAOA 2C3YA 2COEA 2NV2B 3ZGYA 5JAPA 2L69A 2WMNB 5F64A 1MX1A 5BYJA 1B6SA 4RMJA 1U2GC 4KPEC 3ELDA 3PGMA 1T4CB 2QEQA 1TEXA 2DZDA 2GHTA 1R6TA 3CLTD 2E37A 1A5SB 4KW7A 1N6NA 3CR8A 2XT0A 3JWGA 3Q0EA 1G7TA 3E5RA 4ECAA 4BJ3A 2MOKA 1JJBA 4GOJA 4C3VA 2Z4TA 2D54A 4EB3A 4HUJA 2QPTA 2OCGA 3QVKA 4EPYA 3FYDA 1QU3A 1QH1A 2VWPA 4RZSA 4TTVA 1NXXA 4XYBA 4DSAA 5KUTA 2I33A 2VNKA 1QRUA 5LMUB 4B71A 2Q7OE 3ZWVA 1DKUA 2HTEA 1Y4ZA 3NETA 5EJIA 4QODA 1KJIA 2X8LA 4C22A 3IL2A 4DV7B 5EJFA 2H1RA 3C3PA 2ZJ6A 4KTTE 1DZ3A 5E4FA 5J2TF 2Z4SA 5LB2A 2OD9A 3GXOA 6AT1A 4ACAA 4DLNA 2J30A 3PJGA 2BEVB 3ZYCA 5TLSA 1C9EA 4DR7B 1QHNA 2G36A 3KVVA 4WKPA 5CRIA 3KETA 3W6PA 1UAGA 3GBVA 1NVBA 3M4YA 1CQIA 1DX4A 5IEJA 4KBFA 2CK3D 4X65B 4HDNA 4GWGA 5DJ5A 1LDGA 1U81A 2EXXA 2AQKA 2O2IA 3A6HA 3IAM1 1OXKB 4IQGA 2ZUCA 3ROFA 2AVDA 2WWFA 3IHWA 3TSOA 2HDHA 4IIDA 2YV4A 2QXTA 2LNDA 3N76A 4UHKA 2X6QA 1KMQA 1TW2A 2WJYA 3C2QA 1N2IA 5F4ZA 3TTUA 2Z1DA 3UAWA 3WYCA 5IJ0A 4KXWA 5JEEA 5JSUA 3HJGA 2J0QA 4C30A 1ZL2A 1JHZA 1F1JA 4Y2HA 5IZCC 1NAIA 1ZA1A 3A32A 5GZ3A 1TM2A 3GJ5A 4Q3EA 4CM8B 1QDLB 3IMGA 2UU9B 1DJMA 1U8YA 4CDRA 3DO8A 2PNJA 4EENA 1BFUA 1T43A 2DUUA 4A6XA 4A8PA 1I6LA 3HU3A 3SLGA 2VRWA 3PRKE 4CIAA 2JGDB 4E2ZA 4UTNA 1PK8A 1DTWA 5JPCA 4HNRA 5TQ0A 1GGEA 3BD7A 4KR7A 3FM9A 1T0JB 2D3TA 2HEIA 1I24A 3IEUA 2RC6A 2D5AA 3VOAA 2QRLA 1T3GA 4F5YA 1GTMA 2VSYA 1QGAA 1UH5A 2R11A 2WHYA 3MMSA 2WG0A 3DZBA 2Z09A 2LIPA 3BRCA 4JUCA 5EZSA 4BO9A 1PJ8A 1SHKA 4Q5IA 3N0VA 3KR2A 3MGCA 4P3YA 4HLUC 4RSRA 5EZ5A 1HWYA 4OAOA 4MAAA 4B3MB 4UVIA 2ZSDA 2VR1A 3OJLA 3QUAA 4JR0A 3EVEA 2UUBB 3WSVA 5GJVC 5JECA 2DLNA 2O8NA 1RWQA 1SG6A 1A9OA 4M60A 4S1WA 4ENPA 2HWUA 3EMKA 4G36A 4W1SA 1CUBA 2Y6VA 1P5JA 1UAYA 2CL5A 2E4VA 3HXTA 4PTYA 2GEUA 3BS4A 4R4JA 4F2PA 4JCOA 2ZBQA 4UREA 1UZUA 1SKAA 1Y3BE 3F73A 4GMGA 1MAWA 1U8CB 5AMXA 3SI7A 3UB4A 4B82A 3RADC 3W5HA 2Q9CA 2QX6A 1MH9A 4J8PA 2M6KA 3I53A 1UOOA 4YXWD 1Z4OA 2C7VA 2Q3BA 1A72A 3ETHA 4QG7A 1ADJA 1JFSA 1I0IA 3Q11A 5MHTA 1QH8B 1VZ3A 2NU6A 4G4GA 2QKYA 1P72A 4JHXA 5I9BA 4BFVA 1MCZA 5AUNB 4BUZA 3G8DA 4TUYA 1DPGA 2PQ2A 5LZ7A 3DWIA 5H4HA 3N2KA 2XIJA 1O5OA 4BMNA 1JG3A 5BWCA 1VGVA 4A0SA 2B1RA 2UXDB 2GPSA 1MJGM 2GJSA 3HWX1 1Y1KE 4DUGA 3MWFA 1EK5A 2FZLA 3DZ8A 1PR1A 2F1IA 4AK9A 5I47A 5I4CA 1RKVA 3DAYA 3RUCA 4Q16A 4YGYA 2B2CA 4F8JA 3H97A 4ABTA 3UJ7A 4OGFA 1MJFA 2BIFA 4I46A 4RQTA 3FWZA 4DOMA 5IVHA 4B3SB 5J43A 1S6YA 4BZQA 2F8LA 3L77A 1J8VA 3UH1A 5DCUA 3LV8A 3FTQA 3IKTA 4ALMA 4S2UA 2R6GA 5HQJA 3VFDA 5E9AA 4N6OA 4URYR 3NBAA 2Z9CA 4M38A 3VU3A 1WCWA 4QDJA 5DM60 3HCOA 1G19A 3MCVA 3IMCA 3HJAA 2DGDA 3QH4A 2YASA 3G8CA 1DFGA 1YASA 5CXQA 2W2KB 5A0FA 1NN0A 2W6JA 5P21A 3PZRA 3DM9B 4JENA 3QEMA 3STXA 1PI3A 1EUZA 2CXSA 5E38A 2N0SA 4IXMA 4BN0A 4D9KA 4E5YA 3OEYA 2DPXA 4B74A 3NCHA 4LSWA 1KFKB 3HY6A 4FFOA 1HMYA 1I4WA 2VVTA 1KVQA 2Z4RA 3AL3A 4ZVLA 3SYMA 1TLTA 4KV7A 5AW9A 1ONBA 3ENZA 1AKYA 2DBQA 3D5TA 3GDHA 3LC2O 3RC8A 4YT2A 1HOTA 2RSLA 5KX5A 4PR0A 4FYVA 1YHZA 2BUAA 3ADPA 3EVTA 2QL6A 3FFBA 5EJ4A 1RRCA 3IEVA 2I4RA 3DH0A 4DPLA 4JDUA 3JSXA 1QK5A 1W1IA 3ZXYA 4B40A 1E4YA 1VHJA 3F8SA 3L4SO 1RVDA 3BXEA 3DMNA 5JE8A 3O1LA 1B4DA 4MUAA 1DQPA 3JX9A 3DZJA 2E55A 3EUEA 3IB3A 2O0KA 3UC5A 2X40A 4HAVA 1K88A 2ZJFA 5T8KA 4NQRA 3S5UA 4EQZA 1P1HA 4OQFA 3JYQA 2QXUA 4G5HA 4YDHB 2WYIA 4FMCF 1A9PA 2CKMA 1KMCA 2R65A 4I9HA 2O6LA 5FJJA 4E21A 3CRRA 1Y6QA 2Q1SA 4F60A 2H18A 3RWMB 3H9EO 3JQAD 1Y1LA 4G37A 3WWZA 1BD3A 1R3DA 5JFTA 1DG9A 4P86A 4RHXA 4X20A 1GGMA 5ALOA 4QDOA 4WFQA 2JF0A 3RFVA 5JBIA 2YHIA 4MS4A 1OLUA 3ADDA 1H2YA 2OO5A 3FVTA 4NBUA 4BFSA 2B8NA 2Q5LA 4KUHA 1NE7A 1RRKA 4ZQBA 3GGPA 3A8TA 5COQA 4JLAA 1DAFA 4JUIA 4J2TA 2IS1A 2RDMA 2Q1WA 1M34E 3ECSA 3UXEA 2G83A 4EG8A 4MI3A 2R00A 4CU5A 3V8RA 3QX3A 1ETHA 1SEVA 5F98A 5DM1A 3S1AB 4IZOA 3TZLA 2HA5A 3E1GA 4IFEA 4J6FA 4MS1A 2QRHA 3EIUA 1NTRA 5EEGA 5HF9A 5DU2A 1C3EA 3TTTA 2XOXA 5JXHA 3PDJA 3ZWQA 4I5IA 4WCFB 4X41A 3WK8A 2GWRA 4GQIA 3VR2A 1P1RA 4MIYA 5AM1A 2YYSA 4KXYA 1YHNA 3RRBA 1YCHA 2WWGA 3PHHA 5JZ9A 4KHPB 1EVEA 2UZ1A 4H0FA 2HBYA 3O6VA 3MUOA 2NTJA 3THOA 1Z5ZA 3GMIA 4URZR 4UUMA 4ZZIA 1GAJA 2BRUA 4KDEA 2PS3A 4FOPA 4LJ5A 3ILXA 3KXLA 1G17A 2ZREA 4H08A 1IOVA 2QMEA 5FL7A 3U7HB 3O4GA 1XTUA 2VBGA 1M7BA 4A15A 5KVQA 3GPIA 3OPQA 2QN2A 3E3AA 3FB4A 3PKZA 1VKJA 1Y6JA 1ESDA 3NFRA 5ERGB 2CHGA 3DF7A 3RK4A 2JKZA 1VIYA 4PBSA 3NAQA 2Y1DA 3M6WA 3ZPXA 2JI9A 5EKXA 5KTKA 1HC7A 1SZDA 2FPRA 2PVSA 2HM7A 1P8AA 2KLHA 3GRKA 4RZ3A 3AVUA 1G3QA 4DRXB 5K2OA 4Q24A 1UPXA 2J0EA 3DTVB 1OIWA 3QF7A 1OROA 1NBEA 3BJIC 1KFJB 1JHMA 3IHKA 4KXNA 2ODPA 4JX8A 4LC1A 3ZUPA 3ZV5A 3T5GA 1IC6A 1NRWA 1ZRHA 3UUEA 2GBCA 4U6SA 1AT1A 5A5GA 1IDN1 3G7UA 3QXGA 3L8CA 3ROPA 5A4AA 4WADA 2CFRA 3Q1KA 4DDHA 2GXSA 3NBZC 1O97C 3I12A 3NHYA 4PRZA 3ZWMA 1QHHB 3KJFA 1QQ5A 2WRZA 3KTAB 3O0TA 4W7SA 4E14A 2GSDA 3JALA 2RHOA 3AIOA 1P7PA 2E1PA 2BBOA 3C74A 3V8MA 3BCRA 1CUJA 3CCBA 2C7BA 5E1DA 1AQYA 1LWNA 4KPUA 2AOUB 1RFGE 5K3CA 2B82A 3FUXA 4RBNA 2CNOA 2X4LA 4D9JA 4XIGS 1XDGA 5CTJA 3NS7A 1TA4A 3OTIA 1A9XA 1W5BA 1E1CA 1UOEA 1QWSA 2YJGA 4YUZA 3VOTA 2H2WA 3GFQA 1BS9A 4MJXA 2A1IA 2J31A 2JHGA 4NY1A 2PTHA 1J8MF 5BVGA 5HPYB 2YYZA 3TCXB 2A9QA 4BQQA 3E8MA 1T1JA 3EZXA 4JP8A 3GIDA 3ILHA 5TJ9A 3OC0A 4YJ2F 3LJKA 4KN9S 2UZAA 4D1YA 3B82A 4WRRA 5JIBA 1E2EA 4LPSA 3O5AA 1EGMB 5HRCA 3FHOA 2Z8ZA 3L43A 1JKJA 2C8LA 3ILYA 1YL5A 5ETJA 3GPBA 5AXBA 4EM6A 3VPAA 4HDCA 2ZRBA 1RD4A 4P54A 4D92A 4YRBA 4CG1A 1TJPB 4MUEA 5CFZA 1C8KA 1PUIA 1GNQA 1WHTA 3LK6A 5JYEA 1ZK3A 3G5MA 1IXYA 3A3OA 2JFFA 2PQ0A 1R9GA 2WF8A 1S4QA 3TLGB 1PKEA 1U0RA 4MS3B 2VP0A 2XCIA 4JP2A 4BAGA 4IFBA 4B2YA 1VIMA 2WWWA 3OIUA 4A03A 3I01A 3UMRA 4LRQA 4A4DA 4XIJA 4B8ZA 2PH7A 4NICA 1H6DA 5BQOA 2YBDA 3BCHA 1LK7A 1SHLA 3VU9B 4BRWA 4EBBA 1A96A 2D74A 2KPOA 3STTA 2UXBB 2VA8A 1RAHA 1AQUA 1EFPB 4R8MA 4R16A 3RABA 3Q5GA 3T9FA 3OKPA 4EKNB 1GNLA 1N7JA 1S01A 2WA2A 1Z25A 4LYYA 1XAJA 5L3SA 5KJCA 1AGRA 1UWVA 1Q1NA 4IYRA 4NATA 1X7YB 3K0CA 4PZ9A 2ZRNA 2D5LA 2VATA 4UU8A 1NMZA 1Z47A 4OQYA 4LWPA 3O7MA 5FD8A 1ZOPA 3WNCA 4BKUA 1D8TA 2NV6A 2Q07A 3QX9A 2D59A 2FG5A 2FZKA 2NZJA 2ZJ8A 4QT4A 5B2FA 2CSUA 4LN1A 3SYNA 2IUEA 1PGNA 3Q3VA 2PRSA 4RORA 1E79D 2ORVA 1UDCA 2Q3MA 3HV0A 2V8OA 1BD4A 3GT0A 4GZ6A 3SQOA 2WJHA 4JYZA 4E7OA 4U7JA 4OQMA 2IPNA 4QO8A 4U2EA 4Q39A 3KU1A 4G56A 3VOBA 4KKXB 3WRVA 5KOJA 2VAVA 1YIOA 5EXSA 3PE4A 2FX2A 4DMHA 5HZKA 3E9NA 1IN5A 4G97A 5ALKA 2XZOA 2QTZA 1UQUA 2XGOA 3JQFA 1QMGA 3EC2A 4ZOAA 2AC2A 4B6OA 5CVTA 3FCSB 3NAMA 1H1LB 4O2AF 5G1NA 3CH6A 2X77A 2M98A 1M34B 1OWPA 2OM2A 3DE2X 4ZGWA 4U7GA 1YBFA 3I42A 2Y1CA 1FDOA 3DC2A 3H0CA 3IX7A 3C97A 2PZKA 5HBGA 4EI2A 4N3BA 4D56A 5HX7A 1E2DA 2IQ5A 3T7AA 4YUWA 1TQHA 1X7WB 1UODA 2YYYA 5B4TA 5GTDA 1KRXA 4FMDF 1Z7YA 3PHBE 3DEIA 3W5UA 1CJSA 2C77A 3DOEA 3BRWD 3AR4A 3MCAA 2CVOA 4MWCA 4J75A 3RNOA 4C4XA 1U9CA 2XXBA 2ZT6A 3EFHA 2XR1A 5ECWA 4G0YA 1P4HA 3W6OA 4XQ9A 2PBZA 1AF7A 4RL6A 1SHUX 1EP2B 4JHLA 1M7HA 4F3KA 5CB8A 1A0OA 4FPXA 1PQUA 4YA6A 1W93A 3HNOA 2IYNA 2UVPB 4Q4JA 4BFLA 3OPMA 1F8YA 1TX4B 1EQUA 1MN6A 4MWBA 4RH0A 3RBAA 2B4YA 1O08A 1OT3A 1E96A 1TE2A 3FCCA 3DMTA 5I45A 2R60A 4LCJA 2ZULA 3SJZA 5JYDA 3LU1A 1K7CA 4JT4A 4HDKA 2X0NA 3BWCA 2BVNA 5CGZA 3KT0A 2CWWA 4CMGA 1YVEI 4NR0A 3SD7A 2C7OA 3TIXB 5C34B 1ZBDA 1OIXA 3KLPX 2QQ0A 2FEAA 4UMEA 3RTAA 1WU8A 1GGVA 1SC4A 1QYDA 4RH1A 2DEUA 1FNMA 2I71A 3OT4A 1DKPA 1E3IA 3DP7A 3RBVA 4DCUA 1UKZA 5JALA 1GQSA 2NZXA 3AY3A 5K03A 1RABA 3ICCA 1B0PA 2NLOA 3ODPA 1UWKA 2QS9A 1YS4A 3JASB 2I34A 2MSNA 1XMPA 1J8DA 2JBAB 1MIOB 2ZUDA 4NBVA 4ZT2A 3OAAA 4EB6A 4PWYA 3EDYA 1XYVA 2UYGA 4KUGA 1KU6A 1T36A 3B8EA 3L6BA 3IURA 4IKOA 3O8OA 3D6FA 3SC4A 3ZCVA 3HCNA 4IEEA 4M0DA 3UMBA 3ZD8A 4CEHB 2A0WA 1X7XA 3D4LA 3EDQA 4BGIA 3P9QA 1S8AA 5FUXA 1KO5A 5G0UA 2IOHA 4H77A 3M83A 4IW3B 4H3VA 2VHEA 1H69A 4GM4A 4TTQA 5G40A 5K3EA 3WZ2A 1DSSG 1N32B 4BEBA 3O9VA 3PENA 3R3WA 3QUBA 3NW9A 2G88A 5TGDA 4EI8A 4GYKA 4JI6B 1IZ0A 3QVGB 4JB2A 4V0KA 5DK6A 1I7NA 4AJOA 1EZ1A 2IS2A 2AWNA 4H7FA 4HAWA 4D42A 2ZETA 3CFYA 3PWSA 4OF4A 2FOIA 1J9GA 1WXFA 1XKLA 3MQ2A 4UBJA 1Y7HA 2XV1A 5DF1A 4X62B 5EIXA 2W2PA 4RFLA 1NMQA 2ZXEA 5B3KA 3L1VA 4HEA6 4YQEA 4ZCMA 4DV2B 2LPMA 2R6JA 1PV1A 1CFZA 2O20A 3PIDA 1VMDA 4PZYA 3RGWS 1HE2A 1WEKA 1YS7A 2I6TA 3B1ZA 3PTZA 4LDAA 5DMHA 1RPZA 3U31A 4DWOA 1IHUA 1RI2A 1VKHA 4R9UC 1DLJA 4TZ0A 3O8NA 5JZOA 2ZKIA 3Q1LA 3GJTA 2NVBA 3HQ4O 5AKGA 2Y67A 4L0MA 3WBJA 3SDBA 2QL5A 5JANA 3P9YA 3I32A 2AIRA 1JXMA 3CPHA 4BAUA 1ONOA 1Q84A 3MD0A 3MJ4A 1CQXA 4O4IA 3RDPA 4LA4A 3LLMA 2D0IA 3D8SA 3D64A 2FFAA 4IDAA 4QVKA 4R8SA 2B98A 2C5EA 3LS2A 3M3PA 3B3FA 1DAIA 2HRDA 4L9RA 5DM4A 3O8QA 1CQWA 3ZWNA 4G24A 1A77A 1Q50A 2EDAA 4C3UA 4G0UA 4QOGA 3QYFA 2ONCA 3EXFA 4QFCA 1TCAA 1W75A 4MXDA 2RGEA 1QOZA 3LL4A 4TTAA 5A2QA 2SKDA 4ILEA 5LZ4A 3FKSA 2WDZA 3OHSX 5EFOA 5KVSA 1XL1A 2H1IA 3MQFA 5I7SA 1OXMA 4ISBA 4I8IA 1EWRA 4YCSA 1HBJA 3FKQA 2ZXUA 2OBLA 1I01A 3T5MA 1FRNA 3BDIA 4MUMA 1K5PA 2WU8A 3WGTA 4DR1B 2CNBA 3P2YA 5BOSB 5AXAA 3U6KA 3LHFA 1HR0B 5CA0F 2HK8A 4KRFA 3H9JA 2J1LA 4CF5A 4EYKA 1FFYA 2QROA 4WEOA 3C5VA 4A91A 1G21A 1NKTA 1YOBA 2XNJA 3B9RA 3KKMA 4MI9A 3ANTA 4A9AA 2BFMA 3AIIA 3UWPA 1OLSB 2WFAA 4IO0A 5AKZA 3UJ9A 4CFSA 3DD5A 3QVVA 3SAJA 1Z5GA 2IP2A 3KTFA 1LLDA 4NFSA 2D2IA 5EVJA 2AMVA 1E2NA 4WFIA 3NAZA 3QE3A 3UTCA 5BXQC 3THWB 1C41A 1RDFA 2I4NA 4LNAA 3V6LA 4IOLA 4ZQHA 2HIHA 3W7VA 2JLXA 4MW0A 4BBZA 3T3OA 4RZUA 1WCIA 1NTOA 2W70A 1YJBA 1F4PA 1KQ3A 3AI7A 4XX0A 2JBHA 5DSTA 4HVAA 2QTGA 1FFBA 4RENA 3F3MA 4YUXA 4NZPA 1YRYE 3WHKA 4MRAA 2ZRDA 3GFGA 2K6GA 1UC5B 3V4LA 5L95A 3IT2A 3ZDDA 2P4QA 2QDXA 4UEOA 3VDQA 4O6VA 2PX5A 3ZE2B 4MGZR 3L6EA 1XD9A 5LKRA 1I4TD 1UM9B 4HMOA 3W2EA 1EH5A 4DLVA 1E58A 2R1UA 3MWEA 3ZQ6A 3LP5A 5LSAA 3JWJA 1KMNA 2PLFA 4B3DA 2R97A 1HA3A 3CA8A 2CNKA 1RWMA 2HK9A 4DZTA 3PL5A 1S2LA 2WHEA 3COSA 3QKSA 3QPBA 1XRSB 1CBUA 1GTRA 2AMYA 1JEJA 4MWDA 4N1AA 3F6CA 3PRYA 4D74A 4N65A 1Z7BA 1XDZA 3WP0A 2GKOA 4O4LA 3WQSB 1QX4A 4LQDA 5K09A 1TYAE 3RS2A 4GPTA 5L6LB 2V0NA 2YN4A 3AXTA 4UEJA 3TZEA 2NYRA 3HRIA 1RIIA 1QB8A 1DIBA 2E0IA 4GW3A 5G41A 3IP8A 2VSXA 2GVNA 3DAOA 5B4UA 1W2WB 3MGAA 5FFFA 3DEAA 1AN0A 4S3MA 1LK0A 3TOZA 4U0KA 1XZFA 2EYUA 3ZLUA 3CH4B 1XXHA 5FOQA 5HS4A 1TAUA 1XR3A 1Z7EA 3B9QA 1ILWA 3EIFA 3SKVA 1YAHA 1NMEA 2XDQB 1OJLA 3K9QO 4L2IA 4OLFA 3D5EA 5GM1A 3WQHA 1JFRA 2WTMA 2GKGA 1D1SA 1JHAA 2WWIA 3V8EA 1F20A 3VXKA 3NM4A 3GLHE 4HC4A 2HQBA 4N18A 1SQ6A 2ID4A 2VYNA 1C30A 2XLCA 2PWZA 2Z2IA 3KYBA 4JJZA 1DBWA 4NH0A 5ARCA 5FBQB 3HMKA 2JHCA 3OTOB 2P68A 4IIYA 1QHYA 1RS0A 4UAJA 5JPDA 3JXEA 1CR1A 2IF2A 2QAGA 3GX1A 3NTLA 4ZCRA 2XUHA 5J58A 1T0PA 4D0NA 5AK6A 3NH6A 4MRPA 2XB4A 3H11A 3BCUA 2NQTA 3P4XA 2GHQA 5KREA 3PNVA 3WNBA 4DG5A 3BEOA 2DETA 2XIQA 3DBLB 4WASA 3AM3A 2PXHA 3MGKA 2X0KA 3MBKA 3Q98A 5GJCA 2JKVA 1YDWA 4ZJYA 2VKTA 4HXYA 5CB4B 3K1AA 1JIUA 4NNPA 3UY4A 2P41A 3EGIA 1PEYA 2LD4A 3CT4A 4R8RA 2HWXA 1NJFA 2A94A 3I04M 2F67A 5FOTA 1U1GA 5HRAA 1A50B 1FDUA 4BWFB 1U8ZA 1Z3IX 3LWBA 1PWEA 1IZ8A 3L7IA 1EP9A 3HCFA 1AX9A 1AY0A 2JJ2A 6REQB 1F06A 2WAMA 3OZ7A 2J45A 3JCZA 2YDYA 3HI6A 1KZHA 3RUFA 5BN1A 3PE3A 5BV7A 3KPUA 4HN2A 4B4UA 3HFSA 2W11A 3EEFA 3P0IA 3GVXA 2MSLA 1ML4A 4BE9A 3KAJA 4LK3A 2AZ4A 2H29A 4FINA 2QIPA 2YOGA 3BGOS 1JYFA 3VDNB 3LIIA 3VKGA 2HRRA 2QTWB 3D7KA 1E7WA 1NPTO 3N5CA 4P84A 1C4KA 1WRBA 1PFYA 1A7KA 1VSBA 1WHSA 4YRIA 1FE8A 4KGXA 3WYFA 4N76A 2AEJA 3UJ6A 1F8FA 2JLCA 5EXDA 4MR7A 4F93B 3FOEC 2OSVA 2CJYA 1K66A 1KSHA 4YDSA 4F91B 3E3LA 1E3MA 1CRWG 5CH3A 1VJGA 5IUKC 2H7YA 1ACLA 1NY5A 2HF7A 4QOSA 4BLPA 1UPFA 1TYZA 1JIQA 2ERCA 2OGSA 4P3KA 1DL5A 4QBFA 4XQCA 5G4KB 5EOVA 3DHNA 1ZUNB 1IMOA 4QBTA 3ER9A 1JHOA 1S8NA 3QV2A 3LLSA 4K05A 5J2TA 5LLSA 5FEUA 5TGZA 1Q17A 3FOCA 3X1MA 2H4ZA 4Z8XA 2JCYA 3GL9A 4W7HA 4IXDA 4R69A 4X60A 5HF5A 4WOKA 3CIOA 3WWEA 2CEKA 9LDTA 5IRCD 3L9WA 1LPSA 3P2JA 1KPGA 4RHEA 4PRLA 4KQFA 4P4GA 1U2SA 1W59A 1LRJA 2A30A 2Y0CA 3R5TA 4LECA 3PC3A 3EOBI 4J94A 2XVZA 4REQA 4C5AA 1X8XA 3CF4A 3I6QA 4ZDJA 1WKVA 5GGXA 3ES9A 2VFAA 3DE4X 4MZXA 2PGNA 2C57A 4Z86A 4IRXA 2VDRB 3Q87B 3SC6A 1I3LA 1CY8A 2WMYA 4IV8A 2EDCA 1HFJA 2FSVA 1QG2A 4O2LA 3J80A 4M86A 3ZXIA 1HMPA 1NQVA 4JQCA 5FA8A 1SOUA 3RF7A 4IEIA 2PN1A 3N0WA 3ROEA 4BMOB 1YXMA 1VL8A 3GYGA 4I5EA 1KDZA 5B53A 4QVGA 3HYNA 3BMOA 5C5DA 2IOFA 4JIGA 5CCDA 3GRRA 1RCFA 3KJIA 5KTRA 5HQTA 1W0KD 2JL1A 3RVKA 4RTLA 1H0KA 1X7ZB 2B8JA 5K3SA 5KQLA 3SJ7A 1S8FA 4H6VA 9LDBA 4C2BA 4RMHA 1I32A 4W6QA 4BZZA 1M2VB 5FLEX 2BCGY 2CUTA 3HUTA 1OBVA 3MTEA 3CZAA 4IMJB 3V97A 5DBFA 1WBDA 1KBQA 3GWZA 4GVPA 3FUUA 4KIWA 1F7UA 1Z4IA 1SIBE 3HSKA 4AJEA 3BSYA 2IGTA 4D82A 3GLGE 5DHPA 1SURA 1AURA 2IKQA 1XQYA 3NH9A 1E2MA 2H3EA 4PICA 3LVFO 1HEIA 3U44B 4GX0A 4CQLB 1N2SA 3P9XA 1IIBA 3AJAA 2J41A 1KOFA 1OUMA 3NJ8A 1VPEA 2PKQO 4XDZA 1L1FA 1HYBA 3PP8A 4HPWA 3R74A 3AM5A 1QAMA 3L7KA 2NU8B 5BN5B 4NCJA 4I36A 1SA0B 4I4LA 3GWGA 4BFXA 3NQ41 1PR9A 4WXYB 3T12A 1ATZA 3S40A 1I4LD 3DBHB 3HY4A 1YDEA 3UJNA 4JMPA 3S6JA 1VHLA 3SM3A 3PNLA 1E98A 4KFSA 5KKCA 2Y05A 3MJTA 2PEZA 3HB4X 1NMXA 4AF8A 3SZLA 3FRJA 2O2HA 2B6HA 4DQDA 3QENA 6PFKA 4HH1A 1XUOA 4Q15A 4JWKA 4E1AA 2P77A 4EAQA 4MV6A 1E8NA 4OLHA 4EO9A 4NJEB 4WCVA 3IVRA 5JSZB 5DTMA 4XWKA 1TAHA 4F84A 3FSGA 4UNRA 1I6MA 4JJ7A 5M3BA 3QGMA 2D13A 3HUEA 4RK5A 2JGLA 3AZOA 1V8OA 1P7CA 4AY3A 4BC1A 2X0EA 2XECA 2FPXA 1PS0A 4LJYA 2WJ4A 3PNQA 2NUTA 2VQ3A 4XA8A 4AB1A 2B8EA 2PMEA 2QD2A 3VSAA 1KIFA 3IBCA 3QUSA 3R9XA 2EC5A 2BI4A 4G26A 4AP6A 3ZZUA 2W0MA 3B1FA 3C4QA 2DWOA 5TPZD 4D3XA 3A7EA 5JFGA 2ATCA 2VHTA 2CXNA 1LX7A 1NU6A 2CLSA 2M6SA 3O91A 2VAMA 3Q0TA 5A9TA 1IZZA 3T0IA 1LSJA 4FE7A 5H82A 7GPBA 4IDFA 3BIFA 4QJ5A 4OI1A 2C94A 1DIGA 3D8HA 3FBGA 1NRIA 3CZCA 1WY7A 4WT7A 2X2FA 2CL7X 4OAPA 1WO8A 5LQDA 3GLKA 2HU5A 1T9GR 3L41A 5I51A 4WXPA 4HNSA 5EZYB 4C0KA 5IC4A 3UW3A 4EBFA 3CZMA 2ZIXB 1LW6E 3U7JA 5LR6A 3ZBPA 1S2DA 4KZKA 1DBRA 1Z6PA 4FOSA 4NMLA 2CL6X 5BYBA 3RSGA 4RZQA 2BFDA 1F4LA 3E82A 5BMVB 3N6VA 1F0NA 1P74A 1R12A 1XLVA 5AM5A 3A6EA 1MC5A 1LNSA 4E6PA 4WECA 4ZCLA 3OA0A 5TV2A 5JISA 1DCMA 2KMLA 3UB2A 2FMUA 4FD2A 4FDLA 4P34A 2VDLB 4BQNA 2H2DA 1JAZA 1GUFA 3IS3A 4KNYA 4WSOA 2PMWB 1ZONA 1F2DA 1SULA 1H8HA 2FE4A 2FDRA 3TXXA 1NF8A 3REFA 1FRZA 3WIBA 1I94B 4V1CI 4PSKA 3FWKA 4CGZA 3TQIA 2ZI5A 4NBTA 4CMIB 1KI3A 3FMPB 4Q3OA 3KXPA 3O3NB 5DX0A 1L5KA 3T9EA 1XRLA 4JBNA 3A1TA 3GV0A 3W5AA 4F2HA 1A69A 1DEAA 4UC0A 3W5VA 4QLBA 1IXRC 3SHVA 1U2RA 4AYTA 3B89A 1P0PA 3K9LA 1WW2A 4HOYA 3E9ZA 2NSJA 3RVQA 2F1RA 2RD2A 3ER8A 3OJOA 3GCGA 2VJMB 3WGVA 1EB9A 4WH0A 3STWA 1XQXA 3W2HA 3JWEA 4BLOA 4CXMA 2UZ4A 1KZ6A 1F2TB 5GJBA 1Q0UA 2FFJA 1X1SA 2ZFUA 4R40A 1O0BA 3LUCA 3CR3C 3VHXA 4JI0B 1SXJE 4UDOA 4CMKA 1XG5A 4TROA 1L7BA 1NKVA 1W85B 2QRQA 3OU2A 1NYRA 4QXAA 1JHUA 4KRYA 3H7IA 4IIUA 1X39A 3RIMA 1H1TA 1E5TA 1SU8A 3H6GA 5J2UB 2V54A 5ALGA 2OA0A 2W4MA 3VH2A 2MU1A 2I1VB 2W98A 2AH5A 2BFBA 1ZCFA 4BJ6A 4Z4CA 2ECFA 2W4IA 4IWYA 3OY2A 4PPQA 3WGIA 3P4YA 4PM4A 4MSUA 1YD7A 1WMAA 3I28A 3WAKA 4A23A 5FBRB 4BJ5A 2Y71A 4DBVO 4V0MA 2DQYA 4YT8A 1R5NA 3PQ8A 4BJ1A 5AW6A 3RBZA 2YJNA 4ICIA 4F6RB 1ZWLA 1LWOA 1AKVA 1MMFB 1GG5A 3AYXB 5T4EA 3C6KA 5D86A 4ANFA 4DC9A 3AO0B 3L7AA 3EUFA 4L4RA 4ENWA 2C96A 4MA0A 2XHZA 4FK8A 4Q3KA 1PT6A 2G4CA 2PYZA 3NV9A 1KHTA 1W46A 5KSPA 1P31A 3B1KA 1GQFA 1T8UA 1CVLA 3I09A 4N8DA 3UOWA 2X3UA 3WGQA 3HV2A 1RYDA 8MHTA 4BNWA 2QT1A 4KBGA 3ZCPA 1NM5A 2QK4A 2QPAA 3AFNA 3GA5A 4WN9A 5TJHA 4B79A 3BGIA 4US1R 3GOQA 2ZPUA 1U7XA 2CUNA 2I4MA 3H4TA 4FB4A 3NBXX 1SD2A 1XI2A 1HGXA 3LH5A 2R8PA 1SGWA 3CUEF 5GVRA 3VTAA 4JBXA 2OAP1 1PF7E 3WNZA 1M8PA 2QE6A 3SF8A 3TO5A 3G2MA 2C9DA 4IIVA 3U3MA 3TAXA 4LJLA 5IP5A 1B6GA 2I4LA 3H9UA 1VLZA 2QAIA 2Q41A 3FG9A 2E85A 4UQPA 4NCKA 4ZO4A 5AKKA 5JHHB 4LJ8A 4FDUA 4X6LA 1O96B 4M88A 4D44A 3AFMA 5JCZA 1O77A 4HWSA 1KEKA 3FVQA 5KNLA 1DEXA 1WLYA 2X4IA 5A4MS 3RFUA 1SBIA 3KQUA 1N2HA 2HSGA 1N5KA 3IIIA 4LRXA 5CVJA 2PUFA 3GARA 1OV4A 4NULA 1R8SA 1LQUA 3F1KA 3DZFA 3K3PA 5BSMA 2FFQA 4D8VA 5HVNA 1YFLA 4EY7A 1SWVA 3RSOA 1HURA 4DA4A 4JYAB 4C5CA 3DFZA 1M5RA 1J00A 5JASA 1HYQA 1L8LA 5HIKA 1DC7A 4QQNA 2ZBEA 1SXPA 2E49A 1QG6A 3TCKA 1DXHA 1P4RA 1KXJA 3HUUA 4GI5A 4EQ6A 5HUJA 4QNRA 2PU7A 5IHPA 4Z99A 3VAZA 2DBVO 2J32A 5G1OA 1A9ZA 3DDUA 3RTBA 3WV5A 4R6WA 3CUWA 4CMHA 5KPJA 4FQ8A 1NNLA 3G3EA 5AJXA 3VRHA 3HWSA 2A5YB 4OGKA 4YJ2A 3F7MA 1ZIXA 3M6FA 4HTAA 2Q2QA 2XDWA 4E5UA 1LRKA 5KI6A 1U5BA 4B4KA 4H7DA 4UM7A 2XSZD 2H9AA 3BGVA 3OU7A 4OYLA 4HVTA 5F52A 5DDIP 4QLOA 3EVNA 5THXA 2V9PA 3DT8A 4Z53A 1DIHA 1YMQA 2FG7C 2YWXA 3ZU2A 3LCJA 1BS1A 2PJRA 1SBCA 3FETA 2A0UA 3EXHC 4URFA 3UKJA 2AGVA 2AOTA 2Z04A 2EKDA 2JFZA 4OQ4A 1TT5A 4L8FA 5ED0A 2IX3A 1AOXA 2VZ8A 5GVSA 3QBTA 4RHFA 1BH6A 2CFCA 5CCXA 2QU8A 3SOPA 3JQDA 4RKQA 1XJQA 1XP8A 1XAIA 4UUPA 3OQNA 5K0NA 2ZVQX 3HRKA 4PCLA 2FJUA 2Q99A 2V58A 3FRHA 4CDGA 2A4MA 3MM4A 1L5FA 3B13B 4GI3A 5H3HA 2JAWA 4PS1A 1J1UA 4G63A 2CZQA 5IUJC 2G5PA 5C1BA 3W0LB 1N5DA 2HGZA 4UOZA 3T7EA 3AY0A 2ACKA 3PVSA 2OBMA 1NBME 4LF6B 3HA5A 4ZVOA 1EDDA 2GASA 3ACDA 3EEIA 3IAM6 4B2IA 5F23A 1MZVA 5JTTA 2G4LA 1J2RA 3MUEA 1G42A 2OWDA 1RWPA 2QMQA 2YHSA 3WFJA 3CB2A 3B9BA 1PHPA 1TTPB 1ZM9A 4Q03A 5FF9A 3BM5A 1I4DD 2GEVA 5DNUA 2EGUA 3A2MA 4NVRA 4G85A 3LVRE 1TCVA 1Y3HA 2EX1A 1ZRMA 1OBFO 1XCOA 2CLMB 1SZJG 1LBHA 2E4UA 4N5NA 4LUCA 3R40A 4YAFA 3TIGA 1CYDA 1F1BA 3BJEA 5ER6A 3AJDA 2EF0A 2J3MA 3LX5A 1SAYA 2ZYTX 3IGFA 3NJ4A 4L8WB 4OHMA 4J07A 3W8RA 3EJWA 1KI9A 3S28A 1LLQA 3OO1A 3DV9A 3ZHTA 1XMIA 5BWNA 1U2DC 4R2WA 3AV3A 2HO5A 1FQKA 3JQ8B 2Q8NA 1OHHD 4QJBA 5HS6A 3T35A 4AS2A 4CETA 5MGBA 2H2IA 2ZEJA 5BV8A 9ATCA 4WZ6A 4QGSA 3S8YA 4QHSA 3JYOA 1XJ0A 1AHPA 2R68A 4AZ3A 2NVOA 4FFLA 3HJTA 5HWSA 2YBEA 4KYTA 4ARAA 3E03A 4ENSA 4DR3B 2BM9A 1U7HA 2C97A 3DHEA 2Q4OA 3ZU5A 1G8HA 2OB2A 4OXKA 1UF9A 3COPA 3F8WA 3GJ0A 3RVPA 4B7XA 4BB9A 2R62A 3GEBA 4KLNA 4TLEA 3SE0A 2M6RA 2ZJYA 1FJ2A 5ITSA 2EKPA 5C8ZA 1SU7A 1PZMA 4K7JA 3E22B 1OWOA 4DA8A 3T3NA 4LBYA 1RI4A 3BH7A 5KYXB 1QGUB 1TDJA 3NBKA 3CKYA 2QVBA 5F7ZA 2ATEA 1NF9A 2J07A 1GZVA 1KK1A 1QRRA 2ZS9A 4FC6A 2BFEB 4ALLA 4K87A 3PUVA 4FSDA 2C9ZA 1QO9A 2PL5A 4B83A 1H9AA 1U80A 1V2HE 1FXWF 1M10A 1CDOA 2FH5B 3DAFA 2O8BB 4PYOA 3E9YA 3FMGA 4L0DA 2ZIWB 1QZXA 4GR4A 3EY9A 1DHTA 1XZNA 4NNJA 1N8TA 3L6UA 2C4WA 3F5FA 1FXSA 4WNAA 2IU0A 4D4HA 5E8RA 3AOEA 4OREX 4CMAA 3DDSA 3AEXA 3TSCA 5IT5A 4DLRA 1AN9A 4Q1FA 4ZT5A 1RACA 3UV3A 3B1JA 1SXIA 3H5LA 5BNWA 2IYYA 2BZGA 4P0TA 3ETLA 1SVMA 1Z16A 2QX8A 3NBYC 4ENTA 3TXAA 3THYA 1QYIA 1TU4A 4A0RA 4ZCTA 4F1JA 1ATIA 1D7OA 1HF3A 1L5NA 2P2ZA 3KSUA 2MMCA 1A76A 1DAPA 4MUNA 1M2WA 5JO0A 1E6CA 1E1LA 2QN1A 3NTQA 5KYYB 4HFNA 4R01A 5A03A 1TKCA 2VTVA 4JY7A 3T3DA 1C8VB 1W96A 3DMYA 4MRVA 4YXWA 4BN4A 3LW8A 1MT0A 5CG2A 1JEDA 3OPVA 2RGBA 3AHFA 2A0XA 1HZZA 5KOHA 1FW8A 1NNI1 3ICQB 5KMGB 2A7QA 2FRDC 4GXNA 4H2DA 3MFQA 1MQSA 3ZV3A 3DB1A 1U65A 4M21A 1J20A 4X92A 3SN6A 4Y2RA 1IY0A 1CUSA 2BGIA 3GUYA 4WVLA 2B78A 2PX6A 5F1OA 4NPCA 2XKAA 1XLTC 2Z9DA 1EESA 2NZ8A 5F3WB 3O75A 2PUWA 2Q6OA 3NONA 1N5MA 1RXCA 2JI7A 3MK31 3TLEA 2QVYX 1T6ZA 2YFHA 2XQJA 4U63A 2VF2A 1PJBA 2VQSA 1XROA 4ZAFA 1WOMA 5SY6A 3TZKA 1SOVA 1JSXA 4ZT7A 3BILA 4S04A 2WVJA 3PUXA 3IQGX 3HHPA 4F6CA 1K8ZB 4HDRA 1B16A 2VDWB 3CYFA 3V3KA 4BCCA 1RWOA 4HX5A 1T2DA 1UDWA 2L42A 3WBKA 3L0SA 4EA6A 4RHYA 4KV9A 1Y89A 1DXQA 5IT9A 4OHZA 2F9LA 4GG1A 4E1VA 4F4HA 1T3ZA 2VCEA 3FUCA 3INRA 4RXUA 5KWVA 3H4MA 2PSFA 3AZPA 2C1XA 4IIFA 3ZCSA 4QU9A 4EKYA 4AJPA 3ZJVA 4RGVA 3TYXA 5WRFA 1Q91A 3I61A 4U8GA 3TW8B 3DYIA 5TSDA 4ZYZA 2AW3A 2P2YA 1Q22A 2X23A 3EMDA 4HL6A 1WDKA 1YT5A 4EW3A 2GFIA 3ZJYA 1PSZA 4S1PA 5JDIA 1U28A 1E3WB 2BMAA 2JAUA 1Z4KA 5D3KA 4RTSA 2R48A 4Y2TA 1PSDA 3EFOB 3KB8A 3KBBA 3W2IA 1MX9A 1XKQA 2AE2A 3NHMA 1DKOA 3TCNA 4L9WA 2AYZA 5CD9A 2XEDA 5AK5A 1GY8A 3H2ZA 1LJ8A 4RVCA 5IXYA 2ZYSA 1WSBA 2WVAA 3RNLA 1KYZA 4JNKA 1A98A 1XMSA 1OR8A 4EELA 4PIVA 3IVCA 1ZH4A 2OZLA 5LM3A 3UPTA 1O6FA 1UWCA 3DAPA 2BHSA 1EZ4A 1QTNA 4AYXA 4CL2A 3JYPA 1IQUA 2FSGA 4MQMA 5CA0A 4M83A 1FK8A 1YMUA 2P78A 3TTXA 3TUZC 5C3MA 1YDHA 4KMRA 1L7NA 1RP7A 2OP0A 4J76A 4AKTA 4P3XA 4FOLA 5TVGA 3BB4A 3AG5A 3JTEA 4ERNA 1P18A 5KOYA 4F5WA 1WQ3A 3K70B 1ODCA 2AEEA 3JQAA 4V2IA 5CFLA 4I3FA 1VM6A 1CUXA 2D5CA 2DHEA 1TCUA 2HMTA 3OZXA 1E1QD 3OH8A 3BTSA 3P96A 1XZJA 1F0KA 2IYFA 4IV5A 1XCJA 4MJ7A 4BNUA 1XZCA 2HT6A 1LVHA 3UHJA 4HVLA 6Q21A 3QVJA 5BSHA 4XWYA 3GROA 4FGKA 1PZFA 4GEGA 5ALLA 3UWOA 4EITA 3ENVA 3FFWA 1RAGA 3RAJA 1PR3A 2HLNA 5EA2A 4BRUA 3R3SA 4ZGBA 2GGSA 1Y48E 5E3IA 3S2YA 2I4TA 3TWOA 4C29A 1NC1A 4Q4HB 2GWHA 3AT1A 5TVKA 1IEVA 2FUNB 2GX6A 4WXEA 5T4BA 3VQTA 1BG6A 4WCDA 1KDRA 3T1NA 3LKZA 3T3EA 2BFWA 4AUKA 2I99A 2KBEA 2Y3IA 3A2NA 2DPHA 4CTJA 2O3TA 1ADBA 1J09A 2I3BA 3R9KA 1Q3TA 3P2IA 1TJ5A 2YZMA 4LMBA 1K7EB 1GD1O 1ZQ1A 2D2XA 4RIGA 1ESEA 1XFAA 2JGKA 1CV2A 2AVNA 2BONA 1Z0IA 1WW8A 2X76A 3LYUA 3OJWA 1M1YB 3E0XA 4FDVA 4OJTA 2X1MA 2XYVA 4NS4A 1WXGA 1TA0A 1ORIA 4TS3A 5D3QA 3KYDA 3ZK8A 1G8PA 2BM0A 2NADA 4BEVA 3QLUC 2J87A 3M5PA 2J4CA 2QBYA 4GPZA 1OI7A 2GPJA 5FULA 3V2GA 1F12A 1DB3A 3E2PA 1ZKMA 4PXYA 5CNIA 3M4JA 3PG5A 5JOQA 1J2TA 5TMBA 4YRQA 3JPWA 2ZI9A 3AP1A 1YO6A 3LCUA 4RY9A 5E8JA 4A0QA 4CI0B 1QG0A 2WIBA 3G0CA 4L5JA 4WLOA 3SC2A 1CJUC 4ETMA 3D0KA 5IH7A 5J3JA 2QM0A 1RQGA 1UJ5A 3PFFA 1DEKA 5EIHA 2QRMA 2B3DA 5ECDA 5IPFA 1OI2A 3FPJA 4I4TF 2CXRA 3GJ8A 4V0NA 1KE1A 1U11A 1PZNA 2ZWMA 3I76A 3EG9A 1CR4A 4HWGA 6CHYA 4KAJA 3TE6A 2FY8A 4LJ9A 4BMZA 4UEKA 4BX8A 4Y9TA 1E0KA 2WB2A 4TV8B 2K7ZA 2ZS8A 3BA6A 4NE7A 3EPRA 2JCVA 2OORA 5C5CA 3D7NA 5D5QA 2CLHB 4YMHA 4IIGA 2BKXA 3ZNOA 1G55A 2BSAA 3D0OA 1AE1A 4DN6A 2BGGA 2IV7A 4XPIB 2GAJA 4NZ9A 5BOVA 3KE8A 1E8MA 4OQQA 2UAGA 2GRAA 4IBOA 3RV3A 2NSDA 4Y6SA 3AHGA 4O4HF 3G79A 3OLXA 5FOSA 5ICGA 1NULA 5CJJA 1DELA 1VCHA 1ISIA 3ORSA 1U7WA 5KWEA 1SH7A 4D9HA 4E5NA 5JT1A 3HBNA 4DCJA 1N1DA 3P26A 3WWPA 2W6NA 1CIVA 1TO6A 2NQ8A 3GVPA 2ZSBA 4FZ5A 4HR7A 4TWJA 5KTOA 3TD6A 5CFMA 1S4MA 4HRYA 2GVZC 3GLFB 1DBSA 1RAIA 1RCUA 4UEQA 3JS5A 1AHIA 4MYUA 3NUGA 3AHJA 4OHWA 3CCFA 4FYJA 1FSPA 1IDOA 1P45A 2A7XA 5LN1A 1TC1A 3V8VA 4R9RA 2VJPA 3HNRA 2HU2A 2X1HA 3MHPA 1RMYA 2Z2XA 1ORDA 4B46A 2HREA 3FPSA 1ZINA 3B1XA 3GLRA 4YJ3B 1B8PA 4A0HA 4CMEC 4XRRA 1UDRA 4N3GA 1CQIB 2OC4A 2FW6A 3LNTA 3HN2A 4XVUA 4Y0NA 1HKUA 2WDPA 5I3CA 2J46A 3S44A 1M67A 2OV1A 2PS1A 5DNDA 4CIDA 2W48A 2ZRIA 1AA9A 4JJAA 3BMQA 3L01A 4FHCA 4HAZA 5GY7A 5CMLA 3WL5A 3R9WA 3O4IA 1TQ4A 2GZ2A 1RQXA 2DP4E 3OM9A 1AUQA 1GU7A 4IG4A 5IJ0B 5K0CA 2VJOA 2FUG1 2IUSA 1W4AA 1FRFS 1HLFA 1KARA 3W7BA 2DB3A 1Y4AE 3PD1A 5TEVA 2RHMA 3WQBA 2ZVPX 1GFSA 3OESA 1SUAA 1QCDA 3UJ3X 4KVAA 4NU0A 3U7QA 3HA7A 5FBZA 1LDEA 5I7WA 5HUQA 3MJSA 4XIYA 1G8AA 3CX6A 3LUGA 1DTWB 1G66A 1ZUWA 2AR0A 4N5MA 4NC9A 1IG3A 5TQ0B 4KIUA 3TB4A 2CV1A 1D2GA 3AKYA 2GK7A 1MPTA 1VI5A 4KREA 3UYKA 4KQ6A 1Z2DA 4KH1A 2ZRPA 1YF3A 3LC0A 3WHLA 3F4LA 1II8B 3L84A 3RB8A 4EJSA 2RBGA 3ICWA 1H9CA 2HADA 1CULC 1U8UA 1VXOA 3LC1O 4ESVA 1X1CA 3L0CA 2VDQB 4DY4A 3S2ZA 3ZJTA 3M81A 4QSHA 3SOZA 2C2KA 3K1ZA 3GRVA 5TE9A 4XR4A 5I9LA 1W7AA 4GHWA 3ABQB 3LGSA 2WB4A 5MGNA 1UJ6A 2JFOA 2QVXX 4AKGA 4JLSA 4TLMB 3BRSA 2YXBA 4ZALA 5I5EA 3OICA 3AM1A 2FDCA 2DCMA 4PG5A 4MQLA 2CMDA 1BIFA 1L7RA 4X95A 5D01A 3UF0A 4C04A 2QGZA 1TRKA 3BRWA 2DCUA 1ARZA 2ECQA 4CT0A 2XWPA 4HGNA 4EG6A 3IJPA 4YJHA 3EFBA 1ENPA 1ZOSA 2NU6B 3HMQA 3TH5A 1CKEA 4CJXA 2WICA 4DQXA 4F2DA 4QM7A 4HO1X 4IILA 4ND3A 4QOEA 4B76A 4CYMA 2NYVA 5LYJA 2FZGA 1LJUA 4TUYB 4DLPA 1K6EA 2BPOA 5AVVA 1Q15A 5KSYA 2MMGA 3N2KB 4IGFA 2HMYB 3NHZA 4P36A 4RLFA 4DR6B 2V74B 5KQSA 1P9WA 3D8NA 3CUYA 3CSDA 1COWD 4M6WB 3QNMA 1CR2A 4MV5A 3DULA 1ZL0A 5HCNA 2GNAA 3AQIA 3LKDA 3OZAA 2I2BA 1ZGZA 4BV9A 3KVYA 2V6BA 2NO6A 1E2QA 4ARSA 3UJCA 1ZSYA 2HPVA 1INLA 1B42A 1B8VA 1NLUA 1HFWA 1NP7A 2JH3A 2O06A 2ZR9A 3AWDA 3SR3A 4Y3UA 2EZ4A 5ENZA 3ST7A 4N6NA 1GCUA 1LPNA 1NQXA 3DJYA 4NJMA 5FUWA 1MPXA 2ZYUX 1NYLA 3SS9X 5TR9A 1Z39A 3LNCA 1E2KA 1Z12A 4LE0A 4H7KA 1RYNA 2V7QD 4J0QA 3MTBA 1RLMA 4K9RA 4C4PA 2QLFA 4W82A 5HIAA 1GUYA 2EW1A 4IINA 2ORED 3U4IA 4BVEA 4F6LA 3DL2A 1IOLA 3NV7A 5CNJA 3RC2A 3GFPA 1NYQA 1T8PA 2Z5VA 1R4NA 1AIPA 2GZRA 3KT8A 4K5QA 3ZZ0A 4LDRA 3I6IA 1DIRA 1YKFA 2HO4A 1TNDA 2C2XA 2EJWA 4B17A 2EX4A 4A2CA 2WWYA 3R3YA 2HHHB 3REOA 5JTUA 1CZLA 4ZOBA 5TPWA 4MTCA 4GMXA 1GRNA 5KSWB 3WNDA 4F9EA 1YTUA 1ZVVA 1JA9A 1OJ7A 2B1QA 2YR0A 4NOLA 4ARVA 3KJGA 3IBGA 5B1YA 2WSSD 3WLLA 5KX5B 3AUAA 4KNVA 4I66A 2OHGA 1QIJA 4RIFA 3WICA 1JKMA 3C7AA 4DCGA 1AZWA 1EK6A 1JI0A 2EATA 3AEKA 3QTBA 4R0MA 4HG2A 1AD2A 1NONA 1XTZA 2J3HA 2PX2A 4DCSA 3LT5A 2ECPA 3SQDA 3I23A 2JGIA 4EABA 1UP4A 3ECAA 1OZAA 1U3DA 1ZXXA 3H99A 3IV9A 4B85A 3RYIA 2FKAA 3R7NA 1GYRA 3H2KA 3UJBA 3GJYA 5EHQA 2NPIA 4QQFA 2WYHA 2WD8A 1W8DA 2H0AA 3G85A 5TF4A 4E3ZA 1Y6GA 5TNXA 5FOWA 4M87A 3I39X 3RQSA 2H6EA 3K2IA 3TOSA 3UAVA 5A4KA 1QG4A 1X9IA 1M1UA 4LVNA 4WHMA 2KLBA 2AI2A 1DG1G 4DAEA 1PNRA 4KO2S 4CT5A 4YHHB 2CC2A 1T5SA 3MFYA 4FE3A 4X20B 2OKGA 3TAHA 3A4LA 1PG0A 4DBLE 4MCJA 4MS4B 1OLUB 2Q0QA 4GNRA 5HCUA 5F2NA 5FOXA 5JSHA 1APBA 2NTYC 2J9XB 1PTJA 2A86A 1K8QA 1U31A 1UBUS 1DBVO 3H19A 1IWPB 5K4AA 3G9QA 3VZRA 1ZX1A 1FXUA 1U0SY 3DDCA 4QECA 4WESA 5E6RA 1CB0A 1JE1A 1I8TA 5SZKB 5UKDA 3RQIA 3TPCA 1JPVA 2FPGB 1E2FA 3JYNA 4N3AA 3WLKX 5JY6A 1NJ1A 1XEXB 2ZIFA 2PPVA 3NBQA 2RAUA 1NBIA 4JLVA 1OH6A 3HJCA 2R4UA 4MS1B 3VR1A 4AN4A 4D7AA 1TF7A 3EAFA 1GVNB 1KZYC 2DM6A 3HA2A 5DCLA 1OH8A 4FXPA 1WM1A 1IY1A 1QHGA 1YI8A 4I1PA 2FYTA 1MGPA 3BE5A 3INGA 4OBBA 3ZXXA 1HYEA 4P4NA 1RBMA 1TKBA 3ZWKA 1HEUA 1NDQA 5JXIA 2X9LA 4IHJF 2UZ1B 4H0NA 3NKFA 4L4SA 4XM1A 1L7OA 3H5RA 5IFKA 1GOTA 1A4RA 1TVEA 4YRTA 3IDOA 4RO0A 2HXSA 3ZNPA 4UUAA 1PBNA 1T0BA 4OOFA 3PPIA 1PJLA 1TT7A 3INYA 3WFZA 2W83A 1PEDA 1RHQA 3P9CA 2WM3A 3PXXA 4JKOA 3BICA 4LWOA 4UM9D 2QJWA 3KYJB 121PA 3JWPA 1IY8A 4YRSA 4K1LA 1GTSA 2F62A 4L08A 3DOJA 1VPTA 4RTRA 2AT1A 2GM4A 2JAQA 4LI3X 1YE5A 3BF8A 1Z37A 4QDXA 1CUVA 1T91A 5IJ9A 4Z6KA 4WN3A 1S3FA 2C5LA 2PWBA 1Z0SA 1E3EA 3TQRA 4FWIB 5IC5A 5C18A 5HQ3A 4NOKA 3N74A 2VXYA 3PC2A 5JS7A 5M04A 2JLBA 2P9YA 2ZAIA 3F3YA 3F67A 4GKAA 5AI6A 4Q82A 4TMXA 1O9GA 4LWQA 1DKQA 4C0BA 1VJRA 1WIWA 3Q7TA 4N5DA 3C4JA 3TD9A 1WKBA 4TLCA 2YWFA 3W6ZA 2O7VA 1T25A 1U8FO 2A9PA 2O14A 3C3CA 3HBAA 4JIMA 5IJWA 5F9HA 4MI1A 2VPIA 4DHWA 4W8GA 4DV0B 3VYRB 4ARZB 2O7SA 1U9IC 2OCIA 2XCUA 3AIMA 3CSUA 4YRRA 5JMOA 2ZIUB 3EXHB 3QPDA 2J4DA 2C2GA 2GVDC 3JWHA 3O8RA 1KRWA 4EEXA 2J7KA 4H7IA 4G09A 2CV2A 3WDMA 1VL1A 3T7IA 2ZUBA 3FDXA 2CF6A 1U0OC 4YX9A 1BQ4A 1GFWA 3LW7A 2QTVA 3L4JA 4Z7JA 2ERXA 1E1CB 2X5XA 1Q12A 3HXLA 1ZM4A 3CBQA 2WUVA 4ZQCB 5AFSA 1CVRA 2BBWA 3AR8A 3UBTA 2C03A 3FPLA 4TXHA 1X87A 4KX5A 4YP1A 2QZSA 1YR2A 2BJWA 4GWKA 1I9GA 5BVGB 3BT7A 1T2FA 4WKGA 5AKYA 4OU5A 3WV4A 4AJHA 2GDJA 2VJLA 1OC4A 1ZD3A 4DABA 2IH4A 4HTFA 4N7MA 2PWYA 5HE8A 1X70A 1FLAA 3E9CA 3OLYA 3RUIA 3EIOA 4C6SA 4FSXA 2YWBA 3QFTA 3SSAA 1W581 1DKNA 3ULKA 3OKAA 4JQSA 4TTIA 1KVUA 5C7LO 1O9BA 2GSWA 1BVRA 4V0RA 2IEGA 1J07A 1WHTB 4BZWA 1OB5A 3OEED 4X7RA 2GILA 4DQKA 2GTIA 1AO0A 1TIKA 2RGYA 2EBWA 5AIBA 3D6MA 1UEIA 4K6OA 3ABZA 3K6SA 3NIBA 5AYVA 1YA8A 4UJ3A 1E2GA 2COUA 4EP1A 3D8UA 2E6KA 2C5FA 2PANA 3MJCA 1XPUA 1BKDR 3A1SA 4EYGA 5I9SA 4HSEA 1JDSA 2AN4A 3KHKA 5DBIA 2P7IA 2Q27A 5DHQA 4E2YA 1W5EA 3LZCA 1SVKA 2WEKA 3VR3D 5L6MB 5MN5A 4Y18A 2ZU6A 5SYNA 4A10A 3IYLW 1Z6XA 4QAQA 1VXRA 3UAOA 1CRLA 1H2WA 1QBGA 4FN4A 5J5VA 5L3SB 1GNVA 1V48A 4URHA 4H7PA 1E62A 1J5EB 4D9CA 1MP0A 2X6TA 2BMDA 4XI9A 3MXOA 3OOWA 5BR8B 2AX3A 2EP8A 4NAUA 4XJVA 4AX8A 1SK8A 3SSNA 3HZZA 4C4RA 5K4GA 1WNFA 2QTTA 3ZTTA 5FNVF 5FIUA 1C8LA 1YB4A 5IDYA 3MJVA 4MCIA 3HVHA 4B3TB 2Z8YA 4EG5A 2HEGA 3F7TA 4XKJA 4N7RA 4DCOA 4GAEA 2HX1A 1LBIA 1JYSA 4H9GA 1PQYA 5KOJB 4WY5A 4I6GA 4PGAA 3DDOA 4R2IA 4M0LA 4MV8A 1DHRA 4N8EA 1CE8B 2LKDA 3ZHXA 4EH1A 3E48A 3HJNA 2CMKA 4C7BA 2G9VA 2P90A 3N8IA 4PTLA 3TM4A 2QRGA 2N42A 3ZLVA 3EIQA 4N5IX 3KQKA 2P9QA 3I62A 1QYWA 4INZA 5ULLA 2YFYA 3NTUA 4NOJA 3D4PA 5EY5B 1TU0A 3EQ2A 3BMNB 3PGA1 3BE4A 4J3NA 3G9ZA 1B15A 1R0CA 3ZLBA 1K0UA 3SEZA 1CQJA 1UC8A 3Q7SA 1C0LA 2HBZA 3SYLA 4QTUB 4H59A 2FKNA 1JRLA 4YCMA 2PUCA 2CGEA 4PNZA 1BXKA 5C1OA 4HMPA 1ZNXA 4URWR 5FI3A 1D03A 2WAOA 1EX1A 1W34A 3ZVMA 4XTCS 9MHTA 1RWBA 3ONNA 3QNWA 3RREA 1BDMA 1ZCJA 4QU5A 1V9SA 3PEYA 2OL4A 4S0XA 2WKPA 4Q4JB 4PPNA 4KLCA 2NG1A 2QQGA 2WHRA 5AJVB 1XRJA 2QZ9A 3G8BA 2IWRA 4HGPA 4F92B 1XXLA 3H3JA 2G6BA 1IJBA 1Y6ZA 3GIWA 1DUIA 2O23A 3WMXA 3I2YX 5AVWA 3L8GA 4MITA 4ILKA 2H7CA 1BQEA 4RQBA 2NOAA 2OFXA 1L3BA 3DHYA 4B5LA 3P0JA 1Z68A 3UK7A 2AFRA 4RY0A 1X8KA 4MVJM 3TNFA 1Y3FE 2WWHA 2ZUTA 4HUTA 2AOVA 3VKWA 4QPJC 1E4EA 3UATA 4TKZA 5AW5A 3ZE1B 4LSMA 3BWMA 5GV8A 3DGFC 5G1PA 3E4DA 3NO4A 3F2IA 1W0KA 1JPJA 1W4LA 4OYYA 1V71A 4U2GA 3MUFA 1KJYA 4IDCA 4J9UE 2YCLA 4I4NA 4MPRA 4GRAA 4DRYA 5LZ2A 4JV5B 1G5TA 4I99A 4S1OA 4EB6B 3BXHA 2WPDD 3FTPA 1EWYA 7YASA 1T36B 4GC9A 3WWOA 1WUYA 1XB2A 4G2NA 5JARA 3O8OB 3L7OA 1FXWA 2X41A 5D6NA 4IJMA 3OIFA 4D45A 4MW6A 1JZQA 1Z5NA 4CG0A 2Z3WA 3QPCA 4MGKR 1X7XB 4Z9FA 4G1EB 4RKFA 2B1JA 5EZQA 1UPUA 3JPYA 3E18A 5I6DA 1BWSA 2GR9A 3GEPA 4MOWA 3D3WA 3HDHA 4QGGA 1DAKA 4K86A 3THXB 2GN4A 2BZ1A 3IEKA 3PE6A 2QVGA 4FE4A 1HTWA 2O8CA 4TTTS 2VUTA 3OJXA 2AZDA 4G9GA 1T5BA 3MTJA 1TFUA 2DFPA 5EP2A 1T5DX 4PNHA 5CFNA 2MSCB 2O2YA 5CBPB 2EEPA 2BDTA 3CRVA 3FGOA 2VRCA 4GF5A 1VE3A 1I9CA 4K46A 4MGIR 4X3PA 2B5WA 2PMKA 5EG5A 1HSZA 1KDYA 2UZ0A 3NEYA 3X1YA 2HJ9A 3TZCA 1MGOA 1WCXA 4YFVA 5TQJA 1QP0A 3PFCA 3W8NA 4ITRC 2ANBA 2FMIA 2HF2A 5GONF 4DWJA 2QL9A 2I29A 3C70A 3K4HA 2KI5A 4O08A 1OPXA 3OZIA 4IICA 1XNQB 1E7YA 1KYXA 1GR1A 3TSYA 3LDUA 2XB6A 1XF1A 3CEPB 4JX9A 3U0BA 3UMMA 1DT5A 3D7RA 3P5SA 4PC6A 4LGYA 4ZOQI 2W2NA 1U0HC 2VAXA 2QF7A 2Y93A 2W8ZA 4JT9A 4M1TA 2Z30A 4TN1A 3GFOA 3EA5A 3O8QB 2W6OA 3ILVA 4YY3B 2Y2UA 1BHO1 3IXQA 1U0EA 3K5HA 2FW0A 3UWDA 3ZHCA 4NAVA 1ZI8A 5TPZA 1UBMS 3QG5A 3FYSA 3DZKA 1SD5A 1VMKA 4UATA 2YIJA 4MW2A 4TS9A 3LY5A 5AQEA 3JZDA 3RC7A 4DR2B 1XRNA 4IVPA 4OTZA 1FCJA 1L4NA 4R98A 4AJ1A 3L1KA 3W8EA 4YV7A 2RAVA 5JZSA 1V5IA 5TRTA 1IOZA 1COZA 2NZ2A 3N58A 3QUTA 2RKWA 3WY9A 1N92A 1W94A 1ZK1A 4V38A 2CJXA 2TSYB 3KKKA 1W29A 1OASA 3E2MA 1XCLA 3K9FC 1C14A 1G7SA 2QUZA 3JAWB 1Z6TA 1G21B 4DEVA 5BSWA 1RRPA 1N1GA 5JNWA 1Q92A 1KK3A 4FFMA 2ZYWX 1KNQA 2WTAA 3JVIA 4YGXB 2ZSEA 5EVCA 1FQOA 2D0OB 1EVKA 1QO7A 2YYAA 3FOWA 3FPCA 1CHDA 1USGA 2R47A 5DRYA 1WD5A 3RS3A 3WK9A 5CG1A 1SZPA 2YV5A 4KQHA 1GTL1 4CU2A 2Y1EA 4AKIA 1N33B 3KKEA 4GYWA 4NDZA 3SWWA 5LP1A 1WCIB 1Y9DA 3OIYA 2VT6A 2WAYA 3CNQS 4AYWA 2Q3EA 3LL7A 1P4GA 2ZYAA 5DASA 1QF7A 1RLIA 4KJXA 3RC1A 2W2LA 4YECA 2JGAA 1CEXA 2G3YA 3H1AA 4CMEA 2XADA 1BU8A 1PUXA 2QYSA 1VRCA 4D4GA 3W5BA 2QZZA 2Q9BA 2P9CA 1XT6A 3KO8A 1PR4A 5B1DA 1GU0A 3TGPA 1J0XO 3MWEB 2D7CA 4KH0A 4PC1A 3RVSA