4KQ6A

Product complex of lumazine synthase from candida glabrata
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
158
structure length
158
Chain Sequence
b'QNYDGSKLRVGIIHARWNRVIIDALVKGAIDRMLSLGVKEENIIVETVPGSFELPYGSKRFAEKQAKKGEPLDVVIPIGVLIKGSTMHFEYISDSTTQAIMNLQDKINIPVIFGLLTCLTEEQALARAGIDEGKTMHNHGEDWGAAAVEMATKFGANA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6,7-dimethyl-8-ribityllumazine synthase
publication title Catalysis product captured in lumazine synthase from the fungal pathogen Candida glabrata.
pubmed doi rcsb
source organism Candida glabrata
molecule tags Transferase
total genus 51
structure length 158
sequence length 158
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 2.5.1.78: 6,7-dimethyl-8-ribityllumazine synthase.
pdb deposition date 2013-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00885 DMRL_synthase 6,7-dimethyl-8-ribityllumazine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.960 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Lumazine/riboflavin synthase 4kq6A00
1KYXA 3MK31 2A57A 2OBXA 2F59A 1KZ6A 2C9BA 1T13A 2I0FA 1KZ9A 1RVV1 1C41A 2VI5A 1KYYA 2C97A 2B99A 3NQ41 2B98A 1NQVA 1EJBA 2O6HA 1C2YA 5IM4A 2A58A 2JFBA 2C92A 1NQUA 1ZISA 4KQ6A 1DI0A 2C9DA 1HQKA 1KYVA 1XN1A 2C94A 1NQWA 1NQXA 1W19A 5IM5A 1KZ1A 4J07A 1KZ4A 2A59A 1W29A
chains in the Genus database with same CATH superfamily
1C4OA 1B73A 3IAXA 5FHRA 2EHDA 1YZLA 3L8EA 2LWIA 5THQA 4AS2A 1TYEB 2CXTA 1J22A 4V39A 3FROA 5DBOA 5EKSA 3PJRA 1DJOA 4GR9A 2VXYA 3WAGA 3G2JA 3NKLA 1XL0A 2E37A 3ZV6A 3BRSA 5ALVA 4OX9Y 1J21A 2FV8A 4FLEA 3LWBA 4B3TB 2Q27A 2I7CA 2XWBF 3L6DA 3O84A 3ZYCA 1EX7A 4JLOA 3PQ5A 5HTKA 4JROA 4K26A 2PRJA 4ZVRA 4CKCB 4ZT6A 1VMIA 3H65A 1ZRSA 1HE2A 3IKVA 5EMNA 2UAGA 1U63A 1FDTA 4L74A 1Q83A 4DDTA 1SEPA 1OWLA 2XY4A 3DS8A 3JD4A 4KN8A 3UGQA 2AKEA 1P9RA 1QIHA 1P3DA 1OLXA 4BGVA 5JZVA 2PZLA 4MAFA 5TJ9A 3CNLA 1BMTA 2QRNA 4EKNB 4TQGA 3SX0A 1QIGA 1T0JB 1USUA 4L57A 2P1DA 2WAOA 3DXFA 4JEHA 4XA8A 3NDIA 4KFCA 2FUEA 1E0SA 3OCZA 3ES9A 3PJDA 1T5SA 3RS0A 4KPYA 1FFWA 1EK6A 1TKBA 4R05A 1QNLA 3GVCA 5MN4A 2I6GA 3ZDXB 4ALJA 3ICPA 5IN5A 1V0JA 4I50B 5JAPA 5IVHA 4TMVA 4LF9B 4LHSA 3L7IA 3KYBA 3KOYA 4EHJA 1BWSA 3DBLB 4OYRA 2ZJ7A 1DC4A 1IUNA 3CG0A 3CF2A 1TIPA 3BE8A 1RHUA 1A7KA 2A2ZA 3A1CA 3C8MA 1Y7PA 2J5KA 3MK31 5EUQB 5C4GB 4DWJA 2P4QA 1CETA 1ECJA 4D4HA 2GTPA 1SB8A 4DLBA 2CMDA 1Q1QA 2EJBA 2QMZA 1IN4A 5E6SB 3ZIDA 2J1LA 4CEIB 5IKMA 3DHYA 4IIHA 3ENWA 5CURA 4M8SA 1V3TA 1FJXA 4JYZA 4M0PA 3IO3A 4KVAA 2HRCA 3JWJA 4DIUA 2CVOA 2GZRA 1Z6TA 1QLWA 1S2OA 2YN2A 2YUTA 3INRA 4XFJA 3SYNA 2Q49A 3CX8A 1X7YB 4U9IS 4QA9A 1MAUA 2GKOA 2I67A 1EGMB 1YS9A 1G21A 3N76A 2LCIA 3EZFA 5H68A 3CZ5A 4AUEA 2OCAA 4DKXA 4RHXA 1FNCA 4B32A 5JARA 1JVBA 3RLIA 4OTZA 3VGJA 4ZK2A 1N2GA 3KQSA 3PNBA 4ILEA 3Q3JB 4RE5A 1E5XA 2BBTA 2GB4A 2H59A 3H5IA 3QLVC 3RVLA 5L95A 3VTKA 4B79A 2YVAA 4RACA 1GJRA 2JFYA 1T34A 4EVSA 3NGLA 2H57A 2HSDA 2HPZA 1SQ6A 1LC3A 1G8AA 2LBPA 3ROKA 2ZIEA 3AUJB 4B82A 2QD1A 5IXSA 3Q3GE 3H97A 4H7JA 4P3XA 4M1WA 4CU2A 2C61A 2ANBA 2NTVA 3THYA 2PGIA 3AVUA 4W5JA 4CMEC 2XOEA 3H2SA 3Q5GA 5FKJA 3FWHA 1T6XA 4BJ3A 3L8DA 2QUJA 4A8HA 1CEEA 1WX1A 1KYXA 1AZLA 1OVMA 1XTZA 3IB3A 1U1FA 4K0RA 3LBHA 1GXSA 5AOCA 1J97A 2KHZA 4I9FA 4ZFNA 3BGVA 4LF4B 1E1LA 3FDFA 1E4OA 4QATA 3IAUA 3UA4A 3C7AA 1ZH0A 5F64A 1GKIA 1E61A 7ADHA 2AV6A 4YDHB 4QO8A 4RQUA 2D6FA 2HCFA 3QU5A 3DVSX 2QPOA 3G88A 2CJYA 4CE6A 3BE4A 4PCUA 5KSPA 5TQJA 2OCLA 3CEPB 2WT8A 2W98A 3WL6A 2Z58A 3IT3A 2D8MA 4OKIA 3WNZA 1JEYA 1SC6A 1C50A 4A82A 1ADYA 5LZ5A 3L46A 3RYCA 1BFUA 2WHXA 1PQ4A 1YO6A 1SG9A 2N3ZA 3AWIA 3F74A 1T1IA 2IHZA 2VQDA 4IIDA 2E4UA 4TKZA 2COEA 2CNBA 4HF7A 4EGJA 1B7GO 1ZN2A 1KYYA 1L7OA 3FTPA 4MKIA 5E0OA 3G0DA 2W6OA 3D4LA 2QRKA 1CNEA 1SBHA 4TL7A 4OX9B 3E35A 1XKQA 3C6QA 4FMCB 2Q5HA 1YQUA 2Q6KA 4TQ9A 1XVIA 1IG3A 1J1ZA 2FMUA 1JSRA 2IYPA 2BZ0A 1TLLA 3LW7A 2XEDA 3QH4A 4RHYA 5HDQA 4QTZA 3ESYA 3K5WA 2WAMA 3BIXA 4C6RA 1IY8A 4E07A 5CT5A 4L0CA 3A1VA 4WEOA 3HXQA 1I2MA 3NNNA 3I01A 2HM7A 3FYHA 4G2TA 4JT2A 2HSJA 3MS7A 2AW3A 3CW2A 2UYGA 4H3HB 3NALA 3RF6A 4W6ZA 3KDPA 3ZOKA 1PJCA 3ELUA 3K8ZA 3L6CA 4BB5A 1W1IA 5BR4A 4RTOA 3DNPA 4X63A 5BORA 2DPYA 4I4CA 1XX6A 2H11A 5DU2A 5HILA 1LUAA 3D3QA 4Z3DA 1G0OA 3FTCA 3MG9A 3PXDA 4CKCA 4CTNA 3OP4A 1W8DA 1BVUA 3ZLUA 4IH9A 4AG5A 2YXLA 2OV2A 3DOFA 2CK3D 2HBRA 4KQMA 3VR2A 1IJBA 1EEXB 3AIOA 3SQNA 5GIPE 1YQQA 1TI7A 5FFMA 5FOSA 3S4YA 2IFTA 1IWBB 1N5IA 4JX8A 4Q01A 2GO7A 2V74B 2FJ0A 5F2KA 2BM8A 3GCWA 1XKTA 1X39A 3A04A 1DXOA 2BGTA 4LYAA 3R5FA 4W7HA 1I6KA 2B5OA 3MCVA 1I3CA 2BFFB 1Q7GA 1VPVA 1UK9A 3PC2A 3KU4A 3RO7A 4BLPA 1A9ZA 4HWOA 4GEKA 4OJNA 5FPPA 3C16C 2EOAA 4CF3A 3H11B 1SG0A 2QKYA 1ULHA 1KI6A 1IHYA 2XJ9A 4RZ2A 1KBQA 3VV2A 5JNVA 1X9GA 2HLNA 1OCEA 2I4MA 3GJRA 2AT1A 1XR3A 3CLTC 4XLLA 2IWHA 3WWEA 3DBLA 4ZICA 4NBWA 5HR5A 1D8AA 3U80A 2VJKA 3GDFA 2XUIA 2C4VA 5CFOA 5HJEA 4I9UA 5BRNA 3KHUA 2W4MA 1J90A 1ZLXA 2OV3A 2D0PB 3TX6A 4NS1A 1T2CA 3CX3A 4P7GA 1QKKA 4BNDB 4TMFA 3LECA 4GYWA 3VXKA 4JQOA 5IM4F 1J8YF 3VJMA 5E6SA 3REOA 4FUTA 4CEIA 1N2CB 3B2EA 5EFZA 1NXXA 4J7CA 2OBXA 2ZIXB 1CR4A 2UDPA 4XDZA 1VL6A 4PC3A 5LL6P 3P9PA 3O8QB 2Q3JA 3GZJA 4J0FA 1N33B 9LDTA 4DNFA 3W5UA 5I7WA 2JIOA 1X7YA 4HT3B 3DZJA 1JVNA 4YB8A 4TS4A 2G9QA 1I01A 2TMYA 9ABPA 4RD1A 1FMFA 1RJ9B 5CFZA 1UBMS 1L6RA 1GRRA 2PPLA 3IS3A 3PVZA 4GUDA 3KV3O 2IL1A 1T9HA 2AH5A 1A9TA 1QM5A 2O8VA 3AFGA 3HUTA 3K2QA 3QVLA 3U48A 1BXGA 5E2IA 2WZCA 4KXNA 1U98A 4CF6A 2P9QA 1G18A 2A5LA 1AO3A 2X2FA 4J4TA 4KRYA 2VUHB 4NU8X 4H3VA 4I3HA 3U3KA 3BQ9A 4WL0A 1UWKA 1VKOA 3F96A 2OORC 4Q7QA 1POWA 3F4BA 2ZU6A 2AJCA 4TZ0A 2N75A 2FG5A 1NNI1 1SQGA 4O4JB 2ZUEA 3GEMA 2FQ1A 5BNZA 2EZTA 1ONOA 3DKRA 4FZJA 5AJVB 5F7OA 3RAFC 2HJHA 2Y2VA 4ISCA 5IVPA 2QN9A 3EF3A 4OIFA 2TRSB 4YT5A 5HKKD 5KWSA 5LUAA 4ZOLF 1UZMA 4J7AA 2XUFA 5E6UB 3RPEA 3WRXC 5I7OA 3KZ1E 2WWGA 4FMDB 3BZWA 4YCBA 4CQMD 2ORVA 1V1RB 1NNEA 4IDQA 1E5TA 1OR8A 4C14A 1O5IA 2VDWA 3U4QB 1CW2B 3PQ8A 4MR7B 1TPZA 4FS8A 4LUCA 4RTPA 3MT7A 2HMSA 4UUMA 4G67A 2Y27A 1VYVA 3R7LA 5LZ8A 5AM5A 5AKJA 2QX7A 3AEQB 1BD3A 3PQFA 4RF5A 1XALA 3I39X 1D0VA 4C9BA 4FYKA 2EZ4A 3EGXB 3PPXA 1WVMA 2X23A 4TVBA 2PMEA 3H8VA 3V4LA 4PN7A 4GQBA 1E98A 3EXAA 3ICEA 1Z6XA 3MJFA 1PJZA 2ZYUX 4GYKA 1MHPA 1W4BA 3JSAA 2GD6A 4P7BA 2Q6IA 3NWEA 4L6CA 2ECPA 1PT9A 3SBOA 3WGLA 4BVFA 5HNKA 1PL0A 3URMA 2WT4A 2C77A 5HOEA 3B3JA 3VH1A 1GPWB 4G1VA 4EELA 2F2TA 2Y0BA 3NT2A 4M6WB 5KTYA 3E9MA 3W9YA 1OLSA 3FFWA 3ZGLA 4OLAA 1QDLB 3KWLA 4JYBA 2P8JA 4FC6A 4J2OA 9MHTA 3UJ6A 4A0SA 3A7EA 5C18A 3B6KA 2H0QA 4Y2TA 3UB2A 3GJ4A 3S2FA 4DAEA 2QMYA 4E5UA 4XPIB 1L3CA 1P4SA 1BG6A 2XV1A 1KSFX 1XLTC 3CO5A 1CVRA 4L5CA 3TL2A 3EW9A 4ZV7A 3C3DA 2H5EA 4AZ3A 2DTXA 3MUNA 4RMNA 1IWPB 2GEKA 2IF0A 3D6NB 3H5TA 4PGMA 5FJJA 1JG7A 5FXMA 3RVOA 3K0HA 4MYCA 4FW8A 4BLTA 5MFZA 4I9HA 4U5QA 2O0JA 3KZCA 3LDUA 4LY6A 2WKWA 1TQDA 3EARA 2YZKA 1W8IA 1NW4A 1PSDA 2J9FB 4AJJA 3C3WA 1KWKA 1TXGA 3EULA 3QY0A 5JE8A 4DMCA 2BF4A 2YHUA 3N8IA 4M8LA 3FOWA 5G1PA 5EIBD 3AZOA 1CCWA 1ZD3A 4C4SA 2EL7A 3BGDA 3L1UA 3ZDCA 5LP6F 4ZALA 1L7AA 2R4QA 3L92A 5A6VA 3G2KA 4JVSB 2CLEB 5IC4A 4OGLA 1NN3A 1UQRA 1XDZA 4WBXC 4BVLA 2WTUA 1ENYA 1NVDA 3KZXA 4P0PB 3W2FA 1Q3KA 3EIUA 3OWXA 2XMPA 2CBZA 4BNWA 4EG6A 3T15A 1BMFA 2ZG6A 3GMSA 2JHAA 1DIGA 2P9TA 3WL5A 3QZUA 4QGBA 4AB1A 1Y1QA 2CF5A 3BGOS 2V03A 4FX2A 4JS0A 4YK7A 4L2IB 4YONB 2BFOA 4IOLA 1B43A 3IUQA 3C4VA 4JI5B 1NGSA 4AKSA 2PMKA 2O2XA 1BDMA 3HY6A 3PB3A 4NULA 4HKTA 4C0BA 3LX6A 4C2BA 5CFQA 2WV9A 3AKEA 2BFFA 4ACBA 3K20A 3T35A 5LYYA 3JY6A 4DUGA 1QOPB 4C03A 4MZDA 1MQSA 1C0IA 1G41A 1ZJYA 2ZROA 3DBHB 1ONPA 4FNOA 5EP3A 5FLEX 3ROEA 3LX5A 2V7PA 2ATEA 5C51B 3HCFA 1EVQA 3QVGB 2AE1A 3OIFA 1UXOA 1E7RA 4LVOA 1FTQA 2P9YA 3H2KA 3KC2A 4H77A 5ESXA 3T7EA 4B3FX 4EH1A 2YV3A 3EOAI 1Z63A 5AOBA 2O8EA 3KTOA 4HG2A 3FHLA 3HLKA 1LJUA 5J2UB 1L3BA 4IGKA 1OFIA 3V3KA 4FHDA 3DE4X 3ADCA 2IBMA 3CX4A 5BWBA 1R5BA 4EKGA 2PUCA 1JJAA 4TZ6A 1IPHA 1CR6A 3QMMA 3O38A 4M8IA 3SQMA 1DXQA 3VZPA 1E64A 2GFHA 2P2ZA 4UARA 1L8OA 4BNDA 3GLIE 2ERXA 1A69A 2B9EA 2RKBA 3A6FA 4NYMR 1R66A 4LNAA 1YB4A 1OTXA 3ZWOA 2FZ5A 5BSFA 2BW0A 2OPHA 3FHTA 3L40A 2ZIXA 3E2PA 1SUEA 3CVWA 2V45A 3HMQA 4KR6A 1N75A 3AR8A 4EW1A 4F45A 3O8QA 4XYEA 4QJ3A 1EUQA 3ZD6A 3LFHA 2JEZA 2QJOA 2XUGA 1OU4A 4CM6A 1NDHA 2ZUCA 3PSHA 1QG6A 3C5WP 3JXEA 3BWCA 3WMFA 1I8TA 2I1LA 2ZT6A 3W6OA 3I62A 2XCLA 3A8TA 1RJ9A 4DV4B 3V2IA 3ER8A 3IBYA 1P9NA 5CXSA 1XHFA 2QVZX 3N2YA 1P0IA 1UKZA 4FFBB 4J0DA 1T8WA 5AJUA 1BHQ1 1VG9B 3ASZA 5AM1A 1Z74A 4ZVOA 3UJ8A 4ALIA 2HTFA 4HNGA 3ESXA 1MU0A 1RKQA 2A5YB 2QTLA 2DT8A 3QHQA 1V11B 1TEHA 4FFSA 4GI3A 4IGFA 4EPYA 3V32A 2MTBA 1WDTA 3LDHA 4MJLA 4OCZA 5E9JA 5KAPA 3HRKA 3JQ7B 1VHLA 3T1OA 1YCFA 2VJYA 1XMIA 1FP4A 3L7OA 1B0PA 2OHIA 4PLYA 4YRFA 4LBVA 4CM9A 4O4JA 4KHZA 4KCGA 1U2GA 3AHIA 3KM0A 3PR2B 4IIFA 5J4VA 4KUGA 3AONB 2IEBA 2JZOA 4NZYA 4U0JA 5DN9A 3ZD9A 3ZV7A 4DPLA 1NQWA 3EXG2 5MFPA 5ICFA 4D4MA 5KOYA 4FNMA 2QBYA 3A6PC 4AKIA 3HN6A 2JA1A 1Q95A 4P58A 2NVUB 2QRZA 4QBTA 3DXYA 3PXUA 1N0WA 1V1RA 5CEJA 1BOFA 4YRGA 2IBTA 1QHEA 4G5RA 2ETVA 3C0KA 1XHLA 2V6FA 3U4QA 4MR7A 3RJMA 3UG7A 1BA2A 2CC2A 4DCNA 4D3YA 4JA2A 3UWDA 1LBHA 4US0R 3F73A 2NU6B 1OIXA 3DE3X 1I7NA 3O2JA 4MYRA 1D6JA 1E1NA 1ZN8A 3NC4A 4ZJUA 2PLAA 2VH1A 1K7SN 1GCOA 1P1KA 3H99A 4X94A 3PEYA 3QV1A 3EGXA 2H31A 1GU7A 3OZCA 4FDVA 4XCQA 3M9LA 2C2XA 3ANXA 3ETHA 4RPCA 2X0RA 3OO0A 2ZIFA 1C1DA 1ZS9A 1EFRD 4B2IA 2RHCA 2ZT7A 1EAYA 3B12A 5DIFA 1R8JA 2C5GA 3PGVA 3WWCA 4HYTA 4YCMA 1E6MA 1Y9JA 3M4ZA 5HM8A 1NZDA 4MR9B 4JFAA 3QHPA 2I3GA 3T4UA 5CB8A 4BNUA 5EMJA 5BXQC 3GDWA 4HL6A 1QPZA 2VJPA 1QANA 3D6AA 1NXQA 3AF3A 1UT8A 4WBNF 2M9MA 4ME6A 2G9UA 4RL4A 4UCQA 5E6RA 2RH8A 4XYGA 3NTOA 2DZDA 3EIFA 2ORED 4XPIA 4DM3A 4YV7A 1UPBA 1LDYA 3DWGA 3G89A 4ZQBA 2JKZA 4BNVA 2YY5A 1PRYA 2ODAA 3KCNA 5ADVA 4CM8B 4LDRA 4TLCA 3WMRA 2W2LA 1GZHB 1WCXA 4BNMA 1GNVA 4M0EA 2J09A 1NN0A 5LKRA 3LT5A 4QBKA 2JD2A 2I4TA 4BU1A 2J9FA 1KXJA 2R4TA 2YJ6A 2ZQYA 1EHIA 3B1JA 3P2KA 3PHIA 4ZU1X 2RFLA 3H1AA 3H6HA 1EFTA 3AJRA 2A1TS 1PZHA 2UYYA 3OQOA 1JHYA 2YWXA 3LXMA 4GYJA 3VBCA 4U9HS 5DNAA 2G07A 1ZK4A 2JCVA 1KSGA 2ECQA 5A9TA 5SICE 1D2EA 3TBKA 4BB6A 1HNXB 2ZBFA 3WJ1A 3EH2A 4MGIR 3RVKA 1K8QA 1Z45A 1YUBA 1KIMA 3TS1A 3VAYA 2BY4A 1BS9A 1F51E 3GT7A 1ESZA 3MPOA 4L85A 4RJIA 2DRIA 4TMTA 1P8AA 2X8LA 3PHGA 4DWOA 4DTCA 4EUSA 1DADA 4BX9A 4EVQA 4Y6PA 4W5RA 1GV1A 2R85A 1X1CA 1VRWA 3QIVA 2QTMA 1X3LA 4JA0A 4YASA 2ZI7A 4L2IA 1DPFA 3OF2A 3FJOA 4GLJA 4XTCS 3E4CA 1Y1LA 2F3RA 4JWTA 2J41A 2VP0A 5H70A 5FPQA 2GNPA 1AKUA 1U04A 2F9LA 2WG1A 2YHAA 3B3FA 5EZ6B 4TTQA 3T3PB 4HUTA 2O5CA 2I80A 1U6KA 1E2IA 5ISMA 2GVNA 4RKFA 2DE0X 3DBHA 2DH5A 1TZKA 4X5OA 4KPEC 1Y1RA 2WE8A 1M2VB 1ZCZA 1U5CA 3L6UA 2QVLA 4I66A 2VP9A 1XZEA 1E6LA 4MHOA 1GFZA 1AQYA 2W4IA 5TV2A 4L5BA 1OBFO 2BONA 4N54A 3WKEA 4P36A 5J2UA 3M3HA 2F1OA 3IOCA 2UUCB 4G0WA 1PJ4A 1FU7A 1B1AA 2QA5A 3DDOA 4JKOA 4LRQA 3RK1A 2GZSA 2ECKA 3EMDA 3QVMA 2VBCA 3H7AA 4QYSA 2Y0PA 2HUNA 5IG2A 4WUTA 4BYMA 2YBEA 5T4EA 1OLOA 1S2NA 4K6GA 4N5HX 3T0FA 5JECA 3R8CA 5HZKA 3PEWA 3ND6A 1E2EA 3HU1A 4PZCA 1TC1A 1MTOA 4GR5A 2GPJA 4MQEA 3QEAZ 4UU1A 3WRWA 4O2LA 3DCYA 1DWOA 3RSFA 3CCBA 5CLJA 4AS1A 4X61A 1IXRC 3PUIA 1BE0A 1R37A 5F3WB 1RPAA 1YNOA 4G4JA 4H2DA 4JBGA 4EHDA 3FE2A 4AYTA 4QYTA 2AR7A 5IF9A 3W8FA 1SKMA 1M8JA 1BKYA 3BD7A 1O89A 4FFBA 1YHYA 5H83A 1DKRA 1R8XA 3VNRA 3RJ9A 1SC1A 3UXEA 2H4ZA 4E03A 1V11A 1U1EA 4C0LA 3FMFA 3YASA 3K1ZA 2O4CA 3RRFA 2G1PA 2BSAA 2ZSHA 3JQ7A 3VYVA 1J0DA 5FWAA 1DTEA 2WTNA 3IOMA 3K0AB 3V4VB 5HMMA 4JH0A 3B6IA 4X00A 3D59A 1EB8A 4Q4LA 2B6HA 4ZK6A 3ZE1B 5IUNC 1S2IA 2ZSUA 3X44A 3ISTA 5JO9A 4BYGA 2CV1A 4BO3A 3RG2A 4Q9HA 2BDTA 4QAJA 3H16A 4MROA 1NVKA 5DISB 4UQLA 3ICCA 3B3GA 2NVUA 1GTRA 2ETXA 3IE2A 4GGOA 4MIKA 3GFVA 1SHTX 2Q29A 4E3ZA 4F2GA 1S2LA 4MKHA 1PS0A 1ZK1A 4M9ZA 2EXXA 2RK6A 2XW6A 2W48A 4HNQA 5G0UA 2F8SA 5BV8A 4DMFA 3FGZA 1G2PA 3FNEA 5JPDA 1RVDA 3E9ZA 4L1KA 4EPRA 4KNYA 2NU6A 3BOSA 3UMSA 3DP7A 3ZWMA 5HRAA 1IM8A 2ZI9A 3EZNA 3V9AA 1X9IA 3H9BA 4CEJB 3F3SA 4MUYA 2ZDGA 5AVXA 1TJPB 5KDLA 5HFJA 4YXWA 2XNKA 3EVNA 2BEKA 3AKCA 2R7LA 2JLAA 4PONA 3L6EA 1SVOA 2C3MA 2WPDD 4NNOA 4J03A 4XYBA 2LD4A 3IP6A 5GV7A 2VATA 1ADFA 2G8NA 3TEJA 3G2HA 3NHUA 1M74A 3ADOA 4X1OA 3AXTA 1PR1A 4MR9A 1DL5A 1P1RA 2AN5A 2VBIA 4NZZA 4V2IA 3QEMB 1T4GA 5AKEA 5AUOB 1DGQA 3Q0TA 1AN0A 1H0HA 5DGHA 2OFPA 2BUBA 3UY4A 3NJRA 1P45A 4G86A 3F5SA 3LBFA 4N0PA 3P2MA 4GMDA 2H2WA 4ZYZA 5HIAA 4V0LA 1B8NA 1US8B 1QOZA 1JIKA 5DHQA 4W9MC 1KE2A 3SJBA 2IPAB 2DSTA 3A6JA 4KXQA 3VVCA 3GJYA 1B0ZA 3ZWVA 1ZR2A 4KQWA 4CM8A 3OUUA 4IR7A 1IQUA 1I4DD 2LRHA 1PKXA 2F17A 3IAHA 4IHJB 5FI1B 2IEIA 1Q5PA 2B5WA 2VTDA 1T8PA 1RTKA 1HYBA 1GQ2A 1P2SA 4HD8A 3NIBA 4XSGA 4GUAA 4F9TA 2A5GA 4IAOA 2CHFA 2VF2A 1V25A 3MUOA 3MRXA 4NAHA 4PX3A 4CKWA 2O8EB 1PSWA 1Q91A 1HQKA 4QQ8A 5HKAA 1E9BA 2OHOA 2W6QA 3ZWNA 1YBMA 2MSCB 4BUZA 4U9UA 3C3BA 2CHUA 4BWGA 2Z98A 3T3HA 2OXCA 4Z1MD 3TNLA 1CLEA 3O1IC 3R3XA 2PUTA 2PXHA 3PJGA 4DMHA 1EX9A 4K9PA 2W93A 3W3AA 2Z43A 5K4HA 1CV2A 3ELYA 4AYXA 1W1UA 1WY7A 1Z16A 5DGIA 2QEQA 2VF8A 5GM2A 1E3JA 3EAQA 2IGTA 5BW4A 3IQGX 3VDRA 6NULA 3MJVA 4PSKA 3W2EA 2YOGA 4FGWA 3KQKA 1H2EA 1Y42X 4NCBA 2DBZA 5MGNA 4CMGA 1QTRA 4X0EA 1THZA 2JGMA 3GF4A 1X7GA 2IXGA 5KQGA 2AE2A 1K92A 2MWMA 2ZJ2A 4PHCA 1VSUA 1U8FO 3AUUA 3IXQA 2ONKA 2EF1A 4DQVA 1Q0TA 1KJQA 4BFZA 1PJLA 4WK2B 5LZ4A 2NTYC 2ZEJA 5AVQA 3EQ7A 4G1BA 3M1LA 4X41A 2FWJA 5CH3A 1ILWA 5EJ4A 4AMYA 3GDOA 3P7MA 4HCJA 3LCUA 1M2VA 4GBGA 1IHXA 2BF7A 3CJTA 4DIDA 3MBOA 4A23A 4MUJA 4L0QA 3H5AA 3WHIA 4A0RA 2PT7A 5A5DA 1DIBA 2HRDA 4AC9A 3DBIA 5LCXA 1U6IA 2R8BA 1F4LA 2Q1SA 1EUDA 2L0XA 2X1LA 4MGZR 5EPOA 1DKNA 3TM5A 4I4NA 4RD3A 4OI0A 3LY7A 5FUMA 4LOHA 4BMOB 1I2BA 1MO3A 3NP9A 3ZDAA 5KO2A 2A58A 2HSGA 3ZEIA 1DDIA 1YS2X 2Q99A 2Y1OA 4Z5XA 1I9GA 4FFVA 2K7ZA 2GR9A 1FSPA 4Y6QA 3AB8A 1ZI6A 1CJVC 5JWRA 3U3OA 3BTUA 1K4YA 2D5IA 4BNTA 5GZ6A 5IS2A 2VFAA 4JUDX 1L4EA 3T4PA 4S3MA 4P32A 2NYAA 2IH4A 3HGQA 4ZDWA 3ZWQA 1QLJA 5IVIA 1HZZA 1OIWA 5JADA 4D9MA 1JHXA 3GROA 3UAYA 1T8RA 4FN5A 4N7BA 5CCDA 4QX6A 3TOXA 5GINE 1ZY2A 2YW2A 3KQVA 4LQ4A 2NQTA 3S7TA 3N0RA 4E11A 1E1QD 4ENSA 1U2GC 3H75A 4URHA 3VR0A 3ZIAD 4UFPA 1U9CA 3PXBA 2O1XA 1KFJB 1LRKA 3T41A 1KDRA 1ZOOA 2R7MA 1KOLA 4DABA 3KPJA 2QPTA 2IOHA 4N9WA 5CLGA 3ICWA 3ER9A 1ZBQA 1RRCA 4LWOA 1RWWA 1TW3A 2FW6A 4D0RA 1LFDB 3I2KA 2HD4A 1NBMD 3K0AA 3URKA 3WGTA 1KFCB 4FIDA 4TTIA 4KFUA 4M49A 1MX1A 4BZQA 4I8XA 4W5WA 5AWFC 1KAHA 3QJ5A 3CMMA 4CHTA 4Y0NA 3VR6D 3VX4A 4XOIA 4AJ2A 4ZCRA 1VRVA 2XNSA 4HDAA 4RH0A 4JJKA 1I7QB 3N2GB 4BJHB 4F38A 2VWPA 2QPLA 3X1DA 5TC4A 1NYLA 1C3JA 3I6MA 5K0BA 2FH5B 4IGIA 1XOIA 3DMNA 4DUZB 5CCEA 1J8DA 4ZVQA 5CDSA 2E4YA 2YWFA 5EWJB 1KKMA 3V8VA 5AVYA 2HWUA 3NS7A 2B2NA 5LYJF 4WESB 1WB4A 2D0OB 3PBKA 3O8LA 3LLSA 1MQAA 4CEJA 3GXOA 4JCOA 4BE9A 4RK1A 1ZQ9A 1LPBB 4EPTA 2D3WA 4J6EA 4DANA 4JLKA 4YRDA 2QLMA 4I8DA 1W30A 4B6SA 1WXWA 2A0WA 1PZGA 1LY1A 3ESRA 1OA0A 4JBHA 4OBXA 3S28A 1P77A 4CIDA 2GEJA 1HYQA 3P9CA 2IE0A 1DMSA 3H9QA 3EODA 1DCTA 1RQRA 1UOEA 3MXOA 4CI9A 2C97A 1DJPA 2VQ3A 3IILA 5HFAA 5JY1A 3VDNB 4L07A 4U6SA 3QEMA 1VB3A 2JFGA 4IG9A 2NVBA 5EE1A 4QLBA 2HL6A 4BP3A 1IVNA 1TRHA 5C4MA 3AUKA 2EFYA 4JUAA 1DX6A 4BKOA 3CXUA 1UBOS 3FCOA 3N74A 1G66A 5E7MA 4XR4A 3T3OA 4RD4A 1US8A 5IDVA 2EX1A 1PQWA 1YT5A 2G5PA 2GZAA 2QJFA 3AY7A 3G7UA 4PX9A 3TR5A 1M34B 3H3FA 3V1MA 2X6RA 4EATA 1UP6A 4N01A 5L3SB 1X7XB 2FZ4A 4JYAB 4DR3B 4KBGA 3QP9A 4IHJA 4Q6BA 1G5FA 4IYRA 2ZJYA 1OLUB 3LNTA 4X1YB 3EXIB 4QSHA 5F12A 4DLVA 4EY4A 1PK8A 3HUEA 1TUIA 3DCJA 4HNVA 4OQFA 4PPFA 2Z30A 3IRUA 4QNMA 4PLZA 4MWGA 4URVR 1ADJA 3OIDA 2CXPA 1T0HB 4G1FA 3FVTA 2PSDA 5ER9A 3WNCA 1KNXA 5CJPA 2EKDA 1YJBA 4BS9A 5AW8A 3DV2A 3BUSA 5BNWA 2C04A 4EBFA 1VHJA 3AF6A 1FX0B 3GYGA 2JJ1A 3IP8A 1CHDA 3W7AA 2AI1A 1AA9A 4GVXA 4R0MA 3NTXA 2RBKA 3E2IA 4WA8A 5CTAA 1AK9A 1OAKA 3ZBTA 3AVQA 5KDDA 3IKJA 2H1OA 2HT6A 3SYMA 4NAVA 5DRYA 1VIYA 3ACDA 5ELXA 1NC1A 1U7UA 1ZKMA 3AUXA 3GEGA 2PX0A 3E27A 4IHKA 3R0VA 1L5NA 3WDSA 2XGSA 1W4LA 3GMTA 1U65A 4PC2A 1YU9A 3MXTA 1M10A 3PFBA 5B4UA 1CJBA 1T2EA 1XFDA 2PLRA 3UCXA 3ETEA 1RNLA 1G9TA 2CXNA 3L6RA 2ES4A 1GCGA 1JDNA 4G5XA 4U2FA 5ALSA 1G6KA 3PSAA 5EINA 1VL5A 3BTSA 4RZ3A 5AKIA 4EWLA 5KNCH 2ASEA 4BX3A 1MV8A 4UEKA 4YO8A 3A2KA 3C6YA 2JI6A 1SUAA 3AM3A 4DC9A 4G85A 4M1ZA 4PV7A 1RC8A 2AXPA 1SOUA 1L2TA 4UPEA 1EGVB 1EWVA 4JP3A 5K3AA 4B46A 4DEYA 1LS1A 4N6NA 4RA9A 1UBLS 3DT8A 5HW0A 2B35A 3RH0A 5CHYA 3C5VA 4BGUA 4AZ0B 2XE8A 4BQIA 4L4YA 2MSNA 3R9XA 1UFQA 2ZK7A 3PLNA 2WSBA 4A2WA 2XKKA 2AYZA 2VJMB 3CEMA 1OH8A 2BTQB 3GRFA 5AI5A 1SA0B 3LWDA 3SLRA 3ZCSA 2PZEA 3HVHA 3SQWA 1MX3A 5TMBA 1QMGA 4KQ1A 4R8SA 3K71B 4QGHA 4MS1B 2FPRA 4UUPA 1H2ZA 3H1PA 1G5TA 1C7RA 4F4CA 2GD0A 3VSEA 3UMYA 4LBZA 1P4AA 3T8YA 2P9JA 4MYUA 4Q05A 3B3QA 2XDYA 4QTUB 4ZVUA 1UXIA 3IQWA 2CJXA 1XVLA 4JXJA 4R16A 3JQ9C 3L2OB 2V4ZA 3OOYA 4KQFA 4TUYF 5J58A 2FPPB 1MXFA 3SAJA 3G9QA 3PIDA 1ISRA 3I4FA 5B58T 3G5TA 3B70A 1JJFA 2XADA 2I6QA 1F17A 1I4LD 1KOFA 2O4UX 1YQXA 2VJNA 2AGVA 3GRKA 5DXJA 1ULTA 4CLDA 4D79A 1WBBA 2CNNA 2WVJA 3FOAA 2A5FA 1GPUA 2INGX 4GPAA 4R68A 3CA8A 4WPGA 1AO0A 1NJ5A 2PX4A 4BGDA 2VHZA 1PK9A 4CFSA 1X6VA 4MVJG 3ENKA 3K9LA 2JIRA 3DOOA 4X3CA 5FIUA 2F6RA 3N2GA 1T43A 2ZDQA 3TFWA 3BKWA 2NSJA 2WM3A 1XCBA 1J0AA 3A4VA 5FOQA 1JLLB 1G3RA 1QSGA 1ZVVA 3ANYB 5CHEA 2WWHA 3IP9A 3PNLA 5EWJA 4B8WA 1TAUA 2ZBDA 3I01M 4LNHA 1ODJA 5M04A 3D7LA 4FKZA 4WESA 4M1YA 1KNQA 2FCRA 2WD7A 2W90A 2NUAB 2VF7A 1XTIA 4AJ4A 5FQNA 4BO5A 2F8MA 3WA6A 2Q3LA 2V3CC 3IBGA 4LDNA 4FWIB 2VQFB 4WCFB 4WFKA 1XZFA 2HDNB 5ENZA 4DJEC 5JEDA 3O8CA 2ZOSA 4KYUA 3C6ZA 1HE3A 3SR0A 1GZ3A 1AK2A 1TF7A 3ABOB 3BJMA 3N5KA 1PP4A 1YBVA 4NYIQ 3T95A 1FPQA 1RSZA 3VO2A 2ZB8A 4MUFA 4WN9B 2YRFA 3P45A 4IILA 1Z08A 1FUEA 3ECSA 3ADKA 5KJ6A 3AR2A 2PT5A 3AI1A 4LHZA 2C9YA 4MDYA 2NO9A 4MITA 2H0RA 4N5LA 5GONB 3W06A 1VG1A 3ETJA 2HZ7A 4UAJA 4LYFA 4MEJA 3RF7A 3BXXA 4XVCA 3QNUA 4K6OA 1REQB 4MRMB 1ID1A 4NZOA 1P91A 4B85A 2FEXA 2X77A 3ML1A 4F6CA 1JBEA 1U0NA 1YI8A 1EFCA 2R8YA 2ZIVB 3DYVA 3WIUA 4DSAA 4LXUA 4C0QC 3GP5A 3MFYA 1M34A 2TS1A 5I9TA 4MULA 5DI3B 1K4MA 2DWQA 3MD9A 2WZDA 4PZ9A 5L3SA 4X66B 1Z2OX 1LZLA 4QRHA 3L7DA 4WLNA 4O2AB 2GFIA 2F9MA 1OLUA 1PTKA 2ROQA 3DHVA 3EXIA 4TRNA 3CH4B 4X1YA 5TQ2B 1J2TA 1OI7A 4CCSA 1F6DA 8OHMA 1HRKA 3PR1A 2QRUA 3I42A 4L3WA 4NEGA 1SUDA 3P20A 1DX4A 1CP2A 2GNAA 2CNKA 4G5GA 4WNYA 1HL3A 2ZJ5A 2BM0A 3H0EA 1AQLA 1FUIA 4M99A 3UWPA 1DKMA 4AY5A 1EVKA 3FZNA 3ZVRA 3FOZA 2QRPA 3B2QA 4URUR 821PA 1FX0A 4BNLA 1TL7C 3D3WA 3W1EA 5JT1A 1KK2A 2IP4A 4PO8A 1SOWA 4J7UA 1VIMA 3TM4A 1YKSA 4P38A 2FF5A 1ZGAA 1JWLA 2YDYA 4GG1A 4G81A 4YAJA 2ICAA 4FJ0A 4J49A 2LVBA 2G71A 2PMDA 3IQFA 4X8HA 2C4NA 2J5BA 3SSAA 2Q4BA 5ALDA 1WOYA 2PMBA 1WE2A 3KOOA 2QUAA 1QAMA 2Q3EA 2BZGA 1WXIA 3R0JA 1XZCA 3B52X 4HI0E 5JVDA 1ZM3A 4PE5B 3G1UA 2PRZA 2FSPA 2GZHA 4YDSA 4NF2A 4Z9BA 2C96A 5LVAA 2HMYB 1OXXK 3UMRA 1T2VA 1UJBA 2PX3A 2E9SA 2QYTA 2X19A 3KJEA 1P1JA 1DHRA 3GLSA 4KRGA 4KACA 2XR1A 1F2DA 1VCOA 1W34A 3OFSA 1GKLA 2FWRA 2I62A 1UBKS 3NV7A 3OE5A 1H3FA 1YFZA 3S7ZA 1X94A 3AM5A 3FLMA 2XGOA 5EVJA 4KNVA 3QFRA 4P3KA 3TNYA 1H1TA 1EDBA 2DP4E 2VXBA 1CQZA 4ZVMA 3R0ZA 2X0EA 3MILA 1RR6A 2FB9A 1TADA 4BNHA 2QI9F 2A8YA 4EZEA 3GRYA 3BL6A 3PRKE 1Y7HA 3ENVA 4K6KA 4NV1A 3SR3A 3WKDA 4RTNA 2BTQA 2JATA 1AXEA 1SA0A 3Q9LA 3HY3A 1STOA 4J29A 4BO6A 2J6IA 4R83A 4DV3B 3K9GA 2FGJA 2Q6TA 5GPBA 2FYTA 2F1RA 2AX3A 3EQ2A 3DCIA 2FSGA 5DBEX 2YS6A 4PNZA 3WB0A 3AMVA 4BFUA 4CBVA 5G0VA 1Y6JA 1OXUA 1SWWA 2BBOA 1UM8A 1ZSYA 2NYRA 2W2KA 4RU1A 1TZJA 1VHDA 3B1ZA 4P3OA 5EWLB 2IHBA 1AZTA 4IHQA 4C5BA 1AV6A 3BDIA 4C04A 3LW8A 4LC9A 1X8JA 4HK4A 3RADC 3TN7A 2JJMA 3R7SA 1H8EA 4YRIA 4KXYA 1EBFA 5EJAA 4B4VA 1WO8A 2GT1A 3AJAA 4A2QA 1GZ5A 2AB0A 2FPPA 1PLKA 2VCHA 3DP9A 2G5TA 1O6FA 4FI3C 4DSNA 7GPBA 5HZGA 2Z83A 1T5DX 3EVBA 5A05A 1VPWA 3IV6A 3HRHA 4J07A 4RIIA 2P7HA 3FSJX 4C0WA 1PGNA 3B7GA 3KZKA 4J1TA 2IS1A 3I12A 4AF8A 1T1EA 4BNYA 1Z2DA 2XWPA 4Z86A 1KU6A 2IZOA 3AEZA 4GBED 4K28A 4R51A 3SEFA 5A4DA 2JVJA 5DI9A 1IBSA 3SXUB 3ITEA 2FMXA 2GJ4A 3BXPA 3CNBA 1FY2A 5CM2Z 5GM1A 3RV3A 4HS9A 4UM5A 3KQHA 2GPSA 3OZSA 1KP9A 5B1YA 4RTMA 2Z6UA 1UXJA 1JLLA 4YYEA 2D7DA 1N0VC 2Z0MA 1Q6ZA 3H84A 3WGZA 5JJCA 2FG6C 2KQUA 2R6DA 3ZC3A 1NQAO 1SD1A 1SHLA 4B48A 3IVRA 4K87A 1TT5A 1NVVQ 5JYCA 2NUAA 2ZQ5A 5ALEA 1YA4A 4WADA 5GIOE 1L5RA 1UAGA 3PUJA 4C6TB 5BN5A 4MW1A 5EIXA 4G5SA 3TVDA 1AUVA 1L8QA 2NSDA 2HK9A 3C3MA 2PRIA 5AP9A 1M0TA 4IDCA 5EP4A 4KVFA 1JHRA 5JAQA 4JVLA 5TRTA 4X95A 1YVPA 3DV9A 4NBNA 1JWBB 3JRWA 1Z2NX 1JR2A 3V33A 2WIBA 3AJ9A 3HB0A 3HFRA 4OXIA 4C0XA 4F86A 5B3LA 2G80A 2HRBA 4M53A 3VR2D 5GONA 2P35A 2IDZA 4MK4A 3GW8A 4ZRNA 5E4JA 4NJEB 4P54A 3LQKA 1RIIA 3LUHA 4MLPA 4MRMA 1Z4PX 1REQA 1L7PA 1XVUA 3DVAA 4CG2A 2XCTB 3PHJA 4BL5A 2G6TA 4LPSA 1RYDA 2R7KA 1YJCA 2ODEA 4N40A 5DI3A 5TR9A 5WRFA 4OXXA 1L5ZA 2F7SA 2XHEA 2ZB3A 3U2QA 4ER6A 3DMHA 2QAJA 3ZCPA 3E5HA 4RVOA 4WUVA 1ZUD1 4O2AA 3SKVA 1X8LA 1ZM4A 3LQQA 1KVRA 2A94A 2P6UA 3IB6A 3NR2A 4Q3BA 1E3MA 4EA9A 2QMUA 5K3CA 1WB6A 3E3LA 3TCNA 5AVRA 3N3AC 1M2KA 4ZAWA 3K70C 5F5NA 3CTPA 4BAUA 1CUCA 2CZQA 3F7MA 4RCYA 1LI5A 1PNVA 4JV5B 1LRJA 2DUMA 2IPLA 4A2PA 4FZRA 2GARA 2OHJA 3GPBA 4EZIA 5JYEA 3WYAA 5BYJA 2XQKA 3R3VA 1IXZA 4FK8A 4EW2A 4GZ3A 4UE2A 5F23A 4II3A 1P44A 1Z2CA 5F73A 2CFRA 3H1GA 3PNYA 2RGXA 4NPAA 2A9PA 6ADHA 4R5HA 4YWHA 4IMJB 1TQ4A 1QRAA 9GPBA 3OEWA 2ERCA 1X1RA 3TGLA 3O3MB 4CLXA 5LLTA 4BQQA 4TTPA 1CB7A 1ZSNA 4FFNA 4X24A 2F67A 3TLAA 6PFKA 5CEEA 3MQFA 3SF8B 3U4DA 1QRTA 2P9EA 1KC1A 3BWDD 1Z07A 1XTUA 2CMHA 1XF1A 4AURA 3G5LA 5I9LA 2E4WA 2BC9A 3HJNA 2Q4RA 3BPSA 1QO9A 5DF1A 2ZANA 3FNRA 4R1MA 3E3MA 5B37A 2B8WA 2G36A 1VHQA 3IEKA 4RVUA 3CHYA 1QDUA 1E6WA 5DM60 1RLOA 4IUYA 5E0KB 4RY8A 3JZAA 2G83A 2WP0A 4QYXA 1Z7GA 3K8OE 1EFUA 3GT3A 4BVBA 2BP7B 4N7RA 3DWIA 3QU7A 1W9MA 3ECAA 3M6XA 2ZWVA 2TECE 3L0SA 4QUHA 4LMPA 3UBMA 3IUNA 2BGIA 3KLOA 3SP1A 4ESOA 3GIDA 2R0QC 4JEIA 5IANA 1BS1A 3C3CA 3DPIA 2O50A 5J4YA 1W4RA 3QUCA 3HB4X 4TRJA 3PUXA 3ZJYA 1Q2UA 4NCAA 1TDJA 3ZG6A 5DLDA 1NTOA 4JBLA 4MHSA 2JK1A 5DRTA 5IDQA 3U4HA 2IY7A 2V8BA 4MWSA 2AJBA 2VXOA 4D9KA 5LMUB 1C9KA 5K9ZA 3WLKX 3V4RA 2V7BA 4QFBA 4YRKA 1XJ0A 2H1LA 2PX8A 2EW2A 3GQVA 1C9JA 5D84A 5EWLA 4XSHA 4DB4A 1E62A 3LI2A 4YJ3B 3D8SA 4B3JA 5B64A 1H2RS 4QEKA 3HXMA 1KOGA 1P72A 1COWA 3I30X 1BTOA 5DW0A 5CCBA 1CUGA 1IY1A 4ZO7A 4EJSB 4YAUA 4D9EA 5CG1A 3I3SR 4K9RA 4KKVA 3SEQA 1X38A 1WPXA 3FCAA 5C34B 3TMAA 3VHRA 4OGGA 2QVXX 3T94A 2QUHA 1IN1A 5AVTA 1UJ5A 4BWVA 3JASB 4FFWA 2WICA 2XQFA 3UV6A 3SIPA 4DZRA 5E3JA 3THWB 2ORWA 4X84A 5CH8A 2AQKA 1B4DA 2C5HA 3RK0A 3SIXA 1G1MA 3ZGOA 2JF0A 2GYYA 1B1CA 1SCUB 4HQ6A 1M2WA 4PYMA 3ND5A 3SXUA 4BN0A 3SEZA 4HLCA 3IT2A 1YKFA 1PFVA 4OBWA 2UZ1A 3UB4A 1XNQB 1FTNA 3DDHA 3IPAA 2HXGA 4OMCA 1Q1EA 4DVJA 3I92A 4B34A 3ISVA 4LVUA 2JJ8A 3H1BA 3LBNA 4NCIA 5KMGB 1Z4LA 2G17A 4Z4HA 3KV1A 5KHAA 4BGIA 3O8OB 5IZCC 5FV4A 3L7NA 4GI5A 1T5IA 3G8YA 2W6JA 3T3DA 4UU8A 4AXXA 1U3DA 3REGA 3Q12A 4C6TA 1J1UA 4OSEA 1ADGA 3DOUA 3BWEA 1OFTA 1QH1B 1VLHA 3BEDA 3GUYA 4IGAA 1DINA 4LHWA 1O2DA 3FSEA 1BWPA 1CY0A 1JDBB 1N57A 2X6QA 3GLRA 5LC1A 5F7ZA 4B3XA 1GQSA 4ZYTA 5A0TA 1SG6A 2V58A 4UDOA 1A5SB 3WKCA 2V6MA 1QCYA 1ST3A 2XTMA 3UT5B 5SY9A 2R7AA 4II2A 1QIIA 1P8JA 4M1EA 3GFQA 1T4MA 3OOSA 3PCXA 2FPIB 4ND2A 4CDRA 1BMFD 2P4UA 1OZHA 1RKBA 1GKKA 1Z8HA 2JCBA 4MVJA 4NJEA 4A0GA 4QNNA 4RMJA 4XIJA 1UDWA 3CLRC 1PL7A 3H04A 1NRWA 1XD2A 5BWNA 2MSLA 4BVAA 4PM4A 4WLFA 3F5FA 5K0ZA 1J0BA 3L8HA 4N7JA 1Z33A 4OKNA 4ZQIA 3V4FA 2B4QA 4CG1A 1QYXA 5EJ9A 4DUGD 3OJFA 1H2WA 1M72A 3L43A 3S3TA 4EW6A 1XZMA 2R5WA 3CIOA 5KTNA 4ZU3A 1XJCA 4OB7A 4PPNA 3RUPA 3PD0A 3L8YA 2X0JA 3I6YA 1RYHA 3DKVA 1VIVA 4AZWA 7ABPA 4Y1RB 2IH2A 1GD1O 1W73A 3DMRA 4PRLA 1OC2A 2BMDA 1ZJWA 3EISA 2RONA 3EMVA 2I3DA 5AW4A 5E95A 1NV9A 2FW8A 3OWOA 3U56A 3JRNA 2Z95A 3U7RA 3AR5A 2XIQA 4E2ZA 1QRUA 1QE3A 3STVA 2VH5R 5AHWA 5ALXA 3CEAA 2FK7A 2BKXA 3K35A 5EXSA 5C8YF 3WV4A 2C0CA 1Q1AA 5F9HA 3QXXA 5L4SA 1P19A 1GTL1 1VECA 2VPYA 5AJZA 3UAWA 3CX7A 5ALLA 5CIWA 4LQLA 4PSUA 1RYBA 3EPLA 5K0EA 3VU0A 4Y6GB 3ENZA 4MUBA 4G4IA 4CMHA 2BM9A 3EZGA 3N9IA 3OTOB 3NNDA 4KP7A 5IWAB 2A0KA 1FNSA 2I99A 3D6MA 1RI2A 4NWIA 2R6GA 2WFZA 1RCFA 1RJWA 2Z4TA 3HUFA 5K20A 3R9IA 2ZBVA 5EP2A 4D0LB 1GIAA 3D8BA 4OHFA 2L42A 2OQRA 3RUFA 2GS9A 3A4IA 3F71A 5EN4A 5IAGA 2BMVA 1D7OA 2BP7A 3ETGA 4L5AA 4CM9D 1H65A 1WZUA 3KALA 3OQJA 4V1CA 2Q2QA 1IN7A 3ZDDA 2Z5GA 4URZR 4RTQA 3I9OA 4NARA 4BCBA 3HSYA 4NSNA 2PUGA 3D8HA 4BVKA 1VSTA 4HDKB 1T1JA 2G3YA 2QPAA 5DZSA 4ZTUB 1GCUA 2D1RA 1FFDA 2MSEB 3U6KA 2RGRA 4U63A 4CG0A 4KVZA 3FMPB 3OAAA 3I5XA 3S29A 3LHKA 3RQIA 4POOA 3U3ZA 4CCYA 1U7HA 2QGFA 5DHFA 1CVLA 1U5BA 4JDUA 2YMMA 4D26A 1U8AA 4CNBA 1EIZA 5JQGA 2Q6VA 4KH0A 5IK2A 5AW0A 1ZA1A 4RHCA 1N6NA 1N2JA 3LX8A 3ESCA 4QDUA 5CH5A 1NF8A 3NKVA 1PYOA 4JLBA 2M6LA 4CT0A 1S6YA 4YJ3A 5CG2A 3BJRA 2DFDA 3TAHA 3WRYA 1CJTC 3GUZA 1AKRA 3GAMA 1TJ3A 1W5FA 3VZDA 2EKQA 1MEJA 2AUNA 4C6HA 2QIOA 4DA7A 3QUAA 4G1CA 1WUJS 4EJSA 4HQOA 4PG7A 4YO7A 2AJTA 3UAXA 1QYRA 4CDMA 2B4TO 3BGIA 1GGHA 2E6UX 2FW7A 1SC4A 1Y1KE 3HWX1 1H9BA 3IDQA 3RWOA 2EJVA 1P7WA 2BHSA 4R4JA 1PEAA 2EWMA 2CLDX 3CU5A 1RJDA 3TZQA 4Y2PA 1ZCAA 1QZZA 1ND5A 1F2UB 3DHEA 3JASA 4QUIA 3IEMA 4KOAA 2RHTA 3FMIA 5HA5A 3W6ZA 2HIAA 2OCKA 3THWA 1JAYA 5FOVA 2A86A 5EMMA 4Q4JB 1NP6A 1Z6QA 4F5WA 4NQZA 1SCUA 1BHSA 1VSBA 2AZDA 2VDMB 4PFJA 4CM1A 4D74A 4ENUA 1FQJA 3A6LA 4AWBA 2X15A 2ZRPA 3C7KA 2Q4EA 3QYAA 4GI2A 1NYTA 4F3NA 2FPKA 5JJBA 2ZTVA 3T3IA 3QVTA 1DKUA 3TIXB 1HC7A 621PA 5KQLA 5LP1A 2H7XA 4Z4GA 3HVUA 3AIMA 2HEGA 3I5MA 2W2LD 2HF2A 2GHIA 3HG7A 4GOOD 1G5HA 5AUQA 3QTBA 2PT6A 4Z7JA 4DQDA 3O8OA 4J8PA 1KA9H 2XB9A 2WSSA 5AVOA 4M7PA 4E30A 1GNPA 3ZVLA 1SPBS 4YQYA 5JCJA 3TI7A 1CUJA 3FUUA 4HXYA 4HMQA 3SYTA 1QH1A 1DARA 3TRKA 1ABFA 1S89A 2JH9A 2Q1XA 2VPIA 3D54D 3FDXA 1XJWA 4L4XA 3G2MA 3MRSA 1LBSA 1X2BA 3A9TA 2QRGA 3E22B 5BSRA 3WFIA 2I54A 1OW3B 2AMLA 3E5NA 3FOCA 4RM3A 2J3LA 3AJ8A 4TTAA 3U4CA 2HWWA 1ZOSA 1NI4A 3UT5A 3WSVA 3FVRA 4DE5A 2FPIA 5FUBA 1F38A 2VUIB 1ZNYA 3DFZA 4H17A 4D6XA 5AXBA 4EGFA 1LNQA 5CNIA 2C8KA 2JD0A 2CCKA 3HP4A 2BM1A 3DEHA 5IASA 3VKHA 3A6KA 4F1JA 1GTSA 1KP3A 5DCYA 4F60A 2GEFA 3CS3A 1H5NA 3COYA 4FD3A 2CFIA 5I7HA 4K88A 3DF9A 5ES3A 5DH9A 1SVUA 1SQFA 4DLNA 2QF7A 4IMRA 3ORFA 2VYVA 2IZ7A 1VZ3A 2WD8A 4H3SA 4Y2SA 1FRQA 5HXAA 1O0BA 4MQBA 3QKUA 3F49S 1HSZA 2HJGA 2XBUA 2ZWAA 1MP0A 2KS6A 2Y68A 1TK9A 4I6GA 2DH6A 4Y1RA 2HPAA 1P2FA 3QXGA 4ARZA 4BDTA 2AN9A 4TYWA 1ZL2A 1V8PA 5AHOA 3MWDB 2B2CA 2SECE 4L73A 3A27A 3CUUA 4G1EB 5FLYA 3LO8A 1RWNA 3C87A 2BELA 4NFSA 4LF5B 1SCJA 3A4LA 4F2WA 1AKEA 1Z0UA 1T2AA 2X5XA 4N82A 5JD3A 4LK2A 1R8YA 4HOYA 2Z56A 3EIEA 4ZJPA 4WXHA 5IVKA 1U28C 3HWSA 5GJWC 1FP7A 3DE6X 3NJ4A 2ZSBA 2PCJA 1PU2A 3L1KA 4DNXA 3UJNA 4AIIA 1RWVA 7AT1A 4BQSA 3MJEA 1FNBA 2J3HA 3CVXA 2XNCA 1PL6A 1DG1G 2A0FA 2ONCA 3K0CA 1C9NA 1GSIA 2JGJA 3ISJA 2X8JA 4QSMA 1ESEA 5FL7A 4X8LA 3UW3A 4DF3A 4LSZA 1DXHA 1U0LA 3F5DA 4UHEA 5J40A 3T7SA 3FJ1A 3JWHA 3C5CA 1G8FA 5AKKA 1ZC3A 2XSZA 3FZYA 2Z08A 3B8HA 3BREA 3LGAA 3R7BA 1PJTA 3T4EA 2IIPA 1O95A 1G20E 3H0CA 2EBHX 4RHFA 1Z6YA 3NC0C 1B8OA 3C3EA 4YCDA 1O0SA 5AO9A 2JFPA 5EQFA 1R0SA 3DTVA 3UAOA 1GG2A 4LG1A 4NICA 4ZN6A 3MVEA 1C0LA 3HZRA 4KFSA 5T6BA 4FT4A 1SCQA 3BH0A 5KJ1A 1ECFA 3ESQA 2YCLA 2TYSB 3LOUA 4HB2A 2JG3A 4HRXA 1E7QA 3S40A 3H8JA 4JP8A 4YC7A 3RSGA 4WSOA 4ZPJA 1DJQA 3SMVA 2JBAB 5CYPA 4CHGA 4E1VA 5M34A 3E1KA 1ILEA 2PUEA 1XROA 5CW2A 3SCZA 3NOVA 1F60A 2A14A 4HDKA 3BEOA 1XA3A 3KXPA 4JJFA 3V4ZA 2M1ZA 2JLZA 1O0CA 3HTXA 1RCUA 1TTPB 3PG5A 5AJYA 1FW8A 4W1SA 3AHGA 1FDSA 1BCRB 4UU7A 2JEYA 4MV4A 1JF8A 2NGRA 3QU4A 2JFWA 2O8CB 1O4VA 2P1RA 5AMXA 4GX5A 3WISA 2VO1A 2O52A 4U7PB 4DN6A 3TW8B 2D2VA 2O6LA 2A6PA 4QJ4A 3HEAA 3QPWA 1JECA 4E22A 2WTMA 2JAUA 4YQEA 1JDPA 3ZUGA 3PNVA 2CHVA 1EMDA 2P5YA 3VZCA 4EAAA 4YXWD 4LJYA 4BUCA 3K15A 1QORA 2MSWA 4Q3AA 5TPWB 2PANA 1E99A 2GETA 3RHZA 5C1BA 4AI6A 1JPJA 5BQFA 3O8DA 3AILA 3G1WA 3I9LA 3L01A 3D7MA 3PFCA 3QQ5A 4EB3A 5KTSA 3U37A 4RQBA 3UH1A 4ZOCA 5I5EA 3D7KA 2GCGA 2YUIA 2WZBA 4NBRA 4P53A 4UUQA 3WDMA 1T6BY 1NFRA 2ARKA 2Q3FA 3MINB 4PVDA 4OV6B 2VZLA 4MWTA 1UP4A 1F2UA 2RKWA 4FP9A 3FPHA 2YXEA 3ZEAA 2ATVA 3AVVA 1PSZA 4ZC8A 1DEOA 1JAIA 2JGKA 1VOTA 1AHIA 1JQDA 3BL5A 4Q4JA 4D9GA 3UJ9A 1M7HA 2BKAA 5FOXA 3PJFA 1N6PA 1UEIA 4PQEA 4B45A 1HLFA 2CJFA 1XEXB 3S2EA 2OXEA 4OP2A 1KTIA 3GOQA 2AEEA 3AFOA 3BIOA 4FI3F 1XTKA 1YI1A 2CWDA 1B23P 3HA3A 1JDJA 4H4EA 5EIWA 1F2VA 4LZAA 2Y4OA 2G1KA 1YDGA 2CNWA 3E7FA 3M34A 4ZKEA 1O3YA 4OQMA 3TRFA 1NLMA 3GOHA 1SURA 1J6UA 5DYIA 2ZR9A 3UO8B 1QG0A 2EIXA 2FPMA 1BQ4A 1JEJA 3N7UA 3GLGE 1CRWG 2MINB 3G2IA 1UQTA 2GERA 4XCXA 3OJCA 4RVDA 2EZ9A 1H23A 3DT6A 3U13A 3CB4A 1S96A 3LZDA 1E0JA 2H2GA 1L5KA 2CHGA 2OGZA 1V3QE 3AHEA 2QNIA 3DLBA 1D4FA 3ONEA 4GMFA 1FMCA 4MCAA 3W3AD 5E7QA 1R2QA 1KSJA 1QHGA 2BZ1A 5HMLA 5BT8A 4GM0A 3AW9A 2PAAA 3NU1A 4ZQEA 4ZV9A 1U11A 2ZSDA 2WY2D 3W8NA 4YUVA 3SFZA 4QGFA 2HMAA 1ZCJA 4WASA 1L4MA 1J42A 3TQOA 2VDOB 4MLZA 2JI4A 3K6KA 1EEHA 1IUPA 2I4LA 3IYLW 2GSWA 3MMZA 1LK5A 1P61B 2H4HA 4IEIA 3TD6A 4RTSA 1OX5A 1AVTA 2E4VA 2G0AA 4HVAA 1OAOA 1YZUA 2YH2A 1G3MA 1A7JA 1TYAE 2NVWA 3VSDA 5A2QA 3V7WA 2QMHA 1LI4A 4IIJF 4RPJA 1ZH2A 1FRVA 2F43B 4QYWA 3NGMA 1JA9A 2PV7A 4WKNA 5H4HA 4RKWA 1SVIA 1E9SA 1DDOA 1PTJA 1SVSA 2GJ9A 2P65A 3MWDA 1ULUA 2XMSA 4BWYA 2FGKA 5SZJA 5J47A 3NRBA 3E7XA 4MQLA 3QBEA 1O6CA 5LOVA 1E1DA 5I6DA 4QNRA 1QUEA 2GI4A 3BD9A 3HADA 1XP5A 2IPXA 2EERA 2NZVG 3PWKA 4IOKA 3EQ6A 1NQUA 3IMEA 1A2OA 1FSGA 3N8GA 4NZMA 2WJVA 3AX6A 3EA5A 2G08A 3IJEB 1EHYA 5CVUA 5FTMA 2QTWB 8GPBA 3QKRB 1XPOA 2RGCA 4O1MA 1TVEA 4BFLA 2XZDA 1IN8A 4W99A 2BDEA 4KHPB 3RGWS 3DOJA 2MMGA 5JZMA 1WS6A 1RZRA 1UJMA 1GL6A 5AFSA 1SQ0A 1WWKA 5G41A 4B4OA 4QELA 3ZQJA 5UKDA 2Q0HA 3ZWAA 3JQAB 4MI1A 2X5JO 4R1TA 2CNLA 2HK7A 4Y8VA 3KJQA 2W6NA 1L7QA 3KLMX 5HE8A 1ATIA 1Q0HA 2VRCA 2PWAA 4PIVA 1L5SA 1TJYA 1Y1SA 2QVBA 1SXJC 2I3AA 4KN9S 3ZWKA 1E1CB 3SYKA 1U0EA 2KBFA 4EHBA 1EGQA 4Q0MA 1GSAA 2QENA 2EKLA 1GPYA 3R3WA 1DG9A 1J9GA 2YY7A 5HPYB 2EP8A 4MW2A 1NJ8A 4TSKA 1P7PA 3GMIA 2JBAA 3E7PA 3PE6A 1W581 5EHIA 2G7MC 2X1VA 5LOVB 4D25A 5LBTA 1Y7IA 2HF7A 3NG1A 2GAAA 5J5VA 1U5AA 3G5AA 5BPHA 4UFNA 1U7WA 4BFYA 4D1YA 1YE5A 4N1AA 2VI5A 4Z3KA 2RJ3A 5HYVA 1U9JA 1UK8A 3WRYC 2GF2A 1BCRA 4CTKA 3RKSA 1ZO8A 2O8CA 1CYDA 2XVYA 3UFBA 5AVKA 4MR8B 3TW8A 1OOEA 2O2CA 4FN4A 1MCZA 2CYCA 1YQDA 5TF4A 1C3LA 1NW5A 1R9GA 2KI5A 3DAOA 1GZVA 1P81A 1YJAA 3KT8A 3VR4A 1QVRA 4OHKA 1EAMA 3KPVA 3QWHA 5A9SB 1KS2A 2EARA 2ORIA 3A0RB 4LRXA 2LR0A 3ROGA 3VNUA 2YZ7A 4QHTA 2GGSA 5TPWA 2A35A 1IHOA 4MPDA 3RVBA 3S2UA 2J6HA 2GBIA 4HNRA 1PL8A 4NE7A 2FRVA 2VDQB 5EJ7A 2Q5JA 2C9BA 2Q9AA 3LUAA 1DJLA 3IQDB 1GAXA 1W2GA 1PV1A 3Q8KA 1HT0A 3IAFA 3MINA 4H15A 2IH5A 4TWIA 2DCUA 4GP9A 2GZ1A 2G4VA 2AI2A 4D3FA 2ZTLA 4EZBA 1L4KA 3IGFA 1E9EA 1N1EA 3AUAA 2DHQA 3IURA 4IRMA 1HOXA 4UMEA 3TTWA 3W1VA 3WK5A 4RADA 3F7TA 1JH9A 4B0PA 2B8TA 3RIHA 2N42A 1PGJA 1FVXA 2H3HA 3L1HA 1O57A 4YP0A 1JB9A 1Z62A 2P11A 3I1JA 3O4FA 3Q8LA 2BPOA 1VHTA 3A1NA 1OI4A 5DCLA 5DM70 1SBIA 3HVIA 4RD6A 3F1KA 4YALA 2J3KA 4L8WB 5AJTA 2WUEA 3H4IA 4YRRA 5B5SA 4QBIA 3I5AA 5G4KA 1WUYA 1S1MA 4NVRA 2VP3A 2V7EA 3JPYA 4MOWA 3SC3A 4MW5A 2O2JA 1PS9A 4QE3A 1NBWB 3Q6NA 1CZNA 2MINA 2V6BA 5IKXA 1CQXA 3GLIB 1N5MA 2AN3A 1UXHA 2P3SA 2O57A 3FDZB 4IY1A 4OGKA 4MVCA 4ZCPA 3FDJA 4AM8A 3BQNB 2YC2C 3K7EA 4I1RA 1MO5A 2H63A 3QU2A 4RPIA 5F5XA 3WL3A 3UOAB 4DDVA 2JJ1D 2MSDB 3K70D 2P27A 3A1EA 1GILA 4Z51A 3E7WA 1O5OA 5BPFA 2QLLA 2X9QA 3MTIA 3UC9A 4BQOA 4XFKA 3NHZA 1KARA 5F9FA 1LXCA 1KEVA 1TUBA 4HVTA 5I4CA 3AUYA 3NHRA 1JMKC 4OUKX 4TWRA 1NXSA 5DM2A 4JI0B 1E2QA 2IYEA 4OM7A 2PXAA 3CH6A 2YWDA 2B4RO 2RCNA 4LZJA 2WVAA 4WKGA 3STUA 2UYHA 3R76A 3VKVA 2G8LA 1AHPA 1RFLA 5A3QA 5C35A 5JH7F 4UAVA 2Z6VA 4QHSA 1JW9B 5F9MA 5T67A 1B8UA 4K1LA 3INYA 1U2DA 3G9TA 1TZCA 2J87A 1WMAA 2X14A 3PZBA 3T7JA 4YRNA 3SQXA 4OQZA 5TEVA 4W8HA 1YOBA 3C1TA 2GZ3A 5A4MS 1WIWA 2F43A 5BSUA 4BRSA 1DCKA 3N2EA 4WNIA 3KKZA 1V7PC 4BNKA 1W19A 5K6AA 1UQUA 4PC6A 2WYUA 5JHGB 1FA9A 1Z4MA 3MW8A 1F4PA 2ODBA 1ZJ5A 1G19A 2QL9A 1NR1A 3A14A 1PS8A 3OX4A 4IIXA 2A1TR 3H4TA 3K0CC 5DLPA 2CVFA 2PXCA 3TJMA 1T5LA 4E31A 4HDMB 4MQFB 4WLUA 3DO8A 2BUCA 2IQIA 3ZI7A 3WLJA 2J4FA 3IT0A 2BFMA 1GTZA 3OKAA 4GLOA 4UBLA 5COAA 4Q9AA 1UMDB 5LA6F 3N6XA 1S3GA 3GMDA 3O4RA 4R9NA 4W5OA 3LY5A 1NI3A 2I4OA 4LGCA 3LLCA 4WZAE 3RSCA 1JR6A 4EJMA 1GM5A 2DPHA 2IYQA 2CXOA 4DQLA 5B4TA 1YRBA 3NYIA 3BX1A 2WLTA 1CF4A 3OHSX 4C20A 4H27A 3NTVA 2WPNA 1KZ1A 3BGWA 1U0TA 1WEHA 1NX9A 3JQAA 4WJKB 5I47A 5K03A 1UBTS 3GLFE 1DO8A 2RI1A 5THKA 1JT9A 1RYEA 5FNVA 3PGKA 5PGMA 5CVDA 3V2UA 4C3VA 4Z4CA 5JATA 1B3RA 5ARBA 4ALNA 1BIFA 2I8CA 3BERA 3X2EA 1VIAA 3Q72A 4KMSA 2Y8EA 4INAA 4U6QA 1W5SA 4XM1A 5AESA 4MKFA 1X7ZB 4LFCB 4EQ6B 1U8ZA 5JCZA 1CQJB 1DUVG 2VJDA 3NX4A 3VH3A 1NYRA 3E0XA 3JQGB 4I08A 4N8DA 4V0ME 4YFVA 2DWCA 4B3DA 4DA0A 2R8RA 1L8AA 1ODCA 2ZE5A 2R8OA 2EEZA 1MVNA 4G8JA 4J7XA 3V8EA 1GY8A 4L3VA 2AWOA 4D9BA 1AURA 1EWYA 3CFYA 2OV8A 2PE5A 3DONA 4TRMA 3DE5X 5FAKA 2I65A 5EMKA 5ELLA 4C4ZA 1HQCA 2GHRA 2UVPB 3J81k 2CSXA 3DHWC 4BTLA 2CKDA 4MR8A 1NHGA 1Q74A 3F3YA 3KJFA 3L6BA 1V37A 1QV9A 3A0UA 2YDXA 2OLEA 1KEUA 2HBZA 4R2WA 1RS0A 3B82A 4MW6A 3SOZA 3W4IA 2HR1A 1Z2AA 4UAUA 5U9CA 3KIPA 1EG2A 1S0UA 2UVDA 1FB5A 1QK3A 3WKAA 4TVSA 5JCOC 1ZISA 1Q22A 1QYVA 3E23A 5C53B 2GK6A 5IYZB 3AETB 4YWJA 1NONA 4FR0A 2ENUA 3OTIA 1KHTA 1CRZA 2PBZA 3AFHA 3IO5A 1XNHA 3R3YA 4G0XA 4HGQA 4OHOA 1EUCB 2JFXA 2OGSA 2OVBA 3QBDA 4W63A 4RFLA 1X77A 5CAEB 2EP7A 2H3EA 3JQDA 3R5JA 2Q62A 1ESCA 3GNSA 1ZEMA 2R47A 3X1WA 2X5KO 3N39C 2ID4A 2WYVA 4MYTA 2IV7A 3KQPA 1YRAA 3I83A 3M70A 5IJ9B 4M7RA 4TMZA 1JI3A 4WKCA 16PKA 1DZ3A 3P9IA 2IPMA 3DL2A 1B6RA 1VIDA 5JANA 1ZINA 2MIIA 2WKQA 4AK9A 3SFVA 3DF7A 2PZGA 1L6IA 3NT4A 2IKQA 4B44A 5LQUA 2DG2A 4JB0A 3K2EA 2VHCA 1BNCA 1TQ6A 5J2TB 1ZOIA 4NP6A 3FMOB 4ENWA 1KAOA 3Q10A 2XNHA 2XYHA 2EG9A 5BWLA 2HC9A 3WO0A 3VZRA 5JNLA 5TF0A 2CCGA 5HJ7A 3N0WA 1UK7A 3O83A 4FYWA 1P4RA 1Z28A 4R3NA 2Q2VA 3I9NA 4PSVA 4J43A 4OJKA 2B98A 4XQCA 3RUDA 4ARCA 1E9FA 1VYHA 3V8NA 3WADA 1N9KA 2R1UA 4JQSA 1AT1A 4HQRA 1C7FA 3JQPA 3KCQA 1CYEA 5REQB 2IZ0A 4G4SO 3SQOA 5A6SA 3DBVO 1OAOC 3GBPA 4H59A 4Q7EA 3QVWA 1XAGA 3RUIA 4K03A 4IDBA 4P08A 3WLEA 4JVMA 4QBHA 1WULS 1X42A 4M8NE 2WUWE 3I64A 4KQEA 3M2TA 1Z5ZA 3CLHA 4JSRA 1EP3B 1PTJC 1RCTE 2ZS9A 2ZXEA 2V97A 5IAOA 3PTAA 2A1UB 3SHQA 3BMOB 1G1AA 1K86A 2OB1A 3DO6A 3NM6B 4FMBB 2IY9A 3D6VA 4QREA 1PBTA 1W5EA 1E92A 3SYRA 3RC7A 2W11A 1PBNA 4KLAA 4G23A 1E63A 2ZUUA 5IHXA 4FEAA 2WUDA 5MN5A 4V0QA 4IDHA 5D51S 3QPCA 5DX1A 4YHHB 4L5YA 6Q21A 4YR9A 1DT3A 3FPFA 4KYVA 4LWPA 4DRXA 4PCVA 3PXAA 3I8OA 1QOQB 3IUSA 4HDMA 1OGJA 4MQFA 4C3ZA 5DB4A 1E3WB 1G6Q1 4MPTA 5C5IA 3KB1A 1UZNA 4RMIA 4B8YA 2JB9A 2ZRFA 3LPNA 5DHUA 3GA7A 1ORDA 1P1HA 2BSQA 4BV2A 4YPOA 1W1WA 2CLCX 3QK7A 1XV5A 1J5PA 2OSBA 4UFOA 4L22A 3SX2A 3D3EA 4JVOA 4KWEA 3EWNA 2B99A 5EQDA 1EG7A 2QM7A 1P1FA 3CVOA 3HDVA 4RZXA 4BBPA 2PTGA 1R64A 2NO5A 2C8VA 1O6ZA 2B7BA 1U4NA 1GP2A 2JZCA 2CDBA 1GUZA 2F4NA 4OHMA 3ETLA 5BWOA 4RV4A 1H8ED 2JI8A 2FN4A 3V80A 2ODQA 2V3WA 4DM4A 1O1YA 1GFSA 4ZKDA 2AQ8A 3IP5A 3SZMA 3I0NA 1JA0A 2WF8A 2CUTA 3EBPA 4JLNA 5BRAA 5K6RA 3ZVKA 1OH5A 3NIDB 5K0CA 2AC2A 4E5SA 1U9IC 3M4NA 2YTZA 4JC8A 3SHFA 1X7ZA 2CUNA 3PL5A 3DVQX 4EQ6A 1K0UA 1CQJA 5A3VA 3JQGA 2X3YA 5CCXA 2ZTUA 4ND8B 3TRDA 5HCNA 3VYWA 3WIDA 1HEIA 1ECBA 3GDGA 1YOVB 2GA9A 2WB4A 4RJKA 1NJGA 4J0HA 4B3CA 1F0PA 1FDUA 1T91A 4MB6A 1XNGA 2O6HA 2QVYX 2R6AA 4IZ6A 4XLTA 4PEVA 3L06A 4IIUA 3KSRA 5I8WA 5K0GA 4IPTA 4RK6A 1ZGCA 2UVPA 4E5VA 2PA0A 1PLJA 3DBRB 1DBIA 4HAYA 4JB8A 1Y7TA 1NPDA 2B2XA 3LQRA 3VR5H 1LF5A 3LJKA 3QFCA 1B15A 2I2BA 3D2CA 3DTTA 4HXFB 3RAJA 4CKEB 4Q7KA 4ISBA 5AW9A 4JAVC 2QTFA 1ZN7A 3DZGA 1Q3TA 5K3OA 1OIVA 3LSTA 4DR4B 3L8MA 1EM8B 3RIMA 2ZYSA 3JVVA 1F6BA 4C87A 2OZPA 4YBRA 1ZD9A 2NT3A 2DFVA 4Q7LA 4PLWA 1UFRA 2YCBA 3A36A 3I9KA 1GUDA 3P94A 4O2RA 1P39A 5KYUB 2ZCVA 3G0OA 3M1IA 4LTDA 3D7RA 2XVZA 2B92A 4EHKA 5BSVA 5IYZA 3AETA 4XUGB 3RS4A 1XF9A 1U80A 1UXKA 3PT9A 1EUCA 2H1IA 5JNWA 1R0RE 1G6OA 5CAEA 4QXPA 5JNSA 3RLFA 4B7AA 3N87A 1VJ0A 1MDBA 1RHKA 2QT1A 2R6ZA 3T1QA 2ZSAA 1VKNA 2DFPA 4OMDA 4DLZA 3AV3A 3I6IA 2QM3A 1E7YA 1ZUNB 3GY0A 5TIIA 3Q6IA 3TAUA 1NXPA 1A8SA 2J0EA 4KR9A 1Z68A 2A4KA 2W6IA 3AG5A 1LTKA 2FDXA 2NXEA 3LOQA 1UBHS 2CLKB 3S1AB 6AT1A 5HUHA 1YZYA 1JLRA 2P77A 4IUBS 5H59A 1AKTA 1DKLA 1Q0PA 1LBIA 3EEIA 1GZSA 1C8BA 5DGXA 5J2TA 4PICA 5JV5A 5KYXA 2OCYC 1NDUA 2WLSA 1AQJA 1WR8A 1E9CA 3I6BA 3L7CA 1E32A 4JLUA 4I4TB 2XUKA 4NIMA 3EGEA 2VDUE 3SM9A 4NPCA 3GEIA 1CR1A 5TQ0B 3Q2OA 3O0DA 4XEUA 4UOQA 1N5OX 3JSXA 2Q2OA 1HK7A 1FTWA 3I3OA 3CN7A 4URFA 3SG0A 2QXYA 3C39A 3U0VA 1HFEL 2IYZA 2Z2ZA 4TKLA 4LY0A 3ZXXA 4TSFA 1VMKA 4HAUA 1FEZA 4UHCA 3WGHA 4DCJA 3LC2O 3VNQA 3U3JA 2OO7A 5DTQA 5REQA 1NXWA 1SKQA 2H17A 3K92A 3NYWA 2HW8A 3AINA 4GOKA 2WU3A 4KLZA 4OJYA 4CGZA 1JU3A 4MLCA 1E5QA 5IABA 3F4KA 4H60A 4CRWB 2M32A 1JYFA 2E55A 4FYMA 4B09A 1F4VA 1Z4QA 2A1UA 2NUPB 2X0NA 4MKZA 1ONSA 4X7RA 1WQ1R 2WD9A 1XN1A 4OF4A 2W37A 1YJXA 1JQKA 5CGQB 5K3SA 5A6SB 2HU8A 3RTCA 2AEFA 2ZQZA 3BFPA 3GFGA 3NHJA 3E9CA 5A4KA 4OQDA 2WTXA 5BSEA 2QUIA 2Z9DA 4I0WB 1OBVA 2HWXA 3EYWA 4HNAB 1RHJA 3I58A 4INJA 4C08A 4D42A 1RI1A 2GDZA 2LZ0A 5AQEA 3V5NA 3KKEA 3JYLA 1UIRA 4BV8A 2FEPA 4H6VA 4AP9A 1X80B 4PLTA 4FM9A 1AS3A 4DBZA 3B48A 2NXWA 3AXSA 2RGGA 3I2YX 3K9BA 3PI6A 1E3WA 4JSYA 1Z18A 4EPXA 5CDUA 2XMDA 1NUUA 3C85A 2K4MA 1XN4A 4HXEB 3H6KA 1ZVQA 1C1YA 2ZUTA 4XW2A 4XWKA 1RRKA 1HT1E 2B34A 2XVXA 2J5RA 3OQPA 1W0JA 2G77B 3G0GA 2LGJA 3OCYA 1NT2A 1K88A 1NULA 1VE5A 4KC0A 3KQTA 3TIIA 3CINA 1EHCA 1ULZA 3UT6A 3CE9A 4YT4A 2EATA 2IUUA 2OK7A 1EK1A 3MTEA 1B74A 4HEQA 1BC5A 4G0OA 4OYYA 1LS6A 2I34A 4EYOA 2UXCB 5LPNA 2JVKA 1COWD 5E7IA 4GFDA 3SNKA 1CFZA 4FXPA 2C0QA 3GUUA 4K2HA 3OJEA 2WHEA 3KRTA 2FMIA 3NHKA 4GOND 4KMRA 4KMMA 1RJEA 1Z5VA 4CLHA 2VEOA 3A25A 2ET6A 1N2IA 3GC6A 4XKJA 5IUKC 3OO1A 3U17A 4GEGA 1XAJA 4IIYA 4IS2A 2H48A 1YUMA 2WKRA 3UV7A 2W42A 2VF5X 2XQJA 4KQIA 5JMWA 5DNYB 2C2MA 1DAKA 1QCZA 1SRRA 4R8LA 7MHTA 3UHAA 3GRAA 1E18A 1K6JA 3U5TA 4U7TB 3QMWA 4WDQA 4MDHA 1Y5NA 1O87A 3OZFA 4FXOA 3UJHA 5BUQA 1HX7A 4YAKA 4CKZA 2IX3A 2VTBB 1PGQA 4LJAA 1HQYE 3OF5A 4I55F 2AK3A 1JHUA 1V5WA 3G8AA 2YZGA 3FLEA 4UQOA 3DB2A 3NHBA 1N25A 1IPEA 1N5DA 3NBZC 3UJ7A 2L2QA 1L0BA 3FYUB 3DBRA 1PD1A 1Z7BA 4CEHB 2D2EA 4JJ4A 5CMLA 4D98A 3KWFA 1DAPA 3CEHA 3TKAA 6CHYA 4CKEA 1V43A 3ZY2A 2FI1A 5K01A 4WH0A 5HE9A 2G0NA 4DCVA 3ZTTA 2W6JD 2JHFA 1NMXA 3QKIA 4ND1A 3GJTA 1FFBA 4HRVA 1EM8A 1ISMA 4JMLA 3JVIA 4J0CA 3W5BA 4O4HB 1TK3A 2DPMA 2J6CA 3UWOA 1FP2A 2BIFA 1HY3A 4BLSA 3HDYA 2Y93A 5FORA 2FETA 3S5UA 4F92B 5JDCA 5KYUA 5SYAA 2JNWA 1FYWA 2VYQA 1BS2A 2FP3A 2YY6A 5JSQA 1D4ZA 5HKLA 1G59A 4W9RA 1RP7A 4GP7A 4MVJD 4OFZA 5I9SA 5IAAA 4M46A 1OD6A 3H7IA 3P0FA 3JVEA 1T2FA 4ESEA 3TBHA 1UPFA 4XWYA 1HA3A 3MGCA 4LE2A 4Q1BA 3D4NA 4X9XA 2NP6A 1FXWA 5JPIA 1ZUNA 2YJNA 5HTOA 3D3KA 4BNZA 2OAP1 1DS6A 3L3BA 4DCGA 4HLUA 5C8VA 3OZBA 5JUWA 2O0HA 5SZKB 3ZGVA 2HMVA 1CD5A 1TKCA 3QPUA 3QQPA 2PA3A 2J48A 3EGIA 3NZEA 1M2EA 5G1OA 1J5EB 2HYDA 3ZNQA 4MSUA 2F00A 3FA2A 4GPTA 4PY2A 3ZI4A 5B2EA 3EFEA 3IAM6 4D9IA 3I45A 3LC1O 1UKEA 2YRWA 3K05A 1J24A 1Q17A 4I4TA 4AYWA 3FD8A 4MV6A 3UJPA 4D96A 3U19A 2PZBA 4BLVA 1YJ8A 2RHDA 2XTAA 5TQ0A 4BZXA 2EFCB 4Y1EA 1YZVA 3LK7A 4UEQA 1ZESA 2J7PA 5D00A 4YXFA 5FTLA 2VRBA 3VSCA 5KSWB 1PHRA 5KCZA 1W2WB 4GQAA 2Q45A 3LU1A 3M6AA 4KEAA 4A27A 2AF4C 1EBUA 5FA5A 1TIBA 4C7MA 2H1RA 3EGDB 1T36B 2P4EA 3EWIA 3IIJA 3VV3A 1P7ZA 3GFRA 1K5HA 3R9KA 1L5WA 1SGWA 1XD8A 5CIQA 3WGMA 2WWTA 5CB4F 2GHTA 4LYDA 1IIBA 1EUZA 5A5VA 2ZITA 1L4GA 1Y37A 4QHYA 1MDFA 1Y5LA 3UWMA 4FINA 4IKPA 4A36A 4AJNA 4CUKA 2P9GA 2PL5A 1KZ6A 3BQMB 2AWNA 1KBZA 2KLBA 2C3PA 3MTDA 2FZKA 4ITRC 4TXLA 3WL7A 4IVQA 2RBEA 4E6EA 2Q8PA 1K3TA 4PYJA 2G6BA 2ZSIA 1MRZA 3DNFA 3L4SO 2NUPA 4J0IA 4UCXA 1G2OA 2H2AA 4BFSA 4Y9RA 2PZJA 2ZJ6A 2OMKA 2P7IA 4B40A 3QFFA 1ZHFA 2JAXA 1IDN1 1NKVA 2PH5A 4HTFA 5FBZA 2ZYAA 2GKSA 3B6MA 1YH3A 4EFMA 1VE3A 1XMQB 3BXZA 2ZUDA 4K7JA 1TVKB 5H80A 4HNAA 5CJ2A 2IIVA 3WSTA 4E5YA 2X8WA 2DQKA 3A1FA 3TLEA 1NF9A 1L5YA 4TMYA 1AB5A 3HCNA 5LQDA 2H16A 4XVUA 5FUXA 2NM0A 1A5TA 1YMVA 1Q57A 1ZH6A 1A4IA 1Z0ZA 1KQGA 4XQGA 3OAAD 2NOAA 2YIVX 4UBIA 3WMGA 5DCUA 5IT5A 1JEQB 4DA6A 4PPGA 4ZI3A 3L9XA 1ADCA 2C2WA 2ZR7A 4X85A 5DP2A 3TOVA 2P5SA 2VSQA 1TO6A 5T3UA 5IK2D 2G4CA 4BV9A 2O23A 5JXWA 2ID9A 3PUZA 4CIAA 1XCPA 5C3UA 1IMOA 3L82B 4Q3DA 4MW7A 4GS5A 1EJ0A 2WUGA 2XGGA 2JEOA 2BRUC 3HKEB 1TO2E 3D0OA 3O4VA 3KQQA 3OOEA 1DLIA 1I2ZA 1C7QA 2ZB4A 1JHOA 1I0ZA 4YMHA 1KMMA 3ZV4A 3FNQA 5FPHA 3EEQA 1JQ3A 1J1IA 4O4IF 2Y1DA 4BATA 2WHYA 4FOSA 2WI8A 3SC4A 1BN7A 3ABQB 3AR9A 1QF7A 2ZJ1A 3OFJA 3TGPA 1RXWA 5L6MB 2UYOA 2HJWA 4QQRA 4AX4A 1IG0A 4CLOB 2RK4A 3X1XA 2PWBA 2WWRA 3TSZA 1Z17A 4Y98A 5B4VA 4FDLA 2FQYA 5I9IA 2NPFA 4WA7A 1PNRA 3KAKA 1IUOA 3ZK7A 4X1KB 4X20B 4DCSA 1YCGA 4GYYA 4IRUB 1TKAA 2PVPA 4D3SA 4DDKA 2BJVA 2WDPA 3IV7A 3MBKA 1R4NB 1NQVA 4UNPA 4RY2A 4ZVPA 4Z54A 1TTHA 1IVYA 3H4MA 3HABA 1GGNA 1FU8A 1XMPA 2AI3A 3N70A 4JZYA 4MJ7A 2PM8A 4I1VA 2PO7A 1KR5A 5DTRA 2BEJA 2GWHA 4UD2A 5BT9A 3U7JA 4S0XA 5ECDA 3ZPXA 4CF4A 1NMEA 1XVVA 1QQBA 3TPZA 1AUQA 1F2TB 1YS6A 2OCGA 1SXPA 3P27A 2RHBA 3GH3A 1KE1A 3FYUA 4CEHA 3GFFA 1U2ZA 3WGKA 2JFFA 2WJPA 3PZRA 4OHZA 1NA5A 2WSSD 3CRNA 4IXTA 5H3LA 4N0MA 3A2NA 4DSTA 2QOEA 5IT4A 3F6PA 4Q47A 4F4HA 5JCJD 1LSUA 1Z0SA 4UNNA 1Z6GA 1KGSA 4IO1A 4O4HA 1U3WA 1XZGA 3KK0A 3P2EA 4CDNA 4DJ5X 1EM6A 1KKUA 2ACVA 5JXGA 2JHGA 4FYHA 2KSQA 3TLGB 3N7AA 4B2PA 4GD3Q 4G0QA 5KNBH