1ZDMA

Crystal structure of activated chey bound to xe
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
128
structure length
127
Chain Sequence
b'ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein cheY
publication title Distinguishing multiple chemotaxis Y protein conformations with laser-polarized 129Xe NMR.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
total genus 42
structure length 127
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zdmA00
2FLKA 3OM0A 4DQDA 2ZAYA 3HSYA 1SXHA 1DBWA 3TD9A 5KQLA 1ZAYA 1QP4A 4MR8A 5CNJA 2JBAB 1LK0A 2M1ZA 3O1IC 4RZSA 5IX8A 1FFGA 4UHJA 5TQ2A 5C5EA 1A04A 3HS3A 2DRIA 2FEPA 3ILYA 2E4ZA 5CNIA 3TMYA 1BVHA 4Q6WA 3HUUA 1JFTA 2HQBA 4XARA 3D8UA 1ZGGA 3M9XA 3KJXA 1URPA 2JVKA 3H5VA 5TE9A 4OLAA 2HJ9A 5EWJB 4W5QA 2FEKA 4RK4A 3HXMA 1QO0D 1EWKA 1D2AA 3JVDA 5DKFA 3K4HA 2J48A 4EYOA 2PUGA 1YMVA 5FWYA 1JL3A 1ZDMA 4Z4EA 1U2PA 3F6PA 3LKVA 3MQ4A 2GBPA 3C3MA 3QEKA 4LDAA 1DJMA 3LUGA 5JNSA 4W5RA 1QO0A 1FSPA 1MVOA 3VNAA 3RVOA 1LBIA 4EVSA 1QQBA 5DCLA 1Z2DA 4WUTA 4N0QA 4WWHA 2NUBA 1JYFA 4NICA 1GUBA 2WMYA 3IDOA 1JYEA 3O74A 3H6GA 4RS3A 2A9OA 5BRJA 1P6UA 3EODA 3L6UA 4RK1A 2PUBA 3KLOA 3OMWA 1DP4A 5EWMA 3NBMA 3CS3A 3SQNA 3MM4A 4PEVA 5I4CA 2E4XA 2BGGA 3GT7A 3DBIA 4MS3B 4H60A 1DC7A 4FE4A 2E4UA 4F06A 3FFTA 3N53A 1M2EA 2L18A 4G0OA 4QPJC 4UHKA 4L4UA 2RGYA 4P1ZA 3Q15C 2CWDA 4Y9TA 4ETIA 4PICA 4KQCA 1EAYA 4Q7EA 1RZRD 4G0YA 3Q7RA 3QELB 5HM6A 5CNMA 1U04A 3O21A 4XXHA 4F8JA 2JVJA 4L85A 3G1WA 1DRJA 3A0RB 1MB3A 4Z4FA 2X7XA 1D1QA 3CU5A 3LKBA 3OLWA 4YCSA 5KC8A 5TPWB 2ID9A 4KNYA 2AYZA 3GV0A 2FN9A 2MYTA 4IF4A 3OQNA 1GCAA 3O1HB 4Z99A 5BR1A 4YP9A 3H75A 3LMKA 1RNLA 3SNKA 3QLVC 4IMIB 5TQ0A 4EVRA 3N0WA 1Z26A 4MQFA 4RXTA 4RY9A 5DGCA 3MF4A 5IC5A 4NQRA 1GUDA 4PYRA 4H3HB 5E3JA 8ABPA 4MLCA 3UK0A 3T95A 1GCGA 4QYWA 2PUAA 4WZZA 4MR9A 2GI4A 4Z4IA 2QR3A 1PNRA 5EWLB 2PKXA 4JOQA 4RDCA 3O2QB 3HUTA 3NNSA 3RVNA 1XHFA 2IPLA 3EQZA 4NCAA 3LUJA 2L17A 4G0PA 4OTZA 1DBQA 2A9RA 2P4UA 5GOTA 3JVIA 3LUDA 4RSMA 1YK1A 9ABPA 3HJFA 4RKRA 2GKGA 4QICA 4RY8A 2FW0A 2P9HA 2H3HA 1YMUA 3CKMA 1DCFA 1JDPA 3OLZA 3QX9A 1PEYA 2IPAB 1E6MA 1NTRA 1Z2EA 3W9SA 1JHZA 5KI6A 3N0RA 6CHYA 1JBEA 4MR8B 1ZN2A 4MR7A 4KPYA 2HQOA 1ISSA 1ISRA 1MAVA 2FMHA 1DCMA 3OM1A 1ZHHA 3C97A 2WRZA 1DBPA 6ABPA 1SXGA 4D6XA 1DG9A 5JS1A 1M5UA 1L5YA 4M88A 3LUFA 2F8SA 4O5AA 1QQAA 4MS1B 4NV3A 5JNWA 1QP0A 4IMJB 3SAJA 3QEMB 4LE2A 1USGA 4LE1A 4MQEA 4P98A 1TLFA 2L2QA 3Q9SA 1ZITA 1Z12A 1XWWA 3O75A 5FWYB 2Q5CA 1J56A 4LDZA 2PUCA 4QYMA 1ZGZA 3RVRA 4MYRA 5JNVA 3RQIA 1NXPA 2HSGA 1YK0A 3N6VA 5ED4A 2RDMA 1JLKA 3OO0A 1C0EA 3GYBA 2L19A 1XHEA 2A9QA 4Z9BA 2QZJA 2LP4Y 4RXUA 1Z16A 4OBBA 1BA2A 2JRLA 3E3MA 3H1FA 1DCKA 3JTEA 3L49A 3R0JA 3RVKA 3VNBA 1L5ZA 1T34A 3IPCA 3RVPA 2FQXA 4KZKA 4MPTA 3H1GA 3JS5A 4GPAA 3G85A 4E7OA 2FEWB 1F4VA 1PHRA 1PEAA 4RWEA 5KQMA 3T6KA 3IPAA 1VRVA 5BQ3A 3CRNA 5T3YA 4B09A 4S04A 1QKKA 3HM9A 2R4QA 3SG0A 2VYCA 3KCNA 1JFVA 4LX8A 2YHBA 4H3KB 2GX6A 2FMIA 2MYPA 4PZ0A 3O1JC 1SD5A 1WETA 3A3KA 4WXEA 3N8IA 4MS4A 4LE0A 3JPYA 3C6QA 5KQPA 3DGEC 4Q6BA 1U8TA 5F64A 3EAFA 1DRKA 2QW1A 3M6MD 3OMXA 4EYGA 2YHAA 4OG2A 3TX6A 5KWSA 4RU1A 1YIOA 4EYQA 5IUNC 4KV7A 4ZJPA 2FQWA 3KS9A 1Z15A 2JVIA 3EDCA 3H5TA 1K68A 1NXTA 3FMVA 2MYUA 5TQ0B 3A10A 1QP7A 3D02A 3E61A 2TMYA 4YV7A 5HSGA 1USKA 2PUFA 1YS6A 3UUGA 2R48A 2E4VA 4HYEA 4IRXA 1FQWA 3KTOA 4MR9B 3URMA 5EWJA 2O20A 4JP1A 3M9WA 2OQRA 3KHTA 4PE5B 4N41A 4ZYLA 2JB9A 4NCBA 1PNTA 3C3WA 2CHEA 1E6KA 3JPWA 1PUXA 4S05A 4TMYA 2QSJA 2FXIA 2RJOA 4JAVC 4RK0A 4Z4HA 2R25B 4LRQA 3LUCA 1QPZA 4JB0A 2M98A 5HQJA 2WJWA 4MAAA 3H5LA 2R47A 2A9PA 1M5TA 1I3CA 1JX6A 1JFSA 2QV0A 1E6LA 4IILA 1NXXA 4RK7A 1R8JA 1VKRA 2FTKE 2N9UA 3HV2A 3NNNA 4Z4GA 4YGXB 3CTPA 3HO1A 1BDIA 3SM9A 4MRMB 3DLBA 4RK6A 4MR7B 2VK2A 3NHZA 3A0UA 2W42A 2PJUA 5CNKA 2PLNA 1AB6A 1CEYA 3IP7A 1P6QA 3DZDA 4N76A 2QVGA 4EVQA 2B1JA 4YLEA 3ILHA 2B4AA 3RVSA 5JNTA 3H5OA 1FFSA 2FMFA 1EFAA 4EYKA 2I6FA 1EHCA 1D4ZA 1U0SY 3GL9A 3O2JA 1MB0A 4HNQA 4RXMA 4ZMSA 1HEYA 4FE7A 3QELA 4W5NA 1SRRA 1LBHA 1Z25A 5KC9A 2FSPA 1BDHA 4G0MA 2FKAA 5IEJA 2CD7A 4GNRA 3KG2A 3HDVA 2XDYA 3QLUA 4TLMB 5TPWA 5TQ2B 3NNDA 4ZMRA 1M2FA 3EJWA 3CZ5A 5PNTA 3RVQA 3OLXA 2VUIB 3CG0A 3MMNA 5KQGA 3QX8A 4JA2A 4JB2A 4N0PA 2IOYA 3GWGA 2FN8A 4CBVA 1D1PA 1VLZA 1RPJA 3I42A 4MLDA 2PMCA 5TPZD 3Q7SA 2KYRA 2PUEA 4YRZA 2LPMA 2GWRA 1OXKB 1YTUA 1EWTA 3MYYA 4HNRA 3RVMA 3QK7A 3IP6A 2PL9A 1JH9A 3N75A 1S8NA 2OENG 4EUKA 4Z0NA 4RK5A 5TPZA 4Z9AA 5DTEA 4F11A 3MIZA 1H9CA 1OXBB 1W9HA 4KQ9A 2LIVA 4YR7A 3BRQA 4TN5A 3JY6A 4MS4B 3BRSA 4F12A 2PAFA 2ID7A 3C3KA 2WJAA 4DN6A 4W5TA 1JWLA 2WY2D 3P9YA 3OQMA 5IULC 2QXYA 1YVUA 4RY0A 3K9CA 4KREA 3HCWA 1D5WA 5EWMB 4G0QA 2JCGA 2PE5A 3RVLA 5HKOA 4G86A 5FWXA 1YS7A 2FQYA 3FFWA 5D2CA 5GQSA 3FGZA 4Z4CA 3H5IA 1TVMA 1QNLA 4WT7A 4E7PA 1KGSA 3Q7TA 3BILA 2NT3A 5FBHA 2LBPA 2VUHB 3F73A 3KSMA 3EQ2A 2NZVG 5T7BA 3HZHA 3RVJA 3GRCA 1AB5A 2FVYA 4D74A 1W25A 4MS1A 4HNSA 1EWVA 1ABFA 3KYIB 1C4WA 3QEMA 3Q41A 4ML3A 3OLVA 3N0XA 3RH0A 1ZVVA 3IP5A 1RXIA 4KK4A 2MSKA 3F6CA 3HEBA 3H6HA 4RKQA 4YWHA 2ZWMA 2JBAA 2PUDA 3OLYA 4F3TA 2FLWA 3LFTA 1ZH4A 3QLTA 1U2QA 4LZLA 1QMPA 1Z18A 3O2SB 5DLEA 4O1IA 3TO5A 4MQFB 2HPHA 4ETNA 1Y1LA 4XAQA 3CFYA 3KKEA 2CHFA 1LJUA 3BBLA 4XFKA 1TMYA 3LUHA 1P2FA 3LUKA 2RJNA 3UKJA 2FMKA 1JDNA 2H0AA 2PL1A 5IEBA 1A2OA 4EGSA 1NY5A 1TM2A 1ABEA 2JK1A 3DGFC 2IPMA 3EGCA 3CNBA 1NATA 2IDMA 3KYJB 4OLBA 4TLLB 3DLHA 3HDGA 3OQOA 1USIA 3H1EA 1A0OA 5BRAA 1NXSA 5FBKA 1MIHA 5JS2A 2QU7A 3QLUC 1UDRA 4XLTA 4ETMA 4G97A 4KVFA 1DC8A 7ABPA 4ZPJA 1F51E 1K66A 2WB4A 4WXMA 1BDJA 5CHYA 4DADA 1ZY2A 3I45A 4MS3A 2V0NA 3LUAA 1LJLA 1RZRA 3I09A 5ABPA 2WWVD 2LUOA 1NXOA 5IUKC 1RXEA 1VPWA 1IIBA 4FB4A 1E2BA 3I5AA 3GBPA 3LTEA 4W5OA 2MSLA 4RV5A 3FDFA 4MQEB 3F7NA 1JF8A 5C5CA 4O1HA 1NXWA 4D6YA 3EULA 2IYNA 5JNRA 1CHNA 2MSWA 1DZ3A 1ZH2A 3H5WA 4JASB 2AYXA 5JNUA 1SXIA 4N47A 4G0XA 3GBVA 5B3JC 2QVCA 1Z17A 3B2NA 3GA5A 4KFCA 1GLGA 3ROTA 3CHYA 4EY3A 1BAPA 3SY8A 3T38A 4XASA 4G0ZA 1TJYA 3LOPA 3CZCA 2HQRA 3HK2A 3IP9A 3T8YA 3QLVA 2IPNA 3FFXA 2MYNA 1FFWA 2NZUG 5EWLA 5FWXB 2E4YA 2NT4A 4MRMA 1CYEA 3TB6A 1KRWA 4MGEA 4YS6A 3KLNA 3ROFA 1KRXA 1NXVA 4KRFA 3BREA 4KK3A 2IKSA 4YO7A 1Z13A 1KMIY 1P8AA 5IBQA 5TQJA 3S99A 1APBA 3HVRA 4IGAA 4OATA 3CG4A 3MA0A 2F8TA 2E4WA 5IUJC 1ZESA 1B00A 4KMRA 3CLKA 5B3JA 3NHMA 4N03A 3OO1A
chains in the Genus database with same CATH superfamily
2FLKA 4OHVA 2DBQA 3LBNA 1LQTA 4DTIA 2QT0A 4KXUA 1PZEA 4G8DA 5DHSA 3PFWO 1ZHOA 3QUTA 1EBBA 1NP3A 4JQOA 5LXTF 2AX3A 1TO2E 1L4FA 1C0PA 2XECA 3A04A 5TMDA 4U4AA 1SU7A 1UP6A 3ZY3A 1M2NA 3QJGA 3T7DA 4KR9A 1GU1A 1W2HA 2O8CA 4FB4A 1Q12A 1QHHA 4FNOA 4IXNA 4L75A 1K08A 2V65A 4TMVA 2D5BA 4WN9B 4B3XA 4AJOA 1GPDG 4FCCA 3Q3IA 3PNBA 5B37A 4RIHA 5D85A 4X7BA 2O07A 3DUWA 1TU0A 2HBQA 1E6EA 5J9FA 3AVQA 2KLHA 5JFGA 1DVRA 5EZ5A 1N0IA 1JB9A 1L7VC 1XA0A 1KPIA 3MTJA 2A1IA 1T3SA 1UIRA 2VI5A 3MINA 2I6GA 1WLSA 4M3NA 3RUIA 4OQLA 4JLDA 5T6MA 3ZU4A 2YQ4A 4GOMD 1S2GA 2VXYA 1T24A 4J16C 2EARA 5EPOA 3AL0C 4QGFA 4GFDA 1K92A 3VAAA 1UKAA 4CL3A 1FSPA 2PQMA 1E5XA 3U1BA 3UPUA 1T6BY 3C3JA 2WZCA 4FI3F 3ZEIA 2IYXA 2FUKA 1XFDA 2F3QA 5LIPA 4DUYB 1OH5A 3N8NA 2ZANA 3OX2A 1R3UA 2OWEA 5A3VA 3ZGOA 2O1EA 3IV6A 4B6QA 2VDLB 2Z8YA 2VTVA 1EK6A 1MO5A 3DHEA 4HEQA 1WMEA 4NOMA 2GYVA 1JG2A 1IPHA 3AJDA 4OUDB 4U7FA 4CCAA 4ZK2A 2JI6A 4RBNA 5DNCA 4OQQA 1M6WA 3MWEA 2P69A 2CE2X 4MS3B 1N4AA 3T5CA 1L5OA 3M3PA 2OWDA 5A3QA 1DEOA 4F06A 1QE5A 2FPUA 2BH2A 1RLTA 4GMHA 2X5XA 3TTVA 4BNTA 3UAXA 1A8UA 1YDEA 2ADMA 1YCGA 4YRMA 3C4JA 3N74A 4I4TF 2HIMA 2IXAA 2CWDA 4J16A 4JXKA 1Y5IA 3TS1A 2EKZA 2YVKA 4MVJG 3MJ4A 4DARA 3NOOA 1VLJA 1Z7WA 3C6XA 3M1AA 3PIDA 3QMVA 4BQNA 1B93A 4QWMA 3FUVA 2QMEA 2OYRA 4LNHA 2HA6A 4R69A 4ARBA 1K06A 4FYWA 3K2QA 4UUMA 5LD2C 4Z4FA 3ND8A 2M2IA 3EAGA 4AZ0B 1N78A 1PT9A 3ETEA 3B1XA 4YJFB 2J6BA 3DJFA 3CBGA 3U4GA 2MYTA 1MH1A 4OK3A 4ACBA 4EUHA 2GO7A 3DTVD 1VG9B 5F35A 3ZVNA 4NE9A 1XWIA 2AHOA 5JVDB 1Z47A 4GE0A 4IMIB 4MMYB 3U17A 2GILA 1D09A 1TJPB 1LQUA 3TRDA 3IQDB 3HBMA 1YB7A 2O2EA 2MHCA 5CXUA 2VLIA 1CNMA 1G8MA 2NSJA 4MLCA 5C4GB 4IJ5A 1NX9A 2VCEA 3I30X 3LBHA 4KFSA 1W87A 1PNRA 4J0EA 2QTGA 4FI3C 5DYNA 1SKBA 3WQRA 4H7HA 3HJAA 3DG9A 1FJHA 3BMNB 1NWHA 4FYYA 2WNSA 2OCKA 1V1MB 3Q5EA 4ZEXA 5KYXA 3THRA 1PGOA 2WMNB 2EWMA 3M6IA 3LQ2A 4GXRA 4RMGA 3R1IA 3WK5A 5ICFA 2EXXA 4ADSG 4ZZ0A 5J5VA 1WZIA 1NVWQ 2I99A 4C89A 3E7DA 2XB2A 3VU8A 2VAXA 2IX3A 3R3ZA 3OQIB 3RS2A 5FLXA 2A58A 1KJYA 4AUKA 2HJGA 3FF4A 2PPVA 4M1SA 1E6MA 2ZXEA 3ZTYA 1J49A 3SJUA 2OPHA 3OQMA 1JECA 2RGEA 4BMPB 3JZFA 4IGEA 1ZN2A 2PT6A 2R8PA 1E5TA 4ZODA 4QGBA 1RMQA 2K87A 4BJ6A 3EEBA 4WKPA 3IQWA 4K6GA 4IQ4A 1USUA 3V4OA 2W83A 1R9GA 1KVRA 4U2CA 1QHEA 2FWJA 3RUFA 3KQUA 5JH7A 4MUNA 4R84A 1HT3A 4V0RA 1ZW6A 2VAVA 5ECWA 3F5DA 1EFTA 3BWVA 3COVA 4IVNA 4V0ME 2ZBPA 5CEFA 1UK9A 3UH0A 5JNWA 2EFJA 1YBAA 1FNDA 3QEMB 3AOGA 5K8VA 3ORQA 1J70A 2Q5EA 4W99A 3ER9A 4LDZA 3GRKA 2UYOA 4LNUA 4P83A 3SYNA 3VVCA 5LDHA 4TSFA 4GDFA 3PPVA 2YN4A 1W9MA 2A7QA 4K40A 5LB2A 5JNLA 2BAGA 2AMYA 4Z9BA 1Y8CA 4RXUA 3KQYA 2HOQA 4R6WA 2KB0A 2Q4OA 3L49A 3P9RA 3RVKA 3TIVA 1P17A 3WFIA 1R4MA 4Q4HB 4CT5A 2CLMB 3E23A 1D2MA 3JQAD 5CP8A 5F2KA 1XMXA 4B31A 1Y7LA 1M72A 1T1RA 3SQWA 1OWMA 1YBVA 1XTTA 2G3YA 1DBVO 5I3CA 1A9RA 1OXUA 5D7BA 1FDTA 4YJHA 3GPDG 1YS1X 1LB1B 1X2BA 2VSXA 2V7UA 3RUAA 5HIKA 3ZWCA 1GNSA 3FNGA 3SG0A 1R6VA 2Z2KA 2V58A 2ETVA 4I55B 1IUOA 3NM4A 2WFAA 2VJMB 5DI3A 3QIAA 1HEIA 3X1YA 3AYZB 3G2OA 2BGRA 5HZMA 5KTMA 3KQKA 3W2FA 1MX5A 5A02A 2FOIA 1VRCA 3F5FA 3V8QA 1WETA 2GCIA 3RTCA 2Q6VA 3J7TA 1UQTA 4A6PA 2ZBFA 1IY9A 1GOTA 1PFUA 5CH8A 4F4HA 2B4RO 2VFAA 3C6QA 1KC3A 3WQQA 1NUAA 4RJ2A 4YB8A 4B3TB 3GMTA 4X6YA 3HSSA 1XCPA 2QW1A 5EVJA 1C5KA 2VDOB 3EW9A 3S2ZA 1U2GC 1M2HA 4AJNA 3QE9Y 4RU1A 1SPXA 3AQIA 1RQ7A 3IQXA 4OH1A 3KELA 3ZHTA 5IUNC 1OLUB 1BE8A 1K7SN 3ADOA 1BX1A 4ZTZB 2OVBA 3AT1A 4YRSA 1FPMA 1S3FA 3ONNA 3WY9A 1W6UA 4D8VA 4EJ2A 2GFIA 1GNTA 2WZQA 3DEHA 4NKRA 4YP6A 4C4RA 4Q48A 2QRPA 2PUFA 1UXIA 1YS6A 1ORDA 1X7HA 4M0CA 2OKCA 5C9ZA 4NG5A 1IQ0A 1NRJB 3HN7A 3PJDA 4GNKA 4YCCA 4ARZB 4BQSA 1H2ZA 4YRQA 4ZQGA 4HT3B 4QX6A 1XRNA 5GGYA 2P11A 5JWOA 3ESZA 3NRJA 4FBLA 5AK6A 1Z6AA 1CCWA 1IRIA 1BJKA 1LTKA 2BGKA 2CMHA 2GZHA 2EYQA 3CPJB 2RJOA 4P38A 4XPIA 5EYPB 4BNGA 4M9RA 2YN2A 3MGBA 5CDHA 1JHPA 3K9QO 3KSDO 2DQ4A 3VR2A 3ZWOA 2EIXA 2R47A 4IJMA 1N5IA 1S2MA 4UQPA 1OLSA 2QV0A 3ELWA 4C7BA 4MPJA 4EJ6A 1SQ5A 2H1HA 3UAZA 1WZEA 5LJIA 1G7RA 3GHHA 5L40A 3F78A 1THGA 2ZSEA 2FWPA 3UHPA 4BVLA 1ZK1A 2G9ZA 2H1SA 2FJ0A 3NHWA 4CCYB 3HO1A 4Z9FA 3LW7A 2ZULA 3KZVA 3NIWA 3SC2A 5LR6A 1GDTA 3ZDCA 4Q3BA 3C39A 1QIIA 1SH7A 3ZCRA 2QTVA 2YCBA 3C5WP 4C01A 4LYAA 4EY8A 2IYRA 2QD4A 4FHCA 3QPWA 4NDNE 1Z5PA 1P62B 3CF4A 2AG0A 4P58A 1ZO8A 3PJFA 3Q7PA 4HQ6A 4CF6A 3N87A 4JY7A 4K2AA 1KFKB 5E3IA 1XBTA 1J5EB 4DSOA 3DZIA 3FCYA 3HE3A 4FE3A 4KEAA 5ALPA 4RPIA 2QL6A 3UXYA 2IWRA 4LF6B 5KJ1A 3G17A 3KXKA 3BICA 2PFGA 3GROA 4R9RA 3K9HA 2IIQA 3HBLA 3DMHA 3STYA 3VC3A 2WU8A 4GMKA 5HZHA 3ZU5A 5TIIA 4B47A 3IERA 1W4ZA 2G0AA 1VMKA 1N3BA 4LY6A 1FNCA 3MJVA 4LUCA 2YW2A 3VGPA 2X0DA 5IKXA 3C45A 4IIEA 1T36A 4PZEA 4D96A 4A5SA 1ZCBA 1XMVA 3I5MA 3VNRA 4K5QA 1SXJB 4JUFA 3JYOA 1V8DA 3U40A 1AMNA 5FTNA 1Y82A 1TF7A 2C07A 1UINA 3ORSA 4DNXA 1RC0A 4FUTA 1AU9A 1TQ8A 4QXQA 1HK7A 1TCCA 4X93A 3EH1A 2BKVA 4KB5A 1OXKB 5C53B 2HM7A 4UTPA 4MITA 4QPPA 4C87A 4L7VA 3B60A 4U63A 1ZD1A 2X2PA 4XZ3A 3TIGA 3CO5A 4PPYA 3ZNOA 4Q03A 1RC8A 3D2CA 2WJGA 3LKDA 4PAOA 4Z8XA 2WK1A 3EFHA 4FFWA 3FPEA 1FC0A 1SQSA 1VL1A 2WVGA 3S2FA 3MEQA 4BLVA 1G8AA 3AI1A 1LBEA 1ND5A 9GPBA 2HPZA 4MS4B 2UKDA 5DTJA 4OU5A 1XTRA 1WF3A 2A57A 3R5KA 2B4QA 3G0CA 1OXSC 4PYOA 5CK5A 5H3CA 4BB0A 4TV8F 1XWFA 1QYDA 2PN1A 4K6OA 2EERA 1OI3A 2Q0XA 1JI3A 2QQGA 3KQQA 1AO0A 5SY4A 4UDOA 2NIPA 4CE6A 3WKEA 3BXOA 3IDFA 1KERA 2HA3A 3KAJA 2C78A 5BOSA 4RMJA 2FG5A 2J0UA 4KE6A 2LBPA 3GZNA 3P9ZA 3QUSA 2D59A 4PZUA 2OT3B 2ZIEA 1MPTA 3PUJA 1W35A 1IMOA 1FNNA 4N49A 5CT5A 2HCBA 1ZD8A 2PVSA 2WABA 2PMEA 3RAFC 5AIAA 2N42A 3CX8A 4V2IA 4DYHA 3CLTC 3PFFA 2ZETA 1IAVA 1TNDA 3CEPB 3LQ1A 3UA3A 3U7HB 2O3QA 1POXA 1TEXA 4E31A 2Z3VA 5CB6A 1YSCA 3WMFA 1QXSA 4JT2A 1AZLA 1VIDA 2BM1A 2DKFA 3C1TA 4KXYA 3ANNA 3GQBB 1HYHA 1CUBA 1JP7A 3EVTA 1WBDA 1W29A 2R0QC 3NXSA 3KSBC 3GCDA 4Q9KA 3PSAA 5KJEA 1P7YA 4GVLA 2HXGA 3NBZC 4LQCA 4US1R 1M8GA 4HQOA 4L4XA 5T57A 1YR1A 1ZH8A 1QZXA 1GLVA 1L6IA 1SUFA 3CPSA 1RTKA 3M49A 3CFYA 1CZRA 3CGWA 1Z6PA 1U3VA 1Q6YA 2QT9A 2HF9A 1VG0B 3SR3A 2B5VA 2OLJA 3QBEA 2CJWB 4JELA 1P2FA 1WMBA 3A9WA 3OCCA 3IKLA 4TGLA 4NAVA 3CNEA 4I4IA 4UBIA 1R6BX 5H0IA 2ARKA 1CKEA 1DIAA 4YALA 5AJUA 1A2OA 1FFCA 1NI5A 2R44A 2UDPA 2VRBA 1DO0A 1II9A 1AK9A 2X14A 3H65A 4WCFC 4IDQA 5B53A 4ZI5A 5IYZA 1O6BA 2Z5GA 4G1CA 2F17A 5AVRA 3GVHA 4N18A 3X1JA 3OP1A 1HDOA 1QORA 3QYFA 2DCMA 3EAQA 4NJEA 1LDYA 1JBKA 2V7EA 4D4GA 4YAEA 4C7KA 3JRNA 1C1XB 1A9YA 2JZNA 1VJ5A 4LVCA 4ZYZA 1P1FA 3I9V1 4ZVUA 4RJTA 1W4AA 1P7VA 2WG1A 2ZW9A 1GPUA 2D0IA 2IEAA 2A88A 2JNWA 3CIOA 4GM4A 3SVLA 3C3AA 4RZXA 3ANMA 1FJ2A 4ZPJA 4OQEA 3EISA 2RHBA 3SDZA 3R40A 2HMAA 3AEUA 5DX8A 4AMVA 3O8NA 1DKRA 2P67A 4FONA 4WEQA 5ALTA 1MD9A 3KXLA 1PFKA 1SOMA 3EOZA 2PGAA 1C1YA 4L50A 4X45A 5K0BA 2QN2A 3WJ2A 4N5MA 1X80A 3ZJVA 3P71T 3C16C 4OYYA 5C37A 2QRVA 5F23A 5JSFA 4DQUA 3DZJA 5KYWA 4TV8A 2Z4RA 3GBPA 3HGMA 1L1EA 3JALA 4U7PB 3NBFA 4RM2A 2YMQA 2Z09A 2PUJA 3QJYA 4I3GA 4IRMA 3QHPA 1KAGA 4GGOA 4JUDX 1TKRA 3O73A 1WZNA 3JRWA 4CODB 1WY7A 4B1FA 3FX2A 3HCCA 3KR1A 4PLFA 4QU0A 3W0LB 4UARA 1J9EA 3GJ7A 4C29A 5AW6A 2D7DA 3BL5A 1CUIA 5FTMA 1KDOA 5EEHA 2FPRA 3TR5A 4FHDA 2BCEA 1M3SA 1PGPA 5T4HA 4HH1A 4OQPA 5EZSA 2GAIA 4H27A 2CFCA 3HK2A 3OCXA 1CJTC 3SFTA 1DBSA 1R00A 2GPWA 3KV3O 3T3PB 1JKMA 2EBHX 1XHLA 5AKLA 1EP2B 1IK6A 2XE8A 3FUWA 1KRWA 3EZNA 2TMKA 2PIDA 1PG5A 3TKAA 4C4XA 4KK3A 2NXJA 3E3OA 1TU4A 2ON6A 2FETA 3OIYA 5IBQA 3S99A 5MFPA 2VJCA 1Y9ZA 2AJDA 3ETDA 2ZRAA 3RE1A 2APJA 3WVNA 1ZEJA 3REQA 3B48A 1ADFA 2XADA 1DC4A 4Q4LA 1S3SA 2DOKA 3UPDA 4Q05A 3Q2OA 1P31A 2ZYRA 3V1TC 1M2OA 2FEAA 3OM0A 4BFLA 3ZDDA 2JGKA 3VKVA 1G5HA 2ZAYA 1P7ZA 2ZTHA 1R0SA 1B76A 1SHLA 5HRUA 2XEDA 3BTVA 1HGXA 3OE5A 1C1DB 3L7OA 3SZUA 3UF0A 2G71A 2VA8A 2VBGA 3ZE9A 3KYDB 4Z4QA 4RAOA 3PIRA 3BZUA 3MK31 1C50A 2YXNA 4N39A 5B5SA 3L4KA 1PR2A 2JLSA 1BW9B 1KNXA 4NK4A 2QR2A 3BWMA 3DWEX 2H4WA 3C5EA 2DMRA 3G9TA 1YOVB 1UPFA 4ZFNA 1SQ6A 3VO9A 3VSDA 3ZI4A 3STUA 1Y8RA 5FBZA 1RAEA 1C2YA 4L5CA 4MQ4A 2ERYA 2ZIWB 4TTTS 2X8BA 4Y2HA 1TA0A 4IDGA 5DKFA 3I4CA 1XF9A 1YMVA 2F3TA 5FPTA 4CNBA 2P9GA 3IVGA 2AQKA 1Z45A 2CUTA 3H2SA 3G8YA 3ITDA 4CCWA 1U2PA 5JCOC 1O9BA 3P0RA 1NE7A 2QAGB 3I73A 2CMDA 2ZRKA 1HUQA 1D2NA 2IF0A 3NQ41 4MCHA 2XMSA 4TUYF 5DLPA 3U4DA 5CRIA 5FA6A 2CNBA 2QRGA 4R2KA 3U44B 1F1JA 4RABA 2ZE8A 2CVOA 5K7SA 3CZPA 2BSAA 3NHAA 1MVOA 4DMUB 5CG1A 1MFPA 1KMMA 2FUEA 2NLOA 2ZVDA 3ADPA 5CB0A 1QC5B 3SIWA 4PVCA 3IE0A 4K86A 4BNVA 3BSWA 4N3GA 4ZVMA 1JGTA 4JVNA 1TC1A 4JT8A 3RIGA 1MRNA 3ENWA 2G25A 3EEFA 3OPQA 4MW7A 3RJMA 3V8BA 2JANA 4AP5A 4E4TA 5BQ5A 2H4ZA 1I4TD 3GT7A 5F4BA 1JHDA 4H60A 3K71B 3K0KA 1ZBDA 2ZWOA 1FFXB 5JTTA 1ZNWA 1GGKA 5ECGC 4DIDA 3GJZA 1NQXA 1QDEA 2NADA 3AFIA 5E6SA 2NXNA 1GITA 1S2NA 1BFUA 6GPBA 1B15A 5BWCA 5CG2A 4JWTA 1Q0LA 2VCYA 1Y48E 5AJVB 3TIXB 3WBKA 1UPUA 3QXJA 4OAQA 2FZLA 3G5LA 4GZ6A 1DKOA 3E7PA 5ILGA 1PO7A 3JD2A 4B84A 3AB8A 1H8EA 1W0JD 4LRSB 1I3NA 4LV6A 4H1UA 4MVJP 2CVHA 4QDZA 2ZTSA 2FFAA 4PGFA 4OX9Y 3PXBA 4ZVPA 1I4EB 2NTYC 2XWBF 1E9CA 3LMKA 4JQZA 1RNLA 3MRVA 3PKJA 1RWOA 2NU7A 4WZAB 5FFFA 4D5EA 3O6VA 4DHWA 4KN9S 1CUZA 5HFNA 3W2TA 3K9FC 3FUCA 4FQ8A 2XH8A 3L7JA 2E21A 3X2FA 4G41A 3FTDA 4YJKA 3EXHB 3PEEA 5AW9A 5TVGA 4F2GA 1J8MF 1Q2XA 2PKXA 2ZRDA 2G76A 2XCIA 3E7XA 4Y98A 4F5ZA 3TPZA 3NNSA 3HYCA 5JV5A 3LF1A 1ONSA 1TOAA 1ECJA 3HCDA 1ZOOA 3QVSA 3IQZA 3ZHXA 3SLGA 1QSGA 3L7KA 3O26A 3ZS9A 5KYTA 4WMLA 4AL4A 4F1KA 1JHOA 4QSHA 1YB5A 2ZBGA 2EBUA 2G82A 2HL6A 4HN4B 4P6VF 2F64A 3JVIA 3VHXB 3NONA 4WDRA 1YK1A 2IBSA 4MW9A 3PCRB 4ZGWA 4A8JA 1Z7YA 1F9EA 1PQWA 5AI6A 4U8GA 4CMGA 2VHYA 2ZUBA 4GT1A 4RJLA 4UNQA 3OLZA 3REOA 2QLBA 4TQGA 3H87A 3IA7A 1NTRA 1RI3A 2GGSA 4OB7A 4FDAA 5D6OA 3SN6A 1GPBA 1N2CB 2ALJA 1JHAA 2O5RA 3LRXA 2F1JA 1SBQA 4MO2A 5AW5A 4ALKA 4TUYA 5A5GA 3HV0A 3DO6A 4OP3A 3RF7A 1U5BA 2VHVA 2GM3A 3WYFA 4LGVA 2I4IA 5IZ4A 1R6DA 3FNQA 2WRZA 3PWTA 3HCPA 3KOYA 4I4TB 4HX9A 2XQKA 1SXGA 3ZV3A 4Z7OB 1TRKA 4EG1A 1ULSA 2AQIA 2C9OA 1S9DA 4ZO8A 2ZU6A 4A0RA 4EG8A 5JANA 4UPVA 3ZDAA 4QDXA 2LZ0A 2YVUA 1QONA 1NMQA 1WO8A 2LKDA 2V5UA 2YZMA 3DLTA 4B87A 2BFBB 2C5FA 2OAP1 1NI3A 4LE1A 4BGUA 2A5FA 2QYHA 1KO4A 2Q1YA 3HU2A 3MJRA 1ZGBA 1ZITA 3Q9SA 5JLAA 3RK4A 4MVWA 3IJRA 1ZGZA 3QX7A 3TZBA 4UASA 3STXA 3GGPA 4AY2A 2YN0A 1PDOA 5BSVA 1EFUA 2LR0A 5J2TA 1U0BB 3U5TA 3FAKA 3AM3A 4EZEA 2X9GA 1ZIOA 3KXIA 1I0LA 3HBNA 3UMFA 3TLCA 1EXVA 1BG6A 2BGLA 1JILA 1HDIA 3OCUA 1ZCAA 1VHQA 2RK3A 3L4EA 3MCAA 2I3BA 1L7BA 4DS3A 4TLCA 3NIBA 4EJMA 2ZG6A 2Z9DA 3OA2A 5G3ZA 1UKCA 1F4VA 4PHFA 2J0SA 5AI9A 4AECA 4UZSA 1UZMA 5BQ3A 3BK7A 1V8PA 3EYAA 2FFBA 3R20A 1YCDA 3OJWA 3GFOA 3QYJA 1T8WA 4RNCA 4E15A 3MCZA 1AKMA 4DCCA 2Q9CA 2PRKA 2YHBA 3D4NA 5DPMA 1B6TA 1AX9A 4RLHA 5BMVF 3GVPA 5LP6B 1C8BA 4R0MA 5LYJF 2C4HA 4PWYA 3VKWA 4DMRA 3L7AA 5GJCA 1T29A 1UDXA 2BMJA 1N32B 2YV3A 1MOSA 1BH2A 2BGTA 2WFLB 5KQPA 2I2FA 3WWZA 4GLOA 4DLNA 1JHMA 2I29A 1E2FA 2QLLA 2IZ5A 4JWKA 3I6ZA 2AKEA 2IEIA 1CE8A 3NTXA 4K9RA 4OG2A 4FEAA 2R1UA 2A1UA 1KZYC 3LBFA 3NUQA 4XVHA 5DOVA 4KV7A 3O3OB 4HVAA 5IABA 2TMDA 3BEOA 1WPRA 1FVOA 2BGJA 4II3A 4L5JA 4GE3A 5FXMA 3QPVA 1JR3A 4U9IS 5ALHA 4K8OA 4ZU6X 4C6TA 5A5VA 1HPLA 1R1DA 5BXQC 4YCMA 3OOWA 1I7QB 3MJTA 1Q3TA 5E7IA 1QWOA 4AX8A 1PL8A 3F98A 1USKA 1A7AA 1TZCA 4WIAA 3VPXA 4KUHA 3KTOA 4IRUB 4AYWA 2R8YA 3QVGA 1BNCA 5E4TA 4E6EA 1XZGA 2J6IA 5CDFE 2VDVE 3SXUA 1WU7A 3TUZC 1O77A 2PU7A 3A70A 4FLEA 3N5CA 4EJSC 5JOQA 1G8SA 2D6FA 1GPAA 5FTLA 2EJBA 3FYDA 1ZUNB 4QDOA 2FXIA 4IIBA 4JAVC 2QBYA 1WU8A 4K9SA 4AB1A 1I4WA 2YRWA 3OA0A 3AF5A 1ZWKA 5CT4A 2I76A 3QA3E 5FT9A 2QJOA 2EX0A 4IFBA 5KDLA 3WA6A 2BDUA 1QYVA 1V96A 4IVQA 2ZYAA 3S2GA 1JDUA 2A9PA 2V96A 3Q0TA 1O6CA 4P4LA 3S8YA 3ZE6A 1ZXXA 1N0UA 1L5RA 1VI6A 2JAUA 2YRXA 4DCPA 2NO6A 2DUJA 3UMRA 1VKRA 4F5YA 1DKQA 4EY7A 4PZZA 5HKKA 3H5AA 3HCBA 3HPQA 2JKYA 3IAAA 4TLDA 3S1AB 1IUKA 1XD8A 3PCTA 4ECEA 3SM9A 4DZZA 1PDWA 3CONA 1PVOA 4N5NA 3P2MA 4Q18A 1IXSB 2EFHB 1RBQA 3A0UA 3HGTA 3UMJA 4NENB 3D3WA 3B2EA 1IZYA 3IP7A 1R0RE 4EJSA 2V45A 1WWKA 4EB6B 3MPUA 4XQ9A 3ILHA 4FGSA 3FMGA 3H5OA 1JU3A 1I7NA 2BVNA 2EKQA 3V4LA 3H4TA 4KR0A 4IJUA 4QLAA 3NB0A 2CC2A 4LQ4A 3W2GA 1E2NA 5JHGB 4G5FA 4TYYA 3MZ0A 2ZJ1A 1OU4A 2IV7A 1V8FA 2I6QA 3HKCB 2KW5A 1VLQA 3HABA 4DA0A 2H5JA 4K26A 2J0QA 3GGCA 3GDHA 1VE5A 1LVUA 3HR4A 4JEIA 5LYJA 4WK2B 3NNDA 3OJEA 2VSNA 3QBVA 1Y7HA 4CQJA 1V8BA 3KXDA 4DA6A 5BPHA 3QOWA 2A0XA 2ZIZA 2REOA 3GY0A 4YFYA 1Z37A 2O6LA 3QX8A 2JFBA 4N0PA 1T1SA 4K3VA 4O33A 4EA7A 1KVSA 1XRJA 2JGDB 1ZK2A 3ZKAA 2WYOA 3KQLA 5LPNA 4P0PB 3LY5A 1ZRHA 3F3MA 2ASEA 1R0WA 1L5HA 3QK7A 1XX6A 4ZO9A 3DE6X 3ZDQA 3HP7A 1EM8A 4HHEA 2HDOA 3R74A 2AJLI 1N0WA 4XDYA 1UXHA 4I66A 1H9CA 4ROSA 2XYVA 1Q1ZA 1L5VA 4QT4A 1UWLA 2H2IA 2EDAA 2P9QA 2WAXA 1ZD5A 1G66A 3BZBA 3ENQA 4N5HX 4PNPA 5FHRA 3ED5A 1NW3A 1MNAA 4NCKA 3WQHA 4ZI2A 5IJ9B 3IUBA 5HR5A 4EG5A 1JXAA 3LGAA 5IXYA 2CDAA 1XZAA 1QPGA 3NTVA 4BP8A 1T2EA 2IS4A 1Q1NA 2EFGA 4GOXA 4K1LA 3SZLA 3VR5H 3H2ZA 1FYXA 2HYDA 3QEJA 3FAZA 1SG9A 5AJHA 4EB3A 3DEYX 4WT7A 4Z7QB 1X7XB 1DUVG 2AGVA 1PK7A 2V5VA 5H3HA 5AVTA 1MTOA 2FR8C 2Q29A 3UUFA 5HKBA 1ACLA 1DFGA 1XNQB 5IHPA 4B6RA 4KLRA 3D4IA 3DFFA 2QLTA 3CJQA 4ES6A 5CA0F 1TZBA 1EWVA 1HDEA 2ZJ6A 4QUBA 5IXSA 1G8PA 1SU4A 2HK7A 2WVHA 1VSQA 2VRCA 4L4RA 3UJCA 3TOCA 3UMSA 3H4MA 4AYXA 2WE8A 4LXGA 1YVEI 4PXSA 1HF3A 4B81A 4F3TA 1BS2A 1U9CA 3QLTA 3FCUB 3SYRA 1FVXA 5L4SA 1K0FA 3DHNA 3GDOA 1N77A 1KTVA 1P2DA 2O7QA 4CMHA 2PMWB 4RQUA 5T4FA 1E9FA 3FM9A 3JD0A 5ICGA 1CC1S 3R2JA 2QL9A 2OEPA 4K28A 3GLIB 2QHXA 5JAQA 2FR8A 3EXFB 4QBFA 5JBNA 3LLCA 1VA4A 2F1RA 1YS9A 2R86A 4IV0A 4OEHA 2FMKA 1SXQA 2HX1A 5EKTA 2UXDB 1XDBA 1N2CE 1P61B 3QKRA 1N6IA 2ZQ5A 3CLUC 1BROA 3QFHA 1XTBA 3UWOA 3RRXA 2WSLA 1Z83A 3DV0A 1EXNA 2IPMA 3GLHA 3H2KA 3PGXA 4RD0A 3LF2A 2IDMA 4WAUA 3VR6A 1WHTA 3BJIC 3TOVA 3RGGA 1U8YA 5AI0A 3BHMA 1Z7GA 2K5UA 2Q6KA 4HBZA 1N33B 1F17A 2YHIB 4KXVA 4RF4A 4KTTE 5IKEA 3LVFO 4URFA 1ZD3A 3ZHVA 3THXA 4AN0A 2Y2VA 4WXMA 4KRYA 4K6HA 1BDJA 4XWWA 4NBLA 5KSYA 4G0UA 2R5FA 4JJKA 2Y3IA 3UICA 1JMYA 2V0NA 1E7MA 1NPTO 2MOKA 3PQ4A 4MEAA 2FSFA 2OCBA 3ZJ4A 4CV0A 1PT7A 2PH5A 2XYQA 4NR0A 2BBTA 1PLLA 1XTSA 1FYDA 3AUXA 1NJ5A 1LXCA 3GDGA 1VYUA 1IHYA 2HJHA 4KU4A 1QUFA 2XEXA 4MVJF 1HURA 3DLPX 3HCEA 5E9WA 3SYMA 3UYLA 4YYEA 5HUQA 3I52A 3GPCA 2J7KA 1XKQA 4I50B 2AB0A 2WSBA 1RQNA 2IYFA 2QGFA 2Z9CA 4MQEB 5IKPA 1PD1A 2WM3A 4RKEA 3OAAA 2ECOA 2ZTLA 3QFSA 4BNMA 3GO4A 2W6JD 1H2FA 4KODA 4FLFA 2VP9A 3SP1A 4YAUA 4GXQA 1U8UA 4UBNA 1L7MA 1TB4A 2BFEA 2A94A 1WQ1R 4FS3A 1N3IA 4G0XA 5A06A 5KTKA 3DW1X 2YINC 4O3MA 1VL2A 5AOVA 3WRXC 3WWEA 5HUJA 1GLGA 1EKXA 4IFTA 2IYSA 4WV3A 3ACBA 3ZR4B 4GLJA 1QBKC 2G1UA 5KNBA 3LOQA 3EMDA 4L2IB 3T38A 5AW2A 2POQX 4UBLA 4FP9A 2HYIC 2A92A 4H18A 4F4JA 5KNCH 5JCJA 4CN8A 5CA1A 1QR2A 5CBKA 2BHSA 2KLBA 2MYNA 2OG2A 1ISPA 1VXOA 2G4LA 2GZ1A 2P2ZA 4GP9A 2VDMB 2WIJA 5AT1A 4CEJB 5LZ5A 1XTPA 2PWZA 4FOLA 5JPIA 1KQNA 2XSZA 4ZOQI 1HDGO 3ZK9A 4EPYA 1TCAA 2HRQA 3MTBA 2J3DA 3D5EA 3T15A 3BULA 3H97A 4EAAA 3F97A 1SCUB 2QRKA 1U6IA 3PF9A 3R0VA 2PX3A 4U9HS 1M1NA 2ISCA 3NC4A 3USES 2GDZA 1WDTA 3O82A 3FDIA 5C7IO 1M8PA 1US8A 1DEAA 2J08A 3MFYA 3A4IA 1BRTA 2AOUA 1DLJA 1N9ZA 5HUHA 1ND6A 1Z5NA 5CJ2A 3JD4A 1E3DA 5JQWA 5CM8B 1B0AA 1VBKA 1ESEA 5DW3A 3FGPA 3FNFA 1XNHA 4FBGA 1F8GA 3W2HA 1HETA 3ZE7A 2OUKA 1YHYA 1I9CA 3MWDA 4EUEA 5C5EA 1QRTA 1ULAA 2XA9A 2Y27A 5AM0A 3KB6A 1WULS 2X5KO 2CN1A 3GJRA 4IO0A 5EMNA 2FHPA 5K09A 3TTSA 2I7XA 4JBGA 3U4QB 1S1MA 3Q6MA 1LPSA 3KJGA 1MH9A 1NMYA 4LJ9A 3EGXB 3OICA 4H4EA 1FRQA 3KL4A 4LTNA 3SQOA 4J9UE 3ZQJA 4BYMA 2UZIR 4HC4A 4DXAA 3HXMA 3KZKA 1CDOA 1D4AA 1E1QD 1VSTA 3FUUA 1YCFA 4D9IA 3RS4A 4EYOA 1YZTA 3KSAC 1CIPA 1JL3A 4WOBA 4IO1A 3RUPA 1K88A 1KYTA 2ZROA 3T7SA 3A4NA 3WLJA 3IODA 3MQ4A 1N7IA 4RTRA 4MVJA 1S96A 5DWVA 3EBLA 3LUGA 3S3TA 2ZYIA 3TW6A 3WBJA 1E2EA 1SBHA 2ZSUA 4HWKA 1Y63A 4EJFA 2JRCA 5H59A 1ZUWA 3E3LA 4M1EA 2JFHA 1BYIA 2Q6OA 3P94A 4EGAA 2FDXA 1Q0TA 4ED9A 4UZFA 5AVQA 2G5GX 2DC1A 4US2R 1PVVA 1UFRA 2IZZA 1TA9A 3D6JA 5AM2A 4YIHA 3T99A 3NTQA 3HB4X 2GCPA 1CF9A 4R2WA 4ZU1X 4G4SO 2P3QA 3A1VA 3GFQA 3WQSB 3IMKA 1WDMA 2BFAA 3RHSA 1HL3A 3KRTA 2PY6A 3L8ZA 4OBWA 4EDHA 4AWBA 4UVDA 4UEOA 5FOXA 2H8KA 3QFFA 3UJDA 4F8EA 1TQ2A 4QPJC 4DYVA 2YUIA 1XJ5A 3LIPA 5SYMA 2OZKA 5BN5B 3FPCA 1JT2A 5E0KB 1XVIA 2HJWA 2PZAA 4JLUA 3BRWD 5EZ6B 3UC5A 3OF5A 4FEYA 4K3UA 2VJDA 2JLAA 4HD8A 4R6XA 4Q7EA 5HBGA 3X1XA 4U6SA 2REQA 4ZVQA 1SVOA 3LPLA 5E0OA 4IIVA 5CNMA 9LDBA 3KBOA 4P3PA 4LFCB 1A2KC 2BEUA 1YWGO 3RKSA 4JU8A 4EPWA 3AL2A 5KC8A 4U7JA 4I6JA 3QWHA 4HF7A 4OKSA 4UE6A 2E2WA 1MJGA 1UWVA 1EFPB 4LOAA 4V2UA 2I6TA 3FGNA 3DDSA 3RROA 1H5QA 1OGJA 2P6NA 3MF4A 5DXJA 4NJMB 1BMDA 1PGNA 4LRYA 1GM5A 1Y1KE 4RMHA 2ZRMA 3K5HA 5EQJB 4UUOA 4RW0A 1H5UA 3U4CA 1XU9A 1UKEA 2ZDQA 3VH3A 1ZI9A 2C57A 1SU6A 1O2DA 1J97A 1MJ5A 5IAKA 4ARSA 4L15A 3FR8A 5AXBA 1W52X 1XN4A 2XMPA 2PV7A 2VKQA 4F3RA 1JHYA 1PQYA 3UWKA 1AZTA 1B8NA 1P1JA 2CFIA 4KBGA 4Y6LA 3SHTA 4D5GA 1DTWA 1U3TA 2VHUA 4CZ2A 3ND6A 1Z82A 1ZU4A 1HDCA 5LBUA 3MD9A 2A9RA 2FPGA 2PX8A 4JC4A 4QUJA 2QE7A 1QIFA 4D4LA 1LNZA 5DHQA 3U6BA 4O1MA 3ICQB 1MA0A 3IILA 5LQCA 1V9SA 2H5IA 1BN6A 3U7EB 2O8EA 3UYKA 1Z2EA 3SF8B 2H2FA 1G98A 2FU5C 2YY7A 3DDHA 2XBMA 3ZDXB 1A88A 4YN3A 3X43A 1E0SA 4MR8B 1NNSA 3VPGA 1WZ2A 2PZGA 3N58A 4M9SA 4OK6A 1DOAA 2C84A 2FMHA 2LDXA 3SX4A 3X3HA 1Y80A 1LUAA 1VB5A 3K15A 3O5AA 2Q62A 1MB4A 1P19A 3O8CA 4D6XA 1CK4A 1TZKA 2YY6A 3KO8A 2N75A 4L74A 2AW5A 1G0OA 2F3UA 3ECSA 3C0KA 4TSFD 4GBED 2ZRQA 3GGJA 3N2LA 2VRWA 1XKXA 2Q5JA 3WAGA 1FJGB 5ARDA 2VF5X 1TE2A 5REQA 2IHYA 3GLIE 2C96A 2DJ5A 2PL5A 4M55A 4NBSA 3FUTA 4F85A 3N8KA 2O8FA 3N6VA 1DWOA 3TAHA 2AF3C 1AKUA 4QPCA 1C9MA 1FS4A 3TUIC 1A77A 2Y67A 3D59A 1IN1A 2QZJA 4OXRA 2QDXA 3G5TA 2Z2JA 4Y6PA 3R0JA 2GEJA 4LK3A 1LBQA 3BXPA 4ZV9A 3W6PA 1FRNA 4REMA 4JI7B 1QX4A 2ZB3A 4MWEA 2YC2C 3RS7A 4BO8A 4UCXA 1EVEA 2QLMA 4WKGA 2V74B 4URZR 1DRWA 3MSXA 4PGMA 1KYIA 4C7OB 1D07A 1T9GR 4KXWA 5T3YA 4YRGA 1GV1A 4S04A 1L7PA 1YR9A 2H9IA 4J0IA 4JVSB 2QNIA 5CH5A 1NUHA 3D8BA 3DA8A 2YRFA 4KKXB 4M1MA 3N76A 2G88A 1J8QA 4A0SA 3X2SA 4C20A 1U8FO 3G6KA 4QRHA 3RSLA 2OK8A 3SNHA 3D5QA 1GZDA 5G1PA 2GMWA 4DQXA 1LF0A 3SOZA 4ECAA 1VTKA 4RLSA 4WINA 4B40A 5FF9A 1MQAA 4LYGA 3ML1A 4ISCA 3VV2A 1A1VA 1TJ3A 3JCZA 4AURA 4JLMA 1X1TA 5HNKA 4YXWD 3EWSA 3WLHA 2QTZA 1Q95A 2BTEA 1L1QA 4LXTA 4YRNA 1DE0A 1W88B 4JJ8A 3TX6A 4LFBB 1T0UA 4MKIA 2WJVA 3M3DA 4AKSA 3I1IA 2QUAA 2C7VA 5GMOA 3FYUB 1QVAA 3ZE8A 2WYVA 1W85B 2VS1A 2JVIA 2I5PO 4EITA 1KQGA 1BXKA 1KC1A 3A9VA 1GG8A 3NAZA 1TVKA 1ZK3A 3FMVA 4K9OA 4L27A 5BNWA 4XTCS 3A1DA 2PZKA 3WGKA 5H8WA 4L5YA 1UADA 3UV7A 3C43A 5FULA 1QG4A 4UBOA 4XYLA 2J3HA 3L6OO 4GBMA 5FJJA 3I9JA 4OXIA 2K7FA 3ZPXA 1BO6A 7REQA 2OBMA 3A14A 3WWPA 1JLMA 1IHUA 2JD2A 5L3RA 4HQFA 4MUGA 2JIZA 2FUCA 1SBTA 2OVFA 1HTWA 4KQXA 5I8PA 1RPNA 1TM5E 2ZCVA 3AINA 3PFCA 3TE7A 4PR0A 5B58C 3JSAA 2DT5A 4JB0A 2M98A 2F90A 5EQTA 2GYWA 5IAJA 4EKIA 4AX4A 1ULUA 4LWOA 2YFQA 1CUUA 5FNVA 1QYWA 1Z4NA 1NXXA 2H4JA 4B3JA 3PUIA 1LQ2A 2B6HA 2QR5A 1GVNB 2PGJA 2RB5A 2W2QA 3DMGA 3HA3A 4RH0A 2HSZA 4NNJA 4IXTA 1YL7A 3CZAA 5EMJA 5AVJA 1ML3A 1P80A 1HEUA 3G8CA 3NYIA 2Q4RA 5IBPA 1CF4A 1J8VA 4GYKA 3RUCA 4QEDA 4CRWB 5CW2A 3VPFA 1EG7A 2BKLA 3RFUA 3UT5B 5B6PA 5HWSA 1Z35A 3U7IA 3ONFA 3UQYS 1WJGA 3FFAA 4EVQA 4YLEA 1GAEO 1SBCA 4LAFA 3PPWA 4WDQA 1T9HA 1RWNA 3R5SA 2X8JA 5CH3A 2I6XA 1G42A 1GL3A 2PZFA 2WHPA 4X54A 1H0RA 3OCYA 4B0PA 1YGYA 2C4WA 3C3YA 3FOCA 5LCXA 3LYAA 4HTAA 2QTNA 2RGNC 1FX0B 4C22A 2FEOA 1GGNA 1LBHA 2A86A 4I1SA 5LLTA 4JR0A 4RL4A 3U9LA 2FSPA 4DV2B 1BDHA 1NMZA 3HPRA 1WKBA 3QLUA 1KBOA 5FL3A 2RIRA 4IH9A 3PS9A 3E3AA 4WXRA 3OZSA 4F72A 1H66A 1N2BA 1W1WA 2I33A 3RVQA 1JE1A 6REQA 1CUXA 1CQXA 1R6TA 2DBRA 2ZREA 4WK6A 3GNLA 3RJ9A 4D92A 3CNHA 1VYVA 5LFAA 1R50A 1ZP6A 2FN8A 4G36A 3GJ5A 5CIQA 4C3ZA 1M0SA 3T1YB 1YA8A 4LHWA 4CKCB 4D99A 1E64A 4DIBA 2GWRA 2ZS7A 1DLIA 5BN1A 2C7PA 1JAYA 1HC7A 1YTUA 4I2VA 3ZHOA 3DE2X 5EZYB 1UXGA 1V3UA 1VZ3A 2OENG 2YZ2A 4NAUA 2FUG1 5TSDA 2VF8A 2NO0A 3THWA 4HFRA 1D2GA 4HWSA 5EERA 3SC4A 3GLRA 3C41J 3BN3A 3KOMA 1SUPA 2ODWA 3V7UA 2M6SA 1NM5C 3LT4A 1U2ZA 1YRHA 2P1ZA 3TZHA 3BDVA 2C2MA 4II2A 3AF1A 1QUEA 5DM4A 4AO8A 3TMAA 1UL1X 2P9FA 5KTYA 2VYVD 3V7NA 2GRAA 5D84A 1SIWA 1H1TA 3T3OA 2QLJA 3B5EA 4DEYA 2VO1A 3WJ7A 3W4JA 4Z1MD 5FDFA 3WISA 2DH6A 2WP0A 5DIFA 3GELA 4C6SA 4PY2A 5FBHA 3IT3A 2EVWX 5BUCA 3MS7A 3OPYI 5C8YB 5CJJA 2O7SA 2FFJA 2CL5A 4FSDA 4I6GA 4MWTA 5JJCA 3IS3A 2EFEB 1P4AA 3WYDA 1FQJA 3W7AA 2JLBA 4GAEA 4ABYA 4X1KB 3FG9A 2O1SA 1E20A 4PM4A 3BFKA 2QAIA 2WKQA 4J76A 1NJ2A 3BWXA 3R0ZA 1ABFA 3NI2A 1ADBA 2QD2A 4RUKA 3T5GA 1REQA 1E3MA 3A11A 4X8LA 3LJKA 3NWJA 2NVWA 3DXZA 1NM5A 5M04A 3PRKE 4LZOA 1YQXA 3NZEA 4FHFA 3QY0A 4F3NA 5AVZA 4OYLA 3EZYA 3F9RA 1MV5A 1WD5A 3EGVA 2XD9A 1KI9A 3IDSA 4Q9NA 2IQ5A 5KSPA 4XIGS 3NVAA 5JBIA 3AM5A 3K9BA 1N2IA 2W0MA 2WAMA 4G5SA 2FK7A 2G7ZA 4G65A 4YBZA 5C35A 3SIXA 4DPMA 3KLPX 5DLEA 1PUJA 4O1IA 5KTOA 5BW4A 1Y7IA 1A9XB 1QLJA 2F9MA 3CLTD 1G17A 1PT6A 4XAQA 1NVTA 4E03A 1RYYA 1YL6A 3ST7A 3KKEA 2X58A 5AO9A 3L7DA 3SSMA 2AF4C 3ND9A 1SZJG 4M7RA 4Y2GA 1ADGA 1XEWX 2ECFA 1RMYA 3DKRA 3I6IA 3LUHA 3M34A 3C4QA 2RJNA 3K0FA 2FR1A 1PNVA 1FU7A 1Z2AA 2I4NA 4I3FA 1K4MA 5IF3A 3I9FA 1CY6A 3VU3A 3BQNB 1T3LA 2JIRA 1BGWA 3O4VA 3O4JA 2Y6VA 4KO2S 4H35A 3O4RA 2NU8B 3ZD9A 3CRZA 4WNAA 1BD4A 1EWRA 1NATA 2W98A 4P53A 1G8KA 2C9MA 3IA2A 5CR9A 1WIWA 3LS2A 2J3QA 4L28A 5COQA 3CE6A 5EQFA 3T9EA 3TN7A 4D45A 3OQOA 2QTAA 4QU5A 4N6OA 3CJRA 4X6LA 1DKUA 1K7FB 3B3FA 3PNOA 4M1WA 3RSQA 5HZKA 2M1XA 2NX2A 2O8VA 4RQTA 1QFZA 2UYQA 1OOEA 2R65A 2BT4A 1TW3A 3BE4A 4NZOA 2CVQA 1RBMA 2PS1A 3AVVA 4HLQB 1CVRA 2WZDA 3VVBA 4KPUA 1XZHA 4QPDA 2H65A 1JPUA 2WYUA 4QQRA 5D6NA 1HR0B 3IELA 2EL7A 2OBBA 5EJMA 3WLAA 4U39A 1J42A 1C3OB 3AI7A 4YP7A 5A1TA 3ZNQA 3HACA 4C3VA 5ABPA 5KB3A 2C0QA 4JT9A 4FFVA 2DBVO 3DEAA 1IBKB 2AG6A 2Q3LA 1OBOA 2NXEA 2W4MA 1IM2A 1ZQ1A 3IRUA 2QYSA 3KU4A 2BGUA 3PQCA 4Y6QA 3OZTA 2C92A 3AQ4A 3F8TA 4HKTA 4AY5A 4WKOA 1WB5A 4G1FA 2H7YA 1UH5A 3F7NA 4IUCS 1DSSG 2WIAA 3ICOA 4EY5A 2H59A 1E1CB 3JYNA 4LDRA 9LDTA 5KTSA 1G16A 5E4FA 3LVRE 1GZHB 1ZH2A 3OE7D 1SXIA 2HB6A 3NO4A 3ASVA 5E1BA 3IP3A 2O8BA 1KK1A 4FXPA 1UOOA 2D2VA 2NTJA 4QAQA 4A10A 4EY3A 3V4RA 3L0PA 4HDAA 4ZIRA 2DUUA 4BL5A 2GSDA 3AO0B 3O94A 1C9NA 1JQAA 3TKLA 1MOPA 4BLOA 3IP9A 3IOYA 2ATXA 3MHPA 3KLMX 4MIOA 4N9WA 1ZH6A 3HZRA 1WCIB 1YNOA 2GERA 2NZUG 2WG2A 3CPEA 3KDAA 3KTAA 3PFGA 4Y9DA 5KYGA 2F55A 4URWR 2W6NA 5GM2A 1AGYA 4L57A 3NBUA 4EGCB 1XPOA 4ZVRA 1Z2PX 5HS6A 3SZRA 2LXNA 5FBVB 2WWWA 4AP9A 4DA4A 2JJMA 4YO7A 3TLKA 4FK8A 5EPEA 2H1IA 1Q7EA 4NU8X 3DDZX 4RPGA 3MFQA 3LCUA 4PC2A 4H7KA 1CULC 2DUNA 4IDHA 4IIXA 3KT0A 3ZIAA 1IB0A 1T5HX 1RU3A 4EHJA 1WXIA 4FMDF 3DAHA 3FB4A 2IV3A 1BE0A 2BBSA 2PD4A 2R6ZA 5JAUA 2O0MA 1W5BA 1ZOIA 3TINA 4A6DA 2Q9UA 1W59A 3E05A 1DBWA 3HCFA 4QE3A 4RZIA 3UGKA 3THYA 1A7UA 3A2NA 2O0KA 4DM4A 1JZQA 4F9FA 2BHLA 2B99A 3COPA 4HL6A 3ROKA 1DAIA 4RM3A 1CUHA 3VAYA 3LDFA 1R10A 3HS3A 2O8DB 3HMKA 4NMLA 3W5HA 2QPOA 2ZTUA 3GZTB 4IICA 3EDMA 1EDBA 2C03A 3B3AA 4CLEA 2PUTA 1N5RA 2AZDA 2EAUA 2PUWA 2HQBA 3K1AB 4X3CA 4DC9A 1PNOA 1Q1AA 3DNPA 3F7MA 2FZ5A 3AEXA 2HJ9A 3L5OA 2PYIA 4MWSA 2IUSA 3DLAA 1I3KA 3QMPA 1E7RA 1H6BA 3BIXA 3D3EA 4QSMA 1HO3A 3CE9A 5FWYA 4DUGD 3MCUA 4Z4EA 4CTMA 2ZP1A 3P0EA 3IBSA 4OYHA 2GRJA 2VUUA 4M21A 4PHCA 4HDKA 4M53A 4UXHA 3OZVA 4QA9A 5JNSA 3T3EA 3JD3A 4HP8A 4PX9A 1PFQA 4CM8A 4CVNA 1B14A 3T4EA 3PX3A 3PHJA 4OQYA 5KHLB 1ARZA 3NHRA 1N2JA 1HSOA 1JYFA 1QQ6A 2BY4A 2GLTA 5AH0A 3ZK7A 2A35A 4HRYA 3MPOA 3AWDA 3O1LA 3O74A 4N0EA 4UHCA 5BRJA 1N5OX 4MMZB 3EODA 1H6AA 2CSUA 2R1VB 3LQQA 4FDVA 3G02A 4PEVA 3VTKA 3D3QA 3MRSA 4JFRA 4GPIB 4V3BA 2A5DA 1G8JA 4K1XA 1DC7A 1Z4OA 3STVA 4QZVA 5CURA 5IRCD 2C4VA 2RKBA 3FFTA 1Y1SA 2CFSA 2NU6A 4JCOA 4BP9A 1JNYA 3GDWA 5JALA 3AXSA 1KY4A 4XSHA 3BH7A 1GAWA 2H1CA 1M34E 4L4UA 4CF5A 2GD0A 3LT0A 4UU8A 5LC1A 1SC1A 2QWXA 2PPLA 3WB9A 4PONA 1GZSA 5DTIA 3B70A 4ZAZA 3HA2A 1EAYA 3CVOA 3ENVA 5EPUA 5F9FA 1KDRA 1FMLA 3QELB 4B8YA 4I4LA 1J2JA 1PP4A 2LCIA 2HA0A 4Q7MB 3D0QA 2EYUA 4R7GA 3ECAA 1YHNA 2EJVA 2OMKA 3OX3A 4RA6B 5JQGA 1W1IA 2F67A 3K8ZA 1TUBB 4AUEA 4BQIA 4REQB 4BEJA 3GCXA 1L7NA 4PGAA 1LPOA 2C20A 1NP6A 2H2WA 2HA4A 3HN6A 4RXTA 3GAAA 1ULHA 4FBMA 1SXPA 4GP6A 4GS5A 4OBXA 3IIEA 1PZXA 4D6PA 1D7AA 4EI7A 1XYVA 4QPZA 2QR3A 4XGNA 4N3CA 1G6HA 4BV3A 3FKSD 1Y1PA 1E3LA 4RDCA 1IHXA 4YRDA 3V46A 1U7ZA 1RACA 3BE8A 1LDMA 1N6NA 4GYWA 2YWDA 4HFNA 2V3VA 2HV9A 2L17A 1GPKA 4UEWA 5A3RA 4QULA 1PK8A 5K8CA 1SCJA 4ZOBA 3FPLA 1Y33E 3R41A 2E55A 2HGZA 4IXWA 3LLSA 4RVUA 4QM7A 4RY8A 5FUXA 1TEZA 2JGJA 1T8RA 4B75A 2H6EA 1V6CA 4BEWA 5A2GA 3DXXA 3GLGE 1O9HA 4ZZ1A 4P0TA 1E3IA 2NUAA 5A4JA 4EHBA 3HUDA 3UCXA 2OFPA 4AUNA 1J7JA 5HILA 1Q20A 2V8BA 2AFHA 3MAJA 3MRTA 2H7VA 2OB2A 4N6NA 4RJIA 3AOEA 3OM1A 4J03A 4F60A 4BE7B 4PRZA 2I9PA 3IBYA 1E9AA 5FX2A 4HUQA 2I3AA 1OFHA 3OWHA 4RSRA 4ZCSA 3AHDA 2C5AA 4E08A 1P7CA 2A7XA 4CFZA 5IMSA 4E5SA 5J2UF 4Y2TA 5K0ZA 3A6ZA 4N8EA 5CTAA 2G0TA 3GJ6A 1TECE 1BHSA 2SKEA 3RRMA 4LE2A 5THKA 4ARUA 1BC5A 2B36A 2AZXA 4UJ5A 1ONNA 1KI6B 2DYKA 5A5EA 1V45E 2GBLC 5G53C 4G89A 2XT9A 1VI2A 3V32A 5AHXA 3RVRA 3PUWA 5IVDA 5KCZA 3IQIX 4P81A 2I3DA 1JA0A 4MZXA 5KAPA 1JEOA 1GQOA 2VT7A 3GYBA 1ILEA 5EE0A 3I1YA 2GM9A 4OSPA 3GLFB 3TNYA 1XHEA 5FUMA 2I71A 4O0LA 4EF6A 4EPRA 3LY7A 2GM5A 1Z16A 2JHGA 1YE8A 2B25A 4GPTA 1KZHA 3UK1A 4DB2A 3MJCA 1EX6A 4W5WA 5A9SB 4L72A 2YOFA 4U2DA 3RVPA 8ADHA 3KOWA 2EDCA 2C29D 2O1XA 2OXEA 3HLTA 3HXKA 2C1ZA 3VXKA 5D1HA 2C7RA 5HZGA 1YQDA 5K20A 5FR2A 3IPAA 2C9ZA 2I6SA 4PG6A 2YTZA 4LJAA 4W6QA 1XKTA 1XQYA 4AO7A 2XUZA 2GRUA 3L40A 3AUUA 3ZTWA 4EFKA 2XYGA 4KDEA 2OHJA 1UMKA 3MLBA 3ORYA 2XHZA 3VV3A 3OX1A 4PIPA 1XZ8A 4TYMA 2GBLA 4WNIA 4CUKA 1YMQA 2QZSA 3ANSA 4QYIB 1YBHA 3JYLA 4UJ3A 3PJEA 3VSEA 2R6DA 3QNWA 4HXYA 5U1PA 1GL7A 4AS2A 2OGWA 3P4XA 3D8SA 2Y92A 1TK9A 1XNGA 3SQDA 4HCJA 1W75A 4WI1A 2W6MA 2FPKA 4EYQA 4IGFA 3IAHA 1E59A 4AKIA 4L8WB 2HTEA 4BLSA 3KS9A 5F9HA 3IALA 2H4XA 2ZSAA 3OWXA 1ZVMA 3MTAA 1CUDA 2Y0PA 4K03A 2MYUA 5DJ5A 1TZJA 2Z8YM 2YWGA 1QP7A 2OHFA 1Z06A 3ITKA 4JIMA 3T3MB 4MPRA 3AFOA 1G7SA 2NVOA 1QYXA 3P52A 1LVGA 4P33A 3AR3A 4LZWA 3ZW7A 2C3PA 1NPDA 4G1EB 3PHLA 4MR9B 1AS0A 4JP1A 4PO8A 4HNHA 3T1QA 3KHTA 4N41A 1NW4A 4ZYLA 2E85A 2ZRGA 1J5XA 1XN1A 3A9RA 1MDBA 2UUPA 3OIGA 2O2HA 5HKKD 4E5VA 1VB3A 3O7MA 1XSEA 4EHHA 1P2TA 1RAFA 4JS0A 3TCKA 4B2LA 1OLXA 3IVXA 4Q34A 1GRCA 2XKKA 1PQ4A 4YUZA 2YWBA 5EKSA 1FFYA 1XMIA 1KTIA 1BWQA 1I1QB 2PU5A 3HJHA 4KAJA 5D3ZA 2R84A 4RK7A 5DEOA 2HK6A 4DNOA 4V1CI 5ERYA 2C2YA 2VXCA 2WFMA 4TS4A 4HZUB 4DKXA 2EJWA 5F1YA 4TLAA 4BRSA 4KBYA 5K3OA 4MR7B 2ZPUA 2VK2A 3EGEA 3NHZA 1KYZA 1PVDA 1YC2A 3GARA 4QIHA 1TA4A 3H9EO 1A2BA 1SD1A 3SX0A 2XZLA 4YRKA 4Y7CA 5THXA 4TT3D 5J5AA 1W7AA 4AZ3B 1AB6A 2WA2A 4GVPA 1OB5A 3RC8A 5ARCA 4PYMA 5BSMA 4ITVA 4Y2QA 5ALKA 2P79A 1AK2A 3A7DA 4BPRA 2JLXA 1G8GA 3KVYA 2Y68A 5H83A 5KJFA 4ID3A 1EFAA 2GCGA 4NAHA 1RHMA 2PHZA 1Q0QA 2Y1KA 2W8BB 2RCYA 1TO1E 1F6BA 4OO3A 2ZKIA 5LOVA 4IHQA 4FNGA 2NUTB 3CX7A 1S2DA 5BT9A 2Q9BA 2Q3DA 4G0MA 3UVEA 3MUNA 1AQNA 3CH7A 3E5NA 1YZFA 5B2EA 2CWWA 4XWKA 4TWBA 3TVTA 4C5AA 3EXIB 4GKBA 4OP2A 4WERA 3KKNA 1E4EB 1ESDA 3QH4A 4UMVA 4M1YA 4WBSA 1YJBA 1ZLYA 5AKGA 2CNWD 3LFUA 3V8MA 4M54A 4S2UA 1D1PA 2WUEA 5IK2D 1II0A 1TPZA 1E69A 1W47A 4NABA 4EX6A 2R9VA 3GWZA 4RVOA 1NG9A 3Q4GA 1G9XA 1X1QA 1T6XA 3TTTA 4RCYA 1FB5A 4UC0A 4UHHA 1JTFA 5ICCA 5LMZA 4PYNA 3QITA 3K3PA 4H7PA 4TTVA 1TYDE 4LF5B 2PL9A 3DL0A 5F9MA 1RWXA 1SHJA 4K6KA 3RS8A 4ZOEA 5IM5A 1XRRA 3KBBA 4II7A 3PPIA 5EJFA 1N8TA 4Z9AA 4NJOA 1Y5RA 4GL2A 1FLAA 2BCGY 2P90A 4YR7A 1PGJA 3RJZA 3BRQA 1O3YA 4W5TA 2WJAA 1GHTA 2XRZA 3WNZA 3AM4A 3BXGA 3RRYA 1FUIA 2H0RA 3I2YX 2OFXA 4ZHQB 5IULC 1FIUA 4PC6A 4KREA 3BCHA 2NP7A 3HXLA 2VNSA 4EHNA 2WG0A 2QD1A 4ALIA 1NPYA 4LXHA 4X8OA 5KTTA 4WADA 4HB0A 3MCVA 3L2OB 4UTNA 1Q92A 3BKWA 5KYYB 3BB4A 5BN3A 1STOA 5I7SA 2IPXA 3PWSA 3R5JA 2H18A 1PR6A 2QL5A 2VF7A 2O3SA 4KIWA 4Q39A 3OZDA 1NT2A 1DEKA 3EIEA 3H9GA 2EJCA 3ZV4A 1E0JA 4KIFA 4D41A 2VHCA 4EP1A 4MYUA 3OF3A 3AY7A 3IVRA 1CHDA 3TW4A 4YRAA 1DEHA 3C7TA 3P0FA 3J81A 4HLDA 4IJWA 4MUFA 3K0HA 3FTQA 1AB5A 1RWBA 4WRRA 5K0TA 2X42A 3EQ8A 5FBRB 4K0KB 1LNQA 1JQ5A 2AQHA 3OKFA 3RH0A 3NEPX 1A9ZA 4KBFA 2PGIA 1PK9A 3JR7A 4BGDA 4Q1EA 1H2XA 2XYRA 2G77B 4PC7A 5DM1A 4BGIA 3T0FA 4RKQA 1V6AA 1DPGA 1BOFA 3A26A 5TF0A 3ICWA 3SHVA 3SGLA 1YRYE 2R7AA 1Y4ZA 3EC1A 3L6CA 3MVEA 4QHSA 1ZH4A 3B5IA 3OF2A 2GFQA 1XU4A 1E6UA 2JJYA 4IIYA 1XDSA 3CX6A 3GDFA 3OEWA 4HVTA 3L04A 4B33A 5K0SA 3SBOA 1GR0A 1ZN9A 3KOXA 4OGWA 2A84A 4KDCA 2RARA 1RAIA 4MUHA 4E07A 8ATCA 1W48A 2X40A 1JXQA 4O08A 5I4IA 3D8HA 1QOZA 3KQPA 3PPXA 4JLJA 2ZZMA 3KD3A 1GXSB 4X61A 3KJQA 1V16B 1X1CA 5ICSA 4J1SA 1N6PA 1OPXA 4JYPA 3QFCA 1I9GA 4AKHA 2FZEA 3DE1X 4KNWA 1TT5B 2X0FA 5I01A 4RGQA 4AD8A 4ZYVA 3V1YA 3LHFA 2QOEA 4RA9A 5FFNA 4JLAA 1L7EA 4LJ5A 2H7XA 4X9XA 4FB5A 5IFLA 2QI9F 3R5XA 1MIHA 1G38A 5F77A 2IEDA 2Q3FA 1RVDA 4ETMA 1UDRA 2R7LA 2JS7A 4ND1A 4K9PA 1EBFA 5B64A 1HLDA 4FOTA 4GH5A 3V48A 4XD7A 2XJ4A 1UMBA 2BEJA 2H63A 4B4KA 4DOMA 5LZ9A 2J85A 3T5PA 3H9UA 5EIOA 5AW3A 4HK4A 5HK8A 1T1JA 5AHOA 3S2EA 3ZHSA 1GCOA 3KPWA 4BV2A 3VOSA 3AHEA 2FSIA 5JH7B 5EUCA 1JQKA 3G7UA 3BGOS 3PYLA 2ZIXA 3IHKA 3ZH2A 3ZV7A 3BB3A 3DXYA 4NBUA 5JS7A 3GLFE 1KO7A 1R37A 3ERCA 4U2KA 3OX4A 3KKMA 1SOWA 1MVLA 4HGZA 4J7AA 5JARA 1E1KA 4UNPA 2AKYA 2NQTA 3DZKA 2CLKB 4QAJA 4BQFA 1C3XA 5JNRA 1KH2A 2I2DA 4KN6A 1M1XB 4LRUA 3F1LA 1V5FA 2OFFA 1ZJWA 1OI2A 2G1KA 1IZ9A 2ODAA 2CXQA 2PUVA 2BR4A 3FIUA 4KPGA 1Z17A 2VK1A 3DD5A 2GARA 4CI9A 4CUJA 1C7EA 5DBFA 3L9XA 4DJ5X 1T6YA 4NOLA 1XJQA 2TECE 4LHEA 2Q5IA 1LSUA 3SY8A 3ZN2A 1RLUA 5HG0A 1VRWA 1EH5A 4PLPA 2ZJ8A 2FPLA 2W2KA 2NACA 3L02A 1VSBA 3USZA 4ZRDA 4JYBA 3Q6NA 3IOEA 4KX5A 3V2GA 4DA7A 2C9DA 4RH3A 2DBZA 4H17A 3N1UA 1AY0A 2ONYA 3WP0A 1OXTA 4YJHB 3GRZA 2PX6A 1SKMA 1FFWA 1DOHA 3MQ2A 3AM1A 2HEIA 4LRXA 1BTOA 5JD3A 3FRHA 2QI9C 3ME5A 3OPXA 5CX1B 1KRXA 1KEPA 1NVEA 1ZMRA 2YWHA 3CLSC 3JZIA 5KNDA 3OZUA 2WM2A 1E9DA 1P8AA 5EJ5A 1YUMA 2W70A 1XVLA 3F46A 2CL0X 4IGAA 4M0PA 1D8AA 3T7AA 2YX1A 5HKLA 1WXFA 1WRBA 4BKMA 5BP7A 2C3OA 4IDCA 5FWAA 4A73A 1JKJA 5FAXA 3R9KA 1EEXB 1AE1A 4J2OA 2PWBA 2CNDA 3B9PA 1D2HA 2HKIA 2ZJFA 4AVYA 3ITEA 3M1LA 1DKMA 1PKEA 4GDMA 4NMMA 4UULA 1I4OA 4C0JA 2YBEA 4QXPA 3EOBI 5HXAA 3WOVA 3MQFA 4N82A 4N5LA 1LK0A 2J5KA 2M1ZA 5FTWA 3RG2A 3LDHA 3NYWA 1X42A 4G01B 2B30A 5TQ2A 1TM4E 4C43A 5HJEA 4AF7A 1QGUB 3UCFA 1M1YA 2WJ6A 3DKKA 4DIKA 3RS3A 5CNIA 1QH1B 1OYVA 5EJ6A 1DU4A 3E0QA 3K9GA 4ZOAA 3TLZA 2O2YA 2QRJA 1EA5A 3ZQUA 4HNTA 1IWBB 3AZQA 1ZOPA 4R9UC 1G5RA 4H6XA 5EKDA 4NS1A 5T8KC 3SD7A 4CMKA 4MJ7A 4CM1A 1UXJA 4E2FA 2PUGA 2Q1XA 3W1VA 3DWIA 2FGKA 4R2XA 4AXXA 1WXHA 4QGAA 1OWOA 2PEZA 3E53A 3E8SA 1C3EA 2OCPA 3FCAA 3K6JA 4OH7A 3LKVA 5HVNA 5JDIC 3CIFA 1QIMA 1E61A 1A7JA 2RC5A 5ALRA 5KYNA 3GP3A 4DDHA 2H16A 1ESZA 5DNYB 1CNEA 5LB4A 4AJEA 3BL8A 3QE2A 1LBIA 4P7BA 3RWOA 1M5RA 3KE9A 1M0EA 4QXOA 4ZQEA 3K9LA 2XUGA 3TYXA 4AIIA 2HEGA 1HFWA 4CMIA 1GUBA 1QO9A 3LVQE 1A97A 2PD6A 4ZCIA 2NVUA 5SY6A 5FYDA 4MGHA 3LC7O 5LNK6 3MS2A 1SELA 2DLNA 1EFDN 2O6HA 3IKMB 3NBXX 3IKVA 2O5CA 1LLQA 1XP5A 3AIIA 3EF0A 1ABBA 4WL0A 4A36A 2B61A 3BMCB 1Y0BA 4J3JA 1GRRA 3S1SA 3OD1A 4MKGA 1QF9A 5T8KA 4FE4A 2J46A 4AQYB 4JX8A 4TV9F 3TX2A 5SICE 3HVKA 2ZSJA 2A5YB 3N53A 4ARAA 3ETJA 2C4NA 1WE2A 3K8YA 3KL2A 3EDQA 3N70A 3KOUA 2W6ID 3NHJA 4QBIA 4OQDA 4TKVB 5E6UA 1UK8A 2M6RA 3DZBA 3KHSA 4HMPA 4P1ZA 4Y2UA 3HI4A 4BQRA 1R5OA 3R23A 4AS3A 1X6VA 4H16A 1ZKDA 4LOHA 3DFZA 2IXEA 2OSVA 4Q82A 1XQXA 3I32A 3JQQA 1G9TA 3TI9A 1NQOA 4JX9A 4YMUA 4WJZA 2JVJA 2Z56A 1Z07A 2Z4SA 4ZAFA 3WHIA 3RHFA 4LHSA 1RYHA 3MXOA 4DAOA 2AOTB 4OQFA 4JBXA 2VDQB 1EFLA 1H6DA 4QU8A 4UHEA 5HGJA 4BP3A 1ZGHA 3MTGA 4LCJA 4LVOA 5E95A 1AXEA 1VIVA 1ZIDA 4DW8A 1KQFA 4KHPB 1JKFA 1ONOA 1Q0SA 3F5QA 1U1GA 2V7TA 4D4HA 5IDQA 1QU2A 8ABPA 4V39A 5CFLA 1ZSNA 3LRTA 2REXB 3DOOA 1KYVA 3AJ8A 3DC2A 5EHZA 5I9LA 3HKDA 5EWLB 2ZAOA 4V02A 4WUVA 5JCZA 1P5RA 2BC9A 2C77A 1HQKA 2KJQA 1JLLB 3EEIA 3FBTA 2J4CA 3E48A 2OL4A 3LA6A 5DISB 2PXHA 2B9VA 1BH6A 2DHDA 4WVLA 3PVZA 2I2CA 1EFHA 3LUJA 1SCDA 2DWPA 4MMXB 3NTRA 2G83A 4G0PA 5L3SA 3HFJA 2BFFA 2W2VA 4BNNA 4ZICA 1U7WA 3BD6A 4NYJR 4BZZA 5H1YA 2HRDA 2K4MA 3ZD7A 4LJ6A 2GKGA 4HB3A 4O4LB 1GDHA 3DBHA 1ZG3A 1P0MA 3GEEA 2HUNA 1DCFA 2HBYA 3AEQB 2PH3A 3TUJC 1FTNA 5E2BA 4RAQA 4RD3A 3FWNA 3H0KA 3MGKA 1Y8QA 4QVGA 4DR1B 2F9LA 2UAGA 3FCSB 3G3EA 1AO3A 5KCMA 2NO4A 4DNPA 3HC7A 4JEMA 2CZCA 2ZJ7A 1VMEA 3P0IA 1KPHA 2GF9A 4PANA 1QGYA 3RW9A 2I1VB 3HCNA 5A62A 3SSNA 3WA7A 3GZNB 3E70C 1Z5UA 4MIYA 4X91A 1HH4A 3RASA 3BJMA 5HF5A 4XSGA 2W2TA 2WU4A 4M6WA 5B30A 5JASA 1M5UA 3V3TA 5J4YA 1N9GB 2QT1A 2WPDA 1JEEA 3PNSA 3QTLA 1ST2A 1V4NA 1W30A 2QP4A 3H7IA 1WUJS 3GR6A 1PEKE 2WOJA 5E4YA 1OFUX 2EGHA 3MJDA 4P0QB 1XD2A 1Q1GA 1QK3A 1U3GA 4NE7A 1I6KA 3W4KA 3TG2A 4YXFA 4W9RA 3FPAA 3K0CC 4TV9A 1OKKD 4YT4A 2HSGA 2OZVA 2XVAA 5CVUA 4DWWA 1ZGCA 2HLPA 1BS9A 1U7OA 4UBJA 5HFAA 2DHQA 4XVUA 3AIOA 1KWGA 1HWYA 1EMDA 1B1AA 1XDZA 2IU4A 3AIKA 3B1ZA 1Z0IA 2BFDA 4DLWA 1RKXA 1GEGA 4LZZA 5ICMA 1FMFA 1K7CA 4KJZA 3QV1A 4B3FX 3TDKA 3V55A 3HJBA 1GWNA 4E4RA 4DGSA 4KLAA 3PGJA 4AY4A 3M4XA 3ELDA 4R0NA 1H1LA 4E7OA 3VBEA 3CNNA 3QKWA 1KI1A 1XDDA 3KCQA 3EJ6A 3LCVB 3JQBC 3LP6A 4RTJA 1T10A 2C7QA 1ODLA 3HM9A 2FYTA 3BIWA 5FPPA 4LYYA 1O7JA 1TYBE 1EX7A 2VYCA 4DWJA 3AVUA 4H3KB 4EAQA 3BWEA 5IYZB 1T9DA 3SC6A 5DN6D 2W6CX 2QJFA 3ZLVA 5HK9A 4L07A 4MVXA 3IQGX 4Q9JA 5FJIA 3S8MA 1K3FA 1T4DA 3QF4B 5GZ6A 2CXNA 3HYNA 1KSGA 2E82A 2P62A 3PD7A 1DI0A 4B4DA 3L05A 2XQFA 1SJ9A 3DCJA 1DRKA 4HR7A 3T3IA 5KJCA 3FZQA 3LSTA 5FA8A 5C34B 1G1MA 5FQOA 3E7FA 2A4MA 3PC4A 3AC0A 3CUTA 3KDPA 3NW9A 2B7LA 2I55A 4TYQA 3WGUA 4DA9A 4DG8A 4X3PA 5JT1A 5A5FA 1N92A 4DZRA 4ZJPA 3O8OA 2VJLA 3NCTA 5J2UB 1L1RA 1JMKC 1MKYA 3JQBA 4D9MA 1E8DA 1K68A 1X80B 4GI3A 2JCYA 5TQ0B 3A10A 2QRVB 2FLVA 2P5TB 4MIKA 3RFCA 4MGYR 3MAAC 4YV7A 3JALB 3C7CB 1L8XA 2OR3A 3PZRA 4RV9A 3BGVA 2WQZA 3P2IA 1Q50A 1SO8A 2DSTA 4FZRA 1F7UA 4WASA 1V25A 2IL1A 3KFXA 3AHHA 4NMXB 1ZEMA 3VR4A 1LCIA 3IRVA 1WQ3A 2CXXA 4DAEA 5L95A 3IVCA 3RAPR 3F9CA 1HT2E 3F3KA 3FRJA 3M6LA 3P2JA 2GJKA 4WLOA 4XIJA 1CJCA 4Q24A 4RK0A 5DYYA 2O06A 3ZX5A 5TMBA 4L76A 3MJSA 3M4NA 2WIFA 2CYCA 2B4YA 3N7AA 2GESA 4WZ6A 4YWJA 4C4AA 1YQ9A 2Q2WA 2QIPA 3H9QA 3KZMA 5AW7A 1JFSA 2QRZA 2D2XA 3V7YA 1SZDA 3NNNA 4MP3A 1N6OA 3ZGVA 1NBME 1Z38A 3MCTA 1FDRA 1PSWA 2HU8A 4OMUA 1HYEA 2IYWA 3UIEA 1QZTA 3B78A 4FEGA 1RQRA 5HIMA 4BEBA 1YU9A 3KYCB 5ALEA 3W06A 1XLTC 3PJRA 3HGQA 3DHWC 2F7SA 2O23A 1XV5A 2GXSA 2V8OA 5HYVA 3F4BA 3REQB 3AHCA 3RYFA 5DT9A 2DSNA 3RVSA 2ODNA 3V5NA