1ZDMA

Crystal structure of activated chey bound to xe
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
128
structure length
127
Chain Sequence
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinguishing multiple chemotaxis Y protein conformations with laser-polarized 129Xe NMR.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
molecule keywords Chemotaxis protein cheY
total genus 42
structure length 127
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zdmA00
4KFCA 3FFTA 5JNVA 4MR9B 2PKXA 2VUIB 3NNNA 5IBQA 3FDFA 2R48A 3T6KA 3KG2A 2JVJA 4XASA 2QVGA 5KC9A 1SXHA 3BBLA 4LX8A 5ED4A 2HQOA 2CD7A 4QPJC 4EUKA 5BR1A 1KRWA 4YS6A 2FKAA 1Z25A 1EFAA 3CG4A 2OQRA 2PUFA 4MR7A 4P1ZA 4UHJA 2FW0A 1M2FA 3O75A 4G0QA 1AB6A 4ZPJA 4JA2A 4TMYA 3FGZA 3GV0A 2JVKA 1MB0A 3RVQA 4TLLB 4EVQA 3QLVC 3HCWA 1URPA 4MR8A 1USGA 2PUEA 4KRFA 2IPMA 3EJWA 3OM1A 4Q6BA 1P8AA 3L49A 3S99A 2J48A 3M9XA 3MM4A 3N53A 1D4ZA 4N0PA 4G86A 5TQ2A 2AYZA 1QPZA 2FN9A 1K68A 2O20A 1D1QA 1ZGGA 3OQMA 3KKEA 1RNLA 3OO0A 5EWLA 4G0PA 2M98A 2FMIA 5IUKC 1TVMA 2A9QA 4Z9AA 4H3KB 2QSJA 3QK7A 1D1PA 4TN5A 3NHZA 3KLNA 4MS1A 5FWYB 4RKQA 3EQ2A 4IMIB 3HSYA 1JFSA 4LDAA 4MS3B 1DC8A 2GBPA 2P4UA 2BGGA 3LUGA 1ZY2A 5CNIA 2PUBA 1EAYA 4O1IA 2LPMA 2NT4A 1ZH4A 3OLXA 2PLNA 5IX8A 3OLZA 3LMKA 3NBMA 1DBQA 5F64A 3ROFA 3K4HA 1QP7A 2NZUG 3CNBA 4YR7A 1EWVA 4D74A 1W25A 3DZDA 3HK2A 3DBIA 4RY0A 4RY8A 3F6CA 1EWTA 1XHFA 3CRNA 1EHCA 3JVIA 3IPCA 3KJXA 2XDYA 2GX6A 4MS1B 3SM9A 2R4QA 2E4VA 3Q7TA 3N0WA 3EAFA 5FWXA 5JNRA 4Z9BA 3C3WA 1USKA 2A9RA 3KSMA 2IDMA 4YCSA 4MLDA 2QU7A 1DCMA 4YLEA 3JPYA 3JVDA 3LKBA 4Z4EA 5DTEA 2MSKA 1ZN2A 3QLUA 1TLFA 1PNRA 3LOPA 1NXOA 2LP4Y 2IPNA 1L5ZA 2FLKA 3RVPA 1E6MA 5T7BA 4EVRA 1JYEA 2ID9A 2E4WA 4LE2A 4IGAA 3HUTA 1A0OA 2V0NA 3LUFA 3GYBA 1QO0A 2VYCA 3CTPA 1RXIA 3LUDA 3HEBA 3JPWA 5EWMB 3JTEA 1DC7A 3OLWA 3FFWA 3UKJA 1QKKA 2CWDA 3O2JA 3Q7RA 1XWWA 2P9HA 3SY8A 1A04A 4Z4GA 3FMVA 2L19A 3CG0A 3HUUA 2MYPA 3CHYA 5CNKA 1M5UA 1TM2A 1ZAYA 2PAFA 2PUGA 1OXBB 3N6VA 5TE9A 4RS3A 2B4AA 4NQRA 3RVKA 3HO1A 3DGFC 5IULC 8ABPA 3HZHA 1ISSA 3LUKA 5KQPA 3K9CA 4OTZA 4RK5A 3SG0A 3H6GA 4JASB 3JY6A 2L18A 1QQBA 4TLMB 5BQ3A 5GOTA 4MQEA 2RGYA 3BRSA 3RVLA 4KMRA 4WXEA 1SXIA 3RVNA 3EULA 1MIHA 3T8YA 5JS1A 4IMJB 2FMFA 4PEVA 5TPWB 3CZCA 4G0ZA 1CYEA 3RQIA 2MYNA 1Z12A 2PUDA 4F11A 5JNSA 3KYJB 4RWEA 4Z4HA 1JLKA 2CHFA 4ZYLA 4JB2A 1Y1LA 3A3KA 2RJOA 2GKGA 1GLGA 4EY3A 3SAJA 3MF4A 3O21A 4OBBA 2PMCA 3E61A 2E4UA 3LUAA 3GBVA 2PUCA 3OO1A 1ZGZA 1DCFA 1Z16A 4MQFA 1PUXA 3LUJA 2LUOA 2H0AA 2QZJA 1JFVA 4MQFB 3VNAA 1APBA 1YVUA 3QEMB 1JWLA 3HV2A 4F3TA 1P2FA 3IPAA 3H6HA 4XAQA 4RK1A 3H5WA 3N8IA 1AB5A 4IRXA 4RZSA 4CBVA 5FWXB 2PE5A 4N47A 3G85A 2MSWA 1DBWA 2QW1A 4ML3A 2PJUA 1QO0D 1U04A 2MSLA 2MYUA 3CLKA 1MVOA 1UDRA 1ZVVA 4KV7A 1NXTA 2IKSA 1QQAA 1ZITA 3LUCA 4ZMSA 2H3HA 4UHKA 1K66A 1E2BA 4RKRA 2QR3A 3SNKA 2MYTA 2E4XA 5IEJA 3IP6A 3OLVA 3IP7A 3KHTA 5KQLA 4RSMA 3BRQA 5DGCA 2FSPA 3I5AA 3O1HB 1VLZA 1QP4A 3UUGA 1BDJA 1JH9A 3D8UA 2NT3A 1BDHA 4KPYA 4E7OA 1HEYA 5EWJB 3C6QA 4RU1A 3H5LA 1JDPA 1LJLA 1YMVA 1JF8A 4H60A 3EODA 5JS2A 1PEAA 5EWMA 4ZMRA 5HKOA 3RVRA 3NNSA 3LFTA 3HJFA 6CHYA 5JNUA 5I4CA 3DLBA 1FFWA 4OLAA 1RPJA 4W5QA 1EWKA 3O1IC 4MRMB 1DBPA 3BILA 1Z18A 2IPLA 3KYIB 3O1JC 4XARA 1NXPA 4L85A 5B3JA 2WJAA 4KVFA 1XHEA 5IUJC 1DZ3A 2M1ZA 3MQ4A 4YV7A 5IC5A 3EDCA 2E4ZA 2CHEA 4W5OA 4LDZA 2WB4A 3FFXA 4WZZA 4FB4A 7ABPA 3RVSA 1F51E 1PNTA 4LE1A 4EYOA 1Z17A 3GBPA 3IDOA 2FTKE 4XXHA 4JP1A 4Y9TA 3RVJA 2KYRA 3I45A 5FBKA 4Q7EA 1NXWA 4EYKA 3T38A 2AYXA 4RV5A 4S05A 1VKRA 1BVHA 3UK0A 1JHZA 3HM9A 1J56A 4Z0NA 3H75A 1L5YA 1OXKB 2JB9A 2JCGA 4MRMA 1YK0A 5HM6A 3W9SA 4D6XA 1M5TA 2X7XA 5E3JA 4F12A 3SQNA 2QXYA 1PEYA 3OQOA 3H1EA 3OMWA 4M88A 4OATA 5DLEA 2NUBA 1JFTA 4YP9A 1LBHA 1ABEA 1ZDMA 1LBIA 4RXMA 3URMA 4EVSA 3OQNA 1SD5A 3QX9A 3B2NA 3F6PA 2PUAA 1YTUA 3QEMA 4HNRA 4RY9A 1DJMA 1NXXA 4KZKA 1TMYA 4Z4IA 2IOYA 4KQ9A 4JB0A 1ZHHA 3IP9A 3TMYA 1E6KA 3C3MA 5T3YA 3P9YA 5DKFA 5C5CA 5C5EA 5TPZD 4O1HA 1SXGA 3NHMA 1FQWA 5CHYA 1LJUA 1M2EA 1JYFA 5KQGA 2ZWMA 4XFKA 3IP5A 4PE5B 5BRAA 3QEKA 4IILA 4YRZA 5KC8A 1JX6A 2VK2A 4B09A 3GT7A 2WRZA 2DRIA 3N0XA 1Z2EA 5TQ2B 4LRQA 1VRVA 1JL3A 1YS6A 3G1WA 1ABFA 2I6FA 3RH0A 1DRJA 2L2QA 1RZRD 1RZRA 3HDVA 2YHBA 1DG9A 3H5IA 4HNSA 4WXMA 1BDIA 1E6LA 2R47A 5KWSA 2QV0A 3E3MA 3N0RA 2B1JA 4WUTA 1PHRA 2YHAA 3MA0A 4GNRA 9ABPA 2HJ9A 1ZH2A 3GA5A 3D02A 3QLUC 4MGEA 1GUDA 3C3KA 4G97A 4MAAA 1D5WA 4RK7A 3MYYA 3NNDA 1KMIY 1U8TA 4ETNA 1SRRA 1NY5A 1QP0A 2FQWA 5DCLA 1A2OA 5TQJA 4OLBA 2PL1A 1USIA 1YK1A 1P6UA 1MB3A 1WETA 3H5TA 1GCGA 1FFSA 1MAVA 2JRLA 2OENG 3CS3A 3Q9SA 2WY2D 3EGCA 3TX6A 3TB6A 4JAVC 4G0OA 3N75A 4GPAA 3HDGA 4QYMA 4KNYA 2Q5CA 3LKVA 2FEWB 3Q7SA 4KK4A 3DGEC 3LTEA 3F7NA 3I09A 4QYWA 3KLOA 4L4UA 1Z15A 4RK4A 1BA2A 2FMKA 2E4YA 4G0XA 2HQBA 4HNQA 2ZAYA 3R0JA 5FBHA 2F8SA 4Z4FA 4HYEA 4H3HB 2PL9A 1YMUA 1IIBA 3C97A 3A10A 4LE0A 1DRKA 2WJWA 3EQZA 5GQSA 4DN6A 1U2PA 2JBAA 2JBAB 4F8JA 4RK0A 1S8NA 4MS4B 4EGSA 4RK6A 2TMYA 4N03A 1VPWA 1B00A 4FE4A 2VUHB 3QELB 5D2CA 3Q41A 4KQCA 3DLHA 5TPWA 3CFYA 4WT7A 4NCBA 3H5VA 3CKMA 3H1GA 3T95A 4N76A 1C4WA 2JK1A 3GL9A 3I42A 3KCNA 2R25B 4XLTA 4Z4CA 3TD9A 1T34A 3O74A 5TQ0A 1LK0A 1Z26A 4MR8B 4KK3A 5IUNC 1KGSA 2FLWA 2FMHA 3H5OA 4P98A 4N41A 4YWHA 3ILYA 2GWRA 1TJYA 1Z13A 2FQYA 3OMXA 1DCKA 4MYRA 2L17A 4QICA 4PICA 1FFGA 5BRJA 4MPTA 2A9PA 5TPZA 4ZJPA 2RDMA 4RDCA 2A9OA 2QVCA 3GWGA 4YGXB 1GUBA 3KS9A 4KREA 2ID7A 1D2AA 1NTRA 1P6QA 3M6MD 5CNJA 1NATA 5JNWA 2FN8A 4DADA 2HPHA 3HXMA 3Q15C 2JVIA 1RXEA 2IPAB 3QLTA 4G0YA 4NV3A 4YO7A 3QLVA 4E7PA 1ZESA 4RXUA 4EYGA 2GI4A 4W5NA 5TQ0B 4Z99A 1YIOA 1W9HA 2HSGA 3A0UA 5B3JC 1U2QA 3HVRA 1KRXA 1C0EA 1ISRA 3GRCA 4WWHA 4MS3A 2FQXA 4LZLA 5CNMA 4ETIA 4NICA 3L6UA 3O2QB 3ILHA 4OG2A 5EWLB 3O2SB 5IEBA 1DP4A 4ETMA 1JBEA 2WWVD 5PNTA 3F73A 4W5RA 4N0QA 2F8TA 3H1FA 2WMYA 3QX8A 3KTOA 4DQDA 1NXVA 2IYNA 3TO5A 4MQEB 3JS5A 3HS3A 3MIZA 1JDNA 3CU5A 1I3CA 4S04A 1BAPA 1CHNA 4JOQA 2LIVA 3BREA 1F4VA 1CEYA 3OM0A 1GCAA 1R8JA 4MR9A 4NCAA 5FWYA 4PZ0A 4MLCA 4D6YA 2N9UA 3M9WA 4MS4A 5HQJA 3RVMA 1QNLA 4F06A 5HSGA 2FVYA 3RVOA 5KQMA 3QELA 1YS7A 2FXIA 1Z2DA 4PYRA 1FSPA 3MMNA 2W42A 2FEPA 3LUHA 3VNBA 4EYQA 6ABPA 4RXTA 1NXSA 4W5TA 2LBPA 4O5AA 3CZ5A 4Q6WA 1U0SY 2RJNA 4MR7B 5JNTA 2FEKA 2NZVG 4FE7A 3ROTA 3A0RB 3OLYA 4G0MA 5EWJA 5ABPA 1QMPA 1H9CA 4IF4A 2HQRA 5KI6A
chains in the Genus database with same CATH superfamily
4RFSB 5JNVA 1G9TA 4R4JA 2PKXA 4CIVA 1Y5MA 2FMUA 1I8TA 2HIHA 2V4ZA 3DOFA 5LP1A 1WUJS 3UGQA 1OYYA 3K0KA 1PJ8A 2GBLC 2VF2A 3A58B 3EW7A 4Q4HB 4DS3A 2OQVA 3S8EA 5CX1A 3R4VA 1CR6A 2D8AA 3RU3A 4YVFA 5BOSA 1KZGB 3CZRA 3RDPA 2HQOA 4BKUA 4RA9B 2QGFA 3S1AA 1X9HA 2O5CA 2GVDC 4CI9A 4D81A 4L16A 1ISHA 2J67A 2NLOA 1NUSA 4EGFA 1IQPA 5K09A 3CUKA 1PI3A 1KJWA 3GFFA 4BNGA 3WJAA 4D7AA 2VTDA 2B61A 2CYBA 2XYPA 4HNAB 1PKXA 1CZKA 4UUPA 1IN8A 1LU9A 4ZPJA 2YIMA 5KOJB 2QXUA 3AR7A 4PSCA 3BSYA 4UD6A 2I91A 4I3HA 1ILEA 1ML4A 4FDAA 1QB7A 5KMGB 3ZXXA 4O1MA 3H1AA 5K8VA 2EG9A 2X6TA 5EP2A 2WABA 1ZRSA 1A2QA 3FTQA 4HLDA 4K9SA 3OM1A 4KG7A 3J80A 1Y7PA 1G55A 2CLOB 4DLPA 1UUFA 1D4ZA 2BGUA 1X42A 4K6GA 3QVJA 4O0LA 1GNVA 3SHVA 2E6UX 2G1AA 2PLRA 2VP0A 2GZHA 2ZSEA 3MS7A 4C1BA 3GF4A 4NMXB 4B6JA 3PR2B 3LSTA 4OX9B 2FH5B 1OI3A 2IEZA 3FPBA 4N5LA 3HYSA 3TH5A 1Q83A 1HDRA 4TKUA 4UOZA 1AZLA 1QFZA 2XMQA 5DASA 4HB2A 4RHXA 1ZH0A 1XTBA 3AR8A 1WMDA 2GCIA 3N2YA 4DV5B 4BJHB 5D3ZA 4JP8A 2XOKA 2O8DB 1KAQA 2CFSA 2JKYA 3A9VA 3OCYA 3BF8A 4YLGA 3WJ7A 3ZHXA 4C7MA 1E0AA 2PX6A 1D2NA 3LUGA 2X3YA 3ABZA 4LAFA 4CL3A 3KT6A 3KWMA 1OIXA 3AF2A 4GPZA 4LWOA 5H5JA 4ZHSA 1HQYE 3TXAA 1EQAA 5FUYA 2ADOA 2XRYA 4I4NA 1WXXA 3D1LA 1GRCA 5CDFE 2NZUG 3CNBA 2FOLA 1EH5A 1LPBB 2VSNA 2K87A 5KWVA 1QVWA 1VSTA 3SC2B 1DXQA 3KQPA 5KAMA 1GM5A 1SCJA 4FCWA 1S5PA 1PT7A 1MEOA 1RWNA 4LFAB 1G8KA 3AFOA 1G5IA 1OA0A 4G36A 2P1RA 5DXAA 2W83A 3WL7A 3MTBA 4DG8A 2FPIA 1ARZA 3K6RA 1RXCA 1M6YA 3GNSA 4OAOA 2PX2A 3HEAA 5J2TB 1WZCA 3VYSB 2EC5A 4GICA 2AN5A 3NBKA 2EWVA 3K0FB 2D59A 1U4SA 1LDBA 2G88A 2QYTA 1U28A 5A4DA 1WW8A 1SUCA 5DBOA 1AS0A 1HTBA 3OBBA 2IPNA 3PIRA 5EAIA 1N33B 4DWVA 1OBCA 2L69A 3COVA 4IQ4A 4V38A 1E5TA 2AI2A 3A9TA 2X6RA 3DFZA 4PGHA 3SYKA 3UA4A 3A27A 4LJYA 3RLFA 2LGJA 2HYIC 1ORRA 3G9ZA 4IL5A 4LZJA 4RE6A 4UUMA 3JPWA 4DIKA 1EUYA 1GUFA 3OESA 4PSKA 1H22A 4L8LA 5ELMA 1N25A 1FCJA 3M33A 5FFFA 1XN4A 3WGGA 1I7PA 3S2ZA 5DJ5A 4JL8A 1UBUS 2GD2A 2IZ5A 5E2AA 1DIBA 2X8LA 3RKSA 4IGEA 2NO0A 2QTZA 4HZGA 3CEPB 1WPQA 3V33A 4TS1A 2Q5HA 3FOBA 4GM0A 2H5IA 4M0EA 3NMUF 3LPCA 4MP3A 3WB1A 3DPIA 2PBFA 3G1UA 3MTIA 4NQRA 9MHTA 2QLMA 3TINA 2E48A 3K9CA 4MHSA 1KZ4A 4MTLA 1VPTA 3CJRA 3QIVA 1N2HA 3R3ZA 1F8GA 2FN4A 3MW8A 2QG9A 1GQFA 1N78A 3DR5A 4XJSA 5E95A 3WMEA 4YAGA 2QP9X 3AGPA 3ESYA 1KERA 4Y1RA 2ISSD 3HY4A 1E5QA 2NP6A 1TM7E 4LY6A 5BW4A 1LK5A 3GXOA 3TJMA 2IPXA 3P0EA 4G0ZA 2R8ZA 1UMDB 3HWSA 4EP1A 3EPRA 3F74A 4C3ZA 2NXWA 2Q4BA 2VHCA 2DPHA 2VNKA 3C39A 1VIDA 4FJ1A 5DO9A 5JD3A 1K4YA 2JI8A 3AIKA 4IJ5A 4J7AA 3Q8WA 4I19A 1GKLA 4KGVA 4R01A 3D7NA 2LCQA 4PINA 4KQIA 4ZGBA 4URWR 1QHXA 3F0TA 3HCBA 4D9NA 1IUOA 4L9RA 2ZYSA 1QWSA 1E2JA 4UEWA 1CZLA 3THWA 3PUVA 4RF3A 1F8FA 5EIXA 2GK4A 1DO8A 2QTNA 2I3GA 3UWMA 1Z45A 2CBGA 5K03A 5TX7A 3R5JA 5FXMA 4TM8A 4CT0A 2DZDA 2JGLA 3RS4A 3SF8B 4HH0A 4CBVA 3G85A 3HGTA 1TZKA 2A9VA 3E2PA 4QC2A 4BO2A 1SZJG 4D92A 5ITZA 5ITZB 2EERA 1D2RA 5AVJA 5HQ3A 4P2GA 1QKIA 5SV2A 4FGKA 1R4NA 6NULA 4R69A 4J0KA 2H3HA 2X5KO 2JFQA 2R6HA 3PCRB 2CLKB 1VPLA 4D4HA 4KVGA 4OK6A 3NUGA 3BT7A 1KEZA 4DT1B 3I2IA 2VH5R 1E1YA 4OKNA 5A5DA 1VMAA 1RSZA 2ZT7A 2ZVDA 4C20A 1N0WA 2Q2NA 3WMFA 4B73A 3R5FA 3CEAA 1SIWA 2F9MA 2W2LD 4PO3X 4K9NA 2O5RA 3HU5A 4G37A 3FCAA 4IDEA 1XLVA 4OVKA 4TSKA 2PV0A 3DAFA 3OHMA 3Q3VA 4IVNA 3QU4A 4CKEB 1CS0B 4RV9A 2FWAA 4P83A 1FMTA 3MRSA 1UZLA 2WKSA 3LFTA 3N5CA 4IWNA 3SQXA 3TW8A 1U2SA 3B1XA 1SFRA 3IQGX 3R41A 3DV2A 4X66B 3FNRA 2NM0A 1A72A 1LPAB 4D3FA 3FOAA 3E1KA 5JZBA 5AVYA 2J3HA 4G1UC 1PR2A 1Q22A 1IN6A 2F3PA 5HBRA 4EHHA 4MHTA 2PGAA 3DZGA 4EZIA 1Y48E 2EYUA 3T7CA 4E22A 1U0JA 4HLNA 4GC9A 1F4PA 3EWAA 3K9NA 1T36A 4PXAA 3TQQA 4LF4B 1JQKA 2B30A 4TV9F 1RZ3A 2PEZA 1EXNA 3FFXA 3OQBA 4LECA 2VL7A 7ABPA 2IYVA 1WRBA 2GT1A 4B6EA 4DIUA 2M1XA 3LQ4A 1NDUA 3OCZA 1DS6A 1E8NA 1XXLA 2BGLA 2IHVA 2QL5A 4QJ5A 4BAUA 1Z0UA 3I45A 4F5WA 2Q2OA 3QFSA 4PIPA 1CUDA 3VPCA 3T38A 4MARA 2V65A 1L7RA 4PYOA 4Y67A 3H2HA 4MKZA 2JDID 3DCJA 1U0OC 5ALRA 4BZZA 1HX7A 2DR3A 1JR3E 2D74A 3BIWA 2C7VA 3L46A 2I5PO 3EYAA 3HUFA 3HU1A 5K3DA 4K3UA 3EZFA 4ZI3A 2HK6A 1NOJA 2X7XA 3RSOA 5CG1A 1ORVA 1TF7A 4L8YA 3D59A 3HB0A 1XKQA 2CLCX 1Z0JA 1Z8FA 4YRKA 1VIMA 3NRCA 2PWYA 2V4MA 5I5GA 4R1QA 1DQYA 1XK7A 3QX9A 4JUDX 3M6WA 2ASVA 2YXPX 4TYPA 4OUDB 2YFHA 3PGA1 4WEOA 1WS6A 1RR6A 4A8PA 4H6WA 4D8WA 2Y76A 2Q9BA 4TMXA 1GPBA 1OROA 1YHYA 2IV2X 3WLTA 1BEZA 3DBLA 4B6RA 4ZHQF 3IP9A 4TV9A 4QVGA 2TMGA 2CVQA 4UCXA 1Q7RA 5B3LA 5C5CA 1KTIA 5TY0A 3CUEF 5CFPA 3GUYA 4E5MA 1PWXA 3ULKA 2VJMA 3EUWA 4MIOA 4OFWA 3N05A 4JR0A 4RVGA 1LJUA 1EFDN 5KQGA 4CEHB 2R7KA 3DT8A 5AIBA 1FSGA 1IHUA 5A3QA 3GH3A 1J2JA 1V11B 3TGLA 2HTEA 2ODNA 3ZI7A 1H0RA 1IJKA 1EVJA 1HM5A 4HQLA 2H4YA 4MW2A 4PO1A 4ZP1A 4BP1A 2C84A 4Z1MA 4U2EA 1HOXA 2VDNB 3H1PA 3PB3A 3CUYA 1AUOA 3JARA 3TWOA 3ZCTA 4YT4A 3HDVA 1JIIA 3UPTA 3T06B 3HB4X 1X13A 3D0QA 3MCUA 3JQ6A 3JX9A 5DNVA 4FEAA 2QV0A 2DFKB 4IHJA 3F6SA 5D1NA 2ZT5A 2ZZNA 1C41A 1VKZA 3PXDA 5BWOA 3C4VA 1FFAA 3CONA 4DC0A 3OOJA 2OVFA 4RHEA 1V3QE 2C4TA 3CNOA 3MRXA 3DUFB 3IAUA 1SU4A 4OSPA 2I7TA 2W0MA 5CPBA 3UVEA 4HWKA 5A5VA 1F5NA 4BQEA 1T36B 5C2JB 3CVVA 3B20A 3P27A 3T15A 2Q4RA 3RNOA 1O0CA 3TW0A 4RM2A 3AF4A 1FXUA 3QI2A 2XODA 5HA5A 2X86A 3HMQA 3O93A 3FUWA 4WY2A 1NONA 2NOAA 2ZP1A 2WY2D 3Q6NA 4A0RA 3TX6A 2WAMA 2PH7A 4ZT2A 5KWJA 5DEIA 1GEEA 5K9ZA 5KSPA 1KKMA 1V7QA 3FW1A 4F4UA 1DB3A 2NO5A 4PQYA 3H2IA 3IH5A 4YV1A 5LQRA 4Q5IA 5GM2A 2HTFA 2W43A 1WMBA 4KN6A 3IVRA 4OGKA 4E30A 4EYEA 1RAFA 4KE8A 2CHUA 3DT9A 1RLJA 1VYHA 5A4KA 3EC7A 3GT3A 2WIAA 2BBOA 1H9AA 4UTNA 1IIBA 1UXOA 4FE3A 3E7XA 2Q49A 2B8TA 4IIXA 4GOJA 3KXLA 3EXEA 3F6BX 1QP8A 821PA 3VO1A 4R8SA 1AD2A 1WW2A 3WNCA 4YRAA 3DKKA 5HIMA 3ZU2A 2FZVA 4BL5A 1W0JA 4CG2A 4F04A 1MAHA 2ZBUA 3BDVA 1Z36A 4EGSA 4RM3A 4FCTA 3U4QB 1NR5A 2CJWB 3U4QA 1Y1QA 2P2YA 1E0KA 3FJYA 4FYXA 1B23P 1U0RA 1ZD2P 5PGMA 2NYAA 5CVCA 2X7JA 1K0FA 2PVPA 2ENUA 4G1BA 5FBQB 7REQA 7REQB 3CKMA 5JD6A 1SHKA 1C4WA 2H1LA 5HPYB 1IXYA 2OGSA 3M5PA 2R6DA 2A78A 1NDHA 4D99A 2BMJA 3ESRA 3GEMA 4K6MA 4KOEC 4YV0A 3O74A 4C3VA 1DEHA 1FJ2A 2HCBA 2ZANA 4W9NC 5HKKA 1ZJYA 1M0SA 4CMEC 4DMCA 8ADHA 2GPBA 1P0FA 3R8FA 1KYXA 2CBZA 1HPLA 3SI7A 3HRKA 1DRUA 3AB3A 2MMGA 3PHLA 1UBJS 1HZZC 2JPDA 3DL4A 4P84A 5LLSA 5C4GB 1KI7A 1PJ3A 3IUNA 4INAA 4A3SA 3FDJA 2R62A 2C3PA 5BSUA 1NMZA 4BZXA 5C7YA 1E1CB 2A3NA 3GWGA 2QP3A 1RI1A 1JN0A 4KREA 3DLPX 4BPBA 4EAQA 3DYIA 2XDQB 2N46A 2PTHA 2QKYA 1GFIA 2OEPA 1VHTA 1PFQA 1EFTA 2HCJB 1UK6A 4OAQA 1Q20A 1RQ7A 4KODA 4RZQA 5FOTA 7AT1A 1F8UA 1HDIA 3U7QA 1YRYE 4EUEA 4FYVA 3EEYA 5DBEX 5JVDB 2PYIA 3O8OB 4DMUB 5LQJA 1O6GA 1P73A 4Z2AA 4F1KA 2P6RA 1U7WA 2O1XA 3P97A 5ARCA 1T4CA 2WJ3A 2ADMA 3PC8A 2OGZA 2EP7A 2Q8PA 2XKAA 3KT0A 4FLFA 4K2HA 5HIJA 5J47A 5L4NA 2HQSA 3GG2A 5JAZA 1W6UA 5HJ5A 5FDFA 1TCCA 3P4YA 4PYJA 3ZE9A 5ENVA 1B0UA 1NSYA 3R6DA 4UE2A 4BFYA 4DA6A 1KU0A 5I4IA 1OC4A 1YZ3A 2RI0A 4TTTS 4U2KA 2WG0A 4RPIA 4RZUA 4V0OA 3S28A 5K6AA 5K3CA 2H8GA 5JXIA 5JYEA 3MIZA 1I3CA 3GAMA 4K40A 4NATA 1EXVA 2LIVA 4ZCPA 3COPA 3MYRA 3ZWCA 4WCFB 5FPPA 2SKDA 3BSFA 4LYGA 4MGKR 4CM9A 1JW9B 1QF9A 2XMGA 2C4NA 1XWIA 3BGOS 1Y6GA 2G1UA 1RYYA 2COKA 4INPA 3IPRA 3BD8A 3J7TA 2IEGA 2UZ4A 3QY9A 4GQBA 2H2DA 2J46A 2NV0A 4YROA 3RNLA 3AUXA 3R0VA 3EA4A 1ZIXA 1KMNA 3IV7A 3NU1A 3LUHA 1KZ6A 6ABPA 5JZSA 4JYZA 1GSOA 4W5TA 4MKHA 5DLQC 2G9QA 4EL0A 2EX0A 4AWXA 1YNOA 2AVNA 5FTJA 5DE3A 4FQ5A 1OJLA 4DA9A 2FPWA 2I7XA 2VKTA 5A05A 3NHUA 3VSCA 5EQDA 2BR3A 2HREA 3HBLA 3OX4A 2CGEA 2HIMA 4CTMA 4ASUA 2WM8A 2ZBGA 3CZ9A 2HJRA 2R6GA 4EHNA 3K35A 2DLCX 2CL6X 3USES 3G2KA 1TZBA 3EPPA 5I7SA 5I3ZA 1NNSA 5JJ5A 4XVCA 1ZCJA 1LD3A 4GYYA 1VG8A 3M6UA 2HPVA 1FPQA 4NSNA 5BN3A 1DT3A 1U3WA 1HNZB 5L7WA 4QA9A 4EUKA 1JNXX 2A5LA 3AZPA 3JQGB 1DFIA 2QQEA 3RYTC 4RTLA 1H23A 1Z25A 1NT4A 3QU7A 4YQYA 3NHSA 2PUFA 4KKVA 2WYWA 4B82A 4NVRA 1XZHA 2Q4EA 2WF9A 2XCIA 4OA8A 1WHSB 3TJZA 1IRIA 1SR8A 4JA0A 4L0CA 2IX9A 2G5PA 3VV2A 1YI1A 1UMCB 1GXSA 4N5MA 3U4MA 2H16A 1XG5A 3QLVC 4QTXA 1DXOA 3GMDA 3MIIA 4AB1A 5KX5A 1T8RA 5J4LA 3EJWA 5LD2C 1Q1EA 3RU7A 1T43A 1U4OA 2P68A 3OIFA 4V3BA 5L3SB 3AEKA 5L3SA 2QMZA 4D9CA 1IZYA 4RPKA 4ZHQB 4HTAA 2AG5A 2HH9A 1RNLA 1NPTO 4PFQA 3OEED 2VT2A 1NE2A 1CE8B 4IG9A 1N77A 3N2KA 2IL1A 5J3JA 3TQIA 421PA 3JATA 3PIIA 3L05A 4N8SA 3CUWA 2RHLA 1TXGA 4HNAA 5KOJA 1M2KA 4FIDA 4OXXA 2YW9A 3SEAA 1NW7A 4R9SA 5GZ1A 1H2FA 3GAFA 4H4DA 3LL4A 4MINA 1DOHA 3EQ2A 4TTVA 3B9RA 3TAXA 2RFLA 4MS3B 2HN9A 5B58T 2P4UA 4TL8A 3SE7A 5A9TA 4JXZA 1EDZA 4O3MA 3D1JA 5CDYA 1WTAA 1A9ZA 1JE0A 2PZKA 1QGUA 4JC8A 1GNPA 4GSKA 1XDGA 1E77A 3HCPA 3WR5A 1DBQA 4KI0A 1C8KA 4Z9YA 4CHGA 4ZYVA 1CIPA 4YR7A 4DR1B 5JUWA 1JR2A 4LHVA 3I32A 4JLJA 1W25A 2CHVA 3ZBQA 5ALKA 3JWJA 4AO7A 1Q7EA 1PFYA 5FI0B 1PJ4A 3F6CA 2W2PA 2YWJA 3IPCA 1ESCA 1YQDA 2R8XA 1SXPA 4JL5A 4MS1B 4M87A 1F8XA 4DUYB 4KPUA 4D79A 1JQ3A 2H06A 3IA2A 3QVGB 1CEEA 1PHPA 4X95A 3EAFA 5F1OA 4DDTA 3CURA 3DEHA 4I1RA 5KTOA 1VJCA 1NQXA 1II8A 2IIBA 1IWBB 1OREA 3ZOZA 3KXIA 4QODA 8OHMA 4FSHA 1KK1A 4OXYA 1J99A 2QYHA 4D0SA 3DMHA 4OXNA 2AXPA 1M1NA 3I23A 1KDRA 5DTEA 4O2RA 4LF6B 2MINA 2B6NA 1ODJA 5DHAA 2JI6A 3W1WA 4AU1A 2ZIXA 4JC4A 3OJLA 5H3CA 5IXSA 1EFRD 1HMPA 1L8QA 1MF7A 3NVKI 1HKHA 2QAGC 3CEHA 5T7BA 5L3RA 4LPKA 1Y9AA 1Z74A 1R6DA 4WRRA 2NTNA 5CXXA 4I50A 1ZSNA 1XZDA 3D2LA 3LUFA 3ZBPA 1JZTA 4RTJA 5DYYA 1CQWA 2R2AA 4KFSA 3R9XA 2ORWA 5I5EA 1CJBA 1OPRA 4Y8VA 4FR2A 3KKPA 2C98A 2EKDA 3I6BA 4RSRA 1QKKA 1Z34A 5EPEA 4AXXA 3T7AA 2DVMA 4OMUA 1OKKA 1WP4A 4UTOA 2WU3A 3L6EA 3CW2A 4R16A 1XTTA 2JHCA 1XPUA 1SCUB 4AJPA 2RHGB 2BMWA 5FORA 3I5XA 4HAOA 1IE3A 1Y6JA 3PNBA 1FQKA 1YB4A 2HV8A 3EMKA 4FDLA 2A8YA 3T5GA 1CZRA 3Q7QA 4KWCA 1FU7A 1FBTA 4NNPA 1L4EA 1GTMA 5JS1A 4Q3CA 4RMJA 1H0KA 3I8SA 3BMXA 4AMYA 5EJEA 3L9XA 5CVUA 4BNWA 1MZPA 4XIJA 1ZCZA 3F47A 2R66A 1WDKA 3SQOA 2VPIA 2HHCA 4N12A 1Z12A 4XYLA 3TLZA 1XTZA 1BX1A 5JNSA 2ZZKA 3S5JA 3TM4A 4MV5A 4F2GA 1V8PA 4QLBA 4UARA 4P5PA 4DMLA 1PGOA 2CF6A 5GJWC 1JE1A 4QAQA 1QE5A 5EE9A 2W22A 3ZU5A 4KPGA 1Q12A 2I7CA 3QVKA 4OBBA 2ZROA 5JMWA 2HB6A 1HE1C 1Z0KA 3MINA 1K3FA 2BFAA 2VAMA 3IKMB 5TXGA 3NDRA 2PUCA 4KHPB 1Y6FA 5BPHA 4GE0A 4ZWNA 5LYJA 4F1JA 4MQFA 3K70D 5IKXA 1P91A 2DWQA 2WM2A 1X1SA 4C4RA 1RQ2A 3TD2A 1FMFA 2QLTA 3BL5A 4I66A 3IV9A 4GWLA 1CQJA 4O02B 2UAGA 4JUCA 4R1NA 3IQZA 2JFZA 5GZ3A 1RRPA 2AC2A 1L7MA 3L0OA 3PFKA 1YFZA 1HRKA 3PNPA 3U2QA 3WZLA 2JLQA 1UMDA 2IS6A 1L8OA 3K1ZA 4LJ6A 1TKAA 2Q3BA 4TUYA 3OE5A 1LI4A 3OI7A 5EZSA 1F5SA 1Z4PX 2WF8A 5REQB 5C7IO 5DULA 4DV4B 4M8KA 5ARDA 3LLSA 5CLIA 4CTKA 3AERA 2XZPA 3LX4A 5HF6A 5LLDA 2QR3A 2GS9A 1RMTA 3HWWA 2ODQA 3BEOA 4RTPA 1AG9A 1X9IA 1JEAA 4Q1EA 3VVMA 4UQPA 5DHRA 5TIIA 5AVOA 3UUGA 1NVEA 3D8UA 2HQ1A 4YH1A 2JEYA 1EP1B 4FR0A 4IH1A 2DBYA 4RNDB 3TB4A 4R8KA 2AJCA 1ZNWA 5DBGA 3CKYA 1QF7A 1T2CA 2LCIA 2X8BA 1EK1A 1QYCA 4BFTA 4ZCRA 5LQDA 1OFUA 2OAEA 1R6BX 2JFBA 3H86A 2WKQA 3O8LA 4F21A 4HRAA 2R68A 3KQQA 3UAWA 1TLTA 4M22A 1E58A 4W5QA 2B7CA 3NHRA 4NI5A 1K97A 1Z4QA 2C83A 3MBOA 4KQKA 4D2IA 5I9LA 4K46A 2BFEB 4C5CA 2QRQA 1OHHD 1NKVA 3PXEA 4BWGA 1XTQA 4I81A 3NFRA 2ZJ1A 3PLNA 1JNYA 5BUZA 1CY7A 5J4HA 4N5DA 1N1MA 3FRHA 1TM4E 2BEUB 2E89A 2GGSA 4QU9A 2F9FA 1M2OA 3QA9A 2WC1A 4IEFB 4R0MA 1AKVA 5AWFC 1K6MA 4DY4A 3V7UA 4YK7A 1OTYA 2Z57A 2EHDA 1KR5A 3LC1O 5F7XA 3SBEA 1DG1G 1PYGA 2VDQB 1JHQA 2KE5A 4IOLA 4Q12A 4ER7A 5EJ8A 2R6AA 4G2TA 4Y7DA 5G3YA 2PGDA 4LYJA 3LYHA 4NBNA 3SR0A 1Q0LA 1T5TA 3H75A 4JITA 3M3DA 3SN6A 3TR5A 3V1UA 4PANA 4B46A 4EB8A 4ZCIA 4K81B 2VUSA 4BHTA 3S8YA 1LV7A 1TRHA 3UK6A 3ENNA 4NYIQ 2RMKA 3SZ3A 1M1YA 3FVWA 5K45A 2PL3A 2XUOA 5FA8A 1OXXK 1CJUC 3FLAA 3H1EA 4M88A 1U3CA 4ZU3A 1Z73A 3URMA 1RI5A 3IRUA 5FL7D 3H6KA 2X3UA 3F6PA 1DJLA 1R3UA 2RHTA 3OJCA 1IULA 1QTIA 1W47A 2PA0A 1G21E 1NXXA 2PT5A 1ZHFA 4PLVA 4IXDA 4EELA 4ZZIA 1U1IA 4ER6A 4C76A 1AMUA 4H4CA 3R24A 2W2VA 1M34E 3P9YA 1MKYA 4C21A 4RBNA 5TPZD 1ZXXA 4ISCA 5EUQB 4BB5A 1NW9B 3NS7A 5TB5A 3NHMA 4F97A 1MU0A 1D1SA 1WD5A 2J4FA 1J4AA 1F48A 2RHCA 5FNVA 3IULA 3ZDZB 1E9DA 1DAGA 1JX6A 3QUQA 1N2BA 1YU9A 4HPXB 4R68A 2DRIA 2K4MA 3LQ1A 2QZ4A 3ZHTA 4QUJA 3FHLA 3OZWA 5F7OA 3NLLA 3HBMA 3LG2A 1QMGA 1KZ1A 1PZNA 3B1VA 1XMVA 1NVKA 1A96A 3FLMA 2XEDA 4Q3EA 4ZO7A 4FOOA 1VG9B 1RWBA 4YCDA 5D3QA 5BYKA 2CZQA 4ZEVA 2IITA 3O0DA 4UBJA 4Y6RA 2H4HA 4LSWA 3QXCA 3GNLA 3J81A 4US1R 2VJPA 4ARSA 1SXJD 4IFEA 2WM9B 4CT4B 3LSYA 3IPLA 4MYTA 5FCDA 4YCMA 2ZXUA 2BDTA 3EIWA 3RTDA 3IQEA 2XHEA 2EHJA 4XIYA 1NRWA 1V9CA 1NY5A 2FPGA 3PXUA 1E3SA 4HDNB 4OXQA 5DCLA 4CF4A 4HDNA 1V71A 4AS1A 4R9RA 2PNJA 5ICMA 3STHA 1M8JA 2IHNA 1SMKA 4KGZA 4OX9Y 1DARA 2PZGA 5JO0A 1DQRA 3Q7IA 4WERA 4Y3UA 1GDHA 2HBQA 2IXEA 2BM1A 3PNYA 4JAVC 1B41A 4C0BA 5ER9A 1P4RA 5JALA 1HT0A 1XMQB 3DGEC 2H07A 1XQ9A 2FW1A 4TRNA 2R5WA 2GMWA 3FLBA 3TIXB 1BO6A 1SZDA 1WEKA 3OVMA 5JSFA 3DF7A 4V0ME 1EK2A 1BE1A 4NEHB 4QLOA 4QTTB 1YQWA 1BWSA 1AMNA 3C97A 3EGWA 1DX9A 1H9BA 2FZEA 3LD9A 2IP4A 3LVQE 2EKQA 3PKJA 1PJ2A 5CM8B 5ILGA 3T94A 2X13A 3WICA 4R0VA 1GHTA 2IU4A 1UAYA 2X58A 1RU3A 1YL5A 1CSEE 1FVXA 3AT1A 3IR7A 1K5PA 3C7AA 5EUMA 2XQJA 1SEVA 4L08A 4N03A 1R0SA 2XE6A 3C1UA 2EBHX 3PQ8A 4D80A 2YJTD 4FE4A 1TU3A 4UDYX 3RD5A 5D2CA 4CMJA 4G1FA 3HXQA 5F9HA 2V03A 2JL1A 4I5GA 1CYDA 3C5EA 2FHPA 4ZVSA 1OLSB 4ID9A 2PJZA 1MXHA 1V8ZA 2O2CA 4HH1A 5HS6A 1MORA 3ZJVA 1BGXT 4TS4A 4ZZ3A 3OJXA 4IV0A 1TUEA 2X9VA 3PYXA 1FTGA 1LK0A 3DTVB 3DTVA 1USVA 1WV1A 1Z26A 2VWGA 3ZNOA 2R8PA 4A5OA 4DIDA 2FYTA 2QTVA 5J4YA 4KGDA 3BK1A 4MB2A 4CQMB 2B6HA 2VDWA 4D1YA 1BS9A 1DAPA 4NP6A 2Z2KA 1DWQA 1IY9A 1AX9A 1RVV1 1QH1B 1T0IA 1ZK0A 3CMMA 4NU6A 2C4MA 2VJNA 3BUSA 3WNVA 3MD9A 4PICA 4G4SP 1GLNA 4BQPA 5CT9A 2NG1A 1UJBA 2ZRFA 3EC1A 4MPTA 4QD3A 2P3SA 4ZJPA 3CX3A 3BMOA 3L06A 3QKTA 3VR5D 1NKSA 3GQBA 5K0NA 2PBZA 3LYUA 3HCOA 1CS0A 2J3LA 2PZJA 5CA1F 3Q0IA 1E4YA 2JFGA 2YZKA 1XL1A 4J07A 2B5OA 4CLRB 1UINA 4XW2A 3OIDA 1UM9A 3CF2A 5L4SA 3FROA 2O54A 3ZVNA 1JEYB 4BMVA 2Z4TA 4Q9IA 2HSGA 2GZMA 5DSZA 3IUSA 3G2LA 2HCFA 5IWAB 4JFRA 1G5RA 4QBTA 1X7ZA 1E79D 2GK3A 3SC3A 1C9MA 4F5DA 1ZM4A 1X9GA 4ROTA 1EDBA 3ND6A 3MG9A 1FF9A 1PVVA 3BD6A 3TEJA 5E6UB 3ILHA 4OG2A 1PJTA 1BS2A 4RA6B 3WDMA 4EBBA 4N18A 1QH8A 4K9PA 3AVWA 4D8UA 3QPUA 3H1FA 3LZDA 2O23A 3CCBA 3ZNQA 4E2ZA 1H4SA 2XJ9A 2FFHA 3KTOA 3LRPA 4B76A 4GGOA 1W36D 3VR3A 1GQ2A 4TZ6A 5JC1A 5KBYA 5HF8A 3VDNB 4DOMA 1NU8A 3L0DA 4L4XA 4LV5B 4CN9A 5SYMA 1ZAKA 1I1QB 2AYYA 4MV0A 1ZQ9A 5AJYA 4PPGA 4OI4A 3W7VA 1JXOA 1B16A 1H6CA 4HNGA 2YRXA 4DTIA 5K8IA 5KTNA 1UBGA 3SS7X 1YKGA 4K9KA 1E62A 3PENA 5JBIA 4MI9A 1Y7IA 2FVYA 3FUXA 1PD0A 1QU2A 4A0SA 5AM5A 3RUFA 4NMWA 4HX2A 2CB9A 1CERA 2XPCA 2JLYA 3U7EB 1DV1A 2COEA 1ODLA 3CN7A 3ZWQA 1XVLA 1XDZA 3EVBA 1NUAA 1P72A 2GYVA 3K9FC 4RZHA 1D9ZA 1N5JA 2XLBA 4FE7A 4I55F 3EZYA 3ROTA 2O8EB 3RUAA 3SJZA 3HGMA 6AT1A 2JGDA 2HQRA 3CWZA 3I83A 1W0KD 2EKLA 2VJBA 1NQUA 4PLTA 5CEJA 6ADHA 3LBIA 4DGSA 1NTOA 3WB0A 5C80A 2HMVA 3IUMA 3DZKA 3TL2A 5DM1A 1NG9A 1QH1A 2R48A 3A6PC 4B6OA 2ZYGA 5ICCA 1BD3A 4CIAA 1RHUA 3P9QA 2GKSA 3PC6A 2PGXA 2AOWA 1MIOB 2QQ0A 4GWGA 2M6RA 1V3VA 5IMSA 1GGKA 3BZBA 3QVMA 2PHZA 4ARIA 3U4IA 2I2FA 3BD9A 1T3SA 2VHQA 3H0KA 2BZGA 2PRYA 2ZUDA 4LA4A 4XWYA 1E1QD 1U9CA 1QE0A 2XW6A 121PA 3LFUA 4G0QA 4UMDA 3K8ZA 3ZOKA 3AVTA 4BQRA 4AJHA 5JRJA 3S2EA 3I9JA 5FV4A 3RYCA 4GVXA 1USGA 3KSAC 3LXRA 4WINA 1U4NA 3CW8X 1A9XB 3RSZA 3PC8C 3V7FA 2ODWA 2WWFA 3GXBA 4HB3A 4QWMA 221PA 4Q3LA 3M49A 1ID8A 4MO9A 3ZIDA 3AKEA 3ZY3A 4EECA 5CD9A 5H81A 1JDBC 2V7UA 5JV5A 4D3XA 3LWDA 4HWGA 5J2TF 5ICEA 2PSEA 1OIVA 3L5OA 4N54A 1K7CA 4JD5A 5TS2A 2QM8A 5BV7A 3H83A 3IJ5A 4FXOA 3Q3CA 5GAJA 1OBHA 3V1YA 1GD1O 4Z9AA 3OZGA 4JYMA 5SYAA 1TW3A 4ZVMA 1EZZA 5KSWB 1Y8AA 4FD3A 4B4VA 3LCVB 2CXRA 2D8MA 2OBXA 2P6PA 4P4SB 3TZBA 3F8WA 3PQ4A 5KYKA 1UJNA 3KLNA 1S2LA 3V8RA 1EUCA 2J0SA 3UHJA 1YZYA 1G8HA 4WDQA 4F0JA 1FFXB 3FKSD 1JFSA 3BDIA 2PRJA 4DV6B 4ZQCB 3EIEA 4G5SA 1HSZA 5JD5A 3CJQA 1PZHA 1E2NA 1VL8A 4IUDS 3DDCA 4BJ5A 1G63A 4GR5A 4DCUA 5FI5A 1A1SA 2PLNA 3GOHA 5GJVC 4FFLA 1JIJA 1HZJA 1A5ZA 3ZVRA 3KU4A 1U8FO 2G4VA 4LJKA 1D1TA 1EWVA 2GQ0A 2W2XA 5BW6B 5D86A 2FZ4A 4LNUB 4UHHA 1EGAA 3A6HA 1U8UA 2IGBA 2NU9A 2RJ3A 3UJ9A 4TYNA 2JGJA 1QYXA 2GRAA 3CRNA 4V0LA 5CDGA 4P4NA 2FLVA 1NNEA 1U9IC 1CTQA 3EOZA 3WIUA 3GGCA 4WBXC 2LZ0A 4JXJA 3PSHA 4QYSA 1ZA2A 3TNDA 4N82A 3CH5A 1X92A 5TR9A 2JGFA 1TO2E 4M0UA 5DX8A 3EAQA 4MCJA 3D31A 1WM1A 4QREA 4BWVA 5CB8A 1RBZA 4YLEA 4GMKA 5EIBD 3AVOA 1AIPA 2PSSA 3JPYA 4OHKA 5HOEA 1IZ9A 1OASA 2A5GA 3ICEA 4YB8A 2JLWA 1UODA 4RC9A 3NRJA 2NQ8A 3NIDB 1X8XA 3ZX5A 2C7RA 1U28C 3DTYA 3U5TA 1PW7A 5HYVA 5EJ4A 4UJ5A 3ZGZA 1PK7A 2FLKA 1AO3A 2OKGA 2P77A 5DMHA 4IHAA 4WJLA 1DEXA 3NBQA 5ALZA 3A7EA 3NYRA 4ZCMA 1ZNZA 2ID9A 3E9CA 4QYIB 5DBHX 1VSVA 2CFRA 3GROA 1M34B 2C9BA 3WB9A 2VJAA 1EBUA 3IIMA 3NAQA 4P31A 1GFWA 4MRNA 2WAYA 3EY4A 4Q4LA 4LSZA 2MSEB 1OSNA 2GEFA 1H2WA 2YWGA 3PNQA 4K2AA 5TV2A 5DRTA 3GG9A 1CUXA 4BNMA 4HXYA 1DAHA 4CDMA 4WSOA 3G5TA 3Q4GA 1Y3BE 1ESEA 3ROZA 2JGIA 3D7SA 5E1BA 4UOQA 3WWEA 4L95C 3X1ZA 1EX6A 1ZYUA 5B2EA 3EG9B 3VAYA 1XZIA 4C89A 1H85A 1N9KA 5LZ9A 3B8HA 3N7AA 3V97A 1R64A 1XJCA 5LZ2A 4ZVNA 2Q9AA 4G89A 4OL0A 1QGAA 4M4SA 1NU6A 4OTZA 2IZOA 4NX2A 3V5NA 5L51A 3KPWA 5DIFA 3AKYA 4KDFA 5BSKA 2IU3A 4U7TB 3FUCA 1C8LA 2NV6A 1QSGA 1VHLA 3IAFA 3NHLA 3NTOA 3RVLA 4NCXA 5ENZA 4RIFA 3EULA 3TQOA 4BQNA 5KJ6A 1ZZEA 2PZEA 5EUCA 4EEZA 1RWPA 1VCMA 4YRMA 2UUBB 3EFHA 4H16A 1FK8A 1W8DA 1JDSA 2BHLA 2PSFA 1BKYA 3DD5A 3L4JA 1SPXA 4OM8A 1JIQA 4IKPA 5FLYA 3ZH2A 1EFRA 2BTQB 1BXRA 1LPSA 2WG1A 4U2GA 3ZWAA 4AJ9A 4TQAA 2QVLA 1TAGA 3P0FA 5U4XA 1PYDA 4E51A 5A4IS 3PEEA 4CKBB 2KM1A 2IUSA 3LCCA 5GIOE 4QNMA 5ALSA 3TTUA 3DC2A 3AKCA 3FCYA 4MUJA 4PYQA 1YRAA 2J3EA 3LT5A 5B7GA 2IE8A 3GP5A 4GO1A 4R8LA 3U3KA 3L9WA 2AMYA 1EINA 1I80A 1NLUA 1ONSA 1SVSA 1V1RA 1V1RB 1NUTA 2H0AA 2QZJA 2VDUE 1YQTA 3BIXA 1APBA 1LBQA 1QOZA 2GCOB 1Y3HA 3RWOA 3ZE8A 2V7QD 2VP9A 3IODA 3W6ZA 4L0MA 5IZCA 1QUFA 1N5DA 1T6YA 3T7JA 1MVNA 1RT9A 2XOEA 3BQMB 3MT0A 5MN5A 1RYHA 3IJRA 1GSIA 3SD7A 1FXWA 2E49A 4YAJA 1E94E 3BK2A 2G40A 3V6MA 1UDRA 1Z8HA 3CLSC 2II6A 3O03A 5KTPA 4TLBA 1OLUB 2VLBA 1QH9A 2J32A 1J8DA 3AHJA 3O47A 3RT9A 1YS2X 2RK4A 3A4TA 4RSMA 4W6ZA 4J7UA 1XD8A 4Z3DA 2CYCA 2O2IA 2Y8EA 3LC0A 4MGYR 4ZOAA 2IYFA 5ALNA 5TGDA 2ZKIA 1CB0A 1CUJA 2A5FA 1PT8A 1T2AA 2XXBA 1K9VF 3B1FA 1QLWA 1FDSA 4BFLA 2XITA 4X8OA 4ABYA 2JIBA 4ZYWA 3UKOA 5J2UA 1RFLA 3PHCA 2FWPA 2KS6A 3KKMA 2D2IA 2FV8A 3A4MA 2DLDA 3JQCA 4QRHA 2XTJA 3CO5A 4G67A 2HRBA 3TIGA 3HJFA 4E3ZA 1ENZA 5JNUA 4MWCA 1EGVB 2OPBA 1UFVA 4YRBA 1MJNA 1CVRA 1CQZA 2AS0A 3PXBA 4HH4A 4MRMB 2OCDA 1RRMA 5AXAA 1X14A 3OQIA 3DO6A 3BIOA 4JGBA 3O4IA 4TMTA 1BH6A 4FONA 3VTFA 4D97A 3GFOA 2J6CA 3MJSA 4QGHA 4Z0TA 3RARA 4JJ7A 4IWXA 4HMQA 2XUIA 4RVHA 2ZTVA 1VCHA 2OCKA 4P8RA 4JDPA 5B57C 3SFVA 1BXZA 2QTTA 3MCVA 1DTEA 1QHFA 1Q0QA 4W4TA 1J90A 2XD9A 4NU8X 4Y2VA 4CIWA 1QJ4A 2G09A 2BYTA 4MIEA 5CDUA 1WU8A 3PXAA 4Y6SA 4Y9TA 4FGWA 1L5HA 2OOKA 2GZ3A 3LM8A 3MS2A 5JANA 3WHPA 5MFPA 4GKJB 1YB5A 4N7BA 3AOEA 2BFBB 4KWIA 1VE3A 4F60A 1QIFA 1TIPA 3WHLA 4ZT4A 3ZJ4A 1ULBA 10MHA 1SUAA 1XV5A 3LCJA 5HP4A 1N2SA 3Q87B 2YV3A 4OP3A 2B7BA 1XKLA 3ER9A 1MT3A 1J0AA 2YXNA 5E6SA 1ZO8A 3R0QA 2FFBA 3A1TA 1B6RA 2QLLA 3JRXA 3OMWA 1CF4A 1U9IA 2FWBA 1DJQA 1LBHA 2VPZA 1G2OA 4IHKA 5C3UA 4U02A 3WV5A 1GTZA 1EI9A 1U2DC 1XDUA 5K2MA 4B4DA 1XMIA 4RLSA 4QJ4A 1GPJA 2JJ1A 3RC9A 4UCFA 2DPXA 2UXCB 1QCDA 3SM3A 1XMPA 4JL6A 5KVAA 5MGBA 1IK4A 3CO0S 2VF7A 3ZU6A 4CV1A 5C7LO 4NBUA 1DUVG 3G2OA 1XA0A 1U8XX 3CLTD 4C0HA 1TPYA 4FD2A 4RFLA 1RBMA 2GUWA 4C30A 5BRAA 4MVJE 3HBNA 2VA9A 3HHPA 4P32A 4BTEA 1NVMB 2HHHB 1P17A 4X7MA 3T0GA 1L7OA 1U5AA 2UXDB 2A3RA 3FIUA 3VOAA 1OB2A 3ZIUA 3MJRA 2QD2A 3LO8A 1JHUA 2FSVA 4JI4B 2ZYTX 3HZZA 4OQDA 3ILSA 3AYXB 1OWPA 4WXMA 3U9TA 1DKNA 3TBHA 1BDIA 1CUBA 1WCV1 4FGSA 1PHRA 3A11A 3HB1A 1FTWA 2D2VA 3O8QA 4BMDA 2B7LA 2DOKA 2HJ9A 4EPRA 5TMDA 3I1FA 1YR3A 3I30X 2BY4A 2RGDA 2C9DA 2PKYX 4ZVUA 3AUAA 3NATA 1U8TA 4ITUA 5C34B 4DQ0A 4MI6A 1U8EA 3K9WA 1M8FA 3LKDA 3H3XA 5DMXA 4ZI7F 5JRZA 3WB2A 4IMPA 2Z4SA 4KIFA 4LXHA 5H3LA 2RG1A 2YIDA 1OX4A 4I6GA 1FFSA 2D0IA 2WF5A 1SOVA 1MAVA 3D4LA 4FU0A 4D3SA 5KAPA 4F6RA 1UBEA 3RO7A 2UZ1A 3ZBTA 5DM60 4I4IA 1HC7A 4XEHA 4K6KA 2H31A 4BO0A 2XEXA 1W36C 1PL0A 2O0LA 1HQDA 4LHZA 2WHQA 2O0KA 3QJ5A 5CBKA 1PNQA 2H7CA 5CXQA 3Q9LA 1TMGE 1GVHA 2FMKA 4G0XA 3MJCA 2AMVA 3ISTA 1IJEA 2NXCA 3DFFA 4PC7A 2F8SA 3D6NB 3IRVA 3MCTA 3ZE6A 5FWAA 2EJCA 3QX7A 1E2GA 3R77A 1YACA 1DC4A 2CD9A 3DW3X 4GKAA 4B2YA 3P9SA 2W00A 3EXHC 4ZJZA 1OT5A 2JIZD 3L0CA 4OQMA 5I7FA 1Y8CA 1QFYA 2AH5A 1FRNA 1QG4A 2QV7A 3MSXA 4AURA 3VR2D 1T13A 3PRJA 1DHRA 1U2PA 2JBAA 1NA5A 1FIUA 5HKKD 5ALJA 1FDUA 3MCZA 3WLOA 4CT5A 4TYMA 1DJPA 4EJFA 1HL3A 2DBQA 2PX4A 4A23A 3L7IA 1T3GA 1ZPDA 2XGSA 4U7JA 2XE4A 3NO4A 5AJUA 4RA9A 3PWSA 2VPXA 2G0NA 3ZW7A 1A50B 1WLSA 2Q0QA 3GJ6A 1FP6A 1WDTA 4C3UA 2B2CA 3SIRA 4D82A 3PE4A 1XJ5A 4G9GA 1WPXA 1GKKA 1EE1A 1I7DA 2WZCA 3JD3A 4BNFA 4ZJYA 1BIFA 2ZB4A 3H2ZA 2OB1A 3JWGA 3QG5A 1KBOA 4QATA 3TVTA 3KSZO 5GVSA 1KP9A 5LIRA 2O3RA 4PR0A 2HWUA 3NBZC 3TRDA 1JMYA 2GYWA 4OU4A 4YWHA 3DKRA 4YAUA 2ZQZA 1EVIA 3QFRA 3OEHA 4ZTUB 1FNBA 2QUKA 1X2EA 5FYQA 4K9RA 3V8EA 5I9IA 2ERCA 3BN3A 2WU4A 5EIEA 4J1NA 5IKMA 1AHHA 1O7JA 2CLLB 1DKRA 1FU4A 2AE2A 4GPEA 1CJKC 3GP8A 4XYBA 1Y34E 1GUBA 2GPYA 1FTSA 3LOQA 4J94A 1SD2A 1NTRA 4H6VA 4REQA 1NATA 5EJAA 3TSWA 4B7ZA 1XTIA 2HLPA 2H9IA 2V9PA 3IVCA 3QNWA 3DDHA 4OGFA 2KLBA 4ALNA 1VXRA 2NVWA 3W6PA 3W5HA 4EYGA 3WMGA 2QENA 4QRDA 3B9BA 3DDUA 5EMLA 3IVAA 1XGKA 1YA4A 2P2ZA 3AJ8A 1C7RA 2Y1DA 4QECA 4J2HA 3L7LA 3P2JA 4MAFA 1BEUB 1KQOA 3N7TA 4WWHA 3OJ0A 4D43A 3X1DA 4HPJB 1T9BA 3DBHA 4M36A 1CQIB 2GRJA 2ZRQA 3RYFB 3VKVA 4MVYA 1B6SA 2JS7A 1XQ6A 4H17A 5LQAA 1IM2A 3A6KA 1JBEA 3GZ4A 4OQQA 4QXQA 4RWZA 2WWVD 5ITVA 2FG5A 3VYVA 3WAJA 3C3YA 1GCIA 2C7BA 2ZJYA 3H8VA 3M1IA 3N2EA 3D6TB 4L6AA 4LRXA 4NCIA 4RDHA 3RVDA 3KYCA 4A2PA 3JD4A 4DA0A 1YAJA 4PWYA 3T1HB 3SC2A 2AWOA 1M1UA 2J6BA 3SQWA 1FP2A 1YE8A 2E4AA 3THXB 3LX6A 5K0FA 4KO1S 2EX1A 4YJGA 3D3NA 3FAZA 4R2LA 1FYVA 1EG7A 3MRTA 3OWOA 4DQKA 5CFNA 4NQZA 1THGA 3TTVA 2FPIB 4LJ7A 3GJ7A 4L4ZA 4C08A 1KJZA 3M9WA 4IXTA 2OMKA 1E2HA 3RVMA 4EY4A 4JJZA 3AF6A 3WZMA 3VYRB 2EZ9A 3KYDA 3THRA 1OZGA 1YS7A 2P79A 5AO9A 3EJ6A 1Z4OA 2MWMA 3OFNA 3L7AA 1NBME 5CUQA 4ZCSA 5A5GA 4D9JA 1B8NA 1DDGA 2J7PD 2P35A 3OTHA 3GMIA 2MSNA 4GOMD 5AHOA 5CFRA 3THYA 3VC7A 1YHNA 2O1EA 2ZE6A 1XQVA 2X1VA 4I50F 4DAEA 1XZGA 3CE6A 3A04A 3JR7A 1E32A 3OLYA 5EWJA 3FB1A 1PV2A 2GN8A 3O3NB 2WWXA 5KI6A 4BVBA 4D4GA 5GONA 4GBGA 2DHDA 3S2IA 1DWOA 1OH5A 1XVIA 2H59A 2I65A 4RDXA 1PX0A 1GLVA 5AD1A 3CVWA 3C41J 3FDFA 2VF5X 1F12A 1KYQA 2PXHA 2Q4OA 1Z7EA 4JJ6A 4MGHA 2J33A 2XHZA 2FMXA 1NI5A 3WA6A 2ZUUA 3DC7A 4OUDA 2QRUA 3R1IA 4NZYA 5BUQA 1Z63A 3PNMA 3CG4A 3DZCA 1RHRA 3PP8A 4RVSA 3V4PB 1P7CA 1EFCA 1XDWA 3O5AA 1M2FA 3AVXA 3B38A 3DLAA 4O4LF 1J0EA 3QFTA 4YPVA 1KZ7B 2CNWA 4LZAA 4N65A 4TLLB 3UMSA 2HNBA 2JCSA 1MJGA 4I2NA 4LJ8A 3UWDA 3WL3A 4EVQA 4F3RA 5IJ9B 5J23A 3NCTA 2IPMA 1E3LA 4CEHA 1VG1A 3RC1A 2QSUA 3EA5A 3G9XA 4L2IB 2AZ4A 5D6OA 4ZT3A 3DBHB 3RYFA 4DHEA 3ZH9B 2WHEA 1BHSA 3N53A 2C4VA 3JSAA 4N0PA 1XCOA 4OI0A 1Y1SA 2FN9A 2C07A 3QBEA 5CBPB 5K3OA 3KQMA 3W04A 3A4NA 4EB6B 1GPNA 1V41E 1DO0A 4DVGA 5A5FA 2H0RA 1P7WA 2WQ7A 1AGPA 1FS5A 2EAUA 3KYCB 5A6VA 1RC0A 1U6IA 5DYGA 4XUDA 2HA3A 3QSGA 1YS4A 1ZU5A 4WADA 1O9HA 4MCHA 1P1RA 5DYWA 4Z51A 3IBGA 4LUCA 1FNSA 3PDJA 4GI7A 4OFZA 4AN1A 4BMXA 3T34A 2VDKB 4K05A 4MQMA 4ESOA 1J5EB 4IMIB 1UWKA 2P2SA 1PFWA 3IL2A 3GRZA 3KR0A 4YAIA 4LWQA 4ZO9A 4AWAA 4O4LA 1Z4MA 3I0NA 3ZDDA 4YRPA 3UAYA 3F71A 1MN6A 3PE3A 4O8CA 2IYLD 3NM4A 2P67A 1J8FA 5IZ4A 2X5XA 4GX2A 4JBWA 1CUCA 2Y05A 5I3CA 3PDCA 3BA6A 3T3EA 2HU2A 2YMMA 4D74A 5EHNA 5IJZA 1AJEA 2I4LA 2ZPAA 1C0PA 1B93A 2QRZA 2PXAA 3JVIA 1UAAA 2VK4A 4I3FA 4LRTB 3TKLA 2C97A 1FTNA 4Q9AA 1CG6A 1SHTX 4OJNA 4Q00A 2C3MA 2OXTA 3GLIE 4Z53A 2YFQA 4B7UA 1KETA 3V2GA 1FJGB 3Q7TA 3GGSA 3KSMA 2P6UA 3MJVA 2QRNA 4KR0A 2XB6A 3FCXA 4C0KA 4DAOA 4KTVE 3OKFA 4A8HA 1U3FA 1I32A 3L8CA 2AFHA 3CNHA 4HAVA 4CM4B 1QU3A 1PDWA 3WLRA 3ANTA 4M9RA 1WHTB 2FPKA 2P4QA 3RRBA 4FNOA 1XZCA 4AZVA 4B17A 2GILA 5CU7A 4IHQA 1T0JB 4R51A 1D04A 1VOTA 4FZJA 3UH1A 5KSOA 3N8NA 5KO2A 4G0WA 2HSDA 3ET4A 2NGRA 4AP6A 3MUNA 2B1RA 3PCTA 5DF1A 5EZQA 4Z6KA 2EJUA 1NQTA 3HA5A 2C5AA 2Q5JA 1UMBB 3K2IA 1FNNA 2AEFA 2BFOA 2ZAMA 3JYNA 4ENUA 1U3DA 3RREA 2JGMA 3PQFA 2Q6LA 4AMUA 1Z0FA 3NWBA 5GOZA 5JCZA 1UAGA 3AW8A 2WUFA 4H35A 3ZGNA 1C9JA 1Y4ZA 3G9QA 1ACMA 1DO2A 2FEOA 1QFSA 2P9HA 2DY1A 2O6LA 1FYXA 4PLCA 1D6SA 1MTOA 3RI3A 1E4EA 2H4XA 2AI1A 3CPEA 4IPTA 4OA5A 3MUFA 4OYYA 2QVXX 3L3BA 5CG2A 2AGVA 4CPDA 1TF2A 4Q1FA 3ZV6A 1COWD 1T8WA 1Y9JA 2ZWVA 3ABSB 2YWEA 4R2HA 4PLHA 5EKXA 1J0CA 4INZA 3DHVA 3KPYA 2JLUA 1V5FA 5B1EA 2NTYC 5KQPA 1SXJB 3GEEA 1UKAA 1BNCA 4HAXA 3OA0A 4JLOA 2L18A 3DFUA 3WJ2A 4QKQA 1E2MA 2ICAA 2XVZA 2X22A 3IDZA 5GOTA 4GI1A 3EEFA 1KZHA 2RHJA 4LEIA 1UEJA 4IRMA 4KFRA 2P8JA 1M7HA 4YCCA 1Z6YA 1UPBA 3AU9A 1XZ8A 2WPDD 2YZNA 3OAAD 4L76A 4EKYA 1CYEA 5DV9A 1EM6A 1ZC3A 1N5KA 2I1LA 1CIVA 5DTIA 1JB9A 1QE3A 1VCNA 2VT6A 2Z58A 5AR1A 1UADA 3IMEA 1XTRA 1JIKA 4M99A 3KAQA 1U8ZA 1G8SA 1PJBA 3I2HA 4K5QA 2B4QA 2IT1A 4C6RA 3G0IA 1SKQA 1GIAA 1L9XA 3GBVA 1TJ4A 5LQMA 2OZEA 3AK4A 2GASA 1P8JA 1Z16A 1THTA 2B2NA 1MNAA 2HWXA 2QRKA 3JZMA 1OV4A 3K2BA 4ZT6A 1OAOC 4H7KA 3ADCA 5DSXA 4FNGA 4FNMA 3RK4A 4I5FA 5IAKA 4F3TA 4E14A 3DG9A 1G59A 2YOFA 5FTNA 1AV6A 4GZLA 3BJMA 2IIVA 4JBGA 3WYFA 2F1IA 1C1DB 2PE5A 2P9TA 3RU2A 3MLAA 4JMPA 1G4HA 2ES4A 4FGJA 4J4TA 4FI3F 2BTQA 1QO0D 3DAHA 1BFUA 2QA5A 4C29A 4C6TB 3ITDA 3PKIA 4ZREA 3ZKWB 1F3LA 4ZTZB 4F4CA 3EK2A 3A06A 3UXMA 4ND8B 4RKRA 3RRXA 3RIHA 4UPEA 2QQGA 2FSGA 4Y9SA 4LDNA 3IP6A 2QM3A 3I6IA 5AK6A 1ZGHA 4JROA 4NRDA 1JQEA 1R9MA 3GLQA 3UOAB 3K94A 5JSYA 2JLRA 1I13A 4DJJA 4KPYA 1XVUA 2P9ZA 4E7OA 1HEYA 1QZUA 3IQIX 5JAQA 1MPTA 1U8AA 4M37A 2I2AA 2Z9BA 2ZBQA 1YB6A 4B4KA 4BN5A 5M7EA 2HMWA 2REBA 2C7QA 3EOAI 2OAQ1 4YDSA 1PUJA 4CMIA 1G0NA 2AFVA 1YH3A 4EFNA 1JLHA 2Q6IA 5F1KA 2W11A 1QHHA 2FPMA 3BJRA 2WTEA 4LMPA 3SX0A 3U6KA 2DETA 1V1MA 5KU1A 3LT4A 4A36A 4FFPA 3G89A 3A4LA 5B4TA 4JLAA 1UKZA 2HI0A 4DM7A 4PNEA 3L07A 1ZJZA 5ALWA 3E9ZA 1AKWA 4AAYA 4DWWA 1GQYA 1C3OA 3L04A 1WXQA 3UWSA 1O95C 3E48A 2BLLA 3FKQA 3CPJB 4P7KA 4QDOA 1A7JA 2ZIUB 4CIBA 2WJAA 3OWXA 1J8YF 1XHEA 4U5XA 4YRRA 3WGTA 2DQKA 4YMSA 2ZUVA 5HG0A 3VSDA 1HE2A 1JSCA 1UMCA 2R60A 3GIDA 3OKAA 1XYGA 4WZZA 4FB4A 3UKDA 1BA3A 4JP3A 5CGZA 3FSJX 1IQUA 5J2UB 1EVQA 4RDIA 5DCUA 2A0KA 4FBGA 2C7PA 1K89A 2Y0CA 1IPHA 1DOAA 1JSLA 1K4MA 2KYRA 2QTCA 3GA0A 3H4VA 4LCEA 4NBVA 4RUKA 5HQTA 1H5QA 1NVAA 4I1YA 4RLQA 5EP3A 4LVOA 4B9EA 5DT9A 5AOBA 4W1PA 3GFQA 4LYYA 2HK7A 3HUDA 1Q3HA 4LVCA 2FY8A 1IJBA 4ZV7A 1N8SA 3NALA 1ODTC 3JATB 3SSOA 1FC0A 3O7MA 2I22A 4CLOB 2GJ9A 4X71A 4EO7A 2YNMC 5ADUS 2EW1A 4GR9A 2NU9B 1TA4A 4V0RA 3HH8A 5FHRA 1VRWA 5DGXA 1W8IA 4OATA 5DLEA 4AUMA 4QG7A 1T8PA 2BTEA 3CLTC 4D96A 3H2JA 3DSRA 3TZCA 4F71A 1L4KA 4J1TA 4ZV4A 3GJTA 1K5HA 3TGPA 5JCOA 2LV8A 3AR4A 4H0CA 4Q1VA 1R4MB 1YFLA 5CFOA 2A84A 1JR3A 1X7XA 2E18A 3P45A 2PX5A 1F2TB 4O1HA 1DKQA 3BWDD 1TM3E 2QORA 1AQJA 5F4BA 4LBVA 2ZM6B 3UCEA 2WTBA 2O1SA 2VAXA 2XCUA 3UM9A 1UPTA 3WMWA 5BYBA 4X1KB 5G1NA 3IP5A 4E2FA 5KHLB 2FF5A 1AHNA 1Q0SA 2A1UB 4TYYA 1EJ2A 2Y27A 3DMRA 1C2TA 5HS4A 1IG0A 1A8IA 3K9HA 5LBTA 1C1HA 1HFWA 3T1YB 3QBVA 4DHWA 3G2JA 1RXVA 1J1IA 3OPXA 3EMDA 4DKXA 1T4DA 1TMKA 4IKEA 4M8NE 3C70A 1US8A 2Z1NA 3H05A 4JLPA 4HAYA 1C3EA 4IIUA 5DYTA 1OD6A 1KYTA 2EL9A 3OHSX 4M0PA 5AVWA 1Q19A 3D3JA 4ASUD 1ZISA 2B20A 2XJ4A 4YAWA 4JLWA 3V2UA 5B12A 1JSXA 3INGA 5IJ0A 2EFDB 5IJ0B 4MAAA 1JJVA 2O48X 4C1NA 5K8UA 2BGKA 3AEQA 4F8YA 1IXRC 4ETNA 3MWYW 1GP2A 2PT7A 3EQ8A 3NDJA 4PV7A 4ZAFA 3WNDA 4AO6A 1PO7A 3DNFA 4AMZA 1YK1A 1YZFA 5AW6A 1P6UA 3TLXA 3NB0A 3GRUA 5JC8A 1O4VA 2PMWB 4DVJA 3JD2A 1AS3A 5FLEX 2Z9DA 1EDOA 3DXFA 3ENZA 4JU9A 2IV7A 2GZRA 1DJMA 3UFBA 2G0AA 3GDFA 1MQ8B 1POXA 4O8ZA 3HDGA 4J8PA 1V1JA 2Q5CA 1J2UA 2VHEA 1L5OA 1RRFA 3R5HA 1WAMA 4WKGA 2HO4A 5HRCA 1HNXB 2EG5A 5WRFA 4ZI2A 3HFRA 1Z15A 3NW9A 4KXWA 1J0XO 1QV7A 2ZAYA 4A6XA 1NQ5A 1W7AA 1PN3A 2HY7A 1UOEA 4MUYA 4Z4FA 4R7GA 2PS9A 3N2KB 5C8VA 2RH8A 5DCWA 4AF7A 3D7LA 1GNTA 4PZLA 1GZ6A 3TIVA 3WGMA 4ZYZA 4N01A 1CJVC 1WU7A 4LOJA 4U7DA 2WJWA 3E8SA 2IYWA 3L77A 3CUTA 4LXUA 1PR3A 1NIPA 3F1KA 2WJJA 2O2YA 3F6YA 4IUYA 4LQLA 5K8LA 1MHTA 2JFWA 2PO5A 5CDFA 3SYNA 2KJQA 4BNJA 5ESDA 4F8JA 2CN1A 1F2VA 5JPDA 5HF5A 2JRCA 1ZOPA 1SUEA 2XQIA 3F6EX 3OIUA 1R4MA 1JFFA 2XVAA 3KK0A 1VMIA 4KQCA 4AP5A 1YJBA 4R81A 4LOLA 4A0HA 1D0VA 2EYQA 3PPYA 4V0MA 3MLBA 4HO1X 2R25B 3A2MA 1G8FA 3UATA 3LVBA 1LBSA 2RGBA 3N0TA 4GOLD 5J9FA 1BJKA 4C7OA 2QJFA 3RTAA 4D9GA 3ISJA 4DBLE 2DC1A 2I9PA 5ADHA 1ZD5A 2GN2A 3H5OA 1BZYA 4P98A 2D1QA 3IB3A 3R3VA 1YJQA 3VQTA 4BKRA 4DLRA 3O8CA 4WUVA 4GU5A 2FQYA 2FETA 3L6RA 5DI3A 4R8RA 4MQ6A 1YIAA 2XT9A 2WHRA 4AJLA 2W2NA 4DJTA 2AZTA 3M4YA 4AN0A 4J7CA 4DUPA 4XWWA 2CT8A 1HLFA 2EFEB 2EEZA 5KTSA 3TFOA 2QVCA 1ABBA 3EGDB 3C1TA 4F3CA 3TBKA 3E35A 4UAGA 4X94A 5F51A 2CZCA 3BJZA 3DTVD 3IURA 4IJ6A 5AI4A 2ZR9A 3VZSA 4O2AF 5AW4A 4B3JA 1RJFA 3HJTA 1V25A 2WA2A 1GL3A 2OD7A 2W4QA 4YQZA 4B6GA 5KWIA 3GJ8A 3EX7C 3A0UA 4MW0A 4RD2A 2HLNA 2DM6A 3ZE0B 1P3Y1 5B3JC 1OZHA 2IYEA 3HVRA 2EWMA 3C24A 3EIUA 1RCUA 3L8DA 1RI4A 3N8HA 3OE4A 3M4JA 5LM3A 4AC9A 3FWNA 3IKLA 1IHXA 1OT3A 4LZLA 1SKUA 4MS3A 1E3DA 1P2TA 2L82A 4ZPXA 4C4OA 2YBEA 3O95A 5KYVA 1WOMA 2Q0HA 2WSSA 3G7UA 4WQMA 4DILA 5KSYA 2BT4A 3OF2A 1YZGA 2D0DA 1VCOA 2J87A 1DC3A 4AWBA 1MW8X 2PKEA 4R8MA 1JECA 2CMFA 2F8TA 1Q2XA 4JLBA 2WMYA 3FDIA 5M5BA 5JROA 4MUFA 5JAHA 2KW5A 3ICPA 4GWKA 1L6RA 4C2TA 3PZBA 2C77A 3X2SA 5K8CA 5ECWA 2ERYA 3LUPA 4JOQA 4M98A 1SVKA 3IMFA 4HR7A 4LQCA 4PGFA 5D8DA 4BYMA 5UKDA 1HYBA 2JIMA 4H3VA 1AMOA 4YO8A 2EATA 1KDOA 3QYJA 1NY6A 3ZJ5A 1ACLA 3MWFA 4ND2A 4FZRA 4GXNA 5I8ZA 4KH1A 3BMNA 1QNLA 4ZO6A 5LLTA 3J7AC 2DCMA 2XADA 1MBZA 1PBTA 5BV1A 1VFNA 3A3PA 3DOCA 4J49A 4RFVA 4YLYA 1PGNA 3MS4A 2D1FA 4LMRA 4E1BA 2ZWOA 3S55A 4DPKA 4DT1A 1O8BA 2LBPA 1N9ZA 2DFVA 5L8VA 3FDXA 4M83A 4REMA 3P5SA 2FFJA 4FLEA 5AKXA 2NZVG 4YMTA 4B3TB 1QXSA 3JWEA 1LF5A 4G0MA 5F2KA 3OTGA 5ABPA 1J6UA 2Q5IA 2H85A 1YGPA 3D64A 5K2OA 3FCOA 3T7EA 1PNVA 1UZAA 3SZLA 4EKIA 1FXSA 1KJ9A 1QB8A 2HWKA 1HORA 4RULA 1HDEA 1XSEA 3KXDA 2CNLA 4BLTA 2F7SA 2H4FA 4TKMA 5DI3B 1V45E 2FWRA 4YI5A 2RSLA 3DMYA 4UNRA 4X0EA 1ICIA 3W5VA 1JQDA 3C8HA 3IAM1 3WMRA 4RKFA 4QPJC 4ZMBA 1UZUA 4MRPA 4BZQA 4ZICA 2OORC 2YY6A 4MDEA 1ZD3A 3RT7A 3FCUB 1IMOA 1UJCA 1ZOOA 2C20A 2AXNA 3I8XA 5BQPA 5BY2A 2JW5A 3ZGOA 4HRVA 2YW2A 4L50A 4C5AA 5AXBA 3H42B 1USWA 1VE7A 6YASA 3AVVA 1UM8A 1E7WA 1D8AA 2GJKA 5REQA 2AVDA 3UANA 2AIRA 4JA2A 2PCLA 1Q1ZA 3GV0A 2PZLA 3K8OE 4BLQA 3K8YA 3DDNA 1JVSA 4IOJA 3C6ZA 4UATA 4XDYA 4C43A 2O52A 3O3OB 2JCXA 3C85A 3I12A 2W93A 3PUKA 4ZOCA 3T41A 4EK9A 3W5BA 2H1WA 3QYAA 1XCBA 3G2IA 3M1AA 4J0QA 1PJCA 4I3GA 4UMEA 5AI8A 5D6NA 3S99A 4LGMA 5TQ2A 3SLGA 5LOVF 4OU5A 4CIYA 3OQMA 2XT0A 4IDOA 1WUKS 4HDAA 4O2AB 3ZWWA 2AN1A 2C2KA 3P94A 1EVKA 5EWLA 4HZUA 3AUJB 1W4RA 4I1SA 1JHOA 2M98A 4BKQA 5JSZA 1DI0A 2LVBA 4X6XA 4MWOA 2FGKA 1KPGA 1O8CA 2A88A 4N6GA 2BEWA 1JG2A 1LK7A 1LNQA 4Y0VA 3OEWA 2QZ9A 1YZHA 5KOHB 1PZMA 1FP4B 1N7GA 1Q17A 4PX2A 5AHKA 5AKGA 1VMKA 1YRBA 1SCKA 1G64A 2FPGB 3L1KA 3OQ6A 2XZOA 1BH2A 3B9PA 3GLIA 3VC3A 1N57A 1LS1A 1G9XA 3HYCA 2AR0A 3M8KA 4DQVA 1ZY2A 3TRKA 3IVXA 2Z6QA 1K98A 1EAYA 1CY8A 1EK6A 3ICOA 3X1WA 5B6PA 2NT4A 1K7XB 1I6LA 3VH2A 5KYXB 1RLIA 2SNIE 2YZGA 1AKUA 1ZH4A 1N0VC 5CFZA 2WVJA 2RGRA 1ELOA 1BHQ1 3ZHSA 3OICA 4BLSA 1L9KA 3K4HA 4DRZA 1RP1A 2A4MA 1NLYA 16PKA 2FP3A 3EGEA 4NZMA 4PFJA 5FB3A 3IIEA 4LRYA 3TAUA 5KNCH 4TLCA 4L73A 1SC4A 1IY8A 1PZEA 2G7ZA 2O0HA 3HI4A 3BM5A 3OZTA 4HGRA 4MKGA 5HIIA 3TVYA 3R7DA 2O8BB 2HHJA 3QF4B 1MJGM 2BFDA 3OX3A 1C30B 2C5SA 3X44A 3U62A 4C6SA 5IXYA 3SVLA 2GX6A 4DLZA 1GZDA 3SHTA 1KAGA 1G38A 5IC4A 2ASEA 5K0GA 1GU1A 2EFCB 3IDAA 2C78A 2VHTA 4MJLA 2O7VA 3GEGA 1GGEA 2PX0A 2DT5A 1C9KA 1YS1X 3F7TA 1HG0A 3KB6A 4M1ZA 5E2BA 1TJPB 1EUZA 3BMQA 4LXYA 1TVKB 3GEIA 1SD1A 2H2FA 3AR5A 5FYDA 4TSRA 1SELA 2Q07A 2VT3A 3BFJA 4BMNA 1GG8A 1F38A 4EGCB 3ZX4A 5LNK6 3BS4A 1ITZA 4HJRA 2VXBA 5GONF 4DLLA 3O0TA 3JQAB 5FTWA 5B2FA 3Q7EA 1RXSA 2AEMA 4KLNA 2I3DA 3VH1A 5HMLA 4INJA 2IV3A 1FRZA 5F1PA 2FX3A 4LE2A 1DIHA 5DP2A 4EQ6B 4YMWA 2UZAA 4EQ6A 1DG3A 1N36B 1HYQA 3JAWA 3TMAA 4LIPD 2OCBA 3NR2A 4NECA 3TLYA 4LW8A 4A7PA 4OQFA 1XD2A 4KBYA 3TUZC 2AFIB 4ZEMA 3CQ9A 1GG5A 2CWDA 1F0PA 2EU8A 1MRZA 5A3SA 1BEEA 4KXNA 5LBUA 1KEEB 3KPVA 3NHAA 5C8YF 3IALA 1SVUA 4OHBA 2AJLI 4O2AA 2ZT6A 1CDZA 2GA9A 2HW8A 3UJ8A 2H7XA 1PL7A 2JCBA 3MJDA 2A86A 2PH1A 2ZRDA 5EQFA 3WZ2A 1Y4UA 1H2RS 3ENVA 1EZ4A 5CDTA 3V3KA 4K6OA 2REQB 1OY1A 4BO9A 1P2VA 2QGNA 4LVUA 2OMEA 4Q4JA 3FPHA 5GPBA 3MSCA 2WF7A 3AI3A 1N3LA 1FVOA 3QVOA 1WUTA 5IXJA 3A7DA 1O58A 3NBAA 4RW0A 3UWOA 4WOJA 3WGNA 5K0LA 2FJUA 2PGOA 2Y4NA 3BRSA 2YZ2A 3DT6A 3THXA 4I1OA 4KMRA 4YREA 2ZYUX 4OCZA 3C4QA 4IMJB 1NASA 3IOBA 3RUPA 3GU3A 1U7DA 5BXQC 4FHDA 5EPOA 4DCSA 3HCCA 1EEXB 1YQGA 2PUJA 3P26A 2IHUA 4W82A 1W1IA 3T3OA 1RWXA 4Q7JB 1WKCA 1C1YA 5IN4A 3KTAA 3WL4A 3LCUA 1YR9A 1RWKA 3GPDG 1GQQA 1XCJA 3KKNA 3WBBA 4RQBA 3DKPA 3HE3A 1P5FA 2HMTA 2XUAA 2H2GA 2VAWA 3THYB 1S02A 4II2A 4MWGA 4K9QA 4PLFA 2CHGA 1A9TA 3PGVA 2IXTA 3HCDA 4ZZ0A 4AJOA 2QM7A 4RVUA 1NI4B 1XOIA 1OWMA 3O4RA 1V4BA 4YFVA 4LBWA 1VGVA 2G63A 3BZWA 1HE3A 3KOZA 3TK1A 4FDVA 4MVJP 3TDMA 4QUIA 2B34A 1ORTA 3T5DA 2LTAA 3VR6A 4E21A 1MGPA 3FKSA 4F7WA 4P80A 3OFJA 3GOQA 3KQSA 5B1IA 1NN1A 1M8GA 2ETXA 1P0IA 2WKPA 4UTXA 4KV7A 4A15A 1FS4A 2ZI9A 2XSZA 2DGDA 1Q95A 1MMFB 4P4TA 4UHKA 3CPSA 1QIEA 2AZMA 3T12A 1Y8ZA 5JVDA 5HTOA 4ILKA 3NKVA 3B53X 1QZTA 4LXQA 3FYUC 1U0NA 3WI7A 1DTWB 2FSPA 4C0LA 1J42A 4R1PA 1VBNA 4UPDA 1JH9A 4JELA 2PN1A 3HKDB 3FYUA 2ZJOA 3OQPA 4E46A 3EPKA 3PJDA 4J43A 4GPD1 4J91A 2JGDB 1H2ZA 3E8XA 4M1EA 1GYRA 2X0IA 1Z8NA 2AFIA 1T5HX 2ZQ5A 4IQFA 3VU8A 5AI6A 2QTVB 1R74A 4FHGA 2P2CA 2XYGA 2QY6A 3B6JA 1J1ZA 3SJ7A 3O8RA 5E8JA 4Y0AA 1UXJA 2VRBA 3HJCA 1K7EB 1O87A 1Z5UA 3B60A 5KHAA 3J81k 4AKGA 1HURA 3WY9A 1DQPA 1AOXA 2WFAA 4UCQA 3IR6A 4XWAA 2ET6A 3O1JC 2O1WA 2Q5LA 1XL0A 2P65A 4DG9A 4AICA 3OU7A 1ZR4A 5HMMA 1UM9B 3G1TA 5IC5A 4GC5A 4LDZA 1HKUA 2YV1A 5AVTA 5KNCA 2VA8A 2YWBA 1IONA 3IEXA 4AYTA 5E7MA 4BNDA 2VPTA 3N9IA 3G0GA 2IDKA 4XB1A 1RXWA 2CL7X 4GI2A 1FTYA 2GF9A 4RV5A 3HWRA 1RE1A 4RA6A 3UK0A 1RTKA 3PX7A 3V1MA 4LF9B 1WB5A 4X1YB 3H17A 1XRLA 4B4WA 3ETDA 4DSZA 2G9ZA 4QM7A 2JKVA 4F12A 1HNWB 4MA4A 1BROA 4P33A 3T4XA 4MV3A 3IKTA 3EDOA 1A88A 4P81A 3LO5A 5EN4A 5AKIA 4JENA 2W4IA 4CIDA 4KIJA 5B7NA 2JD2A 4CF5A 4MA5A 4FM9A 2Q4DA 2XUJA 3Q5EA 3ZZUA 4R1SA 3W9UA 3D54D 1JMVA 2IJGX 5IAJA 1YKSA