1ZDMA

Crystal structure of activated chey bound to xe
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
128
structure length
127
Chain Sequence
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein cheY
publication title Distinguishing multiple chemotaxis Y protein conformations with laser-polarized 129Xe NMR.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
total genus 42
structure length 127
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zdmA00
4XLTA 3MA0A 4RK4A 4MQEA 4RS3A 1U2PA 4XARA 1QQBA 5TPZA 2WWVD 2FEWB 2HSGA 3LKBA 3NHZA 9ABPA 4B09A 2B4AA 2JRLA 3CS3A 1Z17A 2R48A 4Y9TA 4EVQA 5C5EA 2GX6A 2M1ZA 1DP4A 2WRZA 2JBAB 3ILYA 4H3HB 3SQNA 2P4UA 4YO7A 2MYNA 3FFXA 4MS3A 2HPHA 3K9CA 5FWXB 4E7OA 2LBPA 8ABPA 3TX6A 3H5LA 4S05A 4DN6A 4EY3A 3RVNA 4FE7A 1CHNA 4G0QA 4RZSA 3OLXA 3IPAA 1AB6A 1DG9A 4N0QA 1RXIA 2TMYA 3FFWA 5IEJA 2JVJA 4KPYA 3A0UA 2V0NA 4G0MA 1DBWA 2H3HA 2JCGA 4KVFA 1YK0A 2VUHB 4MRMB 4ZJPA 1DZ3A 2GI4A 2XDYA 1AB5A 2RDMA 2FQWA 1F4VA 4MS1B 3HV2A 1EWKA 1XWWA 3VNBA 1APBA 4Z0NA 3IP7A 3JPYA 4KQCA 3HZHA 1MAVA 3TO5A 4EUKA 3H75A 3G85A 1FQWA 3D8UA 2FTKE 4N0PA 3N75A 3O75A 3I42A 4NQRA 1YTUA 4JA2A 4WXEA 3EJWA 1RXEA 1JLKA 1DC7A 2PUCA 1NXOA 1GLGA 2L2QA 1C0EA 1Z13A 5FWYB 4W5OA 2CD7A 4N41A 1Z15A 1YMUA 3DGEC 1QMPA 4YP9A 2GWRA 3RVJA 3HJFA 1DCMA 1E6LA 4KK4A 2PUDA 3BRSA 4MR7A 2FSPA 4ZMRA 4Z4HA 4RXMA 4KREA 3GRCA 3Q15C 4O5AA 4W5RA 2PMCA 3IPCA 4ZPJA 3Q7RA 4LZLA 5KQLA 3MIZA 1QNLA 3H5VA 1ZDMA 4KNYA 1YS6A 1Z18A 2WB4A 3H5IA 4RWEA 1PNTA 2HQRA 3O74A 3TD9A 4OBBA 1JYFA 2B1JA 6ABPA 1YMVA 3GV0A 4RK6A 4KFCA 2WY2D 2LP4Y 1U0SY 3CG0A 1ISSA 2MSLA 2MYPA 5KQGA 1JX6A 1VKRA 2CHEA 3H1EA 1SD5A 4KV7A 1EFAA 2A9QA 3O1JC 3R0JA 3CLKA 1KRXA 2F8TA 4TLMB 3CZCA 2PE5A 2PAFA 4W5QA 4XAQA 2KYRA 3BILA 3KSMA 3HM9A 3HSYA 3LUGA 2MSWA 2QVCA 2QV0A 2E4UA 2PJUA 1E6KA 4YLEA 2OQRA 5CNJA 3JS5A 3LOPA 5CNMA 3MQ4A 1JL3A 4KRFA 3RVRA 1NY5A 5KQMA 3F6PA 4QYMA 1U8TA 2JB9A 5GQSA 3N0XA 3RQIA 5HKOA 2BGGA 2QR3A 4MGEA 3LUJA 4F8JA 1CYEA 4GNRA 4MQFA 3L6UA 3E3MA 2FN9A 3N53A 3E61A 4EYKA 1M2EA 5DTEA 5CNIA 4IF4A 4L4UA 3CZ5A 5BR1A 1NXWA 2E4XA 2H0AA 2NT3A 1USIA 5DLEA 1LK0A 5EWMA 2IYNA 1FFWA 3G1WA 1WETA 1NXVA 4Z99A 4IGAA 3LUCA 1BVHA 4FB4A 1KRWA 4P98A 4MR9A 3GL9A 3HUTA 3SNKA 1BAPA 3GT7A 1E6MA 3JY6A 1DCFA 4JOQA 2PL9A 1T34A 5JNSA 4D6YA 2PKXA 2FN8A 4PEVA 4EYOA 1DJMA 3CRNA 4MR8A 3RVOA 2QU7A 4LDZA 4LX8A 3EQ2A 3N0WA 4MQEB 5TE9A 1VLZA 3BREA 4O1HA 2JVIA 2GBPA 5HM6A 3LFTA 4EYGA 2QW1A 4IMIB 3BBLA 1ISRA 4MS3B 4RY8A 5FBHA 3I45A 4OATA 1IIBA 3QELA 4M88A 3KLOA 5TQJA 5E3JA 3H6GA 4KQ9A 1TLFA 2AYXA 3GBPA 3LUDA 4XASA 4YRZA 4RKRA 4WXMA 3FFTA 5T7BA 3RH0A 4N47A 5B3JA 3N6VA 4KMRA 3EODA 1BA2A 2YHAA 4Z4IA 2FMKA 3HDVA 1Z25A 1RPJA 1FSPA 3NNNA 1S8NA 4XFKA 5IBQA 2CWDA 2VUIB 4MS4A 4O1IA 3HO1A 4Q6WA 5IUNC 4D6XA 1P6QA 3KTOA 4EVRA 2FXIA 3OQMA 1USKA 1DRJA 4Q7EA 1YS7A 4YGXB 1P6UA 2GKGA 3QLUA 3M6MD 5TQ0A 3HS3A 2FVYA 3KYIB 3VNAA 3IP9A 4QICA 3B2NA 4G86A 4L85A 3TB6A 3T95A 5BRAA 2M98A 4G97A 4MAAA 1NATA 3M9XA 1I3CA 4RK5A 4RY0A 5TPWA 1BDJA 3UUGA 1JFSA 4HYEA 4S04A 1FFSA 4MR7B 2PUEA 5KC9A 3I5AA 3JTEA 2QVGA 2IPMA 3O2SB 4YS6A 1EAYA 1Z26A 4MS1A 1ZHHA 4JAVC 3H1GA 3KCNA 3LKVA 4GPAA 4PZ0A 5JNVA 1YIOA 3O21A 3OO0A 4JB2A 4ETIA 2VYCA 3CTPA 2DRIA 1M5TA 2NUBA 2J48A 1BDIA 1YVUA 3CFYA 2A9RA 1ZN2A 3SAJA 5ABPA 4YV7A 1E2BA 3MM4A 4PE5B 4G0ZA 5B3JC 4H60A 3KS9A 4KK3A 3KJXA 1CEYA 1JF8A 3S99A 1U04A 4H3KB 4TLLB 3L49A 1JWLA 1ABEA 4RK0A 1EHCA 3M9WA 4TN5A 1VRVA 4UHJA 1DBPA 4RV5A 4RSMA 2QXYA 5F64A 1GCGA 3Q9SA 2E4VA 2E4YA 3OQOA 3QLUC 4Z9BA 1D5WA 1QQAA 5TQ2A 5C5CA 2LPMA 4ML3A 3LMKA 3O2JA 3QLVA 4D74A 3OQNA 1USGA 3BRQA 3I09A 3IP5A 1MB3A 1GUBA 4RY9A 4RXUA 2OENG 4DADA 1RZRA 3H5OA 3HCWA 3O1IC 3QEMA 4F06A 5DCLA 1SXIA 1GUDA 1JBEA 4PYRA 4OLAA 4NICA 3C6QA 1K68A 1URPA 2L19A 4MQFB 4ZMSA 2A9OA 4HNRA 1W9HA 2IPNA 3HK2A 1QP7A 4WZZA 1Z12A 3HVRA 2IDMA 2ID7A 3KHTA 5EWMB 4NCBA 4ZYLA 1K66A 2E4ZA 4QYWA 2FQXA 4YCSA 1PEAA 2HQOA 4N03A 2FMHA 4LE2A 1PNRA 1ZGZA 3URMA 2LUOA 4Z4CA 3GBVA 1JFTA 3CG4A 3SM9A 1OXBB 3UK0A 2FLKA 4N76A 1C4WA 2PUAA 4NV3A 3F7NA 5EWJB 4HNQA 4MR8B 3Q41A 5JNRA 2PUGA 3OMWA 3EULA 1YK1A 1ZH4A 3C3WA 4JASB 2QSJA 3IP6A 3KKEA 5JNTA 4Q6BA 2Q5CA 2MYUA 1PUXA 3OM1A 5EWLA 3QLVC 1EWTA 4RXTA 4Z4EA 4EVSA 5KWSA 2WMYA 1BDHA 5KC8A 3DLHA 4W5NA 3OMXA 3QELB 4IMJB 2IKSA 1TMYA 2MYTA 3OLVA 3RVLA 3RVKA 1MB0A 3QEKA 3LTEA 1MVOA 3F73A 5HSGA 4RK1A 5GOTA 1JH9A 1LJLA 5I4CA 3DGFC 4RKQA 4P1ZA 1J56A 4KZKA 3K4HA 3ROFA 1A04A 3CKMA 3KLNA 2PL1A 3HEBA 4LE0A 2YHBA 3NNDA 4E7PA 1QPZA 4PICA 1JDNA 1EWVA 3HUUA 4MS4B 1ZH2A 1VPWA 3DLBA 1JYEA 2FEPA 4RU1A 2NT4A 1SXGA 7ABPA 6CHYA 3NBMA 1TM2A 5IC5A 2HQBA 1LBHA 4Z4GA 1U2QA 2MSKA 2JBAA 2FKAA 5TQ0B 1QKKA 5IEBA 2IPLA 5FWXA 1QO0D 1PHRA 1D1QA 5CNKA 4G0YA 1M5UA 1HEYA 5BQ3A 2R47A 3QX9A 5JNUA 3C3MA 1ABFA 1DRKA 1DCKA 5JS1A 5TPWB 1NTRA 2R25B 1TVMA 1QP0A 4MLCA 5PNTA 2F8SA 5HQJA 4NCAA 1SXHA 3CU5A 4MRMA 4UHKA 3JPWA 3JVIA 2LIVA 2FLWA 4JP1A 3QX8A 1UDRA 3T8YA 5JNWA 1QO0A 4IRXA 5T3YA 1DBQA 4YR7A 4EGSA 3MYYA 4JB0A 5ED4A 3H1FA 2PUBA 5IULC 1P2FA 3EAFA 3HDGA 1KGSA 1XHEA 4OG2A 1L5YA 3Q7SA 3RVMA 4RDCA 4DQDA 4F11A 2PUFA 3P9YA 1B00A 5FWYA 5KI6A 2A9PA 3N0RA 5CHYA 5IUJC 1RZRD 3H5TA 3NNSA 2P9HA 3LUHA 3FDFA 3LUFA 5IX8A 3H5WA 3NHMA 4W5TA 2W42A 3O2QB 3W9SA 1XHFA 3CHYA 2IOYA 3FGZA 3KG2A 1W25A 4XXHA 3F6CA 3MMNA 3CNBA 3ROTA 5TQ2B 2QZJA 1TJYA 4Z9AA 3KYJB 3A0RB 4QPJC 3RVSA 2R4QA 3UKJA 2PLNA 3OLWA 1MIHA 3LUKA 3QLTA 5DKFA 1D1PA 3GYBA 1Z2DA 4ETMA 1ZY2A 2JK1A 3LUAA 2ZAYA 3O1HB 3QEMB 4MYRA 1ZITA 1ZVVA 3EGCA 3FMVA 3ILHA 2RGYA 4MPTA 3SG0A 2O20A 3OLZA 4CBVA 1A2OA 1RNLA 1D4ZA 4RK7A 3HXMA 1JDPA 3MF4A 1PEYA 1Z16A 2ZWMA 3RVQA 3GA5A 2N9UA 1NXTA 2FQYA 2RJNA 3SY8A 2ID9A 3Q7TA 4LRQA 2NZUG 3C3KA 2FMFA 2RJOA 4LE1A 5BRJA 1JHZA 1NXXA 2AYZA 2VK2A 4Z4FA 1JFVA 4TMYA 3GWGA 1D2AA 4WT7A 3EDCA 2JVKA 4MR9B 3JVDA 4OTZA 2L18A 2WJAA 1SRRA 1FFGA 1F51E 5D2CA 2L17A 1L5ZA 1Z2EA 3OO1A 2HJ9A 3N8IA 3OLYA 1M2FA 3T6KA 4LDAA 3C97A 1NXSA 3D02A 1H9CA 2FMIA 3QK7A 3DZDA 3T38A 2E4WA 3A3KA 4G0PA 1LJUA 1A0OA 2CHFA 2WJWA 1NXPA 4YWHA 3RVPA 1R8JA 4F12A 2FW0A 4OLBA 4MLDA 2I6FA 1LBIA 3IDOA 5EWLB 3TMYA 3EQZA 1OXKB 3OM0A 1ZESA 5FBKA 1QP4A 4F3TA 5TPZD 5IUKC 1P8AA 1ZAYA 5DGCA 2IPAB 1KMIY 3DBIA 4WUTA 4IILA 1DC8A 2NZVG 4WWHA 1Y1LA 3H6HA 5KQPA 4HNSA 2X7XA 4EYQA 4FE4A 3A10A 1GCAA 5EWJA 1ZGGA 4G0XA 4G0OA 2FEKA 4ETNA 5JS2A
chains in the Genus database with same CATH superfamily
1ZM9A 3GQBA 4H16A 3PNQA 4M87A 4ZREA 1FBTA 3EARA 4N7BA 2VDJA 4BU0A 2K2WA 1OMOA 3LKBA 3ZCQA 1E9FA 1GU1A 3DWGA 4UFPA 1VJDA 3MJSA 4N9QA 5DCUA 4DGQA 1GZ7A 3BSWA 1E4OA 1US8A 1MXHA 3FYUA 3ILYA 2EBHX 4CQMA 4YCCA 2B37A 3ACCA 1YS9A 3FFXA 5DHRA 2FHSA 2ZBVA 4QU8A 4UZFA 5F4BA 1QO7A 3HB9A 3TM5A 1JJBA 1CU1A 3K8ZA 3TE7A 2IW3A 5J2UF 4QC2A 1ODSA 2XMDA 4HAIA 1U3WA 2J9FA 4WKOA 3ZBUA 4PRLA 4AXBA 4C4ZA 3HCCA 3LI2A 4CW7A 3I2YX 1H6BA 5IEJA 4ZVUA 5DH9A 4RQTA 4AY5A 4ERNA 3A0UA 3KQTA 5MFZA 1E3SA 5CFQA 2EEPA 5JJ5A 2XGOA 3A6KA 5DM60 4BCBA 3L77A 2BFPA 2F43B 1DZ3A 1DO8A 2FWNA 2GI4A 3MW8A 4UE6A 4ZQEA 4TTJA 3RJMA 1AB5A 5AHKA 1AN9A 2PKYX 1F4VA 3E7XA 1O94C 4B43A 1J21A 5AHOA 1Z7EA 2FWJA 1GAQA 5J23A 1T8TA 3IHKA 1XEWY 5BWCA 3OIDA 3R76A 1G9XA 3K6RA 4I1OA 4PR3A 3WDLA 3EQ6A 1NMXA 5TB5A 3NHRA 1ICEA 1R0ZA 5DGXA 2Q5HA 2JIOA 3K6JA 3O0TA 5KVVA 2CY0A 2HPZA 4YCLA 1UFOA 2RKBA 1THTA 1T3GA 3M81A 1T3TA 2EERA 2WZDA 1GLGA 1YQ9A 2P6MA 3KEQA 3FDIA 5LLTA 4YRPA 3WYGA 1XJ0A 1PD0A 4Q4JA 5LNK6 4O2AF 3ST7A 1N2EA 4EJSB 3EXG2 4OB8A 1TJPB 4OXRA 2Y67A 1X7YB 3ZZTA 4BMNA 3BTSA 1UZAA 3AIOA 1CE8A 3E84A 4B4WA 2XZDA 4DMKA 5LYJB 2ECOA 1E9RA 1E0SA 3P1JA 3TLAA 4HNVA 3DE4X 3DM5A 3RIYA 4NH4A 3B3GA 2NYVA 4E5YA 5HFNA 3O1LA 2VKQA 3AEKB 4IIVA 4AF6A 5JS7A 4CL0A 1KMMA 2UZIR 3OZCA 1JYFA 1HE8B 3ECAA 3K0BA 4OBBA 1IK6A 4QUAA 3FB4A 5HF6A 4JI4B 4M7PA 3WR5A 4M1SA 2MSLA 5TLSA 3QP9A 2CHEA 3NDPA 3J81A 4CWAA 2Q5OA 2X6RA 5AO9A 3KXKA 5FOUA 3ZH9B 4N5NA 3I1IA 4CIVA 4P4SA 1L4NA 3PGKA 1Q1NA 1Z2AA 3HLTA 1RLTA 5FLKA 5JFOA 3GLTA 4O1MA 3D8TA 2PU5A 4QWWA 3OA0A 1CCWA 3HSYA 1ZGAA 3WWZA 5J47A 4RZ2A 1U7ZA 4DSUA 2YYZA 4EI7A 1W8IA 5DFAA 4AJ2A 1KP2A 3D2LA 4Z9XA 1KAQA 1XU4A 1FXSA 1C9JA 1NPYA 1IUPA 1W4BA 1WXWA 4MKHA 1PX2A 1PK9A 1T8UA 4F93B 4GI7A 4DPLA 3IB6A 2O9JA 4K28A 1QJ4A 4A8JB 2FFQA 2IXTA 1J42A 5EE0A 4G0UA 5EXSA 4OI0A 3UXMA 1SCNE 1EEXB 2OV8A 2BHNA 1X70A 2Z5VA 1W0KD 3M5DA 1XTJA 4MVJA 1IJEA 2FAXA 3AUSA 3H2ZA 1GVNB 2EL7A 2HDWA 2KLHA 4RJLA 3A32A 3D4IA 1RQXA 2XB2A 2O2YA 3F49S 3M70A 4XJTA 3ETCA 2VH2A 3OJOA 3RSGA 1DIGA 1V6CA 3L05A 4FCVA 3OFKA 2ZBQA 5KNDD 1SKYE 3BL8A 2CLFB 1USIA 1GZ3A 2GPWA 4U7HA 1LK0A 4PBRA 1ZWKA 1BVHA 2AD5A 5TMBA 2G0TA 2BHTA 4DHWA 1SCBA 5GZ3A 1BAPA 3GT7A 3OQIA 3EXIA 1I1OA 4X45A 1ND5A 4UFNA 3IAUA 1GR0A 2BFCB 3E5RA 3IAM6 3WQHA 3QQ5A 1AO0A 1UBCA 5AI8A 1XN4A 2FN8A 4MVJI 1I7DA 1N7GA 1RVV1 4PEVA 4IOJA 4NJEA 3SBDA 2ZI4A 1Z75A 3Q3CA 3T41A 4BQEA 4FZRA 1P9WA 3IGFA 3IMFA 1THMA 1MU0A 1NOKA 1YUBA 5C1BA 2CXNA 3KJGA 3HWX1 5LQAA 4ILEA 1Y3IA 2R86A 4TLCA 3A1TA 4ZI2A 2IH2A 3R7NA 2DP4E 2JCVA 5J2TB 1C1HA 4OOEA 4TYNA 2GCGA 4L07A 4UARA 3AETA 1Z5PA 2IOFA 3BOSA 5BOSB 4D96A 3ZKAA 3L0CA 2AMYA 5JHHB 3AU9A 3PXUA 1Z7YA 2PRZA 3HDJA 5DNVA 2UYQA 2WAYA 1BSVA 5CBPA 3ROQA 1G1AA 3T3HA 4WXMA 1Q0RA 3GT4A 3I2KA 2EL9A 4X93A 3SEQA 3O8QA 1A4UA 3UBMA 4DBLE 1NUSA 1NL3A 1VFPA 2H1LA 2QX8A 1J7KA 1NJ8A 2ZIXA 1YFZA 4CMAA 1RTTA 4YFYA 4OAQA 3S0JA 4BNIA 1FSPA 1Y33E 5DTJA 2C3OA 2NQ8A 3T7TA 3ZDZB 4GOOD 3Q2OA 1ZRHA 3SKYA 2FXIA 2VLIA 2YXPX 5CU7A 1M2OA 2BBSA 4CIWA 1C8LA 4S3MA 4CV3A 1A9XA 3T3OA 1DG3A 3GFQA 4PZCA 5KTNA 3HB0A 3TM4A 3TTWA 3GCDA 3V46A 5L45A 2HD4A 1B2LA 4KQHA 1PFQA 1E61A 3IYLW 4QOHA 1YOVA 2YOGA 4BV3A 4CEHB 3MGKA 1B7GO 2V59A 4QYIA 4LXIA 1W4AA 4FQ8A 2BMJA 5EHGA 8GPBA 2O3JA 4IJWA 4J3JA 5JCZA 4UBMA 1MZPA 2XCUA 3CEHA 1MKYA 4R0NA 3E3OA 4F5YA 2AQHA 3HA2A 3GDWA 5ILGA 4D4LA 2PUEA 3FYDA 1P1KA 2INGX 4NABA 3RBXA 1G3MA 1AXRA 1EP9A 5HTKA 3GJ7A 5GVRA 2AFVA 3IV6A 3OZWA 2XVZA 3HJBA 2P9ZA 5AW8A 5CB4A 4BX8A 1U8XX 1VC2A 1QBGA 3O21A 2H17A 4FEEA 4MUKA 4ZHQF 4EHHA 4AF8A 1XPUA 2DH5A 3QXJA 1JFFB 3FSGA 1TQDA 2CV0A 3VSCA 4JI5B 2J48A 3QI2A 6REQB 3UC9A 3P7MA 4HAXA 5LQJA 1XQ6A 1RJ9B 4M98A 1Z39A 2C3MA 3O8OA 1JR3D 5KOYA 4GLJA 4QOIA 2HF9A 3WWDA 2OOKA 1RXWA 2VDNB 2HUNA 3HBMA 1WCV1 4Y2RA 2IHZA 3H7IA 5FP0A 1GPDG 4RA6B 4DC9A 5B4VA 1O6BA 2RH5A 2P2ZA 1SUAA 4G4JA 4H3KB 2JANA 4TLLB 5DGTA 3ZU2A 4ZWNA 1WB9A 4YP1A 3PGXA 1CP2A 3OJ0A 4ZTBA 4BNHA 1EVIA 1FRVA 1S5PA 5D3MA 1XZEA 1Y1QA 3KT3A 2ZI9A 4HQOA 2DSTA 5H68A 4AIIA 4MVJM 4DLWA 2UYHA 2AFIE 1NW7A 1AUOA 2W2TA 3P97A 2QZSA 2LPMA 3JAKA 3UXHA 5AICA 4O4IF 4B45A 2FPLA 4TT3A 5JSYA 4MTCA 1YBFA 4B35A 2Y6UA 4CL3A 5IVKA 4M0MA 2G88A 1EFLA 4RD2A 1UXIA 2QG6A 5HA5A 2WNSA 3FCCA 2OUKA 4BNDB 1YZ3A 4ZRMA 4OLAA 2HQSA 1G5TA 1V1RB 3FX2A 3Q6NA 4B5LA 3PCXA 3HJRA 3K1ZA 3NJ8A 1Z6ZA 5CH8A 3LYUA 5EMMA 4TXNA 3ZK8A 3M1YA 1X7DA 1ESZA 2PD6A 4FYIA 5HHTA 5JI3E 1C7IA 3A6JA 3IUEA 4Y0VA 5EWMB 2VWPA 5ALSA 4US2R 3PPXA 2C7RA 1VHLA 1V11A 2ILVA 4Y9SA 1E1MA 1THGA 3MCZA 4PVCA 5AM4A 2FMHA 3UN1A 2VTBB 4L2IA 2O2GA 1ZJWA 4E21A 4NZMA 3LIPA 3LO5A 4YRGA 4EQ6B 4YRMA 1OT3A 4TV8B 4DLNA 5HR5A 1EUDB 3BFJA 2XVYA 2HI0A 2ZJ6A 3DFZA 3Q8LA 5G4KA 5A06A 2P2LA 3UK0A 4ZJUA 2AI2A 3OTIA 2OO5A 4JKOA 4X1KA 3RRFA 5LSAA 5IT0A 3DBVO 2D0IA 4DCNA 3OEWA 1ONBA 3M1LA 4B4VA 4FP9A 3CTMA 4Q6BA 2PU7A 1BFKA 2Q5CA 3JQGA 4W9NA 2REQA 1H85A 4BRSA 2CZGA 5KU1A 3SMVA 4QEDA 2A0KA 5IT4A 4G4SO 1OB2A 1ACJA 2AJLI 2GYVA 1E1KA 2WMYA 1GTVA 2FW8A 1OF1A 2W90A 3DAFA 1VHQA 2CXOA 4RD1A 5ESRA 4GR9A 4AZWA 1F2TA 4R71A 4FKZA 3GAZA 2QMYA 1MB0A 1F3LA 4CG1A 3WWEA 3L9WA 3HUEA 4GX1A 4WXHA 4CCYA 1VRWA 1TFUA 5CLLA 4D0RA 4D1YA 2FOXA 1Y7TA 4OSOA 3O38A 1HYQA 2VCHA 2X1VA 3PENA 1T0BA 1XCLA 2GEJA 3FPHA 3PJFA 5DT9A 1XR3A 2I2WA 4TXLA 3RGGA 1Z4PX 4A16A 4LE0A 2EWMA 3JQCA 4PICA 3AHEA 2OLEA 4GXRA 4OQFA 1MNAA 4DA4A 3HBAA 4A1FA 3WHLA 2HU2A 2XCQA 1WU7A 2W4IA 2IBMA 3WGYA 3NBMA 4KWHA 4E5UA 5AW0A 4UAVA 1QS0B 1HOXA 1A8PA 4MA5A 3TTTA 3PUIA 3ZJYA 5IBCA 5ITVA 1QF6A 3ACDA 1NP3A 1R6XA 4KKXB 1KERA 4YASA 3MHPA 4IOKA 4QRHA 4MUIA 1OT5A 1K1EA 3P0IA 2HLNA 3GRRA 4QJ3A 3WBJA 1PS0A 4UAJA 1Y4UA 1P0PA 2HLDA 3K8QA 2Y1DA 2JH8A 3GLFE 1ADJA 1FMLA 4UU1A 4YJGA 4F2WA 5T6BA 3GT0A 4D9NA 1J07A 4EA9A 1QP0A 2X23A 2II6A 2F8SA 1C1XA 1J8YF 3CU5A 4DSZA 1A9YA 1Y6JA 1N9ZA 2AQKA 2R1TA 1IXKA 3JPWA 4KIUA 3UMYA 1Z5NA 4W8OA 1QLWA 2OZLB 3VH1A 3DXYA 2YJ3A 5T3YA 1CR0A 4MDHA 2EFGA 3V1LA 3BH0A 4KPEC 2PY6A 3C3DA 3E22B 3RYHB 3PQFA 2QVLA 5CA0F 3HDGA 1LPPA 1ENZA 1XZ8A 4P80A 3AF1A 3NBAA 4AZSA 5B5SA 1SURA 3CF4A 2GR9A 4FYHA 4TS3A 1P1RA 4PCVA 5AHXA 2QAGB 2X2EA 2ZROA 2Y68A 4M8KA 3VMFA 4X64B 5JD6A 3A28A 5MN4A 3JD4A 2VATA 2Q46A 1H2WA 2H1WA 2GWHA 2AZ4A 1ZCFA 3DNFA 3LLUA 3O2QB 3JW8A 3W9SA 3X1MA 1Z35A 5KPDA 1UMBB 5BNWA 3C14C 1UJ5A 4DLRA 2OD9A 1QZTA 4MQ4A 4MPJA 1NSTA 3TIIA 4GZLA 1R7RA 1UDWA 3BXFA 1AX9A 3GN1A 3CLTC 3KYJB 4G5RA 4TMVA 4X84A 4GO1A 4BJ1A 2SKEA 5A9TA 1MX3A 1H8ED 3NR2A 4B3FX 3VV2A 2OHVA 1J97A 1R2QA 1I3KA 1UDCA 4QXMA 1NVGA 2IE8A 1T5OA 4FNAA 4J1QA 1NQUA 2CUTA 1NJ1A 2Y27A 2Q3HA 4WLFA 2WWHA 1VCHA 3OLZA 2A9FA 2YVUA 1AJEA 1HRKA 2QUHA 3D1VA 2I6SA 2I6GA 1OC2A 3MF4A 4YJHA 2JD2A 2R00A 2NSDA 3JQ6A 5HJ5A 4EUHA 3M33A 3OY7A 1CB0A 1JFRA 3IEXA 3UWSA 5LQNA 3V4ZA 4D26A 1OKKA 5JUWA 2XHZA 3F8TA 2I2AA 4LHWA 1X92A 1OZFA 2J5RA 1OWPA 2OVFA 3GR6A 3PGVA 5GP1A 3TJZA 4A0SA 4F91B 5BN3B 1OXVA 3U19A 4LDRA 3ODGA 5JWOA 4PPFA 4GRAA 2QMEA 3EGXA 5K6RA 1I6WA 3T1YB 3WZMA 3U09A 3A06A 2Q5IA 4BP3A 3I2HA 2H1OA 4JVSB 4B7CA 3IERA 4GD3Q 2BKXA 2PX4A 3N8IA 3NPMA 5JW6A 2DPHA 1NI4B 4O25A 3Q6IA 2B3DA 3DV2A 3W8NA 2ZJBA 3UGJA 3UXYA 2BKEA 3DE3X 1AS0A 1ULAA 3F6YA 3LGXA 3O0DA 1QFYA 5KJCA 3CE6A 4Q9IA 3ROPA 3MXOA 3W1VA 4KMSA 1VZ3A 3GY0A 3WICA 3CEPB 4DIKA 1FYXA 1LBIA 1YMQA 4NBLA 5HGJA 4R9SA 4C7JA 3GFRA 3B9BA 4FUQA 3CSDA 4KPUB 4Q0MA 2BEWB 4RL6A 3IT1A 1GNSA 3SYTA 2WJJA 2X15A 4IWXA 2PUCA 2AG0A 2I4IA 5DGCA 3R0IA 5SY9A 4PO8A 2HGSA 5KDLA 3WKCA 2QRVB 4XJSA 3FYHA 3NH9A 2BEJA 2C9YA 1DBRA 4OMCA 5BUZA 1CD5A 2AI3A 4RTLA 1J2YA 4E5SA 2A0UA 4FE3A 1C9DB 1MHTA 3QVSA 2IUFA 4L22A 4AYTA 2P6RA 1D9ZA 1QHGA 1G3IA 3R7SA 4EKNB 1PFKA 1U9IC 3BTOA 1N3IA 4MRVA 1Z83A 3UV6A 1N5KA 5EJ6A 4BO5A 1EIWA 1UJ2A 3ZDRA 4RK4A 4B3CA 5FUVA 5BW4A 4FYKA 5CXUA 2FEWB 2ORYA 1WP9A 2W2QA 3FWHA 3R8FA 2R48A 1UFVA 2ZAOA 5TEVA 2JH3A 4KREA 2AZDA 4BO1A 1FNBA 2W6PA 1VB3A 1ZPDA 2JBWA 5ALGA 4ZYZA 3OX2A 3M3DA 1XALA 2XUAA 3QUCA 5BVGB 1YRAA 1YF3A 2JFWA 1AZLA 3PXDA 4QNRA 3KKKA 3QU7A 4G63A 5D5HA 5EJ5A 5DTMA 2DFNA 1OU0A 1EDEA 1U7TA 2Q2OA 1B0UA 4TT8A 3WGGA 1CT9A 3WK9A 1WB5A 5LNK1 2VF7A 1YJ5A 2OFFA 5FFFA 1BOFA 3FUCA 2ZJYA 2GERA 2WI8A 4MRMB 4EKYA 3H4MA 3K73O 4CFYA 4U5QA 5JD3A 2IHKA 5IDQA 2VZEA 4UQPA 1HLPA 1TCVA 4BEBA 5JR3A 1LFDB 2XT9A 5K45A 2G76A 4CHGA 3A2NA 3ETGA 1Q74A 5EI5A 3C1TA 2OMKA 2ZEJA 4GRIA 3MAAC 4Z0NA 1WKVA 3CCFA 5ALDA 3HKEB 3AR4A 3NBQA 1BN7A 4NENA 1CUYA 1Y7LA 1HSOA 4LJ9A 4LXQA 3HZHA 3N28A 3QVVA 3PQDA 1IHYA 2AF3C 4HGOA 1O4VA 3JVEA 4AZ0B 2P0AA 3O75A 2WJPA 5TS3A 1Z4JA 1NULA 4BVAA 1SBYA 3SDZA 4R54A 2IA5A 3Q98A 3TQIA 2IYSA 4JGBA 2JHCA 2OPHA 1Q14A 3S6JA 1QRDA 2G6TA 1H2ZA 3WZLA 4CMBA 3DMDA 4DY4A 1OTHA 1YMUA 1YB6A 2V54A 3NHSA 2FJUA 1QE5A 1A2KC 3G2HA 1AK2A 1AXGA 4G36A 4ZQBA 4BFYA 3VI4B 4LFAB 2AVDA 1BH2A 2IVFA 1OXTA 1RKBA 2G5PA 3D81A 3CUTA 3AJAA 3GRCA 1B74A 4ZCQA 1ECGA 3IPCA 4NDAA 5KQLA 3MIZA 1L9KA 5G41A 2IH5A 2WJHA 4CG0A 4Y18A 3D4PA 2GZAA 1QGUB 3Q10A 4DMFA 4B4DA 1B6GA 1TMOA 1MRZA 1O1YA 2NV2B 3HBJA 1PNTA 1GNRA 2HQRA 3AF4A 3PQCA 4HPJB 3KR2A 4HAVA 1UC4B 5FORA 3PTLA 3EVBA 3UWMA 2SHKA 2IYEA 1I2BA 4S2EA 5IP5A 4KTVE 2IIVA 5HK9A 1TTHA 1WVIA 4MCJA 4F84A 1GL6A 3C4QA 4HL6A 1Z6XA 2AOTB 3EBOA 1C5KA 2PAFA 3LD9A 4JUDX 1F2DA 1QV7A 4HMPA 4TMWA 1ZJJA 4LJLA 1YQQA 1KTVA 1XZAA 4P9NA 2EQAA 2WT4A 3DDCA 4HFRA 4OSPA 1H6AA 3VX4A 1B41A 1IIRA 4DCCA 1R74A 2WUWE 4PZDA 1HMYA 1QFXA 2O2CA 3INYA 3VNRA 5H9WA 2MSCB 2W5UA 2DGDA 4N0MA 2JCSA 3IAM1 4DKJA 1XPOA 1NA5A 3FRJA 2V7WA 4XR4A 4HLDA 3O8RA 2ID8A 3AERB 2O8VA 1XQ1A 3N0XA 4QAJA 4XGIA 1D6NA 5CK5A 3UJ3X 5CDTA 4EO7A 1XD8A 2X0NA 3KLBA 1W85B 4OGFA 3RTDA 3VU9B 2ZUSA 2RC6A 2AIRA 2O0MA 4MGEA 3AVVA 3KOZA 3WZ2A 3PGA1 1WABA 2PGIA 5LZ4A 1E2LA 2F1JA 2JFBA 1N2ZA 3GUZA 3LCJA 3DQPA 2FY8A 2O8NA 2R4UA 5K0FA 4UUMA 1TUBA 2HF8A 4EPRA 4DMHA 4QASA 4A2PA 5JAPA 3F2VA 3VO8A 5KU7A 2BP7A 4KR7A 3F96A 1KK3A 4KR6A 2HRZA 4RTPA 3UGTA 3C39A 3WRXA 2AE1A 2HGZA 1C29B 1ZMXA 3FYSA 4I5IA 5EGSA 1U8EA 2GT1A 3VBEA 5KKCA 5ALWA 1OH8A 2BI8A 2Q3EA 4V0SA 2AZTA 2BRUC 3NEAA 5HNKA 4JHLA 3TQFA 2I9KA 1AHNA 4N8DA 3EWIA 1AD2A 2JGDA 4JFRA 4FBGA 5L3VA 4KTTE 1YJXA 5IKPA 4URZR 2VCYA 2IS2A 3UF0A 1X3LA 2YL2A 5B7QA 3JQQA 3NDRA 4RV4A 2VPTA 1BE6A 1GADO 3UK6A 3UO8B 5K03A 4HBZA 4XIYA 3EDMA 3SBOA 4OATA 2HBRA 1JECA 1DIAA 2CBZA 4FSDA 5TQJA 3W0LB 3T5CA 5D87A 1TLTA 3PPVA 3MZ0A 5E9JA 1EG2A 4F6RB 1U98A 3NV7A 4W7HA 5J63A 4H08A 5AKYA 2AMLA 3IR5A 3BK7A 4OVKA 4XQEA 5ELMA 1XCGB 2ZRFA 4JELA 2P2CA 1BA2A 1NVVR 5KTSA 2E9SA 2R60A 3HDVA 1UZNA 4HC4A 3M49A 4XQ0A 2OM2A 1RAHA 5DLYA 3TZBA 1YGYA 4R8LA 2B0JA 5ITZB 3I5YA 1CJMA 1DIOB 4FHDA 1BEZA 3PDHA 5BR8B 3TPZA 2I71A 2YYYA 1R27A 5A6SA 4X97A 4P32A 3AZPA 2YNMC 1ECBA 3NHJA 1JG2A 4H31A 5ESDA 1BWRA 2WM2A 1T36B 4RMJA 3PK0A 4DIDA 4RF2A 1GZ5A 5JCPA 2XZPA 1ORWA 4JLUA 1AQ6A 1SR8A 3PJDA 5K6AA 2Y0PA 1WM1A 1HO3A 1XRJA 2R97A 5EPEA 2YWRA 1FZTA 4R2JA 3WL6A 1OLXA 4G97A 1X19A 5DSTA 1QVAA 2WWWA 1EB9A 5HJEA 2WWGA 5DGDA 5BXYA 4NFLA 3C6XA 1HZZC 1EWYA 1WSAA 1ZEJA 2NXCA 1C3OA 1QORA 2WZCA 3BGSA 4H0NA 4WZBA 5JPIA 2C97A 3E5NA 5GJBA 4PIPA 3AMVA 1FQOA 2F3SA 2VHTA 3ISVA 2SCUA 3TQCA 4QBTA 3A9UA 3NM4A 2XGGA 2G9UA 1L4MA 1TYAE 1GQYA 4JT2A 1LS1A 4OMDA 2YDXA 3WFZA 2O8EA 3H87A 4UBNA 3EH2A 3USCS 3ZQUA 2VC2B 4D79A 2YVQA 4EA7A 3PKZA 5CIWA 2WJ6A 3P52A 1LDBA 1YR7A 2Q0QA 4JXJA 4M89A 4U5XA 5DLQC 1L4FA 2BVNA 3V1KA 2CDBA 4QU5A 5LOVB 5KJ6A 1V4BA 5EGNA 3UAXA 1ISIA 1KO5A 1XDGA 4BGUA 4Q66C 1SCKA 3S68A 4ID9A 1XMVA 1FYWA 5EN4A 2CLOB 2GBCA 1HTWA 2DWOA 4RSMA 1F9AA 2P35A 4XR9A 3AJRA 3O4IA 1Z5WA 1T4BA 3DOJA 2IIPA 1PJLA 1XSEA 3O9ZA 3T3PB 3HCFA 1YU9A 1G6Q1 4BKOA 1KAMA 4GPTA 4OGGA 1EK1A 4JP2A 5I6DA 4GAEA 3L8FA 4BIMA 4PSDA 3EXAA 5I7SA 2ZT6A 3P45A 2XNDA 4KQEA 4U4AA 3OAAA 4RXUA 3H9EO 3OZGA 5DNCA 4DRZA 1RZRA 5BW6B 5CMLA 2C2BA 1R88A 1Q0UA 2V58A 3REQB 5JALA 2VDKB 3U7FB 1TM7E 1X2BA 2ZIZA 3DKVA 1K0UA 5IXJA 4X8OA 1KI2A 2XOKD 3H1PA 5AVYA 2P30A 4I19A 1RHRA 2CNWA 3GJRA 1FX1A 2WWXA 3OCXA 2P41A 1ZA1A 4MVJF 5FNVA 3WTBA 1W1IA 5L3QB 4O2BA 5K3FA 5EXXA 3OY2A 3CX3A 3B38A 2WJ4A 4AKGA 4R81A 4JB3A 3UNXA 5I7RA 3A70A 1LZLA 4GC5A 3OC6A 3LOUA 5J3JA 5AOBA 2H18A 3ZNPA 5KDDA 2QJRA 4EEXA 3VTZA 1DLIA 1F5SA 1ZLYA 2WSSA 2OL4A 4FCTA 4MO2A 3PC6A 3AG5A 1NFQA 2CUZA 1ZH0A 4UOQA 1VLLA 1Y1SA 5HCIA 4DIBA 2BM9A 2PUAA 1PEDA 4YPFA 3KJIA 5ICEA 1HUQA 2GYYA 3FHTA 2MTBA 2Z3VA 4LOIA 3A4TA 4ECAA 5AM3A 1N0VC 1V7CA 2YV4A 1B8PA 1YJ8A 3RC2A 4F0JA 4CV1A 5D7NA 4LXHA 1P5RA 1QYDA 4N6NA 5AJYA 4HDAA 1EVJA 2OZVA 2QIPA 4Q1FA 4J16C 5KWSA 2R8BA 3OMXA 1JBKA 1VMDA 1X9HA 1JQEA 4ZQCB 4ZVSA 4AJOA 3OOJA 5FAKA 1XDDA 3KSUA 4MRPA 4BHTA 5IAGA 3T1TA 4MRSA 1R66A 1WMDA 5CGZA 3JZMA 4RIGA 3WGLA 1LJLA 5HF5A 4BTEA 1Q0SA 1M7HA 3DGFC 5T4HA 3EXHA 1RHKA 1R5JA 3E8MA 2QD3A 2QTAA 4GSLA 1CRPA 3WDSA 4GQAA 4UEKA 5FR1A 4IX9A 4YV0A 1BDMA 1RLUA 3FD8A 3IR6A 5FA5A 1DJLA 5AUQA 3ZCXA 4BXOB 2A35A 2YXDA 2BV3A 3DBLA 1HURA 1G0OA 2X9LA 3ZDQA 2BUBA 4LRWA 5DJ5A 3TW0A 5I9IA 1JIUA 1WL8A 5EXTA 3T1NA 4J1TC 5HZMA 4BQPA 4WD3A 3MFQA 4ARUA 4JS0A 1TM2A 2Y6VA 2HQBA 4WKNA 3V4RA 3C87A 2XUPA 4GLOA 4NCJA 1R50A 4U7FA 4D7AA 3THWA 4JBLA 3ZJ4A 4HDKB 2D2VA 2HPVA 1QF7A 1GUFA 1DOAA 1F06A 4U3JB 4AJNA 1GCOA 1PL6A 5K20A 3BGDA 2HM7A 3SBXA 3TZEA 4WOKA 1G8JA 5E6SA 3ABOB 1T3LA 1UPAA 1XQXA 2GEDA 1Z9BA 3RWOA 3A2LA 4O29A 4RJKA 3QE0A 2BBWA 2Q5LA 5L7TA 3FKSA 1PNVA 2E37A 3STWA 2ZR8A 4BN0A 3F5FA 1TU3A 3JQAA 4W7SA 2M6KA 3SN6A 1SCUA 4IDFA 4M0UA 1XTVA 1DTWB 4HYTA 4OLFA 4YMIA 3AF2A 5C1IA 1W47A 4ZO8A 3ZEIA 3KZNA 3ZNQA 1T9CA 2Q0SA 5C8DA 3KALA 2HA3A 1QO0A 3QVGB 4FILA 2EIXA 2Q7DA 2V7QA 3HYNA 4NY1A 4B8ZA 1RYDA 3H1FA 5CB4F 2Z0MA 4A2WA 4FFBA 1LDYA 1OGYA 4CNBA 2DOKA 5IF9A 3K5HA 3A8TA 3PNBA 4AVYA 1JKJA 2D2FA 3OBIA 2HK7A 3EDRA 3OM9A 3PIDA 4R68A 3A27A 3BWCA 1VJ0A 4PSUA 4ZYWA 4FFPA 5B57C 2OC9A 3L1JA 3V1UA 5IUJC 1CUEA 2Z1DA 3FZNA 1I2MA 1OXSC 1QIHA 1HLGA 3LP5A 3NHMA 3PD7A 3SZ3A 4E31A 5C81A 1EZZA 2D1QA 3F3YA 4GLLA 4D8XA 4IPTA 3W7AA 1XQYA 2NMVA 5EJMA 4C04A 3AEUB 3RYCB 4NBKA 3M2TA 3ROTA 4LXTA 2EW2A 4AP9A 3MWFA 4XWOA 1CUUA 1LX6A 3F3MA 4NK5A 4GOLD 2PSHA 4IZ6A 1T6BY 4UXJA 2R4QA 4BMSA 3FAKA 2PLNA 4AY4A 4FFOA 1M74A 2W2MA 2DFTA 3ICCA 1BU5A 2QTBA 2ZDGA 3UOWA 4EA8A 1HNZB 5FI1B 4MUMA 1KMHA 1Y8QB 3Q4GA 3C7CB 2Q9UA 3QEMB 1EGQA 1S3IA 4TVOA 4ZT6A 1JQJC 3B60A 3CEAA 4ZCLA 3SG0A 5F2OA 1Z62A 4NYJQ 1D07A 4HUQA 3UJNA 4RK7A 2H4HA 1JDPA 4RACA 1DXHA 4E3ZA 1NHWA 4W4TA 1XCOA 1V7ZA 1RAGA 1UCFA 3QWHA 4PCAA 1NVMB 1TNDA 2VDWA 3MWDB 4QO8A 5C35A 3AFGA 1WMBA 4Z6KA 1DRWA 3GLIE 4B17A 1UUFA 2I54A 4P92A 1CZKA 3G2LA 3Q12A 4L72A 1LI4A 1SKYB 1UC5B 2EU8A 4FC7A 4IKPA 2Y1FA 4KLAA 4WT7A 5DT2A 2PRJA 1E5TA 1A9TA 2JEZA 3E4DA 4RE6A 4UHHA 5KYYB 1A5BB 2VF4X 3QPAA 1O8BA 1X80A 1YDMA 3ETEA 4FOLA 4WOPA 2XYPA 2DHRA 3D6AA 4RH0A 10MHA 4YMTA 4E70A 4B2YA 4V3CA 3V5NA 4AMUA 2IYUA 2O2IA 1RPNA 1NXSA 2X4GA 2Y05A 3ZWAA 2RHLA 3HB5X 3V8RA 5KNDH 4ARBA 1T8WA 1DOHA 1II8B 2HJRA 2PSDA 4UQLA 1DSSG 4HXFB 2OCLA 4KAAA 2OWEA 2RHMA 4UUPA 3B9RA 1M34E 3RUEA 5LLSA 2XD4A 3U3JA 4Q7KA 1M2GA 3DONA 4HX5A 4G0WA 4ZI3A 3A1FA 1DJQA 3S1SA 3NC0C 6Q21A 4FWIB 3ICWA 4TSRA 4CUKA 1XAJA 4PQRA 4HMQA 3BB4A 3C3PA 1XELA 3OCVA 1IN5A 2EQ5A 2OHGA 4HV4A 1W0KA 3A11A 3QM1A 1KU0A 4GPEA 4X7MA 4LWQA 2NZJA 3AR6A 4GYJA 1EAMA 2ZWPA 3I01M 2Q0XA 4XIGS 2W0SA 5BSTA 4K26A 4LVUA 3UMGA 1NW8A 3L4KA 1DX9A 1LC3A 1NUQA 2NUPB 3HQ4O 1QYIA 4UDXX 1R4AA 5TPZA 2XRMA 2DT8A 3RSLA 4M0DA 4GWGA 4ZALA 5H82A 3G5TA 4NL4H 2O14A 3EA4A 1Z17A 2EKBA 4U02A 3RS4A 1JH9A 1J90A 2FRVA 1TIPA 3FCYA 3QU4A 3RTAA 4KAJA 3UZUA 3HYCA 3IH5A 5JSKA 1RR6A 2WSMA 2P3QA 5AXAA 3RUIA 1XIVA 3HI4A 2G83A 1DMSA 1KA9H 1PT5A 5AJHA 3D4LA 1G21A 2WWRA 3NATA 2OD7A 3ON5A 4RFSB 2OE2A 3SNHA 2EKLA 2IZ0A 5SZJA 1E3LA 4PZPA 3SQXA 1ES9A 1QR6A 3AINA 2ZDQA 5FR2A 4RHTA 3BCRA 3LX5A 2IY8A 3S1AA 1PD1A 3CR3C 3L4SO 2GM3A 2RDMA 4OQLA 1P29A 4HN2A 1KQGA 1JU9A 1AMNA 1DUVG 1W93A 3H8VA 1BS1A 4BFLA 4DPMA 5LWHA 3IL2A 5KVAA 4JCCA 4QDZA 2NXEA 1G42A 3GXBA 1G38A 2RGRA 2FTKE 3CX8A 1O97D 4AJ4A 2JLVA 3U56A 1X7WB 1USWA 1YTUA 3C3YA 2VJNA 4HUJA 1JEJA 1O6ZA 2Z56A 4PFJA 5F1PA 1JA0A 5A2QA 4J7XA 2C5BA 1Z13A 5KIAA 2JPDA 5CJPA 1Y6RA 1MA0A 2V7XA 2FV8A 1DJNA 2R8YA 2ZRIA 3DOUA 5BNTA 1AKWA 3WKAA 3ND5A 3VPAA 2ASEA 3KR1A 1WD5A 4ZVRA 1X7XB 4PHHA 1D4AA 1CQIA 1MJHA 1PJ2A 5ICFA 2VWGA 4GKBA 2C5EA 2ONJA 1AGNA 4RESA 4GDMA 3SZOA 3RVDA 1N5RA 3T7IA 3GGDA 2LCIA 5KYGA 2WJGA 3CNEA 3DS8A 3L8MA 2FXVA 2DQYA 3TKLA 2XWSA 4F96A 2AFIB 4MKGA 4EUNA 4KV9A 2WB4A 4E30A 4MKXA 3OECA 2PKWA 1A8HA 4KSBA 4TQGA 1XNQB 3E15A 2JLRA 3C15C 3HCNA 1M6YA 4UJ5A 1EFRD 4NU0A 1CZHA 2QL9A 1FSSA 3OIGA 4ZT2A 5ARBA 3ZHRA 1EFAA 1ATIA 2CNDA 2RAPA 3RYIA 3C98A 3VH3A 1Q15A 2W83A 3KWFA 4IIXA 1Z28A 3CZ9A 3STXA 1YSCA 3EZFA 3CR7A 4FOSA 4GM4A 4J3FA 3C3EA 4Z1MA 2QAIA 4FGZA 1GM5A 3BILA 2JJ8A 3LL4A 1UBGA 4TUYA 4WVLA 2XQFA 4DDHA 3HM9A 1TADA 4AY6A 1EFCA 1DWUA 2D1SA 3AGPA 2FN3A 2QQ5A 4GMDA 5E4YA 2VQ3A 4QQFA 3N07A 2YRXA 3JALA 1Q84A 4LHXA 2YWGA 2AXQA 3PUVA 5AXCA 5HE8A 3KSBC 3HU2A 3INGA 2P3OA 4OA5A 2UUBB 5K01A 5DLPA 4PSCA 4MV8A 4OHFA 4UCXA 1LPNA 2X8JA 4UULA 1COWA 2KSQA 3IQEA 3MCVA 3VZBA 1P4HA 2DR3A 1BXRB 2BGGA 3CNHA 3OIUA 1CK4A 2HZ7A 3Q0IA 3L06A 3BZBA 3AJ9A 5E1OA 4J6EA 2UUAB 1ODIA 4RGBA 4FC6A 1EDBA 3P71T 4AG6A 2BTQB 3SWWA 2GXSA 3AVXA 2ODEA 3FOZA 1ZVQA 3D6HA 2W70A 1G291 4N0EA 3ZU6A 3EPPA 2O5EA 4KWEA 3L4JA 2IYNA 1FFWA 4JYPA 5C1OA 3RIMA 4PZEA 1BGWA 3LUCA 3GT3A 5J4VA 1SJ9A 4C7OA 4AW9A 4AX8A 1NN3A 3UK2A 4D57A 2VYVD 4IYRA 2VT3A 4IIJB 3SVZA 4C3OB 4CI0B 1W8DA 3JY6A 1PYOA 521PA 4WBNB 5JNSA 2XJ9A 1DJPA 1POXA 2BMWA 4FFVA 2WABA 4OM8A 1GDDA 2XMGA 2OCGA 4X66B 3VKVA 3UAYA 5LZ5A 3THYA 4KXYA 2W7TA 2ZYSA 4LWZA 3BXHA 3ETJA 1GA1A 3EQ2A 3Q5EA 5HILA 1VLZA 3G0DA 4X3PA 4ZIRB 1Z0SA 2AW5A 1T5DX 3BJRA 3E7FA 5HM6A 2IYFA 1O8CA 3PJEA 4G9BA 4U9IS 3I62A 1GYQA 1TAHA 2WYUA 3HKDB 3PL5A 4IXTA 3V2HA 1VZ2A 1BHO1 1FNNA 1K7EB 2D7JA 4B47A 2OV4A 3CEJA 2J0EA 2DG2A 1N6KA 3OKCA 2D5IA 5H02A 5REQB 4ABTA 1JS1X 2BCEA 4F6CA 1FUYB 1OZAA 3G02A 3H6GA 1DMRA 3PYXA 3K0FA 1QE0A 3EBPA 3GBPA 4UZSA 5DK4A 5KCZA 5A6VA 2PX5A 4XPIA 3D8NA 4DR3B 2VBGA 2JG3A 3KPWA 3KZVA 1K3FA 3ZY3A 5L53A 4MUBA 4WTOA 3WGJA 3WNVA 2RAUA 4XWKA 2GPJA 5IZCA 2YHAA 3HEMA 5ILOA 5EJ2A 3SKVA 3GLFB 1CHDA 4ZU3A 4X3CA 3STTA 4GPZA 4B80A 1G5FA 5AW4A 1XAHA 2ZI6A 4XD7A 5IBQA 1GSHA 4MUAA 3IJ5A 4ZU6X 3DEAA 3NORA 4MO9A 1DFIA 3T3EA 3RBVA 2F4NA 3R8XA 1IN6A 2GEVA 1LJ8A 221PA 3CR8A 5IVIA 3MVEA 1T4MA 1RYNA 4ZODA 1K7SN 1P6UA 4N4AA 4PU0A 3FOEC 4RTJA 3JYOA 2ZIAA 4ZV4A 2GTHA 1LS6A 3HJAA 5B53A 2J5XA 2OYRA 9LDTA 1FMTA 3B2NA 3UMVA 4E2WA 4ZANA 2XCSB 4PTZA 4MITA 4LGYA 3U40A 1CY2A 3FTNA 3DR5A 5TPWA 3PR2B 1NWHA 2CD9A 2IZ1A 2PUJA 2HY7A 3GA7A 3K09C 3NO4A 4D9GA 3G8CA 1OV4A 2X5OA 4U1RA 1V16B 1Y8ZA 4EPYA 3CWZA 4V0QA 3EEFA 3O4JA 1IY8A 1EAYA 4ABYA 3EWSA 4QYXA 5JZBA 2IS4A 4N7MA 1SQFA 4P5PA 4TTPA 3ZD6A 1VDZA 2YN2A 4PZ0A 2J1LA 1QHNA 4EK9A 1F6WA 1LNZA 1SUDA 3OM8A 4GMGA 4QBKA 3TUIC 5HRAA 2X4IA 2Z5GA 3RRZA 3QUBA 2NUBA 1NT4A 1G2PA 4NOJA 1O2DA 3GDOA 3GVPA 1YB1A 5JBNA 3VPSA 1SH7A 4PE5B 2FPIB 2G1UA 2JI4A 2VTKA 2FMXA 4PHGA 5B3JC 4HDNA 2WW8A 2ZRQA 5DXAA 2OTCA 4ZMBA 3OE5A 1I7LA 1JF8A 3B89A 3F8SA 1DDOA 4WLEA 3ZH2A 5A9SA 1YDHA 1R5NA 4YUYA 1L7XA 3G5MA 1XO1A 3TUJC 3T9EA 5HWSA 3PNKA 5F64A 4IQFA 1SZPA 1E99A 2E4VA 3C8HA 2QGNA 3AV3A 5F12A 1QUFA 2ZYGA 2HMYB 4K9MA 3PQ3A 2ZSJA 3I61A 2BJVA 3LMKA 2JGMA 4J4BA 1VI2A 1X1TA 4UM7A 3RU7A 2AKYA 2X1MA 3NHYA 3U17A 1D4FA 3BRQA 3I09A 4IDOA 4R1QA 1HNXB 3SE7A 1A4IA 2JGKA 2GVZC 1ML3A 2FFHA 1FF9A 2G1JA 2OCPA 1N33B 4F06A 3GH1A 1BWPA 5E6UB 1GUDA 1LRKA 4ES6A 4YAGA 4CEIB 1S3GA 2P6PA 3HKCB 4R1TA 4LW8A 1E2KA 1U0RA 2JFFA 2OSVA 3AHIA 3AKCA 4MWEA 4MQFB 4QYSA 1H93A 1YQEA 4XTRA 3VDXA 3B1FA 5AK6A 5GONA 1JN0A 2O1EA 5BR7A 1T9GR 1U2ZA 2DERA 3CRQA 2IP2A 1AG9A 1AIPA 2BGUA 3D0OA 4Y2PA 2YJ6A 2C7BA 2Z08A 4FOTA 5CURA 4ZYLA 4HDMB 1TZ2A 2F1RA 1T2EA 1ZOLA 3CH5A 2XUDA 1KEWA 1XVVA 4KDCA 3T4PA 3KSDO 1I4EB 1CUIA 1NJSA 3H2KA 4R2IA 3SP1A 3TRDA 2C83A 4MQ6A 1V96A 3LDGA 3Q3GE 4MPRA 3S44A 2J33A 3NASA 3AEQA 4X1IB 3Q3VA 3SQOA 4UMEA 2AI1A 2DTEA 4X85A 1IM8A 3UYLA 1W30A 1C0IA 1VSQA 2XA9A 4RVCA 5EWJB 1HWYA 4TTRA 1IVSA 4ZCPA 4U0KA 5FIUA 3TX2A 1WG8A 2NO6A 2VQFB 2WE7A 5FEUA 3RKSA 3O8LA 1FLAA 3T4EA 4EKIA 5HGXA 3UBTA 1MOQA 1DBIA 3R75A 1HNWB 1GA4A 4NAUA 2A5FA 4JI6B 4ZKEA 2Y8EA 5AUOB 3MK31 1QK5A 3P0RA 3P9ZA 1I0LA 1MO4A 4RXTA 4EG6A 4LY3A 1GZ4A 4GQBA 4QA9A 4UBLA 3ETHA 4MYDA 5KYUB 2Z09A 5DISB 1QRTA 3R9WA 5EPOA 3LPAA 3F73A 2Z3WA 5BV7A 5TMDA 3OZIA 3T9BA 1LRJA 2J3LA 2R6ZA 5CXQA 1B14A 5F3DA 4KZKA 4UAUA 6PFKA 4AMZA 3KQLA 4UTZA 3EOBI 4OL9A 4H1VA 1HV8A 1RE1A 5KJ1A 1SOAA 1QIDA 4L4SA 4Q4HB 1VYVA 2Y1LA 3ZGNA 2PLAA 3RTCA 4DC0A 1QK4A 1Y42X 1SVMA 2HR1A 2GVDC 1CTQA 3GZNB 1T9AA 2QN9A 3NKVA 1QTNA 1FSGA 1LBHA 4GT1A 4AJJA 5J2TA 2W6NA 2YZ7A 5EE9A 3H9JA 5BOSA 5F9FA 3TEMA 2IPLA 4PGGA 4ZGGA 2WMNB 1IJFA 1JNYA 1MENA 4RZQA 2Y1KA 3WBFA 4DLAA 2P9GA 1XDSA 4L3OA 3UAVA 1ONSA 3E5HA 5DEIA 2C2HA 1DFHA 5CCXA 1MIOA 4DBZA 3R9XA 5I7VA 5JBQA 2J0UA 3V4OA 4QELA 1JQAA 2QM0A 4G37A 1OYOA 2QRMA 3AHGA 2D2XA 3FWYA 2QTNA 3V1MA 4EG0A 3RUHA 1FRQA 2Y9MB 3T1OA 1ZI9A 3AUKA 3N05A 1UKEA 3H84A 2GCIA 4PFSA 5HK8A 1NW9B 4BVGA 1Q6ZA 2IXAA 4BPRA 3ADBA 1Y9JA 5TGTA 3IEUA 2PBZA 2CLEB 1I4OA 4G1CA 5BMVB 4Z54A 1T2UA 3LBIA 4JB0A 5ED4A 4RWZA 1BG6A 2C2KA 1XN1A 3SEFA 4D9KA 3IQZA 5IULC 2BJWA 1NMSA 1QCCA 1Q1EA 1UANA 1Y5LA 4OBXA 4CEHA 2XCTB 1QQTA 2P1ZA 3B3FA 4QUEA 2B69A 2SKCA 3AL2A 1AA6A 4MRNA 1CPYA 1VPDA 3B1ZA 1VG8A 3H9QA 2R87A 3IE2A 3LUFA 3TW8A 3QG1A 1KJ9A 1LF5A 2GD0A 3E7DA 3GFOA 4LPKA 1W25A 2XUFA 3PWSA 5HYVA 5C37A 3A3NA 1RABA 3KQMA 4F86A 1TJYA 4QPPA 3FUUA 3LPMA 4OH1A 1UFKA 3VSEA 2BFAA 2PRSA 1ZMTA 4B9EA 4CXMA 1PFGA 2VHCA 2XEDA 1RQ7A 1TB4A 3HZZA 3NPAA 3PUYA 5BO5A 3OSUA 1GPLA 3RRYA 1KFKB 5BWLA 1RJ9A 3U7JA 2PFKA 4QOEA 1IB0A 4F4CA 1E98A 1U28C 1XX6A 3BK2A 4MYRA 4CODB 3V3KA 2EV9A 5BUSA 5IXYA 1GG8A 1RACA 3OJEA 3F9IA 3UCFA 4Z4QA 3UJ9A 3I4LA 5BWOA 1YAHA 5KJFA 4LBZA 1Y1TA 2Z1NA 1RRCA 2WSYB 5FNVF 3EPJA 2I4OA 4AMBA 4D3DA 3GFTA 1P77A 4O2BF 5IFLA 1JFVA 2WUEA 1Z2CA 3BK1A 4LGMA 2YS7A 4M46A 3C70A 3DMTC 3DWFA 4EG5A 1SOMA 2YY6A 1QGAA 4MR9B 3LQKA 4CQLA 4OTZA 2XDQB 3I5UA 3HY6A 3NX4A 1JDUA 1CJVC 1TD1A 3EJ6A 1CS4C 3FJYA 3C2QA 2RGWA 1CZRA 3HP7A 4FZVA 4IHQA 1F7VA 3OLYA 3W5IA 3IRVA 3E0QA 3C97A 3K1AA 3KJFA 4IZIA 4Q7LA 1V5FA 3ZUGA 1QG6A 3NHKA 3P9CA 1QOQB 4PYOA 3MAGA 5FWDA 5L6LB 2WIKA 3A3KA 4G0PA 4L4XA 3RV3A 2YQ5A 3TYXA 4F4IA 3L1IA 3AUAA 4E5PA 5BV1A 3HADA 3KEGA 1EUQA 1UDAA 1AQNA 3I9NA 4PLWA 4UUBA 2AMJA 2QMUA 2A6PA 2WU4A 3BF8A 3HDYA 3L0IB 3COWA 4RM3A 4C0AC 4ME6A 4HF7A 5D6OA 1SKBA 1W2HA 1JG3A 2J4DA 3RAJA 2SBTA 1OBVA 4C76A 1HQDA 2BFFA 2PT9A 4NI5A 2K5UA 4EQ6A 1GQOA 2I6TA 2NX2A 1HM5A 3CRW1 3WLAA 4J94A 2J7PD 3WNQA 3U81A 5T4FA 2NUTB 2OFXA 2IHYA 2WTAA 4M6WB 4G0XA 4EJMA 1D6SA 1WVMA 3O82A 2PMWB 4MPPA 4ETNA 3ZDBA 4FFWA 4IVQA 2Y99A 4MWGA 1SXJC 2GJKA 3W1WA 3IUBA 3AI3A 2BFNA 4Y9UA 5WRFA 2BELA 4B6EA 1QYCA 1N92A 1KAHA 3ZHTA 4F7DA 1V1JA 2FP4A 3OEHA 3DEYX 2GMWA 4OF4A 4PBTA 5HIJA 1UL1X 2EJVA 4P5EA 3RODA 3K72B 3H2YA 5J2UB 2HWUA 4JVLA 2J3IA 5B12A 3F74A 3N2KB 1PGNA 5ICGA 1JJ7A 2TRSB 8ABPA 2Q62A 2P6OA 3MRTA 4NFHA 2O3TA 1YR6A 3MWJA 4WACA 4MEBA 4NCIA 4AY2A 4EJ6A 1ML4A 1DC6A 3EFEA 4GYYA 2V8BA 1IN8A 1OGJA 1Y37A 2P62A 3H4IA 3JRNA 3X1JA 1JHOA 4O8ZA 3B6IA 4G0MA 1HLDA 3KTAB 1CJCA 3FWZA 5KSPA 1S2LA 1UZLA 5CUQA 1KDVA 3WLFA 1P7YA 5AUPB 2XDYA 3NVAA 1N6OA 1PS8A 4Q5IA 2CB9A 5DHFA 3EPLA 3O03A 2VP2A 3EPHA 3BERA 2CL6X 1RLJA 1J4AA 2R751 1C9NA 3Q5GA 2XV1A 2B92A 4GM1A 4UFOA 1NE7A 2D1RA 2C2GA 4WE3A 5L8VA 1APBA 5E0KB 4TLEA 3ISJA 4F56A 3IPLA 1QS0A 4DGSA 3BWBA 2EJUA 5HW0A 2XECA 3BMNA 3CPEA 2GDZA 2NVUB 1VBKA 4RLFA 4FSHA 1JDJA 1X1CA 4HAWA 2PGNA 1K8XB 2QRUA 4O2AB 3S1LA 4F4UA 1DC7A 5ILQA 3CSUA 1BC5A 2R1ZA 4EI2A 2CSXA 3SZMA 1XE3A 1DKMA 4KWIA 4GRDA 1I9CA 2E48A 2ABWA 2CHVA 3R3UA 4QREA 3IVAA 3O6VA 4Z53A 4ZVLA 3F71A 3W2HA 1IBRA 1BS9A 1G7SA 3LPLA 3PJRA 1C30B 4L78A 3T5DA 3ANXA 2OXIA 1AHIA 2X58A 1EUCB 2OZLA 4M1WA 4I4NA 5AFSA 1AS2A 3ZCPA 1E94E 3Q11A 3AV0B 3WGIA 4JJIA 5T57A 2PKQO 2VEDA 1F5NA 3VUFA 4KR2A 2PUWA 2QMZA 2P2YA 3F5DA 3MJTA 1DWPA 1XB2A 1FP1D 5KB3A 3LBYA 3H5IA 3MYRA 2WIAA 1M0WA 2R7MA 2V3VA 1XP5A 3Q0EA 3QVOA 1DE0A 2BT4A 2HADA 4DABA 2ZKLA 5IZCC 2P2NA 1KH1A 2IQ5A 2NAFA 3GV0A 2QAGA 4AYWA 1Z47A 2LP4Y 1AF4A 1EBUA 2LR0A 4QX6A 4JSTA 3U3ZA 4RTNA 3I0NA 4OOFA 5U4QA 4DOMA 3VZQA 4GX5A 4J76A 1WQ3A 4E5DA 4NC9A 3RU2A 1IFXA 4ZVOA 1Z2NX 4JA0A 2GAOA 1NKVA 1A9ZA 3CW2A 1RWVA 1W5EA 1ZG3A 2I80A 2XRYA 4GMFA 4RHFA 4EYSA 3PEWA 3CWQA 1L4HA 5J43A 2D2EA 4XZ3A 4EDFA 1L5HB 1YS2X 2O8DB 2OHXA 5ERGB 5A4KA 1N57A 2IZ7A 2WKRA 1XZLA 2GLUA 3JS5A 3LVFO 3CUVA 4NAVA 4GVPA 1RAIA 4P0TA 1OBOA 3H1BA 4CKEA 1KFEB 4RSHA 2UZ1B 2PR7A 4OQZA 3JQ8A 4QXPA 2DETA 4YCDA 5CH3A 3UWKA 1B3BA 4B75A 4D81A 3MCWA 3R7LA 3MT8A 1E9SA 4P4LA 4RHCA 5ALHA 4X1OA 2P2DA 2O7VA 3SQDA 3OFNA 2CJXA 4BNZA 4DTCA 3R3ZA 4BQOA 2CL7X 3WWCA 3OESA 1CLUA 1MJGA 3BULA 3LT5A 4C5BA 1G5IA 5DU2A 4EPTA 1RMYA 1OYWA 1VPTA 3JVVA 1U3TA 1QVZA 1WIWA 4HQLA 4WCFB 5KHAA 5T4EA 4MLPA 5BN3A 1MW9X 2GPYA 1ZUWA 2XUQA 3G1WA 3OJCA 4RE5A 4A0FA 4UTXA 2KBEA 4RQBA 1QIJA 3KT6A 1OWLA 2ZPTX 2VPWA 4JGGA 3B1VA 3N8GA 4A0HA 2XOKA 1FPMA 1PAUA 1PG0A 3LY5A 3Q8WA 1AZSC 4FZ3A 4TM8A 4ISBA 4MH0R 5AK3A 3VU1A 1QYVA 3ZY4A 1QH1A 3RHFA 3EOZA 1NF3A 1X39A 1E9VA 2IZ5A 3HLKA 2IHBA 3LUBA 4CV0A 4CEJB 2BMDA 4NZZA 3T15A 2GBLC 4D3FA 3IKMB 3KX2A 2FPPB 5AVSA 2E4AA 2X1HA 4PXAA 3AESB 5CLGA 4ARVA 2XCRB 4EYGA 4KPUA 1BA3A 3NONA 4F1WA 1BHSA 3ELBA 5IJ0A 3OH8A 1ZN8A 4RY8A 2OBFA 3MRXA 5FBHA 1Z82A 3V80A 4JX8A 1KKUA 1PV1A 1VKZA 2IZOA 2QRVA 1DPFA 3KLOA 3PXAA 3U9TA 3VVMA 2XVMA 3WNDA 1TLFA 3SJ7A 3IUSA 2PDAA 4QECA 4MKZA 2HYDA 3GOQA 4PFQA 3ZWNA 4B73A 3IOMA 5T7BA 1ESDA 5JNVA 2C0QA 2ZQYA 4D46A 1RQPA 3D0KA 1WXHA 2AZMA 2PWBA 3GJ5A 3K8YA 3P0JA 4TRNA 4IGEA 2CMDA 4MPDA 6GPBA 1DQPA 3R0ZA 2XRZA 1PLJA 1NQWA 4NRDA 2HMSA 4NU5A 4UJ3A 5KINB 2WR8A 1R8QA 4DJDC 1DU4A 2Q07A 4II3A 4ENVA 4RIHA 4X65B 3L8YA 2AJTA 3PVCA 1L4YA 2AZXA 3CN7A 5AM1A 4YONB 2BH9A 4HRXA 4JI0B 4BLOA 4BNUA 5C8ZA 5J4LA 2VDMB 4M83A 1Q95A 3O7WA 3QTTA 4M0CA 3M9XA 3CO5A 4Q3KA 3ZXSA 2FI1A 4PNZA 2W2KB 1PZXA 2PVCA 3TLCA 1IY2A 2JJ1A 1FFSA 3E2MA 3IVMA 1GKIA 5LP6C 1ZCBA 2JS7A 5BN5B 1GPKA 4ZHQB 3RANA 3UEOA 1ESCA 1MEOA 3V7WA 1L5RA 1ZHHA 5BSWA 3KDAA 3HKEA 1SUIA 3QBTA 1YI1A 2CXTA 4NJMB 3W5BA 3ZQKA 4F9GA 1F0PA 3LT1A 4ETIA 5B36A 1Z68A 3MTDA 4AZ0A 3C3JA 5CX1B 3G1TA 3ZDCA 1FE8A 3WHKA 1GNQA 2B2CA 3MHTA 3MM4A 3VJMA 4HLUC 3OTGA 1YXMA 3I12A 3GLHA 4BU1A 1T1EA 2P6NA 1KIAA 1F48A 1OZ0A 1VKNA 3CPJB 4IGFA 5ENVA 3RLIA 4CMJA 4YMUA 1NVAA 1CEYA 3UT5B 2BGTA 2QV7A 4I4TA 4KE6A 3L49A 3NIWA 5T64A 1H4TA 3OD1A 4K05A 3HWRA 2X9GA 4I1VA 4JLJA 3V32A 3WDMA 2BSAA 4CTOA 5JSHA 1A7KA 5HOEA 4O4IB 1E1RD 1ZVKA 1E1CB 1EMDA 3NHWA 3Q9SA 4EFLA 1KJYA 5CITA 2MJLA 4Z9BA 2IYOA 1QQAA 5B4TA 4TUYF 2DBZA 2JFOA 2COUA 2WSLA 3JWGA 3L82B 3FVVA 3N6XA 4FLFA 4MI1A 4YY3B 1V43A 1X8KA 3MWGA 1MJGM 1T1GA 3OQ6A 3GLIB 3IXQA 3SX0A 4K0RA 4FYXA 4G4SP 1K9VF 4MB0A 2A33A 2HIAA 4IFTA 2A1TR 2J6IA 1T3ZA 3GRKA 5CLQA 4AJ1A 4E14A 2JJYA 3EASA 3PEYA 3RVBA 1JHVA 2Y1OA 4MROA 1GFIA 4C3UA 1KEKA 2K7FA 3G1UA 5L3SB 4A5OA 1XJCA 5HOQA 3OKPA 2X2PA 4X62B 2PJDA 1URPA 1ZIDA 4J9UE 2CXPA 4TSFD 1LLDA 3IAHA 1E20A 3T7KA 3H65A 2AG8A 2PUTA 1JAYA 1S02A 1II0A 1W59A 2I55A 2NSHA 4KMMA 4YHBA 5EIBC 3UG6A 2ATCA 1QUEA 2NYRA 3OFJA 1OTYA 1Y4SA 1CUJA 4EMBA 4ATNA 5KNLA 3KFXA 1ZC3A 1G8YA 1T0HB 3QJYA 4NOLA 1Z12A 4YMGA 1E3MA 3BUSA 2VN8A 2AFHA 1YDFA 5I3ZA 2GTIA 4IJKA 1NQXA 1KL7A 1NV9A 1G4HA 2EJCA 2HQOA 1K6XA 4N03A 4E08A 4POOA 3JYNA 1V3TA 2I7DA 5B3KA 4UCQA 2LUOA 4MW1A 5CIQA 3UA4A 3URMA 3ENVA 3LE8A 2ZUTA 1EEHA 1XXHE 5F2EA 2IDZA 4Y1FA 5ALFA 4LX0A 3VTFA 4PWYA 2J85A 2VDVE 5F51A 1GR1A 2PMKA 1GNVA 1WF6A 1YK1A 3OT4A 4TN1A 4XPZA 5YASA 4G01B 1M76A 4ZV9A 4ZPXA 4BX3A 1CFZA 4RTKA 3HVHA 2NVWA 3U9LA 3OX4A 3KLPX 4X44A 5DWVA 4DQVA 5ESXA 2BEUB 1EFDN 1HFEL 1D0SA 3GU3A 2BHSA 5C5DA 1WD7A 2TECE 5LA6B 1FVXA 2IU6A 3F4BA 4ITVA 3S5JA 3SX4A 4YCMA 2PH7A 4M8NE 2VJDA 5JJKA 2DZDA 1L4BA 1CVIA 4JQSA 3V4SA 3ISTA 1NKSA 2QI9F 2ZT8A 3JTMA 1N34B 4DZTA 4YAFA 5BV0A 4XIIA 1P5FA 3VNQA 5DIFA 4QKQA 1IEXA 1MO3A 4A8PA 3C1OA 1LI5A 1R4MB 1ISJA 3I9FA 4QVKA 3TCKA 1RI2A 2HMWA 3UGQA 3SKXA 3HUUA 5G0VA 2H85A 1K3TA 4B6JA 2CHQA 4TQUS 3RU3A 2VS1A 2ISSD 3HMQA 1L0BA 4MVWA 3CNQS 2PA3A 3GLVA 1GG2A 2IT1A 4LRXA 2OQIA 3V33A 1NP6A 3BGOS 4HNUA 5C7LO 3IEVA 3MGAA 1H4SA 2HWYA 4DSOA 1E3EA 1CS0B 4GR5A 5K1ZA 3WY9A 4I6GA 1PHRA 2XYGA 3DCJA 2B94A 3DL0A 2P8JA 1FMCA 2QQEA 1ODTC 2YW2A 3CZPA 3HVKA 3K0AB 3RCBA 4C0SA 4F6RA 1E2GA 3O3CA 5JU6A 1A4RA 1HEYA 4KQGA 4LRTB 4JLDA 1XZNA 3DLTA 4RHYA 4PNEA 3FPKA 1LSJA 3N74A 3R3WA 2JGRA 3SGLA 3WMFA 4OHBA 4C4RA 4MRAA 1V5WA 1L3CA 3GO4A 2XI4A 4R2LA 4F5DA 4I9NA 4ZKDA 2F55A 1ACMA 1U9CA 3FN4A 2AJCA 4KE8A 5B1YA 3MINA 3JRXA 3HHPA 4F38A 3DDNA 3DDUA 4JP1A 2IU3A 4FZ5A 4U7WA 2B2NA 2C96A 4MQLA 4QXRA 5EKDA 2UYGA 4XUCA 5CA0B 1R37A 4YDSA 1QKIA 2YMMA 4MW7A 3UVEA 4FFRA 4OIFA 2J0VA 3MUEA 4FNOA 2WP8J 1ORRA 2CBGA 5FWAA 1Z88A 2VK8A 4WZAA 4PX9A 1XHEA 2EATA 2Q4DA 3NHPA 2FGKA 2WC1A 3PEFA 1A72A 1REQA 4ZQHA 3FTPA 1YZFA 3KE8A 5GM1A 1P80A 2QM7A 2VJPA 4YAIA 2C0PA 5FT9A 2EQBA 1X1QA 3CBQA 1IEVA 1NFRA 4D5EA 5IX8A 1G7TA 1RI5A 3D6JA 3HU1A 3VQTA 3AF5A 3ESQA 5C9ZA 2ZB8A 3ZE7A 3KG2A 2O19A 1R0KA 1IRIA 1R6TA 1N8TA 4II2A 3F6CA 2DXIA 2OCAA 1CEQA 1PZGA 1ZFNA 5TQ2B 3QUTA 2X41A 1ZW6A 4QOSA 4RF5A 4QVIA 3DLCA 1ZO8A 1N2GA 2CFTA 4M7RA 4M8SA 3KQVA 2CMHA 1IBSA 3AVPA 3GGPA 3O2NA 2RHJA 4MVCA 3LUKA 4YFVA 4WFJA 5DF1A 3MFYA 2BKAA 1QMGA 3EGDB 4WK2B 1H3EA 5AJVB 1IZ0A 5IJ9A 3U44B 4RMHA 2HUPA 1KVTA 2O0LA 3I32A 3U1BA 4O2LA 4R1NA 3DVLA 1OPXA 3K6SA 3V4VB 2AG6A 1T35A 3B1KA 3JQ9A 2N47A 4S1VA 5MHTA 2BBOA 3KT8A 3CB2A 3EEBA 4E2XA 1RM5A 1B6TA 4EHJA 1W19A 1F9EA 1J70A 1E3QA 1JDVA 3E2PA 3INNA 4ZCSA 1UJMA 2MSDB 3WRYA 2JL1A 4ALNA 1VMKA 1XCJA 2VJYA 2IW1A 2NN3C 3GBSA 1F6BA 2IDKA 4EHLA 4MQMA 4I8XA 2RJOA 1Y48E 5FYDA 5GONF 1NQVA 2PXXA 2VZ9A 4LYFA 2ATEA 1P81A 3ZDDA 1S3SA 4Q48A 1JAHA 1R0XA 3JSAA 2JDID 4ESEA 1EFRA 1JLHA 1QKJA 4IZOA 4BC0A 2PAAA 3KQPA 1M2VA 1GO2A 4FUTA 4LRSB 3KWLA 3TE6A 1GPMA 3LHFA 1XF9A 1Z2EA 1KEZA 3LECA 2RGNC 3OO1A 1UAYA 2PMFA 2PT7A 3L1VA 5A7GA 4BOYA 5LDHA 1NBME 3REQA 4LDQA 3QKIA 3E8SA 3T52A 3G17A 1ZSNA 2JKZA 1E6EA 3AP2A 3FIJA 4J7UA 3R0QA 5EZYB 3VZCA 16PKA 1L7OA 3I9JA 5EPUA 2GZ3A 3O5AA 1OIVA 2IE0A 3IAS1 5L3QA 1SQ5A 1NXPA 2QGFA 4LHEA 2RH8A 3D2CA 3SBEA 1GGHA 4ZC8A 2BGWA 5EE1A 4ZVKA 4JEMA 2BFOA 2P90A 2PTGA 3QVKA 2ORVA 3WAJA 2F7SA 2EXXA 4Y6PA 1BMQA 3RS0A 2HAEA 4KIGA 4RZHA 1XQWA 3VO1A 2ORWA 3FTQA 2GJ8A 2XTZA 3OE7A 1P1FA 3QNUA 4QBGB 5AUNB 3CF2A 3AL0C 3GW8A 4P7BA 3VHXA 4DLXA 1A7UA 3H6HA 3MSXA 1MQAA 1RCTE 2Q6IA 3TPCA 2ZM5A 2NO7A 3G0CA 1L1QA 3RS9A 5JAIA 5C53B 2B4QA 2VBFA 1KOFA 1NNLA 4PZ9A 4G41A 3IQDB 1W34A 3LC2O 4RLHA 8LDHA 1WR8A 1RBQA 3OU6A 5CDYA 4PQYA 4B3MB 4AWAA 2A2ZA 4XEHA 4B8YA 4DCPA 1OCEA 3H13A 4E6EA 1IHDA 4DA9A 3GUHA 3ZY2A 2JRLA 3CS3A 1GG9A 1OA1A 4N5DA 2Z4RA 2XQGA 2JBAB 4KN8A 5BQ5A 2ACEA 2VYVA 3ESDA 1PGOA 5A04A 4N6OA 4TZ6A 2V6GA 1QH8B 1G20E 3FR8A 2MWMA 3HP1A 4G0QA 4TWBA 4RZSA 3WYEA 2XX3A 5CXSA 4MW2A 4R9NA 4TL7A 3HNPA 4PLCA 4Q4AA 2GPAA 4NK4A 4AK9A 1Q17A 3E1KA 4A27A 4B79A 4J0QA 3KP1A 1L4GA 3IBGA 1DBWA 1EHIA 2ORED 5AM5A 1KZHA 3MWEA 4GZ6A 1E4EB 4OREX 4X24A 4ZK2A 2NTYC 2J9YB 3P5SA 1GN9A 1E69A 1U0NA 4CU5A 3M6UA 5FBVB 4UBIA 2LNDA 5K0BA 3C8ZA 1G8KA 1EWKA 2CFRA 5P21A 4RCYA 5EQJB 4PX2A 3IP7A 5JMTA 4JLWA 4NIMA 2QNRA 4EBBA 3HKBB 3U39A 3E9NA 4BNJA 5IKOA 4RDXA 3R3JA 4MUYA 1YS4A 1JSLA 4UZEA 3NOQA 4BX2A 1RXEA 4P36A 4DV5B 4TWIA 2QRGA 4IAOA 4CT4B 5BQXA 5K0SA 4CCWA 4RHUA 3UPUA 3EZ7A 4JVOA 3AK4A 3AONB 3AB7A 4G26A 3FDZB 3ZZ1A 2I7CA 4B9AA 3PA6A 5BPHA 4L95C 1J0AA 2C7GA 1EXNA 3U7GA 3BRSA 1KY3A 4KQWA 2WDZA 4LHVA 4GKVA 1MEEA 3GRUA 2GCPA 1HR0B 4Z4HA 1ADGA 2ZJAA 4KX3A 3J80A 4CE6A 3TNDA 1FTQA 2I4RA 2PMCA 5J4HA 2OLJA 1Q83A 4GLFA 1IN1A 4J6FA 3QMVA 3PWZA 1VL2A 3CUWA 3G8YA 3QVGA 1WEHA 1UEIA 2BR3A 2VF2A 2G4VA 4JYMA 4NV0A 1SG9A 3BCSA 3JQFC 4WUVA 5JCJA 4DAEA 1I3NA 2V96A 5CB8A 2FN7A 1H1DA 3OX3A 4MAFA 3ZGOA 4AQ7A 4CM4B 3UGKA 4ZTZB 1U9JA 2HRQA 4ZDJA 1OXMA 4YUVA 4BVBA 1WEKA 1YKFA 2PBFA 2VK1A 4EFNA 3ORHA 3B5JA 2OB2A 2QDXA 2IX3A 2OUIA 2A9QA 1TMGE 3H05A 4FGUA 1QGYA 4DLZA 4TLMB 3R8CA 1T9KA 2HX1A 3A9RA 3PKJA 3V6LA 4EIWA 3H86A 1BXGB 3TXAA 1CQWA 1YT5A 2R6R1 3AEUA 1KJWA 4KQ6A 2QV0A 3LTNC 1H65A 4V2IA 1KO8A 5AXDA 4AO8A 5EIFA 4IZHA 2IP4A 2YN0A 3F6SA 2YFYA 4TL9A 5DRTA 4F4DA 1HDEA 2ONZA 4DRXA 1MTZA 2ZP1A 1EDDA 1M8FA 2GJSA 4DLKA 1LNSA 1XK6A 3C24A 1KBQA 1C7QA 1XJ5A 5AVKA 3GK3A 1U99A 4ZVPA 1SCDA 2ENWA 2O4CA 1JEOA 3E82A 1XDZA 1ATZA 2JFQA 3QXCA 3MT9A 4ITRC 3T1VA 3WX0A 3ZGZA 4JUFA 4ZI7A 1XCMA 1RP7A 1X7GA 2YIMA 4O59O 5KTKA 2ZRPA 2HA6A 3CKKA 4PYNA 2C9CA 5J1SB 2F67A 3LYLA 3BE4A 1VI6A 2DWQA 4IF4A 3C48A 3WYNA 3D0QA 3PDJA 3IAXA 3OX1A 1YVDA 1U2GA 2XSZA 3SSMA 4LC9A 5AVZA 1XVAA 1AGPA 4HB3A 2G77B 4FN5A 1DIRA 1QB8A 4EGQA 1GYRA 1N9GB 3C16C 1IUOA 2MSNA 1I0IA 2PANA 1PQUA 3KAQA 1DCFA 2W4QA 2YFHA 4AJPA 1BKDR 3QZUA 4YA6A 2YUTA 5ICMA 2CVFA 4MICA 3ROGA 4E15A 5IJWA 3PWKA 4BE9A 4IDPA 1WXGA 1II8A 1NW4A 3U7QA 1YDGA 3GQBB 3DXXA 2GRJA 4RSRA 1PZMA 3VXKA 2UXCB 2ONKA 3N0WA 3WHIA 1J0CA 2R1VB 1LBQA 3BREA 2ZS8A 1PQWA 1U1IA 2G0AA 2FZKA 4BKQA 2GBPA 5B1EA 3JYHA 1P5ZB 3GRAA 1TCUA 2QJWA 3REOA 3V7UA 3R6GA 1QOZA 4IDHA 1US8B 4CQMB 3FYUB 2VBCA 3IVCA 1IY1A 5EEHA 1NI3A 1ONOA 1YA4A 2QY6A 2Q1WA 1GAJA 4Q3AA 3TSZA 2G09A 2F9MA 2VR1A 2NO0A 2KBFA 5DYIA 5K3DA 4EB3A 2REXB 1NLZA 1U0TA 3CLSD 2JGLA 4CLXA 3D6MA 2DKOA 4BQRA 4H4CA 4PRKA 4HB0A 3GLGE 5AW5A 2OZEA 3DEHA 1MH1A 3N7AA 5GY7A 4M0PA 1JIQA 5B2FA 4ZYYA 4IVRA 1PVDA 2ETVA 4U7PB 2R4TA 1O0CA 4YEDA 1ULTA 1KS9A 1D2NA 3RAFC 2NUPA 5CVJA 5H4GA 3NAZA 3HO1A 3KB8A 4RNDB 3E1SA 4LRYA 5HMLA 4EVRA 5CM2Z 1TC1A 4J9VA 2H4ZA 3PVSA 4HEA1 821PA 1JLLB 1JLRA 3U6KA 3HS3A 2O3SA 5CM9C 3ZOZA 4E2ZA 1J25A 4NBUA 5GM2A 1VA5A 3NFYA 2C04A 4FWBA 4AXXA 1FSZA 2CCKA 1AKUA 1AO3A 4KMOA 3H9UA 4CT5A 1IEWA 4RFSA 4Q4JB 2HRCA 3Q8KA 5CYPA 1RZRD 3KETA 2X4LA 2GETA 2UKDA 1QRRA 1CE8B 3BXEA 2ZR0A 3FDJA 2OG1A 3UWDA 3VO9A 5HKKD 1FLNA 4P6VF 4JY7A 2IOFK 2VRCD 3BDVA 4LMRA 1QHEA 4NS1A 4XLLA 1ZJ5A 4Y2XA 4ZOAA 2EKZA 4I3GA 4G0VA 3BE5A 3FSEA 4EHDA 5BWMA 4BMVA 2CLSA 1P45A 1LF0A 4L7QA 1L7DA 4DDVA 1T9ZA 4J7CA 4I0WB 4FYYA 5AKJA 5LB2A 1IOWA 2JI8A 1X7WA 1QFJA 4LWPA 2X6TA 2YWJA 2DWCA 3AX6A 4DBVO 3H11A 3SSNA 4HI0E 4RULA 4TGLA 1A5TA 3WWOA 4ZT7A 4LF6B 1UKBA 2G7ZA 1R6VA 2YXEA 3CCBA 1JG6A 1Q7EA 1Z56C 4R2WA 5J59A 3FPEA 4Q4DA 2WFMA 4UCWA 4UVEA 5CVUA 1VRVA 1XTBA 1EB8A 3TZQA 1WY7A 4OFBA 3GEPA 1MZVA 2FOIA 3FZEA 5JCOA 3F3SA 4LF8B 3ONDA 3EVDA 1M1NA 4MCAA 3RWBA 4L0DA 2WOJA 4Q9NA 1F1JA 1KH3A 3PSHA 1T91A 3BQMB 1QIMA 4NJOA 3DEIA 4QJIA 3TNJA 4EB8A 1FYEA 2AFIA 2G9QA 2WD7A