1ZDMA

Crystal structure of activated chey bound to xe
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
128
structure length
127
Chain Sequence
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Chemotaxis protein cheY
publication title Distinguishing multiple chemotaxis Y protein conformations with laser-polarized 129Xe NMR.
pubmed doi rcsb
source organism Escherichia coli
total genus 42
structure length 127
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zdmA00
3E61A 4MQEB 1LK0A 1D5WA 2A9RA 5GOTA 1M5UA 2PUBA 2H0AA 4YLEA 1QPZA 4MQFB 4G0ZA 3RVLA 5BRJA 3CKMA 1QQBA 4RY0A 1USKA 2R4QA 3Q15C 1K68A 4ZMRA 3EODA 4G0OA 3TB6A 3QELA 4RK1A 3NBMA 1TVMA 2FEKA 2PUDA 1DC8A 2OQRA 3CHYA 2FEPA 2QVCA 1JFVA 3C3KA 1Z2EA 2R25B 2CHFA 3IP7A 3R0JA 4LE1A 4RK7A 4YWHA 1VKRA 5E3JA 3F73A 1JX6A 2PUAA 4OLBA 4KK4A 2LIVA 1T34A 4Q6BA 2QZJA 2GX6A 4YP9A 5ED4A 2JBAA 3OLYA 2YHAA 1DRKA 5DCLA 5DTEA 4S05A 2FQXA 1YMUA 1APBA 4G0MA 5IUJC 3CZ5A 4PZ0A 1W25A 2BGGA 1ABEA 3LUCA 1Z12A 1SD5A 4EYGA 5IC5A 3HUTA 2DRIA 4LE2A 9ABPA 2PUGA 4QYMA 5IEJA 4IGAA 4NICA 4WXMA 1YK0A 1DBWA 4RK4A 2FW0A 4ZJPA 3HO1A 2NUBA 4ETIA 2QXYA 1VRVA 2FTKE 3H75A 2PLNA 3H1FA 1R8JA 3HDGA 1ZHHA 4JP1A 5B3JC 4LX8A 2WJAA 3D02A 4FB4A 5HM6A 4W5RA 1EAYA 2V0NA 4O1IA 4L85A 1JYFA 4LDAA 4MR9B 2N9UA 1BVHA 2JCGA 1Z17A 3W9SA 3DGEC 3IP6A 1E6KA 2A9OA 1JF8A 4L4UA 2JRLA 1Z25A 2IKSA 4FE4A 4Y9TA 1ZVVA 4MQEA 4KPYA 1KRXA 1EHCA 1D4ZA 3KS9A 4MQFA 1H9CA 2R47A 1D2AA 1F51E 3G1WA 3G85A 2PAFA 1OXKB 1PUXA 1TJYA 3C97A 3HEBA 4RK5A 1DCKA 1U04A 2VUIB 1RNLA 1NXWA 4TN5A 1KRWA 4N76A 1CHNA 4MR8B 2FQWA 4RDCA 4OLAA 4M88A 4NV3A 3Q41A 4MLDA 5FWXB 3HCWA 2B1JA 4ETNA 3IP5A 4F11A 3BILA 1Z26A 4RY9A 1JDNA 2VUHB 3K4HA 4O1HA 1Z16A 3QLVC 5BQ3A 4D6XA 1JDPA 4WZZA 2W42A 2E4VA 4E7OA 5IUKC 1MIHA 1XHEA 4IILA 2PUFA 3LTEA 2E4WA 3A3KA 1MVOA 3H5TA 3O75A 3KJXA 4HNQA 4Z4FA 5CNKA 4OG2A 3KKEA 3A0RB 2PE5A 2HPHA 1USIA 1ZESA 2PMCA 2TMYA 5TE9A 4HNRA 3H5OA 1GUBA 3BRQA 5KC8A 4JB2A 2PUEA 4S04A 4MS1A 5KQMA 2ZAYA 4MYRA 3LFTA 5CNMA 4YV7A 4RZSA 1RZRD 2IYNA 3IDOA 4RY8A 4KVFA 5IUNC 5DLEA 2WJWA 5FBKA 5C5CA 1QP7A 2MYUA 3T8YA 1EWVA 4E7PA 1NY5A 3RVKA 3SNKA 3LKBA 4N41A 3CFYA 1WETA 4RKQA 2FKAA 4MR9A 3OLXA 1JLKA 4EYKA 1YS7A 3H5LA 2M1ZA 2FMKA 2HJ9A 3HJFA 5TQJA 4EVRA 3H5WA 5C5EA 1PEYA 2IPMA 3CNBA 3T38A 4RV5A 4RXUA 4XAQA 1BDJA 2FQYA 1JFTA 2B4AA 4KV7A 2KYRA 4Z4GA 4Z0NA 5HSGA 2GKGA 1K66A 3CRNA 3H6GA 1QQAA 4NCAA 3JPWA 1KMIY 3M9XA 1YVUA 2FMHA 3LUJA 4WUTA 3OO0A 5EWLB 2L19A 5TQ2B 3NHMA 3T95A 4EUKA 5ABPA 4KFCA 2IOYA 3BBLA 5FWXA 1QP4A 1VLZA 4IMIB 4RKRA 1QNLA 3BREA 4TLMB 3ROTA 4H60A 3LMKA 2WMYA 3KSMA 4ZPJA 3GRCA 3IPCA 5JNRA 3Q7TA 2FN9A 2RDMA 4MPTA 2MSWA 1DG9A 3I5AA 3N0RA 3RVNA 2E4YA 2NT4A 3CZCA 1PEAA 1P6UA 2GBPA 3HSYA 1W9HA 4DADA 2J48A 1DZ3A 4Z9BA 4QICA 4MS3B 1TM2A 3TO5A 3H5IA 4N03A 3IPAA 3K9CA 2F8SA 3UKJA 5T7BA 3JPYA 3N0WA 1YMVA 3HVRA 4EYQA 4LZLA 5TPWA 3KYJB 3O21A 1ISRA 1QP0A 3F7NA 1FFGA 1JBEA 3C3MA 3QLUA 4YGXB 3Q7SA 3TX6A 1NTRA 1P6QA 2JB9A 4NQRA 1ABFA 4Q6WA 5IX8A 1TLFA 4OBBA 3DZDA 3CG4A 3H6HA 3SAJA 2MYTA 3OO1A 4UHKA 1M5TA 1NXXA 3RQIA 4F12A 3DBIA 4MR7B 4G86A 4N0PA 2PKXA 1ZITA 1DC7A 3OLVA 3SQNA 5CNIA 4OTZA 5BRAA 4JASB 1PHRA 2JVJA 3OLWA 4RK0A 4YRZA 5HQJA 1JYEA 8ABPA 4PE5B 1ZH4A 1IIBA 3S99A 5JS1A 2WRZA 2FMIA 5IBQA 2FLKA 4XXHA 4YS6A 4LE0A 2PL9A 1XHFA 3HUUA 2X7XA 1NXSA 3T6KA 3QEMB 1GLGA 4F8JA 3FMVA 4JAVC 5IULC 3GBPA 5EWLA 1RZRA 2H3HA 4MS4B 4RU1A 5TQ0B 1U0SY 5TQ2A 4UHJA 1Z13A 3NNSA 1P2FA 2FN8A 5CHYA 3DGFC 4EY3A 3JVIA 1PNRA 2QV0A 3F6PA 2WY2D 3EDCA 2FEWB 4TMYA 3L6UA 3P9YA 1EWTA 2I6FA 4XLTA 1VPWA 4PICA 1S8NA 3MMNA 3C3WA 4WXEA 1NXTA 2VYCA 3H5VA 5T3YA 3QLTA 2ID7A 1NXPA 4GPAA 4RXMA 1MB0A 3E3MA 3N0XA 4MAAA 1C4WA 4XFKA 4MS3A 1E6LA 3URMA 4OATA 3B2NA 2RJNA 5JNUA 2QVGA 1GUDA 3FFWA 4W5QA 3BRSA 2L17A 3RVJA 3EQ2A 3GYBA 3LUHA 3VNBA 3FGZA 4Z9AA 3LKVA 3H1GA 1B00A 1DCFA 5TPZD 4B09A 1FQWA 3JVDA 3MF4A 4KNYA 2Q5CA 3UK0A 4WT7A 1DBQA 1DRJA 3RH0A 4D74A 3HS3A 4MR7A 4H3HB 4ZYLA 3KG2A 1NATA 3GBVA 3O2JA 1YIOA 2LBPA 4HYEA 1ZAYA 2FMFA 2RGYA 2ZWMA 3CLKA 3MYYA 3ILHA 4RSMA 1LJUA 1QKKA 4LRQA 3OQMA 2M98A 3HXMA 3KHTA 2CD7A 3Q9SA 2QW1A 4RS3A 3O1HB 3I45A 5B3JA 4N47A 5JNVA 3MQ4A 1D1QA 3O2QB 5D2CA 1Y1LA 3OM1A 2IDMA 1DCMA 2CWDA 5GQSA 3L49A 4F3TA 2O20A 3QEMA 3GV0A 3KYIB 4MRMB 3MIZA 4N0QA 3ILYA 1EFAA 2F8TA 3LUAA 4G0QA 2JVKA 4QPJC 5EWMB 4MS4A 4W5OA 2IPNA 3OLZA 3I09A 4MR8A 2NT3A 3FFXA 3MM4A 4KREA 1M2FA 3KLOA 3OQNA 5FWYB 3A10A 1JHZA 1SXIA 4KK3A 1UDRA 5KI6A 4LDZA 3RVOA 4G0PA 2GI4A 4PEVA 4FE7A 3H1EA 2HQBA 1P8AA 3N75A 3VNAA 4G0YA 2P9HA 4KMRA 4MLCA 5HKOA 3Q7RA 1Z18A 1Z15A 2IPAB 1JL3A 3HDVA 3EAFA 3O74A 1J56A 3LUFA 3QLVA 2R48A 4YO7A 5KQPA 4HNSA 2IPLA 2P4UA 1HEYA 4RWEA 5JNSA 3N6VA 2JK1A 2MSKA 5KWSA 1URPA 4Z4EA 1ISSA 1QO0D 1MB3A 2HQOA 3EGCA 6ABPA 2PJUA 3RVPA 1E6MA 3C6QA 3TMYA 6CHYA 7ABPA 1CYEA 1F4VA 1ZGZA 2A9QA 1TMYA 5EWJB 2AYZA 3M9WA 3LUKA 4Z4IA 4KZKA 2FSPA 3ROFA 3HM9A 3DLHA 4WWHA 3CU5A 1Z2DA 4PYRA 4F06A 1D1PA 3RVMA 5I4CA 1QMPA 1M2EA 1ZY2A 4TLLB 5IEBA 5KQGA 3HV2A 1CEYA 4NCBA 2NZVG 1A2OA 5KQLA 4G0XA 3QX8A 4Z4HA 4YCSA 1RXIA 3SY8A 2PUCA 4IMJB 4MS1B 1YTUA 4ML3A 3CTPA 4Q7EA 3N8IA 2FVYA 1GCGA 2WWVD 1MAVA 3NNDA 4EVQA 2CHEA 4MRMA 5TPZA 5JNTA 2GWRA 3FFTA 3NNNA 3QEKA 1BA2A 1YK1A 2LUOA 3HZHA 2VK2A 5EWMA 1U8TA 4W5NA 4EYOA 4JA2A 4Z99A 2E4ZA 5FWYA 1LBIA 4JB0A 3LUDA 2LP4Y 3EULA 3UUGA 1I3CA 1LJLA 2OENG 3MA0A 3O2SB 1E2BA 2E4XA 1YS6A 5FBHA 3O1JC 2L2QA 4MGEA 1GCAA 3KLNA 2HSGA 5CNJA 1PNTA 1SXHA 1USGA 4GNRA 3GWGA 4JOQA 4KQ9A 4Z4CA 3EJWA 1JFSA 1L5YA 3QK7A 1LBHA 4P98A 2QU7A 1ZH2A 3LUGA 4W5TA 3OQOA 3CG0A 1ZN2A 1BAPA 2MSLA 2MYPA 2A9PA 3JS5A 5F64A 1RXEA 5JNWA 3OMWA 3QELB 3HK2A 1FSPA 3O1IC 3D8UA 3EQZA 1U2PA 1U2QA 2PL1A 4G97A 1XWWA 2E4UA 3N53A 4RXTA 2NZUG 1C0EA 1ZGGA 3LOPA 1BDIA 4XARA 4XASA 3RVSA 3CS3A 3KTOA 3SG0A 3F6CA 1SRRA 1A04A 2QSJA 3GA5A 5EWJA 1AB6A 4EGSA 4KRFA 2ID9A 2XDYA 1KGSA 4EVSA 1DP4A 2FXIA 2JBAB 3M6MD 3QLUC 4ZMSA 3IP9A 3OMXA 3RVQA 3GL9A 1NXOA 1DBPA 4RK6A 3OM0A 3SM9A 4P1ZA 3RVRA 5PNTA 1A0OA 1FFSA 1FFWA 3NHZA 4YR7A 3DLBA 2QR3A 5JS2A 1BDHA 5TPWB 3TD9A 4DQDA 4DN6A 3JTEA 1JWLA 2HQRA 4IF4A 1RPJA 3I42A 1QO0A 1L5ZA 2AYXA 3KCNA 1EWKA 5DKFA 4D6YA 2RJOA 4KQCA 1AB5A 3A0UA 2MYNA 5KC9A 2JVIA 4O5AA 1SXGA 3GT7A 1ZDMA 1DJMA 2YHBA 2FLWA 5TQ0A 1NXVA 3QX9A 5DGCA 2WB4A 2L18A 5BR1A 3JY6A 4H3KB 4ETMA 1JH9A 4IRXA 4QYWA 1OXBB 4CBVA 3FDFA 2LPMA
chains in the Genus database with same CATH superfamily
2J0QA 5FP0A 2AN1A 2AJDA 4BMXA 3UZUA 3O73A 3IOMA 3OAAA 1Z5ZA 1F2TA 1ESEA 4G5GA 1C1DB 2H7VA 3G9XA 4UUNA 5DLDA 5TB5A 5BRJA 4W1QA 2HMYB 4ENPA 1GTG1 1FDOA 1LWOA 1VHWA 5CDFA 1M75A 2H1VA 3SKYA 4FWIB 4C6RA 4YALA 1HK7A 1MPTA 1Q83A 4M0DA 4U7HA 2IYFA 2O3SA 5KKAA 4B3XA 4BNZA 4ALNA 3LC7O 1DRWA 3RBVA 2IHNA 3M7IA 3RJTA 4RIEA 4WNCA 2ZI5A 3P26A 1QHEA 3UMCA 2I66A 5E3JA 3CO0S 4HHEA 2DPYA 1KTIA 2FPGA 1GKLA 4HLDA 4IH4A 1QHXA 1XPJA 2AS0A 2VDWA 1QCDA 1QFSA 1ULAA 2G3YA 3JD0A 4M7WA 1T2UA 5LQCA 1UJMA 2WAOA 4MVWA 5AI5A 4TSKA 4OHYA 2UXCB 1IQRA 2CLHB 4HXFB 4FM9A 3IQFA 1M6VB 3JAWB 3O84A 1Q5PA 5GGYA 5LLSA 4S05A 2R1TA 3IUPA 5HGJA 2ZAMA 5D5QA 2Z30A 2F2TA 2AN5A 1KMHA 5AK0A 2HBQA 4U9UA 4LZOA 1MUUA 5B36A 2BGGA 5EKDA 3K70D 4Q5IA 2XSZA 3VAZA 4MJ3A 4XWYA 2FW6A 5CIWA 1U0RA 1RYYA 2RARA 2C78A 4IEEA 3OIVA 1UH5A 4K86A 4KH1A 4WNYA 3LLMA 4IOJA 2VPXA 4RH0A 5TT1A 1RPZA 4HX9A 3VR2D 3NBUA 4ZOEA 3TECE 1E8DA 2OV4A 3PGKA 4FILA 3CINA 5AVYA 2YRFA 3WWOA 1HE5A 2DSTA 3QVSA 3UA4A 4OXKA 5BSRA 1B16A 1ZUD1 2DPLA 2PS0A 3G17A 4B1FA 3A6PC 5LD2B 4YMSA 3N8DA 2ENWA 4IW3B 3RS4A 2GEVA 4YCJA 4B47A 4R9VA 2DTXA 1Z17A 2WQZA 5B3AA 2OGWA 3OZ7A 2ZB2A 4HB2A 4YJ3B 4QYIB 3VUFA 1GRRA 4L08A 2D2VA 1KMMA 5AOVA 5F4ZA 4NFSA 4F96A 1J2EA 1MDFA 3R3XA 3TX2A 3PEWA 3K0FA 2ZJOA 4YONB 3K6KA 1BS2A 1D8TA 1FRVA 3G85A 1AMOA 4UARA 3U6BA 4WK2B 4AJKA 2CXQA 2YJZA 1N33B 3YASA 3UOAB 1UINA 4V38A 4TN5A 3R9WA 3A1DA 4WCVA 3VR1A 2UKDA 5DO9A 3BXOA 5FI0B 4CLRA 4NV3A 3S7TA 2W6JA 4FSDA 1DHTA 2GHTA 4XM1A 1LU9A 1BS9A 4J0DA 3G49A 1ST3A 1Y9EA 3DV0A 3K4HA 3N2GA 2BKAA 3OQBA 1JFFA 1KY3A 2Q7OE 1NVWQ 3NBKA 4AZWA 1HFJA 4D6XA 5JARA 1ZJ6A 1Q7EA 4G67A 4OU4A 4MYCA 3ZZ0A 1CZOA 1HZZA 1TIKA 2EZ9A 2XKAA 2G83A 2WF5A 1XROA 2GNOA 5DYTA 4YXWA 1NY6A 4JEMA 4KXLA 5IMBA 3N2LA 2OQ2A 2F8MA 5DBFA 1E3DA 1CSEE 4A8JB 3I5YA 4BU1A 4U7DA 1DJNA 3FTNA 2PZBA 1JTEA 4M54A 3VTZA 4EY6A 1LX7A 2EBUA 1R6AA 3GU3A 1RJDA 4GQIA 1XU4A 2A0FA 2Y67A 5DHSA 4KR9A 3SYTA 4OJYA 1FRFS 3UOGA 4EI9A 1JKJB 4Z9FA 4O4LA 1XEFA 3MCAA 4U39A 1SB8A 1BKYA 1CY4A 4R2MA 5P8WA 2ZBPA 4NZOA 4HDSA 2GHRA 2OQIA 1LXCA 1XX6A 5ECYA 4JSRA 1F3LA 1U0LA 3X3HA 4LIPD 4M83A 4R1TA 2RGNC 4C6SA 4DMKA 2CXPA 4PPFA 5FTWA 1CWUA 4ER6A 2QTBA 1TEHA 4C87A 2JPDA 3OT1B 3B6KA 1WETA 4NWIA 2PRZA 2RHWA 2ZAOA 1RQGA 4I19A 4OXQA 1OBFO 1X1DA 1SU6A 3JYHA 1T3HA 2C4KA 1IZZA 4P4SB 3DL4A 2OTCA 1CRQA 3NHUA 4XSGA 3VU3A 3ECAA 3LPCA 3CN9A 1FU8A 4GBJA 4GZMA 4MDYA 4P58A 1EP3B 4RVOA 1TVKA 4H1VA 3WLPA 4AICA 1RVV1 5JAHA 2I71A 3W2GA 2R6GA 1Y82A 1F5SA 2YY7A 3BULA 1EYZA 4LY3A 4MGYR 3WYEA 3LT5A 3WC4A 1MFZA 1LWNA 4AP5A 3NBZC 3GT0A 5JSYA 1K06A 4FKMA 4WUTA 1Q3HA 5DX0A 1G6KA 1GZ4A 3G0BA 1U1DA 5GZ6A 5AI4A 5JO9A 3UJCA 5JPDA 5KTRA 2IELA 2JLUA 3RG2A 3ESXA 3V4OA 4D3FA 2GWHA 2O5CA 4H60A 2I8AA 3IESA 3PA6A 2VDRB 4L9AA 4ZVSA 3NIBA 2FZGA 1DEKA 2G5PA 3R0QA 5J9FA 5K0SA 2RDMA 3ZDEA 1LQ2A 1QIIA 1YIDA 3F96A 3R9XA 5FHQA 4MTCA 4IOLA 3NYQA 3GEEA 4PC6A 1R16A 1U6IA 3W6ZA 3LYAA 4LGVA 1SCUB 2AFVA 1B0PA 3ADOA 2PMFA 4Q4CA 3WOHA 4E70A 2BH9A 4RVNA 4UHDA 4TV8F 3BWCA 5A0FA 3LC0A 4O1MA 5A03A 3F7MA 1MZPA 2CUZA 1ORWA 2GEDA 3D3KA 3JWHA 1Y5LA 4RCZA 2B4QA 5BSVA 4UEKA 4I8IA 3DT6A 1I1QB 3FYTA 2H2FA 4POOA 5IN5A 4E5MA 1TI7A 3OCJA 5GZ1A 3C3MA 2OV8A 1X0XA 1Q2UA 3I39X 1F0KA 3A3OA 3ZGNA 4C78A 1OBVA 4OO3A 3HL4A 3F49S 5BV7A 1DX4A 3I6MA 4FYPA 4R0NA 3F1LA 4RHCA 3RC2A 3PSAA 2O06A 2YV2A 4M1OA 3NGMA 4UFPA 2BN4A 5JSZB 2PUHA 2BBTA 2OXCA 5KYVA 4A7PA 2QTWB 2Y1FA 4PPYA 5LNK1 2ISQA 2BHSA 2Q1UA 2CBGA 1NPYA 1CZRA 2W2OA 4MGZR 2O1SA 4NL4H 4OTZA 3FCOA 4MULA 5FPYA 4YRZA 8ABPA 5DWQA 2ZSUA 1CY0A 1NW9B 1QCZA 2CHVA 2Q2QA 2O9JA 3TEFA 4YHHB 1TMOA 4OB7A 1DIBA 4LCEA 4UJ5A 5HJ2A 4B3FX 1JEYA 1ZL2A 3I8OA 4KV9A 2BI8A 1H2WA 1QR2A 3KSRA 5LDHA 4UVDA 1VE3A 1RHJA 1XXHE 4P2GA 2PL9A 5KPDA 4H2DA 1WUJS 1PJ8A 1A95A 1E9SA 2PYIA 4JQOA 1X7HA 2YZMA 4MP8A 4PYIA 4UNNA 5D5HA 3RNOA 4I9GA 4C4TA 1HFEL 1FTQA 1RYEA 1TIBA 2N47A 4F8JA 4R98A 4GL2A 3ZCQA 4UTNA 2WT8A 3KSAC 5TQ0B 4BMDA 3QBVA 4TYMA 1ZRNA 3KPUA 2QROA 3PIIA 2O7NA 5DYGA 5LDGA 4HXGA 4KHPB 1XQ9A 3V55A 3DCJA 1DEOA 3KYDA 3ESZA 4GMHA 3M6FA 1MEJA 3BPSA 1ZK4A 5B58T 1RKQA 1KVRA 3NX4A 4B3TB 1EWTA 1NA5A 2I6FA 4UUBA 1Y48E 1BXZA 2YVUA 3MMNA 1YI1A 5KHLB 1NYQA 1KIMA 1XRRA 4S3MA 1VZ2A 5D01A 1G6HA 5JRZA 2GF9A 2INGX 2W0MA 2VYCA 3GEPA 3H5VA 3MC1A 2ID7A 3TK1A 3W5SA 3GN1A 4KBGA 5DEIA 4GPAA 3B1XA 4PXAA 1N5DA 2BJWA 3WWPA 5JBIA 2IFTA 4KFRA 4RFSB 3IQXA 2BKVA 4IDAA 2JJ1D 1QO9A 1RZ3A 1TKAA 2BUCA 1Y9ZA 1ZD3A 4N3CA 4OI2A 2WJJA 1T6NA 1X7GA 1TCCA 1EZ4A 5AM0A 2A4MA 2X77A 3KKMA 4AVYA 1T9CA 4FNMA 1UXOA 3FKJA 4KXUA 3RS5A 2JHAA 5A4IS 2YTZA 4C7OB 3ELWA 3ERCA 5AVTA 2GS9A 3L7LA 1P4JA 2CZCA 4MCHA 3E0QA 1HLPA 3GAAA 3VKUA 1EFVA 4NU5A 2BFOA 1IWPB 4NBSA 3H6KA 3AHJA 2QQEA 4F1KA 1PWZA 4OSOA 3RH0A 4R71A 5I7RA 3NW9A 3PQ3A 2M32A 4KXXA 4ZYLA 4Z9XA 2PWZA 2W2KA 3IYLW 1XD8A 2J5QA 2F6RA 2GCOA 3OF5A 4OKSA 3PE4A 1PGQA 1C7FA 2OHFA 4C5BA 4LTMA 1WAMA 2ATXA 5BW6B 2XW6A 4D2IA 2B92A 2LE0A 4LGMA 3NEAA 4OD0A 2J3IA 4C7XA 4ZOCA 5HCIA 3KHTA 4XM0A 5EE0A 4Z49A 3DYVA 3AVWA 2HF2A 4JK3A 1TXGA 3MQ4A 2C82A 5AWFC 2H4WA 1PT7A 2CWDA 2JFWA 2OGSA 2O20A 1CUBA 1PEKE 2OZVA 3QEMA 3W5AA 3MS2A 5FYDA 3KX2A 3WO1A 3ILYA 4HH1A 4ND4A 3WLSA 4LHVA 4RLFA 1KPHA 1UMDB 1Z2OX 3DKVA 3OLCX 4K8OA 2KE5A 4MR8A 4O8ZA 5E0OA 4ZMBA 4N8SA 4L72A 3TIIA 3V97A 1BX0A 5ITZB 1L7RA 3ILXA 2QT0A 1O58A 1S3FA 4G84A 1Z7YA 2RHJA 5I47A 2GI4A 3C98A 4KLZA 1YZGA 1U28C 5B6PA 1MJFA 1Z4IA 1M7BA 2PPLA 4L5AA 3UT5A 4H6VA 2VJPA 3FAKA 2P9HA 1DTWA 5KSYA 4WBNF 4LF5B 2HQ1A 5AKYA 2B30A 3TB4A 4JC4A 4IIGA 4CG1A 1S2MA 2Z83A 1RLUA 2P27A 2IPAB 1MH1A 4YRBA 2FVXA 2PUTA 1UEXC 3AU8A 3F6SA 3LVFO 2PN1A 3T35A 2B1QA 1MD9A 2WVHA 1L9XA 4LSMA 4AB1A 1V6CA 3LF2A 4I4TF 3KVVA 5DTJA 1WVGA 5IDWA 2HJHA 3G59A 3JRWA 2CNWA 5ALPA 3KZCA 2Z2XA 3H5AA 3TDMA 3SQMA 4Q7QA 1MB3A 5DBGA 3HACA 5EUCA 4AD8A 1UOEA 1G8HA 1HDEA 1IFXA 1MBZA 4AJOA 4BX2A 4DMUB 1TMGE 5JHGB 1E64A 1P7ZA 4BZXA 3TZQA 3HJAA 5GINE 1SPBS 2YOFA 2E55A 4P83A 4ZU3A 1I5RA 1KBQA 1FF9A 2O2JA 4HFRA 3SWWA 3D6HA 1HNXB 1AKTA 2ZP1A 2I2FA 3R09A 2D1YA 1NQUA 1VLMA 2VAMA 3O2NA 1W88B 4V02A 2NUAB 1SQ6A 4NESA 4OH1A 5IJAA 4CM6A 2VNIA 2QX7A 4MB2A 4TLLB 5FBLB 4B75A 2FX3A 4BVBA 1GTZA 3D8SA 3ICOA 4HB4A 4PSVA 1V5FA 4US2R 1MT0A 1Q57A 4YCSA 3GFOA 3SY8A 1YTUA 3EVAA 2DFNA 2J3MA 2DUUA 4IDDA 2XNHA 5GAJA 3TLYA 3V9AA 4Z8XA 5BN5A 4PZZA 1BCRA 2DP4E 2MTBA 4LJKA 2WWVD 1TKCA 4K26A 4P84A 4Q9HA 3OE7A 1ESDA 2P30A 2EJTA 2PQ6A 3MYRA 4LZWA 4UAJA 1A9PA 1QKJA 2B69A 2DTDA 2FJUA 2SECE 3EA0A 4PTYA 5B12A 2IE8A 1SIOA 1XPOA 2YJTD 3D3WB 2BIFA 2R0QC 4GR9A 4PZDA 4TLDA 1O5IA 2BGRA 1Y37A 2OXRA 4QRDA 2LP4Y 1G19A 2ZR0A 1WHTB 4UUQA 1PW5A 4N6NA 4P53A 2JAXA 5HFNA 1G4AE 3O1JC 5ADWA 5JCJD 2AMYA 3EF3A 1V8ZA 3Q11A 4HAXA 3U60B 1JKIA 4L8LA 5BV8A 1C3OA 1OROA 1I1HA 3TE7A 1RPAA 2OHIA 1XK7A 1ZMBA 3ZY2A 3ONVA 4Z4CA 3KJIA 1K89A 1IB6A 4PIMA 1J07A 4HRVA 4Q9LA 4ZAXA 4KYUA 2FJ0A 5AI8A 3UXMA 4ROSA 4WEQA 4EA9A 3MSXA 1D6SA 1OWPA 1BAPA 2JW5A 4Y1FA 1UP4A 5B37A 2XUGA 1Q0LA 4QGGA 3WBBA 4EMTA 4D80A 2RI0A 4PZLA 1N7IA 4ZT7A 5G2OA 2RB4A 4PSKA 1T9DA 3NAGA 3HRKA 4BEJA 4V0OA 1UPFA 1N5KA 1C9DB 1PJZA 1TDJA 1XZJA 2R8ZA 3ZCUA 3KQOA 3LOPA 2YOGA 4XASA 4HI0E 3G0CA 3HY3A 1Q7GA 4UCFA 2OVFA 3C15C 3GGJA 2XTAA 5EP1A 3W3ZB 5CVDA 3ZU3A 3ZD7A 2QTLA 5KO2A 3SZMA 2OZKA 5D1HA 2FXIA 2VG8A 2QTAA 3JXEA 5FLEX 3TQRA 4BLOA 1N3BA 5FBQB 1GNQA 4ESVA 3P71T 1A50B 1TA0A 3SYLA 1D03A 2O8FB 1B93A 2ISSD 5L4NA 3OHMA 4I99A 1P5ZB 1DBPA 3IIKA 4FZ3A 5IAJA 2ZYWX 2ZZKA 3CNEA 4G4GA 4HBZA 4NS1A 3CRRA 4JITA 2H2HA 3DW1X 3L18A 5TVKA 1A4IA 3CURA 2FPWA 4X7RA 3GIWA 4DUGA 4O2AF 4OK5A 2NO1A 1SCQA 2IIQA 5DRTA 3H16A 1SMKA 5AJVB 4J76A 4NBRA 1IMJA 1P19A 1SEPA 3RUDA 1LKZA 1TUBB 3D6MA 3RYHA 2OYRA 5IYZB 3E7FA 3KDSE 3OESA 3EYWA 1EWKA 2XNDA 2X23A 4I4NA 3ZV5A 2IP4A 1P9OA 4ZTZB 5I9MA 1TRHA 1DWPA 3LGSA 4CMIB 4F21A 4O33A 5K0EA 5ALJA 4R5HA 1J0EA 2PQMA 2Z95A 5MGNA 3D3QA 1W8DA 3A8TA 4YDRA 2O0JA 4EGAA 1M34E 2J0VA 2WTUA 5CM9C 5BMVB 1IHOA 2LWIA 3DOOA 3T5BA 1N3YA 3GAFA 3HUEA 3RSCA 3JQ9C 3WLEA 4CNQA 1XMOB 1I33A 3RS0A 5T3UA 4BWVA 1GT6A 1XRNA 3EVNA 2GZSA 2E6UX 1RPNA 2G0NA 2J59A 2AJ8A 3EEIA 4ON9A 3LBFA 2XI4A 1WTAA 3FZNA 3K05A 1LDBA 5HDQA 5AXAA 2YOHA 3V2UA 3NHSA 4FFLA 3A2NA 1QRRA 2QPOA 2B6HA 1U99A 1H1LB 2PV0A 3AERA 1P18A 3DYIA 3DBLB 2VDMB 4WLNA 2C2YA 4AUKA 3AESB 4G56A 1ETHA 1RIFA 2ZSDA 4Q02A 2G1UA 2O4UX 3A3YA 4I1YA 4ZCLA 4IVQA 1SELA 3HCEA 3T4EA 1P0MA 4HAYA 2QAGB 4ZYUA 1XZFA 2C20A 4EX6A 1GM5A 1GNSA 1RW4A 3QFSA 3RC1A 2WWYA 3K5IA 2WFLA 1NN0A 4ZTUB 3RDPA 1N2ZA 4L75A 2ZUEA 3ADCA 3SC3A 3BA1A 3X43A 3AIKA 1MIOA 1RXUA 1APBA 4UM7A 5FOWA 4G1MB 2RK3A 2GK6A 3NJ8A 2BMJA 2OYSA 3KVRA 4ARSA 3HDHA 1GA6A 4W5HA 2YN4A 4QYMA 1I13A 2XUHA 3DNFA 3DMPA 2FPSA 1RM5A 4NAVA 4R1UA 4A0HA 4F2GA 1MHTA 3Q2OA 5J2TF 2QTFA 1Y3DE 2H31A 1RHUA 3DZHA 3FTEA 3HXOA 3LO5A 3ED5A 2D54A 4LWQA 4K8RB 1VIYA 1YQUA 1XDWA 3H42B 5FV7A 3A6ZA 3AF0A 4K9QA 1OV6A 2CFIA 2G4LA 1FLVA 3MAGA 1CB7A 4UMFA 3R5XA 4UPDA 1B15A 2H07A 1WZ2A 1IZ7A 2XGOA 1Z73A 5F33A 3QVTA 2JRLA 2GJ8A 5H0IA 3IALA 4HB0A 4UTZA 5KVSA 4IDPA 4YT5A 1QG6A 4Q0MA 1H6AA 3A6JA 4TTPA 2I6XA 4Z0TA 4ZVTA 1FMFA 1U0OC 1Y5MA 3FOWA 3GLTA 3NTOA 4PV7A 2Q2NA 5AHRA 3BWMA 1VLQA 4Q3DA 4EIWA 4BO5A 1J5EB 4BNTA 1ZICA 2AKYA 3F4KA 3PQEA 3ZBPA 1DCKA 3O31A 1NXWA 3CBQA 2GJAA 3DP7A 5D5PA 4F4DA 1UC5B 3E9MA 3FBGA 3KYCA 1GPWB 1PO7A 2C58A 3S3TA 1VSUA 1XGKA 5JDCC 4B3CA 1PV1A 4CCYB 2ZIZA 3EIWA 2B1JA 4TROA 1HURA 4QFCA 5IHPA 4Y2PA 3LXUX 4CTJA 2ID4A 1DOAA 4M4SA 2IV2X 4LF4B 2WJ6A 4E7OA 2FNAA 2ZRHA 1DUSA 4CMBA 1CRWG 4RL6A 3DWFA 2WR8A 2E4WA 3GVPA 1P81A 3P9RA 3SHTA 1CE8B 3PC6A 1V1MB 3ZD6A 1YU9A 1RXCA 3DW3X 4OAPA 4AYTA 1F8XA 2Q5OA 1GWNA 2HN9A 2VSYA 4HNQA 2H9AA 4DR5B 1JDZA 1DV2A 2BGUA 1CUVA 3FUWA 2XCQA 4M6WA 1RU3A 4RETA 3DTYA 1GU0A 3HWWA 3JYPA 4FW8A 2XVAA 2JS7A 2XTZA 3PTAA 2O0HA 1KH1A 1QIKA 1SKYE 3G9TA 1AY0A 4YX9A 2I7CA 2XCSB 5F5LA 2XRYA 5B3LA 4WJLA 4JDUA 1P2GA 3ANMA 5H3HA 2NZJA 5IN4A 2OL4A 4QA9A 4J2TA 4PYLA 4WFQA 3HZOA 5EESA 2IU0A 3KJFA 3O47A 4DLKA 2XZDA 1E4EA 4XIJA 3TD6A 1I4TD 2NPOA 5LZ4A 1MPXA 3P9XA 3ZIAA 1LPPA 2ECKA 3EPPA 1YC2A 2BWJA 3LCVB 2B35A 3W79A 3W6UA 4B5KA 1X1BA 3GFSA 5E2BA 2ZOSA 5FR1A 2YQZA 5FUMA 3RAPR 3HYLA 4FBLA 1OX5A 1QAOA 1QF7A 3F7TA 3L8ZA 5B64A 5KB3A 2G1AA 2F9LA 3CNBA 2H5IA 1O0BA 4Y2TA 2G4VA 1D4FA 1P9WA 3N87A 1ZONA 2Z09A 3BWXA 3UEOA 1KZYC 1YGYA 4J43A 3D6TB 3MQFA 5B4UA 3ZEIA 1QQAA 3FJOA 2H51A 3MMPA 1WHSA 5AVSA 1N2CA 3HR8A 4TS4A 1YE8A 5KYUA 5LQMA 3G0GA 5EKXA 4FHGA 3ET4A 2FWRA 1MOPA 4DSZA 2QM8A 1OLOA 4FZRA 3BMCA 2NU9B 4BRUA 1VDMA 3OEHA 2V97A 3LCRA 3MT0A 4UOZA 1K6JA 1GKKA 3M2PA 3TM5A 2KBEA 5JW6A 3AUAA 3ETLA 3L7CA 1Z0FA 1B8UA 5CR9A 3NVMB 3TCXB 4E2ZA 2WKSA 4CFSA 3MWEA 1ZOIA 4Q1VA 4CKEA 4D9HA 4R3WA 4LDPA 2XXJA 1L7PA 3F8TA 2YHIB 1XDZA 2GBPA 2V74B 3IB3A 5K3FB 1W9HA 1JALA 2B99A 4MVJM 4BNLA 5HQ3B 1WD7A 3E1GA 4UE6A 4QICA 3V8BA 3NHYA 4NY1A 1G20A 4AK9A 3DV9A 1TM2A 2Y4OA 3AW8A 3IPLA 4YRTA 3SYRA 2A2ZA 1RWQA 4MWGA 1VA4A 1JR3A 3I6YA 3KAPA 3LPLA 5CCXA 1GPJA 3K0AA 5AW3A 1GZ3A 2VDLB 2BEVB 2OEPA 5AHKA 4O0MA 3HVIA 4TKUB 4Y2QA 4XUDA 2VRCD 2X1MA 3UYKA 1OA0A 2BFFB 4BE4A 5HK9A 1JJVA 1OX4A 3THYB 2HU7A 2GDJA 2WZQA 4WZAE 3WMGA 1NUSA 3JZDA 4D3DA 1BFKA 2QM3A 2PRJA 3TZ6A 3W9UA 4EABA 2JGEA 1YR1A 4OGLA 5MN6A 3OFJA 1MCZA 1F1BA 3M6VA 2KSQA 3J80A 1XTKA 3DC2A 4IUYA 1II8B 2AI2A 3RGWS 1C9NA 3BZUA 2ZSAA 2BBSA 1RLJA 4OHCA 2ZYAA 2VXBA 4BASA 4CM4B 4XX0B 1JV2B 3LECA 4CU5A 4IGKA 4O4HA 4WDRA 3OZWA 4L4RA 4YJ2B 5H59A 1JYEA 1ZZGA 3LYUA 2B2NA 2J07A 1Y3BE 4X63A 2A84A 4LG1A 4PYOA 3G2LA 3VX3A 1KAEA 2KWIA 4UZFA 4TV9B 3BGWA 3AZQA 1TAQA 3DOUA 1BE1A 4ZO6A 5IBQA 3M3DA 4ZWNA 2QR2A 4G0VA 2C2GA 3EZ6A 3LQ1A 1PBTA 2GCNA 2WTXA 4OOEA 1W75A 2X7XA 3BTOA 5IT5A 3B1WA 3TZLA 2FPMA 2O8CB 3C8MA 3ZVRA 1QPBA 3FMVA 4KKXB 4PPQA 3W2FA 1P9RA 1UC4B 3LIPA 7GPBA 5FEMA 1UFRA 2VHXA 4MS4B 5K3CA 1RZRA 2XHZA 4UHJA 2QTVB 4NFLA 4JT2A 3RPEA 3RTDA 2XUAA 3R75A 3GDFA 4HH4A 5D6OA 1TZ2A 5KX5B 4UHCA 1KZ1A 1VPEA 4CG3A 4QUIA 2J9FA 5A6SB 1PL8A 4TRRA 4WZAA 3RYTC 3CPSA 5FOXA 1Y6ZA 4TWJA 4GXTA 3SYNA 4YLYA 4DA0A 1L2TA 2C5LA 3VDMA 4BUCA 1CF2O 2O2IA 2NTYC 4YJFB 1NF3A 1P72A 1ESCA 5FL7D 4D46A 2GD1O 1NXPA 1QFZA 2Z6QA 5F3RA 2QTHA 3WB9A 4MAAA 3ROPA 1ELOA 1M6VA 3M83A 1IBLB 3I2KA 4OATA 5AOCA 5EPUA 1L5LA 5C2JB 3QKIA 2YV4A 2QVGA 1RXWA 4EFNA 1F1JA 4C03A 2JC3A 3F90A 4GE3A 2F9FA 3C1AA 2FUEA 3HB4X 2QL5A 3ZDDA 1K8ZB 2QP9X 1WSAA 3NOOA 5TPZD 3RSSA 3TW8A 4MB6A 5CDYA 4B3RB 2P8SA 4ZOLA 1MVLA 1MC8A 3DONA 2FPXA 3CMMA 1PZNA 2Z4SA 4I6JA 2DXIA 1GKYA 1DRJA 1I6WA 4Q1FA 1OFHA 4QQKA 1UPCA 4FR0A 5ELMA 4ZJUA 1A9TA 1NATA 1CJMA 2WHQA 5EP2A 3C5WP 1UPXA 1YIOA 3IVXA 3ZZ1A 1ZAYA 3HJBA 1O4WA 1R4NA 3Q3GE 5IKPA 3ILHA 3G0HA 4Q3AA 3U1VA 4AM8A 1BQEA 1SH7A 1IQPA 4U6QA 1XD9A 3A1WA 3BE4A 3HXMA 3VNUA 1RPTA 3ESBA 4JBXA 1OYWA 4RS3A 5B3JA 5KAMA 5EY5B 4Y6PA 1D1QA 3HXQA 3VZCA 4ZICA 3HJNA 2IDMA 2KHZA 1CC1S 1ZD9A 4KQ6A 3P1JA 5EE3A 2GZ2A 4IJMA 4UNRA 3SIXA 4X71A 3K2IA 2P9FA 5L3VA 5FUVA 3CNHA 4YQFA 2R9VA 2EV9A 2BZ1A 1FFXA 2XOXA 3A2MA 2CFSA 3GFQA 4LI3X 3SD7A 5LC1A 1AXRA 1H22A 2AQKA 2BP7A 5T4BA 1YI0A 1AIPA 1Z7EA 3I53A 2ZJ1A 4FMDF 4HVLA 2XXAA 4PZUA 3TSAA 3N75A 2BTEA 2P6OA 2J0EA 3DUFB 2DUNA 2A86A 1AXGA 2IYWA 3PYLA 4MLCA 3ZLBA 5I9IA 1LS1A 1FBTA 2OK7A 5EIBC 4BXOB 1N8NA 1KJQA 2VJLA 3AFNA 5BN3A 4ZHQA 2R48A 3T3EA 3L7BA 4MYDA 3AP1A 3W3AA 4JLWA 1GU7A 1L7OA 4R9NA 3AR9A 4UVHA 3RRNA 5JNSA 4S2EA 1HOTA 3VR5D 2MSKA 3JAKA 3DUWA 2M1XA 4Y6OA 4QBGB 1M6WA 1XRQA 1L7BA 3QPBA 4Y6SA 4U5QA 4L7QA 5BT9A 1JGTA 1C4XA 1JLSA 4H6XA 4UNPA 2A9QA 2RHCA 3NTXA 4OP2A 3UPUA 4MKZA 3SHQA 1T0HB 1NVDA 2F4NA 2XOEA 3PPIA 3Q9NA 3UJNA 1PZHA 1DOHA 1O95C 2BMDA 3PDWA 2OBMA 1VJ0A 4Y2XA 5HG0A 4EB0A 3LGAA 1R8QA 5KQGA 1S3IA 1DKOA 4BIIA 3RFCA 4YT2A 3K2BA 2ZWVA 4J1NA 5ADHA 1YB5A 1L5NA 5ALLA 3AGQA 4QOEA 4TRMA 3FTDA 4E5VA 1HRDA 1XALA 1PL0A 2IXBA 3O90A 1SXJD 2C95A 4Q7EA 1LFAA 3ENNA 1YS4A 3KAJA 2VOEA 5LM3A 1LSSA 4JKYA 1SULA 4JNCA 4WZBB 3KHKA 1K5GA 4NJMB 4FYYA 2JIOA 3O4IA 5A3VA 2W8BA 4GP9A 1XNQB 4PVCA 3AF6A 2JZCA 2PKWA 2WINI 5DMHA 3CB4A 1YB1A 3TJZA 4MI9A 3K1AB 3WKDA 1WCV1 4I1RA 1YA6A 2HLDD 2F1RA 2OENG 3O2SB 1FNNA 3HUFA 2CFTA 2ZE5A 4YMUA 2XLCA 1G41A 3IERA 3P0HA 1EFUA 3DFUA 4LMRA 2Q3CA 5ERGB 3L8YA 1G42A 1GQRA 1P1RA 5EI5A 1USGA 5KBYA 4IKEA 3SC2B 4HWRA 1SKQA 2XGSA 1QHSA 1UKVY 1VZ3A 4Y6RA 1SCUA 2JRCA 3E7WA 1SUEA 2W83A 3BXZA 3TLGB 2MYPA 3A6LA 3JS5A 3FBTA 5F64A 4BFWA 1U28A 2IZ6A 3BCRA 1LPMA 4QOJA 2BE7A 4RIHA 4CQNA 4J1QA 1T2EA 1X15A 2CLCX 2VJOA 3CH4B 1C0EA 3Q2IA 4UKDA 1ZGGA 2PBFA 1FVOA 1FJHA 1UMKA 2QSJA 1A04A 4MQMA 4KRFA 3JATB 3USZA 3N2EA 4U9IS 1AN0A 1W85B 2WZDA 2QW0X 4UD2A 2JBAB 2DECA 3TLBA 5JSZA 1EUCB 3HE3A 2Q1YA 4DLBA 4ENWA 4KX5A 1YRLA 2WWFA 2OXEA 3GRVA 5DASA 1GGHA 4CCSA 4HAIA 1VP9A 3LBAA 1ICEA 3V2HA 3WLNA 1W73A 2J30A 3S68A 4E1VA 2HIHA 3HN2A 3EIHA 4ISBA 2CNLA 4L8FA 5J5AA 4CN8A 2C9MA 2F1HA 3FHCB 3NTVA 4HMPA 2HEGA 1U0HC 2WIDA 2Q7XA 4XR9A 4UTXA 1DX6A 2C4HA 1E3WA 2W70A 3KB8A 3OZAA 1BVYF 2B3DA 1M2JA 1I4DD 1KEUA 1UDBA 1R27A 2HZ7A 3HY6A 5ENZA 3U40A 5I8PA 5JQGF 2ZLBA 4TKVB 5B1HA 1YL5A 3PNSA 3SC4A 1LI7A 4NPCA 1NBHA 4PTLA 5CPBA 3Q8WA 4FMPA 1E2NA 1QSGA 2ZUBA 4MPJA 4Y3UA 2IXAA 5TQ0A 3SXUB 3TIVA 4EJMA 3QX9A 5GIPE 2HBYA 3GFTA 3RJ5A 4WBNA 5K8IA 2PSSA 1BC5A 3UAXA 2WZCA 1E1DA 2XVXA 2QUHA 3AR2A 4FEEA 3ZWBA 3MT7A 5T6BA 4BQEA 2XY4A 1E5LA 3GY0A 1H4QA 4NABA 2P41A 4OREX 4M0UA 4Z0PA 3PNYA 4PZYA 1CT9A 1XZCA 2QX9A 4B5LA 2H0AA 5E9AA 2ZRGA 4X20A 1ZN9A 4RTQA 1WBDA 4UM9D 3VTAA 3WYNA 4P86A 4GXNA 5LQRA 5HKAA 1YR9A 1USKA 1E6WA 2V7VA 1ORRA 5ANRB 4ZN6A 2HRDA 3HLKA 1EVEA 2GD2A 3IQWA 1VFPA 5DLYA 4O4JB 3Q9LA 1OKKA 1HT2E 1ODIA 3LLSA 4MUNA 1DT5A 4J03A 3QSGA 1GYRA 3SYKA 2JLSA 2EBHX 5GMOA 1TFRA 4K7JA 2ACWA 3K9FC 2E2WA 4H1HA 5GONF 3RRXA 3F3SA 1LDGA 3HSSA 4KN9S 1TMKA 5D51S 4ZYWA 2L42A 1KO7A 2QF7A 3R2JA 2R25B 4TYNA 2YBEA 4X61A 1NMZA 1TEXA 1JLLB 2A3NA 4WPGA 5EIAA 3SE0A 1R2QA 1XRJA 2WYIA 2JFQA 1VCHA 2B9EA 4LZPA 3SMVA 2IS2A 1EFDN 1ZD2P 2LIVA 1AQLA 3QU7A 2OP1A 5FTMA 5SZHB 3T7SA 4B76A 4BBJA 4LYFA 1AA9A 1L0BA 4COKA 4L76A 5BVHB 2PV7A 3C7AA 1ZNWA 4G8BA 4LV5B 2WWHA 4HADA 4ZQFA 1K5HA 3P2MA 2X0FA 1R0XA 2JGDA 3ZBUA 4BX8A 5C5DA 2VJDA 4C76A 5C8ZA 3TZHA 1L4NA 3K09A 2Z1MA 2VQDA 3LUCA 4M9RA 1KF0A 2HC9A 3KUDA 5IC5A 1WMFA 4QYSA 5F9MA 3BB1A 1QZZA 1UCFA 3HJUA 1TD1A 2FRDA 1ZK1A 3EF0A 1RJFA 2C7PA 1X39A 5BYBA 3HO1A 1L7EA 3E82A 2ZIUB 1QFMA 1LF0A 3H75A 3EQ9A 3OP1A 1AQIA 1R8JA 1SQFA 2JI9A 5HUJA 1WM1A 2C1ZA 1WQ1R 2JIZD 3TEMA 3T3MB 2AE2A 3WV4A 4BNHA 2WLSA 5F3DA 1RWXA 4X5OA 5REQA 4BP8A 4ZIRB 3AY6A 3CNQS 5AH0A 1YFZA 5J3JA 5THXA 3FNRA 4B0PA 4LK3A 1QZXA 5TIIA 3DE7X 1Y8RA 1OZHA 1Z25A 1WB6A 2G70A 3QXXA 3NPAA 1MC1A 1U2TA 1G8MA 3OJ0A 4ENVA 2KQUA 1WB4A 3HKBA 4HDMB 3U7QA 2F67A 4D3ZA 1XVIA 2IA5A 3NKVA 4ME6A 4GFDA 3SGLA 3RASA 2YWXA 1XHLA 3N5KA 4KQIA 2QNIA 4P08A 4HJXA 3WKAA 1KRWA 3MOIA 4IQ8A 5CUQA 3NASA 4GUAA 3ZV7A 1TCUA 5F21A 1W2HA 2MJLA 1PKXA 2GPWA 3P97A 4I4LA 4JYCA 5IJXA 3S2UA 5DISB 4PRYA 5J4LA 2IPOA 3ASZA 2AN9A 2WPNA 4HMOA 3FTFA 1O97C 2FR8C 3ESRA 3P9SA 4RY9A 3LFUA 2QY6A 4AURA 5BN1A 1T24A 3QLVC 1XWIA 5JO0A 2VPZA 4M8LA 2V6IA 4UMEA 1RADA 4B6RA 3AK4A 4WZZA 5IAOA 5IK2A 2E4VA 3LQQA 5IUKC 4IILA 1H93A 2FQ1A 1SQ0A 1I5EA 2JAOA 1C7RA 3OQHA 4ZP1A 4JP8A 5FIUA 3VDQA 3AETA 3QWBA 4QUDA 4JIMA 4ARAA 1JJAA 4O2AA 1RTTA 1Z5OA 1WLSA 1A1VA 3NRBA 2IYOA 3MXTA 2VBFA 4N3GA 1W88A 1KFEB 2HJWA 5U4QA 4DUYB 4OHRA 1KS2A 3LPNA 2G5CA 5LMNB 4TTVA 4CKBA 1ZX1A 1OJ7A 1M34B 1PZFA 3H8VA 4JB2A 2I4MA 4UEJA 2OLEA 1NULA 1I32A 5E0KB 1R0ZA 1Y6GA 3AR6A 4C3ZA 2AD1A 3FOFC 2RHOA 1TX4B 2ORVA 3B9PA 2BFEB 2R6CA 1HMYA 2Y05A 4RY8A 1BZYA 4L50A 5LA6F 5E6SA 1C5KA 1KZ4A 5I3CA 3DYBA 3HSKA 4BNWA 1IG3A 1O94D 3BXPA 1X7YB 4TYQA 3R20A 3P2OA 3KJEA 5L9AA 2BKEA 4OXIA 1JNYA 4Y1RB 5AICA 1PCXA 4HK4A 3OPNA 4LNHA 5K2MA 4D9KA 2GEFA 3IP8A 4PCAA 5JWRA 3TKAA 1NMXA 2NWQA 5A4MS 2NO9A 1H3FA 4LBVA 5D3KA 3SEQA 4BTEA 5C3UA 1FFYA 3X1KA 1GUAA 2J32A 2W5UA 4V1CA 4UXHA 2PSDA 1F8FA 3DLPX 1VL0A 1H94A 2WHPB 4UQPA 2J87A 1YV9A 5K01A 3R6WA 2HWYA 2AF3C 3GFGA 3LHFA 5HE8A 4CLOB 1CV2A 1KQGA 1GGKA 2YY5A 1O9HA 1GZVA 2QP3A 5BUQA 1DKPA 2VRNA 2JFNA 4EUKA 3DEJA 1XI2A 1Y5NA 1NVVQ 3FGNA 4HQ6A 1UC9A 1W5BA 3GEMA 5CYOA 2DX7A 5EZYA 5FWXA 4IY1A 3QKUA 4ND3A 1ULSA 6AT1A 1T3SA 5M29A 1W36C 3UWPA 3GARA 2PMEA 1CJKC 4EA8A 2PCLA 3Q8MA 4XB6B 4AJ4A 1W44A 1IEVA 1OT5A 1BNCA 2OCIA 2OKGA 3FUTA 4IJUA 2HA5A 3BIWA 5BXYA 3F9IA 2E4YA 3C70A 2XUOA 1G6Q1 5JDCA 1LX6A 1NRJB 3VSDA 4DCMA 1C4KA 3CVWA 2V6MA 2Q3HA 3B36A 3ZI0A 1SVKA 4CVNA 3TKYA 2J48A 4RACA 3T9AA 3M4JA 2O2HA 2Z04A 5AJZA 3WWCA 1LPAB 3VVLA 2AJLI 4G5QA 5AJXA 3ZUGA 4X64B 1JHMA 3E70C 1NW6A 3M49A 4CUZA 2AXQA 3RFVA 3WDMA 2ZT8A 4LN1A 1OFTA 4PGGA 4L4YA 1K8QA 2IOFK 4EKGA 5KZMB 1PAUA 2HMWA 1P3Y1 4MVJH 2L69A 4XSVA 2QPTA 1JILA 4G81A 3WP1B 2HA7A 4QGSA 1NG9A 1WUYA 1CS0A 1UKAA 2ZVJA 4M53A 3VKVA 1Z5PA 3GPCA 2HADA 2QUAA 3ISJA 4NAHA 5EKSA 4HWGA 3D54D 3E03A 4JENA 3CG4A 2WK1A 2CMHA 3BH6A 3ESCA 5JZSA 1RP1A 1M6YA 3IQHX 1SK9A 1H2ZA 3DAHA 3DBOB 4F12A 5BSTA 3VC7A 4LEIA 4N0PA 4UBLA 4OBXA 5JJBA 1GTRA 1F2UB 2OD7A 3ASYA 3UBTA 3CH5A 1F2VA 2O1XA 2WMOB 2DPMA 1A4UA 1E2DA 4Q7LA 1HV8A 4FCCA 3S2YA 3L1VA 4KQJA 1G98A 4LWZA 3COPA 2YQ4A 4GMDA 3SICE 1JVNA 4CLEA 3PNOA 5ALKA 3S2IA 3VBEA 2P40A 1NUTA 4XXHA 5DW0A 4BX9A 3D8TA 3IKTA 4OX9Y 2O59A 1FYDA 2O7SA 4Q1AA 3ND6A 4AJIA 4A3SA 2BDTA 4Y2RA 1HLGA 4G8DA 1L7QA 3QLJA 1WF6A 4CMHA 1S02A 3W8RA 1GLGA 4H08A 1V3UA 4D7AA 4JAVC 3U7EB 4MRRA 3I3SR 4XPZA 1XZPA 1NN5A 4B71A 1FUIA 1HE4A 1OZ0A 4YRLA 1RACA 9ATCA 2VBGA 3AX6A 4QOHA 3U4QB 1KZ7B 1SKYB 4OA8A 4H77A 3HYSA 3TLZA 3P9CA 1WZIA 2FEWB 2VDUE 1FS5A 1KORA 2PMBA 1G0NA 3BXHA 3L6UA 3RIHA 3WLHA 4OHPA 3MUNA 1NF9A 2W90A 2Y71A 2QN7A 2BUBA 4WXEA 3VPXA 2GBLA 3G9UA 4AJ1A 2W98A 4C6HA 3HA2A 5BY2A 5TJHA 2AKEA 1NOJA 1BGWA 3OIYA 1RR6A 4DDKA 3GP5A 4RXMA 1W30A 2X8JB 4Y2SA 4DDMA 1B1CA 2HCRA 4RQAA 2DT5A 4K3UA 5D8DA 1QE5A 4F4HA 5ELXA 2AG6A 2VWHA 3IXLA 5G1PA 1M8KA 1NRXA 2D00A 5CGQB 3U44B 1KYWA 2I80A 2Q41A 1WXWA 5JNUA 4M22A 3IO3A 3WJAA 1BD3A 2L17A 2IEYA 3PI7A 4Q12A 1OILA 1Z5UA 2ORWA 4A8JC 4E5SA 3COZA 1NLFA 3C48A 1DVRA 4RFLA 3I9KA 4B85A 1VYTA 4G23A 5J59A 1EX9A 1HE3A 1HLFA 2DMRA 2GM3A 4WX2B 3QE9Y 3TL6A 2X1HA 5C7LO 3AF2A 2EDCA 4MCJA 1SD2A 1BWRA 3DO6A 2E5WA 2MMGA 4HFMA 2RGAA 4MMYB 4OFZA 1X13A 4QUAA 3FTCA 5IVHA 3TVTA 2R8PA 5K0LA 2PGOA 4H3HB 1PNQA 3Q0IA 4UHHA 4MQ5A 3L05A 4U7PB 3KB2A 4MKRA 3G9QA 1Q1GA 3AFIA 3H84A 4PF1A 4DLNA 4RSMA 4V2UA 5KWEA 4PCVA 5BT8A 1C1YA 1LJUA 2IWRA 1WCWA 4DLWA 3LC2O 4OBWA 4WECA 1Z06A 1V8PA 3A27A 1N0IA 4PGMA 1TYCA 1QX4A 2IOFA 5ER6A 3UJ3X 3ZNNA 4JJFA 3AKYA 1RD4A 3PB3A 4JYZA 3O1HB 5IHXA 1AH2A 1AUVA 2AK2A 3CBGA 4EUHA 5K8TA 2R6FA 2NNLD 4PAGA 1PJAA 4L15A 3FNEA 1U9IC 3TM4A 1JHVA 2BL4A 4PHCA 3RYIB 4L28A 3LUAA 4CDGA 5EHNA 3OCVA 4HWTA 4MO9A 4P4LA 5B1YA 1ADJA 2EW2A 2R8XA 1T9ZA 5CA1A 4MI3A 3MBKA 5F76A 2I67A 5G4LA 4CCYA 1M2FA 5LMCA 1UOQA 2JAHA 4H17A 2C0QA 1SXIA 5E6UB 3AKCA 2ZR8A 2XD9A 4QXOA 3RVOA 5JI3E 4FE7A 2EHDA 4KGVA 2N42A 1FTYA 4GBGA 2C5FA 3GJ4A 2CNKA 3GBSA 3T7EA 4J49A 2OGUA 3C6ZA 2Q3BA 4R4JA 5IC4A 3L02A 4KDFA 4DR4B 2AZDA 3HBAA 4ITRC 4XX1A 2NYUA 3CEAA 1HYBA 2F17A 3MOGA 3TQIA 1JU3A 4PYNA 3RSZA 2OGZA 2ATVA 4D81A 1ZUNA 5HOQA 4FGUA 2D4AA 1G3UA 1LSUA 2P4UA 1S1MA 3N6VA 2P2CA 5ALWA 4N0EA 2X40A 3KT8A 1HORA 4TXHA 3HNPA 3U3JA 5K0JA 2XMQA 3I8SA 1OLXA 4HDAA 5IAGA 1DHRA 1NQVA 3UGQA 1ORVA 2EYQA 2V4UA 1J8QA 4GOXA 4LHYA 2FSSA 421PA 3HM9A 1K6IA 4JLOA 3S70A 4ZCIA 5LQJA 4QXAA 5CB4F 2HYDA 2PMKA 1FVFA 1K88A 2AFHE 2YZKA 3L0YA 4D79A 1Q21A 1FTWA 2E9SA 1KJNA 4N3AA 1NW8A 2GA9A 2O14A 1QVWA 3LK7A 3ZHSA 3PCXA 1M1UA 3H04A 4FBMA 2C7BA 3HV0A 4R6WA 4C2AA 1OXMA 4JXKA 2DBQA 3SIPA 5AXBA 3IR5A 4RVFA 2HSZA 1G9SA 5EPOA 3D8NA 2QRVB 1X14A 4Z4HA 1EE2A 1OA1A 4PC2A 3VYSB 1FNDA 1K0UA 2GD6A 2FP3A 1WQ4A 1W4AA 4RELA 2O19A 4AKGA 1PL7A 2IYVA 1N0UA 4RE5A 3IV6A 2EL7A 4JZYA 1MAVA 1RHRA 4K9KA 1OLUA 2QPAA 5A9RA 2JZNA 1XF9A 4AMVA 1YVEI 4LKOA 1SU4A 1ORTA 2FWPA 3JD4A 3QEKA 1NR7A 1OTHA 3NVAA 4G5YA 4OHFA 5JWOA 4YLGA 2X0IA 4C0BA 4UDXX 5DTIA 1ZUWA 2QJRA 4I66A 5FUBA 2ZJ3A 4BQPA 2J7PD 4Z54A 3V1NA 1TRKA 2NU9A 3DCNA 4G3XA 2A88A 2DUJA 3MA0A 5HHTA 3KNZA 2QN1A 2L2QA 1KO5A 1E5DA 1S9HA 3HLYA 2YWRA 3G6KA 3MGBA 4TV8B 3SR3A 1J39A 1DU4A 4YMWA 3U7HB 4I1VA 3MLAA 1E66A 3JX9A 4KSBA 3OEEA 4IGEA 4AULA 1EMDA 4XQ9A 1FUEA 4OQMA 1C3LA 1AZWA 4HH3C 3I0ZA 5HQ3A 2P5YA 3CF0A 1I8TA 4M1KA 5JFGA 3GGCA 3WGVA 4BPBA 4FK8A 4PLCA 1V96A 1O3YA 2IEDA 2D5AA 2GCIA 2JK0A 1J8YF 2MINA 1IZ0A 2FN4A 3M5DA 5F12A 3GYGA 1KQOA 4GRIA 3L5OA 1EEHA 2AT1A 2BFBB 2CC2A 2QD5A 4R3UC 4ZRDA 1VB5A 4I0WB 4NH4A 3PFIA 4P33A 5FOSA 4B8YA 1SJ9A 1BVRA 4IOMA 3DEKA 1XKLA 1WTCA 2OCKA 4IQ4A 3TNFA 3WLOA 3PHIA 2HU8A 1NVVR 5DBOA 2PO7A 5CYPA 1QIFA 1U7UA 3VOTA 1JDSA 4YRPA 1K4KA 3HCBA 3JQ8B 4QAJA 2WA2A 1SNYA 5DP1A 2CDCA 3DF9A 1LJ8A 3KP1A 1DP4A 4NH0A 3CWQA 5PGMA 2OFWA 4YR9A 4BTVA 1II8A 4RTJA 1Q0HA 2JCBA 4BY9E 1KNXA 4XX0A 1VMDA 3CSUA 2VDPB 5I7HA 2BFDA 4YJ2A 3D3JA 1ZJ5A 2G8LA 2QG6A 3QXHA 3GK3A 4UDNA 1FDWA 1NJ6A 2EXXA 3NHZA 4QOSA 4LC0A 3EC1A 3V1TC 5B4VA 5K0CA 3LQ2A 3OZEA 4LFBB 3IMKA 1OSNA 1E92A 2BEWB 1O95A 2F3UA 3C0KA 4DREA 4C2BA 5IFKA 3B2EA 1X9HA 4Q4AB 2WSYB 4EKEA 2XCTB 1I6MA 1QH1B 3Q7QA 1Q14A 4BL5A 2TECE 3P27A 4D0SA 5JAIA 4WA7A 2R65A 1CY1A 1BE6A 4UBMA 1A76A 3MJEA 3S0JA 4U0KA 3HXLA 3MINB 3CVUA 5HRUA 1VP3A 2Y9MB 1I6LA 5GVRA 1XZQA 4ARZA 5HTOA 3F1KA 5KQRA 3VPCA 2FA9A 2H16A 4B9EA 4P5DA 1X7WB 4CBVA 5A6SA 1NPDA 2LPMA 1ZSNA 3HB7A 3BCUA 3FF1A 3GZNB 2QJOA 1ZD1A 1QPGA 1TCBA 2BJVA 4DBZA 4JB8A 4JC0A 5JZOA 2LKCA 2B1GA 3UMMA 2PWAA 3ELYA 4YP7A 3Q5GA 3HWSA 3LX6A 4NZYA 2W6CX 3Q15C 1I2DA 1QNFA 4YJGB 1R66A 1M8GA 3ZHQA 4LJAA 2ZJAA 1B6SA 3I9V6 3WL6A 1KWKA 1ADYA 5AKIA 5ALGA 1X1TA 1RZVA 3BFXA 1LLFA 3QV1A 3KR0A 2OO5C 1CQJB 3F5QA 1B76A 5A9TA 8OHMA 3AI7A 3E22B 4GOKA 3CT4A 3KQMA 4UHFA 1IK4A 3K1JA 1RKUA 3ELUA 3I9NA 5IVIA 4BVLA 5G40A 1JSLA 2BY4A 1NG1A 2ZQZA 4QM7A 1OTXA 5A5GA 2BAGA 4HG2A 3CISA 1DGQA 3RARA 2RHDA 3DVQX 4U9HS 4IEIA 5FTNA 2ZRDA 5ALIA 4OQNA 3OTOB 8LDHA 5IUJC 2QIOA 2I2AA 2ASVA 1SD5A 3HYCA 3NHKA 5LBTA 4YCBA 1M33A 1QTQA 5E1OA 1RKVA 1SXPA 3V1UA 3ZW9A 3SKXA 4TL6A 3UK6A 3TQTA 5KNCA 3BKWA 1Z34A 2HDNB 2XRFA 3HL0A 4IFBA 4YRAA 3KETA 1GFZA 3N3BC 3GDHA 4TMFA 4UD6A 4ETIA 1WU8A 4IRMA 4DV4B 3K8QA 4M1SA 3H2HA 3LT4A 2PVPA 4PHGA 2RBKA 3HDGA 5B1EA 4CR7A 2BZ0A 3T5PA 3FVWA 2XMBA 5BNWA 1VL8A 2UUAB 5ALXA 2W6ZA 3MCTA 2O7VA 1RWVA 2EJUA 4ZI2A 3UMGA 5EMMA 4GPBA 1K2WA 2ZT7A 4G4IA 2BTQB 3E4DA 2ID8A 4MR9B 5DNDA 3WL4A 4R8LA 5CX1B 3TQFA 1B8PA 3VKFA 2JCGA 4F6RA 3DGEC 4M7RA 1UXJA 5F2OA 5H9WA 3DL7A 2IKSA 4GG1A 3MT8A 4AJEA 2WV7A 1XZMA 1XEAA 3MWDB 1SQSA 4I4TB 4NTZA 4PAWA 4PYMA 3NM5A 4RKEA 2PR2A 1QVAA 3VO1A 4LF6B 1ZWLA 5E3HA 1LPOA 4BJ1A 2QT9A 3OJCA 4GSLA 2G8NA 3C97A 3I4CA 4NZNA 4RK5A 4AN4A 3K0SA 4BXOA 3PD7A 5G3YA 5F5XA 1G8KA 1TCAA 2GARA 3C1UA 4JI3B 4KE7A 1Q0RA 3UGJA 1Z82A 3WE7A 2FW9A 1M10A 3ML1A 5T4HA 1VCIA 2V3CC 3IEVA 4BGIA 4F11A 2FWNA 4QE3A 1HKHA 2MDTA 4FFSA 1M2VA 2X0DA 2NVUA 4HXEB 1YJQA 1SBNE 2OPHA 4A2WA 4OK6A 2H5JA 1U9CA 2H8KA 4L0MA 2AIRA 1ZINA 1KJZA 3PUVA 1MIHA 1XHEA 1W581 2PGXA 3GMSA 3LTEA 3MB8A 1JIIA 2Q28A 2YWDA 3LHDA 4X93A 3IILA 3KAKA 1U2ZA 3IBGA 1TVEA 4HX5A 5ED0A 2BONA 2EFCB 2F00A 2I3AA 2OHGA 3ESDA 4CTKA 2JFUA 1QX3A 1WCXA 3CPHA 3UK7A 1OVGA 1TQ4A 1YO6A 3BZBA 3R6LA 1GPKA 4I1SA 1CUGA 1FYEA 2OA0A 2VP9A 3KXIA 2HTFA 1Z0KA 3AUTA 3TRJA 4DT1B 1GQYA 2DWOA 1U7DA 3KVNA 5KC8A 1E3TA 4DA8A 4EEKA 4R81A 4DQ0A 2AG5A 2P90A 2EKDA 3N2KB 3UH1A 2HY7A 4X1YB 1MOQA 2IZ5A 1B8NA 3GCXA 5ETJA 3KXPA 1AO3A 4DLAA 5E7MA 3ETJA 4CT4B 2SKCA 3B6MA 3HU1A 4NJMA 4C7MA 1N1DA 4N7MA 3CEHA 3E9NA 1EFKA 1COWD 4GO1A 3VTKA 3RU3A 1QFXA 5CD1A 1LSJA 1ZMRA 2VYVD 3U5TA 3Q4GA 1GZUA 5DZSA 3ELBA 1AGYA 4D4HA 1P33A 3FTQA 1HLDA 3K9QO 4CMKA 1FPQA 2FKNA 1E2IA 1ONSA 2X0EA 5IBPA 2HJ9A 3PX7A 5TQJA 3R7FA 1VSVA 2X5NA 3A28A 3PLAE 4G5HA 3T38A 5BNTA 4RV5A 2DUWA 2FZKA 3C6KA 4QTZA 3IP1A 4YO8A 2KYRA 1I3MA 3OSZA 2BBWA 2YCLA 3W7AA 2PD6A 3C5HA 1JR6A 1KOGA 2WIJA 2ZR7A 1EXVA 3CMCO 3JPWA 3ZS8A 4QLAA 3BHMA 4TTJA 1EHIA 1BGXT 1YVUA 1H9BA 1XN4A 3TLGA 3OO0A 1DPGA 1JVBA 4I50B 1XTUA 3EDOA 3L7JA 4L95C 4MUAA 1ESMA 4YAFA 2C99A 1KHHA 3W5HA 2WF9A 3C3AA 3PUJA 3BGSA 4XFJA 1C1XA 1EQUA 1NJ5A 1YZUA 2PH3A 1VLZA 4LRXA 5DN9A 3SHVA 4LBZA 5ICCA 5IPFA 1JFLA 4JIGA 1GEGA 1SO8A 2WMYA 4YAKA 1IMOA 1EFPA 4ZO4A 1EX1A 1JZSA 2AEJA 1N6IA 2ZCUA 3JARA 5TEVA 3GZTB 3B20A 3LA6A 1RQPA 3HR7A 1N5MA 5BV2P 3W5CA 4AY3A 1G5PA 4Q39A 4CV1A 4NRDA 2F43B 5JJCA 3H2YA 3WTCA 3ZOZA 4IXNA 3THRA 1R50A 1EUCA 4Z9BA 4FR5A 2G28A 4W7HA 3GNQA 1QGDA 3RUIA 1OU0A 3TIXB 1Q7RA 2B4RO 5LZ8A 3WHLA 4CWAA 2AJBA 2J5RA 3GP3A 1C2YA 2GSWA 2OCBA 2P7IA 1YVRA 5KMGB 1U0FA 3TINA 3T1TA 3U16A 4GIBA 1KMNA 2Q50A 4HXYA 2ZRNA 3CLRD 2AX4A 3H3FA 5C0OE 1A98A 3NIFB 3L8EA 1KZHA 4C04A 2AUTA 2IXGA 4CXMA 1HGXA 4C9BA 5LMUB 4YGXB 4NF2A 1P6QA 2JB9A 2AOTB 2HR1A 4WKOA 3IMCA 2WDZA 1GSHA 4PYQA 1A9ZA 1DAFA 3ZI4A 4E2WA 5JS8A 3GD5A 4KDRA 1CR4A 1TM3E 3OO1A 3GLIB 2F4VB 2OC4A 3EXHB 5C53B 1NJFA 2Z43A 3S8EA 2MMCA 4CI9A 2B3TA 1NQOA 4H16A 2BELA 4M98A 3BL8A 5HA5A 3H2IA 4G9EA 5HKBA 3IKJA 5D00A 4J0CA 3IQDB 1QMGA 3L0BA 3KFLA 1SGWA 2QTRA 3CW8X 1XNHA 1UJ2A 3V46A 3TOSA 2VQEB 1X19A 2J41A 2GCGA 2VHJA 4G1UC 4YS6A 2ZDGA 2UZ0A 4XRGA 2JCSA 3T6KA 4B48A 3B9RA 1S89A 2XIJA 3H9CA 5CEJA 3ZV6A 4DCPA 4GM4A 2XWQA 4G5RA 4RMIA 3Q85A 3UFXA 3C41J 1HE2A 2A0UA 1ILWA 2HV9A 4G8JA 4PNPA 4TMWA 5H9VA 3TUJC 3ZLJA 1RYZA 3UMJA 3ESYA 3NNSA 3QYPA 1DQNA 5DLPA 4C1BA 2AG8A 2FPLA 2VSNA 4UBJA 5SY9A 3B6EA 3JTMA 3RS8A 3TRFA 1Z39A 1S2NA 3ZKWA 4WCFB 2ODAA 3G88A 2N75A 4W8HA 4DUPA 3M4YA 2P3QA 2Y0PA 2QLMA 3H05A 4XLTA 2XQFA 4IV8A 3C3WA 1RAAA 1XD2A 4LOIA 3N05A 1VIAA 1JQAA 3A70A 3H13A 3T3HA 4HQLA 3QLTA 1OWOA 4QFDA 1YMQA 1G59A 5LXTA 1E1MA 4YRIA 5BVHA 3BGIA 1E6LA 2PNFA 5J2TB 3KL4A 2V3VA 3AHIA 4YASA 5SYNA 3U81A 3I9FA 5DI3A 4P7KA 4HYTA 4DLRA 4OL9A 2V3WA 3EQ2A 4CR6A 3QVOA 3OOHA 3RS3A 4MW1A 4UDOA 3DZBA 3WRWA 1F48A 5BNZA 4HLUC 4D57A 4WTOA 4B09A 3EUWA 3IBCA 4BB0A 1LUAA 3HA7A 4EUSA 5M5BA 4EJSB 1TTQB 2WHYA 1P39A 1NI5A 4B6GA 2NUTA 1N2XA 2V96A 1GL6A 3UK0A 5TVGA 4JT8A 1ECGA 3MUEA 3LA8A 1OH5A 3LRXA 4OQFA 3A6KA 3HVHA 3KE8A 4LJ5A 4RZXA 5SICE 2DH6A 4EY8A 1ZHOA 3BBPA 1W9MA 1NASA 2WSSD 3HLTA 4KB5A 2ZWMA 4M36A 4C0KA 5ALVA 2Q2OA 3HB0A 2X3YA 1Y7PA 2YZNA 3DTNA 4I6EA 2B2CA 3CA8A 3B60A 4FPXA 4HDQB 4RVSA 1Y34E 2HHJA 3WICA 1WVIA 1FEZA 1RAFA 2G1PA 1W4RA 1RIIA 4HDMA 2RHRA 2X7JA 4JBNA 4LQLA 4DCNA 2J85A 2G1JA 3U3KA 3LQRA 4C0SA 4O4IF 3OZRA 4FGZA 4GMGA 3DKIA 2GMWA 2VTBB 2ADFA 3CH7A 4PCLA 4BLSA 1T4BA 2P68A 3F3MA 4QPJC 5EWMB 2JL1A 1T9AA 2J0UA 1CETA 3KLOA 4JFAA 2ZUVA 3OQNA 3KOZA 1RTKA 3ONEA 5IH7A 2PCJA 1GCIA 1P2SA 1WDTA 4G0PA 3TR0A 1YZVA 1FDVA 1Q3TA 1VL1A 3H1EA 1OXXK 2QLTA 4URZR 1FTSA 4OMDA 3HWRA 1PR5A 2HNBA 1GPDG 1Z8NA 4MGHA 4Z7JA 3C5CA 3DPIA 3IULA 3PFWO 1HT3A 2FFJA 3QA9A 2Q5HA 3WYDA 2QNBA 2QD3A 4KDCA 2CFRA 2PEZA 3ZQJA 3SQOA 2YDXA 4D9FA 1FU4A 2D74A 5EKUA 1MU0A 3T1QA 3MUOA 5DULA 3GH3A 3AH8A 4X65B 1WDMA 5TGTA 1H6CA 7ABPA 4CEJB 2CJPA 4KNWA 2QL9A 4CM5A 2IKQA 3BGOS 4RD0A 5C8DA 2WD8A 2AYZA 2PBLA 1JN0A 3M9WA 1OY1A 3C3DA 3WIEA 5GV8A 4GAEA 1V16A 1EK5A 1X9GA 2WJPA 4WWHA 2HJSA 1NDUA 5AJUA 4KX3A 5LZ7A 4XD7D 1R64A 4Y1RA 2NU6B 4J29A 4L16A 1ZK3A 3OX1A 5EAIA 1ZY2A 4AWBA 1Z8HA 2Q0HA 3CF6R 1TUEA 4W8OA 4NCBA 2JJ1A 3FWHA 1NU6A 1ODKA 3WZMA 1ISMA 3UAVA 1Z0ZA 1SD1A 4BCDA 2LR0A 1IXYA 5F9FA 4LNAA 3L7MA 5EQTA 2YJ6A 1YDFA 2WHPA 2GAOA 3A1EA 1X70A 4DLTA 3HFSA 1SM4A 4W9MC 4X3CA 1XCMA 1M7HA 2PGAA 1TF7A 3DMRA 4MVJD 4CLOA 3ICPA 1T10A 2WF6A 5JNTA 4CLHA 1EP2B 2X13A 3NNNA 4WBXC 2K2QB 3HZHA 1USUA 2LUOA 2ZRLA 4IIVA 1YB2A 2GPAA 2VFAA 3TSWA 1MP0A 2E4ZA 3PWZA 4Y98A 1V8OA 3PJDA 5I9BA 5FWYA 1Z9BA 2X8BA 4AO8A 4F7DA 4U6SA 5CIQA 3RJ9A 1JZQA 5FBHA 3QJGA 1U9IA 5A0VA 3IC5A 5DF1A 1KOJA 2WVAA 2P6MA 2P9GA 2G1KA 3KLNA 3KUCA 4X60A 1KI7A 1ES9A 1E69A 2BGLA 1ENPA 1QJCA 3TSCA 3ZWOA 3GWGA 1JFSA 1TTTA 1N2HA 2VPYA 3LOQA 4HLNA 4BRWA 5KYWA 4OI0A 1NVFA 1MQ8B 3CG0A 3KOXA 1DKRA 1JQ3A 1TZBA 4E46A 3NJ4A 1TCVA 5ILOA 1KVUA 3C3JA 5E2IA 1A5BB 5LZ5A 2ZYGA 4BQRA 2QN2A 1KMCA 4L0QA 5JMOA 5CJPA 3H8JA 3CRQA 4MA4A 3V1MA 3G8BA 3ER9A 1BDIA 3NG1A 4NE2A 2VSQA 1YJBA 1K97A 2C3YA 3INRA 2JJQA 4ROTA 5EXXA 2HWXA 1SVMA 4DB2A 2BFCB 3EQ7A 3UG7A 4B6PA 3KV1A 3LRPA 4QU9A 1XLVA 1G66A 2IDKA 2ZKIA 4FP9A 3RIGA 1XZHA 4PONA 4IXMA 3WMEA 3EX7C 2V7QD 4FD2A 2NO6A 5EGSA 5EMKA 2V9ZA 4C0JA 1Y8ZA 4DMLA 1OGJA 1F2UA 1OF1A 4DDTA 1I24A 4XI9A 5KNBH 4AW9A 4J0QA 4LPSA 2IH2A 1U2GC 5EERA 3X1YA 1A0OA 2QW8A 2H1SA 3AB7A 3HVUA 1G5IA 1YBMA 4TSFA 3D5TA 2IVFA 3SZ3A 3ZTWA 4CMCA 4DN6A 1BDHA 2FPRA 1H8ED 4TZKA 4ZT5A 4J3NA 5L6MB 3JQDA 1HETA 1U5AA 4NMWA 4BV3A 1AQYA 5LU9A 1HYGA 4MV3A 5D3QA 3WQSB 1MT3A 2PU5A 1P7YA 2OZLA 3CVYA 2AYXA 2I7XA 5FUYA 1M1YB 3O4VA 4PG5A 3RS9A 5DKFA 4ALLA 4F86A 1OWNA 3SF8A 2P62A 5ERXA 1SZJG 4KQCA 2TMGA 5H5JA 4XGNA 2AQHA 1TD9A 3CKKA 4D97A 1SA0A 2H0QA 1G21A 3IQZA 1ITZA 3BJEA 4US1R 5A1TA 1MB4A 3CF4G 3A26A 3KEMA 1SUSA 2OUKA 2Z6UA 1PFUA 2W6NA 4MB0A 5JATA 5ALZA 4YRGA 4KZPA 3IUSA 1NF2A 1ZI8A 4IAOA 3G23A 1XDBA 3U26A 3GZJA 3FZEA 4MQEB 2C59A 5EYPB 4C29A 2NZ2A 3ZZUA 3ENZA 1GSAA 4TM7A 1LBQA 3WIDA 4RZIA 3U3OA 3CKMA 3QU9A 3LTNC 4EITA 1YF3A 2R6JA 2NSYA 4ZAFA 1R0KA 3EBLA 3PRHA 1D07A 1TM7E 1G16A 1R10A 2AFHB 2C77A 3LDAA 4FGWA 3HJRA 4XWGA 4XWAA 4KJZA 3EXFA 1THGA 4GZLA 5ELLA 3VU9B 4EKDA 2AMFA 3U44A 1N75A 1ULZA 1NNI1 2A9VA 4P80A 4MRVA 1XLTA 2V6GA 4F3CA 3CVJA 3ER6A 3IAFA 3RIEA 5CB4A 3H7IA 2CHFA 4YWHA 3DHWC 1F5NA 3GEIA 2PS1A 2WVJA 5D3MA 1JX6A 4NYMQ 3GLGE 1IPFA 5D6NA 2FEXA 5JCJA 4B6FA 2XMDA 1SY7A 3PLRA 3TR5A 2G5GX 2ZT6A 4MKXA 4EF4A 1A5ZA 1L8XA 1MHPA 5K3SA 1PX0A 3KM0A 1JQJC 1X1RA 4B8WA 1CB0A 3HKDB 4L3OA 1D0IA 3VVMA 1NDQA 1OGIA 3B3QA 4RIFA 1YMUA 3RK4A 4U2EA 3M5PA 1NMEA 4AJ2A 1MLDA 1BD4A 2R68A 3Q7PA 3CZ5A 4LJRA 5A4AA 2Q49A 1TQDA 4RHYA 2P3LA 1EP9A 3KQNA 3L7IA 4RADA 4F1JA 3G02A 5KPJA 2FXVA 1ID1A 3AYXB 4HSGA 1H2AS 2CJYA 2OXFA 1RC0A 2O3JA 2R1VA 5C81A 3LOUA 2BJHA 2VQSA 4YRJA 2QTTA 3VISA 4QXQA 1G2QA 4ZXFA 3OKAA 5C80A 1ODFA 3OPVA 3AL0C 2O5EA 1YL7A 3HHEA 4YJHB 1VBMA 2ZVPX 3VNRA 4NBVA 1OBCA 5DE3A 3TTYA 2I2DA 2KS6A 5E6UA 1OWMA 4ZRMA 3CUKA 4OUDA 3W7VA 2A5JA 2WU1A 1ZMXA 5C8YF 2BSAA 2WJHA 4NZ9A 4GPIB 4Y9TA 3EUEA 1NYRA 2QSYA 1H23A 1D4ZA 3NFRA 4NC9A 4DA6A 2O2XA 4RS4A 2IF0A 3BEDA 3S5JA 4DBLE 1X38A 2FZWA 4IBOA 2C9OA 1FFHA 1ZQ9A 2SBTA 3L9WA 4TL7A 2YWEA 1Z28A 1IM2A 2E85A 5FUQA 3L77A 2YIMA 4BFVA 4GYWA 1RNLA 2PYDA 2V65A 2V7BA 1SC6A 2OBFA 4Z51A 3JQEA 5CBPB 3SEZA 3LS2A 3CLTD 1X1QA 4M88A 2IX9A 3Q41A 1VKHA 4LXYA 5BWBA 3PK0A 4MLDA 3IP5A 5CDHA 1EDOA 5JISA 1SZDA 4GKVA 2W48A 2V7PA 9GPBA 3QVVA 1TPZA 2G9QA 2QPLA 4O2BB 5FPHA 5BQ3A 3L8CA 1FLNA 1PS8A 4WERA 4N40A 5T5QA 3Q6IA 4WK0B 1FDIA 1QCYA 1RM4A 4R84A 1B41A 4PANA 3KAQA 3MTAA 2Q07A 3RM3A 1KK3A 1EFRD 3TFQA 3A25A 2FX2A 1TJNA 3KKLA 3HFGA 4PLTA 4WBSA 1SBZA 2DFPA 2BGKA 1QK5A 1ZESA 4GPEA 4PQFA 1RJEA 3ZZMA 3WGJA 2CXTA 4DA9A 4HDRA 3IT3A 1JMKC 3AG6A 5K4GA 1VJ1A 3AM5A 4IJQA 2UDPA 2AOUB 2HHLA 4CNBA 1WU7A 4I1IA 1YHNA 1HFWA 2CJFA 1CULC 1WVMA 3K53A 4N0DA 4MYRA 2POCA 1ZCZA 3E0XA 5J4HA 2P79A 2H1OA 4AO6A 2P5UA 1Y8AA 1G8SA 4ZV4A 1L3BA 3O4HA 1ZEJA 3NHRA 4RGQA 1ODCA 1AF4A 3RRFA 1JSXA 1QBGA 2VHVA 3SM3A 1EVYA 1JBQA 1ZGCA 2A58A 4MXDA 1LDNA 5D85A 4ZT3A 2FKAA 4KIFA 5LP6F 3H5LA 3CUSA 3RT9A 1GPAA 1P2TA 2GKOA 2YJ3A 3L0IB 3F5FA 1K08A 1EGVB 1CIPA 2BCJQ 3FZGA 4N39A 4P22A 4M0LA 2H1WA 4RHTA 3VR2A 5LQNA 4RXUA 1P7VA 1ZWKA 2VCHA 4IZ6A 4PLFA 1S8OA 3EBOA 1T8RA 4QHTA 5H4GA 3JQRA 4KV7A 5BWCA 3RS2A 1PR2A 5F98A 2FEMA 5ULLA 1UBGA 5K03A 1KK0A 4PSAA 2H4HA 3CRNA 2ZJ5A 3KWJA 4BDTA 3OQJA 1PR0A 2A5YB 2CHGA 2C3OA 1K8YB 2Q4EA 1B26A 1DAOA 3WKBA 1IRXA 2VEOA 1ODTC 1Y6QA 4BRSA 1DARA 2YFKA 3NC0C 2XEXA 4LAFA 4IMIB 4A16A 2XAAA 3B3JA 4EPWA 3ZJVA 1NW7A 2IYSA 2BW0A 1JHRA 2VKTA 4II7A 2ONZA 4EJFA 3GRYA 1I4EB 3LO8A 1O5TA 4Q3BA 4F8EA 1N36B 2VPIA 2YVAA 1VI5A 2MSWA 1DG9A 3FWNA 4H0FA 3TI9A 1QHIA 3G2QA 4PN7A 4CCAA 1W8IA 1Y9DA 3IH5A 3K35A 1SCBA 3VM6A 3AWIA 2W4QA 1UDCA 2ASEA 3BD7A 4QNMA 4RGVA 2PGNA 4LHWA 1EK6A 4XEHA 3A6HA 3NTRA 1RBZA 4LV6A 3FIJA 1DIHA 3FPSA 5F1YA 5JQGB 3PDJA 5LP6C 3ITKA 3NM6B 3OU2A 4OCZA 1P4HA 2OYCA 4J0KA 5CA0F 1FE8A 4Q4LA 1SBTA 1QRUA 3HVRA 4EYQA 2Y6VA 3R3HA 2BT4A 3LVRE 1DAGA 2H1IA 3UCEA 3DMDA 2UVPA 4PAQA 5IX8A 5JLAA 3U4MA 1T5BA 1P4RA 1YQEA 3EMBA 4QXPA 1E1YA 5FUWA 3W5IA 4EW1A 4JJ4A 2YASA 1ZJJA 3GQBB 5E9QA 2O8DA 2GLTA 3QMMA 4MR7B 5AW9A 3C39A 5IJ0B 5MF6A 4B7XA 3MINA 3OLVA 3QHAA 4FX5A 1WB9A 2BDUA 4R1MA 3W34A 2ZTLA 4YUAA 4DWVA 3KLMX 4AZTA 1UBEA 4ZDIA 4ID9A 1QIGA 1N34B 1EB9A 3ETCA 1IIBA 2FW7A 3T12A 2C2WA 2HJRA 5EIFA 1CBUA 1X7WA 3RRJA 5KS2A 4F7WA 3QBDA 5JBNA 3GZNA 1ID8A 5BW5A 2N46A 5BPFA 2FZ4A 3F5MA 3QLEA 2DAPA 3SHFA 1Y42X 4CLXA 3BL5A 5C4IA 1SPXA 1TA9A 2EJVA 3WL7A 3E84A