1ZDMA

Crystal structure of activated chey bound to xe
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
128
structure length
127
Chain Sequence
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinguishing multiple chemotaxis Y protein conformations with laser-polarized 129Xe NMR.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
molecule keywords Chemotaxis protein cheY
total genus 42
structure length 127
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zdmA00
3I09A 3EAFA 3O1JC 4KQ9A 3OQOA 4MLCA 3H5VA 3GBVA 1DJMA 1AB5A 1GCGA 3ILHA 2JCGA 3F6PA 3LUDA 4F12A 1QQAA 4CBVA 5T7BA 3RQIA 4WXEA 9ABPA 2GX6A 2L19A 3NHZA 5B3JC 4JP1A 3O75A 1MVOA 4G0MA 3HDVA 3T8YA 3TO5A 4MQEB 1Z25A 2H0AA 2FMIA 2HQBA 3GA5A 1QP7A 4RY8A 3IPCA 1SXHA 1A0OA 3CU5A 3K9CA 1JF8A 3OLZA 4Z4CA 3C3WA 3OO0A 1K66A 4RKQA 4F06A 3HJFA 2A9PA 4Z9BA 5JS2A 1YK1A 4PEVA 4QYMA 3HDGA 4YWHA 4N76A 2NUBA 3C97A 3CG4A 4KQCA 4RV5A 3CHYA 2PUDA 3FGZA 1IIBA 2KYRA 3JPYA 5EWJB 1QMPA 4G0YA 1Z12A 2QVCA 4ETIA 3TX6A 3H1GA 1BDHA 2IPLA 3CKMA 4OTZA 3F7NA 4RK0A 3L49A 4EYQA 1DCMA 3T6KA 1USGA 5FWXA 4UHKA 2V0NA 3N0XA 5BRAA 3QLVC 4MRMA 1U2PA 2L18A 1LJLA 1ZH4A 1QPZA 4IILA 3S99A 3GBPA 4OBBA 4TLLB 2PE5A 2PUBA 1PHRA 4RK7A 2OQRA 5HSGA 5EWMA 4HNQA 2W42A 2J48A 4RS3A 3IP6A 1CHNA 1PEAA 4KNYA 2E4XA 1RZRD 1B00A 2FMKA 4MR7B 1P6QA 4YRZA 3IP9A 4N0QA 3H5OA 1QKKA 1E6LA 4OLAA 5FWYA 1A2OA 1Z2EA 2IDMA 2E4ZA 2FMHA 3DGFC 1NATA 4MR7A 4KMRA 2JB9A 4RK1A 2A9OA 4N41A 1ISRA 2WY2D 5EWJA 3SQNA 5IEBA 1NY5A 1R8JA 3QEMA 3QELB 1Z17A 4MS3A 5KQGA 1APBA 1NXOA 2HJ9A 3JPWA 1GLGA 5FBKA 4F8JA 2PL9A 4ETMA 4O5AA 4E7PA 2PUFA 5TQJA 2A9RA 5FBHA 5IC5A 1MAVA 4RK4A 4Q6BA 4NCAA 4P98A 1BA2A 3M6MD 4G0XA 1QO0A 4KZKA 1JFSA 4DQDA 2AYXA 1F51E 2JBAA 1NXTA 5IEJA 1Z2DA 4YCSA 2E4UA 1BDIA 1DBWA 1Z26A 4EYOA 1LBHA 1RPJA 2BGGA 2FQYA 2WB4A 3O21A 4Z4EA 5EWMB 2NZVG 3KS9A 3JS5A 1GUBA 1P8AA 4F11A 5CNJA 4LRQA 2TMYA 4JASB 1SXGA 3O1HB 2WMYA 2QU7A 1D1QA 4PZ0A 1ZITA 1AB6A 3VNAA 4DN6A 5JNRA 3CS3A 1DC7A 1SD5A 1KGSA 1DRKA 3JVIA 2L17A 4TN5A 2P9HA 3QLTA 3NHMA 4F3TA 2VUIB 2XDYA 4D6XA 5BRJA 3Q9SA 4MS3B 2LUOA 3M9WA 4KK3A 1ZVVA 3I42A 2GKGA 1VLZA 2FTKE 1FFGA 1C0EA 4ETNA 4EY3A 1HEYA 2PL1A 1J56A 4RZSA 5FWYB 2VK2A 3MYYA 1QP4A 4D74A 1EFAA 3HSYA 5T3YA 1L5ZA 1K68A 3H5IA 4N03A 3O1IC 2E4YA 5D2CA 3H75A 2F8TA 5JNUA 3CLKA 3E61A 5IUNC 1FSPA 4YLEA 4XARA 4RXTA 3DLBA 1RXEA 3C6QA 3T95A 1Z18A 1F4VA 3EGCA 4HNSA 1XWWA 4EYKA 3RVQA 1M5UA 1WETA 4IRXA 4EYGA 2FSPA 4Y9TA 3NNNA 3NNSA 4GPAA 3SAJA 1CYEA 5DKFA 1D4ZA 5KWSA 4H3HB 2IYNA 3KYIB 1PNRA 4Z99A 4NQRA 5KC9A 4YS6A 1PNTA 4LE0A 4TMYA 5HQJA 1FFWA 1DC8A 4KV7A 4RK6A 2FQWA 3W9SA 4TLMB 2MSKA 4S04A 5TPWA 2NT4A 2CHEA 3KJXA 4MRMB 1MB0A 3KG2A 4QICA 4XAQA 3BILA 3SNKA 1M5TA 3OLYA 3RVRA 3LUGA 2PAFA 3MMNA 3HM9A 2PUAA 3LTEA 3NBMA 1URPA 4M88A 1OXBB 5E3JA 4EVQA 3ILYA 1E6KA 2IPNA 3MF4A 3CG0A 4KVFA 3K4HA 3UKJA 2JVIA 2IOYA 3OQMA 2ID7A 4N47A 5ED4A 3HO1A 4NV3A 1NXPA 2PJUA 4L4UA 4EGSA 3GRCA 3QX8A 2GBPA 2PLNA 2CHFA 3QLVA 1JH9A 1QP0A 1JFTA 2B4AA 3HV2A 3KCNA 3NNDA 2MYPA 1T34A 4YR7A 4MR8A 2FEPA 1U0SY 1ABFA 2FVYA 1DP4A 4KK4A 3TB6A 8ABPA 1LK0A 5TPZA 1JYFA 3FFWA 3Q15C 2RDMA 4YGXB 4WZZA 4Q6WA 4MS1A 3B2NA 4RSMA 4W5OA 1A04A 4OLBA 5BQ3A 1W9HA 3LUHA 3LOPA 3A0UA 5JNVA 1U8TA 3LFTA 3OM0A 3RVOA 3UUGA 1UDRA 1E6MA 1KMIY 4XXHA 1ZAYA 5JS1A 3OLXA 1YIOA 1ZHHA 3KYJB 1TVMA 3P9YA 3TMYA 5HM6A 3EDCA 2MYTA 3RVLA 3FDFA 3BRQA 1KRXA 1MIHA 1VKRA 2LPMA 3L6UA 4NICA 3DGEC 3SM9A 2L2QA 1NXXA 2N9UA 2RJOA 2WRZA 5IX8A 2JK1A 4ZPJA 1YS7A 2HQRA 4G0ZA 3URMA 3RH0A 1JX6A 1USKA 3HK2A 3Q7RA 5JNSA 5B3JA 2P4UA 2R4QA 2GWRA 4Z4FA 1DCKA 4JA2A 2MSLA 1H9CA 3JVDA 2IKSA 3OQNA 4MS4A 4G0QA 5F64A 2QXYA 5CNMA 4ML3A 2I6FA 4RY0A 3GWGA 3HS3A 2WJAA 1YK0A 3D02A 3I5AA 4G97A 4MPTA 1NXWA 3D8UA 3RVKA 3QK7A 1OXKB 3MA0A 1W25A 3FMVA 4Z4HA 2HSGA 2IPAB 4RXMA 6ABPA 1GCAA 5IUJC 1JDNA 4W5TA 3LUKA 2QVGA 4XLTA 4WXMA 5KQPA 2VYCA 1PEYA 1TJYA 2PUEA 4RWEA 3H5LA 4UHJA 4P1ZA 2H3HA 3MM4A 4JAVC 1JHZA 1I3CA 3N53A 5IUKC 3ROFA 3OLWA 2IPMA 2QW1A 4DADA 5HKOA 4W5QA 2F8SA 3EULA 3HZHA 2FLKA 4O1IA 1Y1LA 2MYNA 3TD9A 1CEYA 4G86A 3F73A 4Z9AA 3KHTA 5TQ2B 3N0RA 2HPHA 3ROTA 2GI4A 1RNLA 3VNBA 3KLNA 5GQSA 1LJUA 4W5RA 5CNKA 4KPYA 5JNWA 4KREA 3OMWA 1P6UA 3H6HA 4Z0NA 4QPJC 2E4VA 4MQEA 1EWVA 2CWDA 4B09A 4HYEA 1ZDMA 4YO7A 3OMXA 2JVJA 1U04A 3O2JA 1JBEA 1BDJA 3H5WA 4S05A 6CHYA 1DZ3A 3OO1A 1GUDA 3BREA 4PICA 1L5YA 4MYRA 4RU1A 1QQBA 3GT7A 3I45A 4MQFB 3Q7TA 2DRIA 1YTUA 5TE9A 3FFTA 5TQ0B 3HCWA 4MAAA 3SG0A 2B1JA 3RVSA 1USIA 3E3MA 3M9XA 4H60A 2YHBA 1DRJA 3CFYA 1JDPA 1NXVA 1YMVA 2CD7A 2FEKA 1C4WA 3HUUA 1YS6A 2A9QA 3G85A 1EHCA 1U2QA 2ZAYA 5IULC 4EUKA 1Z16A 1S8NA 3N0WA 1JL3A 3CZCA 2FN9A 3MIZA 4N0PA 3N6VA 1ZESA 2LIVA 4FE4A 4Z4IA 1YVUA 2YHAA 2QR3A 1D1PA 2FKAA 3KKEA 3KTOA 1D2AA 3LUCA 4WUTA 4XFKA 5KQLA 5C5EA 1BVHA 1VRVA 2MSWA 4EVSA 3OLVA 4Z4GA 1FQWA 1BAPA 3GV0A 4E7OA 2HQOA 2RJNA 3N8IA 2NZUG 1EAYA 2R47A 3IP5A 1EWTA 4IMJB 3A0RB 4KRFA 2FN8A 4L85A 5EWLA 2R48A 3CZ5A 3LUFA 1DBQA 2ZWMA 1QO0D 4ZYLA 4JOQA 4YV7A 1JLKA 3RVPA 3EODA 1DCFA 1P2FA 1TM2A 3MQ4A 4PYRA 4NCBA 4LE2A 5KC8A 2JVKA 1TLFA 2PKXA 3IDOA 4LDZA 3QEKA 1XHFA 3JY6A 1ZH2A 4OATA 2QV0A 3HUTA 3RVNA 3FFXA 3QELA 1XHEA 3QEMB 5C5CA 4LE1A 2QZJA 2WWVD 3CRNA 2PUGA 2FMFA 3O2SB 2JRLA 4XASA 4HNRA 3CNBA 5JNTA 5DGCA 4FB4A 4IF4A 4W5NA 3Q41A 4JB2A 4G0OA 4RDCA 3UK0A 5TPWB 2JBAB 3C3KA 4JB0A 3RVMA 2PUCA 1E2BA 4MLDA 3LMKA 4YP9A 3A3KA 1VPWA 1JWLA 1NXSA 5KI6A 4WT7A 2RGYA 2E4WA 3QLUC 3GL9A 5DLEA 3CTPA 3R0JA 1JFVA 5FWXB 3DLHA 3OM1A 4KFCA 5TPZD 1ZGZA 4MS1B 4H3KB 3DBIA 3A10A 3QLUA 4D6YA 1D5WA 1Z13A 2FXIA 3HXMA 2O20A 1MB3A 1ABEA 2M1ZA 5I4CA 1RXIA 3KLOA 1ZN2A 3H5TA 2WJWA 4WWHA 4OG2A 2VUHB 3LUJA 4ZMSA 3IPAA 1DBPA 4Q7EA 5TQ2A 1QNLA 4RY9A 4MR9A 4QYWA 1SXIA 3RVJA 5BR1A 4EVRA 5EWLB 2AYZA 3JTEA 1NTRA 1RZRA 1M2FA 4GNRA 3C3MA 3IP7A 2FEWB 4MR8B 4MGEA 5GOTA 3BRSA 1ZGGA 2X7XA 3QX9A 3BBLA 3Q7SA 4O1HA 1ISSA 4RK5A 4G0PA 4ZMRA 1PUXA 2MYUA 2FQXA 3HEBA 2LBPA 3F6CA 2QSJA 1M2EA 3SY8A 2LP4Y 1TMYA 4LZLA 5DCLA 1JYEA 3H1EA 4MQFA 4PE5B 1KRWA 2M98A 2OENG 3EJWA 1YMUA 1Z15A 3O74A 5TQ0A 4MS4B 3EQZA 4LX8A 4RKRA 4IMIB 5CNIA 1DG9A 3LKVA 3LUAA 2ID9A 2NT3A 4FE7A 5PNTA 1FFSA 5DTEA 7ABPA 4LDAA 3T38A 4ZJPA 5ABPA 3O2QB 3HVRA 5KQMA 1SRRA 3GYBA 1ZY2A 3N75A 4RXUA 2FLWA 4IGAA 2Q5CA 1LBIA 1EWKA 2PMCA 3DZDA 3G1WA 2R25B 3H1FA 4MR9B 5CHYA 3H6GA 5IBQA 2FW0A 3EQ2A 3KSMA 3LKBA
chains in the Genus database with same CATH superfamily
1OW3B 4E5YA 4U2KA 3O94A 1Y8CA 2VNAA 4COKA 2ATIA 1N5DA 2OV6A 4EGAA 3LNCA 3KSZO 4QQ8A 1NE2A 5AUQA 1RPNA 1QK4A 4RHYA 4S35A 4ZEVA 1UM9A 3M49A 3RSSA 1W581 5SY6A 1E1RD 4KIJA 5EMKA 3TQRA 3L84A 4BPRA 1SVWA 1LQTA 4MV9A 1Z6ZA 3BXOA 3EWIA 1U3GA 2QT0A 4OYRA 5MFPA 3EJ6A 3GA5A 4RULA 1H6BA 1EUYA 1NJ8A 3L3BA 1Q1ZA 4LVOA 5EIWA 4OQLA 3ZZTA 2H1CA 1WP9A 2V9PA 1QTRA 1TNDA 3BTUA 3KWJA 4MVJD 4N1AA 2WKRA 3DXYA 4NHEA 5T6MA 1ZSNA 1ZGJA 2I22A 1EUCA 1DDIA 1KC3A 4CU5A 1R0ZA 3H42B 5A4JA 1VDZA 4I1RA 4HZGA 2IODA 4QJ3A 1KWGA 3KUXA 3TVDA 4QUHA 1ZWKA 3D3JA 1YJQA 2ZSIA 3B3QA 1LCIA 1VMDA 3A70A 3IB3A 2EF0A 3KFVA 1Z12A 4ERXA 1CIVA 4LXHA 2LVBA 5IMSA 1YZYA 1S1MA 1OREA 1SBHA 1Q20A 4FE3A 5HHTA 2BF4A 3FTQA 3FPGA 4KACA 3CKMA 1YRLA 4C05A 4NAHA 5H3HA 2ISSD 2WA2A 4FXPA 3UGKA 2OG1A 2I29A 4AZ3A 1WZEA 2ZB8A 3H16A 4G5HA 2IU0A 1QRUA 2VYND 2YVAA 2WTNA 3V42A 3DZKA 2GEKA 4IYJA 3IEXA 3IBSA 3IAAA 4D1YA 4Q1AA 2Z8YM 5LJLA 1TVCA 2XNDA 1PL8A 5FI1B 3F5MA 1CF4A 4DCMA 2PS9A 2WLTA 1GPAA 2QTZA 3CUSA 6GPBA 4PSDA 2UXDB 5JNLA 1U1EA 3QWHA 1EYZA 4KRYA 4RS3A 4MDEA 1OAOA 2DB3A 1C8KA 1BCSB 3FYUB 1Z82A 4U2FA 4D8WA 1NKSA 5K3FB 1VPDA 2RMKA 4GKJB 2ZYGA 4QOGA 1FF9A 4NNJA 5J47A 2AJDA 3VC1A 1TKCA 2ORVA 4UW9A 3W7BA 5KOHB 5ERXA 2DQ4A 1QANA 4UNNA 3R7NA 4CEIA 3C8HA 3AV0B 5EJAA 3CVOA 4TRMA 1N6OA 4N41A 2C4UA 3C6YA 1XD9A 2PBRA 3AWDA 4NJEB 1QRTA 2DERA 1WY5A 1RHMA 2WF7A 4UHCA 1WTCA 2GJSA 2X3FA 5LQKA 2OO5C 4CQMD 2NZWA 5JQWA 1WCIB 5HQTA 1X19A 1DKUA 1KAGA 4Y6RA 1CLEA 1QIIA 2WWGA 3E9DA 2DX7A 4EOGA 5H8WA 2PSFA 5TQJA 4GVLA 4ON9A 3WL5A 4E31A 3TBFA 2V7EA 1CY0A 1P29A 4M8SA 2O19A 3P9KA 1E8DA 2B2CA 3QKUA 1F51E 1U7WA 1TIKA 1Z34A 4YQEA 2AE2A 4J0KA 5EHZA 1RKVA 1M2WA 3GJTA 1BDIA 4MZDA 1JG3A 3DAFA 3V55A 1M2OB 3BXGA 3H7IA 4JUFA 4WECA 3ZPXA 1Z0IA 4F5EA 1X14A 2AD5A 5MGBA 4RA6B 2V03A 3K1ZA 3BL6A 3V3KA 4CGYA 5A5EA 3QVGB 1QRSA 1FFAA 2D1TA 4OA8A 1DAKA 2V54A 5T6BA 1U4SA 4EF4A 4DV4B 3ADBA 4XX1A 3CE6A 4IOKA 5AM5A 2PKQO 1ULSA 2WG2A 5KU7A 1EVJA 4X84A 4F3CA 3AHHA 2JFPA 3JQAA 3FWNA 5TR9A 4DEVA 4OGWA 5ALSA 4BWYA 4ZYZA 1TU3A 3I4LA 4MEBA 2R79A 1VECA 3QWIA 1XZFA 4DNFA 2QLLA 4PQYA 4BX3A 4BBZA 4U63A 1ZJJA 3A05A 3SSAA 2CMGA 2Z9DA 3BERA 4FJ0A 1FIUA 2BHRA 4XWOA 2W71A 4MKIA 4O25A 2X9VA 1SZCA 4HFNA 5C4MA 1BXRA 4MDFA 3NYRA 1GPKA 3BQNB 1T6NA 2DC1A 4GPEA 3ZIUA 3W2EA 3HSYA 3UWKA 1DBRA 1P7VA 2AJLI 2BHSA 3R5FA 3DEJA 1BIFA 1V71A 3H2JA 3ELUA 4LHZA 4WLVA 3A37A 2IXTA 4UZEA 1AZWA 1B0AA 5DYGA 5UKDA 1W96A 2RK3A 3BWMA 3FETA 3L0ZA 4KIGA 4MV0A 5AK5A 2XPCA 3AW8A 1ORDA 1I4WA 1TYDE 1V7QA 4BLVA 5F1YA 5AVRA 4RWZA 2JLRA 4MIKA 4TKVB 3TDNA 4C87A 4KR6A 1VKZA 1R8QA 4DR7B 3GEDA 4H77A 1IUKA 2GN4A 4YA6A 1WLYA 4GPAA 3HA7A 3U81A 3FPJA 4Z99A 3S2YA 4JIGA 2CDRA 3EFEA 1C4XA 1E66A 1QHSA 2SNIE 5KKNB 2X6RA 3H5RA 4OAQA 3ONVA 3TPFA 2NT4A 1V37A 2FEAA 1CR4A 2WSYB 4UBOA 1L4BA 1T0BA 4BE9A 4QICA 4Z3KA 1NAHA 4P4TA 4EG3A 1F6DA 5DM1A 2HCRA 1GCIA 4K88A 3VYVA 4RGQA 3SX2A 2FY8A 4KR0A 1WABA 1DE0A 1XAIA 4HH1A 4JZYA 1TFRA 4ND4A 4F4CA 4DV2B 2IZ7A 5HKKD 1T5TA 4JEIA 1Y63A 5JBIA 3SXUB 3C4JA 2B4QA 2IWRA 2A5FA 3DDZX 3EWNA 1U5BA 521PA 1ZL2A 2FVXA 1RKXA 5M3BA 4C4PA 4HAVA 1ZISA 4KVFA 1XJ0A 1V1RA 2QUZA 1ZN8A 4BNDB 4JCCA 4N5MA 3FH0A 5I7WA 1NI4A 1ODIA 2CDAA 2A1UB 1M2KA 4PCAA 4REMA 4MJ7A 2HU2A 4RH0A 3WI7A 1E0AA 2BDTA 3MWEA 3GRCA 3O93A 1QTNA 4DLZA 2CHFA 3BFXA 1UBOS 3QENA 2FUNB 4OI4A 2J41A 1KIFA 4PPQA 2Q2QA 3U6BA 5REQA 4LXXA 1RPZA 2RBKA 4YMVA 2AR0A 1TQ8A 3HCNA 1Y3IA 1WDMA 2WE7A 2ZCUA 3RTDA 3TB6A 5EIOA 5DTRA 1NT4A 2PWBA 5JD6A 2Q4RA 1IATA 3GA0A 1C8BA 3OZCA 4DIEA 1RI4A 1VB3A 2DWUA 3ZCVA 1XFDA 2IP2A 2XVAA 3PCXA 2E5LB 8OHMA 5JNVA 1U8TA 2ATCA 4BTEA 1U0JA 4F3NA 4JHXA 1YHZA 4NZZA 3CT4A 2X4LA 2C9YA 3KELA 3U3KA 3O8NA 2QE6A 1ZG3A 3DLAA 2ZQZA 3WMFA 2WJYA 4EG8A 3G9QA 4BKRA 4DM4A 4DA6A 1H1TA 3ZX5A 4AF6A 5KTRA 121PA 4Q3KA 1V9CA 5K3OA 4Y6LA 2PRYA 2WWTA 3FBGA 1YOVB 1JR3A 5JZSA 2CVPA 2JFHA 1A97A 3Q3HA 4DNPA 3BM5A 5CD1A 1FFYA 3AXTA 3NDJA 4I55F 4UM8B 5JJ5A 2QG9A 2EKPA 1XDGA 4OJYA 1SC3A 1U5BB 3LCMA 3RNLA 3DE0X 4II3A 3EOBI 3U0VA 4BNFA 4BCCA 4E11A 2IPOA 4MYCA 2XQIA 4F2WA 5KDOA 3LBYA 1WB9A 1JNYA 3KDAA 3I9OA 4IWYA 4TROA 1PLJA 1XPRA 4RJ2A 2MSLA 3DKKA 2P90A 4L7VA 4XQGA 1W0JA 3RVBA 4G0QA 1PF7E 3OQNA 1XHLA 3O2NA 2XJ4A 3QG5A 1QXSA 4GZ3A 3FLEA 2I80A 2VF7A 3EXIB 4IGEA 4KZPA 4ML3A 2GZ3A 3NFRA 4YMLA 3DWFA 4L27A 5DYIA 3CR3C 5BN3B 3OPQA 4A1FA 5ENVA 5CDUA 1YK0A 2BGWA 3IEVA 3L05A 2O8CB 1PZNA 2H1IA 2FP4A 3QXCA 3EEQA 5I5EA 1MX1A 1KMMA 3I23A 5SYAA 1NYLA 1ITZA 4H7IA 2XZTA 5DP1A 5JSYA 5AM0A 4E5SA 2Z30A 4HAWA 4M9XA 4A36A 1N9GA 3O3MB 3GOHA 3RYCA 4AX4A 3IE1A 4ARIA 1TJYA 3WTCA 4KOEC 2A0YA 1MU0A 2GRUA 2W2XA 2YCBA 3U4DA 1HNZB 1V43A 1XR3A 1VQ1A 2WF6A 4BGDA 1NLFA 1Z73A 2XE7A 4DADA 1F06A 5DBHX 2LCQA 1FTSA 4TV8B 4LWZA 1JZQA 4M9QA 4TLAA 1FJGB 1V16A 3HCAA 1AKNA 4LDRA 3HL4A 3VH2A 3IV9A 4G86A 4MPRA 2CCKA 5GADl 4Y1EA 4MJ3A 2P7IA 1ZNYA 3OTHA 3THYB 3JAKB 2D0PB 2FDRA 1FJHA 4COOA 4YRGA 1CQZA 1U94A 2NUTB 2Y0PA 3PQEA 1R6TA 3SU8A 1T2NA 4OUDA 5EKSA 1IM2A 3PQ5A 2Y6VA 4Z0NA 2IUUA 5KNDA 3SKVA 2LKCA 3SIWA 2ZZNA 2Z5VA 2JI9A 4D57A 2W2KB 1XTRA 2Y1KA 5DCYA 4Q00A 4F4UA 3UMSA 5K6AC 1MC8A 2PUJA 4IZIA 4PAMA 2FUG1 4OB6A 2J8ZA 4ZK6A 1DZ3A 1O97C 1U6JA 3CXRA 4GWKA 3TMAA 5KNBA 3BIOA 3NP7A 1VI6A 3M5WA 3D2LA 3PRKE 4XJXA 1DWPA 2C2OA 2WOJA 2BPOA 2MJLA 2UU9B 2YC2C 4WVFA 4Q02A 4I46A 1C9EA 2VEDA 1GUYA 1GGFA 1IRXA 1I0LA 1I6WA 3GJSA 3PJGA 1Z08A 4IIFA 3QU4A 1U0LA 4PWYA 2YHBA 4WXPA 4YP0A 3CFYA 3USZA 2DR0A 4IKPA 1C3LA 1RAEA 1U11A 4RVHA 4DIOA 4DZRA 2OCDA 3C8MA 1EJ0A 4EHDA 2DMRA 3CEPB 1ZI8A 1U2QA 4G1MB 4MTCA 4YMSA 2ORIA 5FT9A 3TNJA 4ZGGA 1TO1E 16PKA 1B41A 1QNFA 1KDYA 3IOCA 5CXQA 1UK8A 3ZHBA 2RGWA 4R40A 4WY2A 2X5JO 3FAKA 3HY6A 4QQKA 1G8YA 2DWPA 2HV9A 3K30A 4RHCA 4AQ7A 4YQFA 3FMGA 2W00A 4S2UA 3WB0A 2R1ZA 1D5CA 2VJDA 4HDMB 3A32A 4X93A 3LDHA 4YRNA 2ONYA 3DDWA 1Y0BA 1FDSA 4PG7A 4IWNA 2X9QA 3TQIA 3WISA 2R48A 2YR0A 3NMUF 1DBQA 1KNXA 4B9EA 4JJ4A 4JOQA 5F5XA 4G8BA 4N0MA 1A98A 1TM2A 1VE5A 5AOBA 1IZ7A 1RLUA 4LZPA 2ZITA 2YX1A 5KC8A 1RMYA 1T8PA 3KJFA 5LSAA 2HADA 2V65A 2OOKA 2QV0A 5DOVA 2HK8A 1J2EA 1L7OA 1FJXA 4MARA 4ENVA 2QZJA 2IQIA 2CJFA 2VRBA 3IPLA 4ND5A 5LU8A 2XW6A 3JALA 4MVXA 3FM9A 3WVNA 4QTXA 1L5GB 1GPWB 4K6KA 1MBZA 2I7CA 2XUGA 4KJZA 4PR3A 3Q41A 4I50A 3CTMA 1T3TA 5JMTA 2CXPA 2MINA 5LXTB 3JQAD 3O03A 3OQ6A 1ECLA 1E99A 4RM2A 5AW3A 2AS0A 1GKLA 3C3KA 3IR7A 5BYBA 1IN7A 3TQSA 4BNTA 1I7DA 4DB2A 1M74A 1I1HA 2VSQA 5JO9A 2G0TA 3CT6A 4JJKA 5BV8A 2G6TA 2VSNA 3A04A 4CEHA 4D4HA 3GL9A 3N05A 2OP0A 5JWOA 2IZOA 2FWAA 3D7NA 1TYBE 3GAMA 1NR5A 4DYVA 4EBBA 4QDTA 1RLMA 3WK8A 1UP6A 3A1UA 1XBTA 1DUSA 1MB3A 3KZOA 3LL4A 3VRHA 4DIUA 2B92A 4OGLA 1EUZA 1A27A 3D2BA 2XVZA 1TGVA 3OIWA 1PE0A 1C4KA 1F1BA 5FL3A 3HU2A 1ZD1A 1LI4A 4BVJA 1JKMA 5C51B 1CJBA 3U44B 1EVQA 4OMUA 5CG2A 3QKWA 4FC6A 2HXSA 3BD8A 5ECDA 2JIRA 1F3OA 1IC6A 4HQRA 1Z06A 5FQOA 4EY8A 3NHSA 3SS8A 3FCXA 3RRXA 4GUAA 1CQJB 2XMZA 3SVZA 1I7QB 3FCOA 1REQA 1ZK2A 3BRSA 1I24A 3G59A 5BVHB 1HQYE 1ZD2P 1R8XA 2GB4A 4NTZA 4RK5A 1RYMA 3COYA 5HK8A 3GD5A 5B36A 1G20B 3AF1A 2E6UX 1MCZA 1TCAA 3EB9A 3H18A 3ICWA 4K9NA 4V0OA 4ZEWA 1U2TA 1T1EA 5T67A 4AKHA 3C14C 5CA1B 4EUSA 1EH5A 2XLCA 4OHKA 4F4DA 3SX4A 3ETCA 1OA1A 4KAAA 4ZCSA 1YB2A 1ZVJA 3HKBA 4KX5A 4N7RA 4KNVA 1A5TA 1GQFA 1NLUA 1RPAA 1TM4E 4YWJA 2JEZA 2AK2A 4EA6A 3Q3JB 1A5SB 2WA1A 1KI1A 4KN8A 2O4UX 1DJPA 4HEA6 2BISA 1TECE 4OKIA 4CQNA 1M6HA 5HKKA 4XQEA 4MHSA 2ZTSA 3RUIA 4MCJA 4Q24A 4CLOB 1WPQA 3THWA 1Z4JA 4H1VA 4TQGA 3OZRA 1XXHE 2UZ0A 1T8UA 3KV1A 4OYYA 2D5CA 4QOFA 5E9AA 2FUCA 3EIWA 1PWHA 2ZYUX 3N8DA 1KJQA 1QH0A 2J08A 4GRDA 4JI5B 1JFRA 4U2EA 1F48A 1DAMA 4LI0A 4X3OA 1I3KA 2Q0QA 3UT6A 3VSCA 4ZOBA 3HVKA 2QRKA 2UYYA 4IJQA 5E9WA 3VJRA 5B3JC 3G2IA 3MBIA 1E0JA 1MVOA 1KOLA 3ZD7A 4BO5A 1NJ2A 3EBOA 3B7PA 2D13A 3OECA 3QPWA 3V4VB 1QGOA 1TTQB 2QSYA 5J2TB 5CB4A 4QM6A 2QYHA 1XRLA 2FEMA 1CQIA 2A88A 2L42A 3LK6A 4A5OA 2HMVA 3PI7A 5JSZA 1H22A 4YMHA 3H2GA 5JS2A 2PKQP 1NMXA 2V9CA 1KMCA 2XXAB 2GCGA 4G5YA 1XEWX 3RFTA 3S8MA 1AKVA 1XTQA 4QEKA 4UATA 3F2IA 4JQYA 4D3YA 1A69A 4LJ8A 3I01M 1W5FA 2SCUA 2I8CA 3QVJA 4MRVA 1EUDA 4US1R 1T9BA 1W0KA 3TMKA 3VZRA 3JQ9A 2D8AA 4G0YA 5IBRA 1QYXA 3QY9A 3WS7A 1UBTS 4HDRA 2V58A 2VPTA 4Q9JA 4N3CA 5AOCA 2JI8A 5LBUA 4I4CA 1R9MA 2J30A 3PXXA 2HREA 2Q7XA 4O4JA 4CMKA 1TM5E 4D44A 4RK0A 1L4HA 1SC6A 3P7MA 4L0DA 2ZYDA 4RYDA 1N6NA 3NAQA 3LRXA 4L3OA 1HFEL 1SBNE 5DHAA 3N0XA 1RABA 2GN6A 4BQNA 1U2ZA 5WRFA 3QKSB 3EXEA 4KGDA 4IICA 4UEQA 4RJLA 1KAMA 1PTJA 4FHDA 2RHLA 2JJ8A 1QP8A 2ES4A 1QHEA 2R8XA 4TLLB 5M2QA 3KQPA 1PZEA 1ZUHA 1SOMA 1FU4A 1K06A 1NBWB 4WDRA 4BX8A 1XZNA 1USVA 4CM7A 4K1XA 2N3ZA 2P3QA 4YAEA 4O6VA 2WHPB 3OCCA 3ZH9B 1IYZA 3PDJA 4CL8A 5CDTA 1FQKA 3CLSC 2VC2B 4KR7A 2WDZA 1FFCA 1YAHA 4NR0A 4S24A 4QKQA 1MPXA 2PJRA 4GDFA 4OLAA 1LBQA 1A2OA 2FZKA 4JUIA 1CIJA 4K8RB 4MW1A 4OI0A 3MJ4A 1PS9A 1XMIA 3JQEA 3KC2A 4D8XA 3GRZA 1NNEA 5DLDA 4NBWA 1NY5A 3QELB 2DLCX 2I7DA 1CFJA 3AI3A 4WMLA 4FJ1A 1XK7A 1J24A 2CB9A 3LH5A 4DRZA 2Y9PB 1SPBS 3PQ4A 3X44A 2CEKA 2A9RA 4L73A 4YCBA 1HMYA 4NCAA 1XALA 2IZ5A 2PX6A 3EVFA 5C53B 3L82B 3CO5A 5JZ9A 5GIOE 2B5WA 3IHWA 4DQDA 4JZKA 3VZDA 1D8TA 4HDAA 2WV9A 4K6OA 2IZ1A 2BIFA 1AUOA 1FFXB 3K20A 4WBXC 1T9AA 3MMXA 1NIPA 4BVAA 5HP4A 1NRXA 2AC7A 1VBNA 3I3OA 2AKYA 1NPTO 2FOIA 3B3FA 1QBGA 4K6GA 1P8AA 4ZKEA 3CCFA 3FKSA 3RVSA 1C2TA 3WNVA 1AGRA 2H17A 1DEHA 3OY2A 1HX7A 1XIVA 1XRNA 4YONB 3ZDDA 1MAUA 4GX0A 4KN6A 3MS4A 1R9NA 1LWOA 5BR4A 1DBVO 3NKVA 1D1QA 2I6UA 3RRFA 4ER5A 1AB6A 1EJ6A 3GMIA 4LF8B 4JVLA 4US0R 2D5BA 4OXQA 3U4HA 4EHNA 2C42A 3OT5A 1PFVA 3OCYA 4NS4A 4C2AA 1MNAA 1A7UA 3Q5EA 4I5DA 4CKEB 4CM1A 2R6GA 5F9HA 2O23A 1QYRA 2BD0A 3D6UA 1QAOA 2RFLA 1ZW6A 1JI0A 3H7AA 2VHTA 3A1FA 3O8LA 3Q2OA 2ATVA 4HWPA 2I6TA 2Q3EA 4MVJE 4REOA 1P0PA 4ZVSA 1SNYA 3ZXIA 4XIJA 3LPDA 3G0IA 3ZDEA 3KJIA 4HQKA 3MAGA 1L4FA 1BWRA 5EJ5A 1HE8B 3QPUA 4A8TA 2VK2A 1GPDG 3KEMA 3F49S 2JGJA 1GO2A 2YQ5A 2BY4A 3PEVA 3PWSA 1MC1A 3H19A 4L2IA 4PG6A 4QHTA 4BAZA 4DMCA 1WOMA 5J4KA 5IN4A 5KVQA 2O9JA 3SX0A 1ML4A 3U44A 2FN7A 4V2UA 4XARA 2LCFA 2Q9UA 3C6QA 4LRTB 1U3VA 1E9DA 4OHWA 2C83A 2JKZA 3QU5A 1LPPA 3WMEA 5CPBA 2RHTA 5CLLA 1Z5ZA 3JSXA 2FF5A 1SCNE 3RSOA 1LY1A 1M5UA 2PVSA 1DPGA 3IQFA 4URWR 3QOXA 4U0KA 4X8OA 3GVXA 4Y7DA 4UVIA 1TKAA 1QZUA 3ZW7A 4DQVA 5K0BA 4I66A 2JIPA 4J1TA 2W4IA 3FMIA 1A9RA 3NU1A 2P35A 3EGXA 3OU7A 4DMHA 1JECA 2V0GA 4HD8A 5DSXA 4IMRA 4BWFB 2C3YA 1RYDA 3KEOA 1J0BA 5LDGA 3JQBC 1Z4OA 3HBLA 3SE7A 4QRDA 2RIRA 3ABSB 2X0NA 1N25A 4R1PA 3LUGA 4TV9B 3AUTA 3PD7A 4TS4A 4DSTA 4M88A 1OXBB 2J7PD 1RADA 2AOXA 4JT9A 1ZWLA 5HCIA 6PFKA 4LMRA 3T3DA 5BT8A 1IG0A 1F6BA 1B15A 1TA0A 3EDMA 5TS3A 5JXJA 1NJ1A 2WZDA 1EBUA 4HY3A 2WQ7A 1V41E 3CINA 1CJMA 1XCJA 2XNJA 1JA1A 1E6UA 3VC7A 1KFEB 3VOSA 3E05A 2HSZA 4X24A 3D8TA 3GFFA 3LKDA 4YJGB 3UNXA 2ZTUA 3UT5B 2V7QA 2ZAOA 2NZ8A 4ZYYA 4QEZA 3ZCRA 1SR8A 4W6ZA 1AXGA 4UEOA 1V8FA 4BQPA 4DMMA 2YDYA 3QLVA 3KB6A 4CDRA 3HMKA 1M66A 2R6ZA 1II0A 3I2KA 5AESA 4KPUB 3ZHTA 4CLXA 3FKQA 1WXEA 2PX5A 5F3DA 4BO1A 5JROA 3W5CA 1Z2NX 1NUHA 3WZMA 3LO8A 4DA0A 3ZWAA 2GHIA 2A3RA 1IY2A 1WQ3A 2QT1A 3MJDA 4Z8XA 8ABPA 5JCJD 3R9IA 4BP3A 4DUZB 1G18A 5DGDA 4U7WA 2ZIXB 4PBRA 5B7QA 4FYHA 4ZZ1A 4MVWA 3BJZA 2DR3A 4M53A 1AURA 3EK2A 3ORFA 1QFSA 2FRXA 2X40A 5I45A 1SPXA 3TF5A 2VRWA 3N8NA 1EP3B 4U2CA 4YBZA 1OYVA 2W2TA 4AY3A 4LF6B 5FBZA 1OSNA 1IM5A 3MZ0A 5D84A 1QO7A 1ZHHA 2NIPA 1MD9A 3ZU2A 1BGWA 3EDCA 3Q8XB 4YRQA 1OGJA 2GYWA 3O3OB 3P9CA 4NARA 4PNPA 1X7GA 1TQHA 4FYJA 4YCDA 3V97A 4EHJA 2QKYA 1G2OA 2ACVA 2QU8A 3GUCA 4LDQA 1A7AA 3LNTA 3R24A 2XB8A 3SM9A 3VYUB 4C7VA 2ZTMA 2H1OA 2JK1A 1A7JA 1R0RE 3TDKA 4CKYA 2OGSA 4KQ6A 2PVCA 5A4FS 1AMOA 2CD9A 3WLLA 4L07A 1L5RA 3NEJA 1AN0A 1HR0B 3CR7A 3C43A 2NSLA 4DR3B 1YRYE 3O4FA 3QWFA 3ZUPA 3IO5A 4MW2A 2DQKA 2GWRA 3BH0A 3FW1A 3OE4A 3OZWA 3AL2A 2HLNA 4IP0A 3CRRA 3D4PA 1E5VA 2BKVA 3INGA 3OM8A 4LMBA 1YVDA 2FUEA 3OIFA 2YMLA 2JJ2D 2X1MA 3HJUA 4P81A 4EENA 3LC1O 8ADHA 2Q2WA 2CLSA 2JGDB 2NO5A 4MVJF 2V8BA 3BCSA 4D3ZA 5E0OA 3ZQ4A 2YUIA 3WLIA 5L9AA 3QU7A 2P62A 4UFOA 1E5XA 4ZWNA 4PN3A 4BLWA 5K8JB 5BN4B 4C07A 1DC6A 1Z3CA 2GLUA 3E8MA 1QS0B 1P2BA 3DD1A 1EXDA 1JHVA 1NWHA 2ZJ4A 2ZJ6A 1IUOA 2EFCB 3DPUA 3H0EA 1ENPA 1CT9A 3MA0A 4BEVA 2ZJFA 4CQMB 4QUJA 4WK0B 3VR2A 1M34E 9ATCA 1GCAA 2VJMA 3L93A 1PDVA 4KG7A 3AONB 5HEKA 2RHDA 1F1JA 3IP1A 3D0QA 2IYYA 1I6KA 1RM4A 4I1UA 5KQPA 4EW6A 1CZRA 1JHPA 3H5LA 3KQLA 4ZALA 3LT0A 4JAVC 2CL6X 4FLMA 4Q03A 2VUUA 5DBOA 1ATIA 1JDSA 1THMA 2EQ5A 4MVCA 4NK4A 4OU5A 1FSZA 4QC2A 5KSWB 3F73A 4TVOA 3GMTA 1K97A 2QD1A 3GRFA 4FGUA 3F6RA 1E9VA 3QHPA 3NV7A 4AO7A 1UJMA 2BJWA 2X2OA 1CDOA 1GPMA 2WJPA 3F5SA 5BUZA 1XXHA 4IDGA 4X1KB 4K9DA 2GA8A 1W0KD 2QM3A 3EVDA 2J3EA 2F55A 3FHCB 3V2GA 5DX1A 3VNRA 2PJDA 2VZ8A 1P33A 3JD4A 3CWZA 4IL5A 3TOZA 2QM7A 4F60A 4AUKA 2X0EA 2R1UA 1P8JA 1SCUB 2WG0A 3GOQA 1LDEA 4F9TA 5B1YA 1RXWA 2C99A 2ZAIA 3HL0A 4FEEA 5HYVA 5I4KA 5JUWA 3VYTB 3M81A 4A15A 4ZD6A 3QYAA 4DMLA 4GI3A 1X7ZB 4Z4HA 2H4JA 2X5NA 1T2EA 4NBKA 2B99A 1F12A 1FS5A 2QVXX 3BMNB 2RGBA 5HRUA 1AOXA 1ESMA 2QRJA 1Y8QA 2NVUA 3UOAB 3BGDA 3SIPA 2OOSA 3HUUA 4H7KA 3V7FA 5C81A 2W6ID 2V5VA 4WKNA 2AQ8A 4QU9A 4O4IF 3RUCA 2R65A 4I4IA 1JIVA 4PY2A 4LVNA 2FN9A 4TX1A 5CU7A 1HE3A 4JROA 1ZESA 1DWQA 3OBBA 1UEJA 2B25A 4FUTA 1YGYA 3QKRA 2DVMA 1BVHA 3B5EA 2HCBA 4MWZA 4RTRA 3L4JA 1W5TA 4MGHA 3OLVA 1N2IA 2NU6A 1FMJA 1GNQA 1W5SA 2P5YA 3A26A 3DT6A 1R8SA 4N6GA 1BAPA 1L8XA 1WXWA 3AM5A 3RHTA 4M83A 3I2GA 3ZUGA 2CBXA 3QFSA 2BH2A 1UKBA 3CF4A 3IPRA 2R47A 3IP5A 3VQTA 2YRWA 4P0QB 1PJZA 2DJ5A 4IO0A 3VKWA 1UZMA 1V39A 4LV5B 2N47A 1SHUX 4DV7B 3VTZA 3OJFA 1X1TA 4RO0A 3KX2A 1B8VA 1RWXA 3LBHA 1QHHA 3N7TA 2JFNA 2GZHA 3FSRA 4GP6A 3VR4D 4X1KA 4LE2A 3PUXA 4G5GA 3EH1A 3R7WA 3LKZA 3IDOA 1U8FO 1MW9X 4OATA 1CDEA 2V98A 3AINA 3FFXA 3KB8A 1OLXB 3B9BA 2JGFA 3OTWA 4HAZA 5KIAA 2HPAA 4BFLA 3EVTA 1XTBA 4NZMA 1EM8A 4CG3A 3OA2A 3FYTA 1GV0A 5JNTA 1GPYA 4IKEA 1GCUA 1C7QA 1L8LA 3GUUA 2IY7A 4HMQA 1OIXA 1HL7A 1RC1A 1RD4A 4MUNA 4YAJA 1HQCA 2C8LA 3ZDYB 4PX5A 4EUEA 1P5RA 4D96A 4MW6A 1ESDA 2C0QA 1PWXA 4M8LA 4DAEA 3PUIA 2OBMA 3I04M 3V7NA 4I50B 3WYEA 4BVHA 2BFOA 3VBEA 3M4NA 3CCCA 3NDIA 3UMYA 3RJMA 3TRDA 3SWWA 1KDZA 4B4OA 1DMSA 4HDSA 2XDQA 3BMOB 3QFCA 4D6YA 3LV8A 1K6MA 4P3XA 3QUTA 2YHUA 4E5MA 3S4YA 4B7XA 4EHFA 4PLGA 2PX2A 5I4CA 3V34A 4PZZA 4BAGA 1RXIA 2HK9A 4TZTA 1RXVA 3I9NA 3GUHA 3VPAA 3WL6A 1HF3A 3UT5A 2JKVA 4MUIA 2CXXA 1E1CA 4EYSA 1XAGA 2NU7A 2IZ6A 4L8LA 5ALYA 1E0KA 4HT3B 1SXIA 2NM0A 1AA9A 2Y0CA 1XU7A 3DT8A 2HRDA 3O8OA 4QO8A 1AK2A 2XF2A 1T0UA 2OCLA 3C3MA 2BFFB 3KR0A 4G4JA 2ACWA 1GITA 4XFJA 2H1HA 1OC4A 2JGMA 4KH0A 3Q7SA 2G9ZA 4J49A 4Q4LA 4B34A 4EABA 4QT4A 3K0HA 5BYAA 4E2ZA 3MTQA 5DNYB 1T36A 4QFCA 3GLSA 1ML3A 3Q3EA 4EG1A 1KI6B 3OIDA 4TSFD 1WZ2A 5AO9A 4YP7A 4MQFA 4K3UA 3CJTA 3RIHA 1DI0A 4OQ4A 2LGJA 4AZ0A 2FWBA 1PQWA 4ZEOA 4KNWA 5BSTA 3BQ9A 2VTKA 4AYXA 4D9KA 3O31A 1U0GA 1ZAKA 2GTPA 4J4BA 1NWCA 4D4IA 2R60A 2RI6A 1DG9A 2OCYC 3HB5X 3HKDB 2JGDA 2QYOA 1E96A 3G23A 3L7NA 1I4TD 2WJJA 3LUAA 3PFKA 4JLUA 4WH0A 3S1LA 3VKGA 1ST2A 3ACCA 3AEZA 4AP9A 4EW2A 3ZQKA 3E53A 2FSVC 1D07A 2XNDD 3GJXC 2HPZA 2ZB3A 3IMFA 4DDHA 3K70B 2BEUA 2VF8A 1QF7A 3FRIA 5CX4A 4EPWA 3T3EA 4RFSB 1P5ZB 5FR2A 4YNBA 4YB8A 3HBFA 3EAFA 1EFTA 3RB8A 1E58A 3H5VA 3W6NA 3AUYA 2P30A 4EB8A 2QL6A 3L0CA 3KTDA 1V6AA 5AHOA 3U3JA 5T7BA 3EGVA 4NG5A 2GX6A 1XEAA 2BONA 2GZDA 2CVZA 2IBTA 1R5NA 1L7NA 2IYFA 4J0FA 4MQEB 3TO5A 4J7CA 4D42A 4WZBA 2R87A 1YL7A 3C5VA 4WJZA 3AR8A 4L2IB 4QXMA 4K9LA 4Z1OA 1TAHA 5HUJA 3KOMA 2KS6A 4JYMA 1J09A 1E2EA 2AN4A 1UAYA 3DE4X 5EIAA 3FN4A 1HDCA 3GHYA 3PU6A 1F0PA 2BSXA 3C97A 4LSMA 2EP7A 2HWWA 5FCDA 4RV5A 1MNQA 2FMXA 2JCXA 2VP2A 1S2IA 2BEWA 3D6HA 4UOEA 4GL4A 3RUEA 4CEJA 2Y71A 1K08A 3V4PB 5LD2C 1YI8A 1Y6FA 3NHBA 4X3PA 3RM3A 1GNSA 4AG5A 1YFZA 3SE0A 5FWXA 4GKBA 3H3XA 3QIVA 1GFSA 1DEXA 2NXJA 1V4VA 3A1VA 3ZE6A 4CI9A 5LZ4A 2L18A 1LI5A 4OP1A 4HNAA 3U3OA 5EL0A 1NQVA 3CLTC 3D3EA 2VQEB 2Q6VA 4EI7A 5ESWA 2AUNA 3ADPA 3BSWA 4G4IA 3KJEA 3PPVA 2FEOA 3SCZA 4YRAA 3SVLA 3MGKA 2XF8A 1AUXA 1ONBA 2F43A 1FYVA 3IP6A 3O7MA 4UVGA 421PA 4EFLA 5F98A 2JJ2A 3IA7A 3SXPA 2AJ8A 1XYVA 1RHUA 4KNYA 4P0PB 2OYCA 4DNXA 1H8HD 3E3LA 1SK8A 5IM5A 1DXOA 1F2UB 4W82A 3U62A 4EB3A 3BIFA 3PXUA 3T4UA 1K8QA 1BTOA 2WWRA 5E3HA 3WFJA 4RHTA 1H9AA 1NATA 4V0RA 3U2QA 4HN9A 1ZXBA 2R5NA 4C3UA 3NKLA 4DG5A 3MTAA 4EA7A 1Z4MA 1JA0A 1O95D 2WY2D 3SQOA 3RADC 1KO4A 1YB6A 1ESCA 2J5KA 4ZCIA 3CZMA 3EUFA 1FDWA 4PX9A 1AGPA 4EG0A 3K71B 2VAXA 4ETMA 1SU8A 1I32A 1UAAA 5FLKA 3VNVA 4ZQEA 3T9EA 1W88B 2CHVA 2WAAA 5ALDA 3GJ4A 1T6BY 2CYBA 2XCIA 3E70C 4QD3A 4G0XA 3I6BA 3C8UA 1A82A 1M76A 2GFHA 3OZAA 1OBCA 3D6MA 5EKUA 1LQ2A 1WCWA 4W5HA 1Z2DA 3FBTA 3HA3A 3Q8MA 2ZR9A 4EH1A 3FA2A 3E22B 2YOGA 1TQ6A 1D2HA 3E9NA 2N42A 2QIOA 5ED0A 5KS2A 2IHYA 5ISMA 4E1BA 1PWEA 1EPUA 2DEUA 3OU2A 4I6JA 5BUQA 2BEVB 4F56A 4QECA 1J1IA 4D0SA 2TMYA 4HVLA 1SXGA 4KODA 4RNDB 1NBOA 1R4ZA 3U9SA 5DFAA 3ZWKA 2DHRA 2VP3A 2WMYA 3PIIA 4Y3UA 5ALOA 2PIDA 3BHIA 3W8FA 4WJLA 1KK3A 1X9GA 4UDXX 2DY1A 5B1DA 5JNRA 5IZCA 1DRKA 2OESA 3BRWD 3JVIA 3OOSA 4H1TA 3G68A 4R0VA 5DNUA 2QJRA 3TW4A 2IU3A 1H2YA 4D6XA 1NG9A 3RYHA 3HRHA 1OPRA 1JAYA 3RKRA 3K5HA 3G2NA 4C0JA 1Y82A 3SZ3A 5CM8B 1FFGA 3WYNA 3G9ZA 2GASA 3NTUA 1QFMA 2Q4DA 2AH5A 3BZUA 4HLQB 4JU9A 3ZWYA 4ALKA 1ZNZA 3ESRA 3ND5A 5IWAB 5ALGA 2AR9A 2OT3B 1VLLA 2R6R1 3RANA 5FEMA 5LP6F 2WJGA 4H15A 4RNCA 4WA7A 5FR1A 1C80A 4X90A 1JDJA 1FSPA 1L7XA 2ZAGA 1EEHA 5ITWA 5BUCA 3CUKA 3E9CA 2G5GX 4PCUA 5JH7A 1IQUA 1OWPA 1SULA 2YTZA 1P9LA 4LJ6A 3ZGVA 4AURA 1PEKE 5EIBD 1HYHA 1LPAB 2D2IA 3P0HA 4IIDA 1E2JA 5CDYA 4MAMA 3P2KA 4ZICA 1D6NA 1M6NA 3EG9A 2CT8A 3HUDA 1KK0A 4UBJA 4LE0A 1ZOLA 1X7XA 2NAFA 1XGKA 3MMSA 1DC8A 4P3KA 3RUHA 3T7SA 2FQWA 2IKQA 4MLZA 5EHNA 2YFHA 1XCBA 1CFZA 1TEXA 3SC6A 4H7PA 3TFOA 1GRQA 5TJHA 3RWOA 3ZGOA 1P4GA 3SMVA 1NNSA 3KG2A 1UKZA 4ECEA 1FPMA 5K2MA 3ZD8A 5JWRA 1MQ9A 1M2NA 1ZNWA 3UMJA 4AUNA 2ECKA 3TG2A 2IGTA 3BD9A 3W4JA 4GEKA 4MW5A 2Q4TA 1JR3D 3KHUA 4FPXA 2QJOA 1RTTA 4PVDA 3T7EA 4QHSA 1V6CA 3ZV7A 1I7SB 4X5OA 1ZCZA 4IIBA 1VG1A 1CZUA 4N6NA 3D7LA 3MWGA 4K7JA 2XV1A 3E1KA 4DG9A 5GPBA 2XQJA 3DPIA 1OUMA 3GR6A 1UMBA 4PLVA 3TIXB 1B73A 3B13B 2IH5A 2OHXA 4L8YA 3A4MA 1E2QA 3ZBTA 2ZJ1A 1W8DA 2YXNA 3JQ7A 4D0GA 4KXUA 3H5NA 5HZHA 1Y7LA 5B3LA 3I6ZA 2PJUA 3OUZA 3BEOA 3MWDB 2ORWA 4MI1A 1PJRA 2EBFX 4IEEA 3ZQ6A 3IIIA 2WWFA 3LXMA 3S1AA 2PPVA 1ABFA 3W5IA 1I14A 5FOTA 1G2QA 4A0FA 5AM1A 4RLFA 3MWFA 2OK8A 3Q15C 4A91A 3PNYA 2QPOA 3MCWA 2EARA 3QMPA 1ADYA 4YGXB 2OTCA 4UE3S 4MUEA 4WCFA 5JSQA 3O83A 5DW0A 4FIZA 3REQB 1W9HA 3BZBA 3N2KB 4URUR 5EAIA 4URXR 2MINB 3BS4A 3F1LA 3T7DA 1UDXA 2E89A 1UFQA 2TRSB 3LFTA 1N7GA 2ZIAA 4I5EA 1KHTA 4OVKA 3FLBA 1XL1A 3ZW9A 2VJAA 4PR0A 4Q3OA 2GN9A 1KVTA 1NVKA 3DCJA 4J4HA 1L3IA 1FP6A 3FCSB 1O0CA 4G1VA 3D7SA 3PXEA 2XUIA 1FRFS 4PF1A 3QTTA 3W78A 5CDFA 5GTDA 3QZUA 1YXMA 3AERA 1TW3A 1YJXA 3EZFA 4F1JA 5FO0A 1K6IA 1GDHA 1X1AA 4B17A 3NAGA 4PS1A 3HVHA 3OQBA 1P19A 2IK8A 2VNHA 1VKNA 1YS7A 4K40A 5AQEA 1TTHA 2GAJA 3RH0A 5DXAA 4KPFC 3TW0A 1OH7A 3OQJA 3GJZA 4IVNA 4W9NA 1AHNA 3K16A 1N5RA 1C0PA 3PX3A 3WYCA 4B74A 2C4MA 2O2HA 2AOVA 4N8EA 3IP3A 4W8OA 1POXA 1RJ9A 1XJWA 4B3XA 4CE6A 5L3VA 1YZGA 2K2QB 3OEHD 1A7KA 2QMZA 4R2LA 1NW5A 3TKLA 3WGKA 5CT9A 1UC5B 4I08A 3W5HA 4ALIA 2WHRA 5KNBD 5KHAA 3VC3A 4KL8S 2H2DA 3GXBA 3LL7A 1ZX1A 4AF7A 1BH6A 3LIIA 1KZ7B 1LV7A 1EGQA 1E9AA 4LNUB 3HS3A 1U0TA 5D3KA 2Z57A 1LC0A 4G97A 2CJXA 2Q7OE 3O3NB 3ZHSA 5JDCA 4G0UA 1WKVA 1M2OA 3KKLA 2OAP1 2V9ZA 1KO8A 2DPXA 3GJ8A 3NBXX 1Z83A 1RP1A 2PX0A 1VPEA 3VPSA 5LXTA 4LBYA 3AVQA 4GZ6A 4AX8A 1Z5WA 1IEWA 1JPNA 4YMUA 3HBJA 2P5SA 3CNEA 4RXMA 2WW8A 3C3BA 3W6UA 3U26A 4R8KA 2JIMA 5CA1F 3EVNA 4WN9A 4HZUB 4HEHA 1PEYA 3GLKA 1NBIA 2HTEA 2A5GA 3Q3VA 4UHJA 1P18A 2OWEA 4F3YA 4YAOA 4L5JA 2VNKA 1G3RA 5A7HA 4NOLA 3HV0A 3C0KA 2HRBA 1NPDA 2Z0MA 4YV1A 2G7ZA 3QYJA 2FLKA 2AOTA 1CEYA 3HUEA 5F1PA 4YRFA 1JHDA 1IVYA 5JBNA 1RRCA 3GJRA 5HJ7A 1HKHA 3BKWA 1W8IA 2L82A 3FFBA 4GT1A 1GQYA 3UV6A 5A9SA 4KLNA 1KZYC 1QHXA 3GXOA 1RNLA 4KDFA 4LJYA 2X8BA 4R1TA 3U3RA 4PYIA 5DK4A 3WHPA 5JJCA 5ECWA 1HNNA 1SA0B 3QSGA 1XD8A 1XYGA 3C5WP 4H35A 1EVZA 3JRWA 4GMFA 3C5EA 13PKA 4QAJA 4TSRA 4YO7A 3V8RA 4JT4A 1ZJZA 1HL3A 3HJGA 4E14A 1G8KA 1E2PA 1X7YB 1YE8A 2G08A 3DR3A 6CHYA 3DOUA 4LRYA 3ZWOA 4PICA 4DREA 2TECE 2SECE 1P4AA 3T7CA 4Q12A 3QE4A 4V1CI 1DC4A 3KLPX 4UTRA 2AEJA 1ULTA 1M2VA 4DM3A 3FTFA 5A0VA 3X2SA 1G291 1USIA 3MJVA 3E3MA 1FP7A 4OK3A 3AB3A 3WGZA 4HUQB 2J6HA 1WZCA 2I4TA 2CD7A 2VT7A 1LFDB 3FUXA 4YT5A 1YS6A 5F7JA 4BCDA 4EGJA 1H8HA 2JFWA 2H1WA 4KE7A 5L3ZA 2FPGB 5NULA 2XRMA 2WQ6A 1EJBA 3DOEA 3ZWVA 3MINA 2P2CA 2WYHA 2AG1A 4FX2A 1GPUA 4UBLA 4FT2A 2ZRMA 4AJ9A 3U09A 2ST1A 2W58A 1R0XA 5IKOA 1LNSA 3AMVA 1E4YA 4IOMA 4OD0A 1AKEA 4LRSB 5JD3A 4BS9A 2P3SA 4Z4GA 2HFJA 4TZKA 3RS3A 3TZBA 2C3PA 4YYEA 1KYQA 1WZNA 3MJFA 5D5QA 5EINA 3TECE 3I6YA 4JEMA 4HAOA 1C0KA 1VSQA 3KU4A 2GAFA 2A0UA 3QKRB 5AM4A 2O2JA 4IIYA 1KH3A 2RIPA 3L77A 4QE3A 4KRFA 2OPBA 3X43A 5JO0A 2JIQA 1SU7A 2WNIA 4FCWA 4IV8A 1QPZA 2ODTX 3CZ5A 5E6UA 1J1UA 4Q4JA 1OBFO 3RO7A 1WDKA 1J0CA 3F9CA 3RASA 1MRZA 1ZKMA 1YHNA 3RBZA 3GQVA 4EAAA 2EKLA 3G82C 1YKGA 2G8NA 3UAGA 2VP0A 5CEFA 4M49A 3IULA 4HB4A 5EQDA 4LX0A 1PQUA 1O97D 3QG1A 4KGVA 4X91A 2BGJA 4HQOA 3WLPA 4F9FA 1MW8X 3DO6A 3MILA 1KYZA 3QJ5A 2YRXA 5GZ3A 1YBMA 3EXG2 5CVEA 4HAIA 3KZNA 3CA8A 1UJ6A 4BQEA 3AESB 1BEZA 4BJHB 5KTNA 2J32A 4AO6A 4UBKA 5DGCA 2CLOB 4JB2A 2CZQA 1T9ZA 3HLYA 2PZGA 1EK0A 3DNFA 4QXOA 3EX7C 4BNJA 4ZTUB 1E2BA 5C8VA 1EM8B 3CBGA 4FWIB 4OBXA 4R1QA 4Q7QA 3W2TA 1ISMA 1K6EA 3RE1A 2XKBA 4FD3A 4D9GA 1X3SA 1EFVB 2OFPA 2YV4A 4M0LA 4PPFA 4B79A 4GBGA 3FPFA 4R51A 2JRCA 4NI5A 3PUYA 2W43A 4C4SA 4WGGA 3DHYA 3JWJA 3WAKA 4QU5A 3GU3A 2EFDB 2Y3IA 3DHNA 2WF5A 1YTLA 2P8SA 4M6WA 3ZNNA 3FSGD 1CDZA 1GT91 2JZCA 3KHSA 4JLSA 1IM8A 4RMHA 2WM9B 1RWQA 2Q1SA 3DVSX 5DXJA 2WJWA 1Z74A 4DV0B 1P1CA 1ADGA 2C94A 2YWDA 2EL9A 1E6EA 1HLFA 4QG3A 1RKBA 5ALPA 4DLKA 5CIYA 1D2CA 3PNVA 1HYBA 2GSDA 1IZYA 4OBWA 2IUTA 5FOVA 4A6EA 2ZUDA 1U2GC 4HRXA 2JCSA 4M46A 1ZMRA 4LGCA 1LTHR 1QF9A 3SBXA 1NW3A 5HXAA 4RCYA 1E0SA 3EA0A 4YY3B 1MLDA 2WU3A 3W3ZB 2AE1A 3DOCA 4PLPA 1YI0A 2QSJA 1L5WA 1T9DA 5KWJA 4XWYA 3CPHA 1SELA 2Q1UA 4CKCA 4ZJYA 5KVAA 5DCLA 2XUHA 3H1EA 4EBFA 2Q4BA 3FWHA 4A10A 4FHGA 4UVHA 1RHRA 1P6XA 1CU1A 4J3FA 2ZVQX 3G7UA 4MKZA 5AKYA 1B42A 1JEJA 4X0EA 3NTRA 3ZHVA 1UDWA 2O0LA 4P0TA 3O7WA 4R7GA 1RYYA 4DAOA 4CR8A 3ANNA 5PNTA 2NT3A 2IYEA 2XXBA 3H83A 5DTEA 3K9HA 1BC5A 1MG5A 1Y9DA 4XPZA 4JELA 3U3DA 5JYCA 4XOUA 4DIBA 1RJGA 2CVFA 1JR6A 3DLIA 4HWTA 1PSDA 1JIXA 1UFOA 3F78A 4L51A 4W99A 5AJXA 4D0LB 1DJOA 5BV1A 3GPDG 4O2LA 5LQCA 3FCAA 2YW2A 4NFHA 3SIXA 1JG2A 2PZEA 2CFSA 3OJOA 2D4HA 4RELA 1XMJA 3C3XA 5L6LB 3LLVA 2O3UA 3ML1A 3FWYA 5LA6F 2XTAA 4UUPA 3ZDQA 3OX1A 2ZLBA 4HDMA 3S29A 4JQZA 1SUIA 2J85A 4YJDA 3E7FA 1N2ZA 4R31A 1S3SA 2BTQA 2RHWA 5IWCA 2XNKA 1V4NA 4Q05A 3TOXA 1Z25A 2O8FB 2JIZA 3PR2B 3PE4A 4BNUA 2G1JA 4IGKA 4L5BA 1T1SA 3K9CA 4EI2A 3B9QA 4NE9A 4Z4CA 2VBFA 1O96B 4L3WA 3VNSA 1M33A 1YCFA 2GLTA 2XE4A 2Z5LA 4P2BA 2H2GA 2PEYA 2QUJA 1OT5A 2FJUA 1JU9A 3UGQA 5JSHA 3LCRA 3LU1A 5C31A 2C8JA 4RSHA 1S2NA 3MTGA 5TMBA 1DT5A 4XD2A 4AJOA 4C5CA 3V6MA 4E5NA 1PVVA 2DWCA 2BFDB 3GJYA 3U3XA 3ZU5A 4JP5A 3CGWA 4L57A 2AQKA 1FXWF 4LCJA 2QUAA 3IURA 3QVTA 4C0AC 3FKSD 1K86A 1T10A 2XZLA 1UKEA 2QZ9A 1LLQA 3LS2A 3I3SR 4MW9A 1DCMA 1JWBB 4PIVA 5DNVA 5ES3A 4E51A 3JATA 3ZWWA 1O4WA 3KOYA 2V6GA 2ISQA 3HI4A 1Y8RA 2PQMA 4OBBA 3TW8A 3GLHB 4FIDA 3K9GA 4EW1A 4XWTA 5TARA 3W7VA 3ER6A 1QVAA 1IXRC 5HSGA 4H59A 1XZBA 2K4MA 2QL7A 2W42A 1W36B 1XNGA 4R0NA 1PX0A 1NN1A 4NE7A 1BD4A 3OY7A 3AVYA 3COPA 3KOXA 2R00C 1DXYA 1VIMA 2EX4A 3DYIA 2Q3FA 4UPEA 1SY7A 5K5EA 3AUUA 4OF4A 4PSUA 3RIMA 4MYHA 3BE6A 2RB5A 4L4ZA 3K70D 5BYJA 1S2DA 3OJWA 3R7SA 2FWRA 2Q2VA 1XA0A 1RW4A 3V1MA 1OBVA 1VLVA 2I2FA 1E79A 3QPDA 4FR0A 3GJ7A 3TLGA 1G59A 2I4NA 1DFHA 1CY8A 6Q21A 5JAMA 1QDUA 4OEHA 3I1FA 4YPVA 4Y6OA 1GTMA 5JHHB 4FGZA 1T3ZA 1MOSA 5E6SA 4F2HA 2RHMA 2A0XA 4YDHB 5H4GA 2IEDA 1WW2A 3MJRA 4HQ0A 3C1OA 1R3DA 5C5DA 1FVOA 3OIYA 3W4KA 2O8BA 4JVNA 4B6JA 3ZK9A 2CKDA 1IN6A 3U37A 4C4OA 4TT3D 2AIRA 3M6MD 3GEPA 3MCZA 3OZSA 2O8NA 3AR7A 4KZKA 3RYIB 2OPHA 1GDDA 2O14A 2AZMA 2ADMA 5DHUA 1TF5A 2OHVA 2C7RA 2KB0A 2CYCA 2UZIR 3KPVA 2AOUB 5HILA 2ZPTX 2BL4A 2JI6A 3REOA 1H3EA 3HDYA 1JH8A 1G66A 4XM1A 2QMYA 3NWPA 5FIUA 2O7VA 1PX2A 4W1SA 5A9RA 5LOVF 3PLAE 2M6LA 5CBPB 3LBNA 1JBKA 4QEDA 2JG3A 2AEFA 4QDUA 3STXA 3MELA 1YDEA 2IPXA 2EFYA 2UYHA 3BA6A 1T5LA 1SD5A 2FPXA 1LDNA 2OG2A 3OP4A 3L06A 1JHAA 2RAFA 4EY6A 4U6SA 3EZYA 4JA0A 4R54A 4Q9AA 5JD5A 3EZ6A 1Y80A 1AXEA 2GCOA 2IC5A 2KE5A 3R5TA 1B7GO 2B61A 3GARA 2R3SA 3ITDA 3KV3O 3SIRA 5L7TA 3UPUA 2JJMA 3FAZA 1S2LA 1IZZA 2J46A 1XDWA 4GOJA 1VLZA 1B23P 3PEFA 5KAPA 3PVZA 2ZEJA 5CITA 1AK1A 3VAAA 2Q8NA 3WIOA 2ILVA 2VXBA 5IKEA 1Q44A 3IEUA 3U40A 4Y0VA 1WBDA 5AKLA 2ZVDA 1KQOA 2AXEA 2GRJA 1NF3A 1J1ZA 3NPMA 4MIOA 4CZ2A 4JVMA 5DN6D 1WVIA 1FNNA 2ECPA 5CMLA 5IDYA 1Z35A 3TLBA 2NZYA 2ZUCA 1I2AA 4MUMA 4ZHQB 1N57A 3UK2A 5M04A 1UWVA 1WETA 1X80A 3KPJA 2YMQA 2OBLA 2AMJA 2DCMA 3GO4A 1QQ5A 4L6AA 3PNSA 2Y2VA 1KI7A 3Q3GE 2DPYA 3TWOA 3O3CA 4AMBA 5IH7A 1EGMB 1E2UA 1QG2A 3DMNA 3PGJA 1ID1A 1JZTA 1OJ7A 2HY7A 3IPXA 4FYIA 1H6AA 2W4QA 1J2RA 3IUPA 3QTBA 4C21A 4OHRA 1E2DA 5LIPA 2B69A 1HYEA 1R00A 1PQYA 5LP6C 4EG7A 7MHTA 2Q6IA 3DUFA 1MO5A 4IKOA 5AVVA 3QKSA 4OHCA 1P0CA 2LW7A 3V4SA 1KEZA 2JHFA 2Y0BA 5DXFA 4MUXA 3VAYA 2FCAA 3HM9A 3NBMA 2F3UA 2BGIA 3F5QA 3IAXA 3UJHA 4P7GA 1V3QE 2IXDA 3HDJA 5E3JA 3RSZA 1DXQA 1IPFA 3OCXA 2O5CA 5G4LA 2PUTA 1QWSA 4KDRA 1QR6A 4CV0A 2PYDA 4EELA 3UMGA 5J2TA 1AUPA 4FYWA 4Q7MB 4X85A 3R6LA 4IX1A 5YASA 4M0CA 1YUBA 3VPFA 1UPUA 2GK6A 4BMDA 5A3JA 5TGDA 4Z0PA 3CIFA 2CXRA 1QHHB 4N40A 2CNWA 2CLCX 2OMKA 2PT9A 5GJWC 1A3CA 1JPVA 4NNOA 2EOAA 2DFDA 3QLJA 3T3MB 2FW6A 4LCEA 4FJ2A 5GOZA 3PYMA 3MWKA 4FFNA 5FP0A 1BHQ1 1P1KA 2D0IA 5CDHA 1ZI6A 1C30B 2WHQA 3OQVA 1W4AA 3VH3A 3WL3A 3LQ2A 1RLIA 1EESA 2CMFA 1M7BA 3PTLA 4IJ6A 3BC1A 4TYMA 5B1HA 1OWOA 4ZOCA 3ESAA 4FMDB 1WZUA 2WILA 3UY4A 3LD9A 5EJMA 2QY9A 1OROA 3UMRA 1DDGA 4IJWA 3CWCA 4IYRA 1Z4IA 2P0YA 4PU0A 4TV9F 5AHWA 5IJ0B 1FS6A 4DUGD 4JBNA 2CK3A 1Z6QA 3HGTA 2JD0A 4JL8A 1WXDA 1X3LA 3K9FC 2BGKA 2FP4B 3O0TA 4JCOA 3RC7A 3TMYA 5JANA 3EZGA 3H1TA 2DHDA 2G9RA 3DVAB 4JEHA 1L4UA 4ZCLA 4E32A 1Y4SA 1UCFA 1XOIA 2SBTA 2DBRA 4C22A 3CNHA 5FRDA 2RJOA 2YZ7A 5F7ZA 1KY3A 4HEQA 1D9XA 2QS9A 1A2QA 4I2VA 3CMMA 4BEWA 2C1ZA 3EXFB 5IDWA 1WS6A 1N78A 1IBMB 3GDWA 4EQZA 5H02A 3T5BA 4RE6A 4RCZA 1WEHA 5AW8A 1G7CA 1CJSA 2B6NA 4X8LA 4PBTA 5BQPA 3AF3A 3R44A 2G9VA 3H2SA 3C3CA 4WN3A 3F4BA 5I7OA 2A1TR 1H4QA 2RAUA 2OO5A 3P9ZA 1DO2A 4AMGA 5I4BA 4M1TA 2XEDA 1GSAA 1R10A 3HZRA 1X7DA 5A2QA 3A6PC 4HYTA 1K5PA 1GSHA 4I14A 1E20A 3UMBA 3LWBA 1N2BA 4CI0B 2G25A 1I6MA 1HLDA 2IYPA 3D8HA 3KYCB 4HVTA 4DDKA 1XMVA 1CEQA 1SHLA 1W2GA 2YINC 1I9CA 4RGYA 2ATXA 1Y9EA 1XRRA 2ZI6A 1PT8A 3L04A 5KNCD 5I8WA 4BQQA 3OEED 4NCHA 1KH1A 5FBRB 1NF9A 5IW8A 3GGCA 5JI3E 2D1RA 5GAJA 2DETA 5AVWA 1NQUA 4UBNA 5C34B 3FJ1A 1PT5A 3ZBUA 4AP5A 2IBSA 3TK1A 1YVEI 1JXAA 1UM9B 3M6FA 1E3EA 2GO7A 3OA0A 4J0HA 5DX0A 5IABA 2SHKA 4LZOA 4XUCA 4GMHA 1BSVA 3N53A 4W8HA 1JMVA 1UADA 4XVHA 4EO7A 4NECA 5EJ6A 1BU8A 1O5TA 1IXYA 1H94A 3JR7A 2JBWA 4J2HA 1Z0DA 3OZDA 4KCGA 1G19A 5MFZA 1ES9A 5TQ2B 2CVOA 4DCUA 4FMCF 4D97A 1PW7A 2IHZA 5BSUA 2Q2OA 3ETLA 2X5KO 4GPTA 4LBVA 1OLUA 5HMLA 3HBMA 1R4NA 4B47A 2OD2A 4KMMA 1G8HA 5E4YA 2EP8A 3FR7A 4HLCA 3WSWA 3F4KA 4KXWA 3KTFA 1FRVA 3N87A 5CGQB 4B09A 4LXQA 1LS6A 1U2RA 2XTNA 1ODTC 3AKDA 4HYEA 3RSFA 2JVJA 4X1IA 5AUNB 5CRIA 2OVBA 1J8FA 3FVVA 3ROXA 4UQPA 3DDOA 2ZK7A 4TUYA 5ITVA 1PT9A 4GRAA 1SXJC 1AO0A 3ADCA 1HT0A 1O94A 3DT9A 3P0EA 2YQ4A 721PA 4K2AA 1R0CA 4MQFB 2I3DA 3Q7TA 1CS0A 2Q9CA 2J9XB 2QX8A 5TQ0B 3VAZA 4BJ5A 4WE3A 4F4HA 4AMVA 1PDWA 1DLJA 1I1OA 4HWKA 1I94B 4EMTA 3T1VA 5KINB 5FYQA 4RPIA 3K0AA 1H2HA 1ZOIA 3WLMA 1Z4KA 4EJSA 1VLHA 2ESRA 1VIDA 1C4WA 2VK1A 3ZCXA 2JCYA 4ZHQA 5A9TA 2XYHA 3AR9A 3TCXB 1K2WA 1Z16A 1C3OA 1S8NA 1V25A 3AB8A 4YDQA 4DC1A 4BWGA 5LKAA 2JFZA 1EP2B 1I2CA 2VJNA 2JKYA 3EY4A 4PVCA 5IKPA 3MIZA 2H59A 3ZJTA 1E6CA 3EEIA 1YVUA 2XBLA 2ZWOA 3A3YA 4KFUA 3TGPA 2GD1O 1D2AA 3GLGE 1GARA 1H2RS 3PNBA 5TJ9A 2JAQA 2Q45A 2ZANA 1AKTA 1S9HA 1FMLA 1PHPA 4X41A 1GL3A 5EIHA 3KJNA 1EIZA 2PKCA 2ANCA 3HY3A 2R5WA 5LBIA 1G6HA 4X45A 4X20B 3SLGA 3P97A 4GVPA 5ARCA 3D31A 1GIAA 1CEXA 2DSTA 4UC0A 4WBNA 4I9HA 1I4OA 5ALEA 1U9JA 3W6PA 4DJDC 1OLUB 1P2FA 2VJLA 2JFVA 3ANXA 1KR2A 3FMPB 3NT5A 4XZ3A 1TLTA 3RLIA 3QMVA 4D9IA 4BN5A 2PKXA 4X65B 3TOCA 2JGLA 3T5MA 3TTVA 5JZMA 1V95A 2AR7A 3M3PA 4F8EA 2DZDA 5L4SA 2BZGA 4NCJA 1UBGA 1VTKA 2OM2A 2P77A 3I12A 4QYTA 3FRJA 3WNQA 4EX6A 2P67A 4L16A 1I5EA 5ECGC 4Q15A 5ADHA 4MV5A 4QGFA 1KGDA 2A9VA 1D6JA 3UANA 3VOBA 3W6ZA 3GEEA 1SN7A 4F21A 3FCUB 4WZAA 3UK0A 3IDAA 4PC2A 3W8NA 3RVMA 5LNK1 3FX2A 2VCHA 4G56A 3DXFA 3HM2A 1SBCA 3OT1B 3ZLTA 4CM3A 4LY0A 2RAPA 3EF3A 1YS4A 4CMCA 4RE5A 1QIJA 2G76A 1KJ9A 4PLYA 2Q41A 1UPBA 4KFCA 221PA 4Q4AA 2ZSFA 1U98A 4LZZA 1PQ4A 5C7OO 3DBIA 4JGBA 1JEAA 1EI9A 2WNSA 3EQ7A 3IH5A 5DO9A 5KAMA 5CCEA 2O20A 1F8XA 5A62A 3FVRA 5GJBA 3LY5A 4BGUA 2WJ3A 4GZMA 1ZN2A 1G9SA 1ISHA 2RGNC 3NT2A 1XLTA 5FYDA 1X74A 5CVUA 3UCEA 1XPJA 3F6SA 3PQ8A 4BQIA 4ZMSA 2WAXA 1U0FA 1EB8A 5DEOA 4UAVA 1Y42X 2FHPA 3OESA 1ID8A 4UHHA 4HDNB 3DMGA 3PLRA 5EP4A 3H13A 1LEHA 4IUYA 4HR7A 3UOWA 1QJCA 2QUIA 2CLIB 2HHJA 3KJGA 1D2RA 3JZFA 2W2KA 3ORYA 3D64A 4UASA 2H57A 2OL4A 1ZGGA 1TE2A 3N2EA 4OHUA 3RIXA 1KH2A 3UXMA 2PWZA 4LNHA 4RBNA 1PUXA 5DNWA 1LBTA 2I5PO 4B84A 3CUVA 3HEBA 1T4GA 1M2EA 1XTUA 3HCPA 1IBRA 1RFGE 3SY8A 4WOBA 2P9ZA 4Z4QA 3RQSA 3II6X 4CM4A 5DBFA 3QJGA 3AVOA 2M98A 1ZH8A 4PXAA 2CN1A 4CR6A 1NMSA 2HA7A 2ZSDA 3HCRA 4GHWA 1BGXT 5ESXA 4PWZA 4GLFA 2XXAA 2X22A 3KKPA 3R3ZA 4OY3A 1EU1A 1CNMA 3N0TA 3NM6B 1T9GS 2X3YA 7ABPA 1A4RA 5FTJA 4RD1A 4X00A 1TTTA 4N3BA 2ROQA 4G2NA 2EC5A 5CCDA 1THTA 4AJEA 4TKZA 1SU6A 3CLHA 5CLQA 4LXIA 5AHRA 3X3HA 2H7YA 2YNMD 2Q5CA 1Z0FA 1XVAA 5ERYA 4DDUA 5LYJF 1E7RA 5KYYB 3H6GA 1G5RA 3BT7A 1HSZA 3G2JA 4O4HB 3LCJA 3ZD9A 3OQOA 4MLCA 2ZXUA 5FUVA 4H3VA 4HUJA 4K2HA 4GVXA 5L53A 3SDBA 2V7GA 4M89A 3JQ8A 3DBRA 3E58A 3F90A 3IKLA 4MMYB 5DWQA 5KYNA 2V0CA 3I6MA 5TF0A 2M6RA 4JP1A 2X4DA 1ORRA 3IA2A 4QUBA 4FILA 1ORWA 2Q6TA 3EIUA 4FBGA 3L0PA 3QXGA 3T8YA 4NJMB 1MDFA 2GAOA 1TA9A 3OZFA 3P9NA 3ETGA 2X4GA 4CIAA 5B58T 1KMNA 1Z7WA 1EIWA 2ZJAA 1R50A 4DEYA 4DHEA 1E9EA 4QOIA 3L7CA 2V3VA 3QY0A 4Q3NA 4R2HA 2JARA 1C7ZA 1M1YE 1OWNA 3BMCA 1GZ6A 3CG4A 4QBGB 2CK3D 4N12A 4LF7B 3FGZA 1DIGA 1VMEA 1L9KA 2X76A 4Z49A 5HX7A 1OX6A 1YL5A 1TYEB 1YBAA 1VLJA 1TA4A 3PGMA 4U7HA 5L3SA 1XRSB 5KZMB 2ZSUA 1NASA 1YUMA 3EXEB 3RTCA 3G9UA 4KIUA 1BGVA 4YCAA 4NESA 4P4UA 5E7JA 3AFMA 1SHZA 2GK3A 3ND9A 3NEAA 1TZ2A 1QC5A 1UMKA 3AY3A 4GAEA 4IH9A 4AY4A 1NA5A 1ZH4A 2XDQB 3BZWA 3S70A 5F1OA 3S99A 5K6AA 1OFGA 4YHHB 4X6UA 2PE5A 1PHRA 4KDCA 4PZUA 3R09A 2WJIA 4YRLA 1Y4UA 3GAAA 5LLSA 4I3HA 3UH0A 4ZEMA 4GL2A 1TADA 1LF5A 3KAKA 2VG8A 2YMMA 3BB1A 4LYDA 4OB7A 3TSZA 1U0BB 5IF3A 2R7AA 4O4HA 1E3MA 5JAZA 1KYYA 2ZXEA 4KB5A 2CVQA 4R3NA 3QNUA 2GXQA 2XDWA 1MOPA 1T5OA 4PBSA 2ZB4A 4HDKB 1A9PA 3Q9NA 1X6VA 4Y2YA 3IMEA 2OGTA 1F17A 2QT9A 2HA4A 4FHEA 1DG3A 1Y5LA 4OQNA 1WCV1 4U3JB 4DCVA 4YUZA 2E4ZA 1ZSYA 2C9OA 4AFNA 2BUAA 1T1IA 1WMFA 1AKRA 3ND8A 4LDNA 4XVQA 3VHLB 3WGGA 1CUJA 5G0SA 4DA7A 1W93A 5JXGA 1R8JA 1RM0A 1PLKA 2IUFA 2QTLA 2R8ZA 2JDID 1P45A 1LDGA 1Z4NA 4LMPA 4B9AA 5GVSA 4I9NA 3IUEA 4KDEA 4ND2A 4TKVA 1C41A 4JUCA 1YZFA 1F9AA 3FDZA 3IQXA 2FFRA 3EGOA 1KAQA 4CMBA 3FDXA 5JE8A 1NVXQ 1JJAA 1VLQA 1NXTA 3H8SA 2EDAA 4ZKDA 3GJ5A 3FZNA 1KI3A 4E4RA 2YS6A 3MS7A 4FGJA 4N6OA 2WIJA 2XD9A 4RM3A 4US2R 4FFOA 2QX7A 4NMLA 3OU6A 4CIBA 4RIGA 4BTLA 2FZGA 1ULBA 1Y5IA 3J7TA 4MDHA 2G3YA 2ZR0A 1BCRB 4B2IA 3PC2A 4LEIA 2NTEA 2QJWA 5FOWA 3UHAA 3TNYA 4TL6A 3W5DA 4TSKA 1YDGA 2XADA 1GGNA 3AIMA 1NVAA 1M1YB 2ZJ0A 1I2DA 1KIAA 3PPWA 5T4EA 4E5DA 4LJ7A 1UOOA 4FN4A 4MH0R 4WA8A 1MHTA 4E22A 4KVGA 2NZXA 4RZ3A 3WWDA 3T5AA 3GLIE 3E5RA 3O73A 3V80A 1G8PA 3MHTA 1TPYA 2VYQA 5D7NA 1XK6A 3Q9SA 4M0PA 2BCGY 2X6QA 3PNLA 4XCQA 3S7TA 2RJ3A 3KQOA 4PTYA 4XA8A 5BRNA 2CBGA 3WJ2A 1RBYA 2FK7A 3PICA 4ZCPA 1VYVA 2C2GA 3D0OA 4HDKA 5EXSA 1KTIA 2FNAA 4A03A 2XGGA 2WBLC 3V8PA 1NI3A 1EFAA 1PGOA 3WIVA 3H9UA 5EUCA 1KMQA 3H5IA 4N03A 3RODA 2D8MA 1KMHB 1L6IA 5TEWA 2WJVA 1EWQA 3LX8A 3ZI0A 4RXTA 3T0IA 3RHSA 3KZ1E 4YJGA 4DNQA 1Q57A 1P5HA 1V9LA 2OWDA 2UZ1B 3H3FA 1SWVA 1XWWA 4FYMA 2HQSA 3WBKA 2E48A 4PLTA 3T0FA 4ZAFA 5AD1A 3NNSA 3R6GA 3ZYCA 4PGMA 2C78A 1D4ZA 4WADA 5FWAA 1LC3A 1GZ5A 3GEBA 1EE2A 3OZBA 1C1YA 3MCAA 4LF5B 1QIFA 4TXJA 1YH3A 3N8HA 4CKWB 5LQDA 2WE8A 3QSYA 4TMYA 4YT4A 4XIIA 1FFWA 2VXOA 2AN5A 2P8JA 3DDSA 4MUKA 4QDOA 2R7KA 1U7PA 4HUQA 4TLMB 2A57A 1YIDA 1KK2A 3VXKA 4ZI5A 3KQYA 3N2ZB 1MB0A 2YIJA 1I2ZA 3JASA 4S2EA 4EUNA 2E4AA 4LW8A 4TSFA 5KQSA 3CNQS 1E2MA 4GLOA 3KVRA 3FKJA 3O1LA 4AZSA 2P6OA 1R1DA 2P4EA 2WWWA 2J4FA 2HGZA 1GOTA 1M9NA 1P4RA 2C5LA 4V0MA 1AGYA 1CR0A 1VZ3A 3LE8A 3ZS9A 1EM6A 4IS3A 5BWLA 4WK2B 3IUNA 5HTOA 1BX3A 1HQKA 2X1LA 3KJZA 5AKKA 5EPOA 2G1AA 1GG2A 1HQDA 2OGUA 1MJGM 3GBSA 3SF8B 5IYZA 5KYGA 4G0NA 5HGJA 3OJCA 1ZJWA 2ZPAA 3GVCA 3NBFA 4JUAA 1CUZA 5ALZA 1H2BA 3O82A 1MXFA 1LVHA 5HK9A 1N1MA 3RIEA 2VYNA 2AX4A 3EXIA 4B8ZA 4WLEA 2VH1A 3TJZA 2ZT8A 3IMGA 1P5FA 5K3AA 3TTWA 4WUVA 2EDCA 1ZD8A 1CQJA 4D43A 1FTQA 2XZDA 1CZKA 4FD2A 4QBKA 1VL5A 1OE0A 4K86A 4KLRA 3ZDAA 1XPUA 1XRPA 2D06A 4DCNA 2G1UA 1NJSA 3Q0IA 4B6PA 4RTKA 3GLIB 3DUFB 1NSFA 2Z8ZA 3PNOA 1M72A 1RXYA 4DARA 3T35A 3L7BA 4MS1A 4Q19A 3VPXA 1PFKA 3QPCA 4ZVTA 4OLBA 2ZZMA 1VHQA 3HCFA 1QHNA 4D3FA 3PTAA 3MS2A 2G9QA 2PSJA 3M6XA 3R6WA 1QWOA 3BK7A 3HPRA 4QODA 1YZVA 3QM1A 1D2NA 3V4FA 4NIMA 1SXPA 1XVLA 3CJQA 4B35A 4MI3A 4R9RA 1PK7A 4GO1A 2YWXA 4MMXB 3R7BA 1TKBA 4FBMA 5CHEA 2HM7A 2MYTA 3JQFC 4BO0A 5JCOA 4CQMA 1GDTA 4P84A 1N5OX 1HPLA 4HS4A 4WZAE 3TM4A 4Y6PA 2F62A 3EMKA 1PR9A 2QD3A 1KQPA 2ZULA 3FCEA 1LRJA 3HXKA 3H11B 4NENA 4RV4A 4UM5A 3KR1A 1X0XA 5CW2A 5IVDA 5IX8A 1WSWA 4QFMA 5CLHA 3U5TA 3DZ8A 4C0WA 1UKAA 3HYNA 3BMQB 1DAIA 3RC2A 2MR5A 3M1LA 3WGTA 1QOPB 2DFPA 2J7KA 4DPMA 2J9YB 4UXJA 3TM5A 5M34A 2DQZA 3K6SA 2PRIA 4MVJM 3A7DA 1BA3A 1QIMA 1X7WA 4H17A 2X3UA 3UK1A 3ZHQA 4NRDA 4RVUA 4P53A 2C04A 3MTBA 4NATA 5KSPA 4C7BA 3AK4A 4Q93A 4ZVPA 2YOFA 1P1RA 1VPLA 1T3SA 1AZLA 3EEBA 3I9FA 1OZFA 4IJ5A 3SR3A 2XITA 1ENYA 1M34A 2QTVB 4EHKA 1AS2A 5KCMA 4Q1FA 4RPKA 3R9XA 3P27A 4M1YA 3D4OA 4N7BA 2OHJA 4RMJA 2VHZA 1AN9A 2BN4A 3WR5A 5BSGA 5F7XA 1N2JA 4LF9B 3LI2A 1EGHA 1HTBA 2CY0A 1XVIA 2G63A 2GJ4A 3AF2A 3KQTA 1L6RA 3QBEA 3WLRA 4AG3A