3OG9A

Structure of yahd with malic acid
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
206
structure length
206
Chain Sequence
MTDYVFKAGRKDLAPLLLLHSTGGDEHQLVEIAEMIAPSHPILSIRGRINEQGVNRYFKLRGLGGFTKENFDLESLDEETDWLTDEVSLLAEKHDLDVHKMIAIGYSNGANVALNMFLRGKINFDKIIAFHGMQLEDFEQTVQLDDKHVFLSYAPNDMIVPQKNFGDLKGDLEDSGCQLEIYESSLGHQLTQEEVLAAKKWLTETK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Regulation and structure of YahD, a copper inducible alpha/beta hydrolase of Lactococcus lactis IL1403
pubmed doi rcsb
source organism Lactococcus lactis subsp. lactis
molecule tags Hydrolase
molecule keywords protein yahD a copper inducible hydrolase
total genus 78
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3og9A00
1ZI6A 1P0QA 4K6GA 5HQ3A 4H7EA 4W1RA 5I8PA 5T4HA 1JJIA 4X6YA 4G1FA 4BVLA 5A6VA 3R0VA 4B84A 3WWDA 2C0QA 2XUAA 4BBZA 2EDAA 4BE9A 4ETWA 4J0HA 4Q1VA 5E4YA 2WIKA 6YASA 4QE3A 3W04A 4L9AA 1DT3A 5AK6A 1IVYA 3V1LA 3FBWA 1D07A 2FJ0A 3QH4A 5EIEA 2Y6VA 3I6YA 3LIIA 2H7YA 5FKJA 4MWTA 3C8DA 3D2CA 2OAEA 2ZYIA 1XZBA 4A23A 2HFKA 1KU6A 4HVTA 1XLUA 5FXMA 5AOBA 4OB6A 2RI6A 1LPAB 2G5PA 4QDTA 4S0XA 3SC2A 1K5PA 2OGTA 2VEOA 4Y2RA 2WHQA 2HRRA 2JGLA 4ZI5A 1CUZA 5EHNA 2PPLA 3BF8A 1Q0ZA 2RONA 4UBJA 2PSFA 1EB8A 5BWBA 3N2ZB 4OYLA 3WA7A 5ALRA 3WWEA 1UK6A 1CUAA 1EA5A 1WM1A 2G4LA 3WK9A 3V1KA 5KREA 1E3QA 2DR0A 1XZJA 4KRYA 1C7IA 1IZ7A 1R9NA 2BJHA 5JADA 2JGKA 1A8SA 5JYCA 4X94A 1H23A 4EY8A 4PO3X 3C45A 2VQ6A 3AZOA 4UHFA 5CXXA 4EA6A 5AK4A 1MT3A 5CURA 1E89A 3AZPA 4F60A 4B9EA 1LPBB 2OGSA 3F98A 2ACEA 4OB7A 4FLEA 3ZLTA 4DSAA 2GBIA 4PSDA 4EHBA 1UFOA 5AIAA 4NZZA 5LZ4A 1ZD3A 1HQDA 4HXEB 1TKRA 2J4CA 2XUOA 3BE8A 3AILA 1AKNA 1EB9A 2HU7A 1OILA 3KOOA 3WK5A 3HACA 3RK4A 1G4HA 3DYIA 1ZI9A 5ALGA 1VE7A 5FPQA 3VKFA 5JAHA 1WB5A 3VJMA 4AZ3A 1LPMA 5EHQA 4DGQA 5JD5A 1ZGBA 1W4LA 2HM7A 3TGLA 4G8DA 1QIJA 4LXHA 1CUIA 3PUIA 3U1TA 3LLCA 3PI6A 3M82A 1YASA 2QUAA 1FFCA 1XRNA 1QIMA 1J2EA 3DOHA 3STYA 1YCDA 3NWOA 3X3HA 5ALKA 4CCYB 5C8ZA 2JIDA 2XMSA 1TAHA 1XZIA 1CPYA 2XQGA 4I19A 1GT6A 4WDRA 4ITVA 1DX6A 5AO9A 1XKLA 5ALQA 2XMCA 4QDOA 4WCVA 2WUFA 1EH5A 4DNQA 4H77A 3G02A 1X70A 5LZ8A 2XQKA 4E11A 1ACJA 3WL6A 4UBOA 4DSZA 5K3CA 3WWPA 3G0DA 1XZKA 2I78A 1K6EA 2OCGA 1DU4A 5C7YA 1C7JA 2VF2A 5AK3A 2VT7A 5I7UA 5K3BA 5BWCA 1AX9A 4GHWA 1CUWA 2HRQA 5A71A 1YAHA 4HRXA 5T4FA 3RARA 2B20A 4OCZA 4KJXA 1NX9A 4P92A 5D6OA 2ACKA 1EI9A 1HPLA 2BUBA 3SX4A 2BUAA 2QRUA 4KYVA 4F21A 4LXGA 3E1GA 2ONCA 3W06A 3WK8A 5IVKA 4RNCA 1L7QA 4CG1A 1THGA 5LZ5A 1BCSA 5BV7A 4G5XA 3WZLA 4WY8A 5AI9A 3D2BA 4TPKA 1TK3A 1UK9A 3O4JA 4AO6A 3DJYA 1ACLA 1QIHA 1TIBA 5EHZA 4TGLA 4AN1A 3C5WP 3FLEA 3BDVA 5LKRA 3KDAA 3HXKA 2XUQA 3W2TA 3HSSA 4FNMA 2H1IA 1A8UA 4PW0A 4QNNA 1XZMA 3GZJA 4AO8A 1R9MA 2WIFA 1ZOIA 5AKHA 1UK7A 3G0GA 1XZGA 1ODSA 4GWLA 1ZI8A 4KRXA 4M0MA 3VVLA 4W1SA 2PL5A 1RP1A 3ANSA 4KE9A 3WA6A 2XMZA 1LZLA 3FVRA 4Y2UA 5AIBA 3ESDA 2Z3ZA 1DWPA 1HBJA 3DCNA 1CUBA 2QTBA 4RE5A 4UPDA 2XT0A 1UOQA 4BP9A 2XQIA 2XDWA 2HU5A 3HJUA 3Q8WA 2I3ZA 1CUJA 4Y2SA 3B12A 3HABA 4QDXA 3EQ9A 5ALHA 1LPPA 2PSEA 1QIGA 1FJ2A 3DNMA 3TEJA 4H0CA 3PE6A 5C8XA 1JKMA 5DNUA 1WCYA 4Q05A 1QO9A 2XUKA 4JEIA 5AKZA 2OPHA 3WYDA 2ZYRA 1MX5A 4UFPA 5LZ9A 1CUGA 4B80A 4EY7A 4WFJA 1VE6A 5ALIA 1LLFA 2GYWA 5AM4A 3G9TA 5JZBA 4MEAA 3FNBA 2WUDA 4KE8A 4OPMA 4OB8A 1XRLA 3C8HA 1ZD5A 5A7FA 5JD4A 2IX9A 2E3JA 5AKYA 5FPPA 3A70A 3STTA 4BATA 2Y2UA 2WM2A 3WWOA 2VAXA 3BIWA 2J4FA 4FMPA 2Q0XA 4Y2PA 2GYVA 2WG2A 3KD2A 4MYSA 2VSQA 2HA5A 4F5ZA 3OG9A 4IO0A 3T52A 1Y37A 2RHTA 1L7AA 4U2FA 1W1IA 3W9BA 2XMDA 2WFZA 5YASA 2K2QB 4HZGA 4CFSA 3WLAA 3WYNA 2JGMA 3STXA 1CR6A 1U8EA 3BJRA 1GXSA 4ZREA 5EFZA 2DHCA 3IVMA 1TQHA 3WQHA 3IULA 3WKDA 1Z68A 4OUKX 2ZJFA 3DYVA 3CN7A 4QLAA 5LZ2A 5ISMA 5K3FA 4C88A 4Q3KA 3DKKA 1CUDA 5AM1A 4HTAA 4Z49A 2QMQA 3STUA 3I2FA 1TCAA 2W22A 5EHXA 3IIIA 5HKAA 4X71A 4UBLA 4BZWA 4C6HA 3L1JA 5JANA 3V9AA 3O4HA 5JAPA 4B82A 1HL7A 2OLEA 4P9NA 5AKXA 4B9AA 4G9GA 3H19A 4JYMA 5D7BA 3I6MA 1XZLA 4CIBA 4HRYA 3H2KA 4DIUA 2XUJA 4X6XA 1EDDA 4BTLA 3FAKA 3N0TA 1GGVA 1LBSA 4DM7A 2HA6A 5AKLA 1WPXA 1XQYA 4U2DA 1SCQA 1K4YA 2P8SA 1FFAA 3HLKA 3NOXA 2R11A 1LZKA 1MAHA 1N5RA 3IURA 2VJCA 1GKKA 2PSHA 1CUHA 4HAIA 4AQDA 1UWCA 2R8BA 1XZHA 5D3ZA 5JASA 4X95A 1U4NA 3A6ZA 1M33A 5HQ3B 3QITA 4J0KA 3WJ2A 1BEZA 3BXPA 1OXMA 5ALPA 4MJ3A 5KWJA 4K6KA 1UOOA 2DHDA 3GFFA 4B7ZA 2Z5GA 3S8YA 4BDTA 5LKAA 4HXGA 2VATA 2JBWA 2C7BA 2XUIA 3WZMA 4IHAA 4X91A 3E3AA 3LIPA 2HA7A 5HK8A 5I9IA 3H1BA 2O7RA 4FOLA 4JYPA 3SWWA 5AICA 3B5EA 4U2GA 1CV2A 3C6YA 5CMLA 2WIGA 4FFWA 4H35A 1T4MA 4BCDA 5AOCA 4H7IA 3FYTA 2WQZA 4FWBA 1QFMA 4GDMA 2XE4A 2O7VA 1DTEA 2YH2A 4JUIA 1VA5A 5DTJA 4N5HX 4EY6A 2QXTA 1MPXA 4H7HA 3D59A 1H2WA 4J0CA 4J0DA 3GBSA 1EVQA 2EDCA 2ORYA 1JI3A 3RLIA 4B6GA 1GZ7A 4E14A 3LS2A 3G0IA 4IH4A 4RPCA 2GBGA 2I3DA 2UZ0A 4BCCA 2YXPX 4NVRA 1NU6A 5K5EA 2X8BA 3M83A 4H7FA 5CT6A 5T4EA 4QEKA 1DINA 3M3DA 4DMCA 2Z8ZA 4N8EA 3WKBA 4QZVA 2XB6A 5J3JA 4OU5A 3KWFA 5DLPA 5A62A 1QGED 3O4GA 1MN6A 3C43A 2PSJA 2PX6A 1XKTA 3GA7A 2BGNA 5HKBA 1CUVA 2OAGA 4AN0A 4Y2XA 5HF9A 4J3JA 1RWQA 4BRSA 1F0PA 1XZFA 5FP0A 2C5GA 3R40A 4DMFA 2CJPA 1YA4A 1Q0RA 1G5FA 1QE3A 1EVEA 3L1HA 3O9VA 2OCKA 2AXEA 2HA2A 4U2EA 1MO2A 4GLBA 1R50A 4V2IA 2VJBA 4XIIA 1AURA 2H7CA 2DFPA 3EQ8A 4BVJA 1XZDA 1CUFA 3YASA 7YASA 4RE6A 4DNPA 2JGEA 1XQVA 3AFIA 5ALMA 3MUOA 1EDEA 4ARBA 5ALYA 3I6ZA 4QA9A 4CIAA 1QO7A 1Q84A 4F0JA 2PUJA 3DD5A 5K3AA 5HCUA 3FSGA 4D9JA 4BZZA 5AKEA 3K6KA 5AOAA 5K3FB 4PV7A 5HK9A 3ED1A 5IVHA 2ES4A 4AMZA 4Y2JA 1UT6A 1MNAA 1WHTA 5H3HA 1W6RA 4KE7A 2AJCA 3QPCA 4B0OA 5EIAA 3WKCA 3ZWQA 4UFOA 1YB6A 3JW8A 2QUBA 3O9MA 3CCCA 2RGUA 4EBBA 1W75A 5FOQA 3MUNA 1GKLA 3WL8A 4BP8A 2RHWA 3H17A 4FTWA 4WDQA 2VJDA 2V9ZA 3RM3A 2BGRA 3DS8A 2FUKA 2QJRA 1YSCA 2XUGA 1GPLA 3V1MA 4BE4A 4YASA 1XLVA 1LPOA 1IMJA 4J03A 3CN9A 1DX4A 3D0KA 2ZYHA 4UHCA 4G9EA 1UKCA 3FYUB 1KEZA 4W9RA 3WIOA 3C6ZA 5FDFA 1EK2A 5BOVA 1MNQA 4G8BA 4PNZA 5HZGA 1DT5A 1QIKA 4K2AA 1E8NA 3WMRA 4MYDA 2CKMA 2OQIA 1QJ4A 1YAJA 1ZICA 1SCIA 2G5TA 2WFLA 5HF8A 4WJLA 3L1IA 3E4DA 4MEBA 5AI8A 2H7XA 2CBGA 4Y2VA 2X5XA 2CUTA 3FWHA 2D5LA 2OCIA 5AH0A 3PFBA 4ZV7A 2XQFA 3A2NA 2WHPB 1E5TA 1Y7IA 3R3XA 3G9XA 3ANTA 1R88A 3WL7A 4FHZA 4P93A 2HA4A 3I2HA 3VJKA 3EF3A 1DWQA 4ARAA 3H2HA 2WTMA 2IITA 2XMGA 1Q83A 2AJLI 4K5QA 4PSCA 1H2YA 2J3QA 4FKBA 1IZ8A 5JIBA 1USWA 4X92A 3U0VA 2BAGA 1FFBA 2B4KA 1FFEA 1QFSA 2D0DA 5E4JA 5JZ9A 1ISPA 5ALSA 1UOPA 5IVDA 3F97A 5T4BA 4YPVA 1O6FA 3DL7A 4H7JA 2JF0A 3WI7A 1FFDA 4GXNA 1A8QA 3QMWA 3ESCA 3WJ1A 1IUPA 4IQ4A 4C89A 4KEAA 4C4YA 5ALUA 1IUNA 4BAZA 4GW3A 3AIKA 5LIPA 4CI9A 4QWMA 1K63A 4J0JA 5AI4A 5ALVA 3E0XA 4AB1A 2JEYA 1LPNA 4FLMA 5AK5A 1HLGA 4LXIA 2C5FA 1YB7A 1ZIYA 4MQMA 1QIEA 4QDZA 1CLEA 4UBNA 5EIHA 3H2JA 1YA8A 4FLFA 3FLAA 5KBYA 2DSNA 2HA0A 3AJAA 1QIFA 4DLNA 3HC7A 1I6WA 4X7BA 5KWIA 4DMKA 5JD6A 3I2IA 3G9ZA 4W63A 3C5VA 1TCBA 4J0IA 1AQLA 5HFNA 1E8MA 1EHYA 3PICA 3O95A 5ESRA 4FDMA 4XX1A 3ESBA 3BIXA 2QVBA 4W1QA 3WK7A 5ALJA 2ZYSA 3D3NA 4N8DA 4ROTA 2WLSA 2VA9A 4CCYA 4WY5A 2GBFA 1VKHA 3IUMA 5AM2A 1DWOA 3G0CA 3C70A 4EY4A 1F6WA 4YX9A 3DL4A 5JARA 4L72A 2RIPA 3W05A 1CUUA 3H1AA 4OYYA 4UFNA 2WJ6A 3VISA 1S8OA 2I03A 1UZAA 4UHBA 1U2EA 4B83A 3HEAA 3H2GA 4G8CA 1IUOA 3QYJA 1AUOA 2J3DA 3F9CA 1LPSA 2C0PA 2BFNA 4W1PA 3MVEA 3O4IA 1SFRA 1CUSA 1ZIXA 2W6CX 5CH8A 2B9VA 2XLBA 3W9UA 3ZV7A 4E15A 5E4TA 1XFDA 5AM0A 1WOMA 3ZLUA 3PF9A 1NU8A 4UHHA 3VXKA 2ZVDA 4ZWNA 5AI0A 5ALOA 2QXUA 2XMRA 4DNFA 1EX9A 1HKHA 1R3DA 2OG1A 4OD0A 4DNOA 2V97A 2QOEA 3OURA 1T2NA 5AKKA 1CVLA 2WKWA 3ZLVA 5A7HA 4M0FA 1U65A 5FV4A 1ORWA 4H7DA 1GPNA 3HI4A 5HF6A 3VJLA 4JNCA 1JT2A 3IUQA 1QTIA 1GPKA 1MJ5A 1X2EA 3R3UA 4Q82A 1XRRA 3C6BA 1LBTA 2ZJ7A 2B61A 1WB4A 3QPDA 2PKYX 1JMKC 2O2GA 4Q34A 2JGFA 3C87A 5CT8A 3G8YA 3Q0TA 4ZXFA 1CEXA 1EXWA 3IDAA 3STWA 2GYUA 3R3VA 3UMJA 2PU7A 4BVKA 1DQYA 3BJMA 1ZJ4A 5FRDA 1Y7HA 5AKGA 1QIDA 1BCRA 3NUZA 5A7GA 4Y9SA 3IBTA 3SK0A 1CIJA 5CT5A 1BN7A 3JWEA 4C87A 4I3FA 1UXOA 1P0IA 1K8QA 2VT6A 2PM8A 4GECA 5LP1A 3LCRA 4B0PA 5K3DA 1VZ2A 1XRQA 1BS9A 2QZPA 5A2GA 3R3YA 5JZSA 2ZSIA 3F8SA 3ZI7A 3WL5A 4XJVA 1OCEA 4BYMA 3UUEA 2YASA 4AXBA 3ILSA 3AIOA 5IH7A 2DQZA 2PBLA 3QM1A 1G42A 1JJFA 3AINA 3A2MA 4DYHA 5CT9A 4BDSA 4NS4A 3EIOA 2Y1KA 5LLSA 5ALFA 5C81A 3A2LA 4ZV9A 5DJ5A 5AI6A 4DTCA 1MAAA 1L7RA 3K9BA 5CTAA 3NGMA 4B85A 4C4XA 4X00A 3TJMA 5ALNA 1WHSA 3ZPXA 4EUSA 3FLBA 3CXUA 4UHDA 5ALWA 4Y2TA 4LYDA 1QONA 1QTRA 2WUGA 4X93A 1H2ZA 2PU5A 2PUHA 4H7KA 5ALEA 2VAVA 1SCKA 5AKIA 1MU0A 3F67A 2WU3A 5JAOA 4IH1A 2CMFA 1SOMA 1BEEA 1FSSA 3VVMA 2XUHA 3I2GA 1ORVA 1ODCA 3AZQA 3QPAA 3G7NA 1UKAA 2BCEA 3QVMA 3H18A 5AJHA 4LHEA 4G4IA 1P0PA 3JYHA 2QJWA 3CCBA 4Y2YA 3MGAA 4AMYA 2HIHA 3IUJA 3GELA 2QM0A 4KAJA 4CG3A 1R1DA 2WILA 3AUKA 5CW2A 4MQLA 5DWDA 1W52X 1DQZA 4IH9A 4N5IX 3M81A 3DOIA 3PF8A 3QZUA 5EGNA 2WFMA 2XMQA 2Z3WA 2OXEA 4ZRDA 1CUYA 1G66A 2JGIA 2QT9A 1E66A 2XQJA 3R41A 4WFKA 3OPMA 3WIBA 4X3CA 3H2IA 1HDEA 3ICWA 2OCLA 1WB6A 5D3KA 4Y2QA 2YYSA 1QOZA 1LGYA 3WK6A 3FYUC 4UHEA 1X2BA 3FCXA 1XROA 2C4HA 5HF5A 5CXUA 3I2KA 4XWGA 3HZOA 3D2AA 3I28A 3VDXA 4AZ0A 3WWCA 4BC0A 3D7RA 1W76A 4QWWA 3V1NA 4TVKA 2AJBA 1BRTA 1N1MA 3PDCA 1QIIA 2JGJA 3OM8A 5ALLA 1J06A 4QLOA 2WG0A 5ALZA 4U2BA 1XRPA 1B41A 2AJ8A 4X6UA 3BF7A 3H0CA 4U2CA 5AM5A 4LYEA 2V98A 1ZD2P 3D5EA 4L0CA 3FSGD 5FLKA 2V96A 5ALTA 1B6GA 3I1YA 1P0MA 3DEAA 5CRIA 2HHAA 5DTIA 1VZ3A 3QMVA 3I1IA 1MTZA 4UBKA 4JH0A 1UKBA 1XLWA 1JU3A 3K2IA 1O6GA 3S2ZA 2HDWA 4C01A 1J1IA 4PQEA 3P2MA 2OQVA 3KSRA 2DCMA 1CRLA 2HA3A 5LYYA 1J07A 3PUHA 5C8VA 4INZA 4AO7A 1EK1A 2FX5A 2CEKA 2H9YA 2LIPA 4M0EA 1YS1X 4A5SA 1THTA 3BWXA 4GI1A 5SYNA 1E8DA 2QR5A 2ROQA 4PF1A 1AC5A 2ECFA 3R3WA 2Y6UA 1C4XA 1YR2A 2WSLA 2BKLA 4LIPD 4CG2A 3BL8A 4H18A 3R3ZA 1VXRA 2O2IA 5K3EA 1H2XA 2RAUA 3FVTA 4HS9A 1R4ZA 1TCCA 3O0DA 1GQSA 2GBCA 1F0NA 2DQYA 5IKXA 3ICVA 3DLTA 4XVCA 5E2IA 5AHXA 3FOBA 4FFVA 5DYWA 1EDBA 1VOTA 1CUXA 3OTQA 4BAGA 2BUCA 2WFLB 1XZEA 5DNVA 4KAAA 2X76A 5IVIA 5JATA 2GZRA 3C6XA 4KAFA 2EEPA 4FBMA 4EY5A 3QMMA 3I2JA 2WJ4A 2PVSA 3G0BA 1XZCA 2HU8A 4NMWA 1JFRA 4RGYA 3RKSA 4BAUA 3WKAA 3OOSA 3ESAA 1A88A 3EBLA 2WTNA 3IB3A 3EQ7A 1BE0A 3OC0A 2JEZA 1JJBA 3AIMA 2XLCA 3UUFA 3H04A 4P08A 5AP9A 5FUMA 1CUCA 1XQWA 5SYMA 2QKYA 5AI5A 2WHRA 1RYYA 2VJAA 3TRDA 2HADA 1A7UA 4GEGA 1XRMA 2WIJA 2Y2VA 2ZSHA 2HL6A 1VA4A 1VJ5A 4I4CA 3FCYA 1CQWA 4BTVA 4BRZA 2CB9A 2XI4A 3HRHA 1JMYA 3GUUA 1BN6A 5AM3A 3KWJA 1AGYA 3LP5A 4ZGBA 2WJ3A 4OSEA 1MX1A 1XZAA 4YK7A 2VTVA 2Z8XA 4X97A 2IIVA 1CUEA 4Q3LA 4KE6A 5DYTA 3GROA 3FYUA 4OU4A 5CH5A 5LZ7A 1MX9A 4FNGA 2G63A 4CCWA 3HYSA 3D4LA 5F4ZA 4X90A 4BC1A 1AMNA 1SC9A 3DDUA 3KXPA 2XUDA 3STVA 5DYYA 2WUEA 2XUPA 4MXDA 4Q3OA 1CFJA 1F8UA 1XQXA 4X85A 1ETHA 1PV1A 4EB0A 4UBMA 1EINA 4EZIA 4J7AA 3B3QA 3WKEA 5CH3A 5HFAA 1ZD4A 3BDIA 5EI5A 1VLQA 2WG1A 4LKOA 3PFCA 4K6HA 1JU4A 3DKRA 1PJAA 4A16A 4G4GA 5AKJA 1BU8A 2XMBA 2XUFA 4HXFB 3G9UA 4QDUA 2C58A 4DMHA 3IUNA 5CT4A 1PFQA 4WFIA 2WU4A 2NW6A 4MWSA 2O2HA 4UBIA 2GZSA 1BROA 4GBGA 5JAUA 5ALDA 4J0GA 4N8SA 3WK4A 3T4UA 5ALXA 3IA2A 1UK8A 4O08A 5JALA 3V48A 1ODTC 1YS2X 4Y7DA 1GQRA 2ZJ6A 2FJPA 4KR0A 4FBLA 4PSUA 1WPRA 1AZWA 1CQZA 5CBKA 4BCBA 3QBJA 1H22A 3DQZA 4B81A 2WHPA 3F96A 1ZJ5A 2PSDA 2CZQA 4G4JA 1VXOA 2QS9A 4BB0A 1KU0A 2WIDA 1N5MA 1TRHA 2AJDA 2DHEA 4E46A 4KACA 4AX4A 4UUQA 2OGZA 4C4ZA 2HFJA 1QLWA 1LNSA 5DNWA 1QZ3A 1ZGCA 1N8SA 4L3WA
chains in the Genus database with same CATH superfamily
3OZDA 4E5DA 3AI1A 1MW9X 3MPOA 5AT1A 2J7KA 5EEGA 6PFKA 3HXQA 5TQ0B 3MCTA 4X6YA 1ZR4A 2WR8A 2I99A 1Z12A 1X7XA 4G1FA 1KERA 5FB3A 4V0QA 3UC5A 1N8KA 4XVUA 1NJ2A 1ZN7A 4FYIA 4BMZA 1AVTA 2DQ4A 2PAAA 4BVLA 3CUTA 1KBQA 3IT3A 3ZHTA 3L0SA 3L1UA 5CBPB 5MN5A 2FN3A 1QLJA 2ORWA 5BWMA 2ID4A 3LOPA 4H0NA 2BLNA 4AMVA 1W36B 2C0QA 1H5NA 1KOJA 3PSHA 4P36A 5LQAA 4LG1A 4GSLA 3T7DA 4HQRA 4JJ8A 1G8JA 5EE5B 1L5KA 1IWOA 2BIFA 4C20A 2D2IA 2WIKA 6ABPA 3KKZA 4DCTA 3ZZNA 1FRFS 3P0EA 1J0XO 2ZWPA 2IEGA 1XPOA 1M2NA 2WUWE 1A9ZA 2XD9A 2PS9A 4JU8A 3V1LA 2E49A 3F71A 1P2VA 2YIJA 1CF9A 1MGOA 1NR7A 3FBWA 3K8YA 1U2QA 3KK0A 4G0MA 4JUFA 5EE3A 3SEZA 1EFRD 2FJ0A 1H8ED 3KYIB 2Y6VA 3Q98A 1I01A 3LIIA 4JK3A 4YRCA 2H7YA 3ZOZA 1EXDA 1ZW6A 1CULC 3L8GA 4M0CA 4MWTA 4KDCA 2XA9A 4FVTA 4MR9A 5C53B 1NMXA 1TZJA 3R23A 4TYPA 2FR1A 1SD5A 1XZBA 4BFLA 1QPZA 3UXHA 2MSDB 4EL0A 5FV7A 4DCSA 2ZBPA 4Q1EA 3BD7A 4MKRA 3EFHA 4HVTA 3OZIA 1QWOA 4NBTA 1M66A 3X43A 3U4CA 2XB8A 4OGWA 3D8TA 5IYZA 1ZH6A 1Q2XA 2R1ZA 5C8YB 1YIAA 1OH7A 2B1RA 5EKSA 1Y5MA 2NUBA 2YXBA 4R1MA 4JDPA 3EXIA 2B7CA 2JIPA 2VEOA 3BAFA 4MMZB 1U28C 4GZ3A 4D44A 3CT4A 1DFGA 1CUZA 4B2PA 1GGEA 2VHEA 3MGKA 5A04A 4RCVA 4GOJA 4Z1MD 4D57A 2ZJOA 2C95A 1S1CA 4Q4HB 1GNRA 3OLWA 1EBBA 2V7QD 1SMKA 4O3MA 3BJEA 4W7SA 3MCAA 3O8RA 1NUUA 5JPDA 4Y9DA 1Z36A 1E3QA 1WAMA 4Y0AA 1DHRA 1IUKA 1L5SA 3P96A 4RORA 3KZMA 2AMJA 3ZXUB 2AEMA 4I2NA 4EH1A 4EPYA 1H8HA 2D4AA 1FRZA 2DH5A 2II6A 4M8KA 5CLQA 1JQBA 5JADA 2B8NA 1A8SA 2UXDB 4BN4A 4IGFA 4MPRA 2O3SA 1W88B 4AZWA 1GEEA 2I7XA 1CR4A 1H23A 3KOMA 3QA3E 2DPMA 3C45A 2WA2A 3AZOA 3QE3A 4UHFA 2CXTA 4OM8A 4CGYA 1XTPA 3I3OA 2HYIC 3DZFA 3HP7A 3JPYA 2N3ZA 2BGMA 3S2YA 1L5GB 1P2FA 1IBRA 1U2PA 3OUUA 4OJQA 4S1PA 4M87A 5IZCA 5JVDF 1RM5A 1RBYA 2OLKA 4O25A 4BUZA 3C97A 2OGSA 3VM6A 2ACEA 5HCNA 2I6FA 1ATIA 2GBIA 4Q4LA 3AVTA 2GNOA 3DM5A 3LA8A 5GAJA 5TJHA 1OFHA 2ZZMA 4NZZA 1T8RA 1W46A 4LHXA 1AQIA 1TOAA 4RC9A 4UUBA 3B1XA 3SVTA 2FSGA 4R1QA 1SXPA 1U1DA 1ZD3A 1TO1E 2NOAA 2IEZA 5L3SB 1QB8A 5A3RA 1E6MA 3VSCA 2QV7A 1UBOS 4NONA 2QNIA 2BKAA 4LY6A 1Z6PA 5FOSA 4MR8A 1NYRA 3K70B 4HXEB 3BREA 4RHCA 2O05A 5JPIA 4JMPA 4M49A 4RPLA 3ZQJA 1Y1RA 3JWIA 3L7BA 2RHMA 4Z0PA 3SE0A 3ZCPA 3KP1A 1NMZA 3NZEA 4RD3A 3WRXC 4NSNA 1PJZA 1YUMA 2OV3A 2OYSA 3CTPA 3LBAA 3NNDA 2VJYA 4WVFA 3P9ZA 4AS3A 3I34X 4B09A 4XPIA 1SU6A 4RGQA 1CZOA 3KTFA 2JLQA 2BELA 4CKWA 1XMPA 5F5NA 1II9A 2H00A 3GO4A 3IBGA 2IQIA 1DEKA 3BGSA 3IPLA 3NIGB 4I2VA 3VJMA 5L6MB 2A9PA 1AQNA 4HUTA 2B3TA 1NN0A 2BF4A 2CJYA 4CN8A 4DARA 2E4ZA 2H0RA 4CKYA 2AF3C 4EGFA 1OFUX 1EMDA 2RBGA 3LC0A 3LX6A 2QTVB 3MF4A 3RG2A 2OKCA 1YQQA 1K6MA 3IUSA 3LUHA 3TGLA 2QE6A 2BM0A 3FN4A 1Y1SA 1TMOA 1S2IA 4YTEA 5JMWA 3OOJA 3DL2A 4TN5A 4NNPA 4I8XA 3TTYA 4K6MA 1TF2A 1YK1A 2QGZA 4KVFA 2WHXA 2NWQA 3C0KA 1CUIA 3E05A 3PUIA 1U1EA 4FKZA 4FOPA 3SE7A 5IEJA 3HU2A 4P34A 4OHOA 3PI6A 3JQ6A 1YS6A 4HVAA 1VC2A 3DCJA 5DNAA 4JJ4A 4M54A 1T6NA 4A73A 3OF2A 3BD9A 4K9SA 3D8HA 1XRNA 2EJBA 1QIMA 1GU0A 2P90A 3NT4A 4I5FA 3AB8A 3V6MA 3STYA 1SVSA 4NG5A 4DZZA 3OM9A 3X3HA 2WF9A 2GD1O 1U98A 4PO1A 2NPFA 1GL7A 5EWJB 3KNZA 4Q5IA 4R01A 5LQNA 3EEFA 2JIDA 2AE1A 5LQCA 2YDYA 4JJFA 1Q1EA 1CPYA 1SUDA 2Q49A 3OTHA 3EMDA 4QJ4A 3UIEA 2HLNA 4B5LA 3CLUC 2ZRFA 3QY9A 4DMMA 2H5IA 5KYUB 1MEJA 1YD7A 4Q9KA 1QU2A 3PQFA 2HV8A 5AO9A 1XU9A 2OZVA 1M1UA 5LUBA 2FH5B 2Q5FA 3BIFA 3MN1A 3DFZA 2FA9A 1NVMB 1T2EA 1FNMA 3Q8LA 2I3BA 2XMCA 4DR1B 2P0YA 1USIA 2D13A 3RDPA 1K8ZB 1EH5A 1R9JA 2FRXA 1IY2A 1GG2A 4DNQA 2V65A 3FPJA 1OKKD 1Q21A 4L15A 1M9NA 2CV1A 5JZOA 5CLIA 3G02A 1PG5A 1F12A 3DONA 1KEUA 3JR3A 1ODJA 1IYZA 3K0CA 4E11A 2EBFX 1ZJYA 1A8HA 1T9KA 1UP4A 5FIUA 4MYTA 1FYFA 1BD3A 1BWPA 1WY7A 2ISQA 1C9NA 4UBOA 2QIOA 4ENPA 2WJIA 3WWPA 1CDOA 3HUUA 3PNQA 3CKYA 3PE4A 3SLRA 3SHOA 3ITNA 4YUAA 1HURA 3RS5A 1WSWA 2ZRQA 2YN2A 3DZCA 3JQBA 4F3NA 1OUMA 5BNIA 3KDPA 4MWDA 1N4DA 1GZ4A 2YNMC 3W78A 4J9UE 5CP8A 4DXDA 1L1RA 3L4KA 1XJQA 3GIDA 2B7LA 4DLWA 5AK3A 1XPUA 1L3CA 2VT7A 1PLLA 5I7UA 1OFVA 1SRQA 1EG7A 4EVRA 5JT1A 5KTYA 3HVRA 5BWCA 1NTOA 3HKBB 1PV2A 1K5GA 1P3Y1 2SHKA 1IB6A 1U9CA 3MC1A 1B43A 3I92A 4JOCA 1KKUA 3QELA 2HRQA 4LZOA 4ZAYA 1TEZA 5A71A 4DAOA 3HCAA 4UUAA 3RTEA 3JAKA 4Y18A 4XQGA 3JD2A 4I36A 1N2ZA 1ZHOA 4HYQA 4NCBA 5BR4A 4UMFA 2YZMA 1YWGO 4M98A 2R8XA 1IQPA 3HJNA 4ASUA 4MQEB 4CM3A 1Z15A 1V47A 4PSAA 4G5FA 3ADPA 3N39C 5HDBB 4EUFA 5EIWA 3DTNA 4Z3KA 2W37A 4LBWA 1DX9A 3QTBA 5KWEA 2G5GX 5KTTA 2QRUA 3AFOA 3OQ6A 1D03A 3SYKA 4V1CA 3ZE7A 4CXMA 2TYSB 4HEA6 2BE7A 4EPWA 2WRZA 3DVQX 4Q7LA 5LQKA 3W06A 3S81A 5GZ3A 5JWHA 5J5AA 5IVKA 5B4VA 3T5BA 2X2PA 4KB5A 4FZ5A 4X63A 2FSHA 4E5YA 5HKLA 1IHXA 2WF5A 4QBKA 1M2OB 4LJ7A 4PGGA 4G41A 5FOVA 2VT3A 3WZLA 1XXHB 4O3FA 3FKSA 2UAGA 2PLAA 4EKYA 1K5DA 3BQ9A 4GMKA 1P7CA 2YDXA 4LXYA 4EUNA 3WGOA 1G8KA 1UK9A 4EG4A 3TTWA 2IA5A 4JBXA 3LQQA 4LNHA 4MVJI 5FR1A 3RVKA 4DLPA 1P17A 2XRFA 1U2DA 4NE9A 3HS3A 2R79A 1KJIA 1WZIA 1VB3A 1E0JA 3NHFA 4UUNA 3WAKA 4ALIA 3RUDA 2FN7A 3PEUA 3RVLA 1SKQA 5EHZA 2RHCA 4AN1A 5CVCA 4F38A 1JHRA 4CMCA 4UU1A 2GLXA 3A3OA 4KO8A 3RC3A 1IVSA 1BDJA 3FLEA 3DWFA 5LKRA 4BWFB 3EVFA 3DWIA 5JS2A 4OH1A 1Y4AE 3MWYW 4G5YA 2JFGA 2XUQA 1TKBA 2JLCA 1AB5A 2JD1A 3QE0A 3SMVA 4DUPA 1QQBA 4PNHA 2FPPB 2B8WA 3GJ3A 3H9UA 2QVZX 1KZ6A 4E08A 4AUMA 1NRIA 2XEXA 1E2FA 2GILA 3ANLA 1LDBA 2PHZA 4N47A 2H1IA 4OJNA 4Q24A 3JASB 2Z08A 5CB8A 3DE5X 5IJ0A 4QATA 4L8GA 2YWFA 4EFLA 1EWVA 2Z4RA 4TMWA 1I3CA 3AF2A 1U5CA 3G0GA 1XZGA 4TMVA 5HDQA 2WT8A 5JNWA 1ZI8A 3PKZA 3FPHA 2JKVA 2IS2A 1K2VN 1CIVA 4W1SA 1EX6A 5DN6A 4D79A 5G41A 5CIQA 1A69A 3KRTA 3WHLA 2DUWA 3R5KA 3O94A 4WW0A 1KIMA 1FS5A 2P75A 3HMQA 4UHKA 2VNHA 3ANSA 3TSAA 2K4MA 2GPNA 2AC4A 3AETA 4HTFB 2Q3BA 3EZXA 5CB6A 1LZLA 2IHYA 2W83A 5DM1A 3ELWA 1LH0A 1ESMA 3V55A 1KC3A 3TUJC 2C4VA 1DWPA 1OTHA 2XADA 3LE8A 3Q5DA 1XPRA 4V24A 4EAQA 1E6CA 1OFUA 3EXFA 3ZV5A 4FYKA 4IEIA 4BY9E 2X6QA 1E9RA 1ISSA 5ETJA 3LUPA 3RJ5A 3T9EA 1NLZA 1Q16A 3IKMB 4YHBA 3RU2A 3T0GA 2PUCA 2P3SA 4C3UA 1RVDA 4PAWA 3VYSB 3HWRA 3LYHA 3HNRA 4QT4A 2PLNA 3OLZA 4WKBA 4KXVA 4ONEA 2HU5A 3P1JA 1L4LA 1PZNA 3HJUA 2IYVA 3T5AA 3U81A 2P27A 3W6NA 2EXXA 4Y2SA 3EZ2A 3QEMA 1PQYA 2BC9A 3HABA 1RJFA 1Z5WA 2ZYGA 5EJ9A 1SEPA 4YJGB 1W87A 1Z0AA 1Z4IA 2YQ4A 3BGDA 1DOAA 2PSEA 3PC8C 1QIGA 2RD2A 1FJ2A 3DNMA 2J7PD 1GG8A 3FCAA 4H0CA 4MVYA 1M6HA 1JLSA 2WD8A 5C8XA 2PE5A 1JKMA 1DSSG 1G3IA 1L5YA 1QMPA 4AD8A 1FUYB 2FW7A 1M1NA 3NVMB 1XEXB 3GUCA 1RBZA 2QVGA 1DBSA 1GCGA 4Q05A 4BNGA 2ZYTX 1COZA 2R48A 3C3XA 3AUYA 3O8BA 2QUZA 4PANA 4C76A 3EASA 3GV0A 1JFLA 3T7SA 4K6CA 2Q0SA 4FZVA 4HH1A 3ESQA 2CLCX 3L04A 2NVWA 1M34B 4M1ZA 1ZMXA 3NHLA 5LZ9A 3M2TA 4B80A 3R8FA 4UXIA 5F73A 4ZDWA 1VE6A 4P7GA 5C31A 1FQKA 1MOZA 4KLAA 1C5KA 3E48A 4RLQA 1ZZGA 2OZLA 4NIMA 5AXDA 3HVKA 1ZR2A 2ZRIA 3CZ9A 3FHTA 2BBTA 4FEGA 5EMKA 1UKEA 1A4UA 4TTIA 4DMUB 1H4QA 1MV8A 4LNUA 3WQSB 4HNAA 1ZNWA 2OBMA 1XAIA 4YUYA 2CLSA 1B8OA 5FLXA 3JX9A 4RGVA 1BSVA 2WE7A 1UPCA 2DMRA 4W6ZA 1KPHA 4NPCA 1EFUA 5JJKA 1TM3E 1Y89A 2FQXA 4Q00A 5EWJA 1ZD5A 4XUGB 3OAAA 4KC0A 1EFPA 5A7FA 2OL4A 4CFYA 2AN5A 2H2IA 2VAWA 5AKYA 2O6HA 3A70A 2OPBA 2PYDA 4PONA 1ZH0A 2GEUA 1VL8A 1TMKA 3MJ4A 4N7RA 4HGZA 4ENQA 1S4MA 1P39A 1ZKDA 2FNAA 1KQ3A 1HUQA 4JI3B 3VDNB 1E3EA 2YC4C 4GPAA 3WWOA 4O6VA 1WA5A 4MQ4A 1JGTA 2CV2A 4AIIA 2GD6A 5JROA 2CVFA 2GS9A 1EAYA 3L93A 3AP2A 3LOUA 4ESEA 4GOND 3OE4A 1WW3A 1E4YA 2HA5A 1EFHA 2XT6A 4GICA 5KNBD 4IO0A 3T52A 4NOKA 1GSHA 2C2WA 4EYOA 1K7YA 4BFXA 3J81k 1LU9A 1JWAB 1RFGE 2RHTA 2VZ0A 2VYNA 3OE7A 4HGPA 1UFRA 4I81A 5MFPA 1KEKA 1QHIA 3BCSA 1KZ9A 2XMDA 2GRAA 1SQ6A 2HLDA 5LA6F 2C98A 1K8RA 1XUOA 3BEOA 4G1MB 2QMYA 1GD1O 4XWAA 4C7JA 3WLAA 2HJGA 1YZNA 2IF2A 2QTFA 3FUUA 4CM8B 2XE6A 3TR5A 2CLHB 3HZRA 3ZBTA 3ZWMA 3ETLA 4C04A 4WGFA 1UR5A 4UAUA 5JBNA 4DMGA 5BVHA 1LLUA 1AHHA 1W0CA 1V3VA 1RCUA 3P94A 3DE4X 4ZYUA 4Z53A 2I1WA 4UJ3A 2JFHA 3FB4A 3MCVA 3IVMA 2GTPA 5BMVF 1TQHA 3M7IA 2B4AA 1C1HA 3K92A 4JROA 4LTMA 4OKNA 4W8HA 5HBGA 5DOZA 4QSMA 3UAZA 1L4YA 3IULA 1QRSA 1U8TA 1YZVA 2GZAA 1RHRA 2JJYA 3FCOA 1U7ZA 1WXHA 3DYVA 3M6FA 5BSWA 5A0TA 4R69A 2GJ8A 1PT7A 2PQMA 5AW6A 2CD9A 1QCDA 4EVSA 3PZBA 4KOAA 4DJTA 1PFKA 4L8VA 5IHPA 2ZULA 4ALJA 3DUFA 2GUGA 1P8AA 2B69A 1FIUA 4QG7A 3K0KA 4OOEA 4FGWA 3W6PA 2AUMA 2CJWA 4G0ZA 4U6NA 4Z49A 3OIDA 3S7ZA 1H3NA 2QMQA 5LCXA 2O8BA 3DTYA 2W2TA 1C7RA 2UZAA 3H1TA 4N3AA 3TBKA 4UQLA 2A67A 4DBVO 3CLTD 4OX9B 4X71A 1L7NA 2YVQA 2Y4NA 1XYYA 2FMUA 4R2XA 5BVGB 4P86A 1E63A 1ZM3A 5FQNA 1RWOA 3K0FB 2MSWA 2QT0A 2BMWA 3M0EA 3C1TA 3O4HA 1E3MA 5JAPA 3B1FA 4G5RA 1QBGA 2XYPA 3JSAA 2Z9BA 4H7PA 3D6HA 2JCXA 4OHXA 1JPJA 4GQAA 2I4NA 2V5AA 3QOFA 1Q6YA 3P9XA 2OESA 2A1IA 1T1RA 2HSJA 4XDGA 3R9WA 4HLDA 1T35A 4QQFA 4TSKA 2O5EA 4D9BA 1P61B 4AQ7A 5AKXA 2J6BA 2EC5A 2YJ6A 4EENA 1ONOA 1Z06A 1QR6A 2Q5IA 1YIOA 1DIHA 2OMEA 1XZLA 3V80A 1AHIA 4GX2A 1MDFA 3UG7A 3ZY4A 3M4YA 1YR6A 3UOWA 3IXQA 3WX0A 1VI5A 3FMFA 3RFFA 1U63A 3SEFA 1ID1A 1XWIA 4BXOB 1AQYA 1SULA 4AAYA 1KO4A 4N49A 1JDBB 2EQAA 4RO0A 1MOPA 1E62A 3P9SA 1FTYA 5AKLA 4MPPA 5DBFA 1XQYA 4U2DA 1SCQA 1GG5A 4CZ2A 3KHTA 3LVRE 3M33A 3R2JA 4FI3F 3E22B 3MAAC 3HLKA 4EI2A 1E5XA 2Q9BA 1L4UA 4ND6A 4UZEA 3NOXA 1I3OA 5D5PA 4C0QC 1P77A 1K86A 1MDBA 1QYDA 2ZDHA 3VI4B 2PQ6A 1LZKA 1W0KD 3IURA 4WT7A 1YQDA 1TYZA 2VJCA 2WMDA 3NEJA 3LQ1A 1DV2A 1QNLA 1GKKA 2I34A 3EQ2A 3FPSA 1H1TA 3THOA 5JXIA 1DG3A 1DMSA 4K9MA 3MQ2A 4HAIA 1KE1A 3G6WA 1SC3A 4AQDA 2VF4X 2RJNA 2ZPAA 4Q9LA 1UWCA 3OJEA 4G67A 1XZHA 3RU7A 3C3EA 4YUVA 1GPJA 3PCRB 2BOVA 1O7JA 1ST2A 3ANMA 5AUNB 3KO8A 1I4WA 5JSZB 5HNKA 2GYYA 1G2OA 2FK8A 2H8GA 3T5DA 4MGKR 3K9CA 2JARA 5HFJA 3GP5A 1NVVQ 3O91A 3IE0A 3IQWA 4URUR 4F92B 4AG6A 1VL6A 3Q72A 1G18A 1W0KA 5ALPA 4MJ3A 3USCS 3IUEA 4MWBA 4LQ4A 1WUHS 2EIXA 3TK1A 1NW5A 3QG1A 3SVLA 1P5FA 2WQ6A 1X7WA 2DHDA 2PXAA 3DCIA 4RM2A 4WN9B 4C7MA 4EA8A 5ICSA 4DRXB 3GFFA 4I4TB 5DF1A 1JHUA 1YJ5A 2I2FA 1IONA 3KAJA 4U9UA 4B7ZA 3OCUA 5BSGA 3GRAA 3T7KA 1KVRA 4C0BA 1BOOA 1D6NA 4YFVA 4HXGA 4XJSA 4YDQA 1KQGA 2C7BA 1FTWA 3HR7A 3ZW7A 4RHEA 4GXTA 5IN5A 3S68A 2O19A 2HUNA 4R1SA 5GWXA 3S2IA 3OQIA 2H52A 2ZRPA 4GMHA 1H2AS 4R0VA 3UAVA 1XQ9A 3T9DA 3VNQA 4JYPA 1L5NA 4A1FA 4BO6A 5KTNA 3TSCA 1JB9A 1CV2A 1IOWA 5I7WA 1UOEA 3UBTA 4EW2A 5AHKA 3KTAA 3L7AA 1R5BA 3ZCTA 1T5OA 3RS2A 1VLMA 2BN4A 3PSAA 4H7IA 3CNLA 1QGDA 2FPXA 2ZTSA 3S1LA 2DUMA 5IDXA 4GDMA 5FBKA 2G1AA 2O7VA 2XE4A 1JSZA 1Q0PA 3LUJA 3P8ZA 4M0PA 5KKAA 5JWOA 5K4GA 3J81A 1C0PA 1VA5A 3Q9NA 2FW0A 3GGCA 3HY4A 3KSAC 4Q12A 2ANBA 3VBCA 1G17A 3BUSA 1A9PA 2WTAA 4N5HX 4V2UA 2W90A 2VPXA 3AWDA 3PQ2A 4KN5A 1K3UB 3VGJA 2IEIA 4FS8A 3E9CA 4RTRA 4Y1EA 2W6ID 3HNPA 1H0RA 2RG1A 3SDBA 3EFEA 1H2WA 2GD0A 4LZLA 2V58A 1XCGB 4TZKA 1LLDA 3TLKA 4Z9AA 3TSOA 4BQIA 1C4WA 4P31A 3F2IA 5ITZB 3I37X 3KBOA 1E0DA 4YA6A 2EDCA 1OHHA 3MBOA 1S89A 2D54A 2VDQB 2ZRMA 4IO1A 1SBCA 3B7WA 3TNYA 5IRCD 1LW6E 2C92A 2KM1A 4B6GA 5HUHA 2X1HA 4RIFA 5IMBA 2R6JA 3UAGA 3W6OA 3AGQA 1EDZA 2J0UA 2PGLA 4QXAA 1KI6B 4E12A 3Q1LA 4NULA 4D3FA 5EXSA 1YBMA 1NM5C 2FPSA 4QO7A 4WNAA 5FYQA 2RHOA 3IAFA 3IVCA 5AK0A 2HGSA 1IEVA 5KNBH 3QBVA 1CQJA 5KOJB 1J22A 2P4QA 4UAGA 2JD2A 4EMBA 1LDEA 5HYVA 2OXRA 2X8BA 3TL2A 1JKIA 2ZRLA 3FDZB 4NCIA 3TZ6A 1DINA 3IE1A 3ER9A 4OO3A 4S12A 4N54A 4CMIA 2NV2B 4JYBA 3TQCA 1U2SA 3MB5A 2BH9A 1Y63A 4GWGA 4OU5A 3KWFA 5DLPA 1KI1A 3KCQA 5A62A 3CV3A 3O4GA 1MN6A 2BMVA 2XBMA 1ISFA 3OTIA 1JG2A 1N57A 2HSDA 2Y0BA 3NTRA 3SN6A 3NBZC 4G5OA 4NCHA 3ZS9A 2HKIA 3LL4A 1Z2OX 4B4UA 4U4AA 3WRYC 1NW8A 4QHYA 1U7HA 4TXMA 4M1KA 5A5FA 1I7SB 3ER6A 3KR2A 5IT5A 3THXA 4Z7JA 2AR7A 1URPA 3QXHA 3ROGA 3U7QB 1R8XA 1D1SA 1QO0A 3UV6A 1KFBB 2IYPA 4BRSA 2P1ZA 4TKMA 4KVGA 3TQRA 3UXYA 2IX3A 3KB2A 4BQQA 1JHAA 1TZKA 1L4NA 3R40A 4DMFA 2CJPA 1RXUA 2CFIA 2DBQA 4CLHA 1M8GA 4HN4B 3ZU4A 2DP4E 4ZVMA 3FD8A 4FD3A 4GT1A 2PGDA 5J40A 2Q5CA 3E70C 5GONF 3U3JA 1IBSA 2J0UB 4CKZA 2GAFA 1ZAYA 1LV7A 1W59A 1ZP6A 1KP2A 2ZWAA 3IAM1 2P2GA 3E3NA 4IKEA 5KEIA 2CSUA 1O0SA 2VJBA 3CIOA 4LFBB 1EWRA 2H9IA 1Z82A 2X9QA 4Q48A 4Z3DA 5HRUA 2VDVE 1GQOA 1NATA 2DFPA 2OD2A 2G70A 3QKSB 5ITZA 3VPCA 4BVJA 1BCRB 3D4NA 4RFSA 2N42A 1DIAA 1JJ7A 2N9UA 1CUFA 1GL3A 3BERA 3FTCA 1B2LA 4R2HA 5DGHA 3YASA 3FYHA 7YASA 5HKKD 4DNPA 3FF4A 4URFA 1GYRA 1W73A 4HG2A 2WJPA 3M34A 4PPGA 3RVRA 4URHA 3BHIA 3MUEA 1N2OA 1WUYA 1S4QA 4BBJA 5FWXB 1RC0A 1U4OA 3B2EA 1GTSA 2O8FB 3F5SA 3GMSA 4NZYA 1HTBA 2O2SA 2IHJA 2QNRA 3HPRA 1R6DA 2JI9A 3R76A 4MKIA 1C1XA 1SAYA 4OSOA 3UYLA 2C7RA 4GWKA 3I9FA 4FYPA 4XDYA 2R6R1 3OMXA 1DCFA 1J6UA 2QRQA 4QA9A 2DOKA 4BGUA 2NO5A 1J20A 4WEQA 1MJGM 4CIAA 4HWTA 3O2SB 1XEAA 4E32A 2NZVG 5HRCA 2UU9B 4PPYA 3ILVA 3R5TA 1Q12A 2QTCA 1XK7A 2P77A 3DD5A 3QHAA 4JLWA 2NG1A 4IMPA 5HCUA 3FSGA 2H11A 1NL3A 1R4AA 1ZL2A 2H4ZA 1Z4NA 2IYYA 3LL7A 5EIBC 4C4AA 1PR9A 1NJSA 4MVCA 5AKEA 4D9JA 3K6KA 2QI9F 5AOAA 3MA0A 5K3FB 4KR2A 3GNTA 4RSMA 4PV7A 4ZAXA 3ED1A 5I47A 1L9XA 4OY3A 3CNQS 1FNBA 3EG9A 5EJ2A 1ZCBA 4AMZA 1KORA 4Y2JA 4RFLA 5CX1A 3LP8A 2MOKA 4JP8A 3RRZA 1EWTA 1NRJB 3Q85A 5EJEA 3K7EA 3BWDD 4YT4A 4KE7A 2XT9A 5ER6A 2RB4A 3RIMA 3QWAA 1WZEA 2W6PA 1FK8A 4M6WB 3TLYA 5EIAA 4D4GA 2O07A 3TE7A 3L7LA 1PEDA 4GO1A 2RHDA 3ZJUA 2TMYA 4Y6QA 3GPDG 3SEQA 4KFCA 3AEZA 3GEBA 4IHJF 5CYFA 1NT2A 3JQBC 4BP8A 4LYHA 4D74A 3RUAA 4TMFA 4EI8A 4RD2A 1Q1GA 4AY6A 4CJXA 5JRDS 4LMAA 1U1CA 1RRFA 4PHFA 4C05A 3KXDA 1VHLA 2HCFA 1QK4A 3LHFA 3MB8A 4JZKA 1YZ3A 2C2XA 2Q27A 4GR9A 4I8IA 4L5IA 5HJ7A 5K03A 1XDWA 1EBUA 3FOCA 5FOWA 1LBHA 3KSMA 5H59A 3RM3A 2VS1A 5C2JB 3BXZA 1G19A 2N75A 3DS8A 2ZCUA 1RIFA 1C29B 2BPOA 5CCDA 2P9BA 2QB5A 3AY6A 3PT5A 4JCOA 4FGLA 4IUYA 3OLCX 4UJ5A 1KWGA 3PQDA 2XVZA 1I9CA 3H2SA 3V1MA 4BE4A 3EMBA 4YASA 4BNYA 1IXYA 3IMKA 3LV8A 1ND5A 3ABZA 4X61A 4ZIRA 2ZQZA 1E9CA 2XWBF 3AR4A 3SYLA 1JBKA 1ZZEA 4KTTE 1Y9ZA 2PZAA 3FHJA 4J3FA 3TD2A 2FETA 3ZNNA 1MQ8B 3D0KA 4DJDC 2VRWA 4ZA2A 3A37A 1UKCA 3L6OO 4ZP1A 1MVLA 4IEFB 2V55B 4HRAA 2DUJA 3DO5A 1KEZA 2QD2A 1EP9A 2OGWA 4AXXA 4K9KA 5K6TA 1XU7A 5M2QA 4W9RA 4I55F 2BGWA 1JDNA 3ENZA 3QX8A 1GL9B 2R1TB 4G36A 1N32B 4AJJA 3C6ZA 1YJCA 5T5QA 1NVTA 2QSJA 5TT1A 4IDDA 5FDFA 3EGWA 1EK2A 3C7DB 4EG5A 1B26A 3UOAB 1E4EA 4IHJA 1EYZA 3HP1A 1JHDA 1U04A 3HFGA 3O8QB 4YN3A 4L22A 3UPUA 3EDQA 1OROA 2V3VA 1XKQA 2VDRB 1W96A 3CZMA 3GGSA 4BFTA 5F9MA 5ECWA 1BS1A 3GOHA 4YJ3F 2GT1A 3DZBA 3NBKA 4K2AA 4PFKA 1JR3A 2H54A 2FZCA 5TV2A 4MI9A 1L4FA 1E1CA 1VMKA 2D8AA 3Q3VA 5KYKA 3UY4A 4KRFA 1KDYA 4I55A 4CMHA 1CJVC 4H4CA 2CKMA 3PQ4A 4MYDA 1G7RA 1G2QA 1P29A 1FYWA 1HEUA 5B7QA 1ZU4A 3ER8A 3IEVA 2G5TA 2YJ3A 3A9RA 1U81A 3LDUA 4O4IA 2Y05A 5FJJA 4ZOLB 4U5XA 2XW6A 3V2HA 5HF8A 1T91A 1WZ2A 4TZTA 1DKLA 3R0ZA 5EJFA 1S9DA 3E4DA 3FWKA 4MEBA 2HHHB 2R84A 1VSQA 1T4BA 4I7EA 1GCOA 4RQUA 2H7XA 2E21A 3A05A 3GT3A 3OE5A 1HV8A 2BFCB 2UYGA 4JEMA 2J9YB 4Y2VA 2EZ9A 2IIQA 2HEIA 3TLMA 4DSUA 4YY3B 3TTTA 5HZMA 3UJBA 1ONPA 5C9ZA 4UU7A 2JLYA 2X5XA 2CUTA 5CFMA 1XXLA 3LPDA 2D5LA 2ZIGA 4YB8A 1ZVQA 3G1TA 1QYCA 4DCNA 2X19A 5IKPA 3PV0A 3AUUA 2CVHA 3RREA 3UWMA 2ZR9A 5EPOA 2PG3A 4PCLA 3WMEA 3A2NA 3QEBZ 2PD4A 3DUWA 4GYKA 4LY9A 3CU5A 4E2FA 4J91A 1K75A 4I46A 1DJMA 5K0BA 1QUFA 1P6QA 5F1PA 3E8XA 3AF1A 2GRJA 2YY5A 2E4WA 2WFAA 4HNAB 3V1YA 5JI3E 3DT9A 5FFMA 1P9WA 3LNCA 1M7BA 1J0DA 3X1JA 1YC5A 2BFEB 3ANTA 1KQNA 5BRAA 5CVVA 3TO5A 4P93A 1MQ9A 3G13A 1O3YA 3EZ7A 1JA9A 2HA4A 2Q6KA 3ZD8A 1S8FA 3C3KA 3EF3A 4P6VF 4HDKB 2WJHA 1U8UA 4EKEA 2V7UA 3PXDA 1QPBA 2JRCA 2QG9A 3R5FA 4I50B 4XIJA 1OC4A 4P2BA 2IITA 3WG9A 2BWJA 2GPJA 1F14A 2VQSA 1ATZA 2JGNA 2B25A 5FBLB 2IODA 3HHPA 4BECA 3DBRB 4H27A 1ZM7A 2WV9A 3OZ7A 3AJRA 3AM1A 4K5QA 2XVYA 4KXNA 2ZFUA 2C2HA 3OBIA 5CNJA 1DAOA 1QVVA 1RCFA 1E1CB 4TV8F 1EZZA 1PGJA 2Y3IA 3LGAA 4FW9A 1EK6A 1L4EA 3KLPX 3KDSE 4JU9A 5DLEA 5JAQA 5BNTA 4N48A 2YWGA 2GF2A 1FJHA 3PFNA 4DKJA 1L5OA 2P2NA 3A6EA 3DH0A 3EOAI 1USWA 4WFQA 5DTMA 3ZHOA 4BMXA 2GK4A 1NFFA 4X92A 1KDZA 3U0VA 5LWHA 1PV4A 3T4XA 5KSZA 4C6RA 4CLOA 2YC2C 3PJFA 4EL5A 1QF7A 4KGZA 3FR7A 4RZ2A 3H8VA 1V71A 1JDVA 1FFEA 1KBZA 1QFSA 1T15A 2FW9A 2Q3EA 3F1LA 4GUAA 5BMOA 3GFPA 1W9MA 4AUNA 4BQNA 4JKOA 1PJBA 2KSQA 5L4LA 4KQXA 4U00A 3LMKA 4C22A 2YBDA 1GQYA 2NQTA 3C8MA 4P5DA 3HJFA 3WLMA 1Y9JA 2WYUA 1UOPA 4JN6B 3SHWA 2NO4A 2QD5A 3EZYA 3E7PA 3KSDO 4OUDA 1SGWA 3BD8A 4BP3A 4D99A 3WI7A 3T7EA 4INOA 5KJ1A 3L07A 4IXMA 1I2BA 1Y5RA 4KUGA 1SU8A 3N9IA 1S8AA 3ONWA 1HRKA 5ECGC 2H2HA 2G67A 1IUPA 1N7JA 2PMWB 2UVDA 3TZLA 2CUKA 1Y1TA 1J56A 2ZJ1A 2QN8A 2IYQA 3L0BA 3LXMA 4C89A 5HKOA 3A06A 1K9SA 1ZVJA 3HZZA 2VPQA 2ZUWA 3I32A 3K9QO 5B1SA 3DKPA 1X80B 4D3XA 1CJKC 2BMEA 2GJKA 3LRTA 2AUTA 4BAZA 4YRMA 1DBIA 3UYKA 3CVUA 2FEWB 2B8JA 2H48A 5ENVA 4GMGA 1K63A 4B6FA 4QPPA 3G2NA 4RZHA 3MJVA 2IZ0A 2R62A 4N40A 5DK4A 3MTDA 2FKNA 4AB1A 2JEYA 3KZOA 4ZI2A 2FUCA 2HWYA 1LPNA 3A9TA 2OBFA 1KK1A 4ILEA 1LF5A 4PGMA 5AK5A 5GVSA 3NYQA 1HLGA 2I2CA 3MWGA 2HN9A 3RVOA 2UVPB 3KALA 1V35A 1U0LA 2FPWA 4IMIB 3VR6D 3DB1A 2LR0A 2P9QA 1YB7A 4MQMA 4PG6A 2OB1A 3TJRA 4LCBA 4QDZA 2MSKA 4PLVA 3UN1A 2R8OA 3WQRA 3HB0A 2FPKA 2VNIA 3GNLA 1V9LA 1TEVA 2ENWA 2Q1XA 3OX3A 4K9OA 4MYCA 4NYIQ 4PG7A 3HZHA 4RUKA 4UE3S 5LL6P 3FYSA 3L3BA 3QP9A 1NLFA 1A95A 1KMMA 4YRGA 4HX2A 3SZOA 5HOEA 3AJAA 1FDOA 2OD7A 2WWWA 3HRKA 3PQ7A 3ZYCA 1CR1A 1V9CA 2QW8A 3MWLA 1YVPA 2FB9A 1QIFA 1HYBA 3C3BA 4P2GA 4OAOA 4DLNA 4WKNA 3R7WB 4NKRA 1UXJA 2JZCA 1YVRA 4B4DA 4HNVA 1Q44A 4Q3AA 5DCWA 2YIDA 1OX4A 1JXQA 5EG5A 1EGQA 4BU0A 4C0HA 5A6SA 5KWIA 1RWKA 2F62A 5E6UB 1PR3A 3U9SA 3M4XA 1GAEO 1W44A 3HKBA 1SD2A 4CM9D 4I4IA 3C15C 2EKLA 4E2YA 1TCBA 4M9SA 4O0LA 4L1KA 5EXDA 3LO5A 2WJGA 5IBCA 3KKMA 2DPYA 4G23A 5GOTA 1OWOA 3L18A 2FKAA 5ESRA 3LECA 3A4TA 3QI7A 2ZAOA 3ZVRA 1JIIA 1BD4A 2M32A 3HXOA 1X14A 5A9RA 1V4BA 1WUIS 2C9CA 3OO1A 1L7DA 3VO8A 4DCJA 4ZHSA 3DDCA 3QWFA 4XX1A 3FOWA 3AT1A 3QBTA 4RABA 3T99A 3EEBA 4UC0A 4QU8A 4N5MA 3QUQA 1AOXA 1T6YA 4YBRA 4ZANA 2WVAA 4M3NA 3U2QA 3VNVA 4TWAA 3VR0A 1T25A 2ZYSA 4M2LA 5PNTA 3VR5D 2G25A 5AVOA 4RELA 5KOHB 5E7JA 3P5SA 4LVNA 4MDHA 4F4UA 2H17A 4M55A 5BR1A 2VHCA 1SKUA 4U7PB 3T3IA 4CCYA 1XNQB 2E9SA 5CLHA 1VKHA 2X0FA 1YDEA 3PRYA 1T8PA 1DQPA 1FNSA 1L5ZA 2ONYA 3ZE9A 3IEUA 2X0EA 4FDAA 3VU3A 1ILWA 1OHHD 4B4OA 5AM2A 4HX9A 3TZHA 1UJNA 4RK0A 4EY4A 2C1XA 3LBYA 1STOA 4ZOBA 1ZQ1A 3GT4A 4Q9JA 3O26A 5JNLA 4S04A 3L0YA 3TQFA 3RGWS 4PO8A 5LNK1 3FRJA 4LMBA 5CM8B 2ZUFA 2ET6A 5LR6A 1RYFA 3UGTA 1MKYA 1OZHA 2IYNA 1WQ1R 3UFXA 3W05A 2VOJA 4DQVA 2W6JD 5CNMA 1TUIA 5CFOA 8ATCA 3I61A 2PZEA 4V38A 4OYYA 5COAA 1VCMA 4NU5A 2WJ6A 1I14A 3HYTA 4H4EA 2OP1A 2H2DA 3H65A 3UJCA 2I03A 1UZAA 4YONB 4BRWA 2I7DA 4UHBA 4RTJA 1J8DA 2QRVA 1U2EA 1XQ1A 5BW8A 1XF1A 4URXR 3PCTA 1IUOA 3CGWA 2HSWA 5KNDD 3P2OA 3F9CA 4N9QA 4UCXA 4DYVA 1CNFA 2FP4A 2PRJA 2QVCA 2C0PA 5CA0A 3T9BA 5TPZA 3VHQA 1TQ6A 3NTUA 3TL3A 4FCTA 3DE1X 4XTCS 1H85A 3FUWA 4ND3A 7MDHA 5FWNA 4GMDA 3HP4A 4P32A 5SY6A 1XN4A 1RVV1 5CH8A 3JQRA 4M1SA 1G1AA 2OV2A 2WJAA 4FYHA 3ZGNA 4MV4A 3NH9A 5B58T 2HQSA 4QGAA 2QRPA 2R5WA 4TKUB 1T8UA 4P4SB 3AEQA 2IYEA 2QD3A 2AOXA 4YREA 3C3YA 3MWFA 2ATEA 4ZT2A 5ER9A 4XM0A 1ST3A 4GL4A 1SVIA 4GX0A 4IW3B 4UFPA 1DAIA 4RHUA 3HKDB 2R68A 1NU8A 4UHHA 4E1BA 1APBA 1E6KA 2JL1A 2ZVDA 1EJBA 1FW6A 1J39A 3BXGA 3OFVA 1VB5A 2Y71A 5IF9A 1H3FA 4FT2A 3TM5A 3Q3HA 3A4VA 3U4HA 3EPJA 1MEEA 3GN2A 4M89A 4GDFA 4PR0A 3M3PA 3TLGA 4UEKA 5AYVA 1PR1A 2WWFA 2BZ0A 3DBHB 3PQ5A 4OD0A 5AVUA 5JW6A 5IJXA 2GM4A 3HL0A 1ZESA 1T4DA 4HJXA 2R97A 4TL7A 1GTVA 4IR7A 1F7VA 5CB0A 2FWAA 1ODIA 1KYZA 5E8RA 2EFGA 3BE5A 3LT0A 1RJEA 5CLGA 1ZOPA 1NOJA 3LQKA 5ICCA 2OYCA 5LQSA 3V2IA 4LV8B 3BFVA 3NOQA 3OA2A 5HTOA 3BORA 5A7HA 3N0VA 3EGEA 1DCTA 3B5JA 4B7UA 5B7GA 3FTQA 4TXHA 5EWLB 5FWAA 4N0EA 3G9QA 4OVKA 4BO2A 1Q1QA 1XCJA 3G2QA 2BP7A 3SHVA 1U9IC 1I9GA 3HI4A 4YMWA 5DW3A 5HF6A 2ZSAA 4RHFA 1LS1A 3TLEA 3AUJB 4I1SA 4D81A 1UCFA 3EVBA 3PWTA 1NW7A 2RGRA 1KSJA 3V4VB 5HUJA 1PAUA 1JT2A 2Q5OA 1LDGA 3ZY6A 4ANFA 3IUQA 3UTDA 2JLAA 4AG5A 2MYNA 1OGJA 3FSEA 3ETHA 4OREX 2GN0A 1M1YA 1E3IA 1CJSA 1PZHA 2YHBA 3ACCA 4XVRA 3WXMA 4D6XA 1MOQA 1NULA 1VBFA 2B83A 1WV1A 2ZWIA 3O1JC 4V0ME 4RYLA 3D3JA 4N9WA 1WU7A 1LBTA 1YE5A 4CL2A 4FGZA 1PIWA 2B61A 3MTJA 1FRVA 1WHSB 2TECE 4MI3A 3WNBA 3I9JA 4YRFA 2G72A 5EWMA 2YWXA 2CY0A 4TV9A 1AKRA 2X86A 3HDYA 2PANA 3HEMA 5L8VA 5EIOA 2WZDA 5IM5A 3FPBA 1CZLA 2FDXA 2JI4A 2ZE5A 2QMHA 3WYAA 3TN7A 3J80A 1VKZA 2NUTB 2JFBA 3C87A 1M3SA 5CT8A 5EGSA 3AHFA 2A3RA 4CIYA 4ZEMA 1QU3A 4X0EA 2NXNA 1ULTA 2WINI 1BVUA 1XJ5A 2J32A 2NVUB 2RGCA 1YULA 5THXA 4BNFA 1XFAA 5ECDA 1MTOA 2ZS9A 5FWYB 5HS6A 3RJZA 2EW1A 4LF9B 2IY9A 2C3YA 4Y6RA 4RF5A 4A27A 3R3VA 4F2WA 2EZ4A 2PU7A 5THQA 2REQA 2GDZA 3OFSA 3OIWA 1J49A 2QXYA 2AOUB 2KQUA 1DEAA 2GCEA 2IBSA 4HB2A 1Y7HA 5FRDA 1ECGA 3TF5A 2KBFA 5E9WA 3C3MA 1TMYA 4MI1A 1BCRA 2ZE7A 2BI7A 4IJ5A 4YPOA 2AS0A 4JBIA 4MVJM 1H9BA 1NMYA 3SK0A 4DCGA 1LC3A 3EVTA 4PXYA 1CIJA 3DEJA 1US8B 3TOZA 5I4IA 2W4QA 1BN7A 1XWWA 2Z1DA 1NZDA 3JWEA 4C87A 1WDMA 4EYGA 1LDMA 2G4VA 2I29A 2POQX 5KQPA 2PUBA 2SBTA 3ITKA 2Q3FA 2ZBQA 3T7IA 1WSDA 2JJ2A 2Z58A 3U1VA 2QZPA 1BS9A 5IJ0B 2PH1A 2HIGA 5DHFA 3O3OB 3QJGA 1AH2A 1GUFA 4WASA 1RKQA 2E48A 3VYUB 4EJMA 4ESVA 2EU8A 1U0JA 1MAUA 3BZWA 1MGPA 4CDGA 4FT4A 4Z2AA 4H1UA 5B3KA 1PS0A 2O14A 1OCEA 3LI2A 2C5SA 2I4IA 3KXIA 1L7EA 3AIIA 2J85A 2X9GA 4JB0A 5IAJA 4LUCA 7MHTA 4JYZA 3ZI0A 1O54A 4R3UC 2OXCA 4GG1A 1YK0A 4MUBA 1V8DA 4OFZA 1O9HA 2H4YA 3T3PB 3UUEA 1DNPA 4DV3B 5B1IA 2C8LA 4K9PA 3L7JA 3NV9A 2HRDA 3VPBA 1ODKA 3G2OA 1Z16A 4CTNA 4CT0A 1JJFA 1EGAA 3KR0A 3UXMA 1B4DA 2WUVA 4XEUA 5J4KA 3C41J 4S2UA 5JYBA 4KQIA 2A9JA 2ZJBA 4YO7A 4KPFC 5F3WB 1THMA 2NZJA 1M6VB 3QX3A 2R6HA 1CY8A 2HT6A 1IY8A 2Y66A 2ZPUA 3PD1A 2O2EA 5KSWB 4IJUA 3BWVA 5DGDA 4Z54A 2BEKA 3TS1A 1TO6A 3IE2A 3LY8A 4GRAA 5FR2A 3OOEA 5LLSA 5JS1A 1V5GA 3LX5A 5ADUS 4GOLD 1G1MA 5DISB 5A5GA 2OHJA 5LQJA 5ALFA 1B2RA 3UJHA 4MWZA 1DBVO 2JASA 5FL7D 1UWVA 1C30A 3CA8A 1UT8A 3M5CA 3L9XA 4P3KA 1KR2A 1G8MA 2E82A 2WPDD 4ZV9A 5AI6A 4DTCA 1IWBB 2B99A 3ET4A 4ID9A 2QRVB 4LOKA 3LFUA 4M21A 3NGMA 3O2JA 2GHIA 3RFVA 3TJMA 4FDLA 3QUCA 3MAJA 2H29A 1G2PA 3ZPXA 2GASA 4DBLE 3HKCA 3CXUA 1RLUA 2J5QA 1E3SA 4P4LA 4Q01A 1J8FA 1IL0A 3HDHA 3CLTC 1Z6TA 7GPBA 5IAKA 2N1BA 5K0ZA 2KHZA 1QONA 1H2ZA 1VHWA 2PU5A 4ARSA 1DB3A 3BQMB 3WGYA 3AKDA 2ZSUA 1H5UA 3L1VA 2VHXA 5SZHB 5ALEA 1KMHB 4G86A 4IIJA 4A6XA 4OQDA 2VAVA 3AF4A 5KC9A 5AKIA 3SF8A 4N3NA 4DQDA 1OWPA 3U7IA 4HDKA 3IPAA 3CY6A 4IDHA 4AROA 3F9IA 2OCYC 3Q7PA 4B74A 3CEJA 3QELB 4GEKA 2FZKA 3DAYA 2ZI4A 5DEOA 1OXVA 1ISGA 1RLJA 3DOUA 2CMFA 1OLOA 1T26A 1BEEA 3A3PA 1E5VA 2UDPA 2VHWA 3CH7A 4YQYA 4EZBA 1BAPA 5J4VA 4XVQA 1ZX1A 3RC1A 4E70A 1QZXA 4YV7A 1M83A 1W19A 2AWOA 4K81B 4LMPA 4NY1A 2GSDA 1IB0A 1X7YA 3H11B 4NZ9A 4MA5A 3I6QA 4QO8A 4WSOA 5H81A 4Y67A 2I91A 3G7NA 1HM5A 4DDMA 3I4CA 4NOLA 4OIFA 3QEAZ 3ILYA 5JI2E 2XAUA 2FK7A 3L49A 2CXHA 4G4IA 2OC9A 4LHEA 2Q1WA 4YAWA 2NAPA 1E2PA 3ZXYA 5K7SA 4C6SA 2EERA 2JIZD 2ZXFA 4Y2YA 4CQMB 2QX6A 5KQSA 2I71A 4Y2GA 2Y1EA 1LX6A 4OI2A 3H9EO 3MTBA 1H2BA 1GKIA 1HC7A 1JFFA 2RGEA 3FMIA 3RYTC 4W5QA 3ASZA 2XJ4A 1MW8X 4ZK6A 3HRIA 1XSEA 1FLNA 2QM0A 4HS4A 1SU4A 2QSUA 4KAJA 5HOQA 4LYFA 4ZU6X 2WILA 1LXCA 4IIDA 4ETNA 1V7ZA 1Z0FA 4LGCA 4ZQGA 1AQJA 1X94A 1F0KA 1RWPA 1SHTX 1VL5A 4URVR 5A3QA 3CLRC 5KOHA 2MHCA 3EXFB 4MCHA 3JWJA 3LOQA 1KMHA 4IIJB 5EGNA 3QZUA 2FWMX 5BN5A 2ZW9A 1FB5A 5F1KA 1MVNA 2ZCVA 5TS2A 1M54A 4ZYYA 3MT0A 4M1YA 1CG6A 4LSZA 1KP9A 1SKMA 3K70C 1RQRA 4BFYA 2DE0X 4ZRDA 4LCJA 4E3WA 2AHRA 3QU7A 1KDTA 1RTTA 1OASA 3KHUA 2R3SA 4Q18A 5DTQA 2JGIA 4MV8A 1Q50A 4WMLA 3DGFC 4ABTA 1SM4A 2ZPTX 3R41A 5BNFA 4N6NA 5C80A 4BGDA 4RHYA 2VDWB 4WBNA 4TS4A 2DETA 3OOYA 4MLDA 2O54A 2QLLA 3DZDA 4UULA 4RD1A 3II6X 1AT1A 1MRSA 3C8ZA 4AKHA 1GRNA 3EDCA 3WIBA 3IPRA 1NUAA 3PP8A 3FIJA 1B3RA 2HF7A 3WXBA 3KJQA 4ISBA 3IV7A 3WLIA 5JECA 2JIRA 2OCLA 3K94A 4GIBA 4J1QA 4N6GA 4P4UA 4Y2QA 1QOZA 1L3BA 2HMTA 3DL0A 5JMTA 2BR3A 3BXEA 4HNQA 2JLZA 1UBJS 2WAYA 2XAAA 1GCIA 3PEFA 1XROA 1ID8A 3CX4A 2PEYA 3H05A 2NU7A 4XFKA 1MXHA 3BRWA 4GPD1 421PA 5DRTA 4K7JA 4AY4A 3SXPA 3NTXA 4OXYA 2W48A 3UJAA 3G5MA 3HZOA 3EJ6A 1I4DD 2GJ9A 3E9QA 2JFPA 4BQSA 2ZE8A 2DERA 3KQUA 4S35A 2YV3A 4B4KA 5ICEA 2AV6A 2ODNA 3D7RA 4HGOA 4OUDB 4EYSA 2J30A 1Y6ZA 4QWWA 4WQMA 1IJFA 3V1NA 2C2OA 1KJNA 3Q87B 2CB0A 2OXTA 1E9DA 2FLVA 3D3WA 5KVAA 2FZLA 2PLFA 1S7CA 2F17A 3K2BA 4RJLA 2P5SA 4QOHA 5H4HA 3RUHA 2HWWA 2XNHA 1KZYC 2QM7A 2YWHA 1VI2A 2ZREA 5KUTA 3X1XA 5H70A 2C7VA 2JFOA 3FNHA 1Z33A 2HU2A 5EP2A 4QLOA 4PQRA 4KXYA 1N3BA 4P54A 5ALZA 4YAJA 5BUCA 5K0JA 3SPXA 3E15A 4QFCA 3A2KA 4C0AC 3RS7A 2XDYA 2FWPA 4F86A 4HZUB 1W48A 1VG8A 3EIWA 3LKDA 1X1SA 5ES4B 3MYYA 4J94A 1D9ZA 5HW0A 4BQEA 1A5TA 4ZCPA 2ORIA 5JSKA 1JSXA 4DYDA 4E3ZA 2KW5A 1TW2A 1Y4SA 4ER3A 2AYZA 2IW1A 3EVDA 4B3CA 2QRNA 1UBNA 3JVIA 4NBUA 3LFHA 2XA1A 3D5EA 4MICA 2HEGA 5FLKA 5ARDA 2O57A 1VFPA 3D1JA 3K05A 2V96A 3OMLA 4HWOA 1B6GA 1P0MA 3DEAA 3UMMA 1EEXB 3IR5A 2AEJA 4FN5A 3GLIB 3QX9A 3QMVA 1XC7A 4R7TA 2TSYB 2BL4A 4RK5A 1J33A 3DDHA 2DWCA 2YZGA 2ZEJA 4KSYA 3PC6A 1ZD8A 4LWZA 4Q4JA 3KV3O 4AIRA 3BILA 2IJGX 3AVOA 3ES9A 4ZGWA 1EUYA 1ZIOA 4EPVA 5DIZA 1U2GA 1IEQA 2GEFA 4RIGA 2BBOA 4X1IA 4EHHA 1UXKA 4BVGA 3K2IA 3PLNA 3TX2A 4DR3B 1YI1A 2MYTA 1Z5VA 1F4PA 3DVLA 1H65A 2FJUA 4C01A 1J1IA 5BYKA 2E89A 3I39X 1ZSYA 1FLAA 1PJLA 1JR4A 121PA 1TECE 2YWRA 2RI1A 3P2MA 3E7FA 4PX9A 2DCMA 3B53X 3OKAA 4GNRA 3GDHA 2UYQA 3VH3A 3LUFA 4D80A 1B1CA 2HA3A 5LYYA 3U40A 1JLLA 3K1YA 2ONJA 3NO4A 3ITEA 1YZHA 5C8VA 3VR1A 3L6RA 1B6SA 3SGLA 4AO7A 1E3WA 3AY3A 4MIYA 1FDVA 4JGBA 1A9QA 4LOIA 5DRYA 3WFIA 4DMLA 1NMEA 2CEKA 2X5JO 4M0EA 1LK0A 3DF9A 2GBLC 3DWEX 1YS1X 1N8NA 4A5SA 1THTA 2EF0A 5THKA 3I23A 5FTLA 4LY0A 1N2SA 4KIJA 5DM2A 1ANKA 2AZMA 1E1QD 5EWLA 2ZB3A 2ROQA 3LXRA 1UMCA 2AFHA 3A14A 2GM5A 4E51A 4N41A 4GQBA 1XG5A 1W2WB 2BMDA 3EWNA 2JI8A 4R1NA 3W3AD 5A9SA 1RWNA 4MV3A 1WUJS 4ER0A 1QCYA 1LK5A 4P7BA 5M34A 2ZBGA 2ZCJA 2DYKA 1N7GA 1IXSB 3PUKA 2VPWA 3KUXA 2PCJA 1FVXA 3O0TA 4CKCA 5FEMA 2AA3A 2BKLA 1V1MA 5IYZF 4CG2A 3PGVA 2GA9A 3R3ZA 5IKOA 1U3UA 3IIMA 3LK6A 4DA7A 4RTOA 3PNYA 2AX4A 2YS7A 1ORTA 2VUUA 4HNSA 4HS9A 4PLHA 4BKUA 3TLGB 2XF8A 3VO9A 3H1PA 3L79A 4F4JA 4MB0A 1EGHA 3PR2B 3QUAA 3ICVA 4DVGA 1LKZA 1NFQA 3DLIA 2B5WA 2HRCA 2JHPA 3RYFA 3FOBA 4GX1A 2BFCA 4LZAA 2B3DA 4FFVA 5EZYA 4AT1A 4F8YA 2XCRB 2JH9A 3DO8A 4RF3A 1PX0A 4NBNA 3MGGA 1G20E 1SQFA 2ZRKA 3B5IA 2PXCA 2WWVD 3SAJA 2CYAA 1UODA 1VOTA 1MP0A 3SIRA 3LQYA 3OTQA 4C4SA 1XJ0A 4BAGA 1WG8A 1K6IA 5BN5B 3EIEA 2C07A 3JU3A 3T3GA 1OI7A 2Q46A 3WGTA 3ZVLA 5DNVA 4DCPA 2HF2A 1NN3A 2QN1A 4UCWA 1VSVA 1P4GA 3PNPA 4H1HA 2YWEA 5IVIA 4QJBA 2W43A 2R8PA 1E59A 2GZRA 3AM3A 3E9YA 4OSPA 5D2CA 3AR8A 5EIBD 2G4CA 4YJFB 2Z04A 4QGFA 1TAUA 5JJLA 1CWUA 4KAFA 4BX3A 1PJRA 2FQ1A 1MFPA 4JOBA 4QU9A 3U09A 1PGPA 3LFTA 1P4AA 4R9VA 3LX4A 1U3WA 1UDXA 3ZX5A 2IK8A 4EY5A 2DTDA 1L4HA 1SELA 2BEUA 1B15A 2H0AA 3G0BA 1XZCA 3L92A 4ZOCA 4ZPXA 4OEHA 1ZQ9A 2DBVO 4WNAB 4DG5A 2D5CA 5SY4A 1R2QA 4NICA 1JFRA 4RGYA 2BR4A 3VNBA 3H5LA 4B3BA 5BV1A 1YRWA 1P1IA 2LBPA 5J59A 3UT0A 3ESAA 3LD9A 4GVPA 1A88A 1BJKA 3B1ZA 4EMTA 4B75A 5EXPA 2XNJA 3FRIA 1KIFA 3I09A 3IB3A 3DDNA 3PTAA 1OYWA 2VYVD 3W7AA 1BE0A 3U4QB 4RDIA 3ZWCA 4JLNA 2Y67A 3L0CA 4KKVA 2QAJA 1ULHA 3Q88A 1Y3DE 2P6PA 1MH1A 3H16A 1JJBA 3QEJA 1DXQA 3PUWA 5GONB 1G4UR 2BFOA 2CN1A 2WWHA 5E8JA 1G3QA 2E5FA 3DV0A 4YI3A 4KQ2A 1NONA 3K2EA 5K8TA 1KAHA 1XQWA 1DAMA 2BT4A 4G65A 2X7JA 3M6MD 5A1JA 3PVCA 2FFBA 5LDHA 4AP6A 3ZR4B 5KINB 3X2SA 4Z4HA 5FD8A 3UW3A 3ZE8A 4J07A 2J3JA 3LQ4A 4LZPA 1XRMA 3OKCA 4G1CA 4HDRA 3OJFA 5JQGF 1Y9DA 3BA1A 1ZMRA 3JV7A 4L57A 2XITA 2Y2VA 4PYQA 5K3SA 4JAVC 1YGYA 2XV1A 4JP1A 4PINA 1QX3A 2PZGA 4A9AA 5CNIA 1XMQB 1B93A 1JPUA 4MYHA 4B48A 4ZMRA 8OHMA 2HL6A 2GHRA 1RYMA 1O87A 1DAKA 1EXMA 1VA4A 2ETVA 4PFSA 4XRRA 4OATA 1YDGA 3UWPA 2WQ7A 3IP9A 4ZDIA 3VPFA 1R6UA 1PFYA 2HOQA 4IHKA 1FSGA 2YHIA 3RIHA 3NKLA 3MS7A 4RAQA 2EIHA 1EFDN 4LWQA 4YP7A 4BTVA 4BRZA 3LT2A 2CXNA 4F96A 4M83A 5IJAA 1ZM4A 1MHPA 2MSNA 2QRLA 3FSRA 3IT1A 2ZGVA 4MQBA 4RH1A 2XOKA 1JIXA 1Z0UA 4JWTA 3RFUA 1C2TA 2ZI7A 3FFTA 3KJHA 3T35A 1EIWA 2ZDGA 2ZYUX 5AM3A 1AGYA 3F6RA 1YZTA 2PKXA 3GZNB 3LP5A 4AM8A 1SD1A 5JNTA 1FF9A 1HGXA 3OIVA 1UPXA 2YRFA 3T41A 1F4LA 3K5IA 1DBWA 3MW8A 6GPBA 1Z83A 3X0DA 4C0LA 4MRMB 1W4CA 3ROXA 3W5HA 3N7TA 1RKBA 4OMUA 1F17A 4E5VA 3LVBA 3O5AA 4KE6A 2AMFA 4W9NA 2FN9A 3EGXB 2RC5A 2PFKA 2PH7A 2OZEA 1DKRA 3FYUA 4OU4A 5CH5A 3AW9A 1B0AA 3BMCB 4J16C 3ZNPA 4AMGA 4F4HA 3MS2A 4R8VA 2CUZA 4PYLA 1QGYA 4Z1MA 4U7JA 2QX4A 1SCDA 4PHGA 5KYXB 3BMQB 3CBQA 1W36D 1G5RA 1LJUA 3OLXA 4RK4A 3P4XA 2XZPA 4FOOA 3D4LA 1D4ZA 5AUQA 5MDHA 4YLYA 4EX6A 5CFZA 5F4ZA 1XEWX 3A1WA 3O73A 4X90A 4EFKA 4MWOA 5EQTA 5KQRA 1MB3A 4Q4CA 3QGMA 1PJTA 2OV6A 4HO1X 4JKIA 4N0MA 3ZQKA 4NFYA 1LQTA 3RAEC 4INAA 4CF7A 3KXPA 2XJ9A 2FFAA 4QLBA 1II8B 3GLSA 3ZJTA 2ZUSA 1RYBA 4MXDA 4MZXA 4OQXA 2GAIA 1JG1A 4Q3OA 4QQNA 1R4MB 4JJAA 2ZTLA 3KPUA 3NC4A 3SU8A 3LHKA 3UTCA 3PHBE 1XQXA 3HNOA 4QAJA 1OI3A 3EA5A 2VH1A 3NR2A 5C4MA 1C3VA 3SHQA 2P30A 2G1PA 1IZ9A 3SXUA 3ACDA 3NBUA 3RV3A 2EFDB 1LBQA 2AFRA 1FE8A 2FSVC 4OBEA 4M1TA 4UDNA 4WXMA 3VAZA 2AZXA 2DCUA 3D02A 4L5AA 5HFAA 3SNHA 1OZAA 1WKBA 3GX1A 3Q2IA 5EI5A 2PUDA 1RZRA 3JZAA 4YPFA 4BLTA 2XF2A 1NLUA 4QTYA 2HLHA 1VHTA 2Z5VA 4K6HA 3ELBA 4ED9A 5KB3A 3DKRA 1OTYA 2IC5A 1L5LA 1FTQA 3O93A 3RUCA 4PPNA 1NF8A 4E4TA 5KHAA 4C2TA 1BU8A 3V9PA 2PA3A 4M8IA 3WNQA 5F3RA 5FUBA 1SVOA 5EZQA 2QZJA 2D5AA 5A5EA 1C80A 2NVBA 3IQHX 5CM2Z 4DLYA 1W2GA 1Z39A 2B1IA 3H5WA 3D5QA 2IUYA 3K6SB 1GZSA 5DFAA 1Z8HA 3SJBA 3FKSD 3TBHA 1OD6A 1P5ZB 5KJCA 4DB4A 2EJTA 4QDUA 3OTWA 2NTNA 3HYNA 5AW2A 1WUTA 3IT2A 1SNYA 4TSFA 4DC1A 2HQOA 3E0QA 4WFIA 4MWSA 4WBNF 2O2HA 4KQ6A 1Z6ZA 4UBIA 2AWNA 2DLNA 2PIAA 4DUGA 5K0CA 1GOTA 2EFHB 5HS4A 3ZQUA 4GBGA 3EZ6A 5JAUA 4YC7A 5ALDA 2L0XA 3HY3A 4J0GA 3P5BA 3R20A 1QK3A 1Z8DA 2ZT5A 2K7ZA 3B6IA 3WK4A 1FDUA 4J9VA 2J09A 4BNWA 3IBSA 3W3AH 2ZVPX 1RLIA 1V26A 4LRYA 3VVCA 1YE3A 4B1FA 5ALXA 4O4JF 1UDRA 4YWJA 3B9PA 4DJFC 1CEYA 2ZSDA 1UK8A 4O08A 5JALA 4F12A 4J4BA 2I0FA 1N6KA 4FQ7A 4H16A