3OG9A

Structure of yahd with malic acid
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
206
structure length
206
Chain Sequence
MTDYVFKAGRKDLAPLLLLHSTGGDEHQLVEIAEMIAPSHPILSIRGRINEQGVNRYFKLRGLGGFTKENFDLESLDEETDWLTDEVSLLAEKHDLDVHKMIAIGYSNGANVALNMFLRGKINFDKIIAFHGMQLEDFEQTVQLDDKHVFLSYAPNDMIVPQKNFGDLKGDLEDSGCQLEIYESSLGHQLTQEEVLAAKKWLTETK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords protein yahD a copper inducible hydrolase
publication title Regulation and structure of YahD, a copper inducible alpha/beta hydrolase of Lactococcus lactis IL1403
pubmed doi rcsb
source organism Lactococcus lactis subsp. lactis
total genus 78
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3og9A00
3IURA 4PSCA 5AM1A 3DS8A 3N0TA 4CIAA 3ZI7A 1XZKA 4DSAA 2BAGA 2ZJFA 4FOLA 2HA6A 5FP0A 1K6EA 3BIXA 1F8UA 4KE7A 3D2AA 2GYVA 4Q3KA 4KE6A 3S2ZA 2PSFA 4Y2XA 2C0QA 3HACA 4OU4A 4S0XA 4G9EA 3UUFA 5K3DA 1JJIA 4NMWA 3BJRA 4FHZA 5ESRA 1KEZA 1W75A 1YB6A 1N5MA 2ZJ6A 1A88A 4HVTA 5HCUA 2OCKA 3K2IA 3M3DA 3STTA 4GWLA 4BP9A 3STXA 3HSSA 1J2EA 2OCIA 4RGYA 4BC0A 4FBLA 4FNMA 5DTIA 5AKGA 2VAXA 3TRDA 1LZKA 2O2GA 4FTWA 2D0DA 3QMWA 3HLKA 4W63A 2BKLA 3ANSA 3RARA 2RGUA 1Y37A 3ZLVA 5ALLA 1TAHA 1TK3A 1JJFA 3VJMA 1MTZA 3D2BA 1CUVA 3WKDA 4IH1A 4UHHA 4A23A 4WCVA 2PM8A 1HKHA 2JGMA 5IVDA 5HKBA 4ITVA 3W9BA 1QFMA 1Z68A 1E8DA 2ES4A 2WTMA 5FUMA 2QRUA 3IUNA 1WCYA 4DNPA 4MJ3A 4I19A 3DL4A 4AMZA 1QTIA 3QH4A 2HA2A 1N5RA 4FNGA 5A6VA 4CFSA 1HDEA 4CCWA 5JZBA 2ZYRA 3L1JA 3C5VA 4QE3A 5CT9A 1L7QA 2PUHA 1P0QA 1H2YA 4OB7A 4X00A 2UZ0A 1BRTA 4G4GA 1XZHA 3WWCA 4B84A 2V9ZA 3FSGD 1ZOIA 4U2DA 2AJLI 1CLEA 3STUA 5HKAA 2OGTA 4BRSA 4NVRA 5BWCA 1B6GA 5EGNA 4BRZA 4C01A 2V98A 2WIDA 5JADA 2C4HA 4KE9A 1CPYA 2AJ8A 4WY8A 4Q82A 3W2TA 3A2MA 1XRQA 5AI8A 4UHEA 3M82A 4FLMA 5AI5A 2OQVA 3STVA 4FLFA 1QZ3A 2FUKA 2JGEA 2XQJA 2JEZA 2XB6A 1CUEA 3U0VA 3FNBA 2OGZA 2ONCA 3A70A 1A8UA 2C5GA 2HA5A 3PE6A 4BE4A 3WL8A 1QIJA 3L1IA 1R3DA 4FKBA 1XZMA 3OG9A 2RHTA 4NZZA 3E0XA 2XUPA 4H7IA 1IUOA 5T4EA 3HZOA 3KWJA 3G02A 4HRXA 1OXMA 4BP8A 1N8SA 2HA0A 1JMKC 2HU7A 3FLAA 3IUMA 1YAJA 5K3FA 3NWOA 4OYLA 1XZEA 4ZRDA 1DTEA 4Q3OA 4PF1A 3ZV7A 4CIBA 4IH9A 5AJHA 5F4ZA 4WDQA 5KWIA 3FYTA 4X3CA 3KD2A 4XX1A 1HPLA 3BWXA 3S8YA 3C6XA 3IB3A 1CUSA 3F9CA 5A2GA 3V48A 1SCQA 2OG1A 5ALNA 2PU7A 5AH0A 3SWWA 3WA6A 5AOAA 5A62A 2QUBA 1FFBA 5JYCA 3R3VA 5DNVA 5ALJA 5EFZA 1ZI9A 1GXSA 2QTBA 4E14A 2JEYA 4P9NA 2EEPA 1BCRA 1CFJA 1IMJA 1DT3A 2WHPA 1R50A 5K3FB 2CBGA 2VT6A 1ACJA 4L72A 5JAHA 3SX4A 1SOMA 2O2HA 4AX4A 1P0IA 4UFPA 4EUSA 5LZ4A 3FLBA 2GBFA 4JYMA 1LGYA 3ESCA 1WB5A 4UBLA 4A5SA 2CZQA 5DJ5A 2XMDA 1UZAA 3ILSA 5SYNA 4BVLA 5C7YA 1H23A 3WKEA 3C8DA 1C7JA 1XRLA 3KXPA 3H0CA 1TRHA 3I2IA 5AHXA 2XUQA 4MQLA 2Q0XA 3H19A 1L7AA 3G9TA 4MWSA 5BWBA 4Q3LA 1EI9A 4Y2JA 3W06A 3D7RA 1CUGA 4QLAA 4Y2UA 2Y6UA 3C8HA 4BATA 4JNCA 3ANTA 1J1IA 1I6WA 2XUDA 3SK0A 3DOIA 3G0CA 3PF9A 3ED1A 1DT5A 4TVKA 1T2NA 3QPDA 2WHPB 2OCLA 1JI3A 1C7IA 6YASA 1C4XA 2I78A 3HABA 1WPRA 2BJHA 3H2KA 3N2ZB 3G9XA 1ORWA 4KJXA 5CW2A 1XROA 5HF8A 1UWCA 3H2GA 1QIFA 4AO6A 2FX5A 4FFWA 5CT4A 1BROA 1SFRA 1DINA 2ZYIA 4GW3A 4J0IA 4M0FA 4UBMA 2LIPA 3DEAA 1LLFA 3I6MA 4LXIA 3V1MA 4DMFA 3C43A 5HFAA 3D4LA 1QONA 1MU0A 1FFDA 4BTLA 3WI7A 4A16A 4BDSA 5FPPA 4V2IA 3I1IA 4G4IA 5JIBA 2I3ZA 3HEAA 5IVHA 4BVKA 1HL7A 4KRXA 5AM3A 3R3UA 4Q1VA 5AKZA 1R9MA 2DHCA 1TCBA 4C87A 2HU5A 4UPDA 3PI6A 3TGLA 3F97A 5ALYA 4FBMA 5IVIA 2Y2VA 4ZI5A 5AOCA 2JGKA 1WB4A 4FDMA 1K8QA 3UMJA 2IX9A 2RHWA 3PF8A 2ZSHA 2B61A 3WK6A 2BUAA 1YAHA 5YASA 2RAUA 1UK6A 4YX9A 3WK8A 3G9UA 5LP1A 2G5TA 5AKEA 4GHWA 4J0GA 3AIOA 3ESDA 2PU5A 1XRPA 4KE8A 2D5LA 4OD0A 5ALPA 3X3HA 2PPLA 4K6KA 3VJKA 4UHDA 4Y2YA 4GI1A 3V9AA 2XQKA 4AB1A 2DHDA 5ALTA 1MJ5A 4WFKA 2OAEA 1MPXA 4HZGA 2J3QA 1EXWA 1QIDA 1XFDA 3O4JA 1DU4A 4KAAA 3WQHA 5LKAA 3G0GA 2XUHA 3AINA 1XQYA 2V97A 5CBKA 5LZ9A 1E8MA 3C6YA 1K63A 3HC7A 1JU3A 4Y9SA 2J3DA 3O9VA 4EY7A 3I2GA 2HA7A 1QIMA 1CVLA 1P0MA 3FAKA 1XZIA 4W1PA 4UBNA 4QDUA 4L3WA 4UBIA 5ALEA 4KEAA 3RM3A 3WK7A 3WA7A 3O0DA 3R3ZA 4IHAA 3HYSA 1LPOA 2HRQA 2G5PA 1GT6A 4OYYA 1QE3A 3H18A 2EDAA 1RP1A 1MAHA 4X6UA 1BCSA 2X76A 4GDMA 1FFEA 1G4HA 2WG1A 5E4YA 2XMGA 2RONA 1XZGA 5H3HA 1XRRA 3DCNA 3EBLA 1IZ7A 1EDBA 1DWOA 1Q0RA 2ZYSA 5ALFA 3L1HA 3D5EA 2AJBA 3QYJA 3WIBA 3MUOA 4MYSA 2XQIA 1YS2X 4J0JA 4KACA 3LCRA 1S8OA 2C5FA 1EVEA 1MAAA 2B20A 5HF6A 4B0PA 3E4DA 1YS1X 4MWTA 3VVMA 3EF3A 4KR0A 2C0PA 4DNQA 1VZ3A 4X6YA 4B83A 2XLBA 4M0EA 2QJWA 2G4LA 4K6GA 3G7NA 3KSRA 3DDUA 3EIOA 1CRLA 4XIIA 3ICVA 5D3ZA 4KYVA 3B3QA 2Z3ZA 1SCKA 2BUBA 5A7HA 2H9YA 3H2JA 4B0OA 4G5XA 1XZDA 3C45A 4F60A 2VJBA 4BC1A 4GBGA 3EQ7A 1ODSA 2WUDA 1YSCA 1E89A 3DL7A 4FFVA 2J4FA 3D0KA 1MO2A 5AI9A 1JJBA 1CUAA 2BCEA 2DSNA 7YASA 2PSJA 1ODTC 3I28A 5DLPA 1UKAA 3LP5A 1QIEA 5EIHA 1UXOA 4DMHA 1NU8A 1E8NA 3HRHA 5AM0A 3GBSA 1CUUA 4YK7A 3BIWA 1EX9A 1AURA 3IDAA 2WU4A 4OB6A 3AILA 3WK4A 4F0JA 1E5TA 1ODCA 5E4TA 2WM2A 5AK5A 4X91A 5ALGA 4BZZA 4E11A 3BDIA 4N8SA 2R11A 3FVRA 3GELA 3BF8A 5ALHA 4UFNA 3E3AA 2QXTA 3FSGA 4EY4A 3HJUA 3BF7A 5JD6A 2HA4A 1CUIA 2WG0A 4HXGA 1Q83A 2XQFA 4X97A 3VDXA 2HA3A 1TCCA 4ZV7A 3ZLTA 2C7BA 4K5QA 3WKBA 3E1GA 5ALIA 4BAUA 2GZRA 4G8CA 2JF0A 1FFAA 4ETWA 3BDVA 5LZ5A 1XLVA 2BGNA 5C8VA 1ZD4A 3H1BA 3VISA 1WPXA 4NS4A 2CUTA 3T4UA 5AKHA 1VOTA 1TQHA 1QO9A 4OCZA 3WYNA 4ZV9A 1TKRA 3A2LA 3ESAA 3FWHA 1XZJA 2QR5A 2WFZA 1AUOA 1VXRA 5T4FA 1MNAA 4KAFA 1PFQA 1XKLA 2PX6A 1E66A 4G8DA 1ORVA 1MN6A 1DQZA 3F96A 3G8YA 4Y2VA 5ALWA 3F67A 4H7FA 4I3FA 3PFBA 5BOVA 4AMYA 1ZI8A 5EIAA 4G9GA 4AXBA 3LIIA 4U2BA 5HQ3A 3PDCA 5CT6A 3A2NA 3V1NA 5IKXA 1XRMA 2WUEA 5JAUA 4QNNA 1CUWA 4QDXA 2HADA 3WLAA 3OPMA 2PUJA 1CUFA 2OXEA 5DYWA 5AM5A 1AKNA 1VA5A 5C8ZA 4BAGA 1W76A 3SC2A 5AKJA 1VZ2A 3A6ZA 1O6GA 4AZ0A 4YASA 4H7KA 4J0CA 4UUQA 3DD5A 3KWFA 2WG2A 1R1DA 1XLWA 3WZLA 5HF9A 3K6KA 1X2EA 3O4HA 1MT3A 1QIIA 5JZ9A 1XZFA 3QMVA 4MXDA 5D3KA 5ALUA 2AXEA 4X7BA 4X90A 1EB8A 5C81A 5AKKA 1XZLA 4LHEA 2CKMA 5LKRA 4HAIA 1A8QA 4F5ZA 1P0PA 4GXNA 2DCMA 2DR0A 4OSEA 5HQ3B 4N5HX 1OILA 1GPNA 1ZD5A 2CMFA 2XMSA 3LLCA 4H35A 1GQSA 3FBWA 2X5XA 1F0NA 1NX9A 4ZXFA 3QPCA 4BYMA 1AMNA 2Z3WA 3PUIA 4W1QA 1G66A 2Y2UA 4OB8A 1EHYA 4H0CA 4QDZA 1BEEA 1ZJ4A 5LZ8A 3GA7A 3RKSA 4PV7A 1LPSA 2CJPA 3CCCA 4E15A 1JKMA 1MNQA 2GZSA 5CXXA 1Q84A 4BCCA 2PL5A 4XVCA 4UBJA 2JIDA 4RNCA 2DQYA 4UFOA 1CV2A 3DKKA 3WWDA 1CQZA 4EBBA 4QWWA 4BTVA 2XDWA 2WLSA 5E2IA 5EHQA 1KU6A 1USWA 3WIOA 2BUCA 3WL5A 4U2FA 3WL6A 4AN1A 1UOOA 5JAPA 3ZPXA 4U2GA 4UHCA 1ZIYA 4BDTA 4B7ZA 5HK9A 5I7UA 1THGA 4TGLA 1JMYA 3O4GA 1F6WA 5SYMA 4JYPA 5AO9A 1GGVA 5HK8A 1UKBA 1AC5A 2XUAA 2OLEA 4BCDA 3RK4A 4L0CA 4B9EA 5FKJA 4H18A 4DGQA 4Y2SA 1U65A 3GROA 1VKHA 3NUZA 5AM2A 1OCEA 3G0BA 4QLOA 2XUIA 2WKWA 2XT0A 4X71A 1VA4A 1AZWA 2VT7A 2WUFA 4HXFB 2VAVA 1ACLA 5DNWA 1CUZA 2QM0A 3GZJA 4BVJA 2ORYA 2XMRA 3M83A 3W04A 4B85A 2PSDA 2XUJA 3G0DA 2WQZA 2WJ3A 2GBIA 1QLWA 5AKXA 1MX9A 1U2EA 3ESBA 1DQYA 1NU6A 1H2XA 1H2ZA 2JGIA 3OURA 1ISPA 5AP9A 1UFOA 1XRNA 4B80A 1K5PA 3VXKA 4Y2QA 3D59A 4FLEA 2H7CA 1FSSA 5FLKA 1CUYA 4U2CA 4GECA 1SCIA 3B12A 1LBSA 5CRIA 5FV4A 1Q0ZA 2HIHA 5BV7A 1QJ4A 4MEAA 4P92A 3V1KA 5KWJA 1EH5A 1ZGBA 3M81A 1RWQA 3I2HA 1ZICA 1YR2A 1AX9A 2ZJ7A 3OC0A 2W6CX 1XLUA 3AZPA 1LPMA 2QXUA 1LBTA 4IQ4A 2QJRA 2R8BA 4FWBA 4EY8A 2BFNA 1BN6A 2ACEA 5T4HA 3GFFA 1J07A 2B9VA 5EHXA 1WM1A 4G8BA 4PSDA 5JALA 5JD5A 4CCYA 1TCAA 3DYVA 1WOMA 5DNUA 4EA6A 3AZQA 4PNZA 4CG1A 4OPMA 4Y7DA 2VF2A 4HS9A 5AKIA 3EQ9A 4XJVA 5CXUA 2WIJA 4WDRA 4EZIA 4Z49A 3I1YA 4AO7A 2GBGA 1R88A 1R4ZA 4AO8A 5ALZA 1B41A 1XZBA 3PFCA 1HLGA 5AK3A 5LZ7A 1O6FA 2QZPA 5AKYA 4WFIA 1TIBA 3W05A 3BXPA 1EDEA 3LS2A 4EY5A 1QO7A 4RE5A 4ZGBA 4CG3A 2OQIA 3D2CA 3P2MA 5FPQA 4F21A 4DYHA 4PO3X 5FXMA 5CH5A 3CN9A 2VEOA 1K4YA 4CCYB 4GLBA 2CEKA 3H17A 1UOQA 4C4ZA 1EK2A 4DMKA 4DMCA 5ALVA 2QT9A 4ARAA 1BS9A 1XKTA 1DWQA 3I2FA 4E46A 2WSLA 4H7JA 5CMLA 3QPAA 4B6GA 1Y7IA 1GPLA 3ZWQA 1EINA 2PSHA 1EVQA 1XZCA 4DSZA 2VA9A 4EY6A 3H2HA 4Q34A 1YA8A 4GEGA 4CI9A 2HFJA 3DNMA 5AIAA 1UKCA 3HXKA 3QMMA 1MX5A 4ZREA 5IH7A 2BGRA 3FYUC 2JGFA 3KDAA 3AJAA 2X8BA 3WWOA 4X93A 3WYDA 1KU0A 5JASA 1CEXA 3R40A 3DJYA 1VXOA 4UBKA 2XMCA 4J03A 3PUHA 4FMPA 1LPAB 4N5IX 1JT2A 4AN0A 2WILA 1VE6A 4W1SA 4D9JA 4N8DA 2QOEA 2K2QB 1AGYA 2WIGA 1J06A 5A71A 5AI4A 2JGLA 5J3JA 4DIUA 5A7GA 3JW8A 3V1LA 1PV1A 3CN7A 3AZOA 2Y1KA 3WWPA 2O7VA 3WK5A 5CURA 4OU5A 4N8EA 4X94A 5EIEA 1U4NA 1A8SA 1CR6A 5FOQA 5K3CA 4G4JA 4C89A 2VATA 2E3JA 1VLQA 3OTQA 3VJLA 4WFJA 4J0KA 2C58A 2YXPX 4LIPD 5CT5A 1EB9A 4HXEB 3R3WA 1ZIXA 4C4XA 5D6OA 3I6ZA 3C6ZA 4PSUA 2W22A 2IITA 5D7BA 3WL7A 3WWEA 1BU8A 4J0HA 2VSQA 1JU4A 4MQMA 2O7RA 2DQZA 2IIVA 2XUOA 1HBJA 1WB6A 4Y2RA 5DYYA 2JGJA 5I9IA 1ZI6A 3WKCA 4QDTA 2GYUA 3OM8A 3O4IA 3F98A 5DTJA 1UK9A 5LIPA 4LKOA 2YYSA 3DLTA 1LPNA 3AFIA 2O2IA 5JAOA 3K9BA 2CB9A 3H1AA 4LXGA 5ALSA 1XQVA 1LZLA 1FJ2A 5JANA 3DQZA 5JZSA 3GUUA 3Q8WA 1VJ5A 5CTAA 3TEJA 2PSEA 1A7UA 3TJMA 5AK4A 1BN7A 3WJ2A 1XQXA 2VQ6A 4BBZA 3D3NA 3H2IA 4Y2TA 3VVLA 3O9MA 3H04A 3IA2A 3T52A 1YASA 1XQWA 4OUKX 5AOBA 3JWEA 3BE8A 3IIIA 1UK7A 2WJ6A 3IUQA 2Z5GA 1EDDA 4G1FA 2Z8XA 5FDFA 5LYYA 1WHTA 2GYWA 1IVYA 2PBLA 4QDOA 2RI6A 2Y6VA 3IBTA 3RLIA 2HHAA 5CH8A 5ALQA 5DWDA 2XUGA 5ALRA 4W1RA 5ALXA 2XMBA 4BCBA 2G63A 1T4MA 3WJ1A 4EB0A 2HU8A 2ZSIA 1PJAA 5CT8A 5K3BA 3F8SA 2OCGA 5ALDA 1R9NA 3HI4A 4J7AA 2ZVDA 4U2EA 5ALMA 2WTNA 1AQLA 2V96A 3IULA 3IUJA 1GKKA 2H7YA 1E3QA 3BL8A 1MX1A 3NGMA 3FLEA 2OGSA 1IUNA 4BE9A 1SC9A 2H1IA 2QKYA 1UOPA 4DLNA 1H2WA 5EHZA 4PQEA 2ACKA 2VTVA 4ZWNA 1QOZA 3NOXA 2VJDA 5T4BA 4Y2PA 2FJ0A 3O95A 1CUBA 2P8SA 4WJLA 2EDCA 3Q0TA 5DYTA 1X2BA 2XI4A 5AM4A 4DTCA 2YASA 4O08A 1ZGCA 4LYDA 2XMQA 1W4LA 4JH0A 5KBYA 2HDWA 2HRRA 4X92A 3QVMA 3QITA 3FCXA 5ALOA 1GPKA 1YA4A 3PICA 3STWA 2VJAA 3AIKA 2XLCA 2OAGA 1LPPA 1YCDA 4AZ3A 1EK1A 1X70A 3FOBA 4BB0A 1W1IA 1M33A 1CUXA 3QM1A 2I03A 1G42A 1JFRA 1ZD3A 1GQRA 4JEIA 2QVBA 3BJMA 4H77A 2Z8ZA 5K3EA 2B4KA 5JATA 2QS9A 5K5EA 1N1MA 2NW6A 5JARA 2QMQA 5C8XA 5I8PA 3WZMA 1ZJ5A 3WK9A 4AQDA 2XUFA 1CUJA 3EQ8A 3G9ZA 4EHBA 1XZAA 1DX6A 2WUGA 4K6HA 1L7RA 1W52X 4WY5A 2OPHA 1F0PA 4QZVA 3DOHA 1VE7A 4B9AA 4YPVA 3FYUA 2H7XA 4UHFA 4RPCA 4I4CA 4BAZA 2JBWA 1DX4A 3MVEA 4HTAA 3W9UA 4TPKA 4L9AA 4X85A 2WJ4A 3DKRA 1HQDA 2WU3A 5AI6A 2ECFA 4BZWA 3C5WP 3VKFA 4UBOA 3G0IA 2I3DA 4B81A 3LIPA 4P08A 4X6XA 5EI5A 1QGED 1W6RA 2WFLA 4DNOA 1THTA 5K3AA 3CXUA 3QBJA 5CH3A 5IVKA 4M0MA 3R3XA 2RIPA 3C70A 4DM7A 4QA9A 1QIHA 5A7FA 3I6YA 2DFPA 3R3YA 3JYHA 1UK8A 5EHNA 2YH2A 1CIJA 2WHRA 4ARBA 1QIGA 4KAJA 3C6BA 5LLSA 4J0DA 3U1TA 4KRYA 3STYA 2XE4A 3FYUB 1ZD2P 2WHQA 5E4JA 5AI0A 1CUDA 1WHSA 4Q05A 4DNFA 2GBCA 1BE0A 4RE6A 1YB7A 4QEKA 5AIBA 3CCBA 2QUAA 2XUKA 1CQWA 2PKYX 3WMRA 3FCYA 2WIKA 2AJCA 4C4YA 4LYEA 2HM7A 5HZGA 5LZ2A 2XMZA 4LXHA 2WFLB 2WIFA 3ZLUA 2FJPA 3WKAA 1EA5A 2HFKA 3C87A 2ROQA 5ALKA 1Y7HA 3KOOA 1U8EA 2DHEA 5ISMA 3FVTA 3I2KA 1ETHA 5AICA 5FRDA 1LPBB 4HRYA 4K2AA 3R41A 4XWGA 2XQGA 3B5EA 4ROTA 1IZ8A 4JUIA 1CUCA 2ZYHA 1LNSA 2J4CA 1BEZA 3UUEA 4H7DA 4B82A 2AJDA 4UHBA 1QFSA 5HF5A 1IUPA 4X95A 5JD4A 4H7EA 1H22A 3OOSA 4J3JA 1RYYA 2PVSA 5AKLA 3IVMA 2WFMA 1DWPA 5HFNA 1GZ7A 1QTRA 1G5FA 3MGAA 3YASA 4MEBA 4C6HA 1UT6A 4CG2A 3MUNA 3DYIA 2VJCA 1QIKA 4C88A 4INZA 4P93A 4QWMA 4H7HA 1GKLA 1FFCA 3AUKA 4MYDA 3QZUA 3R0VA 3AIMA 5KREA 3I2JA 5AK6A 2HL6A 4IH4A 4IO0A 1D07A 3ICWA 1CUHA 4W9RA 4PW0A
chains in the Genus database with same CATH superfamily
3IURA 3CNBA 1UC9A 1V4NA 3D3JA 4E51A 1F48A 3BMCA 3O4RA 4Z7NB 3TM5A 1W85A 1E1QA 3GPBA 5A3SA 2WAOA 5JFOA 2VFAA 2W11A 1ZZGA 1NBAA 1NBEA 2AR9A 3SEZA 3ZI7A 3TZKA 4F12A 4Q1DA 2PUBA 2CDNA 5CR9A 2C7PA 4UTXA 1XZKA 2HJSA 2NZVG 2BR3A 2BAGA 4UOEA 3ISVA 2A5DA 4LXUA 3DHNA 2ZI6A 1G21E 4W5OA 3X43A 3H9CA 3ZY2A 4DLZA 2HA6A 4L07A 2O0HA 1I0ZA 2YWBA 5DFAA 3RS5A 1EVJA 3OT5A 4FMBB 2I2CA 4QBHA 2OAQ1 3FUTA 3WNDA 4BFUA 3KQPA 1Y6JA 4EFLA 5JCZA 3K6SA 1A9PA 3CNEA 5DCYA 3Q8MA 3A9TA 4KE7A 3D2AA 1FUIA 3AR5A 2B34A 2W4MA 5E2BA 2JFNA 2JL1A 2NYAA 2BI4A 3AK4A 2ZATA 2HK6A 4MRMA 4Q3KA 3S2ZA 4B3JA 4EB6A 1NT4A 5A02A 2D2IA 2POCA 4REQB 2ATXA 4Y2XA 5KAMA 2IWRA 3HACA 4CR7A 5H9WA 3OFNA 1OXTA 3I04M 5FOWA 3TGWA 4CIVA 4HPWA 4XVRA 2VSNA 1KJYA 2FP4B 3DEFA 3RYIA 1XB2A 2DFVA 1MG0A 1USKA 2Q0SA 4UE2A 1P1HA 3Q8KA 1FIUA 3HB9A 3R74A 4FHZA 1HZJA 4P33A 4RX1A 4MQFA 1B6TA 1EXDA 3QLEA 4PBTA 3GHHA 5DM70 2GVDC 4MS3A 3BILA 1RT9A 1Z5OA 1PEDA 3DEKA 2DGDA 3T06B 1YL6A 2YHSA 1G41A 2Y0BA 3ANMA 2FW6A 1S8FA 3NLLA 1UJ4A 4E88A 3GEHA 1P5JA 4B3XA 3NTQA 1UEXC 1P4JA 3LVQE 4NNPA 1HETA 1T10A 3OWXA 3K9CA 2QVLA 1L7NA 4BP9A 1KZ6A 1HEYA 1J2EA 3LGXA 3EZ2A 1UP6A 5F12A 4DLTA 2OCIA 3U48A 2ZM6B 2NUTB 2HLDA 4FBLA 5DTIA 4KQKA 3ZXXA 4ARVA 4M38A 4Z1MD 4LJ5A 5M7EA 3LO5A 4JJAA 1TJ4A 2VAXA 4FHEA 1JBEA 4DRZA 3Q9UA 4I9FA 5HUHA 1RZRA 1X7ZA 1SWVA 3GI1A 3TRDA 3ZJTA 2IJGX 2O2GA 4E70A 2C2KA 2JS7A 2R85A 4KXLA 1MD9A 4I9HA 2QRVB 2EBUA 1EZ4A 2GXSA 4GC9A 4RORA 3W2HA 1GY8A 3OU7A 3GW8A 1OX4A 4NOJA 5L3RA 1QPZA 3WYGA 3R5FA 4W63A 4WNAB 1SEPA 3F6EX 1T26A 3MBKA 3PKIA 5GVRA 5FLXA 1E64A 2P9TA 1AVTA 2P8JA 4RGVA 3NDJA 3E3MA 3ETCA 1B8OA 1PQUA 1D2RA 1YR9A 3BCSA 2RGUA 2W6MA 1EEHA 4E7OA 1IQPA 4IGAA 5KYGA 3IUSA 4R4JA 3RIEA 3LCUA 4RZHA 1XDBA 3RS0A 3THYA 1TAHA 2RHMA 1AQUA 4R2KA 1JJFA 1Y7PA 5A4AA 2K2WA 3U26A 3LLSA 3R4VA 2JG3A 2GEJA 2OOSA 1FSGA 3U3OA 1LC0A 1UBTS 2W4IA 3D2BA 5K0SA 1KS9A 1QE5A 2FPKA 3BWEA 4XR4A 2HUPA 1GDHA 4ESOA 4U5QA 4NCBA 2O07A 4EENA 1KQ3A 4DCJA 4CTMA 2OB2A 4WCVA 4GZLA 4D9FA 1Z36A 4CMIA 2O14A 1UH5A 3O7MA 3ZUPA 1V48A 3WB9A 4IHQA 1AE1A 3IP1A 3SXPA 4XLLA 3JXEA 1M2JA 4LF5B 2WBLC 1P77A 1MHTA 2C88A 2Q2WA 3C5HA 4A27A 5FUMA 1OSNA 2HMSA 2R6HA 1GGKA 1XVAA 3TMKA 4AKTA 5LXTF 4U7DA 2B99A 4KDFA 4I19A 2FF5A 1NUHA 2P2CA 2BEVA 3CUTA 3IV7A 3L93A 3DL4A 4H08A 1PLKA 3MNFA 5FO1A 1U02A 2HA2A 4IMJB 4EP1A 2CXQA 1DAPA 4BNUA 1U7WA 2PRSA 4RPIA 5KQMA 4N0PA 1SOAA 3WZ2A 3MA0A 2DBZA 4CFSA 4CRWB 4XJTA 3SVTA 3N86A 3HRIA 1GGJA 3WGUA 2RMKA 2G1UA 4JCOA 1SKQA 4RCVA 4ES6A 1WIWA 3C5VA 4HFMA 1T5SA 5CHEA 1RAIA 1XJQA 2JIMA 1L5HB 3H16A 4OHBA 2UXCB 3TW4A 1ITZA 1UBLS 1E4EA 2H54A 1KYTA 3UHAA 4UJ5A 4OB7A 2E89A 2C5BA 1C9JA 4DDVA 1LFAA 3QELB 1R00A 2ZOSA 2O6LA 4JKIA 4P3PA 1L5LA 2UZ0A 1J1UA 5IT9A 3CSDA 3VM6A 3QSYA 1BRTA 5AW0A 2F2TA 3QK7A 5ESXA 3GLGA 5JNLA 1O54A 2J0UA 2V9ZA 2IHUA 3EOBI 4JP1A 1NUQA 2P11A 1XMPA 1NDUA 1JAHA 1HRDA 1KGSA 3EEFA 3DE5X 2YFYA 3EXFA 4V24A 5GWXA 3W4JA 5HKAA 1G18A 4PPFA 2YVAA 2YZ7A 3I58A 3I83A 2FWIA 3H3XA 1TZCA 1JECA 2BF4A 4NVRA 5FFNA 1T9CA 4BRZA 4PO8A 4C01A 4RTNA 3DAHA 1EE9A 4NOMA 5LOVB 1E5DA 1KE1A 4FS3A 4BNVA 2R6DA 4KE9A 3QUBA 3L0PA 4GQBA 4P31A 4D82A 2I7CA 1MZVA 1OGJA 1PWEA 1TU3A 3DTTA 4AMGA 4D74A 2PUTA 4WY8A 3W2TA 4LZJA 4ZEOA 2JAOA 1M54A 3O74A 1FLNA 3VC1A 3T5PA 4FYHA 2Y8EA 1OE0A 4HDKA 2VDQB 4FC6A 2FW8A 4RCZA 2JLWA 1O3YA 1OFIA 2IHKA 2LKDA 3TEFA 4R68A 4Q9NA 1IZ9A 4U7HA 2PMFA 5JCOC 4JBHA 1QP7A 3PCXA 4HB2A 3STVA 2OMEA 2KLHA 4FLFA 1QZ3A 4KQMA 3CX4A 4LRTB 2EU8A 5EYPB 4EF4A 5KOIA 4FM9A 3S5UA 4NARA 2JEZA 2NT3A 2XJ4A 3LAWA 3AV0B 1TZMA 2ZRNA 5TDHA 4IIJF 4TYNA 3P9NA 1BE1A 3FIJA 2FZCA 3LFHA 1Y4DE 3KQQA 1RJ9B 3IBSA 2A1UB 5FORA 1PN3A 2IHBA 1LBHA 4EI8A 2BFCA 4N12A 2YL2A 5HJ5A 2C5GA 3LKVA 5H82A 3HKDB 4B1FA 2JVJA 2HA5A 4NQZA 2CC2A 3O31A 2D8AA 1SUPA 3ZOZA 5JHHB 2VP0A 4JEHA 3ZLJA 5TEWA 1KP2A 1ESZA 2QRHA 2OFXA 4OHFA 4EI2A 3WL8A 1QIJA 2FI1A 2JJQA 4DA8A 3BJIC 3VH2A 3F3MA 1IZZA 4LRUA 1R0BA 4OQMA 1SZDA 3DBHB 1KQFA 1IOZA 4UUOA 5CEEA 3MMNA 2NPOA 4L5JA 4LJKA 2C78A 2RHTA 3I6IA 1M72A 4JLDA 4TQUS 2W6JA 5BWLA 3H8VA 1SO8A 4BEVA 5J2TF 2Z04A 3VA7A 2PT7A 4M88A 1A5AB 1ZX1A 1W0KA 5B1SA 2Z95A 1J24A 2P7IA 3RHSA 2Z30A 3TSOA 1GZSA 2ID8A 2Q1XA 1OXMA 3EK2A 3G02A 3ONEA 5CU7A 3ZQJA 3R4CA 4N54A 1JMKC 2HU7A 1HT3A 2ZFUA 3KKLA 4R1PA 2EKQA 2P9EA 1N92A 4ZAXA 2XZDA 1I1HA 4RLQA 3RVLA 1T3TA 3MAJA 2XECA 2VQDA 2HWYA 1YAJA 3QLUC 5K3FA 1OXKB 4FS8A 4MIYA 3UJBA 1L7BA 1XDGA 1Q3TA 4F2GA 2NWQA 1T25A 1EA7A 1K8ZB 1UAGA 1XL0A 4HDOB 4TTSA 3R7LA 4MB0A 3WGLA 4DA6A 3ZGNA 3SEAA 2NUAB 4GOMD 2QD1A 2CCKA 5IJZA 5K2MA 2CVZA 5L6MB 4LCBA 5J5AA 4BEBA 1Y89A 4ZI2A 4CIBA 1RRCA 3VBCA 3HJAA 4MHSA 3OWHA 3MXTA 1BX0A 1JAZA 1AKWA 1V0JA 4M9UA 5G40A 3FKQA 4M87A 1MA0A 4OFWA 4KGXA 2PL3A 4CKWA 5BSKA 4EHAA 5C53B 4AKGA 4QG7A 2VS1A 1DAGA 3D0QA 1MDBA 5H4GA 2YIDA 3AM4A 1D1QA 3MD9A 4PU0A 3ZWBA 5AVVA 1QRAA 3F9CA 3LP8A 4C22A 5HJEA 1ZBQA 2YCLA 1TF2A 1B8VA 1GNQA 1T6XA 4K9QA 4LRSB 3IRUA 5F5LA 2VP6A 2R8XA 2VK8A 3PXBA 2VXCA 3Q7PA 2OG1A 3GOHA 4TV9F 2VXBA 2XB2A 3C7AA 3FGPA 4UAGA 3W8FA 4M53A 4DT1B 4FKZA 4XQ0A 1HQCA 1YOVA 2BIFA 4WLFA 5E3JA 3ABZA 1GILA 1DJNA 2H1RA 1N2SA 4G0NA 3ZS9A 4NCAA 7ADHA 5L40A 2V54A 3MWDB 1LF5A 2HQ1A 1J7KA 1P5ZB 5AH0A 2TECE 3SWWA 2C61A 2EHJA 3CT4A 4JP8A 2AFVA 2Z1NA 3Q15C 4PTZA 4C29A 4MMXB 9LDBA 1WXEA 1JSRA 4D3XA 1EFPB 3ZWXA 3IAFA 3R3VA 4OFBA 5CLLA 4HV4A 3C48A 5GADl 1AZLA 4ERNA 1N3IA 5EMLA 4WK4B 4EX7A 1Y6GA 2H1SA 4ZZ3A 3SDSA 3P9RA 3RRZA 2W43A 2OQRA 3WJAA 1XVVA 3TZQA 1YUNA 1J70A 2SKCA 1DDIA 1SMKA 4ZODA 3CM0A 5TIIA 2GF9A 2MMGA 3CJTA 3EB9A 4FXPA 2JZOA 2XZOA 1RYNA 1DT3A 2B8JA 1T6ZA 4NOLA 1SB8A 2YV1A 4N7RA 1GRQA 1R50A 3RSHA 5KVVA 3REQB 2SECE 1M6VA 1ACJA 4QYIA 3U0BA 4PLVA 2A9FA 4GG1A 4J75A 1XU9A 1MB9A 4GYKA 4D3ZA 1QNFA 3EYWA 3N74A 4QOHA 2VNIA 1CU1A 2O2HA 2YV4A 2JJYA 4AX4A 4UFPA 1SUSA 2HHJA 4EUSA 5IC6A 3UFXA 1APBA 2OCAA 1P81A 5KVCA 3FLBA 4TWRA 2YY6A 4JYMA 1LGYA 1UC8A 1YVRA 1ECFA 1IYZA 4LG1A 4FIDA 4GOOD 4QVIA 3A3YA 2OOKA 4DJFC 1V1MB 2EBWA 1T4CB 2R7AA 1Y8QA 4JELA 4BJ3A 3HEBA 1TO2E 4ND5A 5DJ5A 1C3EA 4YMHA 1VE9A 1XP5A 4JZYA 4R31A 4YRAA 2JH8A 5CCDA 1G20E 4EGFA 2C97A 1XN4A 3CY6A 4KVGA 3K0HA 4C2UA 2Q2QA 2QTMA 4KPFC 1SEVA 1U0TA 3N58A 4NJEB 1AKRA 2PXXA 3I8SA 5L7WA 2ZIXB 5J4HA 5EWMA 1EUDB 2KBEA 4N03A 5GZ1A 4WKOA 4GLFA 3WKEA 2B1JA 4QPDA 1MAWA 4RWZA 1JTEA 3CJQA 3S7ZA 2ZZMA 1RLTA 3HJTA 5AUNB 5TGTA 4EEXA 1RPJA 5CDHA 1WEHA 4I6EA 3O94A 3VNUA 3I23A 3ON5A 4Q4AB 3FX2A 2WTEA 3ABIA 2Q0XA 3I9NA 3BZUA 4A2PA 2O8CB 5BWBA 3FCOA 4BJ1A 1C8KA 3DV0A 3D7RA 1E18A 3QUTA 3UC9A 4QGGA 3N8KA 3PUVA 4ND1A 4IIGA 1N57A 1GXSB 1WXFA 4I0WB 3T3IA 3TCKA 4DG8A 1TYBE 3ANTA 3VH4A 1COWA 4EOGA 5AVOA 1YS6A 2HF8A 2H31A 5B12A 3Q40A 2C2XA 2E6KA 3DOIA 1BCRB 4JI7B 3G0CA 4U4AA 2WU8A 3HCPA 3I5XA 4P5EA 5M29A 4PX3A 2WKRA 1FSZA 2ZTVA 3QPDA 3G9QA 3IKJA 4REOA 2GSWA 1A71A 3R23A 4ZZIA 5I01A 2H0AA 2QG9A 1C4XA 2C7VA 3HVHA 5AXAA 1WPRA 3H2KA 1MJNA 1NZDA 3HWRA 3ZCXA 2X14A 1SA0B 3N2ZB 3CPHA 3G9XA 4E1BA 1VLVA 1P8AA 3CEMA 1W34A 1GR0A 4C78A 4V0LA 2B78A 4BNGA 3QWAA 5CLQA 4ZOLA 1KO1A 3V2HA 4RKYA 3OCVA 2EZUA 2GNAA 4NZPA 3JU3A 1RJEA 2GD6A 2WJWA 3T7IA 4G5HA 4E33A 5SZJA 2DTEA 4GPBA 4BVFA 3UJ8A 2HSWA 1JLLB 5JS8A 2YYZA 2BGUA 1SFRA 4QDJA 3C1TA 1CZLA 1KOFA 2O1WA 1FF9A 5EZYB 2XB8A 1LBQA 2XDYA 2ZYAA 3EEIA 3NHAA 3NEYA 4MW1A 3KYDB 4TTJA 5FBZA 3LZDA 5J58A 1NAHA 5BSVA 3P0RA 3IPXA 1A9SA 1VJ1A 2WJAA 5HP4A 3OO0A 1TLLA 4LXIA 4DMFA 4HNVA 1DO0A 3C43A 2JRLA 2H4HA 4MVJA 3PFKA 1U31A 5SV2A 5TGDA 2VZ8A 1PT7A 3D4LA 4NCIA 1PHRA 1Z3CA 4UVIA 3TKLA 5ADVA 1KJWA 4P3KA 4UQLA 2EHDA 4A91A 1V5EA 5EUMA 3VH3A 4BE7B 1J49A 1J8MF 3U7HB 4Z0PA 2GNPA 2BD0A 1PJ4A 3I1IA 4JODA 4QULA 3SC6A 1ES9A 3ZJUA 4M36A 2PGOA 2IU0A 5J4LA 4QUHA 1E2BA 2QSZA 3KZMA 3TQHA 3WNQA 1C1HA 3O73A 3FH0A 4C0JA 1KE2A 2WLTA 1BWPA 1QKKA 3OY7A 4YJFB 4ETNA 3B82A 1XU4A 3L4SO 5JWOA 4D8YA 4TKVA 4NBTA 4FSXA 2X23A 1QFXA 3UB4A 3HUUA 4G1UC 3AEXA 1EAMA 3UK7A 3Q9NA 1OU4A 4J6FA 3P96A 3T1HB 3PI6A 4BNIA 4G1MB 3ZWDA 2BFBB 1YU6A 4ZVNA 5AOCA 2UVPB 4Y6QA 2JGKA 1O5TA 3UMJA 2BFDA 1V11B 1NJ1A 5A9TA 2Q21A 4FK8A 2IUUA 3RVMA 2JW5A 2GN9A 2ZSHA 3WK6A 4EMTA 4EPTA 4UEQA 5CBPB 3RSFA 2B4AA 4RA6A 1JVSA 3R09A 1SQSA 1Z82A 3C6QA 5GAJA 3RS3A 5YASA 3TAHA 1MC4A 1XCMA 2ZSAA 3DE6X 1ZISA 1UK6A 3T7CA 4JEMA 1T4BA 5SY4A 1WU7A 1IQ0A 2FSVA 3WK8A 1QYXA 3FNEA 2ZJ1A 1IOWA 1S8NA 2ONKA 3QVTA 4X8MA 1V1RB 3M1YA 4JXJA 1ST3A 4TZKA 2G07A 1A9ZA 2XE8A 5EKTA 4CFYA 2PUEA 3A04A 4J0GA 1ZJ6A 1RP7A 3LPCA 2EWMA 4HTFA 5DM60 2FDCA 5GZ3A 1G6KA 3NH6A 2UXDB 1CYDA 1DTWA 2G3YA 2FPIB 1JHAA 1TEXA 1JFFB 2WUVA 1PFYA 1X7GA 3ORFA 1X14A 5F7JA 4E5VA 1POWA 1P9LA 1BSVA 1Z16A 4QAQA 1XRPA 4UPEA 1YFLA 4JB2A 2GDJA 2J3JA 5FFMA 3X3HA 2PPLA 3E7XA 3MJTA 4Z54A 3CWZA 3OUTA 4UHDA 2PVPA 3BFPA 3OU2A 3WL4A 3WLIA 4GI1A 5TQ2A 4TSKA 3HVKA 5ALTA 2CLDX 5KYVA 2GLXA 2E1RA 5EXSA 2DTDA 1GITA 1GCAA 4CLOB 2OAEA 4KLAA 3S2UA 1T1IA 1S5PA 2X7JA 3MD0A 3MQ4A 1EU1A 1NQWA 1ISMA 5IASA 4D9EA 1XFDA 2FMUA 5FUBA 2W83A 2PS0A 2D13A 2HIMA 4LHZA 1FDSA 1TO1E 1ILWA 1CC1S 3INGA 4TKUA 2EV9A 4BNDB 5IK2D 5TSDA 1BS1A 1PR3A 3HKCB 1R9JA 3VZDA 2X4IA 3M49A 3AINA 3RADC 1HORA 3F6RA 5CBKA 2GO1A 1IN8A 5KINB 5LZ9A 1MOQA 2NM0A 1LK7A 3LSYA 4OSPA 4Z4EA 2VBCA 4BPBA 1K63A 2V3VA 3PDIB 5FUQA 4NOKA 4O2AA 1IH8A 3WLEA 1Z8HA 3HUTA 4I6JA 3FE2A 3EHDA 2XCRB 4BX8A 2LP4Y 4REQA 4LYAA 5IW8A 5ECGC 1ZN2A 2O52A 2DMRA 2Q3LA 4DLPA 2A67A 4LDNA 4C7KA 2NO7A 4YLGA 4LBWA 4JN6B 1KYYA 4YTEA 3AVYA 1QGOA 4GGOA 3SFZA 3WO0A 1RRVA 5I5GA 4XWTA 2ZT7A 3DAPA 1HQKA 4GBJA 3ZHSA 2XBMA 2I65A 1V8BA 4RUKA 3B36A 1A9TA 5EAIA 3LX6A 3IS3A 2O8EA 5L7YA 1QB8A 2IOFA 1NKSA 4TMKA 2I4NA 1V6SA 1X7WB 2PT6A 1NUPA 5KSPA 1PE0A 4HN9A 5EXEA 1KMMA 1WP4A 2P2DA 3IQWA 4HUQB 1UDBA 2ZAOA 2IEIA 5TPZD 2HF9A 3V7UA 1NVMB 3GQBB 2GARA 3OE5A 4ETMA 4YCLA 1QU3A 3D54D 2J9RA 4IHAA 5L51A 1OXBB 1WW2A 3NEAA 3QI2A 1T36B 2HRQA 2Q4EA 2NGRA 5KOJA 2AR7A 4OYYA 1YRWA 1Z38A 1QE3A 4J91A 1OBVA 4Q3NA 3TXXA 3ZG6A 2FPRA 1K92A 2V7EA 5HILA 4HAZA 4OJTA 3IX7A 2CF5A 5FL7D 2GJ9A 4EQZA 2NUTA 1MAHA 1Z5GA 1UC4B 2SCUA 3VR3D 2X76A 1MA3A 4URHA 4GDMA 4QYSA 4FCCA 1RPAA 2A59A 1PWXA 4AURA 4BMCA 2WG1A 3CMMA 5DM1A 3R8XA 5JBQA 1YH3A 4POAA 2RGEA 5ELMA 5JFGA 3DL2A 5HA5A 3SP1A 2Z8YM 4OVKA 4R2IA 2XCIA 2O48X 3VAAA 4D8VA 1OLUB 2GPYA 2J9FA 4H4DA 1VJGA 2QRVA 3LQRA 4BNZA 4C43A 3FNFA 3TIXB 1GG2A 3SSAA 2NYRA 4BUJA 5AUOB 1JXOA 3HCCA 4G97A 5K8LA 4B17A 2CNDA 2FYTA 3GX1A 1V45E 1X1SA 1OA1A 3NP9A 4EJSC 4X1YA 1YDMA 2W6OA 2CEAA 4HNHA 2I0FA 2J5XA 1N7GA 3FJ1A 2ZJ3A 1XTZA 3QYJA 3MUOA 3WIBA 2I9PA 4MYSA 4PYIA 4NHOA 3JWHA 3D4OA 4LWZA 2RGAA 4EJMA 6CHYA 5JU6A 4H15A 1FXWF 3ZNQA 1KY3A 3A4MA 4HNAB 3AVUA 4I6GA 3G8BA 3V8NA 10MHA 1EVEA 2O5RA 2DM6A 3ZCSA 4S1OA 4CMCA 2CFCA 4B0PA 2VPXA 4E4YA 2LV8A 1U8CB 3MPUA 4AK9A 4WY2A 3W1EA 4A26A 1YS1X 4A7PA 2HLHA 4TTTS 4DR6B 1YKSA 1E6CA 4ONEA 4CMJA 5AVWA 1RXIA 2C0PA 3L0DA 4X6YA 1P0CA 3BH6A 3CX8A 1LTQA 4OHYA 5M04A 2XAAA 3KSUA 1W93A 2O2ZA 4YJ2B 3U7JA 4MKIA 3DEHA 4LEIA 1TUBB 4K6GA 3PE4A 1FTQA 4WBNF 3KQHA 1U90A 2RGCA 2OT3B 2Y66A 3DDUA 4IZ6A 1KYXA 2I3BA 3RIXA 3L8MA 1XFAA 3ZWNA 2P6OA 5CLHA 1ZUNB 3ICVA 4RZIA 1N33B 1ORIA 5FHQA 4E5SA 3IXMA 1Z2CA 1V5IA 3F90A 1PZHA 3B9PA 3L8EA 2YHIA 4RFLA 4KYVA 4B43A 4YP1A 5JVDB 5JPDA 3ZHTA 1Q19A 4N48A 1BQEA 3PEEA 1I2BA 4LJAA 1R0ZA 2CFRA 4WGFA 1GU0A 1XU7A 4J16C 1L0BA 1F5SA 2H9YA 3U4CA 4GU5A 4B0OA 2AG6A 2OVBA 2ZB7A 3D7LA 4G5XA 5I9NA 3V3KA 4YN3A 4CT4B 1TM5E 3RVJA 3F2IA 2OSBA 1TUIA 4P0QB 2R8OA 4ZU1X 3DWFA 2XCQA 1Y8RB 1C2YA 4BY9E 1KEEB 4MUYA 4D0GA 1V8DA 3EQ7A 2AF3C 3P5SA 4GBGA 2ZBUA 4KXNA 2WUDA 4RVHA 5JAQA 1O4VA 5CA1B 1XVTA 1SIBE 1A98A 1XQ6A 2Y0PA 4FFVA 2ZE7A 4M6WA 1Z4IA 2OZEA 2R8YA 3MTGA 5AI9A 1QHGA 3U4DA 1ZJZA 2ZULA 3OEHD 3ROMA 5BV1A 1O6CA 3TNFA 2OHFA 4US1R 3FLMA 3GAMA 1G8HA 2I2XB 1X1TA 1M2OA 1S8AA 2NOAA 4UARA 4R41A 4KB5A 1ODTC 3PQ3A 5DP1A 5BSUA 3W34A 4EVSA 1SXQA 2O57A 5JMOA 1U6IA 1GUZA 4Q21A 4YRCA 4BFTA 5KNLA 1TEVA 3QJ5A 2EZ9A 3BOSA 2BRUC 3KZNA 1SKYB 3NB0A 3RAFC 2JCVA 1LK5A 2QD4A 3O3MB 2AXPA 4RVNA 2YRXA 2Q27A 1KBQA 5GQSA 1GAWA 2VYND 4HS4A 4ZZ2A 3TL3A 4BYGA 2WTUA 1E9AA 4UCWA 2WV7A 2N42A 2HEGA 1YZHA 3E7WA 3IDAA 1B74A 2BH9A 4K6CA 3R9XA 1IOLA 1W5FA 4HDAA 3R75A 1AQYA 3CWQA 4H6XA 4RKFA 5E4TA 5LB4A 4YHBA 4FFOA 3RSOA 5JEDA 3BXHA 4XUDA 1GG8A 3GFBA 2O3JA 1I0LA 1R6XA 3RIMA 3GYBA 3EFHA 5HS6A 3VC3A 5JJ5A 3PT5A 2FLKA 4YUVA 4XOUA 3L01A 1V7QA 2R11A 3AKEA 3GELA 4MAFA 4ER0A 3W5HA 1U1DA 4UCXA 2W98A 4P4NA 2QUIA 3HDJA 3KU1A 1M6WA 5HNKA 1X87A 2WJJA 4Q7KA 1NM5A 3FOEC 4RY9A 1DAOA 1ZL2A 3JQFA 3W3AD 4HMQA 4BVAA 3WYBA 1ACMA 4JJ7A 4TT8A 1RIIA 1VM6A 2R65A 2ZUWA 3QEOA 1WVGA 1JE1A 1Y4SA 2YJGA 3E2PA 3UAXA 4LY6A 1Q83A 2H06A 3NJ8A 2XQFA 4TT3A 4UHJA 5THKA 2ON6A 3L6OO 3RAJA 1Y6RA 2RBEA 4JYBA 1BHQ1 4EHLA 5MHTA 2FN4A 4TS4A 3T7AA 1YZ3A 1TCCA 2E5FA 1BXGB 3JV7A 1PTKA 2OZLA 4XYBA 1H3EA 1T8UA 2C84A 3GRRA 5C5CA 2AFHB 1JDPA 3CKMA 1NASA 1P80A 1THZA 1I6LA 4K8RB 4K5QA 5ITSA 3N2EA 3E1GA 1ZAKA 2AVNA 4PSVA 1SIUA 2EARA 3BGVA 2E87A 1KFKB 4BAUA 1QO0D 3IEVA 4EG8A 3NAGA 5HUJA 1JVBA 3HCRA 4GD3Q 3RC9A 2YYAA 4L74A 1FFAA 3NBQA 3IEPA 5K0ZA 1CJBA 1NTOA 1ZM4A 4U0KA 5H7XA 4ETWA 2W00A 3WGQA 5ELXA 1FMCA 3EVZA 1XLVA 4Z2YA 4N7MA 5CFPA 1TEZA 1SBHA 5DI9A 4HRVA 1WQ3A 2AD1A 2J3MA 4JX8A 4B8WA 4B74A 1QANA 1WPXA 2OWEA 1Q16A 4YJDA 4EB8A 4QXOA 2MIIA 3AJ9A 3ZD9A 1FL9A 5C3UA 3BSFA 4I5FA 4JI0B 2QT0A 5JCJA 4DC0A 4RK7A 1P4SA 3ODPA 4M1EA 2IUYA 1VOTA 2NUAA 4Y0NA 5D8DA 1ZGAA 2G06A 4UVHA 3L6EA 1N7IA 2H0RA 4OCZA 5CLIA 5EP2A 2D5CA 1NW4A 4MP8A 1TKRA 3BB1A 4ZV9A 1DBRA 3ZK8A 2BTQA 3VU9B 2GD0A 3A2LA 3H5LA 5FUWA 1N78A 1T5HX 3TW6A 3NDRA 1USVA 3ESAA 3K0FB 5IABA 2VDLB 2NZJA 1LQ2A 3K0EA 3RODA 2QR5A 1AUOA 4LOLA 4BV3A 1VPVA 4I1IA 3E8XA 3PUJA 1T3LA 2JAPA 4WK6A 2CWWA 4WMLA 4IJ5A 1U1IA 2X77A 1ODLA 3JR3A 5BR7A 3RV4A 2F8LA 5DTRA 2RG7A 1E66A 1VFNA 2D2FA 2C4UA 2R79A 1GU1A 4NECA 2M6KA 1G7CA 1KC1A 3HA7A 4AJ1A 4F6CA 2WWXA 2PYZA 3LWNA 1G7SA 3I04A 2LCQA 2ZSFA 1LTHR 1DQZA 4OUDA 4X5OA 3VHXB 4CKBA 3O8NA 2PLFA 5EWLA 3G8YA 5ALWA 2Q6LA 1WX1A 2A7XA 1I2CA 1T9KA 3CH5A 2KX7A 1YI0A 2FPXA 4FFSA 5F7ZA 4BWFB 4CM8B 4MDEA 3MWDA 1E2LA 2GTHA 2X4DA 1ORRA 3CT6A 1TJYA 4XCVA 2WE8A 5E3HA 1DBVO 3PFBA 5BOVA 4I2VA 3G7SA 1C3JA 1J00A 2P5UA 4E7PA 1VHQA 4HPJB 4W5TA 3QPBA 1VGVA 2OBBA 4WCFC 3G2PA 1QHNA 1WNFA 4MR9B 5AVXA 1ILEA 4PYKA 4GMFA 1ZH4A 1OIXA 4JJKA 3GEPA 4G8JA 4J1QA 2HZBA 4W9NA 5JAUA 5BV8A 4B6SA 1E1CB 4LKRA 4NYMQ 1XPOA 1NXWA 1KSHA 1JSXA 2FEAA 3F5SA 3PR2B 4QDXA 1SCUB 5SZIA 3VTFA 4JYZA 2UZ1B 2A3RA 2YJZA 3OHSX 5ICCA 4J1SA 4HLNA 3K0SA 2HADA 3H4MA 3VDMA 4HDQB 1ZNZA 2O05A 1NXTA 5CEJA 3WRYC 1CUFA 2OXEA 4LSWA 3P8ZA 1ADBA 1VA5A 2YBDA 5HGJA 3NBAA 3ZYCA 5C8ZA 3RLFA 4EJ2A 3SMQA 2V1UA 1J2RA 2G36A 4UD2A 5EWJA 2PVCA 1V7CA 1GYRA 1E6UA 1TOAA 1XI2A 3FR8A 2G70A 3NO4A 4Q7JB 1OFUX 3JQ8A 3R6WA 3A6ZA 2IZ7A 1WBJB 2VA8A 3C6MA 1X1AA 2L17A 5I8WA 1E4OA 1XD8A 2JI7A 1JG1A 1T4CA 4J0CA 1C3OB 4Q4JA 4BV2A 2IV7A 4UUQA 3HVRA 3R20A 1SOUA 1DAKA 1CY8A 1JBQA 1WSAA 1UPFA 2IOYA 2BHSA 1KZGB 1MH1A 1Q17A 1BXKA 4CMBA 1ZD9A 3CWCA 1H9CA 4GLJA 5ENVA 4MVJF 1HNNA 4NR0A 4I99A 4DWJA 1MH9A 3TTSA 1IEXA 1QIIA 2OO3A 3TIGA 4EHKA 1XZFA 1EP1B 3G85A 3E61A 3QU2A 3EBOA 4NJEA 4Q1EA 4RBNA 4HLUC 2ZIXA 3JS5A 3HN6A 2ZUUA 4HQRA 2RK4A 4M1TA 1PDOA 3ZD8A 1UPAA 2OHIA 3NOVA 1ZN8A 1PSDA 4LZZA 1UJCA 4GSKA 3KVNA 3MOGA 2NX2A 1E2UA 3CW2A 4HAIA 3B9BA 3IIKA 4MS1B 1IDN1 4F5ZA 1X3LA 3FGNA 4LI3X 3ZVLA 4Q4AA 1JHYA 2DCMA 4MPJA 1V5WA 3R6GA 4R2HA 4WEQA 4ZYTA 2DR0A 5EQTA 2RD2A 1VKZA 4MPPA 2PQMA 3G5LA 3QFRA 4MWBA 4PLPA 2R4TA 5KWSA 1ISIA 2CNWD 3T95A 1Y33E 3HP7A 4IDNA 2HY7A 1GQSA 2GOYA 3OZRA 2QX8A 2NV0A 3KJIA 5LJIA 4C05A 5IC4A 4Y1GA 5D1HA 2IKSA 1ZMRA 5FPSA 1AMNA 1P19A 4BYMA 3T5BA 4L85A 4AX8A 5FH9A 2A9KA 3ROZA 3QVGB 3OZFA 2UDPA 1YMQA 1DOZA 3MTDA 4L73A 4U2KA 1BDMA 3H84A 1FXSA 3ZWOA 2EP8A 2LWIA 1EHYA 1ZRNA 2GHRA 1ZM3A 3WMXA 4CL2A 1QDUA 4QDZA 1ISJA 1BEEA 3C8UA 5LZ8A 3N2NA 3GAAA 3GA7A 4EHJA 3RU2A 1LPSA 1TAGA 4RD0A 3NV9A 4BASA 3ZXIA 4BQPA 4C0HA 1JKMA 1MNQA 1AGNA 3FTEA 3PC8C 4M98A 4A1FA 2FA9A 5K09A 4DDHA 4UBJA 2OORA 4RNCA 4AP5A 1LS1A 2ZU0C 1CRWG 1QORA 2NU9A 3HYTA 4KVFA 4AZ0B 3K1AA 1ZK0A 3HFRA 2AMVA 4DM3A 1KI1A 1MCZA 1CQZA 2J30A 2KLBA 5G1OA 4EBBA 3WGIA 3TUJC 4BTVA 5AFSA 2XDWA 4Y3UA 5EZYA 1Q7BA 1N2XA 4JFAA 821PA 5ANRB 3W1WA 2QTVA 5EHQA 1UAAA 1EIZA 1KU6A 2QR2A 1RWXA 3MC1A 3QEKA 4JC0A 3KYDA 4EO4A 3QENA 1ULBA 3NXSA 4A5OA 2ERCA 2P62A 3MMZA 3WL5A 1DFHA 3K4HA 1NG1A 1OF1A 5JAPA 4L0QA 4LDAA 4M99A 1V9LA 4I4TA 1XNGA 1HM5A 2C5AA 3FPLA 1BGXT 3LG2A 4GX1A 1I7LA 5IWAB 4PQRA 1XCOA 1EFKA 1TVKB 1WCIB 2ZBVA 2ZRFA 3QX7A 4KC0A 4UHCA 5BN1A 4KBGA 1XPRA 1LW6E 4WZAB 2AOTA 5A9SA 5CLFA 1CTQA 4QUGA 5HK9A 2DY1A 4TGLA 4D45A 3UTDA 1XO1A 3BAZA 3O4GA 5IN4A 4FSHA 1F6WA 2V4UA 1R5JA 1U7DA 4PC6A 2QN2A 3SIXA 5JYEA 4QOEA 1VKRA 4ENTA 3EGVA 4O5OA 4G0PA 3AHFA 1QQ7A 1VG1A 2HSJA 2ZYVX 3KPYA 3C3EA 4YROA 2LE0A 3FHOA 3NHSA 2ZT8A 3M6WA 3DTVA 1SWWA 2QN9A 2Y99A 1LNQA 4JXXA 1A77A 4ITUA 4KQWA 4UMVA 1C14A 1O89A 4G0ZA 1EFRD 4NBLA 4OQEA 2Y9PB 5LU8A 4H18A 3EOZA 3ZJ5A 1L3BA 1VRVA 4LWQA 1U65A 2AG0A 1HA3A 1MXFA 3MTBA 3QP9A 4R3WA 4GBMA 1V9CA 3ACDA 3IO3A 3ECAA 4MH0R 1JEOA 1IHOA 5AM2A 3INYA 1OCEA 4NLLA 3THXB 5EPOA 2GBLC 5CBPA 2G25A 5DN6A 2YWJA 4G36A 1ADJA 1G59A 2J31A 2XUIA 2WKWA 5EMKA 4D0LB 3Q6NA 2FLWA 5EESA 3OX4A 1PG0A 1PR4A 4AJ4A 1VA4A 1AZWA 4G09A 3LWBA 2ZS7A 4M0UA 4WKPA 1KDVA 3VHRA 3BH7A 4Q48A 5P21A 2O8BB 3ENZA 1ACLA 4D41A 5DHUA 5DNWA 1JAYA 4U7FA 2V7VA 1E1NA 1UXIA 2QM0A 1RYEA 3GZJA 3OCJA 4M49A 3RNLA 5EIXA 1A96A 2GLUA 2PSDA 3I9MA 3OQVA 2BFWA 2FVXA 1L4MA 4P1ZA 2WQZA 1CDOA 4DAEA 3CYFA 2P40A 1YOBA 2REQA 3AR8A 1BHO1 2C4MA 3EXHA 1QGUA 1T0UA 2C3UA 3QWHA 3I62A 4H4CA 2ANCA 1MX9A 1U2EA 4RGBA 1CQPA 1GAQA 1GGNA 1BHJA 1DQYA 3KIPA 4LTMA 2EW8A 4LNUB 4R71A 1E3MA 3CRNA 2I22A 1P1BA 2XTJA 5TC4A 2WT8A 3EVDA 1PLJA 3EGXA 3P9QA 4NCKA 1CK4A 2O2XA 3Q5DA 3OURA 2ZDQA 2OHJA 1PK8A 3VR5A 5H02A 1NQAO 5AP9A 4FFBB 4KK4A 1SHUX 1RKVA 2CVOA 3KB2A 4X8HA 4C4TA 5C9ZA 1L6IA 4JI2B 4TTQA 3FSEA 4PZCA 4Y2QA 3W8NA 3OJWA 4AW9A 1DKUA 2ZREA 5LA6B 3G79A 4DL9A 1IWOA 3IPRA 1ZWLA 2Q9BA 3T0IA 2JIZD 1EPUA 1MB3A 2OG2A 4NBVA 4F9FA 3QW2A 4NP6A 2X0IA 1CUYA 2V9CA 2J59A 1DCFA 1KORA 3B12A 3EZLA 1LBSA 1PNTA 1FDTA 3FROA 3ZDEA 1GNVA 1I24A 4UULA 1IN1A 3M5PA 1Q0ZA 1QJ4A 2F9LA 1WZUA 3NM4A 3OIYA 5EGSA 1W49A 4P92A 4Q7MB 4W8HA 2HXYA 4LK2A 5KWJA 5FLYA 2VH1A 3H1FA 5KNBA 1N36B 4Y2GA 2F7SA 2KW5A 4ARCA 3V33A 3RI3A 2QI9F 3U81A 1RZUA 3AKYA 3KPVA 4IVQA 1ZXLA 3RC1A 4KITB 4LYYA 5BQ3A 4KO3S 3OC0A 1OFGA 3N2KB 4S1WA 5H16A 4BB9A 5LR6A 2O59A 3K70B 3VZBA 4MCHA 5ED0A 1XLUA 3AZPA 1PR6A 1LPMA 3R76A 2QXUA 2OXRA 3D5TA 1DEHA 2QJRA 2YBEA 3B1KA 4ZO8A 4FWBA 4J4TA 3ZGLA 2JH3A 1VMKA 2JZNA 2V7QA 1L1FA 4Z4IA 3UT6A 2ZUDA 5C4GB 1UUFA 5KTTA 3LUJA 5B2EA 3JQ6A 4LYHA 4KQEA 2AX4A 5JO9A 3UWSA 3WLKX 3UWDA 3DE3X 5T4HA 4HZIA 1J07A 1UBCA 1YJQA 2E0IA 2VTEA 2DYKA 1Z8DA 3KS9A 1DXHA 2C20A 2B9VA 2MT9A 1G3QA 2V5VA 3DEIA 4H3KB 5CB6A 1JFTA 5LL6P 2FK8A 1WSBA 4QRHA 3DOEA 2EYQA 3R7BA 1E2QA 3DDSA 4O29A 4P34A 1RDFA 1CJUC 4PSDA 1PK9A 3EIXA 2WJYA 3HKEA 5JD5A 2UYGA 1ZINA 4M7RA 3EVFA 4CCYA 1X38A 4B79A 2IYAA 2X5JO 3G1UA 3GUVA 4Z99A 2IW1A 2C9YA 3EQ2A 3OPYB 1WOMA 2Q7XA 3A4NA 3H9QA 4DJDC 3KTFA 4EA6A 1G8JA 4OPMA 3HXTA 1EFAA 1G55A 3KXLA 1XJ5A 3MWFA 4HS9A 5AKIA 5C8YB 1ENYA 1RVV1 3FUWA 3OZVA 2ECOA 1N5DA 2JC3A 4PRLA 5F1OA 4KR2A 3D8HA 4QU9A 4XPZA 1HTWA 1JQAA 1F2TB 1JN0A 1O96A 2BEKA 1J0XO 5DWVA 5HKLA 2VWHA 5LD2B 2PQ0A 2WIJA 2FHPA 4Q5IA 2GHIA 3NBUA 4ZZ0A 3GCGA 3G2OA 1VPEA 4KN6A 2P0AA 4YLEA 1P7PA 3DBVO 4BFCA 1BVUA 1Z6PA 1A50B 4Q1AA 4YDRA 1M0WA 4V03A 2Z83A 2VQ3A 1R4ZA 2QAGC 4HNAA 4IAOA 4C06A 3COSA 5LOVF 3NBMA 3RJTA 1JG3A 5GM2A 3DPUA 1XSEA 1B41A 2Q0HA 3HBJA 2V7PA 4Q7EA 2CHUA 3PFCA 4C4PA 2GCEA 1CD5A 1QMGA 2VKTA 4TL6A 3CCFA 2ZDHA 4I2NA 2CL7X 1FP1D 4QU0A 3E9MA 4GBED 5AK3A 5ARDA 1D4ZA 5LZ7A 1XMVA 5HSGA 4JBWA 1J5EB 4OV6B 4LE0A 2IS2A 2Q4BA 4MTLA 1GLNA 3DKVA 1XTPA 3SOZA 4C0BA 3KT6A 5AKYA 3FI9A 3ZJYA 9GPBA 2CJXA 2ODAA 2G1JA 1XNRB 5G0WA 3SLGA 1HSZA 1ZRMA 2V3WA 4D92A 1WSWA 3BXPA 3C24A 1RCFA 4BU1A 1DUIA 5D01A 3TTUA 4CG3A 4ZQCB 3CRMA 4E30A 1XNJA 3ITEA 1VMIA 1FBNA 4JI1B 1CP3A 1ZUNA 2HV9A 4IDDA 3FVVA 2WF6A 4LNHA 4F45A 4BLRA 4DYHA 2CUNA 1T4DA 2OV8A 5JVDA 1FFYA 4MA4A 3L5OA 3IDSA 4FWTA 3AW8A 2B7LA 2XNJA 3KOYA 2WQ6A 3CN9A 3SJBA 2YNMD 1K4YA 3KE8A 3BC1A 4GLBA 2ZM5A 2A8YA 4KW7A 1S2IA 2AMFA 4O4HA 5D00A 4ZQFA 2ZVJA 3ROQA 2R7NA 1K3UB 4TLBA 3TDMA 4C4ZA 4UU0A 1QTQA 3R24A 4DMCA 2J3LA 4JMLA 1C0EA 5DX0A 1SBZA 2Q3MA 3QF4B 2QT9A 5CA1A 5AW2A 3ERCA 3K8ZA 1QAQA 3MCAA 4MQBA 5DSTA 2KI5A 3O6VA 1NQUA 3FDZA 4YJKA 4GNKA 3E48A 2FU5C 2IU4A 3QA9A 4Z0TA 5DXFA 2E9SA 2W2LA 4M9XA 5CX4A 5ER9A 4YYEA 1IBMB 4TSFA 3HCWA 3AVWA 1GYPA 1QH1B 1RC1A 2ZK7A 2X13A 2C9BA 3RUHA 2FDRA 4H0NA 2HI0A 1PL0A 2FZ5A 4X8LA 2NU8B 3VDNB 4J9UE 3VR1A 1TJPB 1W88B 2GD1O 2CN1A 1VLZA 4JNKA 2PSHA 1N9KA 4B4OA 5JNRA 1XZCA 4PHTA 4OI4A 1X8LA 1OLSB 2D3WA 3EIQA 2V55B 3OSUA 4HQNA 5U1PA 1KVUA 5JDIC 5IM4F 3BAFA 4EY6A 4MUHA 4PC1A 1QG0A 5AW5A 3IT0A 1XX6A 2V4ZA 4G5YA 1IB0A 2QORA 5DEIA 1LBEA 4J49A 3DNMA 3IV9A 2JDIA 5JSHA 4X24A 2J08A 1T8PA 2CNKA 2NPFA 5BT8A 3GUYA 3ZHUA 1YU9A 1P91A 1SVNA 2BGRA 3CURA 3DO6A 4ZVSA 4FFLA 4NH4A 1J9GA 2E4AA 4I5EA 3WRXA 3CX6A 3KDAA 1BDHA 1R0KA 3IHLA 1XVLA 4S24A 1NW8A 4ZYWA 3H2YA 2VNHA 2F1IA 4XQGA 3I30X 3KVVA 4IDFA 1SOWA 4RW0A 1UPUA 4U00A 3WYDA 3UF0A 3FFXA 1D3AA 3M9WA 5DGHA 1SHKA 1WDMA 4F1KA 4JLJA 1HDZA 2VHEA 1N6PA 2CZCA 3AETB 5H1YA 4F46A 2JLYA 3EXEA 2Z0MA 1I3MA 3OOHA 1BD4A 2KHZA 1Z26A 1FU8A 1YGPA 3ID6C 2BDEA 1W4RA 2IPLA 5KWEA 3ET5A 2CB0A 2P68A 2QW0X 3MWYW 4R1MA 4TMTA 4OY3A 5IDVA 3T7RA 3UV6A 4R7GA 1E79A 1QH8B 2VG8A 4QQRA 3UICA 1R8XA 4M2LA 4DIMA 4ACAA 1FYFA 2BFMA 4XDZA 1EFCA 4Q9JA 1KYWA 1P1KA 2K2QB 2CVFA 2Q7DA 2H4ZA 1NKTA 2PLAA 2QK4A 4CQMA 5A0VA 3IVGA 2JK1A 4ZYXA 4MW2A 1VYHA 3A9CA 1PGNA 3GBVA 3VZQA 2IY7A 2C4WA 2A1TS 4PYJA 4QGBA 3GO4A 1U94A 4CM7A 4RY2A 1Z47A 1SXGA 4DLAA 2B4TO 2FUNB 1FW8A 3JATA 5DTQA 3PIRA 4F9GA 3AZOA 4Y1FA 1KDRA 4YFYA 1P4GA 3E3NA 1BZYA 3JQ9C 4LY0A 3OZXA 1RPNA 3WLLA 3B5IA 4BMNA 1E63A 4B3IA 3WWPA 2N47A 3WAKA 2B2CA 1B6RA 1YZUA 2ODQA 4PHHA 2EYUA 3MZ0A 2OA0A 3H8JA 3W6OA 1TFUA 2Y3IA 3WK5A 4DXDA 2AE2A 4Q9LA 3NBFA 2BCGY 3JRXA 4DR1B 1M6EX 2XYGA 2IK8A 3F5DA 5BRJA 1YDFA 1U4NA 2IQIA 2WFAA 2P1DA 4YCBA 1SKAA 3GWGA 4JJZA 4WH0A 4XLZA 3J7AC 4JU8A 4JOSA 3UK2A 3OC6A 1SUWA 2HLDD 3G8DA 2VATA 4AY2A 5K99A 3OZ7A 1VLQA 3IKLA 2PNJA 2OD7A 3VJLA 4DABA 1HGXA 3LBFA 2QA5A 1R8SA 3QX9A 4WFJA 5EKUA 1H6BA 3V32A 2BSAA 4BGUA 3WYFA 5A06A 1PJSA 1M7HA 2YXPX 3OQ1A 3PHLA 5IFKA 3DO8A 3CUYA 1HLPA 3ASYA 4RIFA 3ZBPA 3ECSA 1BAPA 5I7EA 1XTUA 2IODA 1Y5MA 2QF7A 5IKPA 4HXEB 4FJ2A 4N40A 4XASA 2W2VA 3BCUA 3VR6D 4C4XA 1U80A 2ISSD 4GOND 1GNRA 1YDGA 1U5CA 6AT1A 1VL2A 3GB9A 2IYTA 5D6OA 3AVTA 4YS6A 1L5FA 4IS2A 2HRBA 2R84A 3GBPA 1AA9A 1U99A 2I7XA 3ZTYA 4FD2A 5B57C 4UDNA 4XJSA 1RIFA 1T1RA 3ONNA 3TQQA 2PUCA 1SURA 4MV9A 4R1TA 3THOA 5KMGB 3GPDG 3JRWA 3O2JA 2GMWA 2O7RA 5FBVB 2DQZA 4QM7A 3U37A 3NTOA 4I1YA 3RG8A 1L4GA 2C1XA 2JGJA 3OO1A 2ZB3A 1QUFA 3WKCA 4QDTA 1IBCA 2M6SA 3AUAA 2GYUA 2XA1A 3OX1A 4FI3F 4I5DA 5ES3A 1YBAA 3FZGA 4L9WA 3URMA 4AJJA 4F9TA 5DTJA 4ZAVA 3R3HA 5ICMA 1LLQA 1UK9A 2GSDA 4IX1A 2QU7A 1JWAB 3OZCA 1E77A 2I99A 3RHFA 5IKMA 5LDHA 1VG9B 5DGCA 1G21A 1JF8A 2IU3A 4NH0A 2FEPA 2VF7A 1YQXA 1YDEA 3DV2A 4YECA 1OYVA 4IRUB 1S2DA 2OYSA 5EE9A 2N0SA 2W2MA 2FSPA 1ZAYA 2Q5JA 1E2JA 3E4CA 5JNSA 3WHIA 1U3DA 2YVKA 2OBMA 4IG4A 4AYXA 4EGAA 4R5HA 3JD0A 5JAOA 5BNWA 2JBAB 5G02A 2Z1MA 3RR2A 5ALSA 4Z7OB 5A5FA 4JFRA 1BOOA 1FJ2A 5F51A 1IULA 4JUBA 5JZSA 3DQZA 2XGSA 3VNRA 1AS3A 1N0HA 1DG3A 1YGYA 3GUUA 3P9YA 1YHZA 4JA0A 1PJ8A 2NIPA 4DRYA 1ULHA 1VJ5A 5CTAA 3TEJA 2OFOA 5JEEA 1JNYA 4DQDA 3U17A 2PSEA 1QP8A 4OMDA 2AN4A 3TJMA 3ND5A 4ER3A 1XXHB 4FCTA 3GLIE 4HEQA 4G89A 2AOUA 4LZPA 4F3RA 3ITNA 3MT0A 5EZYF 1NF9A 4YUWA 4DV4B 1C3OA 4BFWA 4BBZA 1YT5A 3GWZA 3BM5A 4LDZA 4XPIA 2QZZA 2B4RO 4L4XA 4YAKA 2HOQA 2Y92A 4NEQA 2WM3A 2ZB2A 4OOEA 2YC4C 1YASA 4YBRA 1YJBA 3ZC3A 1LVGA 1XQWA 5B7PA 3ADDA 4OUKX 2DOKA 3LXMA 2B5OA 2FFBA 4Q4CA 2K4MA 1DBQA 2ZIFA 2GVNA 1LSOA 4RA9A 1GAJA 3OD1A 2WJ6A 3B3AA 3EBPA 4XQCA 2F8SA 3WV5A 4ESHA 3LF2A 4F11A 2CSXA 1ZH8A 4KMRA 1S2NA 1YUBA 5JSYA 2LNDA 3VKVA 5KYXA 1UXKA 4FHCA 1SCBA 2Z8XA 2QTRA 3GJZA 4PO9A 1A69A 4XWYA 1DFIA 3PFFA 1HI9A 2W37A 1WHTA 3AF3A 4F84A 3A3OA 1Y4ZA 2GYWA 3IAHA 3T9BA 5JH7B 5HRUA 1FSFA 3C1AA 3PNYA 3Q2OA 4PR0A 2ODTX 2QU8A 2RI6A 3N7TA 2NSYA 1OKKA 4PAMA 4L51A 4R1SA 2NVWA 1RFLA 5LUBA 2D5AA 4XJXA 4RSGA 2I4IA 2LW7A 1N3YA 5J40A 1MQSA 3RLIA 2UUBB 1QVVA 2ZUTA 4CM5A 4OXRA 3A3KA 1TAUA 3AI3A 5CH8A 5BYKA 3QVUA 1YNOA 5BR4A 1ZCBA 2JGAA 3CZQA 5C1BA 4UM8B 2XUGA 3IVCA 5ALRA 3W2EA 3U4MA 1J39A 2C2HA 3NS7A 1KJIA 1L4FA 3NBZC 5BW5A 4UNIA 4KUEA 2C2ZA 4FYXA 3ZBTA 5BNFA 4F1WA 4MS4B 3CTMA 3V8QA 2P1RA 4QJ5A 1GGMA 2DG2A 3QNMA 4JBNA 5IAAA 2DR3A 2NO1A 2ZU6A 4ENVA 4RMNA 4IZIA 4HH4A 1K7CA 3WOVA 4B8ZA 5H4HA 2HU8A 4R69A 5LBTA 4ILKA 3B7WA 3EIHA 5DXAA 1E9CA 1QHFA 1H6AA 3QXCA 5K3BA 4DMLA 3F8SA 3QW4B 1PF7E 3L8FA 2HCFA 1AO0A 4RGQA 1W94A 2CF6A 1WKCA 1FYDA 3BH0A 1HV8A 3R0XA 2OL4A 4YGXB 5T57A 3UK6A 621PA 1Z5UA 3IEUA 5IJ0A 1JQ5A 3EDCA 4FFMA 4G37A 4YRTA 2IXBA 3WIDA 4ALIA 1XPUA 1KAGA 4NV1A 2F90A 4TX1A 2I6FA 5CCBA 5IAKA 1MIOA 5IYZA 4CTJA 5IH3A 4KNWA 3OJEA 4GVPA 4N01A 5CGZA 2MR5A 1QCDA 3AL0C 2O2SA 2FR8A 4OQXA 3NGMA 5MN4A 1CZUA 3PFWO 3TUIC 1I13A 4CQLB 1U2TA 3W5UA 1B76A 1Z7BA 2OY0A 1IUNA 2A92A 3E5MA 4M9ZA 5KNDD 5LJLA 2GN2A 2Z9DA 2R96A 4GO1A 3OIDA 5EQFA 1TVKA 4D8XA 2D0OB 1IDOA 1T5OA 5LQKA 1SPXA 1XZPA 1QRRA 1SCAA 1ZU5A 3DT9A 5KU7A 5EHZA 3DDHA 1O9HA 2JD0A 2WWRA 2YJ6A 1E2HA 1OVMA 4V0MA 4W99A 3U4QB 4IYJA 4JGBA 3RVKA 3TH5A 2QI9C 1IC6A 3BIOA 3QVKA 4UM9D 4ZWNA 4NFYA 1QOZA 2XIJA 2XQVA 1T1GA 5FNVB 1FW6A 2J3IA 1AZSC 3GUZA 1G4AE 2IE8A 4Y2PA 2VYQA 1O94D 3GZNA 3B3FA 2ZUVA 3W90A 3FI0A 3O95A 3UV7A 1X13A 1SVSA 3I9LA 1VRWA 3CNHA 3V42A 3KU4A 1PNOA 5FJIA 2FVYA 4CXMA 2BJWA 3P0IA 5E38A 4PR3A 4M86A 2J85A 5F2OA 3NUGA 1NJ8A 3EWNA 4AUMA 3IEMA 4QFMA 3I42A 3A26A 2OZKA 3JSAA 4M1MA 3DWEX 4HGYA 2AV6A 1OLXB 1XMJA 1T9HA 3A06A 4ROSA 4MINA 4V3BA 5DYGA 1QC5B 1FMTA 3MYYA 2XF2A 4GZ6A 1EX7A 1LH0A 3VPGA 2GA8A 3REOA 1K6JA 3FCEA 2XMQA 3GP3A 2AZMA 3O1LA 4JH0A 4BFXA 3SVLA 1GAEO 1WETA 4X92A 3GRFA 3QVMA 1DE0A 1EFVB 3QITA 3FCXA 3KWLA 1PIWA 4TQGA 1Z5ZA 3PICA 1FLVA 3N0XA 5F7XA 5JSZB 2O8BA 3S7TA 1XWWA 5JDCA 2MYNA 4YRDA 4JSYA 1YCDA 4DY4A 3IUYA 1EK1A 5C7LO 1BXRA 4UW9A 1R4NA 4WIAA 5HTKA 2AMYA 4LZOA 1M33A 2JLCA 3Q1LA 4C0LA 1TYCA 1A9QA 3BMOA 5H5JA 3N6XA 3KFXA 2ORWA 1G42A 2EVWX 2J5RA 3DW1X 5IANA 2I6TA 5CFRA 1Z7GA 4MYTA 5DGIA 3BJMA 1NFRA 1OZ0A 4GGMX 4H77A 4MRSA 5LP6B 1R9GA 1UT8A 2PJUA 3MRTA 4GH5A 4OATA 5K3EA 3TLCA 3UT5A 2ZYTX 3R6DA 2E4ZA 2PFGA 3RGWS 2Z4TA 1A5TA 2NW6A 1EUCB 1UBFA 5JARA 2CLKB 2NZWA 3LQFA 3UPTA 3T1NA 2NYVA 5I8PA 2GFIA 3V00A 4GPIB 2WDPA 2EIXA 3WK9A 4MLDA 2QLTA 1FDWA 1QLHA 4JQCA 2QRQA 1CEYA 4AQDA 4UXJA 5HJ7A 4RTMA 1NY6A 1CDDA 3F6BX 1GN8A 2DX7A 1QWSA 2VHYA 3G9ZA 1LV8A 2A35A 3HY3A 1KA9H 3KWMA 3LPDA 2EG5A 2I4LA 1RAHA 3BG5A 2QN7A 3GDFA 2XYQA 3P9ZA 3RUFA 2R48A 4D3SA 3OQMA 2F67A 2ZRHA 4HZUB 1WKVA 3QQ5A 1H8HA 2Q6KA 3AU8A 3D3QA 1F0PA 3PE3A 4YYZA 3DOHA 2AFIB 3ZEAA 2YMMA 1VE7A 2BHTA 4QASA 1Z4QA 4IIBA 1KO7A 3FTDA 4HP8A 4RHEA 5KYYB 1SXJC 2QY9A 3SKVA 4HQ6A 4LOAA 4MEJA 1RE1A 1L4UA 3ZE1B 1GOTA 1GZ3A 3AMVA 4IDGA 1D9ZA 2ODEA 1CQJB 3KKPA 3TKAA 1G8AA 4HBZA 1YQUA 3AT1A 3QE4A 4UHFA 1YS9A 4QD3A 3USZA 3WB2A 4I4CA 5KYNA 3U39A 5BUQA 3Q6IA 3AR2A 3MVEA 4RXUA 4F4HA 4P7FA 5FWXB 3U60B 5K0BA 4ZCLA 2YWGA 3HZRA 5BQXA 5EIWA 1RWOA 1UXGA 2GTIA 3GK3A 2DUMA 3OM0A 1HQDA 3PU6A 4FIZA 4HQ0A 4QUBA 1KI6B 4RJJA 1RR6A 3HUEA 2H16A 3C5WP 3NC4A 1P29A 3HADA 3Q98A 4MX8A 4RHUA 3SICE 2E7ZA 4LK3A 2FFAA 4TXLA 4TWAA 4UBOA 4A0GA 1PTJA 1Y5LA 5DBOA 1TE2A 4BX2A 1NIPA 2I3DA 4B81A 1KVRA 5BXYA 5DF1A 2PRKA 4EFNA 1T2CA 3RJZA 5HYVA 4FGJA 4QSHA 1ZKMA 2KQUA 1P2DA 3CR7A 4X6XA 2PMEA 5JRDS 4AWAA 4KPYA 4DNOA 2GJAA 2PS9A 3H8SA 1VLHA 1ZG3A 3AF5A 5JVDF 5JQGB 3N28A 4O8CA 3ZWCA 4FHGA 5CCXA 2BFEB 3R9IA 4QYWA 4GS5A 4F6LA 5CH3A 1M6HA 4A8JA 4M0MA 3H11A 4QA9A 4EG0A 3H7IA 4NKRA 4N3CA 3D02A 5E6UA 3DZJA 4WNYA 1JQBA 1HTTA 1U7HA 4FQ7A 2ARKA 4Z8XA 4V1CI 5AW3A 4BWVA 3OPYA 4XXHA 5JLAA 2AZ4A 5CA1F 3J81A 4KQGA 3R3YA 3PTZA 2UUPA 3EISA 3JYHA 4ALNA 2RGWA 3GJ3A 1PT8A 3RV3A 1Q20A 4PCLA 3FPFA 4K05A 4EHNA 4ARBA 1QIGA 4MIEA 4CW7A 3NKVA 2A5FA 4RELA 5TJ9A 3ZCTA 4X0EA 1FCJA 3MW8A 4ZVQA 4HNGA 4TQAA 2ST1A 1F3LA 4LVOA 5IKEA 2P41A 3I05A 4TXHA 5LNK6 2FKNA 4ECEA 3ESQA 2DR2A 1J6UA 4D0RA 3KQLA 4QXQA 5L3QB 1V2HE 2C07A 3RRFA 3QIAA 3T7KA 4GNRA 4D3YA 1ISHA 3AIIA 4B4UA 3AF6A 5LU9A 1W6UA 4MIOA 1QZXA 2PMBA 1IY9A 1N2IA 2P6UA 3GVPA 2Z6VA 3OQNA 2NADA 3KLBA 1B26A 3GA5A 3K73O 3QOFA 4Q1FA 2ZAGA 3PXCX 4IG9A 3K8QA 4K40A 5REQB 4JJIA 3I45A 4R8KA 5AIBA 4WVFA 3I3SR 3ONDA 4FN4A 3SDZA 1F4VA 1VLMA 4C7JA 1PZNA 1CQWA 4G84A 2GPSA 4L4ZA 1HDIA 4OHXA 1NATA 1UZMA 4MVJD 1G19A 2ZJZA 4OF4A 3FCYA 4KO1S 5IC5A 3V2GA 1YQWA 3KHUA 2A4KA 2AJCA 4GVLA 2WP8J 4KLNA 4C4YA 1EDOA 1TM7E 4LYEA 3DWIA 1EFDN 1YDWA 1M2VA 3F6SA 5LZ2A 2QTHA 2UKDA 3GLHB 4OOFA 3D6JA 4PTLA 4D46A 1KRHA 2AEJA 3EW7A 4LXHA 3B85A 3MK31 1VBFA 1K7EB 1I1QB 1FYWA 3MJSA 3V4OA 2ROQA 5BVHB 4OBWA 3ZR4B 3UGQA 2EJCA 2HX1A 4DXHA 2JIBA 3WXBA 4GVXA 4URUR 2EL9A 3TQCA 3CF6R 4JJ8A 4AZSA 2R7LA 4D4GA 1JHMA 2VHXA 4F71A 1GQYA 1Q2UA 3H5TA 1ESMA 4RXTA 4GI5A 2QX4A 5ISMA 3DB2A 3E7PA 3FVTA 2FE1A 1GPAA 3PGMA 3S1AB 2QTAA 1S2LA 4XDYA 4BUZA 3WLPA 3IBGA 3NPAA 2BM0A 2OXIA 3JQAB 3UTCA 1QFYA 3V4ZA 3R41A 2XRZA 2PUFA 4EMUA 4DVJA 1WV1A 1BW9B 3V7YA 2V6JA 3QYAA 4LOJA 2FOLA 3PX2A 1IZ8A 1UQTA 1CUCA 2C2YA 3JQ7B 4LX0A 4NNJA 4Q01A 5KYWA 1RKQA 2BY4A 4JBLA 5B3JC 2JCGA 4E1VA 4XWOA 3UUEA 4QICA 1W88A 3UJ3X 3UC5A 2WA1A 1OA0A 1XL1A 1IB6A 2WVHA 3ETNA 1WDWB 1PQWA 3P7MA 3ROEA 5INTA 5K6AC 2QN8A 4PQGA 2CLMB 1IUPA 1OLSA 3DTNA 3C3WA 1JSZA 4BO8A 1Y9EA 1KKMA 5JD4A 1L8OA 4H7EA 5HR5A 1HT2E 4FUTA 4J0FA 1E3TA 2CZGA 4D3FA 1JDSA 1RYYA 3KZOA 4U9HS 1VKOA