3OG9A

Structure of yahd with malic acid
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
206
structure length
206
Chain Sequence
b'MTDYVFKAGRKDLAPLLLLHSTGGDEHQLVEIAEMIAPSHPILSIRGRINEQGVNRYFKLRGLGGFTKENFDLESLDEETDWLTDEVSLLAEKHDLDVHKMIAIGYSNGANVALNMFLRGKINFDKIIAFHGMQLEDFEQTVQLDDKHVFLSYAPNDMIVPQKNFGDLKGDLEDSGCQLEIYESSLGHQLTQEEVLAAKKWLTETK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein yahD a copper inducible hydrolase
publication title Regulation and structure of YahD, a copper inducible alpha/beta hydrolase of Lactococcus lactis IL1403
pubmed doi rcsb
source organism Lactococcus lactis subsp. lactis
molecule tags Hydrolase
total genus 78
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3og9A00
1A7UA 3JWEA 3QZUA 1L7QA 3S2ZA 1Q84A 3BJRA 4U2CA 1CUZA 2XUJA 4OD0A 4PNZA 2QJRA 1YB7A 4DM7A 3K9BA 1MU0A 3FYTA 2FX5A 2FJPA 1LBTA 1Q0ZA 3M83A 4X97A 2VAXA 1ODTC 1Q83A 4KYVA 1UFOA 1BROA 4I4CA 1AKNA 3A2LA 1LNSA 3QVMA 1YR2A 4X6XA 3R3VA 3D2AA 2HA2A 4GECA 1EB9A 3BF8A 4MJ3A 3I2KA 2PU5A 2QXTA 2HU5A 5DTJA 1EXWA 1W52X 2HU8A 3WKCA 5K3AA 2WIDA 4KRYA 3BE8A 2HU7A 1MTZA 2PSDA 3FVTA 4CFSA 4Q3KA 5AM0A 4WFJA 3IULA 4G8CA 3I6MA 3C5VA 4PQEA 4GWLA 2CEKA 4G5XA 1TCCA 3WJ1A 3QMVA 4BYMA 4FBMA 1LPNA 1NU6A 3D0KA 3H2KA 2QUBA 3O4HA 2WQZA 2PUJA 4X7BA 1QIHA 5LZ9A 1KU0A 4DNQA 2XUPA 4PSCA 1X2BA 4F21A 2I3DA 1ACLA 2RHWA 5DWDA 1TAHA 5HF5A 1CFJA 3EIOA 3PFBA 3RK4A 4X92A 4A5SA 4G4JA 5FRDA 1CUHA 1UKCA 4B6GA 1RP1A 4Q82A 3WKAA 3NOXA 1U2EA 2XUFA 3GFFA 4EY4A 4W1QA 2J3QA 1VA4A 3O4JA 4JNCA 3CCCA 4Y2SA 1QOZA 1ETHA 1THTA 1VXRA 4AO8A 5DYYA 3FAKA 4QDXA 5A62A 1EK2A 4AMZA 3PDCA 1WOMA 2JF0A 2JBWA 3ESBA 4F5ZA 5LIPA 4EY5A 2Z8ZA 3QBJA 2XUGA 3FNBA 2VAVA 4X71A 3MVEA 2K2QB 1AURA 2QMQA 3DYVA 4P08A 3ZWQA 3EQ9A 1MX5A 1FFDA 3LLCA 4J0HA 3A2NA 1CUXA 2ZJ7A 4AZ3A 4BBZA 2WM2A 1DWQA 4FFVA 3ZLVA 2XLBA 4N8SA 3LP5A 3CCBA 4KEAA 1YCDA 4BE9A 5CH5A 1QO9A 4FWBA 1XZMA 5ALWA 2BAGA 5EI5A 3D4LA 1AGYA 3DD5A 4IH9A 1EVQA 3VXKA 5A7HA 2ZJFA 2QRUA 3WA6A 2DCMA 3G0BA 1FSSA 2OLEA 1DQYA 5AI5A 5DJ5A 1UZAA 1H23A 5K5EA 1F0NA 3H2HA 3C5WP 4J0KA 4Q34A 5FOQA 2AJ8A 3HACA 2VATA 1DWOA 2HFKA 5FP0A 3R41A 3H2GA 4H7EA 3STUA 4F0JA 3ESDA 3G9XA 2WU3A 2VT7A 5JYCA 3WL8A 4N8DA 1ZGBA 4ZWNA 3QYJA 1VKHA 2BGRA 4K6KA 4QDTA 2XQFA 2XMSA 4RNCA 4MWTA 1UWCA 3K2IA 4C4YA 2XMCA 5HKBA 3BDVA 4BVKA 5HFAA 1D07A 4MYDA 4QLOA 5EIEA 5ALDA 2WUGA 3O0DA 4NS4A 1SCKA 3JW8A 4KE9A 4FLEA 4UHCA 5CMLA 1VXOA 4E14A 1M33A 3WMRA 4IQ4A 4XIIA 1UOQA 2OGTA 2WU4A 2NW6A 2ES4A 2R11A 3GUUA 1XZFA 4JUIA 4BB0A 4H35A 4GLBA 1VE6A 3AIOA 3WK6A 2V97A 2ZSHA 5AKJA 1K5PA 1BN7A 4QLAA 5JAHA 1XZIA 1CUDA 4W1PA 3HRHA 3WWOA 3OG9A 2I78A 5AKHA 3FLBA 4UBLA 4J7AA 4KE8A 3H19A 2XQKA 3STVA 3QPDA 3C6BA 5EIHA 1SC9A 5K3DA 3PFCA 2PKYX 2ZSIA 3KSRA 3G0DA 5AKLA 3OC0A 2JGMA 3F96A 4J3JA 1G5FA 4BTLA 1C7IA 3D3NA 3DNMA 1L7AA 1ODSA 1YS2X 2VEOA 1XZAA 2PU7A 2C4HA 4LHEA 5T4FA 1MJ5A 1JJBA 4E46A 1OILA 3H04A 4Y2PA 5AOBA 1GPNA 3E4DA 2YYSA 4UBNA 5JZSA 3E0XA 1ZI9A 3BJMA 3L1HA 2CZQA 4FKBA 1CQWA 5ALTA 5AO9A 2B9VA 1QIDA 3CXUA 3G0IA 1VE7A 4AQDA 5T4BA 5EHZA 2WG1A 3C70A 3V1MA 2WKWA 2JIDA 1W1IA 2WIKA 3H18A 4QDZA 3GZJA 2WFLA 3W06A 5K3BA 5HQ3A 1QIJA 3G8YA 3TRDA 4H0CA 1HL7A 5ALVA 2OQVA 2W6CX 1JMYA 4U2BA 3QMWA 4EY7A 1UK8A 4LYEA 4WCVA 3MUOA 5ISMA 4BC0A 1QIEA 3F9CA 1W75A 4X95A 2QKYA 1EX9A 4DTCA 2ORYA 5ALMA 3H2IA 3G7NA 4X91A 5ALUA 1XZBA 3AZPA 1UKAA 2AXEA 3R3ZA 3ILSA 1VOTA 2E3JA 1R4ZA 3OPMA 3W04A 2BUBA 2PSFA 4AN0A 4G8DA 4UPDA 1AQLA 4ZV9A 1CUGA 1NU8A 4Y2XA 4RE5A 3IUNA 4MEBA 1QE3A 3HEAA 3I2GA 2DFPA 5LKRA 2BGNA 3PE6A 5AKKA 2PSHA 3K6KA 5AIAA 4G8BA 3MUNA 2OCIA 2J4CA 3C6ZA 3ZPXA 1Z68A 3D5EA 1C7JA 1K63A 1Y7IA 1ZI6A 2ZYHA 1A8SA 1J2EA 3PUHA 4AZ0A 4X6YA 1IMJA 4HTAA 4NZZA 4I3FA 5LZ8A 3PF9A 3GBSA 1GXSA 4HZGA 3VJLA 2XQJA 2PX6A 4J03A 3KD2A 1H2WA 3AILA 4KE6A 3A2MA 2C5GA 4H7JA 1EHYA 2XUIA 4CIBA 4EY6A 4X00A 3D2CA 4U2GA 4ETWA 4GHWA 5FUMA 4XX1A 3UUEA 5LZ5A 5HZGA 1FFBA 2G63A 3WK5A 4OB8A 5LZ2A 1WB5A 2Y2UA 2VJBA 2WUFA 5HFNA 4Q3OA 3DQZA 4CG2A 2QS9A 3IBTA 2ACKA 3IB3A 1MX9A 1WM1A 3QM1A 5AI9A 3EBLA 3M82A 5E2IA 1MT3A 4LXGA 3AINA 2WHQA 4B7ZA 5ALOA 4E15A 3FYUA 3DDUA 3KOOA 4X93A 5JD4A 5IVIA 2VSQA 5BOVA 4CCWA 4MQLA 3SX4A 2HIHA 3G9ZA 3DJYA 3O9VA 4X90A 1CUCA 3IUJA 3OOSA 2ONCA 5LYYA 4JYPA 5AI8A 4HVTA 1QFSA 1E89A 1XRRA 1ZIYA 2WLSA 4BCCA 5ALGA 3FCYA 5AM5A 2XUHA 2ZYIA 3DOHA 3VISA 1OXMA 5ALEA 1GGVA 3AFIA 3BIXA 1F6WA 2JGFA 2V98A 4X85A 2ACEA 1JJFA 4HRXA 4ZGBA 4DGQA 1CUVA 4UBOA 1T4MA 1IUOA 5AKGA 1XZGA 1BN6A 1H2YA 4UHBA 5ALQA 4KJXA 3M81A 2HA6A 1ODCA 3WL5A 3AUKA 3C87A 2V96A 5CXUA 2O2IA 1GZ7A 5F4ZA 2Q0XA 3EQ7A 1CRLA 3FCXA 5AKZA 4DMFA 3EQ8A 4BCBA 5ALZA 1R1DA 1CUAA 1LBSA 1XRQA 3TEJA 1QLWA 4G9GA 4WFKA 5SYNA 1N5MA 2YH2A 4FLFA 1HKHA 1O6GA 5AK3A 3STXA 2LIPA 2WHRA 2D5LA 4H18A 1LGYA 3LS2A 3F98A 3IUQA 3FVRA 4UFNA 3NUZA 4W63A 2HA7A 1MNQA 1T2NA 4MEAA 1CR6A 1U8EA 4UUQA 4ROTA 2QXUA 5AI4A 2PVSA 5DNVA 3I2IA 3WI7A 3GA7A 4X3CA 4B83A 5A7FA 3I6YA 1R3DA 1ZGCA 3ANSA 4P93A 3RM3A 4K2AA 4OU4A 4Z49A 2WFLB 4J0IA 5HQ3B 3BIWA 1R50A 1XQVA 1ORVA 4Y2JA 2P8SA 2GBFA 2QR5A 2WIFA 4GEGA 5C7YA 1ZD4A 3HYSA 3VVMA 3WK9A 1FFAA 2VJAA 3D2BA 5JATA 5DNUA 4S0XA 1RYYA 2HRQA 3V1LA 1EI9A 4B0OA 4HAIA 1MN6A 3WZMA 1ACJA 5KBYA 3R3XA 5JAUA 3I28A 3PF8A 4BDSA 1HDEA 1XLWA 3G02A 1BRTA 1EH5A 1DT5A 5JIBA 3B5EA 1QJ4A 1XRPA 4BRZA 2WTMA 4B85A 5AI6A 3SK0A 2WILA 2C58A 4DNOA 3I1YA 4DSAA 5BWBA 4C01A 5AHXA 3OTQA 4KAAA 3BL8A 5K3EA 3VJMA 4C6HA 4IH4A 1TCAA 4BRSA 1H2XA 4KRXA 1CUIA 5HF9A 3B3QA 3V9AA 5IVKA 1W6RA 3L1IA 4FLMA 2JEZA 1TCBA 2BFNA 2OCGA 1BEEA 1XRNA 1QTRA 4CI9A 2PSJA 5AM4A 4NVRA 4PV7A 3IVMA 5K3CA 4UBJA 2OCLA 5CW2A 3PICA 3QITA 3W9UA 2QJWA 5ALRA 3WL7A 5FLKA 1PFQA 4X6UA 5JADA 3VJKA 4DNFA 4ZI5A 4C88A 3CN9A 4QDUA 3ZI7A 1IUPA 1YB6A 1QZ3A 5CH8A 2OAEA 2HFJA 4Q05A 2AJBA 3FYUB 5AP9A 5EFZA 4GW3A 2WIGA 2XE4A 1QIKA 2HA4A 4ARAA 4DIUA 1VLQA 4W1RA 1XQWA 1WCYA 1USWA 4LXIA 5YASA 1KU6A 4LIPD 4CIAA 3HSSA 1XQXA 2RIPA 3ESCA 1CV2A 3IIIA 1MX1A 3RKSA 2OG1A 1JMKC 5HK8A 3H2JA 3ZLTA 1J07A 3JYHA 2Z5GA 1UK9A 3E1GA 5LZ7A 3W05A 5D7BA 2QVBA 1XZHA 6YASA 1HLGA 1R9MA 2WHPA 4OCZA 4AO7A 3T4UA 2CB9A 3BDIA 1CUFA 5AICA 3AJAA 5ALIA 2O7VA 2DR0A 2OPHA 1AZWA 4Y9SA 4JEIA 3YASA 1L7RA 1UK7A 2Y2VA 3BXPA 5H3HA 2WJ6A 3BF7A 4WJLA 1LPAB 2JGEA 2BUCA 2WG0A 4IHAA 1ZD5A 2H7YA 1YS1X 4U2EA 4BZWA 3DYIA 4LXHA 3ED1A 3M3DA 5AM2A 4Y2VA 1VZ3A 1MPXA 4B9AA 1Q0RA 2AJLI 4WDQA 5FKJA 2HRRA 3WWPA 2RGUA 2X5XA 4OSEA 2PM8A 4IH1A 2X76A 2C7BA 2HA0A 3IURA 4TVKA 3FWHA 3EF3A 4IO0A 1EA5A 1BU8A 5A7GA 2XMDA 1DX6A 4JYMA 1R9NA 3DLTA 3I6ZA 2ZJ6A 1K6EA 1G4HA 5AOCA 4BZZA 4CG1A 3P2MA 3A70A 4H7KA 4EBBA 4EZIA 1YA8A 4H7DA 3C8HA 1XZCA 4MXDA 3RLIA 3AIKA 3HC7A 4G1FA 1WHSA 1XZDA 4EHBA 3WZLA 4UBKA 1GPKA 4ZXFA 5LLSA 5HK9A 2WTNA 2DQZA 1R88A 2QOEA 3O9MA 2B61A 4NMWA 5AM3A 3UMJA 4FTWA 3UUFA 2EEPA 4EA6A 4WDRA 1XRMA 3Q0TA 3WK4A 3FBWA 1LPSA 3V1NA 5KREA 1DINA 4G9EA 5SYMA 1P0MA 5J3JA 4ZV7A 1J1IA 4FNMA 5ALYA 1P0QA 3HXKA 1IVYA 2BJHA 3CN7A 2HA3A 4AX4A 4J0CA 4RE6A 3R3UA 4UBMA 1XROA 2XMQA 5JD6A 2C0QA 2VT6A 4LYDA 1MAAA 4WY5A 5CURA 1SOMA 4J0GA 3WWCA 5FXMA 2EDAA 5HKAA 3R0VA 4UHDA 2GZSA 3U0VA 4OYLA 1UK6A 1MO2A 1HBJA 2H1IA 5ALPA 4W9RA 2G5TA 1AX9A 2XMGA 1LPOA 2Z3ZA 2BKLA 4O08A 4L0CA 3V48A 3ICWA 2R8BA 3QH4A 4DMCA 4Y7DA 3N2ZB 3QPCA 2RHTA 3ZLUA 2C0PA 5EIAA 3HZOA 5IVDA 4C87A 1VZ2A 2DHCA 4QNNA 1E8DA 1PV1A 4UFPA 2GYVA 4OU5A 1E3QA 2O2GA 2DHDA 4B84A 4BC1A 1YAHA 5DYWA 2H7CA 3DCNA 1UXOA 4FHZA 4L9AA 4BP9A 5AKIA 4RPCA 2YXPX 3D59A 3HI4A 3ZV7A 2QTBA 2J3DA 4J0DA 5I8PA 3C45A 1FFCA 3DL7A 3ICVA 3VVLA 3FYUC 3D7RA 4H7HA 5A6VA 1X2EA 2JGJA 3IUMA 4E11A 3TGLA 1WPRA 5EHXA 2WFMA 1BE0A 4KAJA 3FLEA 2GYUA 5JASA 5ALXA 2OGZA 5DNWA 1CLEA 5JANA 2RAUA 1UOOA 1GT6A 3LIPA 4KR0A 4KE7A 4V2IA 3H1BA 5CT4A 2WHPB 4M0EA 5ALFA 1ZD2P 3HLKA 5CRIA 2W22A 4H7FA 4XVCA 5JZ9A 4I19A 4AB1A 3WYNA 4BVJA 4UHEA 2Z3WA 5EGNA 1E8NA 1XZJA 4ARBA 5I7UA 5ALSA 4AO6A 5EHNA 2WFZA 4C4XA 3GELA 3R40A 4A23A 3WLAA 2J4FA 1CUWA 7YASA 3STTA 1JU4A 2DHEA 3NGMA 2OGSA 5AJHA 2GBIA 2ZYSA 3C6YA 2V9ZA 4AN1A 4CG3A 2D0DA 4FOLA 3C8DA 4FFWA 1UT6A 3S8YA 2HA5A 5ALJA 4ZRDA 1G66A 5AK5A 1DQZA 3DOIA 1XLUA 2G4LA 4U2FA 3V1KA 1GQRA 3A6ZA 2BCEA 1EK1A 3WJ2A 1XZEA 5LP1A 1JI3A 2XUAA 3BWXA 4BAZA 2UZ0A 3I1IA 3WK8A 4RGYA 4OYYA 1ZICA 4QWMA 4DSZA 3FSGD 2CBGA 3PUIA 3QMMA 1QIIA 4ITVA 2EDCA 1EDDA 4H77A 3E3AA 1VJ5A 1LZLA 5CT5A 4A16A 3GROA 2XUOA 4K6GA 5AM1A 2G5PA 1GQSA 1EDBA 3VKFA 2RONA 1X70A 2C5FA 1FJ2A 2CJPA 4EY8A 4KACA 4YX9A 4DMKA 1XRLA 4BCDA 1A8QA 3G0CA 5AH0A 3WA7A 2OAGA 2JGKA 1QGED 1SFRA 3FLAA 3SC2A 4PSUA 1CVLA 1ORWA 5C8XA 1XZKA 2XT0A 1TK3A 4HXGA 4U2DA 2HM7A 4Y2UA 5BWCA 1HQDA 4N5HX 3WQHA 1CUJA 1PJAA 4QA9A 3WKEA 4FMPA 1CUUA 1AC5A 5CH3A 4CCYA 3LIIA 5CT8A 3FSGA 4UHFA 3H1AA 1XLVA 5I9IA 2PPLA 4M0MA 4PF1A 4TGLA 1AMNA 2QUAA 5ALHA 4QEKA 4DLNA 3G9UA 5JALA 2GZRA 1E8MA 3KDAA 1DU4A 2YASA 1TRHA 3H0CA 1AUOA 4HXFB 2XI4A 3OM8A 4K5QA 2X8BA 1RWQA 4N5IX 3DEAA 2XUQA 2XMBA 1N8SA 2ZYRA 5E4JA 4B9EA 1DT3A 4HRYA 3HABA 5DLPA 2B20A 5K3FA 4C4ZA 4HS9A 5JZBA 2QM0A 5T4HA 4DNPA 4PW0A 1CUSA 4XJVA 5BV7A 3W2TA 1YAJA 5KWJA 4H7IA 3F97A 1U4NA 1S8OA 1B41A 4MQMA 3STWA 4AMYA 1H2ZA 4GXNA 1QFMA 3WWEA 2VA9A 1ISPA 2HADA 3WK7A 1YA4A 1GPLA 4G4IA 3AZOA 5A2GA 4B82A 2I3ZA 2OQIA 1IZ7A 2PL5A 4AXBA 4FBLA 3DKKA 5DYTA 4PO3X 4BAGA 3ESAA 5DTIA 1A88A 1EB8A 2XMZA 4MWSA 1SCIA 2OCKA 4GDMA 5ALKA 2WSLA 2GBGA 3LCRA 1ZJ4A 2CMFA 4X94A 2PBLA 2WJ4A 2HDWA 3WKBA 4Y2QA 3WIBA 2CUTA 2JGIA 3MGAA 1HPLA 2FJ0A 2ECFA 3C43A 1TQHA 4YK7A 1BS9A 5D3KA 1ZJ5A 1VA5A 1JFRA 3WWDA 1K8QA 2GBCA 2ROQA 4BAUA 1JJIA 1BCSA 5E4TA 1LLFA 4JH0A 2Z8XA 2HL6A 1C4XA 3X3HA 2WUDA 2XDWA 2DSNA 3NWOA 5KWIA 4M0FA 5C8ZA 4QZVA 3KWJA 4N8EA 5ESRA 1N5RA 1P0IA 1YASA 3N0TA 1XKLA 4BE4A 2FUKA 4BP8A 3PI6A 4J0JA 3AZQA 1JT2A 3I2HA 1THGA 4P9NA 3SWWA 4P92A 2PUHA 5HCUA 4HXEB 1ZI8A 1W4LA 1Y7HA 2DQYA 5T4EA 3O4GA 5CXXA 5EHQA 5JAOA 2WG2A 5IH7A 2VJCA 1IZ8A 5C81A 5JAPA 1WHTA 3VDXA 5JARA 5LZ4A 3R3WA 3W9BA 5FPQA 3R3YA 1IUNA 4L3WA 4ZREA 4C89A 2VQ6A 2O7RA 3DS8A 4L72A 2QZPA 5A71A 3U1TA 2XQGA 3DKRA 5D3ZA 1CPYA 3QPAA 3WYDA 1KEZA 1FFEA 1ZD3A 2XB6A 1CUYA 4QE3A 2PSEA 1J06A 2BUAA 4GI1A 1N1MA 5AIBA 1EINA 2XQIA 4QDOA 1QO7A 4YPVA 5AK6A 5AI0A 2CKMA 5HF8A 3C6XA 4YASA 5CT9A 5JD5A 2AJCA 5CBKA 5FDFA 1DTEA 1P0PA 3AIMA 3I2JA 1YSCA 3O95A 1CIJA 4EB0A 1SCQA 1B6GA 1JKMA 4B0PA 1G42A 3ANTA 4DYHA 1GKKA 5CT6A 4UBIA 2XLCA 4KAFA 5C8VA 1XZLA 4OB6A 3F8SA 3T52A 2Y6VA 1XFDA 2IX9A 1MNAA 3I2FA 2H7XA 4MYSA 3G0GA 2Y6UA 1K4YA 4WFIA 4K6HA 2JGLA 3IDAA 3WKDA 1ZOIA 1OCEA 1I6WA 2QT9A 2VF2A 1LPMA 4UHHA 1MAHA 1BCRA 1DWPA 2ZVDA 1U65A 4CCYB 5ALLA 5AKXA 2HHAA 2VJDA 3Q8WA 3G9TA 4FDMA 5HF6A 2H9YA 3DL4A 3HJUA 1EDEA 4QWWA 3B12A 4OUKX 3WIOA 5LKAA 5FPPA 4OPMA 1WPXA 2GYWA 5AKEA 4TPKA 1JU3A 2IITA 1W76A 2B4KA 2VTVA 1WB4A 1XQYA 3FOBA 4GBGA 3WL6A 2AJDA 5AKYA 2WJ3A 1Y37A 1CUEA 2XUDA 4Q3LA 1CQZA 1QTIA 3STYA 4D9JA 4PSDA 1LZKA 4LKOA 1F0PA 1TKRA 3H17A 4OB7A 2IIVA 1EVEA 5IVHA 5K3FB 4BDTA 4B80A 4EUSA 4Y2RA 3O4IA 3RARA 1LPPA 1GKLA 4UFOA 1E66A 4FNGA 5D6OA 5FV4A 4BATA 4F60A 5IKXA 4Y2TA 1TIBA 5E4YA 4G4GA 1WB6A 4INZA 4BVLA 1CEXA 3KWFA 4XWGA 2WUEA 3L1JA 1O6FA 4Y2YA 3F67A 4B81A 1QONA 1ZIXA 2Y1KA 1DX4A 1UKBA 2RI6A 1CUBA 1A8UA 1E5TA 3KXPA 4WY8A 1LPBB 1QIFA 1H22A 1F8UA 5AK4A 3OURA 3IA2A 2I03A 2OXEA 1QIMA 2O2HA 2XMRA 4DMHA 1UOPA 5ALNA 1NX9A 1XKTA 2JEYA 5CTAA 5AOAA 1BEZA 4BTVA 2WIJA 1QIGA 4Q1VA 2XUKA 4W1SA 3TJMA
chains in the Genus database with same CATH superfamily
3JAKB 5CU7A 5HRUA 2M2IA 3OT1A 3T15A 4EPVA 2G8LA 3FCEA 1DAPA 4OP1A 5TX7A 1ES9A 4ZOLA 3G2PA 2AEEA 5JD3A 4C7VA 3Q1KA 3S2ZA 4ALIA 2FJUA 3B9PA 1DJNA 1Q16A 1U6IA 1YRYE 3NRBA 3W4IA 2DY1A 3W5DA 2W37A 4BNHA 1CUZA 4QNRA 2G1UA 1XALA 1V11B 4OD0A 5B1HA 1ABBA 1NR5A 3WLLA 1H2FA 1GGMA 2CCJA 1YB7A 3HI6A 1JEYA 2CB0A 5JWRA 1XVTA 2ZUEA 2ZYTX 2AI2A 3ICCA 4IKEA 2HK7A 3KJNA 2XWQA 1QZZA 4JMPA 4AY6A 4N0EA 1AB6A 3JQGA 4XWTA 1UDAA 5CVTA 2OWDA 1NGSA 2IIQA 3OP4A 1G7SA 3K92A 3B3FA 2DUJA 1OH8A 1RAFA 2NV2B 1ZSNA 2HV8A 1QK3A 5B4VA 1IN1A 1GQOA 1LBTA 2QQ5A 1W5EA 4DEYA 1OWNA 5G1OA 1SC6A 2J7PA 2XNDD 2SECE 2AEMA 1UJ4A 4RZIA 3M83A 3LUPA 2GK3A 4F5EA 1Z8HA 2G1AA 2FWMX 4RPHA 4EARA 1PT9A 2RGXA 1ODTC 4KYVA 1P9WA 2HSGA 4QL3A 2WQ7A 5EEHA 1KBZA 4IDBA 3KUDA 1FJGB 1BROA 3HFSA 3CUTA 5KMGA 5LQJA 5HCIA 3QVMA 4UTXA 4X6XA 5EJIA 5G0UA 3D2AA 1P4JA 2Y1LA 2ZBDA 3Q7RA 3KT6A 2H59A 4C0BA 1MD9A 3UA3A 1RXEA 4GECA 1T4GA 1Q1QA 3PP8A 1ZM9A 3ZW7A 2VPPA 2W4QA 1R66A 3BF8A 1W1UA 3HY3A 3PTAA 1T5TA 2FU5C 2IDMA 2ISQA 4OHKA 3QX8A 3ABSB 4B3SB 2G7MC 4TQGA 3WKCA 4IIYA 3MYYA 2Q41A 3B6JA 3EDMA 3OZWA 4D8VA 4NDZA 4F1WA 3WBFA 4KRYA 1G291 2WAOA 3RC8A 3C4VA 4CN8A 1E98A 3EF1A 5TY0A 1FMFA 4XM1A 2PSDA 3HB9A 3FVTA 2O19A 4DV2B 1GLGA 3CRZA 2HREA 3U4CA 4BKQA 4CFSA 2Q7XA 1D2HA 3DAHA 4GOLD 3UVEA 3FGNA 4LNHA 3KKPA 4U7DA 1CEYA 4BKPA 2VN8A 4OQFA 1T9DA 3IHTA 1MF7A 2ON6A 3JWGA 3GLGB 4G1MB 3AXSA 5GADl 2WWIA 1U8AA 1PWZA 1XMSA 2HSZA 4UNNA 1P0FA 4NCJA 4WFJA 3ZHSA 4CM9D 5JZMA 1YQQA 3GVIA 3HCFA 3KX2A 1XA3A 3C5VA 3CGWA 4TOIA 4RV5A 5EJMA 1U0JA 2RGYA 2K87A 4GWLA 4DKXA 2ASVA 4DJEC 1HYGA 4CQNA 2PD4A 4IO1A 4TX1A 4OHZA 3T5CA 3JQ9A 4Q48A 5I7OA 1U3FA 4AG6A 1LNZA 1TLTA 1RVV1 3AB3A 4FBMA 1YIOA 1LPNA 4HTFA 5E1OA 3OU2A 2Q28A 3ETDA 4L0DA 3O4HA 4QM6A 1KDVA 5IBQA 3EZYA 5AR1A 5C8YB 2C2HA 4YRNA 4RKYA 2SICE 5JZOA 3E82A 1MX3A 1TD1A 1YCFA 4JC8A 4L08A 4US1R 1TM2A 1KU0A 1TAQA 4RZHA 4M37A 3GFVA 4YMIA 4PSCA 4Q39A 5AJTA 5EA2A 1DAKA 1T36A 2A9JA 1EX7A 1QHYA 2I3DA 2X1MA 2YV3A 4ZDIA 2ID9A 5JRDS 1ACLA 2HHCA 2RHWA 3NTXA 3UJ3X 2DFKB 1LBIA 1RBMA 1U2SA 3PVSA 4RZUA 5HF5A 1TM4E 2VP9A 1CFJA 3WSTA 2PRKA 3ZHUA 4F56A 5U9CA 5HP4A 5TXGA 3PFBA 1GKUB 2Z09A 1TUBB 4LHXA 3CF4G 3P0RA 4V24A 2G4CA 3CZCA 2QTGA 3I6BA 5K0GA 1WCXA 4LZPA 2VYQA 3VR2D 3EDYA 4S1TA 4C4SA 1UKCA 5FFMA 3CTMA 5KB3A 7REQB 3TR5A 4DOMA 1ZFNA 1TQDA 4Q82A 5EINA 3TWOA 3LRPA 3NOXA 3T9DA 3LLVA 2E4UA 3QTTA 1TOAA 3C3JA 3OZFA 1OI7A 5CH8A 3RG8A 1JDZA 2FPMA 1H8ED 4R6XA 2CFSA 4WZAB 4MI3A 1WLSA 5KWSA 1GCGA 2A9KA 2PNFA 2F00A 2DFLA 2EZTA 3QVVA 2J3QA 3LC0A 4P35A 5A5DA 4RJTA 1GUBA 4YHBA 3WGLA 3JCZA 2LW7A 2C8KA 4LYAA 4JI3B 4OXNA 1DBWA 1MB4A 3H2SA 2BSAA 3BGWA 3MMZA 4LTMA 4O2BB 2G0AA 5FI1B 2YBDA 1UBJS 1USIA 3TLJA 2QW0X 1ZR4A 1ETHA 3D9QX 2Q3BA 3G68A 3NAMA 2QDKA 1VXRA 1KP3A 2DUMA 5DYYA 3F6BX 3AVWA 4C5AA 1YU9A 3RW9A 4NMHA 5JEDA 2XTAA 1T8RA 3AY3A 3T3OA 3R4VA 3M89A 1PBTA 5A62A 3UCFA 4KH1A 1NXVA 1AK2A 5MN4A 3PYXA 5ITZB 1I7DA 5IJAA 4EITA 4Q37A 3OFJA 4F5ZA 3GJ8A 3T34A 4EY5A 1QV9A 3QBJA 4GZ6A 2PA3A 2XUGA 1ZESA 3FNBA 4CIDA 3TLGB 4Z0PA 5KSZA 3ASVA 3MVEA 4FFSA 1R0XA 4JLVA 1A5TA 1AU9A 4RY9A 1YWGO 4ZMBA 1AURA 4ZQBA 4AXXA 5LPNA 4BMNA 1MX5A 4NV0A 2AL7A 1SN7A 1K2VN 3IPRA 2JAQA 3MD9A 3NAZA 4J0HA 1GADO 3THRA 4UTPA 5BW6B 4LX0A 2ZJ7A 4AS3A 1DELA 2VHWA 1YC5A 3HVUA 1CJSA 2WU1A 4BBZA 2WM2A 2PKEA 5DTQA 4HN4B 2X3FA 3B7GA 2VA8A 2E18A 1YQGA 1T2AA 3C15C 3M1YA 3PJFA 3Q98A 5E6UB 2BONA 1QO0A 3REOA 3TLEA 3G79A 2DJ5A 2Z43A 2ZT6A 1VKNA 2UZ4A 3BHIA 4IGEA 2C20A 5T5QA 2MCFA 3IPAA 5BYJA 3ER9A 1QQBA 5IHPA 2M9MA 1QO9A 3UV7A 4BLRA 3BQNB 2C83A 4PZCA 4XIGS 1UBLS 3BG5A 1L9KA 1XR3A 1UBNA 3R5KA 3WYCA 2I7VA 2KWIA 3D4LA 2DPHA 4K05A 4PXYA 3ZLJA 4N76A 4A5OA 1RWWA 2ZB8A 2FZEA 3DD5A 1GQ2A 4GI3A 4XXHA 5F1PA 5HYVA 1G3UA 4W5OA 2CBXA 5GJVC 1PV4A 1TJ5A 1NPTO 1T6BY 4I66A 1RRVA 3ZNQA 4FYHA 4EAAA 1V8FA 2D2VA 3LUGA 2H57A 1OH5A 4LA4A 4MB0A 3ROGA 5K45A 2PL1A 3CW2A 4W5WA 1S0UA 3VXKA 3ZU4A 4BZQA 4RKRA 5AW1A 4MYHA 2QRUA 2MSCB 4XEHA 2VPIA 3CEHA 4QU5A 1GAQA 3L9WA 5JFGA 4JSYA 1JPUA 1IXZA 1OU4A 3N2NA 1WMSA 4PG6A 2W83A 4YRSA 5IJZA 3QNWA 4Q01A 4HRAA 4JI1B 4YJ3F 3WMEA 3ZH2A 2O20A 2M6LA 5AI5A 3SHVA 2FG6C 4UVDA 1CQIA 4G5HA 3RWBA 1QTQA 3RASA 1DIGA 1R27A 2X40A 3PFFA 3MS4A 5DJ5A 3UAVA 1H23A 3PQ4A 4P4TA 3KELA 2YWXA 3V4ZA 5T6MA 5FTKA 1S02A 1F0NA 3MJCA 3MWLA 821PA 2OSVA 5HOQA 3F71A 5K5EA 1YCGA 4NJEA 2J6BA 5FA8A 1PJ3A 1PZGA 4Q34A 3C8MA 1OC2A 3QW4B 2AJ8A 5J4YA 3IAM1 4DJTA 4U39A 1QVVA 3CB2A 3QIVA 2VP4A 5C52B 1UQUA 2VATA 2JHPA 4OKSA 3CLKA 3DMFA 2Z9CA 4YAFA 2YJ3A 1SKYB 1GTL1 1PKEA 1SHLA 2HYDA 2ZWIA 3TLBA 4OX9B 2I3GA 5A6SB 5KTRA 2LTAA 2GTIA 3UXHA 3WYFA 1ZH2A 2AB0A 1R0SA 3VU9B 1QSGA 2DP4E 2VNKA 2CXOA 3QBEA 1N25A 4K6FA 4U3JA 3ZDRA 2YZKA 4BE7B 4ZICA 2R8OA 5KQMA 2Q8PA 1O95C 2VT7A 5JYCA 3WL8A 2C1EA 3HXPA 3AF4A 4G6ZA 3UEOA 3VR5H 3DMRA 1RRGA 2C9DA 3CUWA 1ZNWA 2AA3A 3AWDA 3QYJA 4MGYR 4KXMA 2GO1A 1P1HA 3QNUA 2EGHA 2XQFA 4H2DA 4X7PA 5DBIA 2NXWA 5LD2C 4JQCA 3K2IA 1HH4A 5IBPA 1MAWA 1EDZA 2C61A 4HO1X 1Q1ZA 4ZHSA 3N6XA 1FRNA 4MR9A 3M1AA 1IEVA 3RFCA 3SVZA 5A3JA 2O2JA 1E7QA 2QSJA 2A84A 3EBPA 1P9NA 4D4LA 5B2ZA 3ZBQA 2EYQA 2VYVA 4IEEA 3Q9LA 4QHSA 4G5SA 4P4SB 3K72B 1HRKA 3VUEA 2WUGA 1GGEA 4AP9A 3KSBC 4Z5XA 1ZGJA 3DG9A 3NP7A 3QIAA 4JLOA 4NNOA 1XWWA 4EYGA 1E2HA 1GLNA 1QZTA 2GD0A 2A0FA 3DEKA 1R4NA 3G2MA 4BQFA 2QE7A 1I2AA 3H9UA 2ZWOA 1PFUA 1EQAA 3OCCA 4N47A 3QXGA 4FZRA 1D6MA 3BERA 1AK9A 3ABOB 4QHTA 4RCYA 4M9UA 5KAMA 4CM4B 5JCZA 3LF1A 3RBXA 5I4CA 3W4KA 2VDJA 4GLLA 4XIYA 1UOQA 1EUCB 1FP4A 4UXIA 2BRUA 1A7AA 1QWSA 1TJ4A 2AKAB 2WU4A 3S2IA 1EP9A 4L6AA 2RKWA 4URHA 5EUCA 3WTCA 2L69A 1GRQA 3F78A 4JLUA 1SG0A 3UJBA 3V5NA 1RQPA 2R11A 1C30A 1TPZA 3I34X 4OAPA 3EIHA 5LFAA 1ZRMA 2WQ6A 1G7CA 3UM9A 3FUVA 4GLBA 1YHYA 3V4SA 3VTKA 1WNTA 2A59A 3A6PC 4JVOA 1X39A 3RV3A 3LK6A 5IJ9A 3GT3A 2FUNB 1IHPA 2WJPA 1BHO1 2ZSHA 4LRXA 4D3DA 1SNYA 3NOVA 4IDAA 4KSCA 4HPXB 4V1CB 2Y0EA 1ATIA 3KV1A 1DDIA 1QYIA 2YJ5A 4R9NA 4ZO4A 1H0SA 1RCTE 1WUYA 2B8NA 4K9NA 3S7ZA 3KZVA 1UPFA 1Z38A 3B9QA 3MT0A 1F60A 4W1PA 4G9BA 4YCSA 3M9WA 4P3XA 1MKYA 1QS0A 4RSGA 2ZZNA 4P3PA 1KQNA 2DJIA 3BQMB 3G6WA 3H9CA 3RT9A 2YIDA 4PN7A 3RSOA 2PE5A 2BF4A 3A6EA 2OMEA 3EUWA 1K86A 3MBKA 1VSUA 1KZ6A 2Q6LA 3DTVD 3Q7TA 4GWKA 5KIAA 1W29A 1QB8A 1PJRA 2R1TA 1FRZA 1RXCA 3LX8A 1WTCA 3WE7A 3D4BA 1YCHA 2BT4A 2RHHA 2DUUA 3T9BA 5JJBA 3L02A 5K3DA 4ECAA 1J0AA 2FRDC 4B4VA 3WGUA 3I72A 3CGGA 4E70A 3OTIA 1GZ3A 1XTSA 2R7NA 2WEKA 2ZSIA 3G2QA 3MGBA 4JL5A 4BGVA 2QLLA 2XTMA 3FHJA 1XN1A 2LCFA 2FQ1A 3F96A 4NP6A 3HH8A 4V0RA 1X8KA 4J3JA 3BWMA 3T5BA 3UUWA 1G5FA 3NHMA 2R3SA 1C7IA 4D41A 4HWGA 3ZVKA 1W8DA 1ZAKA 1XL1A 4HH3C 3HGTA 2A3RA 2G6BA 2B82A 2FLKA 1RE1A 4JR2A 3BMQB 3BSSA 3AEKB 5T4FA 3BB1A 3FKSA 4XYBA 5EWMB 1GYRA 4ZZIA 2YVLA 1HEIA 4KQ6A 1IQRA 3H04A 1VG0B 2CZCA 2F3RA 3OI7A 1L4GA 1NASA 3JZDA 3O94A 4Y2PA 2R4QA 1DC5A 3DLCA 3CNOA 3B5JA 3CX6A 3E4DA 3EPRA 2P0YA 4CLDA 3IILA 2FX2A 4E2WA 1SXJE 1NVTA 4BNGA 2CUZA 3TSAA 3P96A 3TSOA 1FNBA 2QM7A 4HN9A 3EN0A 4LGCA 4BJ3A 3FD8A 3PUYA 3K30A 3I2YX 4F7DA 5JFOA 3L1HA 5FD8A 4EPRA 3OQJA 2XADA 1KO5A 3AKDA 5TPZA 1N0UA 2CZQA 2GRUA 1DZIA 2GRAA 5TDHA 2F55A 1E9RA 1E60A 3RS2A 1DC4A 2B9VA 5TS2A 1M0EA 2ATVA 2HSDA 3QFRA 3BXXA 3VR0A 4AKIA 1TW3A 2AMJA 5M5BA 5T4BA 3UB4A 4EPYA 3KHTA 3IEXA 1QQ6A 3C70A 4DIMA 4JODA 3TL2A 1NG9A 2H54A 3H18A 3SXPA 1WCIA 5IYZF 1H69A 3NH9A 4AJNA 3Q40A 2WDPA 2VHVA 2DYKA 2Q4TA 4BB5A 1RYDA 1DDGA 1E20A 2VH1A 1IN6A 4ZZ2A 5IUKC 1HX7A 1VJTA 3D5QA 4JK3A 1U0SY 1XRJA 3LUDA 4LHSA 3TRDA 1T2EA 3NHUA 2Q5OA 4JB2A 1C1DA 1LRKA 2QTAA 2SKCA 4JC4A 5DCYA 2YY5A 2OQVA 2JCVA 3HNOA 1KDRA 3LBYA 1KDYA 4UU1A 4RJJA 3ZVLA 2AEJA 1J42A 3RAFC 1HFJA 4W6ZA 3QMWA 5C3UA 1XWFA 3HB7A 3Q8KA 2A30A 4EY7A 3WGTA 3QENA 1LQTA 5ISMA 1ZRSA 4P38A 4TS9A 3OIUA 3VNRA 5CCBA 1W75A 3AF2A 1EX9A 2ZWPA 1KHHA 1UBOS 5KVQA 5TNXA 1C5KA 1IE3A 2A1UA 3FPBA 5ALUA 3ONNA 3AZPA 5L4SA 1E2BA 2AXEA 3DMHA 2MR6A 3HVIA 3ILSA 3QE2A 4MUNA 2GD2A 4RA9A 1UBSB 2E3JA 2RIRA 3OFSA 1ZW1A 2ZIZA 5FOVA 2P7IA 5I4BA 1G0NA 1OASA 3CMMA 5LC1A 3V1TC 1O87A 3OPMA 4BFVA 2JFWA 3VPAA 4CTMA 1Z88A 3ICEA 1US8A 1DSSG 3MTBA 4TLDA 4I3HA 1PT5A 1W88A 2VKQA 1RYHA 4RTOA 5I7VA 1WP4A 5JSFA 2G9QA 3AT1A 4DN6A 1AV7A 2JEOA 4G8DA 1CDOA 4UPDA 5NULA 1A1VA 3M5PA 4MVJA 4OHWA 1NPDA 4DUGD 5BNWA 3HUEA 2E6UX 2P3OA 2O0HA 4ML3A 3ZGYA 2QUKA 2YV4A 1O6ZA 1O94C 2QZ4A 4B34A 1CEQA 1QE3A 2P6UA 5LN1A 4O2LA 3PE6A 2OZLA 5LZ9A 3DA8A 2AK3A 1UM8A 2XOXA 4YIKA 3RD5A 5JNVA 4GLOA 1C8VB 2I8AA 3AUTA 3HQ4O 3I9KA 4C0JA 4GR4A 3CUVA 3AONB 1KR2A 1O9GA 2A1TS 3PFHA 3LT4A 4EL5A 4MUFA 3ETNA 3DEHA 4NESA 1C7JA 1RQLA 2UZ3A 3GXBA 3QOFA 5GVRA 4FR2A 2ZYHA 1C2TA 4IINA 4ND8A 4V0OA 4BMPB 1M7HA 2X41A 1YR9A 4AZ0A 4EG0A 5MF6A 4EH1A 3PRKE 4G63A 2O3TA 1Z4KA 2BGJA 1G8PA 1AOXA 3D6UA 3E6AA 1IM2A 1JDTA 3SHFA 1JYSA 4I5EA 4E2XA 2CJWA 3HXTA 3ILVA 2CMDA 2EQBA 3QE9Y 4FNAA 5AW7A 1TCVA 3GDWA 3GG2A 4RVDA 3PXCX 4PC7A 4RSRA 4XQEA 3VJLA 3AK4A 3E5MA 3IGFA 4YAKA 4ZQGA 1M1NB 1DADA 5HTOA 3LZDA 2AG5A 1JA1A 1JFLA 3AILA 3GJXC 1D3AA 4HWPA 1B0UA 1XMPA 1Z7YA 2BMVA 3SICE 4CQMA 4XPZA 2RHBA 1JE1A 2Q5FA 1U9JA 1SHJA 4XX0A 4H7JA 3BDAA 2XUIA 4NU8X 4M8IA 2AS0A 3SKVA 3V4PB 2VVTA 2C0CA 1RNLA 1JQBA 1PK9A 3FNHA 4WGGA 3ML1A 4X00A 4H16A 4EY6A 4ZZ3A 1E4EA 3ETHA 4NYMQ 4BASA 3UUEA 3KRTA 5LZ5A 3H8SA 5I5EA 3V4RA 3VSBA 4WA8A 5ICGA 1GZVA 2V1XA 4L51A 4O4LB 5JVDA 2GUWA 4H4DA 4DR5B 4GZLA 3WK5A 5C5IA 4Z7JA 3DZHA 1GOTA 2DKOA 1FRQA 4KN6A 1O58A 2CDCA 2VJBA 2WUFA 1T0HB 1XLTA 2VDPB 4M38A 4PFQA 5HFNA 4DR4B 1QB7A 5CYFA 1IJFA 5CIWA 5DNCA 4IZ6A 1KARA 2W90A 5FWYB 4D92A 2EF1A 3TZLA 5KWEA 5G53C 2DG2A 4YUVA 1WM1A 3PJGA 2FYTA 4OFBA 1QVRA 1Q74A 5EG5A 1VRVA 3AHCA 4DCOA 3MWJA 1CHNA 1V7QA 5E2IA 4DLYA 3MXOA 5DO9A 1ECLA 1JF8A 1FDTA 3AINA 1PNQA 1WCWA 3QVXA 4HAWA 4TV9F 3WAKA 1OV4A 4RFLA 3W9SA 4OLFA 3LUJA 4EJ6A 1OXSC 2A4KA 1A9PA 3DDUA 2NUPA 4PWYA 4HGYA 3KOOA 5C1OA 2NP7A 1Y1KE 3P0FA 3O84A 3SKXA 5JD4A 1M2GA 1Q92A 5LMZA 3EXAA 1F5NA 1KZ9A 1YZLA 2E1PA 2EU8A 3MA0A 3QKWA 5FUBA 3UANA 4BZXA 1PUXA 4CCWA 1AO0A 1FTYA 1V41E 1EIZA 1N5DA 2IXDA 2HIHA 2NG1A 3OC6A 3SX4A 5DMXA 2LCQA 4XFDA 4PZLA 1A9SA 1W35A 1IUKA 3IMEA 3O9VA 5BR1A 3OQMA 1E6KA 2C54A 2VUIB 1QVAA 3N0WA 2GN6A 5K8UA 1BHSA 2Z9DA 5BVGA 2IHKA 4CLRA 3OPYB 2GHQA 4RFSA 5A5EA 2NTEA 4ZAXA 4GPZA 2XHEA 4LV6A 3OOSA 1PW5A 3MUEA 5LYYA 1EZ4A 3SQDA 4E7OA 2UZAA 2M98A 4GPIB 4JYPA 2P0AA 1JJAA 3OCUA 2PZLA 4RVGA 3U16A 1RXWA 4OATA 2V9CA 3BYZA 1XV5A 4PVDA 1D1PA 3IEUA 1S89A 2IF0A 1MO5A 4WI1A 4R84A 3ZY2A 1TYCA 2YS7A 4DM3A 1E1QD 1QFSA 2O5VA 3FIJA 3OECA 3OJ0A 4FDUA 1K8XB 1KI8A 3K0AA 4Z0NA 1Z45A 4XDYA 4Y6RA 4F91B 4XWYA 2WE7A 3IUEA 3Q7IA 4DQUA 1ZIYA 2WLSA 2J87A 2E5WA 4H0NA 1EP2B 4DS3A 1ZY2A 3D4NA 2O8BA 3K4PA 1XMVA 2CLEB 1KVTA 2WF6A 3MJRA 5AM5A 2E21A 5L45A 4GM0A 1DCKA 4X1KA 1KPGA 3EPHA 1OAKA 1N7IA 1OXMA 1GGVA 1TF5A 2B8JA 2OBXA 2YVQA 3HA3A 1LI7A 3OA2A 4IKPA 4YJDA 2IY9A 1JXOA 4YT8A 1T43A 2JGFA 3WGNA 3CE6A 1CJKC 4KO4S 3TQFA 1VL2A 1LXCA 2W4MA 3EZ6A 4NZPA 5IAOA 5LP6B 4ZO6A 4RGVA 5DZSA 3JQCA 1Q6YA 4QYMA 5IKOA 1TPYA 3IAS1 4HF7A 4UEOA 1IUOA 1IFXA 3GT4A 3DF9A 1E0SA 1GFSA 2WUWE 5T8KA 2VJOA 5JXWA 1SVNA 1J8DA 3NQ41 5ECDA 4E2FA 4F4IA 1B0AA 1ORHA 4FW8A 3A9WA 4NG4A 1N75A 3W5UA 3DO6A 4KJXA 2AVNA 4INOA 3TAXA 3BWCA 3NYQA 2IYWA 5BQ5A 4CEHB 3WL5A 3Q3EA 2B0CA 1QHNA 5CXUA 3IP6A 2GXQA 4OQLA 4KFSA 4RTSA 3I73A 4BX8A 5EQFA 3P9QA 1PZMA 4FX2A 3G9QA 4XRRA 3D1JA 4Z1MD 4K6OA 4LBWA 5GVSA 1ULHA 3V46A 4K9KA 4WX2B 1GGNA 1Y7TA 1DRWA 2NZYA 2C1ZA 1EBFA 1WBJB 3ANMA 3FCXA 3HCNA 5AKZA 1G8HA 2OHXA 4JA2A 5LA6F 3OKCA 4BCBA 4DMFA 5K8CA 3LHDA 1V25A 1I3CA 4AF8A 2WHXA 3SSAA 3ZY6A 5AJYA 4A8JC 1CUAA 5LKAA 3QI7A 3DBVO 3FDIA 5AW2A 3DAYA 4K9MA 3IEIA 3UG7A 3OTOB 1BOOA 3OTGA 1XRQA 4DB2A 1JZTA 3TEJA 3E58A 3ZUPA 2Y1XA 2OORA 1N6KA 4ND3A 4D45A 4KDCA 1RI5A 3BEDA 2Q6OA 2LD4A 2ZI5A 2ORWA 4FLFA 3LOUA 1QRAA 2RK3A 3ZBUA 2LIPA 4Q4AB 1ZD8A 3IQHX 2D5LA 1DO8A 2WSIA 2WW8A 3TB4A 3E84A 5C5DA 3F98A 5T3UA 1FUKA 1YDHA 4R2HA 2BGWA 5TQ0A 3NUZA 5E0KB 3JQ9C 5DNAA 4JT2A 3HS3A 3HYLA 3VYTB 4BVAA 1MMFB 1GPBA 1V7CA 3AL2A 4W7IA 4WZZA 1G64A 1PHPA 2GB4A 3H9JA 3SE0A 2AI1A 4J1QA 4I2VA 2VBGA 2P1DA 3FNGA 3VU3A 4OXXA 1IEXA 1U8EA 4G1UC 2W48A 3KJZA 1QAOA 3OFNA 3ZV5A 1Y4DE 5M29A 4FGLA 4AS2A 4B7XA 1R0ZA 1DMRA 4Y1GA 2X58A 3SIWA 3VR3D 5GONB 3Q5GA 4B83A 1RPJA 3QWIA 3I6YA 3JRXA 2J1LA 1MG5A 1XVUA 1R3DA 2PWBA 2YV2A 3EW9A 2QEQA 4KH0A 5CYGA 3ANSA 5LMCA 5DNDA 4DDVA 1EMDA 1YVRA 4ZCTA 3CSUA 4Z49A 3EXFB 2D6FA 3DTVB 1Z25A 4YWHA 5HQ3B 3Q3GE 1LK5A 4C7JA 3VKHA 4F3KA 5FYQA 3PIIA 1WR8A 5TEVA 1HZZA 4KBFA 4AQYB 1ORVA 1RBQA 4DKJA 2EFEB 1B3BA 3FKQA 1W5BA 2P9BA 1HT2E 3UN1A 2X14A 4RESA 1J25A 1TEZA 2NU6A 5DN6A 4KQHA 3ZHVA 1PDWA 1Q15A 4HI0E 2SHKA 4IWNA 5DSTA 3ZK7A 4LC1A 1XPOA 4QULA 3LTNC 2W6ID 1SK8A 4WJZA 4ROSA 3VVMA 1Z83A 3E5RA 4CMIA 1D4AA 2XYPA 1RLTA 2F1JA 3DQQA 3HMQA 3MTAA 4KPGA 3WK9A 4ARCA 4BLSA 2VHEA 4Q16A 1ODKA 4IMRA 1HQKA 4G37A 4GYJA 4NBKA 1EI9A 1KA9H 2Y67A 1RI3A 4HAIA 1M2EA 2GILA 4EG4A 5KBYA 2IPAB 5BYKA 3AKEA 2Q5HA 3H5WA 3WGIA 1KFCB 5JAUA 3E3MA 1QGUB 2RH4A 1Z4NA 1RHQA 1ZK4A 2JFOA 2KHZA 3I28A 3RUPA 1KY5A 1U94A 5IULC 2IW1A 4BQIA 5EIBD 4JT4A 3HU1A 3R0IA 1OFUX 1HDEA 2H2DA 3V7YA 2EW1A 4TMKA 1NT2A 1NUHA 3HXLA 3K0SA 4Q3DA 2FP4B 3PEWA 1EP1B 3BBPA 3IBGA 4JP3A 2IZOA 3GQVA 4MR7A 1DIRA 4GOJA 2QVYX 2R1VB 5GV8A 5B3KA 5KNBD 3TG2A 1Q3TA 2ODBA 3LWBA 3IBYA 3HWSA 2VDWB 5AI6A 1II8B 4YQZA 3SK0A 1P75A 4KNWA 4RZQA 1NLMA 4LOLA 3MJVA 3DT9A 4GS5A 2JW5A 5CVDA 1TZBA 2PTHA 5LJIA 4FP9A 2VPYA 4LMRA 3LZCA 4ZT5A 2AR7A 5U1PA 5CCDA 3FPKA 3R5HA 1VHQA 4W6QA 1V6CA 4E5KA 4R1MA 3V55A 2N75A 3AH8A 5B1SA 4DR2B 4YROA 2W2NA 4ZOEA 3GJYA 3HJRA 1NF9A 2PS9A 2QRJA 2FETA 3I05A 4KAAA 1NMEA 3GQBB 3LL7A 3OJLA 1RQNA 3VJMA 4RD6A 4EQ6A 5AESA 1TCAA 5KYKA 1H2XA 2QD4A 4XQCA 3QFCA 3JALB 1XCJA 1YJXA 3IIEA 1N6NA 2CCKA 3T4PA 5HF9A 5E3HA 3J80A 3B3QA 3PGVA 1M9NA 4J16C 2FMTA 4E3WA 3EWIA 2XTNA 3VMMA 2HIAA 3I23A 1U90A 3IUSA 4MW0A 3N39C 4R01A 2VNHA 5IVKA 2QDXA 1NMQA 3L1IA 3TIGA 1V5FA 3DD1A 4QOIA 2IHUA 3G5UA 3PCXA 2QVCA 5BUSA 1TCBA 2YWDA 3CNBA 1RPAA 3FPCA 4X3PA 3RS8A 5JS8A 1XPJA 2QA5A 2XTZA 1QTRA 1FQOA 3PDHA 3U4IA 4LOAA 4M22A 2BIFA 5CCXA 4Q1FA 2HUNA 1KI9A 4GSYA 2PSJA 4BNUA 3SHTA 4PV7A 1QNLA 3Q87B 4HN2A 4UBJA 2OK7A 1FTSA 5IBRA 1UKEA 1PWYE 4M1MA 3LHIA 4C03A 3RSSA 3QITA 2QJWA 4TV8A 2HPZA 5FLKA 1KH3A 1ZA2A 4HWSA 4YJ2B 3STHA 1J33A 2ZWVA 4PM4A 4PQFA 3F7TA 3NG1A 1CRQA 4MUBA 1PFQA 4REOA 4WT7A 1J23A 3MWEB 3PRJA 4PSKA 2Y1EA 4EIWA 3OM1A 2X77A 5IJWA 5FOTA 3U37A 1OWLA 1NRJB 1N3BA 1RM3A 2CWWA 3HEBA 4X7MA 2BFFB 3QUAA 1KERA 2G67A 4N18A 4QEZA 3ADCA 4M54A 4V0SA 1KQGA 1LS6A 3NHLA 3P52A 3DL0A 3NIWA 3ZI7A 1NF8A 4WAUA 2AW3A 5JQGB 3N8DA 1CJBA 2BEWB 5ADHA 1IUPA 1NUAA 2DBZA 4X63A 4RTKA 3THWA 4BLWA 1P7YA 2Z95A 3EXIB 1GITA 5BORA 1JKJA 1I5OA 5DGXA 3KHSA 3N0RA 2TS1A 3QNMA 2VYFA 4UCQA 1USVA 4HZUB 4UMEA 1PG0A 3MBOA 1TJYA 2JK1A 3FWKA 4A92A 1SBCA 4CLOB 5BV0A 5EFZA 5FTNA 2I9PA 5HUHA 4CF6A 1NSTA 4A27A 4ARAA 5DXJA 3X1WA 4OQQA 5HW0A 1WNFA 1LKZA 1SKUA 2ZSJA 3BILA 3KKNA 3KYJB 3OZUA 1FNMA 2IEDA 4EI7A 3N70A 4R3WA 5DRTA 4ENQA 4AG3A 3I5AA 2FPWA 3SNHA 4M76B 1VIDA 2MWMA 1YHNA 3X1JA 4ZJPA 1BG6A 3BWYA 4B3HA 3W7AA 4QXPA 2XXAA 1V4NA 4RD2A 4CIAA 4C14A 3HSSA 4RTMA 1QRSA 2BKUA 1XQXA 2ZIGA 1DNPA 1ZUHA 2XF2A 3BD9A 4KG7A 1TUEA 3LDFA 5EMMA 1NWHA 4G01B 2WWRA 1CV2A 3P9NA 2C9CA 3IIIA 1QG4A 4FDAA 3RFFA 4QT4A 3QSYA 3F1LA 1K7XB 2XODA 2C42A 4Y6PA 1SEVA 3HE3A 3BGOS 1YL7A 1P2UA 3VR4D 1NZDA 4PRYA 4PG8A 2H65A 3CH4B 3O8QB 3V3TA 1F06A 1VMKA 1UBFA 3OE4A 2VJQA 1G21E 2WZQA 1J56A 3DP9A 1TUIA 4RQTA 4YP6A 2F17A 4XM2A 5KKAA 5WRFA 3RDPA 1H42A 2Q4OA 4WJKB 3HJHA 2NYAA 4ZAVA 4Y18A 5DP1A 2WHPA 4I14A 4OCZA 4PIVA 5C34B 4MHSA 3WLNA 3DDZX 4KPFC 1M1ZA 3T4UA 1DZ3A 2CB9A 2NIPA 1JPNA 1VLVA 4XAQA 5KSOA 1CUFA 3FPFA 1L5WA 3N05A 3E18A 3ELDA 5TGZA 5BSFA 5B3LA 3BJEA 3NC1C 2YOGA 3OPXA 3OUZA 2BRUC 2XTJA 3NATA 2OPHA 3KQVA 2Q9UA 4R7GA 3SHQA 1F12A 2AQHA 4CM7A 1S3IA 2GM9A 2UUOA 1RC0A 1Y8QB 1RE0A 4WWHA 2CNOA 4LJ4A 2VO1A 1JG4A 3E22B 1X80A 4IV5A 5JARA 3HY4A 4JBNA 2WJGA 4MVJH 1L7RA 1UK7A 4JOCA 3RFUA 1FFHA 1AZTA 2DH6A 5CG2A 2CXTA 5H3HA 2OB2A 1LPAB 2FTKE 2JGEA 2BUCA 3NGXA 4Z8XA 3U60B 1K4MA 4EHAA 5D3MA 4G86A 3V2GA 3ERCA 2H7YA 1FTNA 5H0IA 3WP1B 2ZUTA 4OLBA 2IL1A 4WN3A 3FF1A 3TK1A 2PUCA 1ISMA 2AXPA 2ODAA 3O1IC 4P82A 3QKRA 3FOZA 5A9SB 1WX1A 4DCVA 4ER6A 1OX5A 1PJ4A 1POXA 2VSYA 2FMHA 2OLKA 1TEHA 1SU8A 4KYUA 4D82A 3MC1A 1W4AA 3CKMA 1CR0A 1MC4A 4LXHA 3M3DA 3UHJA 4OP2A 3NJ4A 3RO7A 3SJAA 3BE5A 5DI3A 1X7ZB 3R6WA 2XCLA 3D02A 4U9UA 3HVJA 4AJPA 2AJLI 4WDQA 1Z37A 5ANRB 1DBPA 1ZJYA 3HZRA 2XX3A 2AFHA 3B2NA 4NYIQ 3OCWA 1E6LA 2UVPB 4JBHA 4UXJA 3TAHA 3TQOA 4OLAA 2F8MA 4Q5IA 4OLJA 5IUJC 5KOIA 4MLDA 2GD6A 3EGXB 1E2JA 4IH1A 2HPHA 3ELBA 3SI7A 1IHYA 3GCXA 1NFQA 4CVNA 2I67A 3B8EA 5CX4A 1DLIA 1BGWA 4RK5A 4QVKA 3IPYA 4RS4A 1KO4A 2OXTA 3RAGA 3BMNA 3I12A 2CHGA 1VP3A 2QP4A 2IP2A 3FWHA 3OZDA 4IO0A 1XT6A 4TVKA 1SULA 3EFOA 4JZYA 1EA5A 1BU8A 5JHHB 1KJZA 3BWVA 2HNAA 3QX7A 3AOEA 4RL4A 4AJIA 3ON5A 1CY6A 1P29A 4Q15A 5J63A 3U80A 2L2QA 1CW2B 4E21A 4X20A 3E35A 4B3DA 2W8BB 1G4HA 1UP6A 5BN4B 2IYAA 3D3WA 3ZCQA 1KKLA 1SZPA 1ZCAA 3PL1A 1LSSA 3LUKA 1OTYA 4RFVA 3GP8A 1CZKA 3A70A 4YI3A 3I0ZA 4D43A 1U5BB 3FSRA 1P1CA 4MYTA 2FR8A 4C2TA 3ADOA 5C3MA 1ZUD1 4FN4A 4ID3A 4YY3B 4RV4A 1VE9A 2JGDB 3T7JA 1UXIA 3I45A 4CKCB 1H4VB 3RLIA 4QD3A 4I5FA 1EK6A 3AIKA 4BMCA 1L7VC 1QR6A 1RHJA 5COQA 4CM8B 1ESEA 2BEKA 4GSLA 1WHSA 5E8RA 1HE3A 5AVTA 2P69A 4DQ0A 2YL2A 1T4CB 4D8WA 4EHBA 4D4IA 2UYOA 3MLAA 3OE7A 4HNAA 3FMGA 2OV6A 5T67A 4KQIA 1GPKA 4P3OA 2D06A 2DU8A 4JSRA 4I9FA 3LX4A 1TVCA 4OG2A 3AEUB 4URVR 4LNUA 5JO0A 5BSHA 4NK5A 2WTNA 2PX3A 2CHVA 3DFZA 3NJRA 3W2HA 3JRNA 1KAOA 3H0EA 4K2HA 4OI1A 2GN8A 2PQ0A 2ZZKA 1J1ZA 2Q49A 2XVAA 3PTZA 4L4RA 4TN1A 1FS5A 4Y1EA 1CT9A 1ONNA 2B61A 4RIFA 1JEOA 1L7BA 3KOXA 1Z4JA 3UMJA 3LP6A 4Y2HA 1JWLA 4FTWA 5KQPA 3UUFA 3KQLA 1C81A 1T8TA 2WVAA 1OROA 2P3QA 3JPWA 4EPXA 3ZGZA 1JQEA 2YV1A 2RHGB 4RPLA 3E9MA 4JJFA 3FHOA 5ICSA 2ZUDA 4N48A 1A4UA 2XH8A 3DHNA 3L1UA 1FDSA 2V5UA 1JXMA 4WKPA 4MNTA 4M9CA 1XCBA 3WYAA 1GDHA 1EGHA 4AMGA 4XDZA 3HEMA 4P5PA 5D3QA 1MV8A 3DLHA 1Y81A 2B30A 4WL0A 2QMZA 2YFQA 4RO0A 4F9TA 5BMOA 1DINA 1LS1A 1QC5B 4G9EA 4DUYB 1U7OA 1QK5A 4BQOA 5J3JA 4ZV7A 2JA1A 2TSYB 4CF3A 1T3HA 1X7YB 1BO6A 1OI2A 1PT6A 2EQ5A 2QTLA 1IVYA 3ZWWA 2BJHA 2IXAA 3MWDA 1KZ1A 3BA6A 4XWKA 1JWBB 5FQNA 5J4KA 1SQ6A 5L7TA 4ZYWA 1BQ4A 4FE7A 3HG7A 3JARB 4MVJP 2XUZA 4J0CA 1XJWA 3KPUA 1AM4D 2GNOA 5EP2A 3R3UA 4S0ZA 1LWOA 5C8YF 4B7CA 3L92A 5BNIA 5IWCA 1L7OA 4X6LA 1M8GA 5FLXA 3TCKA 1DX9A 1FNCA 1GT91 2R62A 2PMFA 4RA6B 2C0QA 1QCZA 4KOAA 5TQ2A 1WF6A 3AQIA 3L4KA 3JWJA 4E12A 4F7WA 2VJYA 3A4MA 3DHEA 2X9NA 4CIVA 4EFNA 2BEUB 2P4UA 2XCIA 3CUUA 3FH0A 3UYLA 1EWYA 4KXLA 3RNOA 1Z5UA 3C1UA 5CGQB 3UCEA 1V71A 1CNMA 1A7KA 1U9ZA 2XKKA 3WWCA 3GLFA 2EWVA 2OGUA 5FXMA 2FPGA 3ND9A 3OQNA 3ROEA 5G02A 4M8LA 4MKHA 2JFHA 1ZWLA 4FWTA 3BBLA 3Q5EA 4PG4A 1E79D 1N9KA 2B36A 1SD1A 4IW3B 1T15A 3M6XA 5TPWA 2GVDC 1T9BA 3ZC3A 2PT6A 4H6WA 2C78A 8OHMA 2HEIA 4OYLA 2PCLA 1MO2A 2KPOA 2RI0A 4EO9A 4QXAA 3QKSB 2H1IA 3UWKA 4HNUA 5AOVA 2K4MA 3M5WA 1VSVA 2G5TA 2P9CA 4ZAYA 1JA9A 3BKXA 3RHTA 3OZVA 1LPOA 3JQQA 5EJ6A 2CVPA 3LHKA 2ADOA 4BX2A 4O2BF 4FOSA 3GZTB 4UAVA 1H5UA 1U0OC 4Y7DA 4DMCA 3MJSA 1P60A 2HYIC 4RTQA 3QPCA 5IK2A 1TM1E 1Y3FE 2IQIA 1OBOA 4FD2A 4JWTA 2OFFA 1OZGA 4YH1A 3U9LA 1Y1LA 2OV2A 3W3AD 4EDFA 2J31A 1Z75A 2P9FA 3GBVA 4KHPB 3HTXA 1H6AA 4L76A 3ZZ0A 2YWEA 4RXMA 1UJ2A 2HLDD 3LVFO 1RKQA 5J1SB 2HHJA 4MVYA 1C9NA 3DE3X 1D7OA 1N6LA 5CDUA 4WINA 4OU5A 5JSZA 4LF6B 1OF1A 3AYZB 4RMJA 1XA0A 4LMAA 1P3DA 2JCYA 1IZZA 2Y0PA 2WAXA 3IR7A 2ZAYA 3UJAA 5HA5A 3I09A 2O0KA 2OQ2A 3O75A 1EE2A 5HMMA 4FN5A 3EISA 4EJSB 4QICA 4PPQA 2C4TA 4F84A 3MNFA 3HFJA 4BP9A 5HKKA 4ENTA 5HRCA 4ARZB 5IEBA 2IDJA 4EMSA 4EL0A 2JLRA 1UPBA 3ZV7A 5JNWA 3G2HA 2J3DA 5I8PA 1Z35A 2WICA 2AKYA 1MXFA 3VVLA 4ABTA 1SUIA 5KJEA 1C7FA 1YVDA 4OO3A 2NLOA 4KQ1A 4UOQA 4KV7A 4BQEA 2VQDA 2C9YA 2JGJA 3KJXA 3K9LA 2OHJA 3SC6A 4CKBA 2DWQA 2VJLA 2WWWA 3AETA 3EAQA 3I64A 3V42A 3WAGA 1D6NA 1C50A 1UWLA 2WFMA 1SCUA 2EGUA 3QP9A 4IXWA 3MGKA 1H05A 3GF4A 4M1QA 5CDYA 1QMGA 1Y3AA 5I9NA 1TQ6A 4RMNA 4TLLB 2YFKA 2ZS7A 3FPEA 3GGPA 2F43A 1FS6A 4P0QB 4ZO9A 4UNPA 4CV2A 4N1AA 4I2NA 4AMBA 1M6WA 3I9V1 2JFFA 3A3OA 2RAUA 1S96A 1UMCB 3L4SO 1VIAA 3P9SA 4QGFA 1ZHHA 3LIPA 3DZDA 1K5GA 5A05A 2AOXA 1B42A 2OG2A 3KWLA 3JYOA 3L6DA 5GOZA 1GL7A 3CNLA 5CT4A 4YMVA 3MTQA 1MP0A 4QDKA 1ECPA 5KU1A 5BSMA 5JS2A 3VNSA 1SU7A 3ZDCA 1QHSA 5HXAA 1G17A 5A9RA 4XCXA 4EW6A 1ZD2P 3CLHA 1KS2A 2QLJA 1THZA 4R7TA 3L7IA 3EW7A 2GCPA 2HWUA 1PZXA 4HZIA 1GVHA 5F5LA 4LXYA 5CRIA 4PGAA 2B1RA 2W22A 4H7FA 4RHUA 1NHGA 3JD0A 5JZ9A 2WI8A 1YGYA 4WXRA 1K5HA 5T6BA 4ZJUA 2OGWA 1XNRB 1U2TA 4EY3A 1FL9A 1U2ZA 3F5DA 5A3SA 4E33A 1HC7A 1KKMA 4F71A 4KITB 5JCOA 3SQOA 5EGNA 2DUNA 1DCFA 2FR1A 1E8NA 2PFGA 2ANBA 5F33A 3AJ8A 4NZYA 4J6EA 3GVPA 3RYHA 4EUKA 4PR0A 3JASA 2XBLA 2XF8A 4GXQA 5T8KC 3ZH9B 2HT1A 4HDRA 4AO6A 5EHNA 3TPCA 4WZBE 2WFZA 4ZJYA 5KNCA 3R40A 3WWYA 3V00A 1AXEA 1W5FA 3DR5A 3FPAA 3KBOA 2J4FA 1HG0A 2P6MA 2P2CA 3OQOA 3VJRA 4II7A 4F3RA 2EHJA 2I4NA 2F3TA 1UADA 3GFTA 3I01M 4CT5A 1KF0A 4DC9A 1SCDA 5F78A 1TL7C 4NU6A 1JU4A 4DSNA 3UNXA 2DHEA 2ZRMA 3UJ9A 4AKSA 4QTXA 1JNYA 3BMXA 5IJXA 3T7AA 2OGSA 1RPZA 3QLJA 3SQNA 2YRFA 3UWDA 4CIXA 5BOSB 2M32A 4IMIB 3S2YA 4RF4A 2I66A 4ISBA 3ONWA 5AUQA 4X5OA 2JAHA 2Z5VA 3SFZA 2JI7A 3AUXA 5KTOA 2VJMB 4AN1A 4GIBA 2Z2JA 1LRLA 2D0DA 2PS1A 3IE2A 4FOLA 1UT6A 2PZFA 1WMDA 3QF4A 2WABA 3GZNA 3S55A 4L5CA 4P33A 1P0CA 4ZRDA 4UQPA 2KLHA 5L8VA 3KZCA 2IXGA 2QWXA 2ZQZA 4NPAA 1TE2A 1DQZA 1O6CA 2EKQA 3HJGA 2IYRA 4AUEA 2C88A 2G4LA 3DOIA 4JC0A 4PRKA 4U2FA 3V1KA 1GQRA 4DL9A 3AJEA 3DWEX 3KU1A 3ODGA 5MFZA 2C57A 1EK1A 2JRLA 1T9AA 2E6KA 4BOYA 1ZVVA 4L6IA 4BVHA 1Q3HA 3ICOA 4BAZA 2UZ0A 1JR2A 1YR7A 2F62A 5EMHA 2G71A 2I1QA 1OU0A 3BIFA 1UDBA 1ZICA 1Z8DA 2W6PA 2BR4A 3HYTA 3IUPA 3UQYS 3WV4A 1CR4A 4JWKA 4XYEA 3QKUA 3QBTA 1C7ZA 2CBGA 2AD1A 3K53A 3K15A 3IMKA 1FRVA 4P4UA 1RWPA 5DBOA 5BRAA 3MINB 1HLPA 3OFVA 3KR9A 4P2BA 2Q0SA 4B6OA 2NOAA 3UHOA 2QPOA 1KYIA 1IZ9A 5JR3A 4C1NA 4H77A 1C80A 4YS6A 3EPLA 1M6NA 3E3AA 1SO8A 3IERA 2GAOA 5F12A 3KYCB 2IS1A 1E92A 1L5HB 3F4KA 3KE8A 4RH0A 5DM2A 2FOLA 4YWJA 1L6RA 4I5GA 3RJ5A 4IDCA 4JBIA 3SR4A 3RWOA 1HZZC 2ENUA 3O2QB 2OENG 2G5PA 3ROPA 5LLDA 3RU3A 5KQLA 4V3CA 1GSIA 4CIWA 1RJDA 2Q3EA 3UA4A 1S01A 5HUJA 1QCYA 1RWVA 2RONA 1E3DA 1X70A 3VKFA 1OLXB 1ZITA 2CJPA 2R6GA 3EDRA 5EFOA 4JP8A 4YX9A 1E0JA 4DMKA 1GTMA 1XRLA 2VWGA 3T7DA 4LTDA 3AHGA 4BCDA 5AQ1A 1U2GA 1G8MA 2DR2A 3HBMA 4I7EA 3TRJA 2IH5A 1U3GA 2PKXA 4EDHA 2JGKA 1FU4A 1QGED 2ZRBA 3CBGA 4WXHA 4U7JA 5IKPA 4CWAA 1KRWA 1EAMA 1FP6A 3PC3A 1A8HA 2QSUA 2RAFA 1MOZA 4NAHA 1MBZA 4X7RA 4RTNA 2E4XA 3CR3C 1M75A 5FNVB 4RTPA 1GU7A 1Q91A 3P4UA 3WXMA 1XAGA 4TT3A 1E96A 2O07A 4ZPJA 2YNMA 3AHHA 4EW3A 1K3UB 1EFAA 3SQMA 1A9XB 3CH6A 4HEA6 4HXGA 4UC0A 2P9GA 4PAGA 2QP3A 3L7MA 5BPFA 4LPKA 5IC6A 4DARA 1CUJA 1NYRA 1G3QA 1HE8B 3NOOA 3OU6A 1PJAA 2MINB 2OV1A 2G72A 3QUTA 1TZ2A 4QA9A 4EI8A 2ERYA 1T3ZA 1WUTA 4AD8A 4P86A 2ECPA 3HDTA 4BFCA 4JV5B 4CCYA 3VX3A 2X6RA 3N76A 4QG3A 4FSHA 4TQUS 4KFRA 2P2GA 2A35A 3FSGA 1HUQA 3GUYA 2IYSA 4JENA 2IUTA 3T3DA 4AI6A 2IYYA 3L8CA 2V45A 3QEOA 3ZHQA 2KBFA 3O3NB 1JKFA 1KY3A 2HLHA 2I6FA 4IIUA 1BYUA 2CJXA 2DFTA 1LV7A 1IXRC 3KVRA 3OIWA 5LYJA 4C2AA 1Z33A 1ECBA 2WNSA 1K0UA 3VPCA 2HCFA 1PNVA 1X15A 2W2PA 1V16A 1TFRA 2AQKA 1Q0HA 2FFRA 4XYGA 1KAHA 3KYDB 3MCUA 1WZNA 3MWKA 5COBA 2CT8A 1AB5A 1Q1AA 3QVUA 3BRSA 3UJ8A 4PF1A 3G8AA 4G84A 2VHCA 4DJDC 4EEZA 4IKOA 3SKYA 4C1BA 5CIYA 3G9UA 5HIMA 5DOVA 2AX4A 1DU4A 3M6MD 3P9ZA 3QXJA 4M6WB 3DMPA 3E0QA 1M72A 4JXXA 3CKLA 3H0CA 1AUOA 4MTLA 1LNQA 5L40A 3FCAA 1KK3A 1WMBA 3HUFA 1XXHE 2PYIA 1KPIA 1O95D 2GSDA 4IYRA 4YV2A 2C2ZA 3BE6A 3OM8A 2D1QA 1GN9A 4O4IB 2W0MA 1RS0A 2V8BA 3OMWA 1RWQA 5G0SA 1EDOA 4DQDA 2GN0A 1UP7A 2J59A 3KT0A 1T9GS 2XUQA 4MWDA 1Z17A 5I45A 1XZPA 2ZJOA 3F73A 4RVSA 3HM9A 4FGUA 1I51A 3IJ5A 4E13A 5CAEA 1ZOLA 2SNIE 2HPVA 3GLQA 1W5SA 3C16C 5ADWA 4ND2A 2EP8A 3D81A 3HABA 4R2MA 1F5SA 1UQTA 2QTNA 3H9GA 3Q3CA 4Y1RB 1DFHA 1P80A 5BSWA 2QMUA 2QM0A 3W1EA 1T9KA 4OH1A 4DNPA 4NH0A 1GTJ1 5FORA 2ZUCA 1CUSA 4XJVA 1O5IA 3CNEA 4A1FA 2ZT7A 5CNJA 3RVJA 3ZE1B 1VSBA 2GI4A 2X19A 5KWJA 3LVQE 4H7IA 3ZE8A 2AQ8A 1XOIA 1EBBA 2AOUA 1Z74A 4EHKA 1CVRA 1E6EA 1TMOA 2P9JA 1MH1A 4NBLA 4RU1A 3LL4A 3QLEA 3VR1A 1OGJA 5GPBA 1AKQA 4NCIA 3ZE9A 4GXNA 4I5DA 4ZVRA 3TUJC 1ISPA 4BJ1A 3I5XA 1PGOA 1YA4A 3ZD6A 5E7JA 3AZOA 2UYYA 2EKPA 3UO8B 1ULSA 1G60A 1L1EA 3CSSA 2O9JA 2C29D 2PL5A 4L85A 2ZWMA 2XZPA 4URUR 3M7IA 3K0HA 2Q1WA 1SXIA 2JIQA 2RMKA 2ZI3A 3IV6A 3U19A 3DKKA 4BWYA 2XWJI 2I3BA 5FTJA 5KZMB 2JH9A 3R0JA 4C43A 4KXQA 4P2GA 4YIHA 2NACA 8ADHA 2NNLD 3Q8XB 1DJOA 2RARA 1AMOA 3S2SA 4BQPA 1IXYA 4MWSA 1SCIA 1H4TA 2QHXA 4YQYA 4YMSA 2OCKA 2XZLA 1NV8A 2TMDA 3DFMA 2HIGA 2WSLA 1Z6XA 4ASUA 3LCRA 3G2JA 2FOIA 3R3SA 2ONYA 3C5HA 3EQZA 1GUDA 2CMFA 4X8OA 1H0HA 1U7PA 1E1DA 3ASYA 2PBLA 5CFQA 1SBYA 5A4DA 1ADBA 1RHRA 3WKBA 3L8YA 2A14A 4JMLA 4NE7A 1SVKA 3RODA 4LG1A 2WJHA 1Q14A 2Z56A 1M34A 2CUTA 3QE3A 1IJBA 4EI9A 2DM6A 1QG2A 2UUPA 3BM5A 4CZ2A 3C0KA 4CF4A 5A1JA 1QYVA 3BTOA 2C3UA 3M8KA 4E3ZA 1MCZA 1L7MA 2YWFA 3WQQA 1TU0A 1TQHA 2QG6A 4IIEA 1YOVA 4LOIA 4MAAA 3ZDQA 3JY6A 2BCGY 3KFVA 4GFDA 1YUBA 2NSJA 3FYCA 1MZVA 3EMVA 1ZJ5A 3C7CB 2FZLA 4CU5A 1K8QA 2GBCA 1DIHA 1KYZA 4NU5A 4BP1A 2OXFA 1FRFS 4BAUA 1CQXA 4JIGA 3GVCA 1AKYA 1BCSA 2FPIA 2FPUA 1LLFA 3MMXA 4O4LF 4V0MA 2HL6A 5ITSA 3CVJA 4PNHA 2F3QA 3NWOA 4GBED 1DE0A 1TKAA 2OC4A 1SK9A 5KWIA 4TSRA 3SS8A 3T3IA 5IAKA 3RAEC 3EX7C 4GICA 4XJTA 2OHHA 4BNIA 1WWKA 1W85B 3CJRA 3KT3A 5KHAA 5BSVA 1C4KA 2Q6TA 3OKAA 3PC7A 2K7ZA 1P0IA 2QN9A 1YASA 1I33A 1L5YA 3TN7A 2CVFA 2GGSA 3A9RA 3UK1A 1ZVJA 5EHGA 1SOWA 1SY7A 4K88A 2KYRA 3RT1A 5CLFA 2VFAA 3PI6A 1A72A 1VJCA 4J0JA 3K70B 1JT2A 4RIEA 3RFXA 2P7HA 2YMMA 4XGRA 4JOSA 3C3WA 4P9NA 1KXZA 4F5WA 4BO0A 1B73A 2ZIXB 2IYEA 1JHMA 3STTA 3D8SA 5JAZA 4YDQA 5KC8A 3SWWA 1PJCA 3FZYA 4MQUA 5EKUA 3A58B 1J5EB 5JAOA 1W4LA 1Y7HA 2BMDA 2XB8A 3O4GA 4JX9A 3RROA 1IWBB 2QD2A 5E9QA 3U81A 4ZEWA 3E05A 1IZ8A 1EFPB 1LVGA 1CHDA 1RRKA 4KK4A 1WHTA 5JAPA 4ZV4A 1G2QA 2EARA 2ZT5A 3B78A 4KREA 1HNNA 4U9IS 2CLIB 3AESA 4HDSA 1OZAA 4Q4JA 3RUHA 4UZFA 2HC9A 2VTDA 2ZYWX 1XTQA 4TS1A 5FL7D 5JCJD 1RP7A 4B3CA 3CKYA 3TW8B 3OF5A 3SIXA 1LK0A 2VQ6A 3UJDA 4ZGWA 5F7OA 3OUUA 5KTYA 2XBUA 1XX6A 3FZQA 3P2IA 1UBEA 4JUFA 1SUFA 2VWPA 5IARA 2O8DA 1RWKA 2VPTA 2R6R1 2X1VA 1ESDA 1YVPA 1T6ZA 3AF6A 3L6RA 4HK4A 3U1TA 4URYR 1EVJA 5K6TA 2GD1O 4HQOA 1P9LA 3QU7A 3B2EA 4Q7KA 4CDRA 2D1RA 2W7TA 1UC9A 5KHOC 4AJ1A 4DLKA 3THSA 2GKSA 1UBHS 3DHYA 3CEMA 4FYIA 4GF5A 3M70A 3KT8A 1ZD3A 4REQB 3E8XA 4LMBA 4S2EA 2ZM6B 1BD3A 1M6EX 1NP3A 2V54A 4OF4A 1G5PA 3VDNB 1A9RA 1PFVA 2C07A 4MI1A 4WN9A 5JXIA 4TROA 3L0CA 5LMUB 4QUHA 1J06A 1GN8A 2AUNA 3BTSA 3QXSA 5IP5A 2OKGA 2O8VA 3UMGA 1N1MA 3AOEC 2H85A 3AUFA 4G2TA 4EELA 1BGVA 2NV0A 2JARA 2VPZA 4G0PA 2OL4A 3JZAA 3D6JA 4YT4A 3T9CA 1R8QA 3ENNA 5AK6A 2FZ5A 4QT0A 1WL8A 2CKMA 1Y6FA 4C4AA 4OI0A 1QXSA 5K51A 1ZEMA 3C6XA 4IDDA 2VYCA 4RD3A 2ZU0C 5LP6F 3ZD7A 5CNMA 1UXGA 1OX6A 4Y0AA 1IY2A 1PL8A 4RL6A 4HVCA 4BMZA 5IDWA 4BPBA 2FR8C 3OZCA 4WKNA 5CT9A 1YU6A 5C7OO 5JD5A 5BW4A 2LVBA 3HADA 4LRTB 2ECQA 4QNMA 3W2GA 4BMDA 3CVVA 2YMLA 3ID6C 2BZ0A 1YGPA 1GU1A 1X87A 2C5SA 5FDFA 1DTEA 5F3DA 2W11A 1VMAA 2V6GA 3AIMA 3P9CA 4KSYA 2Y0DA 3O95A 2E4ZA 1BE8A 4TM7A 3URKA 4E5YA 1VYTA 5D86A 5JZVA 1OTXA 4EB0A 4CL2A 1O94D 1DC3A 1BFKA 5FWXA 3MRVA 4YONB 4D9IA 3DH0A 1JKMA 4JLNA 1IY8A 1U9YA 1UJCA 1G42A 3JQBA 3ZTTA 5HM8A 2WKPA 2BGKA 1V5IA 3I9FA 1VP9A 1BMFD 1GNRA 5CT6A 4U7GA 1ZXBA 2E55A 3UPTA 4JJEA 2GZDA 4OB6A 3ZZ1A 4RXTA 4MRSA 3F4LA 1QH1A 3RAJA 3SLGA 3HFRA 3EGIA 2YXLA 4XD2A 5TLSA 4R69A 3OEHA 1K4YA 2GFHA 2CDNA 4K6HA 2HSJA 2FPLA 2RFLA 2XW6A 2CWDA 2PFSA 4CNBA 2GR9A 1O0BA 4ZDWA 1L4NA 4QJ5A 4X8MA 4JI4B 2VUTA 3I92A 3WKDA 5F7ZA 4DWOA 1Z22A 5F1YA 4LV8B 1Z4IA 4NF2A 1I6WA 3WHIA 4A26A 4D8YA 4GAEA 4LCJA 3UMYA 1KI1A 2QT9A 3E9QA 3PSAA 1I7NA 2EJTA 4P22A 2ZBUA 4CI0B 4AKGA 5KQSA 3HKEA 3CCFA 1LPMA 4UHHA 2BHLA 1OLSA 2B4QA 5FI5A 1TJNA 3IPCA 4C2BA 3G88A 1UM9B 1IZYA 1PX2A 5FBQB 4HDKA 3EIUA 5HGXA 2PUEA 1PQUA 4XR9A 4DVGA 2CLOB 2HHLA 4I50A 5SICE 4GPD1 1PJLA 5AJWA 5DN9A 3I9OA 1T10A 1F7VA 4FDMA 2PMDA 3C6QA 2OT3B 5GONF 3OZSA 4NONA 3H84A 4LDPA 2NU7B 1E3SA 5JMWA 2GTPA 3QTBA 4JI2B 2CDBA 3W9YA 2WOOA 3TX2A 1AT1A 3GEDA 3B12A 4OUKX 3VVCA 3M6IA 3AU9A 3VOAA 3AVTA 2HF7A 4Z2YA 3W8EA 4WLFA 1JHXA 4LXTA 1YDMA 3FUCA 4TPKA 2G9RA 1MIOA 3PYLA 3S4YA 5H3LA 5KNCH 3PNSA 2GCIA 3BHMA 3FFXA 5IBCA 2B4KA 2BE7A 5BVHA 2CNDA 4IIBA 3USES 3WL6A 1T24A 5AKYA 3FWYA 1C1XA 1N0VC 2HBQA 2LBPA 2IXTA 5REQA 2R2GA 5LBTA 5BSTA 1PJBA 2ZRLA 1ZNYA 4PCLA 2Z5FA 4B6QA 4B74A 5HJ7A 4QOFA 1WQ4A 3E23A 1RFGE 2EZ8A 2CY0A 1YE8A 1QTIA 3F6PA 1GQYA 2O3JA 3HB4X 1DRKA 5JH7B 4XCVA 2EFHB 3MAAC 3SE7A 3T1QA 4DRXB 1ULAA 1M0WA 4LKOA 3H17A 3GUVA 4OOEA 1FP2A 2R4TA 3VBCA 2UVQA 1Z6GA 3GD5A 4D5GA 1WDKA 4KN5A 1Y42X 4Y0NA 2HZBA 4MP6A 4PZDA 5EP1A 1KXJA 2JVJA 3PQCA 1FU7A 3RRXA 3HNRA 2BTQB 4GMXA 4Y2RA 3WLRA 4DAEA 3TXXA 4DXHA 4DJAA 4FILA 1MR3F 1QP7A 1I4OA 4YLEA 1NBIA 4JEHA 1UDWA 3D8TA 2ZE7A 2FQQA 4RMIA 3UH1A 4WIAA 3TM4A 1TD9A 2C84A 3ENZA 2WPNA 1V8BA 1YBAA 5FV4A 1Z0ZA 3ZDAA 3IE0A 4NMLA 3TSWA 1E2NA 3KDSE 4LKRA 5IKXA 1YMQA 1N2HA 4FT2A 4Q9KA 1BW9B 4Y2TA 3ROZA 3VU8A 2O57A 3BVPA 4DLSA 4ZU3A 3VBEA 5CX1A 1WB6A 4QPCA 4ZMSA 5HUQA 3CX3A 3VKWA 2HDOA 4QVGA 1BJTA 4MO2A 4UZSA 4IJMA 4BVLA 1VPVA 2IP1A 1CEXA 4TTSA 5JO9A 3VTFA 2MSLA 4F45A 3WMGA 3L1JA 1DOZA 4N0MA 2OFPA 3I04A 3NTUA 2J7PD 4Y2YA 3VOSA 1Q7RA 3ZWMA 5JT1A 4B81A 2HI0A 5LUBA 3SJUA 1YR6A 1DX4A 1U3DA 1UKBA 1Z0FA 2Y1KA 4L07A 1TC2A 4JUCA 1H6CA 1ZLXA 4E7PA 3OO0A 4B79A 1E5TA 1NYTA 4Z4FA 2QG4A 1S2DA 2AJTA 1I0ZA 1UFVA 3K0EA 3T7TA 3LUBA 4ZFNA 1DRUA 4HGPA 3DBLB 2ZBQA 4AY5A 4QU0A 1K7FB 2O2HA 3F5SA 3EIEA 2PX2A