3OG9A

Structure of yahd with malic acid
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
206
structure length
206
Chain Sequence
MTDYVFKAGRKDLAPLLLLHSTGGDEHQLVEIAEMIAPSHPILSIRGRINEQGVNRYFKLRGLGGFTKENFDLESLDEETDWLTDEVSLLAEKHDLDVHKMIAIGYSNGANVALNMFLRGKINFDKIIAFHGMQLEDFEQTVQLDDKHVFLSYAPNDMIVPQKNFGDLKGDLEDSGCQLEIYESSLGHQLTQEEVLAAKKWLTETK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Regulation and structure of YahD, a copper inducible alpha/beta hydrolase of Lactococcus lactis IL1403
pubmed doi rcsb
source organism Lactococcus lactis subsp. lactis
molecule tags Hydrolase
molecule keywords protein yahD a copper inducible hydrolase
total genus 78
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3og9A00
1E66A 1ZIXA 2PX6A 4QWWA 5ALIA 1CFJA 2ES4A 3EIOA 5DJ5A 1TKRA 2OXEA 1P0QA 1JT2A 4X93A 1CEXA 2HRQA 4H0CA 1XZLA 4LHEA 4DNPA 4OYYA 1QO7A 5FKJA 1EI9A 3STTA 4OD0A 2PU7A 5A62A 3OTQA 4Q3KA 5F4ZA 5JAUA 2EDAA 5EIEA 1CV2A 5A7FA 1AURA 2GBGA 5FRDA 5A2GA 3WWEA 1K5PA 4YPVA 2HA5A 1TK3A 5AKHA 2Y6VA 4P92A 4G4JA 4G9GA 1UK9A 3BDIA 5FV4A 2HFJA 3I2HA 1XZEA 2WHRA 3V9AA 1BN7A 1XLVA 2PU5A 3PICA 3WWPA 5ALLA 4W9RA 1AGYA 3UUFA 4H7IA 2GYVA 2WIFA 1KU6A 3EQ8A 1EXWA 2XB6A 2DQZA 4X85A 5ISMA 1QIIA 4F0JA 4HXEB 1JJBA 3WI7A 4ZWNA 5I9IA 4H7HA 3TEJA 5HFNA 3WZLA 4GI1A 5AK4A 5LKAA 2GBIA 3A2MA 5BOVA 2VJAA 3QMVA 2JGEA 3WYNA 3QZUA 3WKCA 2C58A 5JD4A 1XRQA 2AJDA 2VTVA 1IUNA 1FSSA 5E4TA 1J06A 1QLWA 2QUBA 2WIGA 5ALQA 1K63A 4EBBA 1DINA 1VZ3A 3O4IA 3NWOA 4N8DA 3WMRA 4H7DA 5A6VA 2CUTA 2WFLB 3A70A 4Y2UA 4CCYA 1QIJA 1XQWA 2Z8XA 3G9XA 1EH5A 5ESRA 4Q3OA 1AUOA 3GELA 3FVRA 4PQEA 4Z49A 1O6FA 1DTEA 4AMZA 2DCMA 3EQ7A 4EY6A 3FNBA 2JGLA 2QJRA 1VE7A 2XMGA 4G9EA 4F5ZA 4X7BA 5ALRA 4X00A 3C8HA 5CT6A 2XMZA 4H7FA 3WL5A 1CUEA 2Z3WA 5ALJA 4FDMA 5K3EA 3PFCA 1BU8A 4Q34A 2O2GA 3QH4A 3ZLUA 5CURA 2JIDA 1H2ZA 3BIXA 4BAGA 1VLQA 1BCRA 4B82A 1GKLA 1MTZA 2RHTA 3WA7A 5C81A 5DYYA 1A8QA 5JAPA 4U2DA 1PJAA 4DNFA 1W52X 2VT7A 4W1SA 1XFDA 1YCDA 4Q1VA 4BVJA 1CUJA 4LXIA 4OU4A 4AO7A 4BTLA 2V97A 3ESAA 2C5FA 4AN0A 1WM1A 4UBLA 1CUUA 1LPAB 2C7BA 5ALHA 4C4ZA 1R1DA 2OQIA 1MN6A 3VJLA 5BV7A 4L9AA 3D0KA 2I78A 3TGLA 2I3ZA 5AM4A 2AXEA 1XZHA 4Y2RA 2WG2A 4B9AA 2JGKA 4OUKX 5CRIA 2HA4A 4I3FA 5EFZA 4C4XA 4UFPA 1YA4A 1HPLA 1VJ5A 1HDEA 4MYSA 1E8DA 4X6XA 2HA7A 2XUDA 3IUNA 2QJWA 1UXOA 1MNQA 1E89A 4C4YA 1BS9A 2ZJ6A 2H7YA 2RI6A 1SCKA 1WOMA 1LNSA 4KAFA 4GBGA 1R3DA 2WG0A 4FKBA 1IZ7A 4QNNA 4UHHA 5HF5A 4PW0A 5JZ9A 1O6GA 3PDCA 3WWOA 2Y2UA 2QXUA 1I6WA 1VZ2A 3Q0TA 4RGYA 2J3DA 3HJUA 1EDDA 1L7RA 3LIIA 5DNVA 4AQDA 4ZGBA 1EK2A 2WHPA 1Q84A 3JW8A 4FBLA 4X6UA 1ZI6A 4KEAA 3VJMA 4X6YA 1Y7HA 5CBKA 1YB6A 1CUBA 3CN9A 3BDVA 3C45A 2ECFA 1VKHA 1E5TA 3H0CA 3WJ1A 3M3DA 3HSSA 1XZKA 4BZWA 3H1BA 2D0DA 5AOCA 4G1FA 2WJ3A 3VVMA 2VJDA 1LLFA 2FJ0A 3BE8A 4DTCA 1EHYA 2BGNA 1QE3A 4GDMA 1N1MA 4QDXA 1BROA 5ALYA 1B41A 2PUHA 4B9EA 2WIKA 3G9UA 4WY8A 4H35A 1Y37A 2WIDA 1CPYA 2WILA 4TPKA 3STVA 4CIBA 4BB0A 1K6EA 4MWSA 1C7IA 2ZYIA 5JAOA 2O7VA 3VJKA 3EQ9A 1JMYA 1E8NA 3C70A 1QONA 2BCEA 1GT6A 4EUSA 1CUAA 5HCUA 4J03A 1MX5A 2ZJ7A 5CT8A 4L0CA 5LLSA 4UUQA 3LIPA 3IVMA 5AH0A 3D2BA 2YXPX 5ALKA 5AI0A 2RAUA 5AIAA 5AKEA 1LBTA 2RGUA 2XUIA 5AI9A 1EINA 1MO2A 2CJPA 1FFDA 2XLCA 4C89A 3C6BA 5LYYA 1CUHA 1ORWA 2WJ4A 3JYHA 2WU4A 4DYHA 1ZJ4A 3H1AA 3FCYA 4N5IX 3ANTA 3DL7A 5D3ZA 4PO3X 1CVLA 2WFMA 4JH0A 5KBYA 2XQJA 1UT6A 1VXOA 4QE3A 3DYIA 3S2ZA 5ALSA 5AOAA 5JALA 4W1RA 2DHCA 1L7AA 4BE9A 2I03A 2D5LA 2VSQA 5AKJA 1CUSA 3ZI7A 1IUPA 2CBGA 1GZ7A 4OPMA 1XRNA 3TJMA 4IO0A 3WKBA 4V2IA 3AINA 1EVEA 2JGFA 5FPPA 1XLUA 4J0JA 4J3JA 5JIBA 5FDFA 3IB3A 3OOSA 5A7HA 1FFAA 5I8PA 2H7XA 4U2GA 3E4DA 5ALPA 4E14A 1PFQA 4DM7A 2XQFA 1MT3A 2PPLA 1TCAA 5AM2A 2HRRA 5LP1A 3FYTA 1DWOA 2RIPA 1VOTA 5SYMA 5FLKA 3AIOA 4Y2VA 1EDBA 2PSEA 4A16A 1BEEA 4B6GA 4G8DA 1XROA 2J3QA 4CI9A 1UOQA 4BRSA 1EVQA 4UFOA 4HXFB 4X92A 1U65A 4EY4A 1QFSA 1MPXA 2NW6A 2X76A 3I2GA 3E1GA 2VQ6A 4GLBA 3R3ZA 3QPCA 5EHNA 1MU0A 1XQXA 1G66A 3IUJA 4LIPD 3WQHA 5LIPA 5AK3A 3O4GA 5CH5A 2V98A 2WIJA 1UZAA 4P08A 4G4IA 2WTNA 3W9UA 3Q8WA 5ALWA 5AM0A 3K9BA 1QTRA 3WLAA 3ESCA 1HQDA 1VXRA 2VJBA 3BIWA 3D2AA 3DCNA 3DKKA 2ZYSA 3VXKA 4UBKA 5K3DA 3G7NA 5FPQA 3DQZA 5HF8A 3RARA 3C5VA 2AJCA 2WFLA 5ALEA 3QM1A 2VEOA 4P93A 1P0IA 2PSHA 3KD2A 4C01A 1DT5A 2GYWA 4X94A 1WB5A 5ALFA 5JD6A 1CIJA 5ALZA 2FUKA 4E46A 1YSCA 3S8YA 3G0BA 1QIHA 1W76A 1G42A 4QZVA 2O7RA 4J0GA 4X95A 3E0XA 1CUDA 2PM8A 5ALNA 4BATA 3G9TA 4RPCA 4WDRA 3QITA 3WWCA 2RHWA 3ESBA 4AZ3A 3H2HA 4OCZA 2DFPA 1X70A 4QDOA 1H2WA 1G5FA 1JU3A 2XQKA 3C43A 3HEAA 5AKKA 5EHZA 5AOBA 2XMSA 3A6ZA 1BRTA 3FBWA 5J3JA 2OGZA 3IURA 3R0VA 5JYCA 3T4UA 4EY5A 2G5PA 3SWWA 3MGAA 1BCSA 4MYDA 3MVEA 4HTAA 3DL4A 4UBIA 5CW2A 4PF1A 4XIIA 2V9ZA 4EY7A 4Y2TA 4IH9A 2B4KA 4LXGA 1NU8A 2OCKA 1ORVA 2PSDA 2WHPB 3DJYA 1XQVA 3IBTA 5IVDA 3NGMA 4UHEA 2HADA 4M0FA 1U2EA 3F98A 3B12A 5SYNA 4UBMA 3PI6A 4J0IA 3W2TA 1BN6A 3DNMA 2QKYA 4LYDA 5JZSA 1X2BA 2WM2A 5K3FB 3C6YA 3BF8A 1QJ4A 4LYEA 3W9BA 1ZOIA 4FLMA 2R11A 4HZGA 3F8SA 1XKTA 3HABA 3DOHA 4JNCA 5A7GA 3KOOA 1ZIYA 2CEKA 5LKRA 4J0CA 2HIHA 2H7CA 1QIDA 3I6MA 1AKNA 3QYJA 1ACLA 3O9VA 2QT9A 4WY5A 1GKKA 2XQGA 4B0OA 3ZPXA 5ALMA 5CMLA 4HVTA 4FNMA 4FWBA 1CUIA 3GBSA 3RKSA 2HFKA 3C6ZA 4H77A 3WJ2A 3IDAA 1G4HA 5FOQA 1A88A 1N5RA 2GYUA 4DSAA 2JBWA 3FLEA 2B61A 2PVSA 1PV1A 3AFIA 3STYA 5D7BA 1W1IA 1R88A 3F9CA 4GXNA 1BE0A 1GPLA 2OG1A 5DNWA 3V1KA 1EA5A 1UOOA 1HLGA 3H2JA 2GZSA 4KAAA 2ZSHA 4UBJA 4KJXA 1LPBB 3I28A 1MX9A 1ZD5A 2XMBA 1LBSA 3LP5A 2EEPA 2WTMA 2GZRA 1GQSA 2QTBA 4U2FA 3FYUA 3W04A 2P8SA 1S8OA 4FBMA 4Y2YA 2PKYX 3UUEA 5C8VA 6YASA 3H19A 1YB7A 1CQWA 1WB4A 5ALOA 3G0CA 4IH4A 4FOLA 4I4CA 1UK6A 5FXMA 4ZREA 5A71A 1LGYA 3F96A 2W6CX 4RNCA 2C0QA 4EZIA 3V48A 4Y2SA 2OQVA 1XZDA 2K2QB 3CXUA 3QPAA 1XRRA 1EK1A 1TCCA 2PUJA 3O0DA 3WYDA 4QDTA 1WB6A 4A5SA 2WG1A 4ZRDA 4XJVA 1TRHA 2X5XA 5DTIA 4Y2PA 3RM3A 2LIPA 2PBLA 1P0MA 5JASA 4OB8A 1VA5A 2XUAA 4UHDA 4BYMA 3VKFA 3WK8A 1H23A 1JJFA 5HF9A 1QIFA 3L1HA 5I7UA 3I6ZA 4L3WA 3MUOA 4B80A 5CXUA 4OB6A 2ZJFA 1YS1X 4HXGA 5DTJA 1GPNA 2OCIA 2O2HA 3PUHA 3ILSA 2WHQA 4JEIA 2HHAA 4AO8A 2QMQA 3OM8A 4YK7A 3HI4A 2HL6A 2XLBA 5CXXA 2XMRA 1ISPA 2OAEA 5LZ2A 3W06A 3V1MA 4EB0A 4CG1A 4Y9SA 5K3FA 3KWFA 3A2NA 5HZGA 5AKLA 4PSDA 4UBOA 1N5MA 1XZFA 3OURA 4BRZA 4AO6A 1QFMA 2JGMA 4H7KA 4J0DA 3IIIA 3EF3A 2ONCA 4WFJA 2H1IA 3R3WA 2C0PA 3RK4A 4AXBA 3GROA 1BEZA 4KE9A 3WIOA 4D9JA 1A8UA 3BF7A 4DNOA 1UFOA 3WL6A 4KYVA 5EIHA 5IKXA 1XRLA 2HDWA 3KWJA 1J07A 4DLNA 2OGSA 5AI4A 2RONA 3H17A 2ZSIA 3U0VA 1UK8A 5FP0A 4QLAA 4WFIA 5ALVA 1L7QA 3CN7A 4C6HA 3B5EA 4CCWA 5BWCA 2B9VA 2HA3A 1CUWA 2WUDA 3OG9A 1LPSA 1ZJ5A 1UOPA 4MWTA 3IUQA 3M82A 5JATA 3GZJA 1XZAA 2HA0A 2XUPA 1F0PA 2R8BA 5C7YA 3CCCA 4EA6A 4C87A 4YX9A 4F60A 5IVHA 5E2IA 4U2CA 4BCCA 2WFZA 1YS2X 3L1IA 3L1JA 5ALUA 1GGVA 2OAGA 3AILA 2OCLA 3G8YA 5KWJA 4IH1A 4HRYA 2XUKA 2WSLA 4Q05A 4A23A 3N2ZB 3WIBA 4NZZA 5KWIA 4GEGA 1IVYA 4WFKA 4YASA 3I2IA 4HS9A 2BUCA 1E8MA 5K3CA 4GW3A 5HQ3B 1AZWA 2WKWA 3PE6A 1TAHA 3FWHA 2AJ8A 2Y1KA 2VT6A 3FAKA 5AKXA 3PUIA 3ESDA 1MAAA 5T4FA 4F21A 2Q0XA 4XX1A 3D3NA 3FVTA 3WL7A 2QOEA 3DLTA 4BCDA 4L72A 4KAJA 1QO9A 1USWA 2CZQA 2QRUA 4B84A 3STWA 1T4MA 1JJIA 4BDSA 4M0EA 5LZ4A 3F97A 2FJPA 2GBFA 2BAGA 3M83A 2PSFA 2DQYA 3QVMA 5AK6A 5CT5A 2XE4A 2HU7A 1XQYA 1KU0A 3KSRA 1ZD2P 2EDCA 2IITA 5AO9A 2XUQA 1ZGCA 1OILA 1VA4A 2AJLI 1QTIA 2XUJA 3GA7A 4ZV9A 4X91A 4X3CA 1AQLA 3OC0A 1XZJA 4QLOA 4B85A 1CQZA 4MQLA 3STXA 3I2FA 4FHZA 5EGNA 3I1YA 5ALDA 1W4LA 5HFAA 4GECA 3WK4A 1ZI9A 5AKIA 7YASA 4ARBA 2E3JA 4B0PA 5IVIA 4ARAA 3FLAA 1OXMA 2DHEA 3IUMA 3DD5A 1QGED 1TIBA 4P9NA 3GUUA 3VVLA 3PF9A 3HYSA 1A7UA 4DMFA 4DGQA 2ZVDA 1RYYA 1K4YA 1LPOA 1P0PA 4XVCA 1FFCA 2WUFA 3WWDA 3DS8A 4DIUA 2H9YA 4FMPA 4KE6A 1WPXA 4EY8A 2QUAA 4U2EA 1YAJA 2WQZA 5EIAA 5CT9A 4H7EA 4DNQA 1ACJA 2QR5A 4BDTA 5YASA 3FSGA 1SCQA 1QZ3A 3BWXA 2ACEA 4PSCA 4ZXFA 4IQ4A 4J7AA 1XKLA 5AM1A 1IZ8A 5AKGA 5HK9A 1N8SA 3X3HA 4BBZA 2O2IA 4Y2XA 4AMYA 2OGTA 1YA8A 2I3DA 2JEYA 1DT3A 4K6GA 3I2JA 5AM3A 1ZD3A 4N8SA 1LZLA 5AI8A 2ROQA 1ODSA 3KDAA 1CUGA 1EB8A 4H18A 4JYMA 2Y6UA 3H2KA 4INZA 1F0NA 3B3QA 1W75A 1DU4A 4BP8A 3D4LA 2HA2A 2QXTA 3DYVA 2ORYA 4PSUA 5DYWA 3A2LA 1JFRA 1CUFA 1F6WA 5HF6A 1LPMA 2XUGA 1FFEA 3DOIA 1Z68A 4W1PA 1YAHA 4HRXA 4BAZA 4DMCA 4S0XA 4KRXA 4I19A 4OSEA 2ACKA 1UKAA 2XMCA 2Y2VA 4K2AA 4BP9A 4WJLA 2HA6A 1CRLA 1UWCA 3HACA 2WLSA 2JEZA 3TRDA 5ALGA 3STUA 4OU5A 1SCIA 2G63A 5K3BA 4OB7A 1LZKA 2Z3ZA 4BZZA 2VJCA 2BGRA 4OYLA 5DNUA 1KEZA 3LS2A 3U1TA 1Y7IA 2XUFA 5KREA 2VA9A 4X71A 2BUBA 3RLIA 3LCRA 2AJBA 3WL8A 3ZV7A 2V96A 1EB9A 3DEAA 4O08A 4QDUA 1C4XA 2WUEA 3K6KA 1CUVA 1XZBA 4FFWA 4C88A 3AUKA 1ODCA 4AN1A 3IULA 5JAHA 1XZIA 1H2XA 3D59A 1DX6A 1ZICA 4MEBA 1EDEA 1IUOA 5E4YA 4RE5A 3O95A 4XWGA 2G4LA 1JU4A 2W22A 3HXKA 1CUCA 1XLWA 3W05A 4B83A 2QM0A 1RP1A 3NUZA 4QWMA 1C7JA 1JMKC 4KR0A 3R3XA 4NS4A 4FNGA 3H18A 1XZGA 2VF2A 5T4HA 3V1LA 5JANA 4G4GA 2XMDA 1R9NA 4UFNA 4N5HX 2GBCA 4UHFA 4DMKA 2X8BA 2OCGA 5HKAA 5D3KA 3BXPA 5JD5A 4BVKA 1AMNA 4GWLA 5AP9A 5K5EA 1LPNA 1QIMA 4B7ZA 5HQ3A 3QBJA 5AI6A 1ETHA 1HL7A 4WCVA 2PL5A 2QZPA 5JZBA 5ALTA 1UKBA 4Y2QA 4UHCA 2XUOA 3AIKA 2VATA 1XZCA 1JKMA 3HZOA 3OPMA 1CR6A 1XRMA 3R3VA 5IVKA 2BKLA 5T4EA 2YH2A 1CUZA 3QMMA 3F67A 5LZ8A 3WK9A 1DQYA 1WPRA 3LLCA 4K6HA 4DSZA 3D5EA 4HAIA 1CLEA 1M33A 4J0HA 4QEKA 5DYTA 3MUNA 1MAHA 4ETWA 2QS9A 2XMQA 3DKRA 3FCXA 4TGLA 3VDXA 3ANSA 1Q83A 4MQMA 5EHQA 5AKZA 1GPKA 5CH3A 1QIKA 5AM5A 3BJRA 4FTWA 3GFFA 3QPDA 1DWQA 4G5XA 3C5WP 1IMJA 4U2BA 2Z8ZA 3G02A 3CCBA 4LKOA 2BJHA 1DX4A 4CG3A 1AC5A 3AZPA 1XZMA 4IHAA 5ALXA 5C8XA 5CT4A 3BL8A 4W1QA 3FYUC 3O4HA 4WDQA 4E15A 4LXHA 1H22A 3H2GA 1Q0RA 4ROTA 5AHXA 1CUXA 2YASA 1XRPA 3PFBA 4RE6A 3FYUB 3KXPA 2G5TA 2HU8A 3G0DA 1Q0ZA 3FLBA 2DR0A 3WK6A 4FFVA 1R9MA 1YASA 1E3QA 2YYSA 3M81A 5CH8A 3WZMA 1HKHA 5T4BA 4UPDA 1NU6A 3WKAA 1DQZA 3SK0A 2BFNA 4UBNA 3YASA 2VAXA 3ZLVA 5LZ9A 1H2YA 3EBLA 3AZQA 3NOXA 4ZI5A 4E11A 1SFRA 2DSNA 1WHTA 1D07A 4Q3LA 3I1IA 3D2CA 4NVRA 3O9MA 3QMWA 4QDZA 3DDUA 1X2EA 3AIMA 3T52A 5HK8A 2BUAA 3C8DA 3G0IA 4QA9A 1R50A 1QIGA 1GQRA 3FSGD 5IH7A 3WA6A 2J4FA 4BTVA 2IX9A 1HBJA 3FOBA 4UHBA 5AJHA 4G8BA 3JWEA 2WJ6A 1SC9A 3AZOA 2OLEA 2XQIA 4ITVA 2DHDA 1MX1A 1RWQA 2JF0A 3AJAA 5D6OA 4FLFA 4G8CA 3N0TA 2HU5A 3O4JA 5HKBA 3C87A 5AIBA 2Z5GA 4KRYA 1ZI8A 2CMFA 2JGIA 3SX4A 1UKCA 5E4JA 3R3UA 1K8QA 2UZ0A 1CUYA 2FX5A 3BJMA 2XI4A 3G9ZA 1ZGBA 4K5QA 2JGJA 1W6RA 3ICWA 3WK5A 1THGA 1T2NA 4X90A 4CCYB 3ICVA 1GXSA 5LZ5A 4PNZA 4BAUA 4DMHA 1R4ZA 1MJ5A 1EX9A 5JADA 3HC7A 4Y7DA 4MXDA 3H2IA 1THTA 5C8ZA 2HM7A 4FLEA 4K6KA 4JUIA 3WKDA 3R40A 5AICA 5AK5A 5CTAA 2CKMA 1NX9A 4KE7A 4BVLA 3WKEA 3V1NA 3K2IA 3IA2A 3HRHA 4BE4A 4JYPA 4BC0A 2ZYHA 1ODTC 2J4CA 3I2KA 5BWBA 1WCYA 5DLPA 5EHXA 5JARA 3P2MA 5H3HA 5EI5A 4AB1A 1B6GA 2C5GA 2PSJA 2OPHA 5AI5A 3PF8A 1U8EA 4KE8A 1QOZA 1FJ2A 1A8SA 3ZLTA 3G0GA 4GHWA 4J0KA 3R41A 1YR2A 1FFBA 1AX9A 3D7RA 4N8EA 2C4HA 5DWDA 1JI3A 4AZ0A 2WUGA 4PV7A 4CG2A 1U4NA 5LZ7A 5AKYA 4Q82A 4CFSA 4CIAA 4B81A 3SC2A 1MNAA 2B20A 1J2EA 1QIEA 4M0MA 1TQHA 2XDWA 3E3AA 2VAVA 5K3AA 1LPPA 3R3YA 1ZD4A 3UMJA 4AX4A 3HLKA 5FUMA 1J1IA 1DWPA 2IIVA 3C6XA 2WU3A 3H04A 1VE6A 3ED1A 1SOMA 1UK7A 4W63A 4KACA 4X97A 4BC1A 4H7JA 4MEAA 2ZYRA 3VISA 2XUHA 4ZV7A 4TVKA 3I6YA 3ZWQA 1F8UA 1WHSA 4EHBA 2XT0A 4MJ3A 4Y2JA 4NMWA 2CB9A 3WK7A 4BCBA 1OCEA 2QVBA 1TCBA
chains in the Genus database with same CATH superfamily
4R5HA 1XVVA 4B5KA 1YRAA 2JLWA 1SCUA 5CFLA 2B2NA 1RAEA 4UOEA 2AI2A 2JCXA 4X20A 2ZBDA 4BJHB 2X1HA 7MDHA 1FBNA 5JJ5A 4D5GA 3U61B 2AUTA 3AHDA 1MQ8B 4PFJA 4RVNA 3UWKA 3AF5A 1Z35A 1Z0FA 1FS5A 1JT2A 3L0BA 3I12A 4ZT2A 1E69A 3OE7A 4GQAA 1CEXA 2ZR7A 1ZD8A 4J2TA 3B20A 4N54A 3VAAA 4IZIA 4H0CA 4Z0PA 3VR4D 1N2JA 4C0JA 5BSUA 3LCUA 1Z56C 3RB8A 3OQVA 4HFNA 1E3IA 1PUXA 3DBRB 2GQ0A 4GMKA 4MQFB 1L8QA 4KH0A 4BN0A 2YR0A 2ZDQA 3AERB 3WHPA 4B43A 1H0KA 5KC9A 1B74A 1XPJA 3BXFA 3QFRA 1BMFD 3STTA 2SKEA 3W5UA 3WLHA 2D2IA 2Q6VA 1JA0A 4J0QA 4OD0A 3ZR4B 4TLLB 1KYTA 4YUZA 3NKLA 5BSWA 2P35A 3K4PA 4Q3KA 3K8YA 4LCEA 5I51A 2WV9A 1LQUA 1RHQA 4XFJA 4C0KA 3NAZA 2GESA 3K09C 4KKVA 4NPAA 2DUUA 4KL8S 4UMVA 4LGMA 2WWHA 4RVHA 5BRAA 2EDAA 4N18A 5JSHA 5F21A 5K0ZA 1E9CA 4FDUA 4IEEA 1Y0BA 2FDRA 2VSYA 4MTCA 1ULAA 4KO3S 4WLFA 1A4IA 1DIHA 1QV7A 2PWPA 3FUWA 1K5PA 3FF1A 5DB4A 2DUMA 4PY2A 3RYHB 3SXUA 4YPVA 1DRVA 4NFLA 1Z38A 4QUJA 2ZCJA 2I7CA 2C7PA 2H08A 4IRXA 4R0VA 4V0MA 2XCLA 1X7YB 3HS3A 1Q7RA 2VN8A 4D0RA 1C4OA 4HLCA 4EHHA 1G41A 2NSDA 5EWLB 2J5RA 5A3VA 2M6LA 1RQRA 3F4KA 4BLQA 1GVHA 3OLQA 2G25A 3FWYA 3NMUF 4ZT4A 3I2HA 1AMOA 2GRAA 5C3UA 3V9AA 2XVYA 4LJ9A 1MV5A 2IYQA 2FEPA 4DLXA 5CW1A 2PGOA 4R71A 2GD2A 4M1MA 1RM0A 3WZ2A 5ALLA 4H6VA 2BC9A 4OQMA 2XF8A 4PS0A 9LDTA 5FWYA 1XDWA 4INJA 2XNSA 2FGKA 4DADA 1KVRA 2I2BA 1UBEA 4BNTA 5TGTA 4B6RA 2BFDB 3RC9A 5FWXA 2GYVA 4BGUA 3FPBA 3DV2A 2WIFA 5WRFA 4YMGA 4BU1A 121PA 2Q07A 2C3OA 4HATA 3W4JA 2QK4A 3PDJA 1TZMA 2ZRQA 2ZYVX 3ILHA 4IJUA 5DN6A 3SC6A 2WJVA 3TW8A 2DQZA 4RH3A 4LVUA 4FGUA 3CO0S 1Y3IA 1RCTE 3ZE2B 3MJCA 5EUQB 4IILA 3V8EA 3M1IA 1J0AA 4F0JA 2QMUA 2W2LA 1IZYA 3G2MA 3OOYA 2HQBA 4HXEB 4ZGWA 4C1NA 5E6RB 4CV3A 4M46A 1NVVQ 5I9IA 3NIFB 4H4DA 1AGRA 2EERA 3II6X 4CM8B 3WZLA 2X19A 5JS8A 2IBTA 3KSBC 1IVSA 4GI1A 2BGGA 3NWEA 3HKDA 1CRQA 3UJPA 4CQMA 3PENA 2NZWA 2OP0A 1RWMA 2F9MA 3L9WA 4P83A 4BMYA 2G7ZA 2A9KA 4EJSB 3ITKA 4E6PA 1NR1A 3WYNA 1QQTA 4MW9A 1QMGA 1OQAA 2VTEA 1DADA 1JDZA 3UK1A 2JGDB 1RPAA 1L7BA 1Z25A 3DOOA 4BQSA 1GZSA 4WUVA 3TW6A 5LOVA 4F04A 1XRQA 2OCDA 4II7A 2C82A 1KK3A 1JG2A 1RI2A 3C3XA 4LQLA 2J7PA 3G5TA 3QKTA 4ZYXA 3W5IA 1MQ9A 1KS9A 4ND5A 4EGFA 4BGDA 2E1RA 3E1SA 4BQFA 5KYYB 2RHCA 2OD2A 1CDZA 1OC4A 4OL0A 3PUJA 5FADA 4AKEA 3W9SA 1J06A 1K2WA 1I5OA 4MMZB 2GHQA 3NHKA 4QJ4A 4NENA 1S2OA 2NG1A 2NTVA 1R6BX 2O2CA 3RHFA 3T9DA 2Q3HA 4IIUA 2WIGA 3EIQA 4KXYA 2EFGA 3M6LA 3VYSB 3ZXXA 1FFYA 4E5MA 3NRCA 1T5LA 1VZ3A 2Q2QA 4K26A 1C2YA 3EHDA 3OVMA 4LF9B 4IJVA 5L3SB 2FAXA 2PA3A 1XCBA 2WKQA 2ZT5A 5CHEA 4AY4A 3T1OA 3WMRA 3KDSE 1E5LA 4NIMA 1J0EA 3LKZA 4GP6A 5DGCA 5BW5A 1XD2A 5JHHB 2BEUB 1V45E 3RJTA 1DG1G 2PIAA 1YQUA 5C9ZA 3A70A 2Q7DA 2YDYA 3ITDA 4IIEA 1QGAA 4MUGA 3TUZC 1QV9A 3TLBA 1ZM3A 1QIJA 2AC4A 3GGPA 4NQRA 4LX0A 1UBHS 1X15A 2Q6IA 4YMIA 1PJTA 4LJSA 2AQIA 4B3CA 1H05A 2GVDC 4NCXA 4BKOA 2WTUA 2O14A 1IXYA 1UDRA 3NJ4A 4AMZA 1ZCAA 4BUCA 4D43A 3L43A 3THYA 5FX2A 4D8TA 3BGIA 5MFZA 4TS3A 2FPXA 1XVIA 4MRMB 2UVPB 2O2YA 2I2FA 5HXAA 4G9EA 2HJ9A 4RHUA 1C3EA 1IBRA 1L4EA 2XYQA 3IELA 4H7FA 1C1YA 3AKZA 5DCWA 2FCRA 1P72A 4FS8A 3OHMA 5DYNA 3EDMA 3O5AA 2IP4A 2AFIB 2O3JA 4FDMA 4KZPA 2JAHA 4M87A 5ALJA 5M04A 5H8WA 2PZBA 1VJ0A 4X62B 4WN3A 1U0BB 1ZJZA 4Q34A 3L0SA 3AVWA 1CJVC 3QH4A 2FPPB 1FNDA 4W7HA 4Y0AA 1G17A 2AB0A 2JIDA 2I34A 3QE9Y 5BN5A 3ZE7A 3N8NA 3TE6A 3MB8A 3OPYA 1ZSNA 4GU5A 4KSBA 3OCYA 1FSPA 4B82A 3E9QA 3KJZA 2WD8A 4HDSA 3U4CA 4OAQA 4TYMA 5DYYA 4RHFA 3F6EX 2GEJA 5DM2A 2WJHA 2OMKA 3A4YA 4U2DA 3HJFA 1PJAA 5KSWB 2F2TA 2VUHB 3K4HA 1C7QA 3KU4A 2VT7A 2JHAA 4GR4A 1QKJA 3GEIA 2B8WA 1TJ3A 1NJGA 3ZIDA 4O4HB 1PR0A 1TFUA 4N0DA 4OU4A 2C2KA 1C81A 4Y3UA 5EWJB 4Z3DA 4AO7A 3R7DA 4E2YA 4QBKA 1XI2A 5EXDA 2CXQA 3IJPA 3LX8A 3DV0B 5DT9A 4B7CA 2C5FA 2PRIA 3F6YA 5L7WA 1RHRA 3WOVA 2BI8A 3SZMA 2JLRA 2NXCA 2OBNA 1TFRA 2WJIA 3JQ8A 4NR0A 4KYUA 1GFZA 3RFVA 4HAWA 3RG8A 2QSYA 2AF3C 1SELA 3KZCA 1GV0A 4IICA 4LXTA 3ROGA 1F9AA 1G3MA 2C7BA 5ALHA 1GG9A 3RGGA 1WRBA 3OICA 4RORA 5IDVA 1Y8QB 1KI9A 4BFVA 3UB4A 3GMDA 3VJLA 4DZTA 4ER3A 1WOYA 1HF3A 1VBFA 5BV7A 2DLCX 5F9FA 3D0KA 2BFWA 4BO3A 4NCHA 2O8EB 2XRMA 5GM2A 3SBDA 3BWCA 1KQNA 1ODIA 2WG2A 3JQGA 2HQ1A 2HHHB 3BBPA 3TDMA 4OUKX 2VF4X 3EPKA 5BV1A 3V00A 1U1EA 3D8RA 1AQNA 2EF1A 3ZLBA 2MR6A 1F2DA 4C4XA 5J43A 6GPBA 1F06A 3HGQA 2BDUA 1DJNA 1HPLA 1ISJA 1M1YB 1HDEA 1PDOA 1J33A 4E5NA 3SHWA 3DEJA 4GO1A 4N82A 4HEJA 3LT4A 1ZP6A 3TZEA 3IUNA 1JMVA 4PBSA 3I04A 1TGYA 2VYVA 4Q1EA 4H9GA 3DEYX 4CNBA 2EF0A 1V3UA 4DPKA 3BSFA 4EEKA 2VHUA 1KFCB 4GPAA 1QRDA 4AJHA 4F6CA 1E2NA 1OZGA 3EWAA 4C2AA 5HZHA 3QVSA 1ZC3A 3UAXA 1WOMA 1GP2A 1MRNA 4A0SA 5GZ1A 2BZ1A 4KAFA 3CPHA 1DDIA 1DRKA 5GJBA 1R3DA 3EFOB 2WG0A 4UZFA 1NOIA 3NTLA 3SC4A 1SIUA 4QRHA 3AB8A 5G53C 5AVUA 4BY9E 4QFDA 4CMAA 3KOWA 4UCQA 2PX5A 4LF7B 5A03A 1RR6A 1EX6A 4Q9IA 4B74A 1VZ2A 3T4PA 3CGGA 1DIBA 3WFZA 2QVYX 1PG2A 3DOJA 3LIIA 1H0SA 4HQKA 3BA1A 3LFUA 4AQDA 4ZGBA 4EI2A 5A3QA 4JVMA 1TC1A 3M7IA 1F3OA 1NVTA 4MO2A 4U7HA 1M1NB 4PCUA 1WSBA 2HV9A 5EZYF 4KYTA 4FBLA 3T38A 4F3NA 1YOVA 3N58A 1QH0A 3H6GA 1CY1A 5CBKA 3U4QA 4UUMA 1CUBA 1E2PA 1USGA 1BA3A 1DTWB 1YJXA 2NO6A 3F78A 4RKYA 4UMEA 1Q12A 1WUHS 2RB4A 3BDVA 4HK4A 4QOHA 1V37A 4BL5A 2H1FA 5A5GA 4BWYA 1TQDA 3T5DA 3JQEA 1YC2A 3LUKA 4J8PA 3L4BC 3JSXA 3EFEA 3AVOA 4BBPA 1US8A 2ZAMA 4IDGA 3SIRA 5IUNC 4KFCA 4KR3A 3ER8A 3KVOA 2R9VA 1X8XA 3I52A 5EPUA 1NLFA 5LQCA 4MGZR 1WL8A 1BGWA 1RFLA 1WPQA 3WDSA 1HETA 5DHPA 1UMDA 4OXNA 3IP8A 2VUIB 5KYTA 2QM8A 4ZZ0A 4K28A 1XZKA 2JFGA 3ORRA 3PGVA 2FXIA 3C7CB 4HLQB 4DABA 4AI6A 2UZ1A 3TNDA 5F64A 4V2UA 3U19A 4JC4A 4GC5A 1YRHA 1FJXA 1PNOA 1W94A 3U7EB 4LE2A 3VYUB 1U7XA 1D6SA 1PE0A 5DGXA 4JJKA 1SK9A 4EDFA 2CFIA 5G40A 2PRZA 3QFCA 3W3AA 3WBFA 1X86B 1CZOA 2LTAA 5AOCA 4P98A 1CE8B 4UU0A 4ZVVA 3VVMA 5AVWA 1KC1A 2VJDA 3BJEA 2FJ0A 3G5AA 3ZI0A 4MI1A 3BM5A 1APBA 1U2GC 5TQ2B 2BDTA 2GRJA 3EQ2A 2VDWB 2Q6OA 1J49A 4MUXA 1MR3F 1IRIA 1QR2A 4GMFA 5IEBA 3DZFA 4Z4IA 4Z4EA 2EBHX 4HNTA 1QE3A 5ALYA 3OQ6A 4YJGA 4BQIA 4F84A 1I33A 5IZCA 2PWAA 4YBRA 2NO5A 1TA9A 4FHEA 4JVSB 3HKEA 1IWBB 3LHFA 1Y3CE 2G1JA 2PUHA 3M5DA 4B9EA 1F8FA 2A1TS 3DWIA 4B48A 1GRCA 2IU4A 3TQCA 3WV4A 3ZTYA 1SR8A 1MXHA 1RHKA 3DNPA 1DUSA 1LW7A 2F9FA 1CU1A 1E5DA 1VLJA 2HXGA 3D7NA 4OKNA 4YJ2F 1EWYA 3L0IB 4Q6WA 3T41A 2UYCA 3DC2A 1U8ZA 4TPKA 2H63A 3LUAA 4WSOA 2PANA 1ZDMA 4NNOA 3O0TA 3WP1B 3WFIA 3ZLJA 1VL2A 2ZYIA 4AJ2A 2YVQA 4RTOA 2H4XA 2O7VA 5REQA 1OLOA 1BVRA 1UJCA 1MEEA 1W581 3A14A 3EQ9A 4GVPA 1GDDA 3JCZA 3AB3A 4BLVA 4P7BA 1E8NA 3F1LA 1MABB 3E27A 2HOQA 3JWHA 4KP7A 4O8CA 1CUAA 3CQ9A 4IOMA 1MX5A 3Q5EA 1QAOA 1A9ZA 4FYXA 4JOQA 4J1TC 3ZWCA 4EQZA 4RULA 4WZAB 2O19A 2FWPA 5JAMA 3ZZTA 4ND8B 1ES9A 2OZVA 1GAXA 4WADA 2PGDA 3SXPA 1N2BA 2ZJ2A 4GF5A 3UBMA 3PWTA 1VG1A 3ZHTA 1VMAA 4YRFA 2RAUA 2NU8A 3M3HA 3KXDA 3ZW8A 4E1BA 1EA7A 1I4EB 2H2HA 2RGUA 3HU5A 1EINA 1SWVA 3KR2A 3KAKA 5ENDA 4FB4A 1QZUA 5C1DA 3IQHX 4C43A 5FJIA 2VPPA 2NP6A 5A5FA 1U63A 2LE0A 2JARA 3E9DA 4C89A 1ECPA 1J0XO 5FYDA 3OKFA 1JHQA 1ORWA 1RXEA 2H29A 2WJ4A 4X7PA 1IBSA 2ZUUA 1KETA 1ONBA 1R4MB 3HYTA 1FYXA 4I4NA 3B5JA 1WW3A 2FRVA 3VR6D 5KNCD 5E9JA 4HJRA 4XQEA 1X1TA 1FVFA 3V8VA 1R0RE 3ZWMA 3TOSA 4D56A 1OGIA 3H1AA 4O33A 3DT9A 1PCXA 3ZWBA 4LOJA 1YBHA 3U56A 2IEAA 4N5IX 3FVVA 5BN4B 4DTIA 2IUYA 4V0OA 3DL7A 5DF1A 4OXXA 2JC3A 3O93A 3H5NA 1SD5A 1BYUA 1AF4A 4L5AA 4ZYYA 1CVLA 1BHSA 1HK7A 1A76A 3SYRA 2I91A 2F3RA 4ZOCA 4IKEA 2QVCA 2Q4EA 2AUNA 4UTNA 1LV7A 4PPNA 4ZXPA 1NAIA 2X6RA 2NMVA 4I8IA 4QE3A 4JI7B 2OR3A 1EVJA 1AM4D 1WQ1R 3NBMA 5J2TF 1ABFA 2C5SA 4DWWA 1KRXA 3EG9A 3G0HA 1M54A 1XTRA 1FFGA 2X9VA 4MCJA 3IBSA 1V8ZA 2H48A 1WZUA 3PE4A 1MOZA 4YONB 3DULA 1OAAA 721PA 2WWWA 3T9CA 2PMCA 1L5VA 2W6QA 1KDYA 1OPXA 3BKWA 4OI2A 2AZDA 3BQMB 2D7DA 3DXYA 2AV6A 1IUPA 1M73E 4JWKA 5KVQA 2MSDB 4YMHA 1D03A 4FFBB 4ITUA 1E96A 1KH1A 2K6GA 2ZSDA 4BIIA 2FW0A 5SZKB 2P2GA 3WGKA 4RTQA 3O8CA 1PJSA 3VKUA 5HBGA 1YDFA 3DZDA 1K5GA 2QV7A 4W5QA 2ZROA 1HE2A 3DTTA 3UUGA 3AF2A 3CZCA 4IDOA 2CSXA 4UW9A 4N5LA 3FOFC 2BISA 3ZE9A 4BGVA 3PUKA 5AVRA 1I51A 1M6VA 3ILVA 4GI2A 1JAXA 2P2CA 2BM0A 3EAQA 4HDOB 4D0SA 4G01B 5EZSA 5JV5A 2Q3MA 4EH1A 1Q7EA 1FFAA 3KEOA 4G4SP 1NVVR 1XQ1A 1R0KA 3PC8A 2NUTB 4JP2A 4YT4A 2HGZA 1IN8A 4MYRA 5KCZA 1Y8AA 4ARUA 2EYQA 1ZS9A 4V39A 5UKDA 3U16A 4E14A 1NRJB 2RGYA 3K0CA 4MKFA 2XQFA 1J2RA 1OV4A 2GD0A 2GM4A 1TCAA 2XE7A 3GF4A 6PFKA 3FYTA 4LG1A 5HPYB 1KOGA 4C06A 4FEGA 3OZUA 1VOTA 1WW2A 2VOEA 3T3PB 2MMCA 2DBVO 5DWVA 4EUEA 3TIVA 1H4VB 4G0OA 3AIOA 4Y2VA 5AVOA 5JJKA 3HVIA 1XELA 4S1OA 1SBZA 1MO4A 4LWOA 3BXGA 1PQUA 3H0KA 2RHLA 3BXEA 4WECA 1YF3A 2RJNA 4W8OA 1NVDA 1Y5LA 3I9JA 4G5OA 2Z1MA 4BRSA 2CHVA 2P4SA 3S28A 1ONPA 1W5EA 5ABPA 4NCJA 3ZJVA 5FLEX 3ZX5A 3HUFA 3JYNA 4HH1A 4P3KA 5I9MA 1P5HA 1YL7A 1NUUA 3D3QA 1Z62A 3K9LA 4UFOA 5DNAA 1YZ3A 1U65A 3U49A 4R7ZA 1QTNA 4EY4A 1O95C 3MWEA 1SOAA 1UP6A 1I01A 2EKQA 2QTCA 5FUWA 2IC5A 4CUZA 3KB8A 2R6ZA 4QEDA 4XUCA 4BNZA 1P1HA 1MPXA 4Q4AB 4ZD6A 3V4SA 2FQQA 2WWRA 3DW1X 2NW6A 4HVAA 4RVGA 3UVEA 1E1CB 2O2DA 2VXOA 1XXHB 4Y0VA 3S8EA 3R3ZA 1OWLA 2DTXA 4IMIB 1ODLA 1EK0A 3QUSA 4UREA 4MQFA 2ET6A 4NBNA 1EGHA 3OCWA 5IJXA 1A98A 1RM3A 1AHIA 4XE5A 4P7GA 5KWEA 1IWPB 2HJWA 3N2EA 4INAA 2OO3A 4U7TB 4N49A 1Q3KA 5KQMA 3LFHA 3FI9A 3O4GA 5CH5A 4CMJA 3RC1A 3MBIA 2WIJA 1OU0A 3U26A 4EDHA 3VTAA 4CGZA 2D62A 3L8HA 4RUKA 3DFUA 4W5NA 1Q0PA 1F4VA 3GLVA 4PYLA 3UBTA 1CZRA 1GNPA 1SBQA 1XWIA 3NO4A 4G4IA 5DPMA 3CUTA 3UMMA 3N2NA 3W9UA 5ALWA 4BKMA 3DD1A 4BQNA 1U8TA 2F17A 4DV0B 2V3WA 3R4VA 1N2CA 3D02A 1XTKA 2XUZA 3G2QA 1K68A 2Q5OA 1DZIA 2OLKA 1R4AA 1V11B 4HOYA 1IPHA 5SY6A 4RTRA 1O0CA 3ASZA 5AQ1A 1YJAA 3NVAA 1E2EA 3D2AA 4TX1A 3DCNA 2B99A 4IIJA 1RZRD 3DKKA 1DKQA 2ZYSA 4LJYA 1GPJA 2F8TA 3PQ2A 1CHNA 2QX7A 5BSRA 4WBNF 1RYNA 2I8CA 4C30A 3ANXA 1EQAA 3HUTA 4I5DA 2J59A 3BMXA 1KPGA 2QSJA 4DANA 3E9CA 2R6AA 4YIHA 1C50A 2C2ZA 3VPFA 4ZCIA 3C5VA 4EG6A 5ADUS 2NOAA 2IU0A 2AJCA 5ALEA 5AUOB 5JCOC 1ND5A 3OMXA 1B6TA 1CQXA 4A03A 5AW8A 4H3KB 4JL5A 3C1OA 2GYWA 5ED0A 4X94A 2DPYA 4GVXA 4QUKA 4BNDA 1WB5A 3R7WA 4XRGA 2CLFB 3PFGA 5LXTB 1QAQA 4IOKA 2XDAA 5TEVA 1I4WA 3GCXA 1WEKA 1W87A 3SOZA 2QWXA 1NFRA 1ZXXA 1YU9A 2X22A 3PXAA 2OZLA 2PRYA 2C4MA 2E1PA 5ALZA 4CR6A 2W0SA 3IMCA 1SVKA 1NJSA 2FUKA 1PS0A 2ILTA 2CSUA 4IHJB 1AUQA 4QFMA 5IG2A 3S8YA 1DB3A 1Q3TA 2PT9A 1INLA 4MROA 1M2GA 1QIHA 5KNDD 4TYWA 4FGLA 3DE2X 4TM8A 1NNUA 5FEUA 4I2NA 2JFFA 4OGLA 3AEUA 3DO8A 3E0XA 4FKMA 2ENWA 5GIOE 2WZBA 1CUDA 1MVLA 1CC1S 2DM6A 1NQUA 2NYVA 2YWHA 1QYVA 4IGFA 5JC8A 4YJ2A 3S2IA 4ERXA 4ZIRB 3H2YA 1L6IA 2X3YA 4G37A 4WDRA 3NTVA 3IP7A 3WWCA 4LY9A 4DIOA 2NSJA 3EE6A 3H2HA 3UH1A 1K5HA 2QD5A 4QYIB 2FP3A 2DFPA 3P9YA 3AF3A 4R1OA 2H17A 1F20A 3F7MA 1G5FA 3IEKA 1X7WB 2RG1A 5FUVA 5CA0A 3SICE 3ANMA 3ORQA 2P2SA 4DOMA 4V24A 1TO1E 3HEAA 4B6PA 4E5KA 3NALA 3KR0A 3DMPA 3KO8A 2JI6A 1OYOA 2AW5A 4TZ6A 1S0UA 1R9JA 4YLGA 1KZHA 3TM4A 3FMPB 1D7OA 1NN5A 3GNLA 3N6XA 4EW1A 4EHDA 5J3JA 1MW8X 1UMBB 3H5OA 1DBWA 5JYCA 1I2ZA 4BZPA 4EYOA 3BPSA 5TJHA 1CJKC 3RW9A 4C4PA 1GN8A 4KWEA 2ZEJA 4Y6PA 2H4HA 3K5PA 3MGAA 3VZSA 1BCSA 4DUYB 4MYDA 3MVEA 1G1AA 3TX6A 1GPAA 2UV8A 3DL4A 4B8YA 8LDHA 1OAOA 2YBEA 3EC7A 2BM8A 1M2JA 3S2UA 1NDQA 4URYR 1T0IA 5FR1A 2QQ5A 4I1YA 3OEEA 4V03A 2V9ZA 4JLVA 4TLAA 3BGSA 3PTLA 3QUBA 4UD6A 3TMKA 4EY7A 1U0LA 2F1KA 1U2DA 4IH9A 1GGEA 3PB3A 4KX5A 5KU7A 5MN6A 4DVGA 2MT9A 2ZBEA 4XX0B 1RWBA 1XDUA 3C4JA 4HFMA 3O8OB 3WB1A 4D8WA 1A96A 3NHAA 2W6NA 3DJYA 1LK0A 1XQVA 3B9RA 2DU8A 2I8LA 3JAMA 1YQXA 1XEXA 5EHIA 3TYXA 2IYSA 2WIBA 2C2BA 2H1LA 4ARSA 4M0FA 1MMFB 1U2EA 3LUCA 4F56A 1WQ3A 2QN9A 4FS3A 4IWNA 4KK4A 4ZEOA 3RVKA 1O5OA 2WKRA 1DQRA 4GBED 1QYIA 4ER6A 4DY4A 1V1RA 5AVYA 4NULA 4UE6A 4J0IA 4DBVO 2WA2A 3TZLA 4BMNA 3OSZA 1MA0A 2I4TA 3DNMA 3EC1A 1V4NA 5JZSA 3PR1A 4WK4B 3CS3A 2XNDA 3NJ8A 5FOSA 4FEYA 1AS0A 4RIIA 4AY3A 1MGPA 3AR7A 5DM0A 1B8NA 5B6IA 3NGLA 3C6YA 4ND4A 1PWZA 4OHXA 4E2ZA 3H16A 5JXHA 1XPOA 4CI0B 3WAGA 1JLHA 2GHTA 5JNVA 4WZBE 2J3LA 4RZUA 2FETA 3HKCB 4WCFB 3V97A 3W9BA 1JZQA 1ZOIA 3KQYA 4FLMA 4P1ZA 2JCVA 5I3ZA 4EJ0A 1FW6A 2J0QA 1XKTA 3DMGA 3ZZ0A 3SR0A 5B6PA 1LFAA 3PCRB 4CR7A 3GJ5A 1ZK1A 5CLIA 3DOHA 1TQ6A 4JNCA 3RC8A 3KOOA 1ZIYA 2CEKA 2OT3B 3FH0A 2A94A 4EJFA 2AUMA 3K6SB 4HNQA 5J47A 2A35A 1W29A 3DE3X 2IYOA 1X9GA 4J0CA 5FNZA 3ZCSA 1FLVA 4RH1A 1IYZA 5KMGA 3Q7PA 5KNDA 3ODPA 1ACLA 1N6OA 4BV9A 1AV6A 4K87A 1PN3A 1HE5A 2JCBA 3CH5A 1Z0DA 4JODA 4Q01A 1CT9A 1T8YA 3EQZA 1LX6A 2IBMA 2F48A 4NP6A 2WW8A 1YZTA 4B35A 3N0XA 2JKZA 1Z82A 1ZCBA 3AUUA 3N9IA 4C7BA 4J6FA 4TN5A 5T8KC 4BJ6A 4Q00A 1ACMA 1UAGA 5CMLA 4HVTA 5AXBA 4FNMA 3A1VA 4FWBA 3AY7A 4BNKA 2EBUA 2GF2A 2YICA 3B82A 5IAKA 3EXAA 5K6AC 3O8DA 1CUIA 2JS7A 1KFEB 1PJZA 1RJ9B 1X1EA 3L3BA 3PNLA 4GLLA 3QUAA 3F47A 1VHJA 2YWJA 3PC8C 3PPWA 4YGXB 2NZJA 1G4HA 3U4HA 2HN9A 1P1JA 1QVVA 1FC0A 3THXA 3PXBA 5LQSA 2FZVA 2JLBA 2WT4A 4IIJB 2P27A 3KWLA 4H1HA 1U5CA 5IABA 1M8JA 1ZX1A 2FOLA 2HDHA 2V6GA 1ETUA 3QKSA 4BRWA 5LP6B 2B61A 5FQOA 2PVSA 5ETJA 3STYA 4E4TA 3DP7A 5D7BA 1V3VA 3LUFA 1KAGA 3MB5A 4K03A 1ZVJA 2GZ3A 1YUMA 2EZTA 4D1YA 1CETA 3F9CA 4F8YA 1UANA 1NBEA 4C0BA 4ZZ1A 1K6JA 4MRVA 1ZL2A 4MGKR 4CRWB 5I7HA 1V16A 5TQ0B 1GPLA 1XMXA 3JVUA 4C0HA 1VJRA 3ANNA 1EA5A 1PZNA 5EE1A 5JXIA 1L5HA 4NG5A 1EM6A 4US1R 1T15A 4MS3A 2B5OA 1NV9A 4QUHA 4NE9A 1KJNA 2FPGB 3AXSA 4EA8A 4XIYA 5K0GA 2BGTA 4OJQA 3DWFA 2C03A 4FD2A 4XB2A 4HQFA 4PAGA 5FLYA 3I28A 4PGAA 3JARA 4IUDS 4YQEA 4DKXA 2IDMA 3HO6A 4Q16A 3RKRA 3SS7X 3TDNA 1GQYA 3PGXA 4RHXA 4C3ZA 2EEPA 1SD1A 1Z26A 2GZRA 2OHIA 1GQSA 3NB0A 2VK1A 1WDLA 4P81A 1W5FA 3D3WA 5GMOA 5B64A 3FYUA 2VNJA 2ZRDA 5B58C 1G0OA 1K27A 1W5SA 2NZYA 4F5WA 2RHBA 3OM1A 5E7IA 3VVBA 5FWNA 2QDXA 3UUEA 3R6TA 5B37A 3VYRB 1T6NA 2C2YA 3QV1A 4HCJA 3LRXA 1RI3A 1HYBA 2DT8A 3KOUA 3LLVA 3OO1A 4C4OA 4JVNA 4ETIA 4QOIA 1WY5A 1WB4A 1EJ2A 3OY2A 1NRIA 4TKUB 4H59A 1GEEA 3J81k 4YNBA 1LX7A 3GH1A 1WJGA 4YCBA 5A71A 1YI0A 4B3DA 4L3OA 1UPUA 3OU7A 3ABOB 2C0QA 3WGJA 4PAWA 2PGNA 1Y8RB 1C14A 5FWYB 2OQVA 1P1FA 1DKOA 2WVJA 2K2QB 2A2ZA 2XY4A 1CEYA 1TCCA 4I0WB 1DNPA 3AF0A 4R01A 1CE8A 3TL6A 2OORA 2VJMA 3TLYA 1CY0A 3U17A 2WG1A 1E2DA 1Y4UA 4BFYA 3P71T 2YZKA 4FOOA 2OO5C 4HWTA 4MSUA 1XMQB 2OFPA 3NLLA 1Z08A 4BX2A 5K8VA 5L3QA 5LNK6 5ELXA 5ECWA 5DTIA 2UZ1B 1LD3A 4BJ5A 1YK0A 2CXXA 1M1ZA 2C96A 1SXHA 2GSDA 3Q7QA 4Y2PA 3SIPA 3RM3A 3TH5A 1NSTA 1P0MA 3NRJA 1NN1A 3DAPA 1DJOA 3HSKA 3HDJA 4JGIA 2QMEA 1JXMA 2V7VA 2YN2A 3WBJA 1AGXA 2SCUB 4NBWA 5M3BA 2XOKD 1H2FA 1GOTA 2FLVA 4FZRA 1N5OX 3VR5D 3KUDA 2QRQA 1JG7A 4GWGA 4Z0TA 1BE6A 3KQOA 3NBZC 3QKRB 1DAOA 2BI4A 1JJFA 4D4KA 3H9BA 4UEOA 2GJ4A 4X66B 4WL0A 3EUWA 3HA7A 3VNAA 3UAVA 1JEOA 2DY1A 3DUFB 1GR0A 5D5QA 1QQ6A 4AMBA 5CVTA 2D8AA 3AUAA 4CM1A 1VPLA 2V0NA 3QXGA 4PQGA 4UAUA 3GCGA 4Y6QA 2ZJFA 3CZPA 1J21A 1YS1X 2R47A 4HG2A 3VVCA 2VDLB 1OX4A 2G71A 2NPOA 3FCAA 3LYAA 1JQBA 2Y93A 4RENA 4S1WA 4ZVOA 3UOGA 5D1NA 3PUHA 3NHWA 2ZBQA 3NXKA 2WHQA 4JEIA 1AU9A 3CLTD 1VSUA 5F73A 4IIDA 1RWKA 2SICE 2JBHA 4HSEA 4PIPA 1IM8A 3VR2D 5BW4A 1UCFA 3MGKA 4YCCA 1JQKA 1P0CA 4TSKA 3K70C 4HNAA 3HI4A 2XLBA 2J9FA 4E5VA 4EPTA 1K9SA 1JNYA 2HLHA 2VZ0A 5LZ2A 4BVFA 3W06A 2COEA 1JH8A 1PI3A 4QU0A 4BTEA 3HRIA 2M9MA 1GR1A 4PG4A 1DO8A 3GP5A 4RD3A 1U2PA 4YH1A 3KWFA 4KV7A 4G67A 3A2NA 2PQ0A 4LGVA 2II6A 3GWZA 4GQIA 3SZOA 1AY0A 1N5MA 4UBOA 3ZVLA 3GJ8A 5FIUA 3OURA 4BRZA 5IBCA 1M0SA 4DNXA 3A9VA 2CYCA 1OU4A 4DG9A 4H7KA 4J0DA 1XTQA 1KP9A 1SZPA 2FN4A 4CKXA 4EJMA 2OAQ1 3U4DA 4LZLA 4KVZA 3LECA 1YJQA 1SULA 3EF3A 1B0UA 5H4GA 4BZXA 4XIGS 2FZCA 2VK8A 2H1IA 4II3A 3EDYA 3VZPA 4Q1CA 2RKBA 4O2AA 3GDHA 2GFQA 3QXJA 4YRDA 3TGWA 3BMQA 3FVQA 2FZ5A 3LHSA 3K9CA 3PNPA 2IHKA 3MS2A 4G89A 2P1RA 3M1LA 4F93B 3FUUA 4FHCA 2Q8NA 4XLTA 1T8PA 3WIOA 5J4KA 3W5AA 1O58A 3BH0A 5J2UB 4DQXA 1A8UA 1XMVA 3JYQA 1ZVQA 2ZXFA 3WL6A 5EIHA 3HU3A 4RMNA 3WS7A 1M5TA 2ZJ4A 5JH7F 3UWSA 1I9CA 2PV7A 2AKYA 1YHZA 1W5AA 4B34A 1EP3B 4QPNA 2RDMA 2REBA 3UT6A 5HDBB 2RONA 2GZMA 2J67A 2R48A 2N42A 3ER9A 2B2XA 2Q5QA 4NJOA 1YRWA 1PL0A 2XE6A 5FP0A 1H65A 4QLAA 2CV0A 1V48A 1Z0AA 3HY4A 3IALA 3UZUA 2QYSA 1ZH0A 4MEJA 2A88A 3RU3A 1K97A 3QNWA 1RQNA 2XGSA 4C6HA 4CNQA 1YD7A 1JAZA 4GSLA 3HNOA 1P8JA 4KXLA 3VH2A 1HWYA 3IHKA 1D6JA 4L78A 1LKZA 1NLMA 1DXOA 1M34E 1N8TA 1Z63A 4MYUA 1PZHA 4BVEA 1KY3A 2WHEA 4FW8A 4LYHA 1OLSB 3NBXX 4MB6A 4KQEA 3KYCA 1XNHA 2DR2A 1A9OA 1J1ZA 3ZJTA 1B42A 1RWPA 3KL2A 4OF4A 1OVGA 3GZJA 1QG6A 3GIDA 4CLOB 2Y67A 2Q29A 4AJEA 1L9XA 2ETVA 4L4RA 2GILA 2DSTA 1WUIS 3W5DA 4LPKA 2XUPA 5CB0A 1NMSA 4A73A 4D79A 2CHUA 3B6JA 2AOWA 3ICCA 1Y48E 5I7RA 3PPXA 4PINA 2FTKE 4JBNA 5MN4A 3D4NA 4KX3A 3KR1A 4F60A 3G6WA 5IVHA 4G65A 7GPBA 4OXKA 5E2IA 2CBXA 1DHTA 3QVGA 3MBKA 4U2CA 5H02A 4TV8B 2W83A 4CLXA 1BXZA 1UJ4A 5LP6A 1MLDA 2JGRA 1Z9BA 1GV1A 3AILA 4H1TA 4OSPA 4RABA 3I9FA 4TXHA 4FI3F 3TOXA 1WF6A 3WLKX 4DIEA 2YKGA 1JPNA 2IEBA 3VDRA 1QC5B 1Z17A 3Q3IA 4HWPA 1FP2A 1QV6A 3M5WA 4P58A 4E1VA 5J1TB 3ZGZA 2IS6A 2V65A 1WCV1 2YWDA 3F3MA 1GJRA 5KNBA 1Q1NA 1U7ZA 5DHQA 2VJMB 4PZAA 1CQJA 1YRYE 4LNAA 1POWA 2PNJA 1T5TA 1T2CA 2Z0MA 2O3RA 4GEGA 3ZWPA 1D2RA 5EJ9A 2K2WA 1RXVA 4QAQA 2Z2XA 4ZFNA 1Z0ZA 3T4EA 4L9RA 3R23A 4U5XA 2G6TA 1E8MA 3QPUA 4FX2A 5A04A 1JFVA 3NHPA 5K3CA 3TBHA 4GW3A 5HQ3B 1AZWA 1PLLA 4ND6A 1TPZA 3KYDB 4RK6A 5T8KA 2EZUA 2V7PA 3BK7A 4RZ3A 2G4VA 3PE6A 4O3MA 2WTBA 1FFXB 4U3JA 2GUGA 3U7QB 1A4RA 3FWHA 3RYFB 5E6UA 1AKQA 2VT6A 4F3TA 4A2PA 1WDKA 2C42A 1W5TA 3HADA 3HA3A 4DJFC 2EKBA 2HDOA 5K4HA 3ES9A 4G41A 5CVVA 1PSWA 1F5NA 3U40A 3GPDG 4H2DA 1QP0A 1BHQ1 5CYFA 1F17A 1MAAA 5T4FA 4DQVA 4PZPA 4F21A 3JD4A 3A3PA 2HJVA 4XVQA 2Q7OE 4B17A 5JHGB 3K2BA 3FVTA 4TTIA 3QVVA 1QYRA 1R6AA 1GL3A 1M2NA 3LV8A 5CDFA 2QOEA 1GSIA 4EPWA 3A26A 3HFRA 1LF5A 1Z12A 3U81A 2AIRA 4P0PB 2ZUBA 3SKYA 1Q19A 3KSMA 4AU1A 2GFHA 1LBIA 3UXHA 3LT2A 2R8PA 1YL6A 2OENG 2QRUA 4BQQA 1ICEA 1OIWA 3OT1B 1JDBB 4OIMA 4ZOEA 4IQ0A 4ZTBA 2XRYA 1Q57A 3B48A 4KQHA 3AGQA 3ZQKA 3V9PA 4S3MA 3EXEB 4M0EA 4QJIA 2HH9A 2FPRA 2ZBRA 3VC3A 2AMVA 4KOEC 2PQ6A 4AWXA 3RYCB 4GP7A 4LYYA 2PSFA 3AUFA 3IIJA 4B8ZA 1JN0A 1OBVA 1OWMA 1QQ7A 5CT5A 2XE4A 4M99A 2OV6A 1EEXB 3MT7A 4PPYA 2HU7A 3AG5A 1JG6A 4CM8A 4MULA 1ESEA 3X1MA 3JTEA 2C29D 1T2UA 4M9XA 4XIFA 4NV1A 4JOCA 5JWOA 1S8AA 1XQYA 1NGSA 1KVQA 1U28A 1U5BA 3AJDA 3Q9NA 4MP6A 2EDCA 1DLJA 1U3TA 1XCGB 4Z2YA 3T6KA 1J5PA 3OLWA 4UM7A 4YLYA 1X1DA 2IITA 3HL4A 2ERYA 4ENSA 2BGIA 1NUPA 2QVZX 2XUQA 3LVQE 4BO8A 4POOA 3GLHA 1VA4A 1R15A 3K1JA 2EZ8A 3JAKA 4HWGA 4BV3A 1FU8A 5IXJA 1CB7A 3L7YA 4ZN6A 3P5BA 2D54A 4ZV9A 4X91A 1Q1EA 2BGUA 4MINA 2EWMA 1E64A 4JITA 4ID3A 3E5HA 2LIVA 3B2EA 3EW9A 3KQSA 3R24A 4U6NA 2CXOA 1R0LA 3SM9A 3VNVA 1G60A 4LW8A 4R2LA 1J4AA 4XSVA 3C6KA 3RWBA 3TLGB 3O2NA 3WVNA 1NF3A 7ADHA 2B4QA 1DTSA 3F4LA 2JAQA 5K2OA 3MT8A 3R3HA 1EFAA 4I50F 2PKQP 5HFAA 4QULA 3PEUA 1TYDE 2QGZA 3FUCA 1U9IC 1ZI9A 3AOGA 4IGAA 2G82A 5KOIA 3PT9A 2ZSUA 3QVJA 1NQXA 1SK8A 3MWDB 5JRZA 1EUZA 1V3TA 4PEVA 4PN7A 5JXGA 1SVUA 1UBOS 3K0CC 2E3JA 4WK6A 3JXEA 3IUSA 5I7OA 2OO5A 5IVIA 3Q3GE 4ARAA 3PITA 3KLNA 5CP8A 4BXOA 1QKKA 2WSIA 1RMQA 1E5VA 1QGED 3DR3A 5A4IS 4IX1A 2VQDA 5LBTA 3VBEA 4B1FA 5EQTA 2ZIXB 3E58A 1I7LA 1CZHA 4R2XA 4ER0A 5HA5A 1ST3A 2Z57A 4M1WA 3WL3A 1A7UA 1M2FA 3DOFA 3NW9A 4WAUA 4CVNA 4DGQA 5KNBD 2R62A 4AKGA 1BG6A 1UMKA 2ZVDA 4YCAA 2G0NA 2BEJA 4ZO6A 3HCCA 2UAGA 3EDOA 1SQ0A 3ROEA 3KKPA 5CCBA 4LJ8A 4LTNA 4WNYA 3WNZA 1L5YA 1XAHA 4P0TA 3ACCA 1VE5A 4TTJA 1F14A 2RH5A 3D64A 3DS8A 2Z08A 1B4DA 4CV2A 5KOYA 4KE6A 3RLFA 2YYZA 1XCLA 2WT8A 3NOVA 1B3BA 4ECAA 1WPXA 2LNDA 4XB1A 2NTJA 5DKFA 3H6KA 1IMOA 5KJEA 2QUAA 4OM8A 3TXYA 3E48A 1IOWA 4FSXA 4AZ0B 2PUDA 1NYLA 1YAJA 2QTRA 5BN5B 2YZ7A 3GU3A 3OTWA 4D0GA 4H7EA 3V8BA 5I5EA 4MQBA 1PG5A 3HJHA 1ACJA 2ZRJA 4NCIA 1AUXA 5CJ2A 1W2WB 3HPQA 5BNFA 4ZEVA 5YASA 1BX3A 2IXAA 2P5SA 2ZTUA 3FSGA 4HYYA 2PL3A 1E3DA 4E3WA 2HB6A 1QZ3A 4R9RA 3ASVA 2ACEA 3KOMA 3PHBE 4IDBA 4J6EA 4LC1A 2LGJA 2A9RA 2WZDA 4IOJA 4OJMX 4CTMA 5LOVF 1I13A 4J7AA 1XKLA 1CVRA 4QYTA 1D4FA 2IUSA 5JNTA 1ZSVA 5AM1A 4EARA 1IZ8A 5AKGA 1HI9A 3H84A 5DNYB 5T6BA 1N8SA 4PE5B 1BCRB 1PGOA 2QEQA 1TKCA 4MS3B 5FO0A 3X3HA 5BXQC 5C18A 1QZXA 3MK31 5H70A 4ERNA 2IYPA 5K8CA 3EF1A 3UKOA 2B25A 3ETJA 3T5BA 1LY1A 2CD9A 3AONB 1L5KA 5HW0A 3BD6A 2P9FA 1WSAA 2DLNA 4OH7A 2OGTA 5H0IA 3BCHA 3GLGA 3M6AA 3TLEA 1LSOA 1RHUA 4XM1A 4W7IA 2F1OA 2R6DA 4H6XA 2OFFA 2ASVA 2GDJA 2JEYA 5EL0A 2H57A 4I1PA 2Q9BA 5G02A 3RWOA 1PK7A 4TVBA 2I9PA 3I2JA 1IOVA 1P9WA 3EIFA 3QNMA 4GOKA 4N8SA 1V8OA 4NYMR 4Y0NA 4YJHA 4F96A 4DLLA 4GL2A 1G6HA 2FFRA 3CZ9A 1LZLA 1YNOA 1TQ8A 2WTEA 3HO1A 1YQQA 2CF5A 2YTZA 2ZUDA 1OBOA 3CLSC 5ADWA 1QRTA 2ROQA 4JUAA 3Q8MA 4JT9A 3KDAA 5JPCA 1CUGA 3FTCA 5B2ZA 4RJKA 1CKEA 2HIGA 3RR2A 1GA4A 1T9CA 2YWBA 5LMUB 4JJEA 4H18A 4QOSA 1IRXA 1C8KA 2YHSA 3O03A 2GPWA 1A27A 3EWNA 3GHYA 2E4VA 4P4TA 5EE0A 2VDQB 2CL6X 3RWMB 1BXRB 4DCPA 4D96A 3GRYA 1ST2A 1DU4A 4MVJI 4O4JF 4EGSA 1AO3A 3JVEA 5GOTA 1QDEA 1RFGE 3ENWA 2C2HA 1NQ5A 3NOOA 5KKNB 4WZAA 2GCGA 4PSUA 4EL5A 1NVMB 5K8IA 3A2LA 5EHGA 3H75A 1Y5NA 4I81A 3U3MA 5HTOA 3QWBA 1NW8A 1IM5A 4OP3A 4E2FA 5HF6A 2ZB4A 2PT5A 2BHSA 2ST1A 5JSQA 1N1GA 3GDOA 3R9XA 3C3EA 1KY5A 1T6YA 1HYHA 2J5BA 4CFZA 1QCDA 1A77A 2WR8A 2XAAA 1KEEB 3MYRA 4ZDJA 3FSEA 3EFHA 5EY5B 4DMCA 4MAFA 5KSPA 3BORA 4KRXA 3T61A 3OD5A 1XD8A 2J0VA 6REQB 2YOGA 1V7PC 1I7PA 2G76A 1I6KA 1D4OA 3HUDA 3A1CA 2HEGA 3Q8KA 3GJYA 5FLXA 3BICA 1AQ6A 1IQRA 1RQ7A 2PEZA 3ML1A 4G3XA 4N6GA 4PVCA 4IEFB 2ZU6A 1L4FA 4GQBA 1NIPA 1VL8A 3WMFA 1H4QA 1GNRA 2OBMA 2HHJA 3L5KA 3TNYA 2IS1A 3N07A 1Z6YA 1RTKA 2BMEA 4DRXA 3PIIA 5CDHA 1NR7A 2CXUA 1GZ6A 2DY0A 2F3QA 2FPKA 5ALGA 1I32A 5LQUA 2C97A 2VDWA 4Z7QB 2YY5A 1KEPA 1SCIA 2ZZKA 4G5HA 2WFAA 4ZC1A 2W6MA 4G5YA 2PZAA 1XIVA 3M9WA 4B71A 1G38A 3KHSA 3HR7A 1LVGA 2YBDA 3ULKA 3VFDA 2AGVA 3GT7A 4HPJB 5J9FA 3TBFA 3I1FA 2BGRA 2IPNA 2FH5B 2NVBA 4DWVA 1D2EA 3LS2A 4FHDA 3FCEA 3U1TA 1GGKA 2P11A 4D9BA 5BWLA 5JS1A 3PUZA 5KREA 1H3FA 1D4AA 1QJCA 4Z0NA 5CFNA 3LCRA 1G291 1PKXA 5CBPA 5AVJA 1R00A 2A1TR 2ID7A 2PMEA 5KX5F 2V96A 1EZZA 2HTFA 1JLRA 2PMKA 4G2TA 1W4RA 4JU8A 1M74A 4L07A 1C4XA 3K6KA 2YVKA 1CUVA 2Q3EA 3IH5A 1GDTA 4OX9B 3IAM1 5FBZA 6REQA 3WB2A 1NIJA 1A9YA 4JNKA 1M3SA 2QNIA 2R7LA 3ET4A 3ORYA 3OY7A 3QXCA 4DE5A 3AUKA 3W8RA 3FOCA 2TMDA 3CY6A 1IG0A 2GA9A 5JS7A 4K1XA 1ODCA 1YS9A 2DFKB 5B1SA 1U0OC 2ZTVA 2P9JA 5ITWA 1N3BA 2ZI7A 4IFIA 3RUAA 4AN1A 4BLTA 3IULA 4ZT7A 4S05A 3D59A 1RAHA 5B6JA 1FP4A 4WQMA 5KB3A 4MEBA 5JZMA 3EYAA 1YQGA 4MVJH 1JEEA 1FS4A 4BQRA 2GXQA 3KNZA 3VZCA 1T2VA 3NDBB 1JALA 2BRUA 3IQIX 4WLUA 4JV5B 3K15A 5GV8A 2JKYA 1EVKA 4UPVA 4G6ZA 1DE0A 4MV9A 3EY4A 4JWTA 3K2QA 5KVSA 3ELYA 4EKNB 2W2PA 2W22A 1E9VA 4FE3A 4NBUA 2XWJI 2ZLBA 2FY8A 3R9IA 2NWQA 2F7SA 1BMDA 1XLWA 1PJCA 2I2DA 3W05A 3FJ1A 2BKXA 3WYBA 1C0EA 4KN8A 2QM0A 2HCRA 2QMYA 4BKQA 1SG0A 2L82A 2O50A 2YJGA 3FWNA 3FRIA 1YDWA 5DVZA 2EFEB 1RP1A 3V4VB 3RYCA 3FCSB 3LF1A 1KMNA 4Q4AA 5DHAA 4Z99A 1C7JA 1JB1A 3HU2A 1ZMTA 4MKIA 4QM7A 3THXB 1N0HA 1Q0HA 2BKUA 2FPUA 2D1SA 1JMKC 1MJGA 2AZTA 1EFKA 2W2MA 1PL6A 2XV1A 1YOBA 3H9EO 4N0MA 1PJ2A 1X38A 1PV4A 1W0JD 2PKRA 3PPVA 4LMRA 3M6UA 4MR7A 1YHNA 4JQZA 4HYQA 2ODAA 2QYTA 1U28C 4MIYA 5TPWB 3VPBA 1O57A 5H7XA 3A04A 4B4KA 3KSZO 2OHXA 2XGMA 1NWCA 2QX8A 1Z5UA 4UTZA 2I29A 1OT3A 4ZCLA 2VF2A 2D5BA 1S6YA 1PU2A 4I1OA 4XSGA 3U60B 5CK4A 4RK4A 2A92A 4KQ1A 1R9NA 2V0GA 3HO8A 3A06A 1Z18A 1JQLB 4MUYA 3G2LA 4DMKA 4C07A 4EF5A 2GXSA 2J9XB 2CLHB 1AD2A 1G20B 1TVEA 2X8BA 1NSFA 3K05A 4FMDB 4YC7A 5HKAA 4J94A 5D3KA 5FI1B 2H1HA 2IGTA 1WU7A 2KBFA 3BXPA 3L8YA 4ODIA 5CDGA 4HN9A 1QH8A 1Z8FA 3QOXA 4I4TF 4O25A 4Q37A 2FUG6 1G2IA 3ZZ1A 4BVKA 1AMNA 1CF9A 3AM4A 3Q8LA 1JLKA 4B7ZA 3DM9B 2DETA 2XHZA 5HQ3A 1NPYA 1IN6A 1PW7A 2C54A 4GYWA 4JGGA 1E60A 3NWPA 1OROA 3WJ7A 3VSEA 2HMYB 2DJ5A 3QE2A 4R8SA 1ID8A 2QZPA 2D8MA 4P7KA 4Q9LA 4D26A 3KPJA 3P9NA 2RAFA 3R6DA 4F45A 1EFPA 4Y2QA 1NNSA 2MINA 3DEHA 3K8OE 4D9IA 5F35A 1CR0A 1AS2A 1PR3A 2P0EA 3B13B 2GX6A 3OE1A 3PD0A 2A5DA 2VDRB 4UHCA 4TTRA 3ZWWA 2XUOA 3AIKA 3LDUA 3PHLA 5CFQA 1KEEA 2A9QA 2VATA 2DZDA 4FBGA 2C9MA 2GBLA 5E2AA 5E9AA 1K4KA 3OZRA 2X7JA 3HZOA 4HGNA 3RVRA 4DCMA 4DBLC 4K9PA 3UEOA 1ZBQA 3NTUA 4O4HF 4FFBA 5FI0B 1ISRA 3ONEA 2POCA 3S2SA 3QHAA 4WCDA 2FZEA 3VR2A 5LN1A 2A84A 2JEOA 1CJBA 3KZ1E 4M1SA 3NC1C 4RZXA 5FPKA 2VRCD 2QTGA 4JASB 4QQ8A 3JASA 3C5HA 3I1JA 2IKQA 1BQEA 5LPNA 4JBXA 1ISMA 3QF4B 1P3Y1 3DDSA 3PSAA 5DX1A 2UUOA 3GFRA 3HYRA 1T8SA 4M89A 2IT1A 1OJ7A 4J76A 3OZGA 2VXYA 4MYTA 4PGFA 5CFPA 3G8BA 1PFUA 1VJCA 3FOZA 4I5FA 1HFKA 4X84A 3WLQA 5ADVA 4W5JA 5IDWA 3CVUA 1MB9A 5FBQB 1E3JA 2WA1A 1OLUB 5EKXA 3JYPA 5EUMA 1ULZA 4EIWA 2E87A 1N77A 1X19A 4KVAA 4FYWA 1E62A 4ZQCB 4EWLA 2Z1DA 4LFCB 4EHNA 4Q7JB 3OP1A 4NZ9A 3R9XB 5D8DA 4FE4A 1GU1A 2Z5VA 4IS2A 1BS2A 1FUKA 1Y9ZA 4CTKA 2WYVA 3KALA 1CJUC 1JR3E 1GYPA 2XWBF 3K0FB 4ZAVA 4D80A 3FCXA 1Z0JA 3ANSA 1SBCA 3FZGA 4ZT3A 4MUBA 5F5LA 2XD4A 4QXQA 4FMDF 4D9EA 4ZI2A 2F8MA 1JDPA 1YVRA 2FMKA 3I34X 4E09A 1DV1A 3PGLA 3ZHYA 2BH9A 1E63A 2QG6A 4ZYZA 3G2OA 1VKJA 1LDMA 1TYCA 3GFGA 3L7OA 3H2BA 4FTWA 4I4TB 4DCUA 3W5BA 3GJ7A 2D0IA 1DKPA 1UXJA 1BMQA 5K6AA 5GVSA 2E2WA 3C5WP 1XD2B 2PGLA 2Q4RA 4MR9A 1AHHA 2LVBA 4J7UA 5FL7A 4XB6B 1GEGA 2EFCB 2VTDA 4PBTA 4EOGA 5JH7A 5TMPA 4AUKA 5D86A 4PYNA 1I4TD 1YE3A 4RD6A 5DH9A 1JPVA 4Q03A 1AE1A 1E6CA 2FGJA 2ISQA 2WMDA 4LKOA 2RI1A 2XSZA 4U7WA 3WLTA 4CG3A 4XWWA 2OXCA 5JS2A 1VIDA 1Z2OX 3X1JA 5HR5A 1XZMA 4YAEA 1K4MA 4B7XA 4Y2HA 4F7WA 3COPA 4P3PA 3PKJA 1KNQA 1PO7A 1HG0A 1Q16A 3M1AA 5JCJA 1ZGGA 1KF0A 1L2TA 3NHRA 3RS4A 5K0SA 5TIIA 4K0RA 4QUEA 4KSCA 4J9UE 2JZOA 4IVQA 2ID4A 4IY1A 2AWOA 3FYUC 3OFVA 1X1SA 4IYJA 4JELA 3ZV4A 5L53A 1BSVA 5AJUA 4DA6A 2B1JA 1Z7GA 4X1KB 4E15A 4YRPA 1N9GB 4XDYA 1T24A 1VGVA 1GZ3A 2PBFA 3AH8A 4ROTA 3TIXB 3VAYA 5B55A 3P7MA 4W8HA 1UBUS 3SU8A 2Z09A 3RG2A 3PNYA 2AF4C 1L1RA 5HIMA 1XEFA 3R7NA 4BO4A 3DTYA 1UZMA 1FFWA 2NT4A 2FRXA 1L7NA 3OUUA 3PBKA 4RE6A 2FK8A 2HKIA 1S89A 4FDTA 2HU8A 3G0DA 3KTDA 3RS3A 3SS8A 4MLPA 3TKLA 1J8DA 3EVNA 2P1DA 3DO5A 3F9RA 3I83A 3LHKA 1IB0A 3LWDA 4N3BA 1DLIA 1OZFA 2G5CA 1DQSA 3RBZA 3G85A 3WK6A 1DC4A 1NF9A 4FFVA 5JSZA 1B3RA 1SBYA 1TVKA 3BHJA 5CYPA 3M8KA 3PIRA 5B1EA 4MUIA 3CVWA 3H3FA 3AV3A 1NG9A 1U81A 4JI1B 5EIXA 3BH7A 4I4LA 3VPHA 2ZRLA 3NHLA 2GEFA 4KQMA 1MRSA 1GN9A 4G1UC 4GKVA 4P34A 5CH8A 2XNKA 3BTVA 1NW4A 3ZKWA 3FTFA 4AYTA 3U44B 3F71A 3EG9B 1NU6A 1E4VA 2Q3LA 5F3DA 2F43A 5IKEA 3HXQA 1DQZA 4ALMA 4YJ3A 3EZXA 4JB3A 4MLCA 3CUKA 2C1EA 3OJCA 3V2GA 4CMEC 8GPBA 4FUTA 2W90A 3W79A 1WZEA 1R5JA 1PQYA 3LW7A 1C3OB 1UL1X 3AEYA 3LI2A 2FVYA 3AZQA 2QVLA 3G5UA 2R1TA 5JYEA 4JJFA 1KR5A 4WH0A 1LW6E 5DFAA 1WLSA 2CLEB 2OZPA 4DIFA 5T7BA 3R09A 1QXSA 4ECEA 2J31A 3A7DA 3I1IA 2ZI3A 4JLAA 3EUAA 2BP7B 1W44A 2EW8A 3E82A 4NVRA 1F8YA 2DFLA 2IYRA 4S12A 2VH5R 2HF7A 4MYCA 1RVDA 3S81A 4FMCB 1YS4A 3E05A 1I80A 4K6FA 4LWZA 4QDZA 4WNIA 4MR7B 4RSHA 4WKGA 5DZSA 3SHQA 3T1NA 1EFRA 1DBIA 1XALA 4OL9A 2OQRA 3H99A 2IZ5A 4YPOA 2A58A 2IRWA 2R6CA 3AIMA 5A3SA 1WMAA 1I9GA 4HL6A 3S99A 1DOZA 1XAJA 2C7VA 3IKVA 3V6MA 1QHYA 2Y77A 1R50A 3TVDA 5CDYA 5JEEA 3DLIA 1BTOA 1EX1A 1C9EA 3AI1A 4MV6A 1PG0A 1NBMD 3M1YA 3WA6A 5CTJA 2IZ0A 1HBJA 3FOBA 4WXHA 3GNSA 2JLUA 3MLEA 2NTEA 3ABIA 4UCWA 2RMKA 3UCFA 2B0CA 1Y6ZA 2VWPA 4OQNA 5D51S 5JBQA 3AZOA 1P17A 2P6NA 4OTZA 4TQUS 1JJVA 4FMBB 1ANKA 4RM2A 2XVZA 3RIEA 5L7TA 5JO0A 4IV8A 4DQUA 1MX1A 2YFQA 4PZ9A 3UAGA 3ZV3A 3IV7A 1NVUQ 2NU6B 4ZC8A 4M0DA 5T67A 5DP2A 4D97A 4COOA 4EMBA 1NQTA 4AIIA 4TTSA 3FTQA 4EECA 1A3CA 3USES 1JIUA 4Q1AA 1L5SA 3BFVA 3F74A 2JGIA 3L6CA 3P8ZA 4POAA 3BB4A 1FRQA 1E6EA 1EWTA 1C3OA 1GFSA 1UKCA 3JATB 2FE4A 3SZUA 3L2OB 5K6TA 1LU9A 2J9ZB 4NQZA 5E4JA 2UZ0A 4OP1A 1XHEA 3I53A 3BTOA 1ZJJA 4J4HA 3QW4B 2Y0EA 1J2UA 1ZGBA 5F7XA 3IBFA 4GXRA 1WUKS 4FQ8A 4K6MA 4O4LF 4ZQGA 4K5QA 3GLGE 1FYDA 3KQTA 5DSTA 4HNGA 4I36A 2VYFA 2XTMA 2GUWA 5D87A 2H51A 3OD1A 4OGWA 3TRKA 4FYHA 2JLZA 2JATA 2YY7A 1WWKA 3GDFA 2XJ4A 4NFYA 2HBQA 1IY2A 3IBGA 3ICVA 4Q4HA 2ZB2A 2X14A 3CHYA 2J3IA 5BSVA 3MINA 3N75A 1SUIA 1R4ZA 2MOKA 2IVZA 5EJIA 4KXNA 4RS4A 4N9QA 3TIGA 2QXYA 3GPBA 1IQ0A 1VPTA 4KMOA 3A1UA 3FNEA 3H2IA 4LPSA 1KO4A 4MXDA 5E6SA 4FLEA 4MVJG 1KEKA 3GVXA 3R40A 5EMMA 3WKDA 3NHYA 2IU3A 4JUCA 3RV3A 2DKNA 3GZTB 1EWVA 3MAAC 3DEIA 1E6WA 2QP9X 2WJPA 4GVLA 3ZWOA 1WR8A 2Z2ZA 2ZR0A 2WWVD 2C00A 2Q3FA 5D85A 3TM5A 3V1NA 3Q3HA 3K2IA 4TSFA 4EO9A 4N0PA 2IS4A 1E2BA 1X14A 4DBLE 2YHBA 2IEGA 2QVGA 2QTZA 1D3AA 2C57A 3CF2A 4YEDA 1ODTC 2J4CA 2AMYA 5KCMA 4C78A 1EFCA 3HUEA 5BWBA 3TVYA 4BMOB 1I94B 2IHZA 4K86A 3UAWA 5GV7A 1SBHA 1HNNA 1OFTA 1OREA 2VNAA 5IZ4A 3COWA 1B6GA 3D7SA 3PC7A 3RFXA 3TPCA 5JW6A 4DQLA 4D6XA 1MV8A 2WVGA 3HB9A 1U0HC 4JYZA 2RGXA 2PIDA 4GUAA 3PF8A 1G8YA 2X8WA 4KE8A 4RNDB 1PWEA 2ONKA 1T36B 1UBKS 5KOHA 1M6WA 2NTNA 4BNWA 4KGZA 2SHKA 1NA5A 1MQSA 3O82A 3HM9A 3K6SA 1DFGA 3O8QB 1HV8A 5IJ0B 3BTUA 1RZ3A 1N36B 4MW6A 1D2NA 2Q2OA 1Z07A 4MQ4A 4N8EA 1JTVA 3P9IA 4QC2A 5DWDA 4U7GA 4RV4A 1ZK4A 1Q6ZA 2WUGA 4AJKA 2GARA 1DV2A 3AP1A 4PV7A 2ZBUA 2YJ6A 2VYVD 4G1MB 5B1YA 1W8IA 5LZ7A 2JD0A 5AKYA 3WIDA 4F4DA 4LJRA 1CTQA 2GXAA 5TY0A 3WLEA 3GD5A 4LJKA 4CIAA 4FPXA 3WLSA 1UBSB 1MNAA 2B20A 3QFSA 4W99A 5J63A 3FOEC 4ARIA 1TQHA 2YV4A 4DLRA 2QN2A 2VAVA 3OM9A 4IM7A 3RUIA 1AS3A 1LBHA 1ADJA 1E7RA 3BMCA 4Y2GA 3TFQA 4HDMA 1T5BA 4HAOA 4P38A 4KPFC 2PGIA 2H4WA 3VX3A 2G07A 4OX9Y 1IY0A 5IUKC 1P1RA 1RWWA 2WU3A 2AH5A 1VE6A 3DZJA 5FBRB 3RVDA 3V1TC 2GF0A 1S02A 3JQDA 1VC2A 5TT0A 1UWVA 1G7RA 3ROTA 3HB4X 3I04M 2QQEA 4WZBA 4ZDKA 1NAHA 1UK7A 3LW8A 3OT4A 1YCFA 4BC1A 5IS2A 5DMXA 1RKUA 4MEAA 4KXQA 2YHIB 1R7RA 4FR0A 3LT5A 3KIPA 3OIGA 4CIVA 1Q6YA 3P52A 4YGYA 2E7ZA 3MILA 3RIGA 3FRJA 2B21A 3DBLA 3PS9A 2B92A 4Z3OA 1IHYA 3P4UA 4YCMA 1N2SA 4N3NA 3UFXA 2XT0A 3DVLA 4G97A 2JHCA 2H1VA 1JWAB 1W0JA 2E4YA 1T2AA 3GY0A 4EGAA 4NPCA 1U9YA 3SJBA 4HHEA 4ESEA 2GWHA 3OLCX 4Y2JA 2B82A 3JQGB 3WK7A 4CV0A 3ZDRA 4HAXA 3WIVA 2MJLA 1UBFA 3OX4A 4XM2A 5IDXA 3THOA 1H9BA 4Z1OA 4EHJA 2XB2A 1DIOB 2ACVA 1CFJA 4YT5A 4QTTB