3OG9A

Structure of yahd with malic acid
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
206
structure length
206
Chain Sequence
MTDYVFKAGRKDLAPLLLLHSTGGDEHQLVEIAEMIAPSHPILSIRGRINEQGVNRYFKLRGLGGFTKENFDLESLDEETDWLTDEVSLLAEKHDLDVHKMIAIGYSNGANVALNMFLRGKINFDKIIAFHGMQLEDFEQTVQLDDKHVFLSYAPNDMIVPQKNFGDLKGDLEDSGCQLEIYESSLGHQLTQEEVLAAKKWLTETK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein yahD a copper inducible hydrolase
publication title Regulation and structure of YahD, a copper inducible alpha/beta hydrolase of Lactococcus lactis IL1403
pubmed doi rcsb
source organism Lactococcus lactis subsp. lactis
molecule tags Hydrolase
total genus 78
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3og9A00
1LGYA 3BIXA 1JT2A 2QJWA 3ANSA 4RNCA 3PUHA 1ZJ5A 3IB3A 2OXEA 4J7AA 4BAGA 3FBWA 1CQWA 3I2KA 1E66A 1XZHA 1K8QA 3EQ9A 4IQ4A 3R40A 1WHTA 3MUNA 4XJVA 3WKAA 4YX9A 1QO7A 1QIJA 4DM7A 2H1IA 2BJHA 5AO9A 4JYPA 1QIEA 3QPAA 5LZ8A 4C88A 4Y2RA 4GECA 1E5TA 4A16A 4KE7A 2OGSA 1IUNA 3O4JA 2WHRA 4N5IX 5FP0A 4FBLA 2OCIA 5HK9A 1U2EA 3ESAA 5LZ2A 3TJMA 4EY4A 1M33A 4LYDA 2PSHA 3F9CA 1QIIA 5CMLA 4FKBA 2OGZA 1FJ2A 4K2AA 3M81A 5D3ZA 1UK9A 1U4NA 2OCLA 3F67A 1VOTA 2IITA 3BDVA 1IVYA 1WB4A 1ZD2P 4OCZA 3ESBA 5E4TA 2HM7A 3LCRA 5EIHA 2ZJFA 4ZGBA 4H18A 2HU7A 2QJRA 1WB5A 4CCYB 1VZ2A 3O4IA 1QGED 4CFSA 3H19A 3FLAA 4UPDA 4QDXA 1XRNA 3R0VA 4AZ0A 4BE4A 1UOQA 5A62A 4BATA 4IH9A 5ALXA 2BUCA 1L7QA 2HADA 4BCBA 1FFAA 3N0TA 1AURA 1WM1A 5JYCA 1CUIA 1CUCA 5AKLA 4H7DA 4F0JA 5HQ3A 1HPLA 5AH0A 4U2DA 4QWMA 4AO6A 5A7FA 2CBGA 3IDAA 3G7NA 2DSNA 1TQHA 4FFWA 4Q3OA 2DR0A 5EHXA 1CUSA 1B41A 3DL4A 5JZ9A 2JGMA 1TRHA 3C5WP 1G42A 2VT6A 1LZLA 3IBTA 3H1BA 5I8PA 5ALUA 1A8UA 1VE7A 1GKLA 1LPMA 3C5VA 1AKNA 3FVTA 4B84A 5KREA 1CR6A 1GPNA 1Q84A 4C87A 1QFSA 4K5QA 1JFRA 1P0MA 3QPCA 4H7HA 5HF6A 2YH2A 1UKCA 3H2JA 2DHCA 5AI9A 2XMQA 3I6YA 4ETWA 3D0KA 3KWJA 5ALJA 2XQIA 2JGIA 2R11A 4F60A 2IX9A 1ODTC 3OG9A 4DMCA 2ZYHA 3GBSA 3Q8WA 1TIBA 3WL7A 4MXDA 2VAVA 7YASA 2B9VA 1YA4A 4DMHA 4EY5A 3TGLA 2VJDA 1ZIYA 3B12A 3I2GA 1C4XA 3SWWA 5SYNA 5JD5A 4C6HA 4CIAA 3C6YA 4PSUA 4ROTA 5AI8A 3IUNA 2QS9A 2HA0A 1KEZA 4F5ZA 5CH8A 3GFFA 2FJ0A 1LLFA 1ZI6A 4X97A 3FYTA 5AJHA 1A88A 4QDUA 2PSFA 2XMBA 1YB7A 3FYUC 1YA8A 1N5RA 3ED1A 1GZ7A 2XUIA 1EVEA 5T4HA 3WK5A 4X6YA 2PL5A 4BDSA 1CUGA 2GYWA 3BE8A 3QZUA 5AM0A 4KAJA 2WFLB 4B6GA 3RARA 4OB6A 4BAUA 5ALGA 1OILA 4XWGA 3PFCA 5IH7A 4O08A 4AMZA 4EBBA 1CQZA 3H04A 3ZWQA 4YPVA 2XMGA 5DJ5A 1ORWA 2XUOA 3OTQA 5CURA 3HRHA 2GBFA 3I2HA 5CXUA 4AB1A 3P2MA 2O7RA 2PVSA 5ALPA 3WL6A 1ACLA 2NW6A 3GROA 2BKLA 3I2FA 1YB6A 3A2LA 5K3CA 3E3AA 2PBLA 5DTJA 2WFZA 4C4ZA 3BJMA 4DNFA 1LPOA 3NUZA 2ZSHA 5ALZA 2VJBA 4K6GA 1ODCA 3D5EA 4IHAA 4MQMA 5DLPA 4BTLA 1H2WA 1S8OA 1TAHA 5CT6A 5YASA 1EXWA 2ZJ7A 1R1DA 4GHWA 4UBLA 4BB0A 2Y2VA 4LIPD 1LBSA 3BDIA 1IUOA 2JGKA 2J4FA 1LPSA 4ZXFA 1GPKA 4ARAA 1K63A 5EHZA 3WKDA 2HA6A 4HTAA 4BRSA 2Z8XA 2GBGA 3FLEA 4UHHA 4DNQA 3G9ZA 3VJKA 1TK3A 2ROQA 2Z3ZA 3M82A 1DX6A 4DTCA 1VA5A 2OG1A 3KXPA 4KACA 2ZVDA 3B5EA 4HXGA 4W9RA 1K6EA 1QTRA 1SFRA 3DS8A 4K6HA 5FV4A 4K6KA 2XMZA 2AXEA 2QR5A 2WG2A 4DMKA 3B3QA 4BP9A 1I6WA 1R4ZA 3HABA 3ZLVA 4X7BA 5E2IA 2XUGA 1MX5A 4WFJA 1H2ZA 3A70A 3E4DA 3DYIA 5AI0A 1W75A 1EHYA 2AJCA 4BZWA 2EEPA 5AKEA 3G0CA 1C7IA 5J3JA 4KAFA 4TPKA 5ISMA 5AP9A 1E8NA 1CUEA 2WUEA 2QMQA 4HS9A 3V1LA 5HF5A 3D2CA 1MNQA 4X71A 2AJBA 4QZVA 2WHPA 2OPHA 1XZJA 4XX1A 2VTVA 1LZKA 4W1SA 4EHBA 4E46A 1R88A 4NMWA 2XLBA 4ZV7A 3WK7A 1CUHA 3G8YA 1G66A 5HKAA 5JANA 4G9GA 3G9UA 3V1KA 4W1QA 3HEAA 2JF0A 2WFMA 2QXUA 1XZAA 5IVKA 1ODSA 1DINA 2YASA 4KJXA 1IZ8A 3R3VA 4PNZA 2GZSA 2P8SA 4BC1A 5ESRA 3BF7A 2WTMA 1XROA 5JZBA 1W52X 3WI7A 1IMJA 1F8UA 1QIKA 3SK0A 4FNGA 5FLKA 3STTA 5K3AA 5ALWA 5JD4A 3PFBA 3AFIA 2VATA 1YSCA 2W6CX 4CCWA 5K3EA 3AUKA 4CI9A 3DOIA 2XUFA 1BU8A 2QKYA 4UBKA 1BCSA 1AZWA 2WQZA 3NWOA 5HFAA 3EBLA 2ZYSA 2FJPA 2OCKA 2CJPA 5A2GA 3OC0A 5KWIA 4Y2SA 2BGRA 1VZ3A 4LXIA 4J0JA 2ZYIA 1LPBB 3ICWA 2O2GA 4BYMA 5IVIA 5ALIA 2CZQA 4I3FA 2Z3WA 1O6GA 3QITA 1CLEA 1FFBA 5ALMA 1XRRA 5HCUA 4B81A 3R3XA 3V1MA 2HA4A 3KSRA 1E3QA 5K5EA 2Y6UA 5JADA 3NOXA 4Y2VA 2BAGA 3GELA 5ALEA 1XLUA 3IUMA 1BEEA 1XLWA 3O9MA 4OB7A 4X6XA 2PUJA 4B80A 2XUPA 3G0DA 4C4XA 3JWEA 4L0CA 4QDTA 2AJ8A 2R8BA 1VJ5A 1AC5A 2D5LA 2G5TA 4BTVA 5AKGA 3WQHA 3C8DA 4I4CA 3D7RA 3PDCA 3IUJA 5ALYA 5AKIA 1HL7A 1OXMA 2B20A 3S8YA 4UHFA 4WDQA 3F8SA 1O6FA 2C0PA 2WFLA 5A7GA 4M0MA 5E4JA 1ZI8A 2XMRA 1SCKA 1Z68A 2RGUA 1PJAA 1H22A 3V9AA 1THTA 3DNMA 2HA2A 4EB0A 1LPPA 2WLSA 1USWA 5AKXA 1E89A 3R3UA 4TVKA 1CUDA 2EDCA 5EFZA 2HA5A 3AIKA 1AGYA 3UMJA 3QBJA 4U2BA 1CUVA 5AI6A 2E3JA 3IIIA 1H2XA 2PSDA 1MX9A 1QIHA 1CUFA 5K3FA 4H35A 3Q0TA 2CMFA 3WKBA 4BVKA 4WY8A 2FUKA 1EK2A 3PF8A 3U1TA 5BWBA 4S0XA 2QOEA 1BROA 5AOAA 4OSEA 5CH5A 3AIOA 5CT5A 3RLIA 2VT7A 1VXOA 2QRUA 1CVLA 1ETHA 3CN9A 2XT0A 3KOOA 3VJLA 5JAOA 5LZ4A 2XDWA 3LIPA 1YR2A 3PUIA 2QT9A 3UUFA 2Y1KA 2WIKA 5AI5A 1KU6A 4ITVA 1UOPA 1VXRA 2BGNA 1YASA 4GXNA 1Y7IA 4HXFB 4GBGA 5LZ5A 4X93A 3YASA 1E8DA 1PV1A 5HK8A 5CW2A 4Y7DA 2C4HA 4FDMA 6YASA 4NS4A 1IZ7A 1MT3A 1DT5A 1XZBA 2DQYA 1CIJA 2W22A 5HFNA 2WUGA 3CXUA 1A8SA 2J3QA 3D2BA 5ALKA 3FNBA 1G5FA 1CFJA 1UKAA 2H7CA 3MUOA 2O2HA 5T4EA 4W63A 3L1HA 3ESCA 3QPDA 1CEXA 1TCBA 3EF3A 2AJLI 3VVLA 4AX4A 4G4JA 3QMMA 1EX9A 3SC2A 3FWHA 5HF8A 3L1JA 3STWA 3IUQA 3FYUA 4INZA 2XUQA 2ZYRA 2JIDA 3BJRA 4L9AA 2DQZA 1JMKC 1N5MA 3W06A 3H17A 2XQGA 3OURA 4LHEA 1Q0ZA 4OD0A 1J07A 3WKCA 1UKBA 3STVA 4M0EA 1JJIA 3JW8A 4FLFA 5DTIA 2VAXA 5D3KA 4B7ZA 5DNVA 5DNUA 4OPMA 5AM4A 4AN0A 1XQXA 4EY7A 1JKMA 2G4LA 4WFKA 3FSGA 4QDOA 1DU4A 3UUEA 3V1NA 2WJ6A 1CUJA 4QWWA 4N5HX 2CUTA 5AK6A 1YAHA 3F96A 4PF1A 2XQKA 2ZJ6A 3I6MA 3ICVA 1XZGA 5EIAA 3C8HA 4F21A 3QMVA 3W05A 3ILSA 1W1IA 1XRPA 1VE6A 4HVTA 5JAPA 4UHDA 2HFJA 5C81A 1RWQA 2PX6A 3RK4A 4Q05A 3W9BA 3AZPA 1HBJA 2VJAA 2OCGA 3HYSA 5I9IA 3E1GA 1BS9A 1GPLA 2QTBA 5ALTA 1H2YA 1QIMA 4Y2YA 1QOZA 3I28A 4X95A 5KBYA 4MYDA 5AIAA 1E8MA 5E4YA 2QZPA 5AM5A 2XMCA 3G9XA 3H2IA 1X70A 5DYYA 4CG2A 4X92A 1THGA 3ZI7A 5CH3A 3ZV7A 2YXPX 3U0VA 3OM8A 3TRDA 1ZOIA 2I78A 4QDZA 5JASA 3WJ1A 1GXSA 3IVMA 4Y2TA 2GBIA 4G4IA 4IH4A 3WL8A 1Q83A 4J0IA 1K5PA 1QIGA 1MTZA 3DLTA 1WB6A 1T2NA 2OGTA 1A7UA 1XQWA 3OOSA 3QM1A 5FRDA 2QXTA 1MX1A 4PW0A 1U65A 1P0PA 4LXGA 4BDTA 3D3NA 2WUFA 2PPLA 5CT4A 2HU8A 4HXEB 3C6ZA 4RPCA 5AKHA 2RHTA 2HRRA 3FVRA 1CRLA 1ZJ4A 4G8CA 3QMWA 2JGFA 5LYYA 5HQ3B 4KEAA 1P0IA 5A71A 4UBNA 5HZGA 1UT6A 1HQDA 3C70A 1DWQA 2VJCA 2CEKA 3HC7A 2HHAA 2XUDA 4RGYA 3M3DA 1EVQA 2HU5A 4UUQA 1T4MA 1OCEA 1HLGA 1RYYA 4KRYA 4BVLA 4X6UA 5AKZA 1F0NA 1YAJA 3WWEA 3C87A 2WHQA 1X2BA 5LP1A 3AJAA 3KD2A 2WSLA 4W1RA 4LKOA 4UBJA 5ALLA 1DQZA 5AICA 4KRXA 1LBTA 1FFEA 2RONA 1F6WA 5AOBA 4AQDA 1L7AA 4H7KA 1CPYA 4GI1A 4DMFA 4KE8A 4CCYA 2BUAA 4JH0A 4BRZA 1N8SA 2WU4A 2WILA 4FHZA 3G9TA 2JGJA 3EQ7A 3WL5A 5LKAA 1XRQA 3WIOA 4FBMA 1GT6A 2XMDA 4OU5A 3KWFA 4Y9SA 4KE6A 4KE9A 4ZI5A 1R9MA 3QVMA 4EZIA 4DNOA 1ZD3A 2QUAA 2Y2UA 3R3ZA 4E14A 1IUPA 4BC0A 5AK3A 1SCQA 2IIVA 2GZRA 5AHXA 2PSJA 4WFIA 3MVEA 3RKSA 4FMPA 1JI3A 3WYNA 3DKKA 1BEZA 5AKKA 4J03A 4P92A 5ALQA 1YS1X 2WIFA 3VISA 1XZLA 2DHDA 5FPQA 2RI6A 4MEAA 3MGAA 1EA5A 2I03A 4FWBA 3PE6A 1LNSA 4MJ3A 1GQSA 1TCCA 2Z8ZA 3N2ZB 4ZWNA 4I19A 2H9YA 1JMYA 4OUKX 4HRYA 1FFCA 4NVRA 3R3YA 3IULA 3VDXA 4QEKA 5DNWA 3HI4A 4UFOA 1JJFA 3W04A 3DL7A 5LZ7A 4G8DA 2JEYA 4UFPA 4JYMA 4V2IA 2V98A 2D0DA 1FSSA 4MWTA 2WUDA 2HDWA 4X91A 1G4HA 5ALNA 5ALDA 2XUHA 4OYYA 5A7HA 4KYVA 3C45A 4M0FA 3T4UA 4G5XA 2B61A 4J0KA 2WM2A 4PSCA 2CB9A 1XZDA 1L7RA 3O4HA 2HRQA 4BBZA 4C01A 1AMNA 5FPPA 1EK1A 1QONA 3VKFA 1LPNA 2V9ZA 4Q3LA 1W76A 1VA4A 4YASA 2Y6VA 5C8VA 3CCBA 3PI6A 4AMYA 4QLOA 3WZLA 1GKKA 2Q0XA 3LLCA 4PQEA 1JU3A 4AO8A 4N8EA 1EDDA 1UK7A 2H7XA 3H2HA 3NGMA 4UHCA 1XQYA 2RIPA 4B9AA 2DFPA 1UXOA 5JIBA 5EGNA 2HA7A 1EB8A 1J06A 1TKRA 4DSZA 1DQYA 3DKRA 1QIDA 3D59A 2VEOA 4LXHA 3GZJA 4AN1A 4B83A 1QTIA 3R41A 2WG0A 3I6ZA 2JBWA 2XB6A 4FNMA 3AIMA 2XE4A 3R3WA 5BWCA 5CT8A 4J3JA 1XRMA 5K3DA 4C89A 3F98A 2GBCA 2XQFA 3KDAA 4EY6A 2I3ZA 3IA2A 4TGLA 2ONCA 3LP5A 4ZREA 3FOBA 2HFKA 1BE0A 3WK9A 3H1AA 4N8DA 2FX5A 4Y2JA 3HLKA 3PICA 3STYA 3WLAA 4ZRDA 1MJ5A 3WK8A 1JJBA 3I1YA 1MN6A 4XIIA 3E0XA 3V48A 5ALHA 1EI9A 1MAAA 2WHPB 4QNNA 2VA9A 2PKYX 1EH5A 4EUSA 1GGVA 3WK4A 3H2GA 1H23A 1NU6A 4BVJA 3BL8A 4H7FA 4CIBA 2AJDA 3ESDA 4AO7A 1VKHA 1QJ4A 3AZOA 1YS2X 2HA3A 2JEZA 2QUBA 1XKLA 1R50A 2WTNA 1ZGCA 1XZCA 4BCDA 4PSDA 2ACKA 3C6XA 1Y7HA 5T4BA 5JALA 4KAAA 1W6RA 4G9EA 4G8BA 2HIHA 4B0OA 4L72A 5AM1A 1DX4A 1MPXA 2GYVA 3H18A 4RE5A 2LIPA 4AXBA 1ZD4A 3WYDA 1QZ3A 4FTWA 1X2EA 3ZPXA 4FOLA 3W2TA 1P0QA 2OAGA 2WIJA 5AK5A 4Y2PA 3C43A 4Q1VA 3VXKA 1CUBA 2XLCA 1WOMA 4X94A 5AIBA 1EDBA 2PUHA 3DJYA 4U2EA 1KU0A 2H7YA 5JD6A 3HZOA 2B4KA 4J0HA 3WWDA 3SX4A 2V97A 4IO0A 1XZIA 5JAUA 4FLMA 5K3BA 4MYSA 5LKRA 3G0GA 1DWOA 5EI5A 4X90A 4A23A 2PU5A 2UZ0A 2OLEA 2O2IA 2DHEA 4Q34A 2PSEA 4H77A 1XLVA 1EDEA 4IH1A 5I7UA 4E11A 2OAEA 1VLQA 1FFDA 2XQJA 5H3HA 3FLBA 4GEGA 1BCRA 4U2FA 3WA7A 4RE6A 2BUBA 3HSSA 5EIEA 1XZMA 5FXMA 3HJUA 4B85A 5C8ZA 2HL6A 4ARBA 5LZ9A 4OU4A 4P93A 1DT3A 2XUAA 4B0PA 1CUXA 3DCNA 2OQIA 1ZIXA 4HAIA 5CRIA 3BXPA 3WZMA 2ACEA 4JUIA 3AILA 4GWLA 2PM8A 4UFNA 3DQZA 2X76A 3LIIA 3GUUA 4HZGA 2EDAA 5AM2A 4GW3A 2RHWA 5AKYA 1QLWA 4GLBA 1R3DA 5CXXA 1MNAA 1ZI9A 1UK8A 5BOVA 3STXA 3K9BA 2XI4A 3QH4A 5CT9A 4FFVA 3K2IA 5JATA 3BWXA 4BZZA 1WHSA 2X8BA 5FOQA 4UBOA 4UBIA 4J0GA 5D6OA 5FUMA 2ES4A 1HDEA 1GQRA 1R9NA 4PO3X 3I2JA 1MAHA 3BF8A 4GDMA 4Z49A 1QIFA 4MEBA 1QE3A 1Y37A 2C58A 1EINA 3A2NA 1UK6A 2XUKA 4Y2UA 3F97A 1BRTA 1TCAA 3WA6A 1XZEA 3FSGD 5FKJA 4QE3A 1QO9A 3M83A 3VJMA 4U2GA 4EA6A 1XKTA 4DNPA 1ZD5A 2QM0A 2J4CA 1ACJA 5K3FB 1RP1A 2I3DA 3WIBA 1CUAA 3I2IA 3RM3A 2ECFA 2C5GA 4PV7A 3C6BA 2G63A 1B6GA 3GA7A 4YK7A 4P08A 5JARA 5C8XA 1J2EA 3S2ZA 5SYMA 2K2QB 4QLAA 2V96A 3ANTA 4EY8A 2QVBA 2ORYA 4U2CA 3BIWA 4DSAA 5ALSA 1XZFA 1BN7A 2Z5GA 4P9NA 5KWJA 4J0CA 5CTAA 1CUWA 3WJ2A 1UWCA 1C7JA 3K6KA 4DGQA 5IVDA 1EB9A 2WIGA 5IVHA 1LPAB 1W4LA 1SOMA 4BP8A 3D2AA 3WWOA 3IURA 5AM3A 5EHNA 5ALVA 3O95A 4QA9A 1F0PA 2C5FA 3ZLUA 4WDRA 1MU0A 4WJLA 3I1IA 3DYVA 3LS2A 2O7VA 3DEAA 1PFQA 3FYUB 4UHEA 3QYJA 3AINA 3T52A 5FDFA 4Y2QA 2JGEA 3FAKA 2VF2A 4C4YA 4WY5A 1UZAA 4LYEA 5EHQA 3DD5A 4AZ3A 2YYSA 3CCCA 4CG1A 4NZZA 3EIOA 4Q3KA 2WKWA 5A6VA 5AK4A 1UFOA 2WIDA 4OYLA 1J1IA 3O4GA 1XFDA 2C7BA 3WWCA 5BV7A 4X00A 4MWSA 5DWDA 3WK6A 3ZLTA 4BAZA 4G4GA 2JGLA 3HACA 5D7BA 4H0CA 1WPRA 1DTEA 3A6ZA 3HXKA 5ALOA 3STUA 1BN6A 1JU4A 1CUZA 1A8QA 4N8SA 2G5PA 4J0DA 5AKJA 3WKEA 4G1FA 4BE9A 2WU3A 3FCXA 4A5SA 5AOCA 1CUYA 1ZICA 2WG1A 5T4FA 2RAUA 4Y2XA 3WWPA 1N1MA 2XMSA 1XQVA 5AI4A 5LIPA 1ZGBA 1QFMA 1AUOA 4H7EA 4E15A 4D9JA 3EQ8A 4OB8A 1HKHA 4ZV9A 3A2MA 5JZSA 4W1PA 1U8EA 1CV2A 3PF9A 4DLNA 4X85A 1UOOA 5C7YA 1NU8A 2X5XA 4B82A 4DYHA 1AQLA 1AX9A 1SC9A 3L1IA 5DYWA 1SCIA 2J3DA 3FCYA 2C0QA 2VQ6A 3G02A 4UBMA 3WMRA 1WCYA 4L3WA 3G0BA 5LLSA 4Q82A 3W9UA 3G0IA 4H7IA 5ALFA 2WJ4A 2CKMA 4FLEA 3D4LA 5ALRA 1K4YA 1Q0RA 1DWPA 4UHBA 3X3HA 4JNCA 1CUUA 4DIUA 5IKXA 3OPMA 1MO2A 1ORVA 2BCEA 5HKBA 3VVMA 1XRLA 2GYUA 4WCVA 4BCCA 3JYHA 2OQVA 4MQLA 4B9EA 4HRXA 2PU7A 4JEIA 2WJ3A 4XVCA 3O9VA 1NX9A 5HF9A 3H2KA 3H0CA 5F4ZA 5JAHA 1D07A 2VSQA 2DCMA 3TEJA 1XZKA 2XUJA 3O0DA 1YCDA 4KR0A 4CG3A 4H7JA 3DDUA 5CBKA 5DYTA 1WPXA 3DOHA 1ISPA 4X3CA 3AZQA 2ZSIA 3CN7A 2BFNA
chains in the Genus database with same CATH superfamily
4NOKA 3QBVA 5E6UA 1KF0A 3AEQB 1RLOA 5ELMA 2QJWA 3UQZA 4QU8A 4CM1A 4DDMA 1QC5B 5FHQA 1ZJ5A 2BWJA 2JI9A 3QHAA 4FIZA 1RLIA 1B1AA 2X1HA 2YR0A 5D8DA 4DN6A 4ZOQI 2OXEA 4US1R 4WGGA 4F8JA 5CB0A 3R8FA 2MJLA 4B4KA 3P5SA 2AFHA 4EF4A 2JAOA 3I2KA 1ZK2A 3OMXA 3OPVA 2IIBA 5E0OA 4QYIA 4UKDA 2G6BA 4TVOA 1WU7A 1YS7A 4EYGA 4ZO9A 2QUZA 1CVIA 4EJFA 2BGTA 3KE9A 2XGMA 3JQ9A 3USCS 2OSVA 3OLYA 3SBOA 4N48A 4RLHA 5FOVA 3UBTA 1WHTA 3MUNA 5FF9A 1JPNA 2AHRA 2QGZA 1IN5A 5BNFA 2CNKA 4O02B 1R5BA 4RHYA 3TXAA 3V55A 4YX9A 5JC1A 1JEDA 2ODWA 1DGQA 4CZ2A 4ZVOA 3U4DA 4ZDIA 4O4LB 1DO2A 2VPXA 5CJ2A 2A4KA 1A8PA 2BZGA 3OPNA 4JX9A 4JYPA 3FR7A 1KOGA 1BSVA 1QBKC 1JR4A 2ZPUA 3D6FA 3ACBA 3HCFA 3QXHA 4XD2A 1XMIA 5E7MA 5FTMA 2R3SA 3I04A 2ZKIA 5DHUA 1XXHE 5DM4A 4ENVA 4F86A 2WYHA 2DF8A 2JFNA 4P4SA 5FOTA 5I01A 5CCBA 4ITUA 5LD2B 3IXQA 1CQIB 4GECA 4NBKA 1E5TA 2PX3A 2J31A 1EUQA 4CXMA 1BHQ1 1IUNA 2JPDA 2XOKA 4QXAA 1T3HA 2FQXA 4QTXA 3VO1A 3SY8A 4YIHA 3GGSA 5EXPA 1QHNA 2EYUA 4J6FA 4ED9A 3RBXA 1XRSB 2G82A 1PCXA 1U2EA 3FPGA 3TX6A 1MRSA 1R64A 1TPYA 2VRCD 4NPAA 5LZ2A 2UUBB 1XMXA 1JI0A 2RBGA 4ONEA 4E7PA 2OV6A 2FPIB 1RACA 4RENA 2N47A 2YBEA 3DHVA 1NAHA 3C3BA 4ZQCB 3W8EA 3OWOA 3I6IA 5CMLA 4JV5B 5DOZA 1JHAA 1P5ZB 2B21A 1T2FA 1D5CA 4YCMA 4RMNA 4EB8A 1RXCA 1FJ2A 4GVXA 2QMZA 2PD4A 3GAAA 4YBZA 2A7XA 3U81A 1QV9A 2V59A 2Z5LA 2EW1A 3M81A 5D3ZA 1XPRA 1IBKB 2DWUA 2OCLA 1UFQA 4K40A 3SHWA 3W78A 3QVWA 3AR7A 3RU7A 3HJHA 4YUAA 1BE8A 2IITA 4H16A 2C57A 5EIBD 1Q1EA 4F71A 2OO7A 2P91A 1IVYA 1ZJJA 4XX0A 3NHYA 4OHBA 3G5UA 4LC0A 1V7PC 2JBAB 1H1LA 1KZYC 2UYGA 2ZUWA 3ESBA 3JQ9C 3K30A 3KKZA 1SQ0A 4RJLA 3FCEA 1QR6A 4PHGA 4Y0NA 4BLTA 5ENDA 5IAJA 4B76A 4Y98A 4BE7B 2OY0A 4ZGBA 3A3YA 3INTA 1ZRNA 4DLWA 2I3GA 5L8VA 2ZATA 4QUHA 2ZZMA 4LBVA 2PZLA 4CCYB 3O4IA 4OLBA 1UBJS 4CM8A 3ITEA 1B2RA 3OPYB 3MXOA 3PCRB 3TB6A 3HVHA 4ALNA 3H19A 1QHHB 2INGX 3JWHA 1GYRA 1XHFA 4IW3B 2QU8A 1JHZA 1U5BA 2Y4OA 3GT3A 2RKOA 4GYJA 4P4NA 3LLMA 3OUUA 3HN6A 4FGUA 1XRNA 1ZRMA 3H87A 1FMLA 5E4FA 1D9XA 2Y1DA 2GZ3A 4YMTA 4MO9A 3AUYA 4NK5A 3MB5A 5L3QB 5LMCA 1R74A 3RVPA 1FVFA 2J9GA 4JJ7A 3GXBA 2EV9A 4EO4A 2GKOA 4QQRA 3TW0A 4IILA 5HIKA 3P8ZA 1LC0A 1Y8QB 2VLIA 4OK6A 5A62A 3ITNA 2MIIA 3E58A 3UJ9A 3WY9A 3SBXA 4XTCS 1QTQA 2GS9A 2I7VA 3T8YA 3ER9A 1GGHA 1B93A 3NIBA 4PZPA 4BCBA 1KNXA 2B4TO 1M8GA 4EQ6B 5I47A 2Q8QA 4QG3A 1QMGA 1KYXA 2QYHA 3GDHA 1JB1A 1I4WA 3QE9Y 4H7DA 3L7OA 5FYQA 3PPXA 3LTNC 1LDNA 1PBNA 1PFYA 4IMPA 1Y63A 5IHXA 4HWRA 1RVDA 3NP7A 5FL3A 1FTQA 1L4HA 3SCZA 4YJ2B 1I6MA 1LVHA 4FJ1A 4U2DA 3WFIA 3WYFA 1I7QB 4IZOA 5A7FA 1O58A 1W2GA 4K9NA 4K46A 5CVUA 5DX0A 2RH9B 3LY7A 4QJ5A 1FSZA 2VSXA 3VR6A 3WVNA 3A2KA 1OBCA 1ULAA 4FSXA 1UKYA 5E3HA 2NU7B 3HR4A 5DWVA 3FYDA 4JFRA 4LRWA 4AUMA 1M2OB 3LPNA 3V8VA 1KO5A 2FMXA 3GZ4A 3SJUA 1OLXA 1Y6ZA 2J9FB 3PTZA 1IBLB 3CV3A 2D1TA 3WJ7A 1EP3B 2VT6A 4GAEA 1AY0A 5KNDA 4PZUA 3UGQA 2R8ZA 2JD1A 2X0NA 4LZPA 3SS8A 1CNMA 1ULTA 3BILA 5I8PA 3SAJA 1HEUA 2YZGA 4DZRA 4BFXA 2BRUA 2XCSB 3GDOA 1LB1B 3VYWA 5JAZA 2H07A 1PFVA 3LC2O 4IUBS 2CNWA 2P1DA 3VR3A 3C5VA 1AKNA 1BAPA 3FFBA 3PSHA 5BORA 3F8TA 2LV8A 1BFDA 3AV3A 2O2ZA 2ZJAA 3RJZA 3RT1A 3LT5A 4E1BA 3T1TA 1FNDA 1UC9A 3OY2A 3O1JC 5DGCA 1B8VA 4HS4A 4D26A 1PI3A 3FCOA 4U9UA 3LGXA 4YVFA 3QEMB 1M0SA 4K5QA 2QWXA 2ZRCA 1SB8A 4M46A 1E9RA 3DVQX 1Q16A 2HPHA 2R5WA 3TLBA 3RTCA 4JLWA 1L8OA 3SQXA 5FFMA 5CVTA 1BHSA 4H7HA 4PRLA 3RAFC 2IU6A 4PX2A 2XA9A 2NZ8A 5DI3A 1JA0A 4ZAZA 4YWHA 3J80A 1PLKA 4BBJA 3CLRC 2CN1A 2ODEA 1II8A 1YC2A 3OCUA 5SICE 2C4KA 2VS1A 1Y4ZA 1U2PA 3DO6A 4BHTA 1WXXA 4OKIA 3VHQA 2JGIA 3ZG6A 4C6TB 4GWKA 1I01A 2VC2B 4I7EA 4MW2A 3ECSA 4F60A 5IBQA 1A82A 1MKYA 2P6MA 1E9VA 3OG9A 4GIBA 2Y68A 2ZYHA 4E5KA 1UBEA 1Z08A 2IW1A 2P11A 2QENA 1WMFA 2JNWA 2YNMA 3LHSA 3Q8WA 4HLNA 4KCGA 4M0PA 3ZQUA 1ACMA 4JDUA 4GI2A 3B1WA 2ZRMA 7YASA 4NCKA 4PLHA 4UOQA 2AB0A 4MUNA 4YCJA 1NYTA 1L4KA 3MUFA 4JNKA 4LHSA 5AUNB 1L5SA 4F84A 2YS7A 3CE6A 2WQ7A 1RJGA 4GR5A 2C83A 3OKPA 4E5NA 3T7AA 1H2HA 4NWIA 2VJDA 4KR6A 1ARZA 3EASA 1G0NA 3PWZA 3S40A 3WDMA 4PZ9A 1IL0A 4Q3BA 5BR7A 1UBNA 1K1EA 4CR8A 3V1TC 1Y48E 4C14A 1FMFA 4A0HA 1K3FA 4HDQB 3FMIA 4RIIA 2Q07A 9ABPA 4UZFA 3NC0C 3QFRA 5SYNA 5JQGF 3KUDA 3ILYA 1URPA 5KNDD 2X9VA 4CIAA 1FBTA 4PSUA 4IFBA 3VZRA 3GLHE 3Q3IA 4RDXA 4XTRA 4Z53A 2FN9A 2DRIA 2PXAA 3A6GA 3DMRA 4DQVA 4FFNA 5HKLA 3HCRA 3OD5A 2PGIA 3TQFA 5H59A 3QVSA 2I99A 1H65A 3AUFA 1PQYA 4DBLC 3DWFA 4Y1GA 2IH4A 4OF4A 3K1JA 4IOLA 1G55A 5AJHA 1JLRA 4K03A 1ZL2A 4QDUA 1YB7A 1YE5A 1Q3HA 4OMCA 4OYHA 2AK3A 4A03A 1TLFA 1YA8A 1KI7A 1Q3KA 1TO1E 1RLMA 1WVMA 3PFFA 1HOTA 2O52A 2ON6A 2NSYA 2AN4A 1FP4A 3IEXA 4TTPA 5AHKA 4QBFA 2GQ0A 1S2LA 2FX3A 2R48A 5T4HA 3WK5A 5AVRA 1DAHA 4COKA 2TMYA 1CQPA 2A9KA 2KJQA 2A1IA 2GA9A 2H5EA 1FXWF 2Q45A 2RIRA 2ZBFA 3BE8A 3BRWA 2QAGC 3R4CA 4J9UE 3OQPA 3TZKA 4IIJB 3PUWA 3TCNA 2WV7A 3W8FA 3PE3A 3RARA 2H6EA 2YUTA 1EXDA 2VBFA 3EXAA 2PEYA 2JLYA 1OZHA 4X63A 3SZ3A 3VNQA 2RK4A 1BO6A 1UP4A 1SKQA 4PZEA 3KU4A 3M89A 4AMZA 4EBBA 2P2SA 3U4IA 4RPGA 3ZWQA 5ITZA 5JT1A 5B1SA 3V8EA 1EK0A 1AHPA 3ZWKA 1ORWA 4O4IF 4XOIA 4ZCRA 1OZ0A 1P33A 1RQNA 2F3UA 4Q47A 5CURA 2O8CB 1MZPA 4JLVA 2JLVA 4RACA 2D2EA 5AUOB 5ILOA 4AB1A 4UNIA 3QKSA 4GC9A 3USES 4JU8A 2C7QA 1YRWA 2V5VA 4ZU1X 2QLMA 2D7DA 3PGKA 2NG1A 3TM4A 2GD6A 1U3CA 3WGKA 4Q4CA 4B74A 1SK8A 1TVMA 1ACLA 1UPFA 3H1PA 3M3PA 3HN7A 1N3LA 3CH7A 1A2BA 2F3TA 4MV5A 4D2IA 2CNLA 2JK0A 4RZUA 3SXUA 3VHXA 2DVMA 1ESCA 4EW3A 3Q11A 4FUTA 5FORA 4BMXA 4BWVA 3PGMA 3KJFA 2GKSA 5E8RA 3WLSA 1G2IA 1FOEB 5SZJA 1R4NB 4M0CA 4WNAA 3THWB 2I9KA 4N0MA 1XEWX 4NZOA 2PEZA 4AXXA 3JYOA 1NFRA 2KBEA 3QFCA 5I7SA 1HDYA 1SH7A 2PBLA 2FKAA 5DTJA 5DSTA 3HBNA 4UATA 1QK3A 2HBQA 3II6X 3O5AA 5GONF 1D4ZA 2WFZA 4LDPA 5HMLA 3TDNA 1WS6A 3KQOA 3GZNA 3EOZA 2Z43A 3BJMA 2D1RA 4YRFA 3GJQA 5U4XA 5EC8A 3LF2A 3OWHA 1O03A 1Z0JA 3KZ1E 4RFLA 3RRYA 5CA0B 4OQFA 5F9HA 4EKNB 1VIMA 4M9ZA 2MR6A 4JT9A 1PWXA 2YV2A 4FOSA 1O94A 1XXHB 1IJFA 2VJBA 1ODCA 2Q2QA 3BGOS 3D5EA 3L5OA 4KIUA 4DCTA 1C1HA 1KOFA 1AN0A 3AJ8A 3IRUA 3LUJA 3OPYI 1PJ3A 4N7RA 5H70A 1HV8A 3PNQA 5CH3A 1P6XA 1UJ5A 5JR3A 1TAHA 1K9SA 2BMEA 3MJTA 1R9GA 3TRJA 4X6LA 4Z0TA 1TB4A 2APJA 4BB0A 2Y2VA 4LDJA 3UWDA 1UJMA 3ILXA 2WVGA 1I0IA 1IUOA 4RPKA 1P5JA 5AW6A 1T9ZA 2J4FA 1E1QD 3L7MA 3NHMA 5JCZA 4NNJA 2IQ5A 2ONKA 1EWVA 3NAQA 4DUPA 4FWTA 2HRZA 5HMMA 3NI2A 4ARAA 4BBPA 4F4CA 1LRKA 2W8ZA 3P2EA 4I55A 3EARA 2IEBA 4EGSA 1VBMA 4GOOD 3PC8C 1JLLA 3QPVA 4ZPXA 3ZJUA 2WWIA 4JC8A 2WAXA 2AN1A 4PC3A 4JUFA 3WR5A 4UD6A 3ZTWA 1QUFA 2MSEB 3JS5A 5DGTA 2WINI 3U7QA 1LTQA 4NCNA 3H86A 3IIKA 3QUSA 2WYWA 5H68A 2QVLA 1QGZA 4EUFA 1EFVB 3LDHA 3MCUA 1DV1A 3DPUA 1IZYA 4DNQA 2QROA 2D1SA 3FGNA 1X9HA 1V3UA 1YOVB 3L1VA 3LMKA 2C2GA 3PDIA 3ZEAA 2BFMA 3EFOB 1KVSA 2DH5A 2WWFA 3OUTA 4JS0A 4P98A 1OFTA 5SY9A 1L5GB 3B8EA 4OXKA 3CZAA 2B8NA 4Q03A 4M4SA 3DBRA 1Z7BA 3QWHA 2J9YB 1DKQA 3A6JA 5DKFA 3U3OA 1VRVA 2C4VA 1JKIA 2QX9A 4PTZA 1SMKA 2OGWA 4UQOA 4UTPA 1A7KA 2GARA 3FUVA 1M76A 3PENA 1QRDA 4J91A 4G6ZA 4PHHA 4OVKA 5INTA 2O1WA 5IJ0B 1YUBA 3KVRA 5KQLA 2Y05A 2YN0A 1QMPA 4JBNA 3H5TA 3I9MA 1V3TA 4LYJA 1O94C 3JU3A 1TAQA 4L9WA 3A7EA 3NUQA 4PANA 5D86A 1TI7A 5D3MB 2IS6A 4FINA 3RHFA 4MNTA 1RI2A 4KQCA 4X20A 4PPNA 1ZO8A 3OJFA 5EJIA 3ZZUA 1SCBA 4CIDA 5J2TB 2CSXA 2FWNA 2UVQA 3AQIA 1UZMA 2DJIA 2Q41A 4P3XA 1H2FA 3AOGA 2C1EA 4DMKA 3HKDA 3PNVA 1OIWA 3PR1A 3ZLVA 1UKEA 3CNNA 3HABA 1U1CA 3C48A 4HEQA 4R9VA 1R8XA 2NWQA 3E7FA 4HNUA 5E2IA 3D1VA 3BFPA 2SBTA 3PD7A 3KT3A 3FOEC 3AESB 3D8HA 3UATA 5DBOA 4WFJA 3KQLA 1H2ZA 1ZC4A 1PN3A 1USGA 5KNBD 1N9GA 5AI0A 4Z3OA 2FSSA 4XFDA 1US8A 4Z7OB 5IM4F 5DW0A 2AG1A 2HXYA 2LNDA 2AEJA 4MYCA 5AKEA 3NBFA 3CR8A 3G0CA 1C7IA 1V37A 2KMLA 1B73A 2VO1A 1OFVA 4NBVA 4KAFA 1VKNA 2G9RA 4BWFB 2AS0A 3QUCA 1PJ2A 4EW6A 2C92A 4HTFA 5AP9A 1M5TA 5IJ9A 3CE9A 3TLYA 3NEPX 2WUEA 1WP4A 4HS9A 5FOSA 1NR7A 1I51A 4N5NA 3CEMA 2PD6A 4IVRA 2G7MC 3LZ6A 3OIDA 5BWOA 1MIOA 3E2PA 1VGRA 1Q1GA 1EVLA 8ABPA 3N0RA 1B14A 2OFPA 3NEYA 4PAGA 1RQ7A 1BCRB 1N2BA 2WHPA 1P19A 4Y1RA 4NP6A 4DXHA 4XX1A 2VTVA 1FX0B 2HSDA 1G6HA 2ADFA 4L4SA 3UF0A 3VNVA 4CKXA 2MMGA 4M55A 1M54A 4EDFA 3O9ZA 1C1XB 4QOFA 4ISBA 1RT9A 3R0JA 1V25A 5CIWA 1AGXA 4Q16A 1LZKA 3HLYA 1HFKA 2GCOA 1FVOA 1Z36A 4XGKA 4AULA 1I33A 1MXFA 4NMWA 5EQJB 1MEEA 1XQ9A 2ZUFA 3D7LA 3EG9A 3G2QA 3W2GA 5HIIA 5HRAA 4EAAA 5IUKC 1R6BX 3M6WA 3QX7A 3ZDEA 2H4XA 4DADA 4ZCMA 3CVXA 4ZV7A 3BGDA 1NSFA 9LDTA 5IKPA 4MQUA 3K2QA 5HKAA 3PQ6A 3VI3B 1VMKA 1U3DA 3JD3A 1G5HA 1XCPA 2BOVA 3KRTA 2GEUA 2W6PA 5A03A 4W1QA 4C6SA 4G65A 1XQ6A 4MW4A 1J0XO 4UHJA 3UYLA 2UYQA 3KPYA 3HB4X 4TKVB 2PR2A 3H5LA 1B15A 1LY1A 1YFKA 3NBAA 2WNHA 1YS4A 2AHOA 3B48A 5EMKA 1KAQA 5IVKA 1DEHA 1XL0A 2A35A 1JHPA 2GJKA 3C0KA 1GTMA 3LI2A 5DBFA 3HZRA 3HXPA 5EMHA 1FF9A 5E38A 2K7ZA 1H3EA 2ZETA 1ZGJA 4A8HA 2YASA 3HJAA 3K8ZA 4RJ2A 3KP1A 4YDHB 4U7GA 4S1VA 1UZNA 3BC1A 2P8SA 3L01A 2DU8A 2CNBA 3W7VA 3WAGA 1NBMA 3VPGA 2M32A 2V3CC 3BF7A 3VYTB 5KTRA 1QPBA 1W52X 1Z8HA 4PYMA 5CPFA 2IOQA 3JWGA 1IMJA 1S2DA 4JC4A 5EYPB 3RD5A 2V0GA 3UMSA 2ATXA 3LAWA 3GLKA 4KH1A 3FGPA 4XWAA 1CZUA 3LUPA 5FLKA 5JD4A 1O9BA 5K7SA 2GZ1A 2VOEA 1AV7A 3EISA 1HQCA 2FR1A 4DV4B 1Z13A 4RHXA 1ONBA 3MMSA 3KXIA 4GNKA 3DAGA 1Y1QA 4L6AA 3F6RA 4HH1A 4AC9A 2VXCA 2OHIA 4YLYA 4V3CA 1BS2A 5K3EA 2ZVPX 2H2HA 1XWIA 5DF1A 1GG9A 1CFZA 3KJIA 4MGZR 3IT2A 5HZHA 1X1BA 4DJJA 3Q6IA 1HE4A 4YGXB 2OZVA 1XEFA 2D00A 2DKOA 5J63A 3TINA 4CI9A 2FHPA 3QHPA 3W2IA 4CUKA 3EGDA 2HTFA 2OHVA 1BU8A 3AGQA 1RRPA 2X8AA 1O6ZA 2HV8A 2OHGA 2QKYA 3ETNA 3O2JA 1AZWA 1T0JB 5EPOA 4B6JA 4OHFA 1TU3A 3QVKA 2PUWA 3NWOA 3OC6A 3N7UA 2DTXA 5HFAA 1WPQA 5KVCA 1J8MF 2ODBA 4AKIA 2VHJA 4GKJB 4YCNA 1ZH6A 3P0JA 1ENOA 3WJAA 4EAQA 4YALA 1G60A 3FZQA 4U9HS 2BI7A 5KWIA 2EERA 3HL0A 2FZKA 1JMVA 3EVZA 4RZIA 5IXJA 3THXA 4WTOA 5J2UB 2COUA 3OAAD 4ZHQF 4BGEA 2OO5A 4HGYA 2ZYIA 5AWFC 5TR9A 1HE2A 3REFA 1GUBA 1LPBB 1UZLA 3VSDA 3ZDXB 5AHWA 5DSZA 3PA6A 3RE1A 3NEAA 4F1KA 1Y6GA 3D8SA 1E58A 3NTQA 4FILA 5ALIA 2V7VA 4M7WA 3TSYA 2RGNA 1X1AA 2XDQB 5DI9A 3UA4A 1S3IA 2QRQA 1FFBA 4RTLA 4JYCA 4Q9NA 3ER8A 1E5LA 1XRRA 1D1PA 4B81A 3LYUA 4U4AA 3V1MA 2VSOA 4XDYA 4RFSA 2XRZA 1V1RA 1YQ9A 4M8NE 4BWGA 1G2PA 4BNKA 1DOHA 4TXJA 4PQRA 5I4KA 5I7EA 4RTPA 1UPBA 2AN5A 3ACDA 2ZBVA 4PLYA 3EGIA 1I7DA 3U4AA 5EN4A 3L4SO 1K7FB 1L4YA 1Z4PX 1NW5A 3PDHA 1HFEL 1I4EB 1Q2UA 2QW0X 4RD1A 4Y2VA 3SR4A 3GELA 3UFXB 4BJ3A 1Y89A 1AK9A 4BV3A 4F6RA 2HCBA 3KOUA 3F47A 3L84A 3NVDA 3FNEA 3GPDG 4HMQA 1GQFA 4PQYA 3GB9A 2QRKA 3IUMA 3ICQB 5E7IA 4FR0A 4OB7A 4PZZA 4X6XA 4CMIA 4RGQA 5JCOA 2VJLA 3HSYA 5ELLA 4MKIA 5CAEB 4OHWA 2HF8A 3ODPA 3QHQA 3FOCA 4GX5A 1N75A 1G9TA 2CLDX 1GV1A 4HPXB 2QIPA 3JASB 3U4HA 1XKXA 4RW0A 2Q3LA 4X1KA 2QJOA 3QYFA 1M6HA 1S3SA 1H66A 4OHRA 3LA6A 1OVMA 2XHZA 5JAQA 4XIJA 2ZSBA 1FP6A 1QRRA 2H51A 3H1TA 2WF5A 1C7FA 3LE8A 5EEHA 3TTUA 2DFVA 1SU4A 1QNFA 2FEMA 2HYDA 2PMWB 4I4CA 4I6GA 4TWAA 1AOXA 2YY5A 3QELB 3PDCA 5LOVF 5JHGB 3AETB 7ABPA 2ZJ1A 1XZQA 2PWYA 2YL2A 1GRQA 3REQB 5ALYA 5LQUA 1KK3A 2WAAA 5FI5A 1GDHA 1XNRB 3S8YA 2K87A 2P62A 1SZJG 3AF4A 3G7SA 4WDQA 4AM8A 4RZHA 1O6FA 3COPA 1E0DA 2D1FA 4CEIA 3P5BA 2VRBA 3F5FA 2VP9A 4KVAA 2WHYA 3QBDA 1ZINA 2O3TA 3DZ8A 4QPCA 2OD7A 1AHHA 1B1CA 1ZI8A 2XMRA 2RGNC 1OC2A 2CUZA 4J75A 1OKKA 1UQTA 2PR7A 4B8YA 4D99A 1I5OA 5IDXA 2WHEA 2RHLA 2ZQZA 3AJDA 4H08A 4QYTA 4YUWA 1L3IA 5C2JB 1V1JA 2CDCA 4O2RA 2B94A 3N2KA 4I5DA 4NFLA 3CHYA 4DJ5X 3N6VA 1YNSA 4LC9A 3VC1A 5TVGA 1HH4A 4JJIA 2Y92A 1TAUA 4QFDA 2EDCA 1VP3A 3D6JA 3PVSA 1RWXA 3GLIE 1QNLA 2VUHB 2HA5A 5DE3A 1FTWA 3WL4A 1P17A 3V2IA 1AGYA 1KZ9A 4Q39A 3OEHD 3JQBA 4EG7A 3E0QA 4G1UC 1R2QA 3HVKA 4BFVA 5BW8A 3UJBA 2IPMA 2NSLA 3EGWA 3ES9A 4UUOA 4RDHA 2EP7A 2VOJA 3GDFA 2JARA 4IJKA 5D7NA 4AL4A 3JR3A 4JR1A 4W6QA 2A9RA 2IXTA 2NU9A 1ZH0A 3H0KA 4NDAA 4MWBA 4H0FA 4ZN6A 2G1PA 5HILA 1H2XA 3R7LA 3KSBC 3U5ZB 1MX9A 4H17A 4Z7JA 2JIZD 1CUFA 5CXSA 1X7XA 3THRA 2QR3A 1XAHA 1R0RE 4ZOEA 5E6RB 1AB6A 5TVKA 4DB2A 3UFBA 4KXFB 3H8SA 2IYPA 1KPGA 4HLUC 5BWBA 2Z6AA 1XMQB 1G8JA 2I1WA 4RXUA 4MAAA 4ZD6A 2D3TA 1F4LA 2A59A 4JLOA 4CLXA 3WOVA 4EG4A 2E5WA 3RLIA 4CGYA 2WYIA 1XKQA 2EJWA 2IYUA 2CWDA 2RH8A 5H7XA 3RW9A 1K5DA 2P30A 5EWLA 2B4RO 4YUYA 5IJZA 4R1TA 2OM2A 3LXMA 2G5GX 3EUEA 3HM2A 3OZ7A 1FPMA 1SBIA 3OCVA 3VJLA 1J5PA 3ESYA 1DIGA 4EHIA 1X80B 2QI9F 3OCJA 2NZWA 5HHTA 3RK1A 5IEJA 3FCAA 1NXXA 1TMKA 2O5RA 1IN4A 3HB9A 2PZBA 2DXIA 3GEBA 1L5FA 2OBMA 5F78A 1GGFA 3OEWA 3MMZA 3FVWA 3AEYA 4A0FA 3SP1A 3NOQA 1KU6A 1UEIA 4ITVA 1QGUB 4GXNA 1P1KA 1UT8A 4BLRA 4L8YA 4GPD1 2HCRA 3Q9LA 4HXFB 2QW8A 4EG3A 3Q72A 3UGKA 2XBUA 4GBGA 2QL5A 4OREX 3WSVA 3R6DA 2PG3A 4DCPA 3K0CA 1Z29A 3LKBA 3MPOA 4G4SP 3UAGA 1A7AA 1RYDA 5CW2A 5BR4A 5JJ5A 1FUUA 3C4QA 3JTMA 2X8WA 3JQFA 4NL4H 4EPTA 5C18A 5DB4A 1VIDA 2PFSA 4LDNA 3QENA 3D3WB 4G1EB 1NLYA 4F85A 3JQBC 5GTDA 4RM3A 1ZR4A 2CLSA 4ETIA 4RHFA 1YR1A 1CJKC 1N5DA 2IYEA 3QOFA 4K05A 3SF8A 3ZHVA 5A02A 1CU1A 3BUSA 2DQYA 3K70D 2WVHA 2R00C 2W22A 3FB4A 4YMSA 1U1IA 5HFNA 3TSWA 3ZGVA 2QX7A 3ZJYA 1M3SA 1A8SA 4KXVA 3D2BA 2REOA 2RHHA 3AI1A 3GEPA 3PUKA 5GGXA 3VU1A 4NY1A 3JQAD 2FF5A 4DIEA 1OAOA 1SPXA 1UKAA 4QM7A 4DIKA 3AIIA 4M1TA 3GHYA 4PX9A 1IC6A 1AA9A 3DDHA 2YN2A 3IP9A 3L1HA 3N28A 2ATEA 4Q4JA 3HTXA 2WI8A 4P5DA 2WZBA 1UAGA 2I7TA 4LCEA 4RSMA 1E1MA 1BDIA 1PVOA 1BDBA 4WOKA 5CFMA 4D57A 1U4SA 1XVVA 3VVLA 1ZSNA 1J24A 1DAMA 4MWZA 2AI2A 3LWDA 5KSOA 3E1KA 2ZIEA 4RTMA 2YOFA 1E60A 1H42A 3OLVA 4RVNA 1TA4A 2RHMA 3E7WA 5HEKA 3PUVA 3RYCB 5K0NA 3ZGLA 3TLJA 5G02A 3IUQA 2VCEA 3BHMA 3GCXA 2XUQA 5LDDC 3C7AA 4LY6A 1ECLA 1C0LA 3AL3A 2VPQA 3C15C 4MITA 2X5OA 4R8VA 3I9NA 4AUNA 5A4AA 1B0ZA 1KO1A 1USVA 4G5QA 3T7CA 1JMKC 4K2HA 4E32A 2FQQA 2GDZA 5EZYF 4BWYA 3AFGA 2MHCA 4AJ4A 1Y9DA 2Z30A 4RJKA 3EC1A 1F4PA 1P45A 1M5UA 2FI1A 4LPSA 2KW5A 1D04A 1EM6A 2R4TA 4WOJA 3S44A 4WCFA 2C94A 1ZQ9A 3CLHA 4Y9RA 1IVSA 1T3LA 1MJGM 1Q0ZA 4NJEA 4ZARA 5I9SA 3K0CC 2W2OA 2X58A 3RVJA 1JF8A 1W47A 3N6RA 1GPJA 3AHDA 2DCUA 2G72A 1UKBA 3FM9A 3FWNA 3GLTA 4PLVA 4ZA2A 4KQWA 1NQWA 1MRZA 5JI2E 4BKOA 3JQFC 4WZBA 1YFJA 1E2BA 1GTL1 3L7YA 1WVGA 5AJTA 4KJZA 4OHCA 3GO4A 4E2YA 1VL6A 1U5AA 4S1TA 1JJIA 2ZE8A 1TYEB 5MN6A 4HUQB 3KB2A 1C1DA 4DWJA 4FLFA 3LPCA 3RYFA 3UVEA 2L82A 2NXEA 4JJ6A 3K1ZA 4XPIA 1I7LA 1JS1X 1XUOA 2R1TA 3BB3A 1QYWA 3K0AB 5D3KA 1C1YA 3IVXA 3C3JA 4EW1A 2A9OA 3FSEA 2ZS8A 3ZR4B 5EE9A 3H13A 3MLBA 1FP1D 1BH6A 1CY6A 5DVZA 1HE1C 1QCDA 3P9QA 13PKA 4M76B 1IN7A 2WJ6A 2JAHA 3KLPX 1P31A 3ND5A 2CL0X 3VV3A 1BKYA 4C1BA 5L6LB 1ZNQO 2WSSA 3GT4A 1YAHA 1V6AA 2I33A 3F96A 3IDZA 3LPMA 4MI1A 4PF1A 2IUSA 4R9RA 4I8DA 1V26A 1EESA 3I6MA 2FG7C 1T15A 1A71A 3JR7A 1JXMA 1N6KA 3C8HA 4EJSB 5J1SB 5EP1A 1I32A 2ONJA 3ECCA 3UIEA 4RLSA 4RLFA 1SVLA 4UZSA 3IEKA 3ILSA 2E0IA 2VH5R 1ATZA 3A6LA 1VE6A 2YVUA 2R0QC 4RULA 5IVHA 1RM3A 1JPUA 3PQ2A 1C80A 5JS6A 4PTLA 1UBGA 3WGZA 4Z99A 2E4WA 2OXCA 2P2DA 4AJEA 1Z0UA 2RK6A 1NQOA 3LUDA 1KKMA 4LRSB 4HT3B 2FEPA 2CC2A 2Q8NA 1UMDA 3CR7A 3M5CA 4ZOLB 4X3PA 3KCNA 2VNHA 5H81A 5IBRA 3TD6A 3Q8MA 4LNUB 3SE7A 3UXYA 3DLBA 4KRGA 4Q05A 4GZ5A 3D8BA 2OZEA 5JJKA 1T1RA 2VJAA 1P4RA 2W6QA 2I7XA 1D1QA 1I1QB 4Y6GB 3WSTA 2L18A 4IOJA 4D45A 2OCGA 3L7DA 3JYLA 3NETA 5I9IA 1RJDA 4D25A 1SQ5A 3RS8A 4PLFA 2O1EA 2RKWA 2XTAA 3W2FA 1H2YA 4KQEA 2H31A 1HYHA 1QOZA 1ZWLA 2ZDQA 1ZEMA 1BGXT 4X95A 2NO4A 3A10A 2R6HA 3AERB 3LBIA 2KWIA 2ZVJA 4OXIA 4PZLA 3Q7QA 4LYGA 5AIAA 3GC6A 1E8MA 1SA0A 4IIUA 5E4YA 1JVSA 521PA 4DIBA 4AJHA 2XSZD 3PHIA 1TLTA 3BX1A 3MJFA 1M6NA 5AM5A 3G9XA 3OLWA 3OM1A 3R6GA 4I9NA 2PYZA 5LXTF 4C1NA 3U44A 3UB2A 3L1UA 4W9MC 1M2FA 2BMWA 4RH0A 4EHAA 4C76A 2CD7A 1KI9A 4EZBA 2B0JA 2QYTA 3N70A 5DYYA 3F6SA 4KBYA 4BN5A 2QTVA 4BV8A 4CG2A 5C52B 4J2HA 3IKLA 3V4VB 3ZI7A 3C3CA 1NFQA 2WWHA 4GQIA 2CUNA 1G7CA 1KETA 1XG5A 1GZ4A 4HGQA 4IJ5A 3F7NA 2YXPX 1YI0A 3AUXA 3M9LA 5E6SB 2R8YA 3HYNA 1WMAA 3OM8A 4BKRA 5LC1A 2DR2A 3K5HA 4BNJA 5JASA 4OQNA 4R1PA 1GXSA 1NP3A 1RE0A 1QWSA 3LWNA 1DQPA 2YV4A 3QYAA 4JMLA 5ARCA 3K70B 2GBIA 5EUMA 4PIPA 4IH4A 5CHEA 5LR6A 3V34A 4F7WA 3K96A 3JQAB 3V3KA 2JAWA 3IJEB 3K2EA 3NDPA 1QQ5A 1K5PA 2NV6A 4ZAYA 4NMXB 1QIGA 3QLUC 1XCBA 3ZKWB 2JA1A 1JR2A 4MS3B 4RD2A 3VR5D 4RO0A 2QL7A 1I3OA 4LRTB 2R6GA 3CCFA 2X2FA 2P4HX 1G1AA 2DPHA 3KQQA 4BUCA 3DLTA 1O5IA 3RSGA 4YT2A 1FRVA 2EWVA 5ES4B 5CFPA 1A9XA 3QM1A 3TTSA 4WT7A 5KKNB 3U4GA 6ADHA 2GDJA 4NU6A 5IN4A 2JHCA 1RQLA 2Y0CA 4I8XA 5CIYA 3M6VA 2XGJA 5B5SA 4ZI7F 4OP1A 3HJNA 3C5HA 1MOSA 3DE0X 3PJRA 1P0PA 3PDUA 4KR9A 1ZCJA 2H0AA 2ZRPA 1JIKA 2I2BA 2WUFA 3D3NA 2FCRA 1RYEA 5KJFA 1JP7A 1YCHA 1N2GA 4IGEA 4NJMB 4RPCA 5FNVA 5AVXA 2PUBA 4I4NA 4JQZA 1LDEA 4Y6RA 4L73A 3JD2A 4ZVMA 2ZCVA 1E2UA 1MUUA 4EI2A 1J5XA 2HRRA 3DCJA 5EY5B 1Z22A 4YMVA 2HT6A 4U7DA 3FVRA 3L77A 1H8EA 2XWBF 3PX2A 4ZTZB 4GUAA 5KQSA 1IZZA 1WCWA 1WXEA 1YZUA 4HDNB 2R79A 5DDIP 3U3KA 3QMWA 4LJ7A 3FJ1A 3VBCA 3ZN2A 1UM8A 1CR1A 2VBGA 4F96A 1XPOA 5AW7A 3NHFA 1XP5A 2R62A 3GN1A 2AYZA 2V6IA 3MGKA 1MW9X 4RJJA 3KKMA 9GPBA 4FHFA 1MVLA 1C9EA 4PN3A 2PH3A 5TEWA 1S7CA 4GPAA 5JNUA 2G0TA 1P0IA 4MA0A 2BM8A 1F2TA 5JG7A 4CL2A 1G2QA 3B85A 1JYSA 2P7IA 2HW8A 1ST2A 2V7BA 2B99A 2IVZA 1N0VC 1L5YA 1OI2A 1Q0SA 3V4LA 2ZB4A 3ZEIA 621PA 2I8CA 5MDHA 4DAEA 5FWXB 2OV1A 1L5HA 3KQUA 3IQXA 2QNIA 3FZGA 4BX8A 1DWQA 4TWIA 5TGTA 2CEKA 2OORA 3K0FB 2JC3A 1ZN8A 3EUFA 3ZIAA 4RGYA 1G18A 1HF3A 3M3DA 3IAM1 3LDUA 1B3RA 3W5SA 1QH9A 2EQ5A 4ND6A 1QGYA 2YWFA 1J70A 3PGVA 4ABYA 2VTBA 3RT9A 1KAHA 2NACA 2ZI9A 2EQAA 4ZAGA 5TRTA 4DS3A 2E5LB 1Q1QA 3AXSA 2GASA 1E59A 4BXOA 4KRYA 4MARA 4BVLA 1C14A 4X6UA 1D4FA 2J30A 1LI7A 1JR3A 4RPIA 4BLUA 4PLTA 4P3OA 2FUG1 3GUCA 3UK6A 3C87A 3TR5A 2WIAA 4WK2B 4Y9UA 1J7KA 1YU6A 4ZYZA 3AJAA 1F48A 3MTJA 1XV5A 3KT6A 4C5CA 2CMKA 1PDWA 4DC9A 2GHRA 3UC5A 3N75A 3EFEA 2Z2JA 5BN4B 3QQPA 3AW8A 4FFOA 1M1XB 3FDZB 4RTQA 4LV5B 3V4PB 5C1PA 3AFMA 3CNOA 4FGZA 1FFEA 3A4LA 4NV3A 5IT0A 2V4UA 4LMPA 4PO8A 1BXRB 1WMEA 2GX6A 5AOBA 5IJXA 4C05A 2QX4A 1QBGA 1GGJA 1UZUA 2J1LA 1R0SA 3IEUA 3D4IA 1YONA 2J07A 3UH0A 4Q5IA 1W5FA 4DIMA 5E7QA 2C9BA 1JA9A 3A1FA 4QTTB 1IN6A 2VYVA 3JD4A 3TQQA 1N8SA 2HJRA 1WZCA 3I12A 1G7TA 2A78A 4HEA1 1GR0A 2NU8B 1QE5A 3KOZA 4NFHA 2WILA 1Y5IA 4IDDA 3TF5A 2X0IA 1NP7A 2J08A 4CRWB 5JFOA 1U1GA 2JGJA 3WRVA 1WA5A 3TUIC 3GK3A 3ZDCA 1H94A 2A0YA 3MJEA 4BQEA 3W5BA 2O2XA 3UTCA 4M1OA 5D1HA 1H2BA 3WIDA 5BSWA 1RPZA 1TJ3A 3PEEA 4FFBA 2A9VA 4OQYA 1W6UA 2Y3IA 2GO7A 2OORC 3WIOA 1RXVA 2XNKA 1JIIA 1HORA 2XJ4A 2B2XA 3PUYA 5JTUA 4E03A 3JWPA 1A9TA 3GQBA 5AW0A 4KXMA 4NZ9A 4W8HA 5DLEA 1LV8A 2H85A 5HKOA 2B3TA 3H9CA 3OIFA 4B8WA 2VUTA 3QVMA 1B6SA 4DNOA 2G9ZA 1Q5PA 2QSUA 2W6IA 2QTRA 4X45A 1OWMA 1AJEA 4FMDF 1A76A 2QQ5A 4E09A 4XGNA 1BD4A 1MA0A 2DKFA 4Z9YA 3TR0A 1H8HD 4B7AA 5UKDA 3HNRA 1M2GA 2ERCA 3CB4A 5BYAA 1U8AA 4LX0A 2CXNA 4XYBA 3L2OB 4MCJA 2IYTA 3TDKA 4LVCA 1W35A 2GZRA 4ARUA 3PD0A 4LYFA 1Z5PA 2E7ZA 7GPBA 2AV6A 1YDEA 2B34A 3ICOA 3GLIB 3ZVNA 1BFUA 1V8BA 3U4QB 4ZODA 3L5KA 4WFIA 2DTDA 1N1GA 3HJTA 2FWAA 3HRIA 3SI7A 4QC2A 1LF0A 4FMPA 2G0AA 3KTDA 1G6Q1 3T0GA 2XZOA 2EC5A 3TAXA 2HOQA 1BEZA 4GE0A 5CA1A 4P92A 2FEKA 3GT7A 4KVGA 5D00A 3QEAZ 4KGDA 2HCTA 1KIMA 3KAKA 4MQEA 2NPOA 2OV3A 1YS1X 5TT0A 1ZS9A 1Z0ZA 2WIFA 4ML3A 1JFVA 5FPQA 4A36A 2WT9A 4OK3A 1V96A 3PGA1 2RI6A 1ZU5A 3UAYA 2XB9A 3GAMA 2QVYX 2WM9B 5A6SA 1F7VA 1EA5A 2JFFA 3T9DA 4WXPA 5DM1A 5LA6B 4CVNA 2AI1A 4DV1B 2ZCJA 1VCIA 3WXMA 4PPQA 4H2DA 5FIUA 4Y18A 3PE6A 1V9CA 1LV7A 4IICA 1G7RA 4DCVA 2AW3A 2FN4A 3TBKA 5CIQA 4GKKB 3EPKA 1ZIPA 3CUWA 3KOMA 4MJ3A 1JZSA 3Q6MA 3TVDA 1MO5A 3BKWA 2XXAB 5E2BA 3O8QA 1ZCFA 5IYZB 2YRFA 3HY3A 1S6YA 2NXWA 3N2ZB 2HZ7A 5EJEA 2OD9A 3QW2A 3PC2A 3T7EA 2YZ2A 2EARA 4R41A 5FBHA 4P38A 5M04A 5F77A 3E15A 2FNAA 3CSSA 3JRNA 3L7LA 4FGWA 1WDWB 2IEIA 3EXFA 4IGKA 2DHQA 4G0OA 1KEKA 3KBBA 4L4ZA 5KKCA 4YLGA 3K9GA 1FP7A 4FEAA 4PG4A 5IC4A 3AHIA 3VDXA 2ZE6A 3QV2A 2PZ8A 4RKWA 3VKGA 1RXWA 3CW2A 2BP7B 4YH1A 5DNWA 2OA0A 1BVHA 4IIXA 4BS9A 4W5NA 4QBHA 5L3RA 1DUSA 2Z4TA 2OFWA 3GA5A 4LHXA 1Q92A 2BZ0A 3FGZA 3K9HA 4ARVA 2Y1LA 1NLUA 1J1ZA 4L7QA 4JBGA 4QYSA 1DPGA 2Y0BA 4CT4B 2BEJA 2IV3A 2OLJA 4DRXA 2FUCA 2P9BA 1U9ZA 1T8YA 1Q77A 5JS7A 3L7NA 1MPTA 1SRRA 2ADOA 3WAJA 1OGIA 2JLSA 3QY9A 2GD1O 3FVVA 4CKCA 4P53A 5TS3A 1Q6ZA 3VR0A 4X91A 1FJHA 1IEXA 5ALNA 1L5RA 3LSTA 2XUHA 1JLMA 3DXFA 3Q3CA 5B7PA 3EPLA 4XJXA 2XXJA 2QY9A 3A6FA 1Y4DE 1XC7A 1X92A 4KYVA 3BL5A 3C45A 3KXLA 2ZJ8A 1N2XA 4HCJA 3T9BA 3LQRA 2NUAA 5BSGA 3HP7A 1YKFA 3NT5A 4JAVC 4LWQA 5K6RA 3GBPA 1P7CA 1P73A 2BMAA 4K3UA 3PIIA 4LHYA 1SUAA 4P3PA 2JLCA 4MW1A 1E2EA 4B6SA 1HO3A 4R8RA 1Y6JA 3D2LA 1DQSA 3EULA 4GXQA 2Y71A 3FZNA 4CMEA 2ISQA 4IDOA 1SQFA 2VP4A 2QLNA 1Z5VA 3AR2A 2R85A 4P58A 2OCAA 1N2CE 3ISVA 1Y5NA 3E18A 5AVKA 1Z17A 4UNNA 4UTZA 1BQ3A 1GZSA 1XT6A 2Z57A 3FA2A 3TOSA 1RZRD 2QX6A 4I36A 2RHCA 1SC6A 2WOOA 3PGXA 3KEOA 1IG0A 3L0PA 1K8XB 3BRQA 2ONYA 3VKFA 5FUBA 4WV3A 3WLHA 3GLFB 3R24A 3R7FA 3IPCA 5IANA 4ER7A 3IKTA 4TYYA 3AI3A 4J90A 2Y6VA 2CDRA 3KAJA 3PI6A 4Z8XA 3CLTC 2Q0XA 1CDDA 4KX3A 4P3NA 3ZCXA 3LHDA 2FG6C 4A6DA 1EDDA 4QOHA 3DEZA 4GLLA 4RVOA 2UZAA 1ISSA 2PZGA 3EGXB 4PLPA 4BMOB 3KETA 5BVHA 1Z16A 2XXBA 3FSRA 3UNXA 5PGMA 4P4GA 4F3YA 3DV0A 1KI6B 4LRQA 2IU0A 1M0TA 1VI5A 2OZPA 3GJ8A 4RVSA 3WLKX 5JIBA 5KHAA 5EGNA 2G9NA 3IEMA 2HA7A 5HSGA 3HV2A 1L1RA 1V7QA 4K8RB 4DSZA 2FLVA 3B13B 2F8TA 2HDNB 4HDOB 3DAOA 3D59A 4PLCA 3BZWA 4EWLA 3GZJA 2OFFA 3KZNA 1GT91 2O48X 4M1EA 3WWZA 4AROA 1EGHA 2RGYA 4F45A 2YX1A 1JSRA 1D2RA 4B45A 5HQJA 3TZHA 3FH0A 2ODQA 2A57A 2XB6A 2HEGA 4L8FA 3AIMA 4LMAA 5E9QA 3S2UA 3FAZA 1T2VA 1L5ZA 2ZI5A 5HUHA 1SBTA 1MCZA 4YIKA 4A5OA 1GRNA 2ZUCA 2VKQA 4J3JA 1JQBA 2FYTA 2ZUVA 1XRMA 3RS3A 1OYOA 4C89A 2HLDD 2NO1A 2XQFA 5F12A 4AJJA 1VBNA 3R5SA 5I3ZA 5LP6A 3B52X 3S8MA 4ZOAA 2O8BB 7MHTA 2ONCA 1HT3A 4CKEB 2NXCA 4FE3A 4IWNA 4PNHA 1SCUB 3LCMA 2ODTX 5MF6A 1NVUQ 4YCSA 2X4LA 1ZN2A 4YRIA 1TJ5A 4J16C 4NBNA 1NATA 4RPHA 4XM1A 3TKYA 3WK9A 4AG3A 5IPFA 1JHQA 5KJEA 3KDSE 3KOYA 3KEMA 3PA8A 4ACBA 1M5RA 3SLGA 3LCJA 1V16A 4WESA 4ZRDA 3IUBA 1WG8A 5LU9A 3T5BA 4OXYA 4IOMA 4L08A 1A9RA 4LOJA 4B3SB 3I1YA 3C8MA 3EZ7A 1Z9BA 2QN6A 5BQ5A 3L8ZA 2IUTA 1EI9A 3H6HA 4ZC8A 3AVXA 1A5SB 4Q12A 4MVJA 5JUWA 5JEDA 3KYJB 3HCPA 3I04M 1I3NA 2D0IA 1Z73A 4DBLE 4EUSA 2C2HA 2ONZA 2BF4A 3UAWA 4NARA 3IAUA 4OFWA 2J32A 4QARA 2B36A 1CJUC 2Y1XA 3QI2A 1TAGA 2HSZA 1PJRA 3AW9A 2ORED 3NJRA 1CZHA 4PYJA 5SYAA 1FMTA 3H2GA 5REQA 3CUTA 3VTZA 1C7QA 2FR8A 3MSCA 3AB8A 3VH3A 3SHQA 1CJVC 1L5MA 4D44A 1ZN9A 4QPJC 3HBAA 3O1HB 4XDGA 3U3ZA 3UMBA 1VKHA 2FXIA 1D2NA 2R6JA 3ANLA 3BD9A 3M9XA 2L17A 1XTVA 5IWAB 1YS2X 2HA3A 4IVPA 3SPXA 2JEZA 5C8YA 1XKLA 2F1KA 4NEQA 2O2CA 3K9NA 3DM5A 1CR2A 1XA0A 1XTJA 3VOSA 1JFTA 4E08A 4WI1A 3CPHA 1Q0UA 8ADHA 4GQAA 4Q4HB 5LBIA 1QKJA 5JALA 4KAAA 3UXHA 2QLTA 1L5KA 3X1ZA 5GJVC 3ECAA 3O38A 2CXSA 2F7SA 1U0LA 5BMVF 3DBLA 4B0OA 4ASUA 2JHPA 1SJ9A 3H18A 2GYVA 4MW0A 2OOKA 5JVDB 2YFKA 5TQ0B 4AXBA 2EBFX 1GCAA 2QORA 4GMFA 4O25A 3QE4A 3UYKA 3CXRA 5HW0A 1QZ3A 1XTIA 1Y1RA 3JAKB 1XEXA 3KV3O 1O95C 5GZ1A 1TTQB 3C3AA 3SGLA 4FOLA 3TLEA 3R7SA 2FG5A 1YQDA 2XQVA 5TQ2B 3GF4A 3W2TA 4AW9A 5AVUA 5HM6A 2FDRA 4D9CA 3URMA 1AVTA 1OLUB 3B9PA 1ADBA 4Y2PA 4R2JA 3ZU2A 3VXKA 2PH1A 1D0SA 1S2OA 1PG2A 2IIQA 3OZTA 1CUBA 4TWJA 5CDFA 3TLXA 2J0UA 3WGUA 1LS1A 1UDRA 1OZFA 3G6WA 1O5OA 3OFNA 2F8MA 4KV7A 4NZYA 4U2EA 5DNAA 5J4VA 4D4JA 3EQ2A 1LQUA 3O1LA 3IERA 4IHKA 2E89A 3LT4A 1WX1A 2BF7A 1IPHA 1KAEA 3WWDA 3LSYA 4OGKA 1EP1B 1U8TA 2V97A 3ISJA 3C3DA 1FIUA 3O2SB 4QD3A 4LF9B 4UULA 1ML4A 2D74A 3GUVA 1G5RA 4V0OA 1LQTA 1OFIA 2G7ZA 1YJBA 5LQSA 3R3SA 1HA3A 3G2NA 5KNBH 4G0MA 4KN5A 1YKSA 2CHQA 3K71B 3PCXA 1XCOA 3VNBA 2G06A 1PR2A 2GNOA 2JIRA 2VH2A 3KVNA 4G9BA 4U6SA 1ND5A 1JLHA 3TW8B 1DCTA 4IV5A 1W0JD 4HNGA 1RSZA 2DHEA 3MEQA 4DWWA 3IH5A 1UJ4A 2R97A 2ZP1A 4IAOA 4JR0A 3S29A 3UJPA 3A05A 3QF4A 3CH6A 3L8MA 4LBYA 4M1YA 3WLTA 4ZICA 2J33A 4GPTA 5FBVB 4F5WA 3ZZTA 1Y3HA 1EDEA 1IHUA 3B1XA 4IH1A 4KPUA 1MHTA 1SRQA 1WNFA 3DZBA 2F55A 3Q9UA 1HDIA 2VDWB 3NAZA 5IC6A 3LUFA 2OAEA 3IDQA 4E11A 2Z83A 2WJYA 1PT5A 3GUHA 4GEGA 5I3CA 1WXHA 3KL4A 5L7YA 3WA7A 3S7TA 4LGMA 1X74A 3UH1A 5JSZB 3JYNA 4Z4QA 3G89A 2ZFUA 3CLUC 1PG0A 3DUFB 2VP6A 5KI6A 1ZD1A 5EIEA 2IHUA 4REQB 3Q7TA 5E6UB 3T9FA 2IUFA 1XZMA 3L0IB 4O2AB 4UEKA 4EKGA 1IPFA 1D2HA 4INAA 4FDAA 4O2BA 3WLIA 4YECA 3RC7A 2CK3A 1E4VA 2HF2A 3T1YB 2R44A 1U0NA 1RIIA 4URWR 1E1CA 2WIBA 3QLVC 1YMUA 1DT3A 1E3WA 4UCXA 4AP9A 1CUXA 4BNMA 1JQ3A 3OKFA 4QYIB 4ADSG 4B3TB 2OQIA 2Z8YA 1STOA 3ZHYA 4OYRA 4WXEA 3JSXA 2J5RA 2MU1A 4XFKA 2OZLB 4JVMA 5IWCA 1J8QA 2GN1A 2I4OA 2Q28A 3OTHA 4QIHA 4TV9A 3RTDA 1TCVA 4R9SA 1J00A 1UM9B 2BCJQ 4FQ5A 3CX4A 4J1QA 4QICA 1QKIA 3TUZC 3HMQA 2YIJA 3QU7A 4BVBA 2ZTLA 4OHYA 3GDWA 2G6TA 5CNMA 1QGDA 3HB5X 4M1QA 3ZE9A 1EEXB 1FTSA 1PJZA 2XWQA 1UC4B 2SCUB 4CMGA 1XHEA 3T5GA 2C3PA 1PGPA 4XR4A 3ZHCA 4BVHA 4P7KA 2XVZA 2UZ4A 4N3BA 4HZGA 1WDKA 4LKRA 2WQ6A 1XJQA 2NZUG 2P0EA 2Q62A 3AUJB 5ECDA 1SXJC 3TYXA 1AKEA 1KVRA 3ONWA 2WLTA 5AKYA 2VH1A 1KOJA 5HE9A 3ZX5A 4PAWA 1R3DA 1XTQA 4M6WB 2P9CA 1FFXB 3H05A 1L3CA 2J0EA 3OJXA 3KQNA 2E4ZA 5BOVA 3UJ3X 3JXEA 3NTVA 3HR8A 5FT9A 4DCCA 3DLPX 1YL5A 4IR7A 4MA4A 4TWZA 4E2ZA 3URKA 4EUHA 3P2OA 3L9XA 3QH4A 4YV1A 3WGOA 3RBVA 4FFVA 1RI4A 4FSHA 1SOAA 4MB2A 5A2QA 5JATA 4GLFA 4ZKEA 1ZXXA 1GAQA 2XADA 3R4VA 1AKYA 4BO5A 4KLNA 3UUGA 3SF0A 1N5KA 1G7SA 4M36A 5D6OA 4BJHB 1O1YA 5B57C 2GLTA 1ABEA 1R9NA 2GTHA 4FKMA 3PYXA 1IM2A 2BLNA 4IZIA 1MAHA 1A98A 1L7NA 2BKXA 2FE4A 2PTHA 3BF8A 2I9PA 1EMDA 1Q7BA 1G5IA 3DB1A 1GU7A 1SCAA 4K9KA 2Z98A 5T7BA 4IO1A 3PFKA 1DEXA 1X7YB 4ZT5A 5BSTA 4RU1A 3NC4A 4JXXA 2D0PB 3A2NA 1GR1A 1MC4A 1NVAA 3QW4B 4OLAA 3TS1A 4AVYA 2XUKA 3DFIA 3RJMA 1GPWB 4JB2A 2P77A 4KYUA 4NATA 4ZU6X 5F2NA 1Q1AA 3I62A 5KNDH 3BULA 2CUKA 4AMGA 3UBMA 1OH5A 2PZKA 4GWGA 3CINA 4ICIA 4QE3A 4XX0B 5FO1A 5FKJA 4EJMA 4F7DA 4FP9A 4MV0A 3IPLA 3PLAE 2FMUA 4YJGA 2NYRA 3C3MA 3RASA 3Q1LA 2RC5A 4U2GA 1N2CB 3M5WA 2VJMB 1NF2A 2W6JA 2YJ3A 3IT3A 1XCMA 1XKTA 4UEWA 5EAIA 2HGZA 3PZBA 1Z4QA 4F6LA 2VDJA 3TOXA 2DFNA 2CYCA 3NDIA 4YAEA 2C2BA 1OFUA 1NE7A 3SZLA 4RHEA 2IPNA 2IPLA 2AOTA 2J4CA 3CW9A 5A3SA 3RHTA 1VIYA 2WKSA 4Q3DA 3FE2A 2Q1XA 2QJFA 3SIRA 4HZUB 3I0NA 5T64A 4FU0A 1ZMBA 3FNGA 2J9RA 5EQTA 4ZKDA 3GPLA 2NV2B 2Q0HA 3DG9A 1W48A 3HU1A 3NYIA 1YDFA 4X41A 1Y1LA 1O4WA 2D06A 3W8NA 1NUTA 2G63A 3PWSA 1BGVA 1VJTA 2OM6A 1B6GA 4RHCA 4FDLA 2VYNA 3CUSA 3SXPA 3EWIA 4O4HA 4Z4CA 2I6XA 2C7GA 1NJ2A 4M1KA 4D98A 5JARA 3E1SA 1QVZA 3GFOA 2OEPA 4M8KA 4TLLB 2DC1A 4ZQBA 2V0NA 1FPQA 3BYZA 2QM8A 3CWQA 5EJMA 3GIDA 1V6CA 3H3FA 2WY2D 2ZIWB 3S2ZA 3TVYA 3VUEA 4CQNA 4DR6B 5AHOA 1Q22A 8MHTA 2XRFA 1W88B 3U31A 4S1NA 1V2HE 1E3EA 1PK8A 2QDKA 4MKZA 2ZIXB 4A1OA 1RRVA 3NNNA 3F6PA 3KZMA 1KYYA 3RVDA 3PEWA 2QUKA 4QLAA 5EJ4A 5A5GA 2VFAA 5I7OA 2FRVA 1Y9EA 2QG4A 2ZSJA 2NUPB 2W4QA 3ANTA 5KWEA 1DIAA 1DFIA 2C98A 1DIRA 3KHKA 3MWDB 3LBFA 3HEMA 5T3YA 4EQZA 3NVKI 4EY8A 2VPWA 3UKOA 1GRVA 1SHTX 2ORYA 4U2CA 1BU5A 3BIWA 1XVTA 4QQKA 3DR3A 1LFDB 4MCHA 3KWMA 4DCSA 2LGJA 1PZNA 3RC9A 5AXCA 4JOQA 2Q9CA 1XD2B 1G8YA 4EGAA 4DSAA 3ABOB 3DC7A 3NH9A 5ALSA 1SBCA 1BN7A 2Z5GA 3IQWA 1PS9A 5BQXA 1C9KA 1NSYA 3DE5X 3NYRA 2IJGX 2HQBA 4OIMA 4GBMA 4REOA 2F6RA 1SNYA 1K6XA 1PSWA 2OMKA 2P6PA 4JLDA 2YXEA 2FQWA 4JBHA 4R16A 1A0OA 4TT3A 1K0FA 4BP1A 1CUWA 4EK9A 2O0JA 3IMKA 2FF7A 5CVVA 2Z1MA 4PGFA 5BV8A 3K6KA 1L7PA 1ZFNA 4LQDA 2CHUA 4K26A 3TLZA 3N2EA 3DT9A 3E9DA 3ZWOA 4DLBA 1ZEJA 3EEIA 3WZ2A 5KYWA 4DT1A 4AMBA 1EB9A 1G8HA 3W90A 2XOEA 4YMLA 4QUBA 1QDLB 4XWKA 2D2VA 5FD8A 1S01A 3V8RA 1Z6GA 3KKEA 3MGBA 1KEEB 2OV2A 3BMOA 3GLRA 2NTNA 4FX2A 5B7QA 1M0WA 3G82C 4BP8A 5BURA 3I37X 4UXHA 1FDUA 5JO9A 3H7AA 1PR4A 3OFSA 5JWHA 5IASA 5KNCA 2P1RA 1OBHA 1E5QA 1OXUA 1VLZA 3O95A 3R5JA 5H9WA 2XITA 4JVLA 3HI6A 3GVCA 5EXTA 1CERA 1A96A 2MSCB 4FVTA 1MU0A 2Q6VA 3D8NA 3SDBA 4OIFA 3ZDFA 3DYVA 4XR9A 3LS2A 1ONPA 3SXJA 2FY8A 3ZVMA 1ZZEA 1TYDE 3QIAA 4HVLA 1PNQA 2UUPA 1DTSA 2WU8A 4RX1A 4Y2QA 3P52A 2XVMA 1TYCA 3B36A 3BERA 3FAKA 4QFCA 5TPWA 5C1OA 1KFBB 4NDNE 5LYJA 4ZMSA 3LQ2A 2XODA 3NJ4A 1QRTA 1J8VA 4XEUA 1S9HA 2OB1A 2XNDA 1UPAA 2YHSA 1KKLA 3FNQA 3LQ1A 4JBIA 3PVCA 1XNHA 4NZZA 4PYLA 3I4FA 3TCKA 2REQB 2UVPA 5E3IA 2WZCA 3EDOA 2C5EA 1QLHA 2QAGB 3I23A 2IHZA 3L8YA 3OT1B 3MTQA 1L4FA 3JATB 3VAZA 2NVUA 1DKPA 1IXZA 1UKZA 2QTFA 3HBJA 1UFOA 2IEZA 4QYMA 3R9IA 2WIDA 5EUCA 3FHLA 3W7BA 4DUYB 1FU8A 4KHPB 3SOZA 1J1IA 1XD9A 3HKBA 4N03A 5AUQA 1COWD 1EYZA 2C7BA 2W48A 3MCZA 3A28A 5M3BA 4X00A 4MWSA 3EK2A 3PRKE 4MICA 5EWMB 4Y2GA 4MUYA 3ETLA 3INNA 2JGLA 3HACA 5D7BA 5F4BA 2GKGA 3R76A 4YPOA 1SVIA 1GN8A 1M1NA 1XU9A 2WMNB 4R1QA 4HC4A 2OPBA 2V4MA 3V97A 1KC3A 1KJIA 5GGYA 4XQ0A 5DGXA 1BJKA 3HXKA 3M1YA 5ALOA 3VUFA 3Q7PA 1POWA 3V8MA 3STUA 1OWPA 1JU4A 4PXYA 3C7KA 2XWSA 5J1TB 2JLXA 1RPJA 2ZIAA 1A8QA 4J0DA 4X8MA 1G3UA 4YV7A 4M9QA 1HNWB 4GPBA 1NHWA 2P41A 1CE8B 1NVTA 3LU1A 4GNRA 4QXMA 4M54A 2FSFA 2EWWA 3FCXA 4D7AA 1FA9A 4YEDA 4UPVA 3KZOA 3O7WA 1ZICA 4MUGA 2XE7A 2HF7A 2QD4A 1RXSA 2CEAA 4TKUA 3FR8A 4A2PA 1PYGA 3LQYA 4AP5A 3GLGA 1MOPA 1RHKA 1ZM4A 3SC6A 1DC4A 2HO5A 2EKPA 1XQVA 4FMCF 4MW7A 3FPJA 3L82B 2Q8PA 5LIPA 4PR3A 1JG2A 1ICIA 2W0SA 1ZGBA 5LDGA 2V3VA 2OKGA 1VSTA 2QTHA 2VTKA 3AOEA 4K9DA 2N1MA 1OV4A 3A1SA 4H7EA 4QUEA 4X7MA 2QQFA 3RTGA 1L4UA 4CN8A 2YBDA 3NUGA 3O73A 2REBA 4R2WA 3PR3A 3D8UA 1P6UA 2WD7A 3KJNA 4ZV9A 4N0QA 4D3XA 4XE5A 1S9DA 1EBFA 4KO8A 4URYR 1E2IA 3WOHA 2HCFA 5DHSA 2MSLA 3GH3A 2PYDA 2O6LA 1K8ZB 1Q7CA 2YWDA 2J3KA 2E4UA 1VCNA 3RF7A 3U3RA 1D7AA 2C20A 1CB0A 2EX4A 1DJNA 1E1RA 2F48A 2ZW9A 3ASYA 3OZXA 4PLZA 5HGXA 3ZDBA 3KAQA 5C7YA 1ZJ6A 4PGAA 1J0DA 2ID4A 2GWRA 2X1LA 3ADCA 1W36C 2HR1A 2QB5A 3DOUA 4NYMQ 1P8AA 3WGNA 2RGRA 2B83A 2BKEA 2BC9A 3R5HA 3WLJA 4B71A 4D3YA 3FUXA 5DYWA 3ABRB 4GOKA 2LR0A 3AJRA 3GFTA 2VNAA 4YAUA 1Z33A 1LBHA 3IKJA 4HAUA 1DJMA 3EC7A 1OFUX 2IE8A 5ITZB 3THYA 5FLYA 2BTQA 3TLAA 1BA2A 1PWHA 2FW0A 2CJWA 4Q82A 2DLDA 1XEWY 3MQ4A 2XKBA 2O2YA 3G0IA 4Q3AA 4W5TA 3KXKA 1O97C 2WSBA 2WJWA 3D4LA 3PBKA 4UMVA 3DFZA 5ALRA 4TWRA