5FLYA

The fhud protein from s.pseudintermedius
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
279
structure length
279
Chain Sequence
b'KETKAFNLKTAKGEEKIDIPKDPKRIVVMAPTYAGGLKYLDANIVGVSDQVDQSPVLAKQFKDVDKVGAEDVEKVASLKPDLIITYNTDKNTDKLKKIAPTIAFDYAKYNYLEQQEAMGDIVGKSDEVKKWKADWEKQTAQDSKDIKAHLGDDTSVTIFEDFDKKIYAYGKNWGRGSEVLYQAFGLQMPKALDDATKKEGWTEVPKEEVGKYAGDVIITAKAKDAAQPEFQKTAMWQNLEAVQNKYAFNVDSSVYWYNDPYTLDVIRKDLKKQLLALPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERRICHROME-BINDING PERIPLASMIC PROTEIN
molecule tags Metal transport
source organism Staphylococcus pseudintermedius
publication title Crystal Structure of Fhud at 1.6 Angstrom Resolution: A Ferrichrome-Binding Protein from the Animal and Human Pathogen Staphylococcus Pseudintermedius
pubmed doi rcsb
total genus 91
structure length 279
sequence length 279
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 5flyA02
1FP4A 2YNMD 5GGXA 4G09A 5JPDA 3GI1A 1N4DA 5CX1B 2QI9F 5JJ5A 1N2ZA 3AEQB 5BVGA 3AEKB 1KAEA 3K1AB 2WHYA 3MINB 4FILA 4FKMA 5B58T 2Q8PA 2M6LA 1ESZA 2M6KA 2XV1A 1QH8A 3R5TA 4B8YA 4CL2A 5KHLB 5KOJA 2XDQA 3LHSA 4WZAB 4FI3F 3EIXA 4UTOA 3HH8A 1QGUB 3K1AA 5FLYA 2XQVA 1M1YA 4ND8B 4DBLE 5CR9A 4TKVA 5KOHA 2AFIA 2AFIB 2O1EA 3ZK9A 2R79A 1N2CA 4OVKA 1MIOA 2AFHA 3BE5A 4G07A 3EIWA 3LI2A 4UDNA 3AESB 4BBPA 4PAGA 3ZK7A 1G21A 1KARA 3ZK8A 1N4AA 1PQ4A 2OV1A 4IRMA 4TKVB 3AERB 3PSHA 5I4KA 4FNAA 4TKUB 4HMPA 1G20A 4OXQA 1MIOB 5HDQA 2Q8QA 5JG7A 3HJTA 1G21B 3NU1A 3MD9A 4WESB 3U7QB 1K2VN 2R7AA 4XPIA 5GGYA 3MWFA 1N2CB 3AEUB 5CX1A 4WZAA 1G20B 4MX8A 3MWGA 1K0FA 3CX3A 2XDQB 1QGUA 4UTPA 4WNAA 1L5HB 1M34A 1PSZA 2PS3A 4MDYA 5M34A 3TLKA 4WZBB 5KOJB 2YNMC 2AFHB 4PM4A 3AERA 4MO9A 2RG7A 3UJPA 2PRSA 2XUZA 5M29A 5HX7A 3AESA 3TNYA 4OXRA 3ZTTA 5JOQA 2PS9A 3R5SA 5M2QA 3MFQA 2XH8A 1EFDN 3ZKAA 2OV3A 1M1YB 4ND8A 4WN9B 5KOHB 4HMOA 4HN9A 1M1NB 2ETVA 2WI8A 1QH1A 5BVHA 1K75A 1L5HA 4WNAB 4WN9A 2MINB 3TEFA 2X4LA 4INOA 1QH1B 3AEQA 5BVGB 4N01A 3AEUA 4H0FA 4NNOA 1H1LB 4UDOA 5AFSA 2OSVA 4MLZA 1XVLA 4XPIB 4K3VA 1FP4B 4WESA 3MINA 3U7QA 3AEKA 1H1LA 4GICA 1K7SN 1TOAA 3BE6A 3AETB 3HXPA 2MINA 4NNPA 4INPA 5BVHB 2XY4A 2OGWA 3PDIB 3G9QA 3PDIA 3PSAA 1M34B 4M7OA 4HMQA 4TKUA 1KAHA 2PHZA 4WZBA 3AETA 4LJSA 4LS3A 4H59A 1QH8B 5M3BA 1M1NA 2PS0A
chains in the Genus database with same CATH superfamily
1FNNA 3RJMA 2QT9A 5BWLA 4FKZA 2M9MA 2H2DA 4K26A 1DJPA 1WZIA 4U1RA 4UCFA 2Q5OA 2JCBA 3MGGA 5C37A 2YXEA 3EZNA 4OMDA 1XZEA 2ZIGA 3AHJA 1CDDA 1DAHA 3AL2A 2YBDA 5B58T 3TMKA 2QUIA 5CEEA 4NPHA 3RRMA 3SXUA 5ALHA 1TT5A 4DUGA 4D9HA 3TZCA 2VEOA 5KIAA 4JDPA 1YIDA 4HLUC 1FDOA 2JAOA 1ULAA 3DZIA 5EXDA 2P6OA 3U3DA 5CVEA 4FFNA 3BA6A 3Q41A 3L0IB 2WYOA 1O94D 1SVKA 3TTSA 4BY9E 1UDRA 1YIOA 2YHSA 2R87A 4D2IA 1QC5B 3FYTA 2E1PA 1XMPA 1FFCA 5KYYB 4U7HA 2JVKA 1UZAA 2YVLA 2NVUB 3PB3A 4E33A 1PQUA 3W04A 3A6ZA 2GCIA 5KAMA 5JY6A 1OGYA 4MWSA 1TK2A 5LOVA 1ZNZA 5E7JA 1PK9A 2XX3A 3T35A 1XROA 4D6XA 4Z4IA 4JMLA 3NP7A 2OCAA 4PG8A 1O7JA 4Y18A 4FNAA 4MKRA 5B7QA 3KQHA 1N9GB 4UUNA 2F90A 1II9A 1ADBA 2JAXA 1E1KA 3QVJA 2WTNA 3B3GA 1GFZA 4NXNB 2O8EA 4A5SA 3CLRD 5HKBA 3ETJA 5CJJA 1TLFA 5HQTA 1BH2A 2Y0DA 5EJ5A 3DEAA 3IGFA 3ROMA 3KT6A 5AD1A 2Z2ZA 1R8QA 2R6ZA 5A3VA 3WLIA 4J03A 1NSTA 5IRCD 1GCIA 3FMPB 3PXXA 1T5LA 2YX1A 5LUAA 3SLRA 5LPNA 3KOUA 4A2QA 2J9GA 3BVPA 5J40A 4YRLA 2AF4C 1ILWA 3RTDA 4QVGA 4M0KA 3GEDA 4KI0A 3G9ZA 4NL4H 4MQUA 5D84A 3L7KA 3A27A 3B5EA 4YYEA 4DABA 4TYQA 5L51A 4ZV7A 1S2OA 1GGMA 2ZJ2A 1GDDA 1CS0B 1ZH8A 3BCRA 2ZPUA 5DLYA 3R8XA 2EBWA 2QBYA 3SSMA 1T8WA 4O0MA 1NW4A 4EBBA 5D6NA 1JHMA 1KZYC 4NH0A 2VWHA 2WVGA 5EZQA 2BFFB 4E5DA 5TF4A 4CQLA 3PGKA 4OK3A 3LM8A 4DLWA 3MCAA 4NPAA 2WG1A 3LOPA 1CUCA 5HJ7A 1LSOA 3NWJA 2WNHA 1XNJA 2R66A 2WFMA 1UBJS 3N2GA 3UUEA 4ESEA 3VPHA 4QOJA 2FMXA 2ZYUX 4IIHA 3F4KA 3ENKA 2X1HA 5BRAA 1CV2A 4QO8A 2OB1A 2YFKA 2HQSA 2WM9B 1CEYA 2AJLI 4Q24A 4AU1A 1KZ9A 2VKTA 3MERA 4CLRA 4YAGA 4C3ZA 4FWBA 1DO8A 2AEEA 1L1RA 5IKPA 3T6KA 1X7DA 1FVFA 1QF7A 2C8JA 3G68A 4UFNA 3UV7A 5FULA 5G3ZA 3UC9A 4IXMA 2Q6OA 3N2LA 2E49A 3P2EA 5FR1A 2QUZA 1LJLA 3U19A 4OSOA 4NF2A 2G7ZA 4NKRA 4U2FA 5DXFA 5MHTA 2XCOA 4NJMB 2XTZA 2F48A 4HHEA 3RVQA 2ZQYA 2X0EA 3WO0A 1EXDA 2JHFA 2IU6A 1ICEA 3FUCA 2WM3A 3Q12A 4MWDA 1KY5A 3TLAA 3QE9Y 3G5UA 1GUDA 4HQ6A 2QY6A 1GUZA 1YZFA 2RHLA 5JC8A 3LO5A 3PDUA 1NX6A 3RS4A 3FSEA 3QE0A 4GDMA 4HFNA 4R5HA 4BCCA 5AMXA 2Y1LA 5DTIA 1WUIS 3L7DA 1CE8B 4TM7A 5DNWA 1U11A 4O3MA 4OAOA 3WL4A 1M7GA 2YXDA 3K0KA 5KSYA 5IJ9B 3LCVB 3CSDA 1UXJA 3N07A 3DM9B 3ECSA 1NQVA 1U1GA 1H2FA 5I3ZA 2J9XB 5JQGF 1E8NA 1XU7A 3CNBA 1RU3A 4KPGA 1LNQA 4KUEA 1JQAA 2ONJA 3WXMA 4E32A 3A4MA 3CEJA 1Y3IA 2BKAA 3KKZA 4DCUA 9GPBA 5JD6A 5IFKA 1T13A 2BGGA 3FR7A 4IVRA 1OT3A 5JVDA 2OR3A 3A26A 4ZOEA 3USES 4DTIA 1YBAA 2ISCA 3JAWB 3DBIA 1C7FA 2G08A 3C3WA 2PLRA 4B3BA 1U94A 4HQFA 2PEYA 4B79A 4DSNA 3N9IA 1PGOA 1QDUA 5CGQB 4ARIA 4BNLA 3HRIA 4HP8A 1DARA 3K0CA 1KWKA 4CN8A 3EEIA 3DDOA 5CLHA 4FZJA 4IIVA 2BFFA 2CMGA 1QO9A 5EVJA 5IYZA 2CHEA 1ZC4A 3OQJA 3EJ6A 1OFVA 1I4TD 1TECE 2R1TB 2Y1GA 4INAA 4NR0A 4UKDA 5HE9A 3C3DA 3SSNA 6GPBA 4KR2A 1QVWA 1MX9A 4ZT5A 3DXFA 5TARA 4RHFA 5EMNA 3IXLA 5HQ3A 3VDQA 2X6QA 3GEHA 3GN2A 3HMKA 1J9GA 3QVTA 4U2GA 4KOEC 4C43A 1GYRA 1ZU4A 4OJTA 3ROPA 2TYSB 3DH0A 4NONA 5K0LA 4CMBA 4OQFA 1QPZA 4FFVA 4RK5A 3SC2A 4PX5A 3IEXA 1XLVA 3S1SA 1UFQA 3OTGA 2O52A 1P1KA 5T4EA 1QRTA 4RPGA 6PFKA 2A0UA 4W9NC 3FD8A 2QQEA 3A70A 2B7LA 2IC5A 3DOFA 4UVDA 1VMIA 2X8JA 2FPSA 1WRBA 3GJ7A 5TGZA 1E1NA 4H16A 5AW6A 2QLLA 1EJ0A 3ESCA 1I6LA 1KERA 1K75A 2AYXA 2FOLA 2DULA 3BKXA 4LJ8A 3OUZA 1G6KA 1L5HA 5C7LO 2WTUA 1MXFA 3THYA 2C5GA 2WIFA 4LKRA 5AUNB 3E58A 4UAUA 2PJRA 2VTEA 2HLDD 4KMOA 3LP8A 2CVOA 4JP3A 2AJCA 4OGWA 3RVSA 4ZOCA 4L73A 4FB4A 1M2WA 4CLOA 2QD5A 4ANFA 4I4LA 2AGVA 3MGCA 1PWZA 2O07A 1JR3D 3OFNA 3W2IA 5KTKA 3UWPA 1NJFA 3SEQA 3AIMA 3G2MA 3UHOA 5JANA 2NTEA 5IN5A 1E63A 4HD8A 5EHXA 4ZICA 1BN7A 2KQUA 4HMQA 1SVIA 1KAHA 2EZTA 3FFAA 1WW8A 3HS3A 2RHGB 5LYYA 4URVR 2W8ZA 4MUIA 2AMLA 4RKRA 1E6KA 3C8ZA 4MRMB 1A9ZA 1TVKA 4O2LA 1XJQA 1PWXA 2RHDA 3VZDA 2W71A 3V9AA 4FSHA 1T3TA 2HXSA 1A9RA 1W2GA 2JCSA 3L7IA 4M7PA 1RXYA 4LZOA 4PYKA 5IDYA 3M3HA 2VHCA 2HRZA 3K20A 5L7YA 5GPBA 1YA4A 3CUSA 3DB1A 4JDUA 1G5HA 3U4IA 3WLSA 1H42A 2VHZA 4QUGA 2XTAA 4FFRA 4MS1B 4RIEA 1E2PA 1OGJA 1VJ0A 1L3IA 2R3SA 3HPRA 4PEVA 5JLAA 1T26A 3LHSA 1WV0A 2B7CA 2H7XA 3C1UA 4YT5A 4ARUA 1WDLA 2GYVA 2MYUA 3DL4A 1Z29A 1LLQA 1VJTA 2JD0A 1Z4LA 4BNYA 4XFKA 1AB6A 1DHTA 1UMBB 5K8TA 2ZIXA 3MMNA 4IFEA 1Z0JA 1UOQA 1NBOA 4GPTA 4N0QA 3I62A 1II8B 1MG5A 1VL0A 2CJWA 5MGBA 4NOKA 2GASA 5DNYB 4A6XA 2IS1A 4CT0A 4X3CA 3TM5A 1PG0A 1TZJA 3CWCA 4UNSA 4BRUA 4QO7A 2UYGA 1W85B 4FDAA 1CXZA 1E18A 5TPWA 2I2XB 4JJKA 1MU0A 2VDNB 2QVXX 3SBDA 3PSHA 1GZUA 3PQ3A 4GYWA 1JKFA 2ZYDA 3JWJA 3G2NA 3HCWA 1L9XA 4ZARA 1X1CA 3B1YA 4X1OA 2FGJA 3L1IA 4M1KA 2VH1A 1OTYA 1FSGA 4TVKA 5K03A 2G63A 4GMHA 2WWFA 1G66A 1JAHA 3KJHA 3UQZA 3OZWA 3VNBA 3PRJA 1H65A 1WUKS 3B53X 1A95A 1NVXQ 2F1HA 2CVZA 4Z1MA 2GKGA 3FPKA 2ZJAA 2IYTA 3B82A 4MWGA 4XDZA 3EG9A 4JCOA 5IVPA 3PI6A 3DZJA 3E5MA 1WB4A 2EU8A 4PPQA 3ZZ0A 2JATA 2G9QA 2OYRA 4GP6A 3T0FA 2G4LA 3FVVA 2JFUA 1QV7A 4PVDA 1Z38A 3USZA 1C1DB 4AJLA 1ZR4A 3WGZA 4J3NA 1BHQ1 1NXVA 1LFAA 1T9GR 2QT1A 1HURA 3BXHA 3GVHA 5ALOA 1WUHS 1PS0A 5JOQA 4RIGA 4F8JA 1HWYA 3PFWO 4PGHA 2PLFA 3H5IA 4UBNA 3BXGA 4CMAA 4ZZ1A 4EG4A 4Z86A 3DV2A 4URZR 2QTMA 4Z49A 1YO6A 3P0FA 2O14A 3DOIA 4MI6A 1FFDA 4PXAA 4JJ8A 4EGCB 4KAAA 4DB2A 1G5TA 2HWKA 2XZDA 4D8TA 1MB3A 2VK1A 4GR5A 1K97A 4OMUA 1RJGA 4FOLA 4JR2A 5A6SA 1PWYE 2UYOA 3C14C 4MK4A 4ER0A 5CXUA 2XMRA 3AVXA 1WSDA 1V6SA 3B78A 4HDKB 1OHHD 3LAWA 5FBRB 5H70A 1EUQA 4XPIB 4L8WB 4E1AA 2HFJA 4LTNA 1CY1A 3HVUA 1RQRA 4P22A 4Q6WA 1QZ3A 4Z7JA 3NAQA 4KR7A 4BO0A 1K5PA 3T0GA 3EZGA 3GUVA 5AJUA 3SJBA 1XGKA 4D9GA 2I99A 1KC3A 2XPCA 3NYRA 4NP6A 4NU8X 7GPBA 4V2IA 3N05A 4P7KA 3ZI4A 1R9GA 2X1LA 4BLTA 2P0EA 3AP1A 4IUYA 2ONKA 1NQUA 3RSHA 3HK2A 1JAXA 2C2WA 1NE2A 1EYZA 5C8VA 1TUEA 4ZEWA 4XQGA 2CB0A 1E5LA 1OI3A 2VK2A 3VPXA 1E69A 2Z2JA 2I3AA 2R7NA 1HYQA 4PO3X 1K66A 3BE4A 4BNXA 1AKWA 4L2IB 3QVMA 5FAKA 1XPJA 4IRUB 1P91A 4DMLA 1VCOA 4FHCA 4BVAA 4AO7A 4RVNA 1RRFA 1WPQA 1E8DA 2B99A 2LP4Y 3HJAA 3OQHA 4X92A 3BJZA 5L95A 4B5KA 1DBRA 3M2PA 1E2EA 1OQAA 1SG6A 2ZSAA 3L7CA 5SICE 5HMMA 2O7NA 3ZGVA 3IDFA 4ZYTA 5KNCH 1Z6PA 2E4YA 2YYAA 5BN5B 3QLUC 2FJ0A 1P7PA 5ALJA 2A9RA 2JLXA 2WSIA 1ZEJA 4MS4B 5DHRA 3BUSA 3T4PA 4EQ6A 4QGSA 3QX3A 4LF4B 4AK9A 2AFVA 4K05A 3IDQA 1JIUA 1ZJZA 2WT9A 4V0NA 3UFBA 3EY4A 1BWSA 1OIWA 4MR9B 4D8VA 3AESB 1JDPA 4B73A 2WZBA 2BGJA 2GD1O 2Z8YA 1YGPA 4IUDS 4LRXA 4QFCA 4C2BA 1XQXA 2HH9A 5BNWA 4HCJA 1J70A 1OBOA 4FHFA 3BHNA 2QUKA 1C1DA 3D2AA 3JARA 2W2LA 1G20A 3ZLTA 3A10A 2GBLC 4OHRA 1FUUA 2VYVD 3EQ9A 4DS3A 2YNMA 4O4LA 5AW7A 2D6FA 4N54A 5HDQA 1NKVA 3W5UA 2IU4A 1E98A 3E9ZA 3Q40A 1SQ0A 4J16C 3TQCA 7ADHA 2HF2A 3IR6A 3DLIA 4WLFA 1P1HA 1MCZA 1SUFA 1W94A 2R1ZA 1Z2PX 3ROZA 3TINA 1JPJA 3TFQA 3A3YA 1V1MB 4PYJA 4ZI3A 2PV7A 3ZV5A 1D5WA 1R64A 4PC1A 2MU1A 3EWSA 4RHEA 3KM0A 1S9HA 4DR4B 1NUHA 4DMUB 2ZBEA 1MNQA 4UZSA 5KX5F 3V46A 1ZCBA 2QRGA 5C80A 4HOYA 1WZEA 2CCKA 2ZTLA 2X41A 3DFMA 5G4KB 2B4TO 1ESDA 2E2WA 2JFXA 5L3SA 1OU4A 3W7VA 2IF2A 1CQJB 4RHTA 2WPDA 4ZCQA 4MVYA 1MRNA 1F4VA 1Q17A 2CUTA 5KX5A 4KPUA 1X74A 4P54A 3SZRA 1CRLA 1RZUA 4NXMB 1R6BX 3N5CA 1HUQA 2REXB 1IUKA 2WTMA 4Q00A 3U3ZA 2V6MA 1J9ZA 3DFUA 1NG1A 2YWXA 4B6PA 3CRNA 5CT4A 4ZYZA 2ZYWX 3GT3A 1G17A 2GA9A 3GUYA 3SQOA 3WKCA 4R41A 2GO7A 1GTRA 2XCQA 1CS4C 2W6MA 4IFBA 4KXNA 5BVGB 5J2TA 3WGOA 4E12A 2NP7A 1Z0UA 2I71A 3G2LA 3HYNA 4NMWA 4MIKA 2WABA 2HQOA 1MX1A 1W4LA 2VDWA 3EC7A 3CY6A 3DBHA 3FNBA 2AMJA 2CFOA 1IY2A 3GFFA 4N9QA 4RD0A 3AJRA 5FI1B 4E51A 4E5MA 1J2RA 1QHSA 1KMQA 5ERGB 4GXQA 4TV9B 4QECA 1GAWA 2OAGA 3Q9SA 3U7RA 4YNBA 2IYXA 2QNIA 1QDEA 2BHRA 1WMEA 2GCNA 3EFOB 3EXFB 1SO8A 5BW6B 4A1FA 5C46F 3D6HA 4CGZA 1AF4A 5AM2A 3KK0A 4RENA 1BSVA 3LT4A 2BC9A 1Y8QB 4N5NA 2DF8A 2WT4A 2ZCVA 1HDGO 2JA2A 4B2IA 3VU3A 1RD4A 1VA5A 2FYTA 1FP4A 2A5FA 3CX8A 2PX0A 4YV7A 2IH4A 3M49A 1R5BA 1VB5A 1VPWA 3EDOA 5KYTA 3R7LA 3S2EA 3DV0B 3V5NA 2RI1A 5KYNA 2VSNA 1BDIA 3ILXA 5IDVA 2HWWA 5JU6A 5F2OA 2OLEA 5AHOA 4LJRA 2O2JA 1VLMA 3PWZA 4OL9A 5FTWA 4O1IA 2Z6AA 4UBOA 1A9PA 5LMUB 4Z8XA 4CT4B 1RHUA 4HR7A 3Q87B 4WOJA 4I19A 4YT8A 2B5OA 4GXTA 1KE2A 1VE5A 1VLQA 3PKIA 4DBLE 1BN6A 1C3JA 1T2EA 4W6QA 3TDMA 4DDUA 1YT5A 1Z13A 2D7CA 5AYVA 3OQOA 4TWBA 3ZK9A 1SUDA 1XEXB 1D4ZA 1Y8AA 2G6BA 1T8PA 2IEDA 4QU0A 2E6KA 2VL7A 2FK7A 3W6NA 1Z4QA 3QA3E 2BTEA 2HI0A 3A1FA 1UXKA 5A62A 2CD9A 3SJCA 3QP9A 4HATA 3GGDA 1WV1A 1USIA 4TKUB 4TTQA 1U2DA 5EYPB 4DILA 4DUZB 1JFVA 2GD2A 4O29A 1JIJA 5FBHA 5EC8A 4Y67A 5ELXA 3MHPA 2ZCJA 3KKOA 4RAOA 3SS8A 1VBFA 2A67A 2DT5A 4HUQA 4K2AA 2Q1WA 4PPNA 4X1KA 3KLPX 2ANCA 4UDYX 1NBEA 1XCJA 1L5MA 1BHJA 1G6Q1 4W6ZA 4WKNA 5D7BA 4DCMA 2WD8A 2J3LA 5KNCA 3X1YA 1A9YA 4EY4A 1KI6B 4UTNA 4DAEA 1K0FA 2YXNA 1OASA 1CDEA 4GQBA 3U7QB 4AZTA 1GPAA 3PCTA 1NNEA 1N3YA 4HAXA 2IV3A 1THMA 5IKOA 3EXAA 2H8GA 1YRAA 3T7KA 4S35A 1Y81A 2DKFA 3MLBA 4F7WA 4OHYA 1FP1D 3QFSA 5EIOA 2IIBA 3H17A 4AJJA 1SZPA 3PYXA 5F51A 2JFHA 2P5UA 5AJHA 3UAGA 4F3TA 2QUHA 4OXRA 2R00C 3EJWA 1PL7A 2FP3A 2PPVA 4B74A 4CR7A 4KVZA 1GITA 1N5MA 2FN3A 2C7PA 4XQ9A 3G8BA 1Q7GA 2IUUA 1GG9A 2PZBA 5BMVF 1N8SA 4TS1A 3C3JA 3DHYA 2G88A 2WTEA 3WGJA 2EFCB 3R7WA 4EFKA 2R47A 2EF1A 5JSHA 2IXFA 3F71A 4Q7LA 5HFNA 5HBGA 1DZIA 1JHZA 2IYAA 1THTA 1PUIA 3B52X 4L22A 1ORTA 2EW2A 3TW8B 4UU0A 1D6NA 1JAZA 2IXGA 1PGNA 5ECGC 3A1CA 4PYOA 3FZEA 4TSFD 3TTXA 4CQMD 4CQMB 3OU6A 2CL7X 2QL9A 1M2KA 1VL1A 2QG4A 3DJYA 4IQFA 1U0TA 1X0VA 4PY2A 1OH8A 1WF6A 5LM3A 2HEIA 1O6BA 4JWKA 3RUCA 2O2GA 3ZGNA 4M9RA 1CP3A 1DX4A 3BJEA 4GOJA 3W2GA 2WU0A 3W90A 5TIIA 2WYHA 4X65B 2CXOA 4HX2A 3R1IA 3PRHA 5BSGA 5CDSA 1CUHA 1FU4A 3FBGA 3PF9A 3IYLW 1D4FA 5K0ZA 1XFDA 3V4FA 1PUJA 2OE2A 3HZRA 3PPIA 5FO0A 1DGQA 3HYCA 5KAPA 1WWKA 5IZCA 2ZBUA 3HA7A 2C9BA 5EJGA 5FNVA 1ZA1A 4JLBA 3F5MA 1ZC3A 4KX5A 1GGKA 1Y9AA 1NA5A 1QHGA 2P9FA 2JIZA 2QMEA 1CUEA 1TQ4A 1BJTA 2V5VA 3FGZA 2ZIEA 2ZE5A 4IG4A 4ROSA 5DCUA 2OL4A 4N5HX 2J45A 2Y4NA 1I2DA 1YI0A 3EIOA 4OJMX 3CTPA 5ESRA 1QLHA 3A14A 1NATA 4BBZA 3SE0A 2F8TA 3KAPA 3H5RA 2ZJ8A 3QNMA 3FF4A 3RS5A 4X24A 1LDYA 4EDFA 4G2TA 2PEZA 1NMYA 5KB3A 1NP6A 3AX6A 1ZCAA 3KU1A 1T9GS 1FS6A 4KGZA 1U81A 3C43A 2AR7A 4MRPA 5TNXA 4CW7A 3HXOA 3F9CA 4GI2A 2FTKE 1TIPA 3LLVA 1TJYA 3U39A 4JJ4A 4CNQA 2CFIA 1SVOA 6ABPA 4N47A 3GFVA 3WV4A 3B85A 1WXQA 2QJFA 2IYYA 3RYFA 4ZDKA 4GIBA 4M87A 3E9NA 1OJLA 2VIIA 4M1EA 4R1SA 3ADCA 4F4FA 3K32A 1AZWA 1HE5A 1X8JA 2OP1A 3GT4A 2Q7XA 2JHAA 1MIOB 2J33A 3HJRA 2C2HA 1FP7A 2I5PO 4OUDA 5CFOA 4C21A 1E3IA 1LPOA 2X9VA 4DV5B 3JQBA 3VR5A 4ZFNA 1M1XB 3G7NA 3ITEA 3JZFA 4RDHA 4PCAA 3DUFB 3NHFA 4W1PA 5ESWA 1X42A 2B1JA 3U9LA 4ALJA 1H2AS 4MVJP 1MN6A 4BQNA 1SIWA 2F9FA 1OC4A 2E4XA 2PV0A 3A1NA 3K7EA 5FPSA 4HLCA 5T8KC 3PC2A 4IY1A 1LS6A 1CQIA 2FSUA 2FMUA 2MYTA 1W1IA 1SZCA 1W2HA 4W5TA 5F33A 2NVWA 4MEBA 5GZ6A 1Q77A 1WVMA 3FH0A 1JVSA 2B3DA 4KK4A 4L8FA 4EX7A 3A0UA 1CR0A 1BGXT 1OWNA 2XUZA 3FHCB 1DIAA 4JEUA 4RY8A 5G40A 5AI4A 4EHBA 4Z9XA 4DLBA 3DMHA 3ZIDA 2P6RA 5I4CA 1AGRA 1XRLA 4XX0A 3W5CA 1I4LD 2P0AA 2JD2A 5JBNA 1AIPA 4COOA 4DFDA 3SI7A 3CMMA 3BZUA 1R7RA 4JBNA 1NI4A 5BSFA 1C14A 2ETVA 1G7SA 4AB1A 1NSFA 4EK9A 4UC0A 3PXUA 4YRBA 4PZCA 3WYGA 1SBNE 2FF7A 1FYEA 1T36B 4FR5A 4FYPA 4IJ6A 5CVVA 2WM2A 3SOZA 3ZDBA 3WS7A 4UCQA 4XGKA 1G20E 1U7TA 3D81A 3K0HA 4B3JA 5HRAA 4XRGA 821PA 2HPHA 1XNGA 5CIQA 3EXIB 4KH1A 1X9HA 3ZH2A 3U1BA 3P71T 2O8FA 3FUTA 1OR8A 2LTAA 1KFCB 3L49A 1WCIA 3LY7A 3OZGA 4MWEA 1LKZA 1OXVA 1VMKA 2DGDA 3N8NA 2DT8A 1OXTA 3KU4A 5KCMA 4MVXA 1RM3A 4D45A 4Q9JA 2PK3A 1E3JA 1Y8RA 5IASA 8LDHA 3S2FA 3K73O 2PKXA 3DZKA 1NR7A 4XDGA 2IUYA 3TZKA 3V3KA 1JSRA 3NBFA 3D6VA 2IU3A 1G7TA 3A4VA 5TF0A 3PHGA 1LPAB 5FTLA 2YMLA 3K2EA 4URFA 3IELA 2QZ4A 2IHKA 2IYUA 1HE4A 3NR2A 4FHDA 1WCYA 3K4QA 1A9XA 1KAEA 2I1QA 1JSLA 2VF4X 1GR0A 5T4HA 5CFNA 1D2HA 2WMNB 2AVDA 3HV2A 4MRMA 2Y8EA 3WDKA 3RODA 1AKMA 1FTWA 2E5LB 1Z0SA 3GGOA 3W9SA 4BFTA 3MSCA 1KVTA 5H8WA 1W9HA 2A5DA 1Z2AA 1PGPA 5DBOA 4W5NA 1I8TA 1PGQA 3HVHA 2D74A 4ICIA 1NDQA 3BH6A 3DG9A 3JATA 1R8SA 4FEYA 4L0DA 1DMSA 2FGKA 2WF7A 2YHAA 3HM9A 2GZDA 2HRCA 3E2MA 3F6RA 4BNVA 1ONBA 1X7XA 3KQNA 1XA3A 3H9BA 3DCYA 3I8OA 2ZETA 1O77A 1TA9A 1MJFA 1WY7A 3FPFA 3LD9A 1QG0A 3QE4A 4YDSA 2FSPA 4JBYA 2P5YA 1ACLA 1VE7A 2J1LA 4DC0A 3HCBA 4FCCA 4C4ZA 1J00A 5I9SA 4IIJF 4OXQA 4AO6A 1RPZA 2WYUA 3AIOA 5H02A 1QCYA 5M7EA 3GDOA 5T8KA 3M6XA 4FNGA 4LRTB 4TWAA 3OTHA 5F3DA 2PZLA 4AUKA 3TGPA 1QYWA 2R5FA 1WXEA 2IYQA 2ZCUA 1ESMA 3HBJA 4RGYA 3P4XA 3TS1A 4WKPA 2XVYA 4JLNA 4N49A 4GLBA 5JALA 1W25A 2P9GA 4I55B 4ZQHA 4TN5A 4MDHA 2PA3A 4ENWA 3PFFA 3L5KA 8ABPA 5FDFA 1X14A 2A9VA 4IHJF 4P34A 2B98A 4DSTA 2PWPA 3ABQB 4E1BA 3LOUA 5MF6A 4LF7B 3G8CA 3IDSA 3L0OA 4IDQA 1XTIA 3EQ6A 5DNAA 3PEYA 2I4TA 1V9LA 3B9RA 2W37A 3ESQA 3F96A 521PA 1XELA 2FPXA 2P27A 4URWR 1JR3E 4EKYA 2P4UA 4IG9A 4ZV4A 5AVYA 2NT4A 1T3LA 2WG2A 2B8WA 5A1TA 2I4LA 4B7ZA 2ODEA 2PX3A 1XWWA 1XD9A 2OAP1 5DNDA 1G41A 3LC0A 1IN4A 1EP9A 2NZVG 2GZAA 2MINB 1COWA 2H16A 2QAJA 2RAUA 2ZTMA 3E23A 4WLEA 1L8AA 2BFOA 1HLFA 2EWWA 5FEUA 1LPMA 3F9IA 1USGA 3CPHA 3EPHA 2ZR8A 2E1RA 1KYTA 3KLNA 5LQUA 1HETA 3AFMA 5KSZA 4QJ4A 1EWTA 4MQEB 4EG7A 1DV2A 1Z62A 3UYKA 3GLIB 3HHPA 5DK6A 4K8RB 3DLAA 4DLVA 5AJYA 1P2BA 2G36A 3CLHA 2OWEA 4HAYA 3DKRA 3UICA 2FKAA 4RVDA 3C3PA 2JGDB 2VATA 5CT9A 4P31A 3CZ4A 1SWWA 2HCJB 5DBFA 2G40A 4N8SA 3RFTA 2NVBA 3SSOA 1DO2A 3C0KA 4GRIA 3RUDA 2ZRFA 3CRMA 4I50F 4PPFA 4XE5A 3TIIA 3L04A 3O0TA 5AQ1A 4XCXA 2UV8A 5HS4A 1ZRNA 4RS4A 1M7BA 2UVQA 3VYRB 5GZ3A 3U48A 5KHAA 3V8VA 2O9JA 3O8RA 2H1OA 1NUPA 1X1RA 4J4TA 3TUIC 3W5BA 4P0QB 1XMJA 2ZI6A 4MVCA 4RZUA 5IANA 4Q48A 3B5JA 1HDIA 4D4LA 1T2FA 4LOIA 3SPXA 1XZCA 2XD9A 1FXWF 4EWLA 4CDNA 2OM6A 5K01A 4RTKA 2OY0A 1W5SA 2VUSA 5GOTA 3IUNA 3F7MA 4IWNA 4LRYA 3TJZA 3VPCA 5DI3A 4CVNA 2W42A 1UJ6A 4EHLA 1BNCA 1FW6A 1RI5A 3U6KA 2FE1A 1TZKA 4GM1A 1XEWY 2PFSA 1NULA 4RV5A 1WKBA 5IZ4A 4BMXA 1GPNA 4IOKA 5L6LB 2UXCB 2X0NA 2WIAA 1HNNA 3K0FB 5K3BA 3ZIUA 5IYZF 2IL1A 1HGXA 4FSDA 2P9JA 5JZ9A 5JBQA 3UGTA 2VYFA 2PMDA 3G89A 5KYXA 4KTVE 4LJLA 4XXHA 3T7AA 4FOTA 1F3LA 2UZIR 1P6UA 4TTSA 3WWPA 2HLHA 3UIEA 1G5PA 1X80B 2XBMA 3ZCXA 1GNVA 4HRVA 3RFVA 2R44A 5FUBA 1E2QA 2Y76A 1X39A 4RNCA 3ZYCA 5DI9A 1MZPA 1YVEI 3L8HA 1K7FB 4XSHA 4F9EA 4OU4A 5C8YB 2XB6A 2AEJA 3EUWA 3KZCA 3E84A 4A3SA 1JN0A 1R37A 4ZIRB 1B2LA 3D8SA 4L4SA 3KSMA 2QJTA 4XRRA 5JZSA 3RYCA 1ID1A 3PHBE 3ZHUA 1QU3A 4Q82A 3IP3A 3REOA 3ICEA 2V1XA 1GR1A 3UV6A 4MVJF 3I2HA 4DIEA 2B0CA 3NHYA 2IHNA 3ZCUA 2A1IA 2ACVA 1S4QA 1JLLA 3LCCA 4JIMA 3UNXA 3CPEA 3TN7A 4BFWA 3DT6A 3SXJA 1X9GA 4D3SA 4FMDB 4H7EA 1UH5A 2OV6A 1LRKA 4M1YA 1IYZA 2IEZA 3ZWYA 3EVEA 4R3NA 4ABTA 1OZFA 7MHTA 1A4XA 4R9RA 1EFTA 1KYXA 2AFHB 4LY9A 3C7AA 2DUJA 2VZEA 1P2DA 4UHBA 5CYFA 3TQIA 1ZO8A 5H4HA 1U28C 1HYEA 4EGAA 4I81A 1MOQA 3ZDFA 1U63A 2A6PA 3LHIA 3AR4A 5JFOA 2UUAB 4X1IA 2JAHA 2HDOA 1O1YA 5C18A 2PGOA 3Q2IA 4S1OA 2BLLA 4KXWA 1KK3A 1A71A 2GEKA 1AM4D 4PAOA 3WTCA 1BCRB 1U0LA 2HWXA 2IITA 3CLVA 3ASUA 1F0NA 3K4PA 3QUTA 1R4NA 2C3OA 1I7LA 3F6EX 4J6EA 4TUYB 5JJBA 1I0IA 2WJAA 1OYVA 3ZJTA 1L4UA 4PZYA 4RE6A 1D07A 4R84A 4EKNB 5A4KA 4DJEC 1OAOA 3L18A 1JG1A 2BBSA 3MS7A 4D25A 2DOKA 3NTVA 2Q4DA 3OJEA 5EIAA 3RE1A 2FUCA 4LK2A 3NJ4A 4TZTA 2I4OA 1II0A 5F1PA 5GWXA 4EJ6A 5JSFA 2PH5A 4QOFA 1I6KA 2D5CA 3V97A 1DKQA 4OOEA 5EHZA 4Q4JB 3AETB 2PWAA 3NNNA 3IMFA 4HDKA 1K9VF 4LY6A 5CYOA 3RC7A 1EPUA 1P60A 2FZEA 5DHTA 3GDWA 1VKHA 2C83A 1EVKA 1E1QD 3MCUA 3DMTA 1ND6A 4LX0A 3Q0TA 1XA0A 3L7NA 1MZVA 4RHXA 1U7XA 3KE9A 2J41A 3SSAA 4HDQB 2DH5A 3MB5A 4JLSA 1V95A 2C0PA 2BT4A 3MMPA 3Q4GA 4NEHB 4EHAA 1HE8B 1BYUA 5BW4A 3ANNA 3RC1A 1IJKA 1SJ9A 3EVNA 1U2DC 3SLKA 5FR2A 1CJUC 1UAAA 2M6LA 3QFRA 4XVCA 1HFKA 4DLZA 2ISQA 1ZOSA 4C4XA 2CVFA 1Q0HA 3CPSA 2OHFA 4FX2A 4G36A 3BORA 3LSYA 4HDNB 2D2FA 4XIGS 2OYSA 5T3UA 3BTSA 4QIHA 3ZCVA 5A2QA 4CIYA 4OEHA 3ZNNA 1JQJC 4HWGA 1KU6A 4I55F 5JXIA 4M0MA 3FPLA 3JR3A 4ZI7A 3GD7A 4G26A 1RT9A 2FHSA 1F5SA 3KQTA 1C5KA 2B1QA 2M98A 4GLLA 5DM2A 3O3NB 1CTQA 3ZEIA 4GH5A 4WQMA 1USUA 1MO3A 2XYHA 4Q7JB 2AG5A 3NOOA 4JBIA 1PZHA 2Q4EA 1AU9A 2PR7A 2E9SA 2FFBA 3Q7IA 1VA4A 3RJTA 3UPDA 1SKBA 2IJGX 3PXGA 2XE7A 3RHSA 3LYHA 4KH0A 5GM1A 1XVIA 3ESZA 3N8IA 2QD3A 4H7HA 4OG2A 4UHHA 4J7UA 5CMLA 1VE3A 3NJ8A 1SUPA 2RBEA 1B76A 4PFKA 4NIMA 1ISJA 3E03A 1FQKA 2H7YA 2JJ2D 4V03A 4BLQA 3L6CA 4MS1A 1QK5A 1C9EA 3UK2A 1YTUA 2L19A 4QXOA 2ZT8A 4LWQA 1CY8A 1ZMBA 1QYIA 5AT1A 4FJ0A 3ZZUA 2SCUB 2G83A 3QXHA 1QK3A 4FMCB 3U7JA 1O6ZA 5JYDA 4DR2B 3M33A 5CIWA 3GLRA 1TAHA 3Q5GA 2IIPA 4NCKA 2GK6A 3RC3A 4P6VF 3T9FA 1QIGA 2AE2A 3KB8A 4MQFB 1WHSA 2JIMA 3HFGA 3OOHA 5DO9A 5KYUA 3CT6A 3ND9A 3R0JA 1W52X 5AO9A 1ZD9A 1TA0A 3D5QA 4XR4A 5BSRA 1RKVA 3D1LA 1IRIA 2EZUA 2NSYA 3K30A 3NYIA 2DEUA 3SD7A 3IH5A 2FR8C 3CW2A 1RCUA 3QBDA 3KZMA 2DPMA 1BS1A 1NVAA 1DJOA 3H5LA 3KVOA 3D4IA 4FFOA 4QXQA 1VLVA 1DQYA 3DTVA 2IOHA 3D31A 1NONA 3VH1A 1I30A 2HF9A 1EWRA 3HR8A 1QWOA 4UEQA 3N2EA 2DBVO 4K9QA 3SVZA 1NQOA 2AKYA 5C7YA 4LG1A 4Z7OB 1T3SA 1Z08A 2VXOA 1EFDN 3RSCA 3LPMA 4A8JB 2PXXA 3GQBA 4TTJA 1NF8A 1Y5RA 3VISA 1GGVA 1J1IA 1Z0FA 3QJ5A 2ZUWA 2R6GA 5AKIA 4ENTA 1JDVA 5HJEA 2PD6A 4Z4GA 2HU2A 2AI3A 1N1DA 2KMLA 3UOGA 3ZU2A 3K70C 3THYB 5C8YF 4TMKA 1E1DA 2HNAA 1RI1A 5GADl 3QX9A 4MRRA 1JU3A 3HDTA 2HCRA 3M1YA 2RGRA 1M6YA 4QG7A 4J29A 3QZUA 1MQSA 2PSEA 5IDQA 2B2NA 2D4HA 5A5VA 1EFLA 3JQ9C 4YR9A 4JAVC 1I4OA 1J0DA 2BR5A 3P2OA 3RSZA 2CNWD 3DVLA 5K8UA 5LWHA 3IAXA 1KTVA 3PNKA 2K7FA 2L82A 1J49A 3M6VA 1PX2A 5JS6A 3IVAA 2JVJA 3I9NA 2GCOA 4I08A 4WZBA 3GLUA 1U3DA 3WMFA 3HA5A 1GPMA 4FT4A 4HTFB 4K5QA 2WE8A 5DB4A 4BWVA 5BXYA 1QH8B 5M3BA 3BOSA 1YRHA 1Z16A 3ND5A 4FHEA 4ENQA 1C9MA 5EXEA 3CB2A 1XTZA 1YK0A 3OX3A 4M0PA 4QOEA 1KDYA 3ZN2A 3E9EA 2CEAA 2WILA 3ZX5A 5F7JA 1KZHA 2GPSA 3DC2A 4NPCA 4Q02A 5EINA 4R8KA 4XX1A 5FUYA 3TLGB 4OHPA 3EVFA 1U65A 4JY7A 3ITKA 5EIXA 4QA9A 1V43A 2YJGA 2GNAA 2WWHA 1UBTS 2P67A 2VSFA 4S3MA 3A2LA 1RWVA 2EF0A 3DWEX 4UNIA 4LZLA 5B7GA 4TX1A 2QD4A 4DQ0A 5B53A 3BBPA 4I36A 5H5JA 5JS8A 3D8NA 1CZOA 2XHEA 4LHSA 4ARZA 2JHGA 1E3LA 1P77A 4HQNA 2VA9A 3DKIA 4KO8A 1DQZA 1Q3TA 5G4LA 5B57C 4TMTA 3CN9A 1U3WA 2QRQA 4NFLA 4IHJB 3MJHA 2GSWA 2VJMA 1QO0A 5IAAA 3IKVA 3D3KA 5CNIA 4Y6LA 1NWCA 1OI2A 2ADOA 4BP3A 5TC4A 3HB5X 1E62A 1G9SA 2IF0A 3FCOA 4H4EA 3V6MA 3UPUA 1EINA 3HMQA 3OPYB 4HWSA 3FHLA 2F3RA 5LIPA 5LQNA 2OENG 2V7GA 3IQIX 4I5GA 3UM9A 4D4MA 2FPRA 4MTLA 1ZN2A 4NYIR 1DG3A 1JHQA 4ZQFA 4I55A 4BJHB 4E4YA 3A2NA 3BIJA 5LD2C 2GJ4A 4LY0A 2IYLD 5HS6A 1GQ2A 5IH3A 4CEJA 4PQEA 1TEVA 4O2AA 1L4EA 3BD9A 2CSUA 2R7LA 4ZCIA 3PZBA 2XXBA 1OXXK 2YYSA 1A5AB 2JPDA 2BOVA 2NTYC 2YHIA 1XALA 3B1FA 5C8ZA 5CBPB 1WMBA 2K2WA 4FINA 4UHCA 2R86A 3EVAA 3HKDB 1KZ6A 1IXRC 4ZGBA 1I24A 3HXMA 2YFYA 2WA1A 3KFVA 5FV7A 1W4AA 2J9FA 4ZOLB 1YZNA 4IJMA 1EDZA 3QWHA 4Z54A 5AVOA 1KH3A 1MA3A 1ORHA 2QAGC 3DHEA 3UB4A 3W9UA 1PSWA 4WBNA 4MW2A 1QMPA 5ILQA 3E0XA 2AQKA 5BWOA 3V4RA 3I05A 4FFSA 1QAQA 4NE2A 3Q1KA 5EQTA 5K3FB 3E8SA 4LTMA 3S1AB 4BP1A 3I0ZA 3NWPA 1O89A 1Q84A 2YZ7A 3TQOA 4BYMA 3FTDA 1S8NA 2JB9A 4G1BA 4HAWA 4ZXFA 4B3RB 1G6HA 2PGAA 4HGRA 1T5OA 5EFOA 4YJ3A 5UKDA 2XRYA 4G2NA 4BUJA 5AFSA 2DVMA 2OFOA 1X1SA 2JGDA 3HRHA 4FD2A 1T9AA 3O2QB 3T3EA 4DM3A 4KQ2A 3EPKA 3QWBA 2G67A 4RACA 4ND6A 4YUXA 4D80A 5LQKA 2I80A 1BMDA 3NIFB 1PVDA 4DG5A 1KP2A 5BSUA 2DTXA 1UBMS 4PU0A 1MO5A 1PQYA 1Y6QA 3I23A 3PVZA 4B3HA 4YRNA 1HFJA 4ZI7B 2O59A 1EUZA 4D99A 4OIMA 4YALA 4ABYA 2R8RA 1WVIA 3C6QA 2EJTA 1ODFA 3L82B 1TX4B 2HK8A 3IESA 2X86A 3W6OA 4AJ4A 4DJ5X 2J3QA 2OOSA 3BL6A 2XKKA 4ZAYA 1JI0A 4GL2A 2LGJA 1WNFA 1R4MB 2PS0A 1C8LA 1DAFA 4JH0A 1DBSA 4TKZA 4F6LA 2FH5B 3KCNA 1I14A 1MLDA 1PI3A 3QA9A 3T4UA 4QUEA 1C3OB 3TR6A 3UJAA 5JXWA 3WISA 4MVJH 3DFFA 5ERYA 5CDTA 1UMKA 4KODA 1JFSA 1TAQA 4P4SA 4WY2A 4CLOB 4F21A 2JIBA 1YQEA 3CHYA 2H0AA 2POCA 1E6WA 4N7MA 2R8PA 4R6XA 5LKRA 4R68A 4KQEA 3VOTA 3RVLA 5IVKA 16PKA 2ZWPA 4ZRMA 5CB0A 1XG5A 3N1UA 2HQRA 4ARSA 2ZSIA 5H81A 1IZ7A 2YWJA 3WB2A 3W5DA 3DAGA 4HDCA 2PL9A 4LV5B 2I1VB 2C7VA 3VYWA 4ZOAA 5K3OA 3DXZA 3OZEA 5A06A 1UBGA 4ARZB 2VHJA 4G1CA 1B0ZA 1MAHA 1DCMA 5FBWB 1COWD 3ME5A 5GVSA 5KPDA 1NOJA 4G07A 4PGAA 1EFPB 1CRWG 2SHKA 3LUAA 4P3OA 5HKLA 2YOGA 2YJ6A 2BRUA 4JEMA 1CZKA 3AZQA 1E59A 1QORA 1QGYA 3C8MA 3MLAA 3L0PA 3QI2A 3UT6A 5EEHA 3ONWA 2YTZA 1D2RA 4O4JF 2XWJI 5HG0A 4EG3A 1HDRA 2AW5A 1KE1A 2G9ZA 4IZOA 5IMBA 3AUUA 2FVYA 3OCZA 1N36B 5KKCA 3AOEA 5CW1A 4HDSA 2J08A 4ZVMA 3OEED 4AJOA 1Z4JA 4CIWA 1NE7A 1RRKA 2EGGA 4OL0A 3ZY4A 4DOMA 1ACJA 2IYSA 3ZQ4A 3NDIA 4JLWA 4KHPB 4CKEA 2EP7A 2IP4A 2W6JD 3ZCPA 1KEKA 2QNRA 2BI8A 3DYVA 3FGNA 3A31A 2RE8A 2ZIFA 1RLOA 3ASZA 3LY9A 4LBZA 3V2UA 1QAOA 1M34A 1OX4A 3A7DA 2BGLA 3QM1A 4KQ6A 3FFBA 5DWDA 2YZMA 4U4AA 5IEBA 4PLVA 5CEJA 2OZVA 3NKVA 1FPQA 2GPBA 3O1IC 4FD3A 1H8HD 4R2KA 1DAMA 2QRNA 4W8HA 4R0NA 1IFXA 3QPWA 4L27A 4X5OA 3ZE6A 2CLCX 3O91A 1NIJA 3I3OA 1L4GA 2WVAA 1JHUA 3KALA 3SIWA 1Q0LA 3B3JA 3R5SA 1ZIXA 5LJIA 3RYCB 4MPRA 1R6UA 3WY9A 3ASYA 5A5FA 3QTTA 1N3IA 3TBHA 1GILA 1MVLA 4LISA 4X7PA 5JSUA 3JQFC 1BH6A 2QLNA 3EAQA 4XYGA 5E1MA 3M4ZA 1JIIA 5A0VA 3OT4A 3Q9NA 3WLFA 4YR7A 2JIPA 3BIXA 2Z2KA 2IODA 2WTXA 1CFJA 2G09A 3CZPA 4WMLA 1BYIA 1SKAA 3CVVA 3F6YA 4X7MA 3DTVB 1AGPA 4YJKA 4D46A 1OVGA 3MXTA 1N77A 2F3TA 1XO1A 2OM2A 4L6IA 2WDPA 1ID8A 1TEHA 2G9RA 1D09A 3HDYA 3AL0C 2M1ZA 2EERA 2OK8A 2WLTA 4GYKA 4G4IA 1DKNA 4CL8A 3HN7A 1J0CA 4O4JA 4U2DA 6Q21A 5A0TA 3CX4A 3P9ZA 4ALKA 1YMUA 2F4NA 4NYJR 3LPCA 3WC4A 4F9TA 3KUCA 1E7RA 1NX9A 3L4BA 2GXAA 2SICE 1HTBA 2H57A 4Y7CA 1HKHA 2PRZA 3RT1A 1BS2A 2IXAA 2R48A 5EVCA 3OOEA 4MVJM 2A14A 2C20A 4MI1A 3NBKA 3LT0A 5CTJA 3ANLA 1L5QA 4B3MB 1ZUD1 2NNLD 2N0SA 1JIKA 2VRCD 4J7AA 3UN1A 2NW6A 5J2TB 5HF8A 4H7FA 1GAJA 3FFTA 4OP3A 4CLRB 3TJMA 5I48A 2QSZA 3OT5A 4Y6OA 1ZIYA 2KJQA 1BXGB 4WUTA 2A9PA 2AN5A 2J5RA 1B8OA 2ZRDA 5H59A 5BWBA 4KYVA 2J0VA 3G2HA 3ZD9A 2FN7A 4ER6A 2FUKA 1X1EA 3H2GA 4LWZA 1IHUA 3I6YA 1AHIA 5F12A 4MDEA 1N2CA 1K7CA 2QG6A 3L77A 2I6SA 3Q88A 2C5SA 1N3BA 3H04A 2EYUA 3TSOA 5FUXA 3UOWA 3VR6H 1A5ZA 2EQAA 2P4QA 1V6AA 3DHNA 4GPD1 4O59O 3RTGA 4BVBA 1YULA 1UJ5A 2BFBA 4UU7A 3JYNA 4BEWA 2BGUA 3O4VA 4QAQA 1S8OA 3QYFA 1TZ2A 3K6KA 4YRAA 3KOOA 1Q95A 4LBYA 2ZSDA 1B41A 4RSHA 3WGNA 2X76A 1TFUA 3GPCA 5TS3A 4DBVO 1WXXA 4YPOA 2PUDA 1C0PA 1AZLA 1H94A 1SOVA 3O90A 3G0HA 2BELA 3CNEA 4FX5A 3RVNA 4YO8A 3OJFA 1RWNA 1ODIA 1W34A 4MP3A 4UCXA 4NCNA 4AXBA 4DR1B 1CUYA 2H5LA 4I1IA 2IH2A 1FFHA 1ZITA 4G5HA 3D6MA 3KJFA 4KFCA 4RTOA 3EZFA 1SXJD 2HA4A 4U00A 2EJVA 3I5UA 2YWBA 4E09A 2XRMA 4DJTA 3FX2A 1XX6A 4US0R 4Z2YA 5L3ZA 1QNLA 2Q5JA 2O6LA 3IX7A 1FSPA 1NHWA 1ZHHA 3P45A 3QV1A 2CV2A 4YUWA 5TQ2A 4FC6A 3VVMA 4PLCA 2PH7A 3BWYA 3SZOA 3C4QA 4WA8A 4IPTA 3IP7A 4O4IA 3TD6A 1S01A 1RCFA 2BF4A 4D1YA 2BTQB 5L3VA 4UEJA 1ZGJA 2BJVA 4K0RA 3WAJA 5IABA 2XMQA 2J46A 3FYSA 3R75A 2WV7A 3IAS6 2IRWA 1AG9A 5DGXA 2A78A 1T6XA 1U99A 2CLDX 1NNSA 1ZNYA 3O2NA 5E4FA 4DQXA 2Z1MA 2XMSA 4QYIB 2QU8A 5TJ9A 3ID6C 3ZXXA 4LAFA 4B5LA 5KVAA 2FPKA 2GZRA 1HOXA 3PDIA 1IRXA 4ID3A 4G0WA 4FGSA 4QYSA 4XJVA 2XXAA 5EE3A 3A1VA 2QKYA 4G23A 4B6RA 4WLVA 3TX6A 3LUDA 2P9BA 4E15A 2ZXUA 4UAVA 3JAKA 4NESA 3CLTC 1ZFNA 4F4DA 3FHJA 3QLJA 1KNXA 2ZUCA 2HFKA 1AN0A 3OF5A 2GVZC 1BFDA 2VO1A 4IIGA 4Z9FA 3V8NA 3ZWBA 4OHZA 2V3VA 2P9YA 4IO1A 3ZGXA 4Q7EA 3ZUGA 1DIRA 3H1GA 4YBZA 5CVCA 3L3BA 4IMIB 3ONFA 1VPEA 1SBTA 4L7QA 3D3WB 4Q3KA 3I5XA 2X19A 3T1QA 2FZ4A 2QJWA 2P4EA 4HY3A 4RA9A 1QQ6A 3AW9A 4I1PA 4TRJA 3CUVA 3I6MA 2WNIA 4CF3A 4MJ7A 1JH8A 1RJWA 2JCGA 3C4JA 2V4UA 4MUKA 5AK6A 5CCEA 1T9BA 3MIZA 1ZU5A 4KPFC 5F23A 1HYHA 1JU4A 3KHUA 1YVRA 1RXEA 2ZIWB 5CR9A 5EXTA 1VQ1A 2V7EA 3RUFA 1GQQA 5TQJA 3SZ3A 2IOYA 4CG3A 3TBFA 5JPCA 4FUQA 2VSQA 1GTSA 2XIJA 1D0SA 4N76A 2WSSA 1DX9A 2ZAIA 3EHDA 2IPAB 4JK3A 4YWJA 1M1YE 1QANA 2X9GA 2X0FA 3RS2A 4BASA 1PT5A 2OV2A 4NS1A 1PYOA 1QV9A 2I4MA 4HZIA 3EISA 3CISA 1IWPB 4HMPA 4JXKA 5IAGA 4YRMA 1A82A 1KK1A 2DPYA 2IDZA 2ZQZA 3H9CA 4XOUA 3ZKWA 1M8GA 1RLJA 2BGRA 2QYSA 2LE0A 2ZWIA 3ICCA 3N7AA 3AONB 1U3TA 4MJ3A 2IS6A 3HLYA 2PKCA 5LOVB 1D2NA 3HKBA 1FTYA 3A32A 3H7IA 4FOPA 1GARA 1KI2A 1NN0A 2YRFA 3ZVRA 2F3UA 4K1LA 4CFSA 1Q83A 3QNUA 3G0GA 3ZHYA 3QKSB 1T43A 2V7WA 3LYUA 4M9UA 4BAUA 4EPTA 1C9YA 1RADA 1J20A 1AGYA 2FEWB 2E37A 4UTPA 1KWGA 4CU2A 4A7PA 2CLLB 2FV8A 1RAGA 2HU8A 2Q07A 2VUUA 2ODQA 3DL7A 4ND1A 3KXKA 3UJ9A 4B34A 5IXSA 5K99A 1VE1A 5K8LA 4FWTA 3JYOA 1E0JA 1E99A 3UEOA 1ADFA 1BWQA 3MK31 4H31A 4C1NA 1EP1B 2OQIA 2ALJA 3KBOA 4FN5A 4IHJA 5AJZA 1S9DA 3UB2A 2Z58A 1CX9B 4MTCA 1RE1A 5BQPA 3NOQA 1DKRA 1T91A 4MAMA 3ECCA 2CXHA 5H0IA 4YCJA 3EZ7A 4E07A 4EMBA 5DZSA 4YCCA 1O95C 1VB3A 3P97A 3QWAA 4D9JA 3TJRA 3AFOA 3E7PA 4H1HA 1FSSA 1K92A 2XUOA 2F59A 4ES6A 1UZLA 4P0TA 1KRHA 1E1RD 2HJHA 4TGLA 1BCSB 1PJAA 1U4SA 2BPOA 2JEYA 1KO4A 3DZGA 3PNBA 4RVFA 1W1WA 1N8KA 3GNTA 3GR6A 2EDAA 3ISJA 3TZLA 4X54A 4MINA 1N75A 3X1WA 3SK0A 5KJEA 1HX7A 4CV3A 3KKLA 3CTMA 4FYVA 2XCUA 4FKBA 3WYDA 4AIIA 3IL2A 3O7WA 3NHAA 3FVTA 1KEZA 4Z0PA 5H83A 3HXPA 3U7HB 4YIKA 3S4YA 2WHPA 1KEEB 3FYDA 4KHZA 2V4ZA 2ZPTX 4L4RA 3VI3B 2B4KA 3B2NA 5ALTA 5FTNA 3FTFA 1WOMA 5E4JA 1L5YA 3PLAE 3JX9A 1V7CA 4A2CA 3HLTA 3UFXB 3I42A 4CQMA 2G5PA 4R9VA 1UC5B 1EWVA 5IBCA 2CL5A 3IPXA 1SWVA 4RVUA 1O58A 2F3SA 1F2UB 1OC2A 2GPTA 3EA5A 1ESZA 1L5ZA 3OZTA 3QHPA 2C98A 2ESRA 4JQZA 1A7AA 3VUEA 4CM4B 5HEKA 2R6R1 1JJVA 2P78A 1XRJA 3PCRB 4FR0A 5FOSA 2GILA 3BL5A 1U0GA 2I6QA 1GPBA 3QH4A 4ISCA 4M1MA 3IEVA 2GKOA 1F9EA 3P2YA 2R8XA 2H0RA 5HNKA 1ULHA 2OHJA 4CMKA 1KJ9A 3SN6A 3MJEA 3RUPA 3O4GA 4ZVNA 4DLXA 1G8HA 2IBSA 3U49A 4BPRA 1JALA 3NAGA 4YRTA 3VHLB 2E4VA 5BNIA 3AFGA 4JZKA 3ORSA 2JLQA 4MW5A 5AP9A 1Z6ZA 3FB4A 4HWOA 2GBLA 3QXSA 2OP0A 3TYXA 4ECEA 2QL6A 2ZJZA 5JDCC 1KSFX 3PYLA 1Y1KE 5T41A 4GT1A 3G1TA 4RY9A 5CU7A 3GGCA 3JPWA 4AZ0B 1Z0AA 4BNMA 4NMLA 3IEIA 3OQ6A 5TE9A 4JXXA 2RMKA 5FKJA 2D7DA 1XPOA 4RXTA 1ZKDA 2ZWAA 4F1JA 5BV0A 2G5GX 5DASA 5IC4A 1FTSA 1KDOA 4N5MA 3CO0S 1EQ2A 2ODTX 3VGPA 2D2XA 3PC3A 1VL5A 1WXWA 2ZVPX 5CX1A 1N2HA 3PHLA 2REOA 5FOUA 2Y1CA 3WL5A 4MV0A 2J85A 4OKSA 1QRUA 3G7UA 5ALNA 1TADA 5K8IA 1QOQB 4IO0A 4LYFA 3BHMA 4QHSA 1DE0A 3WL3A 3AY7A 1ULUA 3HY4A 1GL7A 4H08A 3SYRA 3EFEA 4NU5A 2QYOA 3H9UA 3W3AA 2HBQA 2PUGA 2O3QA 3THSA 4V24A 3E9YA 2IV7A 3J7AC 3DDHA 4M98A 5DM4A 3SQNA 4N1AA 4LF6B 2FZWA 1L7PA 1M67A 3GF4A 4AY3A 1HNWB 3HY3A 3L7LA 2XB4A 4XWAA 2YKGA 4ZZ0A 1UWCA 3RLFA 3AM1A 2I4RA 1E1CA 1L4LA 3B7GA 3MJCA 4CPDA 3P9NA 2OSBA 4LKOA 5D3QA 5EYPA 3LUKA 1BCSA 1DAPA 2PZKA 3H1AA 4ZCTA 3CQ9A 3PRKE 2KE5A 3U4HA 1F12A 1L7MA 2RJ3A 1LNZA 3BFPA 1CR2A 3GO4A 2H2IA 3BSWA 1L7BA 3O03A 1ILEA 1YV9A 4R1OA 5BUZA 4BNDA 1PHRA 4KIUA 1DAGA 1PIWA 2O3TA 4RLSA 3AVPA 4A6DA 2UUCB 1NJ8A 4XQEA 3KL2A 2WHPB 5JPIA 3RFUA 4ZOLF 2I3GA 2PMKA 1ONSA 2ORWA 1BEUB 2DPXA 5CVJA 4F6RA 3RRJA 5K3EA 1DEKA 1DS6A 2Q0QA 1HM5A 2CUNA 3PCXA 3WVNA 2HMYB 2OCDA 3RHZA 1Z6GA 3BMCA 3GI1A 3M89A 1CNMA 2BV3A 4IFIA 4FW9A 4N03A 3UUGA 4FTWA 4MAFA 1N2ZA 4OLAA 5J4KA 5JMOA 4FQ8A 4WBXC 1E2HA 2YZGA 1Q0ZA 1SQSA 3HGQA 4I3GA 4RK1A 3V1NA 1Z5GA 1HDEA 1QPGA 2N1MA 1XAJA 1J90A 4HXEB 4JC8A 3GRYA 5TT1A 3IHKA 2CLHB 2QDXA 1L7NA 1RHKA 2RSLA 5LDHA 4PSKA 3QELB 4QPNA 3BCHA 4GLFA 4YMHA 3ELDA 3R7FA 2X8JB 3VNSA 5TS2A 1W48A 3ADOA 1US8B 1R27A 4JLDA 1I10A 5JCZA 3W3ZB 2JFOA 1IOLA 1W0JA 3RRXA 5ICSA 1BS9A 1YFJA 5IT4A 3LZ6A 4FOOA 4EI8A 1EA5A 1PJ3A 1Y63A 3RWBA 4QU8A 4YV1A 4GXNA 3R9WA 4P5DA 4MDFA 4BVFA 1OZHA 4B0OA 3GUCA 3TE6A 1BXGA 1S3FA 5KWVA 4LPSA 3SFZA 3CNOA 5KQPA 2Q6LA 3ZHBA 1FBTA 2DHEA 5I7SA 3IVGA 1M3SA 2H2GA 3W9YA 2W93A 2IEYA 1XXHE 1TNDA 2OV8A 4KN9S 5I7VA 4GGPA 3LLMA 2AUNA 2WAAA 2PUTA 5DCWA 1F8GA 1LSJA 4X8OA 4EX6A 5L40A 3DLBA 3GJ8A 4D42A 1QIDA 1Z39A 4II2A 4DEXA 5I7HA 4ZC8A 4CTJA 2B7BA 3BPSA 3LWBA 1MEOA 2X6RA 3VSBA 3QVWA 4ME6A 4AJHA 3NX4A 4U5XA 4PZUA 3Q72A 3KYBA 4Z51A 1DKLA 1MQ8B 2BCJQ 4YMUA 5CPFA 3LQ4A 1QFXA 1UFRA 2VH5R 1SC6A 3A6DA 4FYYA 2XWBF 4IQGA 3WK9A 4A4DA 1G5RA 1OLXA 2C9DA 3V48A 2A9KA 2AKAB 1YCHA 2EZ8A 4NTZA 4YRPA 2GEFA 3RU7A 5A4FS 2I7TA 3G2KA 1QKKA 5KWIA 4OM8A 4LYJA 3S0JA 2ASVA 3L8GA 1NMXA 1UMDA 3F7TA 4KQ9A 1ZXXA 1C3XA 1YAJA 3EOAI 1G3MA 1UAYA 4TRNA 1NW8A 5H3LA 1T3HA 1HDOA 1C81A 1HQCA 2YBEA 3F8SA 5BOSB 4FSXA 3UBMA 3HBLA 3QK7A 3DAHA 3FDFA 3ISVA 5IFLA 3ICOA 2QAIA 1C7ZA 1UPUA 3L9XA 3FJ1A 4OU5A 4MQLA 2XUJA 1U0EA 2O2XA 3EGXB 3H13A 4ZV9A 1OILA 2IELA 2GXUA 2IKQA 2V7QD 3QXJA 1IAVA 1T25A 4F3NA 5IULC 1T8YA 1KJ8A 1U9ZA 3ZW8A 4AP9A 3FPBA 5A3RA 2QTHA 4XB1A 3OX4A 1XDUA 2GYWA 2PUJA 1VXRA 4XIFA 5DNEA 2XQIA 2GAOA 4Q5IA 2MYPA 2R7KA 3B9QA 4F85A 5IF3A 2JI4A 4ZTUB 1J2JA 2IZZA 2RARA 1G21E 4Y6QA 1KPHA 3V4SA 3PXAA 4UEKA 1ST3A 2FP4A 3MUNA 3ONNA 2Q50A 2QL5A 3BHIA 3ER6A 4G0YA 4QAJA 4RPJA 2E4ZA 3DBRA 3ZEAA 2FSFA 5JARA 1WCWA 1TMGE 2F1JA 1D4AA 4EB8A 7AT1A 1NRWA 4X1KB 5LBTA 3E2PA 1XEWX 2GEDA 2WMDA 1Z8NA 2PY6A 5FBZA 4C6RA 3EC2A 1YD7A 1GYQA 3B70A 3I6BA 2C77A 3R9IA 3WE7A 1MA0A 1CJSA 4OB6A 1D04A 1RHQA 2BIFA 1W36B 2XQKA 4M76B 1QB7A 4BFUA 1R6VA 1K3TA 3F5QA 4JLJA 2QW0X 3LT1A 4HYQA 3T7DA 1B93A 1C4KA 3ZY3A 5EP1A 1P9WA 1NFQA 1I2BA 5SYAA 3K9HA 3R6TA 2EQ5A 2OAQ1 3ZI0A 3AJ8A 3GRVA 3MUEA 3NM5A 1O9GA 2FZGA 3RRZA 4DUPA 3BM5A 1I3OA 2R8OA 1WETA 1DRJA 1QHFA 2AR0A 2GD6A 2J0EA 4Z0TA 1V4VA 3VDRA 4XYLA 4MH0R 5BSWA 2AFIB 2MJLA 4G1VA 5LL6P 1XXHB 1QQ5A 1SRRA 4IICA 1PYDA 3TRHA 1ML3A 3RS3A 4FNOA 1ZD3A 3H4MA 4AG5A 4DB4A 1JA9A 1OAAA 1ZD1A 3C3YA 3K0SA 1UEIA 3PL5A 1K2WA 1QE0A 4LTDA 3EGWA 1E2DA 4ZYXA 3HTXA 4WA7A 1E6LA 2TS1A 5B1YA 5GY7A 2HSEA 3NEPX 2BBTA 3UXYA 4Q7QA 5K0TA 1JG4A 2XLBA 4ZHQA 4GKKB 1U2TA 1ETUA 2HGSA 3K09A 3WYAA 1B74A 1XQVA 4OUDB 3ZZNA 1M54A 3BN3A 1E79A 2IVFA 2CHQA 2XYPA 3R41A 1QAMA 3KXLA 3OCJA 4JU9A 5EUBA 5B1IA 3KUUA 3AC0A 4PRLA 4Q66C 3TVDA 4DCVA 1NL3A 3S8MA 3QEMB 2D1TA 1NXWA 3DEHA 4HVAA 1ZHFA 2VP0A 3HO1A 4A27A 5HVNA 4HNVA 4B6GA 1HMYA 1LPNA 2GBFA 2V8OA 1QX3A 1DWOA 4BVLA 1JJFA 3IEKA 3O1JC 5JAHA 5AKHA 1Q57A 3ENNA 3BIFA 3OZBA 3VJLA 3QHQA 1JYEA 1FDVA 2RG7A 2AOUB 3KEMA 3H3JA 3E7WA 3IALA 1TF7A 2NMVA 2IPOA 3GMIA 5BWMA 1Q3KA 5ECYA 3PS9A 3T1HB 3CZ9A 4QFBA 2WSMA 1JFFA 3EE6A 3PIRA 1G9TA 2F1OA 4X8MA 2W8BB 2X14A 4Y1RB 4RA6B 2WF5A 5DLDA 4KDRA 4G5XA 3RJZA 1JA1A 2NYRA 1IBKB 3NUQA 3U3MA 5BVHA 3F7NA 5A7GA 3DEIA 1TZBA 2A88A 3FWPA 1MX5A 3N6XA 1TA4A 1MW9X 4GBJA 1S96A 5AICA 1YVUA 3GLHB 5JROA 3U4AA 4E08A 1G4UR 3PGLA 3ZTYA 1OGIA 4EUKA 3TK1A 2HREA 3N6RA 4NRDA 1RQGA 1SHJA 4IV5A 1O94C 5ADWA 1XZ8A 3HKDA 1I36A 1YRQA 2E6UX 2ZKLA 3U1TA 4DWOA 1MABA 1X86B 3E8XA 2KPOA 4MIOA 4FMPA 2VJOA 5LXTB 3M6LA 5JUWA 4DMGA 4KJZA 3PK0A 2ZAMA 2DE0X 1V1MA 1YQDA 3DE4X 5FHRA 3RIXA 3CR8A 1M1UA 2KYRA 5ITSA 4CR8A 5GGXA 3W8DA 4QYIA 5JPDA 1RXVA 3LUHA 1KF0A 3CLKA 3VR3A 3ZC3A 2YDYA 3AWDA 1VE9A 1FRQA 3DE3X 2CF6A 4TTIA 5BN1A 1Q7BA 4AMYA 2Q3HA 1GNRA 1IY0A 4ZJUA 1QHIA 1D0VA 2FPPA 2GZ1A 2Q6TA 1EG2A 4ZPJA 5C35A 6REQB 2W4IA 2OC4A 3G5LA 9LDTA 2EJCA 3L0CA 2P9HA 1Z9BA 2ZRAA 1SB8A 4FXOA 3GCZA 2C9MA 4AWAA 5FBQB 1C0KA 3QWIA 4FZRA 3CH7A 1HRDA 1NI5A 2AFIA 1GTZA 1JB1A 1QBKC 2EEZA 1G7RA 2P3LA 3OHMA 1P7ZA 4OQYA 1Y7LA 1Q0QA 2BZGA 2Q0XA 1APBA 2VSOA 5H82A 1ENPA 2FFHA 2QP4A 2XXJA 3GWGA 3KOYA 3HKBB 3A2KA 2GFIA 5LP6C 3CNHA 1X13A 3HC7A 3ZGLA 2I87A 1LWOA 2Z0MA 2ZAGA 4QTUB 3C3AA 1GNLA 1I1HA 3PD1A 4P4NA 3UOAB 1W76A 4GPIB 3HP7A 1E4OA 2BEVB 4R2HA 4BJ6A 4C7KA 2DLCX 4O25A 3QPCA 3TLGA 1J5XA 4UUBA 1JILA 4CKEB 3E1KA 4CM9A 4ZVKA 1C7EA 2AN4A 1A8HA 3V8BA 1EZZA 1Z5NA 1TCCA 1FFSA 1GZ7A 1ADCA 1RFLA 3M81A 4N3GA 3W4IA 3SZMA 1Y7TA 2A86A 1GM5A 1OZAA 1VCIA 1YE5A 3IV6A 3MIIA 2PX2A 2FW0A 4EW3A 1TW3A 5T6MA 2P41A 2F1RA 3OLVA 3K9GA 2JBAA 1OSNA 4S12A 4A16A 4X64B 3V1TC 2C58A 3SIRA 1JHYA 4LRUA 4JUAA 5LU9A 2SKDA 4DWJA 4MLCA 4U5QA 2XUKA 4Z7NB 1E5DA 1OA1A 1Z35A 4D9MA 2GJAA 1Y3FE 4HH4A 4DLKA 2YCBA 1KA9H 3LX6A 4CKWA 3W6UA 2ZSKA 2OFWA 3D59A 3EAGA 4MQ6A 4QPDA 4EUSA 5KWSA 2R1TA 3G0IA 1NVMB 1Q1BA 2F00A 3R09A 4DVGA 4ZEMA 3MT9A 2B9EA 4YIHA 2ENUA 1ZVQA 1NFRA 2DTDA 4ZHSA 5KTYA 1PW7A 3IFSA 4H7DA 4OJKA 2W48A 4S0ZA 1VSBA 3KUKA 4OH7A 2JLYA 1CJKC 1V11A 3O2SB 1IG0A 2XMGA 3E61A 4HN9A 5EIWA 3JAKB 5CFQA 3QXGA 4XVQA 3QVUA 1R0WA 4JBWA 1SKYE 4DCGA 4G65A 1SIUA 2IYPA 3OM8A 2OVFA 2W2OA 3OP1A 1CETA 4G0QA 1Z7YA 1Y34E 1VG0B 4Q93A 4QPCA 5HF9A 1TAGA 1AKVA 3MVEA 5DW0A 1W36D 1FJGB 4UM9B 3KJGA 3IIJA 1X3SA 3H05A 4BVGA 3LTNC 2OD2A 3O38A 1T8UA 1XHLA 2F43B 3UMFA 2C0CA 2DQYA 4A15A 1EWKA 2V97A 4F6RB 4WBNB 1A50B 1GCAA 1P45A 1X7GA 3K5PA 3WIUA 5CITA 4HDRB 4FDUA 1ZMRA 4JVOA 1PT9A 3LQFA 4INPA 4C4TA 1Q74A 4JUBA 3SF0A 4BBJA 4HVTA 8ATCA 5JXJA 4C0XA 3PTLA 1RYFA 4R51A 2C1XA 4RKFA 2D59A 2BHNA 4MQFA 4YTEA 1HYBA 5LDGA 1YOBA 4Z6KA 3II6X 3R5XA 5J4YA 4BIIA 4OSPA 1PUXA 2VWQA 3GT7A 3E53A 4JLMA 1JG6A 1O4WA 3CGGA 4Q3BA 5EAIA 4YP9A 3UMSA 1M2FA 1PVOA 2UVDA 4IIYA 3DAOA 4RSRA 3EA4A 1DOHA 2PGIA 4X97A 1N0UA 4EFLA 4F4IA 4A8PA 5HUJA 1GPUA 2C5EA 4R8VA 5SY6A 4WK0B 3V1KA 1FDUA 3UPTA 2Z2XA 4NU6A 4PYQA 4WHMA 4BZWA 5HF5A 1XCGB 4W63A 4GNRA 4HL6A 3QUCA 5SZJA 5DSZA 3IIIA 1CQXA 4D5EA 1I7QB 2IS2A 1XKXA 2AEMA 4DW8A 1TF5A 2EFGA 1PSDA 1R0XA 1RC0A 2VXCA 2ZU0C 4OHKA 5CDYA 5DN6D 3A9TA 4R4JA 5IXYA 4WASA 2XUPA 3EZ9A 3GG9A 3OPMA 4M9ZA 5B37A 2ZUEA 1E6MA 4CT5A 1XMQB 1WLYA 4YXWA 1SKMA 1BE8A 2J9FB 4ZOLA 5G3YA 1HT2E 5SY9A 3DPIA 4R8RA 1P9OA 2TMDA 1JG3A 1I0ZA 2B1IA 4G0MA 4GR9A 5E8RA 2IGBA 3VPAA 1RQXA 4DV6B 4YDHB 1E94E 3AUAA 4NC9A 5T57A 4LDZA 3DE2X 2AN9A 5FOVA 3CPJB 3CRQA 4ZAVA 1MJHA 2NOAA 4CCWA 3NONA 1ORRA 2ZM6B 1AUXA 4PHHA 1AF7A 2CL0X 5LZ8A 3J81k 3P0HA 2H1CA 2HV9A 3EYWA 5KS2A 1SXJA 1DTWB 2Y6VA 4W1RA 2D1QA 1QB8A 2B36A 2B4RO 2IZ1A 2YXPX 2I3DA 1RXUA 4NBVA 4YRDA 5C32A 3AG5A 1CF2O 1M6WA 1ECBA 1YCFA 2HK6A 1SU7A 1YONA 2GDZA 1LLCA 2I2WA 3GHYA 4WLUA 4C6HA 4L8VA 2VDKB 4GWLA 2TRSB 4AZ0A 4XTCS 5H9WA 2GERA 4B3TB 3S68A 2I7VA 3UWMA 1T8RA 2A57A 4POAA 4YFYA 1AQ6A 1O54A 3MWYW 5ENZA 3BZWA 4DC9A 3OPQA 2ZW9A 3NAMA 1BEEA 4RSGA 1NNUA 3CNLA 2FDCA 1PBTA 1XTPA 1C1XA 1NQAO 4AY2A 1XN1A 5CNMA 4J0EA 3QVGA 3H87A 4G5GA 3AEYA 5DX1A 2Q3JA 2JGFA 1N8TA 2NVUA 3C5VA 4AD8A 2VYND 4JROA 2DPLA 2FEOA 2B61A 2ID7A 4G25A 4LE2A 5AVKA 5C4GB 1O87A 5JE8A 2REBA 1BCRA 1FOEB 3NT2A 4MV5A 2C92A 1XL0A 3CJRA 4OP1A 1FYDA 2GBIA 1T2UA 4O4JB 3WK7A 4Y9UA 1N0WA 3WQSB 3TAHA 1QG4A 4Q1EA 1H1LB 4GP9A 1E3WA 3ZXSA 5IZCC 2G71A 1UBEA 3CH5A 1WDWB 4BZZA 3TX2A 3OQIA 4DEVA 3K70D 1NBIA 2QYHA 4JT9A 5BN4A 1BFKA 2C0QA 5KTOA 1M2NA 1YBFA 2G1JA 5KCZA 3ENQA 4O4IF 3UAOA 2QVLA 4F9FA 2RGCA 3REGA 4RYDA 2WP0A 2X0KA 4Q1FA 4TYYA 4EHIA 9LDBA 5JNLA 3IEPA 3FRHA 2BGMA 3EHEA 4GL4A 4KR6A 1E3QA 1UT8A 1H05A 1WZCA 2WLSA 4M38A 4P86A 3I9JA 5BYAA 1OXMA 2P79A 2OECA 4WY8A 4JI0B 4H6WA 1JF8A 1KFBB 5IT5A 1DEXA 5CLFA 3MTGA 4XI9A 4RGQA 2ZI3A 2J48A 2UZ1B 2Y05A 3DMNA 1E5TA 1AQUA 4J3FA 1SZDA 5B3AA 1CR6A 4FKMA 4BO3A 2G07A 3O4IA 1KVRA 2QP9X 4LFCB 1DOZA 1ZM9A 4R9SA 5FYDA 2ZU6A 4I6JA 2JFZA 1N6NA 4HUQB 3IT0A 3RDPA 3TG8A 2OXCA 2AWOA 4OX9B 1PV2A 1HFWA 4GRAA 1HTWA 2WWWA 3B60A 1H9BA 2FZ5A 4L15A 3C3CA 4WZAB 3EIXA 5CA0A 4AP5A 4OPMA 2GKSA 5FXMA 3ET5A 3EPJA 2VNJA 4F2WA 1P4AA 4EAQA 1T5IA 4NOLA 4J1TC 5E6UA 4BCBA 2IBTA 4KPUB 2HHAA 3WRVA 3KP1A 2VRNA 1R3DA 4RD6A 4PSCA 1YS7A 2GXQA 2PYZA 3AQIA 3PJDA 4FLMA 4MKIA 4BVHA 4DIUA 1DELA 1GVNB 3S44A 3AYXB 4XB2A 4A0RA 4EFDA 1NIPA 2R9VA 2VF8A 3JQEA 13PKA 1WTCA 2I2AA 4PZZA 4YAWA 4DCJA 2CDBA 5FA8A 4TOIA 3LVFO 5JTUA 4HS4A 1VBKA 1YACA 5AXAA 3FIJA 3Q3HA 3V9PA 5AW4A 2YINC 3NGMA 1UPFA 5P21A 2RGWA 1YS9A 5JHGB 1Z06A 1OX6A 1JJAA 2XZPA 3A9CA 4PWZA 4B7XA 1PL8A 2OKCA 3IVXA 4I4NA 4LYEA 4G5FA 1SAYA 4P4TA 1BMFD 3KKQA 5JI3E 2F8SA 1ZKMA 1LRLA 1ZH6A 2CLIB 3JQCA 3M6FA 3L41A 5KDLA 4MXDA 4JI6B 2A5GA 1UKZA 2HYIC 4FE3A 4EHNA 2RHWA 3L93A 1V6CA 3FLBA 1HDXA 2M6SA 1JR6A 1D5CA 4B4WA 2XBUA 1MAUA 2Z1DA 3T5AA 1GQFA 1WEHA 1Q16A 3JQFA 5EN4A 3E3NA 1HA3A 4NMHA 4EI9A 5IUNC 1PT7A 4Q3AA 1G3QA 1R12A 4NENB 5AK4A 1QTIA 1Y1RA 5I8ZA 1D2CA 2XNHA 3OO0A 3HWWA 2E21A 3CNNA 1VKRA 1OE0A 1PFUA 1KKMA 1P5ZB 1TKCA 1UOEA 5DU2A 4YAKA 2H1RA 3VH2A 4MKFA 3NDRA 4BO5A 5ALXA 4IDPA 1VYHA 4JT4A 3HB7A 3TPFA 2D2EA 1V5EA 4RXMA 2FN4A 2BJHA 4KTTE 4UUMA 3PNQA 2C2OA 3DDWA 4EBFA 1KU0A 1H1LA 2QP3A 5AW1A 3DQPA 2CBXA 3C3MA 2X9QA 3ZCQA 1W4ZA 4LHWA 3WRXA 2HA3A 2WV9A 4HH0A 3NGLA 3IE1A 2I7DA 3IUJA 4C2UA 1JSCA 3FTPA 2X0DA 2VR1A 1J8MF 1LBHA 2V74B 3DB2A 1P9RA 4YS6A 1UF9A 3U26A 4K2HA 1KMHB 4M7RA 5F1KA 3KSBC 5K0BA 4D9NA 4F4CA 3MTDA 5BN4B 2I65A 2VHVA 2W6QA 2H2AA 3P19A 4M36A 2W2MA 1RCTE 1M6VA 3EDCA 1I2MA 1X7ZA 3RIHA 4EVRA 2DAPA 3I39X 4D79A 1ANKA 4D0GA 1CUBA 2IDKA 1RXSA 5AKKA 2C2BA 3OUUA 4B87A 2Q9AA 4PG7A 2XE6A 3AY3A 5EKTA 2O2HA 4JX9A 1ZUNA 2FPGB 4BTVA 2O7VA 2NYUA 1C0LA 1HG0A 1TQDA 3IC5A 3CZCA 1TXGA 3SHWA 5FH9A 1T9HA 2Z8XA 1OCEA 3FW1A 5EIEA 1VMDA 5D00A 1XT6A 4KLRA 3VFDA 1HRKA 3GLSA 1I2AA 5ALEA 3WIVA 4FI3F 2DWCA 3AR5A 3WJAA 2OG2A 3KUXA 4BMSA 3LG2A 3LKVA 3P2MA 4U63A 4Q4CA 4YCNA 3T7IA 4JFRA 2P11A 4JLUA 5BR1A 2O1EA 1IN7A 3KOXA 2O2EA 4D98A 3UK6A 4RZ3A 5BQOA 3OM1A 1BA3A 4UQPA 1P4HA 4M9SA 4RFVA 1S6YA 1W35A 4URHA 3F6PA 3RYIA 5C52B 2HZ7A 2MWMA 3T9EA 2BCEA 3UAVA 3OPYA 2C95A 5DULA 2BDEA 3STYA 2WJGA 3VSDA 3TZBA 2O20A 2RHJA 2UZ0A 1KGDA 1I32A 3GWZA 4TMWA 2Q3EA 3GRUA 3SE7A 1V8OA 3R5FA 3UXHA 4DIOA 3C74A 3KHSA 4K6OA 3HACA 6NULA 1VLHA 1WF3A 2ZIZA 5KNDD 3PTAA 1DWUA 3IMKA 4HNUA 1DFGA 3RRFA 8MHTA 2D5LA 3PG5A 1E92A 5THXA 5F7ZA 2QTVB 1ULBA 3UJ8A 4Z4CA 3AIKA 3OPYI 2IXEA 4WAUA 2QTLA 2O8DB 2O3UA 2EC5A 3DO6A 1CNFA 2YIMA 4GF5A 4HH1A 4N3NA 3MXOA 5HOEA 1E0AA 4ND7A 2GLUA 4LZNA 3PQ5A 3LHDA 3LQRA 4EW6A 2L2QA 1QVVA 4HUTA 1H2XA 3JRXA 3KPYA 1CDOA 4UUQA 5PGMA 4QEDA 1RYNA 2DUUA 3PJEA 3EEQA 5FUQA 2QW8A 1ZESA 1NXTA 4ZMBA 3A11A 3UTDA 4IS3A 1L7AA 1YZVA 3CSUA 3UG6A 4HYTA 4LXUA 2C5BA 5JQGB 4CCYB 5JD3A 2VTDA 4YREA 3SC3A 3WMRA 5JR3A 2W2XA 4MR8A 1O96A 2CLOB 1USVA 3N70A 3UT0A 2ZVQX 3PFIA 1UJCA 4B9EA 2DTEA 3OTWA 1UJ4A 1CJBA 1HTTA 2AXNA 4MVJG 5FPKA 1P0PA 4CLEA 2W2KA 3NTOA 1MC8A 4RF4A 1MT3A 4JP8A 1ECFA 3BILA 1WKCA 3TW4A 3CW9A 1K7SN 1OBHA 2X9NA 3L7JA 3TQFA 3TZHA 1TU3A 3JALA 1AV6A 2AWNA 4DLNA 5SYNA 4UPVA 2JIOA 1X1AA 3UAZA 1SCBA 1FP2A 4OLFA 5A9SB 4RWZA 4ARCA 1GG5A 3I92A 1YCGA 1MJNA 2CLMB 1JLRA 4DZZA 2SECE 1KZ7B 1T9KA 2NXNA 1TO1E 2HCTA 2ZJFA 2VRWA 2A9FA 4E5UA 2JRCA 4GKVA 1ITZA 5EWJA 3V80A 4B3IA 2J0SA 3M8KA 3RFFA 4Q4JA 3PTZA 1FDTA 4GC9A 2BMVA 1SU8A 2JGNA 3NHUA 4BHTA 1JHXA 3H65A 2ECKA 1IEWA 3MOSA 4E2FA 5A5GA 5JRZA 1WUTA 3JCZA 4PGGA 3I45A 4KQCA 4YLGA 1W44A 2Q5FA 1MB9A 2XVZA 3NGXA 4M8IA 3ED5A 2R8ZA 1LX6A 2VPIA 3X1JA 4EI2A 3VHXB 1BJKA 1U8YA 2PG3A 1GZVA 4UOZA 3OPVA 3ZZMA 3GEIA 1CQWA 3RHFA 2CXSA 2NUPB 4H17A 4BNNA 1Z6QA 1MR3F 3FTEA 1UZMA 4EH1A 1NJSA 2X9LA 4OAQA 3VAYA 4CF5A 3VV2A 4C03A 3ZLUA 4HNSA 3HUEA 4QUJA 4F5ZA 1GRCA 1JJ7A 2IQ5A 4ZD6A 2Q5CA 1FJXA 5T7BA 3NWEA 1OWPA 3A6HA 2QVYX 4CL3A 3NHZA 1GNSA 1ULTA 4QTYA 5FNZA 5KTNA 1X92A 5I4IA 4F12A 1Z34A 4JYAB 2DHCA 1Z2NX 3HVIA 4NSNA 5AVTA 3EGEA 5DXAA 4DV2B 3OFJA 4K8OA 3IQEA 1TKBA 4BL5A 1E1YA 5DHFA 3WBBA 3WYFA 4GVLA 2H3EA 4L8LA 3RVMA 4O4LF 3IERA 4ARAA 5TMPA 3NHLA 5FOWA 1FS5A 3WX0A 2YV5A 4ZO4A 1PV4A 2C1ZA 1PJLA 1RYMA 4LN1A 2AJ8A 2I2FA 3TSCA 5CLJA 1D4OA 4XW2A 4L51A 4FPXA 3SFTA 1RBYA 4LFBB 3OQBA 1DWQA 2ID8A 3MWJA 2YY5A 3SBXA 1AMOA 2Z9BA 2GF2A 1U6JA 1F38A 3HN2A 5G2OA 1V7ZA 5JHHB 3FETA 5KREA 1SC9A 2JFPA 2CJXA 1Y4DE 3QIVA 1JQ5A 4WNAA 1MB4A 1L5WA 2PCJA 3FSJX 5CRIA 5AHKA 1IN1A 1FS4A 3KFXA 2J5QA 5CPBA 3TZ6A 121PA 3JAWA 4YT4A 4Y6GB 1J1ZA 2YNMC 3HPQA 4GPEA 3BMOA 5B6PA 2DJIA 2YFHA 1MGPA 4DTCA 3T3MB 4ETIA 2XA9A 1NQ5A 1P5FA 2O2DA 2DBYA 3H8WA 4GWGA 3B48A 3VPSA 3UENA 3OIGA 1K8ZB 1YBVA 2HJVA 1H69A 3OJLA 4QT0A