5FLYA

The fhud protein from s.pseudintermedius
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
279
structure length
279
Chain Sequence
b'KETKAFNLKTAKGEEKIDIPKDPKRIVVMAPTYAGGLKYLDANIVGVSDQVDQSPVLAKQFKDVDKVGAEDVEKVASLKPDLIITYNTDKNTDKLKKIAPTIAFDYAKYNYLEQQEAMGDIVGKSDEVKKWKADWEKQTAQDSKDIKAHLGDDTSVTIFEDFDKKIYAYGKNWGRGSEVLYQAFGLQMPKALDDATKKEGWTEVPKEEVGKYAGDVIITAKAKDAAQPEFQKTAMWQNLEAVQNKYAFNVDSSVYWYNDPYTLDVIRKDLKKQLLALPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERRICHROME-BINDING PERIPLASMIC PROTEIN
publication title Crystal Structure of Fhud at 1.6 Angstrom Resolution: A Ferrichrome-Binding Protein from the Animal and Human Pathogen Staphylococcus Pseudintermedius
pubmed doi rcsb
source organism Staphylococcus pseudintermedius
molecule tags Metal transport
total genus 91
structure length 279
sequence length 279
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 5flyA02
2PRSA 4H0FA 5B58T 4WZBA 2OV1A 4DBLE 1FP4B 3MWFA 4MO9A 4BBPA 3MINB 4TKUB 2WI8A 4UDOA 4UTOA 3K1AA 2OV3A 4WZAB 2YNMD 2QI9F 1KAHA 5BVHB 2AFIA 5KOJB 4TKVA 3HJTA 1G20A 4WESB 1QGUB 3AEKA 1ESZA 4PM4A 1KAEA 5BVGA 3NU1A 3HH8A 4HMQA 2Q8QA 2M6LA 1QH8A 2PS3A 1G20B 1N2CA 5JOQA 2RG7A 4MLZA 3R5SA 4N01A 5JJ5A 1H1LA 1MIOB 4UDNA 3ZKAA 4WNAA 2PS0A 1L5HB 3AESB 1G21A 1QH1B 3AEQA 4WN9A 5JPDA 2X4LA 4INOA 1N4AA 3PDIA 5JG7A 1M1NA 4WZBB 4M7OA 3TLKA 4NNPA 1N4DA 2XV1A 2PHZA 4XPIA 1KARA 1N2ZA 2WHYA 5KOHA 1K7SN 3UJPA 2AFHA 3AEQB 5M3BA 3AEUA 3K1AB 2R7AA 3AERA 5KHLB 4FKMA 5M29A 1M1YA 4LJSA 3U7QA 3ZK8A 3AETA 5CR9A 1PSZA 2AFIB 4ND8A 4TKVB 2Q8PA 2XDQA 5CX1A 3TNYA 5AFSA 4MDYA 2MINA 4NNOA 4INPA 4K3VA 3AEKB 4FNAA 3HXPA 2YNMC 4HMPA 1FP4A 5HX7A 4FILA 2M6KA 4UTPA 3LHSA 5BVGB 3MINA 3ZK7A 3EIWA 4TKUA 1QH8B 1K0FA 3MWGA 1K2VN 2XDQB 5CX1B 4PAGA 1N2CB 2R79A 4MX8A 3MFQA 4WZAA 3MD9A 1H1LB 3EIXA 5BVHA 4WNAB 5KOJA 4IRMA 5HDQA 1G21B 4HN9A 2XY4A 5GGYA 4WN9B 5M34A 1PQ4A 3BE6A 4OVKA 2ETVA 4G09A 1QGUA 4WESA 4HMOA 1EFDN 4CL2A 3PDIB 3CX3A 1M1NB 2XUZA 2XQVA 4G07A 4OXRA 1M34A 3ZTTA 3LI2A 2OSVA 4XPIB 3ZK9A 4FI3F 5KOHB 5FLYA 2O1EA 3R5TA 2AFHB 4OXQA 1TOAA 1K75A 3AEUB 3PSAA 4GICA 5I4KA 3AERB 4LS3A 1M1YB 3G9QA 3U7QB 1MIOA 3AETB 3PSHA 4H59A 4ND8B 5GGXA 3TEFA 3AESA 1L5HA 2OGWA 3GI1A 1QH1A 3BE5A 4B8YA 2XH8A 1M34B 5M2QA 2PS9A 2MINB 1XVLA
chains in the Genus database with same CATH superfamily
3V8MA 3EXHB 2GI4A 1WV0A 1XEXA 3LHFA 3HKDB 3II6X 1Q2XA 3H2JA 1PR0A 3O92A 1E2UA 4JT9A 4P92A 5A0VA 4NE9A 3V7YA 3LPCA 2P9ZA 1PQPA 2MU1A 2UZ1B 4QT4A 4JJAA 2HA5A 4D4HA 4FSXA 4BC1A 2XA1A 4NYJR 1DIRA 3O1IC 2DT5A 1N57A 2PLNA 1I8TA 1NQXA 4MYRA 4RELA 1JQLB 1GARA 1BX3A 3ZX5A 4AY5A 5ESWA 4R83A 2H1HA 4KDCA 1U9IA 2JLAA 3ZY3A 4CQMB 3L0CA 1DX4A 4RV4A 1DQSA 4I5GA 2UZ0A 3S1SA 3C3DA 4CDMA 3Q40A 4IJQA 4FMCF 2WU4A 3C5VA 4ES6A 2R6JA 3E22A 4A36A 2X7JA 1JIUA 1QIHA 5F77A 3WLEA 4CNBA 3HM9A 4N40A 3KPJA 3AM1A 2OBBA 3PUVA 2EF1A 3V1YA 2WE7A 3E27A 4WLVA 3TIFA 2I8AA 1L4GA 3QUTA 3A31A 2ZYDA 4FDVA 4E1BA 4YLYA 2X2EA 5BN4A 4MUHA 5NULA 4MEBA 3PEWA 1KS2A 1LJUA 2QLMA 3E2MA 3DNFA 1RTTA 3LQFA 5CVUA 4CQNA 1X7WA 3TLYA 1GZUA 3ZU6A 3RRNA 5CGZA 4REQB 4ZAVA 3B3GA 1SUAA 4DG5A 2WHYA 4MS4A 4X62B 2BJHA 2X0RA 3RW9A 3NTXA 4HBZA 5L8VA 1N6NA 4L5BA 2AOVA 3HCRA 1YK0A 2Z5VA 4E4TA 1U7PA 2QN7A 4ZTUB 3OG9A 2OHXA 4PX2A 1BA2A 3RSFA 4B3BA 3DHNA 1OLUA 2IZ0A 3SEZA 4KQ2A 4U0KA 1JNYA 4YS6A 2O52A 1ZU5A 1AZSC 5G40A 4E94A 2QSJA 5DTJA 1DXHA 1UWVA 3OSUA 4Z4GA 3E7DA 3NHFA 4ZT6A 3S7ZA 1YNSA 2CKMA 3VR3A 4CF3A 4ZCIA 3WR5A 4YONB 1UFRA 4LOKA 1ZNWA 4Y6OA 3CKLA 2W83A 1H6CA 3T9FA 1LF5A 1OAKA 1UWKA 2RH5A 4IFTA 2WA2A 2PH3A 4FIZA 2WPDA 4S1VA 2WYUA 4MQFA 4IP0A 2JJ2A 4JBWA 1KYTA 4R81A 5GMOA 2ZJFA 3IP8A 1N6RA 2E18A 2VJLA 4J0HA 5MN6A 1B23P 1HXHA 4EAAA 1YJCA 3R6WA 1I9CA 3HCEA 5LQKA 1SHJA 1BMQA 3PDIB 1X2BA 4NFYA 3KLNA 4R1PA 2BFCB 4MCJA 3EVAA 1KMMA 4S1WA 3O4JA 2V8BA 1IQRA 4CN8A 3NP9A 5EWLA 1HE8B 3CA8A 1YTLA 2QVBA 2WKSA 3SMVA 5MFPA 3ISVA 5KKAA 2VHVA 1J2RA 4PYMA 2E4ZA 5EOVA 1WBDA 5BSEA 2QOEA 1ZCBA 3N2EA 3D43A 3WLFA 4NR0A 4DA0A 2QX8A 5HZGA 3LOQA 4G0XA 2P9BA 5A9TA 3I9FA 1UXHA 2ILVA 4H60A 5B37A 5EA2A 1NOJA 3S55A 4RA6B 3GRFA 3PFWO 1O94D 1P8AA 3L41A 5AJTA 3SHVA 4FBLA 3ZDBA 4CEJA 3FCXA 2VDUE 2NGRA 1E7YA 4QFMA 2Y68A 4MVJP 4PY2A 3ROXA 4EZIA 5FWAA 2XQFA 3NPAA 4GBED 3A1EA 3IVXA 3HVUA 2HFJA 3ND5A 1ACMA 5CW2A 1IWBB 4E11A 1DAIA 4FZJA 4RXUA 4UTOA 3UAXA 3P4YA 1YUBA 1M6EX 1ZBQA 4YJHB 2G1AA 4I8XA 1YVUA 1KQNA 3FHOA 2RHGB 4YLGA 1NP6A 2ZUBA 2ZPAA 2G1JA 1XPJA 3GGJA 1LV8A 3UK6A 4CNQA 2B7BA 2A1UB 1V1MB 4ZVKA 1JEAA 4RA9A 5IC5A 3QA9A 4ARIA 2JAQA 2GJ9A 2E4AA 1KE1A 4ENPA 3VTAA 1VI6A 3ZZMA 3HUEA 4ZPXA 3BXPA 1A69A 5DWVA 5LP6B 2M32A 2XQJA 5GJWC 1OXSC 1DIAA 1ORVA 3GFTA 4H7FA 4UBMA 3V2UA 2IYFA 3RJZA 1FQWA 4FDMA 3CH6A 1AKMA 3AYZB 2M6LA 1VIDA 2ZRCA 3G82C 3RHZA 1JHOA 3L0DA 1GFWA 1XNJA 2IPOA 3CFYA 3PTLA 3MQ2A 2I76A 5EGNA 5AXBA 4BO4A 4TZKA 4OQMA 4BVLA 3IJ5A 1PT6A 1ZQ1A 2QXTA 2BUBA 4O08A 3KX2A 4BEWA 1U0BB 3I5AA 2P41A 2DPHA 2BFNA 3H5RA 1ISMA 2Q5OA 1XOIA 3VPDA 4XLTA 2AMFA 3A9CA 3BWCA 3GVHA 4MRAA 4OQPA 2H11A 3AY7A 1G0OA 1LLFA 5D5PA 4CT0A 3G68A 1NA5A 2XODA 2GKSA 3AVPA 3B1XA 4OO3A 5K2OA 2VT6A 1GCOA 5CD1A 3GGCA 4MZDA 1FJGB 2R5NA 4XI9A 2HLPA 3PUHA 4YAIA 3TQQA 4QVKA 5DULA 5KTSA 3WLLA 2R96A 1IBKB 1VPDA 3TFWA 4N7JA 4MQUA 1BMDA 4F04A 3SX4A 1EPUA 1JLKA 3P9SA 4RVHA 2FZCA 4DNXA 2WWGA 3AHHA 4QARA 3A7DA 3KTFA 4BWYA 3EVNA 4ERXA 1Z5PA 1SEPA 2P3QA 3D31A 1G17A 4OM7A 4JWTA 1HKUA 3LF1A 1UC4B 1E60A 1F17A 2Y0EA 4IV0A 3M70A 5IANA 3U61B 1V8OA 3F96A 3WIBA 4AKGA 3WZMA 1ADFA 1F9AA 4M8IA 3X0DA 3JQAA 2YWRA 4DUZB 3EA0A 3T7IA 1NQTA 1WF3A 1UBCA 4FGLA 4KK4A 2F3SA 3FNEA 4URZR 2CF5A 3T38A 2BFCA 3EYAA 3SXJA 4WOBA 4YAEA 3DE1X 4PTZA 1RRKA 1VHWA 1XX6A 3BJRA 5EPUA 3GLFE 1BX0A 1H9BA 1ZMXA 4Z4QA 3IR5A 3ZGLA 2OV2A 5BSMA 5DU2A 2F8LA 5HRUA 1DAOA 2ETVA 3OP1A 1VL5A 2V59A 4AZSA 1Y80A 4R51A 5HK8A 4JLVA 1BMTA 5I5GA 3QPDA 4BRSA 1N34B 2EARA 1CNFA 1XYYA 5JNTA 1QBGA 2CF6A 2ZJAA 1B41A 2AC4A 1MT0A 2GVDC 3LLUA 4AD8A 2HOQA 1W44A 4D0RA 2WOOA 4IDFA 1T8SA 4EPVA 2JGAA 1T9GS 5CEJA 4KWEA 2X7HA 4WCVA 3D5QA 1ZNXA 3VR2D 4KQ1A 3K1JA 4O4HB 4D0LB 1XZAA 2FDCA 1ISFA 3AUAA 2QRMA 3H9CA 3B6KA 2JH9A 3CT6A 5EL0A 3LX4A 5LLSA 3TK1A 2PKQO 3O74A 3W77A 4EECA 1UC9A 2YZNA 4EFNA 2Q6VA 2OBYA 1ZFNA 3ZNPA 4LKOA 1C0EA 3KK0A 2DETA 4AMUA 1UODA 1Q74A 3PZRA 3TL6A 1TQ8A 3H0KA 3OCXA 1CZKA 1KO4A 3M6MD 4J9UE 4IRXA 1XLTA 3QVWA 1A98A 2NSYA 3BF7A 4PPYA 2CCKA 4X94A 4YRDA 2YC2C 1KSGA 5J43A 1DU4A 4JXKA 3KJXA 5A3VA 3V1UA 2B99A 4PLFA 1ZIXA 1QQ5A 1EZ4A 5IYZB 3EXFB 3V8NA 3MUFA 1RC8A 2IFTA 4QQFA 2R7KA 2Z5FA 4XLZA 3USZA 1MPTA 4ZZIA 3ZGNA 2XADA 4FGUA 1XLWA 5ALKA 3LO8A 2CDCA 3LVRE 1NZDA 2W6ID 4NU5A 3K1ZA 2C2ZA 4IDPA 4Y2XA 3TSWA 3C97A 5JJCA 3ZJUA 2CJWA 2PL9A 5EUMA 2IBTA 3DYIA 3D8HA 3F3MA 3HN7A 5I4IA 1KEKA 2A9OA 2GPSA 1NJ8A 1ECBA 1WE2A 1OC4A 1S9HA 4OAOA 4RW0A 1XTKA 3WHLA 1S3FA 1LPNA 1SIOA 3S2ZA 4CJXA 3GH1A 2J32A 3F46A 5D1HA 4UUBA 4WEQA 5ERYA 4HAIA 1JAHA 2XUGA 3EVTA 1JR3D 1QK3A 2YOFA 4LKRA 2BC9A 4LFBB 3JVVA 4O3FA 4J76A 5ER6A 3TAUA 2YY7A 2IPXA 1E1YA 1FDRA 4O02B 5AMXA 3UHPA 5A4MS 4A0QA 1RZUA 1PJQA 1CEEA 4DADA 4RJIA 3PNMA 4E5YA 4HXYA 2AWNA 2CBZA 5FPSA 2I22A 2YJ5A 4EQZA 2QTCA 3HJBA 4EWLA 8MHTA 1ABFA 3ESQA 1QC5A 1WZEA 5B4TA 2CE2X 3BXXA 1PSZA 4A6DA 3KOOA 3MYYA 3DWIA 1QTIA 4C2TA 4O3MA 5IU6A 2FLKA 1XDGA 3C3YA 3I9V1 3GPCA 2OD2A 5CIQA 2FWMX 3U7JA 2VZLA 3W4JA 4JI4B 3RC9A 3N7TA 4DQ0A 4XX0A 4TS3A 2PZBA 4BQQA 4RM2A 5BR4A 4DS3A 2W9XA 3GD5A 5F3RA 2E5FA 1M8FA 2F8SA 3SG0A 2D0PB 3OJFA 1ESEA 4LNUB 4RHEA 5HUQA 5JEDA 3RTDA 5I9IA 3WQHA 1EXMA 1M3SA 2ZJ6A 4PC3A 1TJPB 1BW9B 2FMXA 2P30A 3TFOA 4UNQA 2JFYA 1RFGE 3GOHA 4XIJA 4ZT4A 3VOTA 1F8XA 1IXSB 1IDOA 1QGUA 4GKVA 4QUHA 3GLHA 5E2AA 1SHZA 4L72A 2WWVD 4B3CA 1QU3A 3NM5A 5CDFE 5BYAA 2GJ4A 4MV7A 1JXQA 3ND8A 4Z0PA 3FF4A 3C4VA 1WQ4A 2W6MA 3SM9A 1WMDA 3ADPA 1A9XB 2CNKA 4PZYA 2Z9BA 2GPBA 3IEUA 1O57A 2XMPA 1CUEA 4DJJA 3RVPA 4PG6A 4CLOB 3WYNA 5KTTA 3QENA 2HGSA 1M8KA 3V46A 1P2TA 2PPLA 1M2OA 3KFXA 2KBEA 3ZGVA 5LIRA 5LYJF 4O0MA 3RYFB 5GPBA 3K70B 4JCCA 1OKKA 1CLUA 5E0OA 4D3ZA 2CYBA 2HRDA 4I7EA 5C8VA 2P6RA 1E0AA 1NXXA 4O2RA 2Z2KA 1LEHA 4HEA1 3GMSA 2VT3A 3JATB 1EFAA 5B2EA 1LDBA 5SY6A 1UM8A 2IVZA 5FNVB 4WBNF 2XTJA 3DSRA 4UUOA 3ROQA 3AHDA 3UGQA 4DIFA 2C54A 2ZPUA 1QHIA 1SOWA 1UJ2A 1Q20A 1QHFA 1KP9A 2PEYA 4CMHA 3FDZB 4Z9BA 4BP1A 5DISB 3FUWA 3HLKA 4JS0A 2HJRA 1MEEA 4JBHA 3MTBA 2OLEA 5E6SA 3FUCA 3B3FA 4ZAWA 4TMYA 1R3UA 3C3KA 4JQSA 5BRJA 1QH8A 3FOBA 4XSGA 2G0AA 3DBRA 2O4CA 3NHMA 5K8JB 4PN3A 1PCXA 3GCXA 4BMPB 2E6UX 1ZG3A 3QOXA 1LC0A 4NCKA 1QH1B 5JSQA 4XDHA 1J21A 1RHMA 5JPDA 3N1UA 2JIPA 1XAGA 5DNUA 2VO1A 2PSJA 3GUVA 3W3ZB 1SAYA 1WKBA 1DHRA 4BFCA 5IDYA 1ECGA 4YR7A 2QLLA 2JCBA 5KWVA 3CEPB 2IE8A 3T3MB 3SI7A 2CVFA 4U02A 5EIWA 4IH4A 2LNDA 3ZK8A 3TM4A 3V33A 4A91A 1VG8A 4LQ4A 1L5SA 5HKLA 1XZGA 2WIKA 1TM1E 2I2CA 2WSIA 5HIJA 1BW9A 1F51E 1FF9A 3FYUC 2WP0A 4MP6A 3ZHUA 2FZVA 1N36B 3E0XA 4AJOA 1BD3A 2VQ3A 1DCFA 2ZQ5A 3GZNB 5C31A 3DOIA 2BM9A 2VG8A 1F6WA 3A27A 3CVOA 2I54A 3NEAA 5HA5A 4DQLA 3FWNA 5JPIA 1CZUA 3N70A 3H84A 2RIPA 2WWTA 2Y1EA 3TLXA 3CSUA 4PAGA 1GUZA 3I5XA 1KPIA 4CMBA 1KH2A 1XDSA 4IMIB 5DCWA 1SXQA 2AMLA 4ESOA 1DKPA 3D7LA 3FYDA 2IV7A 3I6YA 4IIBA 1T9ZA 2PR7A 4ETNA 4JV5B 1A9XA 1WHSB 2D2XA 1YRHA 2XYPA 4GXRA 2BEUA 2VP6A 4HAXA 3S28A 4DDKA 4F85A 4LRTB 2B4TO 3RS3A 3B1WA 3PF8A 2NZVG 3WB1A 4BNHA 1NMZA 1E2HA 4EARA 4KOEC 1C4XA 2HWYA 2HU5A 1R1DA 2TRSB 2EJWA 3DKRA 3KZMA 3LU1A 3M4ZA 4LCEA 4U63A 1AKWA 1H85A 2IDMA 4YCBA 3ZHZA 2RH9B 1U9IC 4G63A 4OY3A 1ZGJA 1AKYA 4Z9XA 4YREA 3CVUA 1ZM3A 2GCOB 2VJNA 4AXXA 1BFKA 3UT5B 5ADWA 3DONA 3L1JA 3IPXA 1BCSB 2JD2A 5CA1B 5HK9A 4KFUA 4DRZA 1MOPA 1VCNA 1R8YA 1USWA 3A4VA 3ETCA 4JITA 4EEKA 1PLKA 4FXOA 4ERNA 3PXUA 4B3TB 2H7YA 2J3QA 3K2IA 1OBVA 2VCHA 4C7BA 2ZB8A 3L6DA 1PFGA 4KZKA 3OFND 3ZHQA 2O2JA 1GRQA 3PICA 3VAZA 5EIBD 1AS2A 3NOOA 4CV3A 2HCBA 2R6GA 2NZWA 3FNHA 3W3AA 3VTKA 3WOVA 1TLTA 2JI7A 4RPCA 3QLVC 3QVKA 3EASA 4PLTA 4ZDWA 1ZVMA 1Y3FE 4QM7A 1DOHA 3ZE2B 4GRIA 2JI9A 1WPQA 1KSHA 1O5IA 1OTXA 4ZMBA 2JFUA 4GZLA 2VWQA 1Z8FA 3CXRA 4G1CA 5JWRA 1VL2A 1GIAA 3FGZA 4COKA 4UOZA 3EQ7A 2WSSD 5C3UA 3BAZA 4AF8A 1T9DA 5K0LA 1RM4A 3IUPA 1RJ9B 1A96A 1W4ZA 2BF7A 4BNNA 4OBEA 5CW1A 4I1UA 4ZJYA 5B7QA 3IDZA 5EP4A 3ZWVA 3SZRA 3GFOA 1C3XA 3C2QA 3DWFA 3S3TA 2XHZA 4D74A 4MKHA 1FW8A 3KB6A 2BISA 3MRSA 3LLCA 3QY0A 2ZUCA 4F2DA 3D8SA 1EDZA 4JLAA 5KTNA 2FHPA 1BRTA 3W79A 2JVKA 4WNYA 1N92A 1YDMA 3BZBA 4QODA 2XNKA 3MTEA 3DBHA 1CZOA 4IFIA 1VG9B 1E79D 4L5JA 5BQ5A 5SYNA 4DDVA 5B57C 3HCBA 3QWIA 4KHPB 2I1LA 3GT3A 4WAUA 3GZJA 5HIIA 5C4GB 4GDFA 1KU6A 1W87A 5ALEA 2IW3A 4Q4DA 4D8YA 3W04A 1JFVA 1U7OA 1IXKA 3KD2A 3JQFA 4NJOA 5JAMA 3GEGA 2YW9A 3DWGA 2WUEA 1LB1B 4IIEA 3IELA 3I62A 4RSRA 1NG9A 2JLBA 1FU7A 1II8A 2J48A 2PWAA 2YY5A 1SD5A 1JHRA 2GBGA 3T5AA 5DBIA 3QEMA 1WWKA 1OX6A 3EXHC 3ICCA 5ALVA 2CBXA 5KYXA 2H4FA 4OQFA 1EI9A 3F6RA 4P08A 4G0UA 4LWZA 5A03A 3LQRA 1VSUA 2A84A 5B36A 5BNZA 5C1OA 3EARA 4I08A 2YNMA 2JIQA 1B7GO 3TW0A 1BGVA 1WHSA 3PGLA 5LXTB 1Y8AA 3OM1A 3O93A 2DH5A 2I2FA 2ZRFA 4EY4A 4F9FA 3WNZA 2PT7A 4HHEA 4G5GA 3UJ7A 2W4IA 3LKBA 5KNBD 4AECA 2A9PA 2BR5A 4Y6LA 3A1VA 5KPDA 4Y1GA 1OZAA 1T2DA 3KPWA 5DTMA 5HDQA 3RTAA 5GY7A 3DHEA 2J3HA 4E2ZA 1WB9A 1ZVKA 1VMEA 4GAEA 4RH0A 3DZKA 4XSVA 1P5JA 2JS7A 2GEKA 3FIJA 1JMVA 3E1SA 4IINA 4E2WA 3EAFA 5D86A 1QGYA 1YTUA 5CHYA 1ZVJA 5A02A 3CQ9A 1KRWA 1EAMA 4TRMA 2W22A 5BSKA 1QIGA 1RZRA 4M9UA 4L3VA 4LX0A 1W96A 2G83A 3GDOA 2ZS7A 4DLUA 5FTMA 2DFTA 2Y0DA 3R5TA 5COQA 4PGHA 1YONA 2WIBA 3ETJA 3WHPA 3ZJ5A 4YJDA 2IZZA 2C3PA 4Y1EA 3FPGA 4LS3A 4WMLA 3OEED 3VUEA 1H3FA 2AR9A 3LCUA 4EG8A 3TEFA 2D00A 3JWIA 1OT5A 2P91A 5AQEA 3DT6A 4ZOEA 3GGOA 1V25A 4PW0A 3EW9A 1Y1KE 2FUG6 1N2GA 1O6ZA 4OI2A 4D9JA 3FLEA 4MS3B 1ZESA 4RM3A 4M1TA 1TCBA 1U11A 1Z35A 3BERA 4X85A 2DR0A 3OM0A 1DWPA 1R0KA 1OYOA 2HDNB 5LYJB 4OFWA 4IWYA 2M6RA 2AE2A 4HLDA 1M2FA 3G2KA 7GPBA 3OFJA 4HN2A 4BYGA 1TQ4A 4Q9IA 4EA6A 1Z6AA 1AJEA 1I6WA 5F3WB 4E7PA 1DOZA 1PEKE 2ZP1A 2JIZA 1NV9A 1F0KA 2GH1A 3PRHA 4W9RA 2VHZA 3F3YA 4IHKA 3N74A 3O8QA 5LMCA 5IULC 5KYWB 2NO4A 2V96A 4HDKA 4O2AB 2QD4A 1ETHA 4W6QA 2P77A 4KAAA 4B4UA 2MYNA 2OZKA 4MQ6A 4AJ2A 4PFKA 1KK2A 3T41A 1TVEA 4GR5A 1GPAA 4CODB 2OKCA 3R0IA 1GPUA 4MLDA 2Q46A 1Z39A 4PNEA 1U0TA 3LA8A 3AZQA 5IDXA 3DVAB 4QHTA 3H8WA 3Q98A 1VGRA 2E89A 2JJMA 1MF7A 5JYBA 2OUIA 3COWA 4RTSA 3MWYW 5SV2A 3UFBA 3DEZA 3CNOA 3S2IA 3RTEA 3SY8A 1IHYA 3KEQA 2I3ZA 4YRRA 1J33A 1Z0ZA 1P77A 2C3OA 4OHRA 3WKBA 2R8YA 3PDJA 3RYIB 3X2SA 4B87A 4F1JA 2GJAA 1MJNA 4P5PA 3KZVA 1GT91 3G02A 1KI1A 4L9AA 3RC8A 1Z13A 3TKYA 2EZTA 4N47A 2VRWA 2DF8A 3AJAA 2J7KA 3OLYA 4R69A 5FBKA 1P33A 1Z62A 5LZ7A 3V4SA 5EYPB 3ZS8A 1C3EA 3GP3A 3KSBC 1UF9A 1RRCA 4Q4HB 5J4KA 5BR1A 3KXDA 1AOXA 4J2HA 1CXZA 1OUMA 4WRRA 2EQAA 4L9RA 3TTSA 4BFUA 3DV0A 1LWNA 2FQXA 1R18A 2CNBA 1OR8A 3AR6A 3IOBA 1ZZEA 4QGBA 5DOVA 1WVGA 4EB6B 2GESA 3EBOA 5GZ3A 2ZZNA 1T4GA 4G5RA 4WKCA 2J9XB 1L5OA 5C4MA 3NHUA 1REQB 4G01B 2Q7OE 5C5DA 1P0QA 1X1QA 1NRJB 4M38A 4TTAA 3WDLA 2XUJA 5FLXA 4W5TA 5BVGB 4R31A 1Q95A 4P7KA 3OTGA 2GNOA 3NYQA 1FYVA 4G1FA 5DLYA 3WV4A 1EVZA 4ZEMA 1M2WA 4V1CI 5HSGA 3UGJA 4A2CA 4C4ZA 3TR5A 4X0EA 2YIMA 3ZI4A 3R5FA 5J2TF 1DCMA 2JA2A 1KK3A 3T7AA 5EQDA 3UW3A 2JJYA 3W5AA 4QELA 4IRMA 3LK6A 4MWGA 3UC9A 2QA5A 3VNAA 4Y9DA 3AK4A 2ZIXB 3TTTA 5LP6C 4WESA 1MHPA 3E82A 3SSMA 1OFUX 4E1AA 2JLYA 1SBZA 4J1NA 1V96A 4ZYWA 2I4MA 4FGWA 1UBTS 4R2WA 2KQUA 4E30A 5CU7A 1S2LA 1KNQA 3SKXA 3SSOA 1T2AA 4HB4A 2Z95A 1C3OA 4C0WA 4W7SA 1XXHB 4DIUA 4D25A 1PYGA 1AGYA 4LE1A 1U6JA 1HTBA 1P6QA 3ANMA 5L3VA 3JQ8A 1YQXA 4PLGA 2V9PA 5U1PA 2WFMA 4KG7A 1XKTA 3YASA 2C9BA 1ZIYA 3NVAA 2ID7A 1DEHA 4LTNA 1JYEA 4TWAA 3F5DA 2Q3EA 2RIRA 5KAMA 1H2HA 2L17A 2PBLA 3B1JA 3DOEA 4XWOA 1F2VA 3K6SA 2JK0A 1KEZA 3IB3A 3MN1A 4F3KA 3L7KA 3KRTA 2J3JA 3IMKA 3NBFA 5DBEX 2H51A 4Q1EA 3DC2A 4WBNA 1SCUB 2Q6KA 1T8TA 1R88A 1P5ZB 4O6VA 4PHGA 4KQFA 4V0SA 4CKEA 3ONWA 8OHMA 3IUJA 4AN4A 4N7RA 1L5NA 3WXBA 2F4NA 2WT4A 4NBLA 4DLNA 4J16A 5CNJA 4NAUA 2NWQA 2ZJ4A 3JASB 5IKOA 4GOXA 2FZEA 1NXTA 1UP4A 1D7OA 2TMYA 3OT1A 4NG4A 4NS4A 1MVNA 3EXIA 3NWPA 1E3DA 2JRLA 2OBLA 3PD1A 4GI7A 5JMOA 1HNNA 2GPNA 1F06A 2ZBDA 1BXGB 3OICA 3OIWA 4EABA 2FTKE 2FFRA 3A6DA 2FW6A 2OE2A 2XBUA 3DMTA 4OMUA 3RQIA 3M6WA 4B2YA 5J4VA 4L5AA 2BTEA 1NXSA 4PZUA 1DCTA 2GZRA 5IM5A 3AF4A 5IARA 2FMKA 1X94A 4Q7KA 4KNWA 4OXIA 2Z98A 3HFGA 5C1DA 3ZWYA 1RACA 4IX9A 1NFFA 4KSBA 4P0TA 3ED1A 2IHKA 2V7XA 2QRUA 1UMDB 5EVJA 4U2CA 4B3MB 2WIJA 5IHXA 2Y93A 1V95A 3QVJA 1GKUB 1DV1A 4JB8A 1ISSA 1ZC3A 5AVXA 2X5JO 2XMDA 5D6NA 3SYLA 3IEPA 4J4BA 2WKQA 4KSYA 2WFAA 5BWCA 5AO9A 4C0XA 2Q45A 2X77A 1VE1A 4FZVA 2JLRA 3I39X 4QOHA 3RVBA 1PF7E 2BMVA 5B1IA 4EB6A 2P2ZA 1D1SA 1X1RA 2AXPA 1IJFA 2XITA 2BBWA 1XZQA 1ESMA 4PXSA 5BT8A 2CMKA 4BQIA 1J42A 1BHSA 3AERA 3VPCA 1F2TB 2BFPA 2W2LA 3WRXC 4ARBA 3AETA 4L1KA 2PH7A 2I6GA 1I14A 3GCZA 5LD2B 2BTQA 1W52X 3MT9A 3GJ6A 4W7HA 1NUUA 1Q7TA 3RTBA 4E0BA 1WKCA 2OL4A 3NUQA 4AZ0A 1W8DA 4RACA 1K1EA 3NKLA 3X3HA 3D8RA 1HK7A 2C9MA 2P8JA 2FLWA 3BIJA 4B7AA 2WQ7A 1J1UA 1RYBA 3MMZA 5HFAA 4C2BA 4O2LA 4RETA 2OUKA 1N1GA 4PX5A 5IN5A 3T1QA 5AVYA 3L04A 3VX3A 4MPDA 4FZ3A 2V9CA 5E95A 1DAGA 1L4NA 4DLSA 2CFTA 1Q17A 1UDRA 2R8XA 5HQ3B 4QNRA 4C06A 4MV8A 1RD4A 1K9SA 1WJGA 2X0IA 1NVVR 2C4TA 4AW9A 3QU7A 1C8VB 2JHGA 4D5EA 3PUYA 2QUHA 3BS4A 4YAOA 2FFQA 5A1TA 1M0SA 1YO6A 2B37A 1RCTE 2ZRNA 4R1LA 2A5JA 1DVRA 4CIDA 1E69A 3OLVA 5AW2A 1GYPA 4NJMB 2GDZA 3HU3A 4XD2A 3GLGA 4Q66C 2QX9A 1XZ8A 1FYFA 2XGOA 2Z2XA 3KYBA 5IJ9A 1EUQA 1KVUA 1UJNA 4G1EB 4EPWA 1IXYA 2GFQA 1PFUA 4FIDA 1ES9A 4RGVA 4A5SA 4D97A 5A2GA 1CRQA 1SCNE 4XJXA 1HDIA 2XBMA 1VLHA 5BW8A 2C59A 3RV3A 1JFSA 5E6RB 1PVOA 1NMYA 2WSYB 4IKOA 2PWPA 3IAHA 3LLVA 5DX0A 3RC1A 2QMZA 4X5OA 2CV0A 3DHWC 3G59A 3T12A 2PT9A 5IBPA 3TZQA 3Q7IA 1ZJYA 2P7IA 3AB8A 3OCJA 5F1KA 3LF2A 1JHYA 1ID8A 3L07A 2OMEA 4H7HA 2PGNA 1SBIA 1BXGA 4YWHA 3KE9A 3LFUA 2RJNA 2VOJA 3QX7A 4XM2A 1K6MA 3IE1A 2APJA 1FP2A 1BH2A 1ZD4A 2EFGA 3ZZTA 3SYTA 3UUGA 3NTQA 1T36B 1B6SA 1PJ3A 4NYIQ 2G76A 5K51A 1W93A 2GD6A 4U3JB 5BN5B 2GKOA 3FOZA 2OENG 3U3DA 5C8YF 4BOYA 2CV2A 4IZIA 1SQFA 4EPTA 4KR7A 1G3UA 3WGNA 3HP4A 1I6KA 4I1SA 2JI4A 3KOZA 3O4HA 5IWCA 3OPMA 4LTMA 3TE7A 4EG7A 5KWIA 1M6HA 3VR4A 1TRKA 2IC5A 3E3NA 1J5PA 2VTEA 3ESBA 4JDUA 4LJKA 5HMLA 4ZHQF 3LPNA 4J90A 3ONNA 1J09A 1EFHA 5CT8A 4BLQA 2QTLA 5EE9A 1AU9A 5FIUA 3VKFA 1ISPA 2Q3BA 4ER6A 3NBAA 2L19A 4GLBA 1JEQB 1N75A 2VDQB 2J3DA 3CLKA 1Q19A 2PBZA 2X1HA 1NY6A 1O6CA 4PC6A 6NULA 3KXKA 1YQTA 1TKAA 1NAIA 3HI4A 3WICA 3X43A 3CM0A 3THYA 4NBTA 1SGWA 4K6GA 4RDCA 1NXWA 1QFXA 2X9VA 4LXXA 5D5HA 4EJ0A 1TTQB 1E8DA 3OIVA 4XOIA 4Y1RB 3IS3A 4OU5A 3SYRA 5KYXB 5K6RA 1RW4A 2XNHA 3AJ8A 3L6CA 3Q6IA 1TAQA 1Z16A 1OZ0A 1C1XA 4IIVA 5L3QA 4PRLA 1ZMOA 1BIFA 5CHEA 4A6PA 4ZVUA 5H3HA 3VSEA 3D3KA 1YR6A 2V54A 3HXLA 3PNOA 4LDZA 3K70C 3DVRX 3PC8C 2XOKA 1VRVA 2QG9A 3GFFA 4YK7A 1ONBA 1RLMA 1AKEA 5FOWA 4BO0A 4EL5A 5CLJA 4ZT7A 5K6AC 4S05A 4QJBA 4G0WA 3DS8A 2YYYA 2FCAA 4FNOA 4KGXA 4D8XA 3KDPA 4XIIA 3ZQJA 2BKEA 4N3GA 2C2GA 3TINA 3HZRA 1P7CA 4JJFA 4UNIA 5AI0A 4EKDA 3COJA 4RZHA 3VU3A 5CPBA 3E8XA 5L6MB 5IK2A 2Q07A 1ZJZA 5ALPA 2ID9A 4H08A 1SIBE 3U4DA 5A5DA 1KIAA 2BEVA 2UZAA 5AM4A 3DOFA 1YQDA 5IT0A 3EGXA 3I1YA 5D1NA 4I36A 4MHOA 1RQPA 4Q4JB 4ZVNA 2XDYA 2DPMA 1IM8A 3PKIA 4KO2S 2YUIA 3UT0A 2JLWA 4M8LA 4TMFA 1DQYA 2NU9A 2MR5A 1XDZA 1NN3A 1IK4A 3WLNA 1J2JA 1UBUS 1XMXA 2Z8XA 1ESDA 3C14C 4ZKDA 4N6NA 4RQBA 5EJ6A 1RTKA 1TFUA 1Z17A 1BOFA 1EAYA 2O1EA 3W34A 3ET4A 5KC8A 4Q24A 1M1UA 4W1RA 3H65A 3VI4B 4MKXA 2IGTA 4I0WB 2DY1A 3G79A 3PSHA 1K0UA 4IXTA 5BV1A 4ND8B 4ETWA 1P1CA 1O9BA 2Y92A 1FFAA 2OCLA 1DPFA 1YFJA 2QM8A 5EQFA 2WQZA 1FC0A 3RO7A 2XWQA 5LBIA 2BSAA 1UXOA 1R0BA 3E9DA 5BSTA 2QI9C 1Y37A 1UKVY 1DKOA 1CUDA 3B2NA 3BXHA 1SVMA 3B7GA 3ICWA 1MOQA 3LC7O 2XLBA 4LV6A 1UXJA 4TZTA 2CBGA 1YGPA 2BBOA 2EFCB 2EZ4A 3OZ7A 3ODPA 4MV6A 4WA8A 1OH8A 1Q3HA 3KQYA 3KJZA 1HDRA 3Q8LA 1UKYA 1K3TA 3ICOA 2H2IA 4L16A 4CMAA 2VEDA 5FWYB 5B1EA 4OQQA 2K6GA 121PA 4ZOBA 1QORA 4HI0E 1AQIA 1LBHA 4MKZA 5DBHX 1Z22A 2D8AA 3STYA 1T4BA 3ZY5A 1RFLA 3HKCB 3W5BA 2CW5A 4FBGA 1NXPA 3W4KA 4BGEA 10MHA 2ZR0A 4JUFA 1SVWA 3I01M 3TKAA 3OZCA 4FFOA 3DDNA 1SFRA 3CGGA 2O6HA 4J75A 1WHTB 4MQMA 5TMEA 2Y1GA 3GLSA 3WG9A 1OFGA 1QH0A 2X0DA 3UB2A 3U31A 1VPVA 2WYIA 2GO7A 4RYDA 4Y1RA 4RK6A 1BS9A 1M73E 3EAQA 1T4DA 1XC7A 2BI4A 2ZCVA 1N5MA 1EGVB 2O20A 4LECA 5GQSA 5JANA 5IKXA 3L7AA 4D0SA 2PD4A 3THWA 2PX6A 1N9GB 5FDFA 2Y1CA 5LR6A 5BSUA 5LQDA 2COUA 2Z04A 4BMZA 1SQ0A 2J41A 3BZWA 2M1XA 5KOHA 3WNCA 4K8OA 1PO7A 3EMVA 1N2OA 3AHFA 1IHDA 1G7CA 4GGOA 3SIPA 1E6KA 4H7KA 4DY6A 4JUBA 5EJ8A 3O1JC 4ICIA 4NV3A 5KWSA 4OX9B 4PNPA 4CEIB 3D02A 2BPOA 3U3XA 1HNWB 1XHFA 1N2IA 2QP3A 3TL2A 3AVUA 2JHFA 2NU7A 1GPKA 2IU0A 3SF0A 1RAFA 1AD2A 2FZLA 2FKAA 1Z0DA 4NSNA 4MI9A 3DAFA 4BKQA 3RUDA 4FNAA 4BO2A 4AKHA 3JX9A 1B0PA 2FXIA 2KW5A 4D8VA 5FOXA 4GVXA 3W1EA 3K1TA 2QUKA 1NF3A 3UGKA 1E32A 3LUFA 1KI4A 1B1AA 2G04A 5J2TA 3MUNA 4TN1A 1HYGA 1T5IA 1L5ZA 2IKSA 2QRVA 1NBHA 3CRQA 2B69A 3EA4A 1WEHA 3HJCA 5DWQA 3VNRA 4ND5A 1ZSVA 1RXUA 2D74A 3SIWA 3QG1A 5L95A 2NXWA 2YWHA 2IYSA 2PMWB 2WV9A 3H6GA 1DAMA 1UBRS 1A4UA 3ABOB 2H1OA 4MR7A 4KQHA 3FJOA 3GEDA 2BUCA 4BQOA 1ZK2A 3HKEB 4PF1A 4X3CA 5CT6A 3T4XA 3R0XA 1IQPA 5K0GA 1NM5C 4Y2JA 3NDBB 1PS0A 3EH2A 1UMBB 1VB5A 2A67A 2P78A 3C16C 1SHKA 3LI2A 2VCYA 1X3LA 5E3JA 3ZQKA 5T7BA 4CGZA 1CRPA 1TLLA 2NAPA 4II2A 6REQA 5JH7A 5JYCA 1G63A 1K7XB 2YHBA 1XMJA 4L02A 2NW6A 3U81A 2LW7A 1T1IA 3UW1A 1LZKA 1M1YB 3A10A 1P7PA 4IVNA 4QAJA 5BW5A 1O9HA 3X1ZA 5IEJA 1EHYA 1ZH0A 4ACBA 4K0RA 3N76A 1V4VA 1PDVA 2ZATA 4O29A 3WIDA 1PK7A 4F91B 3AM4A 4QM6A 2ETXA 1MO2A 3FCEA 2AW5A 4ND7A 2H1FA 1RYNA 4WZBA 5E1OA 4MO2A 2IPAB 2WAAA 3UBMA 3DE3X 3HBAA 4WT7A 2D3WA 1FTSA 2W8BA 4ADSG 5A4AA 1LD3A 2BFOA 3KU1A 4TMTA 3I2JA 1KTVA 2ECFA 2IXTA 1I01A 1ISHA 2KWIA 4HWOA 4E2FA 3BMOA 2VYVA 3OPYB 2HYIC 1VGVA 2Y1LA 1FFWA 5I7UA 3HJTA 4WJKB 3MQ4A 1BCRB 2VJMB 4ARCA 1XZLA 1QX3A 4CQJA 3GR6A 1DLJA 2ZVQX 4ZQHA 1PJZA 1U7TA 5DP1A 1QUEA 3KTOA 5KX5F 2NO9A 1NFRA 3KUKA 4JLMA 2HC9A 4HADA 4JJZA 5K3SA 5JFOA 1F9EA 1ZH6A 3TB4A 4OSEA 1R16A 5C8YB 4HXEB 5LZ4A 2BVNA 2CJPA 4ENSA 1Q7RA 3LD9A 1VKZA 3IAM6 1K8ZB 4S35A 2R8OA 4WNAA 5BPHA 2R2GA 1R9MA 3FNGA 3HYSA 5K0ZA 1RI4A 1OGIA 2IPLA 5IVPA 4CEIA 1GP2A 1XFAA 1DQPA 1LFAA 2P69A 3EWSA 4QRIA 2Y0BA 4X6LA 3PFKA 1L7DA 4C3ZA 1HZZC 5K8TA 3VO9A 2Z2IA 3DNMA 1WCIA 1GKLA 3U2QA 2O07A 2OO3A 2LV8A 3IVRA 1P75A 2IIPA 4L15A 5CXUA 3DO6A 2CC2A 1D0IA 2WHXA 3UWMA 1VHQA 3D6NB 4FCTA 2BEJA 4O1IA 5E9WA 1VHJA 3O90A 3AG5A 2DFDA 4HZUB 4E1VA 4QJIA 3U3KA 1F0PA 3MQFA 3MYRA 3BMCA 1WOYA 1JNXX 3LC0A 3R2JA 4K3VA 4QHYA 4Y6PA 3TN7A 5BWOA 4IF6A 2HT1A 4HUQA 3E5MA 2WW8A 4WY2A 4PPNA 5LYYA 1LDMA 1NAHA 1ZJ5A 1DRKA 1VLLA 3E4DA 2W98A 3QYFA 5DCYA 4EKNB 1WMEA 4LY6A 5EHXA 2YIDA 3IP9A 1V43A 3WJ2A 1AQUA 4BX9A 4WQMA 1XL1A 3FKSD 1B16A 2GEDA 4OU4A 1AN9A 4BO6A 1H0KA 1JIXA 2P1RA 4FCCA 4B5LA 5K20A 2IYPA 3B85A 3LOPA 4ZQEA 4BIMA 4PLWA 4ZGWA 5B1YA 1UPAA 4GMDA 4DANA 2A0KA 2Z6QA 1E9DA 2F1OA 3DXZA 3OPQA 3CX3A 3TTUA 2PY6A 1RXWA 3I73A 1KJJA 1H69A 4R6WA 1NBOA 4RZUA 4K9OA 2IDZA 2G09A 2I3DA 3JZIA 2H7CA 4MK4A 1SBYA 3GFPA 2I33A 5DLDA 3SZMA 2DYKA 1EWRA 1RBMA 5CYFA 1A8QA 1AK9A 1KJWA 1NZJA 2XF8A 2ZS9A 4KR0A 4OKSA 8ATCA 1UBNA 2GEFA 5LA6F 1VE5A 1G8SA 2QG4A 3F0TA 1NR7A 1QIFA 4N3NA 4I6GA 4BV8A 4ZVQA 2FVYA 4EG3A 2B5OA 5F12A 3WISA 1FMJA 2PG3A 2IUEA 4ZFNA 4DAOA 3I4LA 1NQVA 2QB5A 4KQEA 4AT1A 4PC2A 1KQ3A 4Q21A 4I8IA 1QONA 4D92A 3KQSA 3TS1A 4RPGA 4CKCB 5FBRB 5CVJA 3L7LA 2Q5EA 1FSPA 5EJ7A 5AM2A 1ZKDA 4TMXA 5KYVA 1A7AA 3L4JA 1GUYA 1B93A 1U2ZA 2XB8A 3IEXA 1UQRA 4YACA 5BSVA 3M82A 4ISCA 1RWVA 4RJKA 4RJ2A 1SXJD 4FFDA 5C8YA 4B4DA 1NI4B 2JC3A 2X8JA 4OPMA 3WP0A 4TL9A 1WXDA 3ZLJA 2JATA 5PGMA 3WK6A 2AW3A 3VNSA 1VKHA 4DQUA 3I0NA 3MSXA 5DYTA 1Y7LA 5FNZA 2DY0A 3EVCA 1NVMB 4ZHQA 2VF7A 2Q62A 1SUCA 3I9OA 1I1HA 2XKJE 1DT3A 1ESCA 3D8UA 5ADVA 3IHWA 3PGKA 3TQHA 2LCFA 2Y71A 2REQB 4A03A 1SMKA 5LZ5A 5ALGA 2YV2A 1OMOA 3DL0A 3T3HA 1E8NA 4I9NA 5P21A 3ZLBA 1CWUA 3ZJ4A 2DBVO 1IJBA 1IULA 4YI5A 3UXEA 1LNZA 4UDNA 4V39A 1EJBA 3NBZC 1M1XB 3LX8A 5FQOA 1P81A 3WB0A 3KT6A 3NDIA 3MUEA 5I6DA 5ALZA 2X41A 3N2IA 4CIWA 4NMLA 4KB5A 1MO6A 2P9QA 2VBCA 3TLKA 2LIVA 3NM6B 4BUZA 3U4GA 3P5SA 4PX9A 2OKGA 1OD6A 2XMCA 2QVXX 3B6ZA 3JD0A 4KBGA 2B98A 3EX7C 2W6IA 4CETA 3P0FA 4YMGA 4PZPA 2V58A 5G1PA 3CNHA 1UT5A 2GZ2A 4G9GA 1R9GA 1ZYUA 1RJFA 3OMLA 4DVGA 3ILSA 4M54A 1GUBA 4KPUB 2FOXA 5TPZD 2C20A 3DQPA 3KQPA 5JNRA 5M29A 1P17A 1JR4A 5EWJB 1S9DA 4IDDA 4CTMA 4PFJA 1H4TA 3GEIA 1LY1A 1ZIPA 1JUDA 4R7GA 4RWZA 1KZGB 3R7DA 5L7YA 2A0YA 1LLCA 2O7NA 3BGWA 1P29A 4RMJA 2ZE7A 3R7WB 1U3VA 3HDYA 5AI5A 4M99A 1JIIA 1MUUA 2OG2A 4HMPA 1GQQA 1KR5A 4NESA 4BLPA 1KVSA 2B61A 1RKVA 2EGHA 3HACA 3IO3A 2D1TA 3L1IA 4H1HA 4P3YA 4XCQA 4JI8B 2X9LA 1ZR4A 3S44A 3SSAA 1LPPA 1WS6A 3DULA 1VRCA 4D9FA 1G2QA 2Z30A 4LF9B 4AO6A 2QVGA 1YZLA 4GR4A 1NW8A 2ZROA 4G8JA 4LE0A 3CRW1 2P62A 1DC7A 4E5SA 1XXHE 1R8XA 1WAMA 5CA0B 4G09A 4DYHA 4DGQA 5DM1A 5CBPA 1RQNA 1KWKA 1PBNA 2W4MA 5ICGA 4MDHA 1NYLA 4YBZA 3TR6A 3ZY6A 1AMNA 3LX6A 4G56A 3U9SA 3S8EA 1OVGA 3HXOA 1M66A 4I1YA 4TKZA 3O8OB 5A7GA 1Z4KA 1LS1A 4BFTA 1Z3IX 5J47A 2I7DA 4JEIA 5FO1A 5E7JA 2GRUA 2VC2B 4S24A 3L8MA 4UUNA 2BEWB 1GYRA 2HHAA 3HABA 5L3RA 5HTOA 3X2FA 4U6QA 3VPXA 4ZI7F 3X44A 2ERCA 4ZVMA 1DLIA 4H59A 4BDTA 3MW8A 4EY6A 1D8TA 1XDUA 2QIOA 1QBKC 3QEOA 4W82A 4YCAA 1EX7A 2OXEA 3HVKA 5KJEA 3TBFA 5IABA 1AK2A 1TMGE 3ZLUA 3LCCA 1U9CA 2IZ7A 1BX1A 5T41A 4LJYA 2FGJA 4CL3A 4YCCA 5BUZA 4OHXA 2M98A 4IIHA 1YH3A 2Y05A 1OFUA 3DTTA 2IJGX 2Q0QA 3KDSE 2C4VA 1ID1A 2FQQA 1T0HB 1CUZA 5ALRA 1JJIA 7ADHA 5JBQA 1U0RA 4NCXA 2HCFA 3F6SA 5KEIA 5LD2C 1L3BA 5C5EA 1I3MA 2J6BA 3G9UA 3PQ7A 2J9ZB 5JAQA 5JYEA 4MVJF 3QQ5A 3CW8X 2D0IA 4AM8A 2DERA 3VYVA 4V0RA 2I8LA 2VYCA 2QV0A 1BXRB 2Z5GA 3KXLA 3WFIA 3A6PC 3CISA 2O1SA 4OQEA 2XYHA 3QJGA 3RC2A 2O8CB 5DBGA 3P9CA 5CLHA 3UKJA 1TPZA 3HI6A 3FWYA 1JHZA 3CLRD 3ER6A 3INRA 3U4HA 2GFHA 4Z6KA 1GPH1 2VFAA 3R40A 5DE3A 1X8XA 2D7CA 1ACJA 2R1TB 1EBUA 1ENZA 2QW8A 3AF5A 3QBVA 3NHLA 4FXPA 2G7MC 2XUOA 4PQEA 3U26A 4PS1A 1LTQA 2WINI 2JD0A 1XNQB 1SNYA 3OOSA 1JG6A 1KPHA 3GW8A 4JQOA 2VRCD 4KQCA 3O2SB 5FOUA 4CYMA 5AICA 4KPUA 5FUBA 4HAUA 3M9LA 4XAQA 2WYOA 5ARCA 2OD7A 5CJPA 1Q6YA 1QB8A 3UUFA 2C1EA 4Z0HO 2EFYA 2W6JD 4NH4A 1UBGA 5BP7A 1P1JA 2X76A 2WF9A 1G5RA 1Y89A 3FAZA 2VR1A 4IIDA 5D3MB 2VBGA 3SFTA 3VKWA 3HJUA 1DZ3A 5DT2A 2IEGA 2HT6A 2QRKA 3COYA 3H2ZA 1E1RD 1TW2A 2Q28A 1UOEA 1JXOA 3D6TB 3DLAA 3K96A 3N7UA 5E1MA 2XLCA 1QLWA 4B81A 2Q5LA 4BP3A 4GOJA 4HTAA 5KYYA 1PJBA 1VJRA 1T0BA 1X7ZA 4NWIA 4OOEA 3U80A 5BUSA 4YRCA 2VCEA 3Q5DA 2BMWA 3RUAA 4HNHA 1RAHA 3DLTA 4Z54A 1RE1A 2EG9A 1V11A 2IXEA 2PLFA 2W4QA 2YV5A 4BKRA 2R6HA 5KYUB 2ZTVA 1Y5NA 2IIBA 1I4OA 1V7CA 1ZN9A 2W2XA 4F8YA 4PBTA 3PFCA 2ZJ2A 4N0MA 2GM4A 2O19A 3AF0A 1BXZA 4WNIA 4UUQA 1I6LA 3Q3GE 3ZBUA 2PDAA 1Z0UA 5EE5B 1BHO1 3IIMA 2ORIA 5AI8A 4DG9A 1X7XA 3AI3A 4CMKA 4L78A 2I2BA 4KRGA 2MSEB 3GJXC 4NYMQ 5BWLA 2DC1A 4JBIA 5ANRB 3KM0A 1PWYE 3DBIA 3R23A 3GFBA 4XIYA 1EK2A 3JWHA 5EQTA 1B6GA 3EC7A 1CUWA 1U5BA 1NZFA 1R6AA 4NQRA 2N3ZA 5D51S 5HBRA 2W70A 4UD2A 1QDEA 3ZHRA 3VSDA 1XQVA 2QMHA 2BI7A 4AF6A 4DR3B 3OOYA 4JYBA 2A5FA 2XHEA 4EO7A 3L7JA 1VMDA 2HLDA 1B00A 4DZTA 3RODA 1MZVA 1UFKA 4UHKA 4ZO4A 3C15C 3GIDA 1E8MA 1KEEB 3MJSA 1SH7A 3TM5A 3AR3A 3G88A 5C8XA 1LK5A 4NI5A 3QFTA 4XYMA 3QELA 2QE7D 1PJRA 2WABA 2PSHA 4Y2RA 2H4XA 3BWBA 5F52A 2P1DA 2YVLA 3JD3A 3UA3A 2ZE5A 3K0KA 1OI4A 3MILA 3L84A 4P7BA 3VU1A 2JEZA 4GPD1 1NI5A 1SEVA 2I2DA 2C4NA 4AWBA 4OQZA 4OSOA 1LVHA 3LT0A 4QQRA 1Z5OA 5B2FA 2FJ0A 4ESEA 4JQZA 2AX3A 1UZUA 2ID8A 3NOVA 4ZQIA 3QOWA 3O6VA 3DZGA 5ES4B 4C9BA 2PD6A 4JLUA 4Q7EA 5TGZA 3RYHA 1GA4A 4IUCS 4DV3B 4ALJA 3KUDA 2QNIA 4M36A 4R54A 4YIHA 5KOJB 1HNXB 4I3HA 1F4VA 1DEKA 4MWZA 3JQ9C 3MWKA 5KX5A 1U0OC 5TJ9A 4CQLA 3EVZA 3LBHA 4H2DA 4Z7NB 3ZGZA 4W1QA 1USGA 2H7VA 3RVOA 1MJHA 5AVSA 4QQNA 1E2DA 2CVQA 2IHUA 5TMPA 4QOIA 3HJAA 3QE4A 2GK4A 2VIIA 3QX9A 2D2IA 3LUDA 2UXCB 4QFDA 3RT9A 2JFXA 2AI2A 3GNSA 1ZCAA 5SICE 4PSCA 3GZ4A 4L0CA 1SKMA 1LK7A 1H93A 4EDHA 1FFDA 3JPYA 4C03A 3SR3A 4RZXA 4B3FX 1UAYA 4I9UA 5BT9A 5K0BA 4L8LA 2NT3A 4M8KA 5KDDA 1OBFO 4UHBA 2YWEA 5IVDA 1Q44A 2WB2A 1UC8A 1KYQA 3EDCA 5EZYF 3U4QA 1MB3A 1RWNA 2XYQA 4OQNA 3OD1A 1JXMA 4R4JA 1JSXA 1TTPB 1VIAA 4AY2A 4YRSA 3FYSA 4XVRA 4JN6B 1M8PA 5IUJC 3KKZA 4LYJA 4O2BF 4WACA 3KAQA 5TQ0A 3WYAA 3FJYA 3SR4A 4A92A 4EA7A 1U98A 3G5LA 1SKYB 4P0QB 3UA4A 4R40A 3U1TA 3W5UA 1PJCA 1PZEA 1ILWA 1Y9DA 5KYUA 2WTUA 4I5DA 1ODLA 5KTMA 3MOGA 2CCJA 2Z57A 3QYPA 5HZHA 1SXPA 5K0FA 3QFCA 4KKXB 4YH1A 1EVIA 4FMDB 3SN6A 1ZK3A 1N8KA 3HPRA 1YB6A 2W7TA 5EFZA 2AG6A 3WWPA 1HYBA 4NU8X 3BF8A 4BMVA 4O5AA 3G0HA 2QP4A 1SUBA 4FWBA 4IR7A 5AJZA 1YOVA 3SC6A 3CKMA 1IPEA 4Z1MA 2BKVA 2COEA 1E6LA 1I1OA 4HYQA 4KJXA 4UD6A 4D9EA 2HBYA 1N3IA 1Z07A 1NPDA 4OYHA 3QRWA 2VHWA 3QVVA 1AIPA 1LRKA 4MA5A 3C45A 2UZIR 3JYPA 5ARBA 2NQ2C 2FSHA 2A9QA 3IKLA 1A5TA 1YC5A 1LBSA 1J00A 1E77A 2QRZA 3SHQA 2ZQYA 5E8JA 1KMIY 1W75A 2EP5A 1HTWA 3NRJA 4R8RA 3DWEX 5A3JA 1G98A 4F6CA 1NW9B 2NSHA 5L3SA 2XA2A 5ICCA 4N3BA 3H5TA 4OM8A 3STVA 1JIKA 2PL3A 4HCJA 4LMPA 1C1DA 1KMHB 2AUNA 3FI9A 4KFRA 4UMDA 3TZCA 3ZXYA 1ZXXA 3T4UA 1FMFA 5LA6A 4BNUA 1DWOA 1U6KA 1TD1A 1CJTC 1P7ZA 2BKXA 5U4QA 2I78A 3PPVA 4IS3A 1C2YA 3ENZA 2C5FA 2CWDA 3RRFA 3DHYA 3OJEA 4MUJA 3OIFA 2H4ZA 3GGPA 4CCYA 5CAEA 4CG1A 5SZHB 2VNKA 2Q2QA 4INJA 5DDIP 2G8NA 1HM5A 2I3GA 1GNVA 2JLQA 1VBKA 3KVRA 4JOCA 2I3AA 1HG1A 1CQZA 2ZR9A 3IDSA 3U48A 3RS7A 1P61B 2H52A 2HA6A 4P82A 4PPQA 1KFJB 2DGDA 2WAOA 1PT9A 3AC0A 2IYRA 3FPAA 3MT8A 2BFBB 2OV8A 3DBVO 4HDOB 4HS4A 4N5LA 4P35A 1X7DA 3EPLA 3LQ1A 1RPZA 4MYSA 2C7VA 3H8SA 3IAAA 2VPTA 5JZBA 4KQIA 4C4TA 3PGVA 4J3NA 1JW9B 5C4IA 3C39A 3SJCA 3VR1A 3PEUA 4YMLA 2BWJA 3QXCA 1N0UA 4IQFA 3IVMA 3UK2A 3EF1A 1QXSA 1UMCA 2C57A 3L8DA 1O95A 2FPUA 2PFSA 2WWXA 4S3MA 3UHFA 3UWOA 3M3PA 5ICEA 3OZGA 3F5MA 2NUAA 3U44A 1JLLB 2ZDGA 1SM4A 2P90A 4HX5A 4BVBA 3R76A 1KNXA 2MSNA 1EJ2A 2O2SA 4K9SA 5A04A 5DI3A 5FT9A 1WQ1R 4B5KA 3COZA 4ETMA 2RGAA 5G1NA 1Q77A 5ADUS 5JNWA 1RXYA 4KTTE 4M0UA 5AHRA 2Q1WA 1O77A 2AN4A 3LDUA 3W2FA 5AR1A 4Q15A 1KS9A 2O2CA 3X1MA 3WWDA 2IYWA 4Q1FA 3DM9B 3EK2A 4IXNA 4MLZA 5ECDA 1GDTA 2DQYA 2CWWA 4X20B 4D5GA 3NBQA 4EMTA 4P93A 1G8KA 4B2LA 3PEEA 4E21A 1PWXA 3ZX4A 4QSHA 4MKGA 2J7PD 3C3WA 3G9XA 5DM2A 1U3GA 5TEVA 2ODPA 2R6R1 1TCUA 1AV7A 1TJ4A 3LM8A 4GYJA 1FFHA 1ZL0A 4KJZA 4WNCA 1IM2A 1YDFA 3R8XA 3SZUA 1E9SA 5JBIA 4HATA 1XJ5A 3OHSX 4E3WA 1H6BA 2WPNA 3VV2A 4JFRA 3ROPA 4ZDJA 4IDGA 1ORIA 2ZE8A 4CV2A 3NETA 1BYUA 4MI1A 2AVDA 3TOSA 3RUIA 2FGKA 1NNUA 1AHHA 4JEUA 4Y98A 1LGYA 3IFSA 1T3GA 4I50B 4TTQA 1GGNA 4Z9FA 5F7JA 3SKVA 4ML3A 1G5FA 4PLHA 4EPXA 3DB1A 4QGAA 3VYRB 1Z15A 1VZ2A 2AC2A 5DBOA 3SM3A 3TIVA 4ZMRA 4W99A 2JFBA 4UVIA 2WWWA 3SYKA 2ZR7A 3QXHA 1MA0A 3E15A 4OFZA 5SZIA 1YL6A 3E1GA 1J49A 3AR5A 1Z74A 3AU8A 4CTJA 1S01A 3MCZA 1TJNA 4JROA 2ZWAA 1CDDA 1VPLA 2HU8A 4O4LB 1D4OA 4BBAA 4BKUA 1XT6A 2JBWA 2OFPA 2P3OA 1KMHA 3H4IA 1Q1NA 4BMXA 2Y9MB 1NJ5A 1T8PA 2DHCA 4GC9A 1Z73A 2UZ4A 4B3RB 2GEBA 4F3CA 1OU0A 2G5CA 1SUFA 1NC1A 1E3IA 2V6BA 2UVDA 3K53A 4LK2A 1F8FA 1GZ7A 4P22A 1GLNA 1PP4A 1BQ4A 4RESA 4NZ9A 1MAUA 2IHJA 2H2WA 2O0JA 3R5XA 1EG7A 1PTJA 4MB2A 4EPYA 1M1YE 1A50B 2XE6A 4DWOA 4YCSA 4YRTA 4NEGA 4W5HA 4RWEA 4JLNA 2DFLA 3C5EA 4W4TA 2J46A 1S3GA 4ZI7A 4YJGB 4AVYA 5IXSA 1VJ5A 2IUSA 4GWKA 4C43A 1SVIA 2YFHA 5DM60 2Z8ZA 4KPEC 1F7UA 1R00A 2J31A 2DHEA 3DW3X 5DMXA 5JCXA 1EFPA 2E4XA 4E4RA 4UFPA 5I8PA 3H4VA 4BWVA 3L6EA 4Q3AA 3DBOB 3OOEA 2SCUB 1NVTA 1XVTA 3E9ZA 4TT3D 2HSZA 4TQUS 2FW8A 2VDWB 1YR2A 4H3KB 1VE3A 2HQSA 1RWXA 4GOKA 4LWPA 3UIEA 1OF1A 1WXIA 3WA6A 1E3WB 1W30A 4AURA 5AVUA 4D81A 2C1ZA 3LY8A 4Q3BA 5KQRA 3GBPA 1NOIA 3KKKA 3FNBA 4BO3A 1D9ZA 4D4MA 1CR2A 1G8GA 1ZD3A 4EW3A 5CB6A 3PJRA 4WINA 3G0OA 5SYMA 3QUQA 4MVJA 3EQ6A 4XQ9A 4DMMA 4DRXA 4TZ0A 1UKBA 4XA8A 4L28A 3KOMA 2TS1A 1DBRA 1NRIA 1COWA 1L5VA 3N3BC 1TAGA 4MJ3A 4Z5XA 2PR2A 2ZBQA 3RC3A 4B1FA 2B0JA 4MH0R 2VRNA 4H7IA 2XAUA 3GN1A 5JV5A 1QHYA 3FUTA 3CLUC 2C78A 5JHHB 5IAOA 4NXNB 1QCDA 4W5RA 3HEAA 2FR8A 4MDFA 1T1JA 2H4WA 2OCBA 1NUQA 1ZN7A 3A6KA 4ZP1A 3KQUA 3I30X 3W9YA 1A1SA 1CQIB 3OZTA 3ZZUA 3I61A 3BTUA 3HDGA 1FFYA 3G3EA 1BVHA 1VFNA 1Q12A 2FSVC 2I6QA 3GDWA 5AKIA 4YX9A 1HE4A 3G2JA 1AN0A 5A5EA 3VPBA 3KHTA 4ND3A 3TSYA 4B3SB 4I1RA 4XWYA 3RS5A 1SC9A 2ZRDA 4DLTA 2DUNA 3H99A 3RARA 1E1MA 3RAGA 3DZFA 5K09A 4DIMA 1YVRA 4FFRA 1LU9A 1KARA 2PQ2A 1WOMA 1PR6A 1CUCA 3NLLA 1T29A 3I8XA 4JJ6A 1FDUA 3W7AA 1ANKA 5I8WA 5JRDS 5JSFA 3LCVB 2G5GX 4ZAZA 3FSGA 2F3UA 3VNUA 4EFLA 2P6OA 5C2JB 1PGQA 1ZPDA 5ITWA 4ZDIA 2AFIB 1FE8A 1CJSA 1NBIA 1QYVA 1X42A 2DKNA 2E21A 2WD7A 2XMBA 2Y66A 3K6KA 1DQRA 2DSNA 4UW9A 3K0EA 3RH0A 2Q5HA 2YDYA 2FPGA 4F6RA 5LM3A 4JELA 3H2GA 3ZXXA 1N5DA 3AHGA 1ZIDA 3C6QA 3MXOA 4HVCA 3GLIB 3V6MA 3IPLA 1VSBA 2AF4C 4ZXPA 4Q34A 4YP0A 4EHIA 3FLMA 5LNK6 4G23A 4RVSA 2H06A 2QMUA 1EDBA 1PUJA 1JSRA 3PRJA 4CCSA 5B3JC 3TZEA 5JSZB 4HDNA 1ZEJA 3LQKA 3LH5A 4JLBA 2H5EA 1HDXA 1IVNA 1SJ9A 3QE2A 3QOYA 3DTVD 1CFJA 4RY0A 3V3TA 4KN9S 1EIZA 1PJLA 2VL7A 1B26A 1V4BA 1SWVA 3RB8A 4DEYA 3BMQB 5JXWA 3ZVLA 3QFFA 3TMYA 3LHIA 5JXIA 2VHEA 2PK3A 2VJDA 4ARZB 3SHWA 2VDWA 2NN3C 1H1DA 1P3Y1 3NTUA 3CEAA 3SK0A 3ZK9A 4DWJA 2YJZA 4OIMA 2AOUA 2LDBA 2GFIA 4M89A 2GETA 3VR6D 3UAYA 4IJUA 3LL7A 2ZRQA 2JVIA 3CINA 2OHIA 1TZJA 3F74A 1D4FA 2V0NA 2WM8A 5E8RA 1V1RB 1R4MA 1HPLA 2MSWA 1WULS 3T1VA 1Q6ZA 4ZODA 3B1YA 1D2MA 3TDNA 3E81A 2N1MA 3QPBA 3L92A 2DZDA 3AL2A 1Q1AA 4DSOA 5A4KA 5KNCH 2FN3A 4JYPA 4V38A 4HWTA 4RADA 5AJHA 1JVSA 3DL2A 3K20A 3P8ZA 2HMUA 3IJEB 2QZSA 1V8DA 2BM0A 3D3NA 1JDJA 1GTJ1 4H1VA 4ZOLF 3U0VA 1TVKB 2HMTA 2ADFA 4FGZA 4YP1A 5DHFA 3WBBA 3TD6A 1ODKA 5ESXA 1ND5A 2OGZA 5HCNA 3HR7A 4TL6A 2RH8A 2HCTA 1CQIA 3INGA 4LRQA 1BMFD 1V3TA 3BH7A 3KB2A 3R7LA 4O4JF 4NHOA 3TKLA 5LJLA 3K2EA 1SUWA 2O5RA 3IPCA 3N2KA 4WDRA 3A1UA 4MW2A 2OHJA 3P9IA 5HKOA 3QIAA 4G4SO 4WK4B 1FU4A 3IE2A 4Q9KA 2B4AA 2ZYSA 3AOEA 4W9MC 5I3CA 4LF5B 5LUBA 2IRWA 2E0IA 3KZXA 5F5XA 3AKEA 1F2UA 1NE7A 5EZYA 5HGJA 4M6WB 5HPYB 3TG2A 1OIVA 1L5HB 3GDFA 4GX1A 4DXHA 2B1JA 1UOQA 2FPWA 2XMSA 5E3IA 3CZPA 2JHAA 2AS0A 2IEAA 2R6FA 3C1TA 2YZKA 3E5RA 1TEXA 4YO8A 5EIAA 2AOXA 1M1NA 4MS1A 3WNVA 3DZHA 2ZI9A 4O2BA 3HA7A 2XKAA 4ND2A 2Q99A 3GPLA 3PUZA 4XVQA 3G6WA 5AXCA 3K0AB 1Z18A 3JYLA 2BFAA 1HOXA 2QNBA 3Q3VA 1YASA 4IWNA 4LV8B 1N32B 2H07A 3EOBI 3A8TA 4HSEA 5EZ5A 2J5RA 4BTVA 1K98A 3NIDB 1UPBA 5K99A 3ZWOA 2QG6A 3H2HA 2CHFA 3JWGA 3L7YA 4TQGA 4H1UA 1XU4A 4B0OA 1ZA1A 2PANA 2FEWB 2NV6A 4GXNA 5HQJA 1QP0A 2IBMA 2P2DA 3H86A 3O8LA 4INAA 2B5WA 3HG7A 1Q1EA 2WSMA 1BWQA 3FF1A 3WK4A 2OCYC 3BB1A 3P2JA 2AUTA 2OP1A 3I6BA 2FQ1A 4YP5A 3HO6A 5CB8A 1U2PA 2OZPA 3KEFA 3NT4A 3D3WB 3SYNA 3HXKA 2BFEB 4C87A 1KZ4A 2VUHB 4EB0A 3LSTA 4Z49A 2PA3A 4HGPA 5KDLA 3PI6A 1DXYA 3P9ZA 3MS4A 3WJ7A 5D00A 1BE0A 1YZ3A 4IIXA 1W5EA 2XJ4A 2VJQA 3WGZA 4ZGBA 5F7XA 4QOGA 3SBOA 3OQPA 2CCGA 1C9EA 3SVLA 3AEZA 1P3JA 4KLZA 4QUKA 4MW9A 4KXLA 7REQB 1SVSA 3CR3C 1O08A 4GQAA 3KR2A 4DTCA 4HPWA 4RYLA 3FPJA 5ALTA 4FW8A 1TT7A 2NVWA 3KQTA 3MLAA 4FFPA 5KSOA 2AEMA 4QXRA 1L8QA 4LXGA 3Q85A 3FROA 3KYDA 3WDKA 4B9AA 1S2GA 1ARZA 2ZE6A 1EE2A 2D7DA 1IWOA 4QYMA 1TVKA 2OGTA 2YHUA 1UJBA 2JFGA 5AH0A 1RT9A 2R62A 3JVIA 5K3FB 1R8JA 1YOBA 1BWPA 3DJYA 4P7GA 5F98A 2R4TA 3WWEA 1ZGBA 5JRZA 5FR2A 1E2QA 1IJEA 4F12A 4UZSA 1NUTA 1FRQA 1IG3A 1P1RA 3PS9A 3LNCA 3AFMA 5T6MA 3PXGA 2EVWX 4WX2B 3FVVA 1GDHA 3A7EA 3I04M 4R1TA 3CKKA 5M2QA 3G2NA 4C01A 4YAWA 3I4CA 2QTVA 3M89A 4X90A 4MUIA 3TG8A 1AZLA 1F3OA 2KBFA 1ISJA 1TI7A 1DAHA 2TSYB 4XEHA 5DEIA 1JP7A 1X8LA 3LY9A 3PITA 5EXTA 5KQSA 5BR8B 4EEZA 4RDHA 1X74A 1H1LA 1QV9A 2VJOA 1T2EA 2I65A 2WRZA 3A1DA 3G0GA 1GXSA 1SIWA 4JODA 4MUEA 3NFYA 1CY7A 4ND6A 4OUKX 2HU2A 4O63O 4TLLB 4YUXA 1NV8A 1VOTA 1N4AA 1KORA 1NY5A 2CXNA 2FEMA 3QHQA 3U37A 3H1GA 3M8KA 5FV7A 1E6CA 1U31A 3VOBA 4DLYA 2OQVA 2PSEA 4K9RA 4GKAA 1GT6A 1J5XA 4B35A 3UJ9A 3LKZA 4AIIA 1M0WA 1XVAA 4XYLA 3QMVA 3N53A 1QIDA 5B3KA 2GWRA 2HWXA 5LQSA 3IT0A 5DK4A 1H05A 2MMCA 5DGHA 4CN9A 4UPVA 3D3WA 4I55F 1SULA 1Y1RA 2D5LA 1NL3A 3BMXA 2BFEA 3VH1A 5JSHA 2OBXA 1NDUA 3ACDA 3MNFA 4GU5A 5C0OE 3TLGB 1O97C 3REQB 3HJRA 2R9VA 4RBNA 5FOVA 3SF8A 4BP9A 1V9SA 2RGDA 4H6PA 2X15A 3C3CA 3GRPA 2DPXA 1DKMA 2OO5C 1R8QA 1A3CA 1T4CB 4DARA 3PD0A 2PU5A 5AKYA 4NE2A 2R6AA 1UT6A 2H29A 3R3ZA 4DXDA 4J3FA 2XNCA 3AHCA 3ZI7A 1FB5A 3RAPR 1XJQA 4XFJA 3HA5A 5LWQA 4EB3A 1OJLA 4P81A 2GPYA 1N5JA 5TARA 2XAAA 4QYSA 1N8TA 2AK3A 4GRDA 1D1PA 4TLMB 3EC2A 3B2QA 5K3DA 3I09A 3OZRA 4TTPA 4AJHA 1IIBA 1XVVA 4Q0MA 1JMKC 4JIMA 1DXQA 4EELA 1OYYA 4BFVA 4X91A 1T43A 1QMPA 4IHAA 4LJ8A 2H2AA 2HDHA 5GVSA 1JQEA 2NTJA 1XLUA 4MINA 3W5IA 4BKOA 3IBSA 2C7OA 3NYRA 1L9XA 5CTAA 4YT2A 4DPLA 3PFBA 3VU9B 1Z83A 4XGIA 3DLPX 1EGAA 3MLEA 3U9LA 4WXYB 1YDGA 4TROA 1TJ5A 4PG5A 2BMDA 2ECQA 1VE6A 3PIDA 4GBMA 1M6YA 3CUSA 4BO8A 4G67A 4KQKA 4CMIA 1EP1B 2BI8A 5KTRA 3EQZA 2CNLA 4RKQA 1V48A 2ONCA 4FD2A 1LDYA 1AGRA 2PPVA 4EUSA 1FX0A 5LL6P 1IZ7A 3QWFA 1Y8QB 3D8BA 1GCUA 1ZWKA 5JD4A 4RUKA 3BDIA 1M8JA 3KHUA 2IYXA 1WVIA 2I6SA 3L18A 1ORWA 4JNKA 4PYKA 4RSMA 2CVZA 3E7FA 3IERA 5EE1A 4BTLA 4URVR 5FAKA 4CL0A 2ZJ1A 4XYBA 3RF6A 2XNSA 2QW0X 3C41J 4JL6A 3EXG2 2I4OA 1PLJA 3C7CB 4RVCA 3UJAA 1TA9A 4LZPA 2GVNA 3HQ4O 2HRBA 3WDSA 1AF7A 4PAQA 2BLLA 2YR0A 5G0WA 3T7RA 1L3CA 1J97A 2C96A 4WCFB 1XJCA 4HAZA 4ZOLB 5KJFA 1S89A 3W2TA 4PYNA 1QTNA 4G8DA 3K5HA 4DKXA 2C5GA 2PXXA 1R4NB 3CRVA 4MAMA 1JG7A 4DR6B 5E2IA 3HRHA 2UUBB 3MTAA 1SVOA 1UBFA 1T9KA 1W85A 2OB1A 2OBFA 1R50A 1ONSA 2ZDHA 3EZGA 3WAGA 2IHVA 3LWZA 5AK5A 2WLSA 4HVTA 2FXVA 2JFPA 2AEJA 1B74A 1V9LA 3WWOA 1KAGA 2ZUUA 4F1WA 2QE6A 4IQ0A 2YC4C 1X80A 2R65A 3PYMA 3R7SA 1V8ZA 4C04A 2PMBA 3EOZA 8ABPA 1XU7A 4GXTA 4RE5A 1SBQA 3SYMA 2VAVA 2BD0A 1SKYE 4BNMA 5MN4A 4X6XA 1BEUB 4KNYA 1CB7A 5KQMA 1AXEA 1A2BA 2O8BB 1TD9A 4X1OA 4HT3B 4JEMA 1PJ8A 1SZJG 2AJBA 4GI3A 2RH4A 5K0TA 1OXTA 1P0MA 3LUJA 1P4AA 3LPMA 2Y1FA 3TXXA 2PUDA 3R3SA 4PZCA 3OLZA 2Q8PA 4WBSA 5A3RA 2QD3A 1J6UA 2GHIA 4K6FA 3V97A 5BQ3A 4TV9F 2YV4A 4BVHA 1KDTA 1PNRA 4AY4A 2V7QD 3GYBA 2J0EA 3ICPA 2VA8A 3REFA 2EWMA 1G8FA 3EIUA 4OBBA 3IMFA 1QYIA 1YNOA 4H3VA 5BR7A 4U5XA 5IF9A 5ALMA 1NW5A 3HB5X 3K8ZA 3SE0A 3NVDA 2E4VA 7ABPA 4KITB 1GFIA 3EIEA 5AVOA 4TX1A 4XRGA 1E99A 1KZ1A 2QAJA 1YFZA 2WVJA 3BIWA 5DGCA 2I2XB 3OOHA 1LDGA 3UATA 1PNVA 2BT4A 4H4CA 2ZTMA 2EG5A 3ETHA 1DBSA 4IHJF 4A8JA 5IXJA 1G8JA 4O5OA 3VU9A 1L4BA 2G9VA 4MR9B 3Q41A 1DJNA 4YYEA 1FS5A 1OY1A 4OJTA 4X1YA 3RGWS 4MQBA 4NJEB 1GG2A 2PEZA 1N78A 5I8ZA 2GJKA 3QNMA 5B4VA 4QRHA 3WL7A 2PM8A 4B74A 3C87A 4BE9A 1AMUA 4Y8VA 1CNMA 3EG9B 2HXYA 3NHWA 1EA7A 3JVDA 2YCLA 4GT1A 4CCAA 4F4JA 1Z3CA 4E2YA 5JFTA 1ZHFA 3RLFA 3T3PB 3V32A 1L1QA 2VJBA 1UOOA 3RIYA 1I4EB 4JU8A 3ZY4A 3EEOA 3VMFA 1QFJA 1TZ2A 3KWMA 4EUFA 5J58A 3M6XA 3STUA 5GAJA 5K7SA 4KYVA 3KSDO 2QN8A 1VJCA 4Q9DA 3G1WA 3RNOA 3QVXA 4RZQA 1RVV1 2WMOB 3COPA 2JZOA 1U2SA 3D0KA 3FKQA 4TL7A 1KBOA 1XKLA 2GZDA 2RJ3A 2EAUA 1IE3A 2XB4A 3BPSA 1NGSA 3DQQA 3IBTA 1U81A 5DNVA 4IGIA 2F1IA 3LAWA 3H9QA 4M9CA 4BCBA 4EMBA 1YA6A 4DV6B 1K4MA 1UQTA 1RBZA 2RHWA 3A6LA 4IH9A 3OTOB 2C42A 3BHIA 4O4JA 1EFUA 1BS1A 5JIBA 3DV9A 3QITA 5I01A 3ESCA 1NONA 4UU8A 5K1ZA 3W1WA 5G3YA 2MOKA 1ATZA 4PZ9A 3ZWBA 1RIFA 3A3OA 3QU5A 2V03A 1F1JA 3LGSA 4M9SA 1W0CA 4PTYA 1ETUA 1CQPA 4WY5A 1UBHS 3O8DA 3RTCA 3PVCA 3IOMA 2Z1DA 5B53A 4FB5A 2NXEA 4FE4A 3RRZA 1N2CA 3DL7A 3RSHA 1C0PA 1CETA 1TADA 1XKQA 2XRFA 1QZ3A 1JRLA 1S1MA 4FE7A 2O8BA 3IQHX 3NASA 2RK3A 1KDRA 4A15A 2H31A 4Q6WA 2ZYWX 4EATA 1G5PA 5E4JA 1IMOA 1WMFA 4XD7A 3TTVA 2PQMA 4V0NA 3KG2A 4IZ6A 5FPHA 4KUHA 2WSBA 2NO6A 1QVRA 1BNCA 1TUBB 1ZICA 3I34X 4GMXA 4NBSA 3RLIA 1QHEA 2YH2A 1PFKA 3UUWA 1JPUA 1A1VA 3IP6A 3KV3O 3EGIA 3UFXA 2H8KA 3GGSA 3ROGA 1JSCA 1M7BA 1B15A 3IA7A 4UXJA 3NAGA 4Z0TA 1GFSA 2JLCA 3EDRA 3JVUA 4AN0A 1KQOA 4Q48A 3N28A 3F9IA 1EXVA 1XO1A 2CD7A 4JXXA 5BMOA 4G8CA 3OU6A 4YT8A 3R8CA 4GFDA 4AWXA 5CCBA 1E66A 1B3RA 1Q7CA 1KOGA 3QBDA 4MWTA 3W06A 5CPFA 1T9HA 2OORA 1C9MA 2AK2A 3VGPA 2BE9A 1XDDA 1LSSA 3BBLA 3N5CA 3VR0A 4JGGA 3CJQA 4Q4AA 5KVVA 2WJPA 2DTDA 4OK5A 2WFLB 3K73O 1U0GA 4QBTA 3V9AA 1WB6A 3BRSA 4KRYA 3GRRA 2M6KA 3Q8KA 3M34A 4P2BA 2WM9B 1DOAA 3EJWA 1Z6GA 2I7TA 4G26A 5DX8A 1FCJA 2J3KA 4XM0A 2D4AA 4MR9A 3RVNA 2CLLB 3EWAA 5H0IA 4FE3A 3V55A 1I6MA 4QXMA 2RAVA 4R7ZA 3WNDA 3CBQA 4QOJA 4B7CA 3NPMA 1T2NA 2JCSA 4PPGA 5H7XA 1NURA 2GN1A 2OAEA 3H5WA 3JYNA 4U2EA 4Q82A 4HNVA 1EVEA 3V80A 2O48X 5FPYA 3B6EA 1EFDN 4GNKA 4DCSA 4PU0A 7YASA 3HNOA 1NF9A 4BFZA 5LLTA 4R16A 2RGWA 3QV1A 4KAFA 2X4GA 1E2GA 1NF2A 1UJCA 3OUUA 3DHVA 1N7IA 1XD9A 4HDSB 3ZY2A 2YS6A 2XUDA 4UFNA 1ZHHA 4EW1A 4NBKA 1MDFA 2ONJA 2UV8A 2IYVA 4OIFA 3K09A 4GPBA 4EYEA 1C4OA 2JRCA 1TIKA 2ACWA 4GO1A 4RTRA 2YRXA 1DPGA 2GLUA 2YXNA 1TO2E 3H13A 4N5MA 5B30A 2YWGA 3ZLVA 4FKBA 2AI1A 3M7IA 4BMSA 1JKIA 2HMYB 2ZRMA 3ULKA 2GXAA 3BICA 1ULSA 4AO7A 1TO6A 3D2LA 2ZZKA 4BQSA 3QU9A 4LI0A 4F5EA 1FNSA 1R4AA 2DHRA 3K1AA 4W8HA 3A05A 1CUFA 3R7AA 4Y7DA 4BDSA 3L0SA 1G38A 3IAM1 1NUSA 4G41A 3TJZA 3DT8A 1DBPA 5BVHB 1I2DA 4EAQA 3UHAA 4RSHA 2XWJI 2Y3IA 2H3EA 4NOKA 3GQBB 3G8CA 5CVDA 1KHTA 2WPDD 4MWDA 2CL7X 4MA0A 5H68A 4MPRA 5DPMA 2WWHA 3Q7RA 3ROZA 2HBRA 4FM9A 3PLAE 2DFNA 1TUBA 4B82A 4MGEA 4YMSA 4ABTA 3JV7A 4LXQA 1KC1A 1SZDA 4DHEA 3FY4A 3HCPA 3RU7A 1WUKS 4B32A 3IKTA 3B1KA 3SMQA 2P4SA 1NI3A 1MW9X 4BNVA 2H1IA 3N6RA 1PT8A 1FLNA 1NUHA 2C3MA 3IXQA 4QTYA 1AKUA 4IBOA 3RREA 3K6RA 4BNGA 2CXSA 4CTKA 2O0HA 1NNLA 4PHCA 4ARSA 4L50A 1I2MA 1E2EA 5JCOA 5YASA 4QQ8A 3VHQA 1GN9A 4EY3A 1QH9A 2HJVA 2XCLA 2Y76A 2ZI7A 1NU6A 4MKIA 2X3YA 4JLKA 4JVSB 4HRAA 5LOVB 4DN6A 4URXR 3VA7A 3DO5A 2AFIE 4JJEA 2PV7A 2ZYAA 2GD2A 4YYZA 3P2OA 1D4AA 1A9OA 4HDRB 1HEYA 3IT1A 1NYQA 3IUYA 4UEOA 3LT4A 4UVDA 3ROMA 5C35A 4ID9A 3DE4X 1RS0A 4I55A 1K4KA 1XXLA 3RT7A 4B09A 2H2GA 7AT1A 1F60A 4NMXB 2Y6UA 5DW3A 3I9V6 4CQMD 4DA6A 5LDHA 4KXUA 2C94A 2F2TA 2VSNA 2DMRA 3QYJA 5AFSA 4Q1DA 3OQNA 3IPRA 3GVPA 2CUTA 2HY7A 3G8YA 3IPYA 4UEWA 5J2UF 1KRHA 3TZKA 2QM3A 5TF0A 4JLPA 1U3UA 1XEFA 3U1BA 4PSDA 1TYDE 1QQ6A 3L49A 4MWCA 3T3NA 3OQIB 1J9GA 1PAUA 2QQGA 3CVJA 4FS3A 1BGWA 3QV2A 4NL4H 4TV9B 4AULA 1UKCA 1DGQA 1OVMA 1E4EB 4B8WA 4TV8B 2W6JA 3JALB 4FYIA 4MPPA 4R68A 4R9UC 5HTKA 3TO5A 3WZLA 1O54A 2XDQB 4WD3A 2OBNA 2ICAA 3C3BA 1RPJA 1KO8A 4M9QA 3HSSA 1KI9A 3V8EA 3IEVA 1NTRA 3AP2A 4QPPA 3TD2A 1Y0BA 4LPSA 4GLLA 1X38A 2BGMA 2Z4SA 3A1SA 4JENA 1ZUD1 1I33A 4H18A 3H18A 4CR6A 1AKNA 1G4UR 1US8A 3M6LA 4QYWA 5ITZA 2QJTA 1DRJA 1BC5A 1BAPA 4HMOA 2PX5A 2AQKA 2J0VA 1QQBA 1EDDA 4WK0B 1FDTA 2JGDB 5ECGC 2J3MA 2QU8A 1Z06A 1YJBA 3E9QA 1UM9A 3KLMX 4ZRMA 1RYEA 2ET6A 4AQDA 5ALJA 1IZZA 2GAFA 1IONA 3PNBA 4LJ6A 5DGTA 2RHDA 1LRLA 3KZ1E 1W4CA 5DNDA 5E6UA 4B4KA 1F6BA 4K8RB 4RFSA 5CM8B 2ZTHA 2NSJA 2P9TA 3FTQA 4XTCS 3U3RA 3MMSA 3P2KA 3JR7A 3A3KA 1PZFA 3C85A 4KQXA 4L8WB 2X2PA 3VDRA 3JD1A 2FW1A 4EK9A 4HEA6 4Y9SA 2JKYA 2Z56A 1U2GA 3R7FA 2XT6A 1XQYA 4M1YA 3GQBA 4MW0A 2NVUA 4B33A 4HR7A 2CLFB 4ZA2A 3RK4A 1MVLA 3FCYA 4YECA 4RDIA 1C7RA 3D7SA 1DADA 1ZGAA 1D1TA 1MIHA 2NZ8A 3AFGA 3E4CA 1QV7A 1W2HA 1XRJA 3HYCA 3LSYA 4YQFA 1GG8A 1UBJS 2QHXA 4I2NA 2PL5A 4UAUA 2W2KB 3W5SA 1V5WA 4RVGA 1EVQA 1XNGA 2QMQA 2HEIA 2GUGA 2XMZA 3CC8A 3G9TA 3GFRA 3FPCA 3HKBA 1PQYA 2OV6A 5EP2A 3RFVA 2J6IA 1R9JA 4IF4A 4AJKA 4IIJF 3I83A 2KE5A 4P36A 1U7UA 2M1ZA 3W7VA 4N12A 1PTKA 1NBME 2I7CA 3QU4A 3HH8A 4QGHA 1E3TA 1HL7A 3DMRA 5BV7A 1AA6A 3GCGA 4G1MB 4J0FA 4YUWA 4MKFA 1R6DA