5FLYA

The fhud protein from s.pseudintermedius
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
279
structure length
279
Chain Sequence
KETKAFNLKTAKGEEKIDIPKDPKRIVVMAPTYAGGLKYLDANIVGVSDQVDQSPVLAKQFKDVDKVGAEDVEKVASLKPDLIITYNTDKNTDKLKKIAPTIAFDYAKYNYLEQQEAMGDIVGKSDEVKKWKADWEKQTAQDSKDIKAHLGDDTSVTIFEDFDKKIYAYGKNWGRGSEVLYQAFGLQMPKALDDATKKEGWTEVPKEEVGKYAGDVIITAKAKDAAQPEFQKTAMWQNLEAVQNKYAFNVDSSVYWYNDPYTLDVIRKDLKKQLLALPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERRICHROME-BINDING PERIPLASMIC PROTEIN
publication title Crystal Structure of Fhud at 1.6 Angstrom Resolution: A Ferrichrome-Binding Protein from the Animal and Human Pathogen Staphylococcus Pseudintermedius
pubmed doi rcsb
source organism Staphylococcus pseudintermedius
molecule tags Metal transport
total genus 91
structure length 279
sequence length 279
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 5flyA02
3ZKAA 4TKUB 1M1YB 1EFDN 1QH8A 2QI9F 2X4LA 1N2CB 5HX7A 3G9QA 4NNPA 1G20A 1MIOA 3LHSA 4PAGA 3PSAA 4WZBB 1N4AA 3MINB 4WESA 1KARA 3U7QA 5M29A 5KOHA 3CX3A 1G21A 3AERA 5B58T 1QH8B 4WNAB 3NU1A 3MFQA 4NNOA 2XY4A 4MDYA 1K7SN 2XUZA 5CR9A 1G20B 1MIOB 2PS0A 2XQVA 4N01A 5M3BA 4WESB 4UDNA 1PSZA 5KHLB 5KOHB 2M6LA 5JG7A 4G09A 2YNMD 3AERB 1QH1A 4HMOA 4WN9B 2YNMC 5KOJA 1KAHA 2M6KA 3GI1A 1ESZA 4OVKA 4K3VA 4LJSA 3HXPA 5GGXA 3MINA 5BVHB 3TNYA 1QH1B 4WNAA 3TLKA 4FILA 5KOJB 4DBLE 1M34B 4FNAA 3BE5A 3ZK7A 5CX1A 1QGUB 4H0FA 1K2VN 3PDIA 4WN9A 1M1NA 2Q8PA 2OGWA 2O1EA 4FI3F 2OSVA 4G07A 3MWGA 5CX1B 3MWFA 4TKVA 3PDIB 5BVHA 1M1NB 4INOA 3HJTA 4ND8B 1M34A 4MX8A 5I4KA 4H59A 4IRMA 5JPDA 2RG7A 3AEQB 3TEFA 3AETB 3MD9A 4INPA 5GGYA 1QGUA 3ZK9A 4TKVB 4HMPA 1FP4A 2AFIB 4HN9A 3EIXA 5FLYA 4PM4A 5AFSA 4WZAA 5M34A 3K1AA 2Q8QA 1N4DA 1KAEA 4XPIB 2XH8A 2R7AA 1FP4B 5HDQA 2XDQA 1TOAA 2WHYA 4M7OA 3HH8A 4ND8A 4BBPA 1N2ZA 3AEKA 3EIWA 4WZAB 3K1AB 3AEQA 4OXRA 3AETA 4GICA 1K75A 4FKMA 2XDQB 3ZTTA 5BVGA 2WI8A 2AFIA 4CL2A 3AEKB 3BE6A 3AEUA 1L5HA 4B8YA 2AFHA 4XPIA 4HMQA 3AESB 2MINA 4LS3A 2XV1A 2ETVA 4MO9A 1H1LA 4UTOA 3R5TA 5BVGB 2R79A 3UJPA 4UTPA 3AEUB 1L5HB 5M2QA 2AFHB 2PRSA 2OV1A 2MINB 1PQ4A 1XVLA 3U7QB 5JOQA 1H1LB 1M1YA 4TKUA 4UDOA 3PSHA 1K0FA 1G21B 3LI2A 4OXQA 2PS3A 3R5SA 5JJ5A 1N2CA 2OV3A 4MLZA 3AESA 2PS9A 3ZK8A 4WZBA 2PHZA
chains in the Genus database with same CATH superfamily
3HNPA 4J2TA 1NBMD 5HWSA 1P29A 1FP6A 1AJEA 1IUKA 2VK4A 2WHQA 3MYYA 4R1PA 1PNTA 1W5SA 3O31A 1KJQA 1VE9A 1PT7A 2ZRFA 3K15A 2VSQA 3H9UA 3OZIA 4YDSA 3STXA 1P45A 4HV4A 2R8BA 3RE1A 3URMA 2G09A 4HC4A 3M5DA 4Q1DA 2WG2A 4H18A 3MHTA 3PEWA 2CD7A 3GELA 3I5XA 1GNLA 1E9VA 1KPGA 2YRXA 2QIPA 3HR4A 5HOQA 4YR9A 1K66A 4UTXA 4QBGB 3K2IA 3HV2A 3R0VA 4JXKA 3FDZB 1Q22A 3TLKA 2UZ1B 2IYVA 3COSA 1OQAA 3K31A 4G1MB 4MVJM 3WADA 1PR2A 4K6FA 5A7HA 3ETJA 1XDZA 4RENA 4WNYA 5DEIA 4ZV4A 1ISFA 2J46A 4DV0B 1K6EA 1NG1A 1R9GA 4PGAA 4TTVA 4PANA 3U4IA 4J75A 1WG8A 1UT6A 4LF6B 4HQ6A 4MR9A 2P9TA 3KM0A 2F6RA 2ERYA 3D9QX 4OMDA 3RHFA 1ZUHA 5IH3A 3L0BA 4GXRA 3I8SA 3AJAA 3LQRA 1U5BB 1PNVA 4L4RA 1N5MA 4JLPA 1WW8A 4PZAA 2AI3A 2AQKA 2HJRA 1BEZA 1YVDA 1XWWA 2II6A 3E5NA 3IDQA 3HJTA 4H27A 4MX8A 4FDMA 4QDTA 1I7SB 3CEMA 1XGKA 4NAHA 4ZVPA 2KHZA 4RWEA 4M1YA 2EAUA 4QU9A 4WBNB 5EJ4A 5J4LA 1M2JA 5DU2A 2FWIA 3IKMB 5D5QA 1J9ZA 1JKMA 4MS1B 4N5IX 5DYGA 4JB8A 4DABA 1ZD4A 1EDZA 2BFCB 1TJNA 1BX1A 1O6GA 2A0WA 3DAFA 4AN0A 3L6OO 2Q8QA 2ZDHA 2J5BA 3M4JA 1QGDA 3B1FA 1Z73A 4CUZA 3C5WP 4KBFA 5B7GA 1W44A 3MMXA 3UWPA 4OHRA 3FH0A 5BMVB 5DM2A 2BMVA 5KSYA 2FQWA 3GLQA 1JIVA 1TAQA 2JRLA 5F64A 3K53A 4BU0A 2CV0A 4D26A 2QD5A 3INTA 4WE3A 4CM8A 1IK4A 1LLDA 2XEXA 1XMSA 2Y1LA 3R0JA 4OHVA 4X1IB 1PFUA 2C57A 1XQXA 3OJCA 1V16A 1LPNA 2PFKA 3G82C 1H5QA 1U3GA 2WI8A 1WQ4A 1X1QA 1VSUA 3K09C 5EHXA 5GM1A 4G81A 1SCKA 3BMOA 2OM6A 3C1OA 2EZ8A 1IBRA 1YIAA 2JFWA 3AM4A 3QW4B 4HAYA 4RZ2A 3RC2A 4D4IA 3MJRA 5ALVA 1ORIA 4OLAA 1RAHA 2BP7A 1RC8A 3DUFB 1XNJA 1ZR2A 4IDNA 1UT8A 4V0ME 3VNUA 5FBHA 3PKIA 4Q3LA 3EXG2 1QPGA 1ZGHA 4GGOA 1XQYA 2EFYA 4IH9A 3BMNA 4G1BA 4LDQA 4HUTA 4OFXA 3U9TA 3X3HA 3U44B 4B4OA 3S2UA 3TR0A 3QXCA 3BF8A 3DO5A 3G88A 2B9EA 1D4FA 3IOEA 4QFCA 3LXRA 4XM2A 3X1DA 2R6FA 4BX9A 4ZYTA 2P9ZA 2Z2XA 3MLEA 1P44A 2CMDA 3E2PA 2EIXA 2ODBA 1G55A 4LZLA 1JF8A 2OXCA 3ZY6A 2B37A 2A9VA 3PGKA 2X6QA 4OSOA 1QR2A 3AHJA 1DAKA 4R54A 4Y30A 3E4CA 3SHWA 4OX9B 4RZ3A 1UC9A 2VRWA 3ADPA 3GLFE 4GRAA 4PIVA 2CXUA 3AFMA 3BRWA 1US8A 5EIAA 2CLSA 5K9ZA 1TYBE 2O5VA 2VVTA 3SI7A 2H5EA 3IVMA 4FYJA 1ST2A 3JQAA 5ILGA 4HWOA 2FEKA 1ISRA 2H1WA 2RHOA 1D4OA 4KRFA 1GZ7A 2JHAA 3OLQA 3IIEA 2X4DA 3A6HA 2E6KA 3PKJA 4MKRA 2DWCA 4IDEA 4KLZA 1G7TA 1UADA 1PL6A 2PZLA 3FVTA 1C9YA 2F3UA 1XPJA 3QLUC 2YH2A 4KWTA 4R98A 5T4FA 5H0IA 3AVXA 4K05A 1JLSA 5ALSA 1LK5A 2D0DA 2NO0A 4IXWA 1VL0A 4GHWA 2Z2YA 4XUDA 3VTZA 4C4YA 3EDQA 1IY0A 5JAQA 2OCAA 4Q4CA 1WZ2A 4IIEA 3QJYA 1G291 2BFEA 3R6DA 4WSOA 2B99A 4KVAA 1Y1RA 1XPUA 1UFOA 2WMOB 3H83A 3N28A 1EMDA 2Z8XA 3UJ6A 2JCGA 4UTNA 3THYA 2PH7A 2RI0A 3H0KA 2I2CA 4Y67A 5JNVA 3CLRC 4AZ3A 4A5SA 5ECGC 1REQB 4FYPA 1OOEA 1NW7A 3DEFA 3I9NA 2J6HA 3O4VA 1DV1A 1RAAA 3GEMA 1ZCZA 3HLYA 3MXOA 1Q74A 1F4VA 1N0HA 3KFLA 2ENUA 5A62A 3ROGA 3CA8A 3H1PA 3HUTA 5AI9A 3ZJ4A 1RD4A 4FYKA 5FO0A 4ASUA 5HRAA 1QZXA 1QGOA 1FK8A 1FP4A 4TV9F 4V0SA 1PQPA 1GZ3A 4D02A 3ZOZA 1H2BA 3FVQA 5A6SA 3F4BA 2OKCA 3M6IA 1PUIA 1P7VA 2H65A 2M6SA 2PX8A 1B73A 1U9JA 4IV0A 5F2EA 1U0OC 3CJTA 5I3CA 3CUTA 1FNSA 1JXQA 2GHTA 2XYRA 2YWEA 2WLTA 4ZPJA 3CIOA 3BD6A 2OYCA 3RYFB 3A4LA 1HEYA 2C2ZA 3RYIB 5DNYB 1SBYA 2PLNA 3ZW7A 4P9NA 1V8PA 1W0KA 3FPAA 3I2KA 1R6BX 3QVSA 3VKVA 4C2UA 2IF0A 5CYPA 3AJ9A 1T35A 1KNXA 1E9RA 3O47A 4HFNA 4WADA 1O1YA 4X71A 3FYUA 5JFGA 2AG8A 1BG6A 1T3LA 2ZQ5A 2YV4A 4M76B 1S1MA 3WGVA 1CJUC 3FX2A 2XXAA 2C2OA 3HCRA 3JVEA 1KE2A 4TMKA 3G5MA 3T06B 4MHOA 1GPYA 3LXUX 4TWJA 1TLLA 3V2IA 3FOZA 1XA4A 1UOEA 2F4NA 4Q1BA 2WD7B 3QIVA 3OU6A 3WLKX 4C1BA 1YR6A 3NW9A 3RS4A 3OJLA 2REQA 3ANSA 4M7WA 2MJLA 3LC0A 3UK6A 2CL7X 2IL1A 5CH5A 2IQ5A 3X1MA 3NHBA 3KKZA 4RVUA 1BXZA 1W4ZA 4FW8A 5JSHA 4C4PA 5AXDA 1ICIA 2C94A 4I8DA 3W2IA 3WGJA 4CM6A 3NVDA 2O3SA 2A1UB 5HTOA 2PHZA 5DM4A 4CM1A 1K27A 2P2CA 2YWXA 2PMBA 2V7QA 3EVEA 1T36B 3LUGA 1PR0A 5AJYA 4M87A 5BOSA 3FXAA 4HL6A 2I7XA 1N9GB 2C9OA 4Q24A 2WOJA 4WVLA 5EZ6B 1RLOA 4DJTA 3A3YA 5IJ9A 3AO0B 2FUNB 1LPBB 3OQIB 4FCWA 1I10A 2J85A 1WDMA 1ZI8A 3CX8A 5I9MA 2HY7A 2ONZA 2YRFA 1WHTB 5CEFA 2Z8ZA 1IXZA 1BQ3A 3LWNA 3QV2A 5E1MA 4EVSA 3IERA 3UJHA 2D8MA 1ENOA 4NMMA 1LLCA 3OPYA 4QPDA 4UHBA 2ZPUA 3L7BA 4BO9A 4YRBA 4XWWA 4CMEA 1ZN2A 3C7DB 4X3OA 3NAGA 1GFIA 2FPOA 3KZNA 2ZZKA 4BNWA 3IQFA 4E33A 3EWSA 4F85A 4X65B 2A5LA 3D6MA 1HQCA 1ZLYA 1JXOA 1W2WB 4X24A 1N3IA 1UJCA 2BI4A 2WLSA 3QLJA 1AF4A 2C58A 1M10A 4OSPA 4C0KA 1H6CA 3VHXA 1MEEA 4G0OA 1KMNA 4C4SA 2JLRA 4Y9TA 3ZNOA 3I9MA 4FBMA 5JS2A 4RETA 4EEXA 5C8DA 3N7TA 4F1JA 1JBEA 5BURA 1DXYA 1OBVA 3O7WA 1QHGA 4KQXA 4ZRNA 2BEUA 2NVBA 1X6VA 4Z2AA 1AK9A 2WSBA 1QAOA 1YZQA 3MG9A 3FD8A 3D7SA 4EUEA 4FQ5A 3R0IA 4LC9A 5IUKC 1KI8A 1TFRA 2JFYA 4G8BA 4TLMB 4OJYA 1Z5WA 2VYQA 3TNFA 5ITZB 4DLPA 2JIBA 1U04A 5K3EA 4C0XA 1PIWA 3OLYA 3UMGA 1JAIA 2CNBA 1F8UA 1SKYB 2C96A 4E14A 2X3FA 4HRXA 2WUGA 5GGYA 3SC2A 4CMJA 2OZVA 3KR1A 1V1RA 2IW1A 1KXJA 4DWVA 5LJIA 2FQQA 2EFEB 1U0SY 1Y7PA 3BEOA 3H2SA 3H1GA 3UJDA 1MVLA 2YXDA 5CEEA 4Q4HA 3BT7A 3EQZA 1H9BA 2ETXA 3G7NA 4LRQA 2P75A 4MWSA 4REOA 4WD3A 5DBEX 3WGZA 3ZCRA 2F2TA 2Y77A 3AKCA 3GOHA 4QGFA 2VHQA 2VK8A 2NV6A 3WK7A 1QIHA 3L4BA 2GFHA 2NM0A 3WG9A 1D2RA 1KGSA 1UQTA 1Y7HA 1CDZA 2C4KA 4YYEA 3ZCVA 1Z18A 1KK0A 3GMTA 3WBKA 4OQLA 4D8UA 5JR3A 4ZTUB 3U09A 1IN1A 1B4DA 3P2YA 1GYPA 1QYDA 4G26A 3V8BA 1MR3F 5J5VA 3UANA 1QOZA 3ILHA 3RLIA 4DDWA 1DZIA 1KMQA 2AH5A 2MINA 1XKTA 2O3TA 1HDXA 4LVUA 1S7GA 4PHGA 4XR4A 3TM5A 1N2JA 3WRXC 1Y8QB 3HDJA 3NGMA 2UYQA 5CXSA 5I7RA 1G59A 4D46A 3OCUA 1UDRA 5AKHA 3HSSA 4EM6A 3QUCA 4LY9A 1QX3A 3GJRA 3BMXA 1ZXBA 4HDCA 1MFPA 2XNDA 2ERXA 3QRWA 4PLGA 3UMSA 5JSUA 3PLNA 1K7FB 4RHYA 1ESDA 3CG4A 4N49A 4IDGA 4KUGA 4P4SA 1CTQA 3EHEA 3UWDA 5INTA 3GLGB 4JI0B 1Z6PA 3QMMA 1TU4A 1H1TA 2CEAA 2WKRA 3JWHA 4LOHA 3VUEA 3FCXA 4OGKA 1NW5A 4H2DA 1RZRA 1SU4A 2JFUA 1ZXXA 4DQDA 2X4LA 3L49A 2ZP1A 1GHTA 5MGBA 3DMYA 4IJWA 5E1DA 1T3GA 3GLGE 4TV8B 2E4YA 2ID8A 2O2SA 4WZBB 1E3WB 2VNJA 5U4XA 3RUIA 4YRIA 4EOGA 4QUHA 2VDUE 2HWXA 1D2NA 4G5RA 3ZWMA 5CLLA 2DWUA 1TK3A 2XLBA 3EUEA 5F35A 5JNUA 2D0PB 2C78A 1Z4OA 2NU8A 5EHNA 2ODWA 3N8KA 2B69A 2OD7A 3FTNA 1IUNA 3N2KA 2GDJA 3QJGA 3ZY5A 4F46A 4XIYA 4B2IA 3VC2A 1AUVA 2PH5A 4V2IA 4AZSA 1STOA 1XX6A 1SVWA 3UMBA 2IIBA 4A2WA 1QK5A 3AFGA 2WUEA 1GKUB 3G0GA 4IQ8A 2GZ2A 1JB1A 4F7DA 2ZRIA 2YOHA 3ZD8A 2WIGA 4EA7A 2OVFA 1SGWA 3VOAA 1WSDA 1Y4SA 1P6UA 2GPSA 4YJ2B 3M5PA 1BW9B 2I76A 5LD2C 3O9ZA 2J7PA 4R0VA 4JR2A 5EUBA 4B3HA 1LNZA 3NIFB 1KMHA 3WLQA 1VJCA 2XGGA 3STWA 4CM4A 2YDXA 4IIJF 1N5IA 2G5TA 4C0BA 4EB3A 2ZT8A 5LSAA 1UK9A 2M6RA 1ZH4A 4Z1OA 2BM1A 2R85A 3LSTA 5FYQA 2VJNA 1EIZA 2OLJA 4S0XA 4HNVA 4KPFC 1FLAA 5L4SA 4P3KA 3WLTA 2PJDA 5AICA 3IAHA 4EKEA 4I8IA 3WL3A 3ZDAA 3LLUA 3THWB 4BPBA 3WGUA 2IYZA 2FU5C 4GNKA 2OYSA 1VCIA 1ULZA 1TVKB 4LZWA 2OO7A 4TS1A 3GT4A 2MHCA 3OP1A 4PFSA 4DBVO 2RGEA 1HT2E 3MCUA 1AVTA 4JLBA 4EBFA 1PR6A 3PGVA 1BA3A 5BSRA 5EWJB 1NUAA 5EXDA 1SMKA 4MS4B 4ZQCB 1LBTA 4CKEA 5AKZA 1QFXA 2A7QA 3L6RA 4KN6A 1W4BA 2XB9A 1K6IA 2FPLA 2G7MC 1MJGA 2VXOA 3GLTA 4XOUA 5CLFA 1YDHA 2Y1WA 4U6SA 3SFTA 1ZRSA 3ENZA 4LXXA 3U49A 4FONA 4PLYA 2GBIA 4K1XA 3MRVA 4OQMA 2I03A 5F4BA 1PW5A 1GPKA 4G36A 4ZO4A 3VJLA 1JEYB 3R9XA 3CZCA 1Z6AA 2ZIFA 3P9CA 3DDCA 1KDZA 4UXIA 1CQJB 1EHCA 1MDFA 1NZDA 2P11A 1X8JA 2HO4A 3AESB 3F90A 3GT3A 2BTOA 4WY5A 1JL3A 5HW0A 2QT0A 4R41A 2V0GA 1MENA 4WW0A 3ETDA 4YPVA 1GY8A 4LYFA 5ENVA 1GJRA 3C3BA 3R24A 4GX0A 5M2QA 4LI0A 4KN8A 3WB0A 4MV7A 3AFIA 4B6EA 3WMXA 1KO5A 4TTQA 1FJXA 2LXNA 1JG3A 1GPNA 3F5DA 3ILVA 3IJEB 1N3YA 3BRWD 3K5IA 2AF4C 3KUKA 4TTJA 8GPBA 3WRYA 8MHTA 3FWZA 4Z0TA 3EPJA 2HD4A 1DADA 4R2KA 3CSDA 3I09A 6ADHA 1C7EA 2PUHA 4URFA 3ST7A 4AD8A 3JQAD 5EWMA 4N0PA 5TPZD 1PSDA 2ZRDA 5IDQA 5C8YB 3E7XA 3ANTA 4WECA 3KC2A 3X1JA 1T9CA 2VNAA 4F0JA 3RSHA 4ZOCA 1Z0DA 4FCTA 3SYTA 1P75A 1R8XA 1DV2A 1RYMA 1XE3A 3QWBA 3A05A 1USWA 3G0IA 5CDSA 1EVZA 5C1BA 1MKYA 3G1TA 4QRHA 5DMHA 4BVEA 5BW6B 2OZPA 1O9GA 4JMPA 5D2CA 4D6PA 1S2IA 4BE7B 5AJWA 2BFFB 4F3CA 2CXHA 3MMPA 4MPRA 1W1WA 1LTKA 1JT9A 2C2KA 2HFKA 3MGKA 2GAIA 1ZONA 1ECJA 4RFLA 2NO7A 3WOHA 1LDNA 4AWBA 4EW1A 1ZW1A 2NACA 4II2A 3V33A 4QVGA 4P0QB 4JDPA 4QOHA 1Q0UA 1SXJB 3IUMA 4P5DA 1EESA 1BOFA 5HP4A 1BDBA 4KYTA 5CTJA 3G6WA 1G5FA 1DUSA 2WRZA 5HPYB 1DJLA 4Z2YA 4RF2A 4W5OA 4Q9NA 2GCNA 1XRNA 2YHIA 3BQMB 1IBKB 2RC5A 3R6GA 2FEMA 3ZK7A 1EWRA 2OR3A 2A0XA 4PRYA 3KUXA 1AKEA 4P2GA 4FE3A 3H5WA 5KTSA 2VPPA 3MRSA 3PDUA 4IDHA 4MPTA 1F1BA 3JPWA 4WXYB 3VSAA 3QNWA 1SKYE 1XMPA 2ZTLA 2GXSA 3BIFA 5JARA 4D41A 3SEFA 1FUYB 1KI9A 1PFGA 4NYIQ 3T7IA 4K9QA 5LMCA 5KTOA 2LRHA 4PFJA 5DOZA 4MVJG 3UMJA 4ITUA 3SQXA 3C5VA 3Q0IA 2XRMA 4EUFA 1R0CA 4DLUA 4WLFA 1AGPA 3AKDA 5JPDA 2VHUA 4D9GA 2KPOA 4P3NA 4OIMA 1W0KD 4TXMA 4RLQA 1XNQB 2WKPA 5JRZA 1UPFA 1GUDA 4WJZA 5E9WA 3WWDA 3RS3A 3DEYX 2CEKA 3ZJUA 1KH3A 2V1UA 5I7VA 3DEZA 2Z30A 2JLYA 1M0SA 4HLCA 1FOEB 2QM8A 3O6VA 4D0GA 1L5VA 5DM1A 3WC4A 1PJRA 4O4JF 3V7NA 3K0CA 3LY9A 1XD2B 6GPBA 2IIVA 5KYGA 5KYNA 4WCFA 4NWIA 1TJPB 5GZ1A 4ZCLA 1EVLA 1NLYA 3ZGYA 2GBLA 5A5VA 2BE7A 4HX5A 4II3A 3RF7A 2X6RA 1WCWA 3LQQA 4YCLA 3SSNA 3T5TA 5LN1A 3GT7A 4CLOA 4MIYA 1VSVA 1YR8A 2XV1A 3C0KA 1YD7A 4YT5A 3B8HA 3GRPA 4K2AA 2IOHA 3O8OA 4LZNA 4B46A 4CF4A 1D09A 3D7KA 4KNYA 1USUA 3UC9A 3ADKA 5CHYA 1QIFA 1ONSA 2IPOA 4QVKA 2ZTUA 4RK0A 4XRRA 4EG5A 4TT3A 5JOQA 5H02A 1JZQA 2H4HA 2PUJA 2WSSA 3AUKA 3EDMA 3GA7A 3GVIA 1X9GA 3PNMA 4ZTBA 3ZDZB 2CK3A 1O9BA 3NALA 1Q1EA 3QIAA 4BNNA 4ZVMA 1KS9A 4BGDA 1ZD3A 1QDLB 1R8JA 4WZBE 1G9SA 1SA0B 1JVNA 2Y3IA 4RA6B 1EFDN 2P5TB 3ND8A 3NAQA 4KQWA 4RHEA 3UWOA 4RC9A 4KO2S 2WKQA 3DL2A 4LPSA 4NECA 4RK4A 1A9XB 1MJHA 1YTUA 4KQ9A 1PGOA 2ZPAA 4OGFA 3L7DA 5AD1A 1X0VA 4C20A 2YL2A 5DI3B 1HLGA 4O4IB 4DYVA 3WVNA 5BSKA 4JC4A 4YALA 1ISSA 3NG1A 2FDCA 1QF6A 2P9YA 1DIRA 4EHJA 1NNI1 2LZ0A 1OD6A 1JZTA 3U39A 5C32A 2WVHA 3ER9A 2O2YA 2CFTA 4MR7A 4MVWA 5G53C 3K70C 2Q5IA 3SKXA 2NADA 4LJ8A 3AERB 2W6ID 2CDCA 4DE5A 1B3RA 3VR4H 1DC4A 3IVGA 2GZ3A 2GO1A 1SXJC 3OZSA 1E18A 5I9TA 2AZMA 2QZPA 4P33A 5K3CA 4AZ0A 2NO9A 3ZUPA 1HFJA 2R5FA 4IGEA 3QEKA 4LXTA 1YBHA 2F64A 3C6BA 1KXZA 2MSNA 2FRVA 4XWKA 2JAQA 5JAZA 2OORC 4MUBA 4I1PA 3QEMB 1TCVA 1YCFA 1ZAYA 2O54A 3A4TA 4XFDA 3HJNA 4GVPA 2OWEA 2OFFA 2CYBA 2CKDA 4EY3A 1GSHA 4BB9A 3F3MA 5JS6A 3OOHA 3U7IA 4MUXA 4QA9A 2CJFA 3RVNA 3ZWXA 5JH7A 3LLMA 1FDTA 3OQ1A 1APBA 3BIJA 4HUQA 1ECPA 2PZAA 1R4NB 1RKQA 1ZM2A 2BUAA 2GILA 2I29A 2WUDA 3OSUA 4P53A 1SG0A 4K6HA 4DCVA 2EU8A 4AMUA 4D96A 1G8YA 3UOAB 4LF9B 1E92A 3MK31 3AHCA 3TG8A 2C7GA 3RK1A 5CBPB 3KT3A 5BW5A 4C7VA 1ZD1A 4K28A 2P4EA 1FBTA 3FTQA 1ZX1A 1ZK3A 3OMWA 4BIIA 1USIA 5K45A 2P8SA 5F23A 2L17A 5DNVA 3RIGA 3AR6A 1ULUA 1T26A 3KJIA 2DC1A 5JAOA 3UJ3X 1XLWA 3QEAZ 1UBSB 5FUBA 1OI2A 5MGNA 3F6EX 3L7NA 1B6SA 4ZOLF 1P3Y1 2DHRA 1UPTA 4RELA 5EMHA 2NQ8A 3EULA 4RS3A 3SBDA 3ZCSA 2QPOA 221PA 2VTEA 1T1GA 4OHZA 3AF0A 2QE6A 4XH9B 3E9DA 5ARDA 4QJIA 5SYAA 2O5RA 3W7AA 3ZE0B 4B09A 4Q0MA 1N1GA 4LQCA 1J7KA 1ABFA 2I4RA 2AG0A 3FCCA 2GYUA 3HU2A 1CUBA 2YZNA 3IE2A 1TA4A 3HE3A 3BFVA 3NUZA 1J0EA 1SBCA 3S2YA 1FVXA 5CLIA 1G8GA 1I3LA 5LB2A 1MDBA 3TJRA 1XFDA 3FYTA 1RZRD 1E4VA 2GZHA 2LWIA 3TAHA 1OXTA 3M1LA 3U37A 3ESAA 1AT1A 1A1SA 1ORVA 3ITDA 1XCLA 3P2OA 3U7QB 1ACMA 2Q2WA 5AM4A 2EEPA 1UAYA 1I5RA 3OD1A 3WTCA 3GQVA 5AK3A 5TDHA 3IKVA 1WIWA 1PTKA 1N32B 3GT0A 1ZM4A 4AJKA 3QQPA 2Y0CA 4HLUC 3UG6A 1EG2A 3DE7X 1J24A 4RV9A 4H3VA 3HRHA 4G85A 2CBZA 3MCTA 2AR0A 1BFUA 1ODKA 2HMUA 2ZRJA 5EEGA 2OBXA 4XASA 1B6RA 4MV8A 4XM1A 4B0OA 4CF6A 1TYAE 1ZH0A 2XMGA 2YFQA 4G3XA 2PRJA 1IQ0A 5GJBA 2HF2A 2IFTA 1SCJA 2A9KA 1VL6A 2EERA 1WABA 3OBBA 3PR3A 1L5FA 3A6JA 3HZRA 3BILA 3PI6A 3C6XA 5ES4B 3MQFA 2P9GA 2YYAA 3CPJB 4LW8A 4LE2A 1W36B 5CLHA 2NZUG 3J81k 2P65A 1LDEA 2RGUA 4JK3A 1SXJE 2C8VA 3DWEX 4OQ4A 2HWKA 3UCXA 3WQHA 5CG2A 2GTPA 2WZCA 3B12A 3PEVA 4X7PA 4YTEA 3U7FB 2X9QA 1XAGA 3JR3A 4ARZB 4RZXA 4G09A 2FMHA 1N3BA 4BUCA 4I6GA 4MCIA 4V0LA 2OUIA 3A36A 2QJRA 4G1VA 4YASA 3QEBZ 2V7WA 2WABA 1D6JA 2B3DA 4KAFA 1VHDA 4NBRA 4JZYA 3P0HA 5F5NA 4D3YA 3BWVA 5CFOA 3UB3A 5B12A 2XUOA 1QDUA 4DGQA 3K96A 2CNDA 3IEVA 4FOPA 1QH1B 2CDAA 4GZ6A 2NW6A 3EVGA 3H6HA 3K3PA 4GNRA 3RB8A 3DE0X 3WXBA 1SXPA 3N2YA 3IVCA 4BMCA 2TMYA 3DDUA 1QYRA 4MA0A 4RGQA 3DDSA 2JCSA 1C41A 1S2DA 1YIOA 1YR2A 2BGTA 1YFLA 1VYTA 2Q29A 3EF3A 2AKEA 2AQ8A 4KACA 1CUFA 3PRJA 3OFSA 4M9ZA 5AI4A 4TS3A 4BLUA 1I01A 1PKXA 1XPOA 2REBA 1NV8A 3HXMA 4EP1A 4ZRDA 4A0GA 4BGIA 5DM70 2OMKA 2WFZA 4NDZA 1XMIA 2ZUCA 3RNOA 1MVOA 2QUKA 1MPTA 1KI7A 5J40A 5K3SA 4CMCA 2FX3A 2QLMA 1WB5A 4DA4A 5HE8A 1Z5GA 2VDJA 5C8XA 2NP7A 2ZRMA 4QARA 5FBLB 2Q6TA 2F17A 5JMWA 4UJ5A 4TL7A 1K06A 4BNGA 1IHDA 1SBTA 3CEPB 5KYVA 4M88A 5FJJA 1XC7A 3DWGA 1VKZA 2XWPA 3W04A 2JGIA 1MHTA 1Z4IA 3ULKA 3RUCA 1FW6A 4J91A 3ILYA 1P19A 3H2IA 1LV8A 1Z37A 2AEJA 2TYSB 5CTAA 4E11A 1U8UA 3JQPA 3AF6A 5K51A 3DZBA 4O59O 1BHJA 5K03A 1I4LD 2XA2A 2RKOA 3FPKA 2A5YB 2WM9B 3F6YA 1UT5A 1R74A 4QBKA 4RQTA 3IHKA 4HYEA 4MGHA 1CCWA 4ND5A 3L8DA 2ID7A 4UC0A 4XAQA 2EJWA 3LWDA 3P9IA 2HU2A 3TNDA 4EBBA 1T5LA 2P67A 4B35A 4WWHA 3MJCA 4U39A 3FTDA 2R79A 4NZNA 4WXMA 4BNIA 1JFFB 1UEJA 1T4CA 5ALYA 2Q2QA 3JAWB 3WLLA 5KYWA 4YJFB 2YHBA 4MJ7A 4V0MA 4B7AA 3BORA 4KFUA 1QHFA 3ZU2A 5CDYA 4NKRA 3K0SA 1UBTS 4B17A 2FG7C 4B3RB 5CEJA 1WF6A 3L8GA 4H08A 4UEWA 1XR3A 1U7TA 1DSSG 1TZMA 1YRLA 3DJFA 4OYHA 4DGSA 1OB2A 4H7KA 5G3YA 4B3FX 3OWXA 4RQAA 4Z9FA 5DN6A 5H59A 1QU2A 2PX3A 3D8SA 3QY0A 3L7IA 4J0CA 1WXXA 4W82A 4OI1A 4YUAA 1PS8A 2XF2A 3GJ7A 3FNGA 2D2IA 1PUXA 4P81A 1RRCA 3GJ5A 4DFDA 3R3UA 1E0AA 5F98A 1U7XA 4AM8A 4OJKA 1MA0A 2I6TA 2J41A 2GN2A 3MGAA 2NOAA 1T29A 2P79A 4ALLA 3GLFA 1JH8A 1QRTA 3FHTA 1G21A 1WW3A 2FEAA 4MI6A 3NZEA 4Y0VA 1RPNA 1W36C 4MUEA 3UMRA 1KVQA 3FNRA 5HS6A 1XBTA 1YQTA 2J4DA 1M2WA 3AY7A 4OAPA 3PCXA 4DZTA 3ZVMA 3KD2A 1P74A 1SEVA 4JVOA 3C3JA 1G60A 1VJGA 1Z22A 2VQSA 1JI0A 1OR8A 1EB9A 4R3UC 4Y2QA 1ENZA 4ZU6X 1M5TA 2B82A 2G1PA 1UPAA 1Z25A 2Q2VA 2C31A 3N0RA 4FYIA 4KR7A 4TYQA 5CW1A 1HMPA 1MA3A 1PWEA 1WF3A 5D86A 4HNAB 1AN0A 3QM1A 3T5MA 4FGUA 3L02A 2I3ZA 3U3KA 1DUIA 3GBVA 1Y37A 4NYIR 1BE6A 4B33A 5IJ0B 5JFTA 4F38A 4R83A 3UPTA 1L5QA 2IYWA 2IH2A 4EYGA 1C50A 3BGVA 3FOBA 7MHTA 3BAFA 4HATA 5EP4A 3TQSA 1SM4A 2DBYA 2ZT7A 1I14A 2H3HA 1U98A 2ZBDA 3K1ZA 2ZWAA 2Y2VA 3E9MA 1IOVA 4F6RA 3UXMA 4PCLA 3SHOA 3AEYA 2I1QA 2I65A 3JALB 4XTRA 1T25A 3GRRA 2VPYA 3CNLA 3V8VA 4YQFA 1PEAA 2M9MA 1HE2A 4QZVA 5DZSA 2I2AA 3A31A 3IHTA 4I9GA 3PQCA 2CZCA 4R9RA 2FUKA 2GEBA 3D6FA 4BBAA 1RWPA 1IHXA 2CUTA 1P0QA 4JJZA 5TMBA 2C2YA 4NE2A 4PZDA 3H4VA 3DBVO 2AXEA 5DNCA 1CE8A 1OXUA 1TJ4A 4PM4A 3R7LA 4NX2A 2B5WA 2CL6X 4WKGA 4BQNA 4JITA 5E3IA 1C0EA 3K9CA 2OB1A 5H3LA 5B1IA 2FB9A 3CW2A 3BHJA 4ITRC 4X63A 5HE9A 3VU9B 3CUKA 3NEAA 4MWDA 3V32A 2BC9A 5KVAA 2A9JA 3TMYA 3WGNA 1YUMA 4O6VA 3K09A 4MAAA 5EHIA 1MGPA 3U81A 3T3OA 1NNEA 4MB0A 4DA9A 3ECSA 4WKNA 3IODA 1YR3A 4PO9A 4Y2JA 2P4UA 3PXEA 5HA5A 1EWTA 2WSSD 4W7HA 1N2IA 1OI4A 2HA4A 2CK3D 3BFPA 1F2VA 2YIDA 3CWZA 4IZHA 4B8YA 1KC1A 2P0EA 4OTZA 4B2PA 2EBFX 2VH1A 4UFPA 1RWBA 2RGWA 2BKEA 3FR7A 4GZ3A 2JASA 2P2NA 2HJHA 3X1XA 3I5MA 3HY4A 2QM7A 3R7BA 3L4SO 4PNHA 2DB3A 3WK6A 1VSQA 2PU7A 3AH8A 1RACA 1XB2A 5I9NA 1SHZA 1K7CA 3NIGB 4I3GA 2IPAB 5DULA 4OFBA 3B8EA 1XZNA 3F71A 1Z6ZA 2NSHA 4KSYA 4XUGB 3DVSX 3JSXA 2DPGA 3PNQA 2X0NA 1QIDA 5ESDA 3TTXA 4A0QA 2ZSDA 3DE2X 4LTMA 2DP4E 5EI5A 2B7CA 1JGTA 5BQFA 2HMAA 3CZ5A 2PO5A 3QLEA 4Q19A 4P5PA 5G4LA 1Y3IA 3DQPA 2ZJZA 4I55F 5CB6A 4NU8X 1RFGE 4M7PA 4PAGA 3EC2A 5LZ8A 2AA3A 3UOWA 2I6XA 1NXSA 2ZYSA 3HEBA 5FI1B 5DHFA 3ZHBA 1BE0A 1RWQA 3ELDA 1MQ8B 1HRKA 2Q7OE 3U4DA 3KJFA 2VNIA 4QXRA 4V1CI 3HC7A 4KB5A 3BZWA 4IX1A 3ZIUA 3IR6A 1GZDA 3QLUA 3QG5A 2FPKA 2OBMA 3VSCA 1AQLA 1M2NA 1T0HB 4TRNA 2RH5A 1L7AA 2UZ1A 4WN9B 1KSHA 5EPUA 1FFXB 1FYVA 1T9GR 2QUHA 2V98A 1B8NA 1R0KA 3IUBA 3L43A 3A04A 1NAHA 3C16C 3R44A 4W1SA 4WEOA 1ECFA 1GCGA 4QJBA 3RQIA 4DAEA 1IMJA 3EEBA 5B53A 5DHAA 1FTQA 2QD2A 3ITKA 5I9BA 3S7ZA 3J7TA 1RKVA 1GCIA 4Y2YA 5K8VA 3FTEA 2R44A 2IELA 4J90A 3DC7A 3A3PA 1EFUA 3AMVA 3FZNA 4YCMA 5LQDA 4HRAA 1U5BA 1OREA 5A0TA 5F2NA 4CDNA 3HZZA 4MVYA 4TLEA 5IZ4A 1PJAA 5AKIA 2Y05A 3DVRX 4B32A 4M86A 2GPNA 3I58A 3U80A 3ZYCA 4MGEA 1CK4A 1Z4QA 3OCCA 4D6XA 3PUWA 1Z68A 2G06A 2JJ2A 2XUGA 2Q07A 2C9CA 4WBNA 4KH1A 4KHPB 2G07A 4DA0A 1Q57A 2MR5A 1GPLA 2ZE7A 4JJFA 5CVVA 4AIIA 2PSFA 4MS1A 2V5VA 3FDJA 4QXQA 4DCTA 4F4FA 2ZM5A 2BFCA 4ER0A 3RFFA 3IAEA 1VLHA 2YMQA 4LNHA 3OJ0A 4RVDA 5EIBC 2IS4A 1YB5A 4RPCA 1I94B 3QMPA 1L1EA 3NX4A 1L8OA 4B9EA 4LF5B 1DEAA 5F3WB 4IGIA 3UKJA 1WMSA 4JI2B 4NOLA 3EPHA 3KTFA 2QGZA 3DTVD 5JXJA 3KCQA 3WX0A 2HT6A 3AL0C 4G1CA 4U7HA 1IC6A 1X70A 2AUTA 2H48A 3BH7A 4X1IA 3RRBA 4QC2A 4OQQA 4PTYA 2O52A 1QHYA 5DGDA 2I34A 3DZFA 3KL4A 3G2OA 1MV5A 1P2VA 4MDEA 2JB9A 2R9VA 4RTSA 2ZK7A 1HLPA 2BGRA 3AHHA 3IPLA 3TF5A 3OLCX 1S0UA 4R2IA 4DNQA 4KQKA 4HSEA 2OCGA 3TW0A 4F56A 1RIFA 2GEFA 5L3VA 3UJBA 3NI2A 3QWAA 3DUFA 1HEIA 1IZ7A 2QV7A 5IARA 5BWMA 5B37A 2ZT6A 2H54A 3SHQA 4Y0AA 4E1VA 5FV4A 3ZTWA 4EJ0A 4JCCA 1U8TA 3MTIA 3UMCA 4CL0A 1T9ZA 4U8GA 2O7QA 1GCOA 3U44A 1J25A 1T9HA 2JLQA 1A8PA 1QQAA 3ROEA 1L5ZA 4Q4LA 1P9NA 1JEQB 1MZVA 3ABZA 5DWQA 1G2QA 1N0WA 2F8LA 1RABA 4QG7A 4MB6A 1ODLA 3O3MB 3EEOA 2CV2A 4WK0B 1DCFA 4G5GA 1CY7A 5BXQC 3RIHA 5JXIA 1RM4A 1L1FA 1T9GS 2WYVA 3R6TA 1AURA 1B0AA 3GR6A 4PWYA 4I3FA 1RTKA 4HUJA 3GEEA 4RIIA 2IKSA 4RCYA 1IEQA 2BSXA 4PLTA 1H0RA 2CNOA 4CKBB 2Y9MB 4E94A 4XJVA 3N6RA 4UM5A 1ESMA 4BO6A 4ETIA 3RK0A 2V58A 5K6RA 3PYXA 2X0RA 3PUHA 1OAOC 2WYUA 4S35A 3UEOA 3ZE7A 5KC8A 3QFTA 1LW6E 1RPJA 3F6SA 2UUBB 4MRMB 1EUZA 1QCDA 2QVCA 2QTAA 3D3WB 1C30B 3IV6A 4DBLC 4C5BA 4G0ZA 1UMKA 3NDRA 4U2BA 3KCNA 5LQCA 4DIDA 2FZ4A 2ADOA 1YRAA 2W0MA 3NR2A 2V7VA 4UAJA 5ALZA 4Z3OA 2Z8YM 1FZTA 4UZFA 1XLTC 4YREA 3W6UA 2M6KA 3ZZNA 2R4QA 1J99A 3HYLA 2QRHA 4W1PA 4EYSA 2QVGA 1DBIA 1GKLA 3L6BA 3EGEA 4EUSA 4GE3A 5EJEA 3AEXA 5K5EA 1NBOA 5EE1A 3V4VB 2IXBA 4Q7MB 4DR5B 4DVJA 4F9EA 2Q9BA 3D6JA 2O7RA 4NBVA 1IWOA 1REQA 1KK2A 1TLFA 3A2NA 4XIGS 4FR2A 3ROTA 3FWYA 4ALJA 4A9AA 1XYVA 4ZZ1A 1B1CA 1JHPA 1F0KA 4KFCA 3BSFA 1RS0A 1XQWA 3E1KA 5FQOA 1JI3A 1AOXA 1CF9A 2CNNA 2HDNB 2PKYX 5BSHA 4J29A 1C9DB 4CDGA 4IEIA 1FUUA 4BLSA 1MW9X 1RLIA 4TS9A 5M7EA 2K2QB 1Q95A 4AUEA 2X86A 2ZTVA 2ZSFA 3PFNA 4RDCA 1LW7A 4TTTS 3UUGA 1PTJA 1R7RA 1XTUA 2FOXA 1DFGA 3R3XA 4IGFA 3TOCA 2VR1A 6YASA 4UE2A 4HT3B 3U5TA 1GYQA 2AOUB 3PFWO 1PWHA 4WCDA 4MWZA 5AM5A 2PV7A 5IBCA 5JJBA 3FF1A 4X66B 3WYEA 1JDNA 2HK6A 2O7SA 2XYQA 3HJGA 2QG9A 1LPAB 2P6UA 2D5BA 3SF8A 4JQZA 4S24A 4QBTA 4P5EA 2VDQB 5C34B 5FIUA 1T8YA 5TS2A 4XKJA 4INJA 1N0IA 3RYFA 4C07A 9LDTA 5ADHA 2JZCA 4CQLB 3RYIA 1EVEA 2QRZA 5FPSA 1H0HA 3INRA 3VOSA 4EHFA 1F1JA 1F9EA 1OXXK 2OG2A 2QSUA 4RJTA 1NFFA 3SJZA 3I2FA 3BSYA 3DZJA 4ACAA 3TFOA 5BSWA 3NRBA 1ZM9A 3LPMA 3ZE2B 2IDZA 3P32A 3AEQA 2PH1A 3RFXA 2RK4A 1EVJA 1Z06A 2WJVA 2ZULA 1XLVA 5KINB 2XCRB 3AEZA 2FKNA 1OA0A 1IG0A 4E3WA 1N77A 2O05A 3E2MA 3TG2A 1V5IA 2V7PA 3LOQA 1J49A 1EFRA 1DIOB 1MX3A 3BRCA 3OQHA 4RW0A 5ANRB 3R7WA 3UXHA 4AO7A 4G0UA 4O8CA 1KKLA 2H2IA 3HI6A 3SFZA 4R5HA 4UUOA 3ICWA 4N3AA 1E5TA 1RLTA 1TCAA 1W93A 4F3YA 3WMGA 4NESA 3NTOA 4EY6A 2PUGA 1EE2A 1JR3E 5LWHA 3GA0A 3KQNA 1QRRA 3INNA 3QPDA 3ZQUA 1QQ6A 2GKOA 1VJTA 1C7QA 3Q7RA 4O2AF 4QFBA 5AVZA 2JFQA 4NBUA 1N75A 5EKDA 2OFPA 3OAAA 1RFLA 2ENWA 2XVYA 3HB1A 4GMFA 3GFRA 1T36A 1VZ2A 3HMKA 4HRYA 5FFNA 2XTMA 1N9GA 4JLJA 2P4QA 3F96A 4RZQA 4DMHA 4ZKEA 4ZJPA 1G8FA 1E8MA 3FAKA 5FORA 5CVTA 1NRXA 2HREA 3JQ9A 3OQIA 5HXAA 2WG1A 4OQZA 1KEPA 1HC7A 2H63A 1CS0B 2BFNA 1KJJA 1WHTA 2G72A 1FJ2A 1OKKA 3IR7A 3ZH9B 3HFRA 3QVLA 1A5AB 3AK4A 4C06A 2IYLD 3PPXA 1VM6A 4J03A 1WUJS 3RT9A 1XXHA 2PQ2A 2WR8A 3QLVC 4NK5A 4XQGA 1HO3A 2G25A 1OZHA 1Q7GA 4BVBA 3PD0A 1XEWY 2BKUA 4EMTA 1E9CA 1R0RE 3KQKA 1OT5A 2OOSA 1FRFS 2MYUA 2ZJ8A 1U2PA 4YRNA 1MAVA 1DWPA 3RFVA 1KP9A 1P0CA 2OQIA 3NTQA 4YUWA 2NMVA 1XK7A 1YC2A 3R7AA 3EFOA 4J0DA 3E8XA 5ALRA 3IEIA 1TVMA 2ZJ7A 2G70A 1QE0A 2A5FA 4N5HX 4UTZA 1G98A 3WQBA 5SICE 1COWA 1NW9B 5MFPA 3K5HA 1HYQA 5REQB 2VWPA 3IMFA 2QN7A 5DHSA 1U1DA 4BNVA 5JLAA 3VU3A 2QTZA 2GFIA 5GMOA 4W8OA 2YQ5A 8ABPA 4JLDA 2Y1FA 4RTNA 1ZVVA 1DKNA 3LT1A 1OZ0A 4HDAA 2C2MA 3WP0A 3UFBA 2GTHA 4FMDB 4CTJA 4JAVC 4IQ4A 5DO9A 5ITZA 3T5AA 2PGOA 4EA8A 5LZ9A 2QTWB 2J6BA 4WJKB 1SRRA 3DONA 4GGMX 4DCGA 3WDMA 4YXWA 2RHGB 2W48A 5KTRA 2C59A 1KY2A 4PRKA 2X14A 3MWEB 3HUFA 4TQGA 2JFHA 4YRSA 2YIMA 4BFCA 3O0TA 3BXZA 4REQA 4ZC1A 1NU8A 4C22A 2IYOA 3MC1A 4LK3A 2X2FA 2DVMA 3OJXA 1MB0A 3IALA 5G1OA 1BRTA 1WB9A 1TKCA 2LKDA 1QANA 3LU1A 3O75A 4C0SA 1C8VB 3LUAA 3A9UA 4IVPA 4ML3A 2VYND 1T4MA 2FJUA 2Y8EA 3AHDA 3GBSA 3GFFA 3I2GA 5A4IS 2DQSA 1AY0A 3LPDA 3TD2A 3TZ6A 4J6FA 1NNSA 3DAHA 2CHVA 3FAZA 4GBED 2GS9A 3GUCA 4A1OA 1PWZA 3A4NA 1C7FA 1POWA 3RBVA 5G2OA 4EPYA 1UFRA 5AQEA 4RFSB 1M67A 1N8SA 2G9QA 4JELA 4M0PA 1XI2A 1Y8QA 2FSGA 1CYEA 3KSRA 2WYWA 3AHIA 4CM7A 2BBWA 2VCYA 3ML1A 4FZVA 1L7EA 3VO2A 3SK0A 1RVDA 3Q6NA 5DBHX 5J63A 3KT0A 5E4FA 4B1FA 4HQLA 1GGFA 2DBZA 2O2EA 3FHCB 5JQWA 1NBIA 3DE5X 2D3WA 5DBIA 3RASA 4C78A 3GLGA 2Y93A 1U2GA 4MINA 1HBJA 1G5IA 2PTGA 4P7KA 4ZEXA 1SBHA 2PPLA 2X3YA 3CNOA 2WU3A 4S1OA 4EW3A 5AKJA 3VU1A 3CRQA 3EXEB 3BKWA 3LT4A 4GKJB 3ANYB 4OJNA 1C2YA 3GPDG 5AK6A 4ZI7F 3QFHA 4TV8A 1PV4A 4WZBA 1E3WA 2IZ1A 3FGZA 4JUFA 1E20A 4F3TA 3O21A 3HVRA 5CM9C 4OGWA 1M2OB 2A9PA 2QLTA 1T6BY 5AUNB 2BUCA 4RO0A 5EIOA 5LOVF 3LTEA 3MOGA 4OAOA 4NE7A 5AOVA 3TW6A 2HSZA 1C7RA 3WNCA 3IAAA 3WLAA 3E03A 3MOSA 4GBGA 2JI4A 5A6VA 4HWSA 1LBEA 2PUVA 4PLPA 3ETCA 1B76A 1K7EB 1GUZA 3EXFB 3H3JA 3H5LA 1GAWA 1PUJA 3QVMA 4GM4A 3PE6A 3DOCA 3EZ7A 4P54A 5AVKA 5BV7A 2QPLA 1N5OX 2F3SA 1ZNZA 3KOYA 1FXWA 4EPVA 1QVZA 4CIVA 3U4QB 1PK9A 2AK2A 3EVFA 3WL6A 5KOIA 2C0QA 1ESZA 2JJ2D 3QF7A 2WJ6A 2PKQO 3HJAA 3ZEAA 2BYTA 5HUQA 2X0EA 1U7DA 5EKUA 3HJBA 3OO0A 5ER6A 4LTNA 4YJ2A 5EVCA 4N9QA 4UM8B 4UBMA 1U7UA 4UEJA 2JCVA 2FPMA 2ZYRA 3IHLA 4DRXB 4MUHA 3R23A 4D42A 2WTMA 3LPLA 3PFCA 1KOLA 1ZH6A 5C7YA 4JI8B 5FXMA 2HJVA 1U5CA 3OQVA 5MN5A 1B14A 1SIBE 1A71A 1QMPA 3COVA 2JJQA 4R05A 5FL3A 4ARSA 3T5GA 2HPAA 5ER9A 4EKDA 4YJGB 1E6EA 3GL9A 4J7UA 4LDJA 5HUHA 4ERNA 1RU3A 2FPGB 3THWA 5C3UA 1U3VA 2AE1A 2MMCA 3FDXA 3MT9A 3TLBA 1ABBA 3DLTA 1TVKA 2XITA 2ACVA 3OPNA 4ARVA 4CU5A 2XODA 4L8GA 3OEEA 2PGNA 1JIIA 2P1ZA 3ZHVA 4I4TB 5AHWA 2NXEA 4KQ6A 5G0UA 3W9UA 5EWJA 4MS4A 2LCIA 2HOQA 4HPJB 1O6ZA 1XP8A 4UNSA 3VHQA 2GK7A 4RZHA 1SN7A 1X0XA 2B21A 4IHJF 3OLWA 1JJIA 1OILA 2X77A 1IJEA 3IDFA 2OCYC 3H13A 1HL7A 5JCXA 5U9CA 1H4SA 1CC1S 1ZEJA 3NVKI 4RIHA 2PDAA 4B7XA 4CMIA 1JEYA 5L3SB 1J8DA 1U2DC 2V59A 1LC0A 1UIRA 1CQJA 2YYYA 1Z5PA 3BH6A 2CXOA 2VHTA 3G2JA 4WRRA 5THQA 4IILA 5TS3A 4B9AA 4G2TA 4NG5A 4UAUA 3THSA 3FG9A 3UC5A 2JVIA 4MP6A 4EG3A 3KXIA 1T8PA 1UXKA 3L6UA 3RI3A 2P1RA 2ZSIA 3N7AA 4QVIA 4G5FA 4CT4B 1M8GA 3RRNA 3E9ZA 1KRWA 4BO3A 1V6SA 4EI7A 3TZQA 4ILEA 3T3NA 5HOEA 3DMNA 4QE3A 4MO9A 1E61A 3MTEA 4ZAZA 3LUCA 4TXNA 3TLGB 4IS3A 2QV0A 2WE8A 1P0IA 4MLPA 4YAWA 1JS1X 1F17A 1KGDA 1LFAA 1ZDMA 2Y4OA 3B60A 3QA3E 5TJHA 4Z9AA 3VYVA 2GVNA 3CLVA 3ZV3A 1PQ4A 2AG1A 5E7JA 5JCOC 4D3SA 1FFHA 1CUAA 4NH0A 5J4VA 1G16A 4CGYA 1B1AA 3SR0A 1AS2A 4BNDA 1T5TA 4U7JA 4LXQA 3K20A 4RMNA 1A8SA 3OT4A 2IW3A 1N2OA 1PV2A 3CF6R 1J90A 2Q4BA 5FPQA 1W52X 2PZGA 4KXQA 2VP2A 1AZWA 4KIGA 5LA6F 1CJBA 2BFFA 3FUCA 3LHSA 4HNGA 4MB2A 5J4KA 1W7AA 4YAFA 2H2DA 1FXUA 4Z3DA 1K5PA 5LQNA 3EK2A 3Q6MA 2HA2A 3CR7A 4YCJA 4JLAA 1Z0IA 5JVDA 4MDYA 5KQLA 5IMBA 1SXJA 1E2GA 2RH4A 1CR6A 4RKFA 5ED0A 1SXHA 2DTDA 1P7CA 3Q7TA 4FJ1A 3WA6A 5DGXA 4AJEA 2CBXA 2NZVG 3DBLB 5LDGA 2W90A 3RSSA 3RGWS 4P31A 2A84A 2RGRA 1RC1A 2XJ4A 5AJVB 4TKZA 5D5PA 4BO5A 2O3UA 1RJWA 1M6WA 4LJ9A 1LZLA 2JAWA 2R47A 3KQYA 3ZXXA 4XIJA 5KNCA 4C4RA 2IRWA 1H2XA 1LVHA 2BFBB 2RD2A 3LBHA 2ZJ3A 2YS6A 1KZ6A 3JQCA 4FNAA 3GD7A 3L40A 4PS1A 2I66A 1WUKS 1E3QA 1TI7A 4BZWA 2IHUA 1NQTA 1U8CB 5CCDA 4AS1A 3WXMA 3H65A 1CXZA 2QP4A 4MWOA 3JCZA 2XHZA 2WFLB 4BS9A 1WY7A 2ZB8A 3ACBA 4XTCS 3NC4A 3D6TB 3T3EA 4C3UA 5JHHB 1KOJA 3L41A 2CLCX 1XVAA 1U7WA 4UQOA 4Y6PA 4O02B 2IYRA 3W34A 3UV6A 1X2EA 2YW9A 4ITVA 3HBNA 5HKKD 2QEQA 3LQ1A 4CT5A 2FFHA 3T5PA 1E77A 4BFTA 5GOTA 4EJMA 3L77A 4QPPA 4WX2B 2FVYA 2XADA 4R7ZA 5JNRA 1WQ3A 1V43A 1EFRD 1JHRA 3SNKA 5CXQA 2ZJAA 4RH0A 2JI6A 3WBJA 5C5DA 2JBWA 3HKDB 2XKKA 3BQNB 4J0FA 1IOZA 1GQQA 3GAMA 4GZLA 1XD2A 1QBKC 4TMXA 4YHBA 1QLWA 4MCAA 2OCPA 3B2EA 3OOJA 1HYHA 1TK2A 2FFQA 2OEPA 4B8WA 4I4TF 4TMVA 4AY5A 1XP5A 4EKNB 2W6NA 4PSKA 4F2GA 3BULA 1P5JA 3MWDB 4YMUA 5B57C 3IURA 1KJ8A 1RWMA 2B1GA 1BOOA 2A14A 4CFZA 3OAAD 4UOZA 5BWBA 1O5OA 1WB4A 3NWEA 2HTEA 3CPSA 3G3EA 5AKLA 5BRAA 2HADA 2CB9A 4NONA 1RI4A 3PFHA 1AUXA 2D2XA 1Y98A 1A8QA 2B78A 3DZCA 3EZNA 2CZQA 3H0CA 3WOVA 3ASZA 1A4RA 1KAOA 1X1SA 2CMKA 4OQYA 4ZHQB 4JP8A 3KT6A 4Y6LA 5CAEB 3VR6D 1V5FA 3GMIA 3JR7A 5FWNA 1U1CA 1TAUA 2EW2A 1JN0A 1J9GA 4KAAA 4BEVA 2QI9C 2WIJA 2ZRCA 2AOWA 5DHUA 4GAEA 4KKVA 3DTTA 4DL9A 1H4QA 1SA0A 4RA6A 1YL6A 1D6NA 2F3TA 2WVAA 3IMEA 2I4TA 2JGMA 2Z9DA 5CDGA 5FWYB 3U48A 4OI4A 4P4LA 4GRDA 1A9XA 3PICA 1DCMA 2XBLA 2F1HA 3I6IA 1QVWA 3E7PA 3VAAA 3O1HB 1U80A 3TSZA 2B35A 1EVYA 2NVOA 4O4IA 3O5AA 5DI3A 4UVEA 4UHJA 3V8PA 1EK0A 1L4UA 1NSTA 3W8DA 2QI9F 2WWTA 3M4YA 3DXFA 4F4HA 3T38A 5HX7A 3GOQA 3LL7A 1GV1A 3UJ9A 1TT7A 1ZIOA 2JW5A 3SDBA 3CWCA 2HIHA 1SUAA 3AERA 2PD3A 2WM8A 3T9CA 3Q3JB 3NU1A 5I7SA 2KWIA 3KPJA 4UNNA 3D8TA 4RMGA 1JNYA 4TOIA 4DTIA 1G2PA 2PS0A 4RFVA 5KHLB 2FEWB 3BCSA 3C41J 3MJDA 4YT4A 2E7ZA 2WJWA 3KEGA 3BKXA 4YHHB 1K97A 5F5LA 5K3BA 4M38A 2ID4A 4LTDA 4UBNA 2W83A 1I7NA 1E94E 3I8OA 3QBEA 4YXWD 1DZ3A 3Q40A 1GDDA 3HEMA 3P97A 2KBEA 4QG3A 4DJDC 3A6ZA 3U3XA 2PJUA 3VZPA 2Q3LA 2D4HA 3ZD7A 1F06A 3X1WA 2BGNA 1GAJA 3PGXA 3H2BA 2OB2A 1U0TA 1TXGA 3P2JA 3H1AA 3KWMA 4YRLA 4E4YA 5IJZA 5FLXA 2WSYB 1V2HE 1DKMA 1R4NA 2P4SA 1YVRA 4QWMA 3L0DA 2H1OA 4MRNA 5EJ2A 1FX0B 1H65A 1Q2XA 1U81A 2VK1A 3HMQA 1XMQB 1HDIA 3KYCB 2WA2A 4GLOA 3KELA 4AJIA 1XNHA 2RE8A 4EJSA 3T0GA 4ZO7A 1YR9A 5D3ZA 3D2AA 4IXMA 4ECAA 2PXAA 1OLSB 1N1DA 3E9CA 3WIBA 3AZQA 3C8UA 3HM2A 3AWDA 4QPJC 1GRNA 2PRYA 3I4FA 2JI9A 3SIWA 2B30A 5A3QA 3GMDA 3ROMA 3N0VA 4QHYA 2FW1A 2JGLA 2PBRA 1AV7A 3M7IA 4Q02A 5JI2E 4E0BA 4L5AA 4TXJA 5FH9A 1V8BA 1CYDA 1Q0SA 3U7HB 5FLKA 3ESZA 3FYHA 1QRSA 3BD7A 1KBZA 3N8IA 5KDLA 4BO0A 4DMLA 4E5NA 2EG5A 2F1KA 3FYCA 2ESRA 5HYVA 1DI0A 4BMXA 3OQOA 4LI3X 4V3BA 2X0FA 1NVAA 3OJOA 4JQSA 4DJEC 5EMNA 1GUBA 4G1EB 3Q0EA 5G1PA 4KI0A 4DNOA 2R751 3NOOA 1CRZA 2Q5EA 5BN5B 3STHA 4H3SA 3VU9A 1SUIA 2RGNC 1KDVA 3R09A 1Z5NA 4FGSA 2Q1SA 1BFKA 4B3SB 1QUEA 4IDDA 5AHRA 3IBTA 4EJ2A 1F6WA 4WPGA 3DMPA 1T2EA 2PMFA 1ETHA 3BPSA 1NY5A 4P3XA 5TC4A 1T13A 5EP3A 5I7OA 2TECE 2IBMA 3RVRA 2F3RA 3DLBA 3HJHA 1EP9A 1KI2A 1ULSA 2Q1WA 3F67A 3PP8A 3C87A 1CB7A 1OSNA 3MT0A 3SCZA 4EDFA 5LKRA 3M6VA 2J3KA 1EFVB 3MWYW 4ZQBA 2QAJA 3G85A 4KXFB 5LMUB 1WP4A 2PX5A 2VJMB 4GMKA 4JUCA 5KJEA 4GPEA 5KPDA 1Z6YA 5EXXA 4D3XA 5CIYA 5ALLA 1KVSA 4ZJUA 7GPBA 3L6DA 4LHYA 2HC9A 3G9ZA 1SCIA 2Z04A 4UNIA 3PD1A 1C2TA 1NAIA 3C7TA 4JY7A 5AHKA 2ST1A 3M6FA 5GY7A 4ZCIA 1P60A 4IYJA 1L4KA 2PRKA 4ARZA 2ZIEA 1Y6FA 5GV8A 3NQ41 5EHQA 3TOZA 4L7VA 3CRW1 1JQAA 3QH4A 3S68A 5IU6A 4IKPA 4LOLA 7ADHA 3TECE 4FEYA 1J1ZA 3WO1A 2AIRA 3FJOA 1SXGA 5ELXA 4EFMA 4URHA 2NT3A 4ZA2A 1QH1A 2O7VA 4U2DA 1E5XA 3C97A 3GJSA 1TZBA 3I6BA 5IAOA 4YK7A 1PK8A 4AG5A 1KI4A 3MVEA 3PYLA 1NXVA 1MFZA 2FAXA 1YNOA 2P7HA 4BIMA 4ZYZA 2P35A 5HJ5A 1SVNA 3JZAA 1MABB 2ZRKA 5HRCA 2RHTA 3TSAA 1MC1A 3AVUA 3T9DA 1B00A 2BI7A 2CMFA 3I6MA 1GRCA 3P19A 2J9GA 3Q5DA 3PGA1 1F7UA 4HYYA 1TYZA 4P38A 1YAJA 2BMEA 4JI3B 1K2VN 4DM7A 3D0KA 1K4KA 1XZGA 3O8BA 4OXIA 1I51A 4D44A 4D43A 1QTNA 1D7AA 3BFXA 4URZR 1H2WA 1OFTA 5GPBA 2EFHB 5I5EA 4MQ5A 3GP3A 4B4KA 3OETA 3P0JA 1MUUA 3ID6C 2CDRA 3UHAA 4N0QA 2PAFA 3MPUA 3Q3CA 4YJ3F 1E1RA 1SNYA 1W0JA 1CJCA 5JZOA 2GEVA 3EZ9A 2HFJA 1V7ZA 4O5AA 3IJ5A 4HNTA 2ZJYA 3KQSA 2Q99A 1O0CA 1NN1A 2PUCA 1A2KC 2DSNA 4TKVB 3PC8C 3DW3X 3G79A 1RKUA 3Q7QA 3KX2A 3U0VA 2ZTMA 3D6HA 1CWUA 2CL0X 3K35A 3MELA 3P9XA 1K1EA 3AIKA 4G5QA 4D4MA 5FFMA 4WLEA 5FTKA 4JLSA 5C46F 4ES6A 5TB5A 1FYFA 2JH8A 1EWYA 2N0SA 1RJDA 2D0IA 5ALNA 2VP0A 1OVMA 3LA6A 2JLZA 4BX8A 3W77A 4E09A 1WV0A 2YYSA 4X90A 2A3RA 1FW8A 5B1YA 3SKYA 3LRXA 3REOA 4KMSA 1RDFA 4FK8A 3GFGA 5D7NA 1JFFA 2ZSBA 3NTXA 3HBFA 4Y3UA 7YASA 4AKGA 1QXSA 2WTAA 2XA1A 2CMHA 4RD2A 3IS3A 4YJFA 3DZIA 5L7WA 2I1WA 2YBEA 4R8LA 4H7JA 4RESA 5D1NA 3H5VA 4CLDA 3KZOA 4ZYLA 3NO4A 3LZ6A 3ZHCA 4FHFA 1RHMA 3HNOA 1AKYA 4TLCA 4V38A 1LH0A 1RXUA 1NL3A 4MJXA 4MVJE 3I4CA 5JISA 5BOVA 2WA1A 2QM3A 4PZUA 5GJVC 1MD9A 1VL5A 3JQBC 1A8HA 4LVNA 5DHRA 5KBYA 1KYZA 4BZXA 2B9VA 2DFTA 1K0FA 3P94A 2X8WA 1TZJA 3LJKA 1H2HA 1OFHA 2AN1A 1MRSA 2IOYA 1Z45A 3LDAA 2ZTSA 4A0SA 4NXMB 3K8YA 4MQ6A 3U7GA 2BKAA 4TYMA 5H7XA 3B13B 2V3WA 1FUKA 1NATA 2WNSA 1XVIA 3KQTA 4AZWA 1IG3A 2CWWA 3CNEA 1J9EA 1TA0A 3U4MA 1FQWA 1W19A 2YDYA 4JHXA 4KWIA 5M29A 5CCEA 5KNCD 5LNK1 2D62A 3OOSA 3IBCA 1XTZA 2VN8A 3M6AA 3JZIA 1JSLA 3OFNA 4Y2PA 4KXMA 3KQOA 5IWCA 3K71B 1EU1A 5CR9A 1MIOB 3U1VA 1XZHA 2J0VA 2XVXA 2ICAA 2P6OA 4HNAA 1GU7A 1VE6A 4K9LA 5TEWA 3RVJA 2CJYA 4KQJA 2D8AA 5IJ0A 1GPJA 1GQOA 4CE6A 4IXNA 2QNIA 1DKQA 3D81A 2BGIA 1PL7A 1YH3A 2UUOA 3O1JC 1I1QB 4KJZA 4Y6SA 3OQBA 4UCWA 1QHHB 3BK2A 1R3DA 2ZRLA 3T3PB 1V9CA 2VPWA 3B70A 1K9VF 4BRWA 1W4CA 1DP4A 1YB4A 1Z36A 1B0UA 1XJ0A 2BM0A 2CVZA 2OD9A 2WKSA 4RDIA 5EHGA 5HF8A 2MCFA 1CZKA 1U31A 1DWOA 4IUDS 3IX7A 3JALA 5CRIA 4UMEA 1UM9B 5B1HA 4D0NA 3PJFA 1UKBA 5CFQA 4RK5A 2NIPA 3OE7D 4JBLA 4PHCA 3DHWC 4ARBA 2AX4A 5LLTA 1DRKA 3GGGA 4ACBA 4OB7A 2CL5A 4R1SA 1NJFA 2AMYA 1KYIA 1VLMA 4FEEA 4Q9HA 1M54A 4UHFA 4YIHA 1ZJWA 3AP3A 3A6PC 2ZSUA 3P9YA 1H5UA 1KZYC 1M5UA 3AC0A 3M6XA 1DT5A 1RJEA 2HHCA 4OH7A 4C3OB 1FRZA 4TLBA 3NKLA 5LP6B 1BYIA 1BGXT 1XZBA 2ZSAA 4DT1A 5DGTA 1M8JA 4YDRA 2VCHA 3UGJA 1L7DA 2XB8A 1XYYA 3KJNA 1GTL1 5EIWA 5K05A 2JKYA 4EUHA 1FDIA 1WTCA 5BSUA 3VBCA 1RJGA 4QEKA 1T91A 2V4MA 1YXMA 3FFAA 1L9KA 1FJGB 4AF7A 3DZGA 4YCNA 2G4VA 3AB7A 1CZUA 4IJ6A 1QJCA 5JEEA 1GA6A 1X8LA 4RZIA 1S89A 1KK1A 1K75A 1XQ1A 3AI7A 4FKMA 4FQ8A 4L5YA 3RV4A 1AHPA 2QN6A 5CB0A 5K4HA 4UXJA 3ONNA 4WBXC 3R75A 1JZSA 3E7FA 1M2HA 1U28A 1TT5B 3HXOA 2JDIA 1U9CA 1A9YA 1NQ5A 2AOTA 1Y1PA 4HH4A 1XQ6A 4QGHA 3S7TA 3STVA 4F8EA 4YT2A 1L8XA 1SCAA 2LPMA 4JC0A 4J0GA 2DZDA 3UT5B 1RHUA 5DTMA 2N1MA 3RC9A 1HH4A 1JEEA 1TCCA 3FFWA 5LZ5A 1ODCA 2I6QA 1JR3A 4MW7A 5KSPA 3PUVA 5ERXA 4YMSA 2CNLA 4L95C 4O3MA 3TQTA 2WHPA 4D9BA 3PR1A 5IT4A 1WSAA 5DIFA 3HKEB 1WNFA 1MH1A 4U9UA 2XYVA 3TZEA 4MV6A 3V80A 5ILOA 4E2WA 2VSXA 1YS9A 4L0DA 3E4DA 4EPTA 4FOOA 2CWDA 3D4PA 1NW6A 4I8XA 4TX1A 3UKOA 2ZRPA 2HJGA 2LUOA 4JYPA 4Q37A 4WN3A 3ZZ1A 2K7ZA 4CNBA 2Y0EA 2JGKA 5JFOA 3TL3A 3WE7A 1ZN7A 4PLWA 4MS3B 3CXUA 4DLNA 4DLAA 1Z6GA 1GCUA 1RXEA 1KE1A 2B4RO 1Z5ZA 2TMGA 2Q6VA 3N76A 5HILA 5AVWA 1EUQA 2XNHA 3RHSA 1H8HA 2Q2NA 2FZCA 1ODJA 2WK1A 3CLTC 3OCVA 5ALGA 1FFXA 1QHSA 2FY8A 2OC4A 5CH3A 4OJTA 2RIPA 4H7FA 2XQVA 2DXIA 1VRWA 4ZANA 5BWCA 1H2EA 1OX6A 5EMLA 2PL3A 4KFRA 1ZXLA 2V8BA 4CG0A 1TCBA 1RBZA 3H16A 1C1XA 3PC4A 3T9AA 3WHKA 3TJMA 5FHRA 4JBIA 4KXWA 3V34A 2DUUA 4O2BF 5DXAA 1BWQA 1JSRA 2IXFA 2I6FA 4YP0A 3RFUA 1AGNA 3DAYA 1U0GA 1FYEA 4M1QA 4P4UA 5DT2A 2QMOA 4RHTA 4F2WA 3C4VA 3RHTA 3B51X 4H17A 3UMFA 1LK0A 4J0IA 1DGQA 3UA4A 1KJIA 3ESXA 1BRMA 1PDWA 2IYFA 4QPZA 5HM6A 2OGWA 2IDKA 1LPPA 2G08A 2IGTA 4GPIB 1JKXA 2PEZA 1GAQA 3HDGA 4LIPD 1S4MA 2ZUVA 4G67A 3CYFA 1QRUA 2I8CA 2N75A 3GJYA 3LX5A 4Y7CA 1JYFA 1H2YA 5IXSA 3LQFA 3AJDA 1USGA 4WQMA 1Y8AA 1HNZB 2GLXA 1NE7A 2IUYA 3QE2A 2B2NA 4UUNA 3DLAA 1DC6A 3OPVA 1G7SA 3EN0A 4ZKDA 2H18A 1OE0A 1C7JA 3ANNA 3TN7A 1AV6A 4FHZA 2W2NA 2ZDGA 1PEKE 3SZOA 4LF4B 2QBYB 3GDWA 4DV1B 4HAWA 3SF0A 3AVOA 5TMDA 3SZGA 3BXHA 1CLUA 2X23A 3MJVA 4P22A 4E5YA 2A9OA 4EA9A 1H2AS 2QZ9A 3HCNA 4O1MA 1YOVB 2WJJA 3F8SA 3UZUA 1M6VB 3CKMA 3ND9A 4LXGA 1JWBB 4RORA 5IUJC 2ZXUA 3I53A 3OZAA 3PJRA 5BSVA 1POXA 2A0UA 4L9SA 1YKGA 4E22A 2IKQA 1X1CA 4NV1A 2F62A 4TKLA 4AJ2A 5KYXB 4PHFA 3QMVA 2YW2A 1J70A 5U4QA 4MV4A 3FMGA 3EH1A 3D31A 4TZTA 4X7BA 2ID9A 3TW8B 5SZIA 3BJMA 2FPIB 1JEQA 4GGPA 3AL2A 3GD5A 4Q3KA 3LFTA 1P7PA 3FRIA 5DM0A 2ZOSA 4P92A 2BF4A 3WS7A 4LJAA 1U0LA 5EQTA 5TT0A 3W8NA 2RI1A 1FTGA 3S8YA 1R5OA 1X7DA 3DDOA 1G41A 4L2IB 5FOWA 3QU2A 1Y5IA 5J2UF 3HO1A 4GWLA 1M83A 2JHFA 4E88A 1AM4D 1LLQA 5IF9A 3K6KA 1NUUA 4MQMA 2FRXA 4KPEC 2X8BA 4B5LA 4CKBA 3FPEA 2FKAA 3ZDRA 2ZYDA 3S28A 4BV9A 1F0NA 2PLWA 5H3CA 4TLAA 2BBSA 3KSMA 4X62B 1WVIA 2SHKA 3LBYA 3GP5A 1UFKA 2AZ4A 2DY1A 3CLUC 3CZMA 3EGXB 4H1HA 3C45A 4FLFA 2IPNA 2BMFA 3NHZA 5EYPB 1P1KA 4MRMA 2IU3A 4Q15A 5HKAA 2Q4RA 3D3WA 1Q44A 1C30A 3GRAA 1TUGA 2HV8A 4TVKA 1SUPA 3ABIA 2JFPA 4YLEA 4Z8XA 5FBZA 2BHNA 2IE0A 1I30A 2HN9A 4X41A 1ADCA 1RYEA 1LSUA 4L6CA 1L7OA 1F2UB 2CLHB 1TECE 1U0BB 2YY5A 3EE6A 4O8ZA 5EE0A 1E99A 2J0EA 1S3GA 3GK3A 4JJKA 5CA0A 3A1WA 4DV6B 3FIUA 1EDDA 2BGKA 4XZ3A 1AB5A 4C87A 2AC2A 3FJ1A 3N5CA 3W5BA 1X1AA 2DQKA 1L3IA 2R1TB 1E1DA 2G36A 2WFAA 3FETA 3DDNA 1MLDA 4P34A 5D87A 2DBQA 3ZXUB 3BICA 2AUNA 2QROA 1W0JD 5BYKA 10MHA 4JR0A 3Q3EA 5JDIC 2F3PA 3OJFA 4OX9Y 3DVAB 4HNUA 3EDRA 4D4JA 5AJZA 1UKZA 3EGOA 2AI2A 2D2FA 3AFHA 1P2UA 3PT5A 3SS9X 3G2MA 3TPFA 2HBZA 2Q4OA 2DY0A 4UJ3A 2AOUA 4HGPA 3UYLA 2GD6A 3DZDA 3BREA 2YIVX 1NWHA 2BGMA 5LYJB 3AF5A 2G5GX 2HL6A 5LU8A 2X2OA 2EX1A 1ZOOA 4Z4FA 2IU0A 3TUJC 4UPDA 1X7ZB 3NM5A 1AZLA 4Z1MA 3SJUA 2O6LA 4CQLA 2IJGX 1N8NA 3N2ZB 1T9DA 4Z49A 2R25B 3EC1A 1WPQA 2PWAA 2EJBA 1UMDB 1QTQA 3FB1A 2GZDA 5DEOA 3B6KA 4QXOA 3U13A 4Q9LA 4LFBB 1NFRA 3C24A 3LDGA 4OHWA 4BLTA 3PWSA 3REFA 4PX5A 4B71A 3EOZA 4Q34A 3LLVA 4HTFB 1HQDA 3W9BA 1K9SA 2YMLA 4IOKA 4JJ6A 2WQ7A 4FT4A 1I7QB 1DKPA 1T0BA 1N2ZA 2GKSA 3A9VA 1H3NA 1AHHA 2OTCA 1YACA 5E9AA 1JBKA 4CG1A 2XQJA 3ZI7A 1NTRA 1YQUA 1GPAA 2FRDC 3TYXA 5KS2A 1URPA 1Z39A 4XJTA 3QYPA 1JG4A 4XJXA 4CQNA 1AA6A 1MX5A 3OWOA 2PMDA 3T54A 3U19A 1XEXB 2HRRA 3VYSB 3OQ6A 3CLKA 2PNJA 2NVUB 3PUIA 1EK5A 5TVKA 4UTOA 1J2YA 2K5UA 1FFBA 1ZMXA 1W87A 3HB0A 5CT4A 4PYNA 1C9NA 2GEDA 4I1IA 1OX5A 3FVRA 3O7MA 2Z6QA 1XJWA 3QXGA 1LQTA 2RHCA 4URYR 5J1SB 4FNMA 1KZ7B 4YGXB 1D04A 4Y18A 4B3IA 4LYAA 1J0DA 4D8TA 2G0TA 3LKBA 4JD5A 3TTWA 1CS0A 1NX9A 2IU6A 3OFND 4HFRA 4WH0A 1NBME 1LQ2A 3QVTA 4IXDA 3A14A 4BX0A 2B6HA 5DBOA 3RTDA 2GHIA 2PMEA 4GL2A 4FN5A 5COQA 3EIUA 2DE0X 3K2QA 1IBLB 1IH8A 1Y4UA 2J3QA 3I5AA 4AJLA 1ORDA 4JKYA 1PX0A 4F96A 3L0OA 5EWLB 1QB7A 3JQFC 4QREA 3LQ2A 1NMYA 3H42B 1WETA 3VZQA 2PUBA 1C1HA 3PWTA 4ODIA 2VAVA 2ZJ0A 3JZDA 2QUIA 4J43A 5HJ2A 1ZUNB 2JEZA 1DKOA 4H0CA 2PZEA 3T0IA 3ZNQA 5KZMB 4OHOA 4GG1A 2C92A 3D5TA 2NO6A 2VKTA 2W2QA 3UOGA 1WBJB 2J3EA 1Y9JA 2OD2A 3EZFA 3FHLA 1PJCA 3IOYA 2FWAA 4Q3BA 2J07A 3HDTA 4TUYB 1H8EA 3F7NA 5REQA 3RUHA 4BCBA 2JAPA 1KAHA 1QBGA 1Z8HA 2ASEA 2RBKA 4NHOA 3WJ7A 1DFHA 2I0FA 2Z1MA 4R8SA 4KR3A 3UH1A 3DB1A 5CNMA 1J1IA 1QC5B 3D0QA 1CUDA 1H05A 3N3AC 3V8NA 4DAOA 2O5EA 5E7IA 3K2EA 2IY9A 4NYJQ 1MJ5A 1NF9A 3DFUA 3PIRA 2OXFA 4BVJA 1KVUA 2OLKA 4K03A 3TX2A 5KHOC 4YIKA 2B8TA 4HS9A 4M9RA 3MJHA 2OBNA 1H3FA 4XUCA 2OZEA 1VJ0A 2KMLA 2PZKA 3MCVA 3PC2A 4H6WA 3MWEA 4CJXA 4DA6A 5C7LO 2V9PA 2ZAMA 1JHVA 4E5KA 3OZDA 3OZ7A 4LSZA 3NUQA 1TKBA 3EFEA 5AESA 1F8GA 2GLTA 4KU4A 3WZ2A 1H2FA 2QY9A 3VPAA 2PD4A 4JCOA 1JAYA 3EXIB 4M0KA 2GAJA 4ND2A 2DCMA 1L2TA 3GFOA 1JRLA 4I1OA 3W3ZB 2RHJA 4Y2XA 2XGJA 1P1JA 4MEAA 1VLVA 3TCKA 1YO6A 5FTLA 2QUAA 5EE9A 3P52A 5K0EA 1TQ8A 4JBNA 4GDFA 5BUZA 1FPMA 3U4GA 3WGKA 3Q1KA 1ISHA 4RVOA 2RGXA 2PJRA 1FMFA 4JWTA 3NKVA 2JDID 1KJ9A 1P6QA 2W2OA 2AVNA 2BFWA 3GDOA 2J3JA 3GHYA 1K5DA 4JA2A 2GN9A 5CNKA 2ZI4A 5AVQA 3V48A 4LDAA 1Z7WA 2J5XA 4RFSA 4PZZA 3ZW9A 1JR3D 2IP2A 4ZK2A 5BR4A 1WE2A 5LXTF 2DQYA 1KFKB 1WXFA 3DVQX 3L0ZA 3VGJA 3AETA 2C2GA 2ZS9A 5EIXA 2Q0HA 4Z4HA 2YINC 3PC3A 1MCZA 5K1ZA 4YYZA 2R3SA 5DE3A 5EFZA 1I3CA 2CF6A 4K9PA 4E2YA 4GEKA 3IIIA 2WWHA 3KFXA 3IPYA 1NQOA 2VAXA 3RRJA 4D4HA 2BJVA 3LUPA 1GVHA 2H7CA 4C3ZA 5C5EA 2WM3A 3DCIA 3JYNA 3FI0A 1W59A 3LMKA 4MKGA 4BAUA 4ZHSA 5JALA 5CVEA 3OFVA 4FEAA 3P20A 2XD9A 1S8NA 5KDOA 1G3RA 1Q3TA 2XQKA 3CE9A 4R1MA 3W3AH 1UDXA 4UHCA 3RUPA 1OJLA 2A7XA 1YGPA 4TMZA 1MIHA 1T1SA 2IYPA 2P5SA 3GEHA 4ZT7A 1NJ1A 1SG9A 1MB4A 1M2OA 1Z4MA 2J30A 1LI4A 2R2GA 5EJAA 3RARA 1I8TA 1M2EA 1LI5A 2GFQA 1FU7A 3IGFA 3JD0A 1I0IA 4LHWA 1HDEA 4QJ4A 3PNLA 3LPNA 4A2CA 1QYXA 4YROA 1NX6A 4GI1A 4N4AA 3UM9A 5IM4F 1Y1QA 1H2ZA 2MYNA 1UINA 1ZNWA 1FDVA 1U9IC 2G0NA 1HV8A 1GTZA 5EZYF 1SELA 3EYWA 2NN3C 2BFOA 3WLRA 3EXFA 1OC2A 3KPUA 5GM2A 4C43A 3S1SA 4LRUA 3TJZA 1ZKMA 2QR2A 2ZSEA 5G0WA 3UQZA 2H1SA 5BY2A 4XDHA 4E46A 3FZGA 2WJZB 4I50B 4JUAA 1PNQA 4N01A 5FA5A 2XSZA 2FMIA 3A1TA 5HZGA 1AZTA 4LPKA 2YV2A 3ZHQA 1DX9A 3U56A 1JPVA 3JD3A 1GADO 3A6FA 3BHIA 4Y6GB 1XZQA 2M2IA 1KJWA 1ZEMA 2G0AA 2I6UA 2PUWA 4J4BA 4DRXA 1E1LA 2D5LA 3FRHA 4P83A 1HNXB 2P7IA 2PZBA 1ZSNA 1EFCA 3HG7A 4XE5A 3T7RA 2QN1A 2HJWA 2IPXA 2PRIA 5TMEA 1RRMA 3L93A 1IJBA 4YJGA 3F3SA 1L4HA 5AKGA 2VPZA 3CMCO 4QELA 4NQZA 4ZC8A 2FPGA 2JAOA 4OOFA 5L53A 1VKNA 1H69A 5DCYA 1WAMA 1TVEA 2JIRA 1CR1A 1ZRHA 2E9SA 5TPWB 3KETA 2V65A 3IRVA 4BMPB 3PL5A 5B2EA 1UEXC 1XD8A 2N9UA 4CGZA 2RJNA 3OG9A 3FLBA 5J4YA 3FNHA 2HRZA 4ZCRA 5BVHA 4IEFB 4W5QA 3N2GB 5AO9A 3GV0A 5AVRA 1GSOA 1MAUA 1TF2A 2XNKA 2GD2A 2FFRA 4I1YA 4E13A 3ZZTA 2JD1A 2P0YA 4X1YB 1MH9A 3E1SA 1Q84A 3N7UA 5TNXA 1OYOA 1G7RA 3UH0A 3EYAA 1I3MA 3EIQA 4CM8B 5FNVF 4P0PB 1T6YA 1AD2A 3Q88A 1PBTA 3GVPA 5COAA 4DLZA 3COYA 1EKXA 1XU4A 4HN9A 4BVHA 2DMRA 2O20A 5L3SA 2Z58A 4J1QA 1E2NA 2XZTA 2DFNA 1FFWA 1WO8A 5B1SA 3V4SA 1NRWA 4AC9A 1FS4A 5JAHA 1C9JA 2YIJA 1C3OB 3FY4A 5JW6A 4JYAB 1E9SA 3HUDA 2UZIR 2E21A 2FA9A 2BP7B 3MB5A 4KYIB 3E8SA 3I3OA 2E5WA 1IVSA 4OXRA 2BRUC 3WK9A 2AX3A 3E7WA 2HIGA 3I23A 3KQMA 3DKKA 3QXJA 5FD8A 5IC4A 4Q18A 4RJIA 1KMCA 2WU4A 3MQ4A 3EAFA 4J1TC 5EJGA 1RQ2A 3DKVA 5IC6A 4R68A 3IQWA 3TLGA 5T67A 4DLBA 2HEIA 1IAQA 4XDZA 1HE8B 1JX6A 3COPA 3OM8A 3WB1A 4HN4B 2L2QA 3SC6A 3R77A 3TIXB 2GRUA 2G82A 3G89A 3Q7IA 4MKFA 4JXZA 2QK4A 2YN2A 1X92A 4YWJA 4NHEA 3G2QA 3L1VA 5LUBA 4QQFA 3WMEA 4ILKA 1E8NA 1K4MA 2I78A 1MO4A 3TM4A 4FD3A 4D25A 5IK2A 4FZ3A 1K6JA 3OOYA 4HQ0A 2EBUA 3G0BA 1JTVA 3SQLA 5LLDA 3N9IA 4OREX 1GITA 1WPXA 3GDGA 4U2FA 4MO2A 4Z86A 2AN5A 3C43A 3H3XA 3H9JA 3MTGA 4DTCA 2F59A 3JQAB 2R6HA 1FDOA 4D98A 1P6XA 2C4NA 4GSKA 5AK4A 1KKMA 1SOAA 1ZK4A 3NT2A 4LFCB 5JJLA 1SVMA 2QQFA 3WHLA 2YVUA 3NCHA 2QLJA 2QXYA 3L2OB 3MCWA 4JLWA 4BASA 1DTSA 4C76A 1ZIXA 3SHVA 5HFAA 2P91A 3ZKAA 1Z17A 2PX4A 4MWEA 3N74A 2GN4A 4RY0A 1G3UA 5T6MA 3DBLA 5KSZA 2EOAA 4ZCMA 2JK0A 4EQ6B 4YUXA 2Q9CA 1P18A 1PRYA 2Q3EA 5ICSA 2GJ9A 4ENWA 3ERCA 3PEYA 2WILA 3IE1A 5CFMA 3G0DA 1F5NA 2BFBA 3AONB 2O2XA 3J7AC 4NU0A 4YI5A 4EABA 5C8VA 2LP4Y 1ZGBA 2BKVA 3KEMA 2IX3A 5IEJA 1RRFA 3H87A 4ND6A 5ALTA 1FNCA 3D4OA 1Q1QA 1GRRA 3IEUA 3S70A 3D7LA 3O9VA 3O92A 1WUHS 1WLYA 1L7QA 2BH9A 2DTEA 1JDVA 1PS0A 2X13A 3KKNA 3NBAA 3PPIA 4POAA 4HN2A 1XRQA 3NTLA 4WASA 3C7KA 4X95A 2GJSA 2XPCA 1MJGM 1DJNA 2JI7A 2ZCUA 4LJ4A 3NUGA 2CYCA 2WTEA 4PX3A 3VV2A 1DOAA 1EHIA 1KU6A 3I30X 5DWVA 1A77A 2GPJA 2P9JA 1BMDA 4BEJA 4V0NA 3QVVA 1OCEA 4RPJA 2FFBA 1ZWKA 4OQXA 1RLJA 2B25A 4TGLA 2XE6A 4LE0A 4V0KA 3DV0A 3AB3A 4E5UA 4IP0A 1UWKA 2GZ1A 1KS2A 3QKRB 4F11A 4EY7A 2OM2A 1E1MA 3FR8A 4ZT4A 1HRDA 1L8QA 1LLFA 2YWJA 3V9PA 2XMDA 2WUWE 1YMQA 3JWGA