5FLYA

The fhud protein from s.pseudintermedius
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
279
structure length
279
Chain Sequence
KETKAFNLKTAKGEEKIDIPKDPKRIVVMAPTYAGGLKYLDANIVGVSDQVDQSPVLAKQFKDVDKVGAEDVEKVASLKPDLIITYNTDKNTDKLKKIAPTIAFDYAKYNYLEQQEAMGDIVGKSDEVKKWKADWEKQTAQDSKDIKAHLGDDTSVTIFEDFDKKIYAYGKNWGRGSEVLYQAFGLQMPKALDDATKKEGWTEVPKEEVGKYAGDVIITAKAKDAAQPEFQKTAMWQNLEAVQNKYAFNVDSSVYWYNDPYTLDVIRKDLKKQLLALPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords FERRICHROME-BINDING PERIPLASMIC PROTEIN
publication title Crystal Structure of Fhud at 1.6 Angstrom Resolution: A Ferrichrome-Binding Protein from the Animal and Human Pathogen Staphylococcus Pseudintermedius
pubmed doi rcsb
source organism Staphylococcus pseudintermedius
total genus 91
structure length 279
sequence length 279
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 5flyA02
1QH8B 4MLZA 3AEQA 5M34A 4WESB 1G20A 3GI1A 4LJSA 5HDQA 4DBLE 1TOAA 4M7OA 4TKUB 5BVGA 1PSZA 4NNPA 3MINB 4UDNA 2Q8QA 3HXPA 5HX7A 3MWGA 3ZK7A 1G21A 3AETB 3TEFA 3TLKA 5CX1A 3LHSA 1MIOA 1K75A 3AEUB 1FP4B 4HN9A 3K1AA 5FLYA 5BVHB 4INOA 3TNYA 4WZAA 3PSHA 4TKVA 4HMQA 4MO9A 3MD9A 3AEQB 4WZBA 4FKMA 1K7SN 5GGYA 5M3BA 3EIXA 1G20B 4MDYA 5KOJB 5M2QA 1H1LA 3R5TA 4FI3F 5BVGB 3ZK9A 1PQ4A 1KAEA 5CR9A 5I4KA 4UTOA 2PRSA 4H59A 4ND8B 2YNMD 2AFIA 4NNOA 4PAGA 2M6KA 3PDIA 1XVLA 3HJTA 1M34A 3LI2A 1N2CA 4LS3A 4WZAB 4OXRA 1QH1A 1M1NA 2XH8A 4XPIB 2AFHA 1K0FA 5GGXA 2M6LA 3U7QA 1QGUB 2OGWA 2XQVA 1ESZA 4WZBB 2X4LA 2WI8A 2XUZA 3AEKA 5B58T 5KOHB 3PSAA 1L5HA 3G9QA 2ETVA 4WNAB 4CL2A 3MWFA 2R79A 4WN9A 4G07A 1KARA 5JJ5A 1EFDN 1KAHA 1QH1B 3ZKAA 1G21B 3BE6A 1K2VN 1N2ZA 2OSVA 4FILA 1QH8A 2PS9A 3EIWA 5CX1B 5KHLB 1MIOB 2XV1A 4WESA 2OV1A 3AEKB 3BE5A 3K1AB 3AERA 2WHYA 4OVKA 3R5SA 3ZK8A 4TKVB 2XDQA 5JG7A 4TKUA 3MINA 4UDOA 4H0FA 4IRMA 4INPA 1H1LB 4FNAA 4PM4A 2RG7A 3AEUA 1FP4A 3AESA 4B8YA 4HMPA 2PS3A 3HH8A 5BVHA 2MINA 2AFIB 5JPDA 5AFSA 3PDIB 5KOJA 3NU1A 3AERB 4BBPA 1M1YA 1M34B 2XDQB 1N2CB 4K3VA 5M29A 1M1NB 2PS0A 3U7QB 2AFHB 2XY4A 4MX8A 3ZTTA 2Q8PA 1N4AA 4ND8A 2O1EA 1L5HB 3AESB 2YNMC 4OXQA 2MINB 2R7AA 3MFQA 4UTPA 4N01A 4XPIA 2OV3A 3AETA 4WN9B 2QI9F 1QGUA 1N4DA 3CX3A 4G09A 4HMOA 1M1YB 4GICA 5KOHA 5JOQA 2PHZA 4WNAA 3UJPA
chains in the Genus database with same CATH superfamily
1T8PA 3UOWA 4X94A 1FL9A 1A9QA 4Q02A 1TJNA 3PQCA 1EWTA 3VQTA 1T1SA 3KJEA 2HU2A 5DT9A 1W1UA 3K9NA 4JA2A 4KR9A 3S7ZA 3OECA 3UB3A 3GPCA 3LKZA 1RMQA 5CT9A 3UVEA 3B7PA 3TTWA 3DCYA 4BJ6A 1Y5MA 1R8SA 4E51A 3TQQA 3WRVA 3O90A 2HH9A 2Q9BA 1DQRA 2X8WA 4IF6A 4DR5B 4ITUA 3N6XA 4P3YA 1J8VA 1UZUA 1JDZA 5E8RA 5KWVA 2GVDC 4E14A 2ZB8A 2G1UA 1N9GA 2WM2A 2YIVX 1OASA 3L02A 4QPDA 4MUGA 4HWOA 4MA4A 4JZYA 4EUSA 1L8AA 2VZ8A 1F5SA 1UWLA 4EKGA 1W0JD 1QX4A 1SPBS 4ZGBA 4M8IA 4KQEA 2XOKA 3LDFA 1YZKA 1UKCA 4RLSA 5AP9A 1XN4A 4D25A 3GXOA 3OIUA 3UV6A 2PT9A 5H16A 3RSHA 1PL6A 3FI0A 1ZMRA 1ILEA 4YJ2A 1CP2A 2O8EB 3NORA 4P7BA 1XNRB 2IYZA 4GBED 4UAVA 3GLFA 5BNIA 5BW8A 4CTOA 3DDWA 1N3YA 2Z8YA 3PT9A 3H4MA 2BLLA 4RADA 4PICA 1JMVA 1CNEA 1E2HA 2QNIA 3D7KA 3CV3A 2PU5A 2GEJA 3EG9A 3P26A 4IW3B 4K03A 1NTOA 3VBCA 4C4TA 2IK8A 1M74A 2YYZA 1UIMA 3K16A 1MAWA 4XXHA 5KYVA 2PSJA 3GELA 3DZCA 1IHPA 4REOA 2W00A 1BN6A 2R1TA 4ZQHA 2O8FA 2FZ4A 3T1YB 2AA3A 4JODA 4KYIB 1F1BA 3GJZA 4G1MB 4BVLA 4XWKA 4L9RA 1HDRA 3G2JA 4HNHA 1MOQA 3BXZA 1C0PA 5I5EA 4HAVA 4JHXA 4FYIA 1ZCZA 3JQFA 4G84A 4TXJA 1TB4A 3X1MA 5EE3A 2BWJA 3KYDA 4IJWA 2G5GX 1M6NA 2CHFA 1EBBA 1MPTA 2YZGA 1ODFA 4JI3B 3QF7A 5EJ2A 3F9RA 4EGCB 2NXEA 1IDN1 3S68A 4ZD6A 3B6EA 3R76A 4H0FA 2AOTB 4QU8A 2XUGA 2GM5A 1JPNA 2ZAGA 3DBRA 4E1AA 2I3AA 3AESA 1Q7GA 4YALA 4BN0A 3ZWCA 4M1SA 1I8TA 1SUWA 3T15A 2A1UB 2UYOA 4JX9A 2RG1A 2FPKA 2GPNA 3OPQA 5AKYA 5IBPA 2ZG6A 4MZDA 1ZNYA 2QTHA 2BMDA 1W8IA 5C1DA 1VPVA 5BSFA 2H1CA 3SSOA 5DEOA 3EEQA 2FUKA 5JC8A 5AHKA 4PHHA 3QI7A 2V58A 2ZRKA 3FUCA 1XEWX 3W79A 4ERXA 5BOVA 4TMVA 4ZGGA 1PT8A 3EGDA 2CNNA 3NEPX 3PC8A 5KQLA 1NJ6A 2R8YA 4PX9A 5DX0A 2V7GA 1ISIA 1UQUA 2Q9CA 3D3QA 3EQ7A 2ZSFA 3IMFA 2E4AA 1OGYA 4WFJA 3TDMA 1E5LA 4EFLA 4RK7A 3NDRA 2W2TA 4DZZA 4MIKA 2FZGA 2YFQA 4D41A 4LN1A 4YRFA 2WHQA 5DVZA 1IONA 5F3WB 2GPTA 1JXAA 2M9MA 3B1FA 4HADA 3WL5A 3HC7A 1CX9B 3I23A 2UUBB 3UZUA 5CLJA 1ZBDA 2ERCA 3LYAA 4WHMA 1KEKA 1PJQA 2BFCB 4KQ9A 5FWNA 2EZ9A 1L4KA 5LP6B 5AT1A 5IYZB 4PZPA 1DJOA 1W93A 1DL5A 4DLBA 5KVCA 5K2OA 1ZGCA 1S4QA 2WU1A 3DGFC 2XE6A 3NH6A 2FWIA 2BEKA 2ZQZA 1JFFA 4FK8A 1MA0A 1V25A 2Q4TA 5IKMA 3IDQA 3PKJA 1E59A 2YJ3A 4WOJA 5BNWA 4IY1A 3NFYA 4JI2B 2G1JA 1D3AA 3GWGA 4RORA 4EKYA 3OLXA 4YMWA 4GQBA 2WINI 4BQNA 4D6YA 2NMVA 1KS2A 3FNQA 4DZRA 1OZAA 3VDQA 1Z45A 4AMZA 5KB3A 3HKCA 3G6WA 4F2GA 1R0CA 3DONA 1XDSA 4DV0B 3RRXA 1BXGA 1ESNA 3HFJA 4FXPA 3WFIA 1PIWA 4EUFA 3OM0A 1Q6ZA 2EOAA 4JYBA 2H7YA 5EZYB 3PQ2A 3EEBA 1XDGA 1CUJA 3AMVA 1KY2A 1OT5A 1GTL1 3SBEA 3ZQ4A 3KSUA 1XROA 3K5WA 3OO0A 1IRIA 4OSEA 5DGDA 3BIWA 4BGVA 4P6VF 4HPXB 4AG3A 4MVJE 2DYKA 2L18A 2C4UA 1F6DA 5C0OE 1TQ4A 2ZXUA 1WXHA 1WZNA 3IERA 4XX0A 2NSLA 2CUKA 5AUPB 3AP1A 1TIKA 5ALRA 2BMFA 3KOXA 3L82B 2J0VA 1Y98A 4JB3A 2VWHA 4RTQA 5JXJA 1USWA 5FXMA 5IJ9A 3I62A 2Q50A 1OFHA 1T1EA 5ERXA 4G1FA 3ZKAA 2HCRA 4IQGA 2R7NA 5DLPA 4HKTA 1GSOA 3GIWA 3B3GA 4QXMA 3W2TA 3HABA 4M2LA 4Y6QA 4MKRA 4XRGA 3PKIA 1E2NA 4REMA 5LMZA 1EH5A 3OZXA 3ER8A 5GJBA 2P9QA 1T0IA 3TW6A 1S6YA 1J6UA 1LW6E 3E1GA 2WLTA 2V7WA 1BE0A 3H86A 3QWBA 1GGVA 4MQEA 4NVRA 4CLRB 5K3SA 2QIOA 2WJ6A 3A4IA 5J63A 1G1MA 3KQQA 3RRYA 4L85A 4CKZA 4IWNA 4TGLA 3H4VA 5H3LA 1SXQA 4HZUA 4D0RA 3ZDFA 2X9VA 3IIMA 3UAXA 5JZSA 3RQIA 1L5FA 1N0HA 2H65A 2J07A 2V8OA 3W6NA 2X77A 4WBSA 4YR7A 1T9CA 3BREA 4H1WA 3QX8A 2NT3A 5IU6A 4IGKA 4O3MA 1IQUA 2J5QA 1X15A 2YXPX 3KLNA 1C0EA 2NAPA 3ECCA 5DN9A 5H8WA 2VPYA 5FNZA 4OTZA 3L8HA 2F90A 1GGFA 1ZD1A 3VR2A 4G0ZA 2BM0A 1L5HB 3ORRA 2ZRPA 2B2XA 5E9WA 2PKYX 5JPIA 3OCJA 4EKEA 1QUEA 4EUKA 2RHGB 4Z3KA 5CK4A 1M8PA 2BE7A 4LNHA 3F6EX 4CFZA 3GBSA 4C0JA 1JWBB 2GN2A 2LR0A 3PR2B 3D8BA 3KU1A 2EV9A 3UB4A 4RIFA 2JA2A 5J5CA 5E4FA 5E4JA 1TFUA 1AE1A 1C1XA 4G67A 3TXYA 2DR0A 2XVAA 3QLEA 2VJDA 4L6CA 1KE1A 4XJTA 4E12A 1RI3A 2PMDA 4G0UA 4XYGA 1JQKA 2AR9A 3RKSA 3KXPA 2J5XA 3ORSA 2F1IA 1MJ5A 1UC4B 2P0YA 4LGMA 4P93A 5JISA 1KYIA 4PBSA 4EYGA 3WL4A 2Y1KA 4YAOA 2ZTSA 3A8TA 1RYDA 1E69A 1HZZA 1RABA 1BCRB 2BM9A 2WJJA 4A82A 2W2XA 1S3FA 4MUMA 1LBTA 3IVAA 2RGNA 4FCVA 1XMQB 5LP6F 3MJVA 5LC1A 2R62A 4LRUA 2MYPA 1CY4A 1TIBA 4DLSA 4Z4HA 1EWVA 1SBQA 3RAFC 3V4OA 2FF5A 3JQEA 3RF7A 2JJMA 4JR0A 3F8SA 1K8XB 3D4IA 2Z4RA 3CLSD 2CHVA 3TBFA 4EA6A 1TX4B 3CNBA 3B2EA 2MMGA 2Q1XA 2V3CC 4V0QA 4JC8A 1ZD8A 2D7JA 2J46A 1B0ZA 2G88A 4QM7A 2UUCB 4W1PA 4RZQA 1JR4A 2WJVA 3I04M 3RFTA 2VJYA 3EXIA 1XAHA 2JAHA 1KQOA 2X4LA 3VZCA 3V7NA 4BNIA 2FEMA 2PH7A 2WVHA 4DA9A 1LLQA 2PA3A 1CUWA 4NQRA 4XVQA 4PLTA 3UHJA 1GGMA 3W2GA 1JSCA 2VNSA 5HBGA 3VOAA 3UHFA 4DQUA 5HJEA 2DPYA 4AF6A 4EJMA 5MN4A 4GC5A 3KYCB 4NS1A 4ZVSA 3RS0A 5FPHA 2HREA 1ODTC 3S4YA 2HA6A 1XX6A 1Z83A 3H11B 4UC0A 4D92A 2I7VA 2IS1A 2UYYA 3GFSA 2C97A 1SCQA 3DTVA 3OHMA 1YE8A 4JP3A 1AO0A 2W71A 3N39C 3Q3HA 4L3OA 1T3HA 4UU1A 1R5NA 4CM5A 4ETNA 1QF6A 2PMKA 1EJBA 2CY0A 3GZ4A 5JZVA 1ZHHA 2PJRA 3QKSB 4MR8B 2AJCA 3DEIA 4RM2A 1JGTA 2B1RA 3C24A 4F4IA 1OPXA 5FH9A 2EW8A 2QGFA 2OAP1 1BU8A 2UUPA 2AT1A 4HQOA 2VHQA 3Q87B 4JU9A 5KU1A 1W87A 2IEZA 3X2EA 3U3RA 1E2IA 1ZD5A 1E5QA 2F9FA 1JUDA 1OV6A 2GO1A 3MWEA 3MIZA 3NU1A 4MUKA 4PYQA 4XOUA 3RVPA 3ZLJA 2VDPB 3HVIA 4J0CA 1WSDA 2CGEA 3CB2A 2XWSA 3S2GA 1MT3A 3W2FA 2DVMA 4NESA 5JARA 3R9WA 2B25A 2Q2QA 4G65A 1RAFA 5DCYA 3AF5A 4UAJA 4HAIA 4CDRA 1LWOA 1JU4A 4H15A 2Q3HA 3C3JA 4QXQA 3QHQA 4YT4A 5IT5A 2W2LD 1Q17A 3RCBA 4JYMA 1DPGA 4NV0A 3P0JA 4KQIA 4BO6A 4Y9SA 3RFXA 1CERA 1KVTA 4YRMA 3SXUB 5D1NA 3FTCA 3OE5A 4JZKA 1V8FA 3HI6A 3IH5A 1M10A 3ITEA 3GFTA 4FSXA 3HLKA 1QPGA 3GEDA 1H0KA 3R0QA 5GZ6A 3FNEA 1HEYA 3I2YX 1CCWA 2WICA 3Q3JB 4BP1A 3RI3A 3RT9A 3QXCA 1OILA 1G5IA 2RGAA 2ZB4A 3O4VA 2DCUA 4LGVA 5HDQA 1R0XA 2WB2A 3I1JA 3L06A 1K7FB 5JS8A 1P0PA 3MUFA 1J9ZA 2V55B 5JBIA 3LFUA 5JLAA 3SXJA 2QD5A 3O21A 3HXLA 5KQSA 1HNWB 2HWWA 4GR4A 1X1BA 4UULA 3RVBA 3VXKA 1Q3TA 4BCCA 5C52B 4G24A 4LX8A 2GJ4A 4R2LA 4UVGA 4NPAA 2A4MA 4WJKB 4C4SA 4Q00A 3N7UA 5AVTA 1CJMA 4KPGA 1KF0A 1Z2AA 1OIVA 3H9UA 3DO6A 3PRKE 1NVXQ 3G2MA 3N2KB 2G7MC 1RAEA 2X4GA 5K0NA 1JAXA 1EHCA 3BSFA 4L4UA 1Y6GA 2H17A 3OU6A 4CKBB 1SQ5A 1SH7A 2I3GA 4O25A 4PRLA 5B6PA 2VWQA 4EG0A 5KVQA 3KKPA 5BN3A 5ILQA 2X8JB 5FAKA 2ZYHA 2PXCA 1SULA 3HCOA 4TTAA 1TADA 1FFDA 2IVFA 1RVV1 1N2CA 1XI2A 3P5BA 1QJ4A 3ORHA 1P5HA 1LSOA 1GM5A 4AF8A 4WZZA 2YJNA 3WB2A 5KYWB 5KYYA 4AY5A 3JZIA 1E62A 1FFXB 1U6JA 1U7HA 2HHCA 1K98A 1P4GA 5JCOC 1VL8A 4EY3A 1W5EA 2Q29A 5F78A 2E3JA 4ZODA 3VDRA 2XKAA 4JYCA 4A8JA 1SHKA 2IF2A 4J1TA 3QKRA 4E46A 1BGVA 1ZNZA 4L0CA 1DB3A 1EKXA 1RHUA 3LP8A 4MWSA 4Y0VA 3EVNA 3G89A 1ZCFA 3LBAA 1LBQA 2GHRA 4NFLA 2QLFA 4YBZA 3ECAA 3UW3A 3BA1A 1UPCA 4MV4A 4AROA 4OATA 4NBTA 3P9KA 4FZ3A 4RA6A 4B6GA 3B48A 2C7PA 3I8XA 3SXPA 4KQCA 1TI7A 2CJWB 1RRMA 3L1IA 2C83A 2CZGA 1VE9A 4OOEA 5AH0A 3SHTA 5KHLB 3IVRA 3UPTA 2AJ8A 3EVCA 3OOYA 4EA7A 2QUAA 2GD2A 4RJKA 4IM7A 1B00A 4NLLA 5CJ2A 1U65A 4IRXA 1HMPA 3VI3B 4PQEA 2I0FA 4U3JA 2ZLBA 4UUMA 2CVFA 3KHSA 1H8EA 1C30A 2ZUWA 3LUFA 2XGGA 5EWMA 2BGLA 2QMQA 1IY2A 4B7ZA 5A6SA 4KE7A 5BV7A 2RD2A 4KAJA 2A86A 3L9WA 4M76B 1L4GA 1WABA 2BHNA 4BRSA 4DSNA 2QX9A 1JI0A 2QTTA 3J81k 2RJOA 1V7PC 4F8YA 5LD2C 2C31A 3V4ZA 5ICSA 5PNTA 1OPRA 1S2MA 1UPTA 3QW4B 4GRIA 3KZCA 1JF8A 3S55A 2CV1A 4UASA 2XY4A 4WUVA 1G8MA 1G64A 4LDRA 5BQPA 3FPKA 4HNUA 3AWDA 3X3HA 3ZXYA 2GBCA 1B8NA 2C8KA 3CUTA 4CG1A 1HR0B 4IQ4A 5ALYA 2SICE 4R9NA 3SFTA 1SVSA 1U3UA 1L5QA 3LUPA 3GR6A 2JIZD 3K8QA 4N0QA 4M9UA 4B3JA 4DEXA 1CSEE 3N0VA 2WC1A 4DR2B 1FYFA 1E6MA 3H84A 2EKQA 3MOIA 1PN3A 3NEJA 3QUCA 4S35A 4W7IA 1UBHS 3E6AA 4Z54A 4H7EA 4NKRA 4GUDA 4QOSA 2XJ9A 1WU7A 3OBBA 1ND6A 2CUTA 4CM4A 1AQLA 2X9LA 5ANRB 2GAIA 4JELA 3WGKA 4FLMA 3KQNA 3AEQA 2OV2A 2VJAA 2X41A 2E4XA 3LO8A 4ZO8A 1GLGA 4ZC1A 1XU4A 3U26A 4EKIA 3GUYA 4NCIA 4F5DA 5HNKA 1T36A 4DANA 3D0RA 1PVVA 1W44A 1UWVA 2JGRA 4P22A 5ADUS 5HX7A 1X6VA 1XEWY 2WWTA 5CH8A 1JH8A 1KY3A 3CJRA 4BP3A 1JEEA 1XMJA 4MV6A 3VPGA 1I3NA 4KH0A 3DV0B 4HN9A 1N2GA 4D8VA 2C57A 1QE3A 2Z4TA 2GZ1A 4CLXA 4TKVA 1XLTC 4BPBA 2D13A 3T94A 1AB5A 4FUTA 1MQSA 3UCEA 2WM3A 3UJAA 4EH1A 1F2TB 2OAEA 3QH4A 3EXAA 1EP1B 1G5FA 4PGFA 1CRZA 1G7RA 4KIJA 3C5WP 4YRLA 5FPTA 4DYVA 4Q9KA 2WD7B 2BMEA 2X3YA 2JCYA 5IX8A 4LVNA 3GLSA 1NGSA 4MROA 3ZY2A 3GJ4A 1DARA 3U19A 2DFPA 4O63O 1TJ3A 1L4NA 2EERA 2PD4A 3MPUA 1UZAA 2PUAA 1JXQA 1XF1A 2JFOA 3Q5EA 4MQMA 3CONA 4RQTA 2IU3A 5EUBA 3FIJA 5JWHA 4AC9A 2A1TR 3OE4A 2HNBA 2HWXA 4H3HB 4NEGA 2FFQA 4U7JA 2V1XA 2L19A 2PZLA 2XRZA 1AXEA 1S8FA 2ZJ6A 3O7MA 2A67A 3AHHA 4TWBA 1XZCA 2FB9A 4JBWA 4GXTA 3ROKA 2V5VA 2V7QA 2QW0X 5DM60 2PU7A 3VU0A 3AJAA 4HJXA 3H9GA 1TU0A 1ZONA 4MK4A 3W5HA 5CVTA 5JCJD 1DAIA 1FPQA 2WRZA 1BD4A 3MCUA 2WSSA 3QXGA 4GAEA 2OM6A 4HGPA 3S44A 1G8AA 2WIKA 1AKTA 4E30A 4ENPA 1SM4A 1W59A 1I13A 2ZDQA 2ZRNA 1KP9A 3IIKA 2WTNA 3PHGA 4U02A 2QL9A 4CKXA 4CMIA 5A4IS 1JIXA 3PYLA 1EFDN 4LOLA 1KZ1A 3DLBA 4RYLA 2I6UA 3MAAC 4TMWA 3VU9A 3IO3A 4PX2A 3B20A 1J2EA 3TKLA 1I0LA 4TOIA 2FW6A 4KX3A 2GI4A 2K2WA 3NP9A 1A2OA 1ZOLA 2ZUUA 3TLEA 1LTHR 2HMWA 2NZ2A 4KXWA 1D5WA 1Z36A 4MV0A 3KT0A 4R9RA 4Y6PA 2FMFA 4JBGA 3M6FA 5AO9A 5F1YA 3UWPA 4DM3A 3H2SA 3NQ41 4R0MA 1R64A 5JZOA 1E3MA 4OXYA 1ZOPA 3D6VA 1OKKA 1ZRHA 4OUKX 4X90A 4C9BA 2D3TA 5BN1A 3MZ0A 3V1MA 3WLIA 8LDHA 2G76A 3RRZA 2MHCA 1GUZA 5F9MA 5KYUB 4GH5A 2VBCA 3KVNA 3NGXA 2WJ3A 3R41A 5CK5A 3U7QB 4YV0A 1V2GA 1I4DD 4OJTA 1S2IA 3EQ6A 3K1ZA 3LS2A 2Z3VA 5AJHA 1C2YA 1M7HA 1UM9B 2ZI7A 3BEDA 2YQ5A 3HDJA 1JHPA 3FWHA 3MWJA 2RKWA 2IIQA 2VPWA 3CC8A 1TQ2A 4ZAGA 3KYIB 4GI7A 3X1WA 4QSHA 4MW1A 2QP3A 2BMJA 3MMXA 3SWWA 3BMOB 2YTZA 1C29B 1FSSA 3F7OA 1PT6A 4GOJA 4PX5A 4Q9JA 1Y34E 3H3JA 3IXLA 4XQ0A 5NLLA 1G1AA 1SU6A 3QU7A 3BL8A 4E15A 2ZROA 4F2PA 3R3WA 4RWZA 4R5HA 3ZXUB 4X8OA 4CCAA 1IZ0A 3PWSA 1U1EA 5EUMA 4MSUA 3TRJA 1E32A 5BY2A 1SG6A 3G8YA 4LIPD 1CD5A 4HWRA 3IKMB 4ZK6A 3E48A 4HB3A 1VHQA 3LVRE 3COZA 1JECA 3LT4A 4QA9A 5FKJA 2XF8A 3SS7X 4D4GA 4KR6A 3KZMA 2P6RA 5EFOA 3T34A 2NTYC 1DKPA 2RHDA 2VQDA 4FOTA 2QMYA 2H57A 2ZM5A 3W7AA 3VU8A 3LPNA 1B15A 5EXXA 1MAHA 3CTMA 3FYDA 4E7PA 4YFYA 1FYXA 3DOJA 3EZ6A 4KK4A 4HNTA 1OW3B 3N59A 1ECFA 4QOIA 1T5IA 4C5BA 4EATA 1Y42X 2FJUA 1AMNA 3IAM1 2VXBA 4Z1MD 1ONPA 2IYTA 4O2LA 4QUAA 5CLGA 4BBZA 4JQOA 4CMKA 5KSYA 3JQDA 4OGWA 3U4QB 2GF2A 1S1CA 3B13B 2JH3A 3I39X 4U2KA 3TMAA 2WM9B 4A9AA 2FMUA 1O3YA 1GG5A 2BOVA 3HB7A 3OZUA 1NQTA 2YXEA 2ZOSA 3KTFA 4UHDA 4C7MA 1Y9AA 3BH6A 1QO0A 1SCJA 1NPDA 1OYYA 2YN4A 2PV7A 3IMEA 4F5WA 1PNQA 4BFSA 1QCCA 2WDPA 2ZUFA 4KIWA 2VAWA 3MJCA 4XX1A 1UJNA 2PPVA 4GMGA 4LYFA 3WMXA 4B3DA 3AEKA 5IRCD 2OC9A 5JXIA 3JPWA 4IEFB 3TF5A 1SBTA 3OIVA 3K70C 4YROA 4UEKA 5BOSB 3UJBA 5LOVA 4HDKB 3LX4A 4Y9DA 1N92A 2FFJA 3BQ9A 4NSNA 4BO8A 4AYTA 5JBQA 3TX6A 4TTJA 5FBQB 2AMLA 1BXRB 4PFQA 5AXCA 1UPFA 4YYZA 3Q98A 3EVTA 3JZMA 4W5RA 3EWNA 2ZBDA 2R1VA 3V33A 1FSZA 1JIJA 1EXWA 1VP3A 1GT6A 2PD3A 3NEAA 4QU0A 5DBFA 1HYEA 1C3EA 2J8ZA 3FSRA 3D54D 3UO8B 3AP2A 4PU0A 1Z7YA 4XLLA 5DYTA 3D6MA 4HEHA 3SKVA 4DZTA 5GV7A 1JTVA 2ZYUX 1Y1RA 2TYSB 4UDOA 1MN6A 2AN5A 1MOPA 3KUUA 3ZDXB 4H3KB 4E5MA 4F06A 1H1LB 2QPOA 1FRZA 4BMPB 1J39A 4IH9A 5IBQA 3IVGA 1QP0A 1ZUHA 4HF7A 4F5ZA 2QZJA 4ESVA 3ZJTA 4GU5A 4UXIA 3OQIB 1YAJA 1V6CA 3H8VA 4QPPA 3STUA 3I0ZA 4CM9D 4YS6A 4CEJB 3OIDA 4IMRA 4U8GA 1XK7A 1YDMA 5CHYA 1J56A 2OB1A 4J29A 5CFLA 2O0HA 3Q72A 4HX5A 1U5BB 4Q9DA 2C3MA 5BRAA 1I6MA 3QTBA 3HKBA 4Z86A 2REXB 2Q2VA 4C0XA 4C5CA 1KU0A 1XMOB 3BXPA 1K3UB 1BJRE 1EGVB 1TIPA 1Q11A 1YA4A 1LNQA 5C1IA 3SDSA 4J76A 2R6ZA 3ESXA 2X2EA 1VZ3A 1CZHA 3DC7A 3I9V6 3W3AD 1L9KA 2XUJA 3RYCA 3GFRA 4MJLA 1VL2A 2OV3A 1YJQA 2VP3A 4PX3A 3WJ1A 3DH0A 2J0QA 3PNQA 1X1CA 4KQMA 5FTLA 2BFFB 2GETA 2W83A 3K30A 4O4IB 2HMUA 3PQ6A 1SHJA 4DA6A 5ALWA 4MP8A 2QTAA 3C15C 3CO5A 1CR4A 1MDBA 4X00A 2HF9A 2ZTMA 5CXXA 4IG4A 4L4YA 4UCQA 4X61A 1J0CA 1LV8A 1OLUB 2LVBA 3GCGA 4HGZA 4W82A 4MZXA 4RS4A 1KFJB 1XHLA 5KPJA 2KLBA 3DHNA 1EWYA 4CT5A 1WUIS 4KSBA 3B12A 4XW2A 1N36B 3ZJUA 3GA5A 3NG1A 2R4UA 4AUNA 2QPTA 4ZYLA 1KDVA 5KMGA 1RQXA 2W6MA 2HIMA 3EASA 5KQGA 3C14C 1YB7A 2J4CA 4GLJA 3JQPA 1QHGA 2OHIA 3GZJA 4RGQA 2QL6A 4NPCA 1N7HA 3Q2OA 1FTWA 4WJLA 2VDKB 1Z0KA 3B60A 3WLNA 4PQFA 4MV8A 3FTFA 1TLTA 4ZOCA 1PD0A 4EG6A 4XR9A 4NENB 3OURA 1QPZA 4LMPA 1PQPA 4UVIA 1UFQA 1XU9A 2XEDA 3X1JA 2VXOA 1VBMA 5IULC 4TLDA 1JT9A 4RVFA 3IPAA 4IV8A 3K9BA 2XE7A 3PUIA 1GGEA 1IQPA 1UKVY 4QICA 3RGGA 3W9YA 1U9CA 5BT9A 1K0FA 3DCNA 3EN0A 4PZ9A 3OAAD 2OGWA 4N8DA 4UE2A 2H2IA 1FDSA 2NVOA 4MCAA 3SJBA 4IVNA 1N1DA 4FHDA 2HBQA 3Q8LA 4HQKA 1ML3A 4P84A 4CCYB 3OC6A 1HE2A 2OC4A 3OBIA 1SC4A 4FW8A 2WYHA 4G5HA 5FR1A 5IEBA 3ZZTA 4EYEA 3NDIA 5I7UA 2C54A 5L7YA 1H5NA 2ZANA 3O8LA 4FBMA 1ZSNA 4DCCA 3BTOA 4TKLA 1AK2A 3GNTA 2ZZMA 3EEFA 1V48A 2ECFA 2IXGA 4PZZA 4QLOA 5A5VA 1KO4A 2RJ3A 3QWIA 2I7XA 4JK3A 3A11A 4TQ9A 4Y0NA 5H9VA 2Y1EA 1MGOA 4EMTA 3VYWA 4HNQA 2D4HA 2UZ3A 2WHEA 3L79A 5LD2B 1Y5NA 4N3GA 5EZ6B 3JQBC 4J0FA 3TG8A 4RIGA 2A0UA 1NKTA 1DKQA 3O7WA 4CQMD 3UMMA 5C5EA 5CXSA 1ZEJA 4URWR 6ADHA 3DNMA 1ZA1A 4Z99A 3TTUA 4H7DA 3MFYA 1Q1BA 4GBGA 2WFLB 3IVCA 2WVJA 1YMUA 3G0GA 3N28A 4MRNA 4Q37A 4CM1A 3WLRA 5D3MA 1M83A 2OB2A 2F1OA 2LDXA 1HFJA 4OHZA 2A3NA 2MINA 3ASUA 3UKJA 1CS0A 1VZ2A 2YHAA 5EEHA 1I6LA 4LZPA 4PYRA 1KO7A 1TVMA 1N0VC 2AVNA 2CSUA 2YRXA 3A6LA 1KERA 1J33A 1ZN8A 3BBPA 1RADA 3M5PA 5ECDA 2C98A 2PZJA 3NVMB 3V34A 3T3GA 3UYKA 4ETWA 3JYPA 2NTJA 1YAHA 5I9SA 4Q7QA 4B3SB 3CLKA 3JARA 1YNOA 2WF5A 3E9QA 3GUHA 2MMCA 1E2MA 4DT1A 5ALZA 4MQUA 3K0AA 4TLBA 4DNOA 1FZTA 4LJAA 2CXOA 4FXOA 4GZ5A 1U8ZA 3PPXA 4EECA 2H1LA 5HKBA 5DGTA 4MARA 1I1HA 2FEAA 4RNDB 3H2HA 4ZHQF 4PANA 4IIDA 1AGNA 2AG5A 4YB8A 1BRMA 4ZTUB 4P2BA 4TLCA 3WGZA 1USUA 2ZAMA 5DSXA 4TX1A 1XLUA 4YDQA 2HRQA 1YB4A 2X6QA 5JZ9A 3A25A 1D2GA 1IIRA 2R6R1 3NRJA 3GUVA 4WNAA 5IAKA 3IUNA 5REQA 4ALKA 3WYBA 5B7GA 2GBPA 3DVRX 1N1MA 2XUPA 5JNUA 1IXKA 2EBFX 3FJYA 4S24A 4CKEA 2YJ6A 1NR1A 1XO1A 2ZTHA 4ZXFA 1H3NA 4IP0A 2VAPA 2YXDA 3H5RA 3OPYB 4I7EA 1J5PA 2BI8A 5JANA 2AC4A 1CK4A 2QT9A 1SA0B 2BMVA 4JJ7A 1R0KA 1RHKA 2ZBVA 4LYAA 4NH0A 3V8PA 4I4TF 5FOSA 1TKCA 4B6RA 5LU9A 4O2BA 1U3GA 2LCIA 1C14A 2V7EA 5B53A 5L6MB 1UFKA 5LQJA 4TQUS 3EIQA 1BOFA 3CURA 3M6UA 4HYQA 1RPZA 1XZ8A 2JFHA 2ZUEA 4OGFA 1PQ4A 1YE5A 3ZXIA 2OMKA 3DLAA 3ELUA 2OLJA 2P69A 2L0XA 3TLBA 3KOUA 1VLMA 3TTTA 3G0OA 3H2BA 4C1NA 3DE2X 2HA3A 4QHYA 1FC0A 4KNYA 1GGHA 4BNDB 3ZVMA 4LJ4A 4DLLA 3DG9A 4LJ8A 4R40A 4BZPA 2EFDB 3R9XB 2ZT6A 2JS7A 2WI8A 3HZZA 4O4JB 4GI5A 3HB5X 4RK5A 2JJQA 2XR1A 1HSOA 4FMDB 4ZARA 3PGVA 4DMHA 1MU0A 1T1JA 1FW8A 2W2NA 2XIJA 2C20A 2ZWVA 3A3PA 4ZV9A 4ALNA 2NUTA 5LDDC 2ZWIA 3RVRA 4ZVRA 2QYSA 5BWCA 1AZWA 2I2AA 3LBHA 4JQYA 1A0OA 1U1DA 1WUTA 2BGMA 4XUGB 4ZA2A 1MB3A 1T6ZA 2VPQA 3IO5A 1LPOA 1MB4A 4TS9A 5CURA 1TCUA 2OBMA 4ZV4A 2M98A 2N3ZA 1U2DC 1W35A 2ZTLA 1IBSA 4PINA 3RVJA 3ZE6A 1Z29A 2DTDA 1WDKA 1JJBA 3NBMA 1Y5RA 4EPVA 3TUIC 1UUFA 3PFHA 3PUZA 5PGMA 2Z56A 1ZGGA 2HDWA 3VSAA 2P79A 3OIWA 2C9ZA 4N4AA 1A72A 3H04A 3B9RA 3BFVA 4KAXA 4GPTA 2R8EA 4URFA 1RMYA 3IE0A 1M67A 3WNVA 3G5AA 4FFDA 2N0SA 3OQ1A 3THWB 4BVAA 5AUOB 5C1PA 1ECLA 1GPJA 2WJGA 3BB4A 3LHFA 4FNGA 4OP3A 1TUGA 4KRFA 4AI6A 1TMKA 1UP4A 4LVUA 5AR1A 2EP8A 4JSTA 4LDZA 1RKXA 4G0MA 3ADBA 3M89A 1M1NB 3TIFA 1W0KA 2CFOA 1UPAA 3QI2A 2BH9A 1GGNA 2Q8PA 2YC2C 3GT4A 5KJ1A 1KYVA 4K87A 2ORYA 3O9ZA 3D6UA 2X14A 5AKIA 1E9VA 4ZAZA 4ZQBA 4B2IA 5CBPA 2W6OA 2Y93A 3L7MA 1NMQA 4J2OA 1PG2A 4KPUB 2H9IA 1NTRA 2XE4A 4YRRA 3H2YA 4E5YA 1XDWA 2Z8XA 4ROTA 4GYJA 2TECE 2HXYA 5DO9A 3RDPA 1IVYA 4RKRA 1NVWQ 4BQPA 2O8FB 4I66A 1JFLA 3LY7A 2XTZA 4FC7A 3IQFA 5ITZA 4V0SA 3SYKA 1RWVA 1Y48E 2QTNA 4XIFA 3VPFA 4ZMBA 5KTSA 2QBYB 3E1SA 1ECCA 2V9CA 4HH4A 4JENA 2XMCA 4NRDA 4RQBA 1QONA 4LBYA 4TWZA 5ALEA 2ATCA 3C6BA 3L0DA 1K6IA 5D3KA 2P5SA 3H3FA 3IEXA 4P34A 5HKKD 2N9UA 4TYMA 3V1YA 4YRZA 3U7FB 4ENVA 2JBAB 2PL9A 4ME6A 3DAFA 1HLGA 3GB9A 1VKNA 4MS3B 4OQ4A 4WBNA 2ODTX 2JGDA 3LT1A 1L7XA 3KPUA 2Q1YA 2RBEA 3BQMB 4JEMA 2HRZA 4L4XA 5ALDA 3RSGA 3W7VA 1OROA 4FWBA 4ZO4A 5LQSA 4CLOB 1Z34A 1CZLA 5HZMA 4OXNA 2FSUA 4CMEA 3R5TA 1TAGA 4I5IA 4O1IA 5DM70 1WVMA 3MSCA 2BKAA 3T1NA 1FP2A 4C78A 4U00A 2OCPA 4LXTA 1NZJA 2V3WA 3QVTA 3KQPA 3OVMA 1JTFA 1T5BA 1CYEA 1DP4A 1IRXA 2CFCA 4FGWA 4E5UA 2ZVQX 1YKFA 4IJ6A 3M83A 4LSMA 1VBFA 3OOJA 4KTVE 3E5NA 1NG1A 1X9GA 4FJ2A 3U60B 2R6DA 2P4UA 4R71A 5LPNA 4ZGWA 3SVLA 2FZLA 5FORA 2E48A 1V5IA 2H5EA 2P5TB 1N0WA 2WAYA 4KKVA 3H0EA 1QM5A 4JV5B 5JS1A 1Z8NA 3G9QA 5K3DA 4UEQA 2VT2A 3JWJA 3AVPA 3A3YA 3NS7A 2EL9A 2JVIA 4C3ZA 3SMVA 1SWWA 5E6RB 4NU6A 1VJ5A 1FUIA 3GYBA 3D8UA 2JFPA 2DBYA 1O8BA 3AR6A 1T8UA 1ZOIA 3RBXA 3AXTA 5TEVA 1NVVQ 1XTUA 1WMAA 2D0OB 3CF6R 4O4JF 4N8EA 3FW1A 5TVGA 2GPAA 4UVHA 4EB6A 1VOTA 3FLBA 4GMHA 3SP1A 2WNSA 2BTEA 1CHNA 1WKCA 3R6TA 3H2ZA 3PE4A 4NYMQ 3HVKA 5AI4A 1QQAA 4QDZA 4X41A 4PYIA 4XM2A 3BWEA 1Z6XA 2HGZA 3CJTA 3L6OO 2NSJA 4KVZA 5AK5A 5AXBA 2RE8A 2ZB7A 1QFYA 2GERA 2BFBB 2E4WA 4AX4A 3F6RA 4MB2A 1ZVJA 5IAGA 1NUQA 4J49A 5L3QA 1HWYA 2QXTA 3LBYA 5TQ0A 3THYB 1FRQA 1U0HC 1VHDA 2L2QA 2BFNA 2AFIB 2GCPA 2ZJ5A 1PFVA 3C5EA 2B69A 4FEEA 1R9GA 2ZKLA 2W4MA 4D80A 3DVLA 4J4BA 3WKEA 2ZPUA 3ZWKA 4KPEC 1HRDA 1IN6A 4POAA 2D0PB 4QBTA 1ZMTA 1O95C 4NZPA 2C7OA 2RHJA 1F3OA 3ANTA 4CM3A 1IXYA 3U4MA 4C0AC 5INTA 2JI6A 4AAYA 2HUNA 5IF3A 4MIYA 1TTTA 5HE8A 1CQZA 5C5IA 5LXTA 1HYQA 1NVAA 3MAJA 3SSMA 1T2EA 3FGOA 1ZJ6A 4GBJA 4LJ7A 4RGBA 3V8EA 2Q6VA 4F3RA 3LSYA 4WBXC 1XWIA 2C5FA 5A4AA 4KTTE 1TF5A 3C3WA 5B1SA 4KITB 3FIUA 3HYTA 4PC7A 1NDHA 1JDSA 1IZZA 1QWSA 3LYHA 4XD2A 5P8WA 2AR0A 3WGQA 4BMYA 4BU1A 1IQRA 3EA0A 3EF1A 5B7PA 1XP5A 3Q12A 4IMJB 4L8FA 2OA0A 5EQFA 1QMPA 2X7HA 4BLPA 4MR7B 3QVGA 4TRNA 2WK1A 3DT8A 4AN0A 4E7OA 1S1MA 2PRYA 2WQZA 3LVBA 2I6TA 2K87A 3DXFA 1VRWA 2YWHA 4W1RA 1KZ7B 3HN7A 4ARSA 1I2DA 4KO2S 1NIJA 3A9WA 3PNKA 1KOJA 1W85B 3NHUA 1EWRA 1GVHA 2PUJA 3RFFA 1L9XA 1I1NA 4LYYA 2ZAYA 1IWPB 3HJHA 2KJQA 5ALLA 3ZJVA 1KFBB 2YL2A 3DE5X 4R6WA 5B12A 2NV0A 1PS8A 1KK0A 3PPYA 3Q7EA 4ZEXA 2JI4A 4TV9B 1NUTA 2P8SA 4DIFA 4WEOA 3Q2IA 1Z2OX 4HD8A 1ZITA 3GGJA 3JVIA 4PSKA 4W8HA 5EFZA 4AUEA 5JHGB 4F60A 1A50B 2ZAOA 2HRBA 3WKAA 1ES9A 3SQNA 2OD7A 5FL3A 5BMVF 3IQDB 2V5UA 2ENUA 3I37X 1GKIA 1PK7A 3D02A 4HX9A 4BL5A 4AWAA 1TYBE 2AC2A 2J9FB 1YQXA 3ABIA 3DZ8A 3PJFA 1AKNA 1UC9A 1WSAA 1YRHA 3DE3X 4FDVA 4JJIA 2ODEA 3P8ZA 3OCUA 2GPJA 1DIAA 3PXXA 4JLWA 2OFFA 4D9NA 1QSGA 1E9FA 3WQBA 2WKQA 1C9MA 2A9RA 3G9ZA 5JAPA 1GR0A 4B5KA 3E2IA 1N3BA 5ENZA 2IHUA 3CMMA 3PGLA 4HDMB 5ITWA 1QGZA 4WFQA 2HZBA 3KL4A 3Q8WA 2VJBA 4C6HA 2HF8A 3MRTA 2QVGA 1T5LA 3ZGVA 4JVOA 2HIHA 5F64A 3V9AA 1V7CA 1NHWA 3AZQA 3R3YA 5THXA 3G5UA 4CF4A 4RTJA 3AHIA 3ROGA 4U2GA 1GUDA 1LDBA 2ZT5A 3GCXA 2ZREA 1DDIA 3I6ZA 3IALA 3KHTA 5HBRA 1E96A 1YQ9A 1MC1A 2CXXA 1P80A 2GCIA 3I0NA 1ZC3A 4X6YA 2FWPA 3NHMA 3W4KA 3EQ8A 2WWRA 1JFSA 4A73A 1MUUA 3OU2A 4Q9AA 4WKOA 3IBYA 1PEDA 2PS3A 4NU8X 5BVHA 2H5LA 3D7LA 3JYOA 1EK6A 1V8ZA 3OEWA 4DQDA 3QUAA 4KACA 4C04A 2QTVB 1CEEA 3SQDA 1NLMA 3JATB 3KV3O 4IIGA 3EDOA 3ND8A 4V38A 1D4ZA 1UPXA 4MV5A 2FSGA 3EXEB 1WF3A 2Q3EA 2W93A 3BSWA 4KVFA 4G0XA 1L1FA 2W2QA 1V47A 3OT1A 4G5QA 2VJMB 3HMKA 2JPDA 2EZTA 1RBQA 3V3KA 5B2FA 3LIIA 4YJFB 2AE2A 2GCEA 4B73A 4EMUA 4ZKDA 3F1KA 4AZ0A 1ICIA 3PWTA 1Q7RA 2GFHA 2OV4A 4BVKA 2W7TA 3FE2A 5LLDA 1NMYA 1X3LA 2NZ8A 4LY0A 4AJPA 1CQWA 5TPWA 1Z4JA 2AEEA 5KNBH 5KBYA 3OLWA 5IABA 3HACA 1GPYA 3PXDA 2YXNA 3GLRA 1KI2A 1Q19A 2VRBA 5HWSA 2PT5A 4RTLA 3K9CA 5ENDA 3QXXA 3WYCA 4Q7EA 3AY7A 4XIIA 2JIOA 2YJTD 4R8SA 1PFYA 2W0MA 4JLBA 4I36A 4W5OA 3HLYA 2PT6A 3P27A 3WGLA 5BVGA 4RPLA 4Z4IA 3BTUA 3ZCXA 1BAPA 3JD1A 2EX0A 1X7WA 3NYRA 3ANSA 1RPTA 2AFIE 3U1BA 4LXUA 1C3LA 1FTYA 4YAIA 2P3OA 1U9JA 2GRUA 3PGXA 3KXKA 4QUBA 1H9CA 1EAYA 1WR8A 1ZJZA 1ZX1A 3ETJA 4AB1A 4EEKA 4OMUA 1KMHB 2IRWA 3L5KA 3IJ5A 4FKMA 1JLSA 3PIIA 1PR2A 4J2TA 3ZVLA 3KTOA 1MVNA 1ENOA 4ISBA 5HG0A 2I8LA 3WL8A 5L7WA 4WCFC 4X54A 4XDGA 4W63A 3P0RA 4DNFA 2W6ID 3TMKA 1KI7A 2YZNA 3O4FA 3IIJA 1KSFX 1MAUA 2D74A 2ZE7A 1RI2A 4K0RA 3BUSA 1CUFA 3WB1A 2XX3A 3N7TA 2GWRA 4JB2A 2GTHA 2O3RA 2Y1OA 3AFMA 3NALA 3S5UA 3IE1A 3PX2A 4M9RA 3IBGA 3F4KA 4AO8A 5EJ5A 5GAJA 1GZDA 1JA0A 4N6OA 4N5HX 3KDAA 3DLPX 1ZA2A 3KPJA 3MJFA 3R20A 1E7MA 4E2ZA 1SURA 2RK4A 1T5DX 3EZXA 4KU4A 2YV1A 4P3PA 1K9SA 3NV9A 2F43B 4FZJA 3B9BA 4LRSB 3ZY4A 5IUJC 2PUEA 4UE6A 1UBSB 4ZI7F 5ABPA 2BGWA 1B8OA 1XC7A 2NUPA 3ED5A 1QCZA 3NUGA 3O93A 1BJKA 1JW9B 5JXGA 4EL0A 1TKRA 4M22A 4I99A 4PNZA 2QOEA 1SBZA 4B0PA 2VDRB 4R1TA 2W6JA 4KRXA 1FQOA 3O91A 5J4KA 3CINA 5LM3A 2HGSA 1L8XA 2OD2A 3LOPA 1Q7BA 1P5FA 3RBZA 1G2QA 1I4TD 4BZXA 3FUXA 2WYUA 3LUGA 4QYXA 3SGLA 1GQ2A 3LQYA 1PCXA 4D8YA 4EMBA 1DUVG 5KS2A 3JAMA 3MB5A 1EFVA 2Z30A 5KTKA 2OMEA 1IHYA 4MMXB 2QSUA 1EFTA 4YJ3B 4MINA 1XTTA 3T7EA 1EFKA 2QS9A 3HSYA 4EJ6A 5B3JC 4PC2A 4M0FA 5KYXA 2NSHA 2E87A 4KRGA 3FTPA 1AO3A 2LIVA 3IAM6 4O5OA 1FXUA 3OETA 3STHA 3TLZA 2XKBA 5KO2A 4YLGA 4BBPA 3IGFA 1P29A 2PMFA 5LZ8A 2ZU0C 5T4EA 1B0UA 4DDMA 5LNK1 4L8YA 3SICE 5FP0A 1W5SA 8ABPA 3VJLA 1PJ2A 1SXJC 2GKSA 2WF8A 3GY0A 3I3OA 3KTAA 4GXNA 4GZMA 2XVYA 3DKVA 3VOTA 4BKRA 3BMQB 1Y8ZA 4ZP1A 3HPRA 5A06A 4ZYUA 1I7SB 1JEDA 5AW7A 4LJKA 4PZYA 1W0JA 2HIGA 3NBYC 4X1IB 5JZBA 1J8QA 1KFEB 3MFQA 4GR9A 4R2JA 2RAPA 1XPOA 2FP4A 1NV9A 2HA5A 1C8VB 1M6VA 2DHDA 2FX5A 2REBA 2NG1A 4IQ8A 5H83A 1NRXA 3KG2A 5HM8A 5LL6P 1M2OA 4JXJA 1J2TA 2Z08A 3NKFA 1GL6A 1JRLA 2H7CA 4TXLA 1U3FA 4E31A 4KB5A 3LVQE 1AKQA 1T91A 1PZHA 1WUYA 4K6MA 3GBPA 3PXCX 1NF3A 4Z7NB 1YFKA 1NATA 3TFOA 4N6NA 3KUCA 5EGSA 4G5SA 1YZGA 4H60A 4JLUA 2BTOA 2AMVA 1NQAO 1RTKA 2QTWB 4JBXA 4N5NA 1JAZA 4UNQA 5EMLA 2WDZA 3AETB 2YWFA 3K5IA 3STVA 4FKBA 2P1ZA 3OKPA 1MIOA 3E0QA 1Y6FA 4ATNA 3CW8X 1ISPA 1JEAA 4YLEA 1E3SA 3ZIAA 2QV0A 2C4WA 2VZLA 1I80A 2HJHA 2AWNA 1W6UA 2FSHA 5I9BA 3KJGA 3ZWBA 5KOJB 3I9JA 2PX0A 4GM4A 1Z12A 4NCJA 1R6DA 2M2IA 3E3MA 1XCGB 2O2DA 3SR3A 1ZAYA 3D2LA 5AUQA 5J5AA 5IKEA 1OH5A 1QORA 3D1JA 1TEVA 2OCXA 1A2BA 2BGGA 3DZIA 3EGXA 3WDMA 3W06A 1AN0A 4Q7MB 5DLYA 5BMOA 3RIYA 3AM5A 3FLMA 3LQ1A 4CDMA 5AI9A 1TZBA 4QDXA 4Z6KA 4OK5A 4EWLA 1F8GA 1SOAA 4D3FA 1OXMA 2XUZA 4QODA 1Z63A 1GQFA 1F0YA 4N82A 1TD1A 3GRPA 1FTQA 1GCOA 3FTNA 5HR5A 2DPMA 4NE9A 2FJ0A 2V65A 2V45A 1LBEA 1P4JA 2XCUA 4HDSB 4Y30A 2Q5OA 4NOJA 2VBFA 2WF9A 1K3FA 2B21A 5DM0A 2FGKA 2W11A 4QOGA 5KAMA 4GT1A 4KR7A 2G1AA 1J70A 1K2VN 2QR3A 5FR2A 5EKXA 3ND5A 4FZVA 5IDQA 1KR5A 4DR1B 3IV7A 1XTPA 3TLXA 3HADA 2Y99A 4QL3A 2O2ZA 2XWPA 5KVSA 2BJHA 2Q07A 3WS7A 4DC9A 2W6NA 2QN8A 4MVJA 1G55A 4MLCA 4BFTA 2BEUB 2FMHA 2FPGA 4EHDA 5B55A 1SUAA 2PH5A 3L77A 1N9ZA 1XCLA 3SD7A 4D96A 1YQQA 2FUG1 2GFIA 4RJ2A 2NO0A 4INPA 1G3IA 4OXKA 1HMYA 1SRRA 1NJ1A 4PYMA 5ADHA 1VLVA 4YXWD 1UP7A 3ZDCA 1RXSA 1XZFA 1HDOA 3NBZC 4AQDA 1GPKA 4S0XA 1JIVA 1XZAA 2D59A 4FOOA 4KOEC 3ZCRA 2CLIB 3M6WA 4LZZA 2O3SA 1NKSA 4YTEA 4ZYWA 1O4VA 3RRBA 3T99A 4PZLA 2Y2UA 3PEEA 1IEQA 3WYEA 3ZD6A 2YY7A 3TIGA 1RQGA 3F4LA 4RVDA 3V6MA 2O8EA 2YINC 1TDJA 4FB4A 3AJDA 4IDGA 2BDEA 3JQAB 3BWXA 4BGDA 4HXEB 3HS3A 1AUQA 3G2LA 1KDZA 3KK0A 2ZRBA 2XUIA 3KWMA 3VR6H 1AZLA 4DEYA 4DNXA 2PV0A 3GLFB 4WLOA 3RJ5A 2PX4A 121PA 1NNI1 1Q0QA 1J2UA 4FGLA 4FFWA 1JKJB 1WCV1 2D62A 2E0IA 2IDJA 2GZDA 4XM0A 1CY2A 3DZFA 3BJZA 1SCAA 4V0NA 3CH7A 5EWJB 5FUQA 2IHKA 1QH8B 3P9QA 5F9HA 1N6OA 2AHOA 1H2YA 3HR7A 1QJCA 1QR6A 3ZHUA 5M7EA 2REQB 4O4HF 3BXOA 2XT6A 1JQDA 4P38A 4DILA 4HDRB 3T5MA 3K53A 1YRWA 3T5DA 2C42A 4HG2A 4HAXA 1DC4A 4XQGA 2BUCA 2IYUA 5ALGA 4KBFA 2JHFA 5CFRA 5E1OA 4ZI5A 4BX0A 4DLAA 3I6QA 2ZYGA 5EN4A 4PZCA 1JB9A 5CD1A 4EYOA 2HF2A 6AT1A 4EDFA 1Z4LA 2C4VA 4PWYA 4YIHA 5ES4B 3ZC3A 3IA2A 1N25A 1T2DA 1WCYA 2C4KA 1C5KA 1DKRA 1LNZA 3JQ8B 4QOEA 3IBCA 1YZFA 4BNVA 2MSWA 3FVQA 1E8DA 2PAFA 3JD0A 5GJVC 3RB8A 5HKAA 3HGQA 4J6FA 4CI0B 4F6RB 1VG8A 2IEIA 4JLNA 1X8JA 4MAMA 5DYWA 4BMZA 1QFJA 3VR4D 1CDZA 3GJYA 4AW9A 4UTVA 3HFGA 5KSZA 2CNOA 4ID9A 1SVLA 3F73A 1EM6A 4K5QA 1XTBA 4OXRA 3CEJA 3QY9A 4Q03A 1SC6A 5F4ZA 2HA7A 2PGNA 3C6KA 2IXDA 1W36C 3LPLA 1KSJA 5TF4A 2AZ4A 3WIUA 4PR0A 4AJNA 3UMVA 4GXQA 2HAEA 2R5FA 3CS3A 1V37A 3G8DA 4RU1A 1ZESA 1HYHA 4HBZA 1S2LA 5EJGA 3TIVA 1HORA 4I50B 2J6IA 5FBHA 1DELA 1EK0A 1LD3A 3BDVA 4JUCA 1RI5A 4QFBA 3W2HA 3PNOA 5CEEA 2QSJA 4IIJB 1O95D 1A4IA 2RHWA 4YC7A 3RTBA 1XZMA 3EOBI 1U9IA 4UUAA 5C3UA 1TUEA 4LZLA 4Z8XA 3VR3A 1E18A 2OO5C 4BQEA 3QA3E 3BGIA 4XWOA 5LQKA 5E1BA 1K7XB 1EUDA 1T2FA 1D0IA 2HBYA 2RH4A 3MLAA 3UXEA 3MCZA 4QM6A 3HJAA 4U2EA 3SNKA 4FGKA 2BFCA 2JFVA 2NYAA 3DAHA 4NBRA 5LP6A 2FEKA 3RUDA 1V1MA 5IYZA 4KLCA 3U44B 3U16A 2Z95A 5T4BA 1FX1A 1P0CA 4QFMA 2JEOA 3VC7A 4BNWA 3DM9B 5AW0A 1KIMA 2EU8A 2BVNA 2WR8A 1XCBA 4KIFA 4RENA 1DUSA 3U4CA 1SCKA 3JQAD 1H2EA 4LBZA 2H06A 3M9WA 1WG8A 4LSGA 2WE8A 3RABA 4AP5A 3QIVA 3PRYA 4OMDA 4BGEA 3WNZA 2EEZA 1O8CA 2VPIA 3D6JA 3W1WA 3NHKA 4RNCA 4WRRA 5AKEA 5DYNA 4AJJA 5AW5A 1LJUA 5EC8A 2C2ZA 2XB9A 2WVGA 1ORDA 3GHYA 5D3QA 5ALXA 2IV7A 3EULA 3QFCA 1WB5A 1J20A 1UXGA 2NTNA 3OSUA 5EZYA 2C9BA 1CS4C 2YNMC 2O2SA 5DWQA 4BMDA 4LXGA 4E3ZA 1XNGA 4GOLD 1JEYB 4BZQA 1SUSA 5I7RA 1ZS9A 4MPTA 4BNUA 4LMAA 1MT0A 1GPH1 4A8PA 4ODIA 2ZDHA 1UXKA 3ZV7A 1DSSG 3UEOA 1L4EA 4BZZA 3IAS6 2H2GA 2X15A 5BN4B 1I10A 2K7ZA 1YZTA 3FOCA 2PHZA 5L3SB 2AEJA 4IXWA 4II7A 5FJIA 4OI1A 4RPCA 4D0LB 2E18A 3LC1O 5JMTA 1KMCA 4C7OB 4YT2A 2Y0DA 2ZJ7A 1ZSYA 2HDHA 1R9NA 2BZGA 4F91B 2XUHA 5FWYB 3ZHOA 1TZKA 2V3VA 2QE7D 2FPSA 2B98A 2CXSA 1NFRA 2HC9A 3I5UA 2PYIA 3CKKA 4KSYA 2ZJ4A 1WOYA 2OORA 3I76A 3QLJA 4A7PA 5DGHA 3RG8A 1EG2A 1I7NA 3MWLA 1TU4A 3TIIA 4RULA 1F2DA 1OWPA 1TQ8A 2P9HA 3DMGA 4U7DA 4UMEA 3EMBA 2VRCA 3DE1X 1QYXA 1D09A 3HXTA 1EGQA 3LUBA 4IHKA 4OB6A 3NHWA 5EJEA 5IC4A 2H3EA 3DPUA 1NULA 4KAAA 1PHPA 3B8HA 4LV8B 3ZY5A 1ZL0A 2PFSA 3PNYA 4E5NA 4E5DA 4YRSA 3EAGA 3IS3A 1N6IA 3KELA 3M2PA 4IHJA 5JDCC 3QW2A 1L5KA 3RSQA 4Y7CA 2Q5EA 5K8IA 1G59A 1Z25A 1EU1A 1PJ8A 2B61A 2OK7A 3PPVA 3TECE 5KC8A 1GPUA 2QPLA 4QQRA 1NUHA 1QH1A 4X7MA 3RUEA 3TQSA 2H2DA 1RMTA 5EPUA 5CBKA 2XBMA 4WZBB 2H4HA 3OJEA 3CLUD 2IUEA 5KTRA 1KJNA 3ULKA 2HM7A 1QC5B 2ZRCA 1X7XB 1J97A 2H1IA 3B2QA 1L5HA 1QV7A 2IYXA 5JAMA 4BQFA 2CN1A 3O8QB 2F8SA 4BMSA 3GV0A 3IQZA 5FLKA 1EFPA 2G6BA 4J16C 1PFGA 4N0MA 1PR6A 5K6AA 2AZDA 1PS9A 2E89A 5LZ2A 1W76A 3FMVA 4Q66C 4B6JA 2ADFA 2OXIA 1G8KA 3ZDYB 4NDNE 1MEOA 2CEAA 2PO7A 3OZCA 4Y6OA 5A9TA 3RYTC 1SB9A 3VU1A 4OSPA 2W2LA 3FKJA 3MJRA 4JS0A 4L8GA 1MHPA 2Q3DA 2GK4A 4Q1BA 4RDCA 3SX4A 3DD1A 3ASZA 3OX4A 2NVUB 4IIJF 5B7QA 1NP3A 4DKJA 1CR0A 1PV4A 1SXJB 1AXRA 3MTBA 3VU3A 1ZOSA 2UVDA 4R9UC 1GG8A 4HRYA 4R0VA 1ZGZA 1YS2X 4OHCA 1M6EX 3GCWA 3L0PA 2X6TA 4WKPA 3AM1A 2ZE8A 3PKZA 3KSRA 1TK3A 3LA6A 1BCRA 4MUEA 4MWGA 1B6SA 1NQOA 2JAQA 3KB8A 2PX5A 3ZDAA 4LDJA 2PL3A 2DWPA 2HCTA 4AU1A 4YGYA 2HJGA 1W4AA 1YRLA 1U3CA 2Q2OA 3MQ4A 5L6LB 4AO7A 2ABWA 4AJOA 3CX8A 5B58C 3PVCA 4ESEA 1YS4A 2AYYA 1R3DA 1JALA 1GEGA 4Y6LA 2C59A 2OBNA 5CPBA 1M2EA 1R0LA 2FEXA 3WSWA 3UOGA 3LOUA 2OZPA 3QEJA 4C88A 2LCFA 1TQDA 2XMQA 4GX1A 5IHXA 5JBNA 1PJLA 3F6CA 3OM8A 5FUVA 4R2IA 5IM5A 5K3CA 4U7GA 3QFTA 2YMLA 5J5VA 4UTPA 4BJ5A 3V1UA 2QVBA 1HDGO 4JHLA 3LWDA 5K5EA 4LX0A 3KKEA 3IOYA 2HOQA 5DJ5A 3ONVA 1QU2A 5T41A 4QWMA 2OGTA 2C95A 3DT9A 2ZAIA 3G1UA 3UUGA 1PE0A 4FHZA 2CXNA 3PB3A 4F38A 1ZXBA 5HRAA 1FLNA 3G8CA 5D3ZA 5ESRA 2BHTA 5F7XA 1N2HA 2N1MA 2WOOA 4W8GA 5IANA 2AJBA 5SZKB 4HSEA 1O94D 2JK1A 3F8TA 3QVSA 4DWOA 1YCHA 4DIKA 4FFSA 4WADA 5CDHA 4N39A 1UJMA 3KYCA 2UUAB 2D1FA 5GZ3A 2J32A 2ARKA 3FOZA 1IPEA 1CQXA 2J3DA 3H11A 3JQQA 3F3YA 4OH7A 4OMCA 4TS3A 5ALMA 5FWDA 3V8VA 4AYXA 2VH5R 1JG7A 2CYCA 4INOA 3NYQA 4YI3A 4HMQA 2KMLA 4MO9A 5AJZA 2CV0A 2NP7A 3TO5A 3ZU2A 1SD1A 3GARA 2Y6VA 4RW0A 5AI6A 2CLCX 3NCHA 2X1LA 2CDRA 1X2BA 2X2OA 4FI3F 1K9VF 4I9FA 4MR8A 3ILXA 3MEQA 2ECQA 3UC9A 3ZLVA 4HFNA 2OOSA 4A3SA 3F67A 4GIBA 3VO9A 4LE0A 1O6GA 5JRZA 4XGKA 3K8OE 2Y1XA 2MSCB 5MN6A 4URZR 3FJ1A 4ZU6X 2VJCA 1CFZA 4J0HA 2PMCA 4GMXA 1JVNA 1R4ZA 1GUBA 2XQJA 2YWDA 2ZSEA 1U1CA 3K72B 3PR1A 1N2JA 1AA6A 1BWRA 1XCMA 2OP0A 2AYXA 4P58A 4IYRA 1SUIA 2Q46A 3H6HA 3TRIA 5F5LA 1ACLA 3AX6A 1K63A 2DMRA 4MITA 4XQ9A 3JVUA 1MCZA 4LHZA 5DGCA 5JYCA 3AF4A 4B87A 3EPLA 1TMOA 2C61A 5C80A 3V1KA 4J7CA 4WN3A 4OHOA 1L4UA 4NYIR 1XRPA 1EWKA 5TMEA 2C03A 1WU8A 1NLUA 3O94A 4UEOA 1UDBA 3N87A 1PQUA 3SXUA 4BX9A 2C3OA 3LKBA 5JJLA 3QVJA 1JHRA 1SXJD 1ZY2A 5ALKA 3AI3A 4TLMB 2YASA 3HY3A 4ER3A 1H4QA 3DE4X 4M9ZA 2JIZA 1I94B 4NBVA 4RAQA 4PZEA 3OZ7A 3FUUA 3V7UA 3VHQA 4ZO7A 1U02A 4ZAVA 1OTXA 1TM5E 5U4XA 3RG2A 2BFEB 2JVJA 4IFEA 4M7WA 5JXHA 3L8YA 2QJWA 3CVWA 2O8CB 1UFVA 1XR3A 3DLCA 5B7NA 2YR0A 3B5JA 3H42B 1I0IA 5K01A 2VZEA 3OPNA 1RYBA 5DNEA 5LA6B 3WJ2A 2C77A 3HFSA 4BWVA 1S5PA 3PWKA 5AM5A 2FXIA 4LYDA 4AN4A 5C8XA 5I7VA 3CVXA 1KKLA 4ALJA 2XYGA 4GM1A 1VYHA 5AVQA 4C3OB 1XZJA 5G3YA 3T9EA 1ML4A 4PHFA 3ED1A 3DVQX 4UXJA 5JALA 3X1YA 1FLAA 2XLBA 2C5LA 3JQGB 2OOKA 2VYQA 2UAGA 2PMEA 2VQSA 2YHUA 3KX2A 3KXLA 1JB1A 2JFWA 5B1IA 5K3FB 4IKEA 3CQ9A 3IAAA 1USKA 3GEMA 2X8JA 1MO6A 5HOEA 3FTQA 1WY7A 2GLXA 4FHGA 2JFNA 2PNFA 3H9JA 3UK0A 2CZQA 3ZH9B 2ON6A 1ZGBA 4HDNB 2YMQA 3UK1A 2GHQA 2ANCA 3JZAA 4AWXA 4M98A 5JSZA 3MXOA 1QOQB 1Z16A 4M88A 2Y1WA 4HGRA 4JVSB 4OQDA 1T3ZA 2I67A 4DW8A 3SSAA 3Q7RA 4LW8A 2G71A 4FEGA 1M1XB 1T9KA 4JJ8A 1SXJE 1DXQA 5D6NA 4WNIA 1WMDA 4JYAB 5AOAA 2NO1A 3K9WA 1N34B 1A9TA 1ZJYA 2WT8A 2J30A 4XTRA 5JV5A 1P9NA 2PUCA 3NCTA 2X1HA 2O5EA 1KZ9A 2Q8QA 3KC2A 4A26A 2CJWA 1A4RA 3CU5A 2AJLI 1T8SA 1ADCA 2ONKA 3ADPA 5E0KB 3SM3A 3TLAA 4EW2A 4L0QA 1BMTA 5K3BA 3WWYA 1EA7A 2WWFA 5AYVA 3ZHYA 1QHHA 4LF7B 1ONOA 1CW2B 3CVJA 2G72A 3ICWA 2O0MA 2VOEA 1LPAB 1GARA 4IFIA 1GUAA 2H31A 2QROA 3KUDA 1P1RA 2EZUA 2IY9A 5DI3B 4C0SA 4EB3A 2CJFA 5AICA 5JNRA 4N5IX 1FMJA 2OQVA 4BNTA 4LPKA 2C7QA 4MUYA 1SCIA 4X9XA 3PFFA 3T7KA 5JQWA 1D1SA 4Q19A 1KQFA 2O1SA 5F3DA 4DIOA 1ZO8A 3A9RA 3SIXA 4C14A 1T6NA 5JSKA 5LQCA 4OYYA 2WHPB 4IRUB 3CTPA 4TWAA 1ZM2A 2O8VA 2PMBA 2O1WA 2PX2A 2Y3IA 2J7PA 2VNHA 2IYRA 1PNOA 1DADA 1YMQA 1IHDA 4RABA 5C35A 1XPRA 1QQ7A 4EUNA 3ETNA 3LGSA 4CN8A 1U8CB 2I8CA 2JGIA 2DUWA 3IJPA 4FT2A 2P8JA 3HCDA 4QYMA 1IUKA 1O0SA 1R6UA 3E7WA 3IIIA 3WXMA 4D9EA 1QFXA 4DCJA 1F0NA 4B35A 3EFEA 4KO1S 2G5CA 3GRCA 3EG9B 4JLOA 1KOFA 2GPSA 3WG9A 5G1PA 3V8BA 3EIWA 5HFAA 4P8RA 1SY7A 1W2WB 1XIVA 4GI2A 3TB6A 1ZNXA 2DUJA 2Q3MA 3EXFB 3AVTA 4YMSA 4RDXA 3KWJA 4LDQA 4BO3A 4YCLA 2IBSA 5CB8A 3SZGA 4A8TA 1DFHA 1R4MB 4DGSA 4ZYYA 3GNSA 5B36A 4CM6A 1V6SA 3OLYA 4QDJA 4IEEA 5TEWA 3DV0A 3CUUA 2NSYA 3FPGA 3HN6A 2HLDD 1USIA 2FK7A 4JCOA 5JC1A 1NNEA 3MM4A 4C21A 1RDFA 2WSMA 1F2TA 2QLNA 2IOFK 4KXXA 4OH1A 2I54A 4XGIA 3BMCB 2DZDA 4ZOLA 2WD7A 4GG1A 4IS2A 4GDMA 4PG6A 4REQB 1AMUA 1G8PA 1EP3B 1YONA 3A31A 3GLHA 3PNMA 3T7AA 2XXAA 2GN1A 4D82A 3FN4A 3D0KA 3R74A 4RY8A 1OUMA 4ZREA 5I7FA 3PS9A 3DBRB 3NIDB 1VKRA 3AESB 3R0JA 1UKZA 3OZDA 3OZAA 2YFKA 4Z0HO 3O0TA 4CNBA 1E63A 4RO0A 3VYUB 4AM8A 1IULA 5GTDA 2ZGVA 3UT5A 5JO0A 4Z1MA 1GNTA 4FD3A 2PRJA 2JJYA 3PC2A 1ISSA 3QJYA 1RKBA 4ED9A 2HA4A 4GYYA 3IESA 1KO8A 3X1KA 2NU7B 2R87A 3VNAA 1N2BA 1H2BA 2ZSBA 4MI6A 5TQ2B 1YB1A 3CZ5A 4GDFA 1T9GS 1OBVA 4LJLA 5AVOA 3RM3A 4E4YA 5M34A 3QKIA 2XGSA 4W8OA 1RRCA 1R88A 2O52A 2O6LA 5CM8B 1NN5A 3EGCA 1THMA 3TSAA 2GD1O 2QSZA 4PHGA 3JTMA 1H4SA 3EGDB 1CQJB 5JMPA 3KQKA 1Q83A 3EUEA 3ZHVA 1PTJC 3WKBA 3DKRA 3NTRA 1EK2A 4WK0B 1I9CA 1X42A 3IP6A 3CF4G 4KPFC 1YBVA 4DG8A 5BT8A 1BFUA 3K71B 2IDKA 2XRYA 5FLYA 2B8WA 2E6UX 4FNMA 3DWFA 1CKEA 1DIBA 5TJ9A 5KNCA 4URYR 4DY4A 3L4KA 4YP7A 5ALVA 3FOFC 1SG0A 2RK3A 4JASB 1P5RA 3LV8A 1K66A 1Z0IA 1IM2A 4N48A 1FS4A 4BO0A 2X58A 2QR2A 1UBLS 2Z2IA 2CK3A 4H0NA 3ZCUA 1DAGA 2XOKD 1NYRA 1POWA 3ELDA 1MVLA 1RHJA 1YBHA 1T25A 4HXGA 2IPLA 2FN3A 4L73A 2R25B 3P71T 4M0DA 4R1PA 5EPOA 3RBAA 3DDOA 2FW7A 1O2DA 1C9NA 1P4RA 2I5PO 2W8ZA 4KGZA 5HIIA 2ATXA 5KYUA 1GL7A 3DHYA 3M9XA 5AHRA 4ZC8A 2EGUA 1CUDA 3EQZA 3U7QA 3UT6A 3KNZA 5C37A 1YQDA 2VSXA 3QQPA 1I4OA 1QHNA 3QSGA 1F7UA 1XYYA 2ORIA 2JASA 3TH5A 3TRDA 3WQRA 2B3DA 2YCBA 3OD1A 5HM6A 4U2FA 5LUBA 4CM9A 4PAOA 2CCKA 3FOWA 2WZDA 3NO4A 2XECA 2W2VA 4UNRA 3EA5A 3PBKA 5JWRA 2UXCB 3PPWA 1HX7A 4NAUA 2C8VA 2RMKA 3HZRA 3ASYA 1SXGA 1E7QA 3VMMA 1NXQA 1FYEA 1TMGE 3BMOA 3BG5A 5MN5A 5E38A 1Z8DA 3QITA 1LZLA 2BL4A 3H2GA 4Q0MA 3DE7X 4DEVA 3N8KA 5KTNA 3W3AA 1CPYA 2OV1A 4Q01A 4YJ2F 3DOFA 2J87A 3IHWA 4CE6A 3OZSA 2I6FA 2H2FA 1ZL2A 4XX0B 2I76A 2XYQA 1UBTS 2DBVO 2UZ1A 1EEHA 3CB4A 4IRMA 4JROA 5KX5A 3R75A 4N6GA 3MA0A 1UBMS 2C7GA 3IQHX 3OTOB 4C07A 2CFRA 4NH4A 3IP3A 1FYWA 2ZTVA 3EWIA 3CRZA 5A9SA 2Q41A 5A3QA 1E0SA 4IV5A 4JJZA 3R7WA 3WNCA 2FR1A 2KM1A 2G4CA 3TS1A 4UTRA 2QA5A 4YRGA 4RD6A 1XNJA 2C94A 4WXHA 4G01B 1P6UA 3V32A 3JQ6A 3NNDA 1PD1A 3E9RA 3UQYS 5I45A 3HUUA 1JQAA 3O73A 1KSHA 3PDHA 5EVCA 3HR4A 1OBCA 3EDQA 1VIDA 3NHBA 4IYJA 4HV4A 1U7ZA 3GLFE 1R8XA 4EMSA 1HA3A 1VLHA 1DXOA 1SWVA 3KCNA 5JRDS 1GSHA 1OSNA 2FCAA 5ICMA 4MEAA 5A9RA 4P7GA 3TJZA 3VJKA 1ETHA 5I9NA 1YE3A 4XM1A 5COBA 2ISCA 2XAUA 2RKOA 4BNJA 5B5SA 3NTVA 4JLKA 5E1MA 1TRKA 3OIFA 5BOSA 3QOFA 4HDKA 4S1WA 1GTVA 1WTCA 3CEMA 2ZU6A 3HLTA 4DC1A 3ZJ5A 3OQPA 4ENSA 4XWTA 1J1ZA 1DRJA 1VJRA 1L5ZA 3OCWA 4PS0A 2VEDA 2DAPA 2RB5A 3AKEA 3CW2A 4RDIA 5DNAA 5TS2A 2HTFA 2QLLA 3BCHA 4S1VA 5CM2Z 1TW3A 3CRNA 3RV4A 1ZEMA 1I3MA 2KYRA 3ICCA 4R1MA 4WNCA 5LN1A 2FUG6 5J2TA 2UYGA 1GNPA 2A8YA 3I2KA 1NZDA 3CLTC 3G2KA 3UG6A 4ECEA 4XR4A 1GUFA 2P2YA 3IURA 1KMMA 2JLUA 3LWZA 2DHRA 3M6VA 2ZSHA 1H1LA 3ZD9A 4ZEOA 3UMJA 1F8XA 1NPYA 4YRPA 1SCBA 2G8LA 4D9JA 2R6FA 2V0CA 5K9ZA 4FFOA 3C7CB 2JAWA 3FPAA 1ZI8A 3CNNA 3OQIA 3QUQA 4HPWA 4MVJI 2VYCA 4CEJA 4EHNA 5BV2P 3GDHA 2B4TO 2XVMA 5TR9A 1JHAA 5KOHA 1D9ZA 4XB1A 3UT0A 2QV7A 4QYWA 2X9NA 1DFGA 1U5BA 4EVQA 5BWMA 3UXMA 3K4HA 4CFYA 5JNLA 1ZG3A 1YU9A 5TX7A 1VLLA 1VE5A 2C8LA 2Y76A 2GEDA 3M1AA 3GMSA 4W5HA 1WXGA 3ORQA 4PCVA 4D3ZA 2BEVA 3RVQA 3WBBA 4DADA 4B3GA 4EGJA 4HLNA 4UEWA 2V97A 2D1RA 1XDUA 4LYEA 5HK9A 4QO7A 1NVMB 1P9OA 2VNAA 3FPFA 3W7BA 2W4IA 4HQLA 3QHPA 1GU0A 2OXEA 1CZUA 1VBKA 2W42A 1F17A 2BFFA 3DW3X 3KEOA 1N6NA 1ZN9A 2B36A 2WA1A 3MK31 3P97A 3PLRA 4JSYA 1UL1X 4WERA 2DBRA 2CUZA 1LKZA 3BPSA 3QRWA 4RKWA 1GAEO 3A4YA 3G3EA 1FOEB 1Y7LA 2O7QA 2GK7A 5J58A 2DKNA 4L1KA 4Y2GA 2RJNA 3DOIA 3CH6A 4LVCA 3TLYA 2O0LA 5A7GA 1ZBQA 1P0QA 1JHQA 1OLUA 4RM3A 3IPLA 3SZMA 3UK2A 4AZWA 3KDPA 4NX2A 1NUSA 4TSKA 3VHLB 4JLPA 4OEHA 3U49A 3TZ6A 3WWCA 4PBTA 1E1MA 1NU8A 1CVIA 3GXBA 1BG6A 1KZ4A 2Y9MB 1Y1SA 1PG0A 1XVIA 5F77A 5JO9A 1XZDA 3VVLA 3ZE9A 4BO4A 4EA8A 1GDDA 4HVTA 4UBKA 4ER0A 2GEUA 1CY8A 3O3CA 4L15A 1BVRA 1EX6A 4W5QA 3V9PA 3RGWS 1GPMA 4D0SA 1QU3A 5JCOA 3FUVA 4DLRA 4R1NA 2WG1A 5T4HA 1U7WA 4ZI2A 2QRGA 3I30X 3KSZO 2IJGX 1S8AA 3IC5A 3O1HB 4RELA 5A7HA 1J4AA 5CDYA 3RU2A 3JASB 4I5FA 3UG7A 5I3ZA 2E4YA 4D56A 4AS3A 1VA4A 2WG2A 1IQ0A 2WAMA 4BV8A 1GFZA 3FKSD 3CLRD 3LT5A 5HZHA 4F97A 3COVA 3CPHA 1HG1A 2ONYA 3CBGA 7ADHA 4BIIA 1DO0A 5AMXA 1PV2A 1H2WA 1TW2A 4CU5A 3EEIA 4DLTA 2WJIA 1PFKA 1YQTA 2R5WA 2J31A 3T35A 1G8JA 5EP1A 4RESA 3TGPA 2OO3A 3A2KA 3B78A 2OHXA 4U5XA 5LYJA 3T0IA 2Y1DA 1JHZA 4L76A 1Z4OA 2F00A 3QPBA 3MW8A 4TKUB 4BNNA 1C9EA 4NNPA 4B8WA 3MBIA 1IBCA 3RIHA 5KQPA 2H8KA 1WKVA 1CWUA 3LP5A 2OEPA 4G9EA 4U2BA 3GRKA 5FNVB 2G25A 3SBOA 1VJCA 3NAQA 1JDUA 3KKLA 3KPYA 3PFGA 4EQ6A 1L5WA 4AJ1A 1YKSA 2NPIA 3OOWA 1JNYA 2P7IA 3KVVA 4BU0A 3HWWA 3K5HA 3IIEA 3INGA 1FS5A 1U8AA 3P2YA 4N54A 1FYVA 2R6JA 2B1IA 4URXR 2DU8A 2GZ3A 3R5XA 3FF4A 2JLYA 2QUZA 4N7MA 4OBBA 3O8NA 2NPOA 3H5IA 4H1VA 3L0SA 2R9VA 5LMUB 3OCCA 3PJEA 2VDOB 4YT5A 4RHCA 3EZGA 4Y67A 2X19A 1FTSA 3QPVA 4RH1A 3V48A 2XUOA 1XGKA 3HCNA 2QVCA 3MXTA 3VKUA 2CHQA 2BM8A 3YASA 1OH8A 1VMIA 3TN7A 2BW0A 1ORIA 2ZSKA 3IR7A 2WJ4A 2COKA 2OFXA 4QUGA 2AZXA 1QGUB 5AKGA 3TD9A 1VJDA 2O2GA 4LCBA 2D1SA 3PF8A 4CCWA 3W6ZA 1Y9JA 4OFZA 3JRNA 2VL7A 4OXIA 2AI2A 2JAXA 3HEAA 3IUPA 2FW0A 2GLUA 2OV8A 1V45E 2E82A 2WMOB 1BW9B 3HJUA 3NRBA 3FZYA 4PAWA 1TC2A 3EBPA 1UBCA 3HVUA 1KPIA 3CSUA 2YS6A 5BN3B 4QPJC 3SIRA 1AOXA 3HDQA 5F2NA 2DWUA 4WQMA 4A16A 2J0SA 1LPPA 1EDDA 4TZ0A 1H2ZA 1XLTA 1K08A 4NMXB 1BS2A 1CJTC 2FNAA 1PFUA 4GPIB 4BRWA 1GNRA 1FXSA 1GRVA 3AZPA 1JKFA 2C82A 2IYAA 1J24A 3C8HA 3DGEC 2I7CA 2IUFA 3M8KA 1PU2A 2C9MA 1OXVA 1Y80A 3F7NA 2Z2YA 1JTEA 4LRXA 1YQWA 1G0NA 2RHBA 3CVUA 4XQEA 3DTVD 3VVCA 3ZWDA 1JDJA 3AH8A 4MW2A 3OPYA 3PFCA 3IA7A 1YR6A 5AOBA 1N6PA 1SA0A 4FYPA 1D2HA 1WEHA 2GN4A 4FLFA 4INAA 5DHQA 3A1EA 4I5DA 4RA6B 5ETJA 1Q21A 2ZT8A 5FPPA 1TU3A 1RJDA 4W9NC 5IN5A 1IJEA 3NTUA 4GVLA 4OREX 4B6FA 4TMTA 2UZAA 3JV7A 3VZPA 4BP8A 1WMFA 1YR9A 5HZGA 3PJRA 1E98A 1D04A 1P1IA 5FBLB 1NJ2A 1M73E 4B82A 2O2XA 1OB2A 2EGGA 4D5EA 1ZVVA 1H9AA 1O97C 1ZZGA 4TM8A 4F4DA 3OCXA 3ZD7A 3ZOZA 4BMOB 1C30B 3ONNA 4G23A 3U7JA 3ESRA 4JWTA 2IC5A 1N33B 1GILA 2CFTA 4JP2A 3P9SA 4BNDA 3AY0A 1CB0A 3G13A 3NBFA 5C4MA 2EKZA 4C6SA 5GADl 3ER9A 3L0YA 4M1EA 2I6SA 3LDUA 1DJQA 4G2TA 4HB2A 4M9SA 2B82A 3A36A 1CY0A 3R9XA 1GZ5A 3DFIA 1MJNA 4DV7B 2XD9A 5EE9A 4Q4CA 1Y4SA 2I6XA 1NUPA 2W0SA 3UJNA 2W58A 2DLCX 2GASA 2HA2A 4M83A 2W2MA 4WESB 1UR5A 4PS1A 3ZYZA 5DNYB 1YZUA 1IUOA 2ANBA 1FDWA 4N8SA 3WX0A 3ZS9A 4HZGA 2JCVA 2Q0XA 4Q3DA 4DYHA 5D6OA 1QDUA 5F2KA 4B9EA 5IS2A 3EPKA 3GEGA 3ETGA 3WLPA 2ZI6A 2VLIA 4DA0A 5CT6A 4QASA 4ARZB 1NBEA 2XXBA 4ZJYA 1Z5WA 2H29A 3ZKWB 4EENA 2QTRA 4CM4B 1XV5A 5ISMA 1H6DA 5T6BA 1TO1E 4F4HA 3BSYA 4AXXA 5EZ5A 3AEQB 4MVWA 5JEEA 1MXHA 1TQ6A 1XQVA 2XSZA 1DPFA 1RIIA 2NNLD 1ZNQO 3LQ2A 1VRVA 4LFAB 4MLPA 5B1EA 3IV9A 3PD7A 4DYDA 4RKYA 3K9QO 3B3JA 1N9KA 4JT9A 3THWA 3C45A 4H59A 4A15A 2NO9A 1R5OA 2XTJA 5KUTA 3ZU4A 3DO5A 2FK8A 2VS1A 4HQ6A 4WD3A 2BI7A 3U31A 1M1NA 1X74A 1TM1E 4FJ1A 4KLZA 4L57A 4G0NA 5I7SA 1YWGO 2EJCA 2BHRA 4N65A 5C5DA 2O2HA 1E7RA 2O9JA 4RSGA 3UK6A 2R2GA 3PUXA 4TMZA 4UPEA 1NJ8A 1XN1A 5T57A 4C0HA 2IS2A 1ONSA 4OHPA 4C03A 3F5FA 1H93A 2OZKA 1T3GA 2WUEA 3DFFA 4MRVA 4TTSA 4BNXA 1N77A 3RF6A 2HHJA 4KPUA 3I5YA 3IUBA 4UZFA 1CJSA 1V95A 1WDMA 1R0SA 4KUEA 1IUPA 5KJEA 2QRHA 1CIPA 4GSKA 3RS9A 3HUTA 1TEXA 4Q4HB 3EZNA 3SYLA 1Z4KA 3N2GA 1ZYUA 4XB6B 2HV9A 1S8OA 4BVBA 4ARCA 1U2ZA 4U1RA 3ZEAA 3U3OA 3BGDA 4AYWA 2QBYA 2H9AA 1TM2A 2C96A 2QHXA 4LK3A 4CGZA 3DFMA 2IBMA 4RMHA 4YP1A 1SK9A 2IEBA 2V74B 3U7EB 2CDBA 1U04A 3N9IA 3Q41A 1WLSA 1ECJA 1R7RA 1AGYA 1ID1A 1T4BA 5HP4A 1Y33E 2JBAA 4AX8A 2GHIA 4WMLA 2QAGC 2VK4A 4IVQA 4AXBA 3GA0A 4MS3A 2PRIA 1PNVA 3ZNNA 1CETA 4MIEA 3OF2A 5CB0A 4MRRA 1E1QD 2I4LA 3LQRA 3U13A 3H9BA 4RYDA 3G68A 1Z88A 5LQAA 3G9XA 2PGIA 5AKLA 2ZJFA 1NNUA 3ZX4A 2GJ9A 4DSAA 1PEYA 1W94A 1HOTA 1FQKA 3M6LA 1KYZA 1SZDA 1DEKA 1T9AA 2ACEA 2ZS7A 4BDTA 4M53A 1V0JA 3KZNA 4IJKA 1F2UB 2OFOA 3K8ZA 4ZYXA 1HRKA 4PG7A 4LTDA 3ZV6A 5EA2A 3ZVRA 3L2OB 2VF2A 2Z2XA 1QTNA 1GITA 1YA6A 4W9RA 1FDUA 2QYHA 1AM4D 2WUDA 1LGYA 5EMHA 3ZI0A 1M75A 1A5AB 3DMTC 3KJFA 3BIJA 3ACCA 4HQNA 4JLMA 4POOA 1TL7C 3LE8A 1OXSC 2DF8A 1WMSA 3I4FA 4N18A 4YO7A 3I9NA 1W5BA 1TCAA 1UANA 2AJTA 4U7HA 3E81A 4EGQA 1Z22A 1JEJA 2CMKA 2C9YA 4I4CA 1J0DA 1QYCA 1B76A 1RLIA 3S2UA 1ZK3A 5ALHA 2Q9AA 2YOGA 4I8XA 5E6RA 4G8DA 5CCDA 3WWOA 4CF3A 3T5AA 1QK5A 1H3EA 4X6XA 1NLZA 2C0PA 4H6VA 5B1HA 2F4VB 3FA2A 1HDZA 3NHSA 4TV8B 1VE3A 5K0FA 2J59A 4HJRA 3L6UA 1VE1A 3FZEA 3TEFA 4D9CA 2GS9A 3Q7SA 3V4SA 4V0LA 1Z5VA 1LJ8A 2RI1A 4NDZA 4R1LA 5ICGA 4CZ2A 3WLFA 3L01A 4F11A 3FHTA 2P6UA 2ZJ0A 4LMRA 1KJIA 4GQAA 2RH5A 4Y3UA 2D0DA 3AB8A 4YWJA 1IVSA 4YI5A 1K5PA 3SCZA 4BKQA 3AHDA 2YFYA 3WNQA 2BFBA 3ONWA 5COQA 1X2EA 1AN9A 4U6QA 3JSAA 4AZ3A 3THYA 4L7QA 5EZQA 3FWYA 1GO2A 1JMKC 3NM4A 4IGEA