5FLYA

The fhud protein from s.pseudintermedius
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
279
structure length
279
Chain Sequence
KETKAFNLKTAKGEEKIDIPKDPKRIVVMAPTYAGGLKYLDANIVGVSDQVDQSPVLAKQFKDVDKVGAEDVEKVASLKPDLIITYNTDKNTDKLKKIAPTIAFDYAKYNYLEQQEAMGDIVGKSDEVKKWKADWEKQTAQDSKDIKAHLGDDTSVTIFEDFDKKIYAYGKNWGRGSEVLYQAFGLQMPKALDDATKKEGWTEVPKEEVGKYAGDVIITAKAKDAAQPEFQKTAMWQNLEAVQNKYAFNVDSSVYWYNDPYTLDVIRKDLKKQLLALPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Fhud at 1.6 Angstrom Resolution: A Ferrichrome-Binding Protein from the Animal and Human Pathogen Staphylococcus Pseudintermedius
pubmed doi rcsb
source organism Staphylococcus pseudintermedius
molecule tags Metal transport
molecule keywords FERRICHROME-BINDING PERIPLASMIC PROTEIN
total genus 91
structure length 279
sequence length 279
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 5flyA02
2R79A 3U7QB 3ZK7A 1G20A 5M29A 5M3BA 4WZAB 1G20B 1ESZA 4HMOA 2YNMC 3AEUB 4G07A 1L5HB 3HH8A 4FI3F 5JOQA 1H1LA 5HDQA 2QI9F 1EFDN 3PSAA 2O1EA 5AFSA 3LHSA 1H1LB 5KOJB 3BE6A 2PHZA 3MINA 4MDYA 5CX1A 5GGXA 3AEUA 1XVLA 3ZKAA 5JJ5A 4WZAA 4TKUA 5GGYA 1MIOA 3PSHA 4WN9A 3R5SA 4TKVB 4LS3A 3U7QA 4UTPA 5HX7A 1N2CA 2PS9A 3TEFA 4WESB 1QH1A 1QGUB 4FILA 5JG7A 2AFIA 1G21A 1FP4A 3AERB 5CR9A 5KHLB 2X4LA 1TOAA 2PRSA 2XQVA 3K1AA 3ZTTA 5FLYA 2YNMD 2M6KA 4WZBA 2XV1A 4INPA 2AFHB 2OV1A 4WNAA 4INOA 1N2ZA 2ETVA 3G9QA 4UDNA 2PS3A 1M1NA 4BBPA 3AESB 4OXRA 4ND8A 4PM4A 4DBLE 5BVHA 5BVGA 1M34A 1K0FA 2XDQA 3AETA 2OV3A 5B58T 2XY4A 3MD9A 1KAEA 4H0FA 3AEKA 1KARA 4N01A 5JPDA 3HXPA 4OVKA 5M34A 4CL2A 3PDIA 3ZK8A 5M2QA 5KOHB 1QH8B 3MWFA 4M7OA 1QH8A 4XPIB 3BE5A 2MINA 3AEQA 2OSVA 4FNAA 4H59A 3TLKA 4NNOA 1PSZA 1KAHA 3CX3A 4HMPA 1M1YA 4NNPA 3AETB 2XDQB 3LI2A 3UJPA 1N4AA 2Q8PA 5BVHB 4ND8B 4IRMA 3AESA 3NU1A 5BVGB 1M1NB 1M1YB 4LJSA 2XUZA 4WNAB 2R7AA 3ZK9A 2RG7A 2MINB 3AEQB 4MO9A 4GICA 1PQ4A 4HMQA 4MLZA 4XPIA 2XH8A 5KOHA 3AERA 4MX8A 1FP4B 2Q8QA 3PDIB 4PAGA 1G21B 3AEKB 3TNYA 1QH1B 1N2CB 3MFQA 2M6LA 1K2VN 1M34B 4TKVA 4WN9B 1MIOB 2WHYA 3R5TA 2PS0A 4TKUB 2OGWA 4UDOA 2AFHA 4WZBB 5CX1B 2WI8A 3MINB 3MWGA 3K1AB 5KOJA 4HN9A 4OXQA 5I4KA 1K7SN 3HJTA 4K3VA 4UTOA 2AFIB 1QGUA 1K75A 1N4DA 3EIXA 4FKMA 4G09A 4WESA 4B8YA 3GI1A 3EIWA 1L5HA
chains in the Genus database with same CATH superfamily
1IONA 1ZCZA 1FNSA 2YJNA 3UJBA 3TNDA 4P2GA 3R0VA 3GJ8A 4RQUA 5BSTA 5M3BA 4DR4B 4MK4A 2DY1A 3D7KA 2JGEA 2RHHA 4ZT4A 1R27A 1K1EA 4DANA 1VPTA 3P32A 5HFJA 3WGNA 3ZD6A 2I3ZA 4PYLA 5DOVA 2VDRB 3PF9A 5TEWA 3WK4A 4MV0A 2ZJAA 1Z6TA 3LTEA 4K6CA 4HS4A 1IIRA 1VMEA 3S1AB 4N0DA 9LDTA 2UZ3A 2UZIR 2X86A 5GM2A 1AV7A 3RYFA 2AJLI 1UMDA 4ZALA 2O8EA 4TKZA 1ODKA 2GD1O 2RAFA 3CJTA 3DDUA 5E4FA 2BFMA 1NR1A 2AJBA 5HMMA 1Y8ZA 1LFDB 2O3JA 2Z3WA 3AOGA 2PGAA 4J75A 4OYRA 4UTPA 4N4AA 3WYBA 3RS5A 4M37A 3EVBA 3IRVA 2FE4A 1GXSA 2MSNA 4MLCA 5H5JA 4ABYA 2XB2A 1WUIS 2YN2A 4LFBB 5EYPB 5LL6P 3H2KA 1Z7BA 1RMYA 1RM4A 1JIQA 3BHNA 4LX0A 5CA1B 4HGNA 3EJ6A 3R77A 3UCXA 4M6WA 5IF9A 3O8CA 2QRZA 1KQOA 3FNQA 1WLYA 4IZHA 4YMWA 3SR4A 4AULA 1M34A 2RAPA 2OT3B 4UUMA 3W8RA 1I0LA 4KLCA 2AK3A 5BMOA 3BWEA 4JD5A 1GM5A 4J90A 5LQJA 4TKLA 1FYWA 1KAGA 4YYEA 5FEMA 4IIYA 2HJRA 2WAMA 1YI1A 4PNZA 3R3WA 2BGJA 1W35A 5HQ3B 5ALNA 3NKLA 2QRPA 2BM9A 4FHGA 2ZXUA 5FV4A 1B74A 3SC4A 1L2TA 2AN9A 3VNVA 2XMQA 4YCCA 2GEBA 4MRMA 2PYDA 2Q28A 3BMOB 1OT5A 2GH1A 1IY0A 2C5SA 2ZZKA 3G0GA 2NU8B 4G37A 4BKPA 4XYLA 1NC3A 2DSNA 4TVKA 3ROEA 4MYSA 1NG1A 3VUEA 3PXCX 2O05A 3BRSA 2ZZMA 3ZY6A 1HE4A 4PY2A 1YNSA 1QGAA 2JVJA 2OGSA 4ZYTA 3O8RA 1VE1A 4BTEA 3EQ7A 2VT3A 1BW9A 2PGNA 4P92A 3M4JA 1YCDA 2MSWA 4KGZA 4MS1B 1UFRA 3B5EA 4HRXA 4S0XA 5ERXA 3IDFA 4JNKA 4R3UC 4CLXA 3L8FA 4RVNA 4A03A 2IU4A 1KE2A 2BR3A 4CCAA 1BDIA 3RLIA 3CRRA 2JPDA 1W9HA 3EWSA 4IZ6A 3IMEA 4B80A 2Z5FA 5B36A 3D8BA 1E4EA 3GLVA 4KLRA 4WZBB 2AFRA 3T7TA 1H9BA 3DC2A 2FR1A 3KV3O 4FE3A 1R9JA 4MW9A 3B3JA 5B1EA 4IVRA 1KH3A 2YWBA 1G19A 3DZJA 1Q95A 3IALA 2BGWA 1S8NA 2LRHA 2FXVA 2GXSA 1JVSA 3HNPA 2BP7B 5IBCA 1QGUA 3PI7A 4GU5A 3OP4A 5DBEX 1LPAB 1MHPA 2NOAA 3DB2A 4DNXA 4ZKEA 2R25B 2AUTA 3DAOA 3I2HA 5G1PA 3MAJA 2WQZA 4OFBA 3HLYA 3U0VA 3VZBA 2BEWA 2J0EA 4BX9A 1EI9A 4DXHA 1HGXA 4H3HB 2P1RA 3L4KA 2C94A 5ILOA 1U3VA 1AUOA 1X19A 3T5CA 2FDXA 3FF1A 4X24A 1XRMA 2VWPA 3CM0A 2CLOB 1XROA 2P4HX 3II6X 3L6CA 2OECA 1TM3E 4X66B 5GADl 3H2SA 1TQ4A 2PM8A 3DVAB 4TRJA 1DDIA 3VYWA 1VHTA 4BQIA 2HLDA 2XCOA 3HWX1 2YXBA 5F35A 3EG5A 3E61A 3BEDA 3BPSA 2IV2X 2DXIA 1MN6A 3AUSA 1EUCA 4WA8A 1PR5A 5GJWC 3T61A 3KOUA 3NIFB 3H2BA 2ON6A 2NO0A 1SC4A 1GAWA 3OM1A 4AY3A 4QYMA 4YS6A 4IS2A 1N34B 4PLYA 4DLAA 4RQAA 3P2MA 1O9GA 3QVOA 4JCOA 5ALMA 4GMGA 4TOIA 4DLTA 5B2ZA 3BM5A 1UMCB 4BQQA 1U1GA 1R6TA 2IE0A 1FUEA 3CEHA 1H5NA 4ZZ0A 3MJCA 1V9CA 2OBXA 4J0EA 3W8FA 1JEYB 3R0JA 4YRRA 4M1EA 5DGCA 5JNWA 3UAGA 5AW9A 2FMFA 3R09A 3BL8A 3MTBA 4M87A 1ZINA 2NUTA 3NBMA 3HJFA 4ER0A 2OBLA 5SV2A 3OIVA 3SZRA 4PC2A 1NMXA 3MWYW 1R4ZA 1AKYA 3BL6A 1NE7A 5ABPA 3Q15C 2X14A 1ZFNA 5EMHA 3E4DA 4NMHA 4D4LA 2P3QA 3G2PA 4L5YA 5FIUA 5LZ9A 1VG9B 3BICA 3VM6A 3ZBTA 3KCNA 2G9QA 3R0QA 1X70A 2PLRA 1RPZA 1II9A 4D0SA 3BN3A 2RGAA 4TWAA 5GJBA 1NRWA 1R0ZA 2G5TA 3B3FA 1JQKA 2ZRCA 1UZLA 1REQA 4PFJA 2PRYA 2WOOA 5EKUA 3SKXA 5JJKA 4EVQA 2EQAA 3G68A 4IJVA 4H2DA 1RHQA 1O94D 1XU9A 1V3VA 1SK9A 2IEDA 4BLWA 1D2NA 2BDUA 1YZYA 1ZYUA 3JZAA 1HXHA 2GQ0A 2J7KA 1G41A 3OX3A 3DBHB 3NV9A 4QG3A 1H2RS 5G4LA 5IHPA 2VUUA 2A14A 1YQXA 2WU3A 2A2ZA 4FZRA 1PEYA 3VR0A 1K5PA 2QRJA 1FCJA 3L04A 1RC0A 3ONFA 4B6PA 1A9XA 2QTBA 1E8MA 3WDKA 3FPEA 1B14A 4FMCF 4XIJA 3UKDA 4EB0A 4UEJA 3T7SA 3DTVA 3WYEA 5CB4F 2E4AA 1GTMA 5U4XA 3PHCA 3ZGOA 2AOUA 4H7KA 1MB4A 1U2SA 4KWTA 3SBDA 3ZV6A 3D1JA 1FVXA 5FOVA 1WXEA 1G7SA 1QO0D 3IOCA 4AX4A 4JJFA 3WSVA 4OFXA 3H4IA 4IDBA 3L2OB 4MWDA 1NMZA 3RJZA 3ZXYA 5K2OA 4PO1A 4PLGA 4LZJA 1R6UA 1M2HA 1T5OA 3WIBA 2VTKA 3WLQA 1RXSA 3Q8LA 1U3FA 3O31A 2A57A 1QE0A 3ODGA 1SG6A 1LLDA 2HUNA 4FKBA 4RJJA 2TS1A 2WAYA 2NAFA 3BWYA 1N36B 1PZEA 4YCJA 2EKDA 1YU9A 1PT8A 2FETA 5AOAA 1NURA 1Q7BA 1DZ3A 2CNBA 2FTKE 3MUFA 1BX3A 2OCIA 3V4VB 3DV2A 3IESA 1XDWA 1Z4KA 3EMBA 2ZJYA 4LE1A 4V0SA 3AHIA 1L1FA 4JYMA 7REQB 1J9EA 1TK2A 3TGLA 5GIOE 2C58A 1T9HA 3N0RA 4GZMA 5BWCA 2A9PA 5DYTA 1UPXA 5JOQA 2JLZA 4JVOA 1GUFA 4GI3A 2CKDA 3OT5A 4HDSA 1XZFA 4ZHSA 3VHLB 3ZW8A 4F84A 3X1WA 2YDXA 1RFGE 2QP4A 2X7JA 1PJCA 3QSGA 3C6QA 3DW1X 5IANA 5DWVA 2Z3VA 4DJDC 2A9FA 3R5JA 1L5SA 1XQYA 3KQYA 5GJCA 2WPDD 3NR2A 3V7YA 2C8JA 2EDAA 1VRCA 2NQ8A 1PQPA 2W2TA 3K0EA 2AJ8A 4KQWA 4LN1A 4MWTA 1QC5B 3AI3A 5AI5A 5KSPA 4EWLA 2RHLA 3JQ9C 2E3JA 1O7JA 2K2QB 3Q7TA 1G21A 5KYUA 3N74A 4JL8A 1UXGA 4X8HA 2OQRA 1CF2O 4LCJA 5AVTA 5FLYA 1O4WA 1NVWQ 4ARAA 1OVMA 1YJ5A 1BVUA 1W9MA 3HACA 1XXHE 3O91A 4TXNA 3VU0A 4FM9A 1MX3A 2FG5A 5K0CA 1H6AA 3NW9A 2RGRA 1EXWA 1XMPA 4BAGA 3BRCA 2NXNA 2FUNB 3IEPA 3UIEA 5B4TA 1BRMA 1QDLB 4TQUS 1JN0A 1Y5RA 1U6IA 1JR2A 1FUIA 1PT5A 2EJCA 3LVQE 4NPAA 2CW5A 3IB6A 4KVGA 4QZVA 2JGDA 2XNJA 3AFOA 3BREA 4XDHA 1XTSA 2OKGA 1DKLA 1OLUA 2NZYA 4FYVA 1JLSA 3TLYA 4JUCA 1HRDA 1V26A 1B16A 4IQ4A 2W93A 4YJFA 2W8BB 5CJ2A 3ZJUA 3AY7A 1P7ZA 4B74A 2XZTA 3WLLA 1VBMA 3B60A 4H6VA 2PJRA 1CDZA 1JG4A 2VEDA 3CX8A 2C82A 2FUCA 4K81B 4OH7A 3BZUA 5LZ7A 2ZULA 4NNPA 1YTLA 3AFNA 4DAEA 3QPVA 3S8YA 1J42A 5HZKA 4NSNA 3CLUD 1IUPA 3JSAA 5KDLA 5LWHA 4DAOA 1PFVA 5GP1A 1H9AA 5BQOA 3V2UA 2E5FA 3V00A 5J1TB 1JKJA 3MT0A 1QOPB 2P0AA 5GOZA 1OBOA 2QYOA 4RD3A 3KYDA 3IERA 4MX8A 2HXYA 4MP3A 2ORED 2PT6A 3JD0A 1T13A 1N57A 4LUCA 1BHJA 1L9XA 2WJYA 2X1MA 3FFWA 1LDGA 3HP4A 3LYUA 5YASA 4C21A 1NIPA 2FSPA 3OZFA 4YQYA 1X1EA 3M83A 5HCNA 4Z1OA 5JYDA 1ONNA 1Q2XA 2P9FA 2R5FA 1CIVA 3OT1B 4KU4A 3ESAA 3EMVA 5AUPB 3X43A 3D7RA 4ZCLA 5AVOA 4CKWB 1M34E 1SCAA 3BD8A 5EE1A 5MF6A 1OD6A 2I87A 4MUHA 1YAHA 2D5AA 1ZN9A 4MRNA 1DTWB 1FP6A 4EX6A 3T1YB 2YVQA 3DE0X 1YQ9A 3X2FA 4RK7A 1DC6A 5REQA 4HNAB 3S2SA 1YT5A 2AOTA 3GPIA 5LXTA 3I4FA 4M9SA 3N7TA 3EASA 1RLIA 3ZI0A 1KYTA 4DLWA 2ZI3A 4E07A 4E2YA 1MH9A 2XZPA 4UM8B 4RIHA 4ZYVA 1Z2NX 4KKVA 5K8IA 4WHMA 1T4GA 1VMKA 2IHZA 4CKYA 1PFQA 1MO5A 2ZE6A 2BLLA 3ZWWA 4CIDA 4DN6A 3ZCRA 1YB5A 4IWNA 4CM4A 2YWEA 4QYWA 3FOZA 2BMJA 2R5NA 1KRXA 2GAJA 1L5YA 1DBQA 1H5UA 3FTCA 1ECBA 3P9XA 2H2GA 1LRKA 2XKAA 2Q2NA 2ZJZA 4L4ZA 4BWGA 2EBFX 1QYVA 3LL7A 1DIGA 4I3FA 3WZ2A 3JATA 4FYXA 2XUAA 3BMCA 1OV4A 2V7VA 4E14A 3AEUA 4JP8A 5K4HA 5JW6A 5D6NA 2FPSA 1SRQA 2B35A 4G81A 2B2XA 1LQ2A 3KAKA 1GG2A 5KB3A 2H2DA 3E81A 3RF7A 2GR9A 4CKZA 2WV9A 3FGOA 1N8NA 1SURA 3OI7A 3TEFA 3DMNA 4TTIA 4GPIB 3O1JC 4RETA 3CW8X 2BCGY 4G5HA 3EZ6A 2NTEA 1D5CA 3K4PA 1QX3A 3HCRA 2Q3LA 4CMJA 2WW8A 1MXHA 4ZQIA 3JAMA 1DXYA 2WOJA 3I61A 2WM2A 3PUYA 4TTSA 3E18A 4EG8A 1QG4A 1XQWA 3OOHA 5J40A 2C7GA 3AM3A 3OQIA 3G9QA 4ARUA 3MS4A 2QIOA 1VSTA 2OFPA 3KZCA 4LG1A 1P1FA 3MMPA 1CG6A 1M8FA 3FRJA 1WABA 3ND5A 3UV6A 4N01A 3ZYZA 2J5QA 4RV4A 4BV8A 4D2IA 1IN1A 1VBFA 1LCIA 6CHYA 2C1ZA 3P9RA 2YIJA 5L4LA 3ZLVA 1AKMA 1NATA 3AF0A 4UAUA 1RRMA 2HUPA 1G3MA 3AEYA 4XX0B 4A2CA 3Q88A 4YHBA 1P2UA 3EW9A 4E5SA 3CF4A 4ZJYA 5LYJA 3GROA 5EG5A 4D5EA 3ZLJA 1WOMA 2NO5A 1DBRA 3CONA 2QZSA 3O26A 1NI4A 5SZHB 4LBYA 2K5UA 3WKDA 4DF3A 3HFJA 2MHCA 4DZTA 2QR5A 3BD6A 4LRWA 2E5WA 4KSBA 4B6QA 3L4BC 3EVGA 4HPXB 4B7UA 3NU1A 3O2SB 4YRGA 1XNJA 3P9SA 5EVCA 1Z5GA 2FX2A 4FYKA 4ZICA 1ZLYA 3DYIA 3SZOA 2KHZA 3G1UA 4RD6A 4AMVA 1QGOA 3HQ4O 4DZZA 4KI0A 1UK9A 4D42A 2RC5A 3THXB 1PSDA 3LDHA 1G3IA 1HEIA 1SBTA 1V5WA 2W8ZA 3IAM6 2QQEA 2Q3HA 1XRSB 3MOGA 3NC0C 1GZ3A 2IYLD 1A69A 4ZQCB 4E11A 2DLCX 4IXMA 1M83A 2F1KA 3WIDA 3OM0A 1RI3A 5DTQA 3TTUA 1Y1RA 3KKKA 1UAYA 3BCSA 5AVSA 5LOVF 4A2PA 2M6LA 3GFRA 2F1IA 1HSZA 5JEEA 3VV3A 5HUHA 3IPYA 3P4YA 3GXBA 4M9QA 3D3KA 1XD2A 2BFNA 4JMLA 5L6MB 4GI2A 2RGDA 1KEEA 1DKQA 2J9GA 1P3Y1 1JE0A 4JX8A 3BEOA 4M54A 3ZX4A 4WPGA 3MPOA 1C8BA 5DE3A 4MAMA 2WSLA 2Z95A 1JXOA 1JEOA 5FT9A 2IUTA 3KWFA 2CL6X 4YA6A 1XZ8A 1U2QA 2Q9UA 4G0PA 2O8VA 1B8PA 4F46A 4L76A 2D0DA 1ZZEA 3C3CA 1MV8A 4YJ3B 3DEYX 3AUYA 3THSA 2X9GA 5ECWA 4L5CA 1MGOA 4FEGA 1PEKE 2OILA 1SD1A 3KOMA 3AOEA 4QQFA 1Z16A 3K53A 3JWHA 1OR8A 4GOLD 3RYTC 3LT5A 1XVIA 3PJEA 2VAWA 3FX2A 4BHTA 5K0LA 2GERA 3R5XA 5EJMA 1TO6A 1AD2A 4GSYA 3E8XA 4FJ1A 1WZCA 5KI6A 2W2KA 3TYXA 4KAJA 3G9XA 1JLMA 2QN7A 1N9KA 1NNI1 4LZWA 1XA3A 5AM5A 3CZCA 3COJA 3A10A 1GCIA 4KWEA 3EQ9A 2DKNA 1X80A 2HA5A 3KTDA 2GYUA 3UYLA 5FWYB 1G17A 4RDHA 3JWPA 5LU9A 1E1YA 2WWXA 5FLEX 4YRZA 3SQOA 3GPLA 2Q7DA 1I51A 3AFHA 2J48A 1OVGA 4LDPA 3RRBA 3SEQA 4AMYA 1UUFA 4QRDA 4H31A 4J1NA 1DQRA 4X92A 3ILSA 1CRQA 2IHTA 5T41A 3PFNA 4FE7A 1R8XA 2X4LA 3GVIA 3JAKB 1BRTA 3DBLA 2GVDC 4ZCSA 3ZXSA 1P4GA 5BWLA 1U0SY 2QTTA 1I8TA 1THGA 3I0NA 1JEEA 1DI0A 4L3OA 5DI3A 13PKA 1XP8A 3UT6A 5HIKA 3PXXA 4B35A 1UBGA 1ZCBA 4KKXB 3F3YA 2W2PA 3C74A 1BU5A 2HJHA 3JVDA 5EUBA 1X1TA 5AW5A 3Q40A 3IVAA 4WCFB 5BVHA 1ZAKA 4RAQA 4RGYA 2TECE 2H07A 5D1HA 3WGUA 2QBYA 1D2AA 1ZOLA 2H18A 5DNEA 2VJPA 5G1OA 5JXJA 1BVHA 1R6XA 2YQ4A 3P0JA 4FGWA 1T3GA 2AR0A 1RC1A 1U7PA 4U8GA 1U63A 5I8PA 3FBWA 4JWTA 2HT1A 2AG6A 2P5YA 3HVJA 5I9IA 5BSKA 4B73A 2IYZA 4RZ3A 2O48X 2RGYA 3JZDA 1LK5A 4IZIA 4RMIA 4BBZA 4XZ3A 2FR0A 3RU7A 1F2TB 1EU1A 3DZFA 4MUJA 1BVRA 4PANA 1QZZA 3LX6A 4YI3A 4I08A 3FMVA 5FPHA 5TT1A 1TW2A 2VBGA 4CTOA 5EJ7A 3UT5A 1U9CA 5CBPA 2VDOB 3DNFA 1NYRA 4DLZA 3RASA 3WAKA 4JA2A 4H7PA 1DELA 1RI4A 1E5XA 3BSFA 2PZLA 3NUZA 4IVNA 1MENA 1CR4A 2WYUA 1HYHA 4JA0A 1YFJA 5KVSA 4ZMSA 1GEGA 1VMIA 1UK6A 4FK8A 3SF8A 4MI6A 4G9GA 1TCAA 4C5CA 1JPVA 2AIRA 1A82A 2ZW9A 2JATA 5FO0A 2IP4A 5MN5A 3W6NA 2OLKA 2OPHA 2JLAA 1CUDA 4DSOA 4O4HA 1VE3A 4PXAA 1AS2A 4N9WA 3TXAA 2C3PA 1LBSA 1XELA 4CMHA 3VO2A 3OWOA 4BJ5A 4TT3D 2YWJA 1OOEA 4TTJA 5B4VA 3EHDA 2P41A 3GZNB 2EARA 1KO7A 1XWWA 4TS1A 3GA5A 5DMXA 3LYLA 5IJ9A 2QSJA 2WHRA 3WLJA 1MPXA 1Z5PA 4JR1A 4BRSA 5EJ4A 1SMKA 2ACWA 4ZVRA 2A9QA 3HZHA 1ONPA 2Z8XA 3NFYA 3RYCB 2E6UX 3BC1A 3MILA 5EE5B 4CMIA 1GILA 2G8LA 2IY7A 1RVDA 4CEIB 1A1SA 4NU0A 3U1VA 1C9MA 5JXGA 2V7UA 2IZ7A 1P17A 4OK3A 4W1SA 2XVAA 3NH9A 1SHTX 5D7BA 3RIGA 2GCEA 4YRSA 5ELXA 1NJFA 4KK4A 2E87A 1DAHA 5CDSA 3EXEB 3C5WP 5CFLA 1VPLA 5KWEA 2E1RA 3PSAA 4AJJA 3QU7A 1F4VA 1NN3A 2AJTA 3ED5A 1W0JD 5EIAA 4AN4A 4GBMA 2WWIA 3T4XA 3EOZA 2CXOA 4JYAB 1DJLA 4O4JF 3A9SA 5IARA 4QUAA 1SXJB 1W0CA 1O96B 4RE6A 5DT9A 1N5JA 5I7WA 4LE0A 2HMYB 1EFPA 1Q15A 2OD7A 3O8QB 1C2YA 3P2KA 3PTZA 4WUTA 3E9RA 2BMWA 1Z0DA 5FTMA 3ZDQA 3DWEX 4YYZA 1UJNA 4YCNA 1D07A 3L07A 3K7EA 2PRSA 4XDGA 3WL7A 3M6AA 4TWRA 5JO0A 3L79A 4LMPA 5BQPA 3ZY2A 2UKDA 1JQEA 3OE7D 3F6EX 4LY9A 4DRXA 3DVSX 4G4JA 1P4AA 3OCUA 4DDMA 2DKOA 4J0FA 1AH2A 2O7NA 5M5BA 1L5VA 4R0VA 2HHJA 3G3EA 4MP8A 3A6HA 4E1VA 5CJPA 2C3UA 4IVPA 3VC1A 2WINI 5HWSA 4FYIA 2WLTA 2FW6A 2W2VA 5B58T 4Z3DA 4DLSA 3A2KA 2QL7A 3MLBA 1Q0ZA 4EHBA 3HXPA 2PRJA 3L49A 1RKBA 2FE1A 2OY0A 2BBSA 3NC1C 4XRGA 4ETWA 1JH8A 1Z4IA 3A06A 1I30A 5ALLA 4I1RA 1VKNA 1VYTA 1Y8CA 3AB8A 3HVKA 4A6EA 4IIDA 1OJ7A 2VYNA 2Z57A 4GO1A 1N0HA 4N7JA 5FD8A 5L3SB 3DEAA 3V2GA 4J6EA 2GYWA 1HTBA 3OQBA 1RXYA 3WBFA 2X6QA 2IZ5A 4B2LA 1CB0A 1M1NB 2PQ6A 4JJEA 5K7SA 5L3SA 1XEXA 1ONBA 3MJEA 2FN9A 4GOKA 3J81A 5TLSA 2J30A 1HEYA 1NDQA 1OKKD 2NQ2C 2ZR8A 3H0KA 3RUHA 1GVHA 4AMGA 5D86A 2BI4A 2OR3A 2C29D 4QDOA 1HQCA 2P2SA 2PRIA 4GMXA 4IIHA 1AQUA 2XH8A 3JYPA 4KFCA 2O8BB 1ECJA 4FCTA 1ECGA 2W0SA 3P19A 3A1VA 1QJ4A 2L69A 1KFJB 2J31A 4EKIA 2I6XA 4ZVLA 3CS3A 1E9FA 2VN8A 5FR2A 1YVPA 2B5WA 5DHFA 4B8WA 2CN1A 4GR5A 4WLNA 4B46A 4N0MA 3P0RA 5BV8A 2EGUA 3Q7PA 4U9HS 5PNTA 4ENRA 2HYIC 2HDWA 2V58A 3HXLA 5IDXA 5FFNA 4DIUA 1MORA 2R47A 4ENWA 4RTOA 1GZ7A 1TYAE 3EG9A 4IHJF 4IZOA 1ZS9A 2V6BA 2HADA 4JEMA 3I5MA 1J97A 1V8DA 4O33A 2UXBB 2F43B 3BQMB 2GN1A 3L6UA 4BVAA 2YHSA 3O47A 4CR7A 1PQWA 4EB3A 4CV1A 4DCCA 1Q91A 2IIBA 3LT4A 2P2YA 2V6MA 4JDUA 4MMYB 2DHDA 4P5EA 5JDIA 5JU6A 4AM8A 1I7NA 3G2HA 2QRUA 2VKQA 2IDZA 1RIFA 1DRVA 3FHCB 3M8KA 4IPTA 4NBWA 5LKRA 3MERA 3A6PC 4KVAA 5DJ5A 3EDCA 1H6DA 5IFLA 4JK3A 3UTCA 3IDZA 3ZDXB 1AOXA 5IXSA 4P4SB 2R7MA 4MW6A 1R1DA 2I4LA 4QXOA 3UUFA 4Z6KA 4IMJB 2PE5A 4M1MA 4QGBA 1YL6A 3VZPA 4DV0B 4RX1A 2Y9MB 3GOQA 1OXBB 2Q5IA 1CJMA 4UFPA 4X00A 4D0GA 4D45A 1JDSA 3GR6A 4G0NA 4EI2A 2OZKA 4URHA 4WZAA 4C05A 5C1PA 3IPCA 2QTNA 1FXWF 2YVKA 3MLAA 1HWYA 2PY6A 4C9BA 5CDGA 3P9ZA 4FFMA 2AYYA 3RC8A 2O2JA 4D8UA 1E94E 1J90A 1H66A 1T8TA 9ATCA 1XWFA 1JH9A 3ZHZA 4XB2A 3TUJC 4YRPA 1A9XB 3GLQA 1Z83A 4Q05A 5FDFA 1BQ3A 1I4OA 1A7UA 2OK7A 3I32A 3IIJA 4BV9A 2IF2A 1ENYA 2NO9A 3DEJA 3QX3A 1A88A 1M7HA 3P9KA 4ZVTA 2CB9A 1T5IA 4U4AA 3GLRA 3MNFA 1J5XA 1W0JA 1Q1AA 5ERGB 2LUOA 5JARA 4RJ2A 5JROA 1JHOA 5TQVA 1GA4A 1ESEA 3WADA 1J25A 1I9CA 1NQVA 3LSYA 1HTWA 5ESRA 1YRHA 3CSSA 1KYWA 4N3BA 5H3LA 2NU8A 3ZE8A 1NNLA 5C4GB 2GBCA 2RGUA 4DZRA 1ULAA 1VCNA 1WB4A 1ZCAA 3AI2A 2B98A 4CR8A 1E3EA 1F0YA 1PR9A 3L84A 3O90A 4JP3A 4UBLA 4ZA2A 2FQXA 3OQMA 2IBTA 3BKXA 3ZH9B 2HBRA 3PICA 3TH5A 1A9SA 1E4OA 1JS1X 3IR6A 1BOOA 1PSZA 2ANBA 1NVFA 1Z74A 3F47A 4J7XA 1W0KA 5J5AA 5L3QB 2W7TA 1Z39A 2VA9A 5ES4B 4X71A 2GD6A 4PQYA 4M3NA 3HBFA 4HRAA 5IKMA 1NVVR 3SR3A 4BZWA 1JHXA 4D0LB 4B3JA 2FEXA 1A5ZA 3CXRA 4PBRA 1H94A 1Q0HA 2YNMA 3ADPA 1QB7A 4JUAA 1O9HA 4GEGA 1MVLA 5IUJC 4FNMA 3IDSA 1DC3A 3D3WA 4ZAZA 4YT5A 3R9XB 3T9EA 1CUAA 5IVHA 3JD3A 2G83A 1KMNA 1Z4LA 3H11B 4Z4QA 1TX4B 1YR2A 5A2QA 3LKVA 1X94A 4BB5A 4UE2A 2HWXA 2KLBA 2XNDD 4B43A 3SQWA 2BFOA 1DAPA 1O58A 2A84A 3IUSA 3R6LA 1Z17A 1DJNA 1QNFA 1MNAA 1N1MA 1TM7E 2ODEA 1B3BA 2NXEA 5TS3A 2QNRA 4ZDIA 2PUAA 4U7GA 1RQ7A 5CRIA 4AB1A 2A9RA 5GAJA 2D8MA 2QD1A 2WNSA 1PE0A 4MI9A 4KNYA 2FX5A 1WNTA 3LGSA 1LVGA 2MR6A 2PZKA 4ITVA 1U8EA 3ZLTA 4KR2A 5KQPA 4M7PA 4QVGA 2ZYSA 3A58B 5IXYA 3COVA 4M1QA 5JYCA 5KQSA 3F1KA 5A06A 3NX4A 1EFCA 1U1CA 3I9FA 1T43A 3EZGA 2XKKA 2POCA 3WMRA 5M29A 4IQ8A 2IVZA 1CWUA 3KE9A 2WHXA 3QVMA 3WJ1A 4A0HA 2KWIA 3R3SA 1X2EA 3ZV7A 3H97A 3KKNA 4HFJA 1NVKA 2SCUA 3EW7A 4FSDA 4WNYA 1Z22A 4ES6A 3ZBPA 1IH8A 3ZVMA 5TVGA 1RQ2A 4WN3A 1J8DA 4TV8F 3B1YA 3CX6A 2NQTA 3BFPA 2GPYA 1XMOB 1WW3A 3C5VA 4LZOA 4EEKA 2H17A 1V5GA 2W6QA 1WETA 1RWNA 4D4KA 4QQRA 5M04A 1N9GA 4BO4A 3RKSA 4BYMA 1HOXA 4AS2A 1PZMA 1XJCA 3ML1A 1QNLA 2KB0A 1IN7A 3VKFA 4BNHA 2HRBA 4TKVA 1YZGA 3I5AA 5JMOA 1BWPA 5LOVB 3WLAA 5IVIA 2PH1A 5HKOA 2ONJA 1RABA 5I9BA 3G2NA 4KOAA 5F77A 3QVUA 4LI0A 1TECE 3K1JA 3T1TA 4R1UA 2XQVA 5G4KA 3JD2A 3C98A 1WM1A 1GSAA 2MYUA 5AK4A 1EDBA 3DOUA 5EE9A 1PJSA 4BU1A 3WRYC 3TW8B 1Y1TA 1OYOA 3A36A 5FBLB 4GIBA 3SWWA 1B15A 1ZI6A 4LJ5A 3ABZA 4YRFA 2RHWA 3VISA 4UAGA 5JC8A 1GPDG 4HQRA 1LDYA 3L8DA 1DBWA 4HQ6A 4F9EA 1ZMBA 2QM7A 3I8XA 2AR9A 4TTTS 3U4QA 3GXOA 4XGNA 2A4MA 1KFEB 3CIFA 1N3YA 1Z4MA 3B6IA 2I67A 3KLPX 1RBZA 1U8ZA 1X77A 4G1MB 4R8RA 5BN5A 4URVR 2D6FA 2XEDA 5D3ZA 3N58A 1A9PA 1PL8A 2I4MA 3VNQA 3I9JA 1ISIA 4A15A 2F59A 4XD7A 1P9LA 2AW3A 2OHGA 5G1NA 4BP9A 3N8KA 2F7SA 3IMGA 3QVGA 1E3JA 2C2WA 3C8MA 4JUDX 4O2BA 4IV8A 3BK1A 4QQ8A 3M5CA 3ZNNA 4D8YA 1QFSA 1G20E 2WD7B 3QVJA 5DLDA 2ONKA 3TDMA 3ZVRA 3F2IA 3E5MA 3FA2A 1JHYA 1GYRA 3I53A 1DO8A 2FWJA 1VCIA 2JASA 2QUBA 3N0XA 3HZOA 3AUUA 5AKYA 3C16C 1NI4B 2C8VA 4CEHA 1J06A 2JJMA 1X7XB 4MUGA 2Q9AA 1MT0A 4NTZA 4FQ5A 4H17A 1U0OC 3WK7A 1IM8A 1HT2E 1CJTC 4HMQA 5K3AA 2CF6A 4V38A 3WX0A 4HVTA 4WW0A 2G28A 3VRHA 1GXSB 1IATA 4JBHA 4BVBA 1SOMA 3Q0EA 1ISPA 2AI2A 5H3HA 1DJPA 3RSHA 1A3CA 1C5KA 1I5RA 2CJFA 5AJZA 2B94A 3UC5A 1V9LA 2PN1A 1TYZA 3HU3A 1PVVA 3SSAA 2NVOA 2PCLA 2I3AA 4TT8A 4DCMA 4DB4A 3Q98A 2OGWA 5A3VA 2AFHA 1AA6A 3TSWA 5KYYB 4F3YA 1X1DA 1U4SA 3EIEA 2CLIB 1JEQA 3CUWA 3KZMA 5EZYB 2J0SA 3QOYA 2PL1A 4B5LA 3S2FA 1YIAA 4BIMA 4F06A 1PDVA 2B3TA 2WAOA 2DEUA 1CY4A 1UQRA 3VNRA 4KR3A 3P45A 1T2NA 2HK9A 4RSHA 2PQ0A 2YCLA 3DNPA 1F3OA 1XCMA 1MFZA 1H2YA 3GI1A 1H8EA 3L41A 4OJMX 3SJZA 4C4AA 2RAVA 4AC9A 3ZK7A 2X40A 2PKQO 1J4AA 1O95C 1W8IA 2IH5A 3TF5A 2HQBA 3I62A 2IYAA 5K45A 1SXJA 3CUUA 4RKFA 2Y4NA 2G82A 3KVNA 5KTRA 2B4YA 3MUNA 1ZU4A 4I46A 3RVNA 4MIYA 2ZJFA 4WI1A 1EK6A 1JBKA 4M0CA 4DNOA 4Y1RB 5AVRA 4M8NE 1HDRA 4WNCA 5ALEA 2GF2A 3NONA 2G71A 1OZFA 4RACA 2ISCA 4O0LA 4E5NA 1XZKA 3CV3A 3NQ41 1SU4A 4ZCPA 2HSZA 1G6HA 3GEMA 4O4HB 1B6RA 1ZW1A 4UUOA 1KK2A 1U3GA 3CRZA 1EDZA 2OZLA 2X6TA 3F5MA 3G1WA 4JXKA 1DOAA 2X2FA 1QFZA 3CRVA 1SC9A 3DMPA 3PRHA 4MMZB 2XQIA 2ADFA 1UJMA 4OSPA 5H9WA 1GG9A 4GLBA 4DEYA 1U2EA 4NFHA 2HM7A 4YRKA 1NBWB 3KEQA 1VC2A 3P9YA 1QO9A 3AJ8A 4WKBA 1T8WA 4ERXA 1E2HA 4DPMA 3KS9A 3GL9A 3F4KA 3E6AA 5CXSA 3OH8A 4V1CA 3R44A 3P7MA 4CTMA 3OMXA 4TV9F 4YPVA 4BEJA 1Q0PA 2FGKA 2D0IA 4YP1A 5KJ6A 3LOPA 4QUIA 2G25A 1P2FA 1NKTA 1YMUA 3KTAB 3L7OA 4EGCB 4RQTA 1J2YA 4FFNA 4NE9A 3HCEA 2ZKLA 1RXIA 3REOA 4MWOA 3F9CA 4CU5A 5ALQA 2CUTA 1YVDA 2HLNA 3JU3A 1E6UA 3O93A 2CVZA 3PTAA 3QLVA 2FSSA 1RHMA 3Q41A 1W6RA 2PH7A 1ZGCA 1NBAA 2Z58A 1XPRA 1KQ3A 3NBYC 2W2LD 5A9SA 2Z2ZA 1WULS 4Q1EA 4X8LA 3WG9A 3D81A 4HWOA 5A3JA 1NVTA 3LUGA 1ATIA 2DPYA 1HQKA 2FZ5A 4GDMA 2BEJA 2JC3A 3HJGA 5EFZA 3IFSA 3CZ4A 3LBYA 5LU8A 5F73A 3PKIA 2GVNA 2AJDA 3VR3D 4KBGA 3TX6A 3OT4A 3K92A 2EKLA 4XJSA 1FPQA 5SICE 3LT2A 3R3XA 2BI8A 2C5LA 1IXKA 2ZBEA 4M1ZA 5ISMA 1M8KA 3ESBA 4OL9A 1HX7A 4N5IX 1FU4A 3I05A 2C2BA 1T1IA 4D4HA 2G04A 3B38A 3AFGA 3ESDA 4CFYA 5LQCA 1NIJA 5BSUA 2WPDA 3QG1A 2AXNA 5JVDA 3VH4A 4ZC8A 1V35A 4HAOA 3OZWA 4O2RA 1C7ZA 1GIAA 4PZ9A 1TVKB 3IE1A 1O6FA 2AQIA 2JHGA 3WQQA 2EAUA 4NAVA 1ZGGA 5DIZA 3P9IA 5FWYA 3C1AA 2J87A 4FYWA 2UUBB 3KLOA 3UEOA 3VPFA 1E3SA 1QIHA 4L72A 4A8JB 4NOMA 1OQAA 1Z15A 3DBLB 5H02A 1N0WA 3KKQA 1ZJYA 4EBFA 2IV3A 1M1XB 3R5HA 1OW3B 4Z2AA 2QVBA 4L75A 3H1GA 4TSFD 2QPTA 1MPTA 2NU7B 5CURA 5DYIA 2C2OA 5MN4A 1R8JA 1J8VA 1KGSA 1WBJB 3JQPA 3L7AA 3ZWBA 5FH9A 5HRCA 3QVKA 5H4HA 3CZRA 3OTIA 1FC0A 4RLQA 1IHXA 3A9VA 1N6LA 2OCKA 1YDGA 2OKCA 1GGHA 2H59A 3A25A 3KD2A 3QPAA 4A0QA 4JB3A 1LW6E 2P9ZA 4F5EA 1MQSA 3LPNA 1ZSYA 2EJVA 1OFGA 1N2HA 4XRRA 2DQKA 4OM8A 4JJKA 3PKJA 2ZPTX 3QMVA 2WT4A 2DQZA 3D3JA 1MBZA 1LLFA 1LC3A 1XPJA 2SKCA 3FWYA 5E4TA 1CUUA 3TLEA 4GMHA 2AG8A 1SC6A 3FPBA 1WW2A 3LG2A 1V6AA 1Y80A 2YJ4A 2PX8A 3PXGA 4TVBA 2ZSJA 1KP2A 1EHCA 1PF7E 3U3RA 1E8DA 3MLEA 1M0WA 3NTOA 1C7EA 5BYAA 3EIUA 2J46A 3NYRA 4C6RA 1MIOA 5AW3A 1NV9A 5CK4A 3RWOA 5IUNC 4F6RA 1OWMA 2CMDA 4P0TA 3FRIA 1VYVA 1RM5A 2CFSA 1MMFB 1SXJD 2VAVA 5HILA 2ZS7A 3VNAA 3UJ7A 4FMCB 4I14A 3P4UA 1YA6A 1YL5A 4HSEA 4MPTA 5AKGA 5HUQA 1PT9A 1CS4C 1EUDB 1QCCA 1T1SA 2GHIA 3AF3A 4P93A 1V8ZA 4QHSA 3NRCA 1M2JA 1MH1A 4EEXA 3PFCA 4MR8B 5HG0A 2RBGA 1W44A 4PONA 1LRJA 2R751 4LXHA 1CP3A 2NUAA 4GD3Q 4RMHA 4WNAA 1SZDA 3Q3JB 4BUCA 3A9WA 4W5WA 2WTEA 3WO0A 2ZIZA 1NDUA 3A1DA 3QV2A 1NUSA 3ICCA 4BLUA 2W98A 2VP4A 4UC0A 4H4CA 4RHEA 4LKOA 2BC9A 2CNWA 2V7GA 2JFZA 2RH5A 2ACVA 1S2MA 3OOYA 5ALXA 4ASUD 3KIPA 2F8TA 4WK4B 2O3UA 2Q21A 3MWFA 1HZZA 2EGHA 2IK8A 4FYMA 2IPLA 5IF3A 5FWAA 3HA2A 4QBFA 2J0VA 1PK8A 1QHEA 3C97A 1E0KA 3IULA 1R6VA 4QOEA 2EFDB 2D59A 3FJYA 1BKYA 3KLBA 1V2HE 5C1OA 4F3CA 1M73E 3QFTA 3RS0A 4YAGA 1ZGZA 3PIRA 4I3GA 4WJKB 1F2TA 3FB4A 3PNLA 4EVSA 5AJXA 4L2IB 5DLEA 5AJVB 1JKMA 2RG7A 3TD2A 2PLWA 2XBMA 2WKSA 3HI6A 3U37A 4JASB 2SKDA 1C30A 4X7PA 4PG8A 4DJFC 5DO9A 5ENZA 4Q00A 1UDCA 2VDQB 1QGDA 2FG6C 4W6ZA 1A9TA 1GTZA 2WZCA 4EL5A 2FSIA 2IOYA 3F6PA 3NIBA 1CZOA 3T12A 1ZD9A 4DLUA 4G0YA 1LSJA 1KQNA 3PPWA 1S9HA 4HPWA 5IMSA 1R66A 3KVOA 2YFQA 2KLHA 1TPZA 3FDZB 3NHJA 4IIJA 4YDRA 1UMDB 5F76A 1A8IA 4W9RA 1QGED 3LX5A 2D1RA 5F4ZA 3PT9A 1ZCFA 2BH9A 2PVCA 5BW5A 1OF1A 4MGZR 1O94A 2WR8A 3FHLA 2G72A 3V1UA 5JCXA 2DPLA 3B6ZA 5JVDF 3RC7A 6ABPA 1VE6A 2FH5B 2Y1OA 3GJZA 3IEKA 2YH2A 3K72B 5DN6A 4UTVA 5KTTA 2R79A 1I3MA 1NJSA 2CLFB 1RWQA 3ZG6A 3NHWA 4BBAA 4G1CA 2VK8A 2L17A 1GPMA 3RAEC 2YNMC 1G5RA 2IHJA 3EPJA 3ICOA 3ESCA 1KO5A 3GNLA 3CEJA 4PF1A 4L02A 4FGZA 4UVIA 3ZWMA 1TZBA 4B7ZA 5CXXA 5F23A 1L5OA 3PWZA 4PAOA 5CUQA 2LE0A 3A1FA 2BZGA 4IDPA 4KAFA 4KITB 1Z0UA 1XMXA 2EATA 5AFSA 5JNUA 1XFDA 2LWIA 3HXKA 4ZVNA 1ULSA 2DPGA 2V9PA 1BNCA 3H3JA 4OSOA 2WG2A 3R3YA 3N0VA 5DM0A 3JAWB 1K0UA 5KC8A 1D4AA 1VL5A 3OT1A 5KX5A 4KMOA 3CG4A 5FFFA 3B82A 4UHKA 2B4KA 3EXHC 3FZGA 4H1TA 2B1RA 5AI4A 1ONSA 5LLTA 3UHFA 3ANSA 1G2OA 4IAOA 2DQSA 3K1AA 1DAOA 1M2WA 1R9NA 4F91B 1ZITA 3LQ4A 1EH5A 1Y1KE 2XJ9A 4LECA 3VR1A 1NOJA 3RYHB 1ZAYA 4AI6A 4G0VA 4IICA 1K06A 4UCWA 3M2TA 1L7EA 1BFKA 4UNSA 5HM6A 3T7JA 5CEFA 2PTGA 3HHEA 1DAGA 3PHGA 4L9AA 3H5IA 4TSRA 2HK8A 3RVSA 4FFPA 2JIRA 4K6OA 1G0OA 2ACEA 1SCQA 2G77B 3ILVA 4OVKA 1QBKC 3EFOB 2ZDQA 5LDGA 1TEHA 3GFBA 3MYYA 5JY6A 4QEZA 1G3UA 2OLJA 2WV7A 3JD4A 1L9KA 3UMYA 3GH1A 3QI2A 4KQ1A 1R4MB 1E3QA 1ZIPA 3HU5A 4RPJA 4RZIA 1X1QA 2CNOA 2GOYA 2Q27A 4LDQA 3RGWS 5JI2E 3LWDA 5HXAA 1RNLA 1GLVA 1QK4A 3QFFA 3RBXA 2X0NA 1I4WA 4UATA 4JY7A 3K5HA 4CCYA 5C3MA 3CW9A 3RDPA 2HPZA 2GBIA 2QX9A 4IIVA 3WL6A 4I5DA 4Z51A 3OQOA 2PX2A 4NFSA 3VAAA 3DTNA 1Q0UA 2NX2A 5EXPA 4XTCS 2MTBA 3WB9A 4U3JA 5GMOA 3DAHA 3NP7A 2OBBA 4LTNA 1VLMA 1LDBA 3H9EO 4LYEA 3RT1A 3SQDA 3ZCTA 4IUCS 1ABBA 4F6CA 4EJSA 3MFQA 1WDWB 1LSSA 1W1IA 2PBFA 2V6GA 3GFSA 3DE2X 4OF4A 4OQNA 4OYHA 5CHYA 3VAYA 2HAEA 5IJWA 5JJBA 4X1YA 1GQFA 2HA4A 1JILA 4CLEA 3G2QA 3LP5A 2ZQYA 2BSQA 1TMOA 2H51A 5E7MA 4EA9A 3DOHA 3KQWA 3KZOA 2FUKA 3NT4A 4KO8A 5A4IS 2DUMA 1E98A 2H85A 5DDIP 4J3NA 2Z2YA 5L45A 4GPD1 3HNOA 4HN9A 1CUCA 4R41A 5K2MA 1MAHA 4NBNA 4M53A 3WIUA 3EXEA 3F7OA 3F74A 1NVGA 2I6SA 3ID6C 4B6EA 4UTNA 3LUDA 5EHIA 4AYXA 1TT7A 3O4HA 3GHHA 4ZTZB 1IMJA 1V43A 1JAZA 2MU1A 1A27A 3IBYA 4P3KA 3DZDA 3WNDA 5E1DA 1JZTA 2Z1NA 2C83A 1TCVA 3DFMA 3FYUA 3GCXA 2E4XA 2WTNA 3HKBA 3HRIA 3I6BA 3BTUA 3LD9A 4JR2A 4Q02A 3I2JA 3SBXA 4OO3A 4X94A 2IPOA 3QENA 1R3UA 4CLRA 1GCUA 2O8EB 5ICCA 2VDLB 2ZIAA 4JLAA 3K20A 2A8YA 2XUQA 2GWRA 4BNZA 4ESVA 4M38A 2FRDA 4TV8B 2I1LA 1BG6A 4K6FA 2XUOA 2OP0A 3UMJA 3GFGA 5IG2A 4BCCA 1XNGA 1P6QA 3N8IA 1Q19A 2FUEA 2PT5A 4PTYA 1B2LA 2JH9A 3KSMA 4QTXA 2WICA 4XLZA 4YDSA 2GT1A 3EEBA 3FE2A 1N9ZA 3FW1A 4ZZ2A 1E2NA 2GSWA 1NW7A 4J2OA 4BQSA 4JKIA 1BE6A 2OFWA 3KPUA 2OB1A 1BEUB 1SUBA 1V8FA 1SXIA 4K6KA 5JAPA 2I8LA 1Y42X 2OMKA 2D5CA 2IYVA 4DG9A 5J23A 4K9DA 2QLLA 3UA3A 3PC7A 3D3WB 1SVOA 4WGGA 2G9RA 3H2ZA 3WHLA 2FP4A 3ZTTA 1WXWA 4BFXA 1SY7A 3PGJA 5KYYA 4MUMA 1CY6A 1E2PA 1BZYA 3KKOA 5BWBA 3VV2A 3S81A 3V1TC 1WCIB 3MGBA 3FUWA 4ZOQI 2NZ8A 1KJQA 2B6HA 4TTVA 3HUDA 4OQDA 4YLGA 1YKSA 3CIOA 3PQ6A 4JLWA 4NR0A 1QVRA 1UXIA 4B2PA 2I3GA 1OGJA 3PGVA 3JQAB 4H0FA 4MCAA 1XK7A 5ULLA 3LP8A 2FX3A 4TYNA 1U0RA 1CP2A 4HFRA 3S0JA 1NMYA 4PG4A 4XPIB 1ZM9A 3WLEA 1YV9A 3E9NA 4BJHB 3H7IA 2OG1A 1G8PA 3H2IA 4UCFA 1W2GA 1XV5A 4MXDA 1ZA2A 4K6GA 3UWKA 1NASA 1JU3A 1YDHA 3VSAA 2PGIA 4HMPA 1TZ2A 3IPXA 5A4KA 2YYZA 4LF7B 2ATCA 2GTIA 2G5PA 4ACBA 3K9HA 3MIIA 1YXMA 4J91A 1N4AA 2GBPA 3EE6A 5LBTA 4BVHA 2XF8A 2BTEA 1T6BY 2JGAA 2BEVB 4E03A 4MV8A 2AN5A 4EYEA 1SVUA 1XLTC 1Y3AA 4IKPA 5C4MA 1KC1A 2AKAB 4IEEA 1B1CA 2OFFA 3WOVA 3S2UA 1SIUA 3R3UA 4L7VA 4QL3A 3PE6A 4Y2VA 3OCCA 5B3AA 2QU8A 4Y2XA 2MSKA 1PKEA 2P6PA 3GHYA 5CDYA 1XTBA 3OFNA 2WRZA 4UCXA 2A9KA 3CT4A 2PV0A 1X7HA 3JWIA 2BGRA 3BD7A 3LA6A 3K09A 5FUWA 5AKJA 4IJWA 1QZUA 2CB0A 2ZGVA 4PGAA 3G6KA 3WYNA 3LLVA 5KCZA 1HT1E 4GW3A 4A8JC 2Q99A 5IVKA 1K3TA 4NARA 1TQDA 3ZHXA 1I1HA 1U8AA 2IU3A 1I6LA 5FLXA 1RWPA 1T4CB 4PHCA 2G6BA 3MRXA 1BTOA 2ADMA 2Q1XA 1LY1A 5BSEA 1UT5A 1Q7TA 2H2FA 1P1JA 4FEYA 2ZBRA 4LZPA 4MWZA 5CP8A 2WPNA 4GPEA 1P0IA 1FFEA 3NWEA 3UXMA 4MQEA 1IXZA 1KI2A 3NWPA 4MUXA 3ZU4A 4NS1A 1L5HA 1JHDA 4O29A 4OAQA 4DCTA 3N6VA 4JBNA 2B2CA 2XSZD 4QU8A 2ZROA 2OCPA 1P0QA 3QW2A 4BDTA 2X8WA 2HWKA 4O2AA 1E20A 3HJHA 3QFHA 3FVVA 2IXBA 4J3JA 2ONYA 3V8EA 1A8UA 3OSZA 3KU1A 1U2DA 3H1AA 2B99A 4E3ZA 3HRHA 4B17A 5JFOA 3ZQ6A 4EHKA 3KFVA 1AXGA 1S96A 5AIAA 2ID9A 2JAOA 3M70A 2H5IA 1DTWA 4DBZA 4JBYA 5G0WA 1AK2A 4U39A 1ML3A 3HKEA 5EPUA 1N1DA 2I1WA 3JVEA 3D5TA 2ZB3A 3OIDA 4IIUA 3I01A 4RPGA 1YOBA 1PGJA 3V97A 2PWYA 1VE5A 3AHHA 3A05A 3OF2A 4IR7A 4QECA 4ZOLB 3VKUA 3RARA 5AKKA 3S29A 2JDIA 2H1WA 3MIZA 3A37A 1YRWA 4XIYA 3E8MA 4QDKA 2GPTA 5J2UB 4FGJA 1ZK1A 4REOA 2H5EA 2GJ9A 4G89A 5A4DA 1GPNA 4HYTA 1EWKA 1L5FA 4C30A 3DAYA 3V8PA 2FWAA 1RLUA 4FONA 3KSUA 5AJHA 4PYRA 4RKEA 5DK6A 2H92A 3OPVA 3MTGA 4HDKB 2XCLA 3RK0A 1DMRA 1G291 3FB1A 4PVDA 4CL3A 1KFKB 5DW3A 1SR8A 1KVQA 1E9SA 3Q5DA 4LV8B 3EMDA 1KEZA 1KEWA 3HKDB 4XWYA 5E3IA 1LVHA 4DIFA 1NJ8A 3AR5A 4GOJA 4BVGA 3PX7A 1QCDA 2GMWA 3AM4A 3AF5A 2AD5A 1Q1NA 4R1SA 5LLSA 4YCSA 3GUCA 3Q87B 3KVVA 1UJBA 4F6LA 3LXMA 2VHQA 4ZHQB 4UBMA 3G2KA 1BU8A 4FFDA 2K7FA 4PICA 4PLCA 3AKYA 3IBCA 4AWBA 3UW1A 1P9WA 1VMAA 4G5QA 5KS2A 1SKMA 2CUNA 4H7HA 2OCXA 4ND8B 1U5CA 2IH4A 2EFHB 1QTQA 2W4MA 3B9BA 4KPUA 3LZCA 4R5HA 4YMSA 4P98A 1XHLA 3JQGB 3SNHA 4HUTA 3T9AA 5BV0A 1ZHHA 5EKSA 1T3SA 2Z9CA 5JLJA 4LRSB 2UXCB 4OREX 3W7VA 4RS4A 4U2KA 4E08A 3V5NA 2PGXA 1JDTA 1K6IA 1RPNA 1FNDA 2VJNA 2HEGA 3GLHE 4L57A 3RFFA 3UMFA 4LZZA 2YIDA 3DLHA 2JLVA 1JXMA 3AEKB 2YXNA 3DTTA 5U1PA 7ADHA 2D2IA 5J2TB 3GOHA 2C61A 5CCBA 4TZ0A 2FMIA 1UANA 3OA0A 2XJ4A 5LP6C 4BO3A 2X23A 1DBPA 3CUSA 4Z7JA 5UKDA 2QMUA 4PLZA 1JSLA 1JAYA 1U4NA 1NPTO 3CF2A 3FWZA 4OMDA 2V7BA 3LC0A 4FDLA 3F9RA 4V1CI 1YB4A 2IL1A 2YWGA 3TQHA 4QJ4A 2IIQA 3GLUA 4QT0A 1VBKA 1EFVA 3SX0A 3LY5A 1X9GA 2QP9X 4EPYA 2Q5HA 1BX0A 4FMPA 5DBOA 2C7BA 3JQAD 4US1R 1F4PA 4EF4A 3BTSA 1KYZA 1MIHA 1KIMA 2VC2B 3HCCA 1IY2A 1KOFA 4OHWA 4RKYA 4ZI7A 4C1BA 1WLSA 3G0DA 4CV3A 7REQA 1ZGAA 4ESEA 3AUKA 4F72A 3GZTB 2VK4A 1B0UA 2WJZB 1T8YA 4B8ZA 5AVJA 3W9UA 4DR6B 2QT0A 3BSWA 3W06A 1T4MA 4IDNA 4MNTA 4UULA 3U3JA 4TWIA 1KK1A 4J0GA 4YQEA 4I55A 3NDJA 4PHTA 3OEYA 4YREA 1NSFA 3IIEA 1ANKA 4L50A 2BGNA 3C6ZA 4L4YA 3FPJA 4WFIA 1JSZA 4PZ0A 1E5TA 1EK2A 3IO3A 4BFZA 1IXSB 2GZ2A 5DP1A 4BKQA 3VO1A 3FDZA 4IXNA 4AJEA 1BWRA 1TQ8A 3ZJ5A 1IHPA 2BFBA 2BEWB 3UK1A 4YRDA 2V7QA 3I04M 1H0RA 1CSEE 2D4HA 4I9FA 5J2TA 1OC4A 3N07A 2PBLA 1H4QA 3CN7A 5LXTB 3VU9A 1UZMA 4N48A 2OHOA 3IE2A 3RLFA 3KT8A 2B5OA 5DSXA 3ROMA 1MAAA 1RQNA 4M98A 1DKRA 3MTDA 3ZJTA 1HPLA 2WA1A 4D9JA 1LI4A 1W4AA 3HE3A 4GGOA 3I76A 4H0CA 3C85A 3GJ5A 4FQ8A 3PITA 1SJ9A 1VPDA 2QR2A 2VI5A 2ECKA 2ES4A 5E1MA 2MOKA 4JQYA 4YCAA 2PYIA 4HNTA 3HPQA 3NOVA 3CVUA 2I78A 3P27A 1QYWA 3P5BA 2XMBA 5C1IA 1MAUA 4MIOA 2CLLB 4LIPD 3Q0IA 5DV9A 5IK2A 1NQOA 3O9MA 3EDRA 1FYEA 2HX1A 3OPNA 1YL7A 2F3PA 2I8CA 4XARA 4JENA 4MW5A 3JARB 1XPUA 1GCGA 2PAAA 3L06A 3JQDA 3PC8C 4TVOA 5JAZA 3RF6A 1ZRMA 1F1BA 5JYEA 2X9NA 2CCJA 4QO8A 2PUVA 1DIAA 3JS5A 4PRLA 4E4TA 4QYXA 1NW8A 3AESA 5JXHA 2XQGA 4P36A 4MGYR 2ZSDA 3QE9Y 2X1VA 5JD6A 3RRNA 3B3AA 4D3DA 1WSAA 2DCMA 5CMLA 5CH3A 5G02A 3MUOA 2I3DA 2AZXA 1PJRA 1XTTA 2D2XA 2JGFA 2PCJA 4MO9A 1D6MA 3SPXA 3UH0A 4PN7A 3BE8A 1A98A 2EL7A 3DKRA 4UDYX 2YN0A 2GILA 3SXUB 4KJZA 4BJ1A 4INJA 5K51A 4WD3A 1RXWA 5FKJA 1KETA 1NXTA 2CBZA 1GP2A 3JWGA 3O3MB 1WG8A 2J7PD 1RRCA 2V1XA 1M34B 1SK8A 3OA2A 4ZXFA 4I5FA 3ND6A 3K09C 5I51A 1A7KA 4ZPXA 3N53A 2C7OA 5D8DA 2C5EA 2EJWA 4IGAA 4ZN6A 4KE7A 4I5GA 5CVCA 1YQGA 2Q0SA 4AF8A 1LXCA 3LWBA 3RC9A 2HWUA 5BW8A 1SOVA 2GD0A 1Q1ZA 1P9NA 5HFNA 1U98A 3ENQA 4K6HA 2D8AA 1OYWA 4MKXA 3F97A 4ARSA 1AGYA 1HV8A 2H4JA 1SPXA 2VDVE 4LBWA 4PC1A 4WK2B 3RJTA 4EYKA 3VA7A 3G1TA 2FRDC 3FTPA 4JC4A 4QWWA 1DINA 1SQSA 5FUVA 4R2WA 4TKMA 3VGPA 5LR6A 4CQLB 1G16A 3IAXA 1UJ6A 3WDLA 3IOYA 3ORHA 3TZEA 2FPWA 2P6OA 4Z0PA 1Y8QB 4I9NA 4CZ2A 1LF0A 1OZAA 5MN6A 5FWNA 1VHJA 1A97A 1CDEA 1YKGA 5D87A 3BIXA 1L5QA 1RBMA 1N2GA 3PGMA 2VYND 2WVAA 4KG7A 5FOSA 3U4IA 1H6BA 2BHRA 3DEIA 3R6TA 4L6IA 1G8HA 5CTAA 1GA6A 1T0JB 3LOUA 4RU1A 3TO5A 3RAFC 3WMFA 1Q2UA 3ENZA 3DMDA 2BUBA 4P81A 4RH0A 2P9JA 1E77A 3LCMA 4JC5A 3VSDA 3SDSA 4CM5A 4NBUA 1WX1A 4HAVA 4ZI7B 4TYPA 4DCOA 4A6DA 1HI9A 1O0SA 1P0FA 3MWDA 4NABA 4YGXB 1L4FA 3NHLA 2H08A 1YQDA 2NZWA 4TQ9A 1K5HA 4G56A 1KOJA 3H99A 4TM7A 3BB4A 4LOIA 1IZ9A 4OU5A 3U7EB 2X3FA 4MUAA 2BGMA 1U2RA 4F97A 2ZIUB 4RJLA 2H3HA 3VO9A 2A30A 5KNBD 5EQDA 2XD9A 1N75A 1U65A 2XYQA 1E6LA 1GRCA 1Q0QA 1Y34E 1I3OA 2P40A 3O8OA 3FMIA 4Y9RA 4OM7A 3U9LA 4CM6A 5BORA 1RZRA 2HIMA 4R9SA 4YV1A 2C8KA 3TW0A 1TJNA 1OJLA 3DJYA 2JHAA 3JYLA 3M9LA 5F2NA 2FWIA 3ODPA 3PEYA 4NBSA 1SIOA 2NV6A 5LYJB 4BKOA 2WHPB 2F2TA 2VTEA 3LPLA 4QPNA 2WMOB 2Q0HA 4I8DA 1E62A 5BWOA 4KQKA 3U80A 5BPFA 2HR1A 1S3IA 3EFBA 3BZBA 1X7XA 1L7RA 3KL2A 4NYJQ 4WXYB 2HC9A 1BYIA 3CO5A 3JCZA 4AWXA 4EUNA 1CEXA 3ZD8A 4U8HA 2QTMA 2NPFA 4BNTA 1YFLA 2Q8PA 2ZREA 2VWGA 1DVRA 1T4BA 1ZOIA 2A0YA 1F14A 2H1RA 3FUTA 4COOA 3KTAA 1Z2CA 2B37A 2A94A 4OP2A 4GWGA 4ZTBA 3R7LA 4B32A 2PMWB 3GCDA 3D6AA 4LW8A 3GLGE 5K9ZA 2GJAA 3EWAA 1RHRA 4ALNA 3W5BA 4DDVA 3R3VA 5KTKA 1U7ZA 3C3XA 1EX9A 3U19A 4JGBA 1JTVA 4KIJA 1U1DA 1XZMA 1AMOA 5IASA 2HJSA 3L8GA 4LVCA 4IIBA 3QG5A 2J6CA 2J67A 3QEKA 4H3SA 5FWDA 3H04A 3Q72A 3UAOA 2WABA 3BWMA 3QU4A 2A0FA 2YYSA 4CIWA 4DJ5X 2FYTA 2X1HA 4CQMB 1ZL2A 3L46A 3T41A 1PWYE 3GCWA 2O20A 5EWMA 1TAUA 2OVFA 2H4ZA 4UVEA 4QT4A 2IWRA 3DVQX 2OAP1 2XHZA 4DUGD 3OTOB 4YCDA 1MB3A 2RK6A 1W0KD 3OIGA 5LQAA 2QE7A 2H1OA 3CH6A 4LVOA 3P94A 1XN1A 2J3HA 4MUYA 4GM1A 5LUAA 2ZRAA 2OBNA 4MARA 2KSQA 2O54A 4EG6A 2CJWB 2R11A 4ITUA 2ATIA 1I24A 3X1ZA 1GZDA 1VJRA 4XGQA 1HDEA 2IITA 3LC2O 4CV2A 3NM5A 1NW3A 1VE9A 3V55A 4ZXPA 3RO7A 5JECA 2EP8A 3KOOA 5CW2A 4HGQA 4YIKA 4KREA 4S24A 4MJ3A 1X80B 1Y4DE 1NLYA 1E1MA 2GK6A 2XVMA 1XYGA 3BWDD 4IQ0A 4R1OA 4Q4AA 1ELOA 5F33A 2JAUA 3F49S 1BCSA 1NQ5A 3M5PA 3RWMB 1S2GA 2WVJA 2LCQA 2WP0A 1QR6A 1BCSB 4PLVA 2I99A 4L6CA 2AOWA 4NS4A 3MAGA 4BS9A 3WI7A 4Y2JA 1LC0A 4EUSA 2ZJ6A 3L7JA 1G8AA 2VZ9A 4JC8A 3X44A 2XIJA 3MELA 3NWJA 2OCBA 4NZMA 1G42A 3BHJA 4ZAWA 1TT5B 3IP7A 2MCFA 5AW8A 1P72A 4FDAA 1OAOA 2PNJA 1ZK3A 4K28A 2YWXA 1CUVA 2G67A 2O2DA 1DFGA 3QX7A 4HGRA 1QH1A 3DEZA 9MHTA 2FI1A 4FILA 3G49A 3O21A 5CCXA 2ZRFA 4KNWA 3C6YA 4IMIB 4UQPA 2GM4A 1TLFA 3R7WB 4DC0A 3BFVA 4ZO4A 2C04A 2Q0QA 3X1DA 4UHCA 3L7YA 2NACA 1SQ0A 2EIHA 3M33A 1KEEB 1PWZA 3KU4A 4UNPA 4DW8A 3EDMA 1VJ5A 4P5PA 1M1NA 3CZQA 4CI9A 1JG6A 5AKHA 4UFOA 4IRXA 1UBOS 2XDQA 3RFTA 1JYSA 3I83A 3MJRA 4OK5A 1BMDA 1MC8A 4RKRA 5BSVA 3UPTA 4C4SA 3PEVA 4BFTA 2WQ6A 2NU6A 2NSJA 4RPHA 1VA5A 1FRZA 3Q2KA 4I19A 3I45A 1PV2A 3TK1A 1QAQA 4OLBA 1HFKA 1JDNA 1S5PA 1VL2A 1E2GA 3GJ7A 1HYGA 4IDCA 4M21A 3G85A 3T5GA 4R9RA 1YZ3A 2FEAA 4RHTA 3U39A 4I50F 3LVFO 1HSOA 3FYHA 1IN6A 2R00C 2HTEA 3WAGA 1SD2A 4LPSA 4MKZA 3W1EA 1EFLA 1YRQA 1P4HA 2B1JA 3NFRA 2XUJA 2J9FB 2ZUBA 4N5MA 4XJTA 2P62A 3AFMA 5IEJA 1QHFA 1PAUA 3BL5A 5LD2B 1UINA 2DUWA 2XWSA 3KX2A 5KHOC 1M76A 4M8LA 2QTLA 3MTAA 4L8YA 2VNIA 1ZVVA 1K63A 3RYHA 2OCGA 4BN5A 3WGIA 4NXMB 4U02A 4KMMA 1NM5A 4LJAA 1T9KA 3ETHA 5ALIA 3T7DA 4Z4IA 5JEDA 2Q9CA 3E3OA 2P4SA 1W4LA 1G0NA 1H2ZA 4ARZA 4CN9A 3JV7A 4MCIA 1X7WA 1YJXA 2F17A 1JZQA 3MHPA 4GKKB 2UVQA 4C0KA 1S2OA 1E99A 2NNLD 2W6IA 1WKVA 3ZGVA 3B36A 3ZQJA 1DOZA 4HH3C 5M7EA 3UVEA 2WFZA 2Q5OA 2ZWVA 5JS1A 4DNQA 1N92A 1F2UA 3I2FA 2RHTA 3M6WA 5DMHA 1JDZA 1KVRA 2MYPA 4HCJA 4KDRA 5HOEA 2FQQA 3A6EA 5CM9C 2VP0A 2X8JB 3TTYA 3OE1A 1SVKA 3P5SA 3PFGA 2C2HA 1OH8A 2ODAA 2A5GA 4IM7A 1N1GA 4LXGA 2AKYA 2YC4C 1BDJA 2GXUA 3EXG1 4G1BA 1DC8A 1UEXC 4G86A 1HH4A 1UOEA 3G8BA 3GGJA 4F3NA 4DV6B 2XEXA 4OQZA 4KMRA 1GUZA 2IYPA 3BD9A 4TYQA 1C8VB 2DE0X 2FZCA 1BGWA 2HBYA 2ZYWX 4M9RA 2ZIXA 3WK5A 4Y6RA 4KL8S 2DR2A 1NL3A 3CUKA 3UAZA 2F90A 1IVNA 5K0JA 5DN6D 3ORYA 2H16A 1M1YE 4M88A 3ZGNA 3FH0A 2B92A 1OIXA 1QHHA 1C1XB 2PL9A 1Y7HA 3BF7A 3QOWA 4MYUA 4Q39A 4WZZA 3G79A 5DGHA 3ZHOA 3I8OA 4EOGA 4YRCA 3BH0A 5LIRA 4JBXA 5KVQA 3CG0A 4PR3A 4N3GA 3A2LA 2DJ5A 2RGCA 4JLDA 1RYHA 2AMJA 3ZHQA 1PTKA 4LV5B 4XSHA 5A2GA 3WRYA 5E4JA 4GEKA 1ZK2A 2FWRA 3F6RA 1CY8A 3A4YA 1VB3A 1RAAA 4GYYA 2IX3A 3BVPA 3C7CB 2GK3A 1SOAA 2HSGA 1QYDA 4ZZIA 4ICIA 4B2YA 2D5IA 3HCDA 1JLRA 1PL7A 5T6BA 1GAJA 1GL3A 5CX4A 4BE4A 4FZ5A 1FA9A 4LJLA 4FXPA 1N7IA 3E70C 4OJQA 4V0QA 3BGIA 1Z0SA 1T9BA 1X87A 3SZMA 2E2WA 3AL2A 1RVV1 3ASYA 5EE3A 1DFHA 4NK4A 1R10A 3LLSA 2I6FA 2CWWA 1X38A 4QDXA 2AZTA 2VP6A 1X9IA 2C77A 2HCBA 4ZAVA 1R0YA 3AEXA 4PTZA 5H83A 3R3JA 1VJDA 3ZU6A 4NJMA 1GDTA 2VZEA 4RSMA 1EJ6A 3L1HA 1U0HC 3LCUA 4PYJA 4M0PA 1ZN2A 3QEMA 3ZDFA 5I7FA 2OC4A 4OKSA 3HCAA 3NIDB 3ZWAA 1IBKB 4D79A 2GJSA 3DE3X 3NXKA 5BVHB 4FT4A 2B69A 1MG5A 2JI8A 1EFHA 1K92A 3HA5A 3IMKA 4FEEA 2DC1A 2WSIA 1DAMA 4AQ7A 4X60A 4B75A 3OLVA 4K9PA 2XB6A 1TTHA 1KSGA 5C3UA 3BAFA 3WNQA 3UH1A 4OGLA 3BYZA 3H3XA 1BN7A 2FR8C 4IHJA 3M4NA 4LGCA 4PAGA 4XYGA 1PZNA 1WKBA 1MG0A 2J0UB 1J0CA 2PUJA 4J43A 4PV7A 4BFYA 3TUZC 2GBLA 4KLAA 3V1KA 4Z49A 1DARA 3HDJA 4RK0A 1P7YA 2QTVB 3S8MA 4Z8XA 2EZUA 1OFUA 2IGBA 3RUAA 1YKFA 4WH0A 4DA6A 3R5TA 2PS0A 1F8FA 1WCXA 1P77A 3EVFA 3G02A 3M7IA 3P2EA 5FNVA 3C6KA 2JH3A 1ICEA 1V1RB 3C3BA 4B82A 5C2JB 3HCOA 4K0KB 2Z09A 3C24A 4E12A 3UWOA 3V7NA 2ZB7A 4BJ3A 3DV9A 4O25A 5A1JA 1NVVQ 2HK7A 3DXZA 3QBJA 4B3SB 2QB5A 1SZCA 3OJWA 4DLPA 2ZFUA 3NTVA 1WXXA 3RVQA 5KOHA 1YO6A 4UZFA 1N0VC 1G63A 3H5LA 1YJBA 3K0HA 5CHEA 3QOXA 2FLWA 1MQAA 3UXYA 3ZV5A 5M2QA 1GKIA 3ASUA 3UHAA 1MO4A 2O2GA 3SQNA 3B2NA 3VZRA 3AHJA 4LFCB 2HA2A 1FLDA 3LDFA 2CF5A 2I2DA 1G18A 5KTOA 2Z6UA 4LYHA 1QH9A 4NQRA 2EYUA 4C87A 4CF6A 5CAEB 2XODA 1YIDA 3B1VA 4G5OA 2EKQA 1W75A 1L5HB 5ARDA 2ZCUA 1ZSVA 3HB1A 9GPBA 1RBYA 4CEJA 3VHXA 3GEHA 2JFWA 3MBKA 3PR1A 4HDSB 4RZXA 3SICE 3ZE0B 3KSAC 5I4IA 2HOQA 1KYIA 1EG7A 2X0JA 3BMQB 4X91A 5KTPA 4D1YA 5ICFA 1UC8A 1T3HA 3ESYA 1GSHA 2FN8A 2Q6IA 1D2GA 1TYDE 4RD1A 4ZVQA 1XDGA 2DOKA 2A35A 3DPIA 1W52X 2JS7A 3FDJA 1NLMA 1F0PA 3GIDA 3GVXA 4I6JA 4TTAA 5H3CA 2BH2A 3AL0C 2IRWA 3ETEA 4CMIB 2ZBPA 4O0MA 1A4XA 4W63A 1E9BA 3TVYA 3Q7EA 1QF7A 3E22B 5F1PA 3RK4A 1E3WA 2BHSA 1UF9A 4P0PB 3NGMA 3P97A 1V8BA 4C7BA 2CLMB 1PR6A 2YJTD 3UGKA 1J07A 1VKZA 2F9FA 1FQOA 4G6ZA 3EXG2 2KX7A 3FR7A 1LLUA 3NHUA 4QTZA 4TN1A 5CA0F 1LI7A 1SVSA 2O4UX 5E6UA 3WQRA 3GG9A 2ZM6B 3WLNA 1ITZA 3KB2A 2OP1A 1T29A 4L9WA 2ZTMA 2WZBA 2F67A 5HS4A 2BZ0A 5K09A 1NP3A 1T25A 1EA5A 1K6EA 4RD4A 4S1NA 2JD1A 3RTEA 2PJUA 1A5TA 4W9NC 4AROA 5HTOA 4IJ5A 3JQBC 1Q3TA 4WBSA 4INAA 5IKOA 3O84A 4FCVA 3AW8A 1XRNA 2AEFA 2O4CA 2SNIE 4AQYB 1Z6AA 3H2JA 3LX8A 2WILA 2FK7A 2VSOA 3UUEA 1CT9A 4YAEA 5K0GA 3OZIA 3IILA 2AOXA 1NJ1A 4POOA 4GXRA 4Y9TA 3GVHA 1VI5A 2AEJA 2BHTA 2FWNA 1A77A 4IJQA 3SM9A 3T9CA 2ZIVB 1FSGA 2WU0A 5B2FA 4QU5A 1KDTA 2EVWX 3EEIA 1SFRA 1EVZA 1P2SA 1PBNA 2FU5C 4GZLA 2FGJA 1TKBA 2WKRA 3WLHA 3M89A 2AC2A 1QVZA 3FLBA 1ZIYA 5BNWA 2QD3A 5BYKA 1MVOA 3C3AA 4FP9A 4HPJB 1QFXA 4NY1A 3U1BA 3MN1A 4K9QA 1Q14A 1E69A 3NRJA 3OPYB 5AD1A 1O5OA 2OENG 4JYZA 1ZH8A 1J20A 2IPAB 1XQ6A 3KQOA 1BXRA 4MPDA 3O1HB 2BR4A 1Y3FE 5LBUA 4E2XA 1EAMA 1CUWA 1NNEA 3AY6A 2P78A 4C2AA 3KJHA 1LQTA 2EW8A 4MA0A 2EZTA 4WUVA 4PSUA 1VYHA 3AHCA 5DGTA 2KJQA 1EP1B 2YHIA 1T0PA 5K6AA 3AR7A 4LPKA 1LJUA 5DHUA 1C50A 5D5HA 4LYJA 1C8LA 1KNXA 1KZYC 1PTJC 3MINB 3E7DA 3N8HA 5GINE 1E60A 1PWHA 3JZIA 3WDMA 4OA5A 1QHXA 3SJCA 4Y0NA 1ZBQA 1YQUA 2YJ3A 3GLFE 2QDXA 1KAOA 1R12A 2OK8A 1DTEA 1U02A 3M6XA 3B6KA 4I6GA 4MDFA 2NSYA 4CM8B 5IVDA 2FQYA 4CVNA 2ESRA 1KI7A 3V3TA 3EFHA 2ONCA 4PYQA 4DVGA 3CPJB 2YZ2A 3KT0A 1HMYA 4G36A 2GAIA 2VFAA 4Y6LA 1YR7A 2Y6VA 1T15A 3V8MA 3C6MA 1P18A 3IEXA 4XWAA 4WXMA 4N41A 4EG4A 3HJAA 4JLJA 4MQFB 1JFTA 5C53B 1AHHA 1UBJS 2FWBA 2IUFA 4MICA 5EOVA 3T1OA 3UKOA 2CLSA 3NBKA 2XT0A 4ZYWA 1CUZA 3IT3A 5C7OO 5D51S 2AD1A 1RHUA 2XHEA 4R2XA 3AK4A 3ANXA 3SZLA 3ZWCA 3U6BA 1PFKA 3KQUA 1Q11A 3ESRA 4Q4CA 3T4EA 4RVGA 4TLBA 1EMDA 3D8SA 4IDFA 1UPAA 3MF4A 2FB9A 5AUQA 2ZSUA 2QT9A 3H1TA 4DLLA 1KEUA 4QUHA 4B76A 1KDOA 2OAGA 3IUMA 1FSPA 3BG5A 1JJ7A 3EA5A 2WY2D 1VRVA 3IV7A 1UJ2A 4PSCA 3UICA 3T5AA 1M5RA 4LAFA 1CD5A 2UUOA 4B3CA 2A5JA 3A4IA 1OH7A 3WE7A 1SQGA 2KM1A 4CG2A 3NS7A 4UKDA 2WYHA 4OXIA 3PC3A 2P5SA 1U5BB 2VUTA 1XQVA 3JQ6A 1TUBA 1P1KA 4D9EA 5DCYA 4DMUB 4U5XA 5LYJF 1I7SB 2WB2A 3TNLA 4B3XA 4DA0A 4INOA 5JS2A 1F48A 4DWWA 3BWXA 2A9OA 3D6HA 4WBNB 2QD2A 3MT8A 5CBPB 1TFUA 3K31A 4GL2A 2QTVA 3I9KA 2Y0DA 3QU5A 1V7CA 3AKEA 5TNXA 3SLRA 3MCVA 4FVTA 1U2GA 1D7OA 4ALLA 4O4LF 1Q7EA 1KY4A 5JPCA 1P1CA 3BXZA 3OY2A 1J8FA 2QZ9A 4D6PA 4LMBA 2YMLA 4J49A 1E5DA 2JBAB 2VHVA 1M2VB 4JODA 4R9UC 1XLWA 3MCAA 3TTTA 4B3DA 3GGPA 2AC7A 3QKRB 3E2IA 2IJGX 3BTVA 3N7AA 4NOKA 2WEKA 3R8XA 5H59A 1YOVB 4HV4A 2QX7A 4KLNA 3AUFA 4KO1S 1NXQA 1Y5NA 4KCGA 4S1TA 3KOZA 5BN3A 3S27A 3A4LA 4R7TA 2Q4BA 5EGSA 2ZJBA 1V1MA 4XB6B 4OJTA 4I1YA 2HGSA 1WRBA 3IR7A 4XSGA 4BWYA 4RDXA 1IAVA 3JZMA 2X1LA 2VNHA 5FOTA 3R0IA 3JAKA 1WHTB 1KRHA 1UWVA 3FZYA 2QY6A 4H77A 4I1SA 3LYHA 3JPYA 2Y66A 4KX3A 5DF1A 4EW1A 5AHXA 4O2BF 2D7CA 2MR5A 3DE5X 4NG5A 4BNJA 2MYNA 3ICPA 1K3FA 1TF7A 3CGGA 4TMFA 4CM3A 3G5AA 1H1TA 2QZZA 2XOKA 1ZH2A 3FI0A 1OB5A 1I1NA 4MEAA 5LUBA 1RE1A 3PQEA 1TAGA 3G5UA 5C8VA 1Z45A 2XE4A 1NI5A 1E66A 1X3SA 1OA1A 1V7QA 4OQ4A 2GN0A 4K9NA 3TQCA 3V2IA 4CRWB 4KTVE 3DA8A 4LWZA 2OQVA 4ZJUA 4BVKA 3MWGA 4FDTA 5I9LA 5GVRA 2GXAA 4NHEA 121PA 4M0LA 4ITRC 4JH0A 4UTOA 3IDOA 2ZJ2A 1K75A 3O4GA 2OEPA 3GN1A 3NASA 5IBRA 1UOQA 1NLZA 1FUUA 1YRLA 3IIKA 3LWZA 2JBHA 3CRMA 2OXIA 3SI7A 3SXPA 2Z6QA 2B21A 1C81A 2SECE 2X2OA 3KKLA 2B2NA 2P8JA 4KQHA 2B4RO 5D3QA 5IKEA 3REFA 4F04A 3OTHA 2BFBB 1GAEO 2Z4RA 3IP8A 2NIPA 3ZPXA 3D2CA 3ZJ4A 6AT1A 2J4CA 2AW5A 3CNQS 7ABPA 1ZRHA 2Y1CA 3M9WA 3GUZA 1IL0A 3O82A 3DFUA 3OBIA 5I7AA 1YA4A 1MTOA 4LJKA 3R9XA 5AK6A 1T35A 1Y7LA 3WFZA 4F7DA 4OHCA 5JCZA 1JB9A 1WP9A 1GGVA 2QAGA 2R6ZA 1TCUA 3ED1A 3LXUX 4N5NA 2GRAA 4WASA 2ODBA 3RS9A 3VU8A 3LDAA 4D9CA 2BSXA 3MINA 3DYVA 1K86A 5FFMA 3RRXA 1M7BA 5AT1A 3T3OA 2PJDA 1IY9A 4YRBA 4E70A 4M9UA 3SR0A 4FKZA 4LA4A 5FO1A 1UJ4A 3WMEA 5DHTA 1WCWA 3KSZO 3QUQA 2IYWA 3VNUA 2I4TA 1TGYA 1GO2A 1U7XA 3GVPA 1NYTA 5C8DA 4NOLA 5GONA 4IHQA 2E89A 2ZPAA 1OXVA 5ALJA 3W77A 2OV8A 4C7XA 3R40A 3M2PA 2C7VA 3Q3CA 4F4CA 2YNMD 4YONB 1F2UB 4LOAA 3TIGA 5J3JA 1C4XA 2C84A 2CXNA 2QUKA 4XCXA 5IZCA 1DGQA 1T9AA 4PR0A 1DV1A 3KKZA 1AGPA 1Z4NA 4GC9A 4JIGA 1ULBA 4JYPA 4M2LA 4DY4A 4CUKA 4PE5B 3NBQA 3LBIA 4ZCMA 2I7VA 2H2WA 2J07A 4UXHA 5EIBC 4LHVA 4QO7A 3D1VA 3RVJA 3GFFA 1KAEA 2CBXA 3VR2D 1TJYA 1R00A 4JX9A 4DL9A 4F85A 3I9V1 5I9MA 3HDQA 2Z04A 1W4BA 4B81A 1YASA 4RHXA 2LPMA 4LTMA 3OP1A 2JB9A 3A28A 2R8ZA 4EB6B 3B20A 1E6MA 4MULA 1QGZA 4H59A 1JG1A 4AVYA 4I1OA 5THQA 2QRVB 2ZJOA 5GJVC 4JI2B 4B44A 3JQGA 3QHQA 4W8OA 1GL6A 1UDWA 2H1IA 1D9ZA 1RP1A 4N3AA 4TTQA 3C45A 4U6QA 5ED0A 2ORIA 1ORHA 4RELA 3KQQA 1RZUA 2IQ5A 3LS2A 3P2OA 4JOCA 1GRQA 1DP4A 1Z88A 2BKEA 2RHMA 3IBTA 1CQPA 1URPA 4WA7A 4DLNA 3PYLA 2B4TO 4BX3A 3QMPA 1W88B 4QICA 2ZVJA 5G2OA 3RUIA 3TKYA 4PYMA 3V32A 5AESA 3IQFA 1HG1A 2Z56A 1VGVA 3T1VA 1UMCA 3KEGA 4P58A 2HQRA 4Y1GA 3PDIB 1LLQA 1AB5A 1KJ9A 1NVDA 3DO5A 4M55A 4WEOA 3VPBA 4EVIA 5CLJA 3QGMA 3TNYA 3VZSA 1ENOA 2Q62A 2QZPA 4KAXA 2CXHA 4UBIA 4D9IA 5CG2A 2IS6A 4D3SA 3B1WA 5FPYA 1G3QA 5IN5A 3T95A 2OFXA 2EBWA 2RGGA 3U3XA 4AZ0B 4UXIA 1QIEA 2C78A 1SWWA 3CSUA 1OGYA 1NMSA 1U5AA 2YRWA 2FZWA 3F46A 5G41A 4G26A 5KNBA 3L4EA 1JE1A 4ON9A 2QM8A 2I8AA 1SBNE 4G4SP 5AM4A 2QRKA 3T5MA 2C2GA 2V4ZA 3VTKA 3F71A 4HXFB 4RGVA 4ZQGA 1ZIOA 4N7MA 3GN2A 2AGVA 4KODA 3WSTA 1SZPA 1T0HB 1IN5A 1FBNA 3HCPA 5I6DA 3GK3A 3IPLA 4O1MA 1Y6ZA 2ABWA 4OV6B 4ZCRA 5JSFA 2Q2OA 2QK4A 4FD3A 3KDSE 5DTIA 2FKNA 4AP5A 3MVEA 2MJLA 3D1LA 1N3IA 2W71A 5HMLA 1NFFA 3FHJA 4MHTA 2L0XA 3HB9A 3C1OA 4HAUA 3DUWA 3GRAA 3L9WA 3IYLW 3N6RA 3MD0A 2IYSA 1DWPA 2COEA 3MJTA 4KDFA 3V34A 5LIPA 2MIIA 1VI2A 2H6EA 2X2EA 4NBTA 2BP7A 3P9NA 1QRDA 2QI9F 3AI1A 3VTAA 3EF1A 4B7XA 1QTNA 5CLIA 1OAAA 2RCNA 4K03A 4ALJA 1BGVA 1QRAA 1DAEA 1V1RA 1VJTA 2WVGA 3T5BA 4JUFA 2BLNA 1JEAA 5CTJA 3X2EA 5AVZA 2JIDA 1DV2A 3BRWD 2OV6A 1UT6A 1O5IA 1ODIA 4JLUA 3E9DA 4GQAA 5B1IA 1QFYA 4DC9A 1IHOA 4LXXA 5K3FB 3CJQA 5F9MA 1FDUA 5C5EA 4DIBA 4FTWA 1OE0A 2QQFA 4W1RA 5HBGA 1VCOA 4BO7A 4F9FA 3LHDA 4HWPA 1X1RA 5CIWA 5JVDB 2VT7A 4LC9A 2B83A 5BQXA 4LXQA 5HJ7A 2AKEA 5EP2A 4OBBA 1KERA 3D2AA 3FFTA 2GFIA 4ME6A 2MWMA 1WIWA 1ST2A 1OASA 1SKBA 5DSZA 2ZM5A